data_2L7F
# 
_entry.id   2L7F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L7F         
RCSB  RCSB102050   
BMRB  17147        
WWPDB D_1000102050 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          17147 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L7F 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-08 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doerdelmann, T.'   1 
'Rance, M.'         2 
'Baird-Titus, J.M.' 3 
'Kojetin, D.J.'     4 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the Pitx2 Homeodomain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Doerdelmann, T.'   1 
primary 'Rance, M.'         2 
primary 'Baird-Titus, J.M.' 3 
primary 'Kojetin, D.J.'     4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Pituitary homeobox 2' 
_entity.formula_weight             8486.523 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Homeobox domain residues 85-144' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ALL1-responsive protein ARP1 
Homeobox protein PITX2, Paired-like homeodomain transcription factor 2, RIEG bicoid-related homeobox transcription factor, Solurshin
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD 
_entity_poly.pdbx_seq_one_letter_code_can   GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD 
_entity_poly.pdbx_strand_id                 P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  GLN n 
1 4  ARG n 
1 5  ARG n 
1 6  GLN n 
1 7  ARG n 
1 8  THR n 
1 9  HIS n 
1 10 PHE n 
1 11 THR n 
1 12 SER n 
1 13 GLN n 
1 14 GLN n 
1 15 LEU n 
1 16 GLN n 
1 17 GLU n 
1 18 LEU n 
1 19 GLU n 
1 20 ALA n 
1 21 THR n 
1 22 PHE n 
1 23 GLN n 
1 24 ARG n 
1 25 ASN n 
1 26 ARG n 
1 27 TYR n 
1 28 PRO n 
1 29 ASP n 
1 30 MET n 
1 31 SER n 
1 32 THR n 
1 33 ARG n 
1 34 GLU n 
1 35 GLU n 
1 36 ILE n 
1 37 ALA n 
1 38 VAL n 
1 39 TRP n 
1 40 THR n 
1 41 ASN n 
1 42 LEU n 
1 43 THR n 
1 44 GLU n 
1 45 ALA n 
1 46 ARG n 
1 47 VAL n 
1 48 ARG n 
1 49 VAL n 
1 50 TRP n 
1 51 PHE n 
1 52 LYS n 
1 53 ASN n 
1 54 ARG n 
1 55 ARG n 
1 56 ALA n 
1 57 LYS n 
1 58 TRP n 
1 59 ARG n 
1 60 LYS n 
1 61 ARG n 
1 62 GLU n 
1 63 GLU n 
1 64 PHE n 
1 65 ILE n 
1 66 VAL n 
1 67 THR n 
1 68 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PITX2, ARP1, RGS, RIEG, RIEG1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pet28 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PITX2_HUMAN 
_struct_ref.pdbx_db_accession          Q99697 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRE 
_struct_ref.pdbx_align_begin           85 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2L7F 
_struct_ref_seq.pdbx_strand_id                P 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 62 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99697 
_struct_ref_seq.db_align_beg                  85 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  144 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       60 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L7F GLY P 1  ? UNP Q99697 ? ? 'EXPRESSION TAG' -1 1 
1 2L7F SER P 2  ? UNP Q99697 ? ? 'EXPRESSION TAG' 0  2 
1 2L7F GLU P 63 ? UNP Q99697 ? ? 'SEE REMARK 999' 61 3 
1 2L7F PHE P 64 ? UNP Q99697 ? ? 'SEE REMARK 999' 62 4 
1 2L7F ILE P 65 ? UNP Q99697 ? ? 'SEE REMARK 999' 63 5 
1 2L7F VAL P 66 ? UNP Q99697 ? ? 'SEE REMARK 999' 64 6 
1 2L7F THR P 67 ? UNP Q99697 ? ? 'SEE REMARK 999' 65 7 
1 2L7F ASP P 68 ? UNP Q99697 ? ? 'SEE REMARK 999' 66 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'           
1 2  1 '2D 1H-13C HSQC aromatic'  
1 3  1 '2D 1H-13C HSQC aliphatic' 
1 4  1 '3D 1H-15N NOESY'          
1 5  1 '3D 1H-13C NOESY'          
1 6  1 '3D HNCACB'                
1 7  1 '3D HNCA'                  
1 8  1 '3D H(CCO)NH'              
1 9  1 '3D HCCH-TOCSY'            
1 10 1 '3D HN(COCA)CB'            
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'10 mM sodium phosphate, 150 mM sodium sulphate, 1 mM EDTA, 2 mM [U-98% 13C; U-98% 15N] Pitx2 Homeodomain, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Varian INOVA 1 'Varian INOVA' 
600 Varian INOVA 2 'Varian INOVA' 
500 Varian INOVA 3 'Varian INOVA' 
400 Varian INOVA 4 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2L7F 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'Lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L7F 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.093 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L7F 
_pdbx_nmr_representative.selection_criteria   'minimized average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Zhengrong and Bax'                                             processing NMRPipe ?  1 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement AMBER   11 2 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L7F 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L7F 
_struct.title                     'Solution Structure of the Pitx2 Homeodomain' 
_struct.pdbx_descriptor           'Pituitary homeobox 2' 
_struct.pdbx_model_details        'minimized average, model 7' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L7F 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Pitx2, Homeodomain, DNA-binding, TRANSCRIPTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 11 ? ASN A 25 ? THR P 9  ASN P 23 1 ? 15 
HELX_P HELX_P2 2 ASP A 29 ? ASN A 41 ? ASP P 27 ASN P 39 1 ? 13 
HELX_P HELX_P3 3 THR A 43 ? LYS A 60 ? THR P 41 LYS P 58 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2L7F 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -22.866 -2.627  15.217  1.00 0.00 ? -1 GLY P N    1  
ATOM 2     C CA   . GLY A 1 1  ? -22.714 -3.068  16.621  1.00 0.00 ? -1 GLY P CA   1  
ATOM 3     C C    . GLY A 1 1  ? -21.276 -3.457  16.936  1.00 0.00 ? -1 GLY P C    1  
ATOM 4     O O    . GLY A 1 1  ? -20.538 -3.887  16.047  1.00 0.00 ? -1 GLY P O    1  
ATOM 5     H H1   . GLY A 1 1  ? -22.583 -3.364  14.590  1.00 0.00 ? -1 GLY P H1   1  
ATOM 6     H H2   . GLY A 1 1  ? -22.293 -1.817  15.040  1.00 0.00 ? -1 GLY P H2   1  
ATOM 7     H H3   . GLY A 1 1  ? -23.828 -2.392  15.027  1.00 0.00 ? -1 GLY P H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? -23.016 -2.261  17.288  1.00 0.00 ? -1 GLY P HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? -23.352 -3.933  16.803  1.00 0.00 ? -1 GLY P HA3  1  
ATOM 10    N N    . SER A 1 2  ? -20.879 -3.332  18.210  1.00 0.00 ? 0  SER P N    1  
ATOM 11    C CA   . SER A 1 2  ? -19.503 -3.526  18.715  1.00 0.00 ? 0  SER P CA   1  
ATOM 12    C C    . SER A 1 2  ? -18.449 -2.591  18.079  1.00 0.00 ? 0  SER P C    1  
ATOM 13    O O    . SER A 1 2  ? -18.766 -1.717  17.266  1.00 0.00 ? 0  SER P O    1  
ATOM 14    C CB   . SER A 1 2  ? -19.117 -5.014  18.638  1.00 0.00 ? 0  SER P CB   1  
ATOM 15    O OG   . SER A 1 2  ? -18.040 -5.301  19.519  1.00 0.00 ? 0  SER P OG   1  
ATOM 16    H H    . SER A 1 2  ? -21.563 -3.005  18.880  1.00 0.00 ? 0  SER P H    1  
ATOM 17    H HA   . SER A 1 2  ? -19.520 -3.274  19.776  1.00 0.00 ? 0  SER P HA   1  
ATOM 18    H HB2  . SER A 1 2  ? -19.976 -5.620  18.931  1.00 0.00 ? 0  SER P HB2  1  
ATOM 19    H HB3  . SER A 1 2  ? -18.839 -5.272  17.614  1.00 0.00 ? 0  SER P HB3  1  
ATOM 20    H HG   . SER A 1 2  ? -17.871 -6.264  19.493  1.00 0.00 ? 0  SER P HG   1  
ATOM 21    N N    . GLN A 1 3  ? -17.185 -2.729  18.492  1.00 0.00 ? 1  GLN P N    1  
ATOM 22    C CA   . GLN A 1 3  ? -16.055 -1.914  18.028  1.00 0.00 ? 1  GLN P CA   1  
ATOM 23    C C    . GLN A 1 3  ? -15.575 -2.336  16.625  1.00 0.00 ? 1  GLN P C    1  
ATOM 24    O O    . GLN A 1 3  ? -15.500 -3.529  16.312  1.00 0.00 ? 1  GLN P O    1  
ATOM 25    C CB   . GLN A 1 3  ? -14.900 -1.980  19.043  1.00 0.00 ? 1  GLN P CB   1  
ATOM 26    C CG   . GLN A 1 3  ? -15.274 -1.389  20.413  1.00 0.00 ? 1  GLN P CG   1  
ATOM 27    C CD   . GLN A 1 3  ? -14.100 -1.433  21.389  1.00 0.00 ? 1  GLN P CD   1  
ATOM 28    O OE1  . GLN A 1 3  ? -13.964 -2.337  22.205  1.00 0.00 ? 1  GLN P OE1  1  
ATOM 29    N NE2  . GLN A 1 3  ? -13.197 -0.474  21.342  1.00 0.00 ? 1  GLN P NE2  1  
ATOM 30    H H    . GLN A 1 3  ? -16.996 -3.495  19.127  1.00 0.00 ? 1  GLN P H    1  
ATOM 31    H HA   . GLN A 1 3  ? -16.382 -0.875  17.967  1.00 0.00 ? 1  GLN P HA   1  
ATOM 32    H HB2  . GLN A 1 3  ? -14.591 -3.020  19.172  1.00 0.00 ? 1  GLN P HB2  1  
ATOM 33    H HB3  . GLN A 1 3  ? -14.052 -1.420  18.644  1.00 0.00 ? 1  GLN P HB3  1  
ATOM 34    H HG2  . GLN A 1 3  ? -15.594 -0.355  20.284  1.00 0.00 ? 1  GLN P HG2  1  
ATOM 35    H HG3  . GLN A 1 3  ? -16.104 -1.950  20.843  1.00 0.00 ? 1  GLN P HG3  1  
ATOM 36    H HE21 . GLN A 1 3  ? -13.291 0.285   20.684  1.00 0.00 ? 1  GLN P HE21 1  
ATOM 37    H HE22 . GLN A 1 3  ? -12.425 -0.511  21.991  1.00 0.00 ? 1  GLN P HE22 1  
ATOM 38    N N    . ARG A 1 4  ? -15.209 -1.353  15.787  1.00 0.00 ? 2  ARG P N    1  
ATOM 39    C CA   . ARG A 1 4  ? -14.742 -1.553  14.398  1.00 0.00 ? 2  ARG P CA   1  
ATOM 40    C C    . ARG A 1 4  ? -13.218 -1.718  14.274  1.00 0.00 ? 2  ARG P C    1  
ATOM 41    O O    . ARG A 1 4  ? -12.747 -2.270  13.277  1.00 0.00 ? 2  ARG P O    1  
ATOM 42    C CB   . ARG A 1 4  ? -15.311 -0.403  13.537  1.00 0.00 ? 2  ARG P CB   1  
ATOM 43    C CG   . ARG A 1 4  ? -15.153 -0.580  12.015  1.00 0.00 ? 2  ARG P CG   1  
ATOM 44    C CD   . ARG A 1 4  ? -13.930 0.149   11.439  1.00 0.00 ? 2  ARG P CD   1  
ATOM 45    N NE   . ARG A 1 4  ? -13.802 -0.087  9.987   1.00 0.00 ? 2  ARG P NE   1  
ATOM 46    C CZ   . ARG A 1 4  ? -12.839 0.354   9.197   1.00 0.00 ? 2  ARG P CZ   1  
ATOM 47    N NH1  . ARG A 1 4  ? -11.860 1.092   9.640   1.00 0.00 ? 2  ARG P NH1  1  
ATOM 48    N NH2  . ARG A 1 4  ? -12.842 0.060   7.928   1.00 0.00 ? 2  ARG P NH2  1  
ATOM 49    H H    . ARG A 1 4  ? -15.332 -0.401  16.112  1.00 0.00 ? 2  ARG P H    1  
ATOM 50    H HA   . ARG A 1 4  ? -15.169 -2.485  14.021  1.00 0.00 ? 2  ARG P HA   1  
ATOM 51    H HB2  . ARG A 1 4  ? -16.382 -0.344  13.739  1.00 0.00 ? 2  ARG P HB2  1  
ATOM 52    H HB3  . ARG A 1 4  ? -14.871 0.547   13.847  1.00 0.00 ? 2  ARG P HB3  1  
ATOM 53    H HG2  . ARG A 1 4  ? -15.102 -1.642  11.771  1.00 0.00 ? 2  ARG P HG2  1  
ATOM 54    H HG3  . ARG A 1 4  ? -16.040 -0.168  11.531  1.00 0.00 ? 2  ARG P HG3  1  
ATOM 55    H HD2  . ARG A 1 4  ? -14.044 1.220   11.624  1.00 0.00 ? 2  ARG P HD2  1  
ATOM 56    H HD3  . ARG A 1 4  ? -13.027 -0.195  11.941  1.00 0.00 ? 2  ARG P HD3  1  
ATOM 57    H HE   . ARG A 1 4  ? -14.518 -0.644  9.549   1.00 0.00 ? 2  ARG P HE   1  
ATOM 58    H HH11 . ARG A 1 4  ? -11.837 1.344   10.613  1.00 0.00 ? 2  ARG P HH11 1  
ATOM 59    H HH12 . ARG A 1 4  ? -11.141 1.419   9.018   1.00 0.00 ? 2  ARG P HH12 1  
ATOM 60    H HH21 . ARG A 1 4  ? -13.580 -0.506  7.541   1.00 0.00 ? 2  ARG P HH21 1  
ATOM 61    H HH22 . ARG A 1 4  ? -12.110 0.397   7.327   1.00 0.00 ? 2  ARG P HH22 1  
ATOM 62    N N    . ARG A 1 5  ? -12.448 -1.261  15.270  1.00 0.00 ? 3  ARG P N    1  
ATOM 63    C CA   . ARG A 1 5  ? -10.970 -1.263  15.282  1.00 0.00 ? 3  ARG P CA   1  
ATOM 64    C C    . ARG A 1 5  ? -10.396 -2.685  15.188  1.00 0.00 ? 3  ARG P C    1  
ATOM 65    O O    . ARG A 1 5  ? -10.788 -3.572  15.947  1.00 0.00 ? 3  ARG P O    1  
ATOM 66    C CB   . ARG A 1 5  ? -10.473 -0.514  16.533  1.00 0.00 ? 3  ARG P CB   1  
ATOM 67    C CG   . ARG A 1 5  ? -8.951  -0.295  16.531  1.00 0.00 ? 3  ARG P CG   1  
ATOM 68    C CD   . ARG A 1 5  ? -8.517  0.526   17.752  1.00 0.00 ? 3  ARG P CD   1  
ATOM 69    N NE   . ARG A 1 5  ? -7.062  0.782   17.747  1.00 0.00 ? 3  ARG P NE   1  
ATOM 70    C CZ   . ARG A 1 5  ? -6.107  0.017   18.248  1.00 0.00 ? 3  ARG P CZ   1  
ATOM 71    N NH1  . ARG A 1 5  ? -6.357  -1.123  18.829  1.00 0.00 ? 3  ARG P NH1  1  
ATOM 72    N NH2  . ARG A 1 5  ? -4.862  0.390   18.174  1.00 0.00 ? 3  ARG P NH2  1  
ATOM 73    H H    . ARG A 1 5  ? -12.927 -0.852  16.058  1.00 0.00 ? 3  ARG P H    1  
ATOM 74    H HA   . ARG A 1 5  ? -10.632 -0.710  14.403  1.00 0.00 ? 3  ARG P HA   1  
ATOM 75    H HB2  . ARG A 1 5  ? -10.960 0.462   16.572  1.00 0.00 ? 3  ARG P HB2  1  
ATOM 76    H HB3  . ARG A 1 5  ? -10.755 -1.072  17.428  1.00 0.00 ? 3  ARG P HB3  1  
ATOM 77    H HG2  . ARG A 1 5  ? -8.439  -1.258  16.549  1.00 0.00 ? 3  ARG P HG2  1  
ATOM 78    H HG3  . ARG A 1 5  ? -8.665  0.239   15.624  1.00 0.00 ? 3  ARG P HG3  1  
ATOM 79    H HD2  . ARG A 1 5  ? -9.043  1.484   17.734  1.00 0.00 ? 3  ARG P HD2  1  
ATOM 80    H HD3  . ARG A 1 5  ? -8.810  0.006   18.667  1.00 0.00 ? 3  ARG P HD3  1  
ATOM 81    H HE   . ARG A 1 5  ? -6.760  1.646   17.323  1.00 0.00 ? 3  ARG P HE   1  
ATOM 82    H HH11 . ARG A 1 5  ? -7.308  -1.435  18.911  1.00 0.00 ? 3  ARG P HH11 1  
ATOM 83    H HH12 . ARG A 1 5  ? -5.609  -1.680  19.208  1.00 0.00 ? 3  ARG P HH12 1  
ATOM 84    H HH21 . ARG A 1 5  ? -4.621  1.266   17.738  1.00 0.00 ? 3  ARG P HH21 1  
ATOM 85    H HH22 . ARG A 1 5  ? -4.134  -0.187  18.559  1.00 0.00 ? 3  ARG P HH22 1  
ATOM 86    N N    . GLN A 1 6  ? -9.466  -2.881  14.253  1.00 0.00 ? 4  GLN P N    1  
ATOM 87    C CA   . GLN A 1 6  ? -8.871  -4.171  13.863  1.00 0.00 ? 4  GLN P CA   1  
ATOM 88    C C    . GLN A 1 6  ? -7.364  -4.026  13.565  1.00 0.00 ? 4  GLN P C    1  
ATOM 89    O O    . GLN A 1 6  ? -6.860  -2.912  13.378  1.00 0.00 ? 4  GLN P O    1  
ATOM 90    C CB   . GLN A 1 6  ? -9.619  -4.703  12.621  1.00 0.00 ? 4  GLN P CB   1  
ATOM 91    C CG   . GLN A 1 6  ? -11.000 -5.296  12.950  1.00 0.00 ? 4  GLN P CG   1  
ATOM 92    C CD   . GLN A 1 6  ? -11.859 -5.452  11.698  1.00 0.00 ? 4  GLN P CD   1  
ATOM 93    O OE1  . GLN A 1 6  ? -11.837 -6.465  11.009  1.00 0.00 ? 4  GLN P OE1  1  
ATOM 94    N NE2  . GLN A 1 6  ? -12.636 -4.447  11.347  1.00 0.00 ? 4  GLN P NE2  1  
ATOM 95    H H    . GLN A 1 6  ? -9.175  -2.076  13.717  1.00 0.00 ? 4  GLN P H    1  
ATOM 96    H HA   . GLN A 1 6  ? -8.976  -4.892  14.675  1.00 0.00 ? 4  GLN P HA   1  
ATOM 97    H HB2  . GLN A 1 6  ? -9.734  -3.888  11.904  1.00 0.00 ? 4  GLN P HB2  1  
ATOM 98    H HB3  . GLN A 1 6  ? -9.029  -5.485  12.142  1.00 0.00 ? 4  GLN P HB3  1  
ATOM 99    H HG2  . GLN A 1 6  ? -10.871 -6.269  13.426  1.00 0.00 ? 4  GLN P HG2  1  
ATOM 100   H HG3  . GLN A 1 6  ? -11.533 -4.653  13.645  1.00 0.00 ? 4  GLN P HG3  1  
ATOM 101   H HE21 . GLN A 1 6  ? -12.669 -3.613  11.928  1.00 0.00 ? 4  GLN P HE21 1  
ATOM 102   H HE22 . GLN A 1 6  ? -13.206 -4.541  10.522  1.00 0.00 ? 4  GLN P HE22 1  
ATOM 103   N N    . ARG A 1 7  ? -6.650  -5.158  13.488  1.00 0.00 ? 5  ARG P N    1  
ATOM 104   C CA   . ARG A 1 7  ? -5.224  -5.260  13.113  1.00 0.00 ? 5  ARG P CA   1  
ATOM 105   C C    . ARG A 1 7  ? -5.014  -6.211  11.929  1.00 0.00 ? 5  ARG P C    1  
ATOM 106   O O    . ARG A 1 7  ? -5.749  -7.189  11.780  1.00 0.00 ? 5  ARG P O    1  
ATOM 107   C CB   . ARG A 1 7  ? -4.365  -5.631  14.340  1.00 0.00 ? 5  ARG P CB   1  
ATOM 108   C CG   . ARG A 1 7  ? -4.716  -6.992  14.972  1.00 0.00 ? 5  ARG P CG   1  
ATOM 109   C CD   . ARG A 1 7  ? -3.874  -7.286  16.223  1.00 0.00 ? 5  ARG P CD   1  
ATOM 110   N NE   . ARG A 1 7  ? -2.455  -7.550  15.899  1.00 0.00 ? 5  ARG P NE   1  
ATOM 111   C CZ   . ARG A 1 7  ? -1.460  -7.669  16.761  1.00 0.00 ? 5  ARG P CZ   1  
ATOM 112   N NH1  . ARG A 1 7  ? -1.636  -7.543  18.047  1.00 0.00 ? 5  ARG P NH1  1  
ATOM 113   N NH2  . ARG A 1 7  ? -0.252  -7.922  16.345  1.00 0.00 ? 5  ARG P NH2  1  
ATOM 114   H H    . ARG A 1 7  ? -7.150  -6.027  13.625  1.00 0.00 ? 5  ARG P H    1  
ATOM 115   H HA   . ARG A 1 7  ? -4.887  -4.277  12.773  1.00 0.00 ? 5  ARG P HA   1  
ATOM 116   H HB2  . ARG A 1 7  ? -3.316  -5.637  14.041  1.00 0.00 ? 5  ARG P HB2  1  
ATOM 117   H HB3  . ARG A 1 7  ? -4.490  -4.853  15.095  1.00 0.00 ? 5  ARG P HB3  1  
ATOM 118   H HG2  . ARG A 1 7  ? -5.764  -6.989  15.271  1.00 0.00 ? 5  ARG P HG2  1  
ATOM 119   H HG3  . ARG A 1 7  ? -4.567  -7.793  14.247  1.00 0.00 ? 5  ARG P HG3  1  
ATOM 120   H HD2  . ARG A 1 7  ? -3.953  -6.437  16.905  1.00 0.00 ? 5  ARG P HD2  1  
ATOM 121   H HD3  . ARG A 1 7  ? -4.292  -8.166  16.717  1.00 0.00 ? 5  ARG P HD3  1  
ATOM 122   H HE   . ARG A 1 7  ? -2.224  -7.696  14.929  1.00 0.00 ? 5  ARG P HE   1  
ATOM 123   H HH11 . ARG A 1 7  ? -2.559  -7.362  18.401  1.00 0.00 ? 5  ARG P HH11 1  
ATOM 124   H HH12 . ARG A 1 7  ? -0.862  -7.641  18.683  1.00 0.00 ? 5  ARG P HH12 1  
ATOM 125   H HH21 . ARG A 1 7  ? -0.066  -8.037  15.362  1.00 0.00 ? 5  ARG P HH21 1  
ATOM 126   H HH22 . ARG A 1 7  ? 0.502   -8.014  17.004  1.00 0.00 ? 5  ARG P HH22 1  
ATOM 127   N N    . THR A 1 8  ? -4.014  -5.925  11.095  1.00 0.00 ? 6  THR P N    1  
ATOM 128   C CA   . THR A 1 8  ? -3.734  -6.631  9.828   1.00 0.00 ? 6  THR P CA   1  
ATOM 129   C C    . THR A 1 8  ? -2.233  -6.819  9.577   1.00 0.00 ? 6  THR P C    1  
ATOM 130   O O    . THR A 1 8  ? -1.396  -6.067  10.085  1.00 0.00 ? 6  THR P O    1  
ATOM 131   C CB   . THR A 1 8  ? -4.352  -5.889  8.623   1.00 0.00 ? 6  THR P CB   1  
ATOM 132   O OG1  . THR A 1 8  ? -3.947  -4.536  8.610   1.00 0.00 ? 6  THR P OG1  1  
ATOM 133   C CG2  . THR A 1 8  ? -5.881  -5.903  8.639   1.00 0.00 ? 6  THR P CG2  1  
ATOM 134   H H    . THR A 1 8  ? -3.464  -5.101  11.281  1.00 0.00 ? 6  THR P H    1  
ATOM 135   H HA   . THR A 1 8  ? -4.177  -7.627  9.865   1.00 0.00 ? 6  THR P HA   1  
ATOM 136   H HB   . THR A 1 8  ? -4.019  -6.370  7.702   1.00 0.00 ? 6  THR P HB   1  
ATOM 137   H HG1  . THR A 1 8  ? -4.401  -4.107  7.866   1.00 0.00 ? 6  THR P HG1  1  
ATOM 138   H HG21 . THR A 1 8  ? -6.260  -5.323  9.480   1.00 0.00 ? 6  THR P HG21 1  
ATOM 139   H HG22 . THR A 1 8  ? -6.238  -6.929  8.717   1.00 0.00 ? 6  THR P HG22 1  
ATOM 140   H HG23 . THR A 1 8  ? -6.259  -5.472  7.711   1.00 0.00 ? 6  THR P HG23 1  
ATOM 141   N N    . HIS A 1 9  ? -1.890  -7.822  8.764   1.00 0.00 ? 7  HIS P N    1  
ATOM 142   C CA   . HIS A 1 9  ? -0.543  -8.062  8.225   1.00 0.00 ? 7  HIS P CA   1  
ATOM 143   C C    . HIS A 1 9  ? -0.616  -8.386  6.721   1.00 0.00 ? 7  HIS P C    1  
ATOM 144   O O    . HIS A 1 9  ? -1.698  -8.659  6.192   1.00 0.00 ? 7  HIS P O    1  
ATOM 145   C CB   . HIS A 1 9  ? 0.165   -9.163  9.030   1.00 0.00 ? 7  HIS P CB   1  
ATOM 146   C CG   . HIS A 1 9  ? -0.336  -10.555 8.735   1.00 0.00 ? 7  HIS P CG   1  
ATOM 147   N ND1  . HIS A 1 9  ? 0.200   -11.409 7.768   1.00 0.00 ? 7  HIS P ND1  1  
ATOM 148   C CD2  . HIS A 1 9  ? -1.399  -11.172 9.329   1.00 0.00 ? 7  HIS P CD2  1  
ATOM 149   C CE1  . HIS A 1 9  ? -0.555  -12.519 7.796   1.00 0.00 ? 7  HIS P CE1  1  
ATOM 150   N NE2  . HIS A 1 9  ? -1.520  -12.406 8.727   1.00 0.00 ? 7  HIS P NE2  1  
ATOM 151   H H    . HIS A 1 9  ? -2.629  -8.392  8.376   1.00 0.00 ? 7  HIS P H    1  
ATOM 152   H HA   . HIS A 1 9  ? 0.047   -7.149  8.323   1.00 0.00 ? 7  HIS P HA   1  
ATOM 153   H HB2  . HIS A 1 9  ? 1.231   -9.131  8.800   1.00 0.00 ? 7  HIS P HB2  1  
ATOM 154   H HB3  . HIS A 1 9  ? 0.057   -8.960  10.097  1.00 0.00 ? 7  HIS P HB3  1  
ATOM 155   H HD2  . HIS A 1 9  ? -2.024  -10.760 10.111  1.00 0.00 ? 7  HIS P HD2  1  
ATOM 156   H HE1  . HIS A 1 9  ? -0.407  -13.379 7.153   1.00 0.00 ? 7  HIS P HE1  1  
ATOM 157   H HE2  . HIS A 1 9  ? -2.216  -13.114 8.934   1.00 0.00 ? 7  HIS P HE2  1  
ATOM 158   N N    . PHE A 1 10 ? 0.521   -8.334  6.024   1.00 0.00 ? 8  PHE P N    1  
ATOM 159   C CA   . PHE A 1 10 ? 0.574   -8.381  4.558   1.00 0.00 ? 8  PHE P CA   1  
ATOM 160   C C    . PHE A 1 10 ? 0.285   -9.783  3.986   1.00 0.00 ? 8  PHE P C    1  
ATOM 161   O O    . PHE A 1 10 ? 1.035   -10.734 4.231   1.00 0.00 ? 8  PHE P O    1  
ATOM 162   C CB   . PHE A 1 10 ? 1.931   -7.849  4.067   1.00 0.00 ? 8  PHE P CB   1  
ATOM 163   C CG   . PHE A 1 10 ? 2.460   -6.628  4.800   1.00 0.00 ? 8  PHE P CG   1  
ATOM 164   C CD1  . PHE A 1 10 ? 1.841   -5.375  4.632   1.00 0.00 ? 8  PHE P CD1  1  
ATOM 165   C CD2  . PHE A 1 10 ? 3.557   -6.752  5.675   1.00 0.00 ? 8  PHE P CD2  1  
ATOM 166   C CE1  . PHE A 1 10 ? 2.309   -4.255  5.342   1.00 0.00 ? 8  PHE P CE1  1  
ATOM 167   C CE2  . PHE A 1 10 ? 4.028   -5.630  6.383   1.00 0.00 ? 8  PHE P CE2  1  
ATOM 168   C CZ   . PHE A 1 10 ? 3.401   -4.384  6.220   1.00 0.00 ? 8  PHE P CZ   1  
ATOM 169   H H    . PHE A 1 10 ? 1.383   -8.178  6.521   1.00 0.00 ? 8  PHE P H    1  
ATOM 170   H HA   . PHE A 1 10 ? -0.189  -7.700  4.180   1.00 0.00 ? 8  PHE P HA   1  
ATOM 171   H HB2  . PHE A 1 10 ? 2.670   -8.646  4.152   1.00 0.00 ? 8  PHE P HB2  1  
ATOM 172   H HB3  . PHE A 1 10 ? 1.835   -7.599  3.010   1.00 0.00 ? 8  PHE P HB3  1  
ATOM 173   H HD1  . PHE A 1 10 ? 1.002   -5.276  3.960   1.00 0.00 ? 8  PHE P HD1  1  
ATOM 174   H HD2  . PHE A 1 10 ? 4.042   -7.710  5.811   1.00 0.00 ? 8  PHE P HD2  1  
ATOM 175   H HE1  . PHE A 1 10 ? 1.834   -3.292  5.212   1.00 0.00 ? 8  PHE P HE1  1  
ATOM 176   H HE2  . PHE A 1 10 ? 4.870   -5.728  7.055   1.00 0.00 ? 8  PHE P HE2  1  
ATOM 177   H HZ   . PHE A 1 10 ? 3.763   -3.522  6.765   1.00 0.00 ? 8  PHE P HZ   1  
ATOM 178   N N    . THR A 1 11 ? -0.769  -9.910  3.177   1.00 0.00 ? 9  THR P N    1  
ATOM 179   C CA   . THR A 1 11 ? -1.073  -11.120 2.388   1.00 0.00 ? 9  THR P CA   1  
ATOM 180   C C    . THR A 1 11 ? -0.210  -11.211 1.125   1.00 0.00 ? 9  THR P C    1  
ATOM 181   O O    . THR A 1 11 ? 0.370   -10.219 0.677   1.00 0.00 ? 9  THR P O    1  
ATOM 182   C CB   . THR A 1 11 ? -2.556  -11.190 1.988   1.00 0.00 ? 9  THR P CB   1  
ATOM 183   O OG1  . THR A 1 11 ? -2.864  -10.171 1.061   1.00 0.00 ? 9  THR P OG1  1  
ATOM 184   C CG2  . THR A 1 11 ? -3.509  -11.069 3.176   1.00 0.00 ? 9  THR P CG2  1  
ATOM 185   H H    . THR A 1 11 ? -1.381  -9.108  3.057   1.00 0.00 ? 9  THR P H    1  
ATOM 186   H HA   . THR A 1 11 ? -0.859  -11.998 2.998   1.00 0.00 ? 9  THR P HA   1  
ATOM 187   H HB   . THR A 1 11 ? -2.740  -12.152 1.509   1.00 0.00 ? 9  THR P HB   1  
ATOM 188   H HG1  . THR A 1 11 ? -3.830  -10.168 0.953   1.00 0.00 ? 9  THR P HG1  1  
ATOM 189   H HG21 . THR A 1 11 ? -3.436  -10.080 3.628   1.00 0.00 ? 9  THR P HG21 1  
ATOM 190   H HG22 . THR A 1 11 ? -3.259  -11.823 3.923   1.00 0.00 ? 9  THR P HG22 1  
ATOM 191   H HG23 . THR A 1 11 ? -4.533  -11.233 2.843   1.00 0.00 ? 9  THR P HG23 1  
ATOM 192   N N    . SER A 1 12 ? -0.160  -12.387 0.490   1.00 0.00 ? 10 SER P N    1  
ATOM 193   C CA   . SER A 1 12 ? 0.601   -12.609 -0.753  1.00 0.00 ? 10 SER P CA   1  
ATOM 194   C C    . SER A 1 12 ? 0.172   -11.693 -1.910  1.00 0.00 ? 10 SER P C    1  
ATOM 195   O O    . SER A 1 12 ? 1.005   -11.334 -2.744  1.00 0.00 ? 10 SER P O    1  
ATOM 196   C CB   . SER A 1 12 ? 0.466   -14.073 -1.194  1.00 0.00 ? 10 SER P CB   1  
ATOM 197   O OG   . SER A 1 12 ? 0.837   -14.948 -0.138  1.00 0.00 ? 10 SER P OG   1  
ATOM 198   H H    . SER A 1 12 ? -0.601  -13.193 0.912   1.00 0.00 ? 10 SER P H    1  
ATOM 199   H HA   . SER A 1 12 ? 1.655   -12.414 -0.555  1.00 0.00 ? 10 SER P HA   1  
ATOM 200   H HB2  . SER A 1 12 ? -0.567  -14.272 -1.483  1.00 0.00 ? 10 SER P HB2  1  
ATOM 201   H HB3  . SER A 1 12 ? 1.112   -14.249 -2.058  1.00 0.00 ? 10 SER P HB3  1  
ATOM 202   H HG   . SER A 1 12 ? 0.765   -15.868 -0.461  1.00 0.00 ? 10 SER P HG   1  
ATOM 203   N N    . GLN A 1 13 ? -1.099  -11.272 -1.961  1.00 0.00 ? 11 GLN P N    1  
ATOM 204   C CA   . GLN A 1 13 ? -1.589  -10.309 -2.959  1.00 0.00 ? 11 GLN P CA   1  
ATOM 205   C C    . GLN A 1 13 ? -1.314  -8.846  -2.569  1.00 0.00 ? 11 GLN P C    1  
ATOM 206   O O    . GLN A 1 13 ? -0.959  -8.046  -3.436  1.00 0.00 ? 11 GLN P O    1  
ATOM 207   C CB   . GLN A 1 13 ? -3.062  -10.583 -3.312  1.00 0.00 ? 11 GLN P CB   1  
ATOM 208   C CG   . GLN A 1 13 ? -4.055  -10.428 -2.147  1.00 0.00 ? 11 GLN P CG   1  
ATOM 209   C CD   . GLN A 1 13 ? -5.512  -10.695 -2.546  1.00 0.00 ? 11 GLN P CD   1  
ATOM 210   O OE1  . GLN A 1 13 ? -5.849  -11.033 -3.676  1.00 0.00 ? 11 GLN P OE1  1  
ATOM 211   N NE2  . GLN A 1 13 ? -6.445  -10.556 -1.628  1.00 0.00 ? 11 GLN P NE2  1  
ATOM 212   H H    . GLN A 1 13 ? -1.738  -11.599 -1.251  1.00 0.00 ? 11 GLN P H    1  
ATOM 213   H HA   . GLN A 1 13 ? -1.038  -10.476 -3.884  1.00 0.00 ? 11 GLN P HA   1  
ATOM 214   H HB2  . GLN A 1 13 ? -3.352  -9.900  -4.111  1.00 0.00 ? 11 GLN P HB2  1  
ATOM 215   H HB3  . GLN A 1 13 ? -3.135  -11.600 -3.701  1.00 0.00 ? 11 GLN P HB3  1  
ATOM 216   H HG2  . GLN A 1 13 ? -3.787  -11.128 -1.357  1.00 0.00 ? 11 GLN P HG2  1  
ATOM 217   H HG3  . GLN A 1 13 ? -3.989  -9.416  -1.751  1.00 0.00 ? 11 GLN P HG3  1  
ATOM 218   H HE21 . GLN A 1 13 ? -6.206  -10.278 -0.689  1.00 0.00 ? 11 GLN P HE21 1  
ATOM 219   H HE22 . GLN A 1 13 ? -7.404  -10.733 -1.891  1.00 0.00 ? 11 GLN P HE22 1  
ATOM 220   N N    . GLN A 1 14 ? -1.378  -8.495  -1.278  1.00 0.00 ? 12 GLN P N    1  
ATOM 221   C CA   . GLN A 1 14 ? -0.987  -7.163  -0.789  1.00 0.00 ? 12 GLN P CA   1  
ATOM 222   C C    . GLN A 1 14 ? 0.511   -6.904  -0.998  1.00 0.00 ? 12 GLN P C    1  
ATOM 223   O O    . GLN A 1 14 ? 0.885   -5.826  -1.456  1.00 0.00 ? 12 GLN P O    1  
ATOM 224   C CB   . GLN A 1 14 ? -1.336  -7.027  0.699   1.00 0.00 ? 12 GLN P CB   1  
ATOM 225   C CG   . GLN A 1 14 ? -2.845  -6.874  0.949   1.00 0.00 ? 12 GLN P CG   1  
ATOM 226   C CD   . GLN A 1 14 ? -3.208  -6.974  2.431   1.00 0.00 ? 12 GLN P CD   1  
ATOM 227   O OE1  . GLN A 1 14 ? -2.507  -7.563  3.238   1.00 0.00 ? 12 GLN P OE1  1  
ATOM 228   N NE2  . GLN A 1 14 ? -4.315  -6.410  2.854   1.00 0.00 ? 12 GLN P NE2  1  
ATOM 229   H H    . GLN A 1 14 ? -1.659  -9.189  -0.593  1.00 0.00 ? 12 GLN P H    1  
ATOM 230   H HA   . GLN A 1 14 ? -1.532  -6.398  -1.346  1.00 0.00 ? 12 GLN P HA   1  
ATOM 231   H HB2  . GLN A 1 14 ? -0.955  -7.902  1.226   1.00 0.00 ? 12 GLN P HB2  1  
ATOM 232   H HB3  . GLN A 1 14 ? -0.836  -6.145  1.103   1.00 0.00 ? 12 GLN P HB3  1  
ATOM 233   H HG2  . GLN A 1 14 ? -3.169  -5.910  0.562   1.00 0.00 ? 12 GLN P HG2  1  
ATOM 234   H HG3  . GLN A 1 14 ? -3.396  -7.645  0.412   1.00 0.00 ? 12 GLN P HG3  1  
ATOM 235   H HE21 . GLN A 1 14 ? -4.855  -5.817  2.228   1.00 0.00 ? 12 GLN P HE21 1  
ATOM 236   H HE22 . GLN A 1 14 ? -4.532  -6.471  3.834   1.00 0.00 ? 12 GLN P HE22 1  
ATOM 237   N N    . LEU A 1 15 ? 1.367   -7.901  -0.736  1.00 0.00 ? 13 LEU P N    1  
ATOM 238   C CA   . LEU A 1 15 ? 2.813   -7.827  -0.976  1.00 0.00 ? 13 LEU P CA   1  
ATOM 239   C C    . LEU A 1 15 ? 3.142   -7.577  -2.456  1.00 0.00 ? 13 LEU P C    1  
ATOM 240   O O    . LEU A 1 15 ? 4.015   -6.765  -2.755  1.00 0.00 ? 13 LEU P O    1  
ATOM 241   C CB   . LEU A 1 15 ? 3.481   -9.132  -0.498  1.00 0.00 ? 13 LEU P CB   1  
ATOM 242   C CG   . LEU A 1 15 ? 3.574   -9.297  1.030   1.00 0.00 ? 13 LEU P CG   1  
ATOM 243   C CD1  . LEU A 1 15 ? 4.101   -10.691 1.369   1.00 0.00 ? 13 LEU P CD1  1  
ATOM 244   C CD2  . LEU A 1 15 ? 4.512   -8.265  1.660   1.00 0.00 ? 13 LEU P CD2  1  
ATOM 245   H H    . LEU A 1 15 ? 0.989   -8.753  -0.331  1.00 0.00 ? 13 LEU P H    1  
ATOM 246   H HA   . LEU A 1 15 ? 3.221   -6.983  -0.420  1.00 0.00 ? 13 LEU P HA   1  
ATOM 247   H HB2  . LEU A 1 15 ? 2.930   -9.977  -0.914  1.00 0.00 ? 13 LEU P HB2  1  
ATOM 248   H HB3  . LEU A 1 15 ? 4.493   -9.173  -0.903  1.00 0.00 ? 13 LEU P HB3  1  
ATOM 249   H HG   . LEU A 1 15 ? 2.588   -9.188  1.473   1.00 0.00 ? 13 LEU P HG   1  
ATOM 250   H HD11 . LEU A 1 15 ? 3.431   -11.445 0.958   1.00 0.00 ? 13 LEU P HD11 1  
ATOM 251   H HD12 . LEU A 1 15 ? 4.139   -10.816 2.451   1.00 0.00 ? 13 LEU P HD12 1  
ATOM 252   H HD13 . LEU A 1 15 ? 5.100   -10.828 0.953   1.00 0.00 ? 13 LEU P HD13 1  
ATOM 253   H HD21 . LEU A 1 15 ? 5.481   -8.285  1.160   1.00 0.00 ? 13 LEU P HD21 1  
ATOM 254   H HD22 . LEU A 1 15 ? 4.654   -8.488  2.717   1.00 0.00 ? 13 LEU P HD22 1  
ATOM 255   H HD23 . LEU A 1 15 ? 4.068   -7.273  1.582   1.00 0.00 ? 13 LEU P HD23 1  
ATOM 256   N N    . GLN A 1 16 ? 2.430   -8.226  -3.383  1.00 0.00 ? 14 GLN P N    1  
ATOM 257   C CA   . GLN A 1 16 ? 2.639   -8.048  -4.826  1.00 0.00 ? 14 GLN P CA   1  
ATOM 258   C C    . GLN A 1 16 ? 2.085   -6.719  -5.351  1.00 0.00 ? 14 GLN P C    1  
ATOM 259   O O    . GLN A 1 16 ? 2.723   -6.086  -6.193  1.00 0.00 ? 14 GLN P O    1  
ATOM 260   C CB   . GLN A 1 16 ? 2.044   -9.241  -5.585  1.00 0.00 ? 14 GLN P CB   1  
ATOM 261   C CG   . GLN A 1 16 ? 2.957   -10.461 -5.423  1.00 0.00 ? 14 GLN P CG   1  
ATOM 262   C CD   . GLN A 1 16 ? 2.358   -11.708 -6.066  1.00 0.00 ? 14 GLN P CD   1  
ATOM 263   O OE1  . GLN A 1 16 ? 2.654   -12.069 -7.200  1.00 0.00 ? 14 GLN P OE1  1  
ATOM 264   N NE2  . GLN A 1 16 ? 1.484   -12.406 -5.374  1.00 0.00 ? 14 GLN P NE2  1  
ATOM 265   H H    . GLN A 1 16 ? 1.734   -8.891  -3.073  1.00 0.00 ? 14 GLN P H    1  
ATOM 266   H HA   . GLN A 1 16 ? 3.712   -8.030  -5.023  1.00 0.00 ? 14 GLN P HA   1  
ATOM 267   H HB2  . GLN A 1 16 ? 1.042   -9.460  -5.210  1.00 0.00 ? 14 GLN P HB2  1  
ATOM 268   H HB3  . GLN A 1 16 ? 1.976   -8.999  -6.647  1.00 0.00 ? 14 GLN P HB3  1  
ATOM 269   H HG2  . GLN A 1 16 ? 3.920   -10.239 -5.883  1.00 0.00 ? 14 GLN P HG2  1  
ATOM 270   H HG3  . GLN A 1 16 ? 3.124   -10.648 -4.362  1.00 0.00 ? 14 GLN P HG3  1  
ATOM 271   H HE21 . GLN A 1 16 ? 1.250   -12.105 -4.433  1.00 0.00 ? 14 GLN P HE21 1  
ATOM 272   H HE22 . GLN A 1 16 ? 1.079   -13.230 -5.791  1.00 0.00 ? 14 GLN P HE22 1  
ATOM 273   N N    . GLU A 1 17 ? 0.954   -6.242  -4.823  1.00 0.00 ? 15 GLU P N    1  
ATOM 274   C CA   . GLU A 1 17 ? 0.444   -4.899  -5.124  1.00 0.00 ? 15 GLU P CA   1  
ATOM 275   C C    . GLU A 1 17 ? 1.394   -3.809  -4.590  1.00 0.00 ? 15 GLU P C    1  
ATOM 276   O O    . GLU A 1 17 ? 1.605   -2.792  -5.252  1.00 0.00 ? 15 GLU P O    1  
ATOM 277   C CB   . GLU A 1 17 ? -0.971  -4.754  -4.539  1.00 0.00 ? 15 GLU P CB   1  
ATOM 278   C CG   . GLU A 1 17 ? -1.740  -3.535  -5.069  1.00 0.00 ? 15 GLU P CG   1  
ATOM 279   C CD   . GLU A 1 17 ? -2.135  -3.701  -6.550  1.00 0.00 ? 15 GLU P CD   1  
ATOM 280   O OE1  . GLU A 1 17 ? -3.180  -4.336  -6.834  1.00 0.00 ? 15 GLU P OE1  1  
ATOM 281   O OE2  . GLU A 1 17 ? -1.413  -3.196  -7.443  1.00 0.00 ? 15 GLU P OE2  1  
ATOM 282   H H    . GLU A 1 17 ? 0.435   -6.823  -4.172  1.00 0.00 ? 15 GLU P H    1  
ATOM 283   H HA   . GLU A 1 17 ? 0.389   -4.786  -6.207  1.00 0.00 ? 15 GLU P HA   1  
ATOM 284   H HB2  . GLU A 1 17 ? -1.551  -5.647  -4.776  1.00 0.00 ? 15 GLU P HB2  1  
ATOM 285   H HB3  . GLU A 1 17 ? -0.897  -4.682  -3.453  1.00 0.00 ? 15 GLU P HB3  1  
ATOM 286   H HG2  . GLU A 1 17 ? -2.647  -3.416  -4.471  1.00 0.00 ? 15 GLU P HG2  1  
ATOM 287   H HG3  . GLU A 1 17 ? -1.144  -2.631  -4.925  1.00 0.00 ? 15 GLU P HG3  1  
ATOM 288   N N    . LEU A 1 18 ? 2.035   -4.038  -3.438  1.00 0.00 ? 16 LEU P N    1  
ATOM 289   C CA   . LEU A 1 18 ? 3.040   -3.129  -2.876  1.00 0.00 ? 16 LEU P CA   1  
ATOM 290   C C    . LEU A 1 18 ? 4.377   -3.193  -3.629  1.00 0.00 ? 16 LEU P C    1  
ATOM 291   O O    . LEU A 1 18 ? 5.003   -2.155  -3.827  1.00 0.00 ? 16 LEU P O    1  
ATOM 292   C CB   . LEU A 1 18 ? 3.196   -3.388  -1.368  1.00 0.00 ? 16 LEU P CB   1  
ATOM 293   C CG   . LEU A 1 18 ? 2.088   -2.713  -0.538  1.00 0.00 ? 16 LEU P CG   1  
ATOM 294   C CD1  . LEU A 1 18 ? 1.982   -3.353  0.847   1.00 0.00 ? 16 LEU P CD1  1  
ATOM 295   C CD2  . LEU A 1 18 ? 2.365   -1.218  -0.339  1.00 0.00 ? 16 LEU P CD2  1  
ATOM 296   H H    . LEU A 1 18 ? 1.823   -4.894  -2.934  1.00 0.00 ? 16 LEU P H    1  
ATOM 297   H HA   . LEU A 1 18 ? 2.677   -2.110  -3.000  1.00 0.00 ? 16 LEU P HA   1  
ATOM 298   H HB2  . LEU A 1 18 ? 3.206   -4.462  -1.188  1.00 0.00 ? 16 LEU P HB2  1  
ATOM 299   H HB3  . LEU A 1 18 ? 4.155   -2.991  -1.041  1.00 0.00 ? 16 LEU P HB3  1  
ATOM 300   H HG   . LEU A 1 18 ? 1.132   -2.819  -1.048  1.00 0.00 ? 16 LEU P HG   1  
ATOM 301   H HD11 . LEU A 1 18 ? 1.199   -2.861  1.419   1.00 0.00 ? 16 LEU P HD11 1  
ATOM 302   H HD12 . LEU A 1 18 ? 2.927   -3.257  1.376   1.00 0.00 ? 16 LEU P HD12 1  
ATOM 303   H HD13 . LEU A 1 18 ? 1.734   -4.408  0.745   1.00 0.00 ? 16 LEU P HD13 1  
ATOM 304   H HD21 . LEU A 1 18 ? 1.557   -0.772  0.240   1.00 0.00 ? 16 LEU P HD21 1  
ATOM 305   H HD22 . LEU A 1 18 ? 2.420   -0.713  -1.302  1.00 0.00 ? 16 LEU P HD22 1  
ATOM 306   H HD23 . LEU A 1 18 ? 3.306   -1.077  0.192   1.00 0.00 ? 16 LEU P HD23 1  
ATOM 307   N N    . GLU A 1 19 ? 4.789   -4.355  -4.146  1.00 0.00 ? 17 GLU P N    1  
ATOM 308   C CA   . GLU A 1 19 ? 5.936   -4.455  -5.061  1.00 0.00 ? 17 GLU P CA   1  
ATOM 309   C C    . GLU A 1 19 ? 5.669   -3.722  -6.385  1.00 0.00 ? 17 GLU P C    1  
ATOM 310   O O    . GLU A 1 19 ? 6.511   -2.946  -6.833  1.00 0.00 ? 17 GLU P O    1  
ATOM 311   C CB   . GLU A 1 19 ? 6.316   -5.927  -5.320  1.00 0.00 ? 17 GLU P CB   1  
ATOM 312   C CG   . GLU A 1 19 ? 7.710   -6.275  -4.784  1.00 0.00 ? 17 GLU P CG   1  
ATOM 313   C CD   . GLU A 1 19 ? 8.823   -5.485  -5.495  1.00 0.00 ? 17 GLU P CD   1  
ATOM 314   O OE1  . GLU A 1 19 ? 9.080   -5.730  -6.698  1.00 0.00 ? 17 GLU P OE1  1  
ATOM 315   O OE2  . GLU A 1 19 ? 9.458   -4.624  -4.845  1.00 0.00 ? 17 GLU P OE2  1  
ATOM 316   H H    . GLU A 1 19 ? 4.295   -5.202  -3.887  1.00 0.00 ? 17 GLU P H    1  
ATOM 317   H HA   . GLU A 1 19 ? 6.783   -3.950  -4.593  1.00 0.00 ? 17 GLU P HA   1  
ATOM 318   H HB2  . GLU A 1 19 ? 5.592   -6.590  -4.851  1.00 0.00 ? 17 GLU P HB2  1  
ATOM 319   H HB3  . GLU A 1 19 ? 6.294   -6.135  -6.391  1.00 0.00 ? 17 GLU P HB3  1  
ATOM 320   H HG2  . GLU A 1 19 ? 7.735   -6.077  -3.709  1.00 0.00 ? 17 GLU P HG2  1  
ATOM 321   H HG3  . GLU A 1 19 ? 7.881   -7.345  -4.925  1.00 0.00 ? 17 GLU P HG3  1  
ATOM 322   N N    . ALA A 1 20 ? 4.483   -3.884  -6.981  1.00 0.00 ? 18 ALA P N    1  
ATOM 323   C CA   . ALA A 1 20 ? 4.075   -3.119  -8.164  1.00 0.00 ? 18 ALA P CA   1  
ATOM 324   C C    . ALA A 1 20 ? 4.017   -1.602  -7.883  1.00 0.00 ? 18 ALA P C    1  
ATOM 325   O O    . ALA A 1 20 ? 4.456   -0.796  -8.707  1.00 0.00 ? 18 ALA P O    1  
ATOM 326   C CB   . ALA A 1 20 ? 2.727   -3.661  -8.653  1.00 0.00 ? 18 ALA P CB   1  
ATOM 327   H H    . ALA A 1 20 ? 3.835   -4.568  -6.601  1.00 0.00 ? 18 ALA P H    1  
ATOM 328   H HA   . ALA A 1 20 ? 4.812   -3.279  -8.951  1.00 0.00 ? 18 ALA P HA   1  
ATOM 329   H HB1  . ALA A 1 20 ? 1.962   -3.519  -7.889  1.00 0.00 ? 18 ALA P HB1  1  
ATOM 330   H HB2  . ALA A 1 20 ? 2.428   -3.132  -9.559  1.00 0.00 ? 18 ALA P HB2  1  
ATOM 331   H HB3  . ALA A 1 20 ? 2.815   -4.725  -8.878  1.00 0.00 ? 18 ALA P HB3  1  
ATOM 332   N N    . THR A 1 21 ? 3.555   -1.208  -6.690  1.00 0.00 ? 19 THR P N    1  
ATOM 333   C CA   . THR A 1 21 ? 3.577   0.185   -6.208  1.00 0.00 ? 19 THR P CA   1  
ATOM 334   C C    . THR A 1 21 ? 5.014   0.707   -6.084  1.00 0.00 ? 19 THR P C    1  
ATOM 335   O O    . THR A 1 21 ? 5.303   1.792   -6.581  1.00 0.00 ? 19 THR P O    1  
ATOM 336   C CB   . THR A 1 21 ? 2.835   0.307   -4.863  1.00 0.00 ? 19 THR P CB   1  
ATOM 337   O OG1  . THR A 1 21 ? 1.481   -0.062  -5.016  1.00 0.00 ? 19 THR P OG1  1  
ATOM 338   C CG2  . THR A 1 21 ? 2.813   1.719   -4.284  1.00 0.00 ? 19 THR P CG2  1  
ATOM 339   H H    . THR A 1 21 ? 3.157   -1.918  -6.085  1.00 0.00 ? 19 THR P H    1  
ATOM 340   H HA   . THR A 1 21 ? 3.060   0.816   -6.931  1.00 0.00 ? 19 THR P HA   1  
ATOM 341   H HB   . THR A 1 21 ? 3.303   -0.348  -4.132  1.00 0.00 ? 19 THR P HB   1  
ATOM 342   H HG1  . THR A 1 21 ? 1.455   -1.027  -5.166  1.00 0.00 ? 19 THR P HG1  1  
ATOM 343   H HG21 . THR A 1 21 ? 2.312   1.686   -3.316  1.00 0.00 ? 19 THR P HG21 1  
ATOM 344   H HG22 . THR A 1 21 ? 2.280   2.393   -4.954  1.00 0.00 ? 19 THR P HG22 1  
ATOM 345   H HG23 . THR A 1 21 ? 3.827   2.082   -4.135  1.00 0.00 ? 19 THR P HG23 1  
ATOM 346   N N    . PHE A 1 22 ? 5.938   -0.071  -5.510  1.00 0.00 ? 20 PHE P N    1  
ATOM 347   C CA   . PHE A 1 22 ? 7.353   0.292   -5.357  1.00 0.00 ? 20 PHE P CA   1  
ATOM 348   C C    . PHE A 1 22 ? 8.081   0.407   -6.708  1.00 0.00 ? 20 PHE P C    1  
ATOM 349   O O    . PHE A 1 22 ? 8.843   1.350   -6.923  1.00 0.00 ? 20 PHE P O    1  
ATOM 350   C CB   . PHE A 1 22 ? 8.028   -0.741  -4.443  1.00 0.00 ? 20 PHE P CB   1  
ATOM 351   C CG   . PHE A 1 22 ? 9.444   -0.394  -4.022  1.00 0.00 ? 20 PHE P CG   1  
ATOM 352   C CD1  . PHE A 1 22 ? 9.663   0.494   -2.952  1.00 0.00 ? 20 PHE P CD1  1  
ATOM 353   C CD2  . PHE A 1 22 ? 10.547  -0.969  -4.685  1.00 0.00 ? 20 PHE P CD2  1  
ATOM 354   C CE1  . PHE A 1 22 ? 10.972  0.809   -2.547  1.00 0.00 ? 20 PHE P CE1  1  
ATOM 355   C CE2  . PHE A 1 22 ? 11.857  -0.655  -4.278  1.00 0.00 ? 20 PHE P CE2  1  
ATOM 356   C CZ   . PHE A 1 22 ? 12.070  0.231   -3.209  1.00 0.00 ? 20 PHE P CZ   1  
ATOM 357   H H    . PHE A 1 22 ? 5.636   -0.951  -5.104  1.00 0.00 ? 20 PHE P H    1  
ATOM 358   H HA   . PHE A 1 22 ? 7.410   1.264   -4.868  1.00 0.00 ? 20 PHE P HA   1  
ATOM 359   H HB2  . PHE A 1 22 ? 7.427   -0.840  -3.542  1.00 0.00 ? 20 PHE P HB2  1  
ATOM 360   H HB3  . PHE A 1 22 ? 8.031   -1.713  -4.938  1.00 0.00 ? 20 PHE P HB3  1  
ATOM 361   H HD1  . PHE A 1 22 ? 8.823   0.933   -2.434  1.00 0.00 ? 20 PHE P HD1  1  
ATOM 362   H HD2  . PHE A 1 22 ? 10.387  -1.659  -5.502  1.00 0.00 ? 20 PHE P HD2  1  
ATOM 363   H HE1  . PHE A 1 22 ? 11.134  1.494   -1.724  1.00 0.00 ? 20 PHE P HE1  1  
ATOM 364   H HE2  . PHE A 1 22 ? 12.702  -1.097  -4.790  1.00 0.00 ? 20 PHE P HE2  1  
ATOM 365   H HZ   . PHE A 1 22 ? 13.078  0.472   -2.895  1.00 0.00 ? 20 PHE P HZ   1  
ATOM 366   N N    . GLN A 1 23 ? 7.801   -0.498  -7.653  1.00 0.00 ? 21 GLN P N    1  
ATOM 367   C CA   . GLN A 1 23 ? 8.323   -0.441  -9.025  1.00 0.00 ? 21 GLN P CA   1  
ATOM 368   C C    . GLN A 1 23 ? 7.831   0.805   -9.789  1.00 0.00 ? 21 GLN P C    1  
ATOM 369   O O    . GLN A 1 23 ? 8.574   1.354   -10.607 1.00 0.00 ? 21 GLN P O    1  
ATOM 370   C CB   . GLN A 1 23 ? 7.929   -1.717  -9.785  1.00 0.00 ? 21 GLN P CB   1  
ATOM 371   C CG   . GLN A 1 23 ? 8.695   -2.969  -9.317  1.00 0.00 ? 21 GLN P CG   1  
ATOM 372   C CD   . GLN A 1 23 ? 8.199   -4.246  -10.001 1.00 0.00 ? 21 GLN P CD   1  
ATOM 373   O OE1  . GLN A 1 23 ? 7.730   -4.252  -11.134 1.00 0.00 ? 21 GLN P OE1  1  
ATOM 374   N NE2  . GLN A 1 23 ? 8.293   -5.391  -9.360  1.00 0.00 ? 21 GLN P NE2  1  
ATOM 375   H H    . GLN A 1 23 ? 7.202   -1.280  -7.400  1.00 0.00 ? 21 GLN P H    1  
ATOM 376   H HA   . GLN A 1 23 ? 9.412   -0.385  -8.986  1.00 0.00 ? 21 GLN P HA   1  
ATOM 377   H HB2  . GLN A 1 23 ? 6.857   -1.886  -9.674  1.00 0.00 ? 21 GLN P HB2  1  
ATOM 378   H HB3  . GLN A 1 23 ? 8.139   -1.570  -10.845 1.00 0.00 ? 21 GLN P HB3  1  
ATOM 379   H HG2  . GLN A 1 23 ? 9.755   -2.847  -9.539  1.00 0.00 ? 21 GLN P HG2  1  
ATOM 380   H HG3  . GLN A 1 23 ? 8.599   -3.082  -8.239  1.00 0.00 ? 21 GLN P HG3  1  
ATOM 381   H HE21 . GLN A 1 23 ? 8.651   -5.424  -8.400  1.00 0.00 ? 21 GLN P HE21 1  
ATOM 382   H HE22 . GLN A 1 23 ? 7.973   -6.227  -9.820  1.00 0.00 ? 21 GLN P HE22 1  
ATOM 383   N N    . ARG A 1 24 ? 6.609   1.285   -9.504  1.00 0.00 ? 22 ARG P N    1  
ATOM 384   C CA   . ARG A 1 24 ? 6.054   2.538   -10.050 1.00 0.00 ? 22 ARG P CA   1  
ATOM 385   C C    . ARG A 1 24 ? 6.651   3.780   -9.371  1.00 0.00 ? 22 ARG P C    1  
ATOM 386   O O    . ARG A 1 24 ? 7.044   4.722   -10.060 1.00 0.00 ? 22 ARG P O    1  
ATOM 387   C CB   . ARG A 1 24 ? 4.518   2.486   -9.942  1.00 0.00 ? 22 ARG P CB   1  
ATOM 388   C CG   . ARG A 1 24 ? 3.824   3.667   -10.643 1.00 0.00 ? 22 ARG P CG   1  
ATOM 389   C CD   . ARG A 1 24 ? 2.295   3.611   -10.493 1.00 0.00 ? 22 ARG P CD   1  
ATOM 390   N NE   . ARG A 1 24 ? 1.701   2.421   -11.138 1.00 0.00 ? 22 ARG P NE   1  
ATOM 391   C CZ   . ARG A 1 24 ? 1.374   2.275   -12.411 1.00 0.00 ? 22 ARG P CZ   1  
ATOM 392   N NH1  . ARG A 1 24 ? 1.557   3.218   -13.293 1.00 0.00 ? 22 ARG P NH1  1  
ATOM 393   N NH2  . ARG A 1 24 ? 0.849   1.159   -12.829 1.00 0.00 ? 22 ARG P NH2  1  
ATOM 394   H H    . ARG A 1 24 ? 6.031   0.743   -8.871  1.00 0.00 ? 22 ARG P H    1  
ATOM 395   H HA   . ARG A 1 24 ? 6.316   2.605   -11.108 1.00 0.00 ? 22 ARG P HA   1  
ATOM 396   H HB2  . ARG A 1 24 ? 4.172   1.557   -10.399 1.00 0.00 ? 22 ARG P HB2  1  
ATOM 397   H HB3  . ARG A 1 24 ? 4.226   2.477   -8.891  1.00 0.00 ? 22 ARG P HB3  1  
ATOM 398   H HG2  . ARG A 1 24 ? 4.170   4.602   -10.203 1.00 0.00 ? 22 ARG P HG2  1  
ATOM 399   H HG3  . ARG A 1 24 ? 4.087   3.665   -11.700 1.00 0.00 ? 22 ARG P HG3  1  
ATOM 400   H HD2  . ARG A 1 24 ? 2.050   3.600   -9.429  1.00 0.00 ? 22 ARG P HD2  1  
ATOM 401   H HD3  . ARG A 1 24 ? 1.863   4.521   -10.914 1.00 0.00 ? 22 ARG P HD3  1  
ATOM 402   H HE   . ARG A 1 24 ? 1.510   1.633   -10.539 1.00 0.00 ? 22 ARG P HE   1  
ATOM 403   H HH11 . ARG A 1 24 ? 1.955   4.093   -13.000 1.00 0.00 ? 22 ARG P HH11 1  
ATOM 404   H HH12 . ARG A 1 24 ? 1.296   3.078   -14.255 1.00 0.00 ? 22 ARG P HH12 1  
ATOM 405   H HH21 . ARG A 1 24 ? 0.688   0.401   -12.186 1.00 0.00 ? 22 ARG P HH21 1  
ATOM 406   H HH22 . ARG A 1 24 ? 0.600   1.047   -13.798 1.00 0.00 ? 22 ARG P HH22 1  
ATOM 407   N N    . ASN A 1 25 ? 6.728   3.782   -8.038  1.00 0.00 ? 23 ASN P N    1  
ATOM 408   C CA   . ASN A 1 25 ? 7.256   4.869   -7.212  1.00 0.00 ? 23 ASN P CA   1  
ATOM 409   C C    . ASN A 1 25 ? 7.809   4.327   -5.874  1.00 0.00 ? 23 ASN P C    1  
ATOM 410   O O    . ASN A 1 25 ? 7.058   3.819   -5.038  1.00 0.00 ? 23 ASN P O    1  
ATOM 411   C CB   . ASN A 1 25 ? 6.120   5.891   -7.000  1.00 0.00 ? 23 ASN P CB   1  
ATOM 412   C CG   . ASN A 1 25 ? 6.528   7.134   -6.226  1.00 0.00 ? 23 ASN P CG   1  
ATOM 413   O OD1  . ASN A 1 25 ? 7.600   7.235   -5.645  1.00 0.00 ? 23 ASN P OD1  1  
ATOM 414   N ND2  . ASN A 1 25 ? 5.670   8.128   -6.202  1.00 0.00 ? 23 ASN P ND2  1  
ATOM 415   H H    . ASN A 1 25 ? 6.350   2.974   -7.553  1.00 0.00 ? 23 ASN P H    1  
ATOM 416   H HA   . ASN A 1 25 ? 8.072   5.363   -7.745  1.00 0.00 ? 23 ASN P HA   1  
ATOM 417   H HB2  . ASN A 1 25 ? 5.751   6.215   -7.974  1.00 0.00 ? 23 ASN P HB2  1  
ATOM 418   H HB3  . ASN A 1 25 ? 5.294   5.413   -6.472  1.00 0.00 ? 23 ASN P HB3  1  
ATOM 419   H HD21 . ASN A 1 25 ? 4.796   8.057   -6.700  1.00 0.00 ? 23 ASN P HD21 1  
ATOM 420   H HD22 . ASN A 1 25 ? 5.931   8.975   -5.726  1.00 0.00 ? 23 ASN P HD22 1  
ATOM 421   N N    . ARG A 1 26 ? 9.123   4.468   -5.650  1.00 0.00 ? 24 ARG P N    1  
ATOM 422   C CA   . ARG A 1 26 ? 9.822   3.932   -4.463  1.00 0.00 ? 24 ARG P CA   1  
ATOM 423   C C    . ARG A 1 26 ? 9.604   4.743   -3.178  1.00 0.00 ? 24 ARG P C    1  
ATOM 424   O O    . ARG A 1 26 ? 9.857   4.225   -2.090  1.00 0.00 ? 24 ARG P O    1  
ATOM 425   C CB   . ARG A 1 26 ? 11.325  3.781   -4.765  1.00 0.00 ? 24 ARG P CB   1  
ATOM 426   C CG   . ARG A 1 26 ? 11.594  2.733   -5.854  1.00 0.00 ? 24 ARG P CG   1  
ATOM 427   C CD   . ARG A 1 26 ? 13.095  2.483   -6.027  1.00 0.00 ? 24 ARG P CD   1  
ATOM 428   N NE   . ARG A 1 26 ? 13.345  1.452   -7.051  1.00 0.00 ? 24 ARG P NE   1  
ATOM 429   C CZ   . ARG A 1 26 ? 14.521  0.974   -7.419  1.00 0.00 ? 24 ARG P CZ   1  
ATOM 430   N NH1  . ARG A 1 26 ? 15.636  1.385   -6.884  1.00 0.00 ? 24 ARG P NH1  1  
ATOM 431   N NH2  . ARG A 1 26 ? 14.600  0.061   -8.345  1.00 0.00 ? 24 ARG P NH2  1  
ATOM 432   H H    . ARG A 1 26 ? 9.677   4.917   -6.366  1.00 0.00 ? 24 ARG P H    1  
ATOM 433   H HA   . ARG A 1 26 ? 9.425   2.939   -4.250  1.00 0.00 ? 24 ARG P HA   1  
ATOM 434   H HB2  . ARG A 1 26 ? 11.737  4.743   -5.075  1.00 0.00 ? 24 ARG P HB2  1  
ATOM 435   H HB3  . ARG A 1 26 ? 11.836  3.466   -3.853  1.00 0.00 ? 24 ARG P HB3  1  
ATOM 436   H HG2  . ARG A 1 26 ? 11.114  1.796   -5.572  1.00 0.00 ? 24 ARG P HG2  1  
ATOM 437   H HG3  . ARG A 1 26 ? 11.178  3.070   -6.803  1.00 0.00 ? 24 ARG P HG3  1  
ATOM 438   H HD2  . ARG A 1 26 ? 13.576  3.418   -6.322  1.00 0.00 ? 24 ARG P HD2  1  
ATOM 439   H HD3  . ARG A 1 26 ? 13.509  2.157   -5.071  1.00 0.00 ? 24 ARG P HD3  1  
ATOM 440   H HE   . ARG A 1 26 ? 12.540  1.070   -7.520  1.00 0.00 ? 24 ARG P HE   1  
ATOM 441   H HH11 . ARG A 1 26 ? 15.604  2.089   -6.169  1.00 0.00 ? 24 ARG P HH11 1  
ATOM 442   H HH12 . ARG A 1 26 ? 16.519  1.013   -7.189  1.00 0.00 ? 24 ARG P HH12 1  
ATOM 443   H HH21 . ARG A 1 26 ? 13.766  -0.282  -8.793  1.00 0.00 ? 24 ARG P HH21 1  
ATOM 444   H HH22 . ARG A 1 26 ? 15.496  -0.300  -8.627  1.00 0.00 ? 24 ARG P HH22 1  
ATOM 445   N N    . TYR A 1 27 ? 9.147   5.992   -3.286  1.00 0.00 ? 25 TYR P N    1  
ATOM 446   C CA   . TYR A 1 27 ? 8.900   6.895   -2.152  1.00 0.00 ? 25 TYR P CA   1  
ATOM 447   C C    . TYR A 1 27 ? 7.728   7.866   -2.441  1.00 0.00 ? 25 TYR P C    1  
ATOM 448   O O    . TYR A 1 27 ? 7.948   9.055   -2.686  1.00 0.00 ? 25 TYR P O    1  
ATOM 449   C CB   . TYR A 1 27 ? 10.216  7.600   -1.744  1.00 0.00 ? 25 TYR P CB   1  
ATOM 450   C CG   . TYR A 1 27 ? 11.098  8.128   -2.871  1.00 0.00 ? 25 TYR P CG   1  
ATOM 451   C CD1  . TYR A 1 27 ? 12.077  7.289   -3.445  1.00 0.00 ? 25 TYR P CD1  1  
ATOM 452   C CD2  . TYR A 1 27 ? 10.972  9.458   -3.324  1.00 0.00 ? 25 TYR P CD2  1  
ATOM 453   C CE1  . TYR A 1 27 ? 12.898  7.762   -4.486  1.00 0.00 ? 25 TYR P CE1  1  
ATOM 454   C CE2  . TYR A 1 27 ? 11.794  9.936   -4.364  1.00 0.00 ? 25 TYR P CE2  1  
ATOM 455   C CZ   . TYR A 1 27 ? 12.757  9.088   -4.952  1.00 0.00 ? 25 TYR P CZ   1  
ATOM 456   O OH   . TYR A 1 27 ? 13.555  9.539   -5.959  1.00 0.00 ? 25 TYR P OH   1  
ATOM 457   H H    . TYR A 1 27 ? 8.946   6.340   -4.213  1.00 0.00 ? 25 TYR P H    1  
ATOM 458   H HA   . TYR A 1 27 ? 8.588   6.299   -1.293  1.00 0.00 ? 25 TYR P HA   1  
ATOM 459   H HB2  . TYR A 1 27 ? 9.986   8.415   -1.057  1.00 0.00 ? 25 TYR P HB2  1  
ATOM 460   H HB3  . TYR A 1 27 ? 10.808  6.883   -1.174  1.00 0.00 ? 25 TYR P HB3  1  
ATOM 461   H HD1  . TYR A 1 27 ? 12.198  6.277   -3.082  1.00 0.00 ? 25 TYR P HD1  1  
ATOM 462   H HD2  . TYR A 1 27 ? 10.242  10.116  -2.873  1.00 0.00 ? 25 TYR P HD2  1  
ATOM 463   H HE1  . TYR A 1 27 ? 13.644  7.120   -4.931  1.00 0.00 ? 25 TYR P HE1  1  
ATOM 464   H HE2  . TYR A 1 27 ? 11.687  10.955  -4.712  1.00 0.00 ? 25 TYR P HE2  1  
ATOM 465   H HH   . TYR A 1 27 ? 13.368  10.466  -6.190  1.00 0.00 ? 25 TYR P HH   1  
ATOM 466   N N    . PRO A 1 28 ? 6.464   7.391   -2.405  1.00 0.00 ? 26 PRO P N    1  
ATOM 467   C CA   . PRO A 1 28 ? 5.293   8.227   -2.685  1.00 0.00 ? 26 PRO P CA   1  
ATOM 468   C C    . PRO A 1 28 ? 5.042   9.310   -1.626  1.00 0.00 ? 26 PRO P C    1  
ATOM 469   O O    . PRO A 1 28 ? 5.546   9.231   -0.502  1.00 0.00 ? 26 PRO P O    1  
ATOM 470   C CB   . PRO A 1 28 ? 4.105   7.264   -2.819  1.00 0.00 ? 26 PRO P CB   1  
ATOM 471   C CG   . PRO A 1 28 ? 4.735   5.884   -2.984  1.00 0.00 ? 26 PRO P CG   1  
ATOM 472   C CD   . PRO A 1 28 ? 6.045   6.009   -2.216  1.00 0.00 ? 26 PRO P CD   1  
ATOM 473   H HA   . PRO A 1 28 ? 5.434   8.724   -3.640  1.00 0.00 ? 26 PRO P HA   1  
ATOM 474   H HB2  . PRO A 1 28 ? 3.498   7.278   -1.915  1.00 0.00 ? 26 PRO P HB2  1  
ATOM 475   H HB3  . PRO A 1 28 ? 3.494   7.516   -3.684  1.00 0.00 ? 26 PRO P HB3  1  
ATOM 476   H HG2  . PRO A 1 28 ? 4.097   5.099   -2.577  1.00 0.00 ? 26 PRO P HG2  1  
ATOM 477   H HG3  . PRO A 1 28 ? 4.946   5.699   -4.038  1.00 0.00 ? 26 PRO P HG3  1  
ATOM 478   H HD2  . PRO A 1 28 ? 5.873   5.821   -1.156  1.00 0.00 ? 26 PRO P HD2  1  
ATOM 479   H HD3  . PRO A 1 28 ? 6.764   5.293   -2.609  1.00 0.00 ? 26 PRO P HD3  1  
ATOM 480   N N    . ASP A 1 29 ? 4.218   10.304  -1.963  1.00 0.00 ? 27 ASP P N    1  
ATOM 481   C CA   . ASP A 1 29 ? 3.696   11.282  -0.999  1.00 0.00 ? 27 ASP P CA   1  
ATOM 482   C C    . ASP A 1 29 ? 2.773   10.594  0.026   1.00 0.00 ? 27 ASP P C    1  
ATOM 483   O O    . ASP A 1 29 ? 2.159   9.569   -0.273  1.00 0.00 ? 27 ASP P O    1  
ATOM 484   C CB   . ASP A 1 29 ? 2.964   12.396  -1.762  1.00 0.00 ? 27 ASP P CB   1  
ATOM 485   C CG   . ASP A 1 29 ? 2.411   13.474  -0.818  1.00 0.00 ? 27 ASP P CG   1  
ATOM 486   O OD1  . ASP A 1 29 ? 3.154   14.428  -0.491  1.00 0.00 ? 27 ASP P OD1  1  
ATOM 487   O OD2  . ASP A 1 29 ? 1.244   13.344  -0.380  1.00 0.00 ? 27 ASP P OD2  1  
ATOM 488   H H    . ASP A 1 29 ? 3.824   10.309  -2.892  1.00 0.00 ? 27 ASP P H    1  
ATOM 489   H HA   . ASP A 1 29 ? 4.532   11.728  -0.458  1.00 0.00 ? 27 ASP P HA   1  
ATOM 490   H HB2  . ASP A 1 29 ? 3.656   12.855  -2.473  1.00 0.00 ? 27 ASP P HB2  1  
ATOM 491   H HB3  . ASP A 1 29 ? 2.143   11.960  -2.333  1.00 0.00 ? 27 ASP P HB3  1  
ATOM 492   N N    . MET A 1 30 ? 2.650   11.143  1.237   1.00 0.00 ? 28 MET P N    1  
ATOM 493   C CA   . MET A 1 30 ? 1.860   10.551  2.326   1.00 0.00 ? 28 MET P CA   1  
ATOM 494   C C    . MET A 1 30 ? 0.382   10.332  1.944   1.00 0.00 ? 28 MET P C    1  
ATOM 495   O O    . MET A 1 30 ? -0.200  9.318   2.336   1.00 0.00 ? 28 MET P O    1  
ATOM 496   C CB   . MET A 1 30 ? 1.966   11.433  3.581   1.00 0.00 ? 28 MET P CB   1  
ATOM 497   C CG   . MET A 1 30 ? 3.337   11.390  4.277   1.00 0.00 ? 28 MET P CG   1  
ATOM 498   S SD   . MET A 1 30 ? 4.752   12.118  3.393   1.00 0.00 ? 28 MET P SD   1  
ATOM 499   C CE   . MET A 1 30 ? 5.587   10.615  2.801   1.00 0.00 ? 28 MET P CE   1  
ATOM 500   H H    . MET A 1 30 ? 3.168   11.987  1.441   1.00 0.00 ? 28 MET P H    1  
ATOM 501   H HA   . MET A 1 30 ? 2.274   9.570   2.560   1.00 0.00 ? 28 MET P HA   1  
ATOM 502   H HB2  . MET A 1 30 ? 1.723   12.466  3.327   1.00 0.00 ? 28 MET P HB2  1  
ATOM 503   H HB3  . MET A 1 30 ? 1.226   11.086  4.305   1.00 0.00 ? 28 MET P HB3  1  
ATOM 504   H HG2  . MET A 1 30 ? 3.236   11.933  5.217   1.00 0.00 ? 28 MET P HG2  1  
ATOM 505   H HG3  . MET A 1 30 ? 3.574   10.356  4.529   1.00 0.00 ? 28 MET P HG3  1  
ATOM 506   H HE1  . MET A 1 30 ? 6.450   10.894  2.195   1.00 0.00 ? 28 MET P HE1  1  
ATOM 507   H HE2  . MET A 1 30 ? 5.926   10.023  3.651   1.00 0.00 ? 28 MET P HE2  1  
ATOM 508   H HE3  . MET A 1 30 ? 4.906   10.018  2.196   1.00 0.00 ? 28 MET P HE3  1  
ATOM 509   N N    . SER A 1 31 ? -0.214  11.211  1.129   1.00 0.00 ? 29 SER P N    1  
ATOM 510   C CA   . SER A 1 31 ? -1.574  11.018  0.600   1.00 0.00 ? 29 SER P CA   1  
ATOM 511   C C    . SER A 1 31 ? -1.636  9.895   -0.444  1.00 0.00 ? 29 SER P C    1  
ATOM 512   O O    . SER A 1 31 ? -2.592  9.122   -0.458  1.00 0.00 ? 29 SER P O    1  
ATOM 513   C CB   . SER A 1 31 ? -2.113  12.318  -0.006  1.00 0.00 ? 29 SER P CB   1  
ATOM 514   O OG   . SER A 1 31 ? -2.240  13.319  0.994   1.00 0.00 ? 29 SER P OG   1  
ATOM 515   H H    . SER A 1 31 ? 0.312   12.021  0.810   1.00 0.00 ? 29 SER P H    1  
ATOM 516   H HA   . SER A 1 31 ? -2.236  10.737  1.421   1.00 0.00 ? 29 SER P HA   1  
ATOM 517   H HB2  . SER A 1 31 ? -1.441  12.660  -0.795  1.00 0.00 ? 29 SER P HB2  1  
ATOM 518   H HB3  . SER A 1 31 ? -3.095  12.126  -0.444  1.00 0.00 ? 29 SER P HB3  1  
ATOM 519   H HG   . SER A 1 31 ? -2.559  14.140  0.570   1.00 0.00 ? 29 SER P HG   1  
ATOM 520   N N    . THR A 1 32 ? -0.597  9.737   -1.271  1.00 0.00 ? 30 THR P N    1  
ATOM 521   C CA   . THR A 1 32 ? -0.476  8.626   -2.233  1.00 0.00 ? 30 THR P CA   1  
ATOM 522   C C    . THR A 1 32 ? -0.317  7.286   -1.507  1.00 0.00 ? 30 THR P C    1  
ATOM 523   O O    . THR A 1 32 ? -1.003  6.323   -1.856  1.00 0.00 ? 30 THR P O    1  
ATOM 524   C CB   . THR A 1 32 ? 0.706   8.853   -3.193  1.00 0.00 ? 30 THR P CB   1  
ATOM 525   O OG1  . THR A 1 32 ? 0.661   10.148  -3.754  1.00 0.00 ? 30 THR P OG1  1  
ATOM 526   C CG2  . THR A 1 32 ? 0.736   7.862   -4.359  1.00 0.00 ? 30 THR P CG2  1  
ATOM 527   H H    . THR A 1 32 ? 0.181   10.380  -1.199  1.00 0.00 ? 30 THR P H    1  
ATOM 528   H HA   . THR A 1 32 ? -1.390  8.574   -2.824  1.00 0.00 ? 30 THR P HA   1  
ATOM 529   H HB   . THR A 1 32 ? 1.638   8.760   -2.637  1.00 0.00 ? 30 THR P HB   1  
ATOM 530   H HG1  . THR A 1 32 ? -0.157  10.222  -4.274  1.00 0.00 ? 30 THR P HG1  1  
ATOM 531   H HG21 . THR A 1 32 ? 1.556   8.119   -5.034  1.00 0.00 ? 30 THR P HG21 1  
ATOM 532   H HG22 . THR A 1 32 ? -0.206  7.893   -4.906  1.00 0.00 ? 30 THR P HG22 1  
ATOM 533   H HG23 . THR A 1 32 ? 0.901   6.852   -3.986  1.00 0.00 ? 30 THR P HG23 1  
ATOM 534   N N    . ARG A 1 33 ? 0.511   7.225   -0.449  1.00 0.00 ? 31 ARG P N    1  
ATOM 535   C CA   . ARG A 1 33 ? 0.632   6.039   0.426   1.00 0.00 ? 31 ARG P CA   1  
ATOM 536   C C    . ARG A 1 33 ? -0.695  5.687   1.106   1.00 0.00 ? 31 ARG P C    1  
ATOM 537   O O    . ARG A 1 33 ? -1.027  4.511   1.210   1.00 0.00 ? 31 ARG P O    1  
ATOM 538   C CB   . ARG A 1 33 ? 1.737   6.215   1.487   1.00 0.00 ? 31 ARG P CB   1  
ATOM 539   C CG   . ARG A 1 33 ? 3.127   6.396   0.863   1.00 0.00 ? 31 ARG P CG   1  
ATOM 540   C CD   . ARG A 1 33 ? 4.241   6.422   1.914   1.00 0.00 ? 31 ARG P CD   1  
ATOM 541   N NE   . ARG A 1 33 ? 5.408   7.150   1.386   1.00 0.00 ? 31 ARG P NE   1  
ATOM 542   C CZ   . ARG A 1 33 ? 6.675   7.058   1.727   1.00 0.00 ? 31 ARG P CZ   1  
ATOM 543   N NH1  . ARG A 1 33 ? 7.111   6.203   2.606   1.00 0.00 ? 31 ARG P NH1  1  
ATOM 544   N NH2  . ARG A 1 33 ? 7.526   7.868   1.170   1.00 0.00 ? 31 ARG P NH2  1  
ATOM 545   H H    . ARG A 1 33 ? 1.081   8.046   -0.252  1.00 0.00 ? 31 ARG P H    1  
ATOM 546   H HA   . ARG A 1 33 ? 0.894   5.182   -0.195  1.00 0.00 ? 31 ARG P HA   1  
ATOM 547   H HB2  . ARG A 1 33 ? 1.514   7.075   2.122   1.00 0.00 ? 31 ARG P HB2  1  
ATOM 548   H HB3  . ARG A 1 33 ? 1.755   5.326   2.118   1.00 0.00 ? 31 ARG P HB3  1  
ATOM 549   H HG2  . ARG A 1 33 ? 3.326   5.590   0.155   1.00 0.00 ? 31 ARG P HG2  1  
ATOM 550   H HG3  . ARG A 1 33 ? 3.137   7.340   0.326   1.00 0.00 ? 31 ARG P HG3  1  
ATOM 551   H HD2  . ARG A 1 33 ? 3.885   6.937   2.809   1.00 0.00 ? 31 ARG P HD2  1  
ATOM 552   H HD3  . ARG A 1 33 ? 4.501   5.396   2.178   1.00 0.00 ? 31 ARG P HD3  1  
ATOM 553   H HE   . ARG A 1 33 ? 5.215   7.866   0.695   1.00 0.00 ? 31 ARG P HE   1  
ATOM 554   H HH11 . ARG A 1 33 ? 6.459   5.577   3.040   1.00 0.00 ? 31 ARG P HH11 1  
ATOM 555   H HH12 . ARG A 1 33 ? 8.088   6.169   2.847   1.00 0.00 ? 31 ARG P HH12 1  
ATOM 556   H HH21 . ARG A 1 33 ? 7.170   8.567   0.526   1.00 0.00 ? 31 ARG P HH21 1  
ATOM 557   H HH22 . ARG A 1 33 ? 8.494   7.869   1.444   1.00 0.00 ? 31 ARG P HH22 1  
ATOM 558   N N    . GLU A 1 34 ? -1.481  6.680   1.522   1.00 0.00 ? 32 GLU P N    1  
ATOM 559   C CA   . GLU A 1 34 ? -2.810  6.454   2.106   1.00 0.00 ? 32 GLU P CA   1  
ATOM 560   C C    . GLU A 1 34 ? -3.832  5.939   1.076   1.00 0.00 ? 32 GLU P C    1  
ATOM 561   O O    . GLU A 1 34 ? -4.585  5.013   1.380   1.00 0.00 ? 32 GLU P O    1  
ATOM 562   C CB   . GLU A 1 34 ? -3.291  7.738   2.804   1.00 0.00 ? 32 GLU P CB   1  
ATOM 563   C CG   . GLU A 1 34 ? -4.611  7.548   3.562   1.00 0.00 ? 32 GLU P CG   1  
ATOM 564   C CD   . GLU A 1 34 ? -5.046  8.854   4.256   1.00 0.00 ? 32 GLU P CD   1  
ATOM 565   O OE1  . GLU A 1 34 ? -5.658  9.726   3.591   1.00 0.00 ? 32 GLU P OE1  1  
ATOM 566   O OE2  . GLU A 1 34 ? -4.801  9.013   5.477   1.00 0.00 ? 32 GLU P OE2  1  
ATOM 567   H H    . GLU A 1 34 ? -1.127  7.626   1.471   1.00 0.00 ? 32 GLU P H    1  
ATOM 568   H HA   . GLU A 1 34 ? -2.712  5.670   2.857   1.00 0.00 ? 32 GLU P HA   1  
ATOM 569   H HB2  . GLU A 1 34 ? -2.528  8.055   3.517   1.00 0.00 ? 32 GLU P HB2  1  
ATOM 570   H HB3  . GLU A 1 34 ? -3.416  8.526   2.062   1.00 0.00 ? 32 GLU P HB3  1  
ATOM 571   H HG2  . GLU A 1 34 ? -5.391  7.236   2.864   1.00 0.00 ? 32 GLU P HG2  1  
ATOM 572   H HG3  . GLU A 1 34 ? -4.486  6.751   4.300   1.00 0.00 ? 32 GLU P HG3  1  
ATOM 573   N N    . GLU A 1 35 ? -3.840  6.453   -0.158  1.00 0.00 ? 33 GLU P N    1  
ATOM 574   C CA   . GLU A 1 35 ? -4.707  5.925   -1.225  1.00 0.00 ? 33 GLU P CA   1  
ATOM 575   C C    . GLU A 1 35 ? -4.362  4.469   -1.569  1.00 0.00 ? 33 GLU P C    1  
ATOM 576   O O    . GLU A 1 35 ? -5.261  3.630   -1.609  1.00 0.00 ? 33 GLU P O    1  
ATOM 577   C CB   . GLU A 1 35 ? -4.638  6.806   -2.482  1.00 0.00 ? 33 GLU P CB   1  
ATOM 578   C CG   . GLU A 1 35 ? -5.413  8.119   -2.308  1.00 0.00 ? 33 GLU P CG   1  
ATOM 579   C CD   . GLU A 1 35 ? -5.386  8.955   -3.602  1.00 0.00 ? 33 GLU P CD   1  
ATOM 580   O OE1  . GLU A 1 35 ? -4.393  9.682   -3.847  1.00 0.00 ? 33 GLU P OE1  1  
ATOM 581   O OE2  . GLU A 1 35 ? -6.368  8.900   -4.383  1.00 0.00 ? 33 GLU P OE2  1  
ATOM 582   H H    . GLU A 1 35 ? -3.234  7.241   -0.366  1.00 0.00 ? 33 GLU P H    1  
ATOM 583   H HA   . GLU A 1 35 ? -5.743  5.913   -0.871  1.00 0.00 ? 33 GLU P HA   1  
ATOM 584   H HB2  . GLU A 1 35 ? -3.597  7.019   -2.729  1.00 0.00 ? 33 GLU P HB2  1  
ATOM 585   H HB3  . GLU A 1 35 ? -5.083  6.261   -3.315  1.00 0.00 ? 33 GLU P HB3  1  
ATOM 586   H HG2  . GLU A 1 35 ? -6.448  7.882   -2.042  1.00 0.00 ? 33 GLU P HG2  1  
ATOM 587   H HG3  . GLU A 1 35 ? -4.989  8.694   -1.483  1.00 0.00 ? 33 GLU P HG3  1  
ATOM 588   N N    . ILE A 1 36 ? -3.079  4.115   -1.728  1.00 0.00 ? 34 ILE P N    1  
ATOM 589   C CA   . ILE A 1 36 ? -2.707  2.712   -1.989  1.00 0.00 ? 34 ILE P CA   1  
ATOM 590   C C    . ILE A 1 36 ? -2.923  1.807   -0.763  1.00 0.00 ? 34 ILE P C    1  
ATOM 591   O O    . ILE A 1 36 ? -3.178  0.614   -0.931  1.00 0.00 ? 34 ILE P O    1  
ATOM 592   C CB   . ILE A 1 36 ? -1.315  2.570   -2.647  1.00 0.00 ? 34 ILE P CB   1  
ATOM 593   C CG1  . ILE A 1 36 ? -0.112  2.952   -1.770  1.00 0.00 ? 34 ILE P CG1  1  
ATOM 594   C CG2  . ILE A 1 36 ? -1.254  3.405   -3.938  1.00 0.00 ? 34 ILE P CG2  1  
ATOM 595   C CD1  . ILE A 1 36 ? 0.320   1.865   -0.783  1.00 0.00 ? 34 ILE P CD1  1  
ATOM 596   H H    . ILE A 1 36 ? -2.356  4.825   -1.696  1.00 0.00 ? 34 ILE P H    1  
ATOM 597   H HA   . ILE A 1 36 ? -3.410  2.343   -2.736  1.00 0.00 ? 34 ILE P HA   1  
ATOM 598   H HB   . ILE A 1 36 ? -1.200  1.526   -2.937  1.00 0.00 ? 34 ILE P HB   1  
ATOM 599   H HG12 . ILE A 1 36 ? 0.745   3.162   -2.411  1.00 0.00 ? 34 ILE P HG12 1  
ATOM 600   H HG13 . ILE A 1 36 ? -0.349  3.858   -1.228  1.00 0.00 ? 34 ILE P HG13 1  
ATOM 601   H HG21 . ILE A 1 36 ? -2.118  3.191   -4.565  1.00 0.00 ? 34 ILE P HG21 1  
ATOM 602   H HG22 . ILE A 1 36 ? -1.234  4.468   -3.700  1.00 0.00 ? 34 ILE P HG22 1  
ATOM 603   H HG23 . ILE A 1 36 ? -0.351  3.154   -4.495  1.00 0.00 ? 34 ILE P HG23 1  
ATOM 604   H HD11 . ILE A 1 36 ? 0.348   0.895   -1.280  1.00 0.00 ? 34 ILE P HD11 1  
ATOM 605   H HD12 . ILE A 1 36 ? 1.317   2.099   -0.418  1.00 0.00 ? 34 ILE P HD12 1  
ATOM 606   H HD13 . ILE A 1 36 ? -0.361  1.828   0.064   1.00 0.00 ? 34 ILE P HD13 1  
ATOM 607   N N    . ALA A 1 37 ? -2.925  2.356   0.461   1.00 0.00 ? 35 ALA P N    1  
ATOM 608   C CA   . ALA A 1 37 ? -3.332  1.638   1.671   1.00 0.00 ? 35 ALA P CA   1  
ATOM 609   C C    . ALA A 1 37 ? -4.835  1.302   1.644   1.00 0.00 ? 35 ALA P C    1  
ATOM 610   O O    . ALA A 1 37 ? -5.213  0.154   1.863   1.00 0.00 ? 35 ALA P O    1  
ATOM 611   C CB   . ALA A 1 37 ? -2.952  2.448   2.917   1.00 0.00 ? 35 ALA P CB   1  
ATOM 612   H H    . ALA A 1 37 ? -2.640  3.323   0.551   1.00 0.00 ? 35 ALA P H    1  
ATOM 613   H HA   . ALA A 1 37 ? -2.785  0.695   1.713   1.00 0.00 ? 35 ALA P HA   1  
ATOM 614   H HB1  . ALA A 1 37 ? -1.905  2.745   2.877   1.00 0.00 ? 35 ALA P HB1  1  
ATOM 615   H HB2  . ALA A 1 37 ? -3.573  3.337   3.005   1.00 0.00 ? 35 ALA P HB2  1  
ATOM 616   H HB3  . ALA A 1 37 ? -3.099  1.832   3.801   1.00 0.00 ? 35 ALA P HB3  1  
ATOM 617   N N    . VAL A 1 38 ? -5.695  2.259   1.280   1.00 0.00 ? 36 VAL P N    1  
ATOM 618   C CA   . VAL A 1 38 ? -7.134  2.039   1.042   1.00 0.00 ? 36 VAL P CA   1  
ATOM 619   C C    . VAL A 1 38 ? -7.357  0.974   -0.041  1.00 0.00 ? 36 VAL P C    1  
ATOM 620   O O    . VAL A 1 38 ? -8.163  0.064   0.153   1.00 0.00 ? 36 VAL P O    1  
ATOM 621   C CB   . VAL A 1 38 ? -7.825  3.371   0.675   1.00 0.00 ? 36 VAL P CB   1  
ATOM 622   C CG1  . VAL A 1 38 ? -9.255  3.217   0.148   1.00 0.00 ? 36 VAL P CG1  1  
ATOM 623   C CG2  . VAL A 1 38 ? -7.904  4.292   1.896   1.00 0.00 ? 36 VAL P CG2  1  
ATOM 624   H H    . VAL A 1 38 ? -5.325  3.192   1.136   1.00 0.00 ? 36 VAL P H    1  
ATOM 625   H HA   . VAL A 1 38 ? -7.588  1.662   1.959   1.00 0.00 ? 36 VAL P HA   1  
ATOM 626   H HB   . VAL A 1 38 ? -7.247  3.878   -0.093  1.00 0.00 ? 36 VAL P HB   1  
ATOM 627   H HG11 . VAL A 1 38 ? -9.876  2.702   0.880   1.00 0.00 ? 36 VAL P HG11 1  
ATOM 628   H HG12 . VAL A 1 38 ? -9.672  4.205   -0.054  1.00 0.00 ? 36 VAL P HG12 1  
ATOM 629   H HG13 . VAL A 1 38 ? -9.258  2.660   -0.787  1.00 0.00 ? 36 VAL P HG13 1  
ATOM 630   H HG21 . VAL A 1 38 ? -8.544  3.848   2.657   1.00 0.00 ? 36 VAL P HG21 1  
ATOM 631   H HG22 . VAL A 1 38 ? -6.913  4.452   2.314   1.00 0.00 ? 36 VAL P HG22 1  
ATOM 632   H HG23 . VAL A 1 38 ? -8.311  5.257   1.595   1.00 0.00 ? 36 VAL P HG23 1  
ATOM 633   N N    . TRP A 1 39 ? -6.611  1.029   -1.150  1.00 0.00 ? 37 TRP P N    1  
ATOM 634   C CA   . TRP A 1 39 ? -6.745  0.084   -2.270  1.00 0.00 ? 37 TRP P CA   1  
ATOM 635   C C    . TRP A 1 39 ? -6.275  -1.342  -1.921  1.00 0.00 ? 37 TRP P C    1  
ATOM 636   O O    . TRP A 1 39 ? -6.839  -2.315  -2.427  1.00 0.00 ? 37 TRP P O    1  
ATOM 637   C CB   . TRP A 1 39 ? -5.981  0.628   -3.487  1.00 0.00 ? 37 TRP P CB   1  
ATOM 638   C CG   . TRP A 1 39 ? -6.375  1.972   -4.036  1.00 0.00 ? 37 TRP P CG   1  
ATOM 639   C CD1  . TRP A 1 39 ? -7.414  2.739   -3.632  1.00 0.00 ? 37 TRP P CD1  1  
ATOM 640   C CD2  . TRP A 1 39 ? -5.695  2.752   -5.070  1.00 0.00 ? 37 TRP P CD2  1  
ATOM 641   N NE1  . TRP A 1 39 ? -7.428  3.927   -4.337  1.00 0.00 ? 37 TRP P NE1  1  
ATOM 642   C CE2  . TRP A 1 39 ? -6.379  3.997   -5.227  1.00 0.00 ? 37 TRP P CE2  1  
ATOM 643   C CE3  . TRP A 1 39 ? -4.558  2.540   -5.882  1.00 0.00 ? 37 TRP P CE3  1  
ATOM 644   C CZ2  . TRP A 1 39 ? -5.954  4.980   -6.133  1.00 0.00 ? 37 TRP P CZ2  1  
ATOM 645   C CZ3  . TRP A 1 39 ? -4.124  3.520   -6.797  1.00 0.00 ? 37 TRP P CZ3  1  
ATOM 646   C CH2  . TRP A 1 39 ? -4.816  4.739   -6.922  1.00 0.00 ? 37 TRP P CH2  1  
ATOM 647   H H    . TRP A 1 39 ? -5.992  1.827   -1.271  1.00 0.00 ? 37 TRP P H    1  
ATOM 648   H HA   . TRP A 1 39 ? -7.799  0.011   -2.542  1.00 0.00 ? 37 TRP P HA   1  
ATOM 649   H HB2  . TRP A 1 39 ? -4.930  0.690   -3.218  1.00 0.00 ? 37 TRP P HB2  1  
ATOM 650   H HB3  . TRP A 1 39 ? -6.067  -0.098  -4.297  1.00 0.00 ? 37 TRP P HB3  1  
ATOM 651   H HD1  . TRP A 1 39 ? -8.100  2.477   -2.836  1.00 0.00 ? 37 TRP P HD1  1  
ATOM 652   H HE1  . TRP A 1 39 ? -8.115  4.657   -4.186  1.00 0.00 ? 37 TRP P HE1  1  
ATOM 653   H HE3  . TRP A 1 39 ? -4.013  1.610   -5.791  1.00 0.00 ? 37 TRP P HE3  1  
ATOM 654   H HZ2  . TRP A 1 39 ? -6.496  5.913   -6.218  1.00 0.00 ? 37 TRP P HZ2  1  
ATOM 655   H HZ3  . TRP A 1 39 ? -3.247  3.338   -7.406  1.00 0.00 ? 37 TRP P HZ3  1  
ATOM 656   H HH2  . TRP A 1 39 ? -4.473  5.489   -7.625  1.00 0.00 ? 37 TRP P HH2  1  
ATOM 657   N N    . THR A 1 40 ? -5.291  -1.485  -1.025  1.00 0.00 ? 38 THR P N    1  
ATOM 658   C CA   . THR A 1 40 ? -4.828  -2.778  -0.472  1.00 0.00 ? 38 THR P CA   1  
ATOM 659   C C    . THR A 1 40 ? -5.587  -3.220  0.787   1.00 0.00 ? 38 THR P C    1  
ATOM 660   O O    . THR A 1 40 ? -5.382  -4.337  1.262   1.00 0.00 ? 38 THR P O    1  
ATOM 661   C CB   . THR A 1 40 ? -3.314  -2.773  -0.185  1.00 0.00 ? 38 THR P CB   1  
ATOM 662   O OG1  . THR A 1 40 ? -2.938  -1.673  0.604   1.00 0.00 ? 38 THR P OG1  1  
ATOM 663   C CG2  . THR A 1 40 ? -2.479  -2.743  -1.463  1.00 0.00 ? 38 THR P CG2  1  
ATOM 664   H H    . THR A 1 40 ? -4.837  -0.643  -0.690  1.00 0.00 ? 38 THR P H    1  
ATOM 665   H HA   . THR A 1 40 ? -5.005  -3.556  -1.214  1.00 0.00 ? 38 THR P HA   1  
ATOM 666   H HB   . THR A 1 40 ? -3.052  -3.682  0.357   1.00 0.00 ? 38 THR P HB   1  
ATOM 667   H HG1  . THR A 1 40 ? -2.925  -0.894  0.018   1.00 0.00 ? 38 THR P HG1  1  
ATOM 668   H HG21 . THR A 1 40 ? -1.419  -2.729  -1.208  1.00 0.00 ? 38 THR P HG21 1  
ATOM 669   H HG22 . THR A 1 40 ? -2.720  -1.862  -2.060  1.00 0.00 ? 38 THR P HG22 1  
ATOM 670   H HG23 . THR A 1 40 ? -2.688  -3.638  -2.047  1.00 0.00 ? 38 THR P HG23 1  
ATOM 671   N N    . ASN A 1 41 ? -6.490  -2.386  1.315   1.00 0.00 ? 39 ASN P N    1  
ATOM 672   C CA   . ASN A 1 41 ? -7.178  -2.544  2.605   1.00 0.00 ? 39 ASN P CA   1  
ATOM 673   C C    . ASN A 1 41 ? -6.219  -2.694  3.814   1.00 0.00 ? 39 ASN P C    1  
ATOM 674   O O    . ASN A 1 41 ? -6.458  -3.477  4.738   1.00 0.00 ? 39 ASN P O    1  
ATOM 675   C CB   . ASN A 1 41 ? -8.276  -3.623  2.519   1.00 0.00 ? 39 ASN P CB   1  
ATOM 676   C CG   . ASN A 1 41 ? -9.348  -3.304  1.489   1.00 0.00 ? 39 ASN P CG   1  
ATOM 677   O OD1  . ASN A 1 41 ? -10.331 -2.630  1.770   1.00 0.00 ? 39 ASN P OD1  1  
ATOM 678   N ND2  . ASN A 1 41 ? -9.207  -3.776  0.269   1.00 0.00 ? 39 ASN P ND2  1  
ATOM 679   H H    . ASN A 1 41 ? -6.604  -1.493  0.855   1.00 0.00 ? 39 ASN P H    1  
ATOM 680   H HA   . ASN A 1 41 ? -7.680  -1.586  2.778   1.00 0.00 ? 39 ASN P HA   1  
ATOM 681   H HB2  . ASN A 1 41 ? -7.827  -4.590  2.297   1.00 0.00 ? 39 ASN P HB2  1  
ATOM 682   H HB3  . ASN A 1 41 ? -8.768  -3.707  3.488   1.00 0.00 ? 39 ASN P HB3  1  
ATOM 683   H HD21 . ASN A 1 41 ? -8.398  -4.325  0.030   1.00 0.00 ? 39 ASN P HD21 1  
ATOM 684   H HD22 . ASN A 1 41 ? -9.910  -3.550  -0.416  1.00 0.00 ? 39 ASN P HD22 1  
ATOM 685   N N    . LEU A 1 42 ? -5.133  -1.920  3.802   1.00 0.00 ? 40 LEU P N    1  
ATOM 686   C CA   . LEU A 1 42 ? -4.175  -1.722  4.895   1.00 0.00 ? 40 LEU P CA   1  
ATOM 687   C C    . LEU A 1 42 ? -4.333  -0.319  5.518   1.00 0.00 ? 40 LEU P C    1  
ATOM 688   O O    . LEU A 1 42 ? -5.068  0.527   5.001   1.00 0.00 ? 40 LEU P O    1  
ATOM 689   C CB   . LEU A 1 42 ? -2.751  -1.918  4.335   1.00 0.00 ? 40 LEU P CB   1  
ATOM 690   C CG   . LEU A 1 42 ? -2.435  -3.344  3.851   1.00 0.00 ? 40 LEU P CG   1  
ATOM 691   C CD1  . LEU A 1 42 ? -1.062  -3.360  3.184   1.00 0.00 ? 40 LEU P CD1  1  
ATOM 692   C CD2  . LEU A 1 42 ? -2.420  -4.338  5.014   1.00 0.00 ? 40 LEU P CD2  1  
ATOM 693   H H    . LEU A 1 42 ? -5.041  -1.292  3.010   1.00 0.00 ? 40 LEU P H    1  
ATOM 694   H HA   . LEU A 1 42 ? -4.352  -2.447  5.689   1.00 0.00 ? 40 LEU P HA   1  
ATOM 695   H HB2  . LEU A 1 42 ? -2.618  -1.231  3.499   1.00 0.00 ? 40 LEU P HB2  1  
ATOM 696   H HB3  . LEU A 1 42 ? -2.021  -1.647  5.099   1.00 0.00 ? 40 LEU P HB3  1  
ATOM 697   H HG   . LEU A 1 42 ? -3.173  -3.662  3.115   1.00 0.00 ? 40 LEU P HG   1  
ATOM 698   H HD11 . LEU A 1 42 ? -1.061  -2.664  2.345   1.00 0.00 ? 40 LEU P HD11 1  
ATOM 699   H HD12 . LEU A 1 42 ? -0.851  -4.358  2.803   1.00 0.00 ? 40 LEU P HD12 1  
ATOM 700   H HD13 . LEU A 1 42 ? -0.293  -3.064  3.896   1.00 0.00 ? 40 LEU P HD13 1  
ATOM 701   H HD21 . LEU A 1 42 ? -1.759  -3.982  5.804   1.00 0.00 ? 40 LEU P HD21 1  
ATOM 702   H HD22 . LEU A 1 42 ? -2.069  -5.308  4.667   1.00 0.00 ? 40 LEU P HD22 1  
ATOM 703   H HD23 . LEU A 1 42 ? -3.428  -4.460  5.405   1.00 0.00 ? 40 LEU P HD23 1  
ATOM 704   N N    . THR A 1 43 ? -3.626  -0.053  6.620   1.00 0.00 ? 41 THR P N    1  
ATOM 705   C CA   . THR A 1 43 ? -3.489  1.308   7.174   1.00 0.00 ? 41 THR P CA   1  
ATOM 706   C C    . THR A 1 43 ? -2.279  2.010   6.554   1.00 0.00 ? 41 THR P C    1  
ATOM 707   O O    . THR A 1 43 ? -1.306  1.368   6.151   1.00 0.00 ? 41 THR P O    1  
ATOM 708   C CB   . THR A 1 43 ? -3.391  1.335   8.708   1.00 0.00 ? 41 THR P CB   1  
ATOM 709   O OG1  . THR A 1 43 ? -2.160  0.809   9.147   1.00 0.00 ? 41 THR P OG1  1  
ATOM 710   C CG2  . THR A 1 43 ? -4.506  0.547   9.394   1.00 0.00 ? 41 THR P CG2  1  
ATOM 711   H H    . THR A 1 43 ? -3.032  -0.771  7.007   1.00 0.00 ? 41 THR P H    1  
ATOM 712   H HA   . THR A 1 43 ? -4.374  1.888   6.912   1.00 0.00 ? 41 THR P HA   1  
ATOM 713   H HB   . THR A 1 43 ? -3.454  2.374   9.034   1.00 0.00 ? 41 THR P HB   1  
ATOM 714   H HG1  . THR A 1 43 ? -2.131  0.919   10.113  1.00 0.00 ? 41 THR P HG1  1  
ATOM 715   H HG21 . THR A 1 43 ? -5.474  0.900   9.038   1.00 0.00 ? 41 THR P HG21 1  
ATOM 716   H HG22 . THR A 1 43 ? -4.452  0.702   10.472  1.00 0.00 ? 41 THR P HG22 1  
ATOM 717   H HG23 . THR A 1 43 ? -4.409  -0.517  9.178   1.00 0.00 ? 41 THR P HG23 1  
ATOM 718   N N    . GLU A 1 44 ? -2.297  3.345   6.503   1.00 0.00 ? 42 GLU P N    1  
ATOM 719   C CA   . GLU A 1 44 ? -1.146  4.120   6.011   1.00 0.00 ? 42 GLU P CA   1  
ATOM 720   C C    . GLU A 1 44 ? 0.109   3.945   6.883   1.00 0.00 ? 42 GLU P C    1  
ATOM 721   O O    . GLU A 1 44 ? 1.226   4.046   6.377   1.00 0.00 ? 42 GLU P O    1  
ATOM 722   C CB   . GLU A 1 44 ? -1.536  5.593   5.808   1.00 0.00 ? 42 GLU P CB   1  
ATOM 723   C CG   . GLU A 1 44 ? -1.962  6.371   7.066   1.00 0.00 ? 42 GLU P CG   1  
ATOM 724   C CD   . GLU A 1 44 ? -0.790  7.138   7.702   1.00 0.00 ? 42 GLU P CD   1  
ATOM 725   O OE1  . GLU A 1 44 ? -0.392  8.202   7.176   1.00 0.00 ? 42 GLU P OE1  1  
ATOM 726   O OE2  . GLU A 1 44 ? -0.224  6.679   8.719   1.00 0.00 ? 42 GLU P OE2  1  
ATOM 727   H H    . GLU A 1 44 ? -3.119  3.844   6.815   1.00 0.00 ? 42 GLU P H    1  
ATOM 728   H HA   . GLU A 1 44 ? -0.885  3.734   5.026   1.00 0.00 ? 42 GLU P HA   1  
ATOM 729   H HB2  . GLU A 1 44 ? -0.702  6.106   5.327   1.00 0.00 ? 42 GLU P HB2  1  
ATOM 730   H HB3  . GLU A 1 44 ? -2.372  5.607   5.110   1.00 0.00 ? 42 GLU P HB3  1  
ATOM 731   H HG2  . GLU A 1 44 ? -2.728  7.092   6.775   1.00 0.00 ? 42 GLU P HG2  1  
ATOM 732   H HG3  . GLU A 1 44 ? -2.419  5.696   7.793   1.00 0.00 ? 42 GLU P HG3  1  
ATOM 733   N N    . ALA A 1 45 ? -0.056  3.588   8.162   1.00 0.00 ? 43 ALA P N    1  
ATOM 734   C CA   . ALA A 1 45 ? 1.048   3.276   9.064   1.00 0.00 ? 43 ALA P CA   1  
ATOM 735   C C    . ALA A 1 45 ? 1.684   1.908   8.750   1.00 0.00 ? 43 ALA P C    1  
ATOM 736   O O    . ALA A 1 45 ? 2.910   1.805   8.675   1.00 0.00 ? 43 ALA P O    1  
ATOM 737   C CB   . ALA A 1 45 ? 0.542   3.359   10.509  1.00 0.00 ? 43 ALA P CB   1  
ATOM 738   H H    . ALA A 1 45 ? -0.996  3.530   8.524   1.00 0.00 ? 43 ALA P H    1  
ATOM 739   H HA   . ALA A 1 45 ? 1.817   4.037   8.928   1.00 0.00 ? 43 ALA P HA   1  
ATOM 740   H HB1  . ALA A 1 45 ? 1.368   3.170   11.197  1.00 0.00 ? 43 ALA P HB1  1  
ATOM 741   H HB2  . ALA A 1 45 ? 0.142   4.355   10.704  1.00 0.00 ? 43 ALA P HB2  1  
ATOM 742   H HB3  . ALA A 1 45 ? -0.240  2.617   10.681  1.00 0.00 ? 43 ALA P HB3  1  
ATOM 743   N N    . ARG A 1 46 ? 0.875   0.870   8.488   1.00 0.00 ? 44 ARG P N    1  
ATOM 744   C CA   . ARG A 1 46 ? 1.362   -0.461  8.067   1.00 0.00 ? 44 ARG P CA   1  
ATOM 745   C C    . ARG A 1 46 ? 2.039   -0.392  6.695   1.00 0.00 ? 44 ARG P C    1  
ATOM 746   O O    . ARG A 1 46 ? 3.084   -1.007  6.495   1.00 0.00 ? 44 ARG P O    1  
ATOM 747   C CB   . ARG A 1 46 ? 0.206   -1.477  8.097   1.00 0.00 ? 44 ARG P CB   1  
ATOM 748   C CG   . ARG A 1 46 ? -0.224  -1.774  9.545   1.00 0.00 ? 44 ARG P CG   1  
ATOM 749   C CD   . ARG A 1 46 ? -1.564  -2.513  9.618   1.00 0.00 ? 44 ARG P CD   1  
ATOM 750   N NE   . ARG A 1 46 ? -2.193  -2.335  10.943  1.00 0.00 ? 44 ARG P NE   1  
ATOM 751   C CZ   . ARG A 1 46 ? -1.925  -2.985  12.059  1.00 0.00 ? 44 ARG P CZ   1  
ATOM 752   N NH1  . ARG A 1 46 ? -1.210  -4.072  12.084  1.00 0.00 ? 44 ARG P NH1  1  
ATOM 753   N NH2  . ARG A 1 46 ? -2.394  -2.557  13.194  1.00 0.00 ? 44 ARG P NH2  1  
ATOM 754   H H    . ARG A 1 46 ? -0.130  1.016   8.555   1.00 0.00 ? 44 ARG P H    1  
ATOM 755   H HA   . ARG A 1 46 ? 2.124   -0.802  8.767   1.00 0.00 ? 44 ARG P HA   1  
ATOM 756   H HB2  . ARG A 1 46 ? -0.637  -1.076  7.530   1.00 0.00 ? 44 ARG P HB2  1  
ATOM 757   H HB3  . ARG A 1 46 ? 0.524   -2.410  7.628   1.00 0.00 ? 44 ARG P HB3  1  
ATOM 758   H HG2  . ARG A 1 46 ? 0.546   -2.368  10.040  1.00 0.00 ? 44 ARG P HG2  1  
ATOM 759   H HG3  . ARG A 1 46 ? -0.321  -0.836  10.091  1.00 0.00 ? 44 ARG P HG3  1  
ATOM 760   H HD2  . ARG A 1 46 ? -2.230  -2.088  8.865   1.00 0.00 ? 44 ARG P HD2  1  
ATOM 761   H HD3  . ARG A 1 46 ? -1.421  -3.568  9.380   1.00 0.00 ? 44 ARG P HD3  1  
ATOM 762   H HE   . ARG A 1 46 ? -2.820  -1.551  11.029  1.00 0.00 ? 44 ARG P HE   1  
ATOM 763   H HH11 . ARG A 1 46 ? -0.966  -4.525  11.208  1.00 0.00 ? 44 ARG P HH11 1  
ATOM 764   H HH12 . ARG A 1 46 ? -0.966  -4.513  12.952  1.00 0.00 ? 44 ARG P HH12 1  
ATOM 765   H HH21 . ARG A 1 46 ? -2.939  -1.710  13.230  1.00 0.00 ? 44 ARG P HH21 1  
ATOM 766   H HH22 . ARG A 1 46 ? -2.156  -3.022  14.054  1.00 0.00 ? 44 ARG P HH22 1  
ATOM 767   N N    . VAL A 1 47 ? 1.519   0.438   5.790   1.00 0.00 ? 45 VAL P N    1  
ATOM 768   C CA   . VAL A 1 47 ? 2.164   0.762   4.505   1.00 0.00 ? 45 VAL P CA   1  
ATOM 769   C C    . VAL A 1 47 ? 3.489   1.512   4.696   1.00 0.00 ? 45 VAL P C    1  
ATOM 770   O O    . VAL A 1 47 ? 4.477   1.158   4.055   1.00 0.00 ? 45 VAL P O    1  
ATOM 771   C CB   . VAL A 1 47 ? 1.174   1.522   3.603   1.00 0.00 ? 45 VAL P CB   1  
ATOM 772   C CG1  . VAL A 1 47 ? 1.829   2.240   2.422   1.00 0.00 ? 45 VAL P CG1  1  
ATOM 773   C CG2  . VAL A 1 47 ? 0.148   0.525   3.048   1.00 0.00 ? 45 VAL P CG2  1  
ATOM 774   H H    . VAL A 1 47 ? 0.628   0.872   6.011   1.00 0.00 ? 45 VAL P H    1  
ATOM 775   H HA   . VAL A 1 47 ? 2.422   -0.172  4.002   1.00 0.00 ? 45 VAL P HA   1  
ATOM 776   H HB   . VAL A 1 47 ? 0.654   2.272   4.195   1.00 0.00 ? 45 VAL P HB   1  
ATOM 777   H HG11 . VAL A 1 47 ? 2.360   1.522   1.798   1.00 0.00 ? 45 VAL P HG11 1  
ATOM 778   H HG12 . VAL A 1 47 ? 1.058   2.742   1.839   1.00 0.00 ? 45 VAL P HG12 1  
ATOM 779   H HG13 . VAL A 1 47 ? 2.517   3.007   2.776   1.00 0.00 ? 45 VAL P HG13 1  
ATOM 780   H HG21 . VAL A 1 47 ? -0.447  0.110   3.861   1.00 0.00 ? 45 VAL P HG21 1  
ATOM 781   H HG22 . VAL A 1 47 ? -0.516  1.025   2.348   1.00 0.00 ? 45 VAL P HG22 1  
ATOM 782   H HG23 . VAL A 1 47 ? 0.652   -0.287  2.523   1.00 0.00 ? 45 VAL P HG23 1  
ATOM 783   N N    . ARG A 1 48 ? 3.576   2.494   5.604   1.00 0.00 ? 46 ARG P N    1  
ATOM 784   C CA   . ARG A 1 48 ? 4.839   3.197   5.909   1.00 0.00 ? 46 ARG P CA   1  
ATOM 785   C C    . ARG A 1 48 ? 5.901   2.253   6.483   1.00 0.00 ? 46 ARG P C    1  
ATOM 786   O O    . ARG A 1 48 ? 7.060   2.323   6.072   1.00 0.00 ? 46 ARG P O    1  
ATOM 787   C CB   . ARG A 1 48 ? 4.533   4.382   6.836   1.00 0.00 ? 46 ARG P CB   1  
ATOM 788   C CG   . ARG A 1 48 ? 5.742   5.308   7.047   1.00 0.00 ? 46 ARG P CG   1  
ATOM 789   C CD   . ARG A 1 48 ? 5.389   6.511   7.933   1.00 0.00 ? 46 ARG P CD   1  
ATOM 790   N NE   . ARG A 1 48 ? 4.396   7.400   7.292   1.00 0.00 ? 46 ARG P NE   1  
ATOM 791   C CZ   . ARG A 1 48 ? 3.105   7.492   7.563   1.00 0.00 ? 46 ARG P CZ   1  
ATOM 792   N NH1  . ARG A 1 48 ? 2.537   6.824   8.525   1.00 0.00 ? 46 ARG P NH1  1  
ATOM 793   N NH2  . ARG A 1 48 ? 2.342   8.262   6.849   1.00 0.00 ? 46 ARG P NH2  1  
ATOM 794   H H    . ARG A 1 48 ? 2.730   2.806   6.074   1.00 0.00 ? 46 ARG P H    1  
ATOM 795   H HA   . ARG A 1 48 ? 5.245   3.588   4.976   1.00 0.00 ? 46 ARG P HA   1  
ATOM 796   H HB2  . ARG A 1 48 ? 3.729   4.961   6.382   1.00 0.00 ? 46 ARG P HB2  1  
ATOM 797   H HB3  . ARG A 1 48 ? 4.190   4.013   7.804   1.00 0.00 ? 46 ARG P HB3  1  
ATOM 798   H HG2  . ARG A 1 48 ? 6.546   4.752   7.529   1.00 0.00 ? 46 ARG P HG2  1  
ATOM 799   H HG3  . ARG A 1 48 ? 6.101   5.668   6.081   1.00 0.00 ? 46 ARG P HG3  1  
ATOM 800   H HD2  . ARG A 1 48 ? 5.028   6.144   8.895   1.00 0.00 ? 46 ARG P HD2  1  
ATOM 801   H HD3  . ARG A 1 48 ? 6.301   7.080   8.120   1.00 0.00 ? 46 ARG P HD3  1  
ATOM 802   H HE   . ARG A 1 48 ? 4.730   7.971   6.531   1.00 0.00 ? 46 ARG P HE   1  
ATOM 803   H HH11 . ARG A 1 48 ? 3.095   6.251   9.128   1.00 0.00 ? 46 ARG P HH11 1  
ATOM 804   H HH12 . ARG A 1 48 ? 1.523   6.869   8.645   1.00 0.00 ? 46 ARG P HH12 1  
ATOM 805   H HH21 . ARG A 1 48 ? 2.718   8.807   6.098   1.00 0.00 ? 46 ARG P HH21 1  
ATOM 806   H HH22 . ARG A 1 48 ? 1.340   8.293   7.045   1.00 0.00 ? 46 ARG P HH22 1  
ATOM 807   N N    . VAL A 1 49 ? 5.504   1.315   7.350   1.00 0.00 ? 47 VAL P N    1  
ATOM 808   C CA   . VAL A 1 49 ? 6.373   0.219   7.818   1.00 0.00 ? 47 VAL P CA   1  
ATOM 809   C C    . VAL A 1 49 ? 6.805   -0.678  6.653   1.00 0.00 ? 47 VAL P C    1  
ATOM 810   O O    . VAL A 1 49 ? 7.979   -1.035  6.587   1.00 0.00 ? 47 VAL P O    1  
ATOM 811   C CB   . VAL A 1 49 ? 5.702   -0.598  8.943   1.00 0.00 ? 47 VAL P CB   1  
ATOM 812   C CG1  . VAL A 1 49 ? 6.490   -1.864  9.318   1.00 0.00 ? 47 VAL P CG1  1  
ATOM 813   C CG2  . VAL A 1 49 ? 5.586   0.251   10.217  1.00 0.00 ? 47 VAL P CG2  1  
ATOM 814   H H    . VAL A 1 49 ? 4.545   1.353   7.678   1.00 0.00 ? 47 VAL P H    1  
ATOM 815   H HA   . VAL A 1 49 ? 7.285   0.654   8.228   1.00 0.00 ? 47 VAL P HA   1  
ATOM 816   H HB   . VAL A 1 49 ? 4.704   -0.896  8.629   1.00 0.00 ? 47 VAL P HB   1  
ATOM 817   H HG11 . VAL A 1 49 ? 6.490   -2.574  8.488   1.00 0.00 ? 47 VAL P HG11 1  
ATOM 818   H HG12 . VAL A 1 49 ? 7.520   -1.610  9.569   1.00 0.00 ? 47 VAL P HG12 1  
ATOM 819   H HG13 . VAL A 1 49 ? 6.023   -2.352  10.173  1.00 0.00 ? 47 VAL P HG13 1  
ATOM 820   H HG21 . VAL A 1 49 ? 5.029   1.165   10.017  1.00 0.00 ? 47 VAL P HG21 1  
ATOM 821   H HG22 . VAL A 1 49 ? 5.058   -0.311  10.988  1.00 0.00 ? 47 VAL P HG22 1  
ATOM 822   H HG23 . VAL A 1 49 ? 6.578   0.517   10.583  1.00 0.00 ? 47 VAL P HG23 1  
ATOM 823   N N    . TRP A 1 50 ? 5.924   -0.985  5.693   1.00 0.00 ? 48 TRP P N    1  
ATOM 824   C CA   . TRP A 1 50 ? 6.302   -1.746  4.496   1.00 0.00 ? 48 TRP P CA   1  
ATOM 825   C C    . TRP A 1 50 ? 7.359   -1.021  3.650   1.00 0.00 ? 48 TRP P C    1  
ATOM 826   O O    . TRP A 1 50 ? 8.363   -1.633  3.295   1.00 0.00 ? 48 TRP P O    1  
ATOM 827   C CB   . TRP A 1 50 ? 5.080   -2.108  3.643   1.00 0.00 ? 48 TRP P CB   1  
ATOM 828   C CG   . TRP A 1 50 ? 5.408   -3.094  2.563   1.00 0.00 ? 48 TRP P CG   1  
ATOM 829   C CD1  . TRP A 1 50 ? 5.308   -4.438  2.671   1.00 0.00 ? 48 TRP P CD1  1  
ATOM 830   C CD2  . TRP A 1 50 ? 5.959   -2.839  1.233   1.00 0.00 ? 48 TRP P CD2  1  
ATOM 831   N NE1  . TRP A 1 50 ? 5.771   -5.031  1.511   1.00 0.00 ? 48 TRP P NE1  1  
ATOM 832   C CE2  . TRP A 1 50 ? 6.200   -4.095  0.595   1.00 0.00 ? 48 TRP P CE2  1  
ATOM 833   C CE3  . TRP A 1 50 ? 6.292   -1.675  0.505   1.00 0.00 ? 48 TRP P CE3  1  
ATOM 834   C CZ2  . TRP A 1 50 ? 6.755   -4.193  -0.690  1.00 0.00 ? 48 TRP P CZ2  1  
ATOM 835   C CZ3  . TRP A 1 50 ? 6.852   -1.762  -0.782  1.00 0.00 ? 48 TRP P CZ3  1  
ATOM 836   C CH2  . TRP A 1 50 ? 7.087   -3.015  -1.380  1.00 0.00 ? 48 TRP P CH2  1  
ATOM 837   H H    . TRP A 1 50 ? 4.954   -0.709  5.806   1.00 0.00 ? 48 TRP P H    1  
ATOM 838   H HA   . TRP A 1 50 ? 6.752   -2.684  4.827   1.00 0.00 ? 48 TRP P HA   1  
ATOM 839   H HB2  . TRP A 1 50 ? 4.308   -2.532  4.282   1.00 0.00 ? 48 TRP P HB2  1  
ATOM 840   H HB3  . TRP A 1 50 ? 4.675   -1.211  3.174   1.00 0.00 ? 48 TRP P HB3  1  
ATOM 841   H HD1  . TRP A 1 50 ? 4.945   -4.965  3.548   1.00 0.00 ? 48 TRP P HD1  1  
ATOM 842   H HE1  . TRP A 1 50 ? 5.811   -6.034  1.380   1.00 0.00 ? 48 TRP P HE1  1  
ATOM 843   H HE3  . TRP A 1 50 ? 6.111   -0.704  0.944   1.00 0.00 ? 48 TRP P HE3  1  
ATOM 844   H HZ2  . TRP A 1 50 ? 6.917   -5.161  -1.143  1.00 0.00 ? 48 TRP P HZ2  1  
ATOM 845   H HZ3  . TRP A 1 50 ? 7.099   -0.854  -1.315  1.00 0.00 ? 48 TRP P HZ3  1  
ATOM 846   H HH2  . TRP A 1 50 ? 7.511   -3.069  -2.374  1.00 0.00 ? 48 TRP P HH2  1  
ATOM 847   N N    . PHE A 1 51 ? 7.204   0.283   3.385   1.00 0.00 ? 49 PHE P N    1  
ATOM 848   C CA   . PHE A 1 51 ? 8.215   1.068   2.658   1.00 0.00 ? 49 PHE P CA   1  
ATOM 849   C C    . PHE A 1 51 ? 9.559   1.122   3.404   1.00 0.00 ? 49 PHE P C    1  
ATOM 850   O O    . PHE A 1 51 ? 10.609  0.944   2.782   1.00 0.00 ? 49 PHE P O    1  
ATOM 851   C CB   . PHE A 1 51 ? 7.695   2.484   2.359   1.00 0.00 ? 49 PHE P CB   1  
ATOM 852   C CG   . PHE A 1 51 ? 6.833   2.573   1.114   1.00 0.00 ? 49 PHE P CG   1  
ATOM 853   C CD1  . PHE A 1 51 ? 7.436   2.565   -0.160  1.00 0.00 ? 49 PHE P CD1  1  
ATOM 854   C CD2  . PHE A 1 51 ? 5.433   2.668   1.217   1.00 0.00 ? 49 PHE P CD2  1  
ATOM 855   C CE1  . PHE A 1 51 ? 6.644   2.636   -1.320  1.00 0.00 ? 49 PHE P CE1  1  
ATOM 856   C CE2  . PHE A 1 51 ? 4.641   2.729   0.058   1.00 0.00 ? 49 PHE P CE2  1  
ATOM 857   C CZ   . PHE A 1 51 ? 5.246   2.709   -1.209  1.00 0.00 ? 49 PHE P CZ   1  
ATOM 858   H H    . PHE A 1 51 ? 6.343   0.734   3.676   1.00 0.00 ? 49 PHE P H    1  
ATOM 859   H HA   . PHE A 1 51 ? 8.414   0.576   1.705   1.00 0.00 ? 49 PHE P HA   1  
ATOM 860   H HB2  . PHE A 1 51 ? 7.149   2.866   3.223   1.00 0.00 ? 49 PHE P HB2  1  
ATOM 861   H HB3  . PHE A 1 51 ? 8.552   3.143   2.205   1.00 0.00 ? 49 PHE P HB3  1  
ATOM 862   H HD1  . PHE A 1 51 ? 8.513   2.507   -0.249  1.00 0.00 ? 49 PHE P HD1  1  
ATOM 863   H HD2  . PHE A 1 51 ? 4.962   2.689   2.186   1.00 0.00 ? 49 PHE P HD2  1  
ATOM 864   H HE1  . PHE A 1 51 ? 7.108   2.635   -2.297  1.00 0.00 ? 49 PHE P HE1  1  
ATOM 865   H HE2  . PHE A 1 51 ? 3.565   2.785   0.142   1.00 0.00 ? 49 PHE P HE2  1  
ATOM 866   H HZ   . PHE A 1 51 ? 4.636   2.757   -2.099  1.00 0.00 ? 49 PHE P HZ   1  
ATOM 867   N N    . LYS A 1 52 ? 9.545   1.288   4.734   1.00 0.00 ? 50 LYS P N    1  
ATOM 868   C CA   . LYS A 1 52 ? 10.756  1.239   5.575   1.00 0.00 ? 50 LYS P CA   1  
ATOM 869   C C    . LYS A 1 52 ? 11.436  -0.136  5.513   1.00 0.00 ? 50 LYS P C    1  
ATOM 870   O O    . LYS A 1 52 ? 12.650  -0.215  5.326   1.00 0.00 ? 50 LYS P O    1  
ATOM 871   C CB   . LYS A 1 52 ? 10.383  1.645   7.012   1.00 0.00 ? 50 LYS P CB   1  
ATOM 872   C CG   . LYS A 1 52 ? 11.615  1.781   7.920   1.00 0.00 ? 50 LYS P CG   1  
ATOM 873   C CD   . LYS A 1 52 ? 11.216  2.262   9.322   1.00 0.00 ? 50 LYS P CD   1  
ATOM 874   C CE   . LYS A 1 52 ? 12.463  2.391   10.208  1.00 0.00 ? 50 LYS P CE   1  
ATOM 875   N NZ   . LYS A 1 52 ? 12.120  2.865   11.575  1.00 0.00 ? 50 LYS P NZ   1  
ATOM 876   H H    . LYS A 1 52 ? 8.650   1.463   5.183   1.00 0.00 ? 50 LYS P H    1  
ATOM 877   H HA   . LYS A 1 52 ? 11.476  1.963   5.189   1.00 0.00 ? 50 LYS P HA   1  
ATOM 878   H HB2  . LYS A 1 52 ? 9.868   2.608   6.980   1.00 0.00 ? 50 LYS P HB2  1  
ATOM 879   H HB3  . LYS A 1 52 ? 9.702   0.906   7.438   1.00 0.00 ? 50 LYS P HB3  1  
ATOM 880   H HG2  . LYS A 1 52 ? 12.115  0.816   8.006   1.00 0.00 ? 50 LYS P HG2  1  
ATOM 881   H HG3  . LYS A 1 52 ? 12.308  2.500   7.479   1.00 0.00 ? 50 LYS P HG3  1  
ATOM 882   H HD2  . LYS A 1 52 ? 10.722  3.232   9.245   1.00 0.00 ? 50 LYS P HD2  1  
ATOM 883   H HD3  . LYS A 1 52 ? 10.526  1.543   9.767   1.00 0.00 ? 50 LYS P HD3  1  
ATOM 884   H HE2  . LYS A 1 52 ? 12.957  1.416   10.263  1.00 0.00 ? 50 LYS P HE2  1  
ATOM 885   H HE3  . LYS A 1 52 ? 13.158  3.092   9.735   1.00 0.00 ? 50 LYS P HE3  1  
ATOM 886   H HZ1  . LYS A 1 52 ? 11.491  2.224   12.040  1.00 0.00 ? 50 LYS P HZ1  1  
ATOM 887   H HZ2  . LYS A 1 52 ? 11.677  3.773   11.548  1.00 0.00 ? 50 LYS P HZ2  1  
ATOM 888   H HZ3  . LYS A 1 52 ? 12.949  2.947   12.149  1.00 0.00 ? 50 LYS P HZ3  1  
ATOM 889   N N    . ASN A 1 53 ? 10.658  -1.217  5.588   1.00 0.00 ? 51 ASN P N    1  
ATOM 890   C CA   . ASN A 1 53 ? 11.138  -2.596  5.478   1.00 0.00 ? 51 ASN P CA   1  
ATOM 891   C C    . ASN A 1 53 ? 11.724  -2.888  4.083   1.00 0.00 ? 51 ASN P C    1  
ATOM 892   O O    . ASN A 1 53 ? 12.820  -3.436  3.973   1.00 0.00 ? 51 ASN P O    1  
ATOM 893   C CB   . ASN A 1 53 ? 9.970   -3.536  5.829   1.00 0.00 ? 51 ASN P CB   1  
ATOM 894   C CG   . ASN A 1 53 ? 10.418  -4.972  6.018   1.00 0.00 ? 51 ASN P CG   1  
ATOM 895   O OD1  . ASN A 1 53 ? 10.573  -5.734  5.075   1.00 0.00 ? 51 ASN P OD1  1  
ATOM 896   N ND2  . ASN A 1 53 ? 10.651  -5.383  7.245   1.00 0.00 ? 51 ASN P ND2  1  
ATOM 897   H H    . ASN A 1 53 ? 9.669   -1.070  5.761   1.00 0.00 ? 51 ASN P H    1  
ATOM 898   H HA   . ASN A 1 53 ? 11.937  -2.745  6.208   1.00 0.00 ? 51 ASN P HA   1  
ATOM 899   H HB2  . ASN A 1 53 ? 9.499   -3.199  6.752   1.00 0.00 ? 51 ASN P HB2  1  
ATOM 900   H HB3  . ASN A 1 53 ? 9.217   -3.509  5.042   1.00 0.00 ? 51 ASN P HB3  1  
ATOM 901   H HD21 . ASN A 1 53 ? 10.491  -4.764  8.026   1.00 0.00 ? 51 ASN P HD21 1  
ATOM 902   H HD22 . ASN A 1 53 ? 10.938  -6.338  7.386   1.00 0.00 ? 51 ASN P HD22 1  
ATOM 903   N N    . ARG A 1 54 ? 11.050  -2.444  3.013   1.00 0.00 ? 52 ARG P N    1  
ATOM 904   C CA   . ARG A 1 54 ? 11.490  -2.592  1.616   1.00 0.00 ? 52 ARG P CA   1  
ATOM 905   C C    . ARG A 1 54 ? 12.786  -1.829  1.327   1.00 0.00 ? 52 ARG P C    1  
ATOM 906   O O    . ARG A 1 54 ? 13.660  -2.364  0.643   1.00 0.00 ? 52 ARG P O    1  
ATOM 907   C CB   . ARG A 1 54 ? 10.337  -2.147  0.693   1.00 0.00 ? 52 ARG P CB   1  
ATOM 908   C CG   . ARG A 1 54 ? 10.611  -2.351  -0.804  1.00 0.00 ? 52 ARG P CG   1  
ATOM 909   C CD   . ARG A 1 54 ? 10.766  -3.830  -1.172  1.00 0.00 ? 52 ARG P CD   1  
ATOM 910   N NE   . ARG A 1 54 ? 11.020  -4.000  -2.610  1.00 0.00 ? 52 ARG P NE   1  
ATOM 911   C CZ   . ARG A 1 54 ? 12.173  -3.950  -3.241  1.00 0.00 ? 52 ARG P CZ   1  
ATOM 912   N NH1  . ARG A 1 54 ? 13.305  -3.685  -2.645  1.00 0.00 ? 52 ARG P NH1  1  
ATOM 913   N NH2  . ARG A 1 54 ? 12.177  -4.182  -4.518  1.00 0.00 ? 52 ARG P NH2  1  
ATOM 914   H H    . ARG A 1 54 ? 10.138  -2.025  3.179   1.00 0.00 ? 52 ARG P H    1  
ATOM 915   H HA   . ARG A 1 54 ? 11.700  -3.647  1.446   1.00 0.00 ? 52 ARG P HA   1  
ATOM 916   H HB2  . ARG A 1 54 ? 9.436   -2.703  0.953   1.00 0.00 ? 52 ARG P HB2  1  
ATOM 917   H HB3  . ARG A 1 54 ? 10.133  -1.088  0.861   1.00 0.00 ? 52 ARG P HB3  1  
ATOM 918   H HG2  . ARG A 1 54 ? 9.774   -1.939  -1.367  1.00 0.00 ? 52 ARG P HG2  1  
ATOM 919   H HG3  . ARG A 1 54 ? 11.508  -1.804  -1.093  1.00 0.00 ? 52 ARG P HG3  1  
ATOM 920   H HD2  . ARG A 1 54 ? 11.580  -4.278  -0.603  1.00 0.00 ? 52 ARG P HD2  1  
ATOM 921   H HD3  . ARG A 1 54 ? 9.844   -4.354  -0.912  1.00 0.00 ? 52 ARG P HD3  1  
ATOM 922   H HE   . ARG A 1 54 ? 10.225  -4.192  -3.216  1.00 0.00 ? 52 ARG P HE   1  
ATOM 923   H HH11 . ARG A 1 54 ? 13.304  -3.459  -1.664  1.00 0.00 ? 52 ARG P HH11 1  
ATOM 924   H HH12 . ARG A 1 54 ? 14.159  -3.667  -3.172  1.00 0.00 ? 52 ARG P HH12 1  
ATOM 925   H HH21 . ARG A 1 54 ? 11.266  -4.373  -4.942  1.00 0.00 ? 52 ARG P HH21 1  
ATOM 926   H HH22 . ARG A 1 54 ? 13.020  -4.175  -5.060  1.00 0.00 ? 52 ARG P HH22 1  
ATOM 927   N N    . ARG A 1 55 ? 12.943  -0.626  1.894   1.00 0.00 ? 53 ARG P N    1  
ATOM 928   C CA   . ARG A 1 55 ? 14.181  0.173   1.836   1.00 0.00 ? 53 ARG P CA   1  
ATOM 929   C C    . ARG A 1 55 ? 15.320  -0.480  2.625   1.00 0.00 ? 53 ARG P C    1  
ATOM 930   O O    . ARG A 1 55 ? 16.437  -0.547  2.121   1.00 0.00 ? 53 ARG P O    1  
ATOM 931   C CB   . ARG A 1 55 ? 13.882  1.606   2.313   1.00 0.00 ? 53 ARG P CB   1  
ATOM 932   C CG   . ARG A 1 55 ? 15.073  2.555   2.097   1.00 0.00 ? 53 ARG P CG   1  
ATOM 933   C CD   . ARG A 1 55 ? 14.715  3.982   2.528   1.00 0.00 ? 53 ARG P CD   1  
ATOM 934   N NE   . ARG A 1 55 ? 15.848  4.907   2.317   1.00 0.00 ? 53 ARG P NE   1  
ATOM 935   C CZ   . ARG A 1 55 ? 15.893  6.187   2.641   1.00 0.00 ? 53 ARG P CZ   1  
ATOM 936   N NH1  . ARG A 1 55 ? 14.889  6.795   3.210   1.00 0.00 ? 53 ARG P NH1  1  
ATOM 937   N NH2  . ARG A 1 55 ? 16.962  6.891   2.400   1.00 0.00 ? 53 ARG P NH2  1  
ATOM 938   H H    . ARG A 1 55 ? 12.142  -0.238  2.383   1.00 0.00 ? 53 ARG P H    1  
ATOM 939   H HA   . ARG A 1 55 ? 14.510  0.224   0.797   1.00 0.00 ? 53 ARG P HA   1  
ATOM 940   H HB2  . ARG A 1 55 ? 13.030  1.991   1.751   1.00 0.00 ? 53 ARG P HB2  1  
ATOM 941   H HB3  . ARG A 1 55 ? 13.618  1.592   3.373   1.00 0.00 ? 53 ARG P HB3  1  
ATOM 942   H HG2  . ARG A 1 55 ? 15.927  2.214   2.682   1.00 0.00 ? 53 ARG P HG2  1  
ATOM 943   H HG3  . ARG A 1 55 ? 15.343  2.556   1.040   1.00 0.00 ? 53 ARG P HG3  1  
ATOM 944   H HD2  . ARG A 1 55 ? 13.856  4.321   1.947   1.00 0.00 ? 53 ARG P HD2  1  
ATOM 945   H HD3  . ARG A 1 55 ? 14.445  3.970   3.586   1.00 0.00 ? 53 ARG P HD3  1  
ATOM 946   H HE   . ARG A 1 55 ? 16.670  4.530   1.873   1.00 0.00 ? 53 ARG P HE   1  
ATOM 947   H HH11 . ARG A 1 55 ? 14.049  6.279   3.405   1.00 0.00 ? 53 ARG P HH11 1  
ATOM 948   H HH12 . ARG A 1 55 ? 14.949  7.771   3.449   1.00 0.00 ? 53 ARG P HH12 1  
ATOM 949   H HH21 . ARG A 1 55 ? 17.761  6.467   1.962   1.00 0.00 ? 53 ARG P HH21 1  
ATOM 950   H HH22 . ARG A 1 55 ? 16.992  7.866   2.649   1.00 0.00 ? 53 ARG P HH22 1  
ATOM 951   N N    . ALA A 1 56 ? 15.045  -1.036  3.805   1.00 0.00 ? 54 ALA P N    1  
ATOM 952   C CA   . ALA A 1 56 ? 16.032  -1.795  4.580   1.00 0.00 ? 54 ALA P CA   1  
ATOM 953   C C    . ALA A 1 56 ? 16.500  -3.061  3.836   1.00 0.00 ? 54 ALA P C    1  
ATOM 954   O O    . ALA A 1 56 ? 17.703  -3.315  3.755   1.00 0.00 ? 54 ALA P O    1  
ATOM 955   C CB   . ALA A 1 56 ? 15.442  -2.115  5.959   1.00 0.00 ? 54 ALA P CB   1  
ATOM 956   H H    . ALA A 1 56 ? 14.119  -0.904  4.198   1.00 0.00 ? 54 ALA P H    1  
ATOM 957   H HA   . ALA A 1 56 ? 16.910  -1.163  4.731   1.00 0.00 ? 54 ALA P HA   1  
ATOM 958   H HB1  . ALA A 1 56 ? 14.564  -2.753  5.861   1.00 0.00 ? 54 ALA P HB1  1  
ATOM 959   H HB2  . ALA A 1 56 ? 16.188  -2.631  6.564   1.00 0.00 ? 54 ALA P HB2  1  
ATOM 960   H HB3  . ALA A 1 56 ? 15.158  -1.191  6.465   1.00 0.00 ? 54 ALA P HB3  1  
ATOM 961   N N    . LYS A 1 57 ? 15.576  -3.808  3.212   1.00 0.00 ? 55 LYS P N    1  
ATOM 962   C CA   . LYS A 1 57 ? 15.875  -4.978  2.362   1.00 0.00 ? 55 LYS P CA   1  
ATOM 963   C C    . LYS A 1 57 ? 16.680  -4.627  1.103   1.00 0.00 ? 55 LYS P C    1  
ATOM 964   O O    . LYS A 1 57 ? 17.542  -5.407  0.700   1.00 0.00 ? 55 LYS P O    1  
ATOM 965   C CB   . LYS A 1 57 ? 14.565  -5.693  1.993   1.00 0.00 ? 55 LYS P CB   1  
ATOM 966   C CG   . LYS A 1 57 ? 14.032  -6.530  3.167   1.00 0.00 ? 55 LYS P CG   1  
ATOM 967   C CD   . LYS A 1 57 ? 12.790  -7.328  2.750   1.00 0.00 ? 55 LYS P CD   1  
ATOM 968   C CE   . LYS A 1 57 ? 12.354  -8.258  3.887   1.00 0.00 ? 55 LYS P CE   1  
ATOM 969   N NZ   . LYS A 1 57 ? 11.312  -9.213  3.431   1.00 0.00 ? 55 LYS P NZ   1  
ATOM 970   H H    . LYS A 1 57 ? 14.601  -3.568  3.367   1.00 0.00 ? 55 LYS P H    1  
ATOM 971   H HA   . LYS A 1 57 ? 16.498  -5.673  2.925   1.00 0.00 ? 55 LYS P HA   1  
ATOM 972   H HB2  . LYS A 1 57 ? 13.814  -4.964  1.683   1.00 0.00 ? 55 LYS P HB2  1  
ATOM 973   H HB3  . LYS A 1 57 ? 14.753  -6.356  1.148   1.00 0.00 ? 55 LYS P HB3  1  
ATOM 974   H HG2  . LYS A 1 57 ? 14.807  -7.226  3.487   1.00 0.00 ? 55 LYS P HG2  1  
ATOM 975   H HG3  . LYS A 1 57 ? 13.782  -5.881  4.006   1.00 0.00 ? 55 LYS P HG3  1  
ATOM 976   H HD2  . LYS A 1 57 ? 11.979  -6.641  2.503   1.00 0.00 ? 55 LYS P HD2  1  
ATOM 977   H HD3  . LYS A 1 57 ? 13.032  -7.923  1.871   1.00 0.00 ? 55 LYS P HD3  1  
ATOM 978   H HE2  . LYS A 1 57 ? 13.226  -8.813  4.244   1.00 0.00 ? 55 LYS P HE2  1  
ATOM 979   H HE3  . LYS A 1 57 ? 11.978  -7.651  4.715   1.00 0.00 ? 55 LYS P HE3  1  
ATOM 980   H HZ1  . LYS A 1 57 ? 11.674  -9.800  2.681   1.00 0.00 ? 55 LYS P HZ1  1  
ATOM 981   H HZ2  . LYS A 1 57 ? 10.493  -8.727  3.091   1.00 0.00 ? 55 LYS P HZ2  1  
ATOM 982   H HZ3  . LYS A 1 57 ? 11.021  -9.823  4.184   1.00 0.00 ? 55 LYS P HZ3  1  
ATOM 983   N N    . TRP A 1 58 ? 16.452  -3.451  0.517   1.00 0.00 ? 56 TRP P N    1  
ATOM 984   C CA   . TRP A 1 58 ? 17.275  -2.905  -0.572  1.00 0.00 ? 56 TRP P CA   1  
ATOM 985   C C    . TRP A 1 58 ? 18.691  -2.513  -0.101  1.00 0.00 ? 56 TRP P C    1  
ATOM 986   O O    . TRP A 1 58 ? 19.675  -2.796  -0.789  1.00 0.00 ? 56 TRP P O    1  
ATOM 987   C CB   . TRP A 1 58 ? 16.536  -1.709  -1.192  1.00 0.00 ? 56 TRP P CB   1  
ATOM 988   C CG   . TRP A 1 58 ? 17.352  -0.845  -2.103  1.00 0.00 ? 56 TRP P CG   1  
ATOM 989   C CD1  . TRP A 1 58 ? 17.666  -1.125  -3.388  1.00 0.00 ? 56 TRP P CD1  1  
ATOM 990   C CD2  . TRP A 1 58 ? 18.010  0.425   -1.799  1.00 0.00 ? 56 TRP P CD2  1  
ATOM 991   N NE1  . TRP A 1 58 ? 18.464  -0.120  -3.901  1.00 0.00 ? 56 TRP P NE1  1  
ATOM 992   C CE2  . TRP A 1 58 ? 18.713  0.860   -2.963  1.00 0.00 ? 56 TRP P CE2  1  
ATOM 993   C CE3  . TRP A 1 58 ? 18.095  1.248   -0.653  1.00 0.00 ? 56 TRP P CE3  1  
ATOM 994   C CZ2  . TRP A 1 58 ? 19.461  2.047   -2.990  1.00 0.00 ? 56 TRP P CZ2  1  
ATOM 995   C CZ3  . TRP A 1 58 ? 18.845  2.440   -0.667  1.00 0.00 ? 56 TRP P CZ3  1  
ATOM 996   C CH2  . TRP A 1 58 ? 19.527  2.841   -1.832  1.00 0.00 ? 56 TRP P CH2  1  
ATOM 997   H H    . TRP A 1 58 ? 15.669  -2.903  0.850   1.00 0.00 ? 56 TRP P H    1  
ATOM 998   H HA   . TRP A 1 58 ? 17.397  -3.664  -1.346  1.00 0.00 ? 56 TRP P HA   1  
ATOM 999   H HB2  . TRP A 1 58 ? 15.670  -2.078  -1.743  1.00 0.00 ? 56 TRP P HB2  1  
ATOM 1000  H HB3  . TRP A 1 58 ? 16.160  -1.071  -0.395  1.00 0.00 ? 56 TRP P HB3  1  
ATOM 1001  H HD1  . TRP A 1 58 ? 17.352  -2.016  -3.922  1.00 0.00 ? 56 TRP P HD1  1  
ATOM 1002  H HE1  . TRP A 1 58 ? 18.837  -0.132  -4.845  1.00 0.00 ? 56 TRP P HE1  1  
ATOM 1003  H HE3  . TRP A 1 58 ? 17.578  0.949   0.249   1.00 0.00 ? 56 TRP P HE3  1  
ATOM 1004  H HZ2  . TRP A 1 58 ? 19.982  2.342   -3.890  1.00 0.00 ? 56 TRP P HZ2  1  
ATOM 1005  H HZ3  . TRP A 1 58 ? 18.904  3.053   0.224   1.00 0.00 ? 56 TRP P HZ3  1  
ATOM 1006  H HH2  . TRP A 1 58 ? 20.102  3.759   -1.834  1.00 0.00 ? 56 TRP P HH2  1  
ATOM 1007  N N    . ARG A 1 59 ? 18.806  -1.888  1.080   1.00 0.00 ? 57 ARG P N    1  
ATOM 1008  C CA   . ARG A 1 59 ? 20.063  -1.345  1.628   1.00 0.00 ? 57 ARG P CA   1  
ATOM 1009  C C    . ARG A 1 59 ? 21.008  -2.409  2.208   1.00 0.00 ? 57 ARG P C    1  
ATOM 1010  O O    . ARG A 1 59 ? 22.226  -2.278  2.063   1.00 0.00 ? 57 ARG P O    1  
ATOM 1011  C CB   . ARG A 1 59 ? 19.706  -0.263  2.664   1.00 0.00 ? 57 ARG P CB   1  
ATOM 1012  C CG   . ARG A 1 59 ? 20.924  0.539   3.149   1.00 0.00 ? 57 ARG P CG   1  
ATOM 1013  C CD   . ARG A 1 59 ? 20.489  1.675   4.083   1.00 0.00 ? 57 ARG P CD   1  
ATOM 1014  N NE   . ARG A 1 59 ? 21.644  2.478   4.536   1.00 0.00 ? 57 ARG P NE   1  
ATOM 1015  C CZ   . ARG A 1 59 ? 22.408  2.266   5.594   1.00 0.00 ? 57 ARG P CZ   1  
ATOM 1016  N NH1  . ARG A 1 59 ? 22.221  1.260   6.403   1.00 0.00 ? 57 ARG P NH1  1  
ATOM 1017  N NH2  . ARG A 1 59 ? 23.395  3.072   5.864   1.00 0.00 ? 57 ARG P NH2  1  
ATOM 1018  H H    . ARG A 1 59 ? 17.941  -1.650  1.556   1.00 0.00 ? 57 ARG P H    1  
ATOM 1019  H HA   . ARG A 1 59 ? 20.608  -0.863  0.813   1.00 0.00 ? 57 ARG P HA   1  
ATOM 1020  H HB2  . ARG A 1 59 ? 19.002  0.436   2.209   1.00 0.00 ? 57 ARG P HB2  1  
ATOM 1021  H HB3  . ARG A 1 59 ? 19.217  -0.729  3.522   1.00 0.00 ? 57 ARG P HB3  1  
ATOM 1022  H HG2  . ARG A 1 59 ? 21.610  -0.119  3.684   1.00 0.00 ? 57 ARG P HG2  1  
ATOM 1023  H HG3  . ARG A 1 59 ? 21.441  0.965   2.287   1.00 0.00 ? 57 ARG P HG3  1  
ATOM 1024  H HD2  . ARG A 1 59 ? 19.799  2.327   3.542   1.00 0.00 ? 57 ARG P HD2  1  
ATOM 1025  H HD3  . ARG A 1 59 ? 19.951  1.262   4.938   1.00 0.00 ? 57 ARG P HD3  1  
ATOM 1026  H HE   . ARG A 1 59 ? 21.877  3.286   3.979   1.00 0.00 ? 57 ARG P HE   1  
ATOM 1027  H HH11 . ARG A 1 59 ? 21.466  0.621   6.225   1.00 0.00 ? 57 ARG P HH11 1  
ATOM 1028  H HH12 . ARG A 1 59 ? 22.818  1.126   7.200   1.00 0.00 ? 57 ARG P HH12 1  
ATOM 1029  H HH21 . ARG A 1 59 ? 23.579  3.864   5.269   1.00 0.00 ? 57 ARG P HH21 1  
ATOM 1030  H HH22 . ARG A 1 59 ? 23.977  2.912   6.668   1.00 0.00 ? 57 ARG P HH22 1  
ATOM 1031  N N    . LYS A 1 60 ? 20.477  -3.443  2.873   1.00 0.00 ? 58 LYS P N    1  
ATOM 1032  C CA   . LYS A 1 60 ? 21.265  -4.463  3.599   1.00 0.00 ? 58 LYS P CA   1  
ATOM 1033  C C    . LYS A 1 60 ? 22.016  -5.444  2.679   1.00 0.00 ? 58 LYS P C    1  
ATOM 1034  O O    . LYS A 1 60 ? 21.637  -5.655  1.526   1.00 0.00 ? 58 LYS P O    1  
ATOM 1035  C CB   . LYS A 1 60 ? 20.382  -5.171  4.647   1.00 0.00 ? 58 LYS P CB   1  
ATOM 1036  C CG   . LYS A 1 60 ? 19.364  -6.161  4.053   1.00 0.00 ? 58 LYS P CG   1  
ATOM 1037  C CD   . LYS A 1 60 ? 18.289  -6.582  5.067   1.00 0.00 ? 58 LYS P CD   1  
ATOM 1038  C CE   . LYS A 1 60 ? 18.871  -7.291  6.300   1.00 0.00 ? 58 LYS P CE   1  
ATOM 1039  N NZ   . LYS A 1 60 ? 17.807  -7.684  7.263   1.00 0.00 ? 58 LYS P NZ   1  
ATOM 1040  H H    . LYS A 1 60 ? 19.467  -3.462  2.966   1.00 0.00 ? 58 LYS P H    1  
ATOM 1041  H HA   . LYS A 1 60 ? 22.031  -3.926  4.160   1.00 0.00 ? 58 LYS P HA   1  
ATOM 1042  H HB2  . LYS A 1 60 ? 21.030  -5.709  5.341   1.00 0.00 ? 58 LYS P HB2  1  
ATOM 1043  H HB3  . LYS A 1 60 ? 19.850  -4.408  5.219   1.00 0.00 ? 58 LYS P HB3  1  
ATOM 1044  H HG2  . LYS A 1 60 ? 18.868  -5.698  3.201   1.00 0.00 ? 58 LYS P HG2  1  
ATOM 1045  H HG3  . LYS A 1 60 ? 19.885  -7.049  3.694   1.00 0.00 ? 58 LYS P HG3  1  
ATOM 1046  H HD2  . LYS A 1 60 ? 17.747  -5.689  5.386   1.00 0.00 ? 58 LYS P HD2  1  
ATOM 1047  H HD3  . LYS A 1 60 ? 17.588  -7.251  4.567   1.00 0.00 ? 58 LYS P HD3  1  
ATOM 1048  H HE2  . LYS A 1 60 ? 19.420  -8.178  5.972   1.00 0.00 ? 58 LYS P HE2  1  
ATOM 1049  H HE3  . LYS A 1 60 ? 19.580  -6.620  6.794   1.00 0.00 ? 58 LYS P HE3  1  
ATOM 1050  H HZ1  . LYS A 1 60 ? 18.201  -8.145  8.073   1.00 0.00 ? 58 LYS P HZ1  1  
ATOM 1051  H HZ2  . LYS A 1 60 ? 17.143  -8.323  6.845   1.00 0.00 ? 58 LYS P HZ2  1  
ATOM 1052  H HZ3  . LYS A 1 60 ? 17.296  -6.877  7.597   1.00 0.00 ? 58 LYS P HZ3  1  
ATOM 1053  N N    . ARG A 1 61 ? 23.068  -6.076  3.221   1.00 0.00 ? 59 ARG P N    1  
ATOM 1054  C CA   . ARG A 1 61 ? 23.953  -7.037  2.515   1.00 0.00 ? 59 ARG P CA   1  
ATOM 1055  C C    . ARG A 1 61 ? 23.352  -8.433  2.269   1.00 0.00 ? 59 ARG P C    1  
ATOM 1056  O O    . ARG A 1 61 ? 23.931  -9.232  1.533   1.00 0.00 ? 59 ARG P O    1  
ATOM 1057  C CB   . ARG A 1 61 ? 25.318  -7.118  3.245   1.00 0.00 ? 59 ARG P CB   1  
ATOM 1058  C CG   . ARG A 1 61 ? 25.460  -8.197  4.342   1.00 0.00 ? 59 ARG P CG   1  
ATOM 1059  C CD   . ARG A 1 61 ? 24.485  -8.071  5.525   1.00 0.00 ? 59 ARG P CD   1  
ATOM 1060  N NE   . ARG A 1 61 ? 24.264  -9.376  6.173   1.00 0.00 ? 59 ARG P NE   1  
ATOM 1061  C CZ   . ARG A 1 61 ? 24.931  -9.944  7.156   1.00 0.00 ? 59 ARG P CZ   1  
ATOM 1062  N NH1  . ARG A 1 61 ? 25.940  -9.379  7.758   1.00 0.00 ? 59 ARG P NH1  1  
ATOM 1063  N NH2  . ARG A 1 61 ? 24.559  -11.129 7.533   1.00 0.00 ? 59 ARG P NH2  1  
ATOM 1064  H H    . ARG A 1 61 ? 23.318  -5.806  4.161   1.00 0.00 ? 59 ARG P H    1  
ATOM 1065  H HA   . ARG A 1 61 ? 24.146  -6.626  1.522   1.00 0.00 ? 59 ARG P HA   1  
ATOM 1066  H HB2  . ARG A 1 61 ? 26.078  -7.337  2.491   1.00 0.00 ? 59 ARG P HB2  1  
ATOM 1067  H HB3  . ARG A 1 61 ? 25.569  -6.143  3.667   1.00 0.00 ? 59 ARG P HB3  1  
ATOM 1068  H HG2  . ARG A 1 61 ? 25.334  -9.177  3.882   1.00 0.00 ? 59 ARG P HG2  1  
ATOM 1069  H HG3  . ARG A 1 61 ? 26.478  -8.163  4.732   1.00 0.00 ? 59 ARG P HG3  1  
ATOM 1070  H HD2  . ARG A 1 61 ? 24.862  -7.334  6.237   1.00 0.00 ? 59 ARG P HD2  1  
ATOM 1071  H HD3  . ARG A 1 61 ? 23.517  -7.723  5.171   1.00 0.00 ? 59 ARG P HD3  1  
ATOM 1072  H HE   . ARG A 1 61 ? 23.510  -9.957  5.811   1.00 0.00 ? 59 ARG P HE   1  
ATOM 1073  H HH11 . ARG A 1 61 ? 26.235  -8.463  7.469   1.00 0.00 ? 59 ARG P HH11 1  
ATOM 1074  H HH12 . ARG A 1 61 ? 26.419  -9.854  8.504   1.00 0.00 ? 59 ARG P HH12 1  
ATOM 1075  H HH21 . ARG A 1 61 ? 23.774  -11.545 7.030   1.00 0.00 ? 59 ARG P HH21 1  
ATOM 1076  H HH22 . ARG A 1 61 ? 25.029  -11.620 8.274   1.00 0.00 ? 59 ARG P HH22 1  
ATOM 1077  N N    . GLU A 1 62 ? 22.235  -8.746  2.926   1.00 0.00 ? 60 GLU P N    1  
ATOM 1078  C CA   . GLU A 1 62 ? 21.635  -10.088 2.989   1.00 0.00 ? 60 GLU P CA   1  
ATOM 1079  C C    . GLU A 1 62 ? 21.049  -10.553 1.636   1.00 0.00 ? 60 GLU P C    1  
ATOM 1080  O O    . GLU A 1 62 ? 20.683  -9.740  0.784   1.00 0.00 ? 60 GLU P O    1  
ATOM 1081  C CB   . GLU A 1 62 ? 20.579  -10.086 4.113   1.00 0.00 ? 60 GLU P CB   1  
ATOM 1082  C CG   . GLU A 1 62 ? 20.239  -11.462 4.711   1.00 0.00 ? 60 GLU P CG   1  
ATOM 1083  C CD   . GLU A 1 62 ? 21.337  -12.050 5.627   1.00 0.00 ? 60 GLU P CD   1  
ATOM 1084  O OE1  . GLU A 1 62 ? 22.450  -11.480 5.724   1.00 0.00 ? 60 GLU P OE1  1  
ATOM 1085  O OE2  . GLU A 1 62 ? 21.086  -13.097 6.272   1.00 0.00 ? 60 GLU P OE2  1  
ATOM 1086  H H    . GLU A 1 62 ? 21.804  -8.016  3.464   1.00 0.00 ? 60 GLU P H    1  
ATOM 1087  H HA   . GLU A 1 62 ? 22.424  -10.790 3.260   1.00 0.00 ? 60 GLU P HA   1  
ATOM 1088  H HB2  . GLU A 1 62 ? 20.918  -9.446  4.929   1.00 0.00 ? 60 GLU P HB2  1  
ATOM 1089  H HB3  . GLU A 1 62 ? 19.666  -9.638  3.720   1.00 0.00 ? 60 GLU P HB3  1  
ATOM 1090  H HG2  . GLU A 1 62 ? 19.327  -11.345 5.300   1.00 0.00 ? 60 GLU P HG2  1  
ATOM 1091  H HG3  . GLU A 1 62 ? 20.014  -12.165 3.908   1.00 0.00 ? 60 GLU P HG3  1  
ATOM 1092  N N    . GLU A 1 63 ? 20.951  -11.871 1.435   1.00 0.00 ? 61 GLU P N    1  
ATOM 1093  C CA   . GLU A 1 63 ? 20.496  -12.520 0.193   1.00 0.00 ? 61 GLU P CA   1  
ATOM 1094  C C    . GLU A 1 63 ? 19.110  -13.187 0.322   1.00 0.00 ? 61 GLU P C    1  
ATOM 1095  O O    . GLU A 1 63 ? 18.717  -13.632 1.403   1.00 0.00 ? 61 GLU P O    1  
ATOM 1096  C CB   . GLU A 1 63 ? 21.572  -13.503 -0.309  1.00 0.00 ? 61 GLU P CB   1  
ATOM 1097  C CG   . GLU A 1 63 ? 21.920  -14.627 0.683   1.00 0.00 ? 61 GLU P CG   1  
ATOM 1098  C CD   . GLU A 1 63 ? 23.057  -15.519 0.147   1.00 0.00 ? 61 GLU P CD   1  
ATOM 1099  O OE1  . GLU A 1 63 ? 24.234  -15.080 0.148   1.00 0.00 ? 61 GLU P OE1  1  
ATOM 1100  O OE2  . GLU A 1 63 ? 22.792  -16.677 -0.260  1.00 0.00 ? 61 GLU P OE2  1  
ATOM 1101  H H    . GLU A 1 63 ? 21.221  -12.486 2.189   1.00 0.00 ? 61 GLU P H    1  
ATOM 1102  H HA   . GLU A 1 63 ? 20.397  -11.757 -0.581  1.00 0.00 ? 61 GLU P HA   1  
ATOM 1103  H HB2  . GLU A 1 63 ? 21.233  -13.950 -1.244  1.00 0.00 ? 61 GLU P HB2  1  
ATOM 1104  H HB3  . GLU A 1 63 ? 22.478  -12.932 -0.523  1.00 0.00 ? 61 GLU P HB3  1  
ATOM 1105  H HG2  . GLU A 1 63 ? 22.228  -14.192 1.637   1.00 0.00 ? 61 GLU P HG2  1  
ATOM 1106  H HG3  . GLU A 1 63 ? 21.027  -15.228 0.868   1.00 0.00 ? 61 GLU P HG3  1  
ATOM 1107  N N    . PHE A 1 64 ? 18.370  -13.263 -0.794  1.00 0.00 ? 62 PHE P N    1  
ATOM 1108  C CA   . PHE A 1 64 ? 17.041  -13.896 -0.921  1.00 0.00 ? 62 PHE P CA   1  
ATOM 1109  C C    . PHE A 1 64 ? 15.956  -13.389 0.061   1.00 0.00 ? 62 PHE P C    1  
ATOM 1110  O O    . PHE A 1 64 ? 14.995  -14.100 0.369   1.00 0.00 ? 62 PHE P O    1  
ATOM 1111  C CB   . PHE A 1 64 ? 17.182  -15.430 -0.967  1.00 0.00 ? 62 PHE P CB   1  
ATOM 1112  C CG   . PHE A 1 64 ? 18.092  -15.937 -2.073  1.00 0.00 ? 62 PHE P CG   1  
ATOM 1113  C CD1  . PHE A 1 64 ? 17.659  -15.900 -3.413  1.00 0.00 ? 62 PHE P CD1  1  
ATOM 1114  C CD2  . PHE A 1 64 ? 19.371  -16.440 -1.770  1.00 0.00 ? 62 PHE P CD2  1  
ATOM 1115  C CE1  . PHE A 1 64 ? 18.502  -16.357 -4.443  1.00 0.00 ? 62 PHE P CE1  1  
ATOM 1116  C CE2  . PHE A 1 64 ? 20.214  -16.897 -2.799  1.00 0.00 ? 62 PHE P CE2  1  
ATOM 1117  C CZ   . PHE A 1 64 ? 19.780  -16.854 -4.136  1.00 0.00 ? 62 PHE P CZ   1  
ATOM 1118  H H    . PHE A 1 64 ? 18.779  -12.902 -1.645  1.00 0.00 ? 62 PHE P H    1  
ATOM 1119  H HA   . PHE A 1 64 ? 16.665  -13.602 -1.901  1.00 0.00 ? 62 PHE P HA   1  
ATOM 1120  H HB2  . PHE A 1 64 ? 17.549  -15.784 -0.002  1.00 0.00 ? 62 PHE P HB2  1  
ATOM 1121  H HB3  . PHE A 1 64 ? 16.198  -15.873 -1.122  1.00 0.00 ? 62 PHE P HB3  1  
ATOM 1122  H HD1  . PHE A 1 64 ? 16.676  -15.518 -3.655  1.00 0.00 ? 62 PHE P HD1  1  
ATOM 1123  H HD2  . PHE A 1 64 ? 19.711  -16.477 -0.744  1.00 0.00 ? 62 PHE P HD2  1  
ATOM 1124  H HE1  . PHE A 1 64 ? 18.166  -16.325 -5.472  1.00 0.00 ? 62 PHE P HE1  1  
ATOM 1125  H HE2  . PHE A 1 64 ? 21.198  -17.281 -2.562  1.00 0.00 ? 62 PHE P HE2  1  
ATOM 1126  H HZ   . PHE A 1 64 ? 20.429  -17.207 -4.928  1.00 0.00 ? 62 PHE P HZ   1  
ATOM 1127  N N    . ILE A 1 65 ? 16.074  -12.139 0.527   1.00 0.00 ? 63 ILE P N    1  
ATOM 1128  C CA   . ILE A 1 65 ? 15.121  -11.482 1.447   1.00 0.00 ? 63 ILE P CA   1  
ATOM 1129  C C    . ILE A 1 65 ? 13.813  -11.007 0.782   1.00 0.00 ? 63 ILE P C    1  
ATOM 1130  O O    . ILE A 1 65 ? 12.875  -10.619 1.484   1.00 0.00 ? 63 ILE P O    1  
ATOM 1131  C CB   . ILE A 1 65 ? 15.798  -10.348 2.256   1.00 0.00 ? 63 ILE P CB   1  
ATOM 1132  C CG1  . ILE A 1 65 ? 16.155  -9.070  1.460   1.00 0.00 ? 63 ILE P CG1  1  
ATOM 1133  C CG2  . ILE A 1 65 ? 17.013  -10.870 3.041   1.00 0.00 ? 63 ILE P CG2  1  
ATOM 1134  C CD1  . ILE A 1 65 ? 17.084  -9.216  0.248   1.00 0.00 ? 63 ILE P CD1  1  
ATOM 1135  H H    . ILE A 1 65 ? 16.904  -11.629 0.267   1.00 0.00 ? 63 ILE P H    1  
ATOM 1136  H HA   . ILE A 1 65 ? 14.816  -12.235 2.176   1.00 0.00 ? 63 ILE P HA   1  
ATOM 1137  H HB   . ILE A 1 65 ? 15.072  -10.037 3.009   1.00 0.00 ? 63 ILE P HB   1  
ATOM 1138  H HG12 . ILE A 1 65 ? 15.230  -8.619  1.111   1.00 0.00 ? 63 ILE P HG12 1  
ATOM 1139  H HG13 . ILE A 1 65 ? 16.616  -8.361  2.149   1.00 0.00 ? 63 ILE P HG13 1  
ATOM 1140  H HG21 . ILE A 1 65 ? 17.354  -10.100 3.733   1.00 0.00 ? 63 ILE P HG21 1  
ATOM 1141  H HG22 . ILE A 1 65 ? 16.731  -11.752 3.618   1.00 0.00 ? 63 ILE P HG22 1  
ATOM 1142  H HG23 . ILE A 1 65 ? 17.830  -11.136 2.373   1.00 0.00 ? 63 ILE P HG23 1  
ATOM 1143  H HD11 . ILE A 1 65 ? 17.349  -8.225  -0.119  1.00 0.00 ? 63 ILE P HD11 1  
ATOM 1144  H HD12 . ILE A 1 65 ? 17.996  -9.741  0.528   1.00 0.00 ? 63 ILE P HD12 1  
ATOM 1145  H HD13 . ILE A 1 65 ? 16.579  -9.752  -0.555  1.00 0.00 ? 63 ILE P HD13 1  
ATOM 1146  N N    . VAL A 1 66 ? 13.728  -11.052 -0.551  1.00 0.00 ? 64 VAL P N    1  
ATOM 1147  C CA   . VAL A 1 66 ? 12.510  -10.816 -1.353  1.00 0.00 ? 64 VAL P CA   1  
ATOM 1148  C C    . VAL A 1 66 ? 12.330  -11.975 -2.344  1.00 0.00 ? 64 VAL P C    1  
ATOM 1149  O O    . VAL A 1 66 ? 13.291  -12.393 -2.995  1.00 0.00 ? 64 VAL P O    1  
ATOM 1150  C CB   . VAL A 1 66 ? 12.562  -9.459  -2.094  1.00 0.00 ? 64 VAL P CB   1  
ATOM 1151  C CG1  . VAL A 1 66 ? 11.267  -9.181  -2.871  1.00 0.00 ? 64 VAL P CG1  1  
ATOM 1152  C CG2  . VAL A 1 66 ? 12.763  -8.281  -1.129  1.00 0.00 ? 64 VAL P CG2  1  
ATOM 1153  H H    . VAL A 1 66 ? 14.541  -11.381 -1.052  1.00 0.00 ? 64 VAL P H    1  
ATOM 1154  H HA   . VAL A 1 66 ? 11.644  -10.802 -0.690  1.00 0.00 ? 64 VAL P HA   1  
ATOM 1155  H HB   . VAL A 1 66 ? 13.393  -9.468  -2.799  1.00 0.00 ? 64 VAL P HB   1  
ATOM 1156  H HG11 . VAL A 1 66 ? 10.410  -9.202  -2.197  1.00 0.00 ? 64 VAL P HG11 1  
ATOM 1157  H HG12 . VAL A 1 66 ? 11.323  -8.201  -3.346  1.00 0.00 ? 64 VAL P HG12 1  
ATOM 1158  H HG13 . VAL A 1 66 ? 11.128  -9.922  -3.657  1.00 0.00 ? 64 VAL P HG13 1  
ATOM 1159  H HG21 . VAL A 1 66 ? 12.745  -7.340  -1.681  1.00 0.00 ? 64 VAL P HG21 1  
ATOM 1160  H HG22 . VAL A 1 66 ? 11.972  -8.272  -0.379  1.00 0.00 ? 64 VAL P HG22 1  
ATOM 1161  H HG23 . VAL A 1 66 ? 13.731  -8.363  -0.640  1.00 0.00 ? 64 VAL P HG23 1  
ATOM 1162  N N    . THR A 1 67 ? 11.109  -12.502 -2.456  1.00 0.00 ? 65 THR P N    1  
ATOM 1163  C CA   . THR A 1 67 ? 10.773  -13.652 -3.319  1.00 0.00 ? 65 THR P CA   1  
ATOM 1164  C C    . THR A 1 67 ? 10.743  -13.263 -4.805  1.00 0.00 ? 65 THR P C    1  
ATOM 1165  O O    . THR A 1 67 ? 10.204  -12.215 -5.169  1.00 0.00 ? 65 THR P O    1  
ATOM 1166  C CB   . THR A 1 67 ? 9.422   -14.265 -2.908  1.00 0.00 ? 65 THR P CB   1  
ATOM 1167  O OG1  . THR A 1 67 ? 9.398   -14.489 -1.510  1.00 0.00 ? 65 THR P OG1  1  
ATOM 1168  C CG2  . THR A 1 67 ? 9.147   -15.615 -3.575  1.00 0.00 ? 65 THR P CG2  1  
ATOM 1169  H H    . THR A 1 67 ? 10.372  -12.137 -1.870  1.00 0.00 ? 65 THR P H    1  
ATOM 1170  H HA   . THR A 1 67 ? 11.538  -14.416 -3.181  1.00 0.00 ? 65 THR P HA   1  
ATOM 1171  H HB   . THR A 1 67 ? 8.619   -13.570 -3.163  1.00 0.00 ? 65 THR P HB   1  
ATOM 1172  H HG1  . THR A 1 67 ? 8.505   -14.801 -1.276  1.00 0.00 ? 65 THR P HG1  1  
ATOM 1173  H HG21 . THR A 1 67 ? 9.044   -15.484 -4.652  1.00 0.00 ? 65 THR P HG21 1  
ATOM 1174  H HG22 . THR A 1 67 ? 8.215   -16.033 -3.194  1.00 0.00 ? 65 THR P HG22 1  
ATOM 1175  H HG23 . THR A 1 67 ? 9.963   -16.308 -3.370  1.00 0.00 ? 65 THR P HG23 1  
ATOM 1176  N N    . ASP A 1 68 ? 11.292  -14.124 -5.672  1.00 0.00 ? 66 ASP P N    1  
ATOM 1177  C CA   . ASP A 1 68 ? 11.324  -13.978 -7.141  1.00 0.00 ? 66 ASP P CA   1  
ATOM 1178  C C    . ASP A 1 68 ? 11.171  -15.329 -7.874  1.00 0.00 ? 66 ASP P C    1  
ATOM 1179  O O    . ASP A 1 68 ? 10.368  -15.398 -8.831  1.00 0.00 ? 66 ASP P O    1  
ATOM 1180  C CB   . ASP A 1 68 ? 12.627  -13.268 -7.561  1.00 0.00 ? 66 ASP P CB   1  
ATOM 1181  C CG   . ASP A 1 68 ? 12.735  -13.053 -9.087  1.00 0.00 ? 66 ASP P CG   1  
ATOM 1182  O OD1  . ASP A 1 68 ? 12.031  -12.163 -9.629  1.00 0.00 ? 66 ASP P OD1  1  
ATOM 1183  O OD2  . ASP A 1 68 ? 13.551  -13.744 -9.748  1.00 0.00 ? 66 ASP P OD2  1  
ATOM 1184  O OXT  . ASP A 1 68 ? 11.833  -16.316 -7.474  1.00 0.00 ? 66 ASP P OXT  1  
ATOM 1185  H H    . ASP A 1 68 ? 11.705  -14.968 -5.298  1.00 0.00 ? 66 ASP P H    1  
ATOM 1186  H HA   . ASP A 1 68 ? 10.490  -13.350 -7.454  1.00 0.00 ? 66 ASP P HA   1  
ATOM 1187  H HB2  . ASP A 1 68 ? 12.676  -12.298 -7.061  1.00 0.00 ? 66 ASP P HB2  1  
ATOM 1188  H HB3  . ASP A 1 68 ? 13.480  -13.856 -7.211  1.00 0.00 ? 66 ASP P HB3  1  
ATOM 1189  N N    . GLY A 1 1  ? 7.889   -28.444 15.733  1.00 0.00 ? -1 GLY P N    2  
ATOM 1190  C CA   . GLY A 1 1  ? 7.573   -27.021 15.481  1.00 0.00 ? -1 GLY P CA   2  
ATOM 1191  C C    . GLY A 1 1  ? 6.614   -26.458 16.523  1.00 0.00 ? -1 GLY P C    2  
ATOM 1192  O O    . GLY A 1 1  ? 5.922   -27.210 17.215  1.00 0.00 ? -1 GLY P O    2  
ATOM 1193  H H1   . GLY A 1 1  ? 8.513   -28.794 15.023  1.00 0.00 ? -1 GLY P H1   2  
ATOM 1194  H H2   . GLY A 1 1  ? 7.043   -28.994 15.722  1.00 0.00 ? -1 GLY P H2   2  
ATOM 1195  H H3   . GLY A 1 1  ? 8.329   -28.551 16.633  1.00 0.00 ? -1 GLY P H3   2  
ATOM 1196  H HA2  . GLY A 1 1  ? 8.492   -26.437 15.501  1.00 0.00 ? -1 GLY P HA2  2  
ATOM 1197  H HA3  . GLY A 1 1  ? 7.112   -26.918 14.499  1.00 0.00 ? -1 GLY P HA3  2  
ATOM 1198  N N    . SER A 1 2  ? 6.561   -25.129 16.644  1.00 0.00 ? 0  SER P N    2  
ATOM 1199  C CA   . SER A 1 2  ? 5.709   -24.412 17.611  1.00 0.00 ? 0  SER P CA   2  
ATOM 1200  C C    . SER A 1 2  ? 4.207   -24.548 17.305  1.00 0.00 ? 0  SER P C    2  
ATOM 1201  O O    . SER A 1 2  ? 3.802   -24.639 16.143  1.00 0.00 ? 0  SER P O    2  
ATOM 1202  C CB   . SER A 1 2  ? 6.092   -22.925 17.657  1.00 0.00 ? 0  SER P CB   2  
ATOM 1203  O OG   . SER A 1 2  ? 7.472   -22.777 17.963  1.00 0.00 ? 0  SER P OG   2  
ATOM 1204  H H    . SER A 1 2  ? 7.168   -24.567 16.063  1.00 0.00 ? 0  SER P H    2  
ATOM 1205  H HA   . SER A 1 2  ? 5.889   -24.829 18.602  1.00 0.00 ? 0  SER P HA   2  
ATOM 1206  H HB2  . SER A 1 2  ? 5.882   -22.465 16.689  1.00 0.00 ? 0  SER P HB2  2  
ATOM 1207  H HB3  . SER A 1 2  ? 5.498   -22.421 18.421  1.00 0.00 ? 0  SER P HB3  2  
ATOM 1208  H HG   . SER A 1 2  ? 7.683   -21.823 17.987  1.00 0.00 ? 0  SER P HG   2  
ATOM 1209  N N    . GLN A 1 3  ? 3.369   -24.526 18.349  1.00 0.00 ? 1  GLN P N    2  
ATOM 1210  C CA   . GLN A 1 3  ? 1.910   -24.725 18.241  1.00 0.00 ? 1  GLN P CA   2  
ATOM 1211  C C    . GLN A 1 3  ? 1.113   -23.474 17.808  1.00 0.00 ? 1  GLN P C    2  
ATOM 1212  O O    . GLN A 1 3  ? -0.063  -23.586 17.447  1.00 0.00 ? 1  GLN P O    2  
ATOM 1213  C CB   . GLN A 1 3  ? 1.372   -25.322 19.556  1.00 0.00 ? 1  GLN P CB   2  
ATOM 1214  C CG   . GLN A 1 3  ? 1.475   -24.382 20.772  1.00 0.00 ? 1  GLN P CG   2  
ATOM 1215  C CD   . GLN A 1 3  ? 0.876   -25.017 22.028  1.00 0.00 ? 1  GLN P CD   2  
ATOM 1216  O OE1  . GLN A 1 3  ? -0.251  -24.742 22.423  1.00 0.00 ? 1  GLN P OE1  2  
ATOM 1217  N NE2  . GLN A 1 3  ? 1.592   -25.895 22.702  1.00 0.00 ? 1  GLN P NE2  2  
ATOM 1218  H H    . GLN A 1 3  ? 3.767   -24.465 19.275  1.00 0.00 ? 1  GLN P H    2  
ATOM 1219  H HA   . GLN A 1 3  ? 1.736   -25.474 17.467  1.00 0.00 ? 1  GLN P HA   2  
ATOM 1220  H HB2  . GLN A 1 3  ? 0.324   -25.590 19.412  1.00 0.00 ? 1  GLN P HB2  2  
ATOM 1221  H HB3  . GLN A 1 3  ? 1.919   -26.242 19.771  1.00 0.00 ? 1  GLN P HB3  2  
ATOM 1222  H HG2  . GLN A 1 3  ? 2.520   -24.139 20.964  1.00 0.00 ? 1  GLN P HG2  2  
ATOM 1223  H HG3  . GLN A 1 3  ? 0.941   -23.455 20.566  1.00 0.00 ? 1  GLN P HG3  2  
ATOM 1224  H HE21 . GLN A 1 3  ? 2.521   -26.142 22.397  1.00 0.00 ? 1  GLN P HE21 2  
ATOM 1225  H HE22 . GLN A 1 3  ? 1.186   -26.311 23.528  1.00 0.00 ? 1  GLN P HE22 2  
ATOM 1226  N N    . ARG A 1 4  ? 1.731   -22.283 17.841  1.00 0.00 ? 2  ARG P N    2  
ATOM 1227  C CA   . ARG A 1 4  ? 1.110   -20.997 17.459  1.00 0.00 ? 2  ARG P CA   2  
ATOM 1228  C C    . ARG A 1 4  ? 0.976   -20.816 15.937  1.00 0.00 ? 2  ARG P C    2  
ATOM 1229  O O    . ARG A 1 4  ? 1.716   -21.426 15.160  1.00 0.00 ? 2  ARG P O    2  
ATOM 1230  C CB   . ARG A 1 4  ? 1.856   -19.822 18.125  1.00 0.00 ? 2  ARG P CB   2  
ATOM 1231  C CG   . ARG A 1 4  ? 3.303   -19.629 17.629  1.00 0.00 ? 2  ARG P CG   2  
ATOM 1232  C CD   . ARG A 1 4  ? 3.985   -18.412 18.272  1.00 0.00 ? 2  ARG P CD   2  
ATOM 1233  N NE   . ARG A 1 4  ? 4.215   -18.594 19.721  1.00 0.00 ? 2  ARG P NE   2  
ATOM 1234  C CZ   . ARG A 1 4  ? 4.774   -17.721 20.543  1.00 0.00 ? 2  ARG P CZ   2  
ATOM 1235  N NH1  . ARG A 1 4  ? 5.196   -16.557 20.139  1.00 0.00 ? 2  ARG P NH1  2  
ATOM 1236  N NH2  . ARG A 1 4  ? 4.921   -18.007 21.805  1.00 0.00 ? 2  ARG P NH2  2  
ATOM 1237  H H    . ARG A 1 4  ? 2.696   -22.278 18.134  1.00 0.00 ? 2  ARG P H    2  
ATOM 1238  H HA   . ARG A 1 4  ? 0.092   -20.993 17.855  1.00 0.00 ? 2  ARG P HA   2  
ATOM 1239  H HB2  . ARG A 1 4  ? 1.299   -18.903 17.936  1.00 0.00 ? 2  ARG P HB2  2  
ATOM 1240  H HB3  . ARG A 1 4  ? 1.863   -19.985 19.204  1.00 0.00 ? 2  ARG P HB3  2  
ATOM 1241  H HG2  . ARG A 1 4  ? 3.894   -20.519 17.840  1.00 0.00 ? 2  ARG P HG2  2  
ATOM 1242  H HG3  . ARG A 1 4  ? 3.293   -19.472 16.551  1.00 0.00 ? 2  ARG P HG3  2  
ATOM 1243  H HD2  . ARG A 1 4  ? 4.944   -18.260 17.774  1.00 0.00 ? 2  ARG P HD2  2  
ATOM 1244  H HD3  . ARG A 1 4  ? 3.364   -17.530 18.102  1.00 0.00 ? 2  ARG P HD3  2  
ATOM 1245  H HE   . ARG A 1 4  ? 3.929   -19.469 20.129  1.00 0.00 ? 2  ARG P HE   2  
ATOM 1246  H HH11 . ARG A 1 4  ? 5.098   -16.310 19.168  1.00 0.00 ? 2  ARG P HH11 2  
ATOM 1247  H HH12 . ARG A 1 4  ? 5.619   -15.911 20.783  1.00 0.00 ? 2  ARG P HH12 2  
ATOM 1248  H HH21 . ARG A 1 4  ? 4.609   -18.894 22.167  1.00 0.00 ? 2  ARG P HH21 2  
ATOM 1249  H HH22 . ARG A 1 4  ? 5.347   -17.342 22.429  1.00 0.00 ? 2  ARG P HH22 2  
ATOM 1250  N N    . ARG A 1 5  ? 0.055   -19.940 15.518  1.00 0.00 ? 3  ARG P N    2  
ATOM 1251  C CA   . ARG A 1 5  ? -0.125  -19.509 14.114  1.00 0.00 ? 3  ARG P CA   2  
ATOM 1252  C C    . ARG A 1 5  ? 0.994   -18.567 13.638  1.00 0.00 ? 3  ARG P C    2  
ATOM 1253  O O    . ARG A 1 5  ? 1.780   -18.067 14.445  1.00 0.00 ? 3  ARG P O    2  
ATOM 1254  C CB   . ARG A 1 5  ? -1.559  -18.966 13.905  1.00 0.00 ? 3  ARG P CB   2  
ATOM 1255  C CG   . ARG A 1 5  ? -1.990  -17.731 14.723  1.00 0.00 ? 3  ARG P CG   2  
ATOM 1256  C CD   . ARG A 1 5  ? -1.336  -16.423 14.262  1.00 0.00 ? 3  ARG P CD   2  
ATOM 1257  N NE   . ARG A 1 5  ? -1.959  -15.242 14.889  1.00 0.00 ? 3  ARG P NE   2  
ATOM 1258  C CZ   . ARG A 1 5  ? -1.689  -13.979 14.609  1.00 0.00 ? 3  ARG P CZ   2  
ATOM 1259  N NH1  . ARG A 1 5  ? -0.796  -13.638 13.723  1.00 0.00 ? 3  ARG P NH1  2  
ATOM 1260  N NH2  . ARG A 1 5  ? -2.320  -13.020 15.225  1.00 0.00 ? 3  ARG P NH2  2  
ATOM 1261  H H    . ARG A 1 5  ? -0.501  -19.488 16.230  1.00 0.00 ? 3  ARG P H    2  
ATOM 1262  H HA   . ARG A 1 5  ? -0.038  -20.397 13.484  1.00 0.00 ? 3  ARG P HA   2  
ATOM 1263  H HB2  . ARG A 1 5  ? -1.706  -18.748 12.845  1.00 0.00 ? 3  ARG P HB2  2  
ATOM 1264  H HB3  . ARG A 1 5  ? -2.249  -19.774 14.152  1.00 0.00 ? 3  ARG P HB3  2  
ATOM 1265  H HG2  . ARG A 1 5  ? -3.070  -17.625 14.607  1.00 0.00 ? 3  ARG P HG2  2  
ATOM 1266  H HG3  . ARG A 1 5  ? -1.781  -17.890 15.782  1.00 0.00 ? 3  ARG P HG3  2  
ATOM 1267  H HD2  . ARG A 1 5  ? -0.278  -16.438 14.524  1.00 0.00 ? 3  ARG P HD2  2  
ATOM 1268  H HD3  . ARG A 1 5  ? -1.436  -16.348 13.177  1.00 0.00 ? 3  ARG P HD3  2  
ATOM 1269  H HE   . ARG A 1 5  ? -2.662  -15.408 15.592  1.00 0.00 ? 3  ARG P HE   2  
ATOM 1270  H HH11 . ARG A 1 5  ? -0.285  -14.363 13.230  1.00 0.00 ? 3  ARG P HH11 2  
ATOM 1271  H HH12 . ARG A 1 5  ? -0.616  -12.670 13.521  1.00 0.00 ? 3  ARG P HH12 2  
ATOM 1272  H HH21 . ARG A 1 5  ? -3.019  -13.236 15.917  1.00 0.00 ? 3  ARG P HH21 2  
ATOM 1273  H HH22 . ARG A 1 5  ? -2.114  -12.059 15.013  1.00 0.00 ? 3  ARG P HH22 2  
ATOM 1274  N N    . GLN A 1 6  ? 1.068   -18.321 12.328  1.00 0.00 ? 4  GLN P N    2  
ATOM 1275  C CA   . GLN A 1 6  ? 2.099   -17.470 11.710  1.00 0.00 ? 4  GLN P CA   2  
ATOM 1276  C C    . GLN A 1 6  ? 2.002   -15.999 12.153  1.00 0.00 ? 4  GLN P C    2  
ATOM 1277  O O    . GLN A 1 6  ? 0.910   -15.460 12.352  1.00 0.00 ? 4  GLN P O    2  
ATOM 1278  C CB   . GLN A 1 6  ? 2.031   -17.578 10.174  1.00 0.00 ? 4  GLN P CB   2  
ATOM 1279  C CG   . GLN A 1 6  ? 2.438   -18.959 9.626   1.00 0.00 ? 4  GLN P CG   2  
ATOM 1280  C CD   . GLN A 1 6  ? 3.922   -19.306 9.803   1.00 0.00 ? 4  GLN P CD   2  
ATOM 1281  O OE1  . GLN A 1 6  ? 4.747   -18.517 10.247  1.00 0.00 ? 4  GLN P OE1  2  
ATOM 1282  N NE2  . GLN A 1 6  ? 4.324   -20.510 9.454   1.00 0.00 ? 4  GLN P NE2  2  
ATOM 1283  H H    . GLN A 1 6  ? 0.376   -18.744 11.728  1.00 0.00 ? 4  GLN P H    2  
ATOM 1284  H HA   . GLN A 1 6  ? 3.072   -17.836 12.039  1.00 0.00 ? 4  GLN P HA   2  
ATOM 1285  H HB2  . GLN A 1 6  ? 1.012   -17.359 9.851   1.00 0.00 ? 4  GLN P HB2  2  
ATOM 1286  H HB3  . GLN A 1 6  ? 2.684   -16.825 9.731   1.00 0.00 ? 4  GLN P HB3  2  
ATOM 1287  H HG2  . GLN A 1 6  ? 1.834   -19.734 10.099  1.00 0.00 ? 4  GLN P HG2  2  
ATOM 1288  H HG3  . GLN A 1 6  ? 2.217   -18.981 8.559   1.00 0.00 ? 4  GLN P HG3  2  
ATOM 1289  H HE21 . GLN A 1 6  ? 3.669   -21.181 9.079   1.00 0.00 ? 4  GLN P HE21 2  
ATOM 1290  H HE22 . GLN A 1 6  ? 5.301   -20.739 9.565   1.00 0.00 ? 4  GLN P HE22 2  
ATOM 1291  N N    . ARG A 1 7  ? 3.157   -15.332 12.292  1.00 0.00 ? 5  ARG P N    2  
ATOM 1292  C CA   . ARG A 1 7  ? 3.274   -13.946 12.793  1.00 0.00 ? 5  ARG P CA   2  
ATOM 1293  C C    . ARG A 1 7  ? 2.907   -12.877 11.750  1.00 0.00 ? 5  ARG P C    2  
ATOM 1294  O O    . ARG A 1 7  ? 2.527   -11.766 12.118  1.00 0.00 ? 5  ARG P O    2  
ATOM 1295  C CB   . ARG A 1 7  ? 4.707   -13.765 13.334  1.00 0.00 ? 5  ARG P CB   2  
ATOM 1296  C CG   . ARG A 1 7  ? 4.911   -12.458 14.120  1.00 0.00 ? 5  ARG P CG   2  
ATOM 1297  C CD   . ARG A 1 7  ? 6.304   -12.376 14.763  1.00 0.00 ? 5  ARG P CD   2  
ATOM 1298  N NE   . ARG A 1 7  ? 7.392   -12.360 13.760  1.00 0.00 ? 5  ARG P NE   2  
ATOM 1299  C CZ   . ARG A 1 7  ? 7.837   -11.322 13.071  1.00 0.00 ? 5  ARG P CZ   2  
ATOM 1300  N NH1  . ARG A 1 7  ? 7.336   -10.126 13.207  1.00 0.00 ? 5  ARG P NH1  2  
ATOM 1301  N NH2  . ARG A 1 7  ? 8.808   -11.470 12.217  1.00 0.00 ? 5  ARG P NH2  2  
ATOM 1302  H H    . ARG A 1 7  ? 4.011   -15.843 12.105  1.00 0.00 ? 5  ARG P H    2  
ATOM 1303  H HA   . ARG A 1 7  ? 2.579   -13.818 13.625  1.00 0.00 ? 5  ARG P HA   2  
ATOM 1304  H HB2  . ARG A 1 7  ? 4.933   -14.598 14.004  1.00 0.00 ? 5  ARG P HB2  2  
ATOM 1305  H HB3  . ARG A 1 7  ? 5.410   -13.799 12.499  1.00 0.00 ? 5  ARG P HB3  2  
ATOM 1306  H HG2  . ARG A 1 7  ? 4.778   -11.602 13.458  1.00 0.00 ? 5  ARG P HG2  2  
ATOM 1307  H HG3  . ARG A 1 7  ? 4.163   -12.401 14.912  1.00 0.00 ? 5  ARG P HG3  2  
ATOM 1308  H HD2  . ARG A 1 7  ? 6.358   -11.482 15.385  1.00 0.00 ? 5  ARG P HD2  2  
ATOM 1309  H HD3  . ARG A 1 7  ? 6.437   -13.237 15.421  1.00 0.00 ? 5  ARG P HD3  2  
ATOM 1310  H HE   . ARG A 1 7  ? 7.861   -13.237 13.590  1.00 0.00 ? 5  ARG P HE   2  
ATOM 1311  H HH11 . ARG A 1 7  ? 6.592   -9.978  13.866  1.00 0.00 ? 5  ARG P HH11 2  
ATOM 1312  H HH12 . ARG A 1 7  ? 7.699   -9.354  12.674  1.00 0.00 ? 5  ARG P HH12 2  
ATOM 1313  H HH21 . ARG A 1 7  ? 9.229   -12.375 12.079  1.00 0.00 ? 5  ARG P HH21 2  
ATOM 1314  H HH22 . ARG A 1 7  ? 9.149   -10.681 11.694  1.00 0.00 ? 5  ARG P HH22 2  
ATOM 1315  N N    . THR A 1 8  ? 3.006   -13.203 10.462  1.00 0.00 ? 6  THR P N    2  
ATOM 1316  C CA   . THR A 1 8  ? 2.777   -12.284 9.332   1.00 0.00 ? 6  THR P CA   2  
ATOM 1317  C C    . THR A 1 8  ? 1.322   -11.804 9.222   1.00 0.00 ? 6  THR P C    2  
ATOM 1318  O O    . THR A 1 8  ? 0.381   -12.572 9.438   1.00 0.00 ? 6  THR P O    2  
ATOM 1319  C CB   . THR A 1 8  ? 3.211   -12.927 8.000   1.00 0.00 ? 6  THR P CB   2  
ATOM 1320  O OG1  . THR A 1 8  ? 2.727   -14.252 7.884   1.00 0.00 ? 6  THR P OG1  2  
ATOM 1321  C CG2  . THR A 1 8  ? 4.735   -13.003 7.894   1.00 0.00 ? 6  THR P CG2  2  
ATOM 1322  H H    . THR A 1 8  ? 3.277   -14.149 10.237  1.00 0.00 ? 6  THR P H    2  
ATOM 1323  H HA   . THR A 1 8  ? 3.396   -11.400 9.487   1.00 0.00 ? 6  THR P HA   2  
ATOM 1324  H HB   . THR A 1 8  ? 2.840   -12.327 7.167   1.00 0.00 ? 6  THR P HB   2  
ATOM 1325  H HG1  . THR A 1 8  ? 1.756   -14.208 7.809   1.00 0.00 ? 6  THR P HG1  2  
ATOM 1326  H HG21 . THR A 1 8  ? 5.159   -12.000 7.954   1.00 0.00 ? 6  THR P HG21 2  
ATOM 1327  H HG22 . THR A 1 8  ? 5.010   -13.441 6.935   1.00 0.00 ? 6  THR P HG22 2  
ATOM 1328  H HG23 . THR A 1 8  ? 5.144   -13.615 8.699   1.00 0.00 ? 6  THR P HG23 2  
ATOM 1329  N N    . HIS A 1 9  ? 1.140   -10.530 8.853   1.00 0.00 ? 7  HIS P N    2  
ATOM 1330  C CA   . HIS A 1 9  ? -0.172  -9.882  8.685   1.00 0.00 ? 7  HIS P CA   2  
ATOM 1331  C C    . HIS A 1 9  ? -0.577  -9.723  7.209   1.00 0.00 ? 7  HIS P C    2  
ATOM 1332  O O    . HIS A 1 9  ? -1.681  -10.119 6.827   1.00 0.00 ? 7  HIS P O    2  
ATOM 1333  C CB   . HIS A 1 9  ? -0.153  -8.533  9.420   1.00 0.00 ? 7  HIS P CB   2  
ATOM 1334  C CG   . HIS A 1 9  ? -1.378  -7.695  9.158   1.00 0.00 ? 7  HIS P CG   2  
ATOM 1335  N ND1  . HIS A 1 9  ? -1.439  -6.632  8.256   1.00 0.00 ? 7  HIS P ND1  2  
ATOM 1336  C CD2  . HIS A 1 9  ? -2.612  -7.881  9.711   1.00 0.00 ? 7  HIS P CD2  2  
ATOM 1337  C CE1  . HIS A 1 9  ? -2.715  -6.215  8.268   1.00 0.00 ? 7  HIS P CE1  2  
ATOM 1338  N NE2  . HIS A 1 9  ? -3.438  -6.937  9.142   1.00 0.00 ? 7  HIS P NE2  2  
ATOM 1339  H H    . HIS A 1 9  ? 1.963   -9.960  8.716   1.00 0.00 ? 7  HIS P H    2  
ATOM 1340  H HA   . HIS A 1 9  ? -0.948  -10.493 9.149   1.00 0.00 ? 7  HIS P HA   2  
ATOM 1341  H HB2  . HIS A 1 9  ? -0.068  -8.712  10.492  1.00 0.00 ? 7  HIS P HB2  2  
ATOM 1342  H HB3  . HIS A 1 9  ? 0.722   -7.962  9.104   1.00 0.00 ? 7  HIS P HB3  2  
ATOM 1343  H HD2  . HIS A 1 9  ? -2.885  -8.642  10.432  1.00 0.00 ? 7  HIS P HD2  2  
ATOM 1344  H HE1  . HIS A 1 9  ? -3.105  -5.412  7.655   1.00 0.00 ? 7  HIS P HE1  2  
ATOM 1345  H HE2  . HIS A 1 9  ? -4.429  -6.815  9.323   1.00 0.00 ? 7  HIS P HE2  2  
ATOM 1346  N N    . PHE A 1 10 ? 0.319   -9.182  6.375   1.00 0.00 ? 8  PHE P N    2  
ATOM 1347  C CA   . PHE A 1 10 ? 0.088   -8.967  4.941   1.00 0.00 ? 8  PHE P CA   2  
ATOM 1348  C C    . PHE A 1 10 ? -0.161  -10.281 4.174   1.00 0.00 ? 8  PHE P C    2  
ATOM 1349  O O    . PHE A 1 10 ? 0.461   -11.307 4.471   1.00 0.00 ? 8  PHE P O    2  
ATOM 1350  C CB   . PHE A 1 10 ? 1.295   -8.245  4.315   1.00 0.00 ? 8  PHE P CB   2  
ATOM 1351  C CG   . PHE A 1 10 ? 1.820   -7.031  5.063   1.00 0.00 ? 8  PHE P CG   2  
ATOM 1352  C CD1  . PHE A 1 10 ? 1.154   -5.796  4.963   1.00 0.00 ? 8  PHE P CD1  2  
ATOM 1353  C CD2  . PHE A 1 10 ? 2.996   -7.127  5.833   1.00 0.00 ? 8  PHE P CD2  2  
ATOM 1354  C CE1  . PHE A 1 10 ? 1.660   -4.663  5.626   1.00 0.00 ? 8  PHE P CE1  2  
ATOM 1355  C CE2  . PHE A 1 10 ? 3.499   -5.995  6.501   1.00 0.00 ? 8  PHE P CE2  2  
ATOM 1356  C CZ   . PHE A 1 10 ? 2.831   -4.762  6.397   1.00 0.00 ? 8  PHE P CZ   2  
ATOM 1357  H H    . PHE A 1 10 ? 1.172   -8.821  6.768   1.00 0.00 ? 8  PHE P H    2  
ATOM 1358  H HA   . PHE A 1 10 ? -0.788  -8.328  4.832   1.00 0.00 ? 8  PHE P HA   2  
ATOM 1359  H HB2  . PHE A 1 10 ? 2.109   -8.964  4.215   1.00 0.00 ? 8  PHE P HB2  2  
ATOM 1360  H HB3  . PHE A 1 10 ? 1.017   -7.932  3.308   1.00 0.00 ? 8  PHE P HB3  2  
ATOM 1361  H HD1  . PHE A 1 10 ? 0.258   -5.716  4.367   1.00 0.00 ? 8  PHE P HD1  2  
ATOM 1362  H HD2  . PHE A 1 10 ? 3.523   -8.068  5.906   1.00 0.00 ? 8  PHE P HD2  2  
ATOM 1363  H HE1  . PHE A 1 10 ? 1.152   -3.712  5.541   1.00 0.00 ? 8  PHE P HE1  2  
ATOM 1364  H HE2  . PHE A 1 10 ? 4.404   -6.071  7.089   1.00 0.00 ? 8  PHE P HE2  2  
ATOM 1365  H HZ   . PHE A 1 10 ? 3.222   -3.890  6.904   1.00 0.00 ? 8  PHE P HZ   2  
ATOM 1366  N N    . THR A 1 11 ? -1.013  -10.240 3.143   1.00 0.00 ? 9  THR P N    2  
ATOM 1367  C CA   . THR A 1 11 ? -1.203  -11.341 2.173   1.00 0.00 ? 9  THR P CA   2  
ATOM 1368  C C    . THR A 1 11 ? -0.532  -11.044 0.824   1.00 0.00 ? 9  THR P C    2  
ATOM 1369  O O    . THR A 1 11 ? -0.178  -9.899  0.528   1.00 0.00 ? 9  THR P O    2  
ATOM 1370  C CB   . THR A 1 11 ? -2.684  -11.737 2.044   1.00 0.00 ? 9  THR P CB   2  
ATOM 1371  O OG1  . THR A 1 11 ? -2.781  -12.976 1.377   1.00 0.00 ? 9  THR P OG1  2  
ATOM 1372  C CG2  . THR A 1 11 ? -3.552  -10.735 1.282   1.00 0.00 ? 9  THR P CG2  2  
ATOM 1373  H H    . THR A 1 11 ? -1.500  -9.366  2.972   1.00 0.00 ? 9  THR P H    2  
ATOM 1374  H HA   . THR A 1 11 ? -0.702  -12.228 2.561   1.00 0.00 ? 9  THR P HA   2  
ATOM 1375  H HB   . THR A 1 11 ? -3.094  -11.858 3.048   1.00 0.00 ? 9  THR P HB   2  
ATOM 1376  H HG1  . THR A 1 11 ? -3.701  -13.286 1.462   1.00 0.00 ? 9  THR P HG1  2  
ATOM 1377  H HG21 . THR A 1 11 ? -4.577  -11.104 1.232   1.00 0.00 ? 9  THR P HG21 2  
ATOM 1378  H HG22 . THR A 1 11 ? -3.177  -10.588 0.270   1.00 0.00 ? 9  THR P HG22 2  
ATOM 1379  H HG23 . THR A 1 11 ? -3.559  -9.788  1.813   1.00 0.00 ? 9  THR P HG23 2  
ATOM 1380  N N    . SER A 1 12 ? -0.346  -12.068 -0.012  1.00 0.00 ? 10 SER P N    2  
ATOM 1381  C CA   . SER A 1 12 ? 0.427   -12.002 -1.265  1.00 0.00 ? 10 SER P CA   2  
ATOM 1382  C C    . SER A 1 12 ? -0.080  -10.948 -2.257  1.00 0.00 ? 10 SER P C    2  
ATOM 1383  O O    . SER A 1 12 ? 0.728   -10.270 -2.888  1.00 0.00 ? 10 SER P O    2  
ATOM 1384  C CB   . SER A 1 12 ? 0.449   -13.381 -1.936  1.00 0.00 ? 10 SER P CB   2  
ATOM 1385  O OG   . SER A 1 12 ? -0.870  -13.839 -2.200  1.00 0.00 ? 10 SER P OG   2  
ATOM 1386  H H    . SER A 1 12 ? -0.761  -12.957 0.237   1.00 0.00 ? 10 SER P H    2  
ATOM 1387  H HA   . SER A 1 12 ? 1.456   -11.742 -1.017  1.00 0.00 ? 10 SER P HA   2  
ATOM 1388  H HB2  . SER A 1 12 ? 1.010   -13.318 -2.872  1.00 0.00 ? 10 SER P HB2  2  
ATOM 1389  H HB3  . SER A 1 12 ? 0.952   -14.089 -1.275  1.00 0.00 ? 10 SER P HB3  2  
ATOM 1390  H HG   . SER A 1 12 ? -0.813  -14.728 -2.602  1.00 0.00 ? 10 SER P HG   2  
ATOM 1391  N N    . GLN A 1 13 ? -1.397  -10.734 -2.347  1.00 0.00 ? 11 GLN P N    2  
ATOM 1392  C CA   . GLN A 1 13 ? -1.998  -9.712  -3.217  1.00 0.00 ? 11 GLN P CA   2  
ATOM 1393  C C    . GLN A 1 13 ? -1.674  -8.276  -2.759  1.00 0.00 ? 11 GLN P C    2  
ATOM 1394  O O    . GLN A 1 13 ? -1.432  -7.398  -3.589  1.00 0.00 ? 11 GLN P O    2  
ATOM 1395  C CB   . GLN A 1 13 ? -3.521  -9.926  -3.288  1.00 0.00 ? 11 GLN P CB   2  
ATOM 1396  C CG   . GLN A 1 13 ? -3.898  -11.265 -3.952  1.00 0.00 ? 11 GLN P CG   2  
ATOM 1397  C CD   . GLN A 1 13 ? -5.407  -11.481 -4.090  1.00 0.00 ? 11 GLN P CD   2  
ATOM 1398  O OE1  . GLN A 1 13 ? -6.242  -10.679 -3.687  1.00 0.00 ? 11 GLN P OE1  2  
ATOM 1399  N NE2  . GLN A 1 13 ? -5.825  -12.588 -4.670  1.00 0.00 ? 11 GLN P NE2  2  
ATOM 1400  H H    . GLN A 1 13 ? -2.003  -11.351 -1.823  1.00 0.00 ? 11 GLN P H    2  
ATOM 1401  H HA   . GLN A 1 13 ? -1.590  -9.827  -4.223  1.00 0.00 ? 11 GLN P HA   2  
ATOM 1402  H HB2  . GLN A 1 13 ? -3.940  -9.888  -2.282  1.00 0.00 ? 11 GLN P HB2  2  
ATOM 1403  H HB3  . GLN A 1 13 ? -3.956  -9.116  -3.875  1.00 0.00 ? 11 GLN P HB3  2  
ATOM 1404  H HG2  . GLN A 1 13 ? -3.452  -11.305 -4.947  1.00 0.00 ? 11 GLN P HG2  2  
ATOM 1405  H HG3  . GLN A 1 13 ? -3.490  -12.091 -3.368  1.00 0.00 ? 11 GLN P HG3  2  
ATOM 1406  H HE21 . GLN A 1 13 ? -5.161  -13.268 -5.010  1.00 0.00 ? 11 GLN P HE21 2  
ATOM 1407  H HE22 . GLN A 1 13 ? -6.819  -12.735 -4.763  1.00 0.00 ? 11 GLN P HE22 2  
ATOM 1408  N N    . GLN A 1 14 ? -1.606  -8.039  -1.444  1.00 0.00 ? 12 GLN P N    2  
ATOM 1409  C CA   . GLN A 1 14 ? -1.219  -6.745  -0.866  1.00 0.00 ? 12 GLN P CA   2  
ATOM 1410  C C    . GLN A 1 14 ? 0.278   -6.485  -1.077  1.00 0.00 ? 12 GLN P C    2  
ATOM 1411  O O    . GLN A 1 14 ? 0.668   -5.404  -1.519  1.00 0.00 ? 12 GLN P O    2  
ATOM 1412  C CB   . GLN A 1 14 ? -1.550  -6.718  0.636   1.00 0.00 ? 12 GLN P CB   2  
ATOM 1413  C CG   . GLN A 1 14 ? -3.046  -6.887  0.948   1.00 0.00 ? 12 GLN P CG   2  
ATOM 1414  C CD   . GLN A 1 14 ? -3.309  -7.061  2.444   1.00 0.00 ? 12 GLN P CD   2  
ATOM 1415  O OE1  . GLN A 1 14 ? -2.586  -7.746  3.154   1.00 0.00 ? 12 GLN P OE1  2  
ATOM 1416  N NE2  . GLN A 1 14 ? -4.361  -6.483  2.977   1.00 0.00 ? 12 GLN P NE2  2  
ATOM 1417  H H    . GLN A 1 14 ? -1.743  -8.818  -0.815  1.00 0.00 ? 12 GLN P H    2  
ATOM 1418  H HA   . GLN A 1 14 ? -1.773  -5.946  -1.360  1.00 0.00 ? 12 GLN P HA   2  
ATOM 1419  H HB2  . GLN A 1 14 ? -0.986  -7.506  1.135   1.00 0.00 ? 12 GLN P HB2  2  
ATOM 1420  H HB3  . GLN A 1 14 ? -1.220  -5.763  1.045   1.00 0.00 ? 12 GLN P HB3  2  
ATOM 1421  H HG2  . GLN A 1 14 ? -3.588  -6.020  0.574   1.00 0.00 ? 12 GLN P HG2  2  
ATOM 1422  H HG3  . GLN A 1 14 ? -3.442  -7.765  0.440   1.00 0.00 ? 12 GLN P HG3  2  
ATOM 1423  H HE21 . GLN A 1 14 ? -4.935  -5.855  2.421   1.00 0.00 ? 12 GLN P HE21 2  
ATOM 1424  H HE22 . GLN A 1 14 ? -4.525  -6.610  3.962   1.00 0.00 ? 12 GLN P HE22 2  
ATOM 1425  N N    . LEU A 1 15 ? 1.113   -7.501  -0.830  1.00 0.00 ? 13 LEU P N    2  
ATOM 1426  C CA   . LEU A 1 15 ? 2.564   -7.447  -1.046  1.00 0.00 ? 13 LEU P CA   2  
ATOM 1427  C C    . LEU A 1 15 ? 2.919   -7.231  -2.528  1.00 0.00 ? 13 LEU P C    2  
ATOM 1428  O O    . LEU A 1 15 ? 3.842   -6.477  -2.830  1.00 0.00 ? 13 LEU P O    2  
ATOM 1429  C CB   . LEU A 1 15 ? 3.201   -8.740  -0.505  1.00 0.00 ? 13 LEU P CB   2  
ATOM 1430  C CG   . LEU A 1 15 ? 3.118   -8.903  1.026   1.00 0.00 ? 13 LEU P CG   2  
ATOM 1431  C CD1  . LEU A 1 15 ? 3.567   -10.308 1.426   1.00 0.00 ? 13 LEU P CD1  2  
ATOM 1432  C CD2  . LEU A 1 15 ? 4.005   -7.893  1.758   1.00 0.00 ? 13 LEU P CD2  2  
ATOM 1433  H H    . LEU A 1 15 ? 0.716   -8.359  -0.461  1.00 0.00 ? 13 LEU P H    2  
ATOM 1434  H HA   . LEU A 1 15 ? 2.970   -6.594  -0.502  1.00 0.00 ? 13 LEU P HA   2  
ATOM 1435  H HB2  . LEU A 1 15 ? 2.709   -9.591  -0.978  1.00 0.00 ? 13 LEU P HB2  2  
ATOM 1436  H HB3  . LEU A 1 15 ? 4.251   -8.765  -0.799  1.00 0.00 ? 13 LEU P HB3  2  
ATOM 1437  H HG   . LEU A 1 15 ? 2.090   -8.770  1.356   1.00 0.00 ? 13 LEU P HG   2  
ATOM 1438  H HD11 . LEU A 1 15 ? 2.921   -11.048 0.952   1.00 0.00 ? 13 LEU P HD11 2  
ATOM 1439  H HD12 . LEU A 1 15 ? 3.493   -10.426 2.507   1.00 0.00 ? 13 LEU P HD12 2  
ATOM 1440  H HD13 . LEU A 1 15 ? 4.598   -10.476 1.114   1.00 0.00 ? 13 LEU P HD13 2  
ATOM 1441  H HD21 . LEU A 1 15 ? 3.974   -8.081  2.830   1.00 0.00 ? 13 LEU P HD21 2  
ATOM 1442  H HD22 . LEU A 1 15 ? 3.644   -6.880  1.582   1.00 0.00 ? 13 LEU P HD22 2  
ATOM 1443  H HD23 . LEU A 1 15 ? 5.034   -7.984  1.412   1.00 0.00 ? 13 LEU P HD23 2  
ATOM 1444  N N    . GLN A 1 16 ? 2.162   -7.829  -3.454  1.00 0.00 ? 14 GLN P N    2  
ATOM 1445  C CA   . GLN A 1 16 ? 2.324   -7.629  -4.897  1.00 0.00 ? 14 GLN P CA   2  
ATOM 1446  C C    . GLN A 1 16 ? 1.962   -6.198  -5.329  1.00 0.00 ? 14 GLN P C    2  
ATOM 1447  O O    . GLN A 1 16 ? 2.680   -5.612  -6.136  1.00 0.00 ? 14 GLN P O    2  
ATOM 1448  C CB   . GLN A 1 16 ? 1.492   -8.685  -5.645  1.00 0.00 ? 14 GLN P CB   2  
ATOM 1449  C CG   . GLN A 1 16 ? 1.694   -8.639  -7.167  1.00 0.00 ? 14 GLN P CG   2  
ATOM 1450  C CD   . GLN A 1 16 ? 0.926   -9.756  -7.872  1.00 0.00 ? 14 GLN P CD   2  
ATOM 1451  O OE1  . GLN A 1 16 ? -0.175  -9.573  -8.374  1.00 0.00 ? 14 GLN P OE1  2  
ATOM 1452  N NE2  . GLN A 1 16 ? 1.462   -10.958 -7.928  1.00 0.00 ? 14 GLN P NE2  2  
ATOM 1453  H H    . GLN A 1 16 ? 1.464   -8.496  -3.143  1.00 0.00 ? 14 GLN P H    2  
ATOM 1454  H HA   . GLN A 1 16 ? 3.374   -7.790  -5.147  1.00 0.00 ? 14 GLN P HA   2  
ATOM 1455  H HB2  . GLN A 1 16 ? 1.786   -9.673  -5.291  1.00 0.00 ? 14 GLN P HB2  2  
ATOM 1456  H HB3  . GLN A 1 16 ? 0.434   -8.539  -5.422  1.00 0.00 ? 14 GLN P HB3  2  
ATOM 1457  H HG2  . GLN A 1 16 ? 1.350   -7.681  -7.558  1.00 0.00 ? 14 GLN P HG2  2  
ATOM 1458  H HG3  . GLN A 1 16 ? 2.758   -8.739  -7.393  1.00 0.00 ? 14 GLN P HG3  2  
ATOM 1459  H HE21 . GLN A 1 16 ? 2.368   -11.136 -7.519  1.00 0.00 ? 14 GLN P HE21 2  
ATOM 1460  H HE22 . GLN A 1 16 ? 0.948   -11.692 -8.393  1.00 0.00 ? 14 GLN P HE22 2  
ATOM 1461  N N    . GLU A 1 17 ? 0.901   -5.600  -4.777  1.00 0.00 ? 15 GLU P N    2  
ATOM 1462  C CA   . GLU A 1 17 ? 0.522   -4.206  -5.067  1.00 0.00 ? 15 GLU P CA   2  
ATOM 1463  C C    . GLU A 1 17 ? 1.555   -3.203  -4.511  1.00 0.00 ? 15 GLU P C    2  
ATOM 1464  O O    . GLU A 1 17 ? 1.949   -2.257  -5.199  1.00 0.00 ? 15 GLU P O    2  
ATOM 1465  C CB   . GLU A 1 17 ? -0.882  -3.943  -4.495  1.00 0.00 ? 15 GLU P CB   2  
ATOM 1466  C CG   . GLU A 1 17 ? -1.510  -2.620  -4.958  1.00 0.00 ? 15 GLU P CG   2  
ATOM 1467  C CD   . GLU A 1 17 ? -1.895  -2.657  -6.451  1.00 0.00 ? 15 GLU P CD   2  
ATOM 1468  O OE1  . GLU A 1 17 ? -2.999  -3.152  -6.783  1.00 0.00 ? 15 GLU P OE1  2  
ATOM 1469  O OE2  . GLU A 1 17 ? -1.102  -2.188  -7.301  1.00 0.00 ? 15 GLU P OE2  2  
ATOM 1470  H H    . GLU A 1 17 ? 0.320   -6.133  -4.140  1.00 0.00 ? 15 GLU P H    2  
ATOM 1471  H HA   . GLU A 1 17 ? 0.487   -4.076  -6.150  1.00 0.00 ? 15 GLU P HA   2  
ATOM 1472  H HB2  . GLU A 1 17 ? -1.547  -4.756  -4.788  1.00 0.00 ? 15 GLU P HB2  2  
ATOM 1473  H HB3  . GLU A 1 17 ? -0.820  -3.937  -3.407  1.00 0.00 ? 15 GLU P HB3  2  
ATOM 1474  H HG2  . GLU A 1 17 ? -2.409  -2.443  -4.362  1.00 0.00 ? 15 GLU P HG2  2  
ATOM 1475  H HG3  . GLU A 1 17 ? -0.826  -1.794  -4.754  1.00 0.00 ? 15 GLU P HG3  2  
ATOM 1476  N N    . LEU A 1 18 ? 2.050   -3.448  -3.292  1.00 0.00 ? 16 LEU P N    2  
ATOM 1477  C CA   . LEU A 1 18 ? 3.120   -2.670  -2.659  1.00 0.00 ? 16 LEU P CA   2  
ATOM 1478  C C    . LEU A 1 18 ? 4.438   -2.763  -3.449  1.00 0.00 ? 16 LEU P C    2  
ATOM 1479  O O    . LEU A 1 18 ? 5.069   -1.741  -3.728  1.00 0.00 ? 16 LEU P O    2  
ATOM 1480  C CB   . LEU A 1 18 ? 3.296   -3.161  -1.209  1.00 0.00 ? 16 LEU P CB   2  
ATOM 1481  C CG   . LEU A 1 18 ? 2.178   -2.710  -0.252  1.00 0.00 ? 16 LEU P CG   2  
ATOM 1482  C CD1  . LEU A 1 18 ? 2.208   -3.535  1.035   1.00 0.00 ? 16 LEU P CD1  2  
ATOM 1483  C CD2  . LEU A 1 18 ? 2.336   -1.237  0.131   1.00 0.00 ? 16 LEU P CD2  2  
ATOM 1484  H H    . LEU A 1 18 ? 1.664   -4.231  -2.773  1.00 0.00 ? 16 LEU P H    2  
ATOM 1485  H HA   . LEU A 1 18 ? 2.833   -1.619  -2.647  1.00 0.00 ? 16 LEU P HA   2  
ATOM 1486  H HB2  . LEU A 1 18 ? 3.357   -4.250  -1.213  1.00 0.00 ? 16 LEU P HB2  2  
ATOM 1487  H HB3  . LEU A 1 18 ? 4.241   -2.785  -0.827  1.00 0.00 ? 16 LEU P HB3  2  
ATOM 1488  H HG   . LEU A 1 18 ? 1.206   -2.847  -0.725  1.00 0.00 ? 16 LEU P HG   2  
ATOM 1489  H HD11 . LEU A 1 18 ? 1.420   -3.199  1.706   1.00 0.00 ? 16 LEU P HD11 2  
ATOM 1490  H HD12 . LEU A 1 18 ? 3.171   -3.421  1.529   1.00 0.00 ? 16 LEU P HD12 2  
ATOM 1491  H HD13 . LEU A 1 18 ? 2.046   -4.585  0.802   1.00 0.00 ? 16 LEU P HD13 2  
ATOM 1492  H HD21 . LEU A 1 18 ? 1.518   -0.945  0.786   1.00 0.00 ? 16 LEU P HD21 2  
ATOM 1493  H HD22 . LEU A 1 18 ? 2.307   -0.612  -0.759  1.00 0.00 ? 16 LEU P HD22 2  
ATOM 1494  H HD23 . LEU A 1 18 ? 3.284   -1.082  0.646   1.00 0.00 ? 16 LEU P HD23 2  
ATOM 1495  N N    . GLU A 1 19 ? 4.824   -3.964  -3.888  1.00 0.00 ? 17 GLU P N    2  
ATOM 1496  C CA   . GLU A 1 19 ? 5.992   -4.162  -4.752  1.00 0.00 ? 17 GLU P CA   2  
ATOM 1497  C C    . GLU A 1 19 ? 5.813   -3.505  -6.128  1.00 0.00 ? 17 GLU P C    2  
ATOM 1498  O O    . GLU A 1 19 ? 6.741   -2.854  -6.608  1.00 0.00 ? 17 GLU P O    2  
ATOM 1499  C CB   . GLU A 1 19 ? 6.313   -5.663  -4.863  1.00 0.00 ? 17 GLU P CB   2  
ATOM 1500  C CG   . GLU A 1 19 ? 7.503   -5.924  -5.796  1.00 0.00 ? 17 GLU P CG   2  
ATOM 1501  C CD   . GLU A 1 19 ? 8.142   -7.299  -5.539  1.00 0.00 ? 17 GLU P CD   2  
ATOM 1502  O OE1  . GLU A 1 19 ? 7.585   -8.335  -5.975  1.00 0.00 ? 17 GLU P OE1  2  
ATOM 1503  O OE2  . GLU A 1 19 ? 9.224   -7.332  -4.902  1.00 0.00 ? 17 GLU P OE2  2  
ATOM 1504  H H    . GLU A 1 19 ? 4.296   -4.780  -3.598  1.00 0.00 ? 17 GLU P H    2  
ATOM 1505  H HA   . GLU A 1 19 ? 6.851   -3.679  -4.285  1.00 0.00 ? 17 GLU P HA   2  
ATOM 1506  H HB2  . GLU A 1 19 ? 6.557   -6.034  -3.867  1.00 0.00 ? 17 GLU P HB2  2  
ATOM 1507  H HB3  . GLU A 1 19 ? 5.442   -6.204  -5.235  1.00 0.00 ? 17 GLU P HB3  2  
ATOM 1508  H HG2  . GLU A 1 19 ? 7.174   -5.852  -6.835  1.00 0.00 ? 17 GLU P HG2  2  
ATOM 1509  H HG3  . GLU A 1 19 ? 8.252   -5.149  -5.632  1.00 0.00 ? 17 GLU P HG3  2  
ATOM 1510  N N    . ALA A 1 20 ? 4.633   -3.596  -6.749  1.00 0.00 ? 18 ALA P N    2  
ATOM 1511  C CA   . ALA A 1 20 ? 4.377   -2.987  -8.054  1.00 0.00 ? 18 ALA P CA   2  
ATOM 1512  C C    . ALA A 1 20 ? 4.573   -1.461  -8.025  1.00 0.00 ? 18 ALA P C    2  
ATOM 1513  O O    . ALA A 1 20 ? 5.270   -0.925  -8.888  1.00 0.00 ? 18 ALA P O    2  
ATOM 1514  C CB   . ALA A 1 20 ? 2.973   -3.377  -8.533  1.00 0.00 ? 18 ALA P CB   2  
ATOM 1515  H H    . ALA A 1 20 ? 3.899   -4.158  -6.331  1.00 0.00 ? 18 ALA P H    2  
ATOM 1516  H HA   . ALA A 1 20 ? 5.098   -3.390  -8.766  1.00 0.00 ? 18 ALA P HA   2  
ATOM 1517  H HB1  . ALA A 1 20 ? 2.219   -3.015  -7.834  1.00 0.00 ? 18 ALA P HB1  2  
ATOM 1518  H HB2  . ALA A 1 20 ? 2.787   -2.941  -9.515  1.00 0.00 ? 18 ALA P HB2  2  
ATOM 1519  H HB3  . ALA A 1 20 ? 2.899   -4.463  -8.613  1.00 0.00 ? 18 ALA P HB3  2  
ATOM 1520  N N    . THR A 1 21 ? 4.050   -0.753  -7.016  1.00 0.00 ? 19 THR P N    2  
ATOM 1521  C CA   . THR A 1 21 ? 4.275   0.701   -6.902  1.00 0.00 ? 19 THR P CA   2  
ATOM 1522  C C    . THR A 1 21 ? 5.730   1.034   -6.530  1.00 0.00 ? 19 THR P C    2  
ATOM 1523  O O    . THR A 1 21 ? 6.314   1.949   -7.113  1.00 0.00 ? 19 THR P O    2  
ATOM 1524  C CB   . THR A 1 21 ? 3.230   1.376   -5.996  1.00 0.00 ? 19 THR P CB   2  
ATOM 1525  O OG1  . THR A 1 21 ? 3.263   2.777   -6.181  1.00 0.00 ? 19 THR P OG1  2  
ATOM 1526  C CG2  . THR A 1 21 ? 3.392   1.104   -4.506  1.00 0.00 ? 19 THR P CG2  2  
ATOM 1527  H H    . THR A 1 21 ? 3.483   -1.231  -6.322  1.00 0.00 ? 19 THR P H    2  
ATOM 1528  H HA   . THR A 1 21 ? 4.118   1.127   -7.892  1.00 0.00 ? 19 THR P HA   2  
ATOM 1529  H HB   . THR A 1 21 ? 2.241   1.024   -6.293  1.00 0.00 ? 19 THR P HB   2  
ATOM 1530  H HG1  . THR A 1 21 ? 2.641   2.985   -6.900  1.00 0.00 ? 19 THR P HG1  2  
ATOM 1531  H HG21 . THR A 1 21 ? 4.381   1.410   -4.172  1.00 0.00 ? 19 THR P HG21 2  
ATOM 1532  H HG22 . THR A 1 21 ? 3.253   0.042   -4.316  1.00 0.00 ? 19 THR P HG22 2  
ATOM 1533  H HG23 . THR A 1 21 ? 2.637   1.658   -3.950  1.00 0.00 ? 19 THR P HG23 2  
ATOM 1534  N N    . PHE A 1 22 ? 6.386   0.243   -5.670  1.00 0.00 ? 20 PHE P N    2  
ATOM 1535  C CA   . PHE A 1 22 ? 7.802   0.447   -5.330  1.00 0.00 ? 20 PHE P CA   2  
ATOM 1536  C C    . PHE A 1 22 ? 8.735   0.269   -6.545  1.00 0.00 ? 20 PHE P C    2  
ATOM 1537  O O    . PHE A 1 22 ? 9.662   1.057   -6.729  1.00 0.00 ? 20 PHE P O    2  
ATOM 1538  C CB   . PHE A 1 22 ? 8.199   -0.489  -4.180  1.00 0.00 ? 20 PHE P CB   2  
ATOM 1539  C CG   . PHE A 1 22 ? 9.566   -0.181  -3.594  1.00 0.00 ? 20 PHE P CG   2  
ATOM 1540  C CD1  . PHE A 1 22 ? 10.730  -0.722  -4.172  1.00 0.00 ? 20 PHE P CD1  2  
ATOM 1541  C CD2  . PHE A 1 22 ? 9.681   0.672   -2.479  1.00 0.00 ? 20 PHE P CD2  2  
ATOM 1542  C CE1  . PHE A 1 22 ? 11.998  -0.401  -3.653  1.00 0.00 ? 20 PHE P CE1  2  
ATOM 1543  C CE2  . PHE A 1 22 ? 10.946  0.988   -1.955  1.00 0.00 ? 20 PHE P CE2  2  
ATOM 1544  C CZ   . PHE A 1 22 ? 12.107  0.458   -2.547  1.00 0.00 ? 20 PHE P CZ   2  
ATOM 1545  H H    . PHE A 1 22 ? 5.884   -0.511  -5.212  1.00 0.00 ? 20 PHE P H    2  
ATOM 1546  H HA   . PHE A 1 22 ? 7.920   1.473   -4.974  1.00 0.00 ? 20 PHE P HA   2  
ATOM 1547  H HB2  . PHE A 1 22 ? 7.458   -0.397  -3.386  1.00 0.00 ? 20 PHE P HB2  2  
ATOM 1548  H HB3  . PHE A 1 22 ? 8.182   -1.522  -4.530  1.00 0.00 ? 20 PHE P HB3  2  
ATOM 1549  H HD1  . PHE A 1 22 ? 10.653  -1.366  -5.035  1.00 0.00 ? 20 PHE P HD1  2  
ATOM 1550  H HD2  . PHE A 1 22 ? 8.793   1.081   -2.022  1.00 0.00 ? 20 PHE P HD2  2  
ATOM 1551  H HE1  . PHE A 1 22 ? 12.890  -0.806  -4.112  1.00 0.00 ? 20 PHE P HE1  2  
ATOM 1552  H HE2  . PHE A 1 22 ? 11.022  1.636   -1.094  1.00 0.00 ? 20 PHE P HE2  2  
ATOM 1553  H HZ   . PHE A 1 22 ? 13.081  0.704   -2.148  1.00 0.00 ? 20 PHE P HZ   2  
ATOM 1554  N N    . GLN A 1 23 ? 8.483   -0.725  -7.405  1.00 0.00 ? 21 GLN P N    2  
ATOM 1555  C CA   . GLN A 1 23 ? 9.306   -1.010  -8.590  1.00 0.00 ? 21 GLN P CA   2  
ATOM 1556  C C    . GLN A 1 23 ? 8.985   -0.109  -9.799  1.00 0.00 ? 21 GLN P C    2  
ATOM 1557  O O    . GLN A 1 23 ? 9.891   0.179   -10.587 1.00 0.00 ? 21 GLN P O    2  
ATOM 1558  C CB   . GLN A 1 23 ? 9.160   -2.492  -8.987  1.00 0.00 ? 21 GLN P CB   2  
ATOM 1559  C CG   . GLN A 1 23 ? 9.692   -3.508  -7.957  1.00 0.00 ? 21 GLN P CG   2  
ATOM 1560  C CD   . GLN A 1 23 ? 11.182  -3.387  -7.647  1.00 0.00 ? 21 GLN P CD   2  
ATOM 1561  O OE1  . GLN A 1 23 ? 11.588  -3.206  -6.506  1.00 0.00 ? 21 GLN P OE1  2  
ATOM 1562  N NE2  . GLN A 1 23 ? 12.057  -3.517  -8.622  1.00 0.00 ? 21 GLN P NE2  2  
ATOM 1563  H H    . GLN A 1 23 ? 7.726   -1.367  -7.183  1.00 0.00 ? 21 GLN P H    2  
ATOM 1564  H HA   . GLN A 1 23 ? 10.353  -0.831  -8.339  1.00 0.00 ? 21 GLN P HA   2  
ATOM 1565  H HB2  . GLN A 1 23 ? 8.105   -2.703  -9.167  1.00 0.00 ? 21 GLN P HB2  2  
ATOM 1566  H HB3  . GLN A 1 23 ? 9.687   -2.653  -9.929  1.00 0.00 ? 21 GLN P HB3  2  
ATOM 1567  H HG2  . GLN A 1 23 ? 9.146   -3.398  -7.024  1.00 0.00 ? 21 GLN P HG2  2  
ATOM 1568  H HG3  . GLN A 1 23 ? 9.503   -4.512  -8.338  1.00 0.00 ? 21 GLN P HG3  2  
ATOM 1569  H HE21 . GLN A 1 23 ? 11.754  -3.698  -9.566  1.00 0.00 ? 21 GLN P HE21 2  
ATOM 1570  H HE22 . GLN A 1 23 ? 13.038  -3.452  -8.392  1.00 0.00 ? 21 GLN P HE22 2  
ATOM 1571  N N    . ARG A 1 24 ? 7.728   0.335   -9.971  1.00 0.00 ? 22 ARG P N    2  
ATOM 1572  C CA   . ARG A 1 24 ? 7.263   1.065   -11.176 1.00 0.00 ? 22 ARG P CA   2  
ATOM 1573  C C    . ARG A 1 24 ? 7.086   2.571   -10.965 1.00 0.00 ? 22 ARG P C    2  
ATOM 1574  O O    . ARG A 1 24 ? 7.485   3.353   -11.827 1.00 0.00 ? 22 ARG P O    2  
ATOM 1575  C CB   . ARG A 1 24 ? 5.956   0.444   -11.704 1.00 0.00 ? 22 ARG P CB   2  
ATOM 1576  C CG   . ARG A 1 24 ? 6.088   -1.046  -12.068 1.00 0.00 ? 22 ARG P CG   2  
ATOM 1577  C CD   . ARG A 1 24 ? 4.723   -1.628  -12.451 1.00 0.00 ? 22 ARG P CD   2  
ATOM 1578  N NE   . ARG A 1 24 ? 4.817   -3.070  -12.750 1.00 0.00 ? 22 ARG P NE   2  
ATOM 1579  C CZ   . ARG A 1 24 ? 3.810   -3.895  -12.981 1.00 0.00 ? 22 ARG P CZ   2  
ATOM 1580  N NH1  . ARG A 1 24 ? 2.570   -3.495  -12.982 1.00 0.00 ? 22 ARG P NH1  2  
ATOM 1581  N NH2  . ARG A 1 24 ? 4.034   -5.156  -13.220 1.00 0.00 ? 22 ARG P NH2  2  
ATOM 1582  H H    . ARG A 1 24 ? 7.025   0.008   -9.314  1.00 0.00 ? 22 ARG P H    2  
ATOM 1583  H HA   . ARG A 1 24 ? 8.008   0.964   -11.966 1.00 0.00 ? 22 ARG P HA   2  
ATOM 1584  H HB2  . ARG A 1 24 ? 5.172   0.569   -10.957 1.00 0.00 ? 22 ARG P HB2  2  
ATOM 1585  H HB3  . ARG A 1 24 ? 5.648   0.988   -12.600 1.00 0.00 ? 22 ARG P HB3  2  
ATOM 1586  H HG2  . ARG A 1 24 ? 6.780   -1.153  -12.905 1.00 0.00 ? 22 ARG P HG2  2  
ATOM 1587  H HG3  . ARG A 1 24 ? 6.475   -1.608  -11.219 1.00 0.00 ? 22 ARG P HG3  2  
ATOM 1588  H HD2  . ARG A 1 24 ? 4.035   -1.473  -11.618 1.00 0.00 ? 22 ARG P HD2  2  
ATOM 1589  H HD3  . ARG A 1 24 ? 4.343   -1.095  -13.327 1.00 0.00 ? 22 ARG P HD3  2  
ATOM 1590  H HE   . ARG A 1 24 ? 5.741   -3.472  -12.785 1.00 0.00 ? 22 ARG P HE   2  
ATOM 1591  H HH11 . ARG A 1 24 ? 2.368   -2.523  -12.821 1.00 0.00 ? 22 ARG P HH11 2  
ATOM 1592  H HH12 . ARG A 1 24 ? 1.822   -4.141  -13.167 1.00 0.00 ? 22 ARG P HH12 2  
ATOM 1593  H HH21 . ARG A 1 24 ? 4.976   -5.511  -13.233 1.00 0.00 ? 22 ARG P HH21 2  
ATOM 1594  H HH22 . ARG A 1 24 ? 3.267   -5.782  -13.399 1.00 0.00 ? 22 ARG P HH22 2  
ATOM 1595  N N    . ASN A 1 25 ? 6.516   2.987   -9.830  1.00 0.00 ? 23 ASN P N    2  
ATOM 1596  C CA   . ASN A 1 25 ? 6.309   4.401   -9.481  1.00 0.00 ? 23 ASN P CA   2  
ATOM 1597  C C    . ASN A 1 25 ? 7.540   5.002   -8.773  1.00 0.00 ? 23 ASN P C    2  
ATOM 1598  O O    . ASN A 1 25 ? 7.864   6.169   -8.981  1.00 0.00 ? 23 ASN P O    2  
ATOM 1599  C CB   . ASN A 1 25 ? 5.025   4.513   -8.637  1.00 0.00 ? 23 ASN P CB   2  
ATOM 1600  C CG   . ASN A 1 25 ? 4.510   5.934   -8.461  1.00 0.00 ? 23 ASN P CG   2  
ATOM 1601  O OD1  . ASN A 1 25 ? 4.799   6.849   -9.219  1.00 0.00 ? 23 ASN P OD1  2  
ATOM 1602  N ND2  . ASN A 1 25 ? 3.693   6.153   -7.459  1.00 0.00 ? 23 ASN P ND2  2  
ATOM 1603  H H    . ASN A 1 25 ? 6.237   2.287   -9.154  1.00 0.00 ? 23 ASN P H    2  
ATOM 1604  H HA   . ASN A 1 25 ? 6.159   4.970   -10.402 1.00 0.00 ? 23 ASN P HA   2  
ATOM 1605  H HB2  . ASN A 1 25 ? 4.230   3.935   -9.105  1.00 0.00 ? 23 ASN P HB2  2  
ATOM 1606  H HB3  . ASN A 1 25 ? 5.209   4.100   -7.647  1.00 0.00 ? 23 ASN P HB3  2  
ATOM 1607  H HD21 . ASN A 1 25 ? 3.431   5.393   -6.849  1.00 0.00 ? 23 ASN P HD21 2  
ATOM 1608  H HD22 . ASN A 1 25 ? 3.314   7.079   -7.348  1.00 0.00 ? 23 ASN P HD22 2  
ATOM 1609  N N    . ARG A 1 26 ? 8.255   4.180   -7.985  1.00 0.00 ? 24 ARG P N    2  
ATOM 1610  C CA   . ARG A 1 26 ? 9.580   4.414   -7.353  1.00 0.00 ? 24 ARG P CA   2  
ATOM 1611  C C    . ARG A 1 26 ? 9.689   5.544   -6.321  1.00 0.00 ? 24 ARG P C    2  
ATOM 1612  O O    . ARG A 1 26 ? 10.550  5.463   -5.444  1.00 0.00 ? 24 ARG P O    2  
ATOM 1613  C CB   . ARG A 1 26 ? 10.677  4.519   -8.435  1.00 0.00 ? 24 ARG P CB   2  
ATOM 1614  C CG   . ARG A 1 26 ? 10.757  3.255   -9.307  1.00 0.00 ? 24 ARG P CG   2  
ATOM 1615  C CD   . ARG A 1 26 ? 11.838  3.370   -10.385 1.00 0.00 ? 24 ARG P CD   2  
ATOM 1616  N NE   . ARG A 1 26 ? 11.836  2.162   -11.229 1.00 0.00 ? 24 ARG P NE   2  
ATOM 1617  C CZ   . ARG A 1 26 ? 12.595  1.904   -12.276 1.00 0.00 ? 24 ARG P CZ   2  
ATOM 1618  N NH1  . ARG A 1 26 ? 13.505  2.734   -12.700 1.00 0.00 ? 24 ARG P NH1  2  
ATOM 1619  N NH2  . ARG A 1 26 ? 12.440  0.783   -12.918 1.00 0.00 ? 24 ARG P NH2  2  
ATOM 1620  H H    . ARG A 1 26 ? 7.844   3.264   -7.835  1.00 0.00 ? 24 ARG P H    2  
ATOM 1621  H HA   . ARG A 1 26 ? 9.813   3.522   -6.772  1.00 0.00 ? 24 ARG P HA   2  
ATOM 1622  H HB2  . ARG A 1 26 ? 10.484  5.385   -9.069  1.00 0.00 ? 24 ARG P HB2  2  
ATOM 1623  H HB3  . ARG A 1 26 ? 11.642  4.664   -7.947  1.00 0.00 ? 24 ARG P HB3  2  
ATOM 1624  H HG2  . ARG A 1 26 ? 10.980  2.397   -8.674  1.00 0.00 ? 24 ARG P HG2  2  
ATOM 1625  H HG3  . ARG A 1 26 ? 9.801   3.089   -9.801  1.00 0.00 ? 24 ARG P HG3  2  
ATOM 1626  H HD2  . ARG A 1 26 ? 11.636  4.249   -10.999 1.00 0.00 ? 24 ARG P HD2  2  
ATOM 1627  H HD3  . ARG A 1 26 ? 12.812  3.485   -9.903  1.00 0.00 ? 24 ARG P HD3  2  
ATOM 1628  H HE   . ARG A 1 26 ? 11.160  1.445   -10.992 1.00 0.00 ? 24 ARG P HE   2  
ATOM 1629  H HH11 . ARG A 1 26 ? 13.639  3.605   -12.215 1.00 0.00 ? 24 ARG P HH11 2  
ATOM 1630  H HH12 . ARG A 1 26 ? 14.071  2.511   -13.502 1.00 0.00 ? 24 ARG P HH12 2  
ATOM 1631  H HH21 . ARG A 1 26 ? 11.739  0.127   -12.609 1.00 0.00 ? 24 ARG P HH21 2  
ATOM 1632  H HH22 . ARG A 1 26 ? 13.010  0.570   -13.719 1.00 0.00 ? 24 ARG P HH22 2  
ATOM 1633  N N    . TYR A 1 27 ? 8.817   6.548   -6.362  1.00 0.00 ? 25 TYR P N    2  
ATOM 1634  C CA   . TYR A 1 27 ? 8.726   7.646   -5.389  1.00 0.00 ? 25 TYR P CA   2  
ATOM 1635  C C    . TYR A 1 27 ? 7.269   8.006   -4.988  1.00 0.00 ? 25 TYR P C    2  
ATOM 1636  O O    . TYR A 1 27 ? 6.897   9.183   -5.018  1.00 0.00 ? 25 TYR P O    2  
ATOM 1637  C CB   . TYR A 1 27 ? 9.573   8.838   -5.890  1.00 0.00 ? 25 TYR P CB   2  
ATOM 1638  C CG   . TYR A 1 27 ? 9.310   9.305   -7.316  1.00 0.00 ? 25 TYR P CG   2  
ATOM 1639  C CD1  . TYR A 1 27 ? 10.018  8.720   -8.388  1.00 0.00 ? 25 TYR P CD1  2  
ATOM 1640  C CD2  . TYR A 1 27 ? 8.388   10.339  -7.575  1.00 0.00 ? 25 TYR P CD2  2  
ATOM 1641  C CE1  . TYR A 1 27 ? 9.788   9.147   -9.710  1.00 0.00 ? 25 TYR P CE1  2  
ATOM 1642  C CE2  . TYR A 1 27 ? 8.155   10.770  -8.896  1.00 0.00 ? 25 TYR P CE2  2  
ATOM 1643  C CZ   . TYR A 1 27 ? 8.851   10.171  -9.969  1.00 0.00 ? 25 TYR P CZ   2  
ATOM 1644  O OH   . TYR A 1 27 ? 8.621   10.594  -11.243 1.00 0.00 ? 25 TYR P OH   2  
ATOM 1645  H H    . TYR A 1 27 ? 8.213   6.589   -7.173  1.00 0.00 ? 25 TYR P H    2  
ATOM 1646  H HA   . TYR A 1 27 ? 9.189   7.314   -4.459  1.00 0.00 ? 25 TYR P HA   2  
ATOM 1647  H HB2  . TYR A 1 27 ? 9.452   9.680   -5.207  1.00 0.00 ? 25 TYR P HB2  2  
ATOM 1648  H HB3  . TYR A 1 27 ? 10.623  8.547   -5.825  1.00 0.00 ? 25 TYR P HB3  2  
ATOM 1649  H HD1  . TYR A 1 27 ? 10.737  7.935   -8.195  1.00 0.00 ? 25 TYR P HD1  2  
ATOM 1650  H HD2  . TYR A 1 27 ? 7.856   10.807  -6.757  1.00 0.00 ? 25 TYR P HD2  2  
ATOM 1651  H HE1  . TYR A 1 27 ? 10.326  8.689   -10.529 1.00 0.00 ? 25 TYR P HE1  2  
ATOM 1652  H HE2  . TYR A 1 27 ? 7.445   11.559  -9.096  1.00 0.00 ? 25 TYR P HE2  2  
ATOM 1653  H HH   . TYR A 1 27 ? 9.160   10.112  -11.895 1.00 0.00 ? 25 TYR P HH   2  
ATOM 1654  N N    . PRO A 1 28 ? 6.416   7.031   -4.589  1.00 0.00 ? 26 PRO P N    2  
ATOM 1655  C CA   . PRO A 1 28 ? 5.091   7.322   -4.027  1.00 0.00 ? 26 PRO P CA   2  
ATOM 1656  C C    . PRO A 1 28 ? 5.212   8.148   -2.734  1.00 0.00 ? 26 PRO P C    2  
ATOM 1657  O O    . PRO A 1 28 ? 5.998   7.809   -1.843  1.00 0.00 ? 26 PRO P O    2  
ATOM 1658  C CB   . PRO A 1 28 ? 4.440   5.957   -3.772  1.00 0.00 ? 26 PRO P CB   2  
ATOM 1659  C CG   . PRO A 1 28 ? 5.629   5.029   -3.549  1.00 0.00 ? 26 PRO P CG   2  
ATOM 1660  C CD   . PRO A 1 28 ? 6.694   5.603   -4.480  1.00 0.00 ? 26 PRO P CD   2  
ATOM 1661  H HA   . PRO A 1 28 ? 4.492   7.877   -4.750  1.00 0.00 ? 26 PRO P HA   2  
ATOM 1662  H HB2  . PRO A 1 28 ? 3.773   5.968   -2.909  1.00 0.00 ? 26 PRO P HB2  2  
ATOM 1663  H HB3  . PRO A 1 28 ? 3.898   5.636   -4.662  1.00 0.00 ? 26 PRO P HB3  2  
ATOM 1664  H HG2  . PRO A 1 28 ? 5.965   5.106   -2.515  1.00 0.00 ? 26 PRO P HG2  2  
ATOM 1665  H HG3  . PRO A 1 28 ? 5.388   3.997   -3.805  1.00 0.00 ? 26 PRO P HG3  2  
ATOM 1666  H HD2  . PRO A 1 28 ? 7.684   5.415   -4.064  1.00 0.00 ? 26 PRO P HD2  2  
ATOM 1667  H HD3  . PRO A 1 28 ? 6.602   5.140   -5.463  1.00 0.00 ? 26 PRO P HD3  2  
ATOM 1668  N N    . ASP A 1 29 ? 4.432   9.223   -2.616  1.00 0.00 ? 27 ASP P N    2  
ATOM 1669  C CA   . ASP A 1 29 ? 4.458   10.152  -1.477  1.00 0.00 ? 27 ASP P CA   2  
ATOM 1670  C C    . ASP A 1 29 ? 3.426   9.753   -0.400  1.00 0.00 ? 27 ASP P C    2  
ATOM 1671  O O    . ASP A 1 29 ? 2.687   8.784   -0.587  1.00 0.00 ? 27 ASP P O    2  
ATOM 1672  C CB   . ASP A 1 29 ? 4.252   11.582  -2.013  1.00 0.00 ? 27 ASP P CB   2  
ATOM 1673  C CG   . ASP A 1 29 ? 4.834   12.684  -1.108  1.00 0.00 ? 27 ASP P CG   2  
ATOM 1674  O OD1  . ASP A 1 29 ? 5.435   12.369  -0.052  1.00 0.00 ? 27 ASP P OD1  2  
ATOM 1675  O OD2  . ASP A 1 29 ? 4.715   13.877  -1.477  1.00 0.00 ? 27 ASP P OD2  2  
ATOM 1676  H H    . ASP A 1 29 ? 3.735   9.397   -3.332  1.00 0.00 ? 27 ASP P H    2  
ATOM 1677  H HA   . ASP A 1 29 ? 5.447   10.101  -1.020  1.00 0.00 ? 27 ASP P HA   2  
ATOM 1678  H HB2  . ASP A 1 29 ? 4.744   11.665  -2.985  1.00 0.00 ? 27 ASP P HB2  2  
ATOM 1679  H HB3  . ASP A 1 29 ? 3.185   11.754  -2.166  1.00 0.00 ? 27 ASP P HB3  2  
ATOM 1680  N N    . MET A 1 30 ? 3.339   10.465  0.730   1.00 0.00 ? 28 MET P N    2  
ATOM 1681  C CA   . MET A 1 30 ? 2.452   10.064  1.840   1.00 0.00 ? 28 MET P CA   2  
ATOM 1682  C C    . MET A 1 30 ? 0.971   9.944   1.431   1.00 0.00 ? 28 MET P C    2  
ATOM 1683  O O    . MET A 1 30 ? 0.288   9.018   1.864   1.00 0.00 ? 28 MET P O    2  
ATOM 1684  C CB   . MET A 1 30 ? 2.636   10.968  3.076   1.00 0.00 ? 28 MET P CB   2  
ATOM 1685  C CG   . MET A 1 30 ? 2.057   12.388  2.978   1.00 0.00 ? 28 MET P CG   2  
ATOM 1686  S SD   . MET A 1 30 ? 2.983   13.547  1.934   1.00 0.00 ? 28 MET P SD   2  
ATOM 1687  C CE   . MET A 1 30 ? 1.650   14.255  0.931   1.00 0.00 ? 28 MET P CE   2  
ATOM 1688  H H    . MET A 1 30 ? 3.963   11.258  0.854   1.00 0.00 ? 28 MET P H    2  
ATOM 1689  H HA   . MET A 1 30 ? 2.764   9.065   2.144   1.00 0.00 ? 28 MET P HA   2  
ATOM 1690  H HB2  . MET A 1 30 ? 2.141   10.475  3.914   1.00 0.00 ? 28 MET P HB2  2  
ATOM 1691  H HB3  . MET A 1 30 ? 3.697   11.032  3.320   1.00 0.00 ? 28 MET P HB3  2  
ATOM 1692  H HG2  . MET A 1 30 ? 1.021   12.339  2.644   1.00 0.00 ? 28 MET P HG2  2  
ATOM 1693  H HG3  . MET A 1 30 ? 2.041   12.806  3.985   1.00 0.00 ? 28 MET P HG3  2  
ATOM 1694  H HE1  . MET A 1 30 ? 0.878   14.671  1.576   1.00 0.00 ? 28 MET P HE1  2  
ATOM 1695  H HE2  . MET A 1 30 ? 2.054   15.044  0.296   1.00 0.00 ? 28 MET P HE2  2  
ATOM 1696  H HE3  . MET A 1 30 ? 1.220   13.482  0.294   1.00 0.00 ? 28 MET P HE3  2  
ATOM 1697  N N    . SER A 1 31 ? 0.491   10.810  0.532   1.00 0.00 ? 29 SER P N    2  
ATOM 1698  C CA   . SER A 1 31 ? -0.863  10.747  -0.035  1.00 0.00 ? 29 SER P CA   2  
ATOM 1699  C C    . SER A 1 31 ? -1.044  9.546   -0.970  1.00 0.00 ? 29 SER P C    2  
ATOM 1700  O O    . SER A 1 31 ? -2.061  8.856   -0.895  1.00 0.00 ? 29 SER P O    2  
ATOM 1701  C CB   . SER A 1 31 ? -1.182  12.051  -0.774  1.00 0.00 ? 29 SER P CB   2  
ATOM 1702  O OG   . SER A 1 31 ? -0.158  12.362  -1.709  1.00 0.00 ? 29 SER P OG   2  
ATOM 1703  H H    . SER A 1 31 ? 1.114   11.516  0.166   1.00 0.00 ? 29 SER P H    2  
ATOM 1704  H HA   . SER A 1 31 ? -1.582  10.639  0.779   1.00 0.00 ? 29 SER P HA   2  
ATOM 1705  H HB2  . SER A 1 31 ? -2.140  11.950  -1.291  1.00 0.00 ? 29 SER P HB2  2  
ATOM 1706  H HB3  . SER A 1 31 ? -1.262  12.861  -0.048  1.00 0.00 ? 29 SER P HB3  2  
ATOM 1707  H HG   . SER A 1 31 ? -0.421  13.164  -2.199  1.00 0.00 ? 29 SER P HG   2  
ATOM 1708  N N    . THR A 1 32 ? -0.036  9.224   -1.787  1.00 0.00 ? 30 THR P N    2  
ATOM 1709  C CA   . THR A 1 32 ? -0.012  8.014   -2.626  1.00 0.00 ? 30 THR P CA   2  
ATOM 1710  C C    . THR A 1 32 ? -0.073  6.749   -1.766  1.00 0.00 ? 30 THR P C    2  
ATOM 1711  O O    . THR A 1 32 ? -0.829  5.827   -2.072  1.00 0.00 ? 30 THR P O    2  
ATOM 1712  C CB   . THR A 1 32 ? 1.262   7.955   -3.491  1.00 0.00 ? 30 THR P CB   2  
ATOM 1713  O OG1  . THR A 1 32 ? 1.653   9.223   -3.979  1.00 0.00 ? 30 THR P OG1  2  
ATOM 1714  C CG2  . THR A 1 32 ? 1.086   7.034   -4.698  1.00 0.00 ? 30 THR P CG2  2  
ATOM 1715  H H    . THR A 1 32 ? 0.769   9.836   -1.820  1.00 0.00 ? 30 THR P H    2  
ATOM 1716  H HA   . THR A 1 32 ? -0.884  8.024   -3.280  1.00 0.00 ? 30 THR P HA   2  
ATOM 1717  H HB   . THR A 1 32 ? 2.082   7.575   -2.884  1.00 0.00 ? 30 THR P HB   2  
ATOM 1718  H HG1  . THR A 1 32 ? 0.927   9.571   -4.525  1.00 0.00 ? 30 THR P HG1  2  
ATOM 1719  H HG21 . THR A 1 32 ? 1.982   7.072   -5.316  1.00 0.00 ? 30 THR P HG21 2  
ATOM 1720  H HG22 . THR A 1 32 ? 0.228   7.351   -5.291  1.00 0.00 ? 30 THR P HG22 2  
ATOM 1721  H HG23 . THR A 1 32 ? 0.932   6.009   -4.363  1.00 0.00 ? 30 THR P HG23 2  
ATOM 1722  N N    . ARG A 1 33 ? 0.677   6.721   -0.653  1.00 0.00 ? 31 ARG P N    2  
ATOM 1723  C CA   . ARG A 1 33 ? 0.707   5.605   0.307   1.00 0.00 ? 31 ARG P CA   2  
ATOM 1724  C C    . ARG A 1 33 ? -0.625  5.447   1.044   1.00 0.00 ? 31 ARG P C    2  
ATOM 1725  O O    . ARG A 1 33 ? -1.089  4.324   1.216   1.00 0.00 ? 31 ARG P O    2  
ATOM 1726  C CB   . ARG A 1 33 ? 1.901   5.753   1.271   1.00 0.00 ? 31 ARG P CB   2  
ATOM 1727  C CG   . ARG A 1 33 ? 3.236   5.619   0.518   1.00 0.00 ? 31 ARG P CG   2  
ATOM 1728  C CD   . ARG A 1 33 ? 4.451   5.787   1.437   1.00 0.00 ? 31 ARG P CD   2  
ATOM 1729  N NE   . ARG A 1 33 ? 5.603   6.310   0.680   1.00 0.00 ? 31 ARG P NE   2  
ATOM 1730  C CZ   . ARG A 1 33 ? 6.841   6.471   1.098   1.00 0.00 ? 31 ARG P CZ   2  
ATOM 1731  N NH1  . ARG A 1 33 ? 7.240   6.094   2.280   1.00 0.00 ? 31 ARG P NH1  2  
ATOM 1732  N NH2  . ARG A 1 33 ? 7.701   7.046   0.310   1.00 0.00 ? 31 ARG P NH2  2  
ATOM 1733  H H    . ARG A 1 33 ? 1.282   7.521   -0.481  1.00 0.00 ? 31 ARG P H    2  
ATOM 1734  H HA   . ARG A 1 33 ? 0.853   4.680   -0.248  1.00 0.00 ? 31 ARG P HA   2  
ATOM 1735  H HB2  . ARG A 1 33 ? 1.856   6.719   1.777   1.00 0.00 ? 31 ARG P HB2  2  
ATOM 1736  H HB3  . ARG A 1 33 ? 1.847   4.970   2.029   1.00 0.00 ? 31 ARG P HB3  2  
ATOM 1737  H HG2  . ARG A 1 33 ? 3.289   4.643   0.034   1.00 0.00 ? 31 ARG P HG2  2  
ATOM 1738  H HG3  . ARG A 1 33 ? 3.281   6.375   -0.263  1.00 0.00 ? 31 ARG P HG3  2  
ATOM 1739  H HD2  . ARG A 1 33 ? 4.208   6.486   2.241   1.00 0.00 ? 31 ARG P HD2  2  
ATOM 1740  H HD3  . ARG A 1 33 ? 4.692   4.819   1.881   1.00 0.00 ? 31 ARG P HD3  2  
ATOM 1741  H HE   . ARG A 1 33 ? 5.424   6.663   -0.252  1.00 0.00 ? 31 ARG P HE   2  
ATOM 1742  H HH11 . ARG A 1 33 ? 6.578   5.668   2.903   1.00 0.00 ? 31 ARG P HH11 2  
ATOM 1743  H HH12 . ARG A 1 33 ? 8.187   6.253   2.576   1.00 0.00 ? 31 ARG P HH12 2  
ATOM 1744  H HH21 . ARG A 1 33 ? 7.366   7.397   -0.582  1.00 0.00 ? 31 ARG P HH21 2  
ATOM 1745  H HH22 . ARG A 1 33 ? 8.638   7.236   0.618   1.00 0.00 ? 31 ARG P HH22 2  
ATOM 1746  N N    . GLU A 1 34 ? -1.288  6.547   1.403   1.00 0.00 ? 32 GLU P N    2  
ATOM 1747  C CA   . GLU A 1 34 ? -2.652  6.525   1.956   1.00 0.00 ? 32 GLU P CA   2  
ATOM 1748  C C    . GLU A 1 34 ? -3.702  6.010   0.951   1.00 0.00 ? 32 GLU P C    2  
ATOM 1749  O O    . GLU A 1 34 ? -4.602  5.266   1.344   1.00 0.00 ? 32 GLU P O    2  
ATOM 1750  C CB   . GLU A 1 34 ? -3.051  7.928   2.449   1.00 0.00 ? 32 GLU P CB   2  
ATOM 1751  C CG   . GLU A 1 34 ? -2.444  8.276   3.813   1.00 0.00 ? 32 GLU P CG   2  
ATOM 1752  C CD   . GLU A 1 34 ? -2.868  9.690   4.255   1.00 0.00 ? 32 GLU P CD   2  
ATOM 1753  O OE1  . GLU A 1 34 ? -3.950  9.833   4.880   1.00 0.00 ? 32 GLU P OE1  2  
ATOM 1754  O OE2  . GLU A 1 34 ? -2.137  10.672  3.981   1.00 0.00 ? 32 GLU P OE2  2  
ATOM 1755  H H    . GLU A 1 34 ? -0.826  7.442   1.289   1.00 0.00 ? 32 GLU P H    2  
ATOM 1756  H HA   . GLU A 1 34 ? -2.674  5.836   2.801   1.00 0.00 ? 32 GLU P HA   2  
ATOM 1757  H HB2  . GLU A 1 34 ? -2.753  8.676   1.716   1.00 0.00 ? 32 GLU P HB2  2  
ATOM 1758  H HB3  . GLU A 1 34 ? -4.136  7.972   2.548   1.00 0.00 ? 32 GLU P HB3  2  
ATOM 1759  H HG2  . GLU A 1 34 ? -2.794  7.544   4.543   1.00 0.00 ? 32 GLU P HG2  2  
ATOM 1760  H HG3  . GLU A 1 34 ? -1.356  8.199   3.767   1.00 0.00 ? 32 GLU P HG3  2  
ATOM 1761  N N    . GLU A 1 35 ? -3.589  6.340   -0.340  1.00 0.00 ? 33 GLU P N    2  
ATOM 1762  C CA   . GLU A 1 35 ? -4.498  5.810   -1.369  1.00 0.00 ? 33 GLU P CA   2  
ATOM 1763  C C    . GLU A 1 35 ? -4.294  4.304   -1.598  1.00 0.00 ? 33 GLU P C    2  
ATOM 1764  O O    . GLU A 1 35 ? -5.266  3.549   -1.564  1.00 0.00 ? 33 GLU P O    2  
ATOM 1765  C CB   . GLU A 1 35 ? -4.364  6.577   -2.693  1.00 0.00 ? 33 GLU P CB   2  
ATOM 1766  C CG   . GLU A 1 35 ? -4.995  7.973   -2.622  1.00 0.00 ? 33 GLU P CG   2  
ATOM 1767  C CD   . GLU A 1 35 ? -4.923  8.688   -3.986  1.00 0.00 ? 33 GLU P CD   2  
ATOM 1768  O OE1  . GLU A 1 35 ? -3.832  9.174   -4.372  1.00 0.00 ? 33 GLU P OE1  2  
ATOM 1769  O OE2  . GLU A 1 35 ? -5.967  8.786   -4.679  1.00 0.00 ? 33 GLU P OE2  2  
ATOM 1770  H H    . GLU A 1 35 ? -2.868  6.997   -0.619  1.00 0.00 ? 33 GLU P H    2  
ATOM 1771  H HA   . GLU A 1 35 ? -5.525  5.928   -1.020  1.00 0.00 ? 33 GLU P HA   2  
ATOM 1772  H HB2  . GLU A 1 35 ? -3.313  6.655   -2.972  1.00 0.00 ? 33 GLU P HB2  2  
ATOM 1773  H HB3  . GLU A 1 35 ? -4.885  6.012   -3.466  1.00 0.00 ? 33 GLU P HB3  2  
ATOM 1774  H HG2  . GLU A 1 35 ? -6.039  7.868   -2.313  1.00 0.00 ? 33 GLU P HG2  2  
ATOM 1775  H HG3  . GLU A 1 35 ? -4.490  8.571   -1.863  1.00 0.00 ? 33 GLU P HG3  2  
ATOM 1776  N N    . ILE A 1 36 ? -3.050  3.826   -1.749  1.00 0.00 ? 34 ILE P N    2  
ATOM 1777  C CA   . ILE A 1 36 ? -2.819  2.380   -1.909  1.00 0.00 ? 34 ILE P CA   2  
ATOM 1778  C C    . ILE A 1 36 ? -3.135  1.591   -0.629  1.00 0.00 ? 34 ILE P C    2  
ATOM 1779  O O    . ILE A 1 36 ? -3.480  0.415   -0.723  1.00 0.00 ? 34 ILE P O    2  
ATOM 1780  C CB   . ILE A 1 36 ? -1.448  2.037   -2.536  1.00 0.00 ? 34 ILE P CB   2  
ATOM 1781  C CG1  . ILE A 1 36 ? -0.198  2.363   -1.703  1.00 0.00 ? 34 ILE P CG1  2  
ATOM 1782  C CG2  . ILE A 1 36 ? -1.300  2.739   -3.896  1.00 0.00 ? 34 ILE P CG2  2  
ATOM 1783  C CD1  . ILE A 1 36 ? 0.050   1.436   -0.511  1.00 0.00 ? 34 ILE P CD1  2  
ATOM 1784  H H    . ILE A 1 36 ? -2.264  4.467   -1.784  1.00 0.00 ? 34 ILE P H    2  
ATOM 1785  H HA   . ILE A 1 36 ? -3.554  2.034   -2.635  1.00 0.00 ? 34 ILE P HA   2  
ATOM 1786  H HB   . ILE A 1 36 ? -1.444  0.965   -2.725  1.00 0.00 ? 34 ILE P HB   2  
ATOM 1787  H HG12 . ILE A 1 36 ? 0.680   2.290   -2.346  1.00 0.00 ? 34 ILE P HG12 2  
ATOM 1788  H HG13 . ILE A 1 36 ? -0.274  3.384   -1.354  1.00 0.00 ? 34 ILE P HG13 2  
ATOM 1789  H HG21 . ILE A 1 36 ? -2.170  2.538   -4.518  1.00 0.00 ? 34 ILE P HG21 2  
ATOM 1790  H HG22 . ILE A 1 36 ? -1.196  3.815   -3.757  1.00 0.00 ? 34 ILE P HG22 2  
ATOM 1791  H HG23 . ILE A 1 36 ? -0.413  2.368   -4.412  1.00 0.00 ? 34 ILE P HG23 2  
ATOM 1792  H HD11 . ILE A 1 36 ? -0.593  1.704   0.321   1.00 0.00 ? 34 ILE P HD11 2  
ATOM 1793  H HD12 . ILE A 1 36 ? -0.122  0.397   -0.796  1.00 0.00 ? 34 ILE P HD12 2  
ATOM 1794  H HD13 . ILE A 1 36 ? 1.083   1.550   -0.193  1.00 0.00 ? 34 ILE P HD13 2  
ATOM 1795  N N    . ALA A 1 37 ? -3.118  2.224   0.553   1.00 0.00 ? 35 ALA P N    2  
ATOM 1796  C CA   . ALA A 1 37 ? -3.545  1.602   1.808   1.00 0.00 ? 35 ALA P CA   2  
ATOM 1797  C C    . ALA A 1 37 ? -5.043  1.247   1.779   1.00 0.00 ? 35 ALA P C    2  
ATOM 1798  O O    . ALA A 1 37 ? -5.403  0.101   2.042   1.00 0.00 ? 35 ALA P O    2  
ATOM 1799  C CB   . ALA A 1 37 ? -3.198  2.516   2.992   1.00 0.00 ? 35 ALA P CB   2  
ATOM 1800  H H    . ALA A 1 37 ? -2.757  3.170   0.585   1.00 0.00 ? 35 ALA P H    2  
ATOM 1801  H HA   . ALA A 1 37 ? -2.993  0.670   1.933   1.00 0.00 ? 35 ALA P HA   2  
ATOM 1802  H HB1  . ALA A 1 37 ? -3.423  2.001   3.925   1.00 0.00 ? 35 ALA P HB1  2  
ATOM 1803  H HB2  . ALA A 1 37 ? -2.139  2.765   2.983   1.00 0.00 ? 35 ALA P HB2  2  
ATOM 1804  H HB3  . ALA A 1 37 ? -3.782  3.434   2.950   1.00 0.00 ? 35 ALA P HB3  2  
ATOM 1805  N N    . VAL A 1 38 ? -5.923  2.175   1.380   1.00 0.00 ? 36 VAL P N    2  
ATOM 1806  C CA   . VAL A 1 38 ? -7.368  1.890   1.267   1.00 0.00 ? 36 VAL P CA   2  
ATOM 1807  C C    . VAL A 1 38 ? -7.692  0.923   0.119   1.00 0.00 ? 36 VAL P C    2  
ATOM 1808  O O    . VAL A 1 38 ? -8.623  0.126   0.246   1.00 0.00 ? 36 VAL P O    2  
ATOM 1809  C CB   . VAL A 1 38 ? -8.238  3.163   1.211   1.00 0.00 ? 36 VAL P CB   2  
ATOM 1810  C CG1  . VAL A 1 38 ? -8.091  3.989   2.492   1.00 0.00 ? 36 VAL P CG1  2  
ATOM 1811  C CG2  . VAL A 1 38 ? -7.944  4.095   0.037   1.00 0.00 ? 36 VAL P CG2  2  
ATOM 1812  H H    . VAL A 1 38 ? -5.586  3.102   1.156   1.00 0.00 ? 36 VAL P H    2  
ATOM 1813  H HA   . VAL A 1 38 ? -7.664  1.369   2.177   1.00 0.00 ? 36 VAL P HA   2  
ATOM 1814  H HB   . VAL A 1 38 ? -9.280  2.852   1.136   1.00 0.00 ? 36 VAL P HB   2  
ATOM 1815  H HG11 . VAL A 1 38 ? -7.075  4.378   2.574   1.00 0.00 ? 36 VAL P HG11 2  
ATOM 1816  H HG12 . VAL A 1 38 ? -8.786  4.828   2.462   1.00 0.00 ? 36 VAL P HG12 2  
ATOM 1817  H HG13 . VAL A 1 38 ? -8.317  3.372   3.360   1.00 0.00 ? 36 VAL P HG13 2  
ATOM 1818  H HG21 . VAL A 1 38 ? -6.949  4.521   0.142   1.00 0.00 ? 36 VAL P HG21 2  
ATOM 1819  H HG22 . VAL A 1 38 ? -8.010  3.550   -0.900  1.00 0.00 ? 36 VAL P HG22 2  
ATOM 1820  H HG23 . VAL A 1 38 ? -8.672  4.906   0.019   1.00 0.00 ? 36 VAL P HG23 2  
ATOM 1821  N N    . TRP A 1 39 ? -6.901  0.909   -0.962  1.00 0.00 ? 37 TRP P N    2  
ATOM 1822  C CA   . TRP A 1 39 ? -7.054  -0.045  -2.076  1.00 0.00 ? 37 TRP P CA   2  
ATOM 1823  C C    . TRP A 1 39 ? -6.598  -1.472  -1.715  1.00 0.00 ? 37 TRP P C    2  
ATOM 1824  O O    . TRP A 1 39 ? -7.202  -2.444  -2.171  1.00 0.00 ? 37 TRP P O    2  
ATOM 1825  C CB   . TRP A 1 39 ? -6.300  0.477   -3.312  1.00 0.00 ? 37 TRP P CB   2  
ATOM 1826  C CG   . TRP A 1 39 ? -6.673  1.836   -3.834  1.00 0.00 ? 37 TRP P CG   2  
ATOM 1827  C CD1  . TRP A 1 39 ? -7.748  2.562   -3.459  1.00 0.00 ? 37 TRP P CD1  2  
ATOM 1828  C CD2  . TRP A 1 39 ? -5.956  2.676   -4.794  1.00 0.00 ? 37 TRP P CD2  2  
ATOM 1829  N NE1  . TRP A 1 39 ? -7.727  3.799   -4.069  1.00 0.00 ? 37 TRP P NE1  2  
ATOM 1830  C CE2  . TRP A 1 39 ? -6.646  3.922   -4.915  1.00 0.00 ? 37 TRP P CE2  2  
ATOM 1831  C CE3  . TRP A 1 39 ? -4.785  2.515   -5.568  1.00 0.00 ? 37 TRP P CE3  2  
ATOM 1832  C CZ2  . TRP A 1 39 ? -6.194  4.955   -5.750  1.00 0.00 ? 37 TRP P CZ2  2  
ATOM 1833  C CZ3  . TRP A 1 39 ? -4.321  3.547   -6.409  1.00 0.00 ? 37 TRP P CZ3  2  
ATOM 1834  C CH2  . TRP A 1 39 ? -5.021  4.765   -6.499  1.00 0.00 ? 37 TRP P CH2  2  
ATOM 1835  H H    . TRP A 1 39 ? -6.206  1.642   -1.056  1.00 0.00 ? 37 TRP P H    2  
ATOM 1836  H HA   . TRP A 1 39 ? -8.111  -0.112  -2.338  1.00 0.00 ? 37 TRP P HA   2  
ATOM 1837  H HB2  . TRP A 1 39 ? -5.243  0.512   -3.063  1.00 0.00 ? 37 TRP P HB2  2  
ATOM 1838  H HB3  . TRP A 1 39 ? -6.426  -0.241  -4.124  1.00 0.00 ? 37 TRP P HB3  2  
ATOM 1839  H HD1  . TRP A 1 39 ? -8.472  2.235   -2.728  1.00 0.00 ? 37 TRP P HD1  2  
ATOM 1840  H HE1  . TRP A 1 39 ? -8.402  4.528   -3.864  1.00 0.00 ? 37 TRP P HE1  2  
ATOM 1841  H HE3  . TRP A 1 39 ? -4.240  1.584   -5.508  1.00 0.00 ? 37 TRP P HE3  2  
ATOM 1842  H HZ2  . TRP A 1 39 ? -6.740  5.886   -5.808  1.00 0.00 ? 37 TRP P HZ2  2  
ATOM 1843  H HZ3  . TRP A 1 39 ? -3.419  3.404   -6.991  1.00 0.00 ? 37 TRP P HZ3  2  
ATOM 1844  H HH2  . TRP A 1 39 ? -4.656  5.554   -7.146  1.00 0.00 ? 37 TRP P HH2  2  
ATOM 1845  N N    . THR A 1 40 ? -5.577  -1.613  -0.862  1.00 0.00 ? 38 THR P N    2  
ATOM 1846  C CA   . THR A 1 40 ? -5.108  -2.903  -0.303  1.00 0.00 ? 38 THR P CA   2  
ATOM 1847  C C    . THR A 1 40 ? -5.834  -3.315  0.987   1.00 0.00 ? 38 THR P C    2  
ATOM 1848  O O    . THR A 1 40 ? -5.622  -4.423  1.481   1.00 0.00 ? 38 THR P O    2  
ATOM 1849  C CB   . THR A 1 40 ? -3.588  -2.909  -0.057  1.00 0.00 ? 38 THR P CB   2  
ATOM 1850  O OG1  . THR A 1 40 ? -3.199  -1.836  0.764   1.00 0.00 ? 38 THR P OG1  2  
ATOM 1851  C CG2  . THR A 1 40 ? -2.778  -2.839  -1.349  1.00 0.00 ? 38 THR P CG2  2  
ATOM 1852  H H    . THR A 1 40 ? -5.088  -0.773  -0.571  1.00 0.00 ? 38 THR P H    2  
ATOM 1853  H HA   . THR A 1 40 ? -5.314  -3.691  -1.028  1.00 0.00 ? 38 THR P HA   2  
ATOM 1854  H HB   . THR A 1 40 ? -3.315  -3.833  0.450   1.00 0.00 ? 38 THR P HB   2  
ATOM 1855  H HG1  . THR A 1 40 ? -3.220  -1.033  0.210   1.00 0.00 ? 38 THR P HG1  2  
ATOM 1856  H HG21 . THR A 1 40 ? -1.713  -2.854  -1.113  1.00 0.00 ? 38 THR P HG21 2  
ATOM 1857  H HG22 . THR A 1 40 ? -3.012  -1.929  -1.901  1.00 0.00 ? 38 THR P HG22 2  
ATOM 1858  H HG23 . THR A 1 40 ? -3.012  -3.702  -1.972  1.00 0.00 ? 38 THR P HG23 2  
ATOM 1859  N N    . ASN A 1 41 ? -6.709  -2.458  1.524   1.00 0.00 ? 39 ASN P N    2  
ATOM 1860  C CA   . ASN A 1 41 ? -7.365  -2.583  2.834   1.00 0.00 ? 39 ASN P CA   2  
ATOM 1861  C C    . ASN A 1 41 ? -6.379  -2.710  4.023   1.00 0.00 ? 39 ASN P C    2  
ATOM 1862  O O    . ASN A 1 41 ? -6.655  -3.388  5.017   1.00 0.00 ? 39 ASN P O    2  
ATOM 1863  C CB   . ASN A 1 41 ? -8.464  -3.666  2.800   1.00 0.00 ? 39 ASN P CB   2  
ATOM 1864  C CG   . ASN A 1 41 ? -9.553  -3.379  1.780   1.00 0.00 ? 39 ASN P CG   2  
ATOM 1865  O OD1  . ASN A 1 41 ? -10.523 -2.684  2.051   1.00 0.00 ? 39 ASN P OD1  2  
ATOM 1866  N ND2  . ASN A 1 41 ? -9.439  -3.901  0.577   1.00 0.00 ? 39 ASN P ND2  2  
ATOM 1867  H H    . ASN A 1 41 ? -6.813  -1.570  1.054   1.00 0.00 ? 39 ASN P H    2  
ATOM 1868  H HA   . ASN A 1 41 ? -7.862  -1.624  3.000   1.00 0.00 ? 39 ASN P HA   2  
ATOM 1869  H HB2  . ASN A 1 41 ? -8.016  -4.639  2.601   1.00 0.00 ? 39 ASN P HB2  2  
ATOM 1870  H HB3  . ASN A 1 41 ? -8.940  -3.719  3.779   1.00 0.00 ? 39 ASN P HB3  2  
ATOM 1871  H HD21 . ASN A 1 41 ? -8.641  -4.469  0.346   1.00 0.00 ? 39 ASN P HD21 2  
ATOM 1872  H HD22 . ASN A 1 41 ? -10.154 -3.696  -0.104  1.00 0.00 ? 39 ASN P HD22 2  
ATOM 1873  N N    . LEU A 1 42 ? -5.228  -2.043  3.919   1.00 0.00 ? 40 LEU P N    2  
ATOM 1874  C CA   . LEU A 1 42 ? -4.237  -1.856  4.984   1.00 0.00 ? 40 LEU P CA   2  
ATOM 1875  C C    . LEU A 1 42 ? -4.406  -0.490  5.673   1.00 0.00 ? 40 LEU P C    2  
ATOM 1876  O O    . LEU A 1 42 ? -5.117  0.391   5.184   1.00 0.00 ? 40 LEU P O    2  
ATOM 1877  C CB   . LEU A 1 42 ? -2.825  -1.976  4.374   1.00 0.00 ? 40 LEU P CB   2  
ATOM 1878  C CG   . LEU A 1 42 ? -2.467  -3.363  3.813   1.00 0.00 ? 40 LEU P CG   2  
ATOM 1879  C CD1  . LEU A 1 42 ? -1.083  -3.300  3.169   1.00 0.00 ? 40 LEU P CD1  2  
ATOM 1880  C CD2  . LEU A 1 42 ? -2.447  -4.420  4.918   1.00 0.00 ? 40 LEU P CD2  2  
ATOM 1881  H H    . LEU A 1 42 ? -5.109  -1.474  3.088   1.00 0.00 ? 40 LEU P H    2  
ATOM 1882  H HA   . LEU A 1 42 ? -4.364  -2.618  5.752   1.00 0.00 ? 40 LEU P HA   2  
ATOM 1883  H HB2  . LEU A 1 42 ? -2.736  -1.245  3.569   1.00 0.00 ? 40 LEU P HB2  2  
ATOM 1884  H HB3  . LEU A 1 42 ? -2.087  -1.719  5.134   1.00 0.00 ? 40 LEU P HB3  2  
ATOM 1885  H HG   . LEU A 1 42 ? -3.189  -3.659  3.053   1.00 0.00 ? 40 LEU P HG   2  
ATOM 1886  H HD11 . LEU A 1 42 ? -1.101  -2.592  2.340   1.00 0.00 ? 40 LEU P HD11 2  
ATOM 1887  H HD12 . LEU A 1 42 ? -0.809  -4.278  2.781   1.00 0.00 ? 40 LEU P HD12 2  
ATOM 1888  H HD13 . LEU A 1 42 ? -0.342  -2.974  3.897   1.00 0.00 ? 40 LEU P HD13 2  
ATOM 1889  H HD21 . LEU A 1 42 ? -3.457  -4.573  5.296   1.00 0.00 ? 40 LEU P HD21 2  
ATOM 1890  H HD22 . LEU A 1 42 ? -1.788  -4.105  5.727   1.00 0.00 ? 40 LEU P HD22 2  
ATOM 1891  H HD23 . LEU A 1 42 ? -2.093  -5.367  4.516   1.00 0.00 ? 40 LEU P HD23 2  
ATOM 1892  N N    . THR A 1 43 ? -3.724  -0.295  6.805   1.00 0.00 ? 41 THR P N    2  
ATOM 1893  C CA   . THR A 1 43 ? -3.581  1.030   7.430   1.00 0.00 ? 41 THR P CA   2  
ATOM 1894  C C    . THR A 1 43 ? -2.381  1.755   6.820   1.00 0.00 ? 41 THR P C    2  
ATOM 1895  O O    . THR A 1 43 ? -1.396  1.129   6.414   1.00 0.00 ? 41 THR P O    2  
ATOM 1896  C CB   . THR A 1 43 ? -3.445  0.970   8.961   1.00 0.00 ? 41 THR P CB   2  
ATOM 1897  O OG1  . THR A 1 43 ? -2.226  0.372   9.340   1.00 0.00 ? 41 THR P OG1  2  
ATOM 1898  C CG2  . THR A 1 43 ? -4.575  0.183   9.625   1.00 0.00 ? 41 THR P CG2  2  
ATOM 1899  H H    . THR A 1 43 ? -3.143  -1.039  7.163   1.00 0.00 ? 41 THR P H    2  
ATOM 1900  H HA   . THR A 1 43 ? -4.469  1.622   7.217   1.00 0.00 ? 41 THR P HA   2  
ATOM 1901  H HB   . THR A 1 43 ? -3.462  1.989   9.346   1.00 0.00 ? 41 THR P HB   2  
ATOM 1902  H HG1  . THR A 1 43 ? -2.213  0.343   10.312  1.00 0.00 ? 41 THR P HG1  2  
ATOM 1903  H HG21 . THR A 1 43 ? -4.493  0.271   10.709  1.00 0.00 ? 41 THR P HG21 2  
ATOM 1904  H HG22 . THR A 1 43 ? -4.521  -0.869  9.346   1.00 0.00 ? 41 THR P HG22 2  
ATOM 1905  H HG23 . THR A 1 43 ? -5.537  0.591   9.312   1.00 0.00 ? 41 THR P HG23 2  
ATOM 1906  N N    . GLU A 1 44 ? -2.416  3.088   6.778   1.00 0.00 ? 42 GLU P N    2  
ATOM 1907  C CA   . GLU A 1 44 ? -1.277  3.877   6.280   1.00 0.00 ? 42 GLU P CA   2  
ATOM 1908  C C    . GLU A 1 44 ? -0.013  3.712   7.142   1.00 0.00 ? 42 GLU P C    2  
ATOM 1909  O O    . GLU A 1 44 ? 1.099   3.839   6.628   1.00 0.00 ? 42 GLU P O    2  
ATOM 1910  C CB   . GLU A 1 44 ? -1.689  5.343   6.084   1.00 0.00 ? 42 GLU P CB   2  
ATOM 1911  C CG   . GLU A 1 44 ? -2.134  6.108   7.344   1.00 0.00 ? 42 GLU P CG   2  
ATOM 1912  C CD   . GLU A 1 44 ? -0.980  6.902   7.975   1.00 0.00 ? 42 GLU P CD   2  
ATOM 1913  O OE1  . GLU A 1 44 ? -0.627  7.989   7.462   1.00 0.00 ? 42 GLU P OE1  2  
ATOM 1914  O OE2  . GLU A 1 44 ? -0.379  6.442   8.972   1.00 0.00 ? 42 GLU P OE2  2  
ATOM 1915  H H    . GLU A 1 44 ? -3.245  3.575   7.091   1.00 0.00 ? 42 GLU P H    2  
ATOM 1916  H HA   . GLU A 1 44 ? -1.020  3.496   5.291   1.00 0.00 ? 42 GLU P HA   2  
ATOM 1917  H HB2  . GLU A 1 44 ? -0.858  5.872   5.614   1.00 0.00 ? 42 GLU P HB2  2  
ATOM 1918  H HB3  . GLU A 1 44 ? -2.518  5.346   5.377   1.00 0.00 ? 42 GLU P HB3  2  
ATOM 1919  H HG2  . GLU A 1 44 ? -2.921  6.809   7.056   1.00 0.00 ? 42 GLU P HG2  2  
ATOM 1920  H HG3  . GLU A 1 44 ? -2.572  5.421   8.072   1.00 0.00 ? 42 GLU P HG3  2  
ATOM 1921  N N    . ALA A 1 45 ? -0.164  3.329   8.414   1.00 0.00 ? 43 ALA P N    2  
ATOM 1922  C CA   . ALA A 1 45 ? 0.950   3.007   9.300   1.00 0.00 ? 43 ALA P CA   2  
ATOM 1923  C C    . ALA A 1 45 ? 1.612   1.663   8.937   1.00 0.00 ? 43 ALA P C    2  
ATOM 1924  O O    . ALA A 1 45 ? 2.838   1.598   8.826   1.00 0.00 ? 43 ALA P O    2  
ATOM 1925  C CB   . ALA A 1 45 ? 0.446   3.030   10.749  1.00 0.00 ? 43 ALA P CB   2  
ATOM 1926  H H    . ALA A 1 45 ? -1.100  3.251   8.781   1.00 0.00 ? 43 ALA P H    2  
ATOM 1927  H HA   . ALA A 1 45 ? 1.702   3.789   9.186   1.00 0.00 ? 43 ALA P HA   2  
ATOM 1928  H HB1  . ALA A 1 45 ? -0.322  2.270   10.896  1.00 0.00 ? 43 ALA P HB1  2  
ATOM 1929  H HB2  . ALA A 1 45 ? 1.277   2.832   11.427  1.00 0.00 ? 43 ALA P HB2  2  
ATOM 1930  H HB3  . ALA A 1 45 ? 0.031   4.012   10.980  1.00 0.00 ? 43 ALA P HB3  2  
ATOM 1931  N N    . ARG A 1 46 ? 0.825   0.606   8.676   1.00 0.00 ? 44 ARG P N    2  
ATOM 1932  C CA   . ARG A 1 46 ? 1.340   -0.700  8.211   1.00 0.00 ? 44 ARG P CA   2  
ATOM 1933  C C    . ARG A 1 46 ? 2.019   -0.583  6.846   1.00 0.00 ? 44 ARG P C    2  
ATOM 1934  O O    . ARG A 1 46 ? 3.084   -1.162  6.636   1.00 0.00 ? 44 ARG P O    2  
ATOM 1935  C CB   . ARG A 1 46 ? 0.206   -1.733  8.173   1.00 0.00 ? 44 ARG P CB   2  
ATOM 1936  C CG   . ARG A 1 46 ? -0.184  -2.184  9.588   1.00 0.00 ? 44 ARG P CG   2  
ATOM 1937  C CD   . ARG A 1 46 ? -1.446  -3.047  9.537   1.00 0.00 ? 44 ARG P CD   2  
ATOM 1938  N NE   . ARG A 1 46 ? -1.910  -3.409  10.891  1.00 0.00 ? 44 ARG P NE   2  
ATOM 1939  C CZ   . ARG A 1 46 ? -1.486  -4.409  11.643  1.00 0.00 ? 44 ARG P CZ   2  
ATOM 1940  N NH1  . ARG A 1 46 ? -0.617  -5.281  11.216  1.00 0.00 ? 44 ARG P NH1  2  
ATOM 1941  N NH2  . ARG A 1 46 ? -1.929  -4.551  12.860  1.00 0.00 ? 44 ARG P NH2  2  
ATOM 1942  H H    . ARG A 1 46 ? -0.180  0.720   8.770   1.00 0.00 ? 44 ARG P H    2  
ATOM 1943  H HA   . ARG A 1 46 ? 2.100   -1.058  8.905   1.00 0.00 ? 44 ARG P HA   2  
ATOM 1944  H HB2  . ARG A 1 46 ? -0.659  -1.306  7.661   1.00 0.00 ? 44 ARG P HB2  2  
ATOM 1945  H HB3  . ARG A 1 46 ? 0.534   -2.612  7.616   1.00 0.00 ? 44 ARG P HB3  2  
ATOM 1946  H HG2  . ARG A 1 46 ? 0.636   -2.756  10.024  1.00 0.00 ? 44 ARG P HG2  2  
ATOM 1947  H HG3  . ARG A 1 46 ? -0.374  -1.315  10.219  1.00 0.00 ? 44 ARG P HG3  2  
ATOM 1948  H HD2  . ARG A 1 46 ? -2.226  -2.471  9.038   1.00 0.00 ? 44 ARG P HD2  2  
ATOM 1949  H HD3  . ARG A 1 46 ? -1.251  -3.939  8.942   1.00 0.00 ? 44 ARG P HD3  2  
ATOM 1950  H HE   . ARG A 1 46 ? -2.598  -2.801  11.308  1.00 0.00 ? 44 ARG P HE   2  
ATOM 1951  H HH11 . ARG A 1 46 ? -0.348  -5.259  10.247  1.00 0.00 ? 44 ARG P HH11 2  
ATOM 1952  H HH12 . ARG A 1 46 ? -0.308  -6.027  11.813  1.00 0.00 ? 44 ARG P HH12 2  
ATOM 1953  H HH21 . ARG A 1 46 ? -2.599  -3.899  13.233  1.00 0.00 ? 44 ARG P HH21 2  
ATOM 1954  H HH22 . ARG A 1 46 ? -1.604  -5.311  13.434  1.00 0.00 ? 44 ARG P HH22 2  
ATOM 1955  N N    . VAL A 1 47 ? 1.458   0.234   5.952   1.00 0.00 ? 45 VAL P N    2  
ATOM 1956  C CA   . VAL A 1 47 ? 2.080   0.592   4.667   1.00 0.00 ? 45 VAL P CA   2  
ATOM 1957  C C    . VAL A 1 47 ? 3.407   1.328   4.879   1.00 0.00 ? 45 VAL P C    2  
ATOM 1958  O O    . VAL A 1 47 ? 4.413   0.931   4.294   1.00 0.00 ? 45 VAL P O    2  
ATOM 1959  C CB   . VAL A 1 47 ? 1.095   1.399   3.801   1.00 0.00 ? 45 VAL P CB   2  
ATOM 1960  C CG1  . VAL A 1 47 ? 1.753   2.038   2.576   1.00 0.00 ? 45 VAL P CG1  2  
ATOM 1961  C CG2  . VAL A 1 47 ? -0.026  0.475   3.308   1.00 0.00 ? 45 VAL P CG2  2  
ATOM 1962  H H    . VAL A 1 47 ? 0.556   0.638   6.188   1.00 0.00 ? 45 VAL P H    2  
ATOM 1963  H HA   . VAL A 1 47 ? 2.320   -0.327  4.130   1.00 0.00 ? 45 VAL P HA   2  
ATOM 1964  H HB   . VAL A 1 47 ? 0.658   2.196   4.399   1.00 0.00 ? 45 VAL P HB   2  
ATOM 1965  H HG11 . VAL A 1 47 ? 0.998   2.563   1.992   1.00 0.00 ? 45 VAL P HG11 2  
ATOM 1966  H HG12 . VAL A 1 47 ? 2.499   2.770   2.881   1.00 0.00 ? 45 VAL P HG12 2  
ATOM 1967  H HG13 . VAL A 1 47 ? 2.222   1.268   1.964   1.00 0.00 ? 45 VAL P HG13 2  
ATOM 1968  H HG21 . VAL A 1 47 ? -0.694  1.022   2.648   1.00 0.00 ? 45 VAL P HG21 2  
ATOM 1969  H HG22 . VAL A 1 47 ? 0.392   -0.369  2.762   1.00 0.00 ? 45 VAL P HG22 2  
ATOM 1970  H HG23 . VAL A 1 47 ? -0.602  0.100   4.151   1.00 0.00 ? 45 VAL P HG23 2  
ATOM 1971  N N    . ARG A 1 48 ? 3.469   2.347   5.748   1.00 0.00 ? 46 ARG P N    2  
ATOM 1972  C CA   . ARG A 1 48 ? 4.715   3.082   6.032   1.00 0.00 ? 46 ARG P CA   2  
ATOM 1973  C C    . ARG A 1 48 ? 5.805   2.177   6.618   1.00 0.00 ? 46 ARG P C    2  
ATOM 1974  O O    . ARG A 1 48 ? 6.958   2.282   6.205   1.00 0.00 ? 46 ARG P O    2  
ATOM 1975  C CB   . ARG A 1 48 ? 4.388   4.275   6.942   1.00 0.00 ? 46 ARG P CB   2  
ATOM 1976  C CG   . ARG A 1 48 ? 5.573   5.239   7.108   1.00 0.00 ? 46 ARG P CG   2  
ATOM 1977  C CD   . ARG A 1 48 ? 5.201   6.454   7.968   1.00 0.00 ? 46 ARG P CD   2  
ATOM 1978  N NE   . ARG A 1 48 ? 4.165   7.293   7.327   1.00 0.00 ? 46 ARG P NE   2  
ATOM 1979  C CZ   . ARG A 1 48 ? 2.881   7.364   7.640   1.00 0.00 ? 46 ARG P CZ   2  
ATOM 1980  N NH1  . ARG A 1 48 ? 2.364   6.705   8.635   1.00 0.00 ? 46 ARG P NH1  2  
ATOM 1981  N NH2  . ARG A 1 48 ? 2.078   8.106   6.941   1.00 0.00 ? 46 ARG P NH2  2  
ATOM 1982  H H    . ARG A 1 48 ? 2.613   2.671   6.191   1.00 0.00 ? 46 ARG P H    2  
ATOM 1983  H HA   . ARG A 1 48 ? 5.103   3.472   5.088   1.00 0.00 ? 46 ARG P HA   2  
ATOM 1984  H HB2  . ARG A 1 48 ? 3.559   4.821   6.490   1.00 0.00 ? 46 ARG P HB2  2  
ATOM 1985  H HB3  . ARG A 1 48 ? 4.072   3.914   7.922   1.00 0.00 ? 46 ARG P HB3  2  
ATOM 1986  H HG2  . ARG A 1 48 ? 6.401   4.718   7.590   1.00 0.00 ? 46 ARG P HG2  2  
ATOM 1987  H HG3  . ARG A 1 48 ? 5.904   5.584   6.126   1.00 0.00 ? 46 ARG P HG3  2  
ATOM 1988  H HD2  . ARG A 1 48 ? 4.874   6.102   8.947   1.00 0.00 ? 46 ARG P HD2  2  
ATOM 1989  H HD3  . ARG A 1 48 ? 6.098   7.057   8.117   1.00 0.00 ? 46 ARG P HD3  2  
ATOM 1990  H HE   . ARG A 1 48 ? 4.456   7.843   6.532   1.00 0.00 ? 46 ARG P HE   2  
ATOM 1991  H HH11 . ARG A 1 48 ? 2.952   6.145   9.220   1.00 0.00 ? 46 ARG P HH11 2  
ATOM 1992  H HH12 . ARG A 1 48 ? 1.354   6.726   8.791   1.00 0.00 ? 46 ARG P HH12 2  
ATOM 1993  H HH21 . ARG A 1 48 ? 2.417   8.650   6.168   1.00 0.00 ? 46 ARG P HH21 2  
ATOM 1994  H HH22 . ARG A 1 48 ? 1.086   8.129   7.181   1.00 0.00 ? 46 ARG P HH22 2  
ATOM 1995  N N    . VAL A 1 49 ? 5.450   1.241   7.503   1.00 0.00 ? 47 VAL P N    2  
ATOM 1996  C CA   . VAL A 1 49 ? 6.370   0.207   8.020   1.00 0.00 ? 47 VAL P CA   2  
ATOM 1997  C C    . VAL A 1 49 ? 6.883   -0.697  6.892   1.00 0.00 ? 47 VAL P C    2  
ATOM 1998  O O    . VAL A 1 49 ? 8.087   -0.947  6.825   1.00 0.00 ? 47 VAL P O    2  
ATOM 1999  C CB   . VAL A 1 49 ? 5.709   -0.611  9.149   1.00 0.00 ? 47 VAL P CB   2  
ATOM 2000  C CG1  . VAL A 1 49 ? 6.520   -1.850  9.556   1.00 0.00 ? 47 VAL P CG1  2  
ATOM 2001  C CG2  . VAL A 1 49 ? 5.552   0.256   10.406  1.00 0.00 ? 47 VAL P CG2  2  
ATOM 2002  H H    . VAL A 1 49 ? 4.488   1.245   7.829   1.00 0.00 ? 47 VAL P H    2  
ATOM 2003  H HA   . VAL A 1 49 ? 7.246   0.704   8.441   1.00 0.00 ? 47 VAL P HA   2  
ATOM 2004  H HB   . VAL A 1 49 ? 4.722   -0.941  8.825   1.00 0.00 ? 47 VAL P HB   2  
ATOM 2005  H HG11 . VAL A 1 49 ? 6.555   -2.571  8.738   1.00 0.00 ? 47 VAL P HG11 2  
ATOM 2006  H HG12 . VAL A 1 49 ? 7.538   -1.563  9.824   1.00 0.00 ? 47 VAL P HG12 2  
ATOM 2007  H HG13 . VAL A 1 49 ? 6.049   -2.337  10.410  1.00 0.00 ? 47 VAL P HG13 2  
ATOM 2008  H HG21 . VAL A 1 49 ? 4.986   1.158   10.181  1.00 0.00 ? 47 VAL P HG21 2  
ATOM 2009  H HG22 . VAL A 1 49 ? 5.018   -0.302  11.175  1.00 0.00 ? 47 VAL P HG22 2  
ATOM 2010  H HG23 . VAL A 1 49 ? 6.532   0.544   10.789  1.00 0.00 ? 47 VAL P HG23 2  
ATOM 2011  N N    . TRP A 1 50 ? 6.019   -1.126  5.962   1.00 0.00 ? 48 TRP P N    2  
ATOM 2012  C CA   . TRP A 1 50 ? 6.450   -1.889  4.783   1.00 0.00 ? 48 TRP P CA   2  
ATOM 2013  C C    . TRP A 1 50 ? 7.432   -1.089  3.915   1.00 0.00 ? 48 TRP P C    2  
ATOM 2014  O O    . TRP A 1 50 ? 8.483   -1.616  3.555   1.00 0.00 ? 48 TRP P O    2  
ATOM 2015  C CB   . TRP A 1 50 ? 5.245   -2.366  3.959   1.00 0.00 ? 48 TRP P CB   2  
ATOM 2016  C CG   . TRP A 1 50 ? 5.621   -3.245  2.803   1.00 0.00 ? 48 TRP P CG   2  
ATOM 2017  C CD1  . TRP A 1 50 ? 5.634   -4.597  2.819   1.00 0.00 ? 48 TRP P CD1  2  
ATOM 2018  C CD2  . TRP A 1 50 ? 6.086   -2.861  1.466   1.00 0.00 ? 48 TRP P CD2  2  
ATOM 2019  N NE1  . TRP A 1 50 ? 6.084   -5.074  1.603   1.00 0.00 ? 48 TRP P NE1  2  
ATOM 2020  C CE2  . TRP A 1 50 ? 6.393   -4.049  0.736   1.00 0.00 ? 48 TRP P CE2  2  
ATOM 2021  C CE3  . TRP A 1 50 ? 6.285   -1.631  0.797   1.00 0.00 ? 48 TRP P CE3  2  
ATOM 2022  C CZ2  . TRP A 1 50 ? 6.891   -4.022  -0.576  1.00 0.00 ? 48 TRP P CZ2  2  
ATOM 2023  C CZ3  . TRP A 1 50 ? 6.791   -1.590  -0.517  1.00 0.00 ? 48 TRP P CZ3  2  
ATOM 2024  C CH2  . TRP A 1 50 ? 7.098   -2.779  -1.201  1.00 0.00 ? 48 TRP P CH2  2  
ATOM 2025  H H    . TRP A 1 50 ? 5.033   -0.911  6.067   1.00 0.00 ? 48 TRP P H    2  
ATOM 2026  H HA   . TRP A 1 50 ? 6.981   -2.776  5.128   1.00 0.00 ? 48 TRP P HA   2  
ATOM 2027  H HB2  . TRP A 1 50 ? 4.568   -2.917  4.611   1.00 0.00 ? 48 TRP P HB2  2  
ATOM 2028  H HB3  . TRP A 1 50 ? 4.704   -1.505  3.567   1.00 0.00 ? 48 TRP P HB3  2  
ATOM 2029  H HD1  . TRP A 1 50 ? 5.347   -5.209  3.669   1.00 0.00 ? 48 TRP P HD1  2  
ATOM 2030  H HE1  . TRP A 1 50 ? 6.184   -6.061  1.397   1.00 0.00 ? 48 TRP P HE1  2  
ATOM 2031  H HE3  . TRP A 1 50 ? 6.037   -0.709  1.300   1.00 0.00 ? 48 TRP P HE3  2  
ATOM 2032  H HZ2  . TRP A 1 50 ? 7.101   -4.943  -1.099  1.00 0.00 ? 48 TRP P HZ2  2  
ATOM 2033  H HZ3  . TRP A 1 50 ? 6.931   -0.635  -1.006  1.00 0.00 ? 48 TRP P HZ3  2  
ATOM 2034  H HH2  . TRP A 1 50 ? 7.479   -2.735  -2.212  1.00 0.00 ? 48 TRP P HH2  2  
ATOM 2035  N N    . PHE A 1 51 ? 7.156   0.192   3.637   1.00 0.00 ? 49 PHE P N    2  
ATOM 2036  C CA   . PHE A 1 51 ? 8.060   1.050   2.859   1.00 0.00 ? 49 PHE P CA   2  
ATOM 2037  C C    . PHE A 1 51 ? 9.408   1.268   3.558   1.00 0.00 ? 49 PHE P C    2  
ATOM 2038  O O    . PHE A 1 51 ? 10.443  1.168   2.904   1.00 0.00 ? 49 PHE P O    2  
ATOM 2039  C CB   . PHE A 1 51 ? 7.386   2.388   2.516   1.00 0.00 ? 49 PHE P CB   2  
ATOM 2040  C CG   . PHE A 1 51 ? 6.615   2.367   1.209   1.00 0.00 ? 49 PHE P CG   2  
ATOM 2041  C CD1  . PHE A 1 51 ? 7.284   2.606   -0.008  1.00 0.00 ? 49 PHE P CD1  2  
ATOM 2042  C CD2  . PHE A 1 51 ? 5.233   2.105   1.198   1.00 0.00 ? 49 PHE P CD2  2  
ATOM 2043  C CE1  . PHE A 1 51 ? 6.572   2.588   -1.221  1.00 0.00 ? 49 PHE P CE1  2  
ATOM 2044  C CE2  . PHE A 1 51 ? 4.524   2.078   -0.014  1.00 0.00 ? 49 PHE P CE2  2  
ATOM 2045  C CZ   . PHE A 1 51 ? 5.192   2.327   -1.222  1.00 0.00 ? 49 PHE P CZ   2  
ATOM 2046  H H    . PHE A 1 51 ? 6.267   0.569   3.948   1.00 0.00 ? 49 PHE P H    2  
ATOM 2047  H HA   . PHE A 1 51 ? 8.286   0.544   1.919   1.00 0.00 ? 49 PHE P HA   2  
ATOM 2048  H HB2  . PHE A 1 51 ? 6.729   2.694   3.332   1.00 0.00 ? 49 PHE P HB2  2  
ATOM 2049  H HB3  . PHE A 1 51 ? 8.157   3.155   2.424   1.00 0.00 ? 49 PHE P HB3  2  
ATOM 2050  H HD1  . PHE A 1 51 ? 8.348   2.801   -0.017  1.00 0.00 ? 49 PHE P HD1  2  
ATOM 2051  H HD2  . PHE A 1 51 ? 4.711   1.922   2.121   1.00 0.00 ? 49 PHE P HD2  2  
ATOM 2052  H HE1  . PHE A 1 51 ? 7.086   2.774   -2.154  1.00 0.00 ? 49 PHE P HE1  2  
ATOM 2053  H HE2  . PHE A 1 51 ? 3.463   1.870   -0.017  1.00 0.00 ? 49 PHE P HE2  2  
ATOM 2054  H HZ   . PHE A 1 51 ? 4.641   2.318   -2.149  1.00 0.00 ? 49 PHE P HZ   2  
ATOM 2055  N N    . LYS A 1 52 ? 9.435   1.495   4.880   1.00 0.00 ? 50 LYS P N    2  
ATOM 2056  C CA   . LYS A 1 52 ? 10.683  1.623   5.659   1.00 0.00 ? 50 LYS P CA   2  
ATOM 2057  C C    . LYS A 1 52 ? 11.528  0.343   5.606   1.00 0.00 ? 50 LYS P C    2  
ATOM 2058  O O    . LYS A 1 52 ? 12.735  0.409   5.371   1.00 0.00 ? 50 LYS P O    2  
ATOM 2059  C CB   . LYS A 1 52 ? 10.350  2.012   7.111   1.00 0.00 ? 50 LYS P CB   2  
ATOM 2060  C CG   . LYS A 1 52 ? 9.907   3.481   7.226   1.00 0.00 ? 50 LYS P CG   2  
ATOM 2061  C CD   . LYS A 1 52 ? 9.321   3.820   8.609   1.00 0.00 ? 50 LYS P CD   2  
ATOM 2062  C CE   . LYS A 1 52 ? 10.285  3.613   9.788   1.00 0.00 ? 50 LYS P CE   2  
ATOM 2063  N NZ   . LYS A 1 52 ? 11.423  4.571   9.769   1.00 0.00 ? 50 LYS P NZ   2  
ATOM 2064  H H    . LYS A 1 52 ? 8.545   1.600   5.362   1.00 0.00 ? 50 LYS P H    2  
ATOM 2065  H HA   . LYS A 1 52 ? 11.298  2.411   5.219   1.00 0.00 ? 50 LYS P HA   2  
ATOM 2066  H HB2  . LYS A 1 52 ? 9.565   1.357   7.490   1.00 0.00 ? 50 LYS P HB2  2  
ATOM 2067  H HB3  . LYS A 1 52 ? 11.241  1.869   7.725   1.00 0.00 ? 50 LYS P HB3  2  
ATOM 2068  H HG2  . LYS A 1 52 ? 10.758  4.130   7.018   1.00 0.00 ? 50 LYS P HG2  2  
ATOM 2069  H HG3  . LYS A 1 52 ? 9.144   3.693   6.478   1.00 0.00 ? 50 LYS P HG3  2  
ATOM 2070  H HD2  . LYS A 1 52 ? 8.981   4.858   8.602   1.00 0.00 ? 50 LYS P HD2  2  
ATOM 2071  H HD3  . LYS A 1 52 ? 8.442   3.192   8.771   1.00 0.00 ? 50 LYS P HD3  2  
ATOM 2072  H HE2  . LYS A 1 52 ? 9.720   3.740   10.717  1.00 0.00 ? 50 LYS P HE2  2  
ATOM 2073  H HE3  . LYS A 1 52 ? 10.656  2.584   9.773   1.00 0.00 ? 50 LYS P HE3  2  
ATOM 2074  H HZ1  . LYS A 1 52 ? 12.027  4.430   10.570  1.00 0.00 ? 50 LYS P HZ1  2  
ATOM 2075  H HZ2  . LYS A 1 52 ? 11.099  5.528   9.803   1.00 0.00 ? 50 LYS P HZ2  2  
ATOM 2076  H HZ3  . LYS A 1 52 ? 11.991  4.461   8.941   1.00 0.00 ? 50 LYS P HZ3  2  
ATOM 2077  N N    . ASN A 1 53 ? 10.890  -0.821  5.751   1.00 0.00 ? 51 ASN P N    2  
ATOM 2078  C CA   . ASN A 1 53 ? 11.533  -2.134  5.643   1.00 0.00 ? 51 ASN P CA   2  
ATOM 2079  C C    . ASN A 1 53 ? 12.073  -2.382  4.217   1.00 0.00 ? 51 ASN P C    2  
ATOM 2080  O O    . ASN A 1 53 ? 13.244  -2.727  4.037   1.00 0.00 ? 51 ASN P O    2  
ATOM 2081  C CB   . ASN A 1 53 ? 10.498  -3.182  6.101   1.00 0.00 ? 51 ASN P CB   2  
ATOM 2082  C CG   . ASN A 1 53 ? 11.031  -4.601  6.241   1.00 0.00 ? 51 ASN P CG   2  
ATOM 2083  O OD1  . ASN A 1 53 ? 12.193  -4.907  6.019   1.00 0.00 ? 51 ASN P OD1  2  
ATOM 2084  N ND2  . ASN A 1 53 ? 10.181  -5.522  6.635   1.00 0.00 ? 51 ASN P ND2  2  
ATOM 2085  H H    . ASN A 1 53 ? 9.899   -0.790  5.963   1.00 0.00 ? 51 ASN P H    2  
ATOM 2086  H HA   . ASN A 1 53 ? 12.384  -2.164  6.326   1.00 0.00 ? 51 ASN P HA   2  
ATOM 2087  H HB2  . ASN A 1 53 ? 10.108  -2.887  7.075   1.00 0.00 ? 51 ASN P HB2  2  
ATOM 2088  H HB3  . ASN A 1 53 ? 9.662   -3.202  5.401   1.00 0.00 ? 51 ASN P HB3  2  
ATOM 2089  H HD21 . ASN A 1 53 ? 9.224   -5.273  6.844   1.00 0.00 ? 51 ASN P HD21 2  
ATOM 2090  H HD22 . ASN A 1 53 ? 10.514  -6.466  6.750   1.00 0.00 ? 51 ASN P HD22 2  
ATOM 2091  N N    . ARG A 1 54 ? 11.258  -2.105  3.190   1.00 0.00 ? 52 ARG P N    2  
ATOM 2092  C CA   . ARG A 1 54 ? 11.631  -2.222  1.771   1.00 0.00 ? 52 ARG P CA   2  
ATOM 2093  C C    . ARG A 1 54 ? 12.803  -1.306  1.411   1.00 0.00 ? 52 ARG P C    2  
ATOM 2094  O O    . ARG A 1 54 ? 13.756  -1.778  0.795   1.00 0.00 ? 52 ARG P O    2  
ATOM 2095  C CB   . ARG A 1 54 ? 10.392  -1.946  0.897   1.00 0.00 ? 52 ARG P CB   2  
ATOM 2096  C CG   . ARG A 1 54 ? 10.614  -2.189  -0.603  1.00 0.00 ? 52 ARG P CG   2  
ATOM 2097  C CD   . ARG A 1 54 ? 10.769  -3.670  -0.962  1.00 0.00 ? 52 ARG P CD   2  
ATOM 2098  N NE   . ARG A 1 54 ? 10.907  -3.849  -2.422  1.00 0.00 ? 52 ARG P NE   2  
ATOM 2099  C CZ   . ARG A 1 54 ? 10.518  -4.896  -3.126  1.00 0.00 ? 52 ARG P CZ   2  
ATOM 2100  N NH1  . ARG A 1 54 ? 9.934   -5.931  -2.602  1.00 0.00 ? 52 ARG P NH1  2  
ATOM 2101  N NH2  . ARG A 1 54 ? 10.694  -4.961  -4.410  1.00 0.00 ? 52 ARG P NH2  2  
ATOM 2102  H H    . ARG A 1 54 ? 10.304  -1.826  3.407   1.00 0.00 ? 52 ARG P H    2  
ATOM 2103  H HA   . ARG A 1 54 ? 11.968  -3.244  1.595   1.00 0.00 ? 52 ARG P HA   2  
ATOM 2104  H HB2  . ARG A 1 54 ? 9.566   -2.579  1.228   1.00 0.00 ? 52 ARG P HB2  2  
ATOM 2105  H HB3  . ARG A 1 54 ? 10.088  -0.907  1.032   1.00 0.00 ? 52 ARG P HB3  2  
ATOM 2106  H HG2  . ARG A 1 54 ? 9.752   -1.798  -1.140  1.00 0.00 ? 52 ARG P HG2  2  
ATOM 2107  H HG3  . ARG A 1 54 ? 11.498  -1.650  -0.936  1.00 0.00 ? 52 ARG P HG3  2  
ATOM 2108  H HD2  . ARG A 1 54 ? 11.655  -4.073  -0.469  1.00 0.00 ? 52 ARG P HD2  2  
ATOM 2109  H HD3  . ARG A 1 54 ? 9.889   -4.200  -0.595  1.00 0.00 ? 52 ARG P HD3  2  
ATOM 2110  H HE   . ARG A 1 54 ? 11.345  -3.101  -2.936  1.00 0.00 ? 52 ARG P HE   2  
ATOM 2111  H HH11 . ARG A 1 54 ? 9.783   -5.987  -1.612  1.00 0.00 ? 52 ARG P HH11 2  
ATOM 2112  H HH12 . ARG A 1 54 ? 9.644   -6.677  -3.233  1.00 0.00 ? 52 ARG P HH12 2  
ATOM 2113  H HH21 . ARG A 1 54 ? 11.140  -4.217  -4.936  1.00 0.00 ? 52 ARG P HH21 2  
ATOM 2114  H HH22 . ARG A 1 54 ? 10.349  -5.796  -4.876  1.00 0.00 ? 52 ARG P HH22 2  
ATOM 2115  N N    . ARG A 1 55 ? 12.792  -0.037  1.844   1.00 0.00 ? 53 ARG P N    2  
ATOM 2116  C CA   . ARG A 1 55 ? 13.896  0.922   1.637   1.00 0.00 ? 53 ARG P CA   2  
ATOM 2117  C C    . ARG A 1 55 ? 15.196  0.456   2.288   1.00 0.00 ? 53 ARG P C    2  
ATOM 2118  O O    . ARG A 1 55 ? 16.235  0.535   1.640   1.00 0.00 ? 53 ARG P O    2  
ATOM 2119  C CB   . ARG A 1 55 ? 13.516  2.325   2.152   1.00 0.00 ? 53 ARG P CB   2  
ATOM 2120  C CG   . ARG A 1 55 ? 12.516  3.078   1.260   1.00 0.00 ? 53 ARG P CG   2  
ATOM 2121  C CD   . ARG A 1 55 ? 13.108  3.517   -0.087  1.00 0.00 ? 53 ARG P CD   2  
ATOM 2122  N NE   . ARG A 1 55 ? 12.109  4.268   -0.867  1.00 0.00 ? 53 ARG P NE   2  
ATOM 2123  C CZ   . ARG A 1 55 ? 12.078  4.448   -2.177  1.00 0.00 ? 53 ARG P CZ   2  
ATOM 2124  N NH1  . ARG A 1 55 ? 13.023  4.033   -2.971  1.00 0.00 ? 53 ARG P NH1  2  
ATOM 2125  N NH2  . ARG A 1 55 ? 11.069  5.066   -2.715  1.00 0.00 ? 53 ARG P NH2  2  
ATOM 2126  H H    . ARG A 1 55 ? 11.959  0.280   2.330   1.00 0.00 ? 53 ARG P H    2  
ATOM 2127  H HA   . ARG A 1 55 ? 14.110  0.982   0.571   1.00 0.00 ? 53 ARG P HA   2  
ATOM 2128  H HB2  . ARG A 1 55 ? 13.094  2.233   3.154   1.00 0.00 ? 53 ARG P HB2  2  
ATOM 2129  H HB3  . ARG A 1 55 ? 14.418  2.934   2.232   1.00 0.00 ? 53 ARG P HB3  2  
ATOM 2130  H HG2  . ARG A 1 55 ? 11.646  2.450   1.073   1.00 0.00 ? 53 ARG P HG2  2  
ATOM 2131  H HG3  . ARG A 1 55 ? 12.185  3.966   1.799   1.00 0.00 ? 53 ARG P HG3  2  
ATOM 2132  H HD2  . ARG A 1 55 ? 13.980  4.150   0.092   1.00 0.00 ? 53 ARG P HD2  2  
ATOM 2133  H HD3  . ARG A 1 55 ? 13.420  2.635   -0.645  1.00 0.00 ? 53 ARG P HD3  2  
ATOM 2134  H HE   . ARG A 1 55 ? 11.347  4.677   -0.350  1.00 0.00 ? 53 ARG P HE   2  
ATOM 2135  H HH11 . ARG A 1 55 ? 13.850  3.608   -2.586  1.00 0.00 ? 53 ARG P HH11 2  
ATOM 2136  H HH12 . ARG A 1 55 ? 12.950  4.188   -3.961  1.00 0.00 ? 53 ARG P HH12 2  
ATOM 2137  H HH21 . ARG A 1 55 ? 10.316  5.404   -2.143  1.00 0.00 ? 53 ARG P HH21 2  
ATOM 2138  H HH22 . ARG A 1 55 ? 11.028  5.190   -3.721  1.00 0.00 ? 53 ARG P HH22 2  
ATOM 2139  N N    . ALA A 1 56 ? 15.153  -0.093  3.504   1.00 0.00 ? 54 ALA P N    2  
ATOM 2140  C CA   . ALA A 1 56 ? 16.342  -0.640  4.164   1.00 0.00 ? 54 ALA P CA   2  
ATOM 2141  C C    . ALA A 1 56 ? 16.947  -1.829  3.386   1.00 0.00 ? 54 ALA P C    2  
ATOM 2142  O O    . ALA A 1 56 ? 18.155  -1.857  3.139   1.00 0.00 ? 54 ALA P O    2  
ATOM 2143  C CB   . ALA A 1 56 ? 15.977  -1.015  5.605   1.00 0.00 ? 54 ALA P CB   2  
ATOM 2144  H H    . ALA A 1 56 ? 14.273  -0.101  4.003   1.00 0.00 ? 54 ALA P H    2  
ATOM 2145  H HA   . ALA A 1 56 ? 17.103  0.141   4.204   1.00 0.00 ? 54 ALA P HA   2  
ATOM 2146  H HB1  . ALA A 1 56 ? 15.597  -0.138  6.130   1.00 0.00 ? 54 ALA P HB1  2  
ATOM 2147  H HB2  . ALA A 1 56 ? 15.218  -1.797  5.615   1.00 0.00 ? 54 ALA P HB2  2  
ATOM 2148  H HB3  . ALA A 1 56 ? 16.867  -1.377  6.124   1.00 0.00 ? 54 ALA P HB3  2  
ATOM 2149  N N    . LYS A 1 57 ? 16.105  -2.769  2.925   1.00 0.00 ? 55 LYS P N    2  
ATOM 2150  C CA   . LYS A 1 57 ? 16.521  -3.936  2.117   1.00 0.00 ? 55 LYS P CA   2  
ATOM 2151  C C    . LYS A 1 57 ? 16.975  -3.570  0.695   1.00 0.00 ? 55 LYS P C    2  
ATOM 2152  O O    . LYS A 1 57 ? 17.807  -4.271  0.118   1.00 0.00 ? 55 LYS P O    2  
ATOM 2153  C CB   . LYS A 1 57 ? 15.373  -4.963  2.080   1.00 0.00 ? 55 LYS P CB   2  
ATOM 2154  C CG   . LYS A 1 57 ? 15.137  -5.610  3.457   1.00 0.00 ? 55 LYS P CG   2  
ATOM 2155  C CD   . LYS A 1 57 ? 13.955  -6.592  3.470   1.00 0.00 ? 55 LYS P CD   2  
ATOM 2156  C CE   . LYS A 1 57 ? 14.213  -7.822  2.590   1.00 0.00 ? 55 LYS P CE   2  
ATOM 2157  N NZ   . LYS A 1 57 ? 13.109  -8.812  2.695   1.00 0.00 ? 55 LYS P NZ   2  
ATOM 2158  H H    . LYS A 1 57 ? 15.128  -2.691  3.188   1.00 0.00 ? 55 LYS P H    2  
ATOM 2159  H HA   . LYS A 1 57 ? 17.383  -4.405  2.594   1.00 0.00 ? 55 LYS P HA   2  
ATOM 2160  H HB2  . LYS A 1 57 ? 14.459  -4.474  1.740   1.00 0.00 ? 55 LYS P HB2  2  
ATOM 2161  H HB3  . LYS A 1 57 ? 15.632  -5.745  1.365   1.00 0.00 ? 55 LYS P HB3  2  
ATOM 2162  H HG2  . LYS A 1 57 ? 16.041  -6.137  3.766   1.00 0.00 ? 55 LYS P HG2  2  
ATOM 2163  H HG3  . LYS A 1 57 ? 14.935  -4.833  4.194   1.00 0.00 ? 55 LYS P HG3  2  
ATOM 2164  H HD2  . LYS A 1 57 ? 13.798  -6.917  4.500   1.00 0.00 ? 55 LYS P HD2  2  
ATOM 2165  H HD3  . LYS A 1 57 ? 13.054  -6.075  3.134   1.00 0.00 ? 55 LYS P HD3  2  
ATOM 2166  H HE2  . LYS A 1 57 ? 14.325  -7.500  1.551   1.00 0.00 ? 55 LYS P HE2  2  
ATOM 2167  H HE3  . LYS A 1 57 ? 15.155  -8.285  2.901   1.00 0.00 ? 55 LYS P HE3  2  
ATOM 2168  H HZ1  . LYS A 1 57 ? 13.288  -9.619  2.111   1.00 0.00 ? 55 LYS P HZ1  2  
ATOM 2169  H HZ2  . LYS A 1 57 ? 12.227  -8.414  2.402   1.00 0.00 ? 55 LYS P HZ2  2  
ATOM 2170  H HZ3  . LYS A 1 57 ? 13.002  -9.144  3.644   1.00 0.00 ? 55 LYS P HZ3  2  
ATOM 2171  N N    . TRP A 1 58 ? 16.466  -2.469  0.143   1.00 0.00 ? 56 TRP P N    2  
ATOM 2172  C CA   . TRP A 1 58 ? 16.840  -1.901  -1.158  1.00 0.00 ? 56 TRP P CA   2  
ATOM 2173  C C    . TRP A 1 58 ? 18.162  -1.111  -1.104  1.00 0.00 ? 56 TRP P C    2  
ATOM 2174  O O    . TRP A 1 58 ? 19.008  -1.262  -1.989  1.00 0.00 ? 56 TRP P O    2  
ATOM 2175  C CB   . TRP A 1 58 ? 15.668  -1.026  -1.625  1.00 0.00 ? 56 TRP P CB   2  
ATOM 2176  C CG   . TRP A 1 58 ? 15.902  -0.098  -2.776  1.00 0.00 ? 56 TRP P CG   2  
ATOM 2177  C CD1  . TRP A 1 58 ? 15.965  -0.448  -4.081  1.00 0.00 ? 56 TRP P CD1  2  
ATOM 2178  C CD2  . TRP A 1 58 ? 16.059  1.355   -2.742  1.00 0.00 ? 56 TRP P CD2  2  
ATOM 2179  N NE1  . TRP A 1 58 ? 16.143  0.684   -4.854  1.00 0.00 ? 56 TRP P NE1  2  
ATOM 2180  C CE2  . TRP A 1 58 ? 16.196  1.825   -4.082  1.00 0.00 ? 56 TRP P CE2  2  
ATOM 2181  C CE3  . TRP A 1 58 ? 16.090  2.325   -1.714  1.00 0.00 ? 56 TRP P CE3  2  
ATOM 2182  C CZ2  . TRP A 1 58 ? 16.345  3.187   -4.388  1.00 0.00 ? 56 TRP P CZ2  2  
ATOM 2183  C CZ3  . TRP A 1 58 ? 16.247  3.694   -2.010  1.00 0.00 ? 56 TRP P CZ3  2  
ATOM 2184  C CH2  . TRP A 1 58 ? 16.372  4.126   -3.342  1.00 0.00 ? 56 TRP P CH2  2  
ATOM 2185  H H    . TRP A 1 58 ? 15.704  -2.024  0.644   1.00 0.00 ? 56 TRP P H    2  
ATOM 2186  H HA   . TRP A 1 58 ? 16.974  -2.705  -1.884  1.00 0.00 ? 56 TRP P HA   2  
ATOM 2187  H HB2  . TRP A 1 58 ? 14.827  -1.676  -1.873  1.00 0.00 ? 56 TRP P HB2  2  
ATOM 2188  H HB3  . TRP A 1 58 ? 15.355  -0.402  -0.790  1.00 0.00 ? 56 TRP P HB3  2  
ATOM 2189  H HD1  . TRP A 1 58 ? 15.871  -1.462  -4.458  1.00 0.00 ? 56 TRP P HD1  2  
ATOM 2190  H HE1  . TRP A 1 58 ? 16.215  0.660   -5.867  1.00 0.00 ? 56 TRP P HE1  2  
ATOM 2191  H HE3  . TRP A 1 58 ? 16.011  2.004   -0.685  1.00 0.00 ? 56 TRP P HE3  2  
ATOM 2192  H HZ2  . TRP A 1 58 ? 16.447  3.506   -5.417  1.00 0.00 ? 56 TRP P HZ2  2  
ATOM 2193  H HZ3  . TRP A 1 58 ? 16.283  4.419   -1.205  1.00 0.00 ? 56 TRP P HZ3  2  
ATOM 2194  H HH2  . TRP A 1 58 ? 16.498  5.179   -3.561  1.00 0.00 ? 56 TRP P HH2  2  
ATOM 2195  N N    . ARG A 1 59 ? 18.366  -0.296  -0.059  1.00 0.00 ? 57 ARG P N    2  
ATOM 2196  C CA   . ARG A 1 59 ? 19.528  0.599   0.103   1.00 0.00 ? 57 ARG P CA   2  
ATOM 2197  C C    . ARG A 1 59 ? 20.758  -0.099  0.690   1.00 0.00 ? 57 ARG P C    2  
ATOM 2198  O O    . ARG A 1 59 ? 21.867  0.186   0.240   1.00 0.00 ? 57 ARG P O    2  
ATOM 2199  C CB   . ARG A 1 59 ? 19.080  1.819   0.926   1.00 0.00 ? 57 ARG P CB   2  
ATOM 2200  C CG   . ARG A 1 59 ? 20.164  2.899   1.083   1.00 0.00 ? 57 ARG P CG   2  
ATOM 2201  C CD   . ARG A 1 59 ? 19.568  4.237   1.544   1.00 0.00 ? 57 ARG P CD   2  
ATOM 2202  N NE   . ARG A 1 59 ? 18.801  4.109   2.799   1.00 0.00 ? 57 ARG P NE   2  
ATOM 2203  C CZ   . ARG A 1 59 ? 17.953  4.972   3.319   1.00 0.00 ? 57 ARG P CZ   2  
ATOM 2204  N NH1  . ARG A 1 59 ? 17.706  6.136   2.785   1.00 0.00 ? 57 ARG P NH1  2  
ATOM 2205  N NH2  . ARG A 1 59 ? 17.337  4.648   4.414   1.00 0.00 ? 57 ARG P NH2  2  
ATOM 2206  H H    . ARG A 1 59 ? 17.605  -0.201  0.608   1.00 0.00 ? 57 ARG P H    2  
ATOM 2207  H HA   . ARG A 1 59 ? 19.823  0.955   -0.885  1.00 0.00 ? 57 ARG P HA   2  
ATOM 2208  H HB2  . ARG A 1 59 ? 18.220  2.267   0.424   1.00 0.00 ? 57 ARG P HB2  2  
ATOM 2209  H HB3  . ARG A 1 59 ? 18.763  1.487   1.916   1.00 0.00 ? 57 ARG P HB3  2  
ATOM 2210  H HG2  . ARG A 1 59 ? 20.911  2.567   1.805   1.00 0.00 ? 57 ARG P HG2  2  
ATOM 2211  H HG3  . ARG A 1 59 ? 20.655  3.061   0.123   1.00 0.00 ? 57 ARG P HG3  2  
ATOM 2212  H HD2  . ARG A 1 59 ? 20.380  4.952   1.686   1.00 0.00 ? 57 ARG P HD2  2  
ATOM 2213  H HD3  . ARG A 1 59 ? 18.913  4.611   0.753   1.00 0.00 ? 57 ARG P HD3  2  
ATOM 2214  H HE   . ARG A 1 59 ? 18.896  3.249   3.335   1.00 0.00 ? 57 ARG P HE   2  
ATOM 2215  H HH11 . ARG A 1 59 ? 18.194  6.404   1.948   1.00 0.00 ? 57 ARG P HH11 2  
ATOM 2216  H HH12 . ARG A 1 59 ? 17.055  6.769   3.217   1.00 0.00 ? 57 ARG P HH12 2  
ATOM 2217  H HH21 . ARG A 1 59 ? 17.568  3.738   4.816   1.00 0.00 ? 57 ARG P HH21 2  
ATOM 2218  H HH22 . ARG A 1 59 ? 16.690  5.272   4.862   1.00 0.00 ? 57 ARG P HH22 2  
ATOM 2219  N N    . LYS A 1 60 ? 20.568  -1.025  1.638   1.00 0.00 ? 58 LYS P N    2  
ATOM 2220  C CA   . LYS A 1 60 ? 21.562  -1.906  2.302   1.00 0.00 ? 58 LYS P CA   2  
ATOM 2221  C C    . LYS A 1 60 ? 22.694  -1.224  3.092   1.00 0.00 ? 58 LYS P C    2  
ATOM 2222  O O    . LYS A 1 60 ? 22.825  -1.479  4.289   1.00 0.00 ? 58 LYS P O    2  
ATOM 2223  C CB   . LYS A 1 60 ? 22.108  -2.959  1.316   1.00 0.00 ? 58 LYS P CB   2  
ATOM 2224  C CG   . LYS A 1 60 ? 20.996  -3.830  0.705   1.00 0.00 ? 58 LYS P CG   2  
ATOM 2225  C CD   . LYS A 1 60 ? 21.521  -4.914  -0.247  1.00 0.00 ? 58 LYS P CD   2  
ATOM 2226  C CE   . LYS A 1 60 ? 22.347  -5.984  0.485   1.00 0.00 ? 58 LYS P CE   2  
ATOM 2227  N NZ   . LYS A 1 60 ? 22.787  -7.061  -0.441  1.00 0.00 ? 58 LYS P NZ   2  
ATOM 2228  H H    . LYS A 1 60 ? 19.604  -1.155  1.927   1.00 0.00 ? 58 LYS P H    2  
ATOM 2229  H HA   . LYS A 1 60 ? 21.008  -2.464  3.061   1.00 0.00 ? 58 LYS P HA   2  
ATOM 2230  H HB2  . LYS A 1 60 ? 22.655  -2.462  0.512   1.00 0.00 ? 58 LYS P HB2  2  
ATOM 2231  H HB3  . LYS A 1 60 ? 22.805  -3.600  1.855   1.00 0.00 ? 58 LYS P HB3  2  
ATOM 2232  H HG2  . LYS A 1 60 ? 20.425  -4.303  1.506   1.00 0.00 ? 58 LYS P HG2  2  
ATOM 2233  H HG3  . LYS A 1 60 ? 20.321  -3.190  0.135   1.00 0.00 ? 58 LYS P HG3  2  
ATOM 2234  H HD2  . LYS A 1 60 ? 20.663  -5.393  -0.721  1.00 0.00 ? 58 LYS P HD2  2  
ATOM 2235  H HD3  . LYS A 1 60 ? 22.128  -4.447  -1.024  1.00 0.00 ? 58 LYS P HD3  2  
ATOM 2236  H HE2  . LYS A 1 60 ? 23.221  -5.510  0.941   1.00 0.00 ? 58 LYS P HE2  2  
ATOM 2237  H HE3  . LYS A 1 60 ? 21.738  -6.409  1.287   1.00 0.00 ? 58 LYS P HE3  2  
ATOM 2238  H HZ1  . LYS A 1 60 ? 21.996  -7.530  -0.862  1.00 0.00 ? 58 LYS P HZ1  2  
ATOM 2239  H HZ2  . LYS A 1 60 ? 23.329  -7.761  0.048   1.00 0.00 ? 58 LYS P HZ2  2  
ATOM 2240  H HZ3  . LYS A 1 60 ? 23.365  -6.694  -1.186  1.00 0.00 ? 58 LYS P HZ3  2  
ATOM 2241  N N    . ARG A 1 61 ? 23.512  -0.374  2.459   1.00 0.00 ? 59 ARG P N    2  
ATOM 2242  C CA   . ARG A 1 61 ? 24.756  0.216   3.024   1.00 0.00 ? 59 ARG P CA   2  
ATOM 2243  C C    . ARG A 1 61 ? 24.573  1.488   3.872   1.00 0.00 ? 59 ARG P C    2  
ATOM 2244  O O    . ARG A 1 61 ? 25.530  2.225   4.111   1.00 0.00 ? 59 ARG P O    2  
ATOM 2245  C CB   . ARG A 1 61 ? 25.872  0.314   1.955   1.00 0.00 ? 59 ARG P CB   2  
ATOM 2246  C CG   . ARG A 1 61 ? 25.831  1.504   0.975   1.00 0.00 ? 59 ARG P CG   2  
ATOM 2247  C CD   . ARG A 1 61 ? 24.540  1.562   0.160   1.00 0.00 ? 59 ARG P CD   2  
ATOM 2248  N NE   . ARG A 1 61 ? 24.589  2.573   -0.911  1.00 0.00 ? 59 ARG P NE   2  
ATOM 2249  C CZ   . ARG A 1 61 ? 23.686  2.726   -1.864  1.00 0.00 ? 59 ARG P CZ   2  
ATOM 2250  N NH1  . ARG A 1 61 ? 22.617  1.982   -1.926  1.00 0.00 ? 59 ARG P NH1  2  
ATOM 2251  N NH2  . ARG A 1 61 ? 23.842  3.637   -2.782  1.00 0.00 ? 59 ARG P NH2  2  
ATOM 2252  H H    . ARG A 1 61 ? 23.292  -0.201  1.485   1.00 0.00 ? 59 ARG P H    2  
ATOM 2253  H HA   . ARG A 1 61 ? 25.128  -0.510  3.751   1.00 0.00 ? 59 ARG P HA   2  
ATOM 2254  H HB2  . ARG A 1 61 ? 26.829  0.364   2.478   1.00 0.00 ? 59 ARG P HB2  2  
ATOM 2255  H HB3  . ARG A 1 61 ? 25.882  -0.611  1.377   1.00 0.00 ? 59 ARG P HB3  2  
ATOM 2256  H HG2  . ARG A 1 61 ? 25.954  2.441   1.518   1.00 0.00 ? 59 ARG P HG2  2  
ATOM 2257  H HG3  . ARG A 1 61 ? 26.673  1.403   0.288   1.00 0.00 ? 59 ARG P HG3  2  
ATOM 2258  H HD2  . ARG A 1 61 ? 24.373  0.579   -0.286  1.00 0.00 ? 59 ARG P HD2  2  
ATOM 2259  H HD3  . ARG A 1 61 ? 23.715  1.804   0.832   1.00 0.00 ? 59 ARG P HD3  2  
ATOM 2260  H HE   . ARG A 1 61 ? 25.383  3.194   -0.931  1.00 0.00 ? 59 ARG P HE   2  
ATOM 2261  H HH11 . ARG A 1 61 ? 22.468  1.277   -1.214  1.00 0.00 ? 59 ARG P HH11 2  
ATOM 2262  H HH12 . ARG A 1 61 ? 21.958  2.095   -2.677  1.00 0.00 ? 59 ARG P HH12 2  
ATOM 2263  H HH21 . ARG A 1 61 ? 24.656  4.231   -2.773  1.00 0.00 ? 59 ARG P HH21 2  
ATOM 2264  H HH22 . ARG A 1 61 ? 23.152  3.752   -3.505  1.00 0.00 ? 59 ARG P HH22 2  
ATOM 2265  N N    . GLU A 1 62 ? 23.349  1.754   4.326   1.00 0.00 ? 60 GLU P N    2  
ATOM 2266  C CA   . GLU A 1 62 ? 23.022  2.862   5.239   1.00 0.00 ? 60 GLU P CA   2  
ATOM 2267  C C    . GLU A 1 62 ? 23.665  2.714   6.637   1.00 0.00 ? 60 GLU P C    2  
ATOM 2268  O O    . GLU A 1 62 ? 24.041  1.616   7.058   1.00 0.00 ? 60 GLU P O    2  
ATOM 2269  C CB   . GLU A 1 62 ? 21.496  3.036   5.323   1.00 0.00 ? 60 GLU P CB   2  
ATOM 2270  C CG   . GLU A 1 62 ? 20.746  1.808   5.864   1.00 0.00 ? 60 GLU P CG   2  
ATOM 2271  C CD   . GLU A 1 62 ? 19.237  2.089   5.951   1.00 0.00 ? 60 GLU P CD   2  
ATOM 2272  O OE1  . GLU A 1 62 ? 18.594  2.228   4.883   1.00 0.00 ? 60 GLU P OE1  2  
ATOM 2273  O OE2  . GLU A 1 62 ? 18.691  2.201   7.074   1.00 0.00 ? 60 GLU P OE2  2  
ATOM 2274  H H    . GLU A 1 62 ? 22.631  1.077   4.134   1.00 0.00 ? 60 GLU P H    2  
ATOM 2275  H HA   . GLU A 1 62 ? 23.424  3.780   4.806   1.00 0.00 ? 60 GLU P HA   2  
ATOM 2276  H HB2  . GLU A 1 62 ? 21.275  3.893   5.962   1.00 0.00 ? 60 GLU P HB2  2  
ATOM 2277  H HB3  . GLU A 1 62 ? 21.122  3.263   4.324   1.00 0.00 ? 60 GLU P HB3  2  
ATOM 2278  H HG2  . GLU A 1 62 ? 20.916  0.956   5.202   1.00 0.00 ? 60 GLU P HG2  2  
ATOM 2279  H HG3  . GLU A 1 62 ? 21.137  1.552   6.852   1.00 0.00 ? 60 GLU P HG3  2  
ATOM 2280  N N    . GLU A 1 63 ? 23.790  3.829   7.364   1.00 0.00 ? 61 GLU P N    2  
ATOM 2281  C CA   . GLU A 1 63 ? 24.449  3.913   8.681   1.00 0.00 ? 61 GLU P CA   2  
ATOM 2282  C C    . GLU A 1 63 ? 23.484  4.360   9.798   1.00 0.00 ? 61 GLU P C    2  
ATOM 2283  O O    . GLU A 1 63 ? 22.458  4.997   9.545   1.00 0.00 ? 61 GLU P O    2  
ATOM 2284  C CB   . GLU A 1 63 ? 25.666  4.853   8.606   1.00 0.00 ? 61 GLU P CB   2  
ATOM 2285  C CG   . GLU A 1 63 ? 26.762  4.335   7.663   1.00 0.00 ? 61 GLU P CG   2  
ATOM 2286  C CD   . GLU A 1 63 ? 27.995  5.258   7.687   1.00 0.00 ? 61 GLU P CD   2  
ATOM 2287  O OE1  . GLU A 1 63 ? 28.033  6.252   6.921   1.00 0.00 ? 61 GLU P OE1  2  
ATOM 2288  O OE2  . GLU A 1 63 ? 28.942  4.993   8.468   1.00 0.00 ? 61 GLU P OE2  2  
ATOM 2289  H H    . GLU A 1 63 ? 23.416  4.689   6.988   1.00 0.00 ? 61 GLU P H    2  
ATOM 2290  H HA   . GLU A 1 63 ? 24.819  2.927   8.966   1.00 0.00 ? 61 GLU P HA   2  
ATOM 2291  H HB2  . GLU A 1 63 ? 25.340  5.841   8.275   1.00 0.00 ? 61 GLU P HB2  2  
ATOM 2292  H HB3  . GLU A 1 63 ? 26.094  4.953   9.604   1.00 0.00 ? 61 GLU P HB3  2  
ATOM 2293  H HG2  . GLU A 1 63 ? 27.046  3.326   7.971   1.00 0.00 ? 61 GLU P HG2  2  
ATOM 2294  H HG3  . GLU A 1 63 ? 26.370  4.275   6.645   1.00 0.00 ? 61 GLU P HG3  2  
ATOM 2295  N N    . PHE A 1 64 ? 23.832  4.046   11.052  1.00 0.00 ? 62 PHE P N    2  
ATOM 2296  C CA   . PHE A 1 64 ? 23.022  4.335   12.248  1.00 0.00 ? 62 PHE P CA   2  
ATOM 2297  C C    . PHE A 1 64 ? 23.174  5.772   12.794  1.00 0.00 ? 62 PHE P C    2  
ATOM 2298  O O    . PHE A 1 64 ? 22.500  6.143   13.759  1.00 0.00 ? 62 PHE P O    2  
ATOM 2299  C CB   . PHE A 1 64 ? 23.333  3.277   13.321  1.00 0.00 ? 62 PHE P CB   2  
ATOM 2300  C CG   . PHE A 1 64 ? 24.772  3.263   13.812  1.00 0.00 ? 62 PHE P CG   2  
ATOM 2301  C CD1  . PHE A 1 64 ? 25.175  4.119   14.856  1.00 0.00 ? 62 PHE P CD1  2  
ATOM 2302  C CD2  . PHE A 1 64 ? 25.713  2.392   13.228  1.00 0.00 ? 62 PHE P CD2  2  
ATOM 2303  C CE1  . PHE A 1 64 ? 26.509  4.114   15.302  1.00 0.00 ? 62 PHE P CE1  2  
ATOM 2304  C CE2  . PHE A 1 64 ? 27.049  2.391   13.671  1.00 0.00 ? 62 PHE P CE2  2  
ATOM 2305  C CZ   . PHE A 1 64 ? 27.447  3.253   14.706  1.00 0.00 ? 62 PHE P CZ   2  
ATOM 2306  H H    . PHE A 1 64 ? 24.693  3.538   11.194  1.00 0.00 ? 62 PHE P H    2  
ATOM 2307  H HA   . PHE A 1 64 ? 21.970  4.222   11.981  1.00 0.00 ? 62 PHE P HA   2  
ATOM 2308  H HB2  . PHE A 1 64 ? 22.674  3.437   14.176  1.00 0.00 ? 62 PHE P HB2  2  
ATOM 2309  H HB3  . PHE A 1 64 ? 23.089  2.292   12.919  1.00 0.00 ? 62 PHE P HB3  2  
ATOM 2310  H HD1  . PHE A 1 64 ? 24.459  4.785   15.318  1.00 0.00 ? 62 PHE P HD1  2  
ATOM 2311  H HD2  . PHE A 1 64 ? 25.413  1.716   12.437  1.00 0.00 ? 62 PHE P HD2  2  
ATOM 2312  H HE1  . PHE A 1 64 ? 26.814  4.775   16.103  1.00 0.00 ? 62 PHE P HE1  2  
ATOM 2313  H HE2  . PHE A 1 64 ? 27.769  1.722   13.217  1.00 0.00 ? 62 PHE P HE2  2  
ATOM 2314  H HZ   . PHE A 1 64 ? 28.474  3.252   15.049  1.00 0.00 ? 62 PHE P HZ   2  
ATOM 2315  N N    . ILE A 1 65 ? 24.052  6.590   12.201  1.00 0.00 ? 63 ILE P N    2  
ATOM 2316  C CA   . ILE A 1 65 ? 24.319  7.975   12.624  1.00 0.00 ? 63 ILE P CA   2  
ATOM 2317  C C    . ILE A 1 65 ? 23.149  8.898   12.238  1.00 0.00 ? 63 ILE P C    2  
ATOM 2318  O O    . ILE A 1 65 ? 22.734  8.938   11.077  1.00 0.00 ? 63 ILE P O    2  
ATOM 2319  C CB   . ILE A 1 65 ? 25.663  8.476   12.041  1.00 0.00 ? 63 ILE P CB   2  
ATOM 2320  C CG1  . ILE A 1 65 ? 26.862  7.554   12.376  1.00 0.00 ? 63 ILE P CG1  2  
ATOM 2321  C CG2  . ILE A 1 65 ? 25.964  9.917   12.497  1.00 0.00 ? 63 ILE P CG2  2  
ATOM 2322  C CD1  . ILE A 1 65 ? 27.157  7.363   13.872  1.00 0.00 ? 63 ILE P CD1  2  
ATOM 2323  H H    . ILE A 1 65 ? 24.551  6.235   11.401  1.00 0.00 ? 63 ILE P H    2  
ATOM 2324  H HA   . ILE A 1 65 ? 24.403  7.986   13.712  1.00 0.00 ? 63 ILE P HA   2  
ATOM 2325  H HB   . ILE A 1 65 ? 25.572  8.493   10.953  1.00 0.00 ? 63 ILE P HB   2  
ATOM 2326  H HG12 . ILE A 1 65 ? 26.693  6.572   11.935  1.00 0.00 ? 63 ILE P HG12 2  
ATOM 2327  H HG13 . ILE A 1 65 ? 27.756  7.962   11.903  1.00 0.00 ? 63 ILE P HG13 2  
ATOM 2328  H HG21 . ILE A 1 65 ? 26.951  10.219  12.145  1.00 0.00 ? 63 ILE P HG21 2  
ATOM 2329  H HG22 . ILE A 1 65 ? 25.235  10.610  12.076  1.00 0.00 ? 63 ILE P HG22 2  
ATOM 2330  H HG23 . ILE A 1 65 ? 25.939  9.990   13.585  1.00 0.00 ? 63 ILE P HG23 2  
ATOM 2331  H HD11 . ILE A 1 65 ? 28.003  6.684   13.985  1.00 0.00 ? 63 ILE P HD11 2  
ATOM 2332  H HD12 . ILE A 1 65 ? 27.413  8.316   14.335  1.00 0.00 ? 63 ILE P HD12 2  
ATOM 2333  H HD13 . ILE A 1 65 ? 26.295  6.932   14.378  1.00 0.00 ? 63 ILE P HD13 2  
ATOM 2334  N N    . VAL A 1 66 ? 22.643  9.659   13.215  1.00 0.00 ? 64 VAL P N    2  
ATOM 2335  C CA   . VAL A 1 66 ? 21.505  10.601  13.072  1.00 0.00 ? 64 VAL P CA   2  
ATOM 2336  C C    . VAL A 1 66 ? 21.793  12.009  13.626  1.00 0.00 ? 64 VAL P C    2  
ATOM 2337  O O    . VAL A 1 66 ? 20.908  12.866  13.652  1.00 0.00 ? 64 VAL P O    2  
ATOM 2338  C CB   . VAL A 1 66 ? 20.213  10.016  13.689  1.00 0.00 ? 64 VAL P CB   2  
ATOM 2339  C CG1  . VAL A 1 66 ? 19.757  8.749   12.956  1.00 0.00 ? 64 VAL P CG1  2  
ATOM 2340  C CG2  . VAL A 1 66 ? 20.358  9.693   15.184  1.00 0.00 ? 64 VAL P CG2  2  
ATOM 2341  H H    . VAL A 1 66 ? 23.009  9.516   14.146  1.00 0.00 ? 64 VAL P H    2  
ATOM 2342  H HA   . VAL A 1 66 ? 21.311  10.748  12.009  1.00 0.00 ? 64 VAL P HA   2  
ATOM 2343  H HB   . VAL A 1 66 ? 19.413  10.749  13.579  1.00 0.00 ? 64 VAL P HB   2  
ATOM 2344  H HG11 . VAL A 1 66 ? 18.790  8.428   13.346  1.00 0.00 ? 64 VAL P HG11 2  
ATOM 2345  H HG12 . VAL A 1 66 ? 19.651  8.959   11.891  1.00 0.00 ? 64 VAL P HG12 2  
ATOM 2346  H HG13 . VAL A 1 66 ? 20.478  7.946   13.094  1.00 0.00 ? 64 VAL P HG13 2  
ATOM 2347  H HG21 . VAL A 1 66 ? 20.663  10.584  15.733  1.00 0.00 ? 64 VAL P HG21 2  
ATOM 2348  H HG22 . VAL A 1 66 ? 19.398  9.358   15.578  1.00 0.00 ? 64 VAL P HG22 2  
ATOM 2349  H HG23 . VAL A 1 66 ? 21.094  8.904   15.337  1.00 0.00 ? 64 VAL P HG23 2  
ATOM 2350  N N    . THR A 1 67 ? 23.026  12.266  14.075  1.00 0.00 ? 65 THR P N    2  
ATOM 2351  C CA   . THR A 1 67 ? 23.452  13.515  14.743  1.00 0.00 ? 65 THR P CA   2  
ATOM 2352  C C    . THR A 1 67 ? 23.894  14.633  13.783  1.00 0.00 ? 65 THR P C    2  
ATOM 2353  O O    . THR A 1 67 ? 24.117  15.765  14.222  1.00 0.00 ? 65 THR P O    2  
ATOM 2354  C CB   . THR A 1 67 ? 24.573  13.224  15.754  1.00 0.00 ? 65 THR P CB   2  
ATOM 2355  O OG1  . THR A 1 67 ? 25.604  12.471  15.141  1.00 0.00 ? 65 THR P OG1  2  
ATOM 2356  C CG2  . THR A 1 67 ? 24.063  12.410  16.946  1.00 0.00 ? 65 THR P CG2  2  
ATOM 2357  H H    . THR A 1 67 ? 23.726  11.542  14.001  1.00 0.00 ? 65 THR P H    2  
ATOM 2358  H HA   . THR A 1 67 ? 22.606  13.916  15.303  1.00 0.00 ? 65 THR P HA   2  
ATOM 2359  H HB   . THR A 1 67 ? 24.981  14.164  16.128  1.00 0.00 ? 65 THR P HB   2  
ATOM 2360  H HG1  . THR A 1 67 ? 26.344  12.422  15.773  1.00 0.00 ? 65 THR P HG1  2  
ATOM 2361  H HG21 . THR A 1 67 ? 23.698  11.437  16.618  1.00 0.00 ? 65 THR P HG21 2  
ATOM 2362  H HG22 . THR A 1 67 ? 23.253  12.951  17.436  1.00 0.00 ? 65 THR P HG22 2  
ATOM 2363  H HG23 . THR A 1 67 ? 24.870  12.267  17.664  1.00 0.00 ? 65 THR P HG23 2  
ATOM 2364  N N    . ASP A 1 68 ? 23.997  14.346  12.479  1.00 0.00 ? 66 ASP P N    2  
ATOM 2365  C CA   . ASP A 1 68 ? 24.380  15.280  11.401  1.00 0.00 ? 66 ASP P CA   2  
ATOM 2366  C C    . ASP A 1 68 ? 23.579  15.049  10.101  1.00 0.00 ? 66 ASP P C    2  
ATOM 2367  O O    . ASP A 1 68 ? 23.419  13.878  9.686   1.00 0.00 ? 66 ASP P O    2  
ATOM 2368  C CB   . ASP A 1 68 ? 25.897  15.171  11.144  1.00 0.00 ? 66 ASP P CB   2  
ATOM 2369  C CG   . ASP A 1 68 ? 26.399  16.153  10.061  1.00 0.00 ? 66 ASP P CG   2  
ATOM 2370  O OD1  . ASP A 1 68 ? 26.497  17.374  10.343  1.00 0.00 ? 66 ASP P OD1  2  
ATOM 2371  O OD2  . ASP A 1 68 ? 26.734  15.706  8.935   1.00 0.00 ? 66 ASP P OD2  2  
ATOM 2372  O OXT  . ASP A 1 68 ? 23.094  16.045  9.518   1.00 0.00 ? 66 ASP P OXT  2  
ATOM 2373  H H    . ASP A 1 68 ? 23.777  13.400  12.201  1.00 0.00 ? 66 ASP P H    2  
ATOM 2374  H HA   . ASP A 1 68 ? 24.172  16.300  11.725  1.00 0.00 ? 66 ASP P HA   2  
ATOM 2375  H HB2  . ASP A 1 68 ? 26.427  15.373  12.077  1.00 0.00 ? 66 ASP P HB2  2  
ATOM 2376  H HB3  . ASP A 1 68 ? 26.135  14.147  10.850  1.00 0.00 ? 66 ASP P HB3  2  
ATOM 2377  N N    . GLY A 1 1  ? -18.253 -13.942 -0.623  1.00 0.00 ? -1 GLY P N    3  
ATOM 2378  C CA   . GLY A 1 1  ? -17.048 -13.279 -0.077  1.00 0.00 ? -1 GLY P CA   3  
ATOM 2379  C C    . GLY A 1 1  ? -17.258 -11.780 0.087   1.00 0.00 ? -1 GLY P C    3  
ATOM 2380  O O    . GLY A 1 1  ? -18.011 -11.166 -0.673  1.00 0.00 ? -1 GLY P O    3  
ATOM 2381  H H1   . GLY A 1 1  ? -19.035 -13.820 0.001   1.00 0.00 ? -1 GLY P H1   3  
ATOM 2382  H H2   . GLY A 1 1  ? -18.084 -14.929 -0.741  1.00 0.00 ? -1 GLY P H2   3  
ATOM 2383  H H3   . GLY A 1 1  ? -18.491 -13.545 -1.519  1.00 0.00 ? -1 GLY P H3   3  
ATOM 2384  H HA2  . GLY A 1 1  ? -16.807 -13.710 0.895   1.00 0.00 ? -1 GLY P HA2  3  
ATOM 2385  H HA3  . GLY A 1 1  ? -16.207 -13.437 -0.751  1.00 0.00 ? -1 GLY P HA3  3  
ATOM 2386  N N    . SER A 1 2  ? -16.594 -11.174 1.077   1.00 0.00 ? 0  SER P N    3  
ATOM 2387  C CA   . SER A 1 2  ? -16.677 -9.728  1.362   1.00 0.00 ? 0  SER P CA   3  
ATOM 2388  C C    . SER A 1 2  ? -15.903 -8.873  0.342   1.00 0.00 ? 0  SER P C    3  
ATOM 2389  O O    . SER A 1 2  ? -14.957 -9.344  -0.295  1.00 0.00 ? 0  SER P O    3  
ATOM 2390  C CB   . SER A 1 2  ? -16.186 -9.449  2.787   1.00 0.00 ? 0  SER P CB   3  
ATOM 2391  O OG   . SER A 1 2  ? -16.519 -8.131  3.178   1.00 0.00 ? 0  SER P OG   3  
ATOM 2392  H H    . SER A 1 2  ? -15.970 -11.728 1.646   1.00 0.00 ? 0  SER P H    3  
ATOM 2393  H HA   . SER A 1 2  ? -17.726 -9.431  1.317   1.00 0.00 ? 0  SER P HA   3  
ATOM 2394  H HB2  . SER A 1 2  ? -16.665 -10.149 3.475   1.00 0.00 ? 0  SER P HB2  3  
ATOM 2395  H HB3  . SER A 1 2  ? -15.105 -9.589  2.840   1.00 0.00 ? 0  SER P HB3  3  
ATOM 2396  H HG   . SER A 1 2  ? -16.197 -8.020  4.100   1.00 0.00 ? 0  SER P HG   3  
ATOM 2397  N N    . GLN A 1 3  ? -16.300 -7.605  0.199   1.00 0.00 ? 1  GLN P N    3  
ATOM 2398  C CA   . GLN A 1 3  ? -15.673 -6.598  -0.671  1.00 0.00 ? 1  GLN P CA   3  
ATOM 2399  C C    . GLN A 1 3  ? -15.531 -5.266  0.084   1.00 0.00 ? 1  GLN P C    3  
ATOM 2400  O O    . GLN A 1 3  ? -16.456 -4.860  0.792   1.00 0.00 ? 1  GLN P O    3  
ATOM 2401  C CB   . GLN A 1 3  ? -16.502 -6.403  -1.955  1.00 0.00 ? 1  GLN P CB   3  
ATOM 2402  C CG   . GLN A 1 3  ? -16.573 -7.665  -2.835  1.00 0.00 ? 1  GLN P CG   3  
ATOM 2403  C CD   . GLN A 1 3  ? -17.341 -7.462  -4.145  1.00 0.00 ? 1  GLN P CD   3  
ATOM 2404  O OE1  . GLN A 1 3  ? -17.849 -6.395  -4.469  1.00 0.00 ? 1  GLN P OE1  3  
ATOM 2405  N NE2  . GLN A 1 3  ? -17.458 -8.489  -4.960  1.00 0.00 ? 1  GLN P NE2  3  
ATOM 2406  H H    . GLN A 1 3  ? -17.041 -7.286  0.808   1.00 0.00 ? 1  GLN P H    3  
ATOM 2407  H HA   . GLN A 1 3  ? -14.673 -6.932  -0.954  1.00 0.00 ? 1  GLN P HA   3  
ATOM 2408  H HB2  . GLN A 1 3  ? -17.514 -6.097  -1.684  1.00 0.00 ? 1  GLN P HB2  3  
ATOM 2409  H HB3  . GLN A 1 3  ? -16.046 -5.601  -2.539  1.00 0.00 ? 1  GLN P HB3  3  
ATOM 2410  H HG2  . GLN A 1 3  ? -15.561 -7.990  -3.074  1.00 0.00 ? 1  GLN P HG2  3  
ATOM 2411  H HG3  . GLN A 1 3  ? -17.065 -8.466  -2.280  1.00 0.00 ? 1  GLN P HG3  3  
ATOM 2412  H HE21 . GLN A 1 3  ? -17.053 -9.382  -4.719  1.00 0.00 ? 1  GLN P HE21 3  
ATOM 2413  H HE22 . GLN A 1 3  ? -17.965 -8.362  -5.824  1.00 0.00 ? 1  GLN P HE22 3  
ATOM 2414  N N    . ARG A 1 4  ? -14.380 -4.587  -0.056  1.00 0.00 ? 2  ARG P N    3  
ATOM 2415  C CA   . ARG A 1 4  ? -13.979 -3.316  0.606   1.00 0.00 ? 2  ARG P CA   3  
ATOM 2416  C C    . ARG A 1 4  ? -13.926 -3.319  2.152   1.00 0.00 ? 2  ARG P C    3  
ATOM 2417  O O    . ARG A 1 4  ? -13.336 -2.412  2.740   1.00 0.00 ? 2  ARG P O    3  
ATOM 2418  C CB   . ARG A 1 4  ? -14.814 -2.159  0.002   1.00 0.00 ? 2  ARG P CB   3  
ATOM 2419  C CG   . ARG A 1 4  ? -14.485 -0.735  0.486   1.00 0.00 ? 2  ARG P CG   3  
ATOM 2420  C CD   . ARG A 1 4  ? -13.017 -0.331  0.278   1.00 0.00 ? 2  ARG P CD   3  
ATOM 2421  N NE   . ARG A 1 4  ? -12.725 0.974   0.903   1.00 0.00 ? 2  ARG P NE   3  
ATOM 2422  C CZ   . ARG A 1 4  ? -12.375 1.188   2.160   1.00 0.00 ? 2  ARG P CZ   3  
ATOM 2423  N NH1  . ARG A 1 4  ? -12.270 0.226   3.034   1.00 0.00 ? 2  ARG P NH1  3  
ATOM 2424  N NH2  . ARG A 1 4  ? -12.131 2.398   2.576   1.00 0.00 ? 2  ARG P NH2  3  
ATOM 2425  H H    . ARG A 1 4  ? -13.698 -5.002  -0.678  1.00 0.00 ? 2  ARG P H    3  
ATOM 2426  H HA   . ARG A 1 4  ? -12.941 -3.143  0.315   1.00 0.00 ? 2  ARG P HA   3  
ATOM 2427  H HB2  . ARG A 1 4  ? -14.692 -2.180  -1.083  1.00 0.00 ? 2  ARG P HB2  3  
ATOM 2428  H HB3  . ARG A 1 4  ? -15.869 -2.338  0.214   1.00 0.00 ? 2  ARG P HB3  3  
ATOM 2429  H HG2  . ARG A 1 4  ? -15.116 -0.032  -0.059  1.00 0.00 ? 2  ARG P HG2  3  
ATOM 2430  H HG3  . ARG A 1 4  ? -14.743 -0.647  1.541   1.00 0.00 ? 2  ARG P HG3  3  
ATOM 2431  H HD2  . ARG A 1 4  ? -12.352 -1.086  0.696   1.00 0.00 ? 2  ARG P HD2  3  
ATOM 2432  H HD3  . ARG A 1 4  ? -12.818 -0.273  -0.794  1.00 0.00 ? 2  ARG P HD3  3  
ATOM 2433  H HE   . ARG A 1 4  ? -12.786 1.785   0.308   1.00 0.00 ? 2  ARG P HE   3  
ATOM 2434  H HH11 . ARG A 1 4  ? -12.505 -0.725  2.762   1.00 0.00 ? 2  ARG P HH11 3  
ATOM 2435  H HH12 . ARG A 1 4  ? -12.005 0.420   3.982   1.00 0.00 ? 2  ARG P HH12 3  
ATOM 2436  H HH21 . ARG A 1 4  ? -12.232 3.180   1.950   1.00 0.00 ? 2  ARG P HH21 3  
ATOM 2437  H HH22 . ARG A 1 4  ? -11.881 2.564   3.536   1.00 0.00 ? 2  ARG P HH22 3  
ATOM 2438  N N    . ARG A 1 5  ? -14.500 -4.325  2.818   1.00 0.00 ? 3  ARG P N    3  
ATOM 2439  C CA   . ARG A 1 5  ? -14.440 -4.572  4.273   1.00 0.00 ? 3  ARG P CA   3  
ATOM 2440  C C    . ARG A 1 5  ? -13.532 -5.776  4.573   1.00 0.00 ? 3  ARG P C    3  
ATOM 2441  O O    . ARG A 1 5  ? -13.205 -6.554  3.673   1.00 0.00 ? 3  ARG P O    3  
ATOM 2442  C CB   . ARG A 1 5  ? -15.866 -4.757  4.840   1.00 0.00 ? 3  ARG P CB   3  
ATOM 2443  C CG   . ARG A 1 5  ? -16.639 -3.457  5.144   1.00 0.00 ? 3  ARG P CG   3  
ATOM 2444  C CD   . ARG A 1 5  ? -16.886 -2.509  3.960   1.00 0.00 ? 3  ARG P CD   3  
ATOM 2445  N NE   . ARG A 1 5  ? -17.541 -3.192  2.827   1.00 0.00 ? 3  ARG P NE   3  
ATOM 2446  C CZ   . ARG A 1 5  ? -18.824 -3.269  2.536   1.00 0.00 ? 3  ARG P CZ   3  
ATOM 2447  N NH1  . ARG A 1 5  ? -19.750 -2.696  3.252   1.00 0.00 ? 3  ARG P NH1  3  
ATOM 2448  N NH2  . ARG A 1 5  ? -19.185 -3.949  1.489   1.00 0.00 ? 3  ARG P NH2  3  
ATOM 2449  H H    . ARG A 1 5  ? -14.955 -5.029  2.254   1.00 0.00 ? 3  ARG P H    3  
ATOM 2450  H HA   . ARG A 1 5  ? -13.981 -3.716  4.774   1.00 0.00 ? 3  ARG P HA   3  
ATOM 2451  H HB2  . ARG A 1 5  ? -16.451 -5.382  4.164   1.00 0.00 ? 3  ARG P HB2  3  
ATOM 2452  H HB3  . ARG A 1 5  ? -15.796 -5.292  5.786   1.00 0.00 ? 3  ARG P HB3  3  
ATOM 2453  H HG2  . ARG A 1 5  ? -17.607 -3.735  5.563   1.00 0.00 ? 3  ARG P HG2  3  
ATOM 2454  H HG3  . ARG A 1 5  ? -16.097 -2.904  5.913   1.00 0.00 ? 3  ARG P HG3  3  
ATOM 2455  H HD2  . ARG A 1 5  ? -17.492 -1.669  4.301   1.00 0.00 ? 3  ARG P HD2  3  
ATOM 2456  H HD3  . ARG A 1 5  ? -15.932 -2.099  3.631   1.00 0.00 ? 3  ARG P HD3  3  
ATOM 2457  H HE   . ARG A 1 5  ? -16.941 -3.704  2.193   1.00 0.00 ? 3  ARG P HE   3  
ATOM 2458  H HH11 . ARG A 1 5  ? -19.486 -2.169  4.066   1.00 0.00 ? 3  ARG P HH11 3  
ATOM 2459  H HH12 . ARG A 1 5  ? -20.720 -2.778  2.996   1.00 0.00 ? 3  ARG P HH12 3  
ATOM 2460  H HH21 . ARG A 1 5  ? -18.466 -4.406  0.942   1.00 0.00 ? 3  ARG P HH21 3  
ATOM 2461  H HH22 . ARG A 1 5  ? -20.154 -4.032  1.234   1.00 0.00 ? 3  ARG P HH22 3  
ATOM 2462  N N    . GLN A 1 6  ? -13.113 -5.913  5.836   1.00 0.00 ? 4  GLN P N    3  
ATOM 2463  C CA   . GLN A 1 6  ? -12.087 -6.871  6.284   1.00 0.00 ? 4  GLN P CA   3  
ATOM 2464  C C    . GLN A 1 6  ? -10.789 -6.755  5.440   1.00 0.00 ? 4  GLN P C    3  
ATOM 2465  O O    . GLN A 1 6  ? -10.395 -5.643  5.077   1.00 0.00 ? 4  GLN P O    3  
ATOM 2466  C CB   . GLN A 1 6  ? -12.675 -8.300  6.400   1.00 0.00 ? 4  GLN P CB   3  
ATOM 2467  C CG   . GLN A 1 6  ? -13.819 -8.437  7.426   1.00 0.00 ? 4  GLN P CG   3  
ATOM 2468  C CD   . GLN A 1 6  ? -15.202 -8.002  6.934   1.00 0.00 ? 4  GLN P CD   3  
ATOM 2469  O OE1  . GLN A 1 6  ? -15.526 -8.018  5.754   1.00 0.00 ? 4  GLN P OE1  3  
ATOM 2470  N NE2  . GLN A 1 6  ? -16.092 -7.620  7.824   1.00 0.00 ? 4  GLN P NE2  3  
ATOM 2471  H H    . GLN A 1 6  ? -13.438 -5.232  6.506   1.00 0.00 ? 4  GLN P H    3  
ATOM 2472  H HA   . GLN A 1 6  ? -11.791 -6.581  7.293   1.00 0.00 ? 4  GLN P HA   3  
ATOM 2473  H HB2  . GLN A 1 6  ? -12.999 -8.662  5.424   1.00 0.00 ? 4  GLN P HB2  3  
ATOM 2474  H HB3  . GLN A 1 6  ? -11.881 -8.962  6.748   1.00 0.00 ? 4  GLN P HB3  3  
ATOM 2475  H HG2  . GLN A 1 6  ? -13.897 -9.485  7.713   1.00 0.00 ? 4  GLN P HG2  3  
ATOM 2476  H HG3  . GLN A 1 6  ? -13.559 -7.875  8.325   1.00 0.00 ? 4  GLN P HG3  3  
ATOM 2477  H HE21 . GLN A 1 6  ? -15.864 -7.615  8.808   1.00 0.00 ? 4  GLN P HE21 3  
ATOM 2478  H HE22 . GLN A 1 6  ? -17.010 -7.359  7.499   1.00 0.00 ? 4  GLN P HE22 3  
ATOM 2479  N N    . ARG A 1 7  ? -10.092 -7.873  5.170   1.00 0.00 ? 5  ARG P N    3  
ATOM 2480  C CA   . ARG A 1 7  ? -8.784  -7.950  4.471   1.00 0.00 ? 5  ARG P CA   3  
ATOM 2481  C C    . ARG A 1 7  ? -7.655  -7.114  5.106   1.00 0.00 ? 5  ARG P C    3  
ATOM 2482  O O    . ARG A 1 7  ? -6.652  -6.837  4.452   1.00 0.00 ? 5  ARG P O    3  
ATOM 2483  C CB   . ARG A 1 7  ? -8.960  -7.700  2.949   1.00 0.00 ? 5  ARG P CB   3  
ATOM 2484  C CG   . ARG A 1 7  ? -9.771  -8.780  2.208   1.00 0.00 ? 5  ARG P CG   3  
ATOM 2485  C CD   . ARG A 1 7  ? -9.078  -10.150 2.090   1.00 0.00 ? 5  ARG P CD   3  
ATOM 2486  N NE   . ARG A 1 7  ? -7.983  -10.170 1.091   1.00 0.00 ? 5  ARG P NE   3  
ATOM 2487  C CZ   . ARG A 1 7  ? -6.682  -10.045 1.300   1.00 0.00 ? 5  ARG P CZ   3  
ATOM 2488  N NH1  . ARG A 1 7  ? -6.186  -9.743  2.465   1.00 0.00 ? 5  ARG P NH1  3  
ATOM 2489  N NH2  . ARG A 1 7  ? -5.835  -10.226 0.331   1.00 0.00 ? 5  ARG P NH2  3  
ATOM 2490  H H    . ARG A 1 7  ? -10.491 -8.744  5.494   1.00 0.00 ? 5  ARG P H    3  
ATOM 2491  H HA   . ARG A 1 7  ? -8.432  -8.972  4.602   1.00 0.00 ? 5  ARG P HA   3  
ATOM 2492  H HB2  . ARG A 1 7  ? -9.458  -6.741  2.806   1.00 0.00 ? 5  ARG P HB2  3  
ATOM 2493  H HB3  . ARG A 1 7  ? -7.987  -7.621  2.464   1.00 0.00 ? 5  ARG P HB3  3  
ATOM 2494  H HG2  . ARG A 1 7  ? -10.725 -8.916  2.721   1.00 0.00 ? 5  ARG P HG2  3  
ATOM 2495  H HG3  . ARG A 1 7  ? -9.994  -8.419  1.203   1.00 0.00 ? 5  ARG P HG3  3  
ATOM 2496  H HD2  . ARG A 1 7  ? -8.724  -10.483 3.066   1.00 0.00 ? 5  ARG P HD2  3  
ATOM 2497  H HD3  . ARG A 1 7  ? -9.831  -10.871 1.769   1.00 0.00 ? 5  ARG P HD3  3  
ATOM 2498  H HE   . ARG A 1 7  ? -8.249  -10.376 0.141   1.00 0.00 ? 5  ARG P HE   3  
ATOM 2499  H HH11 . ARG A 1 7  ? -6.802  -9.585  3.235   1.00 0.00 ? 5  ARG P HH11 3  
ATOM 2500  H HH12 . ARG A 1 7  ? -5.205  -9.501  2.550   1.00 0.00 ? 5  ARG P HH12 3  
ATOM 2501  H HH21 . ARG A 1 7  ? -6.148  -10.510 -0.594  1.00 0.00 ? 5  ARG P HH21 3  
ATOM 2502  H HH22 . ARG A 1 7  ? -4.846  -10.268 0.536   1.00 0.00 ? 5  ARG P HH22 3  
ATOM 2503  N N    . THR A 1 8  ? -7.771  -6.756  6.384   1.00 0.00 ? 6  THR P N    3  
ATOM 2504  C CA   . THR A 1 8  ? -6.708  -6.089  7.158   1.00 0.00 ? 6  THR P CA   3  
ATOM 2505  C C    . THR A 1 8  ? -5.501  -7.011  7.397   1.00 0.00 ? 6  THR P C    3  
ATOM 2506  O O    . THR A 1 8  ? -5.636  -8.240  7.406   1.00 0.00 ? 6  THR P O    3  
ATOM 2507  C CB   . THR A 1 8  ? -7.251  -5.548  8.492   1.00 0.00 ? 6  THR P CB   3  
ATOM 2508  O OG1  . THR A 1 8  ? -8.006  -6.536  9.165   1.00 0.00 ? 6  THR P OG1  3  
ATOM 2509  C CG2  . THR A 1 8  ? -8.166  -4.341  8.274   1.00 0.00 ? 6  THR P CG2  3  
ATOM 2510  H H    . THR A 1 8  ? -8.593  -7.047  6.888   1.00 0.00 ? 6  THR P H    3  
ATOM 2511  H HA   . THR A 1 8  ? -6.350  -5.237  6.579   1.00 0.00 ? 6  THR P HA   3  
ATOM 2512  H HB   . THR A 1 8  ? -6.415  -5.238  9.122   1.00 0.00 ? 6  THR P HB   3  
ATOM 2513  H HG1  . THR A 1 8  ? -8.244  -6.182  10.041  1.00 0.00 ? 6  THR P HG1  3  
ATOM 2514  H HG21 . THR A 1 8  ? -9.031  -4.623  7.673   1.00 0.00 ? 6  THR P HG21 3  
ATOM 2515  H HG22 . THR A 1 8  ? -7.616  -3.554  7.760   1.00 0.00 ? 6  THR P HG22 3  
ATOM 2516  H HG23 . THR A 1 8  ? -8.505  -3.958  9.236   1.00 0.00 ? 6  THR P HG23 3  
ATOM 2517  N N    . HIS A 1 9  ? -4.321  -6.407  7.605   1.00 0.00 ? 7  HIS P N    3  
ATOM 2518  C CA   . HIS A 1 9  ? -2.993  -7.058  7.635   1.00 0.00 ? 7  HIS P CA   3  
ATOM 2519  C C    . HIS A 1 9  ? -2.573  -7.712  6.298   1.00 0.00 ? 7  HIS P C    3  
ATOM 2520  O O    . HIS A 1 9  ? -3.396  -7.942  5.414   1.00 0.00 ? 7  HIS P O    3  
ATOM 2521  C CB   . HIS A 1 9  ? -2.874  -7.995  8.853   1.00 0.00 ? 7  HIS P CB   3  
ATOM 2522  C CG   . HIS A 1 9  ? -1.449  -8.316  9.226   1.00 0.00 ? 7  HIS P CG   3  
ATOM 2523  N ND1  . HIS A 1 9  ? -0.571  -7.441  9.872   1.00 0.00 ? 7  HIS P ND1  3  
ATOM 2524  C CD2  . HIS A 1 9  ? -0.793  -9.481  8.955   1.00 0.00 ? 7  HIS P CD2  3  
ATOM 2525  C CE1  . HIS A 1 9  ? 0.593   -8.106  9.986   1.00 0.00 ? 7  HIS P CE1  3  
ATOM 2526  N NE2  . HIS A 1 9  ? 0.487   -9.330  9.441   1.00 0.00 ? 7  HIS P NE2  3  
ATOM 2527  H H    . HIS A 1 9  ? -4.325  -5.398  7.616   1.00 0.00 ? 7  HIS P H    3  
ATOM 2528  H HA   . HIS A 1 9  ? -2.268  -6.262  7.794   1.00 0.00 ? 7  HIS P HA   3  
ATOM 2529  H HB2  . HIS A 1 9  ? -3.343  -7.521  9.714   1.00 0.00 ? 7  HIS P HB2  3  
ATOM 2530  H HB3  . HIS A 1 9  ? -3.405  -8.926  8.650   1.00 0.00 ? 7  HIS P HB3  3  
ATOM 2531  H HD2  . HIS A 1 9  ? -1.203  -10.347 8.448   1.00 0.00 ? 7  HIS P HD2  3  
ATOM 2532  H HE1  . HIS A 1 9  ? 1.490   -7.712  10.451  1.00 0.00 ? 7  HIS P HE1  3  
ATOM 2533  H HE2  . HIS A 1 9  ? 1.230   -10.022 9.410   1.00 0.00 ? 7  HIS P HE2  3  
ATOM 2534  N N    . PHE A 1 10 ? -1.270  -7.958  6.122   1.00 0.00 ? 8  PHE P N    3  
ATOM 2535  C CA   . PHE A 1 10 ? -0.668  -8.371  4.850   1.00 0.00 ? 8  PHE P CA   3  
ATOM 2536  C C    . PHE A 1 10 ? -1.050  -9.787  4.373   1.00 0.00 ? 8  PHE P C    3  
ATOM 2537  O O    . PHE A 1 10 ? -1.273  -10.705 5.165   1.00 0.00 ? 8  PHE P O    3  
ATOM 2538  C CB   . PHE A 1 10 ? 0.861   -8.290  4.965   1.00 0.00 ? 8  PHE P CB   3  
ATOM 2539  C CG   . PHE A 1 10 ? 1.437   -6.928  5.308   1.00 0.00 ? 8  PHE P CG   3  
ATOM 2540  C CD1  . PHE A 1 10 ? 1.539   -5.934  4.316   1.00 0.00 ? 8  PHE P CD1  3  
ATOM 2541  C CD2  . PHE A 1 10 ? 1.946   -6.682  6.598   1.00 0.00 ? 8  PHE P CD2  3  
ATOM 2542  C CE1  . PHE A 1 10 ? 2.178   -4.714  4.603   1.00 0.00 ? 8  PHE P CE1  3  
ATOM 2543  C CE2  . PHE A 1 10 ? 2.576   -5.460  6.888   1.00 0.00 ? 8  PHE P CE2  3  
ATOM 2544  C CZ   . PHE A 1 10 ? 2.708   -4.484  5.885   1.00 0.00 ? 8  PHE P CZ   3  
ATOM 2545  H H    . PHE A 1 10 ? -0.633  -7.779  6.883   1.00 0.00 ? 8  PHE P H    3  
ATOM 2546  H HA   . PHE A 1 10 ? -0.989  -7.666  4.081   1.00 0.00 ? 8  PHE P HA   3  
ATOM 2547  H HB2  . PHE A 1 10 ? 1.192   -9.013  5.714   1.00 0.00 ? 8  PHE P HB2  3  
ATOM 2548  H HB3  . PHE A 1 10 ? 1.293   -8.601  4.016   1.00 0.00 ? 8  PHE P HB3  3  
ATOM 2549  H HD1  . PHE A 1 10 ? 1.158   -6.117  3.321   1.00 0.00 ? 8  PHE P HD1  3  
ATOM 2550  H HD2  . PHE A 1 10 ? 1.879   -7.443  7.363   1.00 0.00 ? 8  PHE P HD2  3  
ATOM 2551  H HE1  . PHE A 1 10 ? 2.278   -3.960  3.834   1.00 0.00 ? 8  PHE P HE1  3  
ATOM 2552  H HE2  . PHE A 1 10 ? 2.982   -5.279  7.874   1.00 0.00 ? 8  PHE P HE2  3  
ATOM 2553  H HZ   . PHE A 1 10 ? 3.220   -3.556  6.100   1.00 0.00 ? 8  PHE P HZ   3  
ATOM 2554  N N    . THR A 1 11 ? -1.016  -9.959  3.048   1.00 0.00 ? 9  THR P N    3  
ATOM 2555  C CA   . THR A 1 11 ? -1.095  -11.225 2.293   1.00 0.00 ? 9  THR P CA   3  
ATOM 2556  C C    . THR A 1 11 ? -0.225  -11.103 1.040   1.00 0.00 ? 9  THR P C    3  
ATOM 2557  O O    . THR A 1 11 ? 0.161   -9.993  0.664   1.00 0.00 ? 9  THR P O    3  
ATOM 2558  C CB   . THR A 1 11 ? -2.525  -11.575 1.846   1.00 0.00 ? 9  THR P CB   3  
ATOM 2559  O OG1  . THR A 1 11 ? -3.040  -10.550 1.024   1.00 0.00 ? 9  THR P OG1  3  
ATOM 2560  C CG2  . THR A 1 11 ? -3.498  -11.788 3.001   1.00 0.00 ? 9  THR P CG2  3  
ATOM 2561  H H    . THR A 1 11 ? -0.800  -9.145  2.489   1.00 0.00 ? 9  THR P H    3  
ATOM 2562  H HA   . THR A 1 11 ? -0.707  -12.044 2.901   1.00 0.00 ? 9  THR P HA   3  
ATOM 2563  H HB   . THR A 1 11 ? -2.496  -12.496 1.264   1.00 0.00 ? 9  THR P HB   3  
ATOM 2564  H HG1  . THR A 1 11 ? -3.064  -9.749  1.589   1.00 0.00 ? 9  THR P HG1  3  
ATOM 2565  H HG21 . THR A 1 11 ? -4.464  -12.105 2.608   1.00 0.00 ? 9  THR P HG21 3  
ATOM 2566  H HG22 . THR A 1 11 ? -3.622  -10.867 3.572   1.00 0.00 ? 9  THR P HG22 3  
ATOM 2567  H HG23 . THR A 1 11 ? -3.116  -12.567 3.660   1.00 0.00 ? 9  THR P HG23 3  
ATOM 2568  N N    . SER A 1 12 ? 0.049   -12.209 0.341   1.00 0.00 ? 10 SER P N    3  
ATOM 2569  C CA   . SER A 1 12 ? 0.800   -12.205 -0.926  1.00 0.00 ? 10 SER P CA   3  
ATOM 2570  C C    . SER A 1 12 ? 0.223   -11.245 -1.979  1.00 0.00 ? 10 SER P C    3  
ATOM 2571  O O    . SER A 1 12 ? 0.985   -10.602 -2.698  1.00 0.00 ? 10 SER P O    3  
ATOM 2572  C CB   . SER A 1 12 ? 0.853   -13.628 -1.497  1.00 0.00 ? 10 SER P CB   3  
ATOM 2573  O OG   . SER A 1 12 ? -0.455  -14.164 -1.635  1.00 0.00 ? 10 SER P OG   3  
ATOM 2574  H H    . SER A 1 12 ? -0.311  -13.096 0.664   1.00 0.00 ? 10 SER P H    3  
ATOM 2575  H HA   . SER A 1 12 ? 1.823   -11.889 -0.723  1.00 0.00 ? 10 SER P HA   3  
ATOM 2576  H HB2  . SER A 1 12 ? 1.353   -13.612 -2.467  1.00 0.00 ? 10 SER P HB2  3  
ATOM 2577  H HB3  . SER A 1 12 ? 1.431   -14.260 -0.820  1.00 0.00 ? 10 SER P HB3  3  
ATOM 2578  H HG   . SER A 1 12 ? -0.380  -15.073 -1.987  1.00 0.00 ? 10 SER P HG   3  
ATOM 2579  N N    . GLN A 1 13 ? -1.102  -11.067 -2.021  1.00 0.00 ? 11 GLN P N    3  
ATOM 2580  C CA   . GLN A 1 13 ? -1.792  -10.127 -2.918  1.00 0.00 ? 11 GLN P CA   3  
ATOM 2581  C C    . GLN A 1 13 ? -1.446  -8.662  -2.605  1.00 0.00 ? 11 GLN P C    3  
ATOM 2582  O O    . GLN A 1 13 ? -1.119  -7.882  -3.500  1.00 0.00 ? 11 GLN P O    3  
ATOM 2583  C CB   . GLN A 1 13 ? -3.312  -10.329 -2.786  1.00 0.00 ? 11 GLN P CB   3  
ATOM 2584  C CG   . GLN A 1 13 ? -3.782  -11.708 -3.277  1.00 0.00 ? 11 GLN P CG   3  
ATOM 2585  C CD   . GLN A 1 13 ? -5.281  -11.948 -3.062  1.00 0.00 ? 11 GLN P CD   3  
ATOM 2586  O OE1  . GLN A 1 13 ? -5.975  -11.246 -2.333  1.00 0.00 ? 11 GLN P OE1  3  
ATOM 2587  N NE2  . GLN A 1 13 ? -5.841  -12.971 -3.672  1.00 0.00 ? 11 GLN P NE2  3  
ATOM 2588  H H    . GLN A 1 13 ? -1.662  -11.635 -1.402  1.00 0.00 ? 11 GLN P H    3  
ATOM 2589  H HA   . GLN A 1 13 ? -1.497  -10.328 -3.949  1.00 0.00 ? 11 GLN P HA   3  
ATOM 2590  H HB2  . GLN A 1 13 ? -3.596  -10.203 -1.741  1.00 0.00 ? 11 GLN P HB2  3  
ATOM 2591  H HB3  . GLN A 1 13 ? -3.822  -9.563  -3.373  1.00 0.00 ? 11 GLN P HB3  3  
ATOM 2592  H HG2  . GLN A 1 13 ? -3.553  -11.793 -4.341  1.00 0.00 ? 11 GLN P HG2  3  
ATOM 2593  H HG3  . GLN A 1 13 ? -3.235  -12.492 -2.754  1.00 0.00 ? 11 GLN P HG3  3  
ATOM 2594  H HE21 . GLN A 1 13 ? -5.295  -13.572 -4.271  1.00 0.00 ? 11 GLN P HE21 3  
ATOM 2595  H HE22 . GLN A 1 13 ? -6.827  -13.132 -3.527  1.00 0.00 ? 11 GLN P HE22 3  
ATOM 2596  N N    . GLN A 1 14 ? -1.487  -8.288  -1.323  1.00 0.00 ? 12 GLN P N    3  
ATOM 2597  C CA   . GLN A 1 14 ? -1.255  -6.914  -0.860  1.00 0.00 ? 12 GLN P CA   3  
ATOM 2598  C C    . GLN A 1 14 ? 0.239   -6.555  -0.891  1.00 0.00 ? 12 GLN P C    3  
ATOM 2599  O O    . GLN A 1 14 ? 0.607   -5.433  -1.238  1.00 0.00 ? 12 GLN P O    3  
ATOM 2600  C CB   . GLN A 1 14 ? -1.838  -6.768  0.553   1.00 0.00 ? 12 GLN P CB   3  
ATOM 2601  C CG   . GLN A 1 14 ? -3.369  -6.922  0.571   1.00 0.00 ? 12 GLN P CG   3  
ATOM 2602  C CD   . GLN A 1 14 ? -3.871  -7.275  1.962   1.00 0.00 ? 12 GLN P CD   3  
ATOM 2603  O OE1  . GLN A 1 14 ? -3.685  -8.389  2.429   1.00 0.00 ? 12 GLN P OE1  3  
ATOM 2604  N NE2  . GLN A 1 14 ? -4.534  -6.394  2.659   1.00 0.00 ? 12 GLN P NE2  3  
ATOM 2605  H H    . GLN A 1 14 ? -1.705  -8.997  -0.634  1.00 0.00 ? 12 GLN P H    3  
ATOM 2606  H HA   . GLN A 1 14 ? -1.772  -6.215  -1.521  1.00 0.00 ? 12 GLN P HA   3  
ATOM 2607  H HB2  . GLN A 1 14 ? -1.386  -7.524  1.198   1.00 0.00 ? 12 GLN P HB2  3  
ATOM 2608  H HB3  . GLN A 1 14 ? -1.585  -5.785  0.950   1.00 0.00 ? 12 GLN P HB3  3  
ATOM 2609  H HG2  . GLN A 1 14 ? -3.834  -6.002  0.220   1.00 0.00 ? 12 GLN P HG2  3  
ATOM 2610  H HG3  . GLN A 1 14 ? -3.685  -7.724  -0.096  1.00 0.00 ? 12 GLN P HG3  3  
ATOM 2611  H HE21 . GLN A 1 14 ? -4.829  -5.525  2.228   1.00 0.00 ? 12 GLN P HE21 3  
ATOM 2612  H HE22 . GLN A 1 14 ? -4.958  -6.694  3.530   1.00 0.00 ? 12 GLN P HE22 3  
ATOM 2613  N N    . LEU A 1 15 ? 1.106   -7.531  -0.602  1.00 0.00 ? 13 LEU P N    3  
ATOM 2614  C CA   . LEU A 1 15 ? 2.559   -7.406  -0.729  1.00 0.00 ? 13 LEU P CA   3  
ATOM 2615  C C    . LEU A 1 15 ? 2.980   -7.286  -2.206  1.00 0.00 ? 13 LEU P C    3  
ATOM 2616  O O    . LEU A 1 15 ? 3.831   -6.456  -2.527  1.00 0.00 ? 13 LEU P O    3  
ATOM 2617  C CB   . LEU A 1 15 ? 3.226   -8.604  -0.025  1.00 0.00 ? 13 LEU P CB   3  
ATOM 2618  C CG   . LEU A 1 15 ? 3.003   -8.639  1.503   1.00 0.00 ? 13 LEU P CG   3  
ATOM 2619  C CD1  . LEU A 1 15 ? 3.409   -9.999  2.073   1.00 0.00 ? 13 LEU P CD1  3  
ATOM 2620  C CD2  . LEU A 1 15 ? 3.808   -7.568  2.238   1.00 0.00 ? 13 LEU P CD2  3  
ATOM 2621  H H    . LEU A 1 15 ? 0.731   -8.425  -0.301  1.00 0.00 ? 13 LEU P H    3  
ATOM 2622  H HA   . LEU A 1 15 ? 2.880   -6.487  -0.236  1.00 0.00 ? 13 LEU P HA   3  
ATOM 2623  H HB2  . LEU A 1 15 ? 2.830   -9.522  -0.464  1.00 0.00 ? 13 LEU P HB2  3  
ATOM 2624  H HB3  . LEU A 1 15 ? 4.299   -8.581  -0.222  1.00 0.00 ? 13 LEU P HB3  3  
ATOM 2625  H HG   . LEU A 1 15 ? 1.951   -8.482  1.727   1.00 0.00 ? 13 LEU P HG   3  
ATOM 2626  H HD11 . LEU A 1 15 ? 4.467   -10.183 1.890   1.00 0.00 ? 13 LEU P HD11 3  
ATOM 2627  H HD12 . LEU A 1 15 ? 2.819   -10.784 1.602   1.00 0.00 ? 13 LEU P HD12 3  
ATOM 2628  H HD13 . LEU A 1 15 ? 3.217   -10.019 3.146   1.00 0.00 ? 13 LEU P HD13 3  
ATOM 2629  H HD21 . LEU A 1 15 ? 3.500   -6.577  1.911   1.00 0.00 ? 13 LEU P HD21 3  
ATOM 2630  H HD22 . LEU A 1 15 ? 4.872   -7.708  2.051   1.00 0.00 ? 13 LEU P HD22 3  
ATOM 2631  H HD23 . LEU A 1 15 ? 3.624   -7.645  3.311   1.00 0.00 ? 13 LEU P HD23 3  
ATOM 2632  N N    . GLN A 1 16 ? 2.339   -8.023  -3.123  1.00 0.00 ? 14 GLN P N    3  
ATOM 2633  C CA   . GLN A 1 16 ? 2.558   -7.874  -4.570  1.00 0.00 ? 14 GLN P CA   3  
ATOM 2634  C C    . GLN A 1 16 ? 2.097   -6.497  -5.081  1.00 0.00 ? 14 GLN P C    3  
ATOM 2635  O O    . GLN A 1 16 ? 2.779   -5.897  -5.910  1.00 0.00 ? 14 GLN P O    3  
ATOM 2636  C CB   . GLN A 1 16 ? 1.857   -9.024  -5.311  1.00 0.00 ? 14 GLN P CB   3  
ATOM 2637  C CG   . GLN A 1 16 ? 2.121   -9.026  -6.824  1.00 0.00 ? 14 GLN P CG   3  
ATOM 2638  C CD   . GLN A 1 16 ? 1.422   -10.198 -7.513  1.00 0.00 ? 14 GLN P CD   3  
ATOM 2639  O OE1  . GLN A 1 16 ? 0.378   -10.057 -8.138  1.00 0.00 ? 14 GLN P OE1  3  
ATOM 2640  N NE2  . GLN A 1 16 ? 1.954   -11.401 -7.423  1.00 0.00 ? 14 GLN P NE2  3  
ATOM 2641  H H    . GLN A 1 16 ? 1.673   -8.724  -2.815  1.00 0.00 ? 14 GLN P H    3  
ATOM 2642  H HA   . GLN A 1 16 ? 3.629   -7.952  -4.762  1.00 0.00 ? 14 GLN P HA   3  
ATOM 2643  H HB2  . GLN A 1 16 ? 2.222   -9.969  -4.905  1.00 0.00 ? 14 GLN P HB2  3  
ATOM 2644  H HB3  . GLN A 1 16 ? 0.782   -8.966  -5.140  1.00 0.00 ? 14 GLN P HB3  3  
ATOM 2645  H HG2  . GLN A 1 16 ? 1.756   -8.099  -7.265  1.00 0.00 ? 14 GLN P HG2  3  
ATOM 2646  H HG3  . GLN A 1 16 ? 3.195   -9.094  -7.004  1.00 0.00 ? 14 GLN P HG3  3  
ATOM 2647  H HE21 . GLN A 1 16 ? 2.810   -11.545 -6.908  1.00 0.00 ? 14 GLN P HE21 3  
ATOM 2648  H HE22 . GLN A 1 16 ? 1.479   -12.170 -7.872  1.00 0.00 ? 14 GLN P HE22 3  
ATOM 2649  N N    . GLU A 1 17 ? 0.991   -5.952  -4.564  1.00 0.00 ? 15 GLU P N    3  
ATOM 2650  C CA   . GLU A 1 17 ? 0.532   -4.595  -4.904  1.00 0.00 ? 15 GLU P CA   3  
ATOM 2651  C C    . GLU A 1 17 ? 1.507   -3.510  -4.401  1.00 0.00 ? 15 GLU P C    3  
ATOM 2652  O O    . GLU A 1 17 ? 1.749   -2.521  -5.094  1.00 0.00 ? 15 GLU P O    3  
ATOM 2653  C CB   . GLU A 1 17 ? -0.885  -4.383  -4.347  1.00 0.00 ? 15 GLU P CB   3  
ATOM 2654  C CG   . GLU A 1 17 ? -1.614  -3.171  -4.948  1.00 0.00 ? 15 GLU P CG   3  
ATOM 2655  C CD   . GLU A 1 17 ? -2.013  -3.412  -6.420  1.00 0.00 ? 15 GLU P CD   3  
ATOM 2656  O OE1  . GLU A 1 17 ? -3.089  -4.012  -6.669  1.00 0.00 ? 15 GLU P OE1  3  
ATOM 2657  O OE2  . GLU A 1 17 ? -1.267  -2.999  -7.336  1.00 0.00 ? 15 GLU P OE2  3  
ATOM 2658  H H    . GLU A 1 17 ? 0.422   -6.512  -3.939  1.00 0.00 ? 15 GLU P H    3  
ATOM 2659  H HA   . GLU A 1 17 ? 0.491   -4.515  -5.990  1.00 0.00 ? 15 GLU P HA   3  
ATOM 2660  H HB2  . GLU A 1 17 ? -1.488  -5.270  -4.541  1.00 0.00 ? 15 GLU P HB2  3  
ATOM 2661  H HB3  . GLU A 1 17 ? -0.821  -4.253  -3.266  1.00 0.00 ? 15 GLU P HB3  3  
ATOM 2662  H HG2  . GLU A 1 17 ? -2.516  -2.988  -4.360  1.00 0.00 ? 15 GLU P HG2  3  
ATOM 2663  H HG3  . GLU A 1 17 ? -0.988  -2.281  -4.858  1.00 0.00 ? 15 GLU P HG3  3  
ATOM 2664  N N    . LEU A 1 18 ? 2.135   -3.709  -3.235  1.00 0.00 ? 16 LEU P N    3  
ATOM 2665  C CA   . LEU A 1 18 ? 3.199   -2.833  -2.729  1.00 0.00 ? 16 LEU P CA   3  
ATOM 2666  C C    . LEU A 1 18 ? 4.499   -2.942  -3.545  1.00 0.00 ? 16 LEU P C    3  
ATOM 2667  O O    . LEU A 1 18 ? 5.127   -1.917  -3.808  1.00 0.00 ? 16 LEU P O    3  
ATOM 2668  C CB   . LEU A 1 18 ? 3.419   -3.110  -1.232  1.00 0.00 ? 16 LEU P CB   3  
ATOM 2669  C CG   . LEU A 1 18 ? 2.462   -2.282  -0.353  1.00 0.00 ? 16 LEU P CG   3  
ATOM 2670  C CD1  . LEU A 1 18 ? 2.281   -2.939  1.015   1.00 0.00 ? 16 LEU P CD1  3  
ATOM 2671  C CD2  . LEU A 1 18 ? 2.996   -0.865  -0.132  1.00 0.00 ? 16 LEU P CD2  3  
ATOM 2672  H H    . LEU A 1 18 ? 1.867   -4.513  -2.679  1.00 0.00 ? 16 LEU P H    3  
ATOM 2673  H HA   . LEU A 1 18 ? 2.868   -1.801  -2.837  1.00 0.00 ? 16 LEU P HA   3  
ATOM 2674  H HB2  . LEU A 1 18 ? 3.283   -4.174  -1.038  1.00 0.00 ? 16 LEU P HB2  3  
ATOM 2675  H HB3  . LEU A 1 18 ? 4.444   -2.857  -0.964  1.00 0.00 ? 16 LEU P HB3  3  
ATOM 2676  H HG   . LEU A 1 18 ? 1.489   -2.206  -0.840  1.00 0.00 ? 16 LEU P HG   3  
ATOM 2677  H HD11 . LEU A 1 18 ? 3.244   -3.038  1.511   1.00 0.00 ? 16 LEU P HD11 3  
ATOM 2678  H HD12 . LEU A 1 18 ? 1.838   -3.927  0.889   1.00 0.00 ? 16 LEU P HD12 3  
ATOM 2679  H HD13 . LEU A 1 18 ? 1.617   -2.333  1.630   1.00 0.00 ? 16 LEU P HD13 3  
ATOM 2680  H HD21 . LEU A 1 18 ? 3.103   -0.353  -1.087  1.00 0.00 ? 16 LEU P HD21 3  
ATOM 2681  H HD22 . LEU A 1 18 ? 3.965   -0.900  0.364   1.00 0.00 ? 16 LEU P HD22 3  
ATOM 2682  H HD23 . LEU A 1 18 ? 2.298   -0.307  0.487   1.00 0.00 ? 16 LEU P HD23 3  
ATOM 2683  N N    . GLU A 1 19 ? 4.872   -4.126  -4.045  1.00 0.00 ? 17 GLU P N    3  
ATOM 2684  C CA   . GLU A 1 19 ? 5.977   -4.253  -5.009  1.00 0.00 ? 17 GLU P CA   3  
ATOM 2685  C C    . GLU A 1 19 ? 5.654   -3.593  -6.361  1.00 0.00 ? 17 GLU P C    3  
ATOM 2686  O O    . GLU A 1 19 ? 6.509   -2.908  -6.925  1.00 0.00 ? 17 GLU P O    3  
ATOM 2687  C CB   . GLU A 1 19 ? 6.383   -5.720  -5.225  1.00 0.00 ? 17 GLU P CB   3  
ATOM 2688  C CG   . GLU A 1 19 ? 7.071   -6.324  -3.996  1.00 0.00 ? 17 GLU P CG   3  
ATOM 2689  C CD   . GLU A 1 19 ? 7.886   -7.573  -4.375  1.00 0.00 ? 17 GLU P CD   3  
ATOM 2690  O OE1  . GLU A 1 19 ? 7.297   -8.660  -4.584  1.00 0.00 ? 17 GLU P OE1  3  
ATOM 2691  O OE2  . GLU A 1 19 ? 9.135   -7.460  -4.455  1.00 0.00 ? 17 GLU P OE2  3  
ATOM 2692  H H    . GLU A 1 19 ? 4.367   -4.957  -3.755  1.00 0.00 ? 17 GLU P H    3  
ATOM 2693  H HA   . GLU A 1 19 ? 6.846   -3.725  -4.613  1.00 0.00 ? 17 GLU P HA   3  
ATOM 2694  H HB2  . GLU A 1 19 ? 5.512   -6.319  -5.493  1.00 0.00 ? 17 GLU P HB2  3  
ATOM 2695  H HB3  . GLU A 1 19 ? 7.089   -5.753  -6.056  1.00 0.00 ? 17 GLU P HB3  3  
ATOM 2696  H HG2  . GLU A 1 19 ? 7.741   -5.576  -3.567  1.00 0.00 ? 17 GLU P HG2  3  
ATOM 2697  H HG3  . GLU A 1 19 ? 6.329   -6.574  -3.238  1.00 0.00 ? 17 GLU P HG3  3  
ATOM 2698  N N    . ALA A 1 20 ? 4.417   -3.725  -6.856  1.00 0.00 ? 18 ALA P N    3  
ATOM 2699  C CA   . ALA A 1 20 ? 3.946   -3.046  -8.066  1.00 0.00 ? 18 ALA P CA   3  
ATOM 2700  C C    . ALA A 1 20 ? 3.949   -1.510  -7.906  1.00 0.00 ? 18 ALA P C    3  
ATOM 2701  O O    . ALA A 1 20 ? 4.324   -0.787  -8.833  1.00 0.00 ? 18 ALA P O    3  
ATOM 2702  C CB   . ALA A 1 20 ? 2.554   -3.582  -8.422  1.00 0.00 ? 18 ALA P CB   3  
ATOM 2703  H H    . ALA A 1 20 ? 3.769   -4.337  -6.372  1.00 0.00 ? 18 ALA P H    3  
ATOM 2704  H HA   . ALA A 1 20 ? 4.614   -3.302  -8.887  1.00 0.00 ? 18 ALA P HA   3  
ATOM 2705  H HB1  . ALA A 1 20 ? 2.217   -3.131  -9.355  1.00 0.00 ? 18 ALA P HB1  3  
ATOM 2706  H HB2  . ALA A 1 20 ? 2.594   -4.664  -8.547  1.00 0.00 ? 18 ALA P HB2  3  
ATOM 2707  H HB3  . ALA A 1 20 ? 1.842   -3.337  -7.634  1.00 0.00 ? 18 ALA P HB3  3  
ATOM 2708  N N    . THR A 1 21 ? 3.613   -1.017  -6.710  1.00 0.00 ? 19 THR P N    3  
ATOM 2709  C CA   . THR A 1 21 ? 3.722   0.399   -6.321  1.00 0.00 ? 19 THR P CA   3  
ATOM 2710  C C    . THR A 1 21 ? 5.187   0.852   -6.290  1.00 0.00 ? 19 THR P C    3  
ATOM 2711  O O    . THR A 1 21 ? 5.528   1.871   -6.890  1.00 0.00 ? 19 THR P O    3  
ATOM 2712  C CB   . THR A 1 21 ? 3.053   0.626   -4.951  1.00 0.00 ? 19 THR P CB   3  
ATOM 2713  O OG1  . THR A 1 21 ? 1.684   0.283   -5.010  1.00 0.00 ? 19 THR P OG1  3  
ATOM 2714  C CG2  . THR A 1 21 ? 3.103   2.073   -4.465  1.00 0.00 ? 19 THR P CG2  3  
ATOM 2715  H H    . THR A 1 21 ? 3.257   -1.673  -6.024  1.00 0.00 ? 19 THR P H    3  
ATOM 2716  H HA   . THR A 1 21 ? 3.201   1.012   -7.057  1.00 0.00 ? 19 THR P HA   3  
ATOM 2717  H HB   . THR A 1 21 ? 3.539   0.001   -4.204  1.00 0.00 ? 19 THR P HB   3  
ATOM 2718  H HG1  . THR A 1 21 ? 1.629   -0.687  -5.105  1.00 0.00 ? 19 THR P HG1  3  
ATOM 2719  H HG21 . THR A 1 21 ? 4.135   2.401   -4.349  1.00 0.00 ? 19 THR P HG21 3  
ATOM 2720  H HG22 . THR A 1 21 ? 2.615   2.127   -3.492  1.00 0.00 ? 19 THR P HG22 3  
ATOM 2721  H HG23 . THR A 1 21 ? 2.586   2.724   -5.170  1.00 0.00 ? 19 THR P HG23 3  
ATOM 2722  N N    . PHE A 1 22 ? 6.077   0.071   -5.670  1.00 0.00 ? 20 PHE P N    3  
ATOM 2723  C CA   . PHE A 1 22 ? 7.507   0.380   -5.549  1.00 0.00 ? 20 PHE P CA   3  
ATOM 2724  C C    . PHE A 1 22 ? 8.219   0.446   -6.911  1.00 0.00 ? 20 PHE P C    3  
ATOM 2725  O O    . PHE A 1 22 ? 8.980   1.383   -7.156  1.00 0.00 ? 20 PHE P O    3  
ATOM 2726  C CB   . PHE A 1 22 ? 8.149   -0.663  -4.621  1.00 0.00 ? 20 PHE P CB   3  
ATOM 2727  C CG   . PHE A 1 22 ? 9.618   -0.441  -4.311  1.00 0.00 ? 20 PHE P CG   3  
ATOM 2728  C CD1  . PHE A 1 22 ? 10.003  0.485   -3.323  1.00 0.00 ? 20 PHE P CD1  3  
ATOM 2729  C CD2  . PHE A 1 22 ? 10.604  -1.185  -4.990  1.00 0.00 ? 20 PHE P CD2  3  
ATOM 2730  C CE1  . PHE A 1 22 ? 11.362  0.659   -3.006  1.00 0.00 ? 20 PHE P CE1  3  
ATOM 2731  C CE2  . PHE A 1 22 ? 11.963  -1.014  -4.669  1.00 0.00 ? 20 PHE P CE2  3  
ATOM 2732  C CZ   . PHE A 1 22 ? 12.342  -0.096  -3.674  1.00 0.00 ? 20 PHE P CZ   3  
ATOM 2733  H H    . PHE A 1 22 ? 5.736   -0.754  -5.186  1.00 0.00 ? 20 PHE P H    3  
ATOM 2734  H HA   . PHE A 1 22 ? 7.610   1.361   -5.081  1.00 0.00 ? 20 PHE P HA   3  
ATOM 2735  H HB2  . PHE A 1 22 ? 7.603   -0.668  -3.680  1.00 0.00 ? 20 PHE P HB2  3  
ATOM 2736  H HB3  . PHE A 1 22 ? 8.030   -1.652  -5.065  1.00 0.00 ? 20 PHE P HB3  3  
ATOM 2737  H HD1  . PHE A 1 22 ? 9.254   1.065   -2.803  1.00 0.00 ? 20 PHE P HD1  3  
ATOM 2738  H HD2  . PHE A 1 22 ? 10.316  -1.883  -5.764  1.00 0.00 ? 20 PHE P HD2  3  
ATOM 2739  H HE1  . PHE A 1 22 ? 11.655  1.371   -2.245  1.00 0.00 ? 20 PHE P HE1  3  
ATOM 2740  H HE2  . PHE A 1 22 ? 12.720  -1.583  -5.195  1.00 0.00 ? 20 PHE P HE2  3  
ATOM 2741  H HZ   . PHE A 1 22 ? 13.387  0.034   -3.427  1.00 0.00 ? 20 PHE P HZ   3  
ATOM 2742  N N    . GLN A 1 23 ? 7.940   -0.483  -7.836  1.00 0.00 ? 21 GLN P N    3  
ATOM 2743  C CA   . GLN A 1 23 ? 8.535   -0.459  -9.184  1.00 0.00 ? 21 GLN P CA   3  
ATOM 2744  C C    . GLN A 1 23 ? 7.962   0.646   -10.096 1.00 0.00 ? 21 GLN P C    3  
ATOM 2745  O O    . GLN A 1 23 ? 8.613   1.023   -11.074 1.00 0.00 ? 21 GLN P O    3  
ATOM 2746  C CB   . GLN A 1 23 ? 8.509   -1.861  -9.823  1.00 0.00 ? 21 GLN P CB   3  
ATOM 2747  C CG   . GLN A 1 23 ? 7.124   -2.406  -10.208 1.00 0.00 ? 21 GLN P CG   3  
ATOM 2748  C CD   . GLN A 1 23 ? 6.561   -1.843  -11.515 1.00 0.00 ? 21 GLN P CD   3  
ATOM 2749  O OE1  . GLN A 1 23 ? 7.125   -1.999  -12.590 1.00 0.00 ? 21 GLN P OE1  3  
ATOM 2750  N NE2  . GLN A 1 23 ? 5.425   -1.178  -11.481 1.00 0.00 ? 21 GLN P NE2  3  
ATOM 2751  H H    . GLN A 1 23 ? 7.341   -1.263  -7.575  1.00 0.00 ? 21 GLN P H    3  
ATOM 2752  H HA   . GLN A 1 23 ? 9.590   -0.213  -9.057  1.00 0.00 ? 21 GLN P HA   3  
ATOM 2753  H HB2  . GLN A 1 23 ? 9.147   -1.859  -10.708 1.00 0.00 ? 21 GLN P HB2  3  
ATOM 2754  H HB3  . GLN A 1 23 ? 8.955   -2.558  -9.111  1.00 0.00 ? 21 GLN P HB3  3  
ATOM 2755  H HG2  . GLN A 1 23 ? 7.193   -3.488  -10.319 1.00 0.00 ? 21 GLN P HG2  3  
ATOM 2756  H HG3  . GLN A 1 23 ? 6.433   -2.205  -9.398  1.00 0.00 ? 21 GLN P HG3  3  
ATOM 2757  H HE21 . GLN A 1 23 ? 4.952   -1.015  -10.597 1.00 0.00 ? 21 GLN P HE21 3  
ATOM 2758  H HE22 . GLN A 1 23 ? 5.057   -0.816  -12.347 1.00 0.00 ? 21 GLN P HE22 3  
ATOM 2759  N N    . ARG A 1 24 ? 6.786   1.206   -9.766  1.00 0.00 ? 22 ARG P N    3  
ATOM 2760  C CA   . ARG A 1 24 ? 6.231   2.410   -10.416 1.00 0.00 ? 22 ARG P CA   3  
ATOM 2761  C C    . ARG A 1 24 ? 6.910   3.674   -9.880  1.00 0.00 ? 22 ARG P C    3  
ATOM 2762  O O    . ARG A 1 24 ? 7.368   4.511   -10.658 1.00 0.00 ? 22 ARG P O    3  
ATOM 2763  C CB   . ARG A 1 24 ? 4.704   2.456   -10.212 1.00 0.00 ? 22 ARG P CB   3  
ATOM 2764  C CG   . ARG A 1 24 ? 4.037   3.587   -11.012 1.00 0.00 ? 22 ARG P CG   3  
ATOM 2765  C CD   . ARG A 1 24 ? 2.562   3.734   -10.617 1.00 0.00 ? 22 ARG P CD   3  
ATOM 2766  N NE   . ARG A 1 24 ? 1.873   4.738   -11.451 1.00 0.00 ? 22 ARG P NE   3  
ATOM 2767  C CZ   . ARG A 1 24 ? 1.856   6.052   -11.288 1.00 0.00 ? 22 ARG P CZ   3  
ATOM 2768  N NH1  . ARG A 1 24 ? 2.499   6.657   -10.330 1.00 0.00 ? 22 ARG P NH1  3  
ATOM 2769  N NH2  . ARG A 1 24 ? 1.175   6.799   -12.108 1.00 0.00 ? 22 ARG P NH2  3  
ATOM 2770  H H    . ARG A 1 24 ? 6.291   0.825   -8.968  1.00 0.00 ? 22 ARG P H    3  
ATOM 2771  H HA   . ARG A 1 24 ? 6.435   2.365   -11.488 1.00 0.00 ? 22 ARG P HA   3  
ATOM 2772  H HB2  . ARG A 1 24 ? 4.270   1.507   -10.533 1.00 0.00 ? 22 ARG P HB2  3  
ATOM 2773  H HB3  . ARG A 1 24 ? 4.481   2.592   -9.154  1.00 0.00 ? 22 ARG P HB3  3  
ATOM 2774  H HG2  . ARG A 1 24 ? 4.543   4.534   -10.819 1.00 0.00 ? 22 ARG P HG2  3  
ATOM 2775  H HG3  . ARG A 1 24 ? 4.110   3.363   -12.077 1.00 0.00 ? 22 ARG P HG3  3  
ATOM 2776  H HD2  . ARG A 1 24 ? 2.067   2.770   -10.746 1.00 0.00 ? 22 ARG P HD2  3  
ATOM 2777  H HD3  . ARG A 1 24 ? 2.492   4.007   -9.563  1.00 0.00 ? 22 ARG P HD3  3  
ATOM 2778  H HE   . ARG A 1 24 ? 1.339   4.384   -12.230 1.00 0.00 ? 22 ARG P HE   3  
ATOM 2779  H HH11 . ARG A 1 24 ? 3.060   6.123   -9.673  1.00 0.00 ? 22 ARG P HH11 3  
ATOM 2780  H HH12 . ARG A 1 24 ? 2.459   7.656   -10.241 1.00 0.00 ? 22 ARG P HH12 3  
ATOM 2781  H HH21 . ARG A 1 24 ? 0.661   6.382   -12.868 1.00 0.00 ? 22 ARG P HH21 3  
ATOM 2782  H HH22 . ARG A 1 24 ? 1.160   7.799   -11.992 1.00 0.00 ? 22 ARG P HH22 3  
ATOM 2783  N N    . ASN A 1 25 ? 6.984   3.794   -8.553  1.00 0.00 ? 23 ASN P N    3  
ATOM 2784  C CA   . ASN A 1 25 ? 7.606   4.901   -7.829  1.00 0.00 ? 23 ASN P CA   3  
ATOM 2785  C C    . ASN A 1 25 ? 8.111   4.436   -6.446  1.00 0.00 ? 23 ASN P C    3  
ATOM 2786  O O    . ASN A 1 25 ? 7.318   4.152   -5.547  1.00 0.00 ? 23 ASN P O    3  
ATOM 2787  C CB   . ASN A 1 25 ? 6.607   6.082   -7.742  1.00 0.00 ? 23 ASN P CB   3  
ATOM 2788  C CG   . ASN A 1 25 ? 5.158   5.704   -7.449  1.00 0.00 ? 23 ASN P CG   3  
ATOM 2789  O OD1  . ASN A 1 25 ? 4.286   5.787   -8.304  1.00 0.00 ? 23 ASN P OD1  3  
ATOM 2790  N ND2  . ASN A 1 25 ? 4.845   5.287   -6.248  1.00 0.00 ? 23 ASN P ND2  3  
ATOM 2791  H H    . ASN A 1 25 ? 6.557   3.057   -8.000  1.00 0.00 ? 23 ASN P H    3  
ATOM 2792  H HA   . ASN A 1 25 ? 8.476   5.246   -8.391  1.00 0.00 ? 23 ASN P HA   3  
ATOM 2793  H HB2  . ASN A 1 25 ? 6.945   6.789   -6.985  1.00 0.00 ? 23 ASN P HB2  3  
ATOM 2794  H HB3  . ASN A 1 25 ? 6.615   6.604   -8.699  1.00 0.00 ? 23 ASN P HB3  3  
ATOM 2795  H HD21 . ASN A 1 25 ? 5.592   5.053   -5.604  1.00 0.00 ? 23 ASN P HD21 3  
ATOM 2796  H HD22 . ASN A 1 25 ? 3.888   5.044   -6.061  1.00 0.00 ? 23 ASN P HD22 3  
ATOM 2797  N N    . ARG A 1 26 ? 9.437   4.403   -6.250  1.00 0.00 ? 24 ARG P N    3  
ATOM 2798  C CA   . ARG A 1 26 ? 10.071  3.916   -5.004  1.00 0.00 ? 24 ARG P CA   3  
ATOM 2799  C C    . ARG A 1 26 ? 9.830   4.826   -3.795  1.00 0.00 ? 24 ARG P C    3  
ATOM 2800  O O    . ARG A 1 26 ? 9.849   4.348   -2.661  1.00 0.00 ? 24 ARG P O    3  
ATOM 2801  C CB   . ARG A 1 26 ? 11.580  3.707   -5.222  1.00 0.00 ? 24 ARG P CB   3  
ATOM 2802  C CG   . ARG A 1 26 ? 11.885  2.568   -6.208  1.00 0.00 ? 24 ARG P CG   3  
ATOM 2803  C CD   . ARG A 1 26 ? 13.390  2.280   -6.294  1.00 0.00 ? 24 ARG P CD   3  
ATOM 2804  N NE   . ARG A 1 26 ? 14.135  3.377   -6.947  1.00 0.00 ? 24 ARG P NE   3  
ATOM 2805  C CZ   . ARG A 1 26 ? 15.448  3.487   -7.045  1.00 0.00 ? 24 ARG P CZ   3  
ATOM 2806  N NH1  . ARG A 1 26 ? 16.259  2.592   -6.552  1.00 0.00 ? 24 ARG P NH1  3  
ATOM 2807  N NH2  . ARG A 1 26 ? 15.981  4.509   -7.649  1.00 0.00 ? 24 ARG P NH2  3  
ATOM 2808  H H    . ARG A 1 26 ? 10.035  4.636   -7.032  1.00 0.00 ? 24 ARG P H    3  
ATOM 2809  H HA   . ARG A 1 26 ? 9.629   2.953   -4.742  1.00 0.00 ? 24 ARG P HA   3  
ATOM 2810  H HB2  . ARG A 1 26 ? 12.028  4.634   -5.582  1.00 0.00 ? 24 ARG P HB2  3  
ATOM 2811  H HB3  . ARG A 1 26 ? 12.039  3.458   -4.264  1.00 0.00 ? 24 ARG P HB3  3  
ATOM 2812  H HG2  . ARG A 1 26 ? 11.384  1.664   -5.866  1.00 0.00 ? 24 ARG P HG2  3  
ATOM 2813  H HG3  . ARG A 1 26 ? 11.507  2.815   -7.201  1.00 0.00 ? 24 ARG P HG3  3  
ATOM 2814  H HD2  . ARG A 1 26 ? 13.770  2.122   -5.282  1.00 0.00 ? 24 ARG P HD2  3  
ATOM 2815  H HD3  . ARG A 1 26 ? 13.530  1.361   -6.866  1.00 0.00 ? 24 ARG P HD3  3  
ATOM 2816  H HE   . ARG A 1 26 ? 13.594  4.106   -7.383  1.00 0.00 ? 24 ARG P HE   3  
ATOM 2817  H HH11 . ARG A 1 26 ? 15.877  1.786   -6.091  1.00 0.00 ? 24 ARG P HH11 3  
ATOM 2818  H HH12 . ARG A 1 26 ? 17.255  2.698   -6.642  1.00 0.00 ? 24 ARG P HH12 3  
ATOM 2819  H HH21 . ARG A 1 26 ? 15.396  5.225   -8.048  1.00 0.00 ? 24 ARG P HH21 3  
ATOM 2820  H HH22 . ARG A 1 26 ? 16.980  4.590   -7.726  1.00 0.00 ? 24 ARG P HH22 3  
ATOM 2821  N N    . TYR A 1 27 ? 9.600   6.118   -4.030  1.00 0.00 ? 25 TYR P N    3  
ATOM 2822  C CA   . TYR A 1 27 ? 9.353   7.154   -3.017  1.00 0.00 ? 25 TYR P CA   3  
ATOM 2823  C C    . TYR A 1 27 ? 7.947   7.779   -3.198  1.00 0.00 ? 25 TYR P C    3  
ATOM 2824  O O    . TYR A 1 27 ? 7.836   8.916   -3.672  1.00 0.00 ? 25 TYR P O    3  
ATOM 2825  C CB   . TYR A 1 27 ? 10.486  8.200   -3.074  1.00 0.00 ? 25 TYR P CB   3  
ATOM 2826  C CG   . TYR A 1 27 ? 11.834  7.733   -2.543  1.00 0.00 ? 25 TYR P CG   3  
ATOM 2827  C CD1  . TYR A 1 27 ? 12.693  6.956   -3.347  1.00 0.00 ? 25 TYR P CD1  3  
ATOM 2828  C CD2  . TYR A 1 27 ? 12.239  8.097   -1.244  1.00 0.00 ? 25 TYR P CD2  3  
ATOM 2829  C CE1  . TYR A 1 27 ? 13.945  6.535   -2.853  1.00 0.00 ? 25 TYR P CE1  3  
ATOM 2830  C CE2  . TYR A 1 27 ? 13.493  7.685   -0.749  1.00 0.00 ? 25 TYR P CE2  3  
ATOM 2831  C CZ   . TYR A 1 27 ? 14.352  6.906   -1.552  1.00 0.00 ? 25 TYR P CZ   3  
ATOM 2832  O OH   . TYR A 1 27 ? 15.541  6.482   -1.047  1.00 0.00 ? 25 TYR P OH   3  
ATOM 2833  H H    . TYR A 1 27 ? 9.611   6.409   -4.996  1.00 0.00 ? 25 TYR P H    3  
ATOM 2834  H HA   . TYR A 1 27 ? 9.376   6.714   -2.020  1.00 0.00 ? 25 TYR P HA   3  
ATOM 2835  H HB2  . TYR A 1 27 ? 10.611  8.541   -4.102  1.00 0.00 ? 25 TYR P HB2  3  
ATOM 2836  H HB3  . TYR A 1 27 ? 10.184  9.067   -2.486  1.00 0.00 ? 25 TYR P HB3  3  
ATOM 2837  H HD1  . TYR A 1 27 ? 12.399  6.687   -4.354  1.00 0.00 ? 25 TYR P HD1  3  
ATOM 2838  H HD2  . TYR A 1 27 ? 11.592  8.706   -0.623  1.00 0.00 ? 25 TYR P HD2  3  
ATOM 2839  H HE1  . TYR A 1 27 ? 14.598  5.935   -3.472  1.00 0.00 ? 25 TYR P HE1  3  
ATOM 2840  H HE2  . TYR A 1 27 ? 13.810  7.975   0.246   1.00 0.00 ? 25 TYR P HE2  3  
ATOM 2841  H HH   . TYR A 1 27 ? 16.053  5.959   -1.688  1.00 0.00 ? 25 TYR P HH   3  
ATOM 2842  N N    . PRO A 1 28 ? 6.857   7.059   -2.857  1.00 0.00 ? 26 PRO P N    3  
ATOM 2843  C CA   . PRO A 1 28 ? 5.499   7.605   -2.899  1.00 0.00 ? 26 PRO P CA   3  
ATOM 2844  C C    . PRO A 1 28 ? 5.286   8.674   -1.817  1.00 0.00 ? 26 PRO P C    3  
ATOM 2845  O O    . PRO A 1 28 ? 5.837   8.579   -0.716  1.00 0.00 ? 26 PRO P O    3  
ATOM 2846  C CB   . PRO A 1 28 ? 4.562   6.409   -2.710  1.00 0.00 ? 26 PRO P CB   3  
ATOM 2847  C CG   . PRO A 1 28 ? 5.402   5.401   -1.933  1.00 0.00 ? 26 PRO P CG   3  
ATOM 2848  C CD   . PRO A 1 28 ? 6.836   5.684   -2.369  1.00 0.00 ? 26 PRO P CD   3  
ATOM 2849  H HA   . PRO A 1 28 ? 5.308   8.052   -3.875  1.00 0.00 ? 26 PRO P HA   3  
ATOM 2850  H HB2  . PRO A 1 28 ? 3.655   6.672   -2.167  1.00 0.00 ? 26 PRO P HB2  3  
ATOM 2851  H HB3  . PRO A 1 28 ? 4.305   5.991   -3.682  1.00 0.00 ? 26 PRO P HB3  3  
ATOM 2852  H HG2  . PRO A 1 28 ? 5.306   5.581   -0.864  1.00 0.00 ? 26 PRO P HG2  3  
ATOM 2853  H HG3  . PRO A 1 28 ? 5.107   4.382   -2.177  1.00 0.00 ? 26 PRO P HG3  3  
ATOM 2854  H HD2  . PRO A 1 28 ? 7.513   5.546   -1.525  1.00 0.00 ? 26 PRO P HD2  3  
ATOM 2855  H HD3  . PRO A 1 28 ? 7.103   5.004   -3.176  1.00 0.00 ? 26 PRO P HD3  3  
ATOM 2856  N N    . ASP A 1 29 ? 4.448   9.667   -2.107  1.00 0.00 ? 27 ASP P N    3  
ATOM 2857  C CA   . ASP A 1 29 ? 4.032   10.698  -1.144  1.00 0.00 ? 27 ASP P CA   3  
ATOM 2858  C C    . ASP A 1 29 ? 2.966   10.151  -0.172  1.00 0.00 ? 27 ASP P C    3  
ATOM 2859  O O    . ASP A 1 29 ? 2.348   9.119   -0.433  1.00 0.00 ? 27 ASP P O    3  
ATOM 2860  C CB   . ASP A 1 29 ? 3.554   11.944  -1.913  1.00 0.00 ? 27 ASP P CB   3  
ATOM 2861  C CG   . ASP A 1 29 ? 3.434   13.221  -1.056  1.00 0.00 ? 27 ASP P CG   3  
ATOM 2862  O OD1  . ASP A 1 29 ? 3.893   13.237  0.112   1.00 0.00 ? 27 ASP P OD1  3  
ATOM 2863  O OD2  . ASP A 1 29 ? 2.895   14.233  -1.565  1.00 0.00 ? 27 ASP P OD2  3  
ATOM 2864  H H    . ASP A 1 29 ? 3.986   9.652   -3.005  1.00 0.00 ? 27 ASP P H    3  
ATOM 2865  H HA   . ASP A 1 29 ? 4.905   10.983  -0.554  1.00 0.00 ? 27 ASP P HA   3  
ATOM 2866  H HB2  . ASP A 1 29 ? 4.264   12.148  -2.716  1.00 0.00 ? 27 ASP P HB2  3  
ATOM 2867  H HB3  . ASP A 1 29 ? 2.587   11.722  -2.371  1.00 0.00 ? 27 ASP P HB3  3  
ATOM 2868  N N    . MET A 1 30 ? 2.724   10.818  0.957   1.00 0.00 ? 28 MET P N    3  
ATOM 2869  C CA   . MET A 1 30 ? 1.833   10.311  2.013   1.00 0.00 ? 28 MET P CA   3  
ATOM 2870  C C    . MET A 1 30 ? 0.367   10.188  1.560   1.00 0.00 ? 28 MET P C    3  
ATOM 2871  O O    . MET A 1 30 ? -0.333  9.274   1.995   1.00 0.00 ? 28 MET P O    3  
ATOM 2872  C CB   . MET A 1 30 ? 1.956   11.178  3.276   1.00 0.00 ? 28 MET P CB   3  
ATOM 2873  C CG   . MET A 1 30 ? 3.386   11.184  3.836   1.00 0.00 ? 28 MET P CG   3  
ATOM 2874  S SD   . MET A 1 30 ? 4.036   9.551   4.301   1.00 0.00 ? 28 MET P SD   3  
ATOM 2875  C CE   . MET A 1 30 ? 5.742   9.738   3.713   1.00 0.00 ? 28 MET P CE   3  
ATOM 2876  H H    . MET A 1 30 ? 3.211   11.699  1.098   1.00 0.00 ? 28 MET P H    3  
ATOM 2877  H HA   . MET A 1 30 ? 2.157   9.301   2.268   1.00 0.00 ? 28 MET P HA   3  
ATOM 2878  H HB2  . MET A 1 30 ? 1.661   12.204  3.044   1.00 0.00 ? 28 MET P HB2  3  
ATOM 2879  H HB3  . MET A 1 30 ? 1.284   10.792  4.043   1.00 0.00 ? 28 MET P HB3  3  
ATOM 2880  H HG2  . MET A 1 30 ? 4.047   11.630  3.093   1.00 0.00 ? 28 MET P HG2  3  
ATOM 2881  H HG3  . MET A 1 30 ? 3.412   11.826  4.719   1.00 0.00 ? 28 MET P HG3  3  
ATOM 2882  H HE1  . MET A 1 30 ? 6.201   10.608  4.183   1.00 0.00 ? 28 MET P HE1  3  
ATOM 2883  H HE2  . MET A 1 30 ? 6.317   8.848   3.968   1.00 0.00 ? 28 MET P HE2  3  
ATOM 2884  H HE3  . MET A 1 30 ? 5.742   9.868   2.629   1.00 0.00 ? 28 MET P HE3  3  
ATOM 2885  N N    . SER A 1 31 ? -0.083  11.036  0.629   1.00 0.00 ? 29 SER P N    3  
ATOM 2886  C CA   . SER A 1 31 ? -1.385  10.906  -0.043  1.00 0.00 ? 29 SER P CA   3  
ATOM 2887  C C    . SER A 1 31 ? -1.439  9.698   -0.992  1.00 0.00 ? 29 SER P C    3  
ATOM 2888  O O    . SER A 1 31 ? -2.443  8.985   -1.026  1.00 0.00 ? 29 SER P O    3  
ATOM 2889  C CB   . SER A 1 31 ? -1.705  12.197  -0.804  1.00 0.00 ? 29 SER P CB   3  
ATOM 2890  O OG   . SER A 1 31 ? -0.639  12.538  -1.680  1.00 0.00 ? 29 SER P OG   3  
ATOM 2891  H H    . SER A 1 31 ? 0.540   11.757  0.295   1.00 0.00 ? 29 SER P H    3  
ATOM 2892  H HA   . SER A 1 31 ? -2.160  10.765  0.711   1.00 0.00 ? 29 SER P HA   3  
ATOM 2893  H HB2  . SER A 1 31 ? -2.627  12.066  -1.373  1.00 0.00 ? 29 SER P HB2  3  
ATOM 2894  H HB3  . SER A 1 31 ? -1.850  13.005  -0.086  1.00 0.00 ? 29 SER P HB3  3  
ATOM 2895  H HG   . SER A 1 31 ? -0.869  13.372  -2.135  1.00 0.00 ? 29 SER P HG   3  
ATOM 2896  N N    . THR A 1 32 ? -0.345  9.402   -1.702  1.00 0.00 ? 30 THR P N    3  
ATOM 2897  C CA   . THR A 1 32 ? -0.194  8.192   -2.528  1.00 0.00 ? 30 THR P CA   3  
ATOM 2898  C C    . THR A 1 32 ? -0.220  6.934   -1.657  1.00 0.00 ? 30 THR P C    3  
ATOM 2899  O O    . THR A 1 32 ? -0.941  5.988   -1.970  1.00 0.00 ? 30 THR P O    3  
ATOM 2900  C CB   . THR A 1 32 ? 1.118   8.225   -3.337  1.00 0.00 ? 30 THR P CB   3  
ATOM 2901  O OG1  . THR A 1 32 ? 1.324   9.480   -3.953  1.00 0.00 ? 30 THR P OG1  3  
ATOM 2902  C CG2  . THR A 1 32 ? 1.163   7.161   -4.434  1.00 0.00 ? 30 THR P CG2  3  
ATOM 2903  H H    . THR A 1 32 ? 0.440   10.039  -1.653  1.00 0.00 ? 30 THR P H    3  
ATOM 2904  H HA   . THR A 1 32 ? -1.030  8.136   -3.226  1.00 0.00 ? 30 THR P HA   3  
ATOM 2905  H HB   . THR A 1 32 ? 1.954   8.051   -2.662  1.00 0.00 ? 30 THR P HB   3  
ATOM 2906  H HG1  . THR A 1 32 ? 0.586   9.637   -4.567  1.00 0.00 ? 30 THR P HG1  3  
ATOM 2907  H HG21 . THR A 1 32 ? 0.314   7.278   -5.108  1.00 0.00 ? 30 THR P HG21 3  
ATOM 2908  H HG22 . THR A 1 32 ? 1.134   6.166   -3.990  1.00 0.00 ? 30 THR P HG22 3  
ATOM 2909  H HG23 . THR A 1 32 ? 2.090   7.260   -5.001  1.00 0.00 ? 30 THR P HG23 3  
ATOM 2910  N N    . ARG A 1 33 ? 0.508   6.936   -0.528  1.00 0.00 ? 31 ARG P N    3  
ATOM 2911  C CA   . ARG A 1 33 ? 0.529   5.834   0.452   1.00 0.00 ? 31 ARG P CA   3  
ATOM 2912  C C    . ARG A 1 33 ? -0.847  5.599   1.074   1.00 0.00 ? 31 ARG P C    3  
ATOM 2913  O O    . ARG A 1 33 ? -1.258  4.452   1.212   1.00 0.00 ? 31 ARG P O    3  
ATOM 2914  C CB   . ARG A 1 33 ? 1.580   6.094   1.548   1.00 0.00 ? 31 ARG P CB   3  
ATOM 2915  C CG   . ARG A 1 33 ? 3.015   6.064   0.999   1.00 0.00 ? 31 ARG P CG   3  
ATOM 2916  C CD   . ARG A 1 33 ? 4.066   6.264   2.099   1.00 0.00 ? 31 ARG P CD   3  
ATOM 2917  N NE   . ARG A 1 33 ? 5.291   6.861   1.534   1.00 0.00 ? 31 ARG P NE   3  
ATOM 2918  C CZ   . ARG A 1 33 ? 6.539   6.731   1.936   1.00 0.00 ? 31 ARG P CZ   3  
ATOM 2919  N NH1  . ARG A 1 33 ? 6.876   6.018   2.972   1.00 0.00 ? 31 ARG P NH1  3  
ATOM 2920  N NH2  . ARG A 1 33 ? 7.472   7.353   1.281   1.00 0.00 ? 31 ARG P NH2  3  
ATOM 2921  H H    . ARG A 1 33 ? 1.088   7.753   -0.352  1.00 0.00 ? 31 ARG P H    3  
ATOM 2922  H HA   . ARG A 1 33 ? 0.791   4.911   -0.069  1.00 0.00 ? 31 ARG P HA   3  
ATOM 2923  H HB2  . ARG A 1 33 ? 1.389   7.062   2.013   1.00 0.00 ? 31 ARG P HB2  3  
ATOM 2924  H HB3  . ARG A 1 33 ? 1.486   5.329   2.318   1.00 0.00 ? 31 ARG P HB3  3  
ATOM 2925  H HG2  . ARG A 1 33 ? 3.197   5.110   0.503   1.00 0.00 ? 31 ARG P HG2  3  
ATOM 2926  H HG3  . ARG A 1 33 ? 3.123   6.852   0.259   1.00 0.00 ? 31 ARG P HG3  3  
ATOM 2927  H HD2  . ARG A 1 33 ? 3.673   6.931   2.868   1.00 0.00 ? 31 ARG P HD2  3  
ATOM 2928  H HD3  . ARG A 1 33 ? 4.275   5.297   2.559   1.00 0.00 ? 31 ARG P HD3  3  
ATOM 2929  H HE   . ARG A 1 33 ? 5.172   7.477   0.737   1.00 0.00 ? 31 ARG P HE   3  
ATOM 2930  H HH11 . ARG A 1 33 ? 6.159   5.566   3.503   1.00 0.00 ? 31 ARG P HH11 3  
ATOM 2931  H HH12 . ARG A 1 33 ? 7.839   5.958   3.258   1.00 0.00 ? 31 ARG P HH12 3  
ATOM 2932  H HH21 . ARG A 1 33 ? 7.196   7.931   0.494   1.00 0.00 ? 31 ARG P HH21 3  
ATOM 2933  H HH22 . ARG A 1 33 ? 8.433   7.302   1.570   1.00 0.00 ? 31 ARG P HH22 3  
ATOM 2934  N N    . GLU A 1 34 ? -1.582  6.661   1.399   1.00 0.00 ? 32 GLU P N    3  
ATOM 2935  C CA   . GLU A 1 34 ? -2.950  6.566   1.923   1.00 0.00 ? 32 GLU P CA   3  
ATOM 2936  C C    . GLU A 1 34 ? -3.935  5.996   0.886   1.00 0.00 ? 32 GLU P C    3  
ATOM 2937  O O    . GLU A 1 34 ? -4.746  5.136   1.229   1.00 0.00 ? 32 GLU P O    3  
ATOM 2938  C CB   . GLU A 1 34 ? -3.395  7.949   2.426   1.00 0.00 ? 32 GLU P CB   3  
ATOM 2939  C CG   . GLU A 1 34 ? -4.797  7.944   3.052   1.00 0.00 ? 32 GLU P CG   3  
ATOM 2940  C CD   . GLU A 1 34 ? -5.181  9.347   3.563   1.00 0.00 ? 32 GLU P CD   3  
ATOM 2941  O OE1  . GLU A 1 34 ? -5.555  10.218  2.740   1.00 0.00 ? 32 GLU P OE1  3  
ATOM 2942  O OE2  . GLU A 1 34 ? -5.130  9.588   4.794   1.00 0.00 ? 32 GLU P OE2  3  
ATOM 2943  H H    . GLU A 1 34 ? -1.158  7.578   1.321   1.00 0.00 ? 32 GLU P H    3  
ATOM 2944  H HA   . GLU A 1 34 ? -2.941  5.871   2.765   1.00 0.00 ? 32 GLU P HA   3  
ATOM 2945  H HB2  . GLU A 1 34 ? -2.686  8.292   3.179   1.00 0.00 ? 32 GLU P HB2  3  
ATOM 2946  H HB3  . GLU A 1 34 ? -3.382  8.654   1.595   1.00 0.00 ? 32 GLU P HB3  3  
ATOM 2947  H HG2  . GLU A 1 34 ? -5.530  7.624   2.308   1.00 0.00 ? 32 GLU P HG2  3  
ATOM 2948  H HG3  . GLU A 1 34 ? -4.815  7.223   3.872   1.00 0.00 ? 32 GLU P HG3  3  
ATOM 2949  N N    . GLU A 1 35 ? -3.840  6.395   -0.387  1.00 0.00 ? 33 GLU P N    3  
ATOM 2950  C CA   . GLU A 1 35 ? -4.644  5.790   -1.457  1.00 0.00 ? 33 GLU P CA   3  
ATOM 2951  C C    . GLU A 1 35 ? -4.327  4.300   -1.618  1.00 0.00 ? 33 GLU P C    3  
ATOM 2952  O O    . GLU A 1 35 ? -5.247  3.488   -1.551  1.00 0.00 ? 33 GLU P O    3  
ATOM 2953  C CB   . GLU A 1 35 ? -4.451  6.534   -2.790  1.00 0.00 ? 33 GLU P CB   3  
ATOM 2954  C CG   . GLU A 1 35 ? -5.323  7.790   -2.910  1.00 0.00 ? 33 GLU P CG   3  
ATOM 2955  C CD   . GLU A 1 35 ? -6.833  7.462   -2.920  1.00 0.00 ? 33 GLU P CD   3  
ATOM 2956  O OE1  . GLU A 1 35 ? -7.295  6.710   -3.814  1.00 0.00 ? 33 GLU P OE1  3  
ATOM 2957  O OE2  . GLU A 1 35 ? -7.570  7.959   -2.035  1.00 0.00 ? 33 GLU P OE2  3  
ATOM 2958  H H    . GLU A 1 35 ? -3.175  7.123   -0.630  1.00 0.00 ? 33 GLU P H    3  
ATOM 2959  H HA   . GLU A 1 35 ? -5.700  5.839   -1.177  1.00 0.00 ? 33 GLU P HA   3  
ATOM 2960  H HB2  . GLU A 1 35 ? -3.403  6.811   -2.905  1.00 0.00 ? 33 GLU P HB2  3  
ATOM 2961  H HB3  . GLU A 1 35 ? -4.702  5.864   -3.613  1.00 0.00 ? 33 GLU P HB3  3  
ATOM 2962  H HG2  . GLU A 1 35 ? -5.086  8.467   -2.085  1.00 0.00 ? 33 GLU P HG2  3  
ATOM 2963  H HG3  . GLU A 1 35 ? -5.064  8.303   -3.839  1.00 0.00 ? 33 GLU P HG3  3  
ATOM 2964  N N    . ILE A 1 36 ? -3.056  3.896   -1.740  1.00 0.00 ? 34 ILE P N    3  
ATOM 2965  C CA   . ILE A 1 36 ? -2.739  2.467   -1.900  1.00 0.00 ? 34 ILE P CA   3  
ATOM 2966  C C    . ILE A 1 36 ? -3.047  1.645   -0.637  1.00 0.00 ? 34 ILE P C    3  
ATOM 2967  O O    . ILE A 1 36 ? -3.364  0.463   -0.755  1.00 0.00 ? 34 ILE P O    3  
ATOM 2968  C CB   . ILE A 1 36 ? -1.339  2.215   -2.503  1.00 0.00 ? 34 ILE P CB   3  
ATOM 2969  C CG1  . ILE A 1 36 ? -0.130  2.593   -1.634  1.00 0.00 ? 34 ILE P CG1  3  
ATOM 2970  C CG2  . ILE A 1 36 ? -1.203  2.964   -3.840  1.00 0.00 ? 34 ILE P CG2  3  
ATOM 2971  C CD1  . ILE A 1 36 ? 0.151   1.642   -0.472  1.00 0.00 ? 34 ILE P CD1  3  
ATOM 2972  H H    . ILE A 1 36 ? -2.310  4.584   -1.781  1.00 0.00 ? 34 ILE P H    3  
ATOM 2973  H HA   . ILE A 1 36 ? -3.435  2.087   -2.648  1.00 0.00 ? 34 ILE P HA   3  
ATOM 2974  H HB   . ILE A 1 36 ? -1.266  1.152   -2.720  1.00 0.00 ? 34 ILE P HB   3  
ATOM 2975  H HG12 . ILE A 1 36 ? 0.761   2.599   -2.259  1.00 0.00 ? 34 ILE P HG12 3  
ATOM 2976  H HG13 . ILE A 1 36 ? -0.275  3.596   -1.251  1.00 0.00 ? 34 ILE P HG13 3  
ATOM 2977  H HG21 . ILE A 1 36 ? -2.064  2.762   -4.474  1.00 0.00 ? 34 ILE P HG21 3  
ATOM 2978  H HG22 . ILE A 1 36 ? -1.126  4.037   -3.664  1.00 0.00 ? 34 ILE P HG22 3  
ATOM 2979  H HG23 . ILE A 1 36 ? -0.302  2.631   -4.358  1.00 0.00 ? 34 ILE P HG23 3  
ATOM 2980  H HD11 . ILE A 1 36 ? 1.180   1.785   -0.154  1.00 0.00 ? 34 ILE P HD11 3  
ATOM 2981  H HD12 . ILE A 1 36 ? -0.504  1.870   0.364   1.00 0.00 ? 34 ILE P HD12 3  
ATOM 2982  H HD13 . ILE A 1 36 ? 0.019   0.605   -0.783  1.00 0.00 ? 34 ILE P HD13 3  
ATOM 2983  N N    . ALA A 1 37 ? -3.066  2.257   0.555   1.00 0.00 ? 35 ALA P N    3  
ATOM 2984  C CA   . ALA A 1 37 ? -3.553  1.630   1.788   1.00 0.00 ? 35 ALA P CA   3  
ATOM 2985  C C    . ALA A 1 37 ? -5.065  1.340   1.709   1.00 0.00 ? 35 ALA P C    3  
ATOM 2986  O O    . ALA A 1 37 ? -5.500  0.229   2.004   1.00 0.00 ? 35 ALA P O    3  
ATOM 2987  C CB   . ALA A 1 37 ? -3.214  2.527   2.988   1.00 0.00 ? 35 ALA P CB   3  
ATOM 2988  H H    . ALA A 1 37 ? -2.730  3.211   0.607   1.00 0.00 ? 35 ALA P H    3  
ATOM 2989  H HA   . ALA A 1 37 ? -3.038  0.677   1.921   1.00 0.00 ? 35 ALA P HA   3  
ATOM 2990  H HB1  . ALA A 1 37 ? -3.776  3.458   2.939   1.00 0.00 ? 35 ALA P HB1  3  
ATOM 2991  H HB2  . ALA A 1 37 ? -3.470  2.013   3.913   1.00 0.00 ? 35 ALA P HB2  3  
ATOM 2992  H HB3  . ALA A 1 37 ? -2.150  2.756   3.005   1.00 0.00 ? 35 ALA P HB3  3  
ATOM 2993  N N    . VAL A 1 38 ? -5.866  2.298   1.225   1.00 0.00 ? 36 VAL P N    3  
ATOM 2994  C CA   . VAL A 1 38 ? -7.302  2.123   0.941   1.00 0.00 ? 36 VAL P CA   3  
ATOM 2995  C C    . VAL A 1 38 ? -7.536  1.059   -0.140  1.00 0.00 ? 36 VAL P C    3  
ATOM 2996  O O    . VAL A 1 38 ? -8.405  0.203   0.029   1.00 0.00 ? 36 VAL P O    3  
ATOM 2997  C CB   . VAL A 1 38 ? -7.935  3.480   0.558   1.00 0.00 ? 36 VAL P CB   3  
ATOM 2998  C CG1  . VAL A 1 38 ? -9.336  3.366   -0.054  1.00 0.00 ? 36 VAL P CG1  3  
ATOM 2999  C CG2  . VAL A 1 38 ? -8.053  4.377   1.795   1.00 0.00 ? 36 VAL P CG2  3  
ATOM 3000  H H    . VAL A 1 38 ? -5.447  3.195   1.009   1.00 0.00 ? 36 VAL P H    3  
ATOM 3001  H HA   . VAL A 1 38 ? -7.795  1.766   1.846   1.00 0.00 ? 36 VAL P HA   3  
ATOM 3002  H HB   . VAL A 1 38 ? -7.303  3.985   -0.169  1.00 0.00 ? 36 VAL P HB   3  
ATOM 3003  H HG11 . VAL A 1 38 ? -9.286  2.858   -1.016  1.00 0.00 ? 36 VAL P HG11 3  
ATOM 3004  H HG12 . VAL A 1 38 ? -9.994  2.814   0.616   1.00 0.00 ? 36 VAL P HG12 3  
ATOM 3005  H HG13 . VAL A 1 38 ? -9.740  4.364   -0.227  1.00 0.00 ? 36 VAL P HG13 3  
ATOM 3006  H HG21 . VAL A 1 38 ? -7.078  4.506   2.261   1.00 0.00 ? 36 VAL P HG21 3  
ATOM 3007  H HG22 . VAL A 1 38 ? -8.424  5.359   1.498   1.00 0.00 ? 36 VAL P HG22 3  
ATOM 3008  H HG23 . VAL A 1 38 ? -8.738  3.935   2.517   1.00 0.00 ? 36 VAL P HG23 3  
ATOM 3009  N N    . TRP A 1 39 ? -6.744  1.054   -1.219  1.00 0.00 ? 37 TRP P N    3  
ATOM 3010  C CA   . TRP A 1 39 ? -6.885  0.093   -2.326  1.00 0.00 ? 37 TRP P CA   3  
ATOM 3011  C C    . TRP A 1 39 ? -6.537  -1.346  -1.897  1.00 0.00 ? 37 TRP P C    3  
ATOM 3012  O O    . TRP A 1 39 ? -7.185  -2.296  -2.339  1.00 0.00 ? 37 TRP P O    3  
ATOM 3013  C CB   . TRP A 1 39 ? -5.995  0.508   -3.511  1.00 0.00 ? 37 TRP P CB   3  
ATOM 3014  C CG   . TRP A 1 39 ? -6.166  1.864   -4.142  1.00 0.00 ? 37 TRP P CG   3  
ATOM 3015  C CD1  . TRP A 1 39 ? -7.042  2.835   -3.788  1.00 0.00 ? 37 TRP P CD1  3  
ATOM 3016  C CD2  . TRP A 1 39 ? -5.370  2.438   -5.227  1.00 0.00 ? 37 TRP P CD2  3  
ATOM 3017  N NE1  . TRP A 1 39 ? -6.807  3.975   -4.533  1.00 0.00 ? 37 TRP P NE1  3  
ATOM 3018  C CE2  . TRP A 1 39 ? -5.792  3.785   -5.443  1.00 0.00 ? 37 TRP P CE2  3  
ATOM 3019  C CE3  . TRP A 1 39 ? -4.312  1.963   -6.036  1.00 0.00 ? 37 TRP P CE3  3  
ATOM 3020  C CZ2  . TRP A 1 39 ? -5.191  4.621   -6.396  1.00 0.00 ? 37 TRP P CZ2  3  
ATOM 3021  C CZ3  . TRP A 1 39 ? -3.707  2.791   -7.003  1.00 0.00 ? 37 TRP P CZ3  3  
ATOM 3022  C CH2  . TRP A 1 39 ? -4.140  4.118   -7.183  1.00 0.00 ? 37 TRP P CH2  3  
ATOM 3023  H H    . TRP A 1 39 ? -6.071  1.809   -1.322  1.00 0.00 ? 37 TRP P H    3  
ATOM 3024  H HA   . TRP A 1 39 ? -7.922  0.092   -2.664  1.00 0.00 ? 37 TRP P HA   3  
ATOM 3025  H HB2  . TRP A 1 39 ? -4.960  0.445   -3.182  1.00 0.00 ? 37 TRP P HB2  3  
ATOM 3026  H HB3  . TRP A 1 39 ? -6.125  -0.234  -4.300  1.00 0.00 ? 37 TRP P HB3  3  
ATOM 3027  H HD1  . TRP A 1 39 ? -7.751  2.760   -2.972  1.00 0.00 ? 37 TRP P HD1  3  
ATOM 3028  H HE1  . TRP A 1 39 ? -7.242  4.882   -4.337  1.00 0.00 ? 37 TRP P HE1  3  
ATOM 3029  H HE3  . TRP A 1 39 ? -3.961  0.950   -5.900  1.00 0.00 ? 37 TRP P HE3  3  
ATOM 3030  H HZ2  . TRP A 1 39 ? -5.534  5.639   -6.519  1.00 0.00 ? 37 TRP P HZ2  3  
ATOM 3031  H HZ3  . TRP A 1 39 ? -2.896  2.407   -7.610  1.00 0.00 ? 37 TRP P HZ3  3  
ATOM 3032  H HH2  . TRP A 1 39 ? -3.666  4.748   -7.924  1.00 0.00 ? 37 TRP P HH2  3  
ATOM 3033  N N    . THR A 1 40 ? -5.544  -1.513  -1.015  1.00 0.00 ? 38 THR P N    3  
ATOM 3034  C CA   . THR A 1 40 ? -5.133  -2.812  -0.442  1.00 0.00 ? 38 THR P CA   3  
ATOM 3035  C C    . THR A 1 40 ? -5.895  -3.203  0.827   1.00 0.00 ? 38 THR P C    3  
ATOM 3036  O O    . THR A 1 40 ? -5.776  -4.342  1.270   1.00 0.00 ? 38 THR P O    3  
ATOM 3037  C CB   . THR A 1 40 ? -3.626  -2.856  -0.130  1.00 0.00 ? 38 THR P CB   3  
ATOM 3038  O OG1  . THR A 1 40 ? -3.259  -1.802  0.725   1.00 0.00 ? 38 THR P OG1  3  
ATOM 3039  C CG2  . THR A 1 40 ? -2.752  -2.797  -1.380  1.00 0.00 ? 38 THR P CG2  3  
ATOM 3040  H H    . THR A 1 40 ? -5.022  -0.689  -0.736  1.00 0.00 ? 38 THR P H    3  
ATOM 3041  H HA   . THR A 1 40 ? -5.332  -3.596  -1.173  1.00 0.00 ? 38 THR P HA   3  
ATOM 3042  H HB   . THR A 1 40 ? -3.401  -3.793  0.379   1.00 0.00 ? 38 THR P HB   3  
ATOM 3043  H HG1  . THR A 1 40 ? -3.196  -0.999  0.175   1.00 0.00 ? 38 THR P HG1  3  
ATOM 3044  H HG21 . THR A 1 40 ? -2.946  -1.886  -1.946  1.00 0.00 ? 38 THR P HG21 3  
ATOM 3045  H HG22 . THR A 1 40 ? -2.968  -3.661  -2.009  1.00 0.00 ? 38 THR P HG22 3  
ATOM 3046  H HG23 . THR A 1 40 ? -1.701  -2.826  -1.091  1.00 0.00 ? 38 THR P HG23 3  
ATOM 3047  N N    . ASN A 1 41 ? -6.691  -2.305  1.415   1.00 0.00 ? 39 ASN P N    3  
ATOM 3048  C CA   . ASN A 1 41 ? -7.319  -2.431  2.740   1.00 0.00 ? 39 ASN P CA   3  
ATOM 3049  C C    . ASN A 1 41 ? -6.316  -2.561  3.917   1.00 0.00 ? 39 ASN P C    3  
ATOM 3050  O O    . ASN A 1 41 ? -6.664  -3.067  4.987   1.00 0.00 ? 39 ASN P O    3  
ATOM 3051  C CB   . ASN A 1 41 ? -8.414  -3.522  2.752   1.00 0.00 ? 39 ASN P CB   3  
ATOM 3052  C CG   . ASN A 1 41 ? -9.369  -3.461  1.572   1.00 0.00 ? 39 ASN P CG   3  
ATOM 3053  O OD1  . ASN A 1 41 ? -10.347 -2.728  1.563   1.00 0.00 ? 39 ASN P OD1  3  
ATOM 3054  N ND2  . ASN A 1 41 ? -9.116  -4.232  0.537   1.00 0.00 ? 39 ASN P ND2  3  
ATOM 3055  H H    . ASN A 1 41 ? -6.727  -1.388  0.989   1.00 0.00 ? 39 ASN P H    3  
ATOM 3056  H HA   . ASN A 1 41 ? -7.817  -1.471  2.905   1.00 0.00 ? 39 ASN P HA   3  
ATOM 3057  H HB2  . ASN A 1 41 ? -7.939  -4.503  2.779   1.00 0.00 ? 39 ASN P HB2  3  
ATOM 3058  H HB3  . ASN A 1 41 ? -9.001  -3.426  3.666   1.00 0.00 ? 39 ASN P HB3  3  
ATOM 3059  H HD21 . ASN A 1 41 ? -8.295  -4.816  0.538   1.00 0.00 ? 39 ASN P HD21 3  
ATOM 3060  H HD22 . ASN A 1 41 ? -9.724  -4.175  -0.265  1.00 0.00 ? 39 ASN P HD22 3  
ATOM 3061  N N    . LEU A 1 42 ? -5.072  -2.104  3.736   1.00 0.00 ? 40 LEU P N    3  
ATOM 3062  C CA   . LEU A 1 42 ? -4.061  -1.980  4.795   1.00 0.00 ? 40 LEU P CA   3  
ATOM 3063  C C    . LEU A 1 42 ? -4.208  -0.659  5.578   1.00 0.00 ? 40 LEU P C    3  
ATOM 3064  O O    . LEU A 1 42 ? -4.934  0.254   5.177   1.00 0.00 ? 40 LEU P O    3  
ATOM 3065  C CB   . LEU A 1 42 ? -2.652  -2.094  4.175   1.00 0.00 ? 40 LEU P CB   3  
ATOM 3066  C CG   . LEU A 1 42 ? -2.306  -3.457  3.550   1.00 0.00 ? 40 LEU P CG   3  
ATOM 3067  C CD1  . LEU A 1 42 ? -0.909  -3.378  2.932   1.00 0.00 ? 40 LEU P CD1  3  
ATOM 3068  C CD2  . LEU A 1 42 ? -2.302  -4.578  4.588   1.00 0.00 ? 40 LEU P CD2  3  
ATOM 3069  H H    . LEU A 1 42 ? -4.880  -1.634  2.859   1.00 0.00 ? 40 LEU P H    3  
ATOM 3070  H HA   . LEU A 1 42 ? -4.193  -2.786  5.516   1.00 0.00 ? 40 LEU P HA   3  
ATOM 3071  H HB2  . LEU A 1 42 ? -2.552  -1.327  3.408   1.00 0.00 ? 40 LEU P HB2  3  
ATOM 3072  H HB3  . LEU A 1 42 ? -1.908  -1.879  4.943   1.00 0.00 ? 40 LEU P HB3  3  
ATOM 3073  H HG   . LEU A 1 42 ? -3.023  -3.705  2.769   1.00 0.00 ? 40 LEU P HG   3  
ATOM 3074  H HD11 . LEU A 1 42 ? -0.634  -4.339  2.504   1.00 0.00 ? 40 LEU P HD11 3  
ATOM 3075  H HD12 . LEU A 1 42 ? -0.178  -3.100  3.691   1.00 0.00 ? 40 LEU P HD12 3  
ATOM 3076  H HD13 . LEU A 1 42 ? -0.907  -2.628  2.140   1.00 0.00 ? 40 LEU P HD13 3  
ATOM 3077  H HD21 . LEU A 1 42 ? -3.311  -4.731  4.970   1.00 0.00 ? 40 LEU P HD21 3  
ATOM 3078  H HD22 . LEU A 1 42 ? -1.624  -4.333  5.403   1.00 0.00 ? 40 LEU P HD22 3  
ATOM 3079  H HD23 . LEU A 1 42 ? -1.980  -5.505  4.116   1.00 0.00 ? 40 LEU P HD23 3  
ATOM 3080  N N    . THR A 1 43 ? -3.488  -0.543  6.698   1.00 0.00 ? 41 THR P N    3  
ATOM 3081  C CA   . THR A 1 43 ? -3.318  0.717   7.440   1.00 0.00 ? 41 THR P CA   3  
ATOM 3082  C C    . THR A 1 43 ? -2.128  1.510   6.890   1.00 0.00 ? 41 THR P C    3  
ATOM 3083  O O    . THR A 1 43 ? -1.157  0.931   6.393   1.00 0.00 ? 41 THR P O    3  
ATOM 3084  C CB   . THR A 1 43 ? -3.147  0.471   8.948   1.00 0.00 ? 41 THR P CB   3  
ATOM 3085  O OG1  . THR A 1 43 ? -2.108  -0.452  9.212   1.00 0.00 ? 41 THR P OG1  3  
ATOM 3086  C CG2  . THR A 1 43 ? -4.415  -0.098  9.580   1.00 0.00 ? 41 THR P CG2  3  
ATOM 3087  H H    . THR A 1 43 ? -2.905  -1.315  6.984   1.00 0.00 ? 41 THR P H    3  
ATOM 3088  H HA   . THR A 1 43 ? -4.207  1.334   7.310   1.00 0.00 ? 41 THR P HA   3  
ATOM 3089  H HB   . THR A 1 43 ? -2.913  1.419   9.434   1.00 0.00 ? 41 THR P HB   3  
ATOM 3090  H HG1  . THR A 1 43 ? -1.811  -0.285  10.124  1.00 0.00 ? 41 THR P HG1  3  
ATOM 3091  H HG21 . THR A 1 43 ? -4.271  -0.207  10.654  1.00 0.00 ? 41 THR P HG21 3  
ATOM 3092  H HG22 . THR A 1 43 ? -4.652  -1.070  9.146   1.00 0.00 ? 41 THR P HG22 3  
ATOM 3093  H HG23 . THR A 1 43 ? -5.249  0.584   9.407   1.00 0.00 ? 41 THR P HG23 3  
ATOM 3094  N N    . GLU A 1 44 ? -2.148  2.845   7.003   1.00 0.00 ? 42 GLU P N    3  
ATOM 3095  C CA   . GLU A 1 44 ? -1.010  3.670   6.560   1.00 0.00 ? 42 GLU P CA   3  
ATOM 3096  C C    . GLU A 1 44 ? 0.273   3.386   7.364   1.00 0.00 ? 42 GLU P C    3  
ATOM 3097  O O    . GLU A 1 44 ? 1.372   3.507   6.826   1.00 0.00 ? 42 GLU P O    3  
ATOM 3098  C CB   . GLU A 1 44 ? -1.354  5.170   6.570   1.00 0.00 ? 42 GLU P CB   3  
ATOM 3099  C CG   . GLU A 1 44 ? -1.655  5.752   7.961   1.00 0.00 ? 42 GLU P CG   3  
ATOM 3100  C CD   . GLU A 1 44 ? -1.568  7.288   7.953   1.00 0.00 ? 42 GLU P CD   3  
ATOM 3101  O OE1  . GLU A 1 44 ? -0.426  7.811   7.919   1.00 0.00 ? 42 GLU P OE1  3  
ATOM 3102  O OE2  . GLU A 1 44 ? -2.619  7.970   8.004   1.00 0.00 ? 42 GLU P OE2  3  
ATOM 3103  H H    . GLU A 1 44 ? -2.966  3.303   7.383   1.00 0.00 ? 42 GLU P H    3  
ATOM 3104  H HA   . GLU A 1 44 ? -0.789  3.408   5.526   1.00 0.00 ? 42 GLU P HA   3  
ATOM 3105  H HB2  . GLU A 1 44 ? -0.502  5.701   6.141   1.00 0.00 ? 42 GLU P HB2  3  
ATOM 3106  H HB3  . GLU A 1 44 ? -2.211  5.342   5.918   1.00 0.00 ? 42 GLU P HB3  3  
ATOM 3107  H HG2  . GLU A 1 44 ? -2.646  5.420   8.283   1.00 0.00 ? 42 GLU P HG2  3  
ATOM 3108  H HG3  . GLU A 1 44 ? -0.931  5.380   8.687   1.00 0.00 ? 42 GLU P HG3  3  
ATOM 3109  N N    . ALA A 1 45 ? 0.145   2.939   8.619   1.00 0.00 ? 43 ALA P N    3  
ATOM 3110  C CA   . ALA A 1 45 ? 1.270   2.521   9.453   1.00 0.00 ? 43 ALA P CA   3  
ATOM 3111  C C    . ALA A 1 45 ? 1.964   1.271   8.883   1.00 0.00 ? 43 ALA P C    3  
ATOM 3112  O O    . ALA A 1 45 ? 3.189   1.256   8.762   1.00 0.00 ? 43 ALA P O    3  
ATOM 3113  C CB   . ALA A 1 45 ? 0.763   2.297   10.883  1.00 0.00 ? 43 ALA P CB   3  
ATOM 3114  H H    . ALA A 1 45 ? -0.784  2.880   9.010   1.00 0.00 ? 43 ALA P H    3  
ATOM 3115  H HA   . ALA A 1 45 ? 2.008   3.324   9.475   1.00 0.00 ? 43 ALA P HA   3  
ATOM 3116  H HB1  . ALA A 1 45 ? 0.015   1.503   10.902  1.00 0.00 ? 43 ALA P HB1  3  
ATOM 3117  H HB2  . ALA A 1 45 ? 1.597   2.014   11.527  1.00 0.00 ? 43 ALA P HB2  3  
ATOM 3118  H HB3  . ALA A 1 45 ? 0.321   3.218   11.267  1.00 0.00 ? 43 ALA P HB3  3  
ATOM 3119  N N    . ARG A 1 46 ? 1.197   0.259   8.445   1.00 0.00 ? 44 ARG P N    3  
ATOM 3120  C CA   . ARG A 1 46 ? 1.735   -0.930  7.754   1.00 0.00 ? 44 ARG P CA   3  
ATOM 3121  C C    . ARG A 1 46 ? 2.441   -0.561  6.457   1.00 0.00 ? 44 ARG P C    3  
ATOM 3122  O O    . ARG A 1 46 ? 3.552   -1.022  6.214   1.00 0.00 ? 44 ARG P O    3  
ATOM 3123  C CB   . ARG A 1 46 ? 0.611   -1.933  7.472   1.00 0.00 ? 44 ARG P CB   3  
ATOM 3124  C CG   . ARG A 1 46 ? 0.308   -2.767  8.716   1.00 0.00 ? 44 ARG P CG   3  
ATOM 3125  C CD   . ARG A 1 46 ? -0.830  -3.734  8.392   1.00 0.00 ? 44 ARG P CD   3  
ATOM 3126  N NE   . ARG A 1 46 ? -1.189  -4.560  9.555   1.00 0.00 ? 44 ARG P NE   3  
ATOM 3127  C CZ   . ARG A 1 46 ? -2.034  -4.268  10.524  1.00 0.00 ? 44 ARG P CZ   3  
ATOM 3128  N NH1  . ARG A 1 46 ? -2.652  -3.123  10.597  1.00 0.00 ? 44 ARG P NH1  3  
ATOM 3129  N NH2  . ARG A 1 46 ? -2.270  -5.156  11.444  1.00 0.00 ? 44 ARG P NH2  3  
ATOM 3130  H H    . ARG A 1 46 ? 0.193   0.343   8.542   1.00 0.00 ? 44 ARG P H    3  
ATOM 3131  H HA   . ARG A 1 46 ? 2.484   -1.412  8.384   1.00 0.00 ? 44 ARG P HA   3  
ATOM 3132  H HB2  . ARG A 1 46 ? -0.287  -1.409  7.144   1.00 0.00 ? 44 ARG P HB2  3  
ATOM 3133  H HB3  . ARG A 1 46 ? 0.917   -2.606  6.671   1.00 0.00 ? 44 ARG P HB3  3  
ATOM 3134  H HG2  . ARG A 1 46 ? 1.199   -3.331  9.001   1.00 0.00 ? 44 ARG P HG2  3  
ATOM 3135  H HG3  . ARG A 1 46 ? 0.025   -2.114  9.540   1.00 0.00 ? 44 ARG P HG3  3  
ATOM 3136  H HD2  . ARG A 1 46 ? -1.693  -3.164  8.047   1.00 0.00 ? 44 ARG P HD2  3  
ATOM 3137  H HD3  . ARG A 1 46 ? -0.509  -4.389  7.579   1.00 0.00 ? 44 ARG P HD3  3  
ATOM 3138  H HE   . ARG A 1 46 ? -0.751  -5.471  9.621   1.00 0.00 ? 44 ARG P HE   3  
ATOM 3139  H HH11 . ARG A 1 46 ? -2.449  -2.401  9.918   1.00 0.00 ? 44 ARG P HH11 3  
ATOM 3140  H HH12 . ARG A 1 46 ? -3.282  -2.933  11.356  1.00 0.00 ? 44 ARG P HH12 3  
ATOM 3141  H HH21 . ARG A 1 46 ? -1.801  -6.049  11.395  1.00 0.00 ? 44 ARG P HH21 3  
ATOM 3142  H HH22 . ARG A 1 46 ? -2.903  -4.958  12.200  1.00 0.00 ? 44 ARG P HH22 3  
ATOM 3143  N N    . VAL A 1 47 ? 1.836   0.314   5.656   1.00 0.00 ? 45 VAL P N    3  
ATOM 3144  C CA   . VAL A 1 47 ? 2.416   0.803   4.395   1.00 0.00 ? 45 VAL P CA   3  
ATOM 3145  C C    . VAL A 1 47 ? 3.726   1.567   4.633   1.00 0.00 ? 45 VAL P C    3  
ATOM 3146  O O    . VAL A 1 47 ? 4.731   1.297   3.973   1.00 0.00 ? 45 VAL P O    3  
ATOM 3147  C CB   . VAL A 1 47 ? 1.366   1.650   3.651   1.00 0.00 ? 45 VAL P CB   3  
ATOM 3148  C CG1  . VAL A 1 47 ? 1.954   2.425   2.473   1.00 0.00 ? 45 VAL P CG1  3  
ATOM 3149  C CG2  . VAL A 1 47 ? 0.253   0.733   3.126   1.00 0.00 ? 45 VAL P CG2  3  
ATOM 3150  H H    . VAL A 1 47 ? 0.910   0.628   5.925   1.00 0.00 ? 45 VAL P H    3  
ATOM 3151  H HA   . VAL A 1 47 ? 2.665   -0.052  3.766   1.00 0.00 ? 45 VAL P HA   3  
ATOM 3152  H HB   . VAL A 1 47 ? 0.929   2.371   4.340   1.00 0.00 ? 45 VAL P HB   3  
ATOM 3153  H HG11 . VAL A 1 47 ? 2.661   3.174   2.826   1.00 0.00 ? 45 VAL P HG11 3  
ATOM 3154  H HG12 . VAL A 1 47 ? 2.461   1.732   1.804   1.00 0.00 ? 45 VAL P HG12 3  
ATOM 3155  H HG13 . VAL A 1 47 ? 1.155   2.940   1.942   1.00 0.00 ? 45 VAL P HG13 3  
ATOM 3156  H HG21 . VAL A 1 47 ? -0.242  0.221   3.950   1.00 0.00 ? 45 VAL P HG21 3  
ATOM 3157  H HG22 . VAL A 1 47 ? -0.491  1.324   2.599   1.00 0.00 ? 45 VAL P HG22 3  
ATOM 3158  H HG23 . VAL A 1 47 ? 0.665   -0.007  2.439   1.00 0.00 ? 45 VAL P HG23 3  
ATOM 3159  N N    . ARG A 1 48 ? 3.758   2.474   5.617   1.00 0.00 ? 46 ARG P N    3  
ATOM 3160  C CA   . ARG A 1 48 ? 4.955   3.252   5.983   1.00 0.00 ? 46 ARG P CA   3  
ATOM 3161  C C    . ARG A 1 48 ? 6.074   2.361   6.544   1.00 0.00 ? 46 ARG P C    3  
ATOM 3162  O O    . ARG A 1 48 ? 7.238   2.562   6.200   1.00 0.00 ? 46 ARG P O    3  
ATOM 3163  C CB   . ARG A 1 48 ? 4.521   4.372   6.945   1.00 0.00 ? 46 ARG P CB   3  
ATOM 3164  C CG   . ARG A 1 48 ? 5.618   5.417   7.198   1.00 0.00 ? 46 ARG P CG   3  
ATOM 3165  C CD   . ARG A 1 48 ? 5.097   6.613   8.013   1.00 0.00 ? 46 ARG P CD   3  
ATOM 3166  N NE   . ARG A 1 48 ? 4.113   7.421   7.256   1.00 0.00 ? 46 ARG P NE   3  
ATOM 3167  C CZ   . ARG A 1 48 ? 2.814   7.535   7.481   1.00 0.00 ? 46 ARG P CZ   3  
ATOM 3168  N NH1  . ARG A 1 48 ? 2.189   6.932   8.447   1.00 0.00 ? 46 ARG P NH1  3  
ATOM 3169  N NH2  . ARG A 1 48 ? 2.063   8.278   6.729   1.00 0.00 ? 46 ARG P NH2  3  
ATOM 3170  H H    . ARG A 1 48 ? 2.892   2.669   6.114   1.00 0.00 ? 46 ARG P H    3  
ATOM 3171  H HA   . ARG A 1 48 ? 5.348   3.713   5.076   1.00 0.00 ? 46 ARG P HA   3  
ATOM 3172  H HB2  . ARG A 1 48 ? 3.663   4.878   6.499   1.00 0.00 ? 46 ARG P HB2  3  
ATOM 3173  H HB3  . ARG A 1 48 ? 4.205   3.939   7.895   1.00 0.00 ? 46 ARG P HB3  3  
ATOM 3174  H HG2  . ARG A 1 48 ? 6.436   4.951   7.748   1.00 0.00 ? 46 ARG P HG2  3  
ATOM 3175  H HG3  . ARG A 1 48 ? 6.005   5.782   6.246   1.00 0.00 ? 46 ARG P HG3  3  
ATOM 3176  H HD2  . ARG A 1 48 ? 4.674   6.250   8.951   1.00 0.00 ? 46 ARG P HD2  3  
ATOM 3177  H HD3  . ARG A 1 48 ? 5.947   7.250   8.263   1.00 0.00 ? 46 ARG P HD3  3  
ATOM 3178  H HE   . ARG A 1 48 ? 4.472   7.961   6.484   1.00 0.00 ? 46 ARG P HE   3  
ATOM 3179  H HH11 . ARG A 1 48 ? 2.687   6.352   9.096   1.00 0.00 ? 46 ARG P HH11 3  
ATOM 3180  H HH12 . ARG A 1 48 ? 1.190   7.108   8.529   1.00 0.00 ? 46 ARG P HH12 3  
ATOM 3181  H HH21 . ARG A 1 48 ? 2.446   8.798   5.957   1.00 0.00 ? 46 ARG P HH21 3  
ATOM 3182  H HH22 . ARG A 1 48 ? 1.071   8.320   6.963   1.00 0.00 ? 46 ARG P HH22 3  
ATOM 3183  N N    . VAL A 1 49 ? 5.728   1.330   7.322   1.00 0.00 ? 47 VAL P N    3  
ATOM 3184  C CA   . VAL A 1 49 ? 6.673   0.293   7.780   1.00 0.00 ? 47 VAL P CA   3  
ATOM 3185  C C    . VAL A 1 49 ? 7.170   -0.569  6.615   1.00 0.00 ? 47 VAL P C    3  
ATOM 3186  O O    . VAL A 1 49 ? 8.359   -0.872  6.568   1.00 0.00 ? 47 VAL P O    3  
ATOM 3187  C CB   . VAL A 1 49 ? 6.051   -0.560  8.908   1.00 0.00 ? 47 VAL P CB   3  
ATOM 3188  C CG1  . VAL A 1 49 ? 6.854   -1.826  9.238   1.00 0.00 ? 47 VAL P CG1  3  
ATOM 3189  C CG2  . VAL A 1 49 ? 5.971   0.264   10.202  1.00 0.00 ? 47 VAL P CG2  3  
ATOM 3190  H H    . VAL A 1 49 ? 4.754   1.245   7.600   1.00 0.00 ? 47 VAL P H    3  
ATOM 3191  H HA   . VAL A 1 49 ? 7.554   0.786   8.193   1.00 0.00 ? 47 VAL P HA   3  
ATOM 3192  H HB   . VAL A 1 49 ? 5.046   -0.864  8.617   1.00 0.00 ? 47 VAL P HB   3  
ATOM 3193  H HG11 . VAL A 1 49 ? 6.414   -2.331  10.098  1.00 0.00 ? 47 VAL P HG11 3  
ATOM 3194  H HG12 . VAL A 1 49 ? 6.832   -2.519  8.396   1.00 0.00 ? 47 VAL P HG12 3  
ATOM 3195  H HG13 . VAL A 1 49 ? 7.889   -1.568  9.466   1.00 0.00 ? 47 VAL P HG13 3  
ATOM 3196  H HG21 . VAL A 1 49 ? 6.974   0.505   10.557  1.00 0.00 ? 47 VAL P HG21 3  
ATOM 3197  H HG22 . VAL A 1 49 ? 5.430   1.193   10.032  1.00 0.00 ? 47 VAL P HG22 3  
ATOM 3198  H HG23 . VAL A 1 49 ? 5.447   -0.305  10.970  1.00 0.00 ? 47 VAL P HG23 3  
ATOM 3199  N N    . TRP A 1 50 ? 6.328   -0.913  5.634   1.00 0.00 ? 48 TRP P N    3  
ATOM 3200  C CA   . TRP A 1 50 ? 6.741   -1.700  4.465   1.00 0.00 ? 48 TRP P CA   3  
ATOM 3201  C C    . TRP A 1 50 ? 7.804   -0.975  3.631   1.00 0.00 ? 48 TRP P C    3  
ATOM 3202  O O    . TRP A 1 50 ? 8.831   -1.568  3.302   1.00 0.00 ? 48 TRP P O    3  
ATOM 3203  C CB   . TRP A 1 50 ? 5.529   -2.083  3.605   1.00 0.00 ? 48 TRP P CB   3  
ATOM 3204  C CG   . TRP A 1 50 ? 5.837   -3.087  2.535   1.00 0.00 ? 48 TRP P CG   3  
ATOM 3205  C CD1  . TRP A 1 50 ? 5.646   -4.421  2.643   1.00 0.00 ? 48 TRP P CD1  3  
ATOM 3206  C CD2  . TRP A 1 50 ? 6.420   -2.878  1.206   1.00 0.00 ? 48 TRP P CD2  3  
ATOM 3207  N NE1  . TRP A 1 50 ? 6.076   -5.050  1.491   1.00 0.00 ? 48 TRP P NE1  3  
ATOM 3208  C CE2  . TRP A 1 50 ? 6.574   -4.150  0.575   1.00 0.00 ? 48 TRP P CE2  3  
ATOM 3209  C CE3  . TRP A 1 50 ? 6.841   -1.748  0.468   1.00 0.00 ? 48 TRP P CE3  3  
ATOM 3210  C CZ2  . TRP A 1 50 ? 7.127   -4.298  -0.705  1.00 0.00 ? 48 TRP P CZ2  3  
ATOM 3211  C CZ3  . TRP A 1 50 ? 7.407   -1.886  -0.814  1.00 0.00 ? 48 TRP P CZ3  3  
ATOM 3212  C CH2  . TRP A 1 50 ? 7.550   -3.154  -1.404  1.00 0.00 ? 48 TRP P CH2  3  
ATOM 3213  H H    . TRP A 1 50 ? 5.345   -0.678  5.731   1.00 0.00 ? 48 TRP P H    3  
ATOM 3214  H HA   . TRP A 1 50 ? 7.191   -2.626  4.824   1.00 0.00 ? 48 TRP P HA   3  
ATOM 3215  H HB2  . TRP A 1 50 ? 4.757   -2.503  4.251   1.00 0.00 ? 48 TRP P HB2  3  
ATOM 3216  H HB3  . TRP A 1 50 ? 5.116   -1.190  3.135   1.00 0.00 ? 48 TRP P HB3  3  
ATOM 3217  H HD1  . TRP A 1 50 ? 5.229   -4.921  3.512   1.00 0.00 ? 48 TRP P HD1  3  
ATOM 3218  H HE1  . TRP A 1 50 ? 6.036   -6.052  1.357   1.00 0.00 ? 48 TRP P HE1  3  
ATOM 3219  H HE3  . TRP A 1 50 ? 6.720   -0.763  0.896   1.00 0.00 ? 48 TRP P HE3  3  
ATOM 3220  H HZ2  . TRP A 1 50 ? 7.220   -5.280  -1.146  1.00 0.00 ? 48 TRP P HZ2  3  
ATOM 3221  H HZ3  . TRP A 1 50 ? 7.729   -1.008  -1.355  1.00 0.00 ? 48 TRP P HZ3  3  
ATOM 3222  H HH2  . TRP A 1 50 ? 7.978   -3.246  -2.393  1.00 0.00 ? 48 TRP P HH2  3  
ATOM 3223  N N    . PHE A 1 51 ? 7.629   0.323   3.357   1.00 0.00 ? 49 PHE P N    3  
ATOM 3224  C CA   . PHE A 1 51 ? 8.620   1.112   2.611   1.00 0.00 ? 49 PHE P CA   3  
ATOM 3225  C C    . PHE A 1 51 ? 9.946   1.318   3.371   1.00 0.00 ? 49 PHE P C    3  
ATOM 3226  O O    . PHE A 1 51 ? 10.993  1.454   2.731   1.00 0.00 ? 49 PHE P O    3  
ATOM 3227  C CB   . PHE A 1 51 ? 7.991   2.440   2.156   1.00 0.00 ? 49 PHE P CB   3  
ATOM 3228  C CG   . PHE A 1 51 ? 7.018   2.291   0.996   1.00 0.00 ? 49 PHE P CG   3  
ATOM 3229  C CD1  . PHE A 1 51 ? 7.474   1.808   -0.248  1.00 0.00 ? 49 PHE P CD1  3  
ATOM 3230  C CD2  . PHE A 1 51 ? 5.659   2.626   1.150   1.00 0.00 ? 49 PHE P CD2  3  
ATOM 3231  C CE1  . PHE A 1 51 ? 6.574   1.625   -1.313  1.00 0.00 ? 49 PHE P CE1  3  
ATOM 3232  C CE2  . PHE A 1 51 ? 4.761   2.447   0.083   1.00 0.00 ? 49 PHE P CE2  3  
ATOM 3233  C CZ   . PHE A 1 51 ? 5.214   1.926   -1.140  1.00 0.00 ? 49 PHE P CZ   3  
ATOM 3234  H H    . PHE A 1 51 ? 6.752   0.759   3.624   1.00 0.00 ? 49 PHE P H    3  
ATOM 3235  H HA   . PHE A 1 51 ? 8.887   0.547   1.717   1.00 0.00 ? 49 PHE P HA   3  
ATOM 3236  H HB2  . PHE A 1 51 ? 7.491   2.909   3.005   1.00 0.00 ? 49 PHE P HB2  3  
ATOM 3237  H HB3  . PHE A 1 51 ? 8.781   3.118   1.835   1.00 0.00 ? 49 PHE P HB3  3  
ATOM 3238  H HD1  . PHE A 1 51 ? 8.516   1.554   -0.384  1.00 0.00 ? 49 PHE P HD1  3  
ATOM 3239  H HD2  . PHE A 1 51 ? 5.299   3.009   2.092   1.00 0.00 ? 49 PHE P HD2  3  
ATOM 3240  H HE1  . PHE A 1 51 ? 6.919   1.240   -2.261  1.00 0.00 ? 49 PHE P HE1  3  
ATOM 3241  H HE2  . PHE A 1 51 ? 3.719   2.701   0.198   1.00 0.00 ? 49 PHE P HE2  3  
ATOM 3242  H HZ   . PHE A 1 51 ? 4.520   1.773   -1.953  1.00 0.00 ? 49 PHE P HZ   3  
ATOM 3243  N N    . LYS A 1 52 ? 9.938   1.272   4.712   1.00 0.00 ? 50 LYS P N    3  
ATOM 3244  C CA   . LYS A 1 52 ? 11.147  1.242   5.555   1.00 0.00 ? 50 LYS P CA   3  
ATOM 3245  C C    . LYS A 1 52 ? 11.819  -0.141  5.551   1.00 0.00 ? 50 LYS P C    3  
ATOM 3246  O O    . LYS A 1 52 ? 13.032  -0.236  5.378   1.00 0.00 ? 50 LYS P O    3  
ATOM 3247  C CB   . LYS A 1 52 ? 10.746  1.708   6.965   1.00 0.00 ? 50 LYS P CB   3  
ATOM 3248  C CG   . LYS A 1 52 ? 11.931  1.804   7.938   1.00 0.00 ? 50 LYS P CG   3  
ATOM 3249  C CD   . LYS A 1 52 ? 11.470  2.202   9.350   1.00 0.00 ? 50 LYS P CD   3  
ATOM 3250  C CE   . LYS A 1 52 ? 10.915  3.631   9.472   1.00 0.00 ? 50 LYS P CE   3  
ATOM 3251  N NZ   . LYS A 1 52 ? 11.968  4.667   9.296   1.00 0.00 ? 50 LYS P NZ   3  
ATOM 3252  H H    . LYS A 1 52 ? 9.040   1.213   5.179   1.00 0.00 ? 50 LYS P H    3  
ATOM 3253  H HA   . LYS A 1 52 ? 11.878  1.950   5.157   1.00 0.00 ? 50 LYS P HA   3  
ATOM 3254  H HB2  . LYS A 1 52 ? 10.275  2.688   6.880   1.00 0.00 ? 50 LYS P HB2  3  
ATOM 3255  H HB3  . LYS A 1 52 ? 10.011  1.014   7.377   1.00 0.00 ? 50 LYS P HB3  3  
ATOM 3256  H HG2  . LYS A 1 52 ? 12.417  0.831   8.009   1.00 0.00 ? 50 LYS P HG2  3  
ATOM 3257  H HG3  . LYS A 1 52 ? 12.661  2.523   7.563   1.00 0.00 ? 50 LYS P HG3  3  
ATOM 3258  H HD2  . LYS A 1 52 ? 10.688  1.504   9.656   1.00 0.00 ? 50 LYS P HD2  3  
ATOM 3259  H HD3  . LYS A 1 52 ? 12.305  2.082   10.041  1.00 0.00 ? 50 LYS P HD3  3  
ATOM 3260  H HE2  . LYS A 1 52 ? 10.115  3.771   8.738   1.00 0.00 ? 50 LYS P HE2  3  
ATOM 3261  H HE3  . LYS A 1 52 ? 10.467  3.736   10.465  1.00 0.00 ? 50 LYS P HE3  3  
ATOM 3262  H HZ1  . LYS A 1 52 ? 12.708  4.557   9.977   1.00 0.00 ? 50 LYS P HZ1  3  
ATOM 3263  H HZ2  . LYS A 1 52 ? 11.585  5.596   9.418   1.00 0.00 ? 50 LYS P HZ2  3  
ATOM 3264  H HZ3  . LYS A 1 52 ? 12.382  4.628   8.375   1.00 0.00 ? 50 LYS P HZ3  3  
ATOM 3265  N N    . ASN A 1 53 ? 11.033  -1.213  5.659   1.00 0.00 ? 51 ASN P N    3  
ATOM 3266  C CA   . ASN A 1 53 ? 11.482  -2.609  5.592   1.00 0.00 ? 51 ASN P CA   3  
ATOM 3267  C C    . ASN A 1 53 ? 12.141  -2.928  4.233   1.00 0.00 ? 51 ASN P C    3  
ATOM 3268  O O    . ASN A 1 53 ? 13.211  -3.538  4.181   1.00 0.00 ? 51 ASN P O    3  
ATOM 3269  C CB   . ASN A 1 53 ? 10.245  -3.488  5.879   1.00 0.00 ? 51 ASN P CB   3  
ATOM 3270  C CG   . ASN A 1 53 ? 10.514  -4.979  5.982   1.00 0.00 ? 51 ASN P CG   3  
ATOM 3271  O OD1  . ASN A 1 53 ? 11.635  -5.450  6.109   1.00 0.00 ? 51 ASN P OD1  3  
ATOM 3272  N ND2  . ASN A 1 53 ? 9.474   -5.781  5.953   1.00 0.00 ? 51 ASN P ND2  3  
ATOM 3273  H H    . ASN A 1 53 ? 10.047  -1.045  5.826   1.00 0.00 ? 51 ASN P H    3  
ATOM 3274  H HA   . ASN A 1 53 ? 12.226  -2.783  6.372   1.00 0.00 ? 51 ASN P HA   3  
ATOM 3275  H HB2  . ASN A 1 53 ? 9.799   -3.177  6.825   1.00 0.00 ? 51 ASN P HB2  3  
ATOM 3276  H HB3  . ASN A 1 53 ? 9.507   -3.333  5.095   1.00 0.00 ? 51 ASN P HB3  3  
ATOM 3277  H HD21 . ASN A 1 53 ? 8.544   -5.402  5.869   1.00 0.00 ? 51 ASN P HD21 3  
ATOM 3278  H HD22 . ASN A 1 53 ? 9.621   -6.774  6.038   1.00 0.00 ? 51 ASN P HD22 3  
ATOM 3279  N N    . ARG A 1 54 ? 11.563  -2.423  3.134   1.00 0.00 ? 52 ARG P N    3  
ATOM 3280  C CA   . ARG A 1 54 ? 12.105  -2.515  1.767   1.00 0.00 ? 52 ARG P CA   3  
ATOM 3281  C C    . ARG A 1 54 ? 13.495  -1.877  1.650   1.00 0.00 ? 52 ARG P C    3  
ATOM 3282  O O    . ARG A 1 54 ? 14.399  -2.478  1.070   1.00 0.00 ? 52 ARG P O    3  
ATOM 3283  C CB   . ARG A 1 54 ? 11.087  -1.863  0.806   1.00 0.00 ? 52 ARG P CB   3  
ATOM 3284  C CG   . ARG A 1 54 ? 11.338  -2.115  -0.689  1.00 0.00 ? 52 ARG P CG   3  
ATOM 3285  C CD   . ARG A 1 54 ? 11.203  -3.601  -1.042  1.00 0.00 ? 52 ARG P CD   3  
ATOM 3286  N NE   . ARG A 1 54 ? 11.115  -3.814  -2.499  1.00 0.00 ? 52 ARG P NE   3  
ATOM 3287  C CZ   . ARG A 1 54 ? 10.684  -4.917  -3.086  1.00 0.00 ? 52 ARG P CZ   3  
ATOM 3288  N NH1  . ARG A 1 54 ? 10.341  -5.982  -2.424  1.00 0.00 ? 52 ARG P NH1  3  
ATOM 3289  N NH2  . ARG A 1 54 ? 10.565  -5.008  -4.375  1.00 0.00 ? 52 ARG P NH2  3  
ATOM 3290  H H    . ARG A 1 54 ? 10.654  -1.981  3.253   1.00 0.00 ? 52 ARG P H    3  
ATOM 3291  H HA   . ARG A 1 54 ? 12.218  -3.572  1.518   1.00 0.00 ? 52 ARG P HA   3  
ATOM 3292  H HB2  . ARG A 1 54 ? 10.090  -2.240  1.038   1.00 0.00 ? 52 ARG P HB2  3  
ATOM 3293  H HB3  . ARG A 1 54 ? 11.075  -0.785  0.976   1.00 0.00 ? 52 ARG P HB3  3  
ATOM 3294  H HG2  . ARG A 1 54 ? 10.588  -1.556  -1.250  1.00 0.00 ? 52 ARG P HG2  3  
ATOM 3295  H HG3  . ARG A 1 54 ? 12.326  -1.754  -0.975  1.00 0.00 ? 52 ARG P HG3  3  
ATOM 3296  H HD2  . ARG A 1 54 ? 12.063  -4.144  -0.648  1.00 0.00 ? 52 ARG P HD2  3  
ATOM 3297  H HD3  . ARG A 1 54 ? 10.296  -3.982  -0.568  1.00 0.00 ? 52 ARG P HD3  3  
ATOM 3298  H HE   . ARG A 1 54 ? 11.360  -3.040  -3.098  1.00 0.00 ? 52 ARG P HE   3  
ATOM 3299  H HH11 . ARG A 1 54 ? 10.415  -6.009  -1.424  1.00 0.00 ? 52 ARG P HH11 3  
ATOM 3300  H HH12 . ARG A 1 54 ? 9.979   -6.767  -2.960  1.00 0.00 ? 52 ARG P HH12 3  
ATOM 3301  H HH21 . ARG A 1 54 ? 10.841  -4.259  -4.982  1.00 0.00 ? 52 ARG P HH21 3  
ATOM 3302  H HH22 . ARG A 1 54 ? 10.180  -5.875  -4.742  1.00 0.00 ? 52 ARG P HH22 3  
ATOM 3303  N N    . ARG A 1 55 ? 13.693  -0.704  2.264   1.00 0.00 ? 53 ARG P N    3  
ATOM 3304  C CA   . ARG A 1 55 ? 14.985  0.011   2.322   1.00 0.00 ? 53 ARG P CA   3  
ATOM 3305  C C    . ARG A 1 55 ? 16.008  -0.688  3.219   1.00 0.00 ? 53 ARG P C    3  
ATOM 3306  O O    . ARG A 1 55 ? 17.171  -0.793  2.835   1.00 0.00 ? 53 ARG P O    3  
ATOM 3307  C CB   . ARG A 1 55 ? 14.751  1.465   2.765   1.00 0.00 ? 53 ARG P CB   3  
ATOM 3308  C CG   . ARG A 1 55 ? 14.131  2.279   1.623   1.00 0.00 ? 53 ARG P CG   3  
ATOM 3309  C CD   . ARG A 1 55 ? 13.587  3.623   2.124   1.00 0.00 ? 53 ARG P CD   3  
ATOM 3310  N NE   . ARG A 1 55 ? 13.080  4.447   1.010   1.00 0.00 ? 53 ARG P NE   3  
ATOM 3311  C CZ   . ARG A 1 55 ? 12.009  4.220   0.272   1.00 0.00 ? 53 ARG P CZ   3  
ATOM 3312  N NH1  . ARG A 1 55 ? 11.193  3.226   0.474   1.00 0.00 ? 53 ARG P NH1  3  
ATOM 3313  N NH2  . ARG A 1 55 ? 11.723  5.000   -0.721  1.00 0.00 ? 53 ARG P NH2  3  
ATOM 3314  H H    . ARG A 1 55 ? 12.892  -0.287  2.721   1.00 0.00 ? 53 ARG P H    3  
ATOM 3315  H HA   . ARG A 1 55 ? 15.429  0.029   1.325   1.00 0.00 ? 53 ARG P HA   3  
ATOM 3316  H HB2  . ARG A 1 55 ? 14.095  1.484   3.637   1.00 0.00 ? 53 ARG P HB2  3  
ATOM 3317  H HB3  . ARG A 1 55 ? 15.702  1.925   3.040   1.00 0.00 ? 53 ARG P HB3  3  
ATOM 3318  H HG2  . ARG A 1 55 ? 14.892  2.458   0.861   1.00 0.00 ? 53 ARG P HG2  3  
ATOM 3319  H HG3  . ARG A 1 55 ? 13.319  1.712   1.169   1.00 0.00 ? 53 ARG P HG3  3  
ATOM 3320  H HD2  . ARG A 1 55 ? 12.791  3.449   2.851   1.00 0.00 ? 53 ARG P HD2  3  
ATOM 3321  H HD3  . ARG A 1 55 ? 14.392  4.162   2.626   1.00 0.00 ? 53 ARG P HD3  3  
ATOM 3322  H HE   . ARG A 1 55 ? 13.640  5.244   0.750   1.00 0.00 ? 53 ARG P HE   3  
ATOM 3323  H HH11 . ARG A 1 55 ? 11.342  2.610   1.266   1.00 0.00 ? 53 ARG P HH11 3  
ATOM 3324  H HH12 . ARG A 1 55 ? 10.403  3.106   -0.132  1.00 0.00 ? 53 ARG P HH12 3  
ATOM 3325  H HH21 . ARG A 1 55 ? 12.297  5.800   -0.933  1.00 0.00 ? 53 ARG P HH21 3  
ATOM 3326  H HH22 . ARG A 1 55 ? 10.951  4.767   -1.334  1.00 0.00 ? 53 ARG P HH22 3  
ATOM 3327  N N    . ALA A 1 56 ? 15.583  -1.244  4.353   1.00 0.00 ? 54 ALA P N    3  
ATOM 3328  C CA   . ALA A 1 56 ? 16.445  -2.041  5.229   1.00 0.00 ? 54 ALA P CA   3  
ATOM 3329  C C    . ALA A 1 56 ? 16.962  -3.315  4.528   1.00 0.00 ? 54 ALA P C    3  
ATOM 3330  O O    . ALA A 1 56 ? 18.155  -3.616  4.595   1.00 0.00 ? 54 ALA P O    3  
ATOM 3331  C CB   . ALA A 1 56 ? 15.674  -2.362  6.516   1.00 0.00 ? 54 ALA P CB   3  
ATOM 3332  H H    . ALA A 1 56 ? 14.624  -1.075  4.638   1.00 0.00 ? 54 ALA P H    3  
ATOM 3333  H HA   . ALA A 1 56 ? 17.315  -1.441  5.499   1.00 0.00 ? 54 ALA P HA   3  
ATOM 3334  H HB1  . ALA A 1 56 ? 15.349  -1.435  6.994   1.00 0.00 ? 54 ALA P HB1  3  
ATOM 3335  H HB2  . ALA A 1 56 ? 14.800  -2.976  6.294   1.00 0.00 ? 54 ALA P HB2  3  
ATOM 3336  H HB3  . ALA A 1 56 ? 16.321  -2.904  7.205   1.00 0.00 ? 54 ALA P HB3  3  
ATOM 3337  N N    . LYS A 1 57 ? 16.097  -4.020  3.784   1.00 0.00 ? 55 LYS P N    3  
ATOM 3338  C CA   . LYS A 1 57 ? 16.458  -5.210  2.986   1.00 0.00 ? 55 LYS P CA   3  
ATOM 3339  C C    . LYS A 1 57 ? 17.277  -4.886  1.729   1.00 0.00 ? 55 LYS P C    3  
ATOM 3340  O O    . LYS A 1 57 ? 18.084  -5.713  1.307   1.00 0.00 ? 55 LYS P O    3  
ATOM 3341  C CB   . LYS A 1 57 ? 15.182  -6.004  2.654   1.00 0.00 ? 55 LYS P CB   3  
ATOM 3342  C CG   . LYS A 1 57 ? 14.708  -6.780  3.892   1.00 0.00 ? 55 LYS P CG   3  
ATOM 3343  C CD   . LYS A 1 57 ? 13.351  -7.460  3.663   1.00 0.00 ? 55 LYS P CD   3  
ATOM 3344  C CE   . LYS A 1 57 ? 13.009  -8.482  4.759   1.00 0.00 ? 55 LYS P CE   3  
ATOM 3345  N NZ   . LYS A 1 57 ? 13.045  -7.893  6.124   1.00 0.00 ? 55 LYS P NZ   3  
ATOM 3346  H H    . LYS A 1 57 ? 15.119  -3.741  3.812   1.00 0.00 ? 55 LYS P H    3  
ATOM 3347  H HA   . LYS A 1 57 ? 17.105  -5.850  3.590   1.00 0.00 ? 55 LYS P HA   3  
ATOM 3348  H HB2  . LYS A 1 57 ? 14.401  -5.326  2.307   1.00 0.00 ? 55 LYS P HB2  3  
ATOM 3349  H HB3  . LYS A 1 57 ? 15.396  -6.722  1.861   1.00 0.00 ? 55 LYS P HB3  3  
ATOM 3350  H HG2  . LYS A 1 57 ? 15.454  -7.540  4.132   1.00 0.00 ? 55 LYS P HG2  3  
ATOM 3351  H HG3  . LYS A 1 57 ? 14.620  -6.097  4.738   1.00 0.00 ? 55 LYS P HG3  3  
ATOM 3352  H HD2  . LYS A 1 57 ? 12.572  -6.696  3.618   1.00 0.00 ? 55 LYS P HD2  3  
ATOM 3353  H HD3  . LYS A 1 57 ? 13.369  -7.984  2.706   1.00 0.00 ? 55 LYS P HD3  3  
ATOM 3354  H HE2  . LYS A 1 57 ? 12.010  -8.880  4.554   1.00 0.00 ? 55 LYS P HE2  3  
ATOM 3355  H HE3  . LYS A 1 57 ? 13.714  -9.315  4.697   1.00 0.00 ? 55 LYS P HE3  3  
ATOM 3356  H HZ1  . LYS A 1 57 ? 13.986  -7.649  6.396   1.00 0.00 ? 55 LYS P HZ1  3  
ATOM 3357  H HZ2  . LYS A 1 57 ? 12.687  -8.540  6.813   1.00 0.00 ? 55 LYS P HZ2  3  
ATOM 3358  H HZ3  . LYS A 1 57 ? 12.487  -7.042  6.169   1.00 0.00 ? 55 LYS P HZ3  3  
ATOM 3359  N N    . TRP A 1 58 ? 17.137  -3.682  1.171   1.00 0.00 ? 56 TRP P N    3  
ATOM 3360  C CA   . TRP A 1 58 ? 18.013  -3.164  0.110   1.00 0.00 ? 56 TRP P CA   3  
ATOM 3361  C C    . TRP A 1 58 ? 19.423  -2.832  0.636   1.00 0.00 ? 56 TRP P C    3  
ATOM 3362  O O    . TRP A 1 58 ? 20.420  -3.214  0.016   1.00 0.00 ? 56 TRP P O    3  
ATOM 3363  C CB   . TRP A 1 58 ? 17.348  -1.939  -0.535  1.00 0.00 ? 56 TRP P CB   3  
ATOM 3364  C CG   . TRP A 1 58 ? 18.226  -1.132  -1.439  1.00 0.00 ? 56 TRP P CG   3  
ATOM 3365  C CD1  . TRP A 1 58 ? 18.539  -1.439  -2.719  1.00 0.00 ? 56 TRP P CD1  3  
ATOM 3366  C CD2  . TRP A 1 58 ? 18.947  0.105   -1.139  1.00 0.00 ? 56 TRP P CD2  3  
ATOM 3367  N NE1  . TRP A 1 58 ? 19.397  -0.484  -3.230  1.00 0.00 ? 56 TRP P NE1  3  
ATOM 3368  C CE2  . TRP A 1 58 ? 19.687  0.490   -2.297  1.00 0.00 ? 56 TRP P CE2  3  
ATOM 3369  C CE3  . TRP A 1 58 ? 19.055  0.937   -0.001  1.00 0.00 ? 56 TRP P CE3  3  
ATOM 3370  C CZ2  . TRP A 1 58 ? 20.492  1.639   -2.328  1.00 0.00 ? 56 TRP P CZ2  3  
ATOM 3371  C CZ3  . TRP A 1 58 ? 19.861  2.094   -0.021  1.00 0.00 ? 56 TRP P CZ3  3  
ATOM 3372  C CH2  . TRP A 1 58 ? 20.575  2.447   -1.180  1.00 0.00 ? 56 TRP P CH2  3  
ATOM 3373  H H    . TRP A 1 58 ? 16.379  -3.098  1.496   1.00 0.00 ? 56 TRP P H    3  
ATOM 3374  H HA   . TRP A 1 58 ? 18.131  -3.925  -0.663  1.00 0.00 ? 56 TRP P HA   3  
ATOM 3375  H HB2  . TRP A 1 58 ? 16.472  -2.270  -1.095  1.00 0.00 ? 56 TRP P HB2  3  
ATOM 3376  H HB3  . TRP A 1 58 ? 16.997  -1.275  0.253   1.00 0.00 ? 56 TRP P HB3  3  
ATOM 3377  H HD1  . TRP A 1 58 ? 18.177  -2.313  -3.252  1.00 0.00 ? 56 TRP P HD1  3  
ATOM 3378  H HE1  . TRP A 1 58 ? 19.768  -0.517  -4.174  1.00 0.00 ? 56 TRP P HE1  3  
ATOM 3379  H HE3  . TRP A 1 58 ? 18.509  0.679   0.895   1.00 0.00 ? 56 TRP P HE3  3  
ATOM 3380  H HZ2  . TRP A 1 58 ? 21.040  1.900   -3.223  1.00 0.00 ? 56 TRP P HZ2  3  
ATOM 3381  H HZ3  . TRP A 1 58 ? 19.927  2.720   0.860   1.00 0.00 ? 56 TRP P HZ3  3  
ATOM 3382  H HH2  . TRP A 1 58 ? 21.188  3.339   -1.190  1.00 0.00 ? 56 TRP P HH2  3  
ATOM 3383  N N    . ARG A 1 59 ? 19.520  -2.167  1.798   1.00 0.00 ? 57 ARG P N    3  
ATOM 3384  C CA   . ARG A 1 59 ? 20.791  -1.756  2.427   1.00 0.00 ? 57 ARG P CA   3  
ATOM 3385  C C    . ARG A 1 59 ? 21.550  -2.921  3.079   1.00 0.00 ? 57 ARG P C    3  
ATOM 3386  O O    . ARG A 1 59 ? 22.780  -2.895  3.114   1.00 0.00 ? 57 ARG P O    3  
ATOM 3387  C CB   . ARG A 1 59 ? 20.501  -0.609  3.413   1.00 0.00 ? 57 ARG P CB   3  
ATOM 3388  C CG   . ARG A 1 59 ? 21.772  0.121   3.874   1.00 0.00 ? 57 ARG P CG   3  
ATOM 3389  C CD   . ARG A 1 59 ? 21.418  1.327   4.753   1.00 0.00 ? 57 ARG P CD   3  
ATOM 3390  N NE   . ARG A 1 59 ? 22.632  2.039   5.195   1.00 0.00 ? 57 ARG P NE   3  
ATOM 3391  C CZ   . ARG A 1 59 ? 23.083  3.220   4.818   1.00 0.00 ? 57 ARG P CZ   3  
ATOM 3392  N NH1  . ARG A 1 59 ? 22.479  3.972   3.943   1.00 0.00 ? 57 ARG P NH1  3  
ATOM 3393  N NH2  . ARG A 1 59 ? 24.195  3.645   5.335   1.00 0.00 ? 57 ARG P NH2  3  
ATOM 3394  H H    . ARG A 1 59 ? 18.653  -1.845  2.220   1.00 0.00 ? 57 ARG P H    3  
ATOM 3395  H HA   . ARG A 1 59 ? 21.446  -1.370  1.643   1.00 0.00 ? 57 ARG P HA   3  
ATOM 3396  H HB2  . ARG A 1 59 ? 19.857  0.120   2.919   1.00 0.00 ? 57 ARG P HB2  3  
ATOM 3397  H HB3  . ARG A 1 59 ? 19.967  -0.999  4.283   1.00 0.00 ? 57 ARG P HB3  3  
ATOM 3398  H HG2  . ARG A 1 59 ? 22.402  -0.560  4.447   1.00 0.00 ? 57 ARG P HG2  3  
ATOM 3399  H HG3  . ARG A 1 59 ? 22.326  0.468   3.000   1.00 0.00 ? 57 ARG P HG3  3  
ATOM 3400  H HD2  . ARG A 1 59 ? 20.756  1.994   4.198   1.00 0.00 ? 57 ARG P HD2  3  
ATOM 3401  H HD3  . ARG A 1 59 ? 20.876  0.974   5.633   1.00 0.00 ? 57 ARG P HD3  3  
ATOM 3402  H HE   . ARG A 1 59 ? 23.211  1.585   5.897   1.00 0.00 ? 57 ARG P HE   3  
ATOM 3403  H HH11 . ARG A 1 59 ? 21.610  3.664   3.546   1.00 0.00 ? 57 ARG P HH11 3  
ATOM 3404  H HH12 . ARG A 1 59 ? 22.850  4.877   3.705   1.00 0.00 ? 57 ARG P HH12 3  
ATOM 3405  H HH21 . ARG A 1 59 ? 24.638  3.047   6.033   1.00 0.00 ? 57 ARG P HH21 3  
ATOM 3406  H HH22 . ARG A 1 59 ? 24.559  4.558   5.124   1.00 0.00 ? 57 ARG P HH22 3  
ATOM 3407  N N    . LYS A 1 60 ? 20.831  -3.939  3.576   1.00 0.00 ? 58 LYS P N    3  
ATOM 3408  C CA   . LYS A 1 60 ? 21.310  -5.258  4.064   1.00 0.00 ? 58 LYS P CA   3  
ATOM 3409  C C    . LYS A 1 60 ? 22.539  -5.242  4.999   1.00 0.00 ? 58 LYS P C    3  
ATOM 3410  O O    . LYS A 1 60 ? 23.346  -6.173  4.995   1.00 0.00 ? 58 LYS P O    3  
ATOM 3411  C CB   . LYS A 1 60 ? 21.404  -6.261  2.893   1.00 0.00 ? 58 LYS P CB   3  
ATOM 3412  C CG   . LYS A 1 60 ? 22.463  -5.918  1.830   1.00 0.00 ? 58 LYS P CG   3  
ATOM 3413  C CD   . LYS A 1 60 ? 22.525  -6.993  0.739   1.00 0.00 ? 58 LYS P CD   3  
ATOM 3414  C CE   . LYS A 1 60 ? 23.577  -6.612  -0.309  1.00 0.00 ? 58 LYS P CE   3  
ATOM 3415  N NZ   . LYS A 1 60 ? 23.665  -7.627  -1.391  1.00 0.00 ? 58 LYS P NZ   3  
ATOM 3416  H H    . LYS A 1 60 ? 19.826  -3.800  3.576   1.00 0.00 ? 58 LYS P H    3  
ATOM 3417  H HA   . LYS A 1 60 ? 20.513  -5.638  4.707   1.00 0.00 ? 58 LYS P HA   3  
ATOM 3418  H HB2  . LYS A 1 60 ? 21.618  -7.253  3.296   1.00 0.00 ? 58 LYS P HB2  3  
ATOM 3419  H HB3  . LYS A 1 60 ? 20.432  -6.316  2.405   1.00 0.00 ? 58 LYS P HB3  3  
ATOM 3420  H HG2  . LYS A 1 60 ? 22.217  -4.966  1.361   1.00 0.00 ? 58 LYS P HG2  3  
ATOM 3421  H HG3  . LYS A 1 60 ? 23.440  -5.836  2.304   1.00 0.00 ? 58 LYS P HG3  3  
ATOM 3422  H HD2  . LYS A 1 60 ? 22.787  -7.952  1.190   1.00 0.00 ? 58 LYS P HD2  3  
ATOM 3423  H HD3  . LYS A 1 60 ? 21.546  -7.078  0.261   1.00 0.00 ? 58 LYS P HD3  3  
ATOM 3424  H HE2  . LYS A 1 60 ? 23.313  -5.637  -0.731  1.00 0.00 ? 58 LYS P HE2  3  
ATOM 3425  H HE3  . LYS A 1 60 ? 24.547  -6.510  0.187   1.00 0.00 ? 58 LYS P HE3  3  
ATOM 3426  H HZ1  . LYS A 1 60 ? 22.782  -7.726  -1.875  1.00 0.00 ? 58 LYS P HZ1  3  
ATOM 3427  H HZ2  . LYS A 1 60 ? 23.923  -8.533  -1.026  1.00 0.00 ? 58 LYS P HZ2  3  
ATOM 3428  H HZ3  . LYS A 1 60 ? 24.360  -7.367  -2.078  1.00 0.00 ? 58 LYS P HZ3  3  
ATOM 3429  N N    . ARG A 1 61 ? 22.691  -4.167  5.787   1.00 0.00 ? 59 ARG P N    3  
ATOM 3430  C CA   . ARG A 1 61 ? 23.866  -3.844  6.631   1.00 0.00 ? 59 ARG P CA   3  
ATOM 3431  C C    . ARG A 1 61 ? 25.217  -3.833  5.878   1.00 0.00 ? 59 ARG P C    3  
ATOM 3432  O O    . ARG A 1 61 ? 26.280  -4.011  6.473   1.00 0.00 ? 59 ARG P O    3  
ATOM 3433  C CB   . ARG A 1 61 ? 23.846  -4.715  7.907   1.00 0.00 ? 59 ARG P CB   3  
ATOM 3434  C CG   . ARG A 1 61 ? 24.506  -4.096  9.157   1.00 0.00 ? 59 ARG P CG   3  
ATOM 3435  C CD   . ARG A 1 61 ? 23.634  -3.062  9.893   1.00 0.00 ? 59 ARG P CD   3  
ATOM 3436  N NE   . ARG A 1 61 ? 23.638  -1.737  9.245   1.00 0.00 ? 59 ARG P NE   3  
ATOM 3437  C CZ   . ARG A 1 61 ? 22.884  -0.696  9.541   1.00 0.00 ? 59 ARG P CZ   3  
ATOM 3438  N NH1  . ARG A 1 61 ? 21.979  -0.730  10.478  1.00 0.00 ? 59 ARG P NH1  3  
ATOM 3439  N NH2  . ARG A 1 61 ? 23.040  0.416   8.884   1.00 0.00 ? 59 ARG P NH2  3  
ATOM 3440  H H    . ARG A 1 61 ? 21.943  -3.489  5.751   1.00 0.00 ? 59 ARG P H    3  
ATOM 3441  H HA   . ARG A 1 61 ? 23.727  -2.811  6.938   1.00 0.00 ? 59 ARG P HA   3  
ATOM 3442  H HB2  . ARG A 1 61 ? 22.814  -4.957  8.165   1.00 0.00 ? 59 ARG P HB2  3  
ATOM 3443  H HB3  . ARG A 1 61 ? 24.347  -5.658  7.684   1.00 0.00 ? 59 ARG P HB3  3  
ATOM 3444  H HG2  . ARG A 1 61 ? 24.693  -4.910  9.857   1.00 0.00 ? 59 ARG P HG2  3  
ATOM 3445  H HG3  . ARG A 1 61 ? 25.471  -3.653  8.909   1.00 0.00 ? 59 ARG P HG3  3  
ATOM 3446  H HD2  . ARG A 1 61 ? 22.615  -3.447  9.964   1.00 0.00 ? 59 ARG P HD2  3  
ATOM 3447  H HD3  . ARG A 1 61 ? 24.027  -2.951  10.905  1.00 0.00 ? 59 ARG P HD3  3  
ATOM 3448  H HE   . ARG A 1 61 ? 24.316  -1.569  8.504   1.00 0.00 ? 59 ARG P HE   3  
ATOM 3449  H HH11 . ARG A 1 61 ? 21.851  -1.577  11.005  1.00 0.00 ? 59 ARG P HH11 3  
ATOM 3450  H HH12 . ARG A 1 61 ? 21.419  0.081   10.682  1.00 0.00 ? 59 ARG P HH12 3  
ATOM 3451  H HH21 . ARG A 1 61 ? 23.766  0.467   8.167   1.00 0.00 ? 59 ARG P HH21 3  
ATOM 3452  H HH22 . ARG A 1 61 ? 22.498  1.230   9.112   1.00 0.00 ? 59 ARG P HH22 3  
ATOM 3453  N N    . GLU A 1 62 ? 25.178  -3.624  4.561   1.00 0.00 ? 60 GLU P N    3  
ATOM 3454  C CA   . GLU A 1 62 ? 26.344  -3.432  3.678   1.00 0.00 ? 60 GLU P CA   3  
ATOM 3455  C C    . GLU A 1 62 ? 26.654  -1.932  3.455   1.00 0.00 ? 60 GLU P C    3  
ATOM 3456  O O    . GLU A 1 62 ? 27.748  -1.569  3.021   1.00 0.00 ? 60 GLU P O    3  
ATOM 3457  C CB   . GLU A 1 62 ? 26.060  -4.173  2.357   1.00 0.00 ? 60 GLU P CB   3  
ATOM 3458  C CG   . GLU A 1 62 ? 27.267  -4.375  1.429   1.00 0.00 ? 60 GLU P CG   3  
ATOM 3459  C CD   . GLU A 1 62 ? 28.312  -5.333  2.034   1.00 0.00 ? 60 GLU P CD   3  
ATOM 3460  O OE1  . GLU A 1 62 ? 28.161  -6.571  1.889   1.00 0.00 ? 60 GLU P OE1  3  
ATOM 3461  O OE2  . GLU A 1 62 ? 29.301  -4.862  2.649   1.00 0.00 ? 60 GLU P OE2  3  
ATOM 3462  H H    . GLU A 1 62 ? 24.265  -3.520  4.136   1.00 0.00 ? 60 GLU P H    3  
ATOM 3463  H HA   . GLU A 1 62 ? 27.222  -3.881  4.144   1.00 0.00 ? 60 GLU P HA   3  
ATOM 3464  H HB2  . GLU A 1 62 ? 25.661  -5.161  2.591   1.00 0.00 ? 60 GLU P HB2  3  
ATOM 3465  H HB3  . GLU A 1 62 ? 25.289  -3.626  1.810   1.00 0.00 ? 60 GLU P HB3  3  
ATOM 3466  H HG2  . GLU A 1 62 ? 26.901  -4.794  0.488   1.00 0.00 ? 60 GLU P HG2  3  
ATOM 3467  H HG3  . GLU A 1 62 ? 27.719  -3.413  1.186   1.00 0.00 ? 60 GLU P HG3  3  
ATOM 3468  N N    . GLU A 1 63 ? 25.706  -1.059  3.823   1.00 0.00 ? 61 GLU P N    3  
ATOM 3469  C CA   . GLU A 1 63 ? 25.738  0.410   3.704   1.00 0.00 ? 61 GLU P CA   3  
ATOM 3470  C C    . GLU A 1 63 ? 25.780  0.954   2.257   1.00 0.00 ? 61 GLU P C    3  
ATOM 3471  O O    . GLU A 1 63 ? 25.891  0.209   1.279   1.00 0.00 ? 61 GLU P O    3  
ATOM 3472  C CB   . GLU A 1 63 ? 26.830  1.030   4.608   1.00 0.00 ? 61 GLU P CB   3  
ATOM 3473  C CG   . GLU A 1 63 ? 26.914  0.454   6.032   1.00 0.00 ? 61 GLU P CG   3  
ATOM 3474  C CD   . GLU A 1 63 ? 25.546  0.374   6.722   1.00 0.00 ? 61 GLU P CD   3  
ATOM 3475  O OE1  . GLU A 1 63 ? 24.841  1.403   6.836   1.00 0.00 ? 61 GLU P OE1  3  
ATOM 3476  O OE2  . GLU A 1 63 ? 25.125  -0.723  7.145   1.00 0.00 ? 61 GLU P OE2  3  
ATOM 3477  H H    . GLU A 1 63 ? 24.856  -1.464  4.184   1.00 0.00 ? 61 GLU P H    3  
ATOM 3478  H HA   . GLU A 1 63 ? 24.788  0.762   4.099   1.00 0.00 ? 61 GLU P HA   3  
ATOM 3479  H HB2  . GLU A 1 63 ? 27.804  0.911   4.132   1.00 0.00 ? 61 GLU P HB2  3  
ATOM 3480  H HB3  . GLU A 1 63 ? 26.640  2.101   4.689   1.00 0.00 ? 61 GLU P HB3  3  
ATOM 3481  H HG2  . GLU A 1 63 ? 27.365  -0.541  5.989   1.00 0.00 ? 61 GLU P HG2  3  
ATOM 3482  H HG3  . GLU A 1 63 ? 27.579  1.085   6.625   1.00 0.00 ? 61 GLU P HG3  3  
ATOM 3483  N N    . PHE A 1 64 ? 25.637  2.277   2.123   1.00 0.00 ? 62 PHE P N    3  
ATOM 3484  C CA   . PHE A 1 64 ? 25.624  3.005   0.848   1.00 0.00 ? 62 PHE P CA   3  
ATOM 3485  C C    . PHE A 1 64 ? 26.376  4.347   0.955   1.00 0.00 ? 62 PHE P C    3  
ATOM 3486  O O    . PHE A 1 64 ? 26.568  4.880   2.052   1.00 0.00 ? 62 PHE P O    3  
ATOM 3487  C CB   . PHE A 1 64 ? 24.166  3.194   0.393   1.00 0.00 ? 62 PHE P CB   3  
ATOM 3488  C CG   . PHE A 1 64 ? 24.022  3.713   -1.026  1.00 0.00 ? 62 PHE P CG   3  
ATOM 3489  C CD1  . PHE A 1 64 ? 24.260  2.853   -2.115  1.00 0.00 ? 62 PHE P CD1  3  
ATOM 3490  C CD2  . PHE A 1 64 ? 23.665  5.055   -1.262  1.00 0.00 ? 62 PHE P CD2  3  
ATOM 3491  C CE1  . PHE A 1 64 ? 24.147  3.333   -3.432  1.00 0.00 ? 62 PHE P CE1  3  
ATOM 3492  C CE2  . PHE A 1 64 ? 23.553  5.535   -2.580  1.00 0.00 ? 62 PHE P CE2  3  
ATOM 3493  C CZ   . PHE A 1 64 ? 23.794  4.673   -3.665  1.00 0.00 ? 62 PHE P CZ   3  
ATOM 3494  H H    . PHE A 1 64 ? 25.578  2.839   2.962   1.00 0.00 ? 62 PHE P H    3  
ATOM 3495  H HA   . PHE A 1 64 ? 26.139  2.407   0.095   1.00 0.00 ? 62 PHE P HA   3  
ATOM 3496  H HB2  . PHE A 1 64 ? 23.652  2.233   0.451   1.00 0.00 ? 62 PHE P HB2  3  
ATOM 3497  H HB3  . PHE A 1 64 ? 23.663  3.873   1.083   1.00 0.00 ? 62 PHE P HB3  3  
ATOM 3498  H HD1  . PHE A 1 64 ? 24.531  1.820   -1.940  1.00 0.00 ? 62 PHE P HD1  3  
ATOM 3499  H HD2  . PHE A 1 64 ? 23.486  5.725   -0.432  1.00 0.00 ? 62 PHE P HD2  3  
ATOM 3500  H HE1  . PHE A 1 64 ? 24.331  2.669   -4.267  1.00 0.00 ? 62 PHE P HE1  3  
ATOM 3501  H HE2  . PHE A 1 64 ? 23.286  6.568   -2.758  1.00 0.00 ? 62 PHE P HE2  3  
ATOM 3502  H HZ   . PHE A 1 64 ? 23.709  5.043   -4.679  1.00 0.00 ? 62 PHE P HZ   3  
ATOM 3503  N N    . ILE A 1 65 ? 26.815  4.888   -0.186  1.00 0.00 ? 63 ILE P N    3  
ATOM 3504  C CA   . ILE A 1 65 ? 27.622  6.117   -0.278  1.00 0.00 ? 63 ILE P CA   3  
ATOM 3505  C C    . ILE A 1 65 ? 26.854  7.389   0.133   1.00 0.00 ? 63 ILE P C    3  
ATOM 3506  O O    . ILE A 1 65 ? 25.632  7.478   -0.003  1.00 0.00 ? 63 ILE P O    3  
ATOM 3507  C CB   . ILE A 1 65 ? 28.255  6.266   -1.682  1.00 0.00 ? 63 ILE P CB   3  
ATOM 3508  C CG1  . ILE A 1 65 ? 27.196  6.318   -2.809  1.00 0.00 ? 63 ILE P CG1  3  
ATOM 3509  C CG2  . ILE A 1 65 ? 29.276  5.134   -1.911  1.00 0.00 ? 63 ILE P CG2  3  
ATOM 3510  C CD1  . ILE A 1 65 ? 27.774  6.647   -4.191  1.00 0.00 ? 63 ILE P CD1  3  
ATOM 3511  H H    . ILE A 1 65 ? 26.576  4.423   -1.049  1.00 0.00 ? 63 ILE P H    3  
ATOM 3512  H HA   . ILE A 1 65 ? 28.444  6.017   0.434   1.00 0.00 ? 63 ILE P HA   3  
ATOM 3513  H HB   . ILE A 1 65 ? 28.808  7.207   -1.696  1.00 0.00 ? 63 ILE P HB   3  
ATOM 3514  H HG12 . ILE A 1 65 ? 26.675  5.362   -2.872  1.00 0.00 ? 63 ILE P HG12 3  
ATOM 3515  H HG13 . ILE A 1 65 ? 26.462  7.089   -2.573  1.00 0.00 ? 63 ILE P HG13 3  
ATOM 3516  H HG21 . ILE A 1 65 ? 28.769  4.175   -2.016  1.00 0.00 ? 63 ILE P HG21 3  
ATOM 3517  H HG22 . ILE A 1 65 ? 29.858  5.329   -2.812  1.00 0.00 ? 63 ILE P HG22 3  
ATOM 3518  H HG23 . ILE A 1 65 ? 29.969  5.081   -1.070  1.00 0.00 ? 63 ILE P HG23 3  
ATOM 3519  H HD11 . ILE A 1 65 ? 26.958  6.766   -4.902  1.00 0.00 ? 63 ILE P HD11 3  
ATOM 3520  H HD12 . ILE A 1 65 ? 28.344  7.575   -4.146  1.00 0.00 ? 63 ILE P HD12 3  
ATOM 3521  H HD13 . ILE A 1 65 ? 28.419  5.839   -4.537  1.00 0.00 ? 63 ILE P HD13 3  
ATOM 3522  N N    . VAL A 1 66 ? 27.591  8.391   0.624   1.00 0.00 ? 64 VAL P N    3  
ATOM 3523  C CA   . VAL A 1 66 ? 27.078  9.712   1.037   1.00 0.00 ? 64 VAL P CA   3  
ATOM 3524  C C    . VAL A 1 66 ? 28.152  10.797  0.852   1.00 0.00 ? 64 VAL P C    3  
ATOM 3525  O O    . VAL A 1 66 ? 29.351  10.511  0.920   1.00 0.00 ? 64 VAL P O    3  
ATOM 3526  C CB   . VAL A 1 66 ? 26.543  9.650   2.488   1.00 0.00 ? 64 VAL P CB   3  
ATOM 3527  C CG1  . VAL A 1 66 ? 27.633  9.401   3.539   1.00 0.00 ? 64 VAL P CG1  3  
ATOM 3528  C CG2  . VAL A 1 66 ? 25.755  10.906  2.880   1.00 0.00 ? 64 VAL P CG2  3  
ATOM 3529  H H    . VAL A 1 66 ? 28.590  8.251   0.700   1.00 0.00 ? 64 VAL P H    3  
ATOM 3530  H HA   . VAL A 1 66 ? 26.241  9.970   0.387   1.00 0.00 ? 64 VAL P HA   3  
ATOM 3531  H HB   . VAL A 1 66 ? 25.843  8.816   2.543   1.00 0.00 ? 64 VAL P HB   3  
ATOM 3532  H HG11 . VAL A 1 66 ? 28.176  8.486   3.305   1.00 0.00 ? 64 VAL P HG11 3  
ATOM 3533  H HG12 . VAL A 1 66 ? 28.333  10.236  3.572   1.00 0.00 ? 64 VAL P HG12 3  
ATOM 3534  H HG13 . VAL A 1 66 ? 27.174  9.287   4.521   1.00 0.00 ? 64 VAL P HG13 3  
ATOM 3535  H HG21 . VAL A 1 66 ? 25.268  10.742  3.842   1.00 0.00 ? 64 VAL P HG21 3  
ATOM 3536  H HG22 . VAL A 1 66 ? 26.418  11.767  2.970   1.00 0.00 ? 64 VAL P HG22 3  
ATOM 3537  H HG23 . VAL A 1 66 ? 24.986  11.110  2.133   1.00 0.00 ? 64 VAL P HG23 3  
ATOM 3538  N N    . THR A 1 67 ? 27.736  12.041  0.604   1.00 0.00 ? 65 THR P N    3  
ATOM 3539  C CA   . THR A 1 67 ? 28.626  13.203  0.415   1.00 0.00 ? 65 THR P CA   3  
ATOM 3540  C C    . THR A 1 67 ? 29.417  13.528  1.694   1.00 0.00 ? 65 THR P C    3  
ATOM 3541  O O    . THR A 1 67 ? 28.868  13.491  2.799   1.00 0.00 ? 65 THR P O    3  
ATOM 3542  C CB   . THR A 1 67 ? 27.819  14.439  -0.029  1.00 0.00 ? 65 THR P CB   3  
ATOM 3543  O OG1  . THR A 1 67 ? 26.916  14.089  -1.062  1.00 0.00 ? 65 THR P OG1  3  
ATOM 3544  C CG2  . THR A 1 67 ? 28.701  15.561  -0.577  1.00 0.00 ? 65 THR P CG2  3  
ATOM 3545  H H    . THR A 1 67 ? 26.744  12.208  0.514   1.00 0.00 ? 65 THR P H    3  
ATOM 3546  H HA   . THR A 1 67 ? 29.335  12.964  -0.377  1.00 0.00 ? 65 THR P HA   3  
ATOM 3547  H HB   . THR A 1 67 ? 27.246  14.816  0.820   1.00 0.00 ? 65 THR P HB   3  
ATOM 3548  H HG1  . THR A 1 67 ? 26.368  14.872  -1.251  1.00 0.00 ? 65 THR P HG1  3  
ATOM 3549  H HG21 . THR A 1 67 ? 29.308  15.192  -1.406  1.00 0.00 ? 65 THR P HG21 3  
ATOM 3550  H HG22 . THR A 1 67 ? 29.356  15.938  0.208   1.00 0.00 ? 65 THR P HG22 3  
ATOM 3551  H HG23 . THR A 1 67 ? 28.079  16.385  -0.926  1.00 0.00 ? 65 THR P HG23 3  
ATOM 3552  N N    . ASP A 1 68 ? 30.706  13.856  1.549   1.00 0.00 ? 66 ASP P N    3  
ATOM 3553  C CA   . ASP A 1 68 ? 31.627  14.202  2.651   1.00 0.00 ? 66 ASP P CA   3  
ATOM 3554  C C    . ASP A 1 68 ? 31.412  15.613  3.247   1.00 0.00 ? 66 ASP P C    3  
ATOM 3555  O O    . ASP A 1 68 ? 31.574  15.762  4.481   1.00 0.00 ? 66 ASP P O    3  
ATOM 3556  C CB   . ASP A 1 68 ? 33.086  13.996  2.194   1.00 0.00 ? 66 ASP P CB   3  
ATOM 3557  C CG   . ASP A 1 68 ? 33.583  15.021  1.149   1.00 0.00 ? 66 ASP P CG   3  
ATOM 3558  O OD1  . ASP A 1 68 ? 33.219  14.896  -0.047  1.00 0.00 ? 66 ASP P OD1  3  
ATOM 3559  O OD2  . ASP A 1 68 ? 34.388  15.919  1.508   1.00 0.00 ? 66 ASP P OD2  3  
ATOM 3560  O OXT  . ASP A 1 68 ? 31.086  16.560  2.495   1.00 0.00 ? 66 ASP P OXT  3  
ATOM 3561  H H    . ASP A 1 68 ? 31.080  13.895  0.611   1.00 0.00 ? 66 ASP P H    3  
ATOM 3562  H HA   . ASP A 1 68 ? 31.450  13.494  3.462   1.00 0.00 ? 66 ASP P HA   3  
ATOM 3563  H HB2  . ASP A 1 68 ? 33.724  14.046  3.079   1.00 0.00 ? 66 ASP P HB2  3  
ATOM 3564  H HB3  . ASP A 1 68 ? 33.189  12.986  1.789   1.00 0.00 ? 66 ASP P HB3  3  
ATOM 3565  N N    . GLY A 1 1  ? -10.708 -23.295 10.482  1.00 0.00 ? -1 GLY P N    4  
ATOM 3566  C CA   . GLY A 1 1  ? -9.906  -22.567 9.473   1.00 0.00 ? -1 GLY P CA   4  
ATOM 3567  C C    . GLY A 1 1  ? -8.882  -23.477 8.807   1.00 0.00 ? -1 GLY P C    4  
ATOM 3568  O O    . GLY A 1 1  ? -8.388  -24.420 9.424   1.00 0.00 ? -1 GLY P O    4  
ATOM 3569  H H1   . GLY A 1 1  ? -10.104 -23.685 11.189  1.00 0.00 ? -1 GLY P H1   4  
ATOM 3570  H H2   . GLY A 1 1  ? -11.220 -24.046 10.047  1.00 0.00 ? -1 GLY P H2   4  
ATOM 3571  H H3   . GLY A 1 1  ? -11.362 -22.669 10.923  1.00 0.00 ? -1 GLY P H3   4  
ATOM 3572  H HA2  . GLY A 1 1  ? -10.567 -22.161 8.707   1.00 0.00 ? -1 GLY P HA2  4  
ATOM 3573  H HA3  . GLY A 1 1  ? -9.375  -21.745 9.952   1.00 0.00 ? -1 GLY P HA3  4  
ATOM 3574  N N    . SER A 1 2  ? -8.530  -23.192 7.550   1.00 0.00 ? 0  SER P N    4  
ATOM 3575  C CA   . SER A 1 2  ? -7.720  -24.063 6.668   1.00 0.00 ? 0  SER P CA   4  
ATOM 3576  C C    . SER A 1 2  ? -6.194  -24.015 6.909   1.00 0.00 ? 0  SER P C    4  
ATOM 3577  O O    . SER A 1 2  ? -5.412  -24.280 5.995   1.00 0.00 ? 0  SER P O    4  
ATOM 3578  C CB   . SER A 1 2  ? -8.060  -23.774 5.195   1.00 0.00 ? 0  SER P CB   4  
ATOM 3579  O OG   . SER A 1 2  ? -9.464  -23.833 4.981   1.00 0.00 ? 0  SER P OG   4  
ATOM 3580  H H    . SER A 1 2  ? -8.974  -22.401 7.104   1.00 0.00 ? 0  SER P H    4  
ATOM 3581  H HA   . SER A 1 2  ? -8.019  -25.096 6.860   1.00 0.00 ? 0  SER P HA   4  
ATOM 3582  H HB2  . SER A 1 2  ? -7.696  -22.780 4.928   1.00 0.00 ? 0  SER P HB2  4  
ATOM 3583  H HB3  . SER A 1 2  ? -7.569  -24.511 4.557   1.00 0.00 ? 0  SER P HB3  4  
ATOM 3584  H HG   . SER A 1 2  ? -9.639  -23.684 4.032   1.00 0.00 ? 0  SER P HG   4  
ATOM 3585  N N    . GLN A 1 3  ? -5.758  -23.659 8.125   1.00 0.00 ? 1  GLN P N    4  
ATOM 3586  C CA   . GLN A 1 3  ? -4.347  -23.532 8.540   1.00 0.00 ? 1  GLN P CA   4  
ATOM 3587  C C    . GLN A 1 3  ? -3.506  -22.598 7.637   1.00 0.00 ? 1  GLN P C    4  
ATOM 3588  O O    . GLN A 1 3  ? -2.346  -22.882 7.321   1.00 0.00 ? 1  GLN P O    4  
ATOM 3589  C CB   . GLN A 1 3  ? -3.712  -24.920 8.771   1.00 0.00 ? 1  GLN P CB   4  
ATOM 3590  C CG   . GLN A 1 3  ? -4.463  -25.762 9.816   1.00 0.00 ? 1  GLN P CG   4  
ATOM 3591  C CD   . GLN A 1 3  ? -3.774  -27.103 10.061  1.00 0.00 ? 1  GLN P CD   4  
ATOM 3592  O OE1  . GLN A 1 3  ? -4.144  -28.136 9.514   1.00 0.00 ? 1  GLN P OE1  4  
ATOM 3593  N NE2  . GLN A 1 3  ? -2.741  -27.150 10.878  1.00 0.00 ? 1  GLN P NE2  4  
ATOM 3594  H H    . GLN A 1 3  ? -6.462  -23.525 8.838   1.00 0.00 ? 1  GLN P H    4  
ATOM 3595  H HA   . GLN A 1 3  ? -4.361  -23.037 9.513   1.00 0.00 ? 1  GLN P HA   4  
ATOM 3596  H HB2  . GLN A 1 3  ? -3.679  -25.467 7.827   1.00 0.00 ? 1  GLN P HB2  4  
ATOM 3597  H HB3  . GLN A 1 3  ? -2.687  -24.782 9.120   1.00 0.00 ? 1  GLN P HB3  4  
ATOM 3598  H HG2  . GLN A 1 3  ? -4.514  -25.210 10.755  1.00 0.00 ? 1  GLN P HG2  4  
ATOM 3599  H HG3  . GLN A 1 3  ? -5.481  -25.953 9.476   1.00 0.00 ? 1  GLN P HG3  4  
ATOM 3600  H HE21 . GLN A 1 3  ? -2.417  -26.312 11.340  1.00 0.00 ? 1  GLN P HE21 4  
ATOM 3601  H HE22 . GLN A 1 3  ? -2.290  -28.039 11.032  1.00 0.00 ? 1  GLN P HE22 4  
ATOM 3602  N N    . ARG A 1 4  ? -4.101  -21.476 7.203   1.00 0.00 ? 2  ARG P N    4  
ATOM 3603  C CA   . ARG A 1 4  ? -3.463  -20.421 6.387   1.00 0.00 ? 2  ARG P CA   4  
ATOM 3604  C C    . ARG A 1 4  ? -2.941  -19.269 7.258   1.00 0.00 ? 2  ARG P C    4  
ATOM 3605  O O    . ARG A 1 4  ? -3.480  -19.012 8.336   1.00 0.00 ? 2  ARG P O    4  
ATOM 3606  C CB   . ARG A 1 4  ? -4.445  -19.918 5.310   1.00 0.00 ? 2  ARG P CB   4  
ATOM 3607  C CG   . ARG A 1 4  ? -4.816  -21.018 4.301   1.00 0.00 ? 2  ARG P CG   4  
ATOM 3608  C CD   . ARG A 1 4  ? -5.792  -20.499 3.242   1.00 0.00 ? 2  ARG P CD   4  
ATOM 3609  N NE   . ARG A 1 4  ? -6.164  -21.565 2.290   1.00 0.00 ? 2  ARG P NE   4  
ATOM 3610  C CZ   . ARG A 1 4  ? -7.070  -21.490 1.332   1.00 0.00 ? 2  ARG P CZ   4  
ATOM 3611  N NH1  . ARG A 1 4  ? -7.767  -20.409 1.117   1.00 0.00 ? 2  ARG P NH1  4  
ATOM 3612  N NH2  . ARG A 1 4  ? -7.299  -22.515 0.561   1.00 0.00 ? 2  ARG P NH2  4  
ATOM 3613  H H    . ARG A 1 4  ? -5.043  -21.310 7.527   1.00 0.00 ? 2  ARG P H    4  
ATOM 3614  H HA   . ARG A 1 4  ? -2.596  -20.846 5.875   1.00 0.00 ? 2  ARG P HA   4  
ATOM 3615  H HB2  . ARG A 1 4  ? -5.351  -19.547 5.792   1.00 0.00 ? 2  ARG P HB2  4  
ATOM 3616  H HB3  . ARG A 1 4  ? -3.985  -19.092 4.766   1.00 0.00 ? 2  ARG P HB3  4  
ATOM 3617  H HG2  . ARG A 1 4  ? -3.910  -21.376 3.811   1.00 0.00 ? 2  ARG P HG2  4  
ATOM 3618  H HG3  . ARG A 1 4  ? -5.286  -21.850 4.825   1.00 0.00 ? 2  ARG P HG3  4  
ATOM 3619  H HD2  . ARG A 1 4  ? -6.688  -20.128 3.744   1.00 0.00 ? 2  ARG P HD2  4  
ATOM 3620  H HD3  . ARG A 1 4  ? -5.324  -19.673 2.701   1.00 0.00 ? 2  ARG P HD3  4  
ATOM 3621  H HE   . ARG A 1 4  ? -5.667  -22.439 2.366   1.00 0.00 ? 2  ARG P HE   4  
ATOM 3622  H HH11 . ARG A 1 4  ? -7.605  -19.601 1.691   1.00 0.00 ? 2  ARG P HH11 4  
ATOM 3623  H HH12 . ARG A 1 4  ? -8.450  -20.378 0.380   1.00 0.00 ? 2  ARG P HH12 4  
ATOM 3624  H HH21 . ARG A 1 4  ? -6.783  -23.370 0.686   1.00 0.00 ? 2  ARG P HH21 4  
ATOM 3625  H HH22 . ARG A 1 4  ? -7.989  -22.456 -0.170  1.00 0.00 ? 2  ARG P HH22 4  
ATOM 3626  N N    . ARG A 1 5  ? -1.903  -18.565 6.778   1.00 0.00 ? 3  ARG P N    4  
ATOM 3627  C CA   . ARG A 1 5  ? -1.217  -17.444 7.470   1.00 0.00 ? 3  ARG P CA   4  
ATOM 3628  C C    . ARG A 1 5  ? -0.786  -17.787 8.908   1.00 0.00 ? 3  ARG P C    4  
ATOM 3629  O O    . ARG A 1 5  ? -0.997  -17.017 9.845   1.00 0.00 ? 3  ARG P O    4  
ATOM 3630  C CB   . ARG A 1 5  ? -2.049  -16.142 7.349   1.00 0.00 ? 3  ARG P CB   4  
ATOM 3631  C CG   . ARG A 1 5  ? -2.124  -15.565 5.920   1.00 0.00 ? 3  ARG P CG   4  
ATOM 3632  C CD   . ARG A 1 5  ? -1.030  -14.527 5.610   1.00 0.00 ? 3  ARG P CD   4  
ATOM 3633  N NE   . ARG A 1 5  ? 0.341   -15.059 5.746   1.00 0.00 ? 3  ARG P NE   4  
ATOM 3634  C CZ   . ARG A 1 5  ? 1.027   -15.761 4.865   1.00 0.00 ? 3  ARG P CZ   4  
ATOM 3635  N NH1  . ARG A 1 5  ? 0.563   -16.056 3.683   1.00 0.00 ? 3  ARG P NH1  4  
ATOM 3636  N NH2  . ARG A 1 5  ? 2.204   -16.211 5.180   1.00 0.00 ? 3  ARG P NH2  4  
ATOM 3637  H H    . ARG A 1 5  ? -1.556  -18.838 5.868   1.00 0.00 ? 3  ARG P H    4  
ATOM 3638  H HA   . ARG A 1 5  ? -0.273  -17.272 6.954   1.00 0.00 ? 3  ARG P HA   4  
ATOM 3639  H HB2  . ARG A 1 5  ? -3.064  -16.344 7.695   1.00 0.00 ? 3  ARG P HB2  4  
ATOM 3640  H HB3  . ARG A 1 5  ? -1.634  -15.372 8.001   1.00 0.00 ? 3  ARG P HB3  4  
ATOM 3641  H HG2  . ARG A 1 5  ? -2.090  -16.369 5.185   1.00 0.00 ? 3  ARG P HG2  4  
ATOM 3642  H HG3  . ARG A 1 5  ? -3.085  -15.062 5.812   1.00 0.00 ? 3  ARG P HG3  4  
ATOM 3643  H HD2  . ARG A 1 5  ? -1.183  -14.139 4.603   1.00 0.00 ? 3  ARG P HD2  4  
ATOM 3644  H HD3  . ARG A 1 5  ? -1.145  -13.687 6.299   1.00 0.00 ? 3  ARG P HD3  4  
ATOM 3645  H HE   . ARG A 1 5  ? 0.850   -14.778 6.578   1.00 0.00 ? 3  ARG P HE   4  
ATOM 3646  H HH11 . ARG A 1 5  ? -0.344  -15.719 3.416   1.00 0.00 ? 3  ARG P HH11 4  
ATOM 3647  H HH12 . ARG A 1 5  ? 1.117   -16.585 3.032   1.00 0.00 ? 3  ARG P HH12 4  
ATOM 3648  H HH21 . ARG A 1 5  ? 2.533   -16.098 6.135   1.00 0.00 ? 3  ARG P HH21 4  
ATOM 3649  H HH22 . ARG A 1 5  ? 2.737   -16.758 4.526   1.00 0.00 ? 3  ARG P HH22 4  
ATOM 3650  N N    . GLN A 1 6  ? -0.154  -18.956 9.076   1.00 0.00 ? 4  GLN P N    4  
ATOM 3651  C CA   . GLN A 1 6  ? 0.397   -19.419 10.363  1.00 0.00 ? 4  GLN P CA   4  
ATOM 3652  C C    . GLN A 1 6  ? 1.542   -18.516 10.872  1.00 0.00 ? 4  GLN P C    4  
ATOM 3653  O O    . GLN A 1 6  ? 1.715   -18.351 12.082  1.00 0.00 ? 4  GLN P O    4  
ATOM 3654  C CB   . GLN A 1 6  ? 0.902   -20.869 10.225  1.00 0.00 ? 4  GLN P CB   4  
ATOM 3655  C CG   . GLN A 1 6  ? -0.172  -21.889 9.805   1.00 0.00 ? 4  GLN P CG   4  
ATOM 3656  C CD   . GLN A 1 6  ? -1.318  -22.012 10.808  1.00 0.00 ? 4  GLN P CD   4  
ATOM 3657  O OE1  . GLN A 1 6  ? -2.421  -21.529 10.601  1.00 0.00 ? 4  GLN P OE1  4  
ATOM 3658  N NE2  . GLN A 1 6  ? -1.108  -22.661 11.935  1.00 0.00 ? 4  GLN P NE2  4  
ATOM 3659  H H    . GLN A 1 6  ? -0.034  -19.541 8.264   1.00 0.00 ? 4  GLN P H    4  
ATOM 3660  H HA   . GLN A 1 6  ? -0.395  -19.395 11.114  1.00 0.00 ? 4  GLN P HA   4  
ATOM 3661  H HB2  . GLN A 1 6  ? 1.705   -20.893 9.486   1.00 0.00 ? 4  GLN P HB2  4  
ATOM 3662  H HB3  . GLN A 1 6  ? 1.323   -21.185 11.181  1.00 0.00 ? 4  GLN P HB3  4  
ATOM 3663  H HG2  . GLN A 1 6  ? -0.575  -21.612 8.831   1.00 0.00 ? 4  GLN P HG2  4  
ATOM 3664  H HG3  . GLN A 1 6  ? 0.302   -22.865 9.698   1.00 0.00 ? 4  GLN P HG3  4  
ATOM 3665  H HE21 . GLN A 1 6  ? -0.206  -23.067 12.134  1.00 0.00 ? 4  GLN P HE21 4  
ATOM 3666  H HE22 . GLN A 1 6  ? -1.866  -22.722 12.600  1.00 0.00 ? 4  GLN P HE22 4  
ATOM 3667  N N    . ARG A 1 7  ? 2.296   -17.905 9.945   1.00 0.00 ? 5  ARG P N    4  
ATOM 3668  C CA   . ARG A 1 7  ? 3.294   -16.847 10.180  1.00 0.00 ? 5  ARG P CA   4  
ATOM 3669  C C    . ARG A 1 7  ? 3.353   -15.856 9.008   1.00 0.00 ? 5  ARG P C    4  
ATOM 3670  O O    . ARG A 1 7  ? 2.831   -16.151 7.929   1.00 0.00 ? 5  ARG P O    4  
ATOM 3671  C CB   . ARG A 1 7  ? 4.677   -17.463 10.474  1.00 0.00 ? 5  ARG P CB   4  
ATOM 3672  C CG   . ARG A 1 7  ? 5.261   -18.301 9.316   1.00 0.00 ? 5  ARG P CG   4  
ATOM 3673  C CD   . ARG A 1 7  ? 6.793   -18.236 9.291   1.00 0.00 ? 5  ARG P CD   4  
ATOM 3674  N NE   . ARG A 1 7  ? 7.254   -16.888 8.893   1.00 0.00 ? 5  ARG P NE   4  
ATOM 3675  C CZ   . ARG A 1 7  ? 8.410   -16.311 9.160   1.00 0.00 ? 5  ARG P CZ   4  
ATOM 3676  N NH1  . ARG A 1 7  ? 9.368   -16.917 9.802   1.00 0.00 ? 5  ARG P NH1  4  
ATOM 3677  N NH2  . ARG A 1 7  ? 8.606   -15.086 8.771   1.00 0.00 ? 5  ARG P NH2  4  
ATOM 3678  H H    . ARG A 1 7  ? 2.086   -18.118 8.978   1.00 0.00 ? 5  ARG P H    4  
ATOM 3679  H HA   . ARG A 1 7  ? 2.991   -16.271 11.058  1.00 0.00 ? 5  ARG P HA   4  
ATOM 3680  H HB2  . ARG A 1 7  ? 5.359   -16.650 10.724  1.00 0.00 ? 5  ARG P HB2  4  
ATOM 3681  H HB3  . ARG A 1 7  ? 4.608   -18.097 11.360  1.00 0.00 ? 5  ARG P HB3  4  
ATOM 3682  H HG2  . ARG A 1 7  ? 4.947   -19.339 9.439   1.00 0.00 ? 5  ARG P HG2  4  
ATOM 3683  H HG3  . ARG A 1 7  ? 4.890   -17.949 8.354   1.00 0.00 ? 5  ARG P HG3  4  
ATOM 3684  H HD2  . ARG A 1 7  ? 7.173   -18.499 10.279  1.00 0.00 ? 5  ARG P HD2  4  
ATOM 3685  H HD3  . ARG A 1 7  ? 7.164   -18.967 8.569   1.00 0.00 ? 5  ARG P HD3  4  
ATOM 3686  H HE   . ARG A 1 7  ? 6.609   -16.317 8.360   1.00 0.00 ? 5  ARG P HE   4  
ATOM 3687  H HH11 . ARG A 1 7  ? 9.237   -17.871 10.092  1.00 0.00 ? 5  ARG P HH11 4  
ATOM 3688  H HH12 . ARG A 1 7  ? 10.238  -16.447 9.989   1.00 0.00 ? 5  ARG P HH12 4  
ATOM 3689  H HH21 . ARG A 1 7  ? 7.861   -14.613 8.273   1.00 0.00 ? 5  ARG P HH21 4  
ATOM 3690  H HH22 . ARG A 1 7  ? 9.476   -14.617 8.957   1.00 0.00 ? 5  ARG P HH22 4  
ATOM 3691  N N    . THR A 1 8  ? 4.034   -14.726 9.212   1.00 0.00 ? 6  THR P N    4  
ATOM 3692  C CA   . THR A 1 8  ? 4.164   -13.579 8.284   1.00 0.00 ? 6  THR P CA   4  
ATOM 3693  C C    . THR A 1 8  ? 2.827   -12.876 7.988   1.00 0.00 ? 6  THR P C    4  
ATOM 3694  O O    . THR A 1 8  ? 1.821   -13.518 7.678   1.00 0.00 ? 6  THR P O    4  
ATOM 3695  C CB   . THR A 1 8  ? 4.905   -13.961 6.986   1.00 0.00 ? 6  THR P CB   4  
ATOM 3696  O OG1  . THR A 1 8  ? 6.085   -14.690 7.272   1.00 0.00 ? 6  THR P OG1  4  
ATOM 3697  C CG2  . THR A 1 8  ? 5.345   -12.745 6.172   1.00 0.00 ? 6  THR P CG2  4  
ATOM 3698  H H    . THR A 1 8  ? 4.457   -14.619 10.122  1.00 0.00 ? 6  THR P H    4  
ATOM 3699  H HA   . THR A 1 8  ? 4.798   -12.849 8.787   1.00 0.00 ? 6  THR P HA   4  
ATOM 3700  H HB   . THR A 1 8  ? 4.254   -14.580 6.368   1.00 0.00 ? 6  THR P HB   4  
ATOM 3701  H HG1  . THR A 1 8  ? 6.447   -14.970 6.410   1.00 0.00 ? 6  THR P HG1  4  
ATOM 3702  H HG21 . THR A 1 8  ? 5.971   -12.092 6.782   1.00 0.00 ? 6  THR P HG21 4  
ATOM 3703  H HG22 . THR A 1 8  ? 4.473   -12.192 5.824   1.00 0.00 ? 6  THR P HG22 4  
ATOM 3704  H HG23 . THR A 1 8  ? 5.910   -13.070 5.299   1.00 0.00 ? 6  THR P HG23 4  
ATOM 3705  N N    . HIS A 1 9  ? 2.803   -11.543 8.082   1.00 0.00 ? 7  HIS P N    4  
ATOM 3706  C CA   . HIS A 1 9  ? 1.597   -10.726 7.863   1.00 0.00 ? 7  HIS P CA   4  
ATOM 3707  C C    . HIS A 1 9  ? 1.370   -10.370 6.379   1.00 0.00 ? 7  HIS P C    4  
ATOM 3708  O O    . HIS A 1 9  ? 2.287   -10.470 5.559   1.00 0.00 ? 7  HIS P O    4  
ATOM 3709  C CB   . HIS A 1 9  ? 1.650   -9.480  8.766   1.00 0.00 ? 7  HIS P CB   4  
ATOM 3710  C CG   . HIS A 1 9  ? 0.323   -8.772  8.929   1.00 0.00 ? 7  HIS P CG   4  
ATOM 3711  N ND1  . HIS A 1 9  ? -0.939  -9.377  8.863   1.00 0.00 ? 7  HIS P ND1  4  
ATOM 3712  C CD2  . HIS A 1 9  ? 0.157   -7.440  9.171   1.00 0.00 ? 7  HIS P CD2  4  
ATOM 3713  C CE1  . HIS A 1 9  ? -1.832  -8.394  9.063   1.00 0.00 ? 7  HIS P CE1  4  
ATOM 3714  N NE2  . HIS A 1 9  ? -1.202  -7.222  9.251   1.00 0.00 ? 7  HIS P NE2  4  
ATOM 3715  H H    . HIS A 1 9  ? 3.661   -11.059 8.308   1.00 0.00 ? 7  HIS P H    4  
ATOM 3716  H HA   . HIS A 1 9  ? 0.733   -11.313 8.177   1.00 0.00 ? 7  HIS P HA   4  
ATOM 3717  H HB2  . HIS A 1 9  ? 1.979   -9.780  9.761   1.00 0.00 ? 7  HIS P HB2  4  
ATOM 3718  H HB3  . HIS A 1 9  ? 2.383   -8.778  8.365   1.00 0.00 ? 7  HIS P HB3  4  
ATOM 3719  H HD2  . HIS A 1 9  ? 0.945   -6.706  9.272   1.00 0.00 ? 7  HIS P HD2  4  
ATOM 3720  H HE1  . HIS A 1 9  ? -2.909  -8.526  9.074   1.00 0.00 ? 7  HIS P HE1  4  
ATOM 3721  H HE2  . HIS A 1 9  ? -1.664  -6.336  9.422   1.00 0.00 ? 7  HIS P HE2  4  
ATOM 3722  N N    . PHE A 1 10 ? 0.150   -9.917  6.069   1.00 0.00 ? 8  PHE P N    4  
ATOM 3723  C CA   . PHE A 1 10 ? -0.399  -9.608  4.738   1.00 0.00 ? 8  PHE P CA   4  
ATOM 3724  C C    . PHE A 1 10 ? -0.520  -10.824 3.796   1.00 0.00 ? 8  PHE P C    4  
ATOM 3725  O O    . PHE A 1 10 ? 0.191   -11.824 3.928   1.00 0.00 ? 8  PHE P O    4  
ATOM 3726  C CB   . PHE A 1 10 ? 0.348   -8.426  4.094   1.00 0.00 ? 8  PHE P CB   4  
ATOM 3727  C CG   . PHE A 1 10 ? 0.623   -7.251  5.018   1.00 0.00 ? 8  PHE P CG   4  
ATOM 3728  C CD1  . PHE A 1 10 ? -0.437  -6.451  5.486   1.00 0.00 ? 8  PHE P CD1  4  
ATOM 3729  C CD2  . PHE A 1 10 ? 1.940   -6.973  5.434   1.00 0.00 ? 8  PHE P CD2  4  
ATOM 3730  C CE1  . PHE A 1 10 ? -0.181  -5.386  6.369   1.00 0.00 ? 8  PHE P CE1  4  
ATOM 3731  C CE2  . PHE A 1 10 ? 2.197   -5.901  6.308   1.00 0.00 ? 8  PHE P CE2  4  
ATOM 3732  C CZ   . PHE A 1 10 ? 1.137   -5.108  6.776   1.00 0.00 ? 8  PHE P CZ   4  
ATOM 3733  H H    . PHE A 1 10 ? -0.481  -9.796  6.849   1.00 0.00 ? 8  PHE P H    4  
ATOM 3734  H HA   . PHE A 1 10 ? -1.418  -9.264  4.910   1.00 0.00 ? 8  PHE P HA   4  
ATOM 3735  H HB2  . PHE A 1 10 ? 1.296   -8.792  3.706   1.00 0.00 ? 8  PHE P HB2  4  
ATOM 3736  H HB3  . PHE A 1 10 ? -0.227  -8.066  3.243   1.00 0.00 ? 8  PHE P HB3  4  
ATOM 3737  H HD1  . PHE A 1 10 ? -1.452  -6.664  5.177   1.00 0.00 ? 8  PHE P HD1  4  
ATOM 3738  H HD2  . PHE A 1 10 ? 2.759   -7.588  5.090   1.00 0.00 ? 8  PHE P HD2  4  
ATOM 3739  H HE1  . PHE A 1 10 ? -0.999  -4.784  6.737   1.00 0.00 ? 8  PHE P HE1  4  
ATOM 3740  H HE2  . PHE A 1 10 ? 3.210   -5.694  6.627   1.00 0.00 ? 8  PHE P HE2  4  
ATOM 3741  H HZ   . PHE A 1 10 ? 1.338   -4.291  7.454   1.00 0.00 ? 8  PHE P HZ   4  
ATOM 3742  N N    . THR A 1 11 ? -1.448  -10.761 2.835   1.00 0.00 ? 9  THR P N    4  
ATOM 3743  C CA   . THR A 1 11 ? -1.629  -11.816 1.818   1.00 0.00 ? 9  THR P CA   4  
ATOM 3744  C C    . THR A 1 11 ? -0.587  -11.713 0.701   1.00 0.00 ? 9  THR P C    4  
ATOM 3745  O O    . THR A 1 11 ? -0.002  -10.651 0.472   1.00 0.00 ? 9  THR P O    4  
ATOM 3746  C CB   . THR A 1 11 ? -3.041  -11.823 1.204   1.00 0.00 ? 9  THR P CB   4  
ATOM 3747  O OG1  . THR A 1 11 ? -3.209  -10.738 0.318   1.00 0.00 ? 9  THR P OG1  4  
ATOM 3748  C CG2  . THR A 1 11 ? -4.158  -11.769 2.245   1.00 0.00 ? 9  THR P CG2  4  
ATOM 3749  H H    . THR A 1 11 ? -2.024  -9.928  2.768   1.00 0.00 ? 9  THR P H    4  
ATOM 3750  H HA   . THR A 1 11 ? -1.494  -12.784 2.300   1.00 0.00 ? 9  THR P HA   4  
ATOM 3751  H HB   . THR A 1 11 ? -3.156  -12.745 0.633   1.00 0.00 ? 9  THR P HB   4  
ATOM 3752  H HG1  . THR A 1 11 ? -4.134  -10.755 0.017   1.00 0.00 ? 9  THR P HG1  4  
ATOM 3753  H HG21 . THR A 1 11 ? -4.159  -10.805 2.754   1.00 0.00 ? 9  THR P HG21 4  
ATOM 3754  H HG22 . THR A 1 11 ? -4.015  -12.564 2.977   1.00 0.00 ? 9  THR P HG22 4  
ATOM 3755  H HG23 . THR A 1 11 ? -5.120  -11.913 1.755   1.00 0.00 ? 9  THR P HG23 4  
ATOM 3756  N N    . SER A 1 12 ? -0.388  -12.793 -0.061  1.00 0.00 ? 10 SER P N    4  
ATOM 3757  C CA   . SER A 1 12 ? 0.479   -12.784 -1.250  1.00 0.00 ? 10 SER P CA   4  
ATOM 3758  C C    . SER A 1 12 ? 0.033   -11.745 -2.289  1.00 0.00 ? 10 SER P C    4  
ATOM 3759  O O    . SER A 1 12 ? 0.874   -11.127 -2.939  1.00 0.00 ? 10 SER P O    4  
ATOM 3760  C CB   . SER A 1 12 ? 0.501   -14.173 -1.902  1.00 0.00 ? 10 SER P CB   4  
ATOM 3761  O OG   . SER A 1 12 ? 0.850   -15.167 -0.948  1.00 0.00 ? 10 SER P OG   4  
ATOM 3762  H H    . SER A 1 12 ? -0.832  -13.667 0.188   1.00 0.00 ? 10 SER P H    4  
ATOM 3763  H HA   . SER A 1 12 ? 1.495   -12.536 -0.943  1.00 0.00 ? 10 SER P HA   4  
ATOM 3764  H HB2  . SER A 1 12 ? -0.486  -14.397 -2.313  1.00 0.00 ? 10 SER P HB2  4  
ATOM 3765  H HB3  . SER A 1 12 ? 1.229   -14.175 -2.715  1.00 0.00 ? 10 SER P HB3  4  
ATOM 3766  H HG   . SER A 1 12 ? 0.883   -16.032 -1.403  1.00 0.00 ? 10 SER P HG   4  
ATOM 3767  N N    . GLN A 1 13 ? -1.278  -11.495 -2.409  1.00 0.00 ? 11 GLN P N    4  
ATOM 3768  C CA   . GLN A 1 13 ? -1.840  -10.476 -3.304  1.00 0.00 ? 11 GLN P CA   4  
ATOM 3769  C C    . GLN A 1 13 ? -1.552  -9.049  -2.805  1.00 0.00 ? 11 GLN P C    4  
ATOM 3770  O O    . GLN A 1 13 ? -1.156  -8.198  -3.602  1.00 0.00 ? 11 GLN P O    4  
ATOM 3771  C CB   . GLN A 1 13 ? -3.351  -10.700 -3.480  1.00 0.00 ? 11 GLN P CB   4  
ATOM 3772  C CG   . GLN A 1 13 ? -3.672  -12.027 -4.189  1.00 0.00 ? 11 GLN P CG   4  
ATOM 3773  C CD   . GLN A 1 13 ? -5.174  -12.210 -4.399  1.00 0.00 ? 11 GLN P CD   4  
ATOM 3774  O OE1  . GLN A 1 13 ? -5.859  -12.889 -3.643  1.00 0.00 ? 11 GLN P OE1  4  
ATOM 3775  N NE2  . GLN A 1 13 ? -5.753  -11.611 -5.421  1.00 0.00 ? 11 GLN P NE2  4  
ATOM 3776  H H    . GLN A 1 13 ? -1.915  -12.008 -1.817  1.00 0.00 ? 11 GLN P H    4  
ATOM 3777  H HA   . GLN A 1 13 ? -1.368  -10.573 -4.284  1.00 0.00 ? 11 GLN P HA   4  
ATOM 3778  H HB2  . GLN A 1 13 ? -3.840  -10.684 -2.505  1.00 0.00 ? 11 GLN P HB2  4  
ATOM 3779  H HB3  . GLN A 1 13 ? -3.756  -9.882  -4.078  1.00 0.00 ? 11 GLN P HB3  4  
ATOM 3780  H HG2  . GLN A 1 13 ? -3.172  -12.046 -5.159  1.00 0.00 ? 11 GLN P HG2  4  
ATOM 3781  H HG3  . GLN A 1 13 ? -3.298  -12.863 -3.597  1.00 0.00 ? 11 GLN P HG3  4  
ATOM 3782  H HE21 . GLN A 1 13 ? -5.210  -11.047 -6.057  1.00 0.00 ? 11 GLN P HE21 4  
ATOM 3783  H HE22 . GLN A 1 13 ? -6.746  -11.736 -5.550  1.00 0.00 ? 11 GLN P HE22 4  
ATOM 3784  N N    . GLN A 1 14 ? -1.674  -8.791  -1.496  1.00 0.00 ? 12 GLN P N    4  
ATOM 3785  C CA   . GLN A 1 14 ? -1.291  -7.505  -0.896  1.00 0.00 ? 12 GLN P CA   4  
ATOM 3786  C C    . GLN A 1 14 ? 0.206   -7.229  -1.081  1.00 0.00 ? 12 GLN P C    4  
ATOM 3787  O O    . GLN A 1 14 ? 0.578   -6.161  -1.562  1.00 0.00 ? 12 GLN P O    4  
ATOM 3788  C CB   . GLN A 1 14 ? -1.634  -7.481  0.600   1.00 0.00 ? 12 GLN P CB   4  
ATOM 3789  C CG   . GLN A 1 14 ? -3.137  -7.378  0.877   1.00 0.00 ? 12 GLN P CG   4  
ATOM 3790  C CD   . GLN A 1 14 ? -3.416  -7.360  2.378   1.00 0.00 ? 12 GLN P CD   4  
ATOM 3791  O OE1  . GLN A 1 14 ? -3.055  -8.266  3.119   1.00 0.00 ? 12 GLN P OE1  4  
ATOM 3792  N NE2  . GLN A 1 14 ? -4.039  -6.321  2.888   1.00 0.00 ? 12 GLN P NE2  4  
ATOM 3793  H H    . GLN A 1 14 ? -2.005  -9.528  -0.881  1.00 0.00 ? 12 GLN P H    4  
ATOM 3794  H HA   . GLN A 1 14 ? -1.836  -6.700  -1.394  1.00 0.00 ? 12 GLN P HA   4  
ATOM 3795  H HB2  . GLN A 1 14 ? -1.237  -8.378  1.075   1.00 0.00 ? 12 GLN P HB2  4  
ATOM 3796  H HB3  . GLN A 1 14 ? -1.149  -6.614  1.055   1.00 0.00 ? 12 GLN P HB3  4  
ATOM 3797  H HG2  . GLN A 1 14 ? -3.514  -6.466  0.418   1.00 0.00 ? 12 GLN P HG2  4  
ATOM 3798  H HG3  . GLN A 1 14 ? -3.668  -8.216  0.431   1.00 0.00 ? 12 GLN P HG3  4  
ATOM 3799  H HE21 . GLN A 1 14 ? -4.309  -5.552  2.280   1.00 0.00 ? 12 GLN P HE21 4  
ATOM 3800  H HE22 . GLN A 1 14 ? -4.167  -6.269  3.884   1.00 0.00 ? 12 GLN P HE22 4  
ATOM 3801  N N    . LEU A 1 15 ? 1.066   -8.201  -0.759  1.00 0.00 ? 13 LEU P N    4  
ATOM 3802  C CA   . LEU A 1 15 ? 2.524   -8.072  -0.872  1.00 0.00 ? 13 LEU P CA   4  
ATOM 3803  C C    . LEU A 1 15 ? 2.972   -7.856  -2.330  1.00 0.00 ? 13 LEU P C    4  
ATOM 3804  O O    . LEU A 1 15 ? 3.838   -7.017  -2.588  1.00 0.00 ? 13 LEU P O    4  
ATOM 3805  C CB   . LEU A 1 15 ? 3.180   -9.321  -0.251  1.00 0.00 ? 13 LEU P CB   4  
ATOM 3806  C CG   . LEU A 1 15 ? 2.980   -9.443  1.275   1.00 0.00 ? 13 LEU P CG   4  
ATOM 3807  C CD1  . LEU A 1 15 ? 3.426   -10.820 1.762   1.00 0.00 ? 13 LEU P CD1  4  
ATOM 3808  C CD2  . LEU A 1 15 ? 3.767   -8.381  2.045   1.00 0.00 ? 13 LEU P CD2  4  
ATOM 3809  H H    . LEU A 1 15 ? 0.688   -9.061  -0.374  1.00 0.00 ? 13 LEU P H    4  
ATOM 3810  H HA   . LEU A 1 15 ? 2.844   -7.191  -0.318  1.00 0.00 ? 13 LEU P HA   4  
ATOM 3811  H HB2  . LEU A 1 15 ? 2.765   -10.206 -0.736  1.00 0.00 ? 13 LEU P HB2  4  
ATOM 3812  H HB3  . LEU A 1 15 ? 4.251   -9.301  -0.462  1.00 0.00 ? 13 LEU P HB3  4  
ATOM 3813  H HG   . LEU A 1 15 ? 1.927   -9.325  1.518   1.00 0.00 ? 13 LEU P HG   4  
ATOM 3814  H HD11 . LEU A 1 15 ? 3.234   -10.907 2.833   1.00 0.00 ? 13 LEU P HD11 4  
ATOM 3815  H HD12 . LEU A 1 15 ? 4.487   -10.965 1.567   1.00 0.00 ? 13 LEU P HD12 4  
ATOM 3816  H HD13 . LEU A 1 15 ? 2.852   -11.592 1.248   1.00 0.00 ? 13 LEU P HD13 4  
ATOM 3817  H HD21 . LEU A 1 15 ? 3.680   -8.569  3.116   1.00 0.00 ? 13 LEU P HD21 4  
ATOM 3818  H HD22 . LEU A 1 15 ? 3.353   -7.395  1.837   1.00 0.00 ? 13 LEU P HD22 4  
ATOM 3819  H HD23 . LEU A 1 15 ? 4.819   -8.416  1.760   1.00 0.00 ? 13 LEU P HD23 4  
ATOM 3820  N N    . GLN A 1 16 ? 2.342   -8.547  -3.287  1.00 0.00 ? 14 GLN P N    4  
ATOM 3821  C CA   . GLN A 1 16 ? 2.586   -8.355  -4.720  1.00 0.00 ? 14 GLN P CA   4  
ATOM 3822  C C    . GLN A 1 16 ? 2.136   -6.967  -5.206  1.00 0.00 ? 14 GLN P C    4  
ATOM 3823  O O    . GLN A 1 16 ? 2.863   -6.330  -5.965  1.00 0.00 ? 14 GLN P O    4  
ATOM 3824  C CB   . GLN A 1 16 ? 1.894   -9.487  -5.499  1.00 0.00 ? 14 GLN P CB   4  
ATOM 3825  C CG   . GLN A 1 16 ? 2.169   -9.436  -7.009  1.00 0.00 ? 14 GLN P CG   4  
ATOM 3826  C CD   . GLN A 1 16 ? 1.575   -10.648 -7.726  1.00 0.00 ? 14 GLN P CD   4  
ATOM 3827  O OE1  . GLN A 1 16 ? 2.261   -11.603 -8.070  1.00 0.00 ? 14 GLN P OE1  4  
ATOM 3828  N NE2  . GLN A 1 16 ? 0.280   -10.671 -7.970  1.00 0.00 ? 14 GLN P NE2  4  
ATOM 3829  H H    . GLN A 1 16 ? 1.671   -9.254  -3.010  1.00 0.00 ? 14 GLN P H    4  
ATOM 3830  H HA   . GLN A 1 16 ? 3.660   -8.431  -4.897  1.00 0.00 ? 14 GLN P HA   4  
ATOM 3831  H HB2  . GLN A 1 16 ? 2.264   -10.441 -5.121  1.00 0.00 ? 14 GLN P HB2  4  
ATOM 3832  H HB3  . GLN A 1 16 ? 0.818   -9.439  -5.328  1.00 0.00 ? 14 GLN P HB3  4  
ATOM 3833  H HG2  . GLN A 1 16 ? 1.736   -8.530  -7.434  1.00 0.00 ? 14 GLN P HG2  4  
ATOM 3834  H HG3  . GLN A 1 16 ? 3.246   -9.417  -7.180  1.00 0.00 ? 14 GLN P HG3  4  
ATOM 3835  H HE21 . GLN A 1 16 ? -0.306  -9.895  -7.699  1.00 0.00 ? 14 GLN P HE21 4  
ATOM 3836  H HE22 . GLN A 1 16 ? -0.105  -11.478 -8.438  1.00 0.00 ? 14 GLN P HE22 4  
ATOM 3837  N N    . GLU A 1 17 ? 0.980   -6.461  -4.764  1.00 0.00 ? 15 GLU P N    4  
ATOM 3838  C CA   . GLU A 1 17 ? 0.482   -5.140  -5.176  1.00 0.00 ? 15 GLU P CA   4  
ATOM 3839  C C    . GLU A 1 17 ? 1.256   -3.981  -4.517  1.00 0.00 ? 15 GLU P C    4  
ATOM 3840  O O    . GLU A 1 17 ? 1.509   -2.968  -5.167  1.00 0.00 ? 15 GLU P O    4  
ATOM 3841  C CB   . GLU A 1 17 ? -1.028  -5.052  -4.903  1.00 0.00 ? 15 GLU P CB   4  
ATOM 3842  C CG   . GLU A 1 17 ? -1.709  -3.850  -5.579  1.00 0.00 ? 15 GLU P CG   4  
ATOM 3843  C CD   . GLU A 1 17 ? -1.654  -3.931  -7.119  1.00 0.00 ? 15 GLU P CD   4  
ATOM 3844  O OE1  . GLU A 1 17 ? -2.380  -4.762  -7.715  1.00 0.00 ? 15 GLU P OE1  4  
ATOM 3845  O OE2  . GLU A 1 17 ? -0.895  -3.151  -7.744  1.00 0.00 ? 15 GLU P OE2  4  
ATOM 3846  H H    . GLU A 1 17 ? 0.394   -7.030  -4.161  1.00 0.00 ? 15 GLU P H    4  
ATOM 3847  H HA   . GLU A 1 17 ? 0.630   -5.048  -6.252  1.00 0.00 ? 15 GLU P HA   4  
ATOM 3848  H HB2  . GLU A 1 17 ? -1.509  -5.961  -5.266  1.00 0.00 ? 15 GLU P HB2  4  
ATOM 3849  H HB3  . GLU A 1 17 ? -1.190  -4.994  -3.827  1.00 0.00 ? 15 GLU P HB3  4  
ATOM 3850  H HG2  . GLU A 1 17 ? -2.754  -3.823  -5.260  1.00 0.00 ? 15 GLU P HG2  4  
ATOM 3851  H HG3  . GLU A 1 17 ? -1.246  -2.925  -5.230  1.00 0.00 ? 15 GLU P HG3  4  
ATOM 3852  N N    . LEU A 1 18 ? 1.709   -4.140  -3.267  1.00 0.00 ? 16 LEU P N    4  
ATOM 3853  C CA   . LEU A 1 18 ? 2.611   -3.193  -2.595  1.00 0.00 ? 16 LEU P CA   4  
ATOM 3854  C C    . LEU A 1 18 ? 3.963   -3.099  -3.330  1.00 0.00 ? 16 LEU P C    4  
ATOM 3855  O O    . LEU A 1 18 ? 4.452   -1.999  -3.593  1.00 0.00 ? 16 LEU P O    4  
ATOM 3856  C CB   . LEU A 1 18 ? 2.803   -3.618  -1.125  1.00 0.00 ? 16 LEU P CB   4  
ATOM 3857  C CG   . LEU A 1 18 ? 1.573   -3.411  -0.218  1.00 0.00 ? 16 LEU P CG   4  
ATOM 3858  C CD1  . LEU A 1 18 ? 1.720   -4.220  1.072   1.00 0.00 ? 16 LEU P CD1  4  
ATOM 3859  C CD2  . LEU A 1 18 ? 1.394   -1.944  0.180   1.00 0.00 ? 16 LEU P CD2  4  
ATOM 3860  H H    . LEU A 1 18 ? 1.440   -4.981  -2.764  1.00 0.00 ? 16 LEU P H    4  
ATOM 3861  H HA   . LEU A 1 18 ? 2.163   -2.199  -2.620  1.00 0.00 ? 16 LEU P HA   4  
ATOM 3862  H HB2  . LEU A 1 18 ? 3.091   -4.670  -1.108  1.00 0.00 ? 16 LEU P HB2  4  
ATOM 3863  H HB3  . LEU A 1 18 ? 3.628   -3.046  -0.704  1.00 0.00 ? 16 LEU P HB3  4  
ATOM 3864  H HG   . LEU A 1 18 ? 0.671   -3.738  -0.733  1.00 0.00 ? 16 LEU P HG   4  
ATOM 3865  H HD11 . LEU A 1 18 ? 2.570   -3.856  1.650   1.00 0.00 ? 16 LEU P HD11 4  
ATOM 3866  H HD12 . LEU A 1 18 ? 1.867   -5.271  0.836   1.00 0.00 ? 16 LEU P HD12 4  
ATOM 3867  H HD13 . LEU A 1 18 ? 0.816   -4.122  1.667   1.00 0.00 ? 16 LEU P HD13 4  
ATOM 3868  H HD21 . LEU A 1 18 ? 1.331   -1.325  -0.711  1.00 0.00 ? 16 LEU P HD21 4  
ATOM 3869  H HD22 . LEU A 1 18 ? 2.232   -1.619  0.799   1.00 0.00 ? 16 LEU P HD22 4  
ATOM 3870  H HD23 . LEU A 1 18 ? 0.468   -1.831  0.744   1.00 0.00 ? 16 LEU P HD23 4  
ATOM 3871  N N    . GLU A 1 19 ? 4.536   -4.236  -3.743  1.00 0.00 ? 17 GLU P N    4  
ATOM 3872  C CA   . GLU A 1 19 ? 5.756   -4.276  -4.563  1.00 0.00 ? 17 GLU P CA   4  
ATOM 3873  C C    . GLU A 1 19 ? 5.535   -3.687  -5.964  1.00 0.00 ? 17 GLU P C    4  
ATOM 3874  O O    . GLU A 1 19 ? 6.340   -2.874  -6.422  1.00 0.00 ? 17 GLU P O    4  
ATOM 3875  C CB   . GLU A 1 19 ? 6.284   -5.719  -4.614  1.00 0.00 ? 17 GLU P CB   4  
ATOM 3876  C CG   . GLU A 1 19 ? 7.574   -5.843  -5.433  1.00 0.00 ? 17 GLU P CG   4  
ATOM 3877  C CD   . GLU A 1 19 ? 8.242   -7.212  -5.210  1.00 0.00 ? 17 GLU P CD   4  
ATOM 3878  O OE1  . GLU A 1 19 ? 9.074   -7.318  -4.275  1.00 0.00 ? 17 GLU P OE1  4  
ATOM 3879  O OE2  . GLU A 1 19 ? 7.952   -8.172  -5.963  1.00 0.00 ? 17 GLU P OE2  4  
ATOM 3880  H H    . GLU A 1 19 ? 4.109   -5.116  -3.472  1.00 0.00 ? 17 GLU P H    4  
ATOM 3881  H HA   . GLU A 1 19 ? 6.517   -3.657  -4.088  1.00 0.00 ? 17 GLU P HA   4  
ATOM 3882  H HB2  . GLU A 1 19 ? 6.485   -6.045  -3.592  1.00 0.00 ? 17 GLU P HB2  4  
ATOM 3883  H HB3  . GLU A 1 19 ? 5.526   -6.376  -5.042  1.00 0.00 ? 17 GLU P HB3  4  
ATOM 3884  H HG2  . GLU A 1 19 ? 7.344   -5.706  -6.493  1.00 0.00 ? 17 GLU P HG2  4  
ATOM 3885  H HG3  . GLU A 1 19 ? 8.262   -5.048  -5.136  1.00 0.00 ? 17 GLU P HG3  4  
ATOM 3886  N N    . ALA A 1 20 ? 4.424   -4.023  -6.626  1.00 0.00 ? 18 ALA P N    4  
ATOM 3887  C CA   . ALA A 1 20 ? 4.080   -3.472  -7.933  1.00 0.00 ? 18 ALA P CA   4  
ATOM 3888  C C    . ALA A 1 20 ? 3.885   -1.949  -7.874  1.00 0.00 ? 18 ALA P C    4  
ATOM 3889  O O    . ALA A 1 20 ? 4.401   -1.236  -8.731  1.00 0.00 ? 18 ALA P O    4  
ATOM 3890  C CB   . ALA A 1 20 ? 2.833   -4.184  -8.468  1.00 0.00 ? 18 ALA P CB   4  
ATOM 3891  H H    . ALA A 1 20 ? 3.806   -4.719  -6.222  1.00 0.00 ? 18 ALA P H    4  
ATOM 3892  H HA   . ALA A 1 20 ? 4.905   -3.671  -8.619  1.00 0.00 ? 18 ALA P HA   4  
ATOM 3893  H HB1  . ALA A 1 20 ? 3.011   -5.258  -8.520  1.00 0.00 ? 18 ALA P HB1  4  
ATOM 3894  H HB2  . ALA A 1 20 ? 1.980   -3.987  -7.819  1.00 0.00 ? 18 ALA P HB2  4  
ATOM 3895  H HB3  . ALA A 1 20 ? 2.609   -3.818  -9.470  1.00 0.00 ? 18 ALA P HB3  4  
ATOM 3896  N N    . THR A 1 21 ? 3.213   -1.415  -6.847  1.00 0.00 ? 19 THR P N    4  
ATOM 3897  C CA   . THR A 1 21 ? 2.987   0.033   -6.726  1.00 0.00 ? 19 THR P CA   4  
ATOM 3898  C C    . THR A 1 21 ? 4.257   0.802   -6.341  1.00 0.00 ? 19 THR P C    4  
ATOM 3899  O O    . THR A 1 21 ? 4.446   1.925   -6.809  1.00 0.00 ? 19 THR P O    4  
ATOM 3900  C CB   . THR A 1 21 ? 1.764   0.343   -5.847  1.00 0.00 ? 19 THR P CB   4  
ATOM 3901  O OG1  . THR A 1 21 ? 1.042   1.410   -6.426  1.00 0.00 ? 19 THR P OG1  4  
ATOM 3902  C CG2  . THR A 1 21 ? 2.039   0.669   -4.385  1.00 0.00 ? 19 THR P CG2  4  
ATOM 3903  H H    . THR A 1 21 ? 2.780   -2.039  -6.170  1.00 0.00 ? 19 THR P H    4  
ATOM 3904  H HA   . THR A 1 21 ? 2.732   0.382   -7.725  1.00 0.00 ? 19 THR P HA   4  
ATOM 3905  H HB   . THR A 1 21 ? 1.105   -0.524  -5.866  1.00 0.00 ? 19 THR P HB   4  
ATOM 3906  H HG1  . THR A 1 21 ? 1.547   2.230   -6.283  1.00 0.00 ? 19 THR P HG1  4  
ATOM 3907  H HG21 . THR A 1 21 ? 2.608   1.595   -4.297  1.00 0.00 ? 19 THR P HG21 4  
ATOM 3908  H HG22 . THR A 1 21 ? 2.590   -0.154  -3.934  1.00 0.00 ? 19 THR P HG22 4  
ATOM 3909  H HG23 . THR A 1 21 ? 1.092   0.779   -3.861  1.00 0.00 ? 19 THR P HG23 4  
ATOM 3910  N N    . PHE A 1 22 ? 5.183   0.187   -5.593  1.00 0.00 ? 20 PHE P N    4  
ATOM 3911  C CA   . PHE A 1 22 ? 6.529   0.734   -5.367  1.00 0.00 ? 20 PHE P CA   4  
ATOM 3912  C C    . PHE A 1 22 ? 7.340   0.792   -6.677  1.00 0.00 ? 20 PHE P C    4  
ATOM 3913  O O    . PHE A 1 22 ? 8.020   1.785   -6.940  1.00 0.00 ? 20 PHE P O    4  
ATOM 3914  C CB   . PHE A 1 22 ? 7.247   -0.108  -4.299  1.00 0.00 ? 20 PHE P CB   4  
ATOM 3915  C CG   . PHE A 1 22 ? 8.682   0.312   -4.029  1.00 0.00 ? 20 PHE P CG   4  
ATOM 3916  C CD1  . PHE A 1 22 ? 8.955   1.428   -3.214  1.00 0.00 ? 20 PHE P CD1  4  
ATOM 3917  C CD2  . PHE A 1 22 ? 9.751   -0.406  -4.601  1.00 0.00 ? 20 PHE P CD2  4  
ATOM 3918  C CE1  . PHE A 1 22 ? 10.283  1.824   -2.972  1.00 0.00 ? 20 PHE P CE1  4  
ATOM 3919  C CE2  . PHE A 1 22 ? 11.079  -0.010  -4.361  1.00 0.00 ? 20 PHE P CE2  4  
ATOM 3920  C CZ   . PHE A 1 22 ? 11.344  1.105   -3.548  1.00 0.00 ? 20 PHE P CZ   4  
ATOM 3921  H H    . PHE A 1 22 ? 4.963   -0.719  -5.192  1.00 0.00 ? 20 PHE P H    4  
ATOM 3922  H HA   . PHE A 1 22 ? 6.438   1.756   -4.995  1.00 0.00 ? 20 PHE P HA   4  
ATOM 3923  H HB2  . PHE A 1 22 ? 6.684   -0.046  -3.366  1.00 0.00 ? 20 PHE P HB2  4  
ATOM 3924  H HB3  . PHE A 1 22 ? 7.242   -1.153  -4.605  1.00 0.00 ? 20 PHE P HB3  4  
ATOM 3925  H HD1  . PHE A 1 22 ? 8.146   1.988   -2.771  1.00 0.00 ? 20 PHE P HD1  4  
ATOM 3926  H HD2  . PHE A 1 22 ? 9.552   -1.262  -5.233  1.00 0.00 ? 20 PHE P HD2  4  
ATOM 3927  H HE1  . PHE A 1 22 ? 10.487  2.681   -2.344  1.00 0.00 ? 20 PHE P HE1  4  
ATOM 3928  H HE2  . PHE A 1 22 ? 11.900  -0.558  -4.806  1.00 0.00 ? 20 PHE P HE2  4  
ATOM 3929  H HZ   . PHE A 1 22 ? 12.364  1.412   -3.363  1.00 0.00 ? 20 PHE P HZ   4  
ATOM 3930  N N    . GLN A 1 23 ? 7.223   -0.227  -7.537  1.00 0.00 ? 21 GLN P N    4  
ATOM 3931  C CA   . GLN A 1 23 ? 7.864   -0.259  -8.861  1.00 0.00 ? 21 GLN P CA   4  
ATOM 3932  C C    . GLN A 1 23 ? 7.228   0.730   -9.862  1.00 0.00 ? 21 GLN P C    4  
ATOM 3933  O O    . GLN A 1 23 ? 7.951   1.339   -10.655 1.00 0.00 ? 21 GLN P O    4  
ATOM 3934  C CB   . GLN A 1 23 ? 7.841   -1.696  -9.407  1.00 0.00 ? 21 GLN P CB   4  
ATOM 3935  C CG   . GLN A 1 23 ? 8.821   -2.616  -8.656  1.00 0.00 ? 21 GLN P CG   4  
ATOM 3936  C CD   . GLN A 1 23 ? 8.720   -4.088  -9.065  1.00 0.00 ? 21 GLN P CD   4  
ATOM 3937  O OE1  . GLN A 1 23 ? 7.893   -4.510  -9.864  1.00 0.00 ? 21 GLN P OE1  4  
ATOM 3938  N NE2  . GLN A 1 23 ? 9.576   -4.937  -8.534  1.00 0.00 ? 21 GLN P NE2  4  
ATOM 3939  H H    . GLN A 1 23 ? 6.686   -1.038  -7.247  1.00 0.00 ? 21 GLN P H    4  
ATOM 3940  H HA   . GLN A 1 23 ? 8.907   0.040   -8.748  1.00 0.00 ? 21 GLN P HA   4  
ATOM 3941  H HB2  . GLN A 1 23 ? 6.829   -2.095  -9.333  1.00 0.00 ? 21 GLN P HB2  4  
ATOM 3942  H HB3  . GLN A 1 23 ? 8.128   -1.681  -10.460 1.00 0.00 ? 21 GLN P HB3  4  
ATOM 3943  H HG2  . GLN A 1 23 ? 9.839   -2.272  -8.843  1.00 0.00 ? 21 GLN P HG2  4  
ATOM 3944  H HG3  . GLN A 1 23 ? 8.645   -2.551  -7.582  1.00 0.00 ? 21 GLN P HG3  4  
ATOM 3945  H HE21 . GLN A 1 23 ? 10.278  -4.617  -7.885  1.00 0.00 ? 21 GLN P HE21 4  
ATOM 3946  H HE22 . GLN A 1 23 ? 9.515   -5.907  -8.804  1.00 0.00 ? 21 GLN P HE22 4  
ATOM 3947  N N    . ARG A 1 24 ? 5.902   0.945   -9.808  1.00 0.00 ? 22 ARG P N    4  
ATOM 3948  C CA   . ARG A 1 24 ? 5.193   1.971   -10.605 1.00 0.00 ? 22 ARG P CA   4  
ATOM 3949  C C    . ARG A 1 24 ? 5.532   3.399   -10.161 1.00 0.00 ? 22 ARG P C    4  
ATOM 3950  O O    . ARG A 1 24 ? 5.677   4.279   -11.010 1.00 0.00 ? 22 ARG P O    4  
ATOM 3951  C CB   . ARG A 1 24 ? 3.667   1.761   -10.539 1.00 0.00 ? 22 ARG P CB   4  
ATOM 3952  C CG   . ARG A 1 24 ? 3.170   0.532   -11.321 1.00 0.00 ? 22 ARG P CG   4  
ATOM 3953  C CD   . ARG A 1 24 ? 1.634   0.432   -11.352 1.00 0.00 ? 22 ARG P CD   4  
ATOM 3954  N NE   . ARG A 1 24 ? 1.028   0.367   -10.003 1.00 0.00 ? 22 ARG P NE   4  
ATOM 3955  C CZ   . ARG A 1 24 ? 0.452   -0.669  -9.419  1.00 0.00 ? 22 ARG P CZ   4  
ATOM 3956  N NH1  . ARG A 1 24 ? 0.378   -1.859  -9.935  1.00 0.00 ? 22 ARG P NH1  4  
ATOM 3957  N NH2  . ARG A 1 24 ? -0.087  -0.558  -8.247  1.00 0.00 ? 22 ARG P NH2  4  
ATOM 3958  H H    . ARG A 1 24 ? 5.357   0.342   -9.198  1.00 0.00 ? 22 ARG P H    4  
ATOM 3959  H HA   . ARG A 1 24 ? 5.508   1.895   -11.647 1.00 0.00 ? 22 ARG P HA   4  
ATOM 3960  H HB2  . ARG A 1 24 ? 3.363   1.686   -9.495  1.00 0.00 ? 22 ARG P HB2  4  
ATOM 3961  H HB3  . ARG A 1 24 ? 3.181   2.641   -10.965 1.00 0.00 ? 22 ARG P HB3  4  
ATOM 3962  H HG2  . ARG A 1 24 ? 3.524   0.606   -12.350 1.00 0.00 ? 22 ARG P HG2  4  
ATOM 3963  H HG3  . ARG A 1 24 ? 3.578   -0.380  -10.894 1.00 0.00 ? 22 ARG P HG3  4  
ATOM 3964  H HD2  . ARG A 1 24 ? 1.242   1.309   -11.870 1.00 0.00 ? 22 ARG P HD2  4  
ATOM 3965  H HD3  . ARG A 1 24 ? 1.355   -0.442  -11.943 1.00 0.00 ? 22 ARG P HD3  4  
ATOM 3966  H HE   . ARG A 1 24 ? 0.980   1.234   -9.490  1.00 0.00 ? 22 ARG P HE   4  
ATOM 3967  H HH11 . ARG A 1 24 ? 0.753   -2.048  -10.847 1.00 0.00 ? 22 ARG P HH11 4  
ATOM 3968  H HH12 . ARG A 1 24 ? -0.082  -2.578  -9.378  1.00 0.00 ? 22 ARG P HH12 4  
ATOM 3969  H HH21 . ARG A 1 24 ? 0.012   0.291   -7.702  1.00 0.00 ? 22 ARG P HH21 4  
ATOM 3970  H HH22 . ARG A 1 24 ? -0.476  -1.406  -7.839  1.00 0.00 ? 22 ARG P HH22 4  
ATOM 3971  N N    . ASN A 1 25 ? 5.652   3.635   -8.851  1.00 0.00 ? 23 ASN P N    4  
ATOM 3972  C CA   . ASN A 1 25 ? 5.862   4.957   -8.256  1.00 0.00 ? 23 ASN P CA   4  
ATOM 3973  C C    . ASN A 1 25 ? 6.830   4.892   -7.054  1.00 0.00 ? 23 ASN P C    4  
ATOM 3974  O O    . ASN A 1 25 ? 6.405   4.826   -5.895  1.00 0.00 ? 23 ASN P O    4  
ATOM 3975  C CB   . ASN A 1 25 ? 4.477   5.541   -7.898  1.00 0.00 ? 23 ASN P CB   4  
ATOM 3976  C CG   . ASN A 1 25 ? 4.543   7.012   -7.514  1.00 0.00 ? 23 ASN P CG   4  
ATOM 3977  O OD1  . ASN A 1 25 ? 4.161   7.894   -8.269  1.00 0.00 ? 23 ASN P OD1  4  
ATOM 3978  N ND2  . ASN A 1 25 ? 5.043   7.328   -6.343  1.00 0.00 ? 23 ASN P ND2  4  
ATOM 3979  H H    . ASN A 1 25 ? 5.470   2.864   -8.219  1.00 0.00 ? 23 ASN P H    4  
ATOM 3980  H HA   . ASN A 1 25 ? 6.317   5.617   -8.998  1.00 0.00 ? 23 ASN P HA   4  
ATOM 3981  H HB2  . ASN A 1 25 ? 3.816   5.452   -8.759  1.00 0.00 ? 23 ASN P HB2  4  
ATOM 3982  H HB3  . ASN A 1 25 ? 4.037   4.975   -7.077  1.00 0.00 ? 23 ASN P HB3  4  
ATOM 3983  H HD21 . ASN A 1 25 ? 5.426   6.593   -5.760  1.00 0.00 ? 23 ASN P HD21 4  
ATOM 3984  H HD22 . ASN A 1 25 ? 5.139   8.303   -6.112  1.00 0.00 ? 23 ASN P HD22 4  
ATOM 3985  N N    . ARG A 1 26 ? 8.140   4.968   -7.328  1.00 0.00 ? 24 ARG P N    4  
ATOM 3986  C CA   . ARG A 1 26 ? 9.187   5.140   -6.301  1.00 0.00 ? 24 ARG P CA   4  
ATOM 3987  C C    . ARG A 1 26 ? 9.078   6.495   -5.584  1.00 0.00 ? 24 ARG P C    4  
ATOM 3988  O O    . ARG A 1 26 ? 8.507   7.445   -6.124  1.00 0.00 ? 24 ARG P O    4  
ATOM 3989  C CB   . ARG A 1 26 ? 10.589  4.905   -6.899  1.00 0.00 ? 24 ARG P CB   4  
ATOM 3990  C CG   . ARG A 1 26 ? 10.948  5.845   -8.062  1.00 0.00 ? 24 ARG P CG   4  
ATOM 3991  C CD   . ARG A 1 26 ? 12.400  5.628   -8.505  1.00 0.00 ? 24 ARG P CD   4  
ATOM 3992  N NE   . ARG A 1 26 ? 12.783  6.574   -9.572  1.00 0.00 ? 24 ARG P NE   4  
ATOM 3993  C CZ   . ARG A 1 26 ? 13.969  6.684   -10.143 1.00 0.00 ? 24 ARG P CZ   4  
ATOM 3994  N NH1  . ARG A 1 26 ? 14.973  5.922   -9.810  1.00 0.00 ? 24 ARG P NH1  4  
ATOM 3995  N NH2  . ARG A 1 26 ? 14.173  7.574   -11.072 1.00 0.00 ? 24 ARG P NH2  4  
ATOM 3996  H H    . ARG A 1 26 ? 8.415   4.982   -8.299  1.00 0.00 ? 24 ARG P H    4  
ATOM 3997  H HA   . ARG A 1 26 ? 9.029   4.374   -5.539  1.00 0.00 ? 24 ARG P HA   4  
ATOM 3998  H HB2  . ARG A 1 26 ? 11.330  5.025   -6.106  1.00 0.00 ? 24 ARG P HB2  4  
ATOM 3999  H HB3  . ARG A 1 26 ? 10.652  3.876   -7.251  1.00 0.00 ? 24 ARG P HB3  4  
ATOM 4000  H HG2  . ARG A 1 26 ? 10.288  5.651   -8.909  1.00 0.00 ? 24 ARG P HG2  4  
ATOM 4001  H HG3  . ARG A 1 26 ? 10.821  6.881   -7.751  1.00 0.00 ? 24 ARG P HG3  4  
ATOM 4002  H HD2  . ARG A 1 26 ? 13.055  5.768   -7.643  1.00 0.00 ? 24 ARG P HD2  4  
ATOM 4003  H HD3  . ARG A 1 26 ? 12.509  4.603   -8.866  1.00 0.00 ? 24 ARG P HD3  4  
ATOM 4004  H HE   . ARG A 1 26 ? 12.068  7.203   -9.906  1.00 0.00 ? 24 ARG P HE   4  
ATOM 4005  H HH11 . ARG A 1 26 ? 14.841  5.217   -9.107  1.00 0.00 ? 24 ARG P HH11 4  
ATOM 4006  H HH12 . ARG A 1 26 ? 15.866  6.024   -10.261 1.00 0.00 ? 24 ARG P HH12 4  
ATOM 4007  H HH21 . ARG A 1 26 ? 13.427  8.184   -11.363 1.00 0.00 ? 24 ARG P HH21 4  
ATOM 4008  H HH22 . ARG A 1 26 ? 15.078  7.656   -11.506 1.00 0.00 ? 24 ARG P HH22 4  
ATOM 4009  N N    . TYR A 1 27 ? 9.629   6.579   -4.371  1.00 0.00 ? 25 TYR P N    4  
ATOM 4010  C CA   . TYR A 1 27 ? 9.549   7.747   -3.474  1.00 0.00 ? 25 TYR P CA   4  
ATOM 4011  C C    . TYR A 1 27 ? 8.115   8.328   -3.297  1.00 0.00 ? 25 TYR P C    4  
ATOM 4012  O O    . TYR A 1 27 ? 7.915   9.532   -3.493  1.00 0.00 ? 25 TYR P O    4  
ATOM 4013  C CB   . TYR A 1 27 ? 10.577  8.812   -3.907  1.00 0.00 ? 25 TYR P CB   4  
ATOM 4014  C CG   . TYR A 1 27 ? 12.017  8.341   -4.026  1.00 0.00 ? 25 TYR P CG   4  
ATOM 4015  C CD1  . TYR A 1 27 ? 12.831  8.264   -2.878  1.00 0.00 ? 25 TYR P CD1  4  
ATOM 4016  C CD2  . TYR A 1 27 ? 12.559  8.043   -5.292  1.00 0.00 ? 25 TYR P CD2  4  
ATOM 4017  C CE1  . TYR A 1 27 ? 14.190  7.908   -2.997  1.00 0.00 ? 25 TYR P CE1  4  
ATOM 4018  C CE2  . TYR A 1 27 ? 13.917  7.689   -5.414  1.00 0.00 ? 25 TYR P CE2  4  
ATOM 4019  C CZ   . TYR A 1 27 ? 14.739  7.630   -4.269  1.00 0.00 ? 25 TYR P CZ   4  
ATOM 4020  O OH   . TYR A 1 27 ? 16.058  7.323   -4.401  1.00 0.00 ? 25 TYR P OH   4  
ATOM 4021  H H    . TYR A 1 27 ? 10.118  5.765   -4.029  1.00 0.00 ? 25 TYR P H    4  
ATOM 4022  H HA   . TYR A 1 27 ? 9.853   7.407   -2.484  1.00 0.00 ? 25 TYR P HA   4  
ATOM 4023  H HB2  . TYR A 1 27 ? 10.268  9.231   -4.867  1.00 0.00 ? 25 TYR P HB2  4  
ATOM 4024  H HB3  . TYR A 1 27 ? 10.555  9.628   -3.183  1.00 0.00 ? 25 TYR P HB3  4  
ATOM 4025  H HD1  . TYR A 1 27 ? 12.417  8.503   -1.906  1.00 0.00 ? 25 TYR P HD1  4  
ATOM 4026  H HD2  . TYR A 1 27 ? 11.939  8.109   -6.175  1.00 0.00 ? 25 TYR P HD2  4  
ATOM 4027  H HE1  . TYR A 1 27 ? 14.820  7.866   -2.121  1.00 0.00 ? 25 TYR P HE1  4  
ATOM 4028  H HE2  . TYR A 1 27 ? 14.345  7.483   -6.386  1.00 0.00 ? 25 TYR P HE2  4  
ATOM 4029  H HH   . TYR A 1 27 ? 16.530  7.341   -3.551  1.00 0.00 ? 25 TYR P HH   4  
ATOM 4030  N N    . PRO A 1 28 ? 7.093   7.511   -2.953  1.00 0.00 ? 26 PRO P N    4  
ATOM 4031  C CA   . PRO A 1 28 ? 5.713   7.984   -2.802  1.00 0.00 ? 26 PRO P CA   4  
ATOM 4032  C C    . PRO A 1 28 ? 5.549   8.933   -1.605  1.00 0.00 ? 26 PRO P C    4  
ATOM 4033  O O    . PRO A 1 28 ? 6.155   8.733   -0.547  1.00 0.00 ? 26 PRO P O    4  
ATOM 4034  C CB   . PRO A 1 28 ? 4.861   6.721   -2.649  1.00 0.00 ? 26 PRO P CB   4  
ATOM 4035  C CG   . PRO A 1 28 ? 5.823   5.724   -2.010  1.00 0.00 ? 26 PRO P CG   4  
ATOM 4036  C CD   . PRO A 1 28 ? 7.174   6.094   -2.617  1.00 0.00 ? 26 PRO P CD   4  
ATOM 4037  H HA   . PRO A 1 28 ? 5.404   8.511   -3.706  1.00 0.00 ? 26 PRO P HA   4  
ATOM 4038  H HB2  . PRO A 1 28 ? 3.982   6.880   -2.026  1.00 0.00 ? 26 PRO P HB2  4  
ATOM 4039  H HB3  . PRO A 1 28 ? 4.565   6.356   -3.633  1.00 0.00 ? 26 PRO P HB3  4  
ATOM 4040  H HG2  . PRO A 1 28 ? 5.850   5.870   -0.931  1.00 0.00 ? 26 PRO P HG2  4  
ATOM 4041  H HG3  . PRO A 1 28 ? 5.541   4.703   -2.254  1.00 0.00 ? 26 PRO P HG3  4  
ATOM 4042  H HD2  . PRO A 1 28 ? 7.974   5.898   -1.903  1.00 0.00 ? 26 PRO P HD2  4  
ATOM 4043  H HD3  . PRO A 1 28 ? 7.328   5.510   -3.524  1.00 0.00 ? 26 PRO P HD3  4  
ATOM 4044  N N    . ASP A 1 29 ? 4.692   9.945   -1.752  1.00 0.00 ? 27 ASP P N    4  
ATOM 4045  C CA   . ASP A 1 29 ? 4.346   10.900  -0.689  1.00 0.00 ? 27 ASP P CA   4  
ATOM 4046  C C    . ASP A 1 29 ? 3.377   10.275  0.337   1.00 0.00 ? 27 ASP P C    4  
ATOM 4047  O O    . ASP A 1 29 ? 2.785   9.222   0.091   1.00 0.00 ? 27 ASP P O    4  
ATOM 4048  C CB   . ASP A 1 29 ? 3.777   12.174  -1.345  1.00 0.00 ? 27 ASP P CB   4  
ATOM 4049  C CG   . ASP A 1 29 ? 3.739   13.417  -0.432  1.00 0.00 ? 27 ASP P CG   4  
ATOM 4050  O OD1  . ASP A 1 29 ? 4.286   13.383  0.694   1.00 0.00 ? 27 ASP P OD1  4  
ATOM 4051  O OD2  . ASP A 1 29 ? 3.173   14.452  -0.859  1.00 0.00 ? 27 ASP P OD2  4  
ATOM 4052  H H    . ASP A 1 29 ? 4.181   10.023  -2.621  1.00 0.00 ? 27 ASP P H    4  
ATOM 4053  H HA   . ASP A 1 29 ? 5.263   11.169  -0.161  1.00 0.00 ? 27 ASP P HA   4  
ATOM 4054  H HB2  . ASP A 1 29 ? 4.392   12.422  -2.212  1.00 0.00 ? 27 ASP P HB2  4  
ATOM 4055  H HB3  . ASP A 1 29 ? 2.767   11.962  -1.703  1.00 0.00 ? 27 ASP P HB3  4  
ATOM 4056  N N    . MET A 1 30 ? 3.186   10.908  1.494   1.00 0.00 ? 28 MET P N    4  
ATOM 4057  C CA   . MET A 1 30 ? 2.330   10.400  2.576   1.00 0.00 ? 28 MET P CA   4  
ATOM 4058  C C    . MET A 1 30 ? 0.870   10.206  2.128   1.00 0.00 ? 28 MET P C    4  
ATOM 4059  O O    . MET A 1 30 ? 0.239   9.210   2.488   1.00 0.00 ? 28 MET P O    4  
ATOM 4060  C CB   . MET A 1 30 ? 2.401   11.358  3.777   1.00 0.00 ? 28 MET P CB   4  
ATOM 4061  C CG   . MET A 1 30 ? 3.654   11.180  4.652   1.00 0.00 ? 28 MET P CG   4  
ATOM 4062  S SD   . MET A 1 30 ? 5.260   11.626  3.920   1.00 0.00 ? 28 MET P SD   4  
ATOM 4063  C CE   . MET A 1 30 ? 5.862   9.995   3.395   1.00 0.00 ? 28 MET P CE   4  
ATOM 4064  H H    . MET A 1 30 ? 3.681   11.787  1.636   1.00 0.00 ? 28 MET P H    4  
ATOM 4065  H HA   . MET A 1 30 ? 2.697   9.422   2.890   1.00 0.00 ? 28 MET P HA   4  
ATOM 4066  H HB2  . MET A 1 30 ? 2.343   12.391  3.432   1.00 0.00 ? 28 MET P HB2  4  
ATOM 4067  H HB3  . MET A 1 30 ? 1.534   11.177  4.412   1.00 0.00 ? 28 MET P HB3  4  
ATOM 4068  H HG2  . MET A 1 30 ? 3.522   11.814  5.529   1.00 0.00 ? 28 MET P HG2  4  
ATOM 4069  H HG3  . MET A 1 30 ? 3.699   10.148  5.001   1.00 0.00 ? 28 MET P HG3  4  
ATOM 4070  H HE1  . MET A 1 30 ? 6.835   10.106  2.914   1.00 0.00 ? 28 MET P HE1  4  
ATOM 4071  H HE2  . MET A 1 30 ? 5.965   9.343   4.263   1.00 0.00 ? 28 MET P HE2  4  
ATOM 4072  H HE3  . MET A 1 30 ? 5.166   9.547   2.689   1.00 0.00 ? 28 MET P HE3  4  
ATOM 4073  N N    . SER A 1 31 ? 0.348   11.104  1.288   1.00 0.00 ? 29 SER P N    4  
ATOM 4074  C CA   . SER A 1 31 ? -0.970  10.967  0.652   1.00 0.00 ? 29 SER P CA   4  
ATOM 4075  C C    . SER A 1 31 ? -1.003  9.842   -0.389  1.00 0.00 ? 29 SER P C    4  
ATOM 4076  O O    . SER A 1 31 ? -1.963  9.073   -0.420  1.00 0.00 ? 29 SER P O    4  
ATOM 4077  C CB   . SER A 1 31 ? -1.379  12.299  0.014   1.00 0.00 ? 29 SER P CB   4  
ATOM 4078  O OG   . SER A 1 31 ? -0.361  12.770  -0.857  1.00 0.00 ? 29 SER P OG   4  
ATOM 4079  H H    . SER A 1 31 ? 0.917   11.890  1.007   1.00 0.00 ? 29 SER P H    4  
ATOM 4080  H HA   . SER A 1 31 ? -1.708  10.721  1.418   1.00 0.00 ? 29 SER P HA   4  
ATOM 4081  H HB2  . SER A 1 31 ? -2.311  12.165  -0.539  1.00 0.00 ? 29 SER P HB2  4  
ATOM 4082  H HB3  . SER A 1 31 ? -1.544  13.034  0.804   1.00 0.00 ? 29 SER P HB3  4  
ATOM 4083  H HG   . SER A 1 31 ? -0.650  13.623  -1.236  1.00 0.00 ? 29 SER P HG   4  
ATOM 4084  N N    . THR A 1 32 ? 0.062   9.666   -1.182  1.00 0.00 ? 30 THR P N    4  
ATOM 4085  C CA   . THR A 1 32 ? 0.204   8.550   -2.135  1.00 0.00 ? 30 THR P CA   4  
ATOM 4086  C C    . THR A 1 32 ? 0.164   7.201   -1.412  1.00 0.00 ? 30 THR P C    4  
ATOM 4087  O O    . THR A 1 32 ? -0.568  6.302   -1.829  1.00 0.00 ? 30 THR P O    4  
ATOM 4088  C CB   . THR A 1 32 ? 1.522   8.649   -2.926  1.00 0.00 ? 30 THR P CB   4  
ATOM 4089  O OG1  . THR A 1 32 ? 1.765   9.960   -3.393  1.00 0.00 ? 30 THR P OG1  4  
ATOM 4090  C CG2  . THR A 1 32 ? 1.553   7.719   -4.139  1.00 0.00 ? 30 THR P CG2  4  
ATOM 4091  H H    . THR A 1 32 ? 0.811   10.342  -1.132  1.00 0.00 ? 30 THR P H    4  
ATOM 4092  H HA   . THR A 1 32 ? -0.629  8.581   -2.838  1.00 0.00 ? 30 THR P HA   4  
ATOM 4093  H HB   . THR A 1 32 ? 2.346   8.379   -2.270  1.00 0.00 ? 30 THR P HB   4  
ATOM 4094  H HG1  . THR A 1 32 ? 1.044   10.200  -4.000  1.00 0.00 ? 30 THR P HG1  4  
ATOM 4095  H HG21 . THR A 1 32 ? 2.483   7.867   -4.689  1.00 0.00 ? 30 THR P HG21 4  
ATOM 4096  H HG22 . THR A 1 32 ? 0.710   7.929   -4.797  1.00 0.00 ? 30 THR P HG22 4  
ATOM 4097  H HG23 . THR A 1 32 ? 1.504   6.679   -3.815  1.00 0.00 ? 30 THR P HG23 4  
ATOM 4098  N N    . ARG A 1 33 ? 0.891   7.071   -0.291  1.00 0.00 ? 31 ARG P N    4  
ATOM 4099  C CA   . ARG A 1 33 ? 0.904   5.865   0.558   1.00 0.00 ? 31 ARG P CA   4  
ATOM 4100  C C    . ARG A 1 33 ? -0.478  5.579   1.146   1.00 0.00 ? 31 ARG P C    4  
ATOM 4101  O O    . ARG A 1 33 ? -0.914  4.433   1.158   1.00 0.00 ? 31 ARG P O    4  
ATOM 4102  C CB   . ARG A 1 33 ? 1.950   6.001   1.682   1.00 0.00 ? 31 ARG P CB   4  
ATOM 4103  C CG   . ARG A 1 33 ? 3.388   6.054   1.142   1.00 0.00 ? 31 ARG P CG   4  
ATOM 4104  C CD   . ARG A 1 33 ? 4.400   6.370   2.252   1.00 0.00 ? 31 ARG P CD   4  
ATOM 4105  N NE   . ARG A 1 33 ? 5.627   6.948   1.672   1.00 0.00 ? 31 ARG P NE   4  
ATOM 4106  C CZ   . ARG A 1 33 ? 6.872   6.839   2.087   1.00 0.00 ? 31 ARG P CZ   4  
ATOM 4107  N NH1  . ARG A 1 33 ? 7.214   6.147   3.136   1.00 0.00 ? 31 ARG P NH1  4  
ATOM 4108  N NH2  . ARG A 1 33 ? 7.801   7.465   1.429   1.00 0.00 ? 31 ARG P NH2  4  
ATOM 4109  H H    . ARG A 1 33 ? 1.472   7.862   -0.018  1.00 0.00 ? 31 ARG P H    4  
ATOM 4110  H HA   . ARG A 1 33 ? 1.165   5.005   -0.060  1.00 0.00 ? 31 ARG P HA   4  
ATOM 4111  H HB2  . ARG A 1 33 ? 1.744   6.903   2.260   1.00 0.00 ? 31 ARG P HB2  4  
ATOM 4112  H HB3  . ARG A 1 33 ? 1.866   5.143   2.350   1.00 0.00 ? 31 ARG P HB3  4  
ATOM 4113  H HG2  . ARG A 1 33 ? 3.645   5.099   0.681   1.00 0.00 ? 31 ARG P HG2  4  
ATOM 4114  H HG3  . ARG A 1 33 ? 3.456   6.824   0.379   1.00 0.00 ? 31 ARG P HG3  4  
ATOM 4115  H HD2  . ARG A 1 33 ? 3.968   7.098   2.943   1.00 0.00 ? 31 ARG P HD2  4  
ATOM 4116  H HD3  . ARG A 1 33 ? 4.614   5.453   2.803   1.00 0.00 ? 31 ARG P HD3  4  
ATOM 4117  H HE   . ARG A 1 33 ? 5.509   7.544   0.860   1.00 0.00 ? 31 ARG P HE   4  
ATOM 4118  H HH11 . ARG A 1 33 ? 6.503   5.687   3.674   1.00 0.00 ? 31 ARG P HH11 4  
ATOM 4119  H HH12 . ARG A 1 33 ? 8.174   6.107   3.431   1.00 0.00 ? 31 ARG P HH12 4  
ATOM 4120  H HH21 . ARG A 1 33 ? 7.526   8.032   0.634   1.00 0.00 ? 31 ARG P HH21 4  
ATOM 4121  H HH22 . ARG A 1 33 ? 8.762   7.423   1.719   1.00 0.00 ? 31 ARG P HH22 4  
ATOM 4122  N N    . GLU A 1 34 ? -1.200  6.607   1.585   1.00 0.00 ? 32 GLU P N    4  
ATOM 4123  C CA   . GLU A 1 34 ? -2.556  6.454   2.126   1.00 0.00 ? 32 GLU P CA   4  
ATOM 4124  C C    . GLU A 1 34 ? -3.613  6.113   1.057   1.00 0.00 ? 32 GLU P C    4  
ATOM 4125  O O    . GLU A 1 34 ? -4.546  5.364   1.351   1.00 0.00 ? 32 GLU P O    4  
ATOM 4126  C CB   . GLU A 1 34 ? -2.936  7.713   2.921   1.00 0.00 ? 32 GLU P CB   4  
ATOM 4127  C CG   . GLU A 1 34 ? -2.257  7.696   4.300   1.00 0.00 ? 32 GLU P CG   4  
ATOM 4128  C CD   . GLU A 1 34 ? -2.477  8.982   5.121   1.00 0.00 ? 32 GLU P CD   4  
ATOM 4129  O OE1  . GLU A 1 34 ? -3.446  9.741   4.881   1.00 0.00 ? 32 GLU P OE1  4  
ATOM 4130  O OE2  . GLU A 1 34 ? -1.667  9.214   6.052   1.00 0.00 ? 32 GLU P OE2  4  
ATOM 4131  H H    . GLU A 1 34 ? -0.774  7.526   1.588   1.00 0.00 ? 32 GLU P H    4  
ATOM 4132  H HA   . GLU A 1 34 ? -2.552  5.606   2.813   1.00 0.00 ? 32 GLU P HA   4  
ATOM 4133  H HB2  . GLU A 1 34 ? -2.638  8.603   2.366   1.00 0.00 ? 32 GLU P HB2  4  
ATOM 4134  H HB3  . GLU A 1 34 ? -4.016  7.739   3.061   1.00 0.00 ? 32 GLU P HB3  4  
ATOM 4135  H HG2  . GLU A 1 34 ? -2.640  6.844   4.866   1.00 0.00 ? 32 GLU P HG2  4  
ATOM 4136  H HG3  . GLU A 1 34 ? -1.184  7.541   4.169   1.00 0.00 ? 32 GLU P HG3  4  
ATOM 4137  N N    . GLU A 1 35 ? -3.460  6.568   -0.192  1.00 0.00 ? 33 GLU P N    4  
ATOM 4138  C CA   . GLU A 1 35 ? -4.313  6.120   -1.303  1.00 0.00 ? 33 GLU P CA   4  
ATOM 4139  C C    . GLU A 1 35 ? -4.055  4.649   -1.660  1.00 0.00 ? 33 GLU P C    4  
ATOM 4140  O O    . GLU A 1 35 ? -5.001  3.863   -1.724  1.00 0.00 ? 33 GLU P O    4  
ATOM 4141  C CB   . GLU A 1 35 ? -4.145  7.006   -2.547  1.00 0.00 ? 33 GLU P CB   4  
ATOM 4142  C CG   . GLU A 1 35 ? -4.809  8.378   -2.378  1.00 0.00 ? 33 GLU P CG   4  
ATOM 4143  C CD   . GLU A 1 35 ? -4.711  9.205   -3.674  1.00 0.00 ? 33 GLU P CD   4  
ATOM 4144  O OE1  . GLU A 1 35 ? -3.647  9.819   -3.936  1.00 0.00 ? 33 GLU P OE1  4  
ATOM 4145  O OE2  . GLU A 1 35 ? -5.706  9.263   -4.438  1.00 0.00 ? 33 GLU P OE2  4  
ATOM 4146  H H    . GLU A 1 35 ? -2.717  7.234   -0.382  1.00 0.00 ? 33 GLU P H    4  
ATOM 4147  H HA   . GLU A 1 35 ? -5.357  6.185   -0.992  1.00 0.00 ? 33 GLU P HA   4  
ATOM 4148  H HB2  . GLU A 1 35 ? -3.087  7.128   -2.777  1.00 0.00 ? 33 GLU P HB2  4  
ATOM 4149  H HB3  . GLU A 1 35 ? -4.626  6.502   -3.388  1.00 0.00 ? 33 GLU P HB3  4  
ATOM 4150  H HG2  . GLU A 1 35 ? -5.859  8.230   -2.112  1.00 0.00 ? 33 GLU P HG2  4  
ATOM 4151  H HG3  . GLU A 1 35 ? -4.339  8.920   -1.555  1.00 0.00 ? 33 GLU P HG3  4  
ATOM 4152  N N    . ILE A 1 36 ? -2.792  4.227   -1.815  1.00 0.00 ? 34 ILE P N    4  
ATOM 4153  C CA   . ILE A 1 36 ? -2.497  2.813   -2.103  1.00 0.00 ? 34 ILE P CA   4  
ATOM 4154  C C    . ILE A 1 36 ? -2.832  1.896   -0.914  1.00 0.00 ? 34 ILE P C    4  
ATOM 4155  O O    . ILE A 1 36 ? -3.156  0.728   -1.127  1.00 0.00 ? 34 ILE P O    4  
ATOM 4156  C CB   . ILE A 1 36 ? -1.081  2.597   -2.689  1.00 0.00 ? 34 ILE P CB   4  
ATOM 4157  C CG1  . ILE A 1 36 ? 0.096   2.907   -1.750  1.00 0.00 ? 34 ILE P CG1  4  
ATOM 4158  C CG2  . ILE A 1 36 ? -0.902  3.450   -3.955  1.00 0.00 ? 34 ILE P CG2  4  
ATOM 4159  C CD1  . ILE A 1 36 ? 0.443   1.791   -0.766  1.00 0.00 ? 34 ILE P CD1  4  
ATOM 4160  H H    . ILE A 1 36 ? -2.029  4.895   -1.757  1.00 0.00 ? 34 ILE P H    4  
ATOM 4161  H HA   . ILE A 1 36 ? -3.184  2.510   -2.893  1.00 0.00 ? 34 ILE P HA   4  
ATOM 4162  H HB   . ILE A 1 36 ? -1.007  1.552   -2.991  1.00 0.00 ? 34 ILE P HB   4  
ATOM 4163  H HG12 . ILE A 1 36 ? 0.995   3.091   -2.341  1.00 0.00 ? 34 ILE P HG12 4  
ATOM 4164  H HG13 . ILE A 1 36 ? -0.131  3.812   -1.202  1.00 0.00 ? 34 ILE P HG13 4  
ATOM 4165  H HG21 . ILE A 1 36 ? -1.727  3.279   -4.642  1.00 0.00 ? 34 ILE P HG21 4  
ATOM 4166  H HG22 . ILE A 1 36 ? -0.857  4.508   -3.695  1.00 0.00 ? 34 ILE P HG22 4  
ATOM 4167  H HG23 . ILE A 1 36 ? 0.027   3.178   -4.456  1.00 0.00 ? 34 ILE P HG23 4  
ATOM 4168  H HD11 . ILE A 1 36 ? 1.324   2.092   -0.204  1.00 0.00 ? 34 ILE P HD11 4  
ATOM 4169  H HD12 . ILE A 1 36 ? -0.368  1.618   -0.064  1.00 0.00 ? 34 ILE P HD12 4  
ATOM 4170  H HD13 . ILE A 1 36 ? 0.658   0.871   -1.309  1.00 0.00 ? 34 ILE P HD13 4  
ATOM 4171  N N    . ALA A 1 37 ? -2.856  2.411   0.322   1.00 0.00 ? 35 ALA P N    4  
ATOM 4172  C CA   . ALA A 1 37 ? -3.311  1.676   1.505   1.00 0.00 ? 35 ALA P CA   4  
ATOM 4173  C C    . ALA A 1 37 ? -4.806  1.327   1.432   1.00 0.00 ? 35 ALA P C    4  
ATOM 4174  O O    . ALA A 1 37 ? -5.161  0.177   1.673   1.00 0.00 ? 35 ALA P O    4  
ATOM 4175  C CB   . ALA A 1 37 ? -2.986  2.480   2.766   1.00 0.00 ? 35 ALA P CB   4  
ATOM 4176  H H    . ALA A 1 37 ? -2.501  3.351   0.454   1.00 0.00 ? 35 ALA P H    4  
ATOM 4177  H HA   . ALA A 1 37 ? -2.761  0.737   1.573   1.00 0.00 ? 35 ALA P HA   4  
ATOM 4178  H HB1  . ALA A 1 37 ? -1.921  2.679   2.797   1.00 0.00 ? 35 ALA P HB1  4  
ATOM 4179  H HB2  . ALA A 1 37 ? -3.538  3.417   2.775   1.00 0.00 ? 35 ALA P HB2  4  
ATOM 4180  H HB3  . ALA A 1 37 ? -3.256  1.902   3.649   1.00 0.00 ? 35 ALA P HB3  4  
ATOM 4181  N N    . VAL A 1 38 ? -5.693  2.250   1.035   1.00 0.00 ? 36 VAL P N    4  
ATOM 4182  C CA   . VAL A 1 38 ? -7.124  1.922   0.860   1.00 0.00 ? 36 VAL P CA   4  
ATOM 4183  C C    . VAL A 1 38 ? -7.382  1.018   -0.356  1.00 0.00 ? 36 VAL P C    4  
ATOM 4184  O O    . VAL A 1 38 ? -8.341  0.247   -0.345  1.00 0.00 ? 36 VAL P O    4  
ATOM 4185  C CB   . VAL A 1 38 ? -8.049  3.157   0.867   1.00 0.00 ? 36 VAL P CB   4  
ATOM 4186  C CG1  . VAL A 1 38 ? -7.990  3.881   2.215   1.00 0.00 ? 36 VAL P CG1  4  
ATOM 4187  C CG2  . VAL A 1 38 ? -7.753  4.190   -0.221  1.00 0.00 ? 36 VAL P CG2  4  
ATOM 4188  H H    . VAL A 1 38 ? -5.373  3.190   0.840   1.00 0.00 ? 36 VAL P H    4  
ATOM 4189  H HA   . VAL A 1 38 ? -7.425  1.329   1.725   1.00 0.00 ? 36 VAL P HA   4  
ATOM 4190  H HB   . VAL A 1 38 ? -9.072  2.811   0.726   1.00 0.00 ? 36 VAL P HB   4  
ATOM 4191  H HG11 . VAL A 1 38 ? -6.992  4.290   2.380   1.00 0.00 ? 36 VAL P HG11 4  
ATOM 4192  H HG12 . VAL A 1 38 ? -8.711  4.699   2.218   1.00 0.00 ? 36 VAL P HG12 4  
ATOM 4193  H HG13 . VAL A 1 38 ? -8.235  3.188   3.019   1.00 0.00 ? 36 VAL P HG13 4  
ATOM 4194  H HG21 . VAL A 1 38 ? -6.789  4.656   -0.035  1.00 0.00 ? 36 VAL P HG21 4  
ATOM 4195  H HG22 . VAL A 1 38 ? -7.747  3.713   -1.197  1.00 0.00 ? 36 VAL P HG22 4  
ATOM 4196  H HG23 . VAL A 1 38 ? -8.524  4.960   -0.215  1.00 0.00 ? 36 VAL P HG23 4  
ATOM 4197  N N    . TRP A 1 39 ? -6.504  1.034   -1.368  1.00 0.00 ? 37 TRP P N    4  
ATOM 4198  C CA   . TRP A 1 39 ? -6.569  0.127   -2.530  1.00 0.00 ? 37 TRP P CA   4  
ATOM 4199  C C    . TRP A 1 39 ? -6.068  -1.298  -2.213  1.00 0.00 ? 37 TRP P C    4  
ATOM 4200  O O    . TRP A 1 39 ? -6.584  -2.268  -2.771  1.00 0.00 ? 37 TRP P O    4  
ATOM 4201  C CB   . TRP A 1 39 ? -5.780  0.736   -3.703  1.00 0.00 ? 37 TRP P CB   4  
ATOM 4202  C CG   . TRP A 1 39 ? -6.153  2.117   -4.165  1.00 0.00 ? 37 TRP P CG   4  
ATOM 4203  C CD1  . TRP A 1 39 ? -7.243  2.815   -3.783  1.00 0.00 ? 37 TRP P CD1  4  
ATOM 4204  C CD2  . TRP A 1 39 ? -5.416  3.010   -5.059  1.00 0.00 ? 37 TRP P CD2  4  
ATOM 4205  N NE1  . TRP A 1 39 ? -7.215  4.085   -4.323  1.00 0.00 ? 37 TRP P NE1  4  
ATOM 4206  C CE2  . TRP A 1 39 ? -6.108  4.260   -5.128  1.00 0.00 ? 37 TRP P CE2  4  
ATOM 4207  C CE3  . TRP A 1 39 ? -4.226  2.897   -5.813  1.00 0.00 ? 37 TRP P CE3  4  
ATOM 4208  C CZ2  . TRP A 1 39 ? -5.639  5.341   -5.888  1.00 0.00 ? 37 TRP P CZ2  4  
ATOM 4209  C CZ3  . TRP A 1 39 ? -3.748  3.976   -6.585  1.00 0.00 ? 37 TRP P CZ3  4  
ATOM 4210  C CH2  . TRP A 1 39 ? -4.447  5.196   -6.619  1.00 0.00 ? 37 TRP P CH2  4  
ATOM 4211  H H    . TRP A 1 39 ? -5.790  1.753   -1.366  1.00 0.00 ? 37 TRP P H    4  
ATOM 4212  H HA   . TRP A 1 39 ? -7.609  0.032   -2.845  1.00 0.00 ? 37 TRP P HA   4  
ATOM 4213  H HB2  . TRP A 1 39 ? -4.734  0.773   -3.416  1.00 0.00 ? 37 TRP P HB2  4  
ATOM 4214  H HB3  . TRP A 1 39 ? -5.863  0.064   -4.560  1.00 0.00 ? 37 TRP P HB3  4  
ATOM 4215  H HD1  . TRP A 1 39 ? -7.985  2.447   -3.090  1.00 0.00 ? 37 TRP P HD1  4  
ATOM 4216  H HE1  . TRP A 1 39 ? -7.898  4.798   -4.096  1.00 0.00 ? 37 TRP P HE1  4  
ATOM 4217  H HE3  . TRP A 1 39 ? -3.676  1.967   -5.789  1.00 0.00 ? 37 TRP P HE3  4  
ATOM 4218  H HZ2  . TRP A 1 39 ? -6.186  6.273   -5.907  1.00 0.00 ? 37 TRP P HZ2  4  
ATOM 4219  H HZ3  . TRP A 1 39 ? -2.831  3.867   -7.150  1.00 0.00 ? 37 TRP P HZ3  4  
ATOM 4220  H HH2  . TRP A 1 39 ? -4.069  6.021   -7.211  1.00 0.00 ? 37 TRP P HH2  4  
ATOM 4221  N N    . THR A 1 40 ? -5.101  -1.439  -1.298  1.00 0.00 ? 38 THR P N    4  
ATOM 4222  C CA   . THR A 1 40 ? -4.539  -2.729  -0.823  1.00 0.00 ? 38 THR P CA   4  
ATOM 4223  C C    . THR A 1 40 ? -5.137  -3.218  0.507   1.00 0.00 ? 38 THR P C    4  
ATOM 4224  O O    . THR A 1 40 ? -4.771  -4.286  0.999   1.00 0.00 ? 38 THR P O    4  
ATOM 4225  C CB   . THR A 1 40 ? -3.003  -2.678  -0.718  1.00 0.00 ? 38 THR P CB   4  
ATOM 4226  O OG1  . THR A 1 40 ? -2.584  -1.628  0.122   1.00 0.00 ? 38 THR P OG1  4  
ATOM 4227  C CG2  . THR A 1 40 ? -2.327  -2.490  -2.077  1.00 0.00 ? 38 THR P CG2  4  
ATOM 4228  H H    . THR A 1 40 ? -4.685  -0.590  -0.931  1.00 0.00 ? 38 THR P H    4  
ATOM 4229  H HA   . THR A 1 40 ? -4.777  -3.501  -1.553  1.00 0.00 ? 38 THR P HA   4  
ATOM 4230  H HB   . THR A 1 40 ? -2.646  -3.621  -0.299  1.00 0.00 ? 38 THR P HB   4  
ATOM 4231  H HG1  . THR A 1 40 ? -2.707  -0.798  -0.377  1.00 0.00 ? 38 THR P HG1  4  
ATOM 4232  H HG21 . THR A 1 40 ? -2.627  -1.545  -2.530  1.00 0.00 ? 38 THR P HG21 4  
ATOM 4233  H HG22 . THR A 1 40 ? -2.614  -3.308  -2.736  1.00 0.00 ? 38 THR P HG22 4  
ATOM 4234  H HG23 . THR A 1 40 ? -1.245  -2.501  -1.949  1.00 0.00 ? 38 THR P HG23 4  
ATOM 4235  N N    . ASN A 1 41 ? -6.071  -2.461  1.090   1.00 0.00 ? 39 ASN P N    4  
ATOM 4236  C CA   . ASN A 1 41 ? -6.655  -2.664  2.421   1.00 0.00 ? 39 ASN P CA   4  
ATOM 4237  C C    . ASN A 1 41 ? -5.607  -2.774  3.559   1.00 0.00 ? 39 ASN P C    4  
ATOM 4238  O O    . ASN A 1 41 ? -5.665  -3.672  4.405   1.00 0.00 ? 39 ASN P O    4  
ATOM 4239  C CB   . ASN A 1 41 ? -7.696  -3.802  2.366   1.00 0.00 ? 39 ASN P CB   4  
ATOM 4240  C CG   . ASN A 1 41 ? -8.617  -3.843  3.580   1.00 0.00 ? 39 ASN P CG   4  
ATOM 4241  O OD1  . ASN A 1 41 ? -8.762  -2.892  4.337   1.00 0.00 ? 39 ASN P OD1  4  
ATOM 4242  N ND2  . ASN A 1 41 ? -9.307  -4.944  3.784   1.00 0.00 ? 39 ASN P ND2  4  
ATOM 4243  H H    . ASN A 1 41 ? -6.287  -1.586  0.633   1.00 0.00 ? 39 ASN P H    4  
ATOM 4244  H HA   . ASN A 1 41 ? -7.197  -1.738  2.632   1.00 0.00 ? 39 ASN P HA   4  
ATOM 4245  H HB2  . ASN A 1 41 ? -8.324  -3.677  1.484   1.00 0.00 ? 39 ASN P HB2  4  
ATOM 4246  H HB3  . ASN A 1 41 ? -7.178  -4.756  2.282   1.00 0.00 ? 39 ASN P HB3  4  
ATOM 4247  H HD21 . ASN A 1 41 ? -9.208  -5.729  3.160   1.00 0.00 ? 39 ASN P HD21 4  
ATOM 4248  H HD22 . ASN A 1 41 ? -9.929  -4.980  4.577   1.00 0.00 ? 39 ASN P HD22 4  
ATOM 4249  N N    . LEU A 1 42 ? -4.635  -1.857  3.561   1.00 0.00 ? 40 LEU P N    4  
ATOM 4250  C CA   . LEU A 1 42 ? -3.669  -1.621  4.643   1.00 0.00 ? 40 LEU P CA   4  
ATOM 4251  C C    . LEU A 1 42 ? -4.063  -0.400  5.499   1.00 0.00 ? 40 LEU P C    4  
ATOM 4252  O O    . LEU A 1 42 ? -4.911  0.413   5.126   1.00 0.00 ? 40 LEU P O    4  
ATOM 4253  C CB   . LEU A 1 42 ? -2.234  -1.488  4.078   1.00 0.00 ? 40 LEU P CB   4  
ATOM 4254  C CG   . LEU A 1 42 ? -1.460  -2.820  4.081   1.00 0.00 ? 40 LEU P CG   4  
ATOM 4255  C CD1  . LEU A 1 42 ? -1.835  -3.719  2.908   1.00 0.00 ? 40 LEU P CD1  4  
ATOM 4256  C CD2  . LEU A 1 42 ? 0.045   -2.573  4.030   1.00 0.00 ? 40 LEU P CD2  4  
ATOM 4257  H H    . LEU A 1 42 ? -4.668  -1.165  2.821   1.00 0.00 ? 40 LEU P H    4  
ATOM 4258  H HA   . LEU A 1 42 ? -3.689  -2.474  5.323   1.00 0.00 ? 40 LEU P HA   4  
ATOM 4259  H HB2  . LEU A 1 42 ? -2.254  -1.068  3.071   1.00 0.00 ? 40 LEU P HB2  4  
ATOM 4260  H HB3  . LEU A 1 42 ? -1.679  -0.787  4.703   1.00 0.00 ? 40 LEU P HB3  4  
ATOM 4261  H HG   . LEU A 1 42 ? -1.676  -3.348  5.008   1.00 0.00 ? 40 LEU P HG   4  
ATOM 4262  H HD11 . LEU A 1 42 ? -1.548  -3.246  1.970   1.00 0.00 ? 40 LEU P HD11 4  
ATOM 4263  H HD12 . LEU A 1 42 ? -2.907  -3.886  2.908   1.00 0.00 ? 40 LEU P HD12 4  
ATOM 4264  H HD13 . LEU A 1 42 ? -1.327  -4.678  3.002   1.00 0.00 ? 40 LEU P HD13 4  
ATOM 4265  H HD21 . LEU A 1 42 ? 0.356   -2.006  4.905   1.00 0.00 ? 40 LEU P HD21 4  
ATOM 4266  H HD22 . LEU A 1 42 ? 0.303   -2.022  3.127   1.00 0.00 ? 40 LEU P HD22 4  
ATOM 4267  H HD23 . LEU A 1 42 ? 0.565   -3.531  4.035   1.00 0.00 ? 40 LEU P HD23 4  
ATOM 4268  N N    . THR A 1 43 ? -3.415  -0.278  6.660   1.00 0.00 ? 41 THR P N    4  
ATOM 4269  C CA   . THR A 1 43 ? -3.589  0.817   7.634   1.00 0.00 ? 41 THR P CA   4  
ATOM 4270  C C    . THR A 1 43 ? -2.508  1.887   7.446   1.00 0.00 ? 41 THR P C    4  
ATOM 4271  O O    . THR A 1 43 ? -1.392  1.576   7.030   1.00 0.00 ? 41 THR P O    4  
ATOM 4272  C CB   . THR A 1 43 ? -3.558  0.281   9.079   1.00 0.00 ? 41 THR P CB   4  
ATOM 4273  O OG1  . THR A 1 43 ? -4.210  -0.971  9.178   1.00 0.00 ? 41 THR P OG1  4  
ATOM 4274  C CG2  . THR A 1 43 ? -4.233  1.202   10.092  1.00 0.00 ? 41 THR P CG2  4  
ATOM 4275  H H    . THR A 1 43 ? -2.717  -0.974  6.866   1.00 0.00 ? 41 THR P H    4  
ATOM 4276  H HA   . THR A 1 43 ? -4.558  1.290   7.471   1.00 0.00 ? 41 THR P HA   4  
ATOM 4277  H HB   . THR A 1 43 ? -2.521  0.138   9.381   1.00 0.00 ? 41 THR P HB   4  
ATOM 4278  H HG1  . THR A 1 43 ? -5.073  -0.888  8.732   1.00 0.00 ? 41 THR P HG1  4  
ATOM 4279  H HG21 . THR A 1 43 ? -4.226  0.731   11.076  1.00 0.00 ? 41 THR P HG21 4  
ATOM 4280  H HG22 . THR A 1 43 ? -5.264  1.393   9.796   1.00 0.00 ? 41 THR P HG22 4  
ATOM 4281  H HG23 . THR A 1 43 ? -3.696  2.146   10.164  1.00 0.00 ? 41 THR P HG23 4  
ATOM 4282  N N    . GLU A 1 44 ? -2.799  3.140   7.796   1.00 0.00 ? 42 GLU P N    4  
ATOM 4283  C CA   . GLU A 1 44 ? -1.944  4.314   7.543   1.00 0.00 ? 42 GLU P CA   4  
ATOM 4284  C C    . GLU A 1 44 ? -0.539  4.235   8.176   1.00 0.00 ? 42 GLU P C    4  
ATOM 4285  O O    . GLU A 1 44 ? 0.409   4.801   7.630   1.00 0.00 ? 42 GLU P O    4  
ATOM 4286  C CB   . GLU A 1 44 ? -2.651  5.594   8.029   1.00 0.00 ? 42 GLU P CB   4  
ATOM 4287  C CG   . GLU A 1 44 ? -4.024  5.852   7.388   1.00 0.00 ? 42 GLU P CG   4  
ATOM 4288  C CD   . GLU A 1 44 ? -5.186  5.315   8.251   1.00 0.00 ? 42 GLU P CD   4  
ATOM 4289  O OE1  . GLU A 1 44 ? -5.407  4.081   8.270   1.00 0.00 ? 42 GLU P OE1  4  
ATOM 4290  O OE2  . GLU A 1 44 ? -5.879  6.123   8.917   1.00 0.00 ? 42 GLU P OE2  4  
ATOM 4291  H H    . GLU A 1 44 ? -3.754  3.326   8.104   1.00 0.00 ? 42 GLU P H    4  
ATOM 4292  H HA   . GLU A 1 44 ? -1.797  4.403   6.465   1.00 0.00 ? 42 GLU P HA   4  
ATOM 4293  H HB2  . GLU A 1 44 ? -2.754  5.569   9.115   1.00 0.00 ? 42 GLU P HB2  4  
ATOM 4294  H HB3  . GLU A 1 44 ? -2.009  6.440   7.780   1.00 0.00 ? 42 GLU P HB3  4  
ATOM 4295  H HG2  . GLU A 1 44 ? -4.141  6.931   7.260   1.00 0.00 ? 42 GLU P HG2  4  
ATOM 4296  H HG3  . GLU A 1 44 ? -4.054  5.406   6.391   1.00 0.00 ? 42 GLU P HG3  4  
ATOM 4297  N N    . ALA A 1 45 ? -0.377  3.515   9.291   1.00 0.00 ? 43 ALA P N    4  
ATOM 4298  C CA   . ALA A 1 45 ? 0.929   3.236   9.905   1.00 0.00 ? 43 ALA P CA   4  
ATOM 4299  C C    . ALA A 1 45 ? 1.590   1.956   9.354   1.00 0.00 ? 43 ALA P C    4  
ATOM 4300  O O    . ALA A 1 45 ? 2.805   1.925   9.154   1.00 0.00 ? 43 ALA P O    4  
ATOM 4301  C CB   . ALA A 1 45 ? 0.737   3.174   11.426  1.00 0.00 ? 43 ALA P CB   4  
ATOM 4302  H H    . ALA A 1 45 ? -1.206  3.136   9.726   1.00 0.00 ? 43 ALA P H    4  
ATOM 4303  H HA   . ALA A 1 45 ? 1.614   4.062   9.690   1.00 0.00 ? 43 ALA P HA   4  
ATOM 4304  H HB1  . ALA A 1 45 ? 0.318   4.113   11.785  1.00 0.00 ? 43 ALA P HB1  4  
ATOM 4305  H HB2  . ALA A 1 45 ? 0.068   2.354   11.691  1.00 0.00 ? 43 ALA P HB2  4  
ATOM 4306  H HB3  . ALA A 1 45 ? 1.703   3.014   11.909  1.00 0.00 ? 43 ALA P HB3  4  
ATOM 4307  N N    . ARG A 1 46 ? 0.809   0.912   9.042   1.00 0.00 ? 44 ARG P N    4  
ATOM 4308  C CA   . ARG A 1 46 ? 1.318   -0.350  8.467   1.00 0.00 ? 44 ARG P CA   4  
ATOM 4309  C C    . ARG A 1 46 ? 1.876   -0.166  7.054   1.00 0.00 ? 44 ARG P C    4  
ATOM 4310  O O    . ARG A 1 46 ? 2.927   -0.726  6.745   1.00 0.00 ? 44 ARG P O    4  
ATOM 4311  C CB   . ARG A 1 46 ? 0.231   -1.440  8.520   1.00 0.00 ? 44 ARG P CB   4  
ATOM 4312  C CG   . ARG A 1 46 ? 0.247   -2.156  9.881   1.00 0.00 ? 44 ARG P CG   4  
ATOM 4313  C CD   . ARG A 1 46 ? -0.821  -3.253  9.987   1.00 0.00 ? 44 ARG P CD   4  
ATOM 4314  N NE   . ARG A 1 46 ? -2.137  -2.713  10.384  1.00 0.00 ? 44 ARG P NE   4  
ATOM 4315  C CZ   . ARG A 1 46 ? -2.665  -2.687  11.596  1.00 0.00 ? 44 ARG P CZ   4  
ATOM 4316  N NH1  . ARG A 1 46 ? -2.052  -3.154  12.647  1.00 0.00 ? 44 ARG P NH1  4  
ATOM 4317  N NH2  . ARG A 1 46 ? -3.844  -2.172  11.765  1.00 0.00 ? 44 ARG P NH2  4  
ATOM 4318  H H    . ARG A 1 46 ? -0.186  1.013   9.182   1.00 0.00 ? 44 ARG P H    4  
ATOM 4319  H HA   . ARG A 1 46 ? 2.171   -0.686  9.062   1.00 0.00 ? 44 ARG P HA   4  
ATOM 4320  H HB2  . ARG A 1 46 ? -0.751  -1.005  8.328   1.00 0.00 ? 44 ARG P HB2  4  
ATOM 4321  H HB3  . ARG A 1 46 ? 0.428   -2.179  7.743   1.00 0.00 ? 44 ARG P HB3  4  
ATOM 4322  H HG2  . ARG A 1 46 ? 1.224   -2.624  10.006  1.00 0.00 ? 44 ARG P HG2  4  
ATOM 4323  H HG3  . ARG A 1 46 ? 0.111   -1.433  10.686  1.00 0.00 ? 44 ARG P HG3  4  
ATOM 4324  H HD2  . ARG A 1 46 ? -0.909  -3.766  9.028   1.00 0.00 ? 44 ARG P HD2  4  
ATOM 4325  H HD3  . ARG A 1 46 ? -0.487  -3.994  10.716  1.00 0.00 ? 44 ARG P HD3  4  
ATOM 4326  H HE   . ARG A 1 46 ? -2.724  -2.318  9.657   1.00 0.00 ? 44 ARG P HE   4  
ATOM 4327  H HH11 . ARG A 1 46 ? -1.132  -3.548  12.548  1.00 0.00 ? 44 ARG P HH11 4  
ATOM 4328  H HH12 . ARG A 1 46 ? -2.488  -3.116  13.553  1.00 0.00 ? 44 ARG P HH12 4  
ATOM 4329  H HH21 . ARG A 1 46 ? -4.308  -1.766  10.959  1.00 0.00 ? 44 ARG P HH21 4  
ATOM 4330  H HH22 . ARG A 1 46 ? -4.275  -2.143  12.673  1.00 0.00 ? 44 ARG P HH22 4  
ATOM 4331  N N    . VAL A 1 47 ? 1.251   0.679   6.231   1.00 0.00 ? 45 VAL P N    4  
ATOM 4332  C CA   . VAL A 1 47 ? 1.794   1.061   4.914   1.00 0.00 ? 45 VAL P CA   4  
ATOM 4333  C C    . VAL A 1 47 ? 3.102   1.849   5.049   1.00 0.00 ? 45 VAL P C    4  
ATOM 4334  O O    . VAL A 1 47 ? 4.056   1.588   4.318   1.00 0.00 ? 45 VAL P O    4  
ATOM 4335  C CB   . VAL A 1 47 ? 0.743   1.816   4.075   1.00 0.00 ? 45 VAL P CB   4  
ATOM 4336  C CG1  . VAL A 1 47 ? 0.449   3.239   4.571   1.00 0.00 ? 45 VAL P CG1  4  
ATOM 4337  C CG2  . VAL A 1 47 ? 1.176   1.891   2.613   1.00 0.00 ? 45 VAL P CG2  4  
ATOM 4338  H H    . VAL A 1 47 ? 0.368   1.078   6.538   1.00 0.00 ? 45 VAL P H    4  
ATOM 4339  H HA   . VAL A 1 47 ? 2.032   0.141   4.378   1.00 0.00 ? 45 VAL P HA   4  
ATOM 4340  H HB   . VAL A 1 47 ? -0.187  1.248   4.111   1.00 0.00 ? 45 VAL P HB   4  
ATOM 4341  H HG11 . VAL A 1 47 ? 0.147   3.204   5.614   1.00 0.00 ? 45 VAL P HG11 4  
ATOM 4342  H HG12 . VAL A 1 47 ? 1.323   3.881   4.463   1.00 0.00 ? 45 VAL P HG12 4  
ATOM 4343  H HG13 . VAL A 1 47 ? -0.361  3.679   3.994   1.00 0.00 ? 45 VAL P HG13 4  
ATOM 4344  H HG21 . VAL A 1 47 ? 2.086   2.482   2.507   1.00 0.00 ? 45 VAL P HG21 4  
ATOM 4345  H HG22 . VAL A 1 47 ? 1.347   0.886   2.223   1.00 0.00 ? 45 VAL P HG22 4  
ATOM 4346  H HG23 . VAL A 1 47 ? 0.385   2.358   2.034   1.00 0.00 ? 45 VAL P HG23 4  
ATOM 4347  N N    . ARG A 1 48 ? 3.197   2.753   6.035   1.00 0.00 ? 46 ARG P N    4  
ATOM 4348  C CA   . ARG A 1 48 ? 4.415   3.526   6.327   1.00 0.00 ? 46 ARG P CA   4  
ATOM 4349  C C    . ARG A 1 48 ? 5.571   2.622   6.754   1.00 0.00 ? 46 ARG P C    4  
ATOM 4350  O O    . ARG A 1 48 ? 6.674   2.777   6.234   1.00 0.00 ? 46 ARG P O    4  
ATOM 4351  C CB   . ARG A 1 48 ? 4.105   4.603   7.381   1.00 0.00 ? 46 ARG P CB   4  
ATOM 4352  C CG   . ARG A 1 48 ? 3.460   5.845   6.750   1.00 0.00 ? 46 ARG P CG   4  
ATOM 4353  C CD   . ARG A 1 48 ? 3.100   6.855   7.845   1.00 0.00 ? 46 ARG P CD   4  
ATOM 4354  N NE   . ARG A 1 48 ? 2.606   8.127   7.287   1.00 0.00 ? 46 ARG P NE   4  
ATOM 4355  C CZ   . ARG A 1 48 ? 1.360   8.420   6.963   1.00 0.00 ? 46 ARG P CZ   4  
ATOM 4356  N NH1  . ARG A 1 48 ? 0.403   7.548   6.932   1.00 0.00 ? 46 ARG P NH1  4  
ATOM 4357  N NH2  . ARG A 1 48 ? 1.008   9.629   6.654   1.00 0.00 ? 46 ARG P NH2  4  
ATOM 4358  H H    . ARG A 1 48 ? 2.379   2.909   6.610   1.00 0.00 ? 46 ARG P H    4  
ATOM 4359  H HA   . ARG A 1 48 ? 4.753   4.016   5.413   1.00 0.00 ? 46 ARG P HA   4  
ATOM 4360  H HB2  . ARG A 1 48 ? 3.444   4.198   8.145   1.00 0.00 ? 46 ARG P HB2  4  
ATOM 4361  H HB3  . ARG A 1 48 ? 5.027   4.908   7.879   1.00 0.00 ? 46 ARG P HB3  4  
ATOM 4362  H HG2  . ARG A 1 48 ? 4.166   6.303   6.056   1.00 0.00 ? 46 ARG P HG2  4  
ATOM 4363  H HG3  . ARG A 1 48 ? 2.562   5.560   6.203   1.00 0.00 ? 46 ARG P HG3  4  
ATOM 4364  H HD2  . ARG A 1 48 ? 2.353   6.419   8.512   1.00 0.00 ? 46 ARG P HD2  4  
ATOM 4365  H HD3  . ARG A 1 48 ? 3.993   7.059   8.439   1.00 0.00 ? 46 ARG P HD3  4  
ATOM 4366  H HE   . ARG A 1 48 ? 3.279   8.870   7.191   1.00 0.00 ? 46 ARG P HE   4  
ATOM 4367  H HH11 . ARG A 1 48 ? 0.577   6.577   7.161   1.00 0.00 ? 46 ARG P HH11 4  
ATOM 4368  H HH12 . ARG A 1 48 ? -0.520  7.889   6.675   1.00 0.00 ? 46 ARG P HH12 4  
ATOM 4369  H HH21 . ARG A 1 48 ? 1.638   10.402  6.760   1.00 0.00 ? 46 ARG P HH21 4  
ATOM 4370  H HH22 . ARG A 1 48 ? 0.026   9.774   6.417   1.00 0.00 ? 46 ARG P HH22 4  
ATOM 4371  N N    . VAL A 1 49 ? 5.315   1.628   7.611   1.00 0.00 ? 47 VAL P N    4  
ATOM 4372  C CA   . VAL A 1 49 ? 6.307   0.598   7.975   1.00 0.00 ? 47 VAL P CA   4  
ATOM 4373  C C    . VAL A 1 49 ? 6.716   -0.233  6.755   1.00 0.00 ? 47 VAL P C    4  
ATOM 4374  O O    . VAL A 1 49 ? 7.914   -0.419  6.541   1.00 0.00 ? 47 VAL P O    4  
ATOM 4375  C CB   . VAL A 1 49 ? 5.803   -0.300  9.124   1.00 0.00 ? 47 VAL P CB   4  
ATOM 4376  C CG1  . VAL A 1 49 ? 6.739   -1.488  9.404   1.00 0.00 ? 47 VAL P CG1  4  
ATOM 4377  C CG2  . VAL A 1 49 ? 5.700   0.505   10.427  1.00 0.00 ? 47 VAL P CG2  4  
ATOM 4378  H H    . VAL A 1 49 ? 4.391   1.592   8.029   1.00 0.00 ? 47 VAL P H    4  
ATOM 4379  H HA   . VAL A 1 49 ? 7.209   1.100   8.325   1.00 0.00 ? 47 VAL P HA   4  
ATOM 4380  H HB   . VAL A 1 49 ? 4.817   -0.689  8.872   1.00 0.00 ? 47 VAL P HB   4  
ATOM 4381  H HG11 . VAL A 1 49 ? 6.391   -2.037  10.279  1.00 0.00 ? 47 VAL P HG11 4  
ATOM 4382  H HG12 . VAL A 1 49 ? 6.745   -2.178  8.560   1.00 0.00 ? 47 VAL P HG12 4  
ATOM 4383  H HG13 . VAL A 1 49 ? 7.756   -1.136  9.583   1.00 0.00 ? 47 VAL P HG13 4  
ATOM 4384  H HG21 . VAL A 1 49 ? 6.686   0.860   10.727  1.00 0.00 ? 47 VAL P HG21 4  
ATOM 4385  H HG22 . VAL A 1 49 ? 5.044   1.364   10.295  1.00 0.00 ? 47 VAL P HG22 4  
ATOM 4386  H HG23 . VAL A 1 49 ? 5.289   -0.122  11.217  1.00 0.00 ? 47 VAL P HG23 4  
ATOM 4387  N N    . TRP A 1 50 ? 5.774   -0.683  5.916   1.00 0.00 ? 48 TRP P N    4  
ATOM 4388  C CA   . TRP A 1 50 ? 6.099   -1.489  4.735   1.00 0.00 ? 48 TRP P CA   4  
ATOM 4389  C C    . TRP A 1 50 ? 6.979   -0.721  3.739   1.00 0.00 ? 48 TRP P C    4  
ATOM 4390  O O    . TRP A 1 50 ? 8.011   -1.234  3.305   1.00 0.00 ? 48 TRP P O    4  
ATOM 4391  C CB   . TRP A 1 50 ? 4.813   -2.008  4.077   1.00 0.00 ? 48 TRP P CB   4  
ATOM 4392  C CG   . TRP A 1 50 ? 5.037   -3.122  3.100   1.00 0.00 ? 48 TRP P CG   4  
ATOM 4393  C CD1  . TRP A 1 50 ? 4.860   -4.436  3.366   1.00 0.00 ? 48 TRP P CD1  4  
ATOM 4394  C CD2  . TRP A 1 50 ? 5.517   -3.059  1.718   1.00 0.00 ? 48 TRP P CD2  4  
ATOM 4395  N NE1  . TRP A 1 50 ? 5.200   -5.187  2.257   1.00 0.00 ? 48 TRP P NE1  4  
ATOM 4396  C CE2  . TRP A 1 50 ? 5.623   -4.392  1.216   1.00 0.00 ? 48 TRP P CE2  4  
ATOM 4397  C CE3  . TRP A 1 50 ? 5.880   -2.015  0.839   1.00 0.00 ? 48 TRP P CE3  4  
ATOM 4398  C CZ2  . TRP A 1 50 ? 6.075   -4.676  -0.082  1.00 0.00 ? 48 TRP P CZ2  4  
ATOM 4399  C CZ3  . TRP A 1 50 ? 6.343   -2.285  -0.462  1.00 0.00 ? 48 TRP P CZ3  4  
ATOM 4400  C CH2  . TRP A 1 50 ? 6.450   -3.611  -0.919  1.00 0.00 ? 48 TRP P CH2  4  
ATOM 4401  H H    . TRP A 1 50 ? 4.791   -0.523  6.122   1.00 0.00 ? 48 TRP P H    4  
ATOM 4402  H HA   . TRP A 1 50 ? 6.672   -2.358  5.065   1.00 0.00 ? 48 TRP P HA   4  
ATOM 4403  H HB2  . TRP A 1 50 ? 4.143   -2.377  4.856   1.00 0.00 ? 48 TRP P HB2  4  
ATOM 4404  H HB3  . TRP A 1 50 ? 4.305   -1.186  3.569   1.00 0.00 ? 48 TRP P HB3  4  
ATOM 4405  H HD1  . TRP A 1 50 ? 4.514   -4.837  4.314   1.00 0.00 ? 48 TRP P HD1  4  
ATOM 4406  H HE1  . TRP A 1 50 ? 5.154   -6.200  2.240   1.00 0.00 ? 48 TRP P HE1  4  
ATOM 4407  H HE3  . TRP A 1 50 ? 5.798   -0.992  1.169   1.00 0.00 ? 48 TRP P HE3  4  
ATOM 4408  H HZ2  . TRP A 1 50 ? 6.114   -5.697  -0.432  1.00 0.00 ? 48 TRP P HZ2  4  
ATOM 4409  H HZ3  . TRP A 1 50 ? 6.602   -1.463  -1.116  1.00 0.00 ? 48 TRP P HZ3  4  
ATOM 4410  H HH2  . TRP A 1 50 ? 6.800   -3.806  -1.921  1.00 0.00 ? 48 TRP P HH2  4  
ATOM 4411  N N    . PHE A 1 51 ? 6.637   0.536   3.430   1.00 0.00 ? 49 PHE P N    4  
ATOM 4412  C CA   . PHE A 1 51 ? 7.421   1.374   2.516   1.00 0.00 ? 49 PHE P CA   4  
ATOM 4413  C C    . PHE A 1 51 ? 8.773   1.811   3.096   1.00 0.00 ? 49 PHE P C    4  
ATOM 4414  O O    . PHE A 1 51 ? 9.752   1.856   2.351   1.00 0.00 ? 49 PHE P O    4  
ATOM 4415  C CB   . PHE A 1 51 ? 6.579   2.559   2.018   1.00 0.00 ? 49 PHE P CB   4  
ATOM 4416  C CG   . PHE A 1 51 ? 5.759   2.187   0.797   1.00 0.00 ? 49 PHE P CG   4  
ATOM 4417  C CD1  . PHE A 1 51 ? 4.578   1.435   0.934   1.00 0.00 ? 49 PHE P CD1  4  
ATOM 4418  C CD2  . PHE A 1 51 ? 6.233   2.506   -0.490  1.00 0.00 ? 49 PHE P CD2  4  
ATOM 4419  C CE1  . PHE A 1 51 ? 3.889   0.988   -0.203  1.00 0.00 ? 49 PHE P CE1  4  
ATOM 4420  C CE2  . PHE A 1 51 ? 5.532   2.071   -1.628  1.00 0.00 ? 49 PHE P CE2  4  
ATOM 4421  C CZ   . PHE A 1 51 ? 4.367   1.302   -1.485  1.00 0.00 ? 49 PHE P CZ   4  
ATOM 4422  H H    . PHE A 1 51 ? 5.770   0.906   3.803   1.00 0.00 ? 49 PHE P H    4  
ATOM 4423  H HA   . PHE A 1 51 ? 7.664   0.772   1.639   1.00 0.00 ? 49 PHE P HA   4  
ATOM 4424  H HB2  . PHE A 1 51 ? 5.926   2.922   2.813   1.00 0.00 ? 49 PHE P HB2  4  
ATOM 4425  H HB3  . PHE A 1 51 ? 7.246   3.378   1.744   1.00 0.00 ? 49 PHE P HB3  4  
ATOM 4426  H HD1  . PHE A 1 51 ? 4.214   1.165   1.912   1.00 0.00 ? 49 PHE P HD1  4  
ATOM 4427  H HD2  . PHE A 1 51 ? 7.148   3.072   -0.607  1.00 0.00 ? 49 PHE P HD2  4  
ATOM 4428  H HE1  . PHE A 1 51 ? 2.997   0.392   -0.094  1.00 0.00 ? 49 PHE P HE1  4  
ATOM 4429  H HE2  . PHE A 1 51 ? 5.889   2.318   -2.619  1.00 0.00 ? 49 PHE P HE2  4  
ATOM 4430  H HZ   . PHE A 1 51 ? 3.845   0.946   -2.357  1.00 0.00 ? 49 PHE P HZ   4  
ATOM 4431  N N    . LYS A 1 52 ? 8.883   2.050   4.411   1.00 0.00 ? 50 LYS P N    4  
ATOM 4432  C CA   . LYS A 1 52 ? 10.176  2.294   5.081   1.00 0.00 ? 50 LYS P CA   4  
ATOM 4433  C C    . LYS A 1 52 ? 11.087  1.061   5.009   1.00 0.00 ? 50 LYS P C    4  
ATOM 4434  O O    . LYS A 1 52 ? 12.261  1.182   4.656   1.00 0.00 ? 50 LYS P O    4  
ATOM 4435  C CB   . LYS A 1 52 ? 9.916   2.748   6.529   1.00 0.00 ? 50 LYS P CB   4  
ATOM 4436  C CG   . LYS A 1 52 ? 11.205  3.141   7.267   1.00 0.00 ? 50 LYS P CG   4  
ATOM 4437  C CD   . LYS A 1 52 ? 10.896  3.654   8.680   1.00 0.00 ? 50 LYS P CD   4  
ATOM 4438  C CE   . LYS A 1 52 ? 12.195  4.041   9.397   1.00 0.00 ? 50 LYS P CE   4  
ATOM 4439  N NZ   . LYS A 1 52 ? 11.934  4.545   10.771  1.00 0.00 ? 50 LYS P NZ   4  
ATOM 4440  H H    . LYS A 1 52 ? 8.038   2.043   4.977   1.00 0.00 ? 50 LYS P H    4  
ATOM 4441  H HA   . LYS A 1 52 ? 10.694  3.100   4.558   1.00 0.00 ? 50 LYS P HA   4  
ATOM 4442  H HB2  . LYS A 1 52 ? 9.255   3.615   6.508   1.00 0.00 ? 50 LYS P HB2  4  
ATOM 4443  H HB3  . LYS A 1 52 ? 9.416   1.948   7.079   1.00 0.00 ? 50 LYS P HB3  4  
ATOM 4444  H HG2  . LYS A 1 52 ? 11.863  2.273   7.343   1.00 0.00 ? 50 LYS P HG2  4  
ATOM 4445  H HG3  . LYS A 1 52 ? 11.716  3.923   6.704   1.00 0.00 ? 50 LYS P HG3  4  
ATOM 4446  H HD2  . LYS A 1 52 ? 10.243  4.527   8.611   1.00 0.00 ? 50 LYS P HD2  4  
ATOM 4447  H HD3  . LYS A 1 52 ? 10.385  2.871   9.244   1.00 0.00 ? 50 LYS P HD3  4  
ATOM 4448  H HE2  . LYS A 1 52 ? 12.848  3.164   9.439   1.00 0.00 ? 50 LYS P HE2  4  
ATOM 4449  H HE3  . LYS A 1 52 ? 12.706  4.811   8.809   1.00 0.00 ? 50 LYS P HE3  4  
ATOM 4450  H HZ1  . LYS A 1 52 ? 11.479  3.844   11.340  1.00 0.00 ? 50 LYS P HZ1  4  
ATOM 4451  H HZ2  . LYS A 1 52 ? 11.346  5.366   10.758  1.00 0.00 ? 50 LYS P HZ2  4  
ATOM 4452  H HZ3  . LYS A 1 52 ? 12.797  4.797   11.235  1.00 0.00 ? 50 LYS P HZ3  4  
ATOM 4453  N N    . ASN A 1 53 ? 10.536  -0.126  5.268   1.00 0.00 ? 51 ASN P N    4  
ATOM 4454  C CA   . ASN A 1 53 ? 11.247  -1.405  5.184   1.00 0.00 ? 51 ASN P CA   4  
ATOM 4455  C C    . ASN A 1 53 ? 11.711  -1.702  3.742   1.00 0.00 ? 51 ASN P C    4  
ATOM 4456  O O    . ASN A 1 53 ? 12.886  -2.002  3.517   1.00 0.00 ? 51 ASN P O    4  
ATOM 4457  C CB   . ASN A 1 53 ? 10.315  -2.494  5.748   1.00 0.00 ? 51 ASN P CB   4  
ATOM 4458  C CG   . ASN A 1 53 ? 11.025  -3.818  5.962   1.00 0.00 ? 51 ASN P CG   4  
ATOM 4459  O OD1  . ASN A 1 53 ? 11.223  -4.601  5.046   1.00 0.00 ? 51 ASN P OD1  4  
ATOM 4460  N ND2  . ASN A 1 53 ? 11.434  -4.105  7.177   1.00 0.00 ? 51 ASN P ND2  4  
ATOM 4461  H H    . ASN A 1 53 ? 9.567   -0.140  5.566   1.00 0.00 ? 51 ASN P H    4  
ATOM 4462  H HA   . ASN A 1 53 ? 12.139  -1.349  5.811   1.00 0.00 ? 51 ASN P HA   4  
ATOM 4463  H HB2  . ASN A 1 53 ? 9.913   -2.162  6.705   1.00 0.00 ? 51 ASN P HB2  4  
ATOM 4464  H HB3  . ASN A 1 53 ? 9.475   -2.656  5.074   1.00 0.00 ? 51 ASN P HB3  4  
ATOM 4465  H HD21 . ASN A 1 53 ? 11.237  -3.475  7.941   1.00 0.00 ? 51 ASN P HD21 4  
ATOM 4466  H HD22 . ASN A 1 53 ? 11.897  -4.987  7.332   1.00 0.00 ? 51 ASN P HD22 4  
ATOM 4467  N N    . ARG A 1 54 ? 10.822  -1.516  2.755   1.00 0.00 ? 52 ARG P N    4  
ATOM 4468  C CA   . ARG A 1 54 ? 11.120  -1.635  1.317   1.00 0.00 ? 52 ARG P CA   4  
ATOM 4469  C C    . ARG A 1 54 ? 12.217  -0.662  0.882   1.00 0.00 ? 52 ARG P C    4  
ATOM 4470  O O    . ARG A 1 54 ? 13.185  -1.096  0.262   1.00 0.00 ? 52 ARG P O    4  
ATOM 4471  C CB   . ARG A 1 54 ? 9.818   -1.432  0.517   1.00 0.00 ? 52 ARG P CB   4  
ATOM 4472  C CG   . ARG A 1 54 ? 9.989   -1.425  -1.013  1.00 0.00 ? 52 ARG P CG   4  
ATOM 4473  C CD   . ARG A 1 54 ? 10.637  -2.685  -1.601  1.00 0.00 ? 52 ARG P CD   4  
ATOM 4474  N NE   . ARG A 1 54 ? 9.826   -3.892  -1.351  1.00 0.00 ? 52 ARG P NE   4  
ATOM 4475  C CZ   . ARG A 1 54 ? 9.736   -4.955  -2.128  1.00 0.00 ? 52 ARG P CZ   4  
ATOM 4476  N NH1  . ARG A 1 54 ? 10.409  -5.096  -3.230  1.00 0.00 ? 52 ARG P NH1  4  
ATOM 4477  N NH2  . ARG A 1 54 ? 8.944   -5.941  -1.839  1.00 0.00 ? 52 ARG P NH2  4  
ATOM 4478  H H    . ARG A 1 54 ? 9.864   -1.303  3.024   1.00 0.00 ? 52 ARG P H    4  
ATOM 4479  H HA   . ARG A 1 54 ? 11.498  -2.640  1.125   1.00 0.00 ? 52 ARG P HA   4  
ATOM 4480  H HB2  . ARG A 1 54 ? 9.109   -2.213  0.794   1.00 0.00 ? 52 ARG P HB2  4  
ATOM 4481  H HB3  . ARG A 1 54 ? 9.377   -0.475  0.800   1.00 0.00 ? 52 ARG P HB3  4  
ATOM 4482  H HG2  . ARG A 1 54 ? 9.008   -1.294  -1.471  1.00 0.00 ? 52 ARG P HG2  4  
ATOM 4483  H HG3  . ARG A 1 54 ? 10.595  -0.565  -1.295  1.00 0.00 ? 52 ARG P HG3  4  
ATOM 4484  H HD2  . ARG A 1 54 ? 10.744  -2.524  -2.676  1.00 0.00 ? 52 ARG P HD2  4  
ATOM 4485  H HD3  . ARG A 1 54 ? 11.635  -2.819  -1.181  1.00 0.00 ? 52 ARG P HD3  4  
ATOM 4486  H HE   . ARG A 1 54 ? 9.246   -3.893  -0.526  1.00 0.00 ? 52 ARG P HE   4  
ATOM 4487  H HH11 . ARG A 1 54 ? 11.069  -4.397  -3.519  1.00 0.00 ? 52 ARG P HH11 4  
ATOM 4488  H HH12 . ARG A 1 54 ? 10.226  -5.929  -3.785  1.00 0.00 ? 52 ARG P HH12 4  
ATOM 4489  H HH21 . ARG A 1 54 ? 8.408   -5.949  -0.990  1.00 0.00 ? 52 ARG P HH21 4  
ATOM 4490  H HH22 . ARG A 1 54 ? 8.884   -6.700  -2.515  1.00 0.00 ? 52 ARG P HH22 4  
ATOM 4491  N N    . ARG A 1 55 ? 12.111  0.622   1.244   1.00 0.00 ? 53 ARG P N    4  
ATOM 4492  C CA   . ARG A 1 55 ? 13.109  1.659   0.921   1.00 0.00 ? 53 ARG P CA   4  
ATOM 4493  C C    . ARG A 1 55 ? 14.486  1.317   1.488   1.00 0.00 ? 53 ARG P C    4  
ATOM 4494  O O    . ARG A 1 55 ? 15.468  1.408   0.758   1.00 0.00 ? 53 ARG P O    4  
ATOM 4495  C CB   . ARG A 1 55 ? 12.601  3.028   1.409   1.00 0.00 ? 53 ARG P CB   4  
ATOM 4496  C CG   . ARG A 1 55 ? 13.559  4.181   1.066   1.00 0.00 ? 53 ARG P CG   4  
ATOM 4497  C CD   . ARG A 1 55 ? 12.973  5.524   1.521   1.00 0.00 ? 53 ARG P CD   4  
ATOM 4498  N NE   . ARG A 1 55 ? 13.912  6.639   1.279   1.00 0.00 ? 53 ARG P NE   4  
ATOM 4499  C CZ   . ARG A 1 55 ? 14.869  7.073   2.084   1.00 0.00 ? 53 ARG P CZ   4  
ATOM 4500  N NH1  . ARG A 1 55 ? 15.120  6.514   3.235   1.00 0.00 ? 53 ARG P NH1  4  
ATOM 4501  N NH2  . ARG A 1 55 ? 15.605  8.092   1.743   1.00 0.00 ? 53 ARG P NH2  4  
ATOM 4502  H H    . ARG A 1 55 ? 11.269  0.904   1.736   1.00 0.00 ? 53 ARG P H    4  
ATOM 4503  H HA   . ARG A 1 55 ? 13.224  1.705   -0.165  1.00 0.00 ? 53 ARG P HA   4  
ATOM 4504  H HB2  . ARG A 1 55 ? 11.637  3.229   0.937   1.00 0.00 ? 53 ARG P HB2  4  
ATOM 4505  H HB3  . ARG A 1 55 ? 12.456  2.996   2.489   1.00 0.00 ? 53 ARG P HB3  4  
ATOM 4506  H HG2  . ARG A 1 55 ? 14.516  4.026   1.566   1.00 0.00 ? 53 ARG P HG2  4  
ATOM 4507  H HG3  . ARG A 1 55 ? 13.725  4.209   -0.013  1.00 0.00 ? 53 ARG P HG3  4  
ATOM 4508  H HD2  . ARG A 1 55 ? 12.051  5.708   0.966   1.00 0.00 ? 53 ARG P HD2  4  
ATOM 4509  H HD3  . ARG A 1 55 ? 12.714  5.471   2.580   1.00 0.00 ? 53 ARG P HD3  4  
ATOM 4510  H HE   . ARG A 1 55 ? 13.800  7.142   0.413   1.00 0.00 ? 53 ARG P HE   4  
ATOM 4511  H HH11 . ARG A 1 55 ? 14.565  5.734   3.536   1.00 0.00 ? 53 ARG P HH11 4  
ATOM 4512  H HH12 . ARG A 1 55 ? 15.846  6.874   3.831   1.00 0.00 ? 53 ARG P HH12 4  
ATOM 4513  H HH21 . ARG A 1 55 ? 15.439  8.572   0.874   1.00 0.00 ? 53 ARG P HH21 4  
ATOM 4514  H HH22 . ARG A 1 55 ? 16.319  8.432   2.366   1.00 0.00 ? 53 ARG P HH22 4  
ATOM 4515  N N    . ALA A 1 56 ? 14.564  0.861   2.740   1.00 0.00 ? 54 ALA P N    4  
ATOM 4516  C CA   . ALA A 1 56 ? 15.825  0.456   3.368   1.00 0.00 ? 54 ALA P CA   4  
ATOM 4517  C C    . ALA A 1 56 ? 16.486  -0.736  2.645   1.00 0.00 ? 54 ALA P C    4  
ATOM 4518  O O    . ALA A 1 56 ? 17.675  -0.677  2.319   1.00 0.00 ? 54 ALA P O    4  
ATOM 4519  C CB   . ALA A 1 56 ? 15.555  0.154   4.848   1.00 0.00 ? 54 ALA P CB   4  
ATOM 4520  H H    . ALA A 1 56 ? 13.718  0.835   3.297   1.00 0.00 ? 54 ALA P H    4  
ATOM 4521  H HA   . ALA A 1 56 ? 16.522  1.296   3.318   1.00 0.00 ? 54 ALA P HA   4  
ATOM 4522  H HB1  . ALA A 1 56 ? 15.139  1.036   5.336   1.00 0.00 ? 54 ALA P HB1  4  
ATOM 4523  H HB2  . ALA A 1 56 ? 14.853  -0.674  4.946   1.00 0.00 ? 54 ALA P HB2  4  
ATOM 4524  H HB3  . ALA A 1 56 ? 16.490  -0.112  5.343   1.00 0.00 ? 54 ALA P HB3  4  
ATOM 4525  N N    . LYS A 1 57 ? 15.712  -1.784  2.324   1.00 0.00 ? 55 LYS P N    4  
ATOM 4526  C CA   . LYS A 1 57 ? 16.188  -2.979  1.596   1.00 0.00 ? 55 LYS P CA   4  
ATOM 4527  C C    . LYS A 1 57 ? 16.562  -2.690  0.135   1.00 0.00 ? 55 LYS P C    4  
ATOM 4528  O O    . LYS A 1 57 ? 17.465  -3.331  -0.402  1.00 0.00 ? 55 LYS P O    4  
ATOM 4529  C CB   . LYS A 1 57 ? 15.120  -4.085  1.671   1.00 0.00 ? 55 LYS P CB   4  
ATOM 4530  C CG   . LYS A 1 57 ? 14.987  -4.668  3.089   1.00 0.00 ? 55 LYS P CG   4  
ATOM 4531  C CD   . LYS A 1 57 ? 13.838  -5.684  3.206   1.00 0.00 ? 55 LYS P CD   4  
ATOM 4532  C CE   . LYS A 1 57 ? 14.000  -6.947  2.345   1.00 0.00 ? 55 LYS P CE   4  
ATOM 4533  N NZ   . LYS A 1 57 ? 15.126  -7.807  2.798   1.00 0.00 ? 55 LYS P NZ   4  
ATOM 4534  H H    . LYS A 1 57 ? 14.744  -1.767  2.637   1.00 0.00 ? 55 LYS P H    4  
ATOM 4535  H HA   . LYS A 1 57 ? 17.099  -3.345  2.074   1.00 0.00 ? 55 LYS P HA   4  
ATOM 4536  H HB2  . LYS A 1 57 ? 14.158  -3.682  1.346   1.00 0.00 ? 55 LYS P HB2  4  
ATOM 4537  H HB3  . LYS A 1 57 ? 15.402  -4.888  0.989   1.00 0.00 ? 55 LYS P HB3  4  
ATOM 4538  H HG2  . LYS A 1 57 ? 15.927  -5.141  3.375   1.00 0.00 ? 55 LYS P HG2  4  
ATOM 4539  H HG3  . LYS A 1 57 ? 14.794  -3.862  3.796   1.00 0.00 ? 55 LYS P HG3  4  
ATOM 4540  H HD2  . LYS A 1 57 ? 13.733  -5.977  4.251   1.00 0.00 ? 55 LYS P HD2  4  
ATOM 4541  H HD3  . LYS A 1 57 ? 12.912  -5.186  2.912   1.00 0.00 ? 55 LYS P HD3  4  
ATOM 4542  H HE2  . LYS A 1 57 ? 13.066  -7.516  2.399   1.00 0.00 ? 55 LYS P HE2  4  
ATOM 4543  H HE3  . LYS A 1 57 ? 14.141  -6.655  1.299   1.00 0.00 ? 55 LYS P HE3  4  
ATOM 4544  H HZ1  . LYS A 1 57 ? 16.014  -7.329  2.727   1.00 0.00 ? 55 LYS P HZ1  4  
ATOM 4545  H HZ2  . LYS A 1 57 ? 15.189  -8.646  2.238   1.00 0.00 ? 55 LYS P HZ2  4  
ATOM 4546  H HZ3  . LYS A 1 57 ? 15.003  -8.095  3.760   1.00 0.00 ? 55 LYS P HZ3  4  
ATOM 4547  N N    . TRP A 1 58 ? 15.895  -1.725  -0.499  1.00 0.00 ? 56 TRP P N    4  
ATOM 4548  C CA   . TRP A 1 58 ? 16.149  -1.290  -1.878  1.00 0.00 ? 56 TRP P CA   4  
ATOM 4549  C C    . TRP A 1 58 ? 17.377  -0.370  -1.998  1.00 0.00 ? 56 TRP P C    4  
ATOM 4550  O O    . TRP A 1 58 ? 18.221  -0.577  -2.874  1.00 0.00 ? 56 TRP P O    4  
ATOM 4551  C CB   . TRP A 1 58 ? 14.879  -0.607  -2.400  1.00 0.00 ? 56 TRP P CB   4  
ATOM 4552  C CG   . TRP A 1 58 ? 14.982  0.022   -3.754  1.00 0.00 ? 56 TRP P CG   4  
ATOM 4553  C CD1  . TRP A 1 58 ? 15.017  -0.641  -4.932  1.00 0.00 ? 56 TRP P CD1  4  
ATOM 4554  C CD2  . TRP A 1 58 ? 15.057  1.441   -4.091  1.00 0.00 ? 56 TRP P CD2  4  
ATOM 4555  N NE1  . TRP A 1 58 ? 15.098  0.265   -5.972  1.00 0.00 ? 56 TRP P NE1  4  
ATOM 4556  C CE2  . TRP A 1 58 ? 15.118  1.566   -5.511  1.00 0.00 ? 56 TRP P CE2  4  
ATOM 4557  C CE3  . TRP A 1 58 ? 15.067  2.637   -3.338  1.00 0.00 ? 56 TRP P CE3  4  
ATOM 4558  C CZ2  . TRP A 1 58 ? 15.182  2.811   -6.155  1.00 0.00 ? 56 TRP P CZ2  4  
ATOM 4559  C CZ3  . TRP A 1 58 ? 15.128  3.892   -3.975  1.00 0.00 ? 56 TRP P CZ3  4  
ATOM 4560  C CH2  . TRP A 1 58 ? 15.186  3.982   -5.378  1.00 0.00 ? 56 TRP P CH2  4  
ATOM 4561  H H    . TRP A 1 58 ? 15.104  -1.316  -0.015  1.00 0.00 ? 56 TRP P H    4  
ATOM 4562  H HA   . TRP A 1 58 ? 16.340  -2.165  -2.502  1.00 0.00 ? 56 TRP P HA   4  
ATOM 4563  H HB2  . TRP A 1 58 ? 14.072  -1.340  -2.424  1.00 0.00 ? 56 TRP P HB2  4  
ATOM 4564  H HB3  . TRP A 1 58 ? 14.588  0.175   -1.698  1.00 0.00 ? 56 TRP P HB3  4  
ATOM 4565  H HD1  . TRP A 1 58 ? 14.981  -1.721  -5.037  1.00 0.00 ? 56 TRP P HD1  4  
ATOM 4566  H HE1  . TRP A 1 58 ? 15.135  -0.009  -6.948  1.00 0.00 ? 56 TRP P HE1  4  
ATOM 4567  H HE3  . TRP A 1 58 ? 15.024  2.583   -2.258  1.00 0.00 ? 56 TRP P HE3  4  
ATOM 4568  H HZ2  . TRP A 1 58 ? 15.230  2.864   -7.233  1.00 0.00 ? 56 TRP P HZ2  4  
ATOM 4569  H HZ3  . TRP A 1 58 ? 15.132  4.797   -3.380  1.00 0.00 ? 56 TRP P HZ3  4  
ATOM 4570  H HH2  . TRP A 1 58 ? 15.239  4.953   -5.854  1.00 0.00 ? 56 TRP P HH2  4  
ATOM 4571  N N    . ARG A 1 59 ? 17.504  0.626   -1.108  1.00 0.00 ? 57 ARG P N    4  
ATOM 4572  C CA   . ARG A 1 59 ? 18.579  1.636   -1.129  1.00 0.00 ? 57 ARG P CA   4  
ATOM 4573  C C    . ARG A 1 59 ? 19.915  1.114   -0.581  1.00 0.00 ? 57 ARG P C    4  
ATOM 4574  O O    . ARG A 1 59 ? 20.953  1.393   -1.184  1.00 0.00 ? 57 ARG P O    4  
ATOM 4575  C CB   . ARG A 1 59 ? 18.090  2.903   -0.401  1.00 0.00 ? 57 ARG P CB   4  
ATOM 4576  C CG   . ARG A 1 59 ? 19.167  3.996   -0.342  1.00 0.00 ? 57 ARG P CG   4  
ATOM 4577  C CD   . ARG A 1 59 ? 18.598  5.361   0.081   1.00 0.00 ? 57 ARG P CD   4  
ATOM 4578  N NE   . ARG A 1 59 ? 19.649  6.258   0.612   1.00 0.00 ? 57 ARG P NE   4  
ATOM 4579  C CZ   . ARG A 1 59 ? 20.764  6.646   0.014   1.00 0.00 ? 57 ARG P CZ   4  
ATOM 4580  N NH1  . ARG A 1 59 ? 20.996  6.433   -1.249  1.00 0.00 ? 57 ARG P NH1  4  
ATOM 4581  N NH2  . ARG A 1 59 ? 21.693  7.249   0.696   1.00 0.00 ? 57 ARG P NH2  4  
ATOM 4582  H H    . ARG A 1 59 ? 16.755  0.744   -0.432  1.00 0.00 ? 57 ARG P H    4  
ATOM 4583  H HA   . ARG A 1 59 ? 18.770  1.908   -2.169  1.00 0.00 ? 57 ARG P HA   4  
ATOM 4584  H HB2  . ARG A 1 59 ? 17.215  3.290   -0.926  1.00 0.00 ? 57 ARG P HB2  4  
ATOM 4585  H HB3  . ARG A 1 59 ? 17.800  2.652   0.621   1.00 0.00 ? 57 ARG P HB3  4  
ATOM 4586  H HG2  . ARG A 1 59 ? 19.929  3.693   0.377   1.00 0.00 ? 57 ARG P HG2  4  
ATOM 4587  H HG3  . ARG A 1 59 ? 19.628  4.091   -1.325  1.00 0.00 ? 57 ARG P HG3  4  
ATOM 4588  H HD2  . ARG A 1 59 ? 18.093  5.827   -0.767  1.00 0.00 ? 57 ARG P HD2  4  
ATOM 4589  H HD3  . ARG A 1 59 ? 17.857  5.201   0.866   1.00 0.00 ? 57 ARG P HD3  4  
ATOM 4590  H HE   . ARG A 1 59 ? 19.561  6.520   1.582   1.00 0.00 ? 57 ARG P HE   4  
ATOM 4591  H HH11 . ARG A 1 59 ? 20.288  6.001   -1.813  1.00 0.00 ? 57 ARG P HH11 4  
ATOM 4592  H HH12 . ARG A 1 59 ? 21.917  6.617   -1.642  1.00 0.00 ? 57 ARG P HH12 4  
ATOM 4593  H HH21 . ARG A 1 59 ? 21.573  7.430   1.677   1.00 0.00 ? 57 ARG P HH21 4  
ATOM 4594  H HH22 . ARG A 1 59 ? 22.608  7.393   0.268   1.00 0.00 ? 57 ARG P HH22 4  
ATOM 4595  N N    . LYS A 1 60 ? 19.880  0.335   0.511   1.00 0.00 ? 58 LYS P N    4  
ATOM 4596  C CA   . LYS A 1 60 ? 21.046  -0.249  1.219   1.00 0.00 ? 58 LYS P CA   4  
ATOM 4597  C C    . LYS A 1 60 ? 22.089  0.789   1.693   1.00 0.00 ? 58 LYS P C    4  
ATOM 4598  O O    . LYS A 1 60 ? 21.899  2.002   1.570   1.00 0.00 ? 58 LYS P O    4  
ATOM 4599  C CB   . LYS A 1 60 ? 21.682  -1.366  0.357   1.00 0.00 ? 58 LYS P CB   4  
ATOM 4600  C CG   . LYS A 1 60 ? 20.676  -2.450  -0.075  1.00 0.00 ? 58 LYS P CG   4  
ATOM 4601  C CD   . LYS A 1 60 ? 21.310  -3.574  -0.908  1.00 0.00 ? 58 LYS P CD   4  
ATOM 4602  C CE   . LYS A 1 60 ? 22.305  -4.420  -0.100  1.00 0.00 ? 58 LYS P CE   4  
ATOM 4603  N NZ   . LYS A 1 60 ? 22.850  -5.542  -0.909  1.00 0.00 ? 58 LYS P NZ   4  
ATOM 4604  H H    . LYS A 1 60 ? 18.966  0.157   0.910   1.00 0.00 ? 58 LYS P H    4  
ATOM 4605  H HA   . LYS A 1 60 ? 20.671  -0.720  2.129   1.00 0.00 ? 58 LYS P HA   4  
ATOM 4606  H HB2  . LYS A 1 60 ? 22.141  -0.921  -0.527  1.00 0.00 ? 58 LYS P HB2  4  
ATOM 4607  H HB3  . LYS A 1 60 ? 22.477  -1.841  0.933   1.00 0.00 ? 58 LYS P HB3  4  
ATOM 4608  H HG2  . LYS A 1 60 ? 20.208  -2.882  0.811   1.00 0.00 ? 58 LYS P HG2  4  
ATOM 4609  H HG3  . LYS A 1 60 ? 19.898  -1.992  -0.685  1.00 0.00 ? 58 LYS P HG3  4  
ATOM 4610  H HD2  . LYS A 1 60 ? 20.507  -4.221  -1.269  1.00 0.00 ? 58 LYS P HD2  4  
ATOM 4611  H HD3  . LYS A 1 60 ? 21.813  -3.138  -1.773  1.00 0.00 ? 58 LYS P HD3  4  
ATOM 4612  H HE2  . LYS A 1 60 ? 23.124  -3.778  0.239   1.00 0.00 ? 58 LYS P HE2  4  
ATOM 4613  H HE3  . LYS A 1 60 ? 21.795  -4.811  0.785   1.00 0.00 ? 58 LYS P HE3  4  
ATOM 4614  H HZ1  . LYS A 1 60 ? 22.115  -6.162  -1.221  1.00 0.00 ? 58 LYS P HZ1  4  
ATOM 4615  H HZ2  . LYS A 1 60 ? 23.504  -6.094  -0.370  1.00 0.00 ? 58 LYS P HZ2  4  
ATOM 4616  H HZ3  . LYS A 1 60 ? 23.340  -5.204  -1.726  1.00 0.00 ? 58 LYS P HZ3  4  
ATOM 4617  N N    . ARG A 1 61 ? 23.198  0.300   2.261   1.00 0.00 ? 59 ARG P N    4  
ATOM 4618  C CA   . ARG A 1 61 ? 24.405  1.080   2.592   1.00 0.00 ? 59 ARG P CA   4  
ATOM 4619  C C    . ARG A 1 61 ? 25.159  1.504   1.320   1.00 0.00 ? 59 ARG P C    4  
ATOM 4620  O O    . ARG A 1 61 ? 25.274  0.733   0.367   1.00 0.00 ? 59 ARG P O    4  
ATOM 4621  C CB   . ARG A 1 61 ? 25.283  0.247   3.548   1.00 0.00 ? 59 ARG P CB   4  
ATOM 4622  C CG   . ARG A 1 61 ? 26.601  0.933   3.938   1.00 0.00 ? 59 ARG P CG   4  
ATOM 4623  C CD   . ARG A 1 61 ? 27.386  0.092   4.954   1.00 0.00 ? 59 ARG P CD   4  
ATOM 4624  N NE   . ARG A 1 61 ? 28.745  0.631   5.160   1.00 0.00 ? 59 ARG P NE   4  
ATOM 4625  C CZ   . ARG A 1 61 ? 29.809  0.395   4.410   1.00 0.00 ? 59 ARG P CZ   4  
ATOM 4626  N NH1  . ARG A 1 61 ? 29.796  -0.396  3.379   1.00 0.00 ? 59 ARG P NH1  4  
ATOM 4627  N NH2  . ARG A 1 61 ? 30.955  0.952   4.658   1.00 0.00 ? 59 ARG P NH2  4  
ATOM 4628  H H    . ARG A 1 61 ? 23.253  -0.704  2.355   1.00 0.00 ? 59 ARG P H    4  
ATOM 4629  H HA   . ARG A 1 61 ? 24.099  1.989   3.113   1.00 0.00 ? 59 ARG P HA   4  
ATOM 4630  H HB2  . ARG A 1 61 ? 24.712  0.045   4.457   1.00 0.00 ? 59 ARG P HB2  4  
ATOM 4631  H HB3  . ARG A 1 61 ? 25.518  -0.709  3.075   1.00 0.00 ? 59 ARG P HB3  4  
ATOM 4632  H HG2  . ARG A 1 61 ? 27.216  1.063   3.047   1.00 0.00 ? 59 ARG P HG2  4  
ATOM 4633  H HG3  . ARG A 1 61 ? 26.394  1.914   4.371   1.00 0.00 ? 59 ARG P HG3  4  
ATOM 4634  H HD2  . ARG A 1 61 ? 26.847  0.093   5.904   1.00 0.00 ? 59 ARG P HD2  4  
ATOM 4635  H HD3  . ARG A 1 61 ? 27.442  -0.942  4.608   1.00 0.00 ? 59 ARG P HD3  4  
ATOM 4636  H HE   . ARG A 1 61 ? 28.877  1.255   5.941   1.00 0.00 ? 59 ARG P HE   4  
ATOM 4637  H HH11 . ARG A 1 61 ? 28.960  -0.883  3.116   1.00 0.00 ? 59 ARG P HH11 4  
ATOM 4638  H HH12 . ARG A 1 61 ? 30.668  -0.502  2.863   1.00 0.00 ? 59 ARG P HH12 4  
ATOM 4639  H HH21 . ARG A 1 61 ? 31.076  1.583   5.432   1.00 0.00 ? 59 ARG P HH21 4  
ATOM 4640  H HH22 . ARG A 1 61 ? 31.721  0.734   4.024   1.00 0.00 ? 59 ARG P HH22 4  
ATOM 4641  N N    . GLU A 1 62 ? 25.712  2.714   1.341   1.00 0.00 ? 60 GLU P N    4  
ATOM 4642  C CA   . GLU A 1 62 ? 26.584  3.284   0.297   1.00 0.00 ? 60 GLU P CA   4  
ATOM 4643  C C    . GLU A 1 62 ? 28.052  3.372   0.761   1.00 0.00 ? 60 GLU P C    4  
ATOM 4644  O O    . GLU A 1 62 ? 28.329  3.580   1.945   1.00 0.00 ? 60 GLU P O    4  
ATOM 4645  C CB   . GLU A 1 62 ? 26.083  4.682   -0.111  1.00 0.00 ? 60 GLU P CB   4  
ATOM 4646  C CG   . GLU A 1 62 ? 24.689  4.659   -0.754  1.00 0.00 ? 60 GLU P CG   4  
ATOM 4647  C CD   . GLU A 1 62 ? 24.201  6.069   -1.137  1.00 0.00 ? 60 GLU P CD   4  
ATOM 4648  O OE1  . GLU A 1 62 ? 24.271  7.007   -0.307  1.00 0.00 ? 60 GLU P OE1  4  
ATOM 4649  O OE2  . GLU A 1 62 ? 23.625  6.243   -2.237  1.00 0.00 ? 60 GLU P OE2  4  
ATOM 4650  H H    . GLU A 1 62 ? 25.561  3.266   2.169   1.00 0.00 ? 60 GLU P H    4  
ATOM 4651  H HA   . GLU A 1 62 ? 26.556  2.649   -0.589  1.00 0.00 ? 60 GLU P HA   4  
ATOM 4652  H HB2  . GLU A 1 62 ? 26.066  5.319   0.774   1.00 0.00 ? 60 GLU P HB2  4  
ATOM 4653  H HB3  . GLU A 1 62 ? 26.783  5.111   -0.829  1.00 0.00 ? 60 GLU P HB3  4  
ATOM 4654  H HG2  . GLU A 1 62 ? 24.727  4.023   -1.642  1.00 0.00 ? 60 GLU P HG2  4  
ATOM 4655  H HG3  . GLU A 1 62 ? 23.971  4.221   -0.057  1.00 0.00 ? 60 GLU P HG3  4  
ATOM 4656  N N    . GLU A 1 63 ? 28.999  3.254   -0.178  1.00 0.00 ? 61 GLU P N    4  
ATOM 4657  C CA   . GLU A 1 63 ? 30.452  3.374   0.076   1.00 0.00 ? 61 GLU P CA   4  
ATOM 4658  C C    . GLU A 1 63 ? 31.194  4.218   -0.994  1.00 0.00 ? 61 GLU P C    4  
ATOM 4659  O O    . GLU A 1 63 ? 32.415  4.383   -0.936  1.00 0.00 ? 61 GLU P O    4  
ATOM 4660  C CB   . GLU A 1 63 ? 31.033  1.952   0.235   1.00 0.00 ? 61 GLU P CB   4  
ATOM 4661  C CG   . GLU A 1 63 ? 32.389  1.902   0.958   1.00 0.00 ? 61 GLU P CG   4  
ATOM 4662  C CD   . GLU A 1 63 ? 32.766  0.456   1.321   1.00 0.00 ? 61 GLU P CD   4  
ATOM 4663  O OE1  . GLU A 1 63 ? 32.378  -0.003  2.425   1.00 0.00 ? 61 GLU P OE1  4  
ATOM 4664  O OE2  . GLU A 1 63 ? 33.441  -0.231  0.517   1.00 0.00 ? 61 GLU P OE2  4  
ATOM 4665  H H    . GLU A 1 63 ? 28.709  3.008   -1.114  1.00 0.00 ? 61 GLU P H    4  
ATOM 4666  H HA   . GLU A 1 63 ? 30.595  3.899   1.022   1.00 0.00 ? 61 GLU P HA   4  
ATOM 4667  H HB2  . GLU A 1 63 ? 30.330  1.362   0.824   1.00 0.00 ? 61 GLU P HB2  4  
ATOM 4668  H HB3  . GLU A 1 63 ? 31.123  1.484   -0.746  1.00 0.00 ? 61 GLU P HB3  4  
ATOM 4669  H HG2  . GLU A 1 63 ? 33.167  2.330   0.325   1.00 0.00 ? 61 GLU P HG2  4  
ATOM 4670  H HG3  . GLU A 1 63 ? 32.329  2.502   1.869   1.00 0.00 ? 61 GLU P HG3  4  
ATOM 4671  N N    . PHE A 1 64 ? 30.474  4.779   -1.974  1.00 0.00 ? 62 PHE P N    4  
ATOM 4672  C CA   . PHE A 1 64 ? 31.047  5.577   -3.067  1.00 0.00 ? 62 PHE P CA   4  
ATOM 4673  C C    . PHE A 1 64 ? 31.507  6.976   -2.606  1.00 0.00 ? 62 PHE P C    4  
ATOM 4674  O O    . PHE A 1 64 ? 30.924  7.574   -1.697  1.00 0.00 ? 62 PHE P O    4  
ATOM 4675  C CB   . PHE A 1 64 ? 30.036  5.645   -4.225  1.00 0.00 ? 62 PHE P CB   4  
ATOM 4676  C CG   . PHE A 1 64 ? 30.510  6.390   -5.464  1.00 0.00 ? 62 PHE P CG   4  
ATOM 4677  C CD1  . PHE A 1 64 ? 31.715  6.026   -6.098  1.00 0.00 ? 62 PHE P CD1  4  
ATOM 4678  C CD2  . PHE A 1 64 ? 29.738  7.444   -5.995  1.00 0.00 ? 62 PHE P CD2  4  
ATOM 4679  C CE1  . PHE A 1 64 ? 32.160  6.732   -7.230  1.00 0.00 ? 62 PHE P CE1  4  
ATOM 4680  C CE2  . PHE A 1 64 ? 30.176  8.135   -7.139  1.00 0.00 ? 62 PHE P CE2  4  
ATOM 4681  C CZ   . PHE A 1 64 ? 31.394  7.788   -7.750  1.00 0.00 ? 62 PHE P CZ   4  
ATOM 4682  H H    . PHE A 1 64 ? 29.471  4.681   -1.942  1.00 0.00 ? 62 PHE P H    4  
ATOM 4683  H HA   . PHE A 1 64 ? 31.930  5.050   -3.431  1.00 0.00 ? 62 PHE P HA   4  
ATOM 4684  H HB2  . PHE A 1 64 ? 29.782  4.627   -4.526  1.00 0.00 ? 62 PHE P HB2  4  
ATOM 4685  H HB3  . PHE A 1 64 ? 29.121  6.115   -3.856  1.00 0.00 ? 62 PHE P HB3  4  
ATOM 4686  H HD1  . PHE A 1 64 ? 32.303  5.199   -5.722  1.00 0.00 ? 62 PHE P HD1  4  
ATOM 4687  H HD2  . PHE A 1 64 ? 28.801  7.719   -5.530  1.00 0.00 ? 62 PHE P HD2  4  
ATOM 4688  H HE1  . PHE A 1 64 ? 33.090  6.454   -7.710  1.00 0.00 ? 62 PHE P HE1  4  
ATOM 4689  H HE2  . PHE A 1 64 ? 29.573  8.932   -7.555  1.00 0.00 ? 62 PHE P HE2  4  
ATOM 4690  H HZ   . PHE A 1 64 ? 31.732  8.322   -8.628  1.00 0.00 ? 62 PHE P HZ   4  
ATOM 4691  N N    . ILE A 1 65 ? 32.546  7.512   -3.257  1.00 0.00 ? 63 ILE P N    4  
ATOM 4692  C CA   . ILE A 1 65 ? 33.183  8.802   -2.924  1.00 0.00 ? 63 ILE P CA   4  
ATOM 4693  C C    . ILE A 1 65 ? 32.397  10.035  -3.422  1.00 0.00 ? 63 ILE P C    4  
ATOM 4694  O O    . ILE A 1 65 ? 32.652  11.152  -2.971  1.00 0.00 ? 63 ILE P O    4  
ATOM 4695  C CB   . ILE A 1 65 ? 34.652  8.776   -3.422  1.00 0.00 ? 63 ILE P CB   4  
ATOM 4696  C CG1  . ILE A 1 65 ? 35.556  9.902   -2.872  1.00 0.00 ? 63 ILE P CG1  4  
ATOM 4697  C CG2  . ILE A 1 65 ? 34.734  8.792   -4.958  1.00 0.00 ? 63 ILE P CG2  4  
ATOM 4698  C CD1  . ILE A 1 65 ? 35.634  9.952   -1.341  1.00 0.00 ? 63 ILE P CD1  4  
ATOM 4699  H H    . ILE A 1 65 ? 32.965  6.969   -3.998  1.00 0.00 ? 63 ILE P H    4  
ATOM 4700  H HA   . ILE A 1 65 ? 33.203  8.870   -1.837  1.00 0.00 ? 63 ILE P HA   4  
ATOM 4701  H HB   . ILE A 1 65 ? 35.090  7.834   -3.085  1.00 0.00 ? 63 ILE P HB   4  
ATOM 4702  H HG12 . ILE A 1 65 ? 36.567  9.742   -3.248  1.00 0.00 ? 63 ILE P HG12 4  
ATOM 4703  H HG13 . ILE A 1 65 ? 35.220  10.870  -3.242  1.00 0.00 ? 63 ILE P HG13 4  
ATOM 4704  H HG21 . ILE A 1 65 ? 34.366  9.741   -5.351  1.00 0.00 ? 63 ILE P HG21 4  
ATOM 4705  H HG22 . ILE A 1 65 ? 35.771  8.667   -5.274  1.00 0.00 ? 63 ILE P HG22 4  
ATOM 4706  H HG23 . ILE A 1 65 ? 34.150  7.980   -5.389  1.00 0.00 ? 63 ILE P HG23 4  
ATOM 4707  H HD11 . ILE A 1 65 ? 36.386  10.684  -1.044  1.00 0.00 ? 63 ILE P HD11 4  
ATOM 4708  H HD12 . ILE A 1 65 ? 34.675  10.252  -0.919  1.00 0.00 ? 63 ILE P HD12 4  
ATOM 4709  H HD13 . ILE A 1 65 ? 35.917  8.975   -0.950  1.00 0.00 ? 63 ILE P HD13 4  
ATOM 4710  N N    . VAL A 1 66 ? 31.418  9.839   -4.317  1.00 0.00 ? 64 VAL P N    4  
ATOM 4711  C CA   . VAL A 1 66 ? 30.590  10.893  -4.943  1.00 0.00 ? 64 VAL P CA   4  
ATOM 4712  C C    . VAL A 1 66 ? 31.457  11.923  -5.692  1.00 0.00 ? 64 VAL P C    4  
ATOM 4713  O O    . VAL A 1 66 ? 31.536  13.101  -5.336  1.00 0.00 ? 64 VAL P O    4  
ATOM 4714  C CB   . VAL A 1 66 ? 29.566  11.512  -3.959  1.00 0.00 ? 64 VAL P CB   4  
ATOM 4715  C CG1  . VAL A 1 66 ? 28.491  12.313  -4.710  1.00 0.00 ? 64 VAL P CG1  4  
ATOM 4716  C CG2  . VAL A 1 66 ? 28.819  10.438  -3.149  1.00 0.00 ? 64 VAL P CG2  4  
ATOM 4717  H H    . VAL A 1 66 ? 31.262  8.888   -4.620  1.00 0.00 ? 64 VAL P H    4  
ATOM 4718  H HA   . VAL A 1 66 ? 29.996  10.403  -5.710  1.00 0.00 ? 64 VAL P HA   4  
ATOM 4719  H HB   . VAL A 1 66 ? 30.074  12.173  -3.258  1.00 0.00 ? 64 VAL P HB   4  
ATOM 4720  H HG11 . VAL A 1 66 ? 27.786  12.743  -3.998  1.00 0.00 ? 64 VAL P HG11 4  
ATOM 4721  H HG12 . VAL A 1 66 ? 28.943  13.128  -5.272  1.00 0.00 ? 64 VAL P HG12 4  
ATOM 4722  H HG13 . VAL A 1 66 ? 27.949  11.664  -5.399  1.00 0.00 ? 64 VAL P HG13 4  
ATOM 4723  H HG21 . VAL A 1 66 ? 28.060  10.908  -2.521  1.00 0.00 ? 64 VAL P HG21 4  
ATOM 4724  H HG22 . VAL A 1 66 ? 28.340  9.725   -3.819  1.00 0.00 ? 64 VAL P HG22 4  
ATOM 4725  H HG23 . VAL A 1 66 ? 29.511  9.910   -2.494  1.00 0.00 ? 64 VAL P HG23 4  
ATOM 4726  N N    . THR A 1 67 ? 32.150  11.448  -6.731  1.00 0.00 ? 65 THR P N    4  
ATOM 4727  C CA   . THR A 1 67 ? 33.044  12.243  -7.594  1.00 0.00 ? 65 THR P CA   4  
ATOM 4728  C C    . THR A 1 67 ? 32.306  13.406  -8.279  1.00 0.00 ? 65 THR P C    4  
ATOM 4729  O O    . THR A 1 67 ? 31.180  13.241  -8.758  1.00 0.00 ? 65 THR P O    4  
ATOM 4730  C CB   . THR A 1 67 ? 33.691  11.351  -8.671  1.00 0.00 ? 65 THR P CB   4  
ATOM 4731  O OG1  . THR A 1 67 ? 34.147  10.138  -8.101  1.00 0.00 ? 65 THR P OG1  4  
ATOM 4732  C CG2  . THR A 1 67 ? 34.902  12.005  -9.336  1.00 0.00 ? 65 THR P CG2  4  
ATOM 4733  H H    . THR A 1 67 ? 32.095  10.458  -6.927  1.00 0.00 ? 65 THR P H    4  
ATOM 4734  H HA   . THR A 1 67 ? 33.839  12.653  -6.972  1.00 0.00 ? 65 THR P HA   4  
ATOM 4735  H HB   . THR A 1 67 ? 32.948  11.114  -9.435  1.00 0.00 ? 65 THR P HB   4  
ATOM 4736  H HG1  . THR A 1 67 ? 34.508  9.593   -8.822  1.00 0.00 ? 65 THR P HG1  4  
ATOM 4737  H HG21 . THR A 1 67 ? 35.351  11.314  -10.050 1.00 0.00 ? 65 THR P HG21 4  
ATOM 4738  H HG22 . THR A 1 67 ? 35.643  12.275  -8.583  1.00 0.00 ? 65 THR P HG22 4  
ATOM 4739  H HG23 . THR A 1 67 ? 34.595  12.898  -9.878  1.00 0.00 ? 65 THR P HG23 4  
ATOM 4740  N N    . ASP A 1 68 ? 32.944  14.582  -8.347  1.00 0.00 ? 66 ASP P N    4  
ATOM 4741  C CA   . ASP A 1 68 ? 32.413  15.802  -8.987  1.00 0.00 ? 66 ASP P CA   4  
ATOM 4742  C C    . ASP A 1 68 ? 32.385  15.737  -10.532 1.00 0.00 ? 66 ASP P C    4  
ATOM 4743  O O    . ASP A 1 68 ? 33.406  15.349  -11.147 1.00 0.00 ? 66 ASP P O    4  
ATOM 4744  C CB   . ASP A 1 68 ? 33.209  17.024  -8.490  1.00 0.00 ? 66 ASP P CB   4  
ATOM 4745  C CG   . ASP A 1 68 ? 32.684  18.363  -9.058  1.00 0.00 ? 66 ASP P CG   4  
ATOM 4746  O OD1  . ASP A 1 68 ? 31.610  18.835  -8.607  1.00 0.00 ? 66 ASP P OD1  4  
ATOM 4747  O OD2  . ASP A 1 68 ? 33.361  18.968  -9.927  1.00 0.00 ? 66 ASP P OD2  4  
ATOM 4748  O OXT  . ASP A 1 68 ? 31.335  16.078  -11.122 1.00 0.00 ? 66 ASP P OXT  4  
ATOM 4749  H H    . ASP A 1 68 ? 33.869  14.636  -7.947  1.00 0.00 ? 66 ASP P H    4  
ATOM 4750  H HA   . ASP A 1 68 ? 31.380  15.936  -8.658  1.00 0.00 ? 66 ASP P HA   4  
ATOM 4751  H HB2  . ASP A 1 68 ? 33.157  17.057  -7.399  1.00 0.00 ? 66 ASP P HB2  4  
ATOM 4752  H HB3  . ASP A 1 68 ? 34.260  16.896  -8.762  1.00 0.00 ? 66 ASP P HB3  4  
ATOM 4753  N N    . GLY A 1 1  ? -14.957 -27.915 15.598  1.00 0.00 ? -1 GLY P N    5  
ATOM 4754  C CA   . GLY A 1 1  ? -13.854 -27.653 16.549  1.00 0.00 ? -1 GLY P CA   5  
ATOM 4755  C C    . GLY A 1 1  ? -13.259 -26.263 16.368  1.00 0.00 ? -1 GLY P C    5  
ATOM 4756  O O    . GLY A 1 1  ? -13.609 -25.540 15.432  1.00 0.00 ? -1 GLY P O    5  
ATOM 4757  H H1   . GLY A 1 1  ? -15.698 -27.245 15.732  1.00 0.00 ? -1 GLY P H1   5  
ATOM 4758  H H2   . GLY A 1 1  ? -15.328 -28.842 15.740  1.00 0.00 ? -1 GLY P H2   5  
ATOM 4759  H H3   . GLY A 1 1  ? -14.624 -27.840 14.650  1.00 0.00 ? -1 GLY P H3   5  
ATOM 4760  H HA2  . GLY A 1 1  ? -14.227 -27.740 17.570  1.00 0.00 ? -1 GLY P HA2  5  
ATOM 4761  H HA3  . GLY A 1 1  ? -13.064 -28.389 16.400  1.00 0.00 ? -1 GLY P HA3  5  
ATOM 4762  N N    . SER A 1 2  ? -12.350 -25.874 17.266  1.00 0.00 ? 0  SER P N    5  
ATOM 4763  C CA   . SER A 1 2  ? -11.690 -24.554 17.272  1.00 0.00 ? 0  SER P CA   5  
ATOM 4764  C C    . SER A 1 2  ? -10.756 -24.336 16.070  1.00 0.00 ? 0  SER P C    5  
ATOM 4765  O O    . SER A 1 2  ? -10.164 -25.284 15.545  1.00 0.00 ? 0  SER P O    5  
ATOM 4766  C CB   . SER A 1 2  ? -10.899 -24.360 18.574  1.00 0.00 ? 0  SER P CB   5  
ATOM 4767  O OG   . SER A 1 2  ? -11.748 -24.520 19.701  1.00 0.00 ? 0  SER P OG   5  
ATOM 4768  H H    . SER A 1 2  ? -12.121 -26.503 18.024  1.00 0.00 ? 0  SER P H    5  
ATOM 4769  H HA   . SER A 1 2  ? -12.463 -23.784 17.239  1.00 0.00 ? 0  SER P HA   5  
ATOM 4770  H HB2  . SER A 1 2  ? -10.091 -25.092 18.619  1.00 0.00 ? 0  SER P HB2  5  
ATOM 4771  H HB3  . SER A 1 2  ? -10.465 -23.358 18.587  1.00 0.00 ? 0  SER P HB3  5  
ATOM 4772  H HG   . SER A 1 2  ? -11.217 -24.374 20.510  1.00 0.00 ? 0  SER P HG   5  
ATOM 4773  N N    . GLN A 1 3  ? -10.598 -23.075 15.654  1.00 0.00 ? 1  GLN P N    5  
ATOM 4774  C CA   . GLN A 1 3  ? -9.736  -22.636 14.543  1.00 0.00 ? 1  GLN P CA   5  
ATOM 4775  C C    . GLN A 1 3  ? -8.905  -21.397 14.933  1.00 0.00 ? 1  GLN P C    5  
ATOM 4776  O O    . GLN A 1 3  ? -9.268  -20.661 15.857  1.00 0.00 ? 1  GLN P O    5  
ATOM 4777  C CB   . GLN A 1 3  ? -10.590 -22.344 13.293  1.00 0.00 ? 1  GLN P CB   5  
ATOM 4778  C CG   . GLN A 1 3  ? -11.322 -23.583 12.749  1.00 0.00 ? 1  GLN P CG   5  
ATOM 4779  C CD   . GLN A 1 3  ? -12.084 -23.270 11.462  1.00 0.00 ? 1  GLN P CD   5  
ATOM 4780  O OE1  . GLN A 1 3  ? -13.275 -22.981 11.462  1.00 0.00 ? 1  GLN P OE1  5  
ATOM 4781  N NE2  . GLN A 1 3  ? -11.435 -23.297 10.314  1.00 0.00 ? 1  GLN P NE2  5  
ATOM 4782  H H    . GLN A 1 3  ? -11.095 -22.349 16.153  1.00 0.00 ? 1  GLN P H    5  
ATOM 4783  H HA   . GLN A 1 3  ? -9.030  -23.431 14.295  1.00 0.00 ? 1  GLN P HA   5  
ATOM 4784  H HB2  . GLN A 1 3  ? -11.325 -21.571 13.531  1.00 0.00 ? 1  GLN P HB2  5  
ATOM 4785  H HB3  . GLN A 1 3  ? -9.938  -21.960 12.507  1.00 0.00 ? 1  GLN P HB3  5  
ATOM 4786  H HG2  . GLN A 1 3  ? -10.597 -24.373 12.552  1.00 0.00 ? 1  GLN P HG2  5  
ATOM 4787  H HG3  . GLN A 1 3  ? -12.034 -23.946 13.490  1.00 0.00 ? 1  GLN P HG3  5  
ATOM 4788  H HE21 . GLN A 1 3  ? -10.454 -23.535 10.287  1.00 0.00 ? 1  GLN P HE21 5  
ATOM 4789  H HE22 . GLN A 1 3  ? -11.946 -23.089 9.469   1.00 0.00 ? 1  GLN P HE22 5  
ATOM 4790  N N    . ARG A 1 4  ? -7.796  -21.156 14.219  1.00 0.00 ? 2  ARG P N    5  
ATOM 4791  C CA   . ARG A 1 4  ? -6.867  -20.023 14.425  1.00 0.00 ? 2  ARG P CA   5  
ATOM 4792  C C    . ARG A 1 4  ? -6.588  -19.274 13.113  1.00 0.00 ? 2  ARG P C    5  
ATOM 4793  O O    . ARG A 1 4  ? -6.557  -19.888 12.043  1.00 0.00 ? 2  ARG P O    5  
ATOM 4794  C CB   . ARG A 1 4  ? -5.552  -20.516 15.061  1.00 0.00 ? 2  ARG P CB   5  
ATOM 4795  C CG   . ARG A 1 4  ? -5.750  -21.128 16.458  1.00 0.00 ? 2  ARG P CG   5  
ATOM 4796  C CD   . ARG A 1 4  ? -4.405  -21.534 17.072  1.00 0.00 ? 2  ARG P CD   5  
ATOM 4797  N NE   . ARG A 1 4  ? -4.577  -22.139 18.409  1.00 0.00 ? 2  ARG P NE   5  
ATOM 4798  C CZ   . ARG A 1 4  ? -4.798  -23.411 18.695  1.00 0.00 ? 2  ARG P CZ   5  
ATOM 4799  N NH1  . ARG A 1 4  ? -4.898  -24.328 17.773  1.00 0.00 ? 2  ARG P NH1  5  
ATOM 4800  N NH2  . ARG A 1 4  ? -4.923  -23.792 19.934  1.00 0.00 ? 2  ARG P NH2  5  
ATOM 4801  H H    . ARG A 1 4  ? -7.583  -21.792 13.460  1.00 0.00 ? 2  ARG P H    5  
ATOM 4802  H HA   . ARG A 1 4  ? -7.323  -19.302 15.107  1.00 0.00 ? 2  ARG P HA   5  
ATOM 4803  H HB2  . ARG A 1 4  ? -5.091  -21.259 14.407  1.00 0.00 ? 2  ARG P HB2  5  
ATOM 4804  H HB3  . ARG A 1 4  ? -4.867  -19.670 15.150  1.00 0.00 ? 2  ARG P HB3  5  
ATOM 4805  H HG2  . ARG A 1 4  ? -6.233  -20.397 17.108  1.00 0.00 ? 2  ARG P HG2  5  
ATOM 4806  H HG3  . ARG A 1 4  ? -6.387  -22.010 16.386  1.00 0.00 ? 2  ARG P HG3  5  
ATOM 4807  H HD2  . ARG A 1 4  ? -3.892  -22.229 16.404  1.00 0.00 ? 2  ARG P HD2  5  
ATOM 4808  H HD3  . ARG A 1 4  ? -3.779  -20.644 17.165  1.00 0.00 ? 2  ARG P HD3  5  
ATOM 4809  H HE   . ARG A 1 4  ? -4.513  -21.513 19.197  1.00 0.00 ? 2  ARG P HE   5  
ATOM 4810  H HH11 . ARG A 1 4  ? -4.799  -24.067 16.808  1.00 0.00 ? 2  ARG P HH11 5  
ATOM 4811  H HH12 . ARG A 1 4  ? -5.060  -25.289 18.022  1.00 0.00 ? 2  ARG P HH12 5  
ATOM 4812  H HH21 . ARG A 1 4  ? -4.850  -23.121 20.681  1.00 0.00 ? 2  ARG P HH21 5  
ATOM 4813  H HH22 . ARG A 1 4  ? -5.088  -24.761 20.153  1.00 0.00 ? 2  ARG P HH22 5  
ATOM 4814  N N    . ARG A 1 5  ? -6.376  -17.955 13.203  1.00 0.00 ? 3  ARG P N    5  
ATOM 4815  C CA   . ARG A 1 5  ? -6.093  -17.033 12.081  1.00 0.00 ? 3  ARG P CA   5  
ATOM 4816  C C    . ARG A 1 5  ? -5.070  -15.957 12.474  1.00 0.00 ? 3  ARG P C    5  
ATOM 4817  O O    . ARG A 1 5  ? -4.938  -15.623 13.654  1.00 0.00 ? 3  ARG P O    5  
ATOM 4818  C CB   . ARG A 1 5  ? -7.396  -16.355 11.603  1.00 0.00 ? 3  ARG P CB   5  
ATOM 4819  C CG   . ARG A 1 5  ? -8.433  -17.332 11.020  1.00 0.00 ? 3  ARG P CG   5  
ATOM 4820  C CD   . ARG A 1 5  ? -9.643  -16.603 10.417  1.00 0.00 ? 3  ARG P CD   5  
ATOM 4821  N NE   . ARG A 1 5  ? -10.400 -15.826 11.424  1.00 0.00 ? 3  ARG P NE   5  
ATOM 4822  C CZ   . ARG A 1 5  ? -11.332 -16.270 12.250  1.00 0.00 ? 3  ARG P CZ   5  
ATOM 4823  N NH1  . ARG A 1 5  ? -11.714 -17.517 12.268  1.00 0.00 ? 3  ARG P NH1  5  
ATOM 4824  N NH2  . ARG A 1 5  ? -11.906 -15.457 13.088  1.00 0.00 ? 3  ARG P NH2  5  
ATOM 4825  H H    . ARG A 1 5  ? -6.391  -17.555 14.131  1.00 0.00 ? 3  ARG P H    5  
ATOM 4826  H HA   . ARG A 1 5  ? -5.664  -17.595 11.247  1.00 0.00 ? 3  ARG P HA   5  
ATOM 4827  H HB2  . ARG A 1 5  ? -7.840  -15.814 12.441  1.00 0.00 ? 3  ARG P HB2  5  
ATOM 4828  H HB3  . ARG A 1 5  ? -7.146  -15.626 10.828  1.00 0.00 ? 3  ARG P HB3  5  
ATOM 4829  H HG2  . ARG A 1 5  ? -7.960  -17.922 10.234  1.00 0.00 ? 3  ARG P HG2  5  
ATOM 4830  H HG3  . ARG A 1 5  ? -8.781  -18.009 11.800  1.00 0.00 ? 3  ARG P HG3  5  
ATOM 4831  H HD2  . ARG A 1 5  ? -9.291  -15.927 9.636   1.00 0.00 ? 3  ARG P HD2  5  
ATOM 4832  H HD3  . ARG A 1 5  ? -10.298 -17.334 9.939   1.00 0.00 ? 3  ARG P HD3  5  
ATOM 4833  H HE   . ARG A 1 5  ? -10.191 -14.842 11.480  1.00 0.00 ? 3  ARG P HE   5  
ATOM 4834  H HH11 . ARG A 1 5  ? -11.302 -18.165 11.621  1.00 0.00 ? 3  ARG P HH11 5  
ATOM 4835  H HH12 . ARG A 1 5  ? -12.431 -17.823 12.903  1.00 0.00 ? 3  ARG P HH12 5  
ATOM 4836  H HH21 . ARG A 1 5  ? -11.646 -14.483 13.109  1.00 0.00 ? 3  ARG P HH21 5  
ATOM 4837  H HH22 . ARG A 1 5  ? -12.616 -15.792 13.718  1.00 0.00 ? 3  ARG P HH22 5  
ATOM 4838  N N    . GLN A 1 6  ? -4.385  -15.383 11.483  1.00 0.00 ? 4  GLN P N    5  
ATOM 4839  C CA   . GLN A 1 6  ? -3.529  -14.197 11.650  1.00 0.00 ? 4  GLN P CA   5  
ATOM 4840  C C    . GLN A 1 6  ? -4.371  -12.911 11.786  1.00 0.00 ? 4  GLN P C    5  
ATOM 4841  O O    . GLN A 1 6  ? -5.516  -12.860 11.323  1.00 0.00 ? 4  GLN P O    5  
ATOM 4842  C CB   . GLN A 1 6  ? -2.536  -14.090 10.478  1.00 0.00 ? 4  GLN P CB   5  
ATOM 4843  C CG   . GLN A 1 6  ? -1.541  -15.265 10.434  1.00 0.00 ? 4  GLN P CG   5  
ATOM 4844  C CD   . GLN A 1 6  ? -0.508  -15.155 9.308   1.00 0.00 ? 4  GLN P CD   5  
ATOM 4845  O OE1  . GLN A 1 6  ? -0.481  -14.225 8.511   1.00 0.00 ? 4  GLN P OE1  5  
ATOM 4846  N NE2  . GLN A 1 6  ? 0.390   -16.111 9.194   1.00 0.00 ? 4  GLN P NE2  5  
ATOM 4847  H H    . GLN A 1 6  ? -4.570  -15.699 10.543  1.00 0.00 ? 4  GLN P H    5  
ATOM 4848  H HA   . GLN A 1 6  ? -2.950  -14.308 12.570  1.00 0.00 ? 4  GLN P HA   5  
ATOM 4849  H HB2  . GLN A 1 6  ? -3.091  -14.048 9.539   1.00 0.00 ? 4  GLN P HB2  5  
ATOM 4850  H HB3  . GLN A 1 6  ? -1.970  -13.164 10.584  1.00 0.00 ? 4  GLN P HB3  5  
ATOM 4851  H HG2  . GLN A 1 6  ? -1.008  -15.315 11.384  1.00 0.00 ? 4  GLN P HG2  5  
ATOM 4852  H HG3  . GLN A 1 6  ? -2.086  -16.200 10.304  1.00 0.00 ? 4  GLN P HG3  5  
ATOM 4853  H HE21 . GLN A 1 6  ? 0.392   -16.890 9.835   1.00 0.00 ? 4  GLN P HE21 5  
ATOM 4854  H HE22 . GLN A 1 6  ? 1.070   -16.042 8.452   1.00 0.00 ? 4  GLN P HE22 5  
ATOM 4855  N N    . ARG A 1 7  ? -3.809  -11.864 12.411  1.00 0.00 ? 5  ARG P N    5  
ATOM 4856  C CA   . ARG A 1 7  ? -4.492  -10.583 12.698  1.00 0.00 ? 5  ARG P CA   5  
ATOM 4857  C C    . ARG A 1 7  ? -3.688  -9.373  12.206  1.00 0.00 ? 5  ARG P C    5  
ATOM 4858  O O    . ARG A 1 7  ? -2.518  -9.213  12.557  1.00 0.00 ? 5  ARG P O    5  
ATOM 4859  C CB   . ARG A 1 7  ? -4.789  -10.467 14.206  1.00 0.00 ? 5  ARG P CB   5  
ATOM 4860  C CG   . ARG A 1 7  ? -5.788  -11.526 14.707  1.00 0.00 ? 5  ARG P CG   5  
ATOM 4861  C CD   . ARG A 1 7  ? -6.057  -11.404 16.214  1.00 0.00 ? 5  ARG P CD   5  
ATOM 4862  N NE   . ARG A 1 7  ? -6.773  -10.158 16.560  1.00 0.00 ? 5  ARG P NE   5  
ATOM 4863  C CZ   . ARG A 1 7  ? -6.969  -9.671  17.773  1.00 0.00 ? 5  ARG P CZ   5  
ATOM 4864  N NH1  . ARG A 1 7  ? -6.537  -10.277 18.844  1.00 0.00 ? 5  ARG P NH1  5  
ATOM 4865  N NH2  . ARG A 1 7  ? -7.616  -8.553  17.937  1.00 0.00 ? 5  ARG P NH2  5  
ATOM 4866  H H    . ARG A 1 7  ? -2.858  -11.970 12.743  1.00 0.00 ? 5  ARG P H    5  
ATOM 4867  H HA   . ARG A 1 7  ? -5.450  -10.561 12.174  1.00 0.00 ? 5  ARG P HA   5  
ATOM 4868  H HB2  . ARG A 1 7  ? -3.856  -10.561 14.765  1.00 0.00 ? 5  ARG P HB2  5  
ATOM 4869  H HB3  . ARG A 1 7  ? -5.201  -9.475  14.401  1.00 0.00 ? 5  ARG P HB3  5  
ATOM 4870  H HG2  . ARG A 1 7  ? -6.729  -11.431 14.163  1.00 0.00 ? 5  ARG P HG2  5  
ATOM 4871  H HG3  . ARG A 1 7  ? -5.383  -12.521 14.521  1.00 0.00 ? 5  ARG P HG3  5  
ATOM 4872  H HD2  . ARG A 1 7  ? -6.660  -12.259 16.526  1.00 0.00 ? 5  ARG P HD2  5  
ATOM 4873  H HD3  . ARG A 1 7  ? -5.100  -11.447 16.741  1.00 0.00 ? 5  ARG P HD3  5  
ATOM 4874  H HE   . ARG A 1 7  ? -7.168  -9.629  15.798  1.00 0.00 ? 5  ARG P HE   5  
ATOM 4875  H HH11 . ARG A 1 7  ? -6.045  -11.148 18.750  1.00 0.00 ? 5  ARG P HH11 5  
ATOM 4876  H HH12 . ARG A 1 7  ? -6.701  -9.886  19.757  1.00 0.00 ? 5  ARG P HH12 5  
ATOM 4877  H HH21 . ARG A 1 7  ? -7.971  -8.049  17.141  1.00 0.00 ? 5  ARG P HH21 5  
ATOM 4878  H HH22 . ARG A 1 7  ? -7.766  -8.184  18.863  1.00 0.00 ? 5  ARG P HH22 5  
ATOM 4879  N N    . THR A 1 8  ? -4.337  -8.513  11.415  1.00 0.00 ? 6  THR P N    5  
ATOM 4880  C CA   . THR A 1 8  ? -3.833  -7.219  10.890  1.00 0.00 ? 6  THR P CA   5  
ATOM 4881  C C    . THR A 1 8  ? -2.430  -7.250  10.252  1.00 0.00 ? 6  THR P C    5  
ATOM 4882  O O    . THR A 1 8  ? -1.662  -6.289  10.359  1.00 0.00 ? 6  THR P O    5  
ATOM 4883  C CB   . THR A 1 8  ? -4.005  -6.063  11.897  1.00 0.00 ? 6  THR P CB   5  
ATOM 4884  O OG1  . THR A 1 8  ? -3.142  -6.166  13.014  1.00 0.00 ? 6  THR P OG1  5  
ATOM 4885  C CG2  . THR A 1 8  ? -5.435  -5.935  12.426  1.00 0.00 ? 6  THR P CG2  5  
ATOM 4886  H H    . THR A 1 8  ? -5.296  -8.743  11.198  1.00 0.00 ? 6  THR P H    5  
ATOM 4887  H HA   . THR A 1 8  ? -4.490  -6.969  10.057  1.00 0.00 ? 6  THR P HA   5  
ATOM 4888  H HB   . THR A 1 8  ? -3.776  -5.136  11.373  1.00 0.00 ? 6  THR P HB   5  
ATOM 4889  H HG1  . THR A 1 8  ? -2.616  -6.978  12.915  1.00 0.00 ? 6  THR P HG1  5  
ATOM 4890  H HG21 . THR A 1 8  ? -6.127  -5.831  11.590  1.00 0.00 ? 6  THR P HG21 5  
ATOM 4891  H HG22 . THR A 1 8  ? -5.509  -5.048  13.054  1.00 0.00 ? 6  THR P HG22 5  
ATOM 4892  H HG23 . THR A 1 8  ? -5.706  -6.811  13.016  1.00 0.00 ? 6  THR P HG23 5  
ATOM 4893  N N    . HIS A 1 9  ? -2.088  -8.357  9.587   1.00 0.00 ? 7  HIS P N    5  
ATOM 4894  C CA   . HIS A 1 9  ? -0.795  -8.600  8.927   1.00 0.00 ? 7  HIS P CA   5  
ATOM 4895  C C    . HIS A 1 9  ? -0.945  -8.731  7.403   1.00 0.00 ? 7  HIS P C    5  
ATOM 4896  O O    . HIS A 1 9  ? -2.037  -9.024  6.903   1.00 0.00 ? 7  HIS P O    5  
ATOM 4897  C CB   . HIS A 1 9  ? -0.141  -9.841  9.556   1.00 0.00 ? 7  HIS P CB   5  
ATOM 4898  C CG   . HIS A 1 9  ? 1.262   -10.098 9.062   1.00 0.00 ? 7  HIS P CG   5  
ATOM 4899  N ND1  . HIS A 1 9  ? 2.313   -9.177  9.098   1.00 0.00 ? 7  HIS P ND1  5  
ATOM 4900  C CD2  . HIS A 1 9  ? 1.701   -11.244 8.468   1.00 0.00 ? 7  HIS P CD2  5  
ATOM 4901  C CE1  . HIS A 1 9  ? 3.366   -9.799  8.539   1.00 0.00 ? 7  HIS P CE1  5  
ATOM 4902  N NE2  . HIS A 1 9  ? 3.025   -11.038 8.149   1.00 0.00 ? 7  HIS P NE2  5  
ATOM 4903  H H    . HIS A 1 9  ? -2.787  -9.081  9.503   1.00 0.00 ? 7  HIS P H    5  
ATOM 4904  H HA   . HIS A 1 9  ? -0.130  -7.753  9.110   1.00 0.00 ? 7  HIS P HA   5  
ATOM 4905  H HB2  . HIS A 1 9  ? -0.098  -9.708  10.638  1.00 0.00 ? 7  HIS P HB2  5  
ATOM 4906  H HB3  . HIS A 1 9  ? -0.760  -10.715 9.347   1.00 0.00 ? 7  HIS P HB3  5  
ATOM 4907  H HD2  . HIS A 1 9  ? 1.112   -12.133 8.276   1.00 0.00 ? 7  HIS P HD2  5  
ATOM 4908  H HE1  . HIS A 1 9  ? 4.352   -9.362  8.418   1.00 0.00 ? 7  HIS P HE1  5  
ATOM 4909  H HE2  . HIS A 1 9  ? 3.647   -11.702 7.696   1.00 0.00 ? 7  HIS P HE2  5  
ATOM 4910  N N    . PHE A 1 10 ? 0.140   -8.510  6.655   1.00 0.00 ? 8  PHE P N    5  
ATOM 4911  C CA   . PHE A 1 10 ? 0.123   -8.502  5.188   1.00 0.00 ? 8  PHE P CA   5  
ATOM 4912  C C    . PHE A 1 10 ? -0.099  -9.899  4.566   1.00 0.00 ? 8  PHE P C    5  
ATOM 4913  O O    . PHE A 1 10 ? 0.242   -10.924 5.166   1.00 0.00 ? 8  PHE P O    5  
ATOM 4914  C CB   . PHE A 1 10 ? 1.412   -7.886  4.624   1.00 0.00 ? 8  PHE P CB   5  
ATOM 4915  C CG   . PHE A 1 10 ? 1.954   -6.649  5.315   1.00 0.00 ? 8  PHE P CG   5  
ATOM 4916  C CD1  . PHE A 1 10 ? 1.430   -5.379  5.010   1.00 0.00 ? 8  PHE P CD1  5  
ATOM 4917  C CD2  . PHE A 1 10 ? 3.024   -6.761  6.224   1.00 0.00 ? 8  PHE P CD2  5  
ATOM 4918  C CE1  . PHE A 1 10 ? 1.969   -4.229  5.613   1.00 0.00 ? 8  PHE P CE1  5  
ATOM 4919  C CE2  . PHE A 1 10 ? 3.553   -5.612  6.839   1.00 0.00 ? 8  PHE P CE2  5  
ATOM 4920  C CZ   . PHE A 1 10 ? 3.024   -4.345  6.534   1.00 0.00 ? 8  PHE P CZ   5  
ATOM 4921  H H    . PHE A 1 10 ? 1.015   -8.319  7.123   1.00 0.00 ? 8  PHE P H    5  
ATOM 4922  H HA   . PHE A 1 10 ? -0.702  -7.862  4.884   1.00 0.00 ? 8  PHE P HA   5  
ATOM 4923  H HB2  . PHE A 1 10 ? 2.195   -8.647  4.616   1.00 0.00 ? 8  PHE P HB2  5  
ATOM 4924  H HB3  . PHE A 1 10 ? 1.207   -7.622  3.587   1.00 0.00 ? 8  PHE P HB3  5  
ATOM 4925  H HD1  . PHE A 1 10 ? 0.624   -5.290  4.297   1.00 0.00 ? 8  PHE P HD1  5  
ATOM 4926  H HD2  . PHE A 1 10 ? 3.449   -7.731  6.440   1.00 0.00 ? 8  PHE P HD2  5  
ATOM 4927  H HE1  . PHE A 1 10 ? 1.577   -3.252  5.363   1.00 0.00 ? 8  PHE P HE1  5  
ATOM 4928  H HE2  . PHE A 1 10 ? 4.373   -5.701  7.539   1.00 0.00 ? 8  PHE P HE2  5  
ATOM 4929  H HZ   . PHE A 1 10 ? 3.439   -3.460  6.999   1.00 0.00 ? 8  PHE P HZ   5  
ATOM 4930  N N    . THR A 1 11 ? -0.600  -9.937  3.326   1.00 0.00 ? 9  THR P N    5  
ATOM 4931  C CA   . THR A 1 11 ? -0.710  -11.149 2.486   1.00 0.00 ? 9  THR P CA   5  
ATOM 4932  C C    . THR A 1 11 ? -0.154  -10.931 1.070   1.00 0.00 ? 9  THR P C    5  
ATOM 4933  O O    . THR A 1 11 ? 0.097   -9.797  0.656   1.00 0.00 ? 9  THR P O    5  
ATOM 4934  C CB   . THR A 1 11 ? -2.153  -11.685 2.483   1.00 0.00 ? 9  THR P CB   5  
ATOM 4935  O OG1  . THR A 1 11 ? -2.161  -13.009 1.993   1.00 0.00 ? 9  THR P OG1  5  
ATOM 4936  C CG2  . THR A 1 11 ? -3.133  -10.863 1.642   1.00 0.00 ? 9  THR P CG2  5  
ATOM 4937  H H    . THR A 1 11 ? -0.908  -9.060  2.923   1.00 0.00 ? 9  THR P H    5  
ATOM 4938  H HA   . THR A 1 11 ? -0.094  -11.931 2.931   1.00 0.00 ? 9  THR P HA   5  
ATOM 4939  H HB   . THR A 1 11 ? -2.513  -11.705 3.513   1.00 0.00 ? 9  THR P HB   5  
ATOM 4940  H HG1  . THR A 1 11 ? -3.062  -13.361 2.109   1.00 0.00 ? 9  THR P HG1  5  
ATOM 4941  H HG21 . THR A 1 11 ? -3.155  -9.839  2.005   1.00 0.00 ? 9  THR P HG21 5  
ATOM 4942  H HG22 . THR A 1 11 ? -4.134  -11.283 1.734   1.00 0.00 ? 9  THR P HG22 5  
ATOM 4943  H HG23 . THR A 1 11 ? -2.842  -10.870 0.592   1.00 0.00 ? 9  THR P HG23 5  
ATOM 4944  N N    . SER A 1 12 ? 0.052   -12.011 0.308   1.00 0.00 ? 10 SER P N    5  
ATOM 4945  C CA   . SER A 1 12 ? 0.776   -12.024 -0.977  1.00 0.00 ? 10 SER P CA   5  
ATOM 4946  C C    . SER A 1 12 ? 0.244   -11.030 -2.018  1.00 0.00 ? 10 SER P C    5  
ATOM 4947  O O    . SER A 1 12 ? 1.035   -10.387 -2.706  1.00 0.00 ? 10 SER P O    5  
ATOM 4948  C CB   . SER A 1 12 ? 0.736   -13.431 -1.583  1.00 0.00 ? 10 SER P CB   5  
ATOM 4949  O OG   . SER A 1 12 ? 1.277   -14.380 -0.674  1.00 0.00 ? 10 SER P OG   5  
ATOM 4950  H H    . SER A 1 12 ? -0.226  -12.907 0.689   1.00 0.00 ? 10 SER P H    5  
ATOM 4951  H HA   . SER A 1 12 ? 1.819   -11.772 -0.787  1.00 0.00 ? 10 SER P HA   5  
ATOM 4952  H HB2  . SER A 1 12 ? -0.297  -13.697 -1.818  1.00 0.00 ? 10 SER P HB2  5  
ATOM 4953  H HB3  . SER A 1 12 ? 1.316   -13.438 -2.508  1.00 0.00 ? 10 SER P HB3  5  
ATOM 4954  H HG   . SER A 1 12 ? 1.256   -15.261 -1.099  1.00 0.00 ? 10 SER P HG   5  
ATOM 4955  N N    . GLN A 1 13 ? -1.076  -10.851 -2.117  1.00 0.00 ? 11 GLN P N    5  
ATOM 4956  C CA   . GLN A 1 13 ? -1.701  -9.911  -3.058  1.00 0.00 ? 11 GLN P CA   5  
ATOM 4957  C C    . GLN A 1 13 ? -1.427  -8.443  -2.683  1.00 0.00 ? 11 GLN P C    5  
ATOM 4958  O O    . GLN A 1 13 ? -1.235  -7.603  -3.564  1.00 0.00 ? 11 GLN P O    5  
ATOM 4959  C CB   . GLN A 1 13 ? -3.219  -10.170 -3.137  1.00 0.00 ? 11 GLN P CB   5  
ATOM 4960  C CG   . GLN A 1 13 ? -3.598  -11.521 -3.776  1.00 0.00 ? 11 GLN P CG   5  
ATOM 4961  C CD   . GLN A 1 13 ? -3.469  -12.748 -2.866  1.00 0.00 ? 11 GLN P CD   5  
ATOM 4962  O OE1  . GLN A 1 13 ? -3.209  -12.673 -1.672  1.00 0.00 ? 11 GLN P OE1  5  
ATOM 4963  N NE2  . GLN A 1 13 ? -3.649  -13.938 -3.397  1.00 0.00 ? 11 GLN P NE2  5  
ATOM 4964  H H    . GLN A 1 13 ? -1.683  -11.433 -1.548  1.00 0.00 ? 11 GLN P H    5  
ATOM 4965  H HA   . GLN A 1 13 ? -1.277  -10.072 -4.050  1.00 0.00 ? 11 GLN P HA   5  
ATOM 4966  H HB2  . GLN A 1 13 ? -3.668  -10.083 -2.146  1.00 0.00 ? 11 GLN P HB2  5  
ATOM 4967  H HB3  . GLN A 1 13 ? -3.653  -9.387  -3.761  1.00 0.00 ? 11 GLN P HB3  5  
ATOM 4968  H HG2  . GLN A 1 13 ? -4.639  -11.463 -4.096  1.00 0.00 ? 11 GLN P HG2  5  
ATOM 4969  H HG3  . GLN A 1 13 ? -2.991  -11.675 -4.669  1.00 0.00 ? 11 GLN P HG3  5  
ATOM 4970  H HE21 . GLN A 1 13 ? -3.872  -14.035 -4.376  1.00 0.00 ? 11 GLN P HE21 5  
ATOM 4971  H HE22 . GLN A 1 13 ? -3.574  -14.745 -2.795  1.00 0.00 ? 11 GLN P HE22 5  
ATOM 4972  N N    . GLN A 1 14 ? -1.341  -8.137  -1.385  1.00 0.00 ? 12 GLN P N    5  
ATOM 4973  C CA   . GLN A 1 14 ? -0.971  -6.808  -0.885  1.00 0.00 ? 12 GLN P CA   5  
ATOM 4974  C C    . GLN A 1 14 ? 0.522   -6.543  -1.123  1.00 0.00 ? 12 GLN P C    5  
ATOM 4975  O O    . GLN A 1 14 ? 0.879   -5.483  -1.630  1.00 0.00 ? 12 GLN P O    5  
ATOM 4976  C CB   . GLN A 1 14 ? -1.311  -6.687  0.609   1.00 0.00 ? 12 GLN P CB   5  
ATOM 4977  C CG   . GLN A 1 14 ? -2.810  -6.857  0.913   1.00 0.00 ? 12 GLN P CG   5  
ATOM 4978  C CD   . GLN A 1 14 ? -3.087  -6.972  2.411   1.00 0.00 ? 12 GLN P CD   5  
ATOM 4979  O OE1  . GLN A 1 14 ? -2.341  -7.585  3.159   1.00 0.00 ? 12 GLN P OE1  5  
ATOM 4980  N NE2  . GLN A 1 14 ? -4.169  -6.423  2.911   1.00 0.00 ? 12 GLN P NE2  5  
ATOM 4981  H H    . GLN A 1 14 ? -1.431  -8.887  -0.712  1.00 0.00 ? 12 GLN P H    5  
ATOM 4982  H HA   . GLN A 1 14 ? -1.534  -6.048  -1.429  1.00 0.00 ? 12 GLN P HA   5  
ATOM 4983  H HB2  . GLN A 1 14 ? -0.738  -7.432  1.160   1.00 0.00 ? 12 GLN P HB2  5  
ATOM 4984  H HB3  . GLN A 1 14 ? -0.997  -5.702  0.957   1.00 0.00 ? 12 GLN P HB3  5  
ATOM 4985  H HG2  . GLN A 1 14 ? -3.355  -6.011  0.500   1.00 0.00 ? 12 GLN P HG2  5  
ATOM 4986  H HG3  . GLN A 1 14 ? -3.194  -7.761  0.443   1.00 0.00 ? 12 GLN P HG3  5  
ATOM 4987  H HE21 . GLN A 1 14 ? -4.761  -5.841  2.325   1.00 0.00 ? 12 GLN P HE21 5  
ATOM 4988  H HE22 . GLN A 1 14 ? -4.327  -6.498  3.902   1.00 0.00 ? 12 GLN P HE22 5  
ATOM 4989  N N    . LEU A 1 15 ? 1.387   -7.531  -0.848  1.00 0.00 ? 13 LEU P N    5  
ATOM 4990  C CA   . LEU A 1 15 ? 2.825   -7.474  -1.153  1.00 0.00 ? 13 LEU P CA   5  
ATOM 4991  C C    . LEU A 1 15 ? 3.088   -7.273  -2.654  1.00 0.00 ? 13 LEU P C    5  
ATOM 4992  O O    . LEU A 1 15 ? 3.964   -6.492  -3.015  1.00 0.00 ? 13 LEU P O    5  
ATOM 4993  C CB   . LEU A 1 15 ? 3.515   -8.761  -0.648  1.00 0.00 ? 13 LEU P CB   5  
ATOM 4994  C CG   . LEU A 1 15 ? 4.136   -8.643  0.753   1.00 0.00 ? 13 LEU P CG   5  
ATOM 4995  C CD1  . LEU A 1 15 ? 3.135   -8.238  1.828   1.00 0.00 ? 13 LEU P CD1  5  
ATOM 4996  C CD2  . LEU A 1 15 ? 4.752   -9.977  1.174   1.00 0.00 ? 13 LEU P CD2  5  
ATOM 4997  H H    . LEU A 1 15 ? 1.021   -8.372  -0.414  1.00 0.00 ? 13 LEU P H    5  
ATOM 4998  H HA   . LEU A 1 15 ? 3.263   -6.614  -0.644  1.00 0.00 ? 13 LEU P HA   5  
ATOM 4999  H HB2  . LEU A 1 15 ? 2.808   -9.591  -0.667  1.00 0.00 ? 13 LEU P HB2  5  
ATOM 5000  H HB3  . LEU A 1 15 ? 4.326   -9.012  -1.334  1.00 0.00 ? 13 LEU P HB3  5  
ATOM 5001  H HG   . LEU A 1 15 ? 4.923   -7.892  0.734   1.00 0.00 ? 13 LEU P HG   5  
ATOM 5002  H HD11 . LEU A 1 15 ? 3.641   -8.193  2.793   1.00 0.00 ? 13 LEU P HD11 5  
ATOM 5003  H HD12 . LEU A 1 15 ? 2.330   -8.970  1.875   1.00 0.00 ? 13 LEU P HD12 5  
ATOM 5004  H HD13 . LEU A 1 15 ? 2.722   -7.255  1.611   1.00 0.00 ? 13 LEU P HD13 5  
ATOM 5005  H HD21 . LEU A 1 15 ? 3.982   -10.746 1.221   1.00 0.00 ? 13 LEU P HD21 5  
ATOM 5006  H HD22 . LEU A 1 15 ? 5.217   -9.875  2.154   1.00 0.00 ? 13 LEU P HD22 5  
ATOM 5007  H HD23 . LEU A 1 15 ? 5.514   -10.273 0.453   1.00 0.00 ? 13 LEU P HD23 5  
ATOM 5008  N N    . GLN A 1 16 ? 2.313   -7.922  -3.527  1.00 0.00 ? 14 GLN P N    5  
ATOM 5009  C CA   . GLN A 1 16 ? 2.419   -7.769  -4.982  1.00 0.00 ? 14 GLN P CA   5  
ATOM 5010  C C    . GLN A 1 16 ? 2.033   -6.353  -5.449  1.00 0.00 ? 14 GLN P C    5  
ATOM 5011  O O    . GLN A 1 16 ? 2.736   -5.765  -6.270  1.00 0.00 ? 14 GLN P O    5  
ATOM 5012  C CB   . GLN A 1 16 ? 1.560   -8.862  -5.639  1.00 0.00 ? 14 GLN P CB   5  
ATOM 5013  C CG   . GLN A 1 16 ? 1.646   -8.873  -7.173  1.00 0.00 ? 14 GLN P CG   5  
ATOM 5014  C CD   . GLN A 1 16 ? 0.935   -10.092 -7.758  1.00 0.00 ? 14 GLN P CD   5  
ATOM 5015  O OE1  . GLN A 1 16 ? 1.549   -11.036 -8.242  1.00 0.00 ? 14 GLN P OE1  5  
ATOM 5016  N NE2  . GLN A 1 16 ? -0.382  -10.138 -7.728  1.00 0.00 ? 14 GLN P NE2  5  
ATOM 5017  H H    . GLN A 1 16 ? 1.658   -8.608  -3.167  1.00 0.00 ? 14 GLN P H    5  
ATOM 5018  H HA   . GLN A 1 16 ? 3.458   -7.938  -5.270  1.00 0.00 ? 14 GLN P HA   5  
ATOM 5019  H HB2  . GLN A 1 16 ? 1.900   -9.833  -5.274  1.00 0.00 ? 14 GLN P HB2  5  
ATOM 5020  H HB3  . GLN A 1 16 ? 0.519   -8.731  -5.344  1.00 0.00 ? 14 GLN P HB3  5  
ATOM 5021  H HG2  . GLN A 1 16 ? 1.189   -7.968  -7.573  1.00 0.00 ? 14 GLN P HG2  5  
ATOM 5022  H HG3  . GLN A 1 16 ? 2.695   -8.897  -7.474  1.00 0.00 ? 14 GLN P HG3  5  
ATOM 5023  H HE21 . GLN A 1 16 ? -0.911  -9.374  -7.334  1.00 0.00 ? 14 GLN P HE21 5  
ATOM 5024  H HE22 . GLN A 1 16 ? -0.840  -10.955 -8.102  1.00 0.00 ? 14 GLN P HE22 5  
ATOM 5025  N N    . GLU A 1 17 ? 0.963   -5.769  -4.899  1.00 0.00 ? 15 GLU P N    5  
ATOM 5026  C CA   . GLU A 1 17 ? 0.549   -4.390  -5.205  1.00 0.00 ? 15 GLU P CA   5  
ATOM 5027  C C    . GLU A 1 17 ? 1.550   -3.351  -4.660  1.00 0.00 ? 15 GLU P C    5  
ATOM 5028  O O    . GLU A 1 17 ? 1.911   -2.399  -5.357  1.00 0.00 ? 15 GLU P O    5  
ATOM 5029  C CB   . GLU A 1 17 ? -0.863  -4.160  -4.638  1.00 0.00 ? 15 GLU P CB   5  
ATOM 5030  C CG   . GLU A 1 17 ? -1.528  -2.862  -5.119  1.00 0.00 ? 15 GLU P CG   5  
ATOM 5031  C CD   . GLU A 1 17 ? -1.889  -2.919  -6.618  1.00 0.00 ? 15 GLU P CD   5  
ATOM 5032  O OE1  . GLU A 1 17 ? -2.948  -3.492  -6.969  1.00 0.00 ? 15 GLU P OE1  5  
ATOM 5033  O OE2  . GLU A 1 17 ? -1.120  -2.389  -7.455  1.00 0.00 ? 15 GLU P OE2  5  
ATOM 5034  H H    . GLU A 1 17 ? 0.403   -6.304  -4.243  1.00 0.00 ? 15 GLU P H    5  
ATOM 5035  H HA   . GLU A 1 17 ? 0.512   -4.274  -6.289  1.00 0.00 ? 15 GLU P HA   5  
ATOM 5036  H HB2  . GLU A 1 17 ? -1.504  -4.997  -4.922  1.00 0.00 ? 15 GLU P HB2  5  
ATOM 5037  H HB3  . GLU A 1 17 ? -0.806  -4.141  -3.549  1.00 0.00 ? 15 GLU P HB3  5  
ATOM 5038  H HG2  . GLU A 1 17 ? -2.442  -2.710  -4.539  1.00 0.00 ? 15 GLU P HG2  5  
ATOM 5039  H HG3  . GLU A 1 17 ? -0.874  -2.013  -4.909  1.00 0.00 ? 15 GLU P HG3  5  
ATOM 5040  N N    . LEU A 1 18 ? 2.056   -3.561  -3.439  1.00 0.00 ? 16 LEU P N    5  
ATOM 5041  C CA   . LEU A 1 18 ? 3.073   -2.714  -2.810  1.00 0.00 ? 16 LEU P CA   5  
ATOM 5042  C C    . LEU A 1 18 ? 4.414   -2.774  -3.563  1.00 0.00 ? 16 LEU P C    5  
ATOM 5043  O O    . LEU A 1 18 ? 5.021   -1.737  -3.822  1.00 0.00 ? 16 LEU P O    5  
ATOM 5044  C CB   . LEU A 1 18 ? 3.229   -3.124  -1.334  1.00 0.00 ? 16 LEU P CB   5  
ATOM 5045  C CG   . LEU A 1 18 ? 2.051   -2.692  -0.441  1.00 0.00 ? 16 LEU P CG   5  
ATOM 5046  C CD1  . LEU A 1 18 ? 2.073   -3.443  0.891   1.00 0.00 ? 16 LEU P CD1  5  
ATOM 5047  C CD2  . LEU A 1 18 ? 2.108   -1.195  -0.127  1.00 0.00 ? 16 LEU P CD2  5  
ATOM 5048  H H    . LEU A 1 18 ? 1.708   -4.354  -2.909  1.00 0.00 ? 16 LEU P H    5  
ATOM 5049  H HA   . LEU A 1 18 ? 2.739   -1.678  -2.850  1.00 0.00 ? 16 LEU P HA   5  
ATOM 5050  H HB2  . LEU A 1 18 ? 3.354   -4.206  -1.282  1.00 0.00 ? 16 LEU P HB2  5  
ATOM 5051  H HB3  . LEU A 1 18 ? 4.135   -2.670  -0.940  1.00 0.00 ? 16 LEU P HB3  5  
ATOM 5052  H HG   . LEU A 1 18 ? 1.106   -2.909  -0.938  1.00 0.00 ? 16 LEU P HG   5  
ATOM 5053  H HD11 . LEU A 1 18 ? 2.982   -3.204  1.437   1.00 0.00 ? 16 LEU P HD11 5  
ATOM 5054  H HD12 . LEU A 1 18 ? 2.034   -4.516  0.712   1.00 0.00 ? 16 LEU P HD12 5  
ATOM 5055  H HD13 . LEU A 1 18 ? 1.211   -3.155  1.489   1.00 0.00 ? 16 LEU P HD13 5  
ATOM 5056  H HD21 . LEU A 1 18 ? 1.256   -0.922  0.493   1.00 0.00 ? 16 LEU P HD21 5  
ATOM 5057  H HD22 . LEU A 1 18 ? 2.065   -0.617  -1.048  1.00 0.00 ? 16 LEU P HD22 5  
ATOM 5058  H HD23 . LEU A 1 18 ? 3.031   -0.956  0.402   1.00 0.00 ? 16 LEU P HD23 5  
ATOM 5059  N N    . GLU A 1 19 ? 4.849   -3.959  -3.999  1.00 0.00 ? 17 GLU P N    5  
ATOM 5060  C CA   . GLU A 1 19 ? 6.075   -4.121  -4.788  1.00 0.00 ? 17 GLU P CA   5  
ATOM 5061  C C    . GLU A 1 19 ? 5.947   -3.561  -6.219  1.00 0.00 ? 17 GLU P C    5  
ATOM 5062  O O    . GLU A 1 19 ? 6.947   -3.133  -6.800  1.00 0.00 ? 17 GLU P O    5  
ATOM 5063  C CB   . GLU A 1 19 ? 6.520   -5.592  -4.764  1.00 0.00 ? 17 GLU P CB   5  
ATOM 5064  C CG   . GLU A 1 19 ? 7.926   -5.773  -5.352  1.00 0.00 ? 17 GLU P CG   5  
ATOM 5065  C CD   . GLU A 1 19 ? 8.503   -7.164  -5.046  1.00 0.00 ? 17 GLU P CD   5  
ATOM 5066  O OE1  . GLU A 1 19 ? 8.019   -8.174  -5.612  1.00 0.00 ? 17 GLU P OE1  5  
ATOM 5067  O OE2  . GLU A 1 19 ? 9.473   -7.242  -4.252  1.00 0.00 ? 17 GLU P OE2  5  
ATOM 5068  H H    . GLU A 1 19 ? 4.338   -4.794  -3.728  1.00 0.00 ? 17 GLU P H    5  
ATOM 5069  H HA   . GLU A 1 19 ? 6.856   -3.547  -4.294  1.00 0.00 ? 17 GLU P HA   5  
ATOM 5070  H HB2  . GLU A 1 19 ? 6.545   -5.931  -3.727  1.00 0.00 ? 17 GLU P HB2  5  
ATOM 5071  H HB3  . GLU A 1 19 ? 5.807   -6.205  -5.317  1.00 0.00 ? 17 GLU P HB3  5  
ATOM 5072  H HG2  . GLU A 1 19 ? 7.887   -5.628  -6.432  1.00 0.00 ? 17 GLU P HG2  5  
ATOM 5073  H HG3  . GLU A 1 19 ? 8.585   -5.007  -4.935  1.00 0.00 ? 17 GLU P HG3  5  
ATOM 5074  N N    . ALA A 1 20 ? 4.736   -3.490  -6.782  1.00 0.00 ? 18 ALA P N    5  
ATOM 5075  C CA   . ALA A 1 20 ? 4.493   -2.841  -8.073  1.00 0.00 ? 18 ALA P CA   5  
ATOM 5076  C C    . ALA A 1 20 ? 4.702   -1.315  -8.000  1.00 0.00 ? 18 ALA P C    5  
ATOM 5077  O O    . ALA A 1 20 ? 5.419   -0.756  -8.832  1.00 0.00 ? 18 ALA P O    5  
ATOM 5078  C CB   . ALA A 1 20 ? 3.094   -3.217  -8.576  1.00 0.00 ? 18 ALA P CB   5  
ATOM 5079  H H    . ALA A 1 20 ? 3.948   -3.897  -6.294  1.00 0.00 ? 18 ALA P H    5  
ATOM 5080  H HA   . ALA A 1 20 ? 5.213   -3.231  -8.793  1.00 0.00 ? 18 ALA P HA   5  
ATOM 5081  H HB1  . ALA A 1 20 ? 2.934   -2.783  -9.564  1.00 0.00 ? 18 ALA P HB1  5  
ATOM 5082  H HB2  . ALA A 1 20 ? 3.007   -4.302  -8.652  1.00 0.00 ? 18 ALA P HB2  5  
ATOM 5083  H HB3  . ALA A 1 20 ? 2.330   -2.842  -7.898  1.00 0.00 ? 18 ALA P HB3  5  
ATOM 5084  N N    . THR A 1 21 ? 4.166   -0.632  -6.980  1.00 0.00 ? 19 THR P N    5  
ATOM 5085  C CA   . THR A 1 21 ? 4.426   0.810   -6.781  1.00 0.00 ? 19 THR P CA   5  
ATOM 5086  C C    . THR A 1 21 ? 5.878   1.077   -6.348  1.00 0.00 ? 19 THR P C    5  
ATOM 5087  O O    . THR A 1 21 ? 6.512   2.002   -6.858  1.00 0.00 ? 19 THR P O    5  
ATOM 5088  C CB   . THR A 1 21 ? 3.370   1.466   -5.872  1.00 0.00 ? 19 THR P CB   5  
ATOM 5089  O OG1  . THR A 1 21 ? 3.579   2.857   -5.781  1.00 0.00 ? 19 THR P OG1  5  
ATOM 5090  C CG2  . THR A 1 21 ? 3.315   0.921   -4.450  1.00 0.00 ? 19 THR P CG2  5  
ATOM 5091  H H    . THR A 1 21 ? 3.582   -1.130  -6.315  1.00 0.00 ? 19 THR P H    5  
ATOM 5092  H HA   . THR A 1 21 ? 4.311   1.298   -7.749  1.00 0.00 ? 19 THR P HA   5  
ATOM 5093  H HB   . THR A 1 21 ? 2.392   1.306   -6.327  1.00 0.00 ? 19 THR P HB   5  
ATOM 5094  H HG1  . THR A 1 21 ? 2.860   3.219   -5.235  1.00 0.00 ? 19 THR P HG1  5  
ATOM 5095  H HG21 . THR A 1 21 ? 3.003   -0.119  -4.479  1.00 0.00 ? 19 THR P HG21 5  
ATOM 5096  H HG22 . THR A 1 21 ? 2.583   1.479   -3.864  1.00 0.00 ? 19 THR P HG22 5  
ATOM 5097  H HG23 . THR A 1 21 ? 4.293   0.993   -3.977  1.00 0.00 ? 19 THR P HG23 5  
ATOM 5098  N N    . PHE A 1 22 ? 6.473   0.198   -5.530  1.00 0.00 ? 20 PHE P N    5  
ATOM 5099  C CA   . PHE A 1 22 ? 7.887   0.267   -5.127  1.00 0.00 ? 20 PHE P CA   5  
ATOM 5100  C C    . PHE A 1 22 ? 8.855   0.231   -6.325  1.00 0.00 ? 20 PHE P C    5  
ATOM 5101  O O    . PHE A 1 22 ? 9.818   0.998   -6.348  1.00 0.00 ? 20 PHE P O    5  
ATOM 5102  C CB   . PHE A 1 22 ? 8.169   -0.890  -4.155  1.00 0.00 ? 20 PHE P CB   5  
ATOM 5103  C CG   . PHE A 1 22 ? 9.532   -0.902  -3.486  1.00 0.00 ? 20 PHE P CG   5  
ATOM 5104  C CD1  . PHE A 1 22 ? 10.621  -1.552  -4.101  1.00 0.00 ? 20 PHE P CD1  5  
ATOM 5105  C CD2  . PHE A 1 22 ? 9.699   -0.319  -2.215  1.00 0.00 ? 20 PHE P CD2  5  
ATOM 5106  C CE1  . PHE A 1 22 ? 11.870  -1.605  -3.454  1.00 0.00 ? 20 PHE P CE1  5  
ATOM 5107  C CE2  . PHE A 1 22 ? 10.946  -0.374  -1.567  1.00 0.00 ? 20 PHE P CE2  5  
ATOM 5108  C CZ   . PHE A 1 22 ? 12.034  -1.013  -2.188  1.00 0.00 ? 20 PHE P CZ   5  
ATOM 5109  H H    . PHE A 1 22 ? 5.905   -0.537  -5.121  1.00 0.00 ? 20 PHE P H    5  
ATOM 5110  H HA   . PHE A 1 22 ? 8.052   1.206   -4.597  1.00 0.00 ? 20 PHE P HA   5  
ATOM 5111  H HB2  . PHE A 1 22 ? 7.415   -0.867  -3.369  1.00 0.00 ? 20 PHE P HB2  5  
ATOM 5112  H HB3  . PHE A 1 22 ? 8.053   -1.826  -4.697  1.00 0.00 ? 20 PHE P HB3  5  
ATOM 5113  H HD1  . PHE A 1 22 ? 10.499  -2.020  -5.069  1.00 0.00 ? 20 PHE P HD1  5  
ATOM 5114  H HD2  . PHE A 1 22 ? 8.862   0.159   -1.729  1.00 0.00 ? 20 PHE P HD2  5  
ATOM 5115  H HE1  . PHE A 1 22 ? 12.704  -2.104  -3.929  1.00 0.00 ? 20 PHE P HE1  5  
ATOM 5116  H HE2  . PHE A 1 22 ? 11.069  0.069   -0.588  1.00 0.00 ? 20 PHE P HE2  5  
ATOM 5117  H HZ   . PHE A 1 22 ? 12.994  -1.057  -1.692  1.00 0.00 ? 20 PHE P HZ   5  
ATOM 5118  N N    . GLN A 1 23 ? 8.597   -0.610  -7.339  1.00 0.00 ? 21 GLN P N    5  
ATOM 5119  C CA   . GLN A 1 23 ? 9.476   -0.746  -8.515  1.00 0.00 ? 21 GLN P CA   5  
ATOM 5120  C C    . GLN A 1 23 ? 9.157   0.223   -9.669  1.00 0.00 ? 21 GLN P C    5  
ATOM 5121  O O    . GLN A 1 23 ? 10.070  0.591   -10.414 1.00 0.00 ? 21 GLN P O    5  
ATOM 5122  C CB   . GLN A 1 23 ? 9.504   -2.214  -8.984  1.00 0.00 ? 21 GLN P CB   5  
ATOM 5123  C CG   . GLN A 1 23 ? 8.278   -2.635  -9.812  1.00 0.00 ? 21 GLN P CG   5  
ATOM 5124  C CD   . GLN A 1 23 ? 8.212   -4.144  -10.013 1.00 0.00 ? 21 GLN P CD   5  
ATOM 5125  O OE1  . GLN A 1 23 ? 8.567   -4.686  -11.051 1.00 0.00 ? 21 GLN P OE1  5  
ATOM 5126  N NE2  . GLN A 1 23 ? 7.754   -4.875  -9.021  1.00 0.00 ? 21 GLN P NE2  5  
ATOM 5127  H H    . GLN A 1 23 ? 7.824   -1.259  -7.237  1.00 0.00 ? 21 GLN P H    5  
ATOM 5128  H HA   . GLN A 1 23 ? 10.493  -0.514  -8.196  1.00 0.00 ? 21 GLN P HA   5  
ATOM 5129  H HB2  . GLN A 1 23 ? 10.395  -2.365  -9.599  1.00 0.00 ? 21 GLN P HB2  5  
ATOM 5130  H HB3  . GLN A 1 23 ? 9.595   -2.859  -8.109  1.00 0.00 ? 21 GLN P HB3  5  
ATOM 5131  H HG2  . GLN A 1 23 ? 7.373   -2.318  -9.302  1.00 0.00 ? 21 GLN P HG2  5  
ATOM 5132  H HG3  . GLN A 1 23 ? 8.307   -2.150  -10.788 1.00 0.00 ? 21 GLN P HG3  5  
ATOM 5133  H HE21 . GLN A 1 23 ? 7.487   -4.416  -8.155  1.00 0.00 ? 21 GLN P HE21 5  
ATOM 5134  H HE22 . GLN A 1 23 ? 7.710   -5.875  -9.132  1.00 0.00 ? 21 GLN P HE22 5  
ATOM 5135  N N    . ARG A 1 24 ? 7.890   0.636   -9.842  1.00 0.00 ? 22 ARG P N    5  
ATOM 5136  C CA   . ARG A 1 24 ? 7.422   1.420   -11.007 1.00 0.00 ? 22 ARG P CA   5  
ATOM 5137  C C    . ARG A 1 24 ? 7.215   2.908   -10.707 1.00 0.00 ? 22 ARG P C    5  
ATOM 5138  O O    . ARG A 1 24 ? 7.598   3.749   -11.519 1.00 0.00 ? 22 ARG P O    5  
ATOM 5139  C CB   . ARG A 1 24 ? 6.151   0.757   -11.569 1.00 0.00 ? 22 ARG P CB   5  
ATOM 5140  C CG   . ARG A 1 24 ? 5.749   1.304   -12.950 1.00 0.00 ? 22 ARG P CG   5  
ATOM 5141  C CD   . ARG A 1 24 ? 4.503   0.602   -13.508 1.00 0.00 ? 22 ARG P CD   5  
ATOM 5142  N NE   . ARG A 1 24 ? 4.764   -0.813  -13.850 1.00 0.00 ? 22 ARG P NE   5  
ATOM 5143  C CZ   . ARG A 1 24 ? 3.866   -1.721  -14.191 1.00 0.00 ? 22 ARG P CZ   5  
ATOM 5144  N NH1  . ARG A 1 24 ? 2.593   -1.447  -14.264 1.00 0.00 ? 22 ARG P NH1  5  
ATOM 5145  N NH2  . ARG A 1 24 ? 4.233   -2.938  -14.469 1.00 0.00 ? 22 ARG P NH2  5  
ATOM 5146  H H    . ARG A 1 24 ? 7.186   0.249   -9.218  1.00 0.00 ? 22 ARG P H    5  
ATOM 5147  H HA   . ARG A 1 24 ? 8.185   1.376   -11.788 1.00 0.00 ? 22 ARG P HA   5  
ATOM 5148  H HB2  . ARG A 1 24 ? 6.329   -0.317  -11.657 1.00 0.00 ? 22 ARG P HB2  5  
ATOM 5149  H HB3  . ARG A 1 24 ? 5.323   0.910   -10.874 1.00 0.00 ? 22 ARG P HB3  5  
ATOM 5150  H HG2  . ARG A 1 24 ? 5.525   2.368   -12.863 1.00 0.00 ? 22 ARG P HG2  5  
ATOM 5151  H HG3  . ARG A 1 24 ? 6.576   1.183   -13.651 1.00 0.00 ? 22 ARG P HG3  5  
ATOM 5152  H HD2  . ARG A 1 24 ? 3.704   0.668   -12.766 1.00 0.00 ? 22 ARG P HD2  5  
ATOM 5153  H HD3  . ARG A 1 24 ? 4.184   1.132   -14.407 1.00 0.00 ? 22 ARG P HD3  5  
ATOM 5154  H HE   . ARG A 1 24 ? 5.724   -1.117  -13.844 1.00 0.00 ? 22 ARG P HE   5  
ATOM 5155  H HH11 . ARG A 1 24 ? 2.281   -0.512  -14.067 1.00 0.00 ? 22 ARG P HH11 5  
ATOM 5156  H HH12 . ARG A 1 24 ? 1.929   -2.156  -14.527 1.00 0.00 ? 22 ARG P HH12 5  
ATOM 5157  H HH21 . ARG A 1 24 ? 5.205   -3.197  -14.430 1.00 0.00 ? 22 ARG P HH21 5  
ATOM 5158  H HH22 . ARG A 1 24 ? 3.548   -3.627  -14.731 1.00 0.00 ? 22 ARG P HH22 5  
ATOM 5159  N N    . ASN A 1 25 ? 6.642   3.238   -9.547  1.00 0.00 ? 23 ASN P N    5  
ATOM 5160  C CA   . ASN A 1 25 ? 6.410   4.622   -9.108  1.00 0.00 ? 23 ASN P CA   5  
ATOM 5161  C C    . ASN A 1 25 ? 7.617   5.179   -8.328  1.00 0.00 ? 23 ASN P C    5  
ATOM 5162  O O    . ASN A 1 25 ? 8.000   6.335   -8.516  1.00 0.00 ? 23 ASN P O    5  
ATOM 5163  C CB   . ASN A 1 25 ? 5.108   4.650   -8.287  1.00 0.00 ? 23 ASN P CB   5  
ATOM 5164  C CG   . ASN A 1 25 ? 4.551   6.040   -8.024  1.00 0.00 ? 23 ASN P CG   5  
ATOM 5165  O OD1  . ASN A 1 25 ? 4.968   7.048   -8.577  1.00 0.00 ? 23 ASN P OD1  5  
ATOM 5166  N ND2  . ASN A 1 25 ? 3.555   6.130   -7.175  1.00 0.00 ? 23 ASN P ND2  5  
ATOM 5167  H H    . ASN A 1 25 ? 6.381   2.491   -8.918  1.00 0.00 ? 23 ASN P H    5  
ATOM 5168  H HA   . ASN A 1 25 ? 6.272   5.254   -9.987  1.00 0.00 ? 23 ASN P HA   5  
ATOM 5169  H HB2  . ASN A 1 25 ? 4.336   4.085   -8.812  1.00 0.00 ? 23 ASN P HB2  5  
ATOM 5170  H HB3  . ASN A 1 25 ? 5.279   4.172   -7.324  1.00 0.00 ? 23 ASN P HB3  5  
ATOM 5171  H HD21 . ASN A 1 25 ? 3.210   5.295   -6.725  1.00 0.00 ? 23 ASN P HD21 5  
ATOM 5172  H HD22 . ASN A 1 25 ? 3.142   7.033   -7.017  1.00 0.00 ? 23 ASN P HD22 5  
ATOM 5173  N N    . ARG A 1 26 ? 8.252   4.326   -7.506  1.00 0.00 ? 24 ARG P N    5  
ATOM 5174  C CA   . ARG A 1 26 ? 9.517   4.518   -6.754  1.00 0.00 ? 24 ARG P CA   5  
ATOM 5175  C C    . ARG A 1 26 ? 9.520   5.603   -5.665  1.00 0.00 ? 24 ARG P C    5  
ATOM 5176  O O    . ARG A 1 26 ? 10.189  5.425   -4.648  1.00 0.00 ? 24 ARG P O    5  
ATOM 5177  C CB   . ARG A 1 26 ? 10.703  4.684   -7.726  1.00 0.00 ? 24 ARG P CB   5  
ATOM 5178  C CG   . ARG A 1 26 ? 10.851  3.503   -8.698  1.00 0.00 ? 24 ARG P CG   5  
ATOM 5179  C CD   . ARG A 1 26 ? 12.021  3.708   -9.666  1.00 0.00 ? 24 ARG P CD   5  
ATOM 5180  N NE   . ARG A 1 26 ? 12.079  2.597   -10.632 1.00 0.00 ? 24 ARG P NE   5  
ATOM 5181  C CZ   . ARG A 1 26 ? 12.928  2.432   -11.626 1.00 0.00 ? 24 ARG P CZ   5  
ATOM 5182  N NH1  . ARG A 1 26 ? 13.887  3.278   -11.874 1.00 0.00 ? 24 ARG P NH1  5  
ATOM 5183  N NH2  . ARG A 1 26 ? 12.816  1.389   -12.397 1.00 0.00 ? 24 ARG P NH2  5  
ATOM 5184  H H    . ARG A 1 26 ? 7.800   3.422   -7.399  1.00 0.00 ? 24 ARG P H    5  
ATOM 5185  H HA   . ARG A 1 26 ? 9.703   3.597   -6.204  1.00 0.00 ? 24 ARG P HA   5  
ATOM 5186  H HB2  . ARG A 1 26 ? 10.576  5.601   -8.301  1.00 0.00 ? 24 ARG P HB2  5  
ATOM 5187  H HB3  . ARG A 1 26 ? 11.624  4.773   -7.146  1.00 0.00 ? 24 ARG P HB3  5  
ATOM 5188  H HG2  . ARG A 1 26 ? 11.019  2.588   -8.130  1.00 0.00 ? 24 ARG P HG2  5  
ATOM 5189  H HG3  . ARG A 1 26 ? 9.940   3.393   -9.284  1.00 0.00 ? 24 ARG P HG3  5  
ATOM 5190  H HD2  . ARG A 1 26 ? 11.879  4.650   -10.199 1.00 0.00 ? 24 ARG P HD2  5  
ATOM 5191  H HD3  . ARG A 1 26 ? 12.952  3.755   -9.096  1.00 0.00 ? 24 ARG P HD3  5  
ATOM 5192  H HE   . ARG A 1 26 ? 11.371  1.877   -10.539 1.00 0.00 ? 24 ARG P HE   5  
ATOM 5193  H HH11 . ARG A 1 26 ? 13.989  4.089   -11.288 1.00 0.00 ? 24 ARG P HH11 5  
ATOM 5194  H HH12 . ARG A 1 26 ? 14.521  3.127   -12.641 1.00 0.00 ? 24 ARG P HH12 5  
ATOM 5195  H HH21 . ARG A 1 26 ? 12.079  0.723   -12.225 1.00 0.00 ? 24 ARG P HH21 5  
ATOM 5196  H HH22 . ARG A 1 26 ? 13.454  1.246   -13.161 1.00 0.00 ? 24 ARG P HH22 5  
ATOM 5197  N N    . TYR A 1 27 ? 8.757   6.682   -5.839  1.00 0.00 ? 25 TYR P N    5  
ATOM 5198  C CA   . TYR A 1 27 ? 8.678   7.833   -4.929  1.00 0.00 ? 25 TYR P CA   5  
ATOM 5199  C C    . TYR A 1 27 ? 7.220   8.275   -4.638  1.00 0.00 ? 25 TYR P C    5  
ATOM 5200  O O    . TYR A 1 27 ? 6.885   9.449   -4.838  1.00 0.00 ? 25 TYR P O    5  
ATOM 5201  C CB   . TYR A 1 27 ? 9.548   8.970   -5.502  1.00 0.00 ? 25 TYR P CB   5  
ATOM 5202  C CG   . TYR A 1 27 ? 10.995  8.590   -5.776  1.00 0.00 ? 25 TYR P CG   5  
ATOM 5203  C CD1  . TYR A 1 27 ? 11.950  8.656   -4.743  1.00 0.00 ? 25 TYR P CD1  5  
ATOM 5204  C CD2  . TYR A 1 27 ? 11.379  8.156   -7.061  1.00 0.00 ? 25 TYR P CD2  5  
ATOM 5205  C CE1  . TYR A 1 27 ? 13.288  8.292   -4.994  1.00 0.00 ? 25 TYR P CE1  5  
ATOM 5206  C CE2  . TYR A 1 27 ? 12.716  7.791   -7.317  1.00 0.00 ? 25 TYR P CE2  5  
ATOM 5207  C CZ   . TYR A 1 27 ? 13.675  7.860   -6.282  1.00 0.00 ? 25 TYR P CZ   5  
ATOM 5208  O OH   . TYR A 1 27 ? 14.971  7.511   -6.516  1.00 0.00 ? 25 TYR P OH   5  
ATOM 5209  H H    . TYR A 1 27 ? 8.284   6.758   -6.730  1.00 0.00 ? 25 TYR P H    5  
ATOM 5210  H HA   . TYR A 1 27 ? 9.107   7.552   -3.967  1.00 0.00 ? 25 TYR P HA   5  
ATOM 5211  H HB2  . TYR A 1 27 ? 9.100   9.324   -6.432  1.00 0.00 ? 25 TYR P HB2  5  
ATOM 5212  H HB3  . TYR A 1 27 ? 9.543   9.805   -4.800  1.00 0.00 ? 25 TYR P HB3  5  
ATOM 5213  H HD1  . TYR A 1 27 ? 11.656  8.981   -3.754  1.00 0.00 ? 25 TYR P HD1  5  
ATOM 5214  H HD2  . TYR A 1 27 ? 10.641  8.087   -7.850  1.00 0.00 ? 25 TYR P HD2  5  
ATOM 5215  H HE1  . TYR A 1 27 ? 14.025  8.340   -4.206  1.00 0.00 ? 25 TYR P HE1  5  
ATOM 5216  H HE2  . TYR A 1 27 ? 13.007  7.458   -8.303  1.00 0.00 ? 25 TYR P HE2  5  
ATOM 5217  H HH   . TYR A 1 27 ? 15.119  7.237   -7.438  1.00 0.00 ? 25 TYR P HH   5  
ATOM 5218  N N    . PRO A 1 28 ? 6.319   7.372   -4.184  1.00 0.00 ? 26 PRO P N    5  
ATOM 5219  C CA   . PRO A 1 28 ? 4.946   7.733   -3.821  1.00 0.00 ? 26 PRO P CA   5  
ATOM 5220  C C    . PRO A 1 28 ? 4.907   8.703   -2.628  1.00 0.00 ? 26 PRO P C    5  
ATOM 5221  O O    . PRO A 1 28 ? 5.641   8.532   -1.650  1.00 0.00 ? 26 PRO P O    5  
ATOM 5222  C CB   . PRO A 1 28 ? 4.238   6.410   -3.506  1.00 0.00 ? 26 PRO P CB   5  
ATOM 5223  C CG   . PRO A 1 28 ? 5.369   5.481   -3.073  1.00 0.00 ? 26 PRO P CG   5  
ATOM 5224  C CD   . PRO A 1 28 ? 6.554   5.959   -3.908  1.00 0.00 ? 26 PRO P CD   5  
ATOM 5225  H HA   . PRO A 1 28 ? 4.453   8.204   -4.672  1.00 0.00 ? 26 PRO P HA   5  
ATOM 5226  H HB2  . PRO A 1 28 ? 3.487   6.514   -2.723  1.00 0.00 ? 26 PRO P HB2  5  
ATOM 5227  H HB3  . PRO A 1 28 ? 3.780   6.017   -4.413  1.00 0.00 ? 26 PRO P HB3  5  
ATOM 5228  H HG2  . PRO A 1 28 ? 5.583   5.621   -2.014  1.00 0.00 ? 26 PRO P HG2  5  
ATOM 5229  H HG3  . PRO A 1 28 ? 5.132   4.439   -3.285  1.00 0.00 ? 26 PRO P HG3  5  
ATOM 5230  H HD2  . PRO A 1 28 ? 7.483   5.806   -3.356  1.00 0.00 ? 26 PRO P HD2  5  
ATOM 5231  H HD3  . PRO A 1 28 ? 6.575   5.405   -4.847  1.00 0.00 ? 26 PRO P HD3  5  
ATOM 5232  N N    . ASP A 1 29 ? 4.026   9.702   -2.685  1.00 0.00 ? 27 ASP P N    5  
ATOM 5233  C CA   . ASP A 1 29 ? 3.795   10.673  -1.604  1.00 0.00 ? 27 ASP P CA   5  
ATOM 5234  C C    . ASP A 1 29 ? 2.988   10.050  -0.446  1.00 0.00 ? 27 ASP P C    5  
ATOM 5235  O O    . ASP A 1 29 ? 2.340   9.020   -0.625  1.00 0.00 ? 27 ASP P O    5  
ATOM 5236  C CB   . ASP A 1 29 ? 3.089   11.900  -2.205  1.00 0.00 ? 27 ASP P CB   5  
ATOM 5237  C CG   . ASP A 1 29 ? 2.871   13.013  -1.172  1.00 0.00 ? 27 ASP P CG   5  
ATOM 5238  O OD1  . ASP A 1 29 ? 3.840   13.747  -0.861  1.00 0.00 ? 27 ASP P OD1  5  
ATOM 5239  O OD2  . ASP A 1 29 ? 1.745   13.117  -0.635  1.00 0.00 ? 27 ASP P OD2  5  
ATOM 5240  H H    . ASP A 1 29 ? 3.405   9.748   -3.484  1.00 0.00 ? 27 ASP P H    5  
ATOM 5241  H HA   . ASP A 1 29 ? 4.758   10.996  -1.206  1.00 0.00 ? 27 ASP P HA   5  
ATOM 5242  H HB2  . ASP A 1 29 ? 3.691   12.290  -3.028  1.00 0.00 ? 27 ASP P HB2  5  
ATOM 5243  H HB3  . ASP A 1 29 ? 2.125   11.594  -2.614  1.00 0.00 ? 27 ASP P HB3  5  
ATOM 5244  N N    . MET A 1 30 ? 2.969   10.670  0.740   1.00 0.00 ? 28 MET P N    5  
ATOM 5245  C CA   . MET A 1 30 ? 2.130   10.223  1.865   1.00 0.00 ? 28 MET P CA   5  
ATOM 5246  C C    . MET A 1 30 ? 0.641   10.096  1.489   1.00 0.00 ? 28 MET P C    5  
ATOM 5247  O O    . MET A 1 30 ? -0.012  9.141   1.914   1.00 0.00 ? 28 MET P O    5  
ATOM 5248  C CB   . MET A 1 30 ? 2.279   11.181  3.058   1.00 0.00 ? 28 MET P CB   5  
ATOM 5249  C CG   . MET A 1 30 ? 3.686   11.205  3.671   1.00 0.00 ? 28 MET P CG   5  
ATOM 5250  S SD   . MET A 1 30 ? 4.281   9.613   4.318   1.00 0.00 ? 28 MET P SD   5  
ATOM 5251  C CE   . MET A 1 30 ? 5.515   9.205   3.054   1.00 0.00 ? 28 MET P CE   5  
ATOM 5252  H H    . MET A 1 30 ? 3.494   11.528  0.850   1.00 0.00 ? 28 MET P H    5  
ATOM 5253  H HA   . MET A 1 30 ? 2.462   9.231   2.173   1.00 0.00 ? 28 MET P HA   5  
ATOM 5254  H HB2  . MET A 1 30 ? 2.015   12.192  2.744   1.00 0.00 ? 28 MET P HB2  5  
ATOM 5255  H HB3  . MET A 1 30 ? 1.579   10.879  3.839   1.00 0.00 ? 28 MET P HB3  5  
ATOM 5256  H HG2  . MET A 1 30 ? 4.395   11.581  2.933   1.00 0.00 ? 28 MET P HG2  5  
ATOM 5257  H HG3  . MET A 1 30 ? 3.674   11.916  4.497   1.00 0.00 ? 28 MET P HG3  5  
ATOM 5258  H HE1  . MET A 1 30 ? 6.290   9.973   3.034   1.00 0.00 ? 28 MET P HE1  5  
ATOM 5259  H HE2  . MET A 1 30 ? 5.974   8.245   3.289   1.00 0.00 ? 28 MET P HE2  5  
ATOM 5260  H HE3  . MET A 1 30 ? 5.039   9.151   2.075   1.00 0.00 ? 28 MET P HE3  5  
ATOM 5261  N N    . SER A 1 31 ? 0.110   10.985  0.640   1.00 0.00 ? 29 SER P N    5  
ATOM 5262  C CA   . SER A 1 31 ? -1.261  10.874  0.114   1.00 0.00 ? 29 SER P CA   5  
ATOM 5263  C C    . SER A 1 31 ? -1.419  9.697   -0.857  1.00 0.00 ? 29 SER P C    5  
ATOM 5264  O O    . SER A 1 31 ? -2.427  8.994   -0.809  1.00 0.00 ? 29 SER P O    5  
ATOM 5265  C CB   . SER A 1 31 ? -1.686  12.175  -0.576  1.00 0.00 ? 29 SER P CB   5  
ATOM 5266  O OG   . SER A 1 31 ? -1.759  13.235  0.367   1.00 0.00 ? 29 SER P OG   5  
ATOM 5267  H H    . SER A 1 31 ? 0.683   11.765  0.324   1.00 0.00 ? 29 SER P H    5  
ATOM 5268  H HA   . SER A 1 31 ? -1.944  10.702  0.946   1.00 0.00 ? 29 SER P HA   5  
ATOM 5269  H HB2  . SER A 1 31 ? -0.971  12.423  -1.363  1.00 0.00 ? 29 SER P HB2  5  
ATOM 5270  H HB3  . SER A 1 31 ? -2.669  12.034  -1.029  1.00 0.00 ? 29 SER P HB3  5  
ATOM 5271  H HG   . SER A 1 31 ? -1.998  14.055  -0.108  1.00 0.00 ? 29 SER P HG   5  
ATOM 5272  N N    . THR A 1 32 ? -0.411  9.414   -1.692  1.00 0.00 ? 30 THR P N    5  
ATOM 5273  C CA   . THR A 1 32 ? -0.385  8.227   -2.569  1.00 0.00 ? 30 THR P CA   5  
ATOM 5274  C C    . THR A 1 32 ? -0.374  6.936   -1.743  1.00 0.00 ? 30 THR P C    5  
ATOM 5275  O O    . THR A 1 32 ? -1.130  6.011   -2.034  1.00 0.00 ? 30 THR P O    5  
ATOM 5276  C CB   . THR A 1 32 ? 0.853   8.233   -3.485  1.00 0.00 ? 30 THR P CB   5  
ATOM 5277  O OG1  . THR A 1 32 ? 1.092   9.506   -4.046  1.00 0.00 ? 30 THR P OG1  5  
ATOM 5278  C CG2  . THR A 1 32 ? 0.732   7.242   -4.641  1.00 0.00 ? 30 THR P CG2  5  
ATOM 5279  H H    . THR A 1 32 ? 0.408   10.007  -1.685  1.00 0.00 ? 30 THR P H    5  
ATOM 5280  H HA   . THR A 1 32 ? -1.280  8.225   -3.189  1.00 0.00 ? 30 THR P HA   5  
ATOM 5281  H HB   . THR A 1 32 ? 1.728   7.966   -2.896  1.00 0.00 ? 30 THR P HB   5  
ATOM 5282  H HG1  . THR A 1 32 ? 0.329   9.737   -4.605  1.00 0.00 ? 30 THR P HG1  5  
ATOM 5283  H HG21 . THR A 1 32 ? 1.605   7.329   -5.286  1.00 0.00 ? 30 THR P HG21 5  
ATOM 5284  H HG22 . THR A 1 32 ? -0.168  7.449   -5.223  1.00 0.00 ? 30 THR P HG22 5  
ATOM 5285  H HG23 . THR A 1 32 ? 0.682   6.223   -4.257  1.00 0.00 ? 30 THR P HG23 5  
ATOM 5286  N N    . ARG A 1 33 ? 0.438   6.891   -0.677  1.00 0.00 ? 31 ARG P N    5  
ATOM 5287  C CA   . ARG A 1 33 ? 0.548   5.749   0.247   1.00 0.00 ? 31 ARG P CA   5  
ATOM 5288  C C    . ARG A 1 33 ? -0.756  5.510   1.012   1.00 0.00 ? 31 ARG P C    5  
ATOM 5289  O O    . ARG A 1 33 ? -1.167  4.365   1.164   1.00 0.00 ? 31 ARG P O    5  
ATOM 5290  C CB   . ARG A 1 33 ? 1.739   5.946   1.200   1.00 0.00 ? 31 ARG P CB   5  
ATOM 5291  C CG   . ARG A 1 33 ? 3.075   5.909   0.440   1.00 0.00 ? 31 ARG P CG   5  
ATOM 5292  C CD   . ARG A 1 33 ? 4.276   6.146   1.363   1.00 0.00 ? 31 ARG P CD   5  
ATOM 5293  N NE   . ARG A 1 33 ? 5.404   6.715   0.599   1.00 0.00 ? 31 ARG P NE   5  
ATOM 5294  C CZ   . ARG A 1 33 ? 6.697   6.562   0.797   1.00 0.00 ? 31 ARG P CZ   5  
ATOM 5295  N NH1  . ARG A 1 33 ? 7.186   5.822   1.750   1.00 0.00 ? 31 ARG P NH1  5  
ATOM 5296  N NH2  . ARG A 1 33 ? 7.525   7.192   0.018   1.00 0.00 ? 31 ARG P NH2  5  
ATOM 5297  H H    . ARG A 1 33 ? 1.033   7.699   -0.513  1.00 0.00 ? 31 ARG P H    5  
ATOM 5298  H HA   . ARG A 1 33 ? 0.733   4.846   -0.334  1.00 0.00 ? 31 ARG P HA   5  
ATOM 5299  H HB2  . ARG A 1 33 ? 1.636   6.902   1.717   1.00 0.00 ? 31 ARG P HB2  5  
ATOM 5300  H HB3  . ARG A 1 33 ? 1.737   5.152   1.947   1.00 0.00 ? 31 ARG P HB3  5  
ATOM 5301  H HG2  . ARG A 1 33 ? 3.190   4.947   -0.057  1.00 0.00 ? 31 ARG P HG2  5  
ATOM 5302  H HG3  . ARG A 1 33 ? 3.070   6.677   -0.327  1.00 0.00 ? 31 ARG P HG3  5  
ATOM 5303  H HD2  . ARG A 1 33 ? 3.995   6.851   2.148   1.00 0.00 ? 31 ARG P HD2  5  
ATOM 5304  H HD3  . ARG A 1 33 ? 4.550   5.199   1.830   1.00 0.00 ? 31 ARG P HD3  5  
ATOM 5305  H HE   . ARG A 1 33 ? 5.169   7.337   -0.165  1.00 0.00 ? 31 ARG P HE   5  
ATOM 5306  H HH11 . ARG A 1 33 ? 6.555   5.328   2.354   1.00 0.00 ? 31 ARG P HH11 5  
ATOM 5307  H HH12 . ARG A 1 33 ? 8.179   5.742   1.872   1.00 0.00 ? 31 ARG P HH12 5  
ATOM 5308  H HH21 . ARG A 1 33 ? 7.139   7.794   -0.701  1.00 0.00 ? 31 ARG P HH21 5  
ATOM 5309  H HH22 . ARG A 1 33 ? 8.520   7.116   0.144   1.00 0.00 ? 31 ARG P HH22 5  
ATOM 5310  N N    . GLU A 1 34 ? -1.444  6.572   1.430   1.00 0.00 ? 32 GLU P N    5  
ATOM 5311  C CA   . GLU A 1 34 ? -2.763  6.481   2.070   1.00 0.00 ? 32 GLU P CA   5  
ATOM 5312  C C    . GLU A 1 34 ? -3.862  5.994   1.103   1.00 0.00 ? 32 GLU P C    5  
ATOM 5313  O O    . GLU A 1 34 ? -4.712  5.193   1.497   1.00 0.00 ? 32 GLU P O    5  
ATOM 5314  C CB   . GLU A 1 34 ? -3.107  7.845   2.692   1.00 0.00 ? 32 GLU P CB   5  
ATOM 5315  C CG   . GLU A 1 34 ? -4.383  7.815   3.542   1.00 0.00 ? 32 GLU P CG   5  
ATOM 5316  C CD   . GLU A 1 34 ? -4.643  9.188   4.193   1.00 0.00 ? 32 GLU P CD   5  
ATOM 5317  O OE1  . GLU A 1 34 ? -4.129  9.445   5.309   1.00 0.00 ? 32 GLU P OE1  5  
ATOM 5318  O OE2  . GLU A 1 34 ? -5.372  10.019  3.599   1.00 0.00 ? 32 GLU P OE2  5  
ATOM 5319  H H    . GLU A 1 34 ? -1.020  7.486   1.326   1.00 0.00 ? 32 GLU P H    5  
ATOM 5320  H HA   . GLU A 1 34 ? -2.700  5.744   2.873   1.00 0.00 ? 32 GLU P HA   5  
ATOM 5321  H HB2  . GLU A 1 34 ? -2.280  8.154   3.333   1.00 0.00 ? 32 GLU P HB2  5  
ATOM 5322  H HB3  . GLU A 1 34 ? -3.223  8.585   1.899   1.00 0.00 ? 32 GLU P HB3  5  
ATOM 5323  H HG2  . GLU A 1 34 ? -5.233  7.541   2.913   1.00 0.00 ? 32 GLU P HG2  5  
ATOM 5324  H HG3  . GLU A 1 34 ? -4.280  7.049   4.314   1.00 0.00 ? 32 GLU P HG3  5  
ATOM 5325  N N    . GLU A 1 35 ? -3.828  6.396   -0.173  1.00 0.00 ? 33 GLU P N    5  
ATOM 5326  C CA   . GLU A 1 35 ? -4.760  5.881   -1.187  1.00 0.00 ? 33 GLU P CA   5  
ATOM 5327  C C    . GLU A 1 35 ? -4.520  4.393   -1.486  1.00 0.00 ? 33 GLU P C    5  
ATOM 5328  O O    . GLU A 1 35 ? -5.466  3.606   -1.438  1.00 0.00 ? 33 GLU P O    5  
ATOM 5329  C CB   . GLU A 1 35 ? -4.690  6.711   -2.478  1.00 0.00 ? 33 GLU P CB   5  
ATOM 5330  C CG   . GLU A 1 35 ? -5.361  8.087   -2.364  1.00 0.00 ? 33 GLU P CG   5  
ATOM 5331  C CD   . GLU A 1 35 ? -6.896  7.983   -2.257  1.00 0.00 ? 33 GLU P CD   5  
ATOM 5332  O OE1  . GLU A 1 35 ? -7.574  7.833   -3.303  1.00 0.00 ? 33 GLU P OE1  5  
ATOM 5333  O OE2  . GLU A 1 35 ? -7.440  8.073   -1.130  1.00 0.00 ? 33 GLU P OE2  5  
ATOM 5334  H H    . GLU A 1 35 ? -3.139  7.086   -0.452  1.00 0.00 ? 33 GLU P H    5  
ATOM 5335  H HA   . GLU A 1 35 ? -5.775  5.953   -0.795  1.00 0.00 ? 33 GLU P HA   5  
ATOM 5336  H HB2  . GLU A 1 35 ? -3.646  6.844   -2.765  1.00 0.00 ? 33 GLU P HB2  5  
ATOM 5337  H HB3  . GLU A 1 35 ? -5.184  6.157   -3.276  1.00 0.00 ? 33 GLU P HB3  5  
ATOM 5338  H HG2  . GLU A 1 35 ? -4.960  8.621   -1.499  1.00 0.00 ? 33 GLU P HG2  5  
ATOM 5339  H HG3  . GLU A 1 35 ? -5.101  8.670   -3.252  1.00 0.00 ? 33 GLU P HG3  5  
ATOM 5340  N N    . ILE A 1 36 ? -3.271  3.959   -1.708  1.00 0.00 ? 34 ILE P N    5  
ATOM 5341  C CA   . ILE A 1 36 ? -3.000  2.527   -1.926  1.00 0.00 ? 34 ILE P CA   5  
ATOM 5342  C C    . ILE A 1 36 ? -3.240  1.687   -0.661  1.00 0.00 ? 34 ILE P C    5  
ATOM 5343  O O    . ILE A 1 36 ? -3.551  0.503   -0.781  1.00 0.00 ? 34 ILE P O    5  
ATOM 5344  C CB   . ILE A 1 36 ? -1.640  2.250   -2.611  1.00 0.00 ? 34 ILE P CB   5  
ATOM 5345  C CG1  . ILE A 1 36 ? -0.375  2.570   -1.797  1.00 0.00 ? 34 ILE P CG1  5  
ATOM 5346  C CG2  . ILE A 1 36 ? -1.545  3.009   -3.945  1.00 0.00 ? 34 ILE P CG2  5  
ATOM 5347  C CD1  . ILE A 1 36 ? -0.043  1.557   -0.701  1.00 0.00 ? 34 ILE P CD1  5  
ATOM 5348  H H    . ILE A 1 36 ? -2.507  4.625   -1.752  1.00 0.00 ? 34 ILE P H    5  
ATOM 5349  H HA   . ILE A 1 36 ? -3.748  2.181   -2.638  1.00 0.00 ? 34 ILE P HA   5  
ATOM 5350  H HB   . ILE A 1 36 ? -1.616  1.188   -2.848  1.00 0.00 ? 34 ILE P HB   5  
ATOM 5351  H HG12 . ILE A 1 36 ? 0.482   2.593   -2.472  1.00 0.00 ? 34 ILE P HG12 5  
ATOM 5352  H HG13 . ILE A 1 36 ? -0.485  3.554   -1.360  1.00 0.00 ? 34 ILE P HG13 5  
ATOM 5353  H HG21 . ILE A 1 36 ? -1.476  4.082   -3.767  1.00 0.00 ? 34 ILE P HG21 5  
ATOM 5354  H HG22 . ILE A 1 36 ? -0.657  2.687   -4.491  1.00 0.00 ? 34 ILE P HG22 5  
ATOM 5355  H HG23 . ILE A 1 36 ? -2.421  2.801   -4.556  1.00 0.00 ? 34 ILE P HG23 5  
ATOM 5356  H HD11 . ILE A 1 36 ? 1.000   1.681   -0.416  1.00 0.00 ? 34 ILE P HD11 5  
ATOM 5357  H HD12 . ILE A 1 36 ? -0.660  1.728   0.177   1.00 0.00 ? 34 ILE P HD12 5  
ATOM 5358  H HD13 . ILE A 1 36 ? -0.192  0.541   -1.066  1.00 0.00 ? 34 ILE P HD13 5  
ATOM 5359  N N    . ALA A 1 37 ? -3.193  2.280   0.539   1.00 0.00 ? 35 ALA P N    5  
ATOM 5360  C CA   . ALA A 1 37 ? -3.556  1.610   1.789   1.00 0.00 ? 35 ALA P CA   5  
ATOM 5361  C C    . ALA A 1 37 ? -5.046  1.222   1.812   1.00 0.00 ? 35 ALA P C    5  
ATOM 5362  O O    . ALA A 1 37 ? -5.370  0.064   2.060   1.00 0.00 ? 35 ALA P O    5  
ATOM 5363  C CB   . ALA A 1 37 ? -3.179  2.489   2.991   1.00 0.00 ? 35 ALA P CB   5  
ATOM 5364  H H    . ALA A 1 37 ? -2.858  3.233   0.587   1.00 0.00 ? 35 ALA P H    5  
ATOM 5365  H HA   . ALA A 1 37 ? -2.980  0.686   1.864   1.00 0.00 ? 35 ALA P HA   5  
ATOM 5366  H HB1  . ALA A 1 37 ? -2.136  2.792   2.931   1.00 0.00 ? 35 ALA P HB1  5  
ATOM 5367  H HB2  . ALA A 1 37 ? -3.810  3.374   3.032   1.00 0.00 ? 35 ALA P HB2  5  
ATOM 5368  H HB3  . ALA A 1 37 ? -3.316  1.921   3.909   1.00 0.00 ? 35 ALA P HB3  5  
ATOM 5369  N N    . VAL A 1 38 ? -5.967  2.135   1.474   1.00 0.00 ? 36 VAL P N    5  
ATOM 5370  C CA   . VAL A 1 38 ? -7.405  1.806   1.408   1.00 0.00 ? 36 VAL P CA   5  
ATOM 5371  C C    . VAL A 1 38 ? -7.746  0.868   0.240   1.00 0.00 ? 36 VAL P C    5  
ATOM 5372  O O    . VAL A 1 38 ? -8.658  0.049   0.371   1.00 0.00 ? 36 VAL P O    5  
ATOM 5373  C CB   . VAL A 1 38 ? -8.319  3.050   1.432   1.00 0.00 ? 36 VAL P CB   5  
ATOM 5374  C CG1  . VAL A 1 38 ? -8.148  3.834   2.736   1.00 0.00 ? 36 VAL P CG1  5  
ATOM 5375  C CG2  . VAL A 1 38 ? -8.102  4.029   0.279   1.00 0.00 ? 36 VAL P CG2  5  
ATOM 5376  H H    . VAL A 1 38 ? -5.667  3.078   1.268   1.00 0.00 ? 36 VAL P H    5  
ATOM 5377  H HA   . VAL A 1 38 ? -7.647  1.245   2.310   1.00 0.00 ? 36 VAL P HA   5  
ATOM 5378  H HB   . VAL A 1 38 ? -9.352  2.704   1.387   1.00 0.00 ? 36 VAL P HB   5  
ATOM 5379  H HG11 . VAL A 1 38 ? -8.322  3.178   3.589   1.00 0.00 ? 36 VAL P HG11 5  
ATOM 5380  H HG12 . VAL A 1 38 ? -7.143  4.251   2.796   1.00 0.00 ? 36 VAL P HG12 5  
ATOM 5381  H HG13 . VAL A 1 38 ? -8.870  4.650   2.762   1.00 0.00 ? 36 VAL P HG13 5  
ATOM 5382  H HG21 . VAL A 1 38 ? -7.117  4.482   0.360   1.00 0.00 ? 36 VAL P HG21 5  
ATOM 5383  H HG22 . VAL A 1 38 ? -8.190  3.514   -0.672  1.00 0.00 ? 36 VAL P HG22 5  
ATOM 5384  H HG23 . VAL A 1 38 ? -8.855  4.816   0.321   1.00 0.00 ? 36 VAL P HG23 5  
ATOM 5385  N N    . TRP A 1 39 ? -6.987  0.902   -0.863  1.00 0.00 ? 37 TRP P N    5  
ATOM 5386  C CA   . TRP A 1 39 ? -7.154  -0.024  -1.999  1.00 0.00 ? 37 TRP P CA   5  
ATOM 5387  C C    . TRP A 1 39 ? -6.646  -1.448  -1.696  1.00 0.00 ? 37 TRP P C    5  
ATOM 5388  O O    . TRP A 1 39 ? -7.242  -2.424  -2.156  1.00 0.00 ? 37 TRP P O    5  
ATOM 5389  C CB   . TRP A 1 39 ? -6.457  0.547   -3.246  1.00 0.00 ? 37 TRP P CB   5  
ATOM 5390  C CG   . TRP A 1 39 ? -6.867  1.913   -3.718  1.00 0.00 ? 37 TRP P CG   5  
ATOM 5391  C CD1  . TRP A 1 39 ? -7.935  2.615   -3.283  1.00 0.00 ? 37 TRP P CD1  5  
ATOM 5392  C CD2  . TRP A 1 39 ? -6.194  2.785   -4.681  1.00 0.00 ? 37 TRP P CD2  5  
ATOM 5393  N NE1  . TRP A 1 39 ? -7.944  3.872   -3.855  1.00 0.00 ? 37 TRP P NE1  5  
ATOM 5394  C CE2  . TRP A 1 39 ? -6.898  4.027   -4.740  1.00 0.00 ? 37 TRP P CE2  5  
ATOM 5395  C CE3  . TRP A 1 39 ? -5.055  2.655   -5.507  1.00 0.00 ? 37 TRP P CE3  5  
ATOM 5396  C CZ2  . TRP A 1 39 ? -6.488  5.087   -5.564  1.00 0.00 ? 37 TRP P CZ2  5  
ATOM 5397  C CZ3  . TRP A 1 39 ? -4.635  3.713   -6.338  1.00 0.00 ? 37 TRP P CZ3  5  
ATOM 5398  C CH2  . TRP A 1 39 ? -5.345  4.927   -6.366  1.00 0.00 ? 37 TRP P CH2  5  
ATOM 5399  H H    . TRP A 1 39 ? -6.309  1.651   -0.955  1.00 0.00 ? 37 TRP P H    5  
ATOM 5400  H HA   . TRP A 1 39 ? -8.218  -0.113  -2.227  1.00 0.00 ? 37 TRP P HA   5  
ATOM 5401  H HB2  . TRP A 1 39 ? -5.392  0.592   -3.037  1.00 0.00 ? 37 TRP P HB2  5  
ATOM 5402  H HB3  . TRP A 1 39 ? -6.602  -0.149  -4.074  1.00 0.00 ? 37 TRP P HB3  5  
ATOM 5403  H HD1  . TRP A 1 39 ? -8.629  2.259   -2.537  1.00 0.00 ? 37 TRP P HD1  5  
ATOM 5404  H HE1  . TRP A 1 39 ? -8.605  4.596   -3.593  1.00 0.00 ? 37 TRP P HE1  5  
ATOM 5405  H HE3  . TRP A 1 39 ? -4.501  1.728   -5.493  1.00 0.00 ? 37 TRP P HE3  5  
ATOM 5406  H HZ2  . TRP A 1 39 ? -7.043  6.014   -5.572  1.00 0.00 ? 37 TRP P HZ2  5  
ATOM 5407  H HZ3  . TRP A 1 39 ? -3.756  3.593   -6.959  1.00 0.00 ? 37 TRP P HZ3  5  
ATOM 5408  H HH2  . TRP A 1 39 ? -5.012  5.736   -7.005  1.00 0.00 ? 37 TRP P HH2  5  
ATOM 5409  N N    . THR A 1 40 ? -5.585  -1.584  -0.889  1.00 0.00 ? 38 THR P N    5  
ATOM 5410  C CA   . THR A 1 40 ? -5.057  -2.878  -0.394  1.00 0.00 ? 38 THR P CA   5  
ATOM 5411  C C    . THR A 1 40 ? -5.713  -3.356  0.909   1.00 0.00 ? 38 THR P C    5  
ATOM 5412  O O    . THR A 1 40 ? -5.454  -4.476  1.347   1.00 0.00 ? 38 THR P O    5  
ATOM 5413  C CB   . THR A 1 40 ? -3.527  -2.850  -0.213  1.00 0.00 ? 38 THR P CB   5  
ATOM 5414  O OG1  . THR A 1 40 ? -3.122  -1.792  0.620   1.00 0.00 ? 38 THR P OG1  5  
ATOM 5415  C CG2  . THR A 1 40 ? -2.776  -2.727  -1.538  1.00 0.00 ? 38 THR P CG2  5  
ATOM 5416  H H    . THR A 1 40 ? -5.109  -0.740  -0.593  1.00 0.00 ? 38 THR P H    5  
ATOM 5417  H HA   . THR A 1 40 ? -5.273  -3.646  -1.136  1.00 0.00 ? 38 THR P HA   5  
ATOM 5418  H HB   . THR A 1 40 ? -3.211  -3.782  0.254   1.00 0.00 ? 38 THR P HB   5  
ATOM 5419  H HG1  . THR A 1 40 ? -3.201  -0.974  0.095   1.00 0.00 ? 38 THR P HG1  5  
ATOM 5420  H HG21 . THR A 1 40 ? -3.011  -3.584  -2.169  1.00 0.00 ? 38 THR P HG21 5  
ATOM 5421  H HG22 . THR A 1 40 ? -1.702  -2.714  -1.348  1.00 0.00 ? 38 THR P HG22 5  
ATOM 5422  H HG23 . THR A 1 40 ? -3.061  -1.812  -2.058  1.00 0.00 ? 38 THR P HG23 5  
ATOM 5423  N N    . ASN A 1 41 ? -6.581  -2.542  1.519   1.00 0.00 ? 39 ASN P N    5  
ATOM 5424  C CA   . ASN A 1 41 ? -7.180  -2.738  2.846   1.00 0.00 ? 39 ASN P CA   5  
ATOM 5425  C C    . ASN A 1 41 ? -6.136  -2.905  3.977   1.00 0.00 ? 39 ASN P C    5  
ATOM 5426  O O    . ASN A 1 41 ? -6.149  -3.869  4.748   1.00 0.00 ? 39 ASN P O    5  
ATOM 5427  C CB   . ASN A 1 41 ? -8.252  -3.845  2.784   1.00 0.00 ? 39 ASN P CB   5  
ATOM 5428  C CG   . ASN A 1 41 ? -9.177  -3.860  3.994   1.00 0.00 ? 39 ASN P CG   5  
ATOM 5429  O OD1  . ASN A 1 41 ? -9.250  -2.932  4.789   1.00 0.00 ? 39 ASN P OD1  5  
ATOM 5430  N ND2  . ASN A 1 41 ? -9.950  -4.911  4.156   1.00 0.00 ? 39 ASN P ND2  5  
ATOM 5431  H H    . ASN A 1 41 ? -6.719  -1.636  1.094   1.00 0.00 ? 39 ASN P H    5  
ATOM 5432  H HA   . ASN A 1 41 ? -7.690  -1.794  3.064   1.00 0.00 ? 39 ASN P HA   5  
ATOM 5433  H HB2  . ASN A 1 41 ? -8.868  -3.707  1.895   1.00 0.00 ? 39 ASN P HB2  5  
ATOM 5434  H HB3  . ASN A 1 41 ? -7.754  -4.812  2.713   1.00 0.00 ? 39 ASN P HB3  5  
ATOM 5435  H HD21 . ASN A 1 41 ? -9.911  -5.678  3.502   1.00 0.00 ? 39 ASN P HD21 5  
ATOM 5436  H HD22 . ASN A 1 41 ? -10.575 -4.930  4.947   1.00 0.00 ? 39 ASN P HD22 5  
ATOM 5437  N N    . LEU A 1 42 ? -5.219  -1.941  4.052   1.00 0.00 ? 40 LEU P N    5  
ATOM 5438  C CA   . LEU A 1 42 ? -4.198  -1.746  5.086   1.00 0.00 ? 40 LEU P CA   5  
ATOM 5439  C C    . LEU A 1 42 ? -4.341  -0.353  5.727   1.00 0.00 ? 40 LEU P C    5  
ATOM 5440  O O    . LEU A 1 42 ? -5.085  0.500   5.235   1.00 0.00 ? 40 LEU P O    5  
ATOM 5441  C CB   . LEU A 1 42 ? -2.806  -1.894  4.439   1.00 0.00 ? 40 LEU P CB   5  
ATOM 5442  C CG   . LEU A 1 42 ? -2.476  -3.295  3.894   1.00 0.00 ? 40 LEU P CG   5  
ATOM 5443  C CD1  . LEU A 1 42 ? -1.121  -3.251  3.189   1.00 0.00 ? 40 LEU P CD1  5  
ATOM 5444  C CD2  . LEU A 1 42 ? -2.402  -4.327  5.019   1.00 0.00 ? 40 LEU P CD2  5  
ATOM 5445  H H    . LEU A 1 42 ? -5.284  -1.206  3.354   1.00 0.00 ? 40 LEU P H    5  
ATOM 5446  H HA   . LEU A 1 42 ? -4.316  -2.485  5.879   1.00 0.00 ? 40 LEU P HA   5  
ATOM 5447  H HB2  . LEU A 1 42 ? -2.735  -1.182  3.616   1.00 0.00 ? 40 LEU P HB2  5  
ATOM 5448  H HB3  . LEU A 1 42 ? -2.041  -1.626  5.169   1.00 0.00 ? 40 LEU P HB3  5  
ATOM 5449  H HG   . LEU A 1 42 ? -3.229  -3.603  3.169   1.00 0.00 ? 40 LEU P HG   5  
ATOM 5450  H HD11 . LEU A 1 42 ? -1.166  -2.542  2.362   1.00 0.00 ? 40 LEU P HD11 5  
ATOM 5451  H HD12 . LEU A 1 42 ? -0.884  -4.234  2.790   1.00 0.00 ? 40 LEU P HD12 5  
ATOM 5452  H HD13 . LEU A 1 42 ? -0.343  -2.939  3.884   1.00 0.00 ? 40 LEU P HD13 5  
ATOM 5453  H HD21 . LEU A 1 42 ? -3.397  -4.482  5.439   1.00 0.00 ? 40 LEU P HD21 5  
ATOM 5454  H HD22 . LEU A 1 42 ? -1.720  -3.988  5.799   1.00 0.00 ? 40 LEU P HD22 5  
ATOM 5455  H HD23 . LEU A 1 42 ? -2.048  -5.279  4.626   1.00 0.00 ? 40 LEU P HD23 5  
ATOM 5456  N N    . THR A 1 43 ? -3.605  -0.100  6.813   1.00 0.00 ? 41 THR P N    5  
ATOM 5457  C CA   . THR A 1 43 ? -3.446  1.254   7.372   1.00 0.00 ? 41 THR P CA   5  
ATOM 5458  C C    . THR A 1 43 ? -2.242  1.944   6.731   1.00 0.00 ? 41 THR P C    5  
ATOM 5459  O O    . THR A 1 43 ? -1.260  1.297   6.357   1.00 0.00 ? 41 THR P O    5  
ATOM 5460  C CB   . THR A 1 43 ? -3.330  1.276   8.905   1.00 0.00 ? 41 THR P CB   5  
ATOM 5461  O OG1  . THR A 1 43 ? -2.180  0.590   9.365   1.00 0.00 ? 41 THR P OG1  5  
ATOM 5462  C CG2  . THR A 1 43 ? -4.540  0.641   9.585   1.00 0.00 ? 41 THR P CG2  5  
ATOM 5463  H H    . THR A 1 43 ? -2.996  -0.821  7.169   1.00 0.00 ? 41 THR P H    5  
ATOM 5464  H HA   . THR A 1 43 ? -4.325  1.849   7.123   1.00 0.00 ? 41 THR P HA   5  
ATOM 5465  H HB   . THR A 1 43 ? -3.263  2.317   9.224   1.00 0.00 ? 41 THR P HB   5  
ATOM 5466  H HG1  . THR A 1 43 ? -1.893  1.048   10.177  1.00 0.00 ? 41 THR P HG1  5  
ATOM 5467  H HG21 . THR A 1 43 ? -5.451  1.129   9.239   1.00 0.00 ? 41 THR P HG21 5  
ATOM 5468  H HG22 . THR A 1 43 ? -4.463  0.774   10.664  1.00 0.00 ? 41 THR P HG22 5  
ATOM 5469  H HG23 . THR A 1 43 ? -4.592  -0.422  9.355   1.00 0.00 ? 41 THR P HG23 5  
ATOM 5470  N N    . GLU A 1 44 ? -2.275  3.271   6.620   1.00 0.00 ? 42 GLU P N    5  
ATOM 5471  C CA   . GLU A 1 44 ? -1.151  4.051   6.084   1.00 0.00 ? 42 GLU P CA   5  
ATOM 5472  C C    . GLU A 1 44 ? 0.132   3.897   6.917   1.00 0.00 ? 42 GLU P C    5  
ATOM 5473  O O    . GLU A 1 44 ? 1.228   3.960   6.364   1.00 0.00 ? 42 GLU P O    5  
ATOM 5474  C CB   . GLU A 1 44 ? -1.544  5.528   5.907   1.00 0.00 ? 42 GLU P CB   5  
ATOM 5475  C CG   . GLU A 1 44 ? -1.727  6.356   7.194   1.00 0.00 ? 42 GLU P CG   5  
ATOM 5476  C CD   . GLU A 1 44 ? -2.773  5.785   8.176   1.00 0.00 ? 42 GLU P CD   5  
ATOM 5477  O OE1  . GLU A 1 44 ? -3.873  5.371   7.738   1.00 0.00 ? 42 GLU P OE1  5  
ATOM 5478  O OE2  . GLU A 1 44 ? -2.477  5.711   9.391   1.00 0.00 ? 42 GLU P OE2  5  
ATOM 5479  H H    . GLU A 1 44 ? -3.101  3.779   6.930   1.00 0.00 ? 42 GLU P H    5  
ATOM 5480  H HA   . GLU A 1 44 ? -0.926  3.665   5.090   1.00 0.00 ? 42 GLU P HA   5  
ATOM 5481  H HB2  . GLU A 1 44 ? -0.755  6.001   5.323   1.00 0.00 ? 42 GLU P HB2  5  
ATOM 5482  H HB3  . GLU A 1 44 ? -2.459  5.575   5.316   1.00 0.00 ? 42 GLU P HB3  5  
ATOM 5483  H HG2  . GLU A 1 44 ? -0.757  6.438   7.691   1.00 0.00 ? 42 GLU P HG2  5  
ATOM 5484  H HG3  . GLU A 1 44 ? -2.024  7.367   6.909   1.00 0.00 ? 42 GLU P HG3  5  
ATOM 5485  N N    . ALA A 1 45 ? 0.014   3.617   8.220   1.00 0.00 ? 43 ALA P N    5  
ATOM 5486  C CA   . ALA A 1 45 ? 1.153   3.312   9.082   1.00 0.00 ? 43 ALA P CA   5  
ATOM 5487  C C    . ALA A 1 45 ? 1.793   1.948   8.748   1.00 0.00 ? 43 ALA P C    5  
ATOM 5488  O O    . ALA A 1 45 ? 3.017   1.864   8.640   1.00 0.00 ? 43 ALA P O    5  
ATOM 5489  C CB   . ALA A 1 45 ? 0.698   3.395   10.543  1.00 0.00 ? 43 ALA P CB   5  
ATOM 5490  H H    . ALA A 1 45 ? -0.910  3.612   8.629   1.00 0.00 ? 43 ALA P H    5  
ATOM 5491  H HA   . ALA A 1 45 ? 1.909   4.080   8.916   1.00 0.00 ? 43 ALA P HA   5  
ATOM 5492  H HB1  . ALA A 1 45 ? 1.550   3.219   11.202  1.00 0.00 ? 43 ALA P HB1  5  
ATOM 5493  H HB2  . ALA A 1 45 ? 0.293   4.387   10.751  1.00 0.00 ? 43 ALA P HB2  5  
ATOM 5494  H HB3  . ALA A 1 45 ? -0.068  2.645   10.746  1.00 0.00 ? 43 ALA P HB3  5  
ATOM 5495  N N    . ARG A 1 46 ? 0.989   0.898   8.503   1.00 0.00 ? 44 ARG P N    5  
ATOM 5496  C CA   . ARG A 1 46 ? 1.488   -0.414  8.037   1.00 0.00 ? 44 ARG P CA   5  
ATOM 5497  C C    . ARG A 1 46 ? 2.165   -0.301  6.673   1.00 0.00 ? 44 ARG P C    5  
ATOM 5498  O O    . ARG A 1 46 ? 3.241   -0.861  6.476   1.00 0.00 ? 44 ARG P O    5  
ATOM 5499  C CB   . ARG A 1 46 ? 0.346   -1.441  7.996   1.00 0.00 ? 44 ARG P CB   5  
ATOM 5500  C CG   . ARG A 1 46 ? 0.018   -1.963  9.399   1.00 0.00 ? 44 ARG P CG   5  
ATOM 5501  C CD   . ARG A 1 46 ? -1.239  -2.840  9.348   1.00 0.00 ? 44 ARG P CD   5  
ATOM 5502  N NE   . ARG A 1 46 ? -1.609  -3.370  10.676  1.00 0.00 ? 44 ARG P NE   5  
ATOM 5503  C CZ   . ARG A 1 46 ? -2.162  -2.704  11.674  1.00 0.00 ? 44 ARG P CZ   5  
ATOM 5504  N NH1  . ARG A 1 46 ? -2.486  -1.445  11.571  1.00 0.00 ? 44 ARG P NH1  5  
ATOM 5505  N NH2  . ARG A 1 46 ? -2.417  -3.291  12.808  1.00 0.00 ? 44 ARG P NH2  5  
ATOM 5506  H H    . ARG A 1 46 ? -0.013  1.033   8.577   1.00 0.00 ? 44 ARG P H    5  
ATOM 5507  H HA   . ARG A 1 46 ? 2.247   -0.779  8.729   1.00 0.00 ? 44 ARG P HA   5  
ATOM 5508  H HB2  . ARG A 1 46 ? -0.538  -0.991  7.545   1.00 0.00 ? 44 ARG P HB2  5  
ATOM 5509  H HB3  . ARG A 1 46 ? 0.646   -2.291  7.382   1.00 0.00 ? 44 ARG P HB3  5  
ATOM 5510  H HG2  . ARG A 1 46 ? 0.859   -2.551  9.772   1.00 0.00 ? 44 ARG P HG2  5  
ATOM 5511  H HG3  . ARG A 1 46 ? -0.145  -1.122  10.072  1.00 0.00 ? 44 ARG P HG3  5  
ATOM 5512  H HD2  . ARG A 1 46 ? -2.059  -2.250  8.939   1.00 0.00 ? 44 ARG P HD2  5  
ATOM 5513  H HD3  . ARG A 1 46 ? -1.056  -3.678  8.673   1.00 0.00 ? 44 ARG P HD3  5  
ATOM 5514  H HE   . ARG A 1 46 ? -1.440  -4.359  10.826  1.00 0.00 ? 44 ARG P HE   5  
ATOM 5515  H HH11 . ARG A 1 46 ? -2.344  -0.971  10.690  1.00 0.00 ? 44 ARG P HH11 5  
ATOM 5516  H HH12 . ARG A 1 46 ? -2.906  -0.961  12.344  1.00 0.00 ? 44 ARG P HH12 5  
ATOM 5517  H HH21 . ARG A 1 46 ? -2.290  -4.291  12.908  1.00 0.00 ? 44 ARG P HH21 5  
ATOM 5518  H HH22 . ARG A 1 46 ? -2.830  -2.775  13.565  1.00 0.00 ? 44 ARG P HH22 5  
ATOM 5519  N N    . VAL A 1 47 ? 1.591   0.485   5.763   1.00 0.00 ? 45 VAL P N    5  
ATOM 5520  C CA   . VAL A 1 47 ? 2.189   0.799   4.455   1.00 0.00 ? 45 VAL P CA   5  
ATOM 5521  C C    . VAL A 1 47 ? 3.514   1.557   4.608   1.00 0.00 ? 45 VAL P C    5  
ATOM 5522  O O    . VAL A 1 47 ? 4.514   1.156   4.014   1.00 0.00 ? 45 VAL P O    5  
ATOM 5523  C CB   . VAL A 1 47 ? 1.173   1.566   3.585   1.00 0.00 ? 45 VAL P CB   5  
ATOM 5524  C CG1  . VAL A 1 47 ? 1.790   2.163   2.319   1.00 0.00 ? 45 VAL P CG1  5  
ATOM 5525  C CG2  . VAL A 1 47 ? 0.043   0.618   3.163   1.00 0.00 ? 45 VAL P CG2  5  
ATOM 5526  H H    . VAL A 1 47 ? 0.684   0.880   5.995   1.00 0.00 ? 45 VAL P H    5  
ATOM 5527  H HA   . VAL A 1 47 ? 2.425   -0.136  3.946   1.00 0.00 ? 45 VAL P HA   5  
ATOM 5528  H HB   . VAL A 1 47 ? 0.748   2.384   4.164   1.00 0.00 ? 45 VAL P HB   5  
ATOM 5529  H HG11 . VAL A 1 47 ? 2.549   2.900   2.576   1.00 0.00 ? 45 VAL P HG11 5  
ATOM 5530  H HG12 . VAL A 1 47 ? 2.235   1.370   1.716   1.00 0.00 ? 45 VAL P HG12 5  
ATOM 5531  H HG13 . VAL A 1 47 ? 1.016   2.673   1.749   1.00 0.00 ? 45 VAL P HG13 5  
ATOM 5532  H HG21 . VAL A 1 47 ? 0.451   -0.251  2.648   1.00 0.00 ? 45 VAL P HG21 5  
ATOM 5533  H HG22 . VAL A 1 47 ? -0.516  0.284   4.037   1.00 0.00 ? 45 VAL P HG22 5  
ATOM 5534  H HG23 . VAL A 1 47 ? -0.640  1.133   2.493   1.00 0.00 ? 45 VAL P HG23 5  
ATOM 5535  N N    . ARG A 1 48 ? 3.574   2.601   5.447   1.00 0.00 ? 46 ARG P N    5  
ATOM 5536  C CA   . ARG A 1 48 ? 4.803   3.370   5.714   1.00 0.00 ? 46 ARG P CA   5  
ATOM 5537  C C    . ARG A 1 48 ? 5.916   2.493   6.302   1.00 0.00 ? 46 ARG P C    5  
ATOM 5538  O O    . ARG A 1 48 ? 7.064   2.613   5.880   1.00 0.00 ? 46 ARG P O    5  
ATOM 5539  C CB   . ARG A 1 48 ? 4.449   4.562   6.620   1.00 0.00 ? 46 ARG P CB   5  
ATOM 5540  C CG   . ARG A 1 48 ? 5.616   5.546   6.807   1.00 0.00 ? 46 ARG P CG   5  
ATOM 5541  C CD   . ARG A 1 48 ? 5.223   6.729   7.703   1.00 0.00 ? 46 ARG P CD   5  
ATOM 5542  N NE   . ARG A 1 48 ? 4.191   7.585   7.078   1.00 0.00 ? 46 ARG P NE   5  
ATOM 5543  C CZ   . ARG A 1 48 ? 2.944   7.778   7.476   1.00 0.00 ? 46 ARG P CZ   5  
ATOM 5544  N NH1  . ARG A 1 48 ? 2.450   7.214   8.542   1.00 0.00 ? 46 ARG P NH1  5  
ATOM 5545  N NH2  . ARG A 1 48 ? 2.161   8.562   6.795   1.00 0.00 ? 46 ARG P NH2  5  
ATOM 5546  H H    . ARG A 1 48 ? 2.713   2.912   5.891   1.00 0.00 ? 46 ARG P H    5  
ATOM 5547  H HA   . ARG A 1 48 ? 5.179   3.759   4.766   1.00 0.00 ? 46 ARG P HA   5  
ATOM 5548  H HB2  . ARG A 1 48 ? 3.617   5.100   6.166   1.00 0.00 ? 46 ARG P HB2  5  
ATOM 5549  H HB3  . ARG A 1 48 ? 4.130   4.194   7.597   1.00 0.00 ? 46 ARG P HB3  5  
ATOM 5550  H HG2  . ARG A 1 48 ? 6.455   5.030   7.273   1.00 0.00 ? 46 ARG P HG2  5  
ATOM 5551  H HG3  . ARG A 1 48 ? 5.935   5.922   5.834   1.00 0.00 ? 46 ARG P HG3  5  
ATOM 5552  H HD2  . ARG A 1 48 ? 4.891   6.343   8.668   1.00 0.00 ? 46 ARG P HD2  5  
ATOM 5553  H HD3  . ARG A 1 48 ? 6.115   7.334   7.882   1.00 0.00 ? 46 ARG P HD3  5  
ATOM 5554  H HE   . ARG A 1 48 ? 4.472   8.096   6.255   1.00 0.00 ? 46 ARG P HE   5  
ATOM 5555  H HH11 . ARG A 1 48 ? 3.045   6.640   9.111   1.00 0.00 ? 46 ARG P HH11 5  
ATOM 5556  H HH12 . ARG A 1 48 ? 1.505   7.403   8.830   1.00 0.00 ? 46 ARG P HH12 5  
ATOM 5557  H HH21 . ARG A 1 48 ? 2.509   9.026   5.972   1.00 0.00 ? 46 ARG P HH21 5  
ATOM 5558  H HH22 . ARG A 1 48 ? 1.215   8.726   7.097   1.00 0.00 ? 46 ARG P HH22 5  
ATOM 5559  N N    . VAL A 1 49 ? 5.575   1.562   7.199   1.00 0.00 ? 47 VAL P N    5  
ATOM 5560  C CA   . VAL A 1 49 ? 6.507   0.538   7.706   1.00 0.00 ? 47 VAL P CA   5  
ATOM 5561  C C    . VAL A 1 49 ? 6.946   -0.416  6.590   1.00 0.00 ? 47 VAL P C    5  
ATOM 5562  O O    . VAL A 1 49 ? 8.136   -0.709  6.490   1.00 0.00 ? 47 VAL P O    5  
ATOM 5563  C CB   . VAL A 1 49 ? 5.895   -0.220  8.905   1.00 0.00 ? 47 VAL P CB   5  
ATOM 5564  C CG1  . VAL A 1 49 ? 6.706   -1.455  9.321   1.00 0.00 ? 47 VAL P CG1  5  
ATOM 5565  C CG2  . VAL A 1 49 ? 5.824   0.703   10.131  1.00 0.00 ? 47 VAL P CG2  5  
ATOM 5566  H H    . VAL A 1 49 ? 4.615   1.554   7.533   1.00 0.00 ? 47 VAL P H    5  
ATOM 5567  H HA   . VAL A 1 49 ? 7.411   1.035   8.059   1.00 0.00 ? 47 VAL P HA   5  
ATOM 5568  H HB   . VAL A 1 49 ? 4.887   -0.545  8.651   1.00 0.00 ? 47 VAL P HB   5  
ATOM 5569  H HG11 . VAL A 1 49 ? 6.279   -1.893  10.222  1.00 0.00 ? 47 VAL P HG11 5  
ATOM 5570  H HG12 . VAL A 1 49 ? 6.676   -2.211  8.536   1.00 0.00 ? 47 VAL P HG12 5  
ATOM 5571  H HG13 . VAL A 1 49 ? 7.744   -1.176  9.515   1.00 0.00 ? 47 VAL P HG13 5  
ATOM 5572  H HG21 . VAL A 1 49 ? 6.828   0.988   10.445  1.00 0.00 ? 47 VAL P HG21 5  
ATOM 5573  H HG22 . VAL A 1 49 ? 5.262   1.605   9.897   1.00 0.00 ? 47 VAL P HG22 5  
ATOM 5574  H HG23 . VAL A 1 49 ? 5.322   0.189   10.951  1.00 0.00 ? 47 VAL P HG23 5  
ATOM 5575  N N    . TRP A 1 50 ? 6.046   -0.851  5.701   1.00 0.00 ? 48 TRP P N    5  
ATOM 5576  C CA   . TRP A 1 50 ? 6.380   -1.747  4.586   1.00 0.00 ? 48 TRP P CA   5  
ATOM 5577  C C    . TRP A 1 50 ? 7.426   -1.145  3.630   1.00 0.00 ? 48 TRP P C    5  
ATOM 5578  O O    . TRP A 1 50 ? 8.380   -1.829  3.259   1.00 0.00 ? 48 TRP P O    5  
ATOM 5579  C CB   . TRP A 1 50 ? 5.108   -2.157  3.831   1.00 0.00 ? 48 TRP P CB   5  
ATOM 5580  C CG   . TRP A 1 50 ? 5.298   -3.305  2.889   1.00 0.00 ? 48 TRP P CG   5  
ATOM 5581  C CD1  . TRP A 1 50 ? 4.981   -4.592  3.155   1.00 0.00 ? 48 TRP P CD1  5  
ATOM 5582  C CD2  . TRP A 1 50 ? 5.856   -3.303  1.535   1.00 0.00 ? 48 TRP P CD2  5  
ATOM 5583  N NE1  . TRP A 1 50 ? 5.307   -5.385  2.071   1.00 0.00 ? 48 TRP P NE1  5  
ATOM 5584  C CE2  . TRP A 1 50 ? 5.856   -4.645  1.046   1.00 0.00 ? 48 TRP P CE2  5  
ATOM 5585  C CE3  . TRP A 1 50 ? 6.361   -2.306  0.670   1.00 0.00 ? 48 TRP P CE3  5  
ATOM 5586  C CZ2  . TRP A 1 50 ? 6.341   -4.983  -0.226  1.00 0.00 ? 48 TRP P CZ2  5  
ATOM 5587  C CZ3  . TRP A 1 50 ? 6.863   -2.636  -0.603  1.00 0.00 ? 48 TRP P CZ3  5  
ATOM 5588  C CH2  . TRP A 1 50 ? 6.855   -3.969  -1.052  1.00 0.00 ? 48 TRP P CH2  5  
ATOM 5589  H H    . TRP A 1 50 ? 5.071   -0.601  5.835   1.00 0.00 ? 48 TRP P H    5  
ATOM 5590  H HA   . TRP A 1 50 ? 6.810   -2.655  5.005   1.00 0.00 ? 48 TRP P HA   5  
ATOM 5591  H HB2  . TRP A 1 50 ? 4.344   -2.440  4.557   1.00 0.00 ? 48 TRP P HB2  5  
ATOM 5592  H HB3  . TRP A 1 50 ? 4.727   -1.308  3.264   1.00 0.00 ? 48 TRP P HB3  5  
ATOM 5593  H HD1  . TRP A 1 50 ? 4.539   -4.945  4.081   1.00 0.00 ? 48 TRP P HD1  5  
ATOM 5594  H HE1  . TRP A 1 50 ? 5.162   -6.386  2.056   1.00 0.00 ? 48 TRP P HE1  5  
ATOM 5595  H HE3  . TRP A 1 50 ? 6.359   -1.275  0.990   1.00 0.00 ? 48 TRP P HE3  5  
ATOM 5596  H HZ2  . TRP A 1 50 ? 6.321   -6.010  -0.565  1.00 0.00 ? 48 TRP P HZ2  5  
ATOM 5597  H HZ3  . TRP A 1 50 ? 7.250   -1.854  -1.240  1.00 0.00 ? 48 TRP P HZ3  5  
ATOM 5598  H HH2  . TRP A 1 50 ? 7.241   -4.212  -2.032  1.00 0.00 ? 48 TRP P HH2  5  
ATOM 5599  N N    . PHE A 1 51 ? 7.321   0.151   3.302   1.00 0.00 ? 49 PHE P N    5  
ATOM 5600  C CA   . PHE A 1 51 ? 8.303   0.864   2.466   1.00 0.00 ? 49 PHE P CA   5  
ATOM 5601  C C    . PHE A 1 51 ? 9.716   0.932   3.078   1.00 0.00 ? 49 PHE P C    5  
ATOM 5602  O O    . PHE A 1 51 ? 10.683  1.126   2.334   1.00 0.00 ? 49 PHE P O    5  
ATOM 5603  C CB   . PHE A 1 51 ? 7.781   2.272   2.126   1.00 0.00 ? 49 PHE P CB   5  
ATOM 5604  C CG   . PHE A 1 51 ? 6.852   2.318   0.926   1.00 0.00 ? 49 PHE P CG   5  
ATOM 5605  C CD1  . PHE A 1 51 ? 7.385   2.246   -0.376  1.00 0.00 ? 49 PHE P CD1  5  
ATOM 5606  C CD2  . PHE A 1 51 ? 5.461   2.442   1.096   1.00 0.00 ? 49 PHE P CD2  5  
ATOM 5607  C CE1  . PHE A 1 51 ? 6.533   2.273   -1.496  1.00 0.00 ? 49 PHE P CE1  5  
ATOM 5608  C CE2  . PHE A 1 51 ? 4.608   2.460   -0.021  1.00 0.00 ? 49 PHE P CE2  5  
ATOM 5609  C CZ   . PHE A 1 51 ? 5.142   2.374   -1.317  1.00 0.00 ? 49 PHE P CZ   5  
ATOM 5610  H H    . PHE A 1 51 ? 6.501   0.655   3.620   1.00 0.00 ? 49 PHE P H    5  
ATOM 5611  H HA   . PHE A 1 51 ? 8.414   0.313   1.531   1.00 0.00 ? 49 PHE P HA   5  
ATOM 5612  H HB2  . PHE A 1 51 ? 7.286   2.701   2.999   1.00 0.00 ? 49 PHE P HB2  5  
ATOM 5613  H HB3  . PHE A 1 51 ? 8.631   2.917   1.897   1.00 0.00 ? 49 PHE P HB3  5  
ATOM 5614  H HD1  . PHE A 1 51 ? 8.454   2.171   -0.519  1.00 0.00 ? 49 PHE P HD1  5  
ATOM 5615  H HD2  . PHE A 1 51 ? 5.043   2.523   2.084   1.00 0.00 ? 49 PHE P HD2  5  
ATOM 5616  H HE1  . PHE A 1 51 ? 6.945   2.214   -2.495  1.00 0.00 ? 49 PHE P HE1  5  
ATOM 5617  H HE2  . PHE A 1 51 ? 3.539   2.540   0.111   1.00 0.00 ? 49 PHE P HE2  5  
ATOM 5618  H HZ   . PHE A 1 51 ? 4.481   2.395   -2.171  1.00 0.00 ? 49 PHE P HZ   5  
ATOM 5619  N N    . LYS A 1 52 ? 9.863   0.748   4.399   1.00 0.00 ? 50 LYS P N    5  
ATOM 5620  C CA   . LYS A 1 52 ? 11.159  0.565   5.086   1.00 0.00 ? 50 LYS P CA   5  
ATOM 5621  C C    . LYS A 1 52 ? 11.538  -0.918  5.199   1.00 0.00 ? 50 LYS P C    5  
ATOM 5622  O O    . LYS A 1 52 ? 12.680  -1.285  4.934   1.00 0.00 ? 50 LYS P O    5  
ATOM 5623  C CB   . LYS A 1 52 ? 11.129  1.240   6.473   1.00 0.00 ? 50 LYS P CB   5  
ATOM 5624  C CG   . LYS A 1 52 ? 11.513  2.730   6.468   1.00 0.00 ? 50 LYS P CG   5  
ATOM 5625  C CD   . LYS A 1 52 ? 10.584  3.627   5.633   1.00 0.00 ? 50 LYS P CD   5  
ATOM 5626  C CE   . LYS A 1 52 ? 10.829  5.123   5.888   1.00 0.00 ? 50 LYS P CE   5  
ATOM 5627  N NZ   . LYS A 1 52 ? 12.173  5.575   5.432   1.00 0.00 ? 50 LYS P NZ   5  
ATOM 5628  H H    . LYS A 1 52 ? 9.017   0.635   4.947   1.00 0.00 ? 50 LYS P H    5  
ATOM 5629  H HA   . LYS A 1 52 ? 11.952  1.030   4.500   1.00 0.00 ? 50 LYS P HA   5  
ATOM 5630  H HB2  . LYS A 1 52 ? 10.144  1.119   6.927   1.00 0.00 ? 50 LYS P HB2  5  
ATOM 5631  H HB3  . LYS A 1 52 ? 11.847  0.734   7.121   1.00 0.00 ? 50 LYS P HB3  5  
ATOM 5632  H HG2  . LYS A 1 52 ? 11.495  3.080   7.502   1.00 0.00 ? 50 LYS P HG2  5  
ATOM 5633  H HG3  . LYS A 1 52 ? 12.534  2.824   6.096   1.00 0.00 ? 50 LYS P HG3  5  
ATOM 5634  H HD2  . LYS A 1 52 ? 10.714  3.413   4.571   1.00 0.00 ? 50 LYS P HD2  5  
ATOM 5635  H HD3  . LYS A 1 52 ? 9.553   3.407   5.905   1.00 0.00 ? 50 LYS P HD3  5  
ATOM 5636  H HE2  . LYS A 1 52 ? 10.055  5.692   5.364   1.00 0.00 ? 50 LYS P HE2  5  
ATOM 5637  H HE3  . LYS A 1 52 ? 10.711  5.320   6.957   1.00 0.00 ? 50 LYS P HE3  5  
ATOM 5638  H HZ1  . LYS A 1 52 ? 12.303  5.411   4.443   1.00 0.00 ? 50 LYS P HZ1  5  
ATOM 5639  H HZ2  . LYS A 1 52 ? 12.913  5.101   5.932   1.00 0.00 ? 50 LYS P HZ2  5  
ATOM 5640  H HZ3  . LYS A 1 52 ? 12.292  6.567   5.593   1.00 0.00 ? 50 LYS P HZ3  5  
ATOM 5641  N N    . ASN A 1 53 ? 10.581  -1.788  5.517   1.00 0.00 ? 51 ASN P N    5  
ATOM 5642  C CA   . ASN A 1 53 ? 10.781  -3.234  5.652   1.00 0.00 ? 51 ASN P CA   5  
ATOM 5643  C C    . ASN A 1 53 ? 11.294  -3.882  4.349   1.00 0.00 ? 51 ASN P C    5  
ATOM 5644  O O    . ASN A 1 53 ? 12.195  -4.722  4.389   1.00 0.00 ? 51 ASN P O    5  
ATOM 5645  C CB   . ASN A 1 53 ? 9.449   -3.846  6.116   1.00 0.00 ? 51 ASN P CB   5  
ATOM 5646  C CG   . ASN A 1 53 ? 9.574   -5.310  6.490   1.00 0.00 ? 51 ASN P CG   5  
ATOM 5647  O OD1  . ASN A 1 53 ? 9.210   -6.201  5.738   1.00 0.00 ? 51 ASN P OD1  5  
ATOM 5648  N ND2  . ASN A 1 53 ? 10.092  -5.605  7.662   1.00 0.00 ? 51 ASN P ND2  5  
ATOM 5649  H H    . ASN A 1 53 ? 9.667   -1.413  5.739   1.00 0.00 ? 51 ASN P H    5  
ATOM 5650  H HA   . ASN A 1 53 ? 11.535  -3.408  6.423   1.00 0.00 ? 51 ASN P HA   5  
ATOM 5651  H HB2  . ASN A 1 53 ? 9.077   -3.302  6.985   1.00 0.00 ? 51 ASN P HB2  5  
ATOM 5652  H HB3  . ASN A 1 53 ? 8.713   -3.762  5.318   1.00 0.00 ? 51 ASN P HB3  5  
ATOM 5653  H HD21 . ASN A 1 53 ? 10.369  -4.871  8.295   1.00 0.00 ? 51 ASN P HD21 5  
ATOM 5654  H HD22 . ASN A 1 53 ? 10.154  -6.572  7.934   1.00 0.00 ? 51 ASN P HD22 5  
ATOM 5655  N N    . ARG A 1 54 ? 10.791  -3.441  3.186   1.00 0.00 ? 52 ARG P N    5  
ATOM 5656  C CA   . ARG A 1 54 ? 11.172  -3.971  1.866   1.00 0.00 ? 52 ARG P CA   5  
ATOM 5657  C C    . ARG A 1 54 ? 12.630  -3.686  1.481   1.00 0.00 ? 52 ARG P C    5  
ATOM 5658  O O    . ARG A 1 54 ? 13.237  -4.520  0.803   1.00 0.00 ? 52 ARG P O    5  
ATOM 5659  C CB   . ARG A 1 54 ? 10.174  -3.442  0.812   1.00 0.00 ? 52 ARG P CB   5  
ATOM 5660  C CG   . ARG A 1 54 ? 10.423  -3.958  -0.618  1.00 0.00 ? 52 ARG P CG   5  
ATOM 5661  C CD   . ARG A 1 54 ? 10.356  -5.491  -0.713  1.00 0.00 ? 52 ARG P CD   5  
ATOM 5662  N NE   . ARG A 1 54 ? 10.761  -5.983  -2.040  1.00 0.00 ? 52 ARG P NE   5  
ATOM 5663  C CZ   . ARG A 1 54 ? 11.985  -6.118  -2.511  1.00 0.00 ? 52 ARG P CZ   5  
ATOM 5664  N NH1  . ARG A 1 54 ? 13.056  -5.755  -1.859  1.00 0.00 ? 52 ARG P NH1  5  
ATOM 5665  N NH2  . ARG A 1 54 ? 12.128  -6.650  -3.686  1.00 0.00 ? 52 ARG P NH2  5  
ATOM 5666  H H    . ARG A 1 54 ? 10.021  -2.776  3.232   1.00 0.00 ? 52 ARG P H    5  
ATOM 5667  H HA   . ARG A 1 54 ? 11.082  -5.056  1.922   1.00 0.00 ? 52 ARG P HA   5  
ATOM 5668  H HB2  . ARG A 1 54 ? 9.165   -3.730  1.110   1.00 0.00 ? 52 ARG P HB2  5  
ATOM 5669  H HB3  . ARG A 1 54 ? 10.217  -2.352  0.794   1.00 0.00 ? 52 ARG P HB3  5  
ATOM 5670  H HG2  . ARG A 1 54 ? 9.675   -3.529  -1.284  1.00 0.00 ? 52 ARG P HG2  5  
ATOM 5671  H HG3  . ARG A 1 54 ? 11.397  -3.610  -0.960  1.00 0.00 ? 52 ARG P HG3  5  
ATOM 5672  H HD2  . ARG A 1 54 ? 11.005  -5.948  0.033   1.00 0.00 ? 52 ARG P HD2  5  
ATOM 5673  H HD3  . ARG A 1 54 ? 9.332   -5.810  -0.507  1.00 0.00 ? 52 ARG P HD3  5  
ATOM 5674  H HE   . ARG A 1 54 ? 10.036  -6.340  -2.657  1.00 0.00 ? 52 ARG P HE   5  
ATOM 5675  H HH11 . ARG A 1 54 ? 12.975  -5.351  -0.932  1.00 0.00 ? 52 ARG P HH11 5  
ATOM 5676  H HH12 . ARG A 1 54 ? 13.962  -5.878  -2.273  1.00 0.00 ? 52 ARG P HH12 5  
ATOM 5677  H HH21 . ARG A 1 54 ? 11.274  -6.971  -4.146  1.00 0.00 ? 52 ARG P HH21 5  
ATOM 5678  H HH22 . ARG A 1 54 ? 13.032  -6.795  -4.098  1.00 0.00 ? 52 ARG P HH22 5  
ATOM 5679  N N    . ARG A 1 55 ? 13.207  -2.561  1.930   1.00 0.00 ? 53 ARG P N    5  
ATOM 5680  C CA   . ARG A 1 55 ? 14.636  -2.227  1.729   1.00 0.00 ? 53 ARG P CA   5  
ATOM 5681  C C    . ARG A 1 55 ? 15.540  -2.738  2.858   1.00 0.00 ? 53 ARG P C    5  
ATOM 5682  O O    . ARG A 1 55 ? 16.689  -3.097  2.603   1.00 0.00 ? 53 ARG P O    5  
ATOM 5683  C CB   . ARG A 1 55 ? 14.809  -0.732  1.399   1.00 0.00 ? 53 ARG P CB   5  
ATOM 5684  C CG   . ARG A 1 55 ? 14.709  0.220   2.603   1.00 0.00 ? 53 ARG P CG   5  
ATOM 5685  C CD   . ARG A 1 55 ? 14.638  1.686   2.162   1.00 0.00 ? 53 ARG P CD   5  
ATOM 5686  N NE   . ARG A 1 55 ? 13.310  1.998   1.597   1.00 0.00 ? 53 ARG P NE   5  
ATOM 5687  C CZ   . ARG A 1 55 ? 13.011  2.801   0.596   1.00 0.00 ? 53 ARG P CZ   5  
ATOM 5688  N NH1  . ARG A 1 55 ? 13.906  3.485   -0.058  1.00 0.00 ? 53 ARG P NH1  5  
ATOM 5689  N NH2  . ARG A 1 55 ? 11.764  2.920   0.246   1.00 0.00 ? 53 ARG P NH2  5  
ATOM 5690  H H    . ARG A 1 55 ? 12.627  -1.930  2.463   1.00 0.00 ? 53 ARG P H    5  
ATOM 5691  H HA   . ARG A 1 55 ? 14.972  -2.758  0.836   1.00 0.00 ? 53 ARG P HA   5  
ATOM 5692  H HB2  . ARG A 1 55 ? 15.789  -0.589  0.940   1.00 0.00 ? 53 ARG P HB2  5  
ATOM 5693  H HB3  . ARG A 1 55 ? 14.060  -0.458  0.654   1.00 0.00 ? 53 ARG P HB3  5  
ATOM 5694  H HG2  . ARG A 1 55 ? 13.815  -0.007  3.176   1.00 0.00 ? 53 ARG P HG2  5  
ATOM 5695  H HG3  . ARG A 1 55 ? 15.582  0.084   3.241   1.00 0.00 ? 53 ARG P HG3  5  
ATOM 5696  H HD2  . ARG A 1 55 ? 14.807  2.321   3.035   1.00 0.00 ? 53 ARG P HD2  5  
ATOM 5697  H HD3  . ARG A 1 55 ? 15.433  1.877   1.439   1.00 0.00 ? 53 ARG P HD3  5  
ATOM 5698  H HE   . ARG A 1 55 ? 12.512  1.538   2.021   1.00 0.00 ? 53 ARG P HE   5  
ATOM 5699  H HH11 . ARG A 1 55 ? 14.871  3.413   0.213   1.00 0.00 ? 53 ARG P HH11 5  
ATOM 5700  H HH12 . ARG A 1 55 ? 13.638  4.087   -0.817  1.00 0.00 ? 53 ARG P HH12 5  
ATOM 5701  H HH21 . ARG A 1 55 ? 11.071  2.397   0.764   1.00 0.00 ? 53 ARG P HH21 5  
ATOM 5702  H HH22 . ARG A 1 55 ? 11.501  3.515   -0.520  1.00 0.00 ? 53 ARG P HH22 5  
ATOM 5703  N N    . ALA A 1 56 ? 15.007  -2.886  4.073   1.00 0.00 ? 54 ALA P N    5  
ATOM 5704  C CA   . ALA A 1 56 ? 15.691  -3.562  5.178   1.00 0.00 ? 54 ALA P CA   5  
ATOM 5705  C C    . ALA A 1 56 ? 15.936  -5.055  4.879   1.00 0.00 ? 54 ALA P C    5  
ATOM 5706  O O    . ALA A 1 56 ? 17.026  -5.559  5.142   1.00 0.00 ? 54 ALA P O    5  
ATOM 5707  C CB   . ALA A 1 56 ? 14.874  -3.360  6.461   1.00 0.00 ? 54 ALA P CB   5  
ATOM 5708  H H    . ALA A 1 56 ? 14.082  -2.512  4.244   1.00 0.00 ? 54 ALA P H    5  
ATOM 5709  H HA   . ALA A 1 56 ? 16.666  -3.093  5.323   1.00 0.00 ? 54 ALA P HA   5  
ATOM 5710  H HB1  . ALA A 1 56 ? 13.898  -3.836  6.367   1.00 0.00 ? 54 ALA P HB1  5  
ATOM 5711  H HB2  . ALA A 1 56 ? 15.404  -3.805  7.305   1.00 0.00 ? 54 ALA P HB2  5  
ATOM 5712  H HB3  . ALA A 1 56 ? 14.741  -2.295  6.653   1.00 0.00 ? 54 ALA P HB3  5  
ATOM 5713  N N    . LYS A 1 57 ? 14.978  -5.748  4.246   1.00 0.00 ? 55 LYS P N    5  
ATOM 5714  C CA   . LYS A 1 57 ? 15.135  -7.137  3.758   1.00 0.00 ? 55 LYS P CA   5  
ATOM 5715  C C    . LYS A 1 57 ? 16.138  -7.275  2.605   1.00 0.00 ? 55 LYS P C    5  
ATOM 5716  O O    . LYS A 1 57 ? 16.794  -8.309  2.485   1.00 0.00 ? 55 LYS P O    5  
ATOM 5717  C CB   . LYS A 1 57 ? 13.756  -7.681  3.346   1.00 0.00 ? 55 LYS P CB   5  
ATOM 5718  C CG   . LYS A 1 57 ? 12.928  -8.086  4.575   1.00 0.00 ? 55 LYS P CG   5  
ATOM 5719  C CD   . LYS A 1 57 ? 11.479  -8.399  4.188   1.00 0.00 ? 55 LYS P CD   5  
ATOM 5720  C CE   . LYS A 1 57 ? 10.742  -9.007  5.386   1.00 0.00 ? 55 LYS P CE   5  
ATOM 5721  N NZ   . LYS A 1 57 ? 9.272   -8.989  5.184   1.00 0.00 ? 55 LYS P NZ   5  
ATOM 5722  H H    . LYS A 1 57 ? 14.072  -5.301  4.134   1.00 0.00 ? 55 LYS P H    5  
ATOM 5723  H HA   . LYS A 1 57 ? 15.527  -7.757  4.567   1.00 0.00 ? 55 LYS P HA   5  
ATOM 5724  H HB2  . LYS A 1 57 ? 13.222  -6.927  2.764   1.00 0.00 ? 55 LYS P HB2  5  
ATOM 5725  H HB3  . LYS A 1 57 ? 13.885  -8.566  2.720   1.00 0.00 ? 55 LYS P HB3  5  
ATOM 5726  H HG2  . LYS A 1 57 ? 13.385  -8.967  5.029   1.00 0.00 ? 55 LYS P HG2  5  
ATOM 5727  H HG3  . LYS A 1 57 ? 12.928  -7.277  5.307   1.00 0.00 ? 55 LYS P HG3  5  
ATOM 5728  H HD2  . LYS A 1 57 ? 10.993  -7.471  3.880   1.00 0.00 ? 55 LYS P HD2  5  
ATOM 5729  H HD3  . LYS A 1 57 ? 11.460  -9.106  3.356   1.00 0.00 ? 55 LYS P HD3  5  
ATOM 5730  H HE2  . LYS A 1 57 ? 11.096  -10.031 5.537   1.00 0.00 ? 55 LYS P HE2  5  
ATOM 5731  H HE3  . LYS A 1 57 ? 10.993  -8.430  6.281   1.00 0.00 ? 55 LYS P HE3  5  
ATOM 5732  H HZ1  . LYS A 1 57 ? 8.794   -9.453  5.944   1.00 0.00 ? 55 LYS P HZ1  5  
ATOM 5733  H HZ2  . LYS A 1 57 ? 9.008   -9.444  4.322   1.00 0.00 ? 55 LYS P HZ2  5  
ATOM 5734  H HZ3  . LYS A 1 57 ? 8.945   -8.025  5.160   1.00 0.00 ? 55 LYS P HZ3  5  
ATOM 5735  N N    . TRP A 1 58 ? 16.292  -6.236  1.783   1.00 0.00 ? 56 TRP P N    5  
ATOM 5736  C CA   . TRP A 1 58 ? 17.266  -6.180  0.683   1.00 0.00 ? 56 TRP P CA   5  
ATOM 5737  C C    . TRP A 1 58 ? 18.711  -6.012  1.187   1.00 0.00 ? 56 TRP P C    5  
ATOM 5738  O O    . TRP A 1 58 ? 19.599  -6.748  0.752   1.00 0.00 ? 56 TRP P O    5  
ATOM 5739  C CB   . TRP A 1 58 ? 16.843  -5.051  -0.268  1.00 0.00 ? 56 TRP P CB   5  
ATOM 5740  C CG   . TRP A 1 58 ? 17.799  -4.635  -1.346  1.00 0.00 ? 56 TRP P CG   5  
ATOM 5741  C CD1  . TRP A 1 58 ? 18.328  -5.438  -2.298  1.00 0.00 ? 56 TRP P CD1  5  
ATOM 5742  C CD2  . TRP A 1 58 ? 18.301  -3.292  -1.634  1.00 0.00 ? 56 TRP P CD2  5  
ATOM 5743  N NE1  . TRP A 1 58 ? 19.109  -4.686  -3.156  1.00 0.00 ? 56 TRP P NE1  5  
ATOM 5744  C CE2  . TRP A 1 58 ? 19.105  -3.350  -2.812  1.00 0.00 ? 56 TRP P CE2  5  
ATOM 5745  C CE3  . TRP A 1 58 ? 18.144  -2.024  -1.028  1.00 0.00 ? 56 TRP P CE3  5  
ATOM 5746  C CZ2  . TRP A 1 58 ? 19.685  -2.208  -3.383  1.00 0.00 ? 56 TRP P CZ2  5  
ATOM 5747  C CZ3  . TRP A 1 58 ? 18.726  -0.870  -1.591  1.00 0.00 ? 56 TRP P CZ3  5  
ATOM 5748  C CH2  . TRP A 1 58 ? 19.478  -0.955  -2.777  1.00 0.00 ? 56 TRP P CH2  5  
ATOM 5749  H H    . TRP A 1 58 ? 15.688  -5.442  1.926   1.00 0.00 ? 56 TRP P H    5  
ATOM 5750  H HA   . TRP A 1 58 ? 17.231  -7.117  0.124   1.00 0.00 ? 56 TRP P HA   5  
ATOM 5751  H HB2  . TRP A 1 58 ? 15.903  -5.336  -0.740  1.00 0.00 ? 56 TRP P HB2  5  
ATOM 5752  H HB3  . TRP A 1 58 ? 16.641  -4.163  0.325   1.00 0.00 ? 56 TRP P HB3  5  
ATOM 5753  H HD1  . TRP A 1 58 ? 18.144  -6.504  -2.387  1.00 0.00 ? 56 TRP P HD1  5  
ATOM 5754  H HE1  . TRP A 1 58 ? 19.593  -5.080  -3.956  1.00 0.00 ? 56 TRP P HE1  5  
ATOM 5755  H HE3  . TRP A 1 58 ? 17.572  -1.946  -0.112  1.00 0.00 ? 56 TRP P HE3  5  
ATOM 5756  H HZ2  . TRP A 1 58 ? 20.260  -2.291  -4.295  1.00 0.00 ? 56 TRP P HZ2  5  
ATOM 5757  H HZ3  . TRP A 1 58 ? 18.576  0.093   -1.118  1.00 0.00 ? 56 TRP P HZ3  5  
ATOM 5758  H HH2  . TRP A 1 58 ? 19.885  -0.055  -3.223  1.00 0.00 ? 56 TRP P HH2  5  
ATOM 5759  N N    . ARG A 1 59 ? 18.948  -5.086  2.131   1.00 0.00 ? 57 ARG P N    5  
ATOM 5760  C CA   . ARG A 1 59 ? 20.296  -4.754  2.647   1.00 0.00 ? 57 ARG P CA   5  
ATOM 5761  C C    . ARG A 1 59 ? 20.738  -5.572  3.871   1.00 0.00 ? 57 ARG P C    5  
ATOM 5762  O O    . ARG A 1 59 ? 21.934  -5.842  3.998   1.00 0.00 ? 57 ARG P O    5  
ATOM 5763  C CB   . ARG A 1 59 ? 20.373  -3.236  2.905   1.00 0.00 ? 57 ARG P CB   5  
ATOM 5764  C CG   . ARG A 1 59 ? 20.474  -2.431  1.600   1.00 0.00 ? 57 ARG P CG   5  
ATOM 5765  C CD   . ARG A 1 59 ? 21.866  -2.515  0.958   1.00 0.00 ? 57 ARG P CD   5  
ATOM 5766  N NE   . ARG A 1 59 ? 21.877  -1.923  -0.393  1.00 0.00 ? 57 ARG P NE   5  
ATOM 5767  C CZ   . ARG A 1 59 ? 22.946  -1.696  -1.137  1.00 0.00 ? 57 ARG P CZ   5  
ATOM 5768  N NH1  . ARG A 1 59 ? 24.155  -1.939  -0.714  1.00 0.00 ? 57 ARG P NH1  5  
ATOM 5769  N NH2  . ARG A 1 59 ? 22.819  -1.215  -2.339  1.00 0.00 ? 57 ARG P NH2  5  
ATOM 5770  H H    . ARG A 1 59 ? 18.168  -4.499  2.412   1.00 0.00 ? 57 ARG P H    5  
ATOM 5771  H HA   . ARG A 1 59 ? 21.028  -5.008  1.882   1.00 0.00 ? 57 ARG P HA   5  
ATOM 5772  H HB2  . ARG A 1 59 ? 19.475  -2.918  3.440   1.00 0.00 ? 57 ARG P HB2  5  
ATOM 5773  H HB3  . ARG A 1 59 ? 21.239  -3.006  3.528   1.00 0.00 ? 57 ARG P HB3  5  
ATOM 5774  H HG2  . ARG A 1 59 ? 19.732  -2.806  0.902   1.00 0.00 ? 57 ARG P HG2  5  
ATOM 5775  H HG3  . ARG A 1 59 ? 20.251  -1.383  1.812   1.00 0.00 ? 57 ARG P HG3  5  
ATOM 5776  H HD2  . ARG A 1 59 ? 22.574  -1.991  1.603   1.00 0.00 ? 57 ARG P HD2  5  
ATOM 5777  H HD3  . ARG A 1 59 ? 22.173  -3.559  0.882   1.00 0.00 ? 57 ARG P HD3  5  
ATOM 5778  H HE   . ARG A 1 59 ? 20.982  -1.709  -0.810  1.00 0.00 ? 57 ARG P HE   5  
ATOM 5779  H HH11 . ARG A 1 59 ? 24.288  -2.316  0.208   1.00 0.00 ? 57 ARG P HH11 5  
ATOM 5780  H HH12 . ARG A 1 59 ? 24.951  -1.756  -1.302  1.00 0.00 ? 57 ARG P HH12 5  
ATOM 5781  H HH21 . ARG A 1 59 ? 21.902  -1.045  -2.713  1.00 0.00 ? 57 ARG P HH21 5  
ATOM 5782  H HH22 . ARG A 1 59 ? 23.631  -1.041  -2.906  1.00 0.00 ? 57 ARG P HH22 5  
ATOM 5783  N N    . LYS A 1 60 ? 19.785  -6.010  4.704   1.00 0.00 ? 58 LYS P N    5  
ATOM 5784  C CA   . LYS A 1 60 ? 19.933  -6.825  5.934   1.00 0.00 ? 58 LYS P CA   5  
ATOM 5785  C C    . LYS A 1 60 ? 20.802  -6.206  7.043   1.00 0.00 ? 58 LYS P C    5  
ATOM 5786  O O    . LYS A 1 60 ? 21.575  -5.269  6.826   1.00 0.00 ? 58 LYS P O    5  
ATOM 5787  C CB   . LYS A 1 60 ? 20.359  -8.267  5.582   1.00 0.00 ? 58 LYS P CB   5  
ATOM 5788  C CG   . LYS A 1 60 ? 19.329  -8.979  4.687   1.00 0.00 ? 58 LYS P CG   5  
ATOM 5789  C CD   . LYS A 1 60 ? 19.771  -10.416 4.370   1.00 0.00 ? 58 LYS P CD   5  
ATOM 5790  C CE   . LYS A 1 60 ? 18.704  -11.217 3.609   1.00 0.00 ? 58 LYS P CE   5  
ATOM 5791  N NZ   . LYS A 1 60 ? 18.401  -10.645 2.270   1.00 0.00 ? 58 LYS P NZ   5  
ATOM 5792  H H    . LYS A 1 60 ? 18.842  -5.717  4.483   1.00 0.00 ? 58 LYS P H    5  
ATOM 5793  H HA   . LYS A 1 60 ? 18.937  -6.897  6.374   1.00 0.00 ? 58 LYS P HA   5  
ATOM 5794  H HB2  . LYS A 1 60 ? 21.328  -8.252  5.082   1.00 0.00 ? 58 LYS P HB2  5  
ATOM 5795  H HB3  . LYS A 1 60 ? 20.468  -8.843  6.503   1.00 0.00 ? 58 LYS P HB3  5  
ATOM 5796  H HG2  . LYS A 1 60 ? 18.366  -9.003  5.199   1.00 0.00 ? 58 LYS P HG2  5  
ATOM 5797  H HG3  . LYS A 1 60 ? 19.221  -8.428  3.753   1.00 0.00 ? 58 LYS P HG3  5  
ATOM 5798  H HD2  . LYS A 1 60 ? 20.694  -10.393 3.788   1.00 0.00 ? 58 LYS P HD2  5  
ATOM 5799  H HD3  . LYS A 1 60 ? 19.975  -10.936 5.307   1.00 0.00 ? 58 LYS P HD3  5  
ATOM 5800  H HE2  . LYS A 1 60 ? 19.066  -12.243 3.494   1.00 0.00 ? 58 LYS P HE2  5  
ATOM 5801  H HE3  . LYS A 1 60 ? 17.793  -11.255 4.213   1.00 0.00 ? 58 LYS P HE3  5  
ATOM 5802  H HZ1  . LYS A 1 60 ? 17.946  -9.738  2.354   1.00 0.00 ? 58 LYS P HZ1  5  
ATOM 5803  H HZ2  . LYS A 1 60 ? 17.769  -11.244 1.757   1.00 0.00 ? 58 LYS P HZ2  5  
ATOM 5804  H HZ3  . LYS A 1 60 ? 19.239  -10.534 1.716   1.00 0.00 ? 58 LYS P HZ3  5  
ATOM 5805  N N    . ARG A 1 61 ? 20.657  -6.740  8.263   1.00 0.00 ? 59 ARG P N    5  
ATOM 5806  C CA   . ARG A 1 61 ? 21.483  -6.441  9.452   1.00 0.00 ? 59 ARG P CA   5  
ATOM 5807  C C    . ARG A 1 61 ? 22.149  -7.716  9.985   1.00 0.00 ? 59 ARG P C    5  
ATOM 5808  O O    . ARG A 1 61 ? 21.621  -8.816  9.812   1.00 0.00 ? 59 ARG P O    5  
ATOM 5809  C CB   . ARG A 1 61 ? 20.649  -5.768  10.562  1.00 0.00 ? 59 ARG P CB   5  
ATOM 5810  C CG   . ARG A 1 61 ? 19.802  -4.539  10.175  1.00 0.00 ? 59 ARG P CG   5  
ATOM 5811  C CD   . ARG A 1 61 ? 20.519  -3.404  9.427   1.00 0.00 ? 59 ARG P CD   5  
ATOM 5812  N NE   . ARG A 1 61 ? 21.785  -2.990  10.066  1.00 0.00 ? 59 ARG P NE   5  
ATOM 5813  C CZ   . ARG A 1 61 ? 22.989  -2.955  9.516   1.00 0.00 ? 59 ARG P CZ   5  
ATOM 5814  N NH1  . ARG A 1 61 ? 23.237  -3.407  8.318   1.00 0.00 ? 59 ARG P NH1  5  
ATOM 5815  N NH2  . ARG A 1 61 ? 23.994  -2.465  10.183  1.00 0.00 ? 59 ARG P NH2  5  
ATOM 5816  H H    . ARG A 1 61 ? 19.999  -7.502  8.347   1.00 0.00 ? 59 ARG P H    5  
ATOM 5817  H HA   . ARG A 1 61 ? 22.293  -5.768  9.172   1.00 0.00 ? 59 ARG P HA   5  
ATOM 5818  H HB2  . ARG A 1 61 ? 19.969  -6.512  10.982  1.00 0.00 ? 59 ARG P HB2  5  
ATOM 5819  H HB3  . ARG A 1 61 ? 21.327  -5.471  11.365  1.00 0.00 ? 59 ARG P HB3  5  
ATOM 5820  H HG2  . ARG A 1 61 ? 18.966  -4.872  9.559   1.00 0.00 ? 59 ARG P HG2  5  
ATOM 5821  H HG3  . ARG A 1 61 ? 19.381  -4.127  11.092  1.00 0.00 ? 59 ARG P HG3  5  
ATOM 5822  H HD2  . ARG A 1 61 ? 20.680  -3.703  8.396   1.00 0.00 ? 59 ARG P HD2  5  
ATOM 5823  H HD3  . ARG A 1 61 ? 19.847  -2.544  9.397   1.00 0.00 ? 59 ARG P HD3  5  
ATOM 5824  H HE   . ARG A 1 61 ? 21.716  -2.627  11.004  1.00 0.00 ? 59 ARG P HE   5  
ATOM 5825  H HH11 . ARG A 1 61 ? 22.504  -3.857  7.782   1.00 0.00 ? 59 ARG P HH11 5  
ATOM 5826  H HH12 . ARG A 1 61 ? 24.164  -3.348  7.932   1.00 0.00 ? 59 ARG P HH12 5  
ATOM 5827  H HH21 . ARG A 1 61 ? 23.856  -2.096  11.110  1.00 0.00 ? 59 ARG P HH21 5  
ATOM 5828  H HH22 . ARG A 1 61 ? 24.911  -2.433  9.771   1.00 0.00 ? 59 ARG P HH22 5  
ATOM 5829  N N    . GLU A 1 62 ? 23.291  -7.572  10.651  1.00 0.00 ? 60 GLU P N    5  
ATOM 5830  C CA   . GLU A 1 62 ? 24.019  -8.690  11.271  1.00 0.00 ? 60 GLU P CA   5  
ATOM 5831  C C    . GLU A 1 62 ? 23.425  -9.054  12.645  1.00 0.00 ? 60 GLU P C    5  
ATOM 5832  O O    . GLU A 1 62 ? 23.423  -8.242  13.571  1.00 0.00 ? 60 GLU P O    5  
ATOM 5833  C CB   . GLU A 1 62 ? 25.518  -8.359  11.387  1.00 0.00 ? 60 GLU P CB   5  
ATOM 5834  C CG   . GLU A 1 62 ? 26.199  -8.278  10.013  1.00 0.00 ? 60 GLU P CG   5  
ATOM 5835  C CD   . GLU A 1 62 ? 27.708  -8.000  10.151  1.00 0.00 ? 60 GLU P CD   5  
ATOM 5836  O OE1  . GLU A 1 62 ? 28.488  -8.958  10.380  1.00 0.00 ? 60 GLU P OE1  5  
ATOM 5837  O OE2  . GLU A 1 62 ? 28.129  -6.826  10.015  1.00 0.00 ? 60 GLU P OE2  5  
ATOM 5838  H H    . GLU A 1 62 ? 23.656  -6.641  10.775  1.00 0.00 ? 60 GLU P H    5  
ATOM 5839  H HA   . GLU A 1 62 ? 23.932  -9.571  10.632  1.00 0.00 ? 60 GLU P HA   5  
ATOM 5840  H HB2  . GLU A 1 62 ? 25.645  -7.410  11.909  1.00 0.00 ? 60 GLU P HB2  5  
ATOM 5841  H HB3  . GLU A 1 62 ? 26.005  -9.143  11.969  1.00 0.00 ? 60 GLU P HB3  5  
ATOM 5842  H HG2  . GLU A 1 62 ? 26.044  -9.222  9.483   1.00 0.00 ? 60 GLU P HG2  5  
ATOM 5843  H HG3  . GLU A 1 62 ? 25.729  -7.488  9.421   1.00 0.00 ? 60 GLU P HG3  5  
ATOM 5844  N N    . GLU A 1 63 ? 22.941  -10.290 12.797  1.00 0.00 ? 61 GLU P N    5  
ATOM 5845  C CA   . GLU A 1 63 ? 22.312  -10.775 14.042  1.00 0.00 ? 61 GLU P CA   5  
ATOM 5846  C C    . GLU A 1 63 ? 23.330  -11.126 15.146  1.00 0.00 ? 61 GLU P C    5  
ATOM 5847  O O    . GLU A 1 63 ? 22.969  -11.199 16.322  1.00 0.00 ? 61 GLU P O    5  
ATOM 5848  C CB   . GLU A 1 63 ? 21.415  -11.988 13.736  1.00 0.00 ? 61 GLU P CB   5  
ATOM 5849  C CG   . GLU A 1 63 ? 20.232  -11.635 12.823  1.00 0.00 ? 61 GLU P CG   5  
ATOM 5850  C CD   . GLU A 1 63 ? 19.302  -12.849 12.634  1.00 0.00 ? 61 GLU P CD   5  
ATOM 5851  O OE1  . GLU A 1 63 ? 19.551  -13.676 11.723  1.00 0.00 ? 61 GLU P OE1  5  
ATOM 5852  O OE2  . GLU A 1 63 ? 18.309  -12.985 13.390  1.00 0.00 ? 61 GLU P OE2  5  
ATOM 5853  H H    . GLU A 1 63 ? 22.932  -10.908 11.995  1.00 0.00 ? 61 GLU P H    5  
ATOM 5854  H HA   . GLU A 1 63 ? 21.675  -9.986  14.446  1.00 0.00 ? 61 GLU P HA   5  
ATOM 5855  H HB2  . GLU A 1 63 ? 22.014  -12.771 13.269  1.00 0.00 ? 61 GLU P HB2  5  
ATOM 5856  H HB3  . GLU A 1 63 ? 21.017  -12.375 14.674  1.00 0.00 ? 61 GLU P HB3  5  
ATOM 5857  H HG2  . GLU A 1 63 ? 19.675  -10.805 13.269  1.00 0.00 ? 61 GLU P HG2  5  
ATOM 5858  H HG3  . GLU A 1 63 ? 20.605  -11.300 11.852  1.00 0.00 ? 61 GLU P HG3  5  
ATOM 5859  N N    . PHE A 1 64 ? 24.605  -11.309 14.779  1.00 0.00 ? 62 PHE P N    5  
ATOM 5860  C CA   . PHE A 1 64 ? 25.731  -11.603 15.679  1.00 0.00 ? 62 PHE P CA   5  
ATOM 5861  C C    . PHE A 1 64 ? 26.770  -10.461 15.692  1.00 0.00 ? 62 PHE P C    5  
ATOM 5862  O O    . PHE A 1 64 ? 27.981  -10.683 15.773  1.00 0.00 ? 62 PHE P O    5  
ATOM 5863  C CB   . PHE A 1 64 ? 26.297  -12.995 15.339  1.00 0.00 ? 62 PHE P CB   5  
ATOM 5864  C CG   . PHE A 1 64 ? 27.213  -13.590 16.399  1.00 0.00 ? 62 PHE P CG   5  
ATOM 5865  C CD1  . PHE A 1 64 ? 26.692  -13.957 17.656  1.00 0.00 ? 62 PHE P CD1  5  
ATOM 5866  C CD2  . PHE A 1 64 ? 28.582  -13.792 16.129  1.00 0.00 ? 62 PHE P CD2  5  
ATOM 5867  C CE1  . PHE A 1 64 ? 27.533  -14.515 18.636  1.00 0.00 ? 62 PHE P CE1  5  
ATOM 5868  C CE2  . PHE A 1 64 ? 29.422  -14.348 17.110  1.00 0.00 ? 62 PHE P CE2  5  
ATOM 5869  C CZ   . PHE A 1 64 ? 28.899  -14.710 18.363  1.00 0.00 ? 62 PHE P CZ   5  
ATOM 5870  H H    . PHE A 1 64 ? 24.809  -11.241 13.792  1.00 0.00 ? 62 PHE P H    5  
ATOM 5871  H HA   . PHE A 1 64 ? 25.347  -11.657 16.698  1.00 0.00 ? 62 PHE P HA   5  
ATOM 5872  H HB2  . PHE A 1 64 ? 25.463  -13.686 15.208  1.00 0.00 ? 62 PHE P HB2  5  
ATOM 5873  H HB3  . PHE A 1 64 ? 26.824  -12.939 14.385  1.00 0.00 ? 62 PHE P HB3  5  
ATOM 5874  H HD1  . PHE A 1 64 ? 25.641  -13.812 17.870  1.00 0.00 ? 62 PHE P HD1  5  
ATOM 5875  H HD2  . PHE A 1 64 ? 28.991  -13.512 15.168  1.00 0.00 ? 62 PHE P HD2  5  
ATOM 5876  H HE1  . PHE A 1 64 ? 27.128  -14.795 19.600  1.00 0.00 ? 62 PHE P HE1  5  
ATOM 5877  H HE2  . PHE A 1 64 ? 30.473  -14.498 16.899  1.00 0.00 ? 62 PHE P HE2  5  
ATOM 5878  H HZ   . PHE A 1 64 ? 29.546  -15.141 19.115  1.00 0.00 ? 62 PHE P HZ   5  
ATOM 5879  N N    . ILE A 1 65 ? 26.298  -9.210  15.597  1.00 0.00 ? 63 ILE P N    5  
ATOM 5880  C CA   . ILE A 1 65 ? 27.128  -7.990  15.653  1.00 0.00 ? 63 ILE P CA   5  
ATOM 5881  C C    . ILE A 1 65 ? 27.866  -7.823  17.000  1.00 0.00 ? 63 ILE P C    5  
ATOM 5882  O O    . ILE A 1 65 ? 28.923  -7.192  17.063  1.00 0.00 ? 63 ILE P O    5  
ATOM 5883  C CB   . ILE A 1 65 ? 26.254  -6.760  15.297  1.00 0.00 ? 63 ILE P CB   5  
ATOM 5884  C CG1  . ILE A 1 65 ? 27.045  -5.451  15.084  1.00 0.00 ? 63 ILE P CG1  5  
ATOM 5885  C CG2  . ILE A 1 65 ? 25.155  -6.501  16.346  1.00 0.00 ? 63 ILE P CG2  5  
ATOM 5886  C CD1  . ILE A 1 65 ? 28.095  -5.531  13.968  1.00 0.00 ? 63 ILE P CD1  5  
ATOM 5887  H H    . ILE A 1 65 ? 25.299  -9.095  15.484  1.00 0.00 ? 63 ILE P H    5  
ATOM 5888  H HA   . ILE A 1 65 ? 27.894  -8.094  14.884  1.00 0.00 ? 63 ILE P HA   5  
ATOM 5889  H HB   . ILE A 1 65 ? 25.755  -6.981  14.354  1.00 0.00 ? 63 ILE P HB   5  
ATOM 5890  H HG12 . ILE A 1 65 ? 26.341  -4.662  14.817  1.00 0.00 ? 63 ILE P HG12 5  
ATOM 5891  H HG13 . ILE A 1 65 ? 27.536  -5.154  16.012  1.00 0.00 ? 63 ILE P HG13 5  
ATOM 5892  H HG21 . ILE A 1 65 ? 24.537  -7.388  16.485  1.00 0.00 ? 63 ILE P HG21 5  
ATOM 5893  H HG22 . ILE A 1 65 ? 25.594  -6.213  17.301  1.00 0.00 ? 63 ILE P HG22 5  
ATOM 5894  H HG23 . ILE A 1 65 ? 24.508  -5.694  16.003  1.00 0.00 ? 63 ILE P HG23 5  
ATOM 5895  H HD11 . ILE A 1 65 ? 28.899  -6.211  14.247  1.00 0.00 ? 63 ILE P HD11 5  
ATOM 5896  H HD12 . ILE A 1 65 ? 27.628  -5.875  13.044  1.00 0.00 ? 63 ILE P HD12 5  
ATOM 5897  H HD13 . ILE A 1 65 ? 28.521  -4.541  13.804  1.00 0.00 ? 63 ILE P HD13 5  
ATOM 5898  N N    . VAL A 1 66 ? 27.340  -8.433  18.069  1.00 0.00 ? 64 VAL P N    5  
ATOM 5899  C CA   . VAL A 1 66 ? 27.957  -8.543  19.401  1.00 0.00 ? 64 VAL P CA   5  
ATOM 5900  C C    . VAL A 1 66 ? 27.655  -9.920  20.017  1.00 0.00 ? 64 VAL P C    5  
ATOM 5901  O O    . VAL A 1 66 ? 26.611  -10.517 19.742  1.00 0.00 ? 64 VAL P O    5  
ATOM 5902  C CB   . VAL A 1 66 ? 27.516  -7.364  20.298  1.00 0.00 ? 64 VAL P CB   5  
ATOM 5903  C CG1  . VAL A 1 66 ? 26.020  -7.372  20.636  1.00 0.00 ? 64 VAL P CG1  5  
ATOM 5904  C CG2  . VAL A 1 66 ? 28.319  -7.287  21.602  1.00 0.00 ? 64 VAL P CG2  5  
ATOM 5905  H H    . VAL A 1 66 ? 26.474  -8.935  17.931  1.00 0.00 ? 64 VAL P H    5  
ATOM 5906  H HA   . VAL A 1 66 ? 29.039  -8.474  19.280  1.00 0.00 ? 64 VAL P HA   5  
ATOM 5907  H HB   . VAL A 1 66 ? 27.720  -6.443  19.749  1.00 0.00 ? 64 VAL P HB   5  
ATOM 5908  H HG11 . VAL A 1 66 ? 25.428  -7.380  19.721  1.00 0.00 ? 64 VAL P HG11 5  
ATOM 5909  H HG12 . VAL A 1 66 ? 25.767  -8.247  21.235  1.00 0.00 ? 64 VAL P HG12 5  
ATOM 5910  H HG13 . VAL A 1 66 ? 25.768  -6.474  21.200  1.00 0.00 ? 64 VAL P HG13 5  
ATOM 5911  H HG21 . VAL A 1 66 ? 28.072  -8.120  22.259  1.00 0.00 ? 64 VAL P HG21 5  
ATOM 5912  H HG22 . VAL A 1 66 ? 29.387  -7.296  21.381  1.00 0.00 ? 64 VAL P HG22 5  
ATOM 5913  H HG23 . VAL A 1 66 ? 28.082  -6.357  22.119  1.00 0.00 ? 64 VAL P HG23 5  
ATOM 5914  N N    . THR A 1 67 ? 28.577  -10.442 20.831  1.00 0.00 ? 65 THR P N    5  
ATOM 5915  C CA   . THR A 1 67 ? 28.510  -11.802 21.410  1.00 0.00 ? 65 THR P CA   5  
ATOM 5916  C C    . THR A 1 67 ? 27.485  -11.929 22.551  1.00 0.00 ? 65 THR P C    5  
ATOM 5917  O O    . THR A 1 67 ? 26.926  -13.006 22.767  1.00 0.00 ? 65 THR P O    5  
ATOM 5918  C CB   . THR A 1 67 ? 29.904  -12.220 21.921  1.00 0.00 ? 65 THR P CB   5  
ATOM 5919  O OG1  . THR A 1 67 ? 30.888  -11.945 20.941  1.00 0.00 ? 65 THR P OG1  5  
ATOM 5920  C CG2  . THR A 1 67 ? 30.016  -13.709 22.253  1.00 0.00 ? 65 THR P CG2  5  
ATOM 5921  H H    . THR A 1 67 ? 29.442  -9.935  20.958  1.00 0.00 ? 65 THR P H    5  
ATOM 5922  H HA   . THR A 1 67 ? 28.218  -12.498 20.624  1.00 0.00 ? 65 THR P HA   5  
ATOM 5923  H HB   . THR A 1 67 ? 30.138  -11.640 22.816  1.00 0.00 ? 65 THR P HB   5  
ATOM 5924  H HG1  . THR A 1 67 ? 31.758  -12.126 21.339  1.00 0.00 ? 65 THR P HG1  5  
ATOM 5925  H HG21 . THR A 1 67 ? 29.386  -13.950 23.108  1.00 0.00 ? 65 THR P HG21 5  
ATOM 5926  H HG22 . THR A 1 67 ? 31.046  -13.956 22.511  1.00 0.00 ? 65 THR P HG22 5  
ATOM 5927  H HG23 . THR A 1 67 ? 29.705  -14.307 21.397  1.00 0.00 ? 65 THR P HG23 5  
ATOM 5928  N N    . ASP A 1 68 ? 27.228  -10.836 23.285  1.00 0.00 ? 66 ASP P N    5  
ATOM 5929  C CA   . ASP A 1 68 ? 26.340  -10.780 24.464  1.00 0.00 ? 66 ASP P CA   5  
ATOM 5930  C C    . ASP A 1 68 ? 24.834  -10.895 24.133  1.00 0.00 ? 66 ASP P C    5  
ATOM 5931  O O    . ASP A 1 68 ? 24.340  -10.156 23.251  1.00 0.00 ? 66 ASP P O    5  
ATOM 5932  C CB   . ASP A 1 68 ? 26.645  -9.497  25.262  1.00 0.00 ? 66 ASP P CB   5  
ATOM 5933  C CG   . ASP A 1 68 ? 25.826  -9.388  26.568  1.00 0.00 ? 66 ASP P CG   5  
ATOM 5934  O OD1  . ASP A 1 68 ? 26.133  -10.123 27.540  1.00 0.00 ? 66 ASP P OD1  5  
ATOM 5935  O OD2  . ASP A 1 68 ? 24.900  -8.542  26.644  1.00 0.00 ? 66 ASP P OD2  5  
ATOM 5936  O OXT  . ASP A 1 68 ? 24.149  -11.725 24.775  1.00 0.00 ? 66 ASP P OXT  5  
ATOM 5937  H H    . ASP A 1 68 ? 27.691  -9.983  23.013  1.00 0.00 ? 66 ASP P H    5  
ATOM 5938  H HA   . ASP A 1 68 ? 26.586  -11.624 25.110  1.00 0.00 ? 66 ASP P HA   5  
ATOM 5939  H HB2  . ASP A 1 68 ? 27.709  -9.482  25.509  1.00 0.00 ? 66 ASP P HB2  5  
ATOM 5940  H HB3  . ASP A 1 68 ? 26.447  -8.629  24.628  1.00 0.00 ? 66 ASP P HB3  5  
ATOM 5941  N N    . GLY A 1 1  ? -18.882 -3.892  8.438   1.00 0.00 ? -1 GLY P N    6  
ATOM 5942  C CA   . GLY A 1 1  ? -18.557 -3.358  9.780   1.00 0.00 ? -1 GLY P CA   6  
ATOM 5943  C C    . GLY A 1 1  ? -18.552 -4.461  10.829  1.00 0.00 ? -1 GLY P C    6  
ATOM 5944  O O    . GLY A 1 1  ? -18.074 -5.564  10.563  1.00 0.00 ? -1 GLY P O    6  
ATOM 5945  H H1   . GLY A 1 1  ? -18.857 -3.153  7.755   1.00 0.00 ? -1 GLY P H1   6  
ATOM 5946  H H2   . GLY A 1 1  ? -19.803 -4.303  8.438   1.00 0.00 ? -1 GLY P H2   6  
ATOM 5947  H H3   . GLY A 1 1  ? -18.214 -4.600  8.176   1.00 0.00 ? -1 GLY P H3   6  
ATOM 5948  H HA2  . GLY A 1 1  ? -17.569 -2.898  9.761   1.00 0.00 ? -1 GLY P HA2  6  
ATOM 5949  H HA3  . GLY A 1 1  ? -19.292 -2.603  10.059  1.00 0.00 ? -1 GLY P HA3  6  
ATOM 5950  N N    . SER A 1 2  ? -19.084 -4.174  12.024  1.00 0.00 ? 0  SER P N    6  
ATOM 5951  C CA   . SER A 1 2  ? -19.260 -5.130  13.142  1.00 0.00 ? 0  SER P CA   6  
ATOM 5952  C C    . SER A 1 2  ? -17.977 -5.859  13.592  1.00 0.00 ? 0  SER P C    6  
ATOM 5953  O O    . SER A 1 2  ? -18.018 -7.024  13.997  1.00 0.00 ? 0  SER P O    6  
ATOM 5954  C CB   . SER A 1 2  ? -20.421 -6.099  12.859  1.00 0.00 ? 0  SER P CB   6  
ATOM 5955  O OG   . SER A 1 2  ? -21.609 -5.384  12.540  1.00 0.00 ? 0  SER P OG   6  
ATOM 5956  H H    . SER A 1 2  ? -19.475 -3.252  12.156  1.00 0.00 ? 0  SER P H    6  
ATOM 5957  H HA   . SER A 1 2  ? -19.565 -4.539  14.007  1.00 0.00 ? 0  SER P HA   6  
ATOM 5958  H HB2  . SER A 1 2  ? -20.155 -6.754  12.027  1.00 0.00 ? 0  SER P HB2  6  
ATOM 5959  H HB3  . SER A 1 2  ? -20.603 -6.714  13.743  1.00 0.00 ? 0  SER P HB3  6  
ATOM 5960  H HG   . SER A 1 2  ? -22.325 -6.032  12.383  1.00 0.00 ? 0  SER P HG   6  
ATOM 5961  N N    . GLN A 1 3  ? -16.824 -5.184  13.514  1.00 0.00 ? 1  GLN P N    6  
ATOM 5962  C CA   . GLN A 1 3  ? -15.496 -5.687  13.901  1.00 0.00 ? 1  GLN P CA   6  
ATOM 5963  C C    . GLN A 1 3  ? -14.672 -4.606  14.619  1.00 0.00 ? 1  GLN P C    6  
ATOM 5964  O O    . GLN A 1 3  ? -14.892 -3.406  14.427  1.00 0.00 ? 1  GLN P O    6  
ATOM 5965  C CB   . GLN A 1 3  ? -14.736 -6.192  12.656  1.00 0.00 ? 1  GLN P CB   6  
ATOM 5966  C CG   . GLN A 1 3  ? -15.271 -7.503  12.056  1.00 0.00 ? 1  GLN P CG   6  
ATOM 5967  C CD   . GLN A 1 3  ? -15.051 -8.702  12.976  1.00 0.00 ? 1  GLN P CD   6  
ATOM 5968  O OE1  . GLN A 1 3  ? -13.997 -9.325  12.985  1.00 0.00 ? 1  GLN P OE1  6  
ATOM 5969  N NE2  . GLN A 1 3  ? -16.007 -9.056  13.808  1.00 0.00 ? 1  GLN P NE2  6  
ATOM 5970  H H    . GLN A 1 3  ? -16.870 -4.225  13.196  1.00 0.00 ? 1  GLN P H    6  
ATOM 5971  H HA   . GLN A 1 3  ? -15.611 -6.511  14.608  1.00 0.00 ? 1  GLN P HA   6  
ATOM 5972  H HB2  . GLN A 1 3  ? -14.768 -5.417  11.887  1.00 0.00 ? 1  GLN P HB2  6  
ATOM 5973  H HB3  . GLN A 1 3  ? -13.688 -6.352  12.914  1.00 0.00 ? 1  GLN P HB3  6  
ATOM 5974  H HG2  . GLN A 1 3  ? -16.331 -7.404  11.822  1.00 0.00 ? 1  GLN P HG2  6  
ATOM 5975  H HG3  . GLN A 1 3  ? -14.748 -7.693  11.119  1.00 0.00 ? 1  GLN P HG3  6  
ATOM 5976  H HE21 . GLN A 1 3  ? -16.863 -8.509  13.853  1.00 0.00 ? 1  GLN P HE21 6  
ATOM 5977  H HE22 . GLN A 1 3  ? -15.855 -9.849  14.412  1.00 0.00 ? 1  GLN P HE22 6  
ATOM 5978  N N    . ARG A 1 4  ? -13.676 -5.027  15.410  1.00 0.00 ? 2  ARG P N    6  
ATOM 5979  C CA   . ARG A 1 4  ? -12.770 -4.157  16.192  1.00 0.00 ? 2  ARG P CA   6  
ATOM 5980  C C    . ARG A 1 4  ? -11.507 -3.727  15.423  1.00 0.00 ? 2  ARG P C    6  
ATOM 5981  O O    . ARG A 1 4  ? -10.603 -3.132  16.011  1.00 0.00 ? 2  ARG P O    6  
ATOM 5982  C CB   . ARG A 1 4  ? -12.417 -4.846  17.530  1.00 0.00 ? 2  ARG P CB   6  
ATOM 5983  C CG   . ARG A 1 4  ? -13.618 -5.301  18.380  1.00 0.00 ? 2  ARG P CG   6  
ATOM 5984  C CD   . ARG A 1 4  ? -14.559 -4.150  18.765  1.00 0.00 ? 2  ARG P CD   6  
ATOM 5985  N NE   . ARG A 1 4  ? -15.650 -4.623  19.640  1.00 0.00 ? 2  ARG P NE   6  
ATOM 5986  C CZ   . ARG A 1 4  ? -16.601 -3.887  20.188  1.00 0.00 ? 2  ARG P CZ   6  
ATOM 5987  N NH1  . ARG A 1 4  ? -16.675 -2.598  20.005  1.00 0.00 ? 2  ARG P NH1  6  
ATOM 5988  N NH2  . ARG A 1 4  ? -17.509 -4.438  20.941  1.00 0.00 ? 2  ARG P NH2  6  
ATOM 5989  H H    . ARG A 1 4  ? -13.515 -6.028  15.470  1.00 0.00 ? 2  ARG P H    6  
ATOM 5990  H HA   . ARG A 1 4  ? -13.289 -3.225  16.424  1.00 0.00 ? 2  ARG P HA   6  
ATOM 5991  H HB2  . ARG A 1 4  ? -11.801 -5.722  17.322  1.00 0.00 ? 2  ARG P HB2  6  
ATOM 5992  H HB3  . ARG A 1 4  ? -11.818 -4.162  18.134  1.00 0.00 ? 2  ARG P HB3  6  
ATOM 5993  H HG2  . ARG A 1 4  ? -14.183 -6.061  17.840  1.00 0.00 ? 2  ARG P HG2  6  
ATOM 5994  H HG3  . ARG A 1 4  ? -13.233 -5.756  19.293  1.00 0.00 ? 2  ARG P HG3  6  
ATOM 5995  H HD2  . ARG A 1 4  ? -13.979 -3.383  19.283  1.00 0.00 ? 2  ARG P HD2  6  
ATOM 5996  H HD3  . ARG A 1 4  ? -14.987 -3.721  17.858  1.00 0.00 ? 2  ARG P HD3  6  
ATOM 5997  H HE   . ARG A 1 4  ? -15.678 -5.611  19.845  1.00 0.00 ? 2  ARG P HE   6  
ATOM 5998  H HH11 . ARG A 1 4  ? -15.984 -2.143  19.434  1.00 0.00 ? 2  ARG P HH11 6  
ATOM 5999  H HH12 . ARG A 1 4  ? -17.408 -2.059  20.435  1.00 0.00 ? 2  ARG P HH12 6  
ATOM 6000  H HH21 . ARG A 1 4  ? -17.493 -5.430  21.112  1.00 0.00 ? 2  ARG P HH21 6  
ATOM 6001  H HH22 . ARG A 1 4  ? -18.233 -3.875  21.358  1.00 0.00 ? 2  ARG P HH22 6  
ATOM 6002  N N    . ARG A 1 5  ? -11.439 -4.031  14.116  1.00 0.00 ? 3  ARG P N    6  
ATOM 6003  C CA   . ARG A 1 5  ? -10.276 -3.836  13.220  1.00 0.00 ? 3  ARG P CA   6  
ATOM 6004  C C    . ARG A 1 5  ? -9.005  -4.525  13.755  1.00 0.00 ? 3  ARG P C    6  
ATOM 6005  O O    . ARG A 1 5  ? -7.890  -4.015  13.638  1.00 0.00 ? 3  ARG P O    6  
ATOM 6006  C CB   . ARG A 1 5  ? -10.085 -2.347  12.844  1.00 0.00 ? 3  ARG P CB   6  
ATOM 6007  C CG   . ARG A 1 5  ? -11.233 -1.714  12.028  1.00 0.00 ? 3  ARG P CG   6  
ATOM 6008  C CD   . ARG A 1 5  ? -12.512 -1.356  12.806  1.00 0.00 ? 3  ARG P CD   6  
ATOM 6009  N NE   . ARG A 1 5  ? -12.254 -0.379  13.882  1.00 0.00 ? 3  ARG P NE   6  
ATOM 6010  C CZ   . ARG A 1 5  ? -13.027 -0.105  14.918  1.00 0.00 ? 3  ARG P CZ   6  
ATOM 6011  N NH1  . ARG A 1 5  ? -14.123 -0.762  15.178  1.00 0.00 ? 3  ARG P NH1  6  
ATOM 6012  N NH2  . ARG A 1 5  ? -12.706 0.858   15.734  1.00 0.00 ? 3  ARG P NH2  6  
ATOM 6013  H H    . ARG A 1 5  ? -12.234 -4.527  13.742  1.00 0.00 ? 3  ARG P H    6  
ATOM 6014  H HA   . ARG A 1 5  ? -10.489 -4.366  12.290  1.00 0.00 ? 3  ARG P HA   6  
ATOM 6015  H HB2  . ARG A 1 5  ? -9.899  -1.757  13.742  1.00 0.00 ? 3  ARG P HB2  6  
ATOM 6016  H HB3  . ARG A 1 5  ? -9.193  -2.273  12.222  1.00 0.00 ? 3  ARG P HB3  6  
ATOM 6017  H HG2  . ARG A 1 5  ? -10.855 -0.796  11.575  1.00 0.00 ? 3  ARG P HG2  6  
ATOM 6018  H HG3  . ARG A 1 5  ? -11.498 -2.390  11.214  1.00 0.00 ? 3  ARG P HG3  6  
ATOM 6019  H HD2  . ARG A 1 5  ? -13.226 -0.922  12.103  1.00 0.00 ? 3  ARG P HD2  6  
ATOM 6020  H HD3  . ARG A 1 5  ? -12.960 -2.262  13.206  1.00 0.00 ? 3  ARG P HD3  6  
ATOM 6021  H HE   . ARG A 1 5  ? -11.429 0.190   13.787  1.00 0.00 ? 3  ARG P HE   6  
ATOM 6022  H HH11 . ARG A 1 5  ? -14.386 -1.560  14.610  1.00 0.00 ? 3  ARG P HH11 6  
ATOM 6023  H HH12 . ARG A 1 5  ? -14.707 -0.492  15.949  1.00 0.00 ? 3  ARG P HH12 6  
ATOM 6024  H HH21 . ARG A 1 5  ? -11.871 1.399   15.577  1.00 0.00 ? 3  ARG P HH21 6  
ATOM 6025  H HH22 . ARG A 1 5  ? -13.292 1.073   16.524  1.00 0.00 ? 3  ARG P HH22 6  
ATOM 6026  N N    . GLN A 1 6  ? -9.196  -5.692  14.372  1.00 0.00 ? 4  GLN P N    6  
ATOM 6027  C CA   . GLN A 1 6  ? -8.165  -6.516  15.004  1.00 0.00 ? 4  GLN P CA   6  
ATOM 6028  C C    . GLN A 1 6  ? -7.413  -7.412  14.000  1.00 0.00 ? 4  GLN P C    6  
ATOM 6029  O O    . GLN A 1 6  ? -7.982  -7.826  12.985  1.00 0.00 ? 4  GLN P O    6  
ATOM 6030  C CB   . GLN A 1 6  ? -8.792  -7.317  16.168  1.00 0.00 ? 4  GLN P CB   6  
ATOM 6031  C CG   . GLN A 1 6  ? -9.627  -8.563  15.796  1.00 0.00 ? 4  GLN P CG   6  
ATOM 6032  C CD   . GLN A 1 6  ? -10.943 -8.320  15.045  1.00 0.00 ? 4  GLN P CD   6  
ATOM 6033  O OE1  . GLN A 1 6  ? -11.496 -7.228  14.984  1.00 0.00 ? 4  GLN P OE1  6  
ATOM 6034  N NE2  . GLN A 1 6  ? -11.510 -9.351  14.458  1.00 0.00 ? 4  GLN P NE2  6  
ATOM 6035  H H    . GLN A 1 6  ? -10.148 -6.033  14.418  1.00 0.00 ? 4  GLN P H    6  
ATOM 6036  H HA   . GLN A 1 6  ? -7.432  -5.840  15.448  1.00 0.00 ? 4  GLN P HA   6  
ATOM 6037  H HB2  . GLN A 1 6  ? -7.973  -7.662  16.801  1.00 0.00 ? 4  GLN P HB2  6  
ATOM 6038  H HB3  . GLN A 1 6  ? -9.401  -6.649  16.777  1.00 0.00 ? 4  GLN P HB3  6  
ATOM 6039  H HG2  . GLN A 1 6  ? -9.010  -9.246  15.212  1.00 0.00 ? 4  GLN P HG2  6  
ATOM 6040  H HG3  . GLN A 1 6  ? -9.878  -9.085  16.720  1.00 0.00 ? 4  GLN P HG3  6  
ATOM 6041  H HE21 . GLN A 1 6  ? -11.081 -10.262 14.497  1.00 0.00 ? 4  GLN P HE21 6  
ATOM 6042  H HE22 . GLN A 1 6  ? -12.383 -9.212  13.953  1.00 0.00 ? 4  GLN P HE22 6  
ATOM 6043  N N    . ARG A 1 7  ? -6.149  -7.747  14.311  1.00 0.00 ? 5  ARG P N    6  
ATOM 6044  C CA   . ARG A 1 7  ? -5.295  -8.727  13.597  1.00 0.00 ? 5  ARG P CA   6  
ATOM 6045  C C    . ARG A 1 7  ? -5.310  -8.571  12.062  1.00 0.00 ? 5  ARG P C    6  
ATOM 6046  O O    . ARG A 1 7  ? -5.539  -9.528  11.321  1.00 0.00 ? 5  ARG P O    6  
ATOM 6047  C CB   . ARG A 1 7  ? -5.638  -10.147 14.100  1.00 0.00 ? 5  ARG P CB   6  
ATOM 6048  C CG   . ARG A 1 7  ? -4.498  -11.155 13.858  1.00 0.00 ? 5  ARG P CG   6  
ATOM 6049  C CD   . ARG A 1 7  ? -4.888  -12.578 14.276  1.00 0.00 ? 5  ARG P CD   6  
ATOM 6050  N NE   . ARG A 1 7  ? -5.918  -13.152 13.383  1.00 0.00 ? 5  ARG P NE   6  
ATOM 6051  C CZ   . ARG A 1 7  ? -6.512  -14.324 13.513  1.00 0.00 ? 5  ARG P CZ   6  
ATOM 6052  N NH1  . ARG A 1 7  ? -6.238  -15.138 14.494  1.00 0.00 ? 5  ARG P NH1  6  
ATOM 6053  N NH2  . ARG A 1 7  ? -7.405  -14.710 12.646  1.00 0.00 ? 5  ARG P NH2  6  
ATOM 6054  H H    . ARG A 1 7  ? -5.775  -7.350  15.164  1.00 0.00 ? 5  ARG P H    6  
ATOM 6055  H HA   . ARG A 1 7  ? -4.266  -8.521  13.894  1.00 0.00 ? 5  ARG P HA   6  
ATOM 6056  H HB2  . ARG A 1 7  ? -5.822  -10.110 15.175  1.00 0.00 ? 5  ARG P HB2  6  
ATOM 6057  H HB3  . ARG A 1 7  ? -6.555  -10.487 13.617  1.00 0.00 ? 5  ARG P HB3  6  
ATOM 6058  H HG2  . ARG A 1 7  ? -4.207  -11.165 12.807  1.00 0.00 ? 5  ARG P HG2  6  
ATOM 6059  H HG3  . ARG A 1 7  ? -3.631  -10.848 14.445  1.00 0.00 ? 5  ARG P HG3  6  
ATOM 6060  H HD2  . ARG A 1 7  ? -3.995  -13.205 14.238  1.00 0.00 ? 5  ARG P HD2  6  
ATOM 6061  H HD3  . ARG A 1 7  ? -5.254  -12.557 15.305  1.00 0.00 ? 5  ARG P HD3  6  
ATOM 6062  H HE   . ARG A 1 7  ? -6.186  -12.600 12.583  1.00 0.00 ? 5  ARG P HE   6  
ATOM 6063  H HH11 . ARG A 1 7  ? -5.548  -14.868 15.176  1.00 0.00 ? 5  ARG P HH11 6  
ATOM 6064  H HH12 . ARG A 1 7  ? -6.703  -16.027 14.571  1.00 0.00 ? 5  ARG P HH12 6  
ATOM 6065  H HH21 . ARG A 1 7  ? -7.647  -14.115 11.870  1.00 0.00 ? 5  ARG P HH21 6  
ATOM 6066  H HH22 . ARG A 1 7  ? -7.855  -15.604 12.744  1.00 0.00 ? 5  ARG P HH22 6  
ATOM 6067  N N    . THR A 1 8  ? -5.090  -7.344  11.584  1.00 0.00 ? 6  THR P N    6  
ATOM 6068  C CA   . THR A 1 8  ? -5.199  -6.965  10.159  1.00 0.00 ? 6  THR P CA   6  
ATOM 6069  C C    . THR A 1 8  ? -4.163  -7.649  9.258   1.00 0.00 ? 6  THR P C    6  
ATOM 6070  O O    . THR A 1 8  ? -4.514  -8.089  8.160   1.00 0.00 ? 6  THR P O    6  
ATOM 6071  C CB   . THR A 1 8  ? -5.106  -5.438  10.002  1.00 0.00 ? 6  THR P CB   6  
ATOM 6072  O OG1  . THR A 1 8  ? -4.080  -4.908  10.823  1.00 0.00 ? 6  THR P OG1  6  
ATOM 6073  C CG2  . THR A 1 8  ? -6.408  -4.766  10.433  1.00 0.00 ? 6  THR P CG2  6  
ATOM 6074  H H    . THR A 1 8  ? -4.915  -6.602  12.247  1.00 0.00 ? 6  THR P H    6  
ATOM 6075  H HA   . THR A 1 8  ? -6.178  -7.277  9.796   1.00 0.00 ? 6  THR P HA   6  
ATOM 6076  H HB   . THR A 1 8  ? -4.912  -5.184  8.960   1.00 0.00 ? 6  THR P HB   6  
ATOM 6077  H HG1  . THR A 1 8  ? -4.341  -3.995  11.047  1.00 0.00 ? 6  THR P HG1  6  
ATOM 6078  H HG21 . THR A 1 8  ? -6.614  -4.983  11.481  1.00 0.00 ? 6  THR P HG21 6  
ATOM 6079  H HG22 . THR A 1 8  ? -7.232  -5.138  9.823   1.00 0.00 ? 6  THR P HG22 6  
ATOM 6080  H HG23 . THR A 1 8  ? -6.333  -3.688  10.293  1.00 0.00 ? 6  THR P HG23 6  
ATOM 6081  N N    . HIS A 1 9  ? -2.924  -7.811  9.746   1.00 0.00 ? 7  HIS P N    6  
ATOM 6082  C CA   . HIS A 1 9  ? -1.812  -8.541  9.103   1.00 0.00 ? 7  HIS P CA   6  
ATOM 6083  C C    . HIS A 1 9  ? -1.516  -8.103  7.643   1.00 0.00 ? 7  HIS P C    6  
ATOM 6084  O O    . HIS A 1 9  ? -1.902  -7.012  7.216   1.00 0.00 ? 7  HIS P O    6  
ATOM 6085  C CB   . HIS A 1 9  ? -2.080  -10.053 9.284   1.00 0.00 ? 7  HIS P CB   6  
ATOM 6086  C CG   . HIS A 1 9  ? -0.878  -10.952 9.101   1.00 0.00 ? 7  HIS P CG   6  
ATOM 6087  N ND1  . HIS A 1 9  ? 0.462   -10.558 9.185   1.00 0.00 ? 7  HIS P ND1  6  
ATOM 6088  C CD2  . HIS A 1 9  ? -0.924  -12.280 8.792   1.00 0.00 ? 7  HIS P CD2  6  
ATOM 6089  C CE1  . HIS A 1 9  ? 1.190   -11.658 8.926   1.00 0.00 ? 7  HIS P CE1  6  
ATOM 6090  N NE2  . HIS A 1 9  ? 0.382   -12.706 8.687   1.00 0.00 ? 7  HIS P NE2  6  
ATOM 6091  H H    . HIS A 1 9  ? -2.747  -7.409  10.654  1.00 0.00 ? 7  HIS P H    6  
ATOM 6092  H HA   . HIS A 1 9  ? -0.904  -8.315  9.662   1.00 0.00 ? 7  HIS P HA   6  
ATOM 6093  H HB2  . HIS A 1 9  ? -2.452  -10.226 10.294  1.00 0.00 ? 7  HIS P HB2  6  
ATOM 6094  H HB3  . HIS A 1 9  ? -2.859  -10.362 8.587   1.00 0.00 ? 7  HIS P HB3  6  
ATOM 6095  H HD2  . HIS A 1 9  ? -1.819  -12.873 8.645   1.00 0.00 ? 7  HIS P HD2  6  
ATOM 6096  H HE1  . HIS A 1 9  ? 2.274   -11.697 8.911   1.00 0.00 ? 7  HIS P HE1  6  
ATOM 6097  H HE2  . HIS A 1 9  ? 0.695   -13.645 8.462   1.00 0.00 ? 7  HIS P HE2  6  
ATOM 6098  N N    . PHE A 1 10 ? -0.800  -8.937  6.885   1.00 0.00 ? 8  PHE P N    6  
ATOM 6099  C CA   . PHE A 1 10 ? -0.568  -8.830  5.440   1.00 0.00 ? 8  PHE P CA   6  
ATOM 6100  C C    . PHE A 1 10 ? -0.886  -10.166 4.737   1.00 0.00 ? 8  PHE P C    6  
ATOM 6101  O O    . PHE A 1 10 ? -0.832  -11.232 5.359   1.00 0.00 ? 8  PHE P O    6  
ATOM 6102  C CB   . PHE A 1 10 ? 0.901   -8.466  5.162   1.00 0.00 ? 8  PHE P CB   6  
ATOM 6103  C CG   . PHE A 1 10 ? 1.417   -7.160  5.741   1.00 0.00 ? 8  PHE P CG   6  
ATOM 6104  C CD1  . PHE A 1 10 ? 2.024   -7.143  7.014   1.00 0.00 ? 8  PHE P CD1  6  
ATOM 6105  C CD2  . PHE A 1 10 ? 1.391   -5.983  4.968   1.00 0.00 ? 8  PHE P CD2  6  
ATOM 6106  C CE1  . PHE A 1 10 ? 2.616   -5.963  7.501   1.00 0.00 ? 8  PHE P CE1  6  
ATOM 6107  C CE2  . PHE A 1 10 ? 1.987   -4.805  5.453   1.00 0.00 ? 8  PHE P CE2  6  
ATOM 6108  C CZ   . PHE A 1 10 ? 2.604   -4.795  6.716   1.00 0.00 ? 8  PHE P CZ   6  
ATOM 6109  H H    . PHE A 1 10 ? -0.451  -9.779  7.327   1.00 0.00 ? 8  PHE P H    6  
ATOM 6110  H HA   . PHE A 1 10 ? -1.207  -8.055  5.019   1.00 0.00 ? 8  PHE P HA   6  
ATOM 6111  H HB2  . PHE A 1 10 ? 1.534   -9.276  5.527   1.00 0.00 ? 8  PHE P HB2  6  
ATOM 6112  H HB3  . PHE A 1 10 ? 1.037   -8.426  4.081   1.00 0.00 ? 8  PHE P HB3  6  
ATOM 6113  H HD1  . PHE A 1 10 ? 2.065   -8.048  7.604   1.00 0.00 ? 8  PHE P HD1  6  
ATOM 6114  H HD2  . PHE A 1 10 ? 0.940   -5.991  3.985   1.00 0.00 ? 8  PHE P HD2  6  
ATOM 6115  H HE1  . PHE A 1 10 ? 3.112   -5.962  8.463   1.00 0.00 ? 8  PHE P HE1  6  
ATOM 6116  H HE2  . PHE A 1 10 ? 1.989   -3.911  4.844   1.00 0.00 ? 8  PHE P HE2  6  
ATOM 6117  H HZ   . PHE A 1 10 ? 3.080   -3.894  7.078   1.00 0.00 ? 8  PHE P HZ   6  
ATOM 6118  N N    . THR A 1 11 ? -1.154  -10.129 3.429   1.00 0.00 ? 9  THR P N    6  
ATOM 6119  C CA   . THR A 1 11 ? -1.249  -11.319 2.559   1.00 0.00 ? 9  THR P CA   6  
ATOM 6120  C C    . THR A 1 11 ? -0.540  -11.094 1.218   1.00 0.00 ? 9  THR P C    6  
ATOM 6121  O O    . THR A 1 11 ? -0.271  -9.955  0.827   1.00 0.00 ? 9  THR P O    6  
ATOM 6122  C CB   . THR A 1 11 ? -2.706  -11.788 2.391   1.00 0.00 ? 9  THR P CB   6  
ATOM 6123  O OG1  . THR A 1 11 ? -2.718  -13.073 1.809   1.00 0.00 ? 9  THR P OG1  6  
ATOM 6124  C CG2  . THR A 1 11 ? -3.578  -10.881 1.520   1.00 0.00 ? 9  THR P CG2  6  
ATOM 6125  H H    . THR A 1 11 ? -1.247  -9.221  2.991   1.00 0.00 ? 9  THR P H    6  
ATOM 6126  H HA   . THR A 1 11 ? -0.718  -12.137 3.044   1.00 0.00 ? 9  THR P HA   6  
ATOM 6127  H HB   . THR A 1 11 ? -3.160  -11.858 3.381   1.00 0.00 ? 9  THR P HB   6  
ATOM 6128  H HG1  . THR A 1 11 ? -3.628  -13.418 1.872   1.00 0.00 ? 9  THR P HG1  6  
ATOM 6129  H HG21 . THR A 1 11 ? -3.173  -10.807 0.513   1.00 0.00 ? 9  THR P HG21 6  
ATOM 6130  H HG22 . THR A 1 11 ? -3.631  -9.893  1.968   1.00 0.00 ? 9  THR P HG22 6  
ATOM 6131  H HG23 . THR A 1 11 ? -4.589  -11.286 1.469   1.00 0.00 ? 9  THR P HG23 6  
ATOM 6132  N N    . SER A 1 12 ? -0.220  -12.172 0.499   1.00 0.00 ? 10 SER P N    6  
ATOM 6133  C CA   . SER A 1 12 ? 0.623   -12.155 -0.709  1.00 0.00 ? 10 SER P CA   6  
ATOM 6134  C C    . SER A 1 12 ? 0.086   -11.270 -1.839  1.00 0.00 ? 10 SER P C    6  
ATOM 6135  O O    . SER A 1 12 ? 0.873   -10.696 -2.591  1.00 0.00 ? 10 SER P O    6  
ATOM 6136  C CB   . SER A 1 12 ? 0.830   -13.587 -1.218  1.00 0.00 ? 10 SER P CB   6  
ATOM 6137  O OG   . SER A 1 12 ? -0.413  -14.187 -1.551  1.00 0.00 ? 10 SER P OG   6  
ATOM 6138  H H    . SER A 1 12 ? -0.569  -13.069 0.816   1.00 0.00 ? 10 SER P H    6  
ATOM 6139  H HA   . SER A 1 12 ? 1.603   -11.762 -0.434  1.00 0.00 ? 10 SER P HA   6  
ATOM 6140  H HB2  . SER A 1 12 ? 1.478   -13.570 -2.096  1.00 0.00 ? 10 SER P HB2  6  
ATOM 6141  H HB3  . SER A 1 12 ? 1.319   -14.175 -0.439  1.00 0.00 ? 10 SER P HB3  6  
ATOM 6142  H HG   . SER A 1 12 ? -0.245  -15.107 -1.835  1.00 0.00 ? 10 SER P HG   6  
ATOM 6143  N N    . GLN A 1 13 ? -1.235  -11.096 -1.949  1.00 0.00 ? 11 GLN P N    6  
ATOM 6144  C CA   . GLN A 1 13 ? -1.854  -10.195 -2.931  1.00 0.00 ? 11 GLN P CA   6  
ATOM 6145  C C    . GLN A 1 13 ? -1.577  -8.714  -2.608  1.00 0.00 ? 11 GLN P C    6  
ATOM 6146  O O    . GLN A 1 13 ? -1.251  -7.935  -3.504  1.00 0.00 ? 11 GLN P O    6  
ATOM 6147  C CB   . GLN A 1 13 ? -3.367  -10.465 -3.007  1.00 0.00 ? 11 GLN P CB   6  
ATOM 6148  C CG   . GLN A 1 13 ? -3.688  -11.875 -3.531  1.00 0.00 ? 11 GLN P CG   6  
ATOM 6149  C CD   . GLN A 1 13 ? -5.193  -12.107 -3.654  1.00 0.00 ? 11 GLN P CD   6  
ATOM 6150  O OE1  . GLN A 1 13 ? -5.835  -12.688 -2.787  1.00 0.00 ? 11 GLN P OE1  6  
ATOM 6151  N NE2  . GLN A 1 13 ? -5.821  -11.656 -4.721  1.00 0.00 ? 11 GLN P NE2  6  
ATOM 6152  H H    . GLN A 1 13 ? -1.829  -11.639 -1.339  1.00 0.00 ? 11 GLN P H    6  
ATOM 6153  H HA   . GLN A 1 13 ? -1.425  -10.394 -3.914  1.00 0.00 ? 11 GLN P HA   6  
ATOM 6154  H HB2  . GLN A 1 13 ? -3.812  -10.338 -2.018  1.00 0.00 ? 11 GLN P HB2  6  
ATOM 6155  H HB3  . GLN A 1 13 ? -3.817  -9.733  -3.681  1.00 0.00 ? 11 GLN P HB3  6  
ATOM 6156  H HG2  . GLN A 1 13 ? -3.225  -12.009 -4.510  1.00 0.00 ? 11 GLN P HG2  6  
ATOM 6157  H HG3  . GLN A 1 13 ? -3.274  -12.624 -2.855  1.00 0.00 ? 11 GLN P HG3  6  
ATOM 6158  H HE21 . GLN A 1 13 ? -5.314  -11.174 -5.448  1.00 0.00 ? 11 GLN P HE21 6  
ATOM 6159  H HE22 . GLN A 1 13 ? -6.816  -11.811 -4.793  1.00 0.00 ? 11 GLN P HE22 6  
ATOM 6160  N N    . GLN A 1 14 ? -1.631  -8.331  -1.327  1.00 0.00 ? 12 GLN P N    6  
ATOM 6161  C CA   . GLN A 1 14 ? -1.318  -6.972  -0.862  1.00 0.00 ? 12 GLN P CA   6  
ATOM 6162  C C    . GLN A 1 14 ? 0.180   -6.673  -1.006  1.00 0.00 ? 12 GLN P C    6  
ATOM 6163  O O    . GLN A 1 14 ? 0.562   -5.596  -1.459  1.00 0.00 ? 12 GLN P O    6  
ATOM 6164  C CB   . GLN A 1 14 ? -1.724  -6.812  0.612   1.00 0.00 ? 12 GLN P CB   6  
ATOM 6165  C CG   . GLN A 1 14 ? -3.227  -6.996  0.874   1.00 0.00 ? 12 GLN P CG   6  
ATOM 6166  C CD   . GLN A 1 14 ? -3.543  -7.041  2.369   1.00 0.00 ? 12 GLN P CD   6  
ATOM 6167  O OE1  . GLN A 1 14 ? -2.876  -7.703  3.151   1.00 0.00 ? 12 GLN P OE1  6  
ATOM 6168  N NE2  . GLN A 1 14 ? -4.571  -6.365  2.826   1.00 0.00 ? 12 GLN P NE2  6  
ATOM 6169  H H    . GLN A 1 14 ? -1.818  -9.038  -0.627  1.00 0.00 ? 12 GLN P H    6  
ATOM 6170  H HA   . GLN A 1 14 ? -1.869  -6.245  -1.462  1.00 0.00 ? 12 GLN P HA   6  
ATOM 6171  H HB2  . GLN A 1 14 ? -1.162  -7.530  1.210   1.00 0.00 ? 12 GLN P HB2  6  
ATOM 6172  H HB3  . GLN A 1 14 ? -1.442  -5.813  0.943   1.00 0.00 ? 12 GLN P HB3  6  
ATOM 6173  H HG2  . GLN A 1 14 ? -3.766  -6.177  0.400   1.00 0.00 ? 12 GLN P HG2  6  
ATOM 6174  H HG3  . GLN A 1 14 ? -3.579  -7.927  0.431   1.00 0.00 ? 12 GLN P HG3  6  
ATOM 6175  H HE21 . GLN A 1 14 ? -5.081  -5.744  2.205   1.00 0.00 ? 12 GLN P HE21 6  
ATOM 6176  H HE22 . GLN A 1 14 ? -4.753  -6.383  3.815   1.00 0.00 ? 12 GLN P HE22 6  
ATOM 6177  N N    . LEU A 1 15 ? 1.030   -7.648  -0.667  1.00 0.00 ? 13 LEU P N    6  
ATOM 6178  C CA   . LEU A 1 15 ? 2.489   -7.530  -0.735  1.00 0.00 ? 13 LEU P CA   6  
ATOM 6179  C C    . LEU A 1 15 ? 2.995   -7.427  -2.187  1.00 0.00 ? 13 LEU P C    6  
ATOM 6180  O O    . LEU A 1 15 ? 3.928   -6.671  -2.456  1.00 0.00 ? 13 LEU P O    6  
ATOM 6181  C CB   . LEU A 1 15 ? 3.114   -8.721  0.017   1.00 0.00 ? 13 LEU P CB   6  
ATOM 6182  C CG   . LEU A 1 15 ? 2.830   -8.726  1.536   1.00 0.00 ? 13 LEU P CG   6  
ATOM 6183  C CD1  . LEU A 1 15 ? 3.220   -10.074 2.144   1.00 0.00 ? 13 LEU P CD1  6  
ATOM 6184  C CD2  . LEU A 1 15 ? 3.606   -7.634  2.274   1.00 0.00 ? 13 LEU P CD2  6  
ATOM 6185  H H    . LEU A 1 15 ? 0.634   -8.500  -0.281  1.00 0.00 ? 13 LEU P H    6  
ATOM 6186  H HA   . LEU A 1 15 ? 2.788   -6.607  -0.239  1.00 0.00 ? 13 LEU P HA   6  
ATOM 6187  H HB2  . LEU A 1 15 ? 2.729   -9.642  -0.422  1.00 0.00 ? 13 LEU P HB2  6  
ATOM 6188  H HB3  . LEU A 1 15 ? 4.194   -8.709  -0.136  1.00 0.00 ? 13 LEU P HB3  6  
ATOM 6189  H HG   . LEU A 1 15 ? 1.768   -8.572  1.716   1.00 0.00 ? 13 LEU P HG   6  
ATOM 6190  H HD11 . LEU A 1 15 ? 2.642   -10.869 1.674   1.00 0.00 ? 13 LEU P HD11 6  
ATOM 6191  H HD12 . LEU A 1 15 ? 2.999   -10.074 3.212   1.00 0.00 ? 13 LEU P HD12 6  
ATOM 6192  H HD13 . LEU A 1 15 ? 4.282   -10.261 1.993   1.00 0.00 ? 13 LEU P HD13 6  
ATOM 6193  H HD21 . LEU A 1 15 ? 3.300   -6.649  1.921   1.00 0.00 ? 13 LEU P HD21 6  
ATOM 6194  H HD22 . LEU A 1 15 ? 4.676   -7.765  2.116   1.00 0.00 ? 13 LEU P HD22 6  
ATOM 6195  H HD23 . LEU A 1 15 ? 3.396   -7.691  3.342   1.00 0.00 ? 13 LEU P HD23 6  
ATOM 6196  N N    . GLN A 1 16 ? 2.354   -8.113  -3.139  1.00 0.00 ? 14 GLN P N    6  
ATOM 6197  C CA   . GLN A 1 16 ? 2.668   -7.992  -4.572  1.00 0.00 ? 14 GLN P CA   6  
ATOM 6198  C C    . GLN A 1 16 ? 2.116   -6.707  -5.202  1.00 0.00 ? 14 GLN P C    6  
ATOM 6199  O O    . GLN A 1 16 ? 2.779   -6.118  -6.054  1.00 0.00 ? 14 GLN P O    6  
ATOM 6200  C CB   . GLN A 1 16 ? 2.164   -9.228  -5.325  1.00 0.00 ? 14 GLN P CB   6  
ATOM 6201  C CG   . GLN A 1 16 ? 3.070   -10.429 -5.026  1.00 0.00 ? 14 GLN P CG   6  
ATOM 6202  C CD   . GLN A 1 16 ? 2.500   -11.724 -5.597  1.00 0.00 ? 14 GLN P CD   6  
ATOM 6203  O OE1  . GLN A 1 16 ? 2.941   -12.247 -6.613  1.00 0.00 ? 14 GLN P OE1  6  
ATOM 6204  N NE2  . GLN A 1 16 ? 1.490   -12.282 -4.965  1.00 0.00 ? 14 GLN P NE2  6  
ATOM 6205  H H    . GLN A 1 16 ? 1.630   -8.764  -2.860  1.00 0.00 ? 14 GLN P H    6  
ATOM 6206  H HA   . GLN A 1 16 ? 3.752   -7.953  -4.689  1.00 0.00 ? 14 GLN P HA   6  
ATOM 6207  H HB2  . GLN A 1 16 ? 1.133   -9.441  -5.035  1.00 0.00 ? 14 GLN P HB2  6  
ATOM 6208  H HB3  . GLN A 1 16 ? 2.189   -9.037  -6.400  1.00 0.00 ? 14 GLN P HB3  6  
ATOM 6209  H HG2  . GLN A 1 16 ? 4.054   -10.239 -5.455  1.00 0.00 ? 14 GLN P HG2  6  
ATOM 6210  H HG3  . GLN A 1 16 ? 3.185   -10.537 -3.947  1.00 0.00 ? 14 GLN P HG3  6  
ATOM 6211  H HE21 . GLN A 1 16 ? 1.130   -11.830 -4.132  1.00 0.00 ? 14 GLN P HE21 6  
ATOM 6212  H HE22 . GLN A 1 16 ? 1.095   -13.135 -5.330  1.00 0.00 ? 14 GLN P HE22 6  
ATOM 6213  N N    . GLU A 1 17 ? 0.955   -6.217  -4.755  1.00 0.00 ? 15 GLU P N    6  
ATOM 6214  C CA   . GLU A 1 17 ? 0.467   -4.887  -5.144  1.00 0.00 ? 15 GLU P CA   6  
ATOM 6215  C C    . GLU A 1 17 ? 1.408   -3.784  -4.626  1.00 0.00 ? 15 GLU P C    6  
ATOM 6216  O O    . GLU A 1 17 ? 1.696   -2.825  -5.341  1.00 0.00 ? 15 GLU P O    6  
ATOM 6217  C CB   . GLU A 1 17 ? -0.968  -4.697  -4.624  1.00 0.00 ? 15 GLU P CB   6  
ATOM 6218  C CG   . GLU A 1 17 ? -1.695  -3.485  -5.227  1.00 0.00 ? 15 GLU P CG   6  
ATOM 6219  C CD   . GLU A 1 17 ? -2.081  -3.724  -6.702  1.00 0.00 ? 15 GLU P CD   6  
ATOM 6220  O OE1  . GLU A 1 17 ? -3.174  -4.281  -6.961  1.00 0.00 ? 15 GLU P OE1  6  
ATOM 6221  O OE2  . GLU A 1 17 ? -1.300  -3.354  -7.611  1.00 0.00 ? 15 GLU P OE2  6  
ATOM 6222  H H    . GLU A 1 17 ? 0.405   -6.764  -4.103  1.00 0.00 ? 15 GLU P H    6  
ATOM 6223  H HA   . GLU A 1 17 ? 0.455   -4.827  -6.233  1.00 0.00 ? 15 GLU P HA   6  
ATOM 6224  H HB2  . GLU A 1 17 ? -1.555  -5.587  -4.851  1.00 0.00 ? 15 GLU P HB2  6  
ATOM 6225  H HB3  . GLU A 1 17 ? -0.937  -4.584  -3.541  1.00 0.00 ? 15 GLU P HB3  6  
ATOM 6226  H HG2  . GLU A 1 17 ? -2.602  -3.307  -4.645  1.00 0.00 ? 15 GLU P HG2  6  
ATOM 6227  H HG3  . GLU A 1 17 ? -1.072  -2.593  -5.128  1.00 0.00 ? 15 GLU P HG3  6  
ATOM 6228  N N    . LEU A 1 18 ? 1.970   -3.953  -3.422  1.00 0.00 ? 16 LEU P N    6  
ATOM 6229  C CA   . LEU A 1 18 ? 2.980   -3.050  -2.858  1.00 0.00 ? 16 LEU P CA   6  
ATOM 6230  C C    . LEU A 1 18 ? 4.324   -3.142  -3.597  1.00 0.00 ? 16 LEU P C    6  
ATOM 6231  O O    . LEU A 1 18 ? 4.940   -2.112  -3.856  1.00 0.00 ? 16 LEU P O    6  
ATOM 6232  C CB   . LEU A 1 18 ? 3.138   -3.328  -1.354  1.00 0.00 ? 16 LEU P CB   6  
ATOM 6233  C CG   . LEU A 1 18 ? 2.115   -2.566  -0.494  1.00 0.00 ? 16 LEU P CG   6  
ATOM 6234  C CD1  . LEU A 1 18 ? 2.021   -3.202  0.893   1.00 0.00 ? 16 LEU P CD1  6  
ATOM 6235  C CD2  . LEU A 1 18 ? 2.519   -1.102  -0.311  1.00 0.00 ? 16 LEU P CD2  6  
ATOM 6236  H H    . LEU A 1 18 ? 1.696   -4.767  -2.880  1.00 0.00 ? 16 LEU P H    6  
ATOM 6237  H HA   . LEU A 1 18 ? 2.632   -2.025  -2.985  1.00 0.00 ? 16 LEU P HA   6  
ATOM 6238  H HB2  . LEU A 1 18 ? 3.052   -4.399  -1.176  1.00 0.00 ? 16 LEU P HB2  6  
ATOM 6239  H HB3  . LEU A 1 18 ? 4.135   -3.026  -1.038  1.00 0.00 ? 16 LEU P HB3  6  
ATOM 6240  H HG   . LEU A 1 18 ? 1.136   -2.593  -0.974  1.00 0.00 ? 16 LEU P HG   6  
ATOM 6241  H HD11 . LEU A 1 18 ? 1.333   -2.632  1.514   1.00 0.00 ? 16 LEU P HD11 6  
ATOM 6242  H HD12 . LEU A 1 18 ? 3.003   -3.217  1.365   1.00 0.00 ? 16 LEU P HD12 6  
ATOM 6243  H HD13 . LEU A 1 18 ? 1.650   -4.223  0.803   1.00 0.00 ? 16 LEU P HD13 6  
ATOM 6244  H HD21 . LEU A 1 18 ? 2.549   -0.599  -1.276  1.00 0.00 ? 16 LEU P HD21 6  
ATOM 6245  H HD22 . LEU A 1 18 ? 3.499   -1.039  0.160   1.00 0.00 ? 16 LEU P HD22 6  
ATOM 6246  H HD23 . LEU A 1 18 ? 1.789   -0.599  0.321   1.00 0.00 ? 16 LEU P HD23 6  
ATOM 6247  N N    . GLU A 1 19 ? 4.754   -4.334  -4.021  1.00 0.00 ? 17 GLU P N    6  
ATOM 6248  C CA   . GLU A 1 19 ? 5.945   -4.506  -4.863  1.00 0.00 ? 17 GLU P CA   6  
ATOM 6249  C C    . GLU A 1 19 ? 5.781   -3.822  -6.232  1.00 0.00 ? 17 GLU P C    6  
ATOM 6250  O O    . GLU A 1 19 ? 6.672   -3.090  -6.666  1.00 0.00 ? 17 GLU P O    6  
ATOM 6251  C CB   . GLU A 1 19 ? 6.257   -6.005  -5.009  1.00 0.00 ? 17 GLU P CB   6  
ATOM 6252  C CG   . GLU A 1 19 ? 7.534   -6.302  -5.812  1.00 0.00 ? 17 GLU P CG   6  
ATOM 6253  C CD   . GLU A 1 19 ? 8.803   -5.670  -5.210  1.00 0.00 ? 17 GLU P CD   6  
ATOM 6254  O OE1  . GLU A 1 19 ? 8.931   -5.591  -3.969  1.00 0.00 ? 17 GLU P OE1  6  
ATOM 6255  O OE2  . GLU A 1 19 ? 9.709   -5.265  -5.977  1.00 0.00 ? 17 GLU P OE2  6  
ATOM 6256  H H    . GLU A 1 19 ? 4.258   -5.161  -3.706  1.00 0.00 ? 17 GLU P H    6  
ATOM 6257  H HA   . GLU A 1 19 ? 6.788   -4.030  -4.364  1.00 0.00 ? 17 GLU P HA   6  
ATOM 6258  H HB2  . GLU A 1 19 ? 6.355   -6.449  -4.017  1.00 0.00 ? 17 GLU P HB2  6  
ATOM 6259  H HB3  . GLU A 1 19 ? 5.423   -6.494  -5.510  1.00 0.00 ? 17 GLU P HB3  6  
ATOM 6260  H HG2  . GLU A 1 19 ? 7.666   -7.384  -5.857  1.00 0.00 ? 17 GLU P HG2  6  
ATOM 6261  H HG3  . GLU A 1 19 ? 7.392   -5.951  -6.835  1.00 0.00 ? 17 GLU P HG3  6  
ATOM 6262  N N    . ALA A 1 20 ? 4.626   -3.979  -6.886  1.00 0.00 ? 18 ALA P N    6  
ATOM 6263  C CA   . ALA A 1 20 ? 4.305   -3.262  -8.122  1.00 0.00 ? 18 ALA P CA   6  
ATOM 6264  C C    . ALA A 1 20 ? 4.252   -1.733  -7.909  1.00 0.00 ? 18 ALA P C    6  
ATOM 6265  O O    . ALA A 1 20 ? 4.774   -0.971  -8.726  1.00 0.00 ? 18 ALA P O    6  
ATOM 6266  C CB   . ALA A 1 20 ? 2.982   -3.809  -8.672  1.00 0.00 ? 18 ALA P CB   6  
ATOM 6267  H H    . ALA A 1 20 ? 3.935   -4.621  -6.507  1.00 0.00 ? 18 ALA P H    6  
ATOM 6268  H HA   . ALA A 1 20 ? 5.088   -3.465  -8.855  1.00 0.00 ? 18 ALA P HA   6  
ATOM 6269  H HB1  . ALA A 1 20 ? 2.745   -3.314  -9.614  1.00 0.00 ? 18 ALA P HB1  6  
ATOM 6270  H HB2  . ALA A 1 20 ? 3.071   -4.882  -8.848  1.00 0.00 ? 18 ALA P HB2  6  
ATOM 6271  H HB3  . ALA A 1 20 ? 2.175   -3.628  -7.962  1.00 0.00 ? 18 ALA P HB3  6  
ATOM 6272  N N    . THR A 1 21 ? 3.693   -1.282  -6.781  1.00 0.00 ? 19 THR P N    6  
ATOM 6273  C CA   . THR A 1 21 ? 3.654   0.135   -6.376  1.00 0.00 ? 19 THR P CA   6  
ATOM 6274  C C    . THR A 1 21 ? 5.068   0.695   -6.169  1.00 0.00 ? 19 THR P C    6  
ATOM 6275  O O    . THR A 1 21 ? 5.379   1.767   -6.685  1.00 0.00 ? 19 THR P O    6  
ATOM 6276  C CB   . THR A 1 21 ? 2.807   0.306   -5.101  1.00 0.00 ? 19 THR P CB   6  
ATOM 6277  O OG1  . THR A 1 21 ? 1.482   -0.123  -5.331  1.00 0.00 ? 19 THR P OG1  6  
ATOM 6278  C CG2  . THR A 1 21 ? 2.676   1.746   -4.615  1.00 0.00 ? 19 THR P CG2  6  
ATOM 6279  H H    . THR A 1 21 ? 3.249   -1.964  -6.176  1.00 0.00 ? 19 THR P H    6  
ATOM 6280  H HA   . THR A 1 21 ? 3.183   0.716   -7.169  1.00 0.00 ? 19 THR P HA   6  
ATOM 6281  H HB   . THR A 1 21 ? 3.241   -0.286  -4.297  1.00 0.00 ? 19 THR P HB   6  
ATOM 6282  H HG1  . THR A 1 21 ? 1.498   -1.098  -5.399  1.00 0.00 ? 19 THR P HG1  6  
ATOM 6283  H HG21 . THR A 1 21 ? 2.123   2.340   -5.342  1.00 0.00 ? 19 THR P HG21 6  
ATOM 6284  H HG22 . THR A 1 21 ? 3.655   2.191   -4.459  1.00 0.00 ? 19 THR P HG22 6  
ATOM 6285  H HG23 . THR A 1 21 ? 2.143   1.732   -3.663  1.00 0.00 ? 19 THR P HG23 6  
ATOM 6286  N N    . PHE A 1 22 ? 5.957   -0.045  -5.499  1.00 0.00 ? 20 PHE P N    6  
ATOM 6287  C CA   . PHE A 1 22 ? 7.360   0.323   -5.270  1.00 0.00 ? 20 PHE P CA   6  
ATOM 6288  C C    . PHE A 1 22 ? 8.166   0.425   -6.574  1.00 0.00 ? 20 PHE P C    6  
ATOM 6289  O O    . PHE A 1 22 ? 8.949   1.359   -6.755  1.00 0.00 ? 20 PHE P O    6  
ATOM 6290  C CB   . PHE A 1 22 ? 7.978   -0.717  -4.328  1.00 0.00 ? 20 PHE P CB   6  
ATOM 6291  C CG   . PHE A 1 22 ? 9.430   -0.477  -3.961  1.00 0.00 ? 20 PHE P CG   6  
ATOM 6292  C CD1  . PHE A 1 22 ? 9.751   0.362   -2.877  1.00 0.00 ? 20 PHE P CD1  6  
ATOM 6293  C CD2  . PHE A 1 22 ? 10.461  -1.107  -4.685  1.00 0.00 ? 20 PHE P CD2  6  
ATOM 6294  C CE1  . PHE A 1 22 ? 11.094  0.566   -2.517  1.00 0.00 ? 20 PHE P CE1  6  
ATOM 6295  C CE2  . PHE A 1 22 ? 11.806  -0.895  -4.328  1.00 0.00 ? 20 PHE P CE2  6  
ATOM 6296  C CZ   . PHE A 1 22 ? 12.123  -0.064  -3.239  1.00 0.00 ? 20 PHE P CZ   6  
ATOM 6297  H H    . PHE A 1 22 ? 5.633   -0.912  -5.083  1.00 0.00 ? 20 PHE P H    6  
ATOM 6298  H HA   . PHE A 1 22 ? 7.397   1.296   -4.780  1.00 0.00 ? 20 PHE P HA   6  
ATOM 6299  H HB2  . PHE A 1 22 ? 7.391   -0.728  -3.414  1.00 0.00 ? 20 PHE P HB2  6  
ATOM 6300  H HB3  . PHE A 1 22 ? 7.896   -1.706  -4.777  1.00 0.00 ? 20 PHE P HB3  6  
ATOM 6301  H HD1  . PHE A 1 22 ? 8.965   0.839   -2.310  1.00 0.00 ? 20 PHE P HD1  6  
ATOM 6302  H HD2  . PHE A 1 22 ? 10.222  -1.758  -5.514  1.00 0.00 ? 20 PHE P HD2  6  
ATOM 6303  H HE1  . PHE A 1 22 ? 11.336  1.203   -1.683  1.00 0.00 ? 20 PHE P HE1  6  
ATOM 6304  H HE2  . PHE A 1 22 ? 12.597  -1.376  -4.889  1.00 0.00 ? 20 PHE P HE2  6  
ATOM 6305  H HZ   . PHE A 1 22 ? 13.154  0.098   -2.961  1.00 0.00 ? 20 PHE P HZ   6  
ATOM 6306  N N    . GLN A 1 23 ? 7.942   -0.498  -7.517  1.00 0.00 ? 21 GLN P N    6  
ATOM 6307  C CA   . GLN A 1 23 ? 8.574   -0.464  -8.841  1.00 0.00 ? 21 GLN P CA   6  
ATOM 6308  C C    . GLN A 1 23 ? 8.040   0.683   -9.725  1.00 0.00 ? 21 GLN P C    6  
ATOM 6309  O O    . GLN A 1 23 ? 8.781   1.199   -10.566 1.00 0.00 ? 21 GLN P O    6  
ATOM 6310  C CB   . GLN A 1 23 ? 8.414   -1.829  -9.529  1.00 0.00 ? 21 GLN P CB   6  
ATOM 6311  C CG   . GLN A 1 23 ? 9.255   -2.922  -8.842  1.00 0.00 ? 21 GLN P CG   6  
ATOM 6312  C CD   . GLN A 1 23 ? 9.111   -4.298  -9.494  1.00 0.00 ? 21 GLN P CD   6  
ATOM 6313  O OE1  . GLN A 1 23 ? 8.763   -4.453  -10.659 1.00 0.00 ? 21 GLN P OE1  6  
ATOM 6314  N NE2  . GLN A 1 23 ? 9.396   -5.363  -8.776  1.00 0.00 ? 21 GLN P NE2  6  
ATOM 6315  H H    . GLN A 1 23 ? 7.327   -1.275  -7.294  1.00 0.00 ? 21 GLN P H    6  
ATOM 6316  H HA   . GLN A 1 23 ? 9.643   -0.281  -8.709  1.00 0.00 ? 21 GLN P HA   6  
ATOM 6317  H HB2  . GLN A 1 23 ? 7.362   -2.119  -9.527  1.00 0.00 ? 21 GLN P HB2  6  
ATOM 6318  H HB3  . GLN A 1 23 ? 8.745   -1.738  -10.563 1.00 0.00 ? 21 GLN P HB3  6  
ATOM 6319  H HG2  . GLN A 1 23 ? 10.307  -2.639  -8.875  1.00 0.00 ? 21 GLN P HG2  6  
ATOM 6320  H HG3  . GLN A 1 23 ? 8.970   -3.001  -7.794  1.00 0.00 ? 21 GLN P HG3  6  
ATOM 6321  H HE21 . GLN A 1 23 ? 9.621   -5.265  -7.782  1.00 0.00 ? 21 GLN P HE21 6  
ATOM 6322  H HE22 . GLN A 1 23 ? 9.308   -6.270  -9.202  1.00 0.00 ? 21 GLN P HE22 6  
ATOM 6323  N N    . ARG A 1 24 ? 6.790   1.127   -9.516  1.00 0.00 ? 22 ARG P N    6  
ATOM 6324  C CA   . ARG A 1 24 ? 6.196   2.301   -10.187 1.00 0.00 ? 22 ARG P CA   6  
ATOM 6325  C C    . ARG A 1 24 ? 6.623   3.638   -9.565  1.00 0.00 ? 22 ARG P C    6  
ATOM 6326  O O    . ARG A 1 24 ? 6.776   4.616   -10.300 1.00 0.00 ? 22 ARG P O    6  
ATOM 6327  C CB   . ARG A 1 24 ? 4.661   2.134   -10.220 1.00 0.00 ? 22 ARG P CB   6  
ATOM 6328  C CG   . ARG A 1 24 ? 3.892   3.313   -10.844 1.00 0.00 ? 22 ARG P CG   6  
ATOM 6329  C CD   . ARG A 1 24 ? 4.304   3.617   -12.293 1.00 0.00 ? 22 ARG P CD   6  
ATOM 6330  N NE   . ARG A 1 24 ? 3.673   4.857   -12.788 1.00 0.00 ? 22 ARG P NE   6  
ATOM 6331  C CZ   . ARG A 1 24 ? 4.119   6.093   -12.637 1.00 0.00 ? 22 ARG P CZ   6  
ATOM 6332  N NH1  . ARG A 1 24 ? 5.197   6.379   -11.959 1.00 0.00 ? 22 ARG P NH1  6  
ATOM 6333  N NH2  . ARG A 1 24 ? 3.475   7.089   -13.175 1.00 0.00 ? 22 ARG P NH2  6  
ATOM 6334  H H    . ARG A 1 24 ? 6.211   0.605   -8.866  1.00 0.00 ? 22 ARG P H    6  
ATOM 6335  H HA   . ARG A 1 24 ? 6.560   2.315   -11.216 1.00 0.00 ? 22 ARG P HA   6  
ATOM 6336  H HB2  . ARG A 1 24 ? 4.420   1.228   -10.781 1.00 0.00 ? 22 ARG P HB2  6  
ATOM 6337  H HB3  . ARG A 1 24 ? 4.296   2.000   -9.202  1.00 0.00 ? 22 ARG P HB3  6  
ATOM 6338  H HG2  . ARG A 1 24 ? 2.826   3.079   -10.829 1.00 0.00 ? 22 ARG P HG2  6  
ATOM 6339  H HG3  . ARG A 1 24 ? 4.039   4.202   -10.228 1.00 0.00 ? 22 ARG P HG3  6  
ATOM 6340  H HD2  . ARG A 1 24 ? 5.387   3.714   -12.368 1.00 0.00 ? 22 ARG P HD2  6  
ATOM 6341  H HD3  . ARG A 1 24 ? 4.003   2.781   -12.926 1.00 0.00 ? 22 ARG P HD3  6  
ATOM 6342  H HE   . ARG A 1 24 ? 2.827   4.749   -13.325 1.00 0.00 ? 22 ARG P HE   6  
ATOM 6343  H HH11 . ARG A 1 24 ? 5.720   5.641   -11.500 1.00 0.00 ? 22 ARG P HH11 6  
ATOM 6344  H HH12 . ARG A 1 24 ? 5.508   7.332   -11.876 1.00 0.00 ? 22 ARG P HH12 6  
ATOM 6345  H HH21 . ARG A 1 24 ? 2.639   6.920   -13.712 1.00 0.00 ? 22 ARG P HH21 6  
ATOM 6346  H HH22 . ARG A 1 24 ? 3.810   8.031   -13.065 1.00 0.00 ? 22 ARG P HH22 6  
ATOM 6347  N N    . ASN A 1 25 ? 6.811   3.696   -8.247  1.00 0.00 ? 23 ASN P N    6  
ATOM 6348  C CA   . ASN A 1 25 ? 7.292   4.865   -7.504  1.00 0.00 ? 23 ASN P CA   6  
ATOM 6349  C C    . ASN A 1 25 ? 8.001   4.413   -6.214  1.00 0.00 ? 23 ASN P C    6  
ATOM 6350  O O    . ASN A 1 25 ? 7.383   3.817   -5.328  1.00 0.00 ? 23 ASN P O    6  
ATOM 6351  C CB   . ASN A 1 25 ? 6.102   5.802   -7.203  1.00 0.00 ? 23 ASN P CB   6  
ATOM 6352  C CG   . ASN A 1 25 ? 6.501   7.098   -6.506  1.00 0.00 ? 23 ASN P CG   6  
ATOM 6353  O OD1  . ASN A 1 25 ? 7.622   7.294   -6.060  1.00 0.00 ? 23 ASN P OD1  6  
ATOM 6354  N ND2  . ASN A 1 25 ? 5.589   8.035   -6.394  1.00 0.00 ? 23 ASN P ND2  6  
ATOM 6355  H H    . ASN A 1 25 ? 6.616   2.860   -7.706  1.00 0.00 ? 23 ASN P H    6  
ATOM 6356  H HA   . ASN A 1 25 ? 8.011   5.408   -8.122  1.00 0.00 ? 23 ASN P HA   6  
ATOM 6357  H HB2  . ASN A 1 25 ? 5.609   6.063   -8.140  1.00 0.00 ? 23 ASN P HB2  6  
ATOM 6358  H HB3  . ASN A 1 25 ? 5.378   5.283   -6.574  1.00 0.00 ? 23 ASN P HB3  6  
ATOM 6359  H HD21 . ASN A 1 25 ? 4.665   7.897   -6.772  1.00 0.00 ? 23 ASN P HD21 6  
ATOM 6360  H HD22 . ASN A 1 25 ? 5.864   8.912   -5.981  1.00 0.00 ? 23 ASN P HD22 6  
ATOM 6361  N N    . ARG A 1 26 ? 9.296   4.730   -6.092  1.00 0.00 ? 24 ARG P N    6  
ATOM 6362  C CA   . ARG A 1 26 ? 10.151  4.305   -4.969  1.00 0.00 ? 24 ARG P CA   6  
ATOM 6363  C C    . ARG A 1 26 ? 10.128  5.256   -3.761  1.00 0.00 ? 24 ARG P C    6  
ATOM 6364  O O    . ARG A 1 26 ? 10.721  4.945   -2.727  1.00 0.00 ? 24 ARG P O    6  
ATOM 6365  C CB   . ARG A 1 26 ? 11.575  4.050   -5.503  1.00 0.00 ? 24 ARG P CB   6  
ATOM 6366  C CG   . ARG A 1 26 ? 12.175  2.796   -4.859  1.00 0.00 ? 24 ARG P CG   6  
ATOM 6367  C CD   . ARG A 1 26 ? 13.615  2.514   -5.305  1.00 0.00 ? 24 ARG P CD   6  
ATOM 6368  N NE   . ARG A 1 26 ? 13.700  2.202   -6.747  1.00 0.00 ? 24 ARG P NE   6  
ATOM 6369  C CZ   . ARG A 1 26 ? 14.271  2.919   -7.699  1.00 0.00 ? 24 ARG P CZ   6  
ATOM 6370  N NH1  . ARG A 1 26 ? 14.881  4.046   -7.459  1.00 0.00 ? 24 ARG P NH1  6  
ATOM 6371  N NH2  . ARG A 1 26 ? 14.235  2.514   -8.935  1.00 0.00 ? 24 ARG P NH2  6  
ATOM 6372  H H    . ARG A 1 26 ? 9.728   5.245   -6.848  1.00 0.00 ? 24 ARG P H    6  
ATOM 6373  H HA   . ARG A 1 26 ? 9.754   3.356   -4.600  1.00 0.00 ? 24 ARG P HA   6  
ATOM 6374  H HB2  . ARG A 1 26 ? 11.541  3.889   -6.582  1.00 0.00 ? 24 ARG P HB2  6  
ATOM 6375  H HB3  . ARG A 1 26 ? 12.212  4.913   -5.305  1.00 0.00 ? 24 ARG P HB3  6  
ATOM 6376  H HG2  . ARG A 1 26 ? 12.170  2.915   -3.776  1.00 0.00 ? 24 ARG P HG2  6  
ATOM 6377  H HG3  . ARG A 1 26 ? 11.546  1.944   -5.124  1.00 0.00 ? 24 ARG P HG3  6  
ATOM 6378  H HD2  . ARG A 1 26 ? 14.244  3.364   -5.040  1.00 0.00 ? 24 ARG P HD2  6  
ATOM 6379  H HD3  . ARG A 1 26 ? 13.979  1.652   -4.745  1.00 0.00 ? 24 ARG P HD3  6  
ATOM 6380  H HE   . ARG A 1 26 ? 13.265  1.342   -7.042  1.00 0.00 ? 24 ARG P HE   6  
ATOM 6381  H HH11 . ARG A 1 26 ? 14.961  4.364   -6.509  1.00 0.00 ? 24 ARG P HH11 6  
ATOM 6382  H HH12 . ARG A 1 26 ? 15.301  4.571   -8.205  1.00 0.00 ? 24 ARG P HH12 6  
ATOM 6383  H HH21 . ARG A 1 26 ? 13.774  1.652   -9.175  1.00 0.00 ? 24 ARG P HH21 6  
ATOM 6384  H HH22 . ARG A 1 26 ? 14.668  3.060   -9.662  1.00 0.00 ? 24 ARG P HH22 6  
ATOM 6385  N N    . TYR A 1 27 ? 9.477   6.412   -3.892  1.00 0.00 ? 25 TYR P N    6  
ATOM 6386  C CA   . TYR A 1 27 ? 9.407   7.485   -2.888  1.00 0.00 ? 25 TYR P CA   6  
ATOM 6387  C C    . TYR A 1 27 ? 8.027   8.202   -2.868  1.00 0.00 ? 25 TYR P C    6  
ATOM 6388  O O    . TYR A 1 27 ? 7.965   9.431   -2.973  1.00 0.00 ? 25 TYR P O    6  
ATOM 6389  C CB   . TYR A 1 27 ? 10.608  8.438   -3.090  1.00 0.00 ? 25 TYR P CB   6  
ATOM 6390  C CG   . TYR A 1 27 ? 10.821  8.979   -4.501  1.00 0.00 ? 25 TYR P CG   6  
ATOM 6391  C CD1  . TYR A 1 27 ? 11.572  8.233   -5.434  1.00 0.00 ? 25 TYR P CD1  6  
ATOM 6392  C CD2  . TYR A 1 27 ? 10.299  10.234  -4.876  1.00 0.00 ? 25 TYR P CD2  6  
ATOM 6393  C CE1  . TYR A 1 27 ? 11.772  8.721   -6.740  1.00 0.00 ? 25 TYR P CE1  6  
ATOM 6394  C CE2  . TYR A 1 27 ? 10.498  10.727  -6.180  1.00 0.00 ? 25 TYR P CE2  6  
ATOM 6395  C CZ   . TYR A 1 27 ? 11.232  9.969   -7.120  1.00 0.00 ? 25 TYR P CZ   6  
ATOM 6396  O OH   . TYR A 1 27 ? 11.430  10.436  -8.383  1.00 0.00 ? 25 TYR P OH   6  
ATOM 6397  H H    . TYR A 1 27 ? 9.016   6.587   -4.777  1.00 0.00 ? 25 TYR P H    6  
ATOM 6398  H HA   . TYR A 1 27 ? 9.518   7.038   -1.899  1.00 0.00 ? 25 TYR P HA   6  
ATOM 6399  H HB2  . TYR A 1 27 ? 10.523  9.274   -2.394  1.00 0.00 ? 25 TYR P HB2  6  
ATOM 6400  H HB3  . TYR A 1 27 ? 11.512  7.899   -2.804  1.00 0.00 ? 25 TYR P HB3  6  
ATOM 6401  H HD1  . TYR A 1 27 ? 11.999  7.283   -5.148  1.00 0.00 ? 25 TYR P HD1  6  
ATOM 6402  H HD2  . TYR A 1 27 ? 9.741   10.824  -4.161  1.00 0.00 ? 25 TYR P HD2  6  
ATOM 6403  H HE1  . TYR A 1 27 ? 12.342  8.149   -7.457  1.00 0.00 ? 25 TYR P HE1  6  
ATOM 6404  H HE2  . TYR A 1 27 ? 10.090  11.687  -6.463  1.00 0.00 ? 25 TYR P HE2  6  
ATOM 6405  H HH   . TYR A 1 27 ? 11.016  11.304  -8.525  1.00 0.00 ? 25 TYR P HH   6  
ATOM 6406  N N    . PRO A 1 28 ? 6.895   7.474   -2.733  1.00 0.00 ? 26 PRO P N    6  
ATOM 6407  C CA   . PRO A 1 28 ? 5.557   8.073   -2.723  1.00 0.00 ? 26 PRO P CA   6  
ATOM 6408  C C    . PRO A 1 28 ? 5.336   9.009   -1.526  1.00 0.00 ? 26 PRO P C    6  
ATOM 6409  O O    . PRO A 1 28 ? 5.828   8.760   -0.421  1.00 0.00 ? 26 PRO P O    6  
ATOM 6410  C CB   . PRO A 1 28 ? 4.576   6.896   -2.716  1.00 0.00 ? 26 PRO P CB   6  
ATOM 6411  C CG   . PRO A 1 28 ? 5.367   5.779   -2.039  1.00 0.00 ? 26 PRO P CG   6  
ATOM 6412  C CD   . PRO A 1 28 ? 6.797   6.036   -2.509  1.00 0.00 ? 26 PRO P CD   6  
ATOM 6413  H HA   . PRO A 1 28 ? 5.404   8.646   -3.638  1.00 0.00 ? 26 PRO P HA   6  
ATOM 6414  H HB2  . PRO A 1 28 ? 3.657   7.121   -2.174  1.00 0.00 ? 26 PRO P HB2  6  
ATOM 6415  H HB3  . PRO A 1 28 ? 4.349   6.606   -3.743  1.00 0.00 ? 26 PRO P HB3  6  
ATOM 6416  H HG2  . PRO A 1 28 ? 5.313   5.885   -0.957  1.00 0.00 ? 26 PRO P HG2  6  
ATOM 6417  H HG3  . PRO A 1 28 ? 5.010   4.796   -2.347  1.00 0.00 ? 26 PRO P HG3  6  
ATOM 6418  H HD2  . PRO A 1 28 ? 7.507   5.694   -1.756  1.00 0.00 ? 26 PRO P HD2  6  
ATOM 6419  H HD3  . PRO A 1 28 ? 6.963   5.514   -3.451  1.00 0.00 ? 26 PRO P HD3  6  
ATOM 6420  N N    . ASP A 1 29 ? 4.553   10.068  -1.731  1.00 0.00 ? 27 ASP P N    6  
ATOM 6421  C CA   . ASP A 1 29 ? 4.103   10.983  -0.674  1.00 0.00 ? 27 ASP P CA   6  
ATOM 6422  C C    . ASP A 1 29 ? 2.994   10.345  0.185   1.00 0.00 ? 27 ASP P C    6  
ATOM 6423  O O    . ASP A 1 29 ? 2.334   9.394   -0.240  1.00 0.00 ? 27 ASP P O    6  
ATOM 6424  C CB   . ASP A 1 29 ? 3.649   12.306  -1.313  1.00 0.00 ? 27 ASP P CB   6  
ATOM 6425  C CG   . ASP A 1 29 ? 3.470   13.414  -0.262  1.00 0.00 ? 27 ASP P CG   6  
ATOM 6426  O OD1  . ASP A 1 29 ? 4.486   14.028  0.142   1.00 0.00 ? 27 ASP P OD1  6  
ATOM 6427  O OD2  . ASP A 1 29 ? 2.326   13.647  0.191   1.00 0.00 ? 27 ASP P OD2  6  
ATOM 6428  H H    . ASP A 1 29 ? 4.176   10.209  -2.656  1.00 0.00 ? 27 ASP P H    6  
ATOM 6429  H HA   . ASP A 1 29 ? 4.951   11.199  -0.022  1.00 0.00 ? 27 ASP P HA   6  
ATOM 6430  H HB2  . ASP A 1 29 ? 4.401   12.629  -2.037  1.00 0.00 ? 27 ASP P HB2  6  
ATOM 6431  H HB3  . ASP A 1 29 ? 2.713   12.145  -1.853  1.00 0.00 ? 27 ASP P HB3  6  
ATOM 6432  N N    . MET A 1 30 ? 2.760   10.857  1.396   1.00 0.00 ? 28 MET P N    6  
ATOM 6433  C CA   . MET A 1 30 ? 1.825   10.264  2.362   1.00 0.00 ? 28 MET P CA   6  
ATOM 6434  C C    . MET A 1 30 ? 0.370   10.209  1.863   1.00 0.00 ? 28 MET P C    6  
ATOM 6435  O O    . MET A 1 30 ? -0.356  9.284   2.228   1.00 0.00 ? 28 MET P O    6  
ATOM 6436  C CB   . MET A 1 30 ? 1.918   11.005  3.708   1.00 0.00 ? 28 MET P CB   6  
ATOM 6437  C CG   . MET A 1 30 ? 3.341   11.002  4.287   1.00 0.00 ? 28 MET P CG   6  
ATOM 6438  S SD   . MET A 1 30 ? 4.063   9.355   4.552   1.00 0.00 ? 28 MET P SD   6  
ATOM 6439  C CE   . MET A 1 30 ? 5.777   9.698   4.071   1.00 0.00 ? 28 MET P CE   6  
ATOM 6440  H H    . MET A 1 30 ? 3.284   11.673  1.683   1.00 0.00 ? 28 MET P H    6  
ATOM 6441  H HA   . MET A 1 30 ? 2.133   9.233   2.529   1.00 0.00 ? 28 MET P HA   6  
ATOM 6442  H HB2  . MET A 1 30 ? 1.593   12.038  3.576   1.00 0.00 ? 28 MET P HB2  6  
ATOM 6443  H HB3  . MET A 1 30 ? 1.250   10.524  4.424   1.00 0.00 ? 28 MET P HB3  6  
ATOM 6444  H HG2  . MET A 1 30 ? 3.989   11.564  3.615   1.00 0.00 ? 28 MET P HG2  6  
ATOM 6445  H HG3  . MET A 1 30 ? 3.330   11.530  5.241   1.00 0.00 ? 28 MET P HG3  6  
ATOM 6446  H HE1  . MET A 1 30 ? 6.388   8.811   4.236   1.00 0.00 ? 28 MET P HE1  6  
ATOM 6447  H HE2  . MET A 1 30 ? 5.813   9.966   3.013   1.00 0.00 ? 28 MET P HE2  6  
ATOM 6448  H HE3  . MET A 1 30 ? 6.171   10.521  4.668   1.00 0.00 ? 28 MET P HE3  6  
ATOM 6449  N N    . SER A 1 31 ? -0.053  11.118  0.978   1.00 0.00 ? 29 SER P N    6  
ATOM 6450  C CA   . SER A 1 31 ? -1.368  11.053  0.312   1.00 0.00 ? 29 SER P CA   6  
ATOM 6451  C C    . SER A 1 31 ? -1.464  9.909   -0.711  1.00 0.00 ? 29 SER P C    6  
ATOM 6452  O O    . SER A 1 31 ? -2.504  9.257   -0.821  1.00 0.00 ? 29 SER P O    6  
ATOM 6453  C CB   . SER A 1 31 ? -1.681  12.392  -0.366  1.00 0.00 ? 29 SER P CB   6  
ATOM 6454  O OG   . SER A 1 31 ? -0.705  12.701  -1.351  1.00 0.00 ? 29 SER P OG   6  
ATOM 6455  H H    . SER A 1 31 ? 0.584   11.853  0.695   1.00 0.00 ? 29 SER P H    6  
ATOM 6456  H HA   . SER A 1 31 ? -2.134  10.881  1.068   1.00 0.00 ? 29 SER P HA   6  
ATOM 6457  H HB2  . SER A 1 31 ? -2.666  12.338  -0.831  1.00 0.00 ? 29 SER P HB2  6  
ATOM 6458  H HB3  . SER A 1 31 ? -1.697  13.179  0.391   1.00 0.00 ? 29 SER P HB3  6  
ATOM 6459  H HG   . SER A 1 31 ? -0.912  13.580  -1.722  1.00 0.00 ? 29 SER P HG   6  
ATOM 6460  N N    . THR A 1 32 ? -0.365  9.601   -1.408  1.00 0.00 ? 30 THR P N    6  
ATOM 6461  C CA   . THR A 1 32 ? -0.259  8.443   -2.313  1.00 0.00 ? 30 THR P CA   6  
ATOM 6462  C C    . THR A 1 32 ? -0.210  7.142   -1.511  1.00 0.00 ? 30 THR P C    6  
ATOM 6463  O O    . THR A 1 32 ? -0.918  6.193   -1.848  1.00 0.00 ? 30 THR P O    6  
ATOM 6464  C CB   . THR A 1 32 ? 0.970   8.569   -3.232  1.00 0.00 ? 30 THR P CB   6  
ATOM 6465  O OG1  . THR A 1 32 ? 0.859   9.726   -4.037  1.00 0.00 ? 30 THR P OG1  6  
ATOM 6466  C CG2  . THR A 1 32 ? 1.129   7.390   -4.196  1.00 0.00 ? 30 THR P CG2  6  
ATOM 6467  H H    . THR A 1 32 ? 0.466   10.149  -1.228  1.00 0.00 ? 30 THR P H    6  
ATOM 6468  H HA   . THR A 1 32 ? -1.146  8.404   -2.946  1.00 0.00 ? 30 THR P HA   6  
ATOM 6469  H HB   . THR A 1 32 ? 1.872   8.647   -2.627  1.00 0.00 ? 30 THR P HB   6  
ATOM 6470  H HG1  . THR A 1 32 ? 0.691   10.486  -3.452  1.00 0.00 ? 30 THR P HG1  6  
ATOM 6471  H HG21 . THR A 1 32 ? 0.214   7.253   -4.772  1.00 0.00 ? 30 THR P HG21 6  
ATOM 6472  H HG22 . THR A 1 32 ? 1.346   6.477   -3.642  1.00 0.00 ? 30 THR P HG22 6  
ATOM 6473  H HG23 . THR A 1 32 ? 1.957   7.584   -4.877  1.00 0.00 ? 30 THR P HG23 6  
ATOM 6474  N N    . ARG A 1 33 ? 0.550   7.109   -0.404  1.00 0.00 ? 31 ARG P N    6  
ATOM 6475  C CA   . ARG A 1 33 ? 0.582   5.965   0.531   1.00 0.00 ? 31 ARG P CA   6  
ATOM 6476  C C    . ARG A 1 33 ? -0.793  5.686   1.143   1.00 0.00 ? 31 ARG P C    6  
ATOM 6477  O O    . ARG A 1 33 ? -1.186  4.528   1.241   1.00 0.00 ? 31 ARG P O    6  
ATOM 6478  C CB   . ARG A 1 33 ? 1.634   6.178   1.633   1.00 0.00 ? 31 ARG P CB   6  
ATOM 6479  C CG   . ARG A 1 33 ? 3.061   6.207   1.071   1.00 0.00 ? 31 ARG P CG   6  
ATOM 6480  C CD   . ARG A 1 33 ? 4.113   6.294   2.184   1.00 0.00 ? 31 ARG P CD   6  
ATOM 6481  N NE   . ARG A 1 33 ? 5.352   6.901   1.668   1.00 0.00 ? 31 ARG P NE   6  
ATOM 6482  C CZ   . ARG A 1 33 ? 6.587   6.770   2.102   1.00 0.00 ? 31 ARG P CZ   6  
ATOM 6483  N NH1  . ARG A 1 33 ? 6.904   6.009   3.111   1.00 0.00 ? 31 ARG P NH1  6  
ATOM 6484  N NH2  . ARG A 1 33 ? 7.528   7.442   1.509   1.00 0.00 ? 31 ARG P NH2  6  
ATOM 6485  H H    . ARG A 1 33 ? 1.132   7.920   -0.209  1.00 0.00 ? 31 ARG P H    6  
ATOM 6486  H HA   . ARG A 1 33 ? 0.857   5.072   -0.029  1.00 0.00 ? 31 ARG P HA   6  
ATOM 6487  H HB2  . ARG A 1 33 ? 1.428   7.108   2.162   1.00 0.00 ? 31 ARG P HB2  6  
ATOM 6488  H HB3  . ARG A 1 33 ? 1.559   5.362   2.352   1.00 0.00 ? 31 ARG P HB3  6  
ATOM 6489  H HG2  . ARG A 1 33 ? 3.246   5.307   0.482   1.00 0.00 ? 31 ARG P HG2  6  
ATOM 6490  H HG3  . ARG A 1 33 ? 3.163   7.070   0.415   1.00 0.00 ? 31 ARG P HG3  6  
ATOM 6491  H HD2  . ARG A 1 33 ? 3.730   6.916   2.995   1.00 0.00 ? 31 ARG P HD2  6  
ATOM 6492  H HD3  . ARG A 1 33 ? 4.298   5.291   2.569   1.00 0.00 ? 31 ARG P HD3  6  
ATOM 6493  H HE   . ARG A 1 33 ? 5.252   7.550   0.895   1.00 0.00 ? 31 ARG P HE   6  
ATOM 6494  H HH11 . ARG A 1 33 ? 6.178   5.504   3.582   1.00 0.00 ? 31 ARG P HH11 6  
ATOM 6495  H HH12 . ARG A 1 33 ? 7.857   5.951   3.428   1.00 0.00 ? 31 ARG P HH12 6  
ATOM 6496  H HH21 . ARG A 1 33 ? 7.263   8.059   0.749   1.00 0.00 ? 31 ARG P HH21 6  
ATOM 6497  H HH22 . ARG A 1 33 ? 8.480   7.393   1.824   1.00 0.00 ? 31 ARG P HH22 6  
ATOM 6498  N N    . GLU A 1 34 ? -1.551  6.722   1.501   1.00 0.00 ? 32 GLU P N    6  
ATOM 6499  C CA   . GLU A 1 34 ? -2.919  6.585   2.015   1.00 0.00 ? 32 GLU P CA   6  
ATOM 6500  C C    . GLU A 1 34 ? -3.893  6.035   0.957   1.00 0.00 ? 32 GLU P C    6  
ATOM 6501  O O    . GLU A 1 34 ? -4.690  5.150   1.269   1.00 0.00 ? 32 GLU P O    6  
ATOM 6502  C CB   . GLU A 1 34 ? -3.391  7.943   2.565   1.00 0.00 ? 32 GLU P CB   6  
ATOM 6503  C CG   . GLU A 1 34 ? -4.798  7.895   3.175   1.00 0.00 ? 32 GLU P CG   6  
ATOM 6504  C CD   . GLU A 1 34 ? -5.209  9.273   3.734   1.00 0.00 ? 32 GLU P CD   6  
ATOM 6505  O OE1  . GLU A 1 34 ? -5.567  10.175  2.938   1.00 0.00 ? 32 GLU P OE1  6  
ATOM 6506  O OE2  . GLU A 1 34 ? -5.197  9.461   4.975   1.00 0.00 ? 32 GLU P OE2  6  
ATOM 6507  H H    . GLU A 1 34 ? -1.140  7.647   1.466   1.00 0.00 ? 32 GLU P H    6  
ATOM 6508  H HA   . GLU A 1 34 ? -2.902  5.863   2.834   1.00 0.00 ? 32 GLU P HA   6  
ATOM 6509  H HB2  . GLU A 1 34 ? -2.694  8.266   3.340   1.00 0.00 ? 32 GLU P HB2  6  
ATOM 6510  H HB3  . GLU A 1 34 ? -3.378  8.678   1.761   1.00 0.00 ? 32 GLU P HB3  6  
ATOM 6511  H HG2  . GLU A 1 34 ? -5.518  7.592   2.412   1.00 0.00 ? 32 GLU P HG2  6  
ATOM 6512  H HG3  . GLU A 1 34 ? -4.815  7.144   3.968   1.00 0.00 ? 32 GLU P HG3  6  
ATOM 6513  N N    . GLU A 1 35 ? -3.806  6.481   -0.302  1.00 0.00 ? 33 GLU P N    6  
ATOM 6514  C CA   . GLU A 1 35 ? -4.594  5.892   -1.395  1.00 0.00 ? 33 GLU P CA   6  
ATOM 6515  C C    . GLU A 1 35 ? -4.256  4.410   -1.593  1.00 0.00 ? 33 GLU P C    6  
ATOM 6516  O O    . GLU A 1 35 ? -5.162  3.581   -1.554  1.00 0.00 ? 33 GLU P O    6  
ATOM 6517  C CB   . GLU A 1 35 ? -4.392  6.669   -2.707  1.00 0.00 ? 33 GLU P CB   6  
ATOM 6518  C CG   . GLU A 1 35 ? -5.285  7.912   -2.811  1.00 0.00 ? 33 GLU P CG   6  
ATOM 6519  C CD   . GLU A 1 35 ? -6.787  7.556   -2.863  1.00 0.00 ? 33 GLU P CD   6  
ATOM 6520  O OE1  . GLU A 1 35 ? -7.209  6.784   -3.759  1.00 0.00 ? 33 GLU P OE1  6  
ATOM 6521  O OE2  . GLU A 1 35 ? -7.560  8.055   -2.010  1.00 0.00 ? 33 GLU P OE2  6  
ATOM 6522  H H    . GLU A 1 35 ? -3.156  7.228   -0.517  1.00 0.00 ? 33 GLU P H    6  
ATOM 6523  H HA   . GLU A 1 35 ? -5.652  5.919   -1.125  1.00 0.00 ? 33 GLU P HA   6  
ATOM 6524  H HB2  . GLU A 1 35 ? -3.348  6.969   -2.798  1.00 0.00 ? 33 GLU P HB2  6  
ATOM 6525  H HB3  . GLU A 1 35 ? -4.615  6.015   -3.549  1.00 0.00 ? 33 GLU P HB3  6  
ATOM 6526  H HG2  . GLU A 1 35 ? -5.076  8.570   -1.965  1.00 0.00 ? 33 GLU P HG2  6  
ATOM 6527  H HG3  . GLU A 1 35 ? -5.014  8.455   -3.721  1.00 0.00 ? 33 GLU P HG3  6  
ATOM 6528  N N    . ILE A 1 36 ? -2.979  4.029   -1.717  1.00 0.00 ? 34 ILE P N    6  
ATOM 6529  C CA   . ILE A 1 36 ? -2.634  2.611   -1.918  1.00 0.00 ? 34 ILE P CA   6  
ATOM 6530  C C    . ILE A 1 36 ? -2.924  1.746   -0.679  1.00 0.00 ? 34 ILE P C    6  
ATOM 6531  O O    . ILE A 1 36 ? -3.199  0.555   -0.826  1.00 0.00 ? 34 ILE P O    6  
ATOM 6532  C CB   . ILE A 1 36 ? -1.226  2.415   -2.524  1.00 0.00 ? 34 ILE P CB   6  
ATOM 6533  C CG1  . ILE A 1 36 ? -0.044  2.819   -1.628  1.00 0.00 ? 34 ILE P CG1  6  
ATOM 6534  C CG2  . ILE A 1 36 ? -1.106  3.203   -3.840  1.00 0.00 ? 34 ILE P CG2  6  
ATOM 6535  C CD1  . ILE A 1 36 ? 0.278   1.823   -0.517  1.00 0.00 ? 34 ILE P CD1  6  
ATOM 6536  H H    . ILE A 1 36 ? -2.245  4.731   -1.732  1.00 0.00 ? 34 ILE P H    6  
ATOM 6537  H HA   . ILE A 1 36 ? -3.320  2.239   -2.680  1.00 0.00 ? 34 ILE P HA   6  
ATOM 6538  H HB   . ILE A 1 36 ? -1.119  1.359   -2.768  1.00 0.00 ? 34 ILE P HB   6  
ATOM 6539  H HG12 . ILE A 1 36 ? 0.850   2.917   -2.241  1.00 0.00 ? 34 ILE P HG12 6  
ATOM 6540  H HG13 . ILE A 1 36 ? -0.254  3.787   -1.193  1.00 0.00 ? 34 ILE P HG13 6  
ATOM 6541  H HG21 . ILE A 1 36 ? -1.958  2.991   -4.483  1.00 0.00 ? 34 ILE P HG21 6  
ATOM 6542  H HG22 . ILE A 1 36 ? -1.063  4.273   -3.636  1.00 0.00 ? 34 ILE P HG22 6  
ATOM 6543  H HG23 . ILE A 1 36 ? -0.195  2.910   -4.361  1.00 0.00 ? 34 ILE P HG23 6  
ATOM 6544  H HD11 . ILE A 1 36 ? -0.396  1.968   0.324   1.00 0.00 ? 34 ILE P HD11 6  
ATOM 6545  H HD12 . ILE A 1 36 ? 0.199   0.801   -0.886  1.00 0.00 ? 34 ILE P HD12 6  
ATOM 6546  H HD13 . ILE A 1 36 ? 1.298   1.999   -0.179  1.00 0.00 ? 34 ILE P HD13 6  
ATOM 6547  N N    . ALA A 1 37 ? -2.973  2.330   0.527   1.00 0.00 ? 35 ALA P N    6  
ATOM 6548  C CA   . ALA A 1 37 ? -3.453  1.665   1.742   1.00 0.00 ? 35 ALA P CA   6  
ATOM 6549  C C    . ALA A 1 37 ? -4.959  1.348   1.646   1.00 0.00 ? 35 ALA P C    6  
ATOM 6550  O O    . ALA A 1 37 ? -5.378  0.228   1.927   1.00 0.00 ? 35 ALA P O    6  
ATOM 6551  C CB   . ALA A 1 37 ? -3.141  2.540   2.964   1.00 0.00 ? 35 ALA P CB   6  
ATOM 6552  H H    . ALA A 1 37 ? -2.665  3.291   0.600   1.00 0.00 ? 35 ALA P H    6  
ATOM 6553  H HA   . ALA A 1 37 ? -2.920  0.719   1.856   1.00 0.00 ? 35 ALA P HA   6  
ATOM 6554  H HB1  . ALA A 1 37 ? -2.091  2.823   2.979   1.00 0.00 ? 35 ALA P HB1  6  
ATOM 6555  H HB2  . ALA A 1 37 ? -3.748  3.443   2.952   1.00 0.00 ? 35 ALA P HB2  6  
ATOM 6556  H HB3  . ALA A 1 37 ? -3.359  1.986   3.875   1.00 0.00 ? 35 ALA P HB3  6  
ATOM 6557  N N    . VAL A 1 38 ? -5.772  2.296   1.166   1.00 0.00 ? 36 VAL P N    6  
ATOM 6558  C CA   . VAL A 1 38 ? -7.200  2.093   0.860   1.00 0.00 ? 36 VAL P CA   6  
ATOM 6559  C C    . VAL A 1 38 ? -7.389  1.048   -0.249  1.00 0.00 ? 36 VAL P C    6  
ATOM 6560  O O    . VAL A 1 38 ? -8.247  0.172   -0.117  1.00 0.00 ? 36 VAL P O    6  
ATOM 6561  C CB   . VAL A 1 38 ? -7.859  3.445   0.504   1.00 0.00 ? 36 VAL P CB   6  
ATOM 6562  C CG1  . VAL A 1 38 ? -9.252  3.322   -0.123  1.00 0.00 ? 36 VAL P CG1  6  
ATOM 6563  C CG2  . VAL A 1 38 ? -8.003  4.312   1.761   1.00 0.00 ? 36 VAL P CG2  6  
ATOM 6564  H H    . VAL A 1 38 ? -5.368  3.203   0.965   1.00 0.00 ? 36 VAL P H    6  
ATOM 6565  H HA   . VAL A 1 38 ? -7.694  1.702   1.749   1.00 0.00 ? 36 VAL P HA   6  
ATOM 6566  H HB   . VAL A 1 38 ? -7.232  3.981   -0.204  1.00 0.00 ? 36 VAL P HB   6  
ATOM 6567  H HG11 . VAL A 1 38 ? -9.188  2.819   -1.087  1.00 0.00 ? 36 VAL P HG11 6  
ATOM 6568  H HG12 . VAL A 1 38 ? -9.917  2.766   0.538   1.00 0.00 ? 36 VAL P HG12 6  
ATOM 6569  H HG13 . VAL A 1 38 ? -9.658  4.319   -0.297  1.00 0.00 ? 36 VAL P HG13 6  
ATOM 6570  H HG21 . VAL A 1 38 ? -8.682  3.837   2.468   1.00 0.00 ? 36 VAL P HG21 6  
ATOM 6571  H HG22 . VAL A 1 38 ? -7.033  4.452   2.236   1.00 0.00 ? 36 VAL P HG22 6  
ATOM 6572  H HG23 . VAL A 1 38 ? -8.394  5.292   1.485   1.00 0.00 ? 36 VAL P HG23 6  
ATOM 6573  N N    . TRP A 1 39 ? -6.571  1.074   -1.308  1.00 0.00 ? 37 TRP P N    6  
ATOM 6574  C CA   . TRP A 1 39 ? -6.670  0.134   -2.438  1.00 0.00 ? 37 TRP P CA   6  
ATOM 6575  C C    . TRP A 1 39 ? -6.297  -1.309  -2.040  1.00 0.00 ? 37 TRP P C    6  
ATOM 6576  O O    . TRP A 1 39 ? -6.919  -2.260  -2.519  1.00 0.00 ? 37 TRP P O    6  
ATOM 6577  C CB   . TRP A 1 39 ? -5.777  0.597   -3.602  1.00 0.00 ? 37 TRP P CB   6  
ATOM 6578  C CG   . TRP A 1 39 ? -5.974  1.963   -4.206  1.00 0.00 ? 37 TRP P CG   6  
ATOM 6579  C CD1  . TRP A 1 39 ? -6.872  2.908   -3.837  1.00 0.00 ? 37 TRP P CD1  6  
ATOM 6580  C CD2  . TRP A 1 39 ? -5.186  2.576   -5.275  1.00 0.00 ? 37 TRP P CD2  6  
ATOM 6581  N NE1  . TRP A 1 39 ? -6.655  4.070   -4.553  1.00 0.00 ? 37 TRP P NE1  6  
ATOM 6582  C CE2  . TRP A 1 39 ? -5.633  3.919   -5.461  1.00 0.00 ? 37 TRP P CE2  6  
ATOM 6583  C CE3  . TRP A 1 39 ? -4.119  2.138   -6.093  1.00 0.00 ? 37 TRP P CE3  6  
ATOM 6584  C CZ2  . TRP A 1 39 ? -5.045  4.788   -6.394  1.00 0.00 ? 37 TRP P CZ2  6  
ATOM 6585  C CZ3  . TRP A 1 39 ? -3.527  2.998   -7.040  1.00 0.00 ? 37 TRP P CZ3  6  
ATOM 6586  C CH2  . TRP A 1 39 ? -3.985  4.321   -7.189  1.00 0.00 ? 37 TRP P CH2  6  
ATOM 6587  H H    . TRP A 1 39 ? -5.910  1.842   -1.380  1.00 0.00 ? 37 TRP P H    6  
ATOM 6588  H HA   . TRP A 1 39 ? -7.702  0.117   -2.790  1.00 0.00 ? 37 TRP P HA   6  
ATOM 6589  H HB2  . TRP A 1 39 ? -4.744  0.550   -3.264  1.00 0.00 ? 37 TRP P HB2  6  
ATOM 6590  H HB3  . TRP A 1 39 ? -5.881  -0.129  -4.410  1.00 0.00 ? 37 TRP P HB3  6  
ATOM 6591  H HD1  . TRP A 1 39 ? -7.584  2.801   -3.027  1.00 0.00 ? 37 TRP P HD1  6  
ATOM 6592  H HE1  . TRP A 1 39 ? -7.109  4.963   -4.338  1.00 0.00 ? 37 TRP P HE1  6  
ATOM 6593  H HE3  . TRP A 1 39 ? -3.750  1.128   -5.979  1.00 0.00 ? 37 TRP P HE3  6  
ATOM 6594  H HZ2  . TRP A 1 39 ? -5.407  5.801   -6.494  1.00 0.00 ? 37 TRP P HZ2  6  
ATOM 6595  H HZ3  . TRP A 1 39 ? -2.709  2.642   -7.653  1.00 0.00 ? 37 TRP P HZ3  6  
ATOM 6596  H HH2  . TRP A 1 39 ? -3.519  4.976   -7.915  1.00 0.00 ? 37 TRP P HH2  6  
ATOM 6597  N N    . THR A 1 40 ? -5.315  -1.485  -1.146  1.00 0.00 ? 38 THR P N    6  
ATOM 6598  C CA   . THR A 1 40 ? -4.889  -2.796  -0.602  1.00 0.00 ? 38 THR P CA   6  
ATOM 6599  C C    . THR A 1 40 ? -5.667  -3.235  0.646   1.00 0.00 ? 38 THR P C    6  
ATOM 6600  O O    . THR A 1 40 ? -5.526  -4.379  1.078   1.00 0.00 ? 38 THR P O    6  
ATOM 6601  C CB   . THR A 1 40 ? -3.382  -2.831  -0.283  1.00 0.00 ? 38 THR P CB   6  
ATOM 6602  O OG1  . THR A 1 40 ? -3.019  -1.785  0.586   1.00 0.00 ? 38 THR P OG1  6  
ATOM 6603  C CG2  . THR A 1 40 ? -2.512  -2.738  -1.535  1.00 0.00 ? 38 THR P CG2  6  
ATOM 6604  H H    . THR A 1 40 ? -4.812  -0.661  -0.834  1.00 0.00 ? 38 THR P H    6  
ATOM 6605  H HA   . THR A 1 40 ? -5.072  -3.561  -1.356  1.00 0.00 ? 38 THR P HA   6  
ATOM 6606  H HB   . THR A 1 40 ? -3.151  -3.776  0.207   1.00 0.00 ? 38 THR P HB   6  
ATOM 6607  H HG1  . THR A 1 40 ? -2.986  -0.968  0.054   1.00 0.00 ? 38 THR P HG1  6  
ATOM 6608  H HG21 . THR A 1 40 ? -2.736  -3.580  -2.188  1.00 0.00 ? 38 THR P HG21 6  
ATOM 6609  H HG22 . THR A 1 40 ? -1.461  -2.783  -1.251  1.00 0.00 ? 38 THR P HG22 6  
ATOM 6610  H HG23 . THR A 1 40 ? -2.703  -1.808  -2.070  1.00 0.00 ? 38 THR P HG23 6  
ATOM 6611  N N    . ASN A 1 41 ? -6.498  -2.362  1.224   1.00 0.00 ? 39 ASN P N    6  
ATOM 6612  C CA   . ASN A 1 41 ? -7.153  -2.538  2.526   1.00 0.00 ? 39 ASN P CA   6  
ATOM 6613  C C    . ASN A 1 41 ? -6.149  -2.789  3.682   1.00 0.00 ? 39 ASN P C    6  
ATOM 6614  O O    . ASN A 1 41 ? -6.301  -3.711  4.489   1.00 0.00 ? 39 ASN P O    6  
ATOM 6615  C CB   . ASN A 1 41 ? -8.290  -3.576  2.403   1.00 0.00 ? 39 ASN P CB   6  
ATOM 6616  C CG   . ASN A 1 41 ? -9.379  -3.401  3.451   1.00 0.00 ? 39 ASN P CG   6  
ATOM 6617  O OD1  . ASN A 1 41 ? -10.486 -2.963  3.165   1.00 0.00 ? 39 ASN P OD1  6  
ATOM 6618  N ND2  . ASN A 1 41 ? -9.113  -3.730  4.693   1.00 0.00 ? 39 ASN P ND2  6  
ATOM 6619  H H    . ASN A 1 41 ? -6.553  -1.442  0.811   1.00 0.00 ? 39 ASN P H    6  
ATOM 6620  H HA   . ASN A 1 41 ? -7.612  -1.570  2.745   1.00 0.00 ? 39 ASN P HA   6  
ATOM 6621  H HB2  . ASN A 1 41 ? -8.757  -3.484  1.422   1.00 0.00 ? 39 ASN P HB2  6  
ATOM 6622  H HB3  . ASN A 1 41 ? -7.870  -4.579  2.486   1.00 0.00 ? 39 ASN P HB3  6  
ATOM 6623  H HD21 . ASN A 1 41 ? -8.172  -4.032  4.926   1.00 0.00 ? 39 ASN P HD21 6  
ATOM 6624  H HD22 . ASN A 1 41 ? -9.829  -3.618  5.394   1.00 0.00 ? 39 ASN P HD22 6  
ATOM 6625  N N    . LEU A 1 42 ? -5.110  -1.956  3.744   1.00 0.00 ? 40 LEU P N    6  
ATOM 6626  C CA   . LEU A 1 42 ? -4.124  -1.866  4.825   1.00 0.00 ? 40 LEU P CA   6  
ATOM 6627  C C    . LEU A 1 42 ? -4.249  -0.531  5.582   1.00 0.00 ? 40 LEU P C    6  
ATOM 6628  O O    . LEU A 1 42 ? -4.953  0.385   5.150   1.00 0.00 ? 40 LEU P O    6  
ATOM 6629  C CB   . LEU A 1 42 ? -2.710  -2.030  4.230   1.00 0.00 ? 40 LEU P CB   6  
ATOM 6630  C CG   . LEU A 1 42 ? -2.393  -3.424  3.662   1.00 0.00 ? 40 LEU P CG   6  
ATOM 6631  C CD1  . LEU A 1 42 ? -0.983  -3.414  3.075   1.00 0.00 ? 40 LEU P CD1  6  
ATOM 6632  C CD2  . LEU A 1 42 ? -2.451  -4.498  4.747   1.00 0.00 ? 40 LEU P CD2  6  
ATOM 6633  H H    . LEU A 1 42 ? -5.073  -1.227  3.039   1.00 0.00 ? 40 LEU P H    6  
ATOM 6634  H HA   . LEU A 1 42 ? -4.297  -2.655  5.556   1.00 0.00 ? 40 LEU P HA   6  
ATOM 6635  H HB2  . LEU A 1 42 ? -2.583  -1.295  3.435   1.00 0.00 ? 40 LEU P HB2  6  
ATOM 6636  H HB3  . LEU A 1 42 ? -1.971  -1.804  5.000   1.00 0.00 ? 40 LEU P HB3  6  
ATOM 6637  H HG   . LEU A 1 42 ? -3.098  -3.677  2.871   1.00 0.00 ? 40 LEU P HG   6  
ATOM 6638  H HD11 . LEU A 1 42 ? -0.738  -4.397  2.679   1.00 0.00 ? 40 LEU P HD11 6  
ATOM 6639  H HD12 . LEU A 1 42 ? -0.256  -3.142  3.840   1.00 0.00 ? 40 LEU P HD12 6  
ATOM 6640  H HD13 . LEU A 1 42 ? -0.940  -2.689  2.262   1.00 0.00 ? 40 LEU P HD13 6  
ATOM 6641  H HD21 . LEU A 1 42 ? -2.083  -5.443  4.354   1.00 0.00 ? 40 LEU P HD21 6  
ATOM 6642  H HD22 . LEU A 1 42 ? -3.481  -4.641  5.068   1.00 0.00 ? 40 LEU P HD22 6  
ATOM 6643  H HD23 . LEU A 1 42 ? -1.833  -4.208  5.595   1.00 0.00 ? 40 LEU P HD23 6  
ATOM 6644  N N    . THR A 1 43 ? -3.548  -0.409  6.710   1.00 0.00 ? 41 THR P N    6  
ATOM 6645  C CA   . THR A 1 43 ? -3.371  0.869   7.419   1.00 0.00 ? 41 THR P CA   6  
ATOM 6646  C C    . THR A 1 43 ? -2.200  1.650   6.816   1.00 0.00 ? 41 THR P C    6  
ATOM 6647  O O    . THR A 1 43 ? -1.264  1.063   6.261   1.00 0.00 ? 41 THR P O    6  
ATOM 6648  C CB   . THR A 1 43 ? -3.149  0.670   8.927   1.00 0.00 ? 41 THR P CB   6  
ATOM 6649  O OG1  . THR A 1 43 ? -1.941  -0.018  9.168   1.00 0.00 ? 41 THR P OG1  6  
ATOM 6650  C CG2  . THR A 1 43 ? -4.275  -0.124  9.590   1.00 0.00 ? 41 THR P CG2  6  
ATOM 6651  H H    . THR A 1 43 ? -2.982  -1.185  7.020   1.00 0.00 ? 41 THR P H    6  
ATOM 6652  H HA   . THR A 1 43 ? -4.271  1.473   7.301   1.00 0.00 ? 41 THR P HA   6  
ATOM 6653  H HB   . THR A 1 43 ? -3.093  1.650   9.403   1.00 0.00 ? 41 THR P HB   6  
ATOM 6654  H HG1  . THR A 1 43 ? -1.916  -0.227  10.117  1.00 0.00 ? 41 THR P HG1  6  
ATOM 6655  H HG21 . THR A 1 43 ? -4.288  -1.149  9.220   1.00 0.00 ? 41 THR P HG21 6  
ATOM 6656  H HG22 . THR A 1 43 ? -5.233  0.349   9.374   1.00 0.00 ? 41 THR P HG22 6  
ATOM 6657  H HG23 . THR A 1 43 ? -4.127  -0.135  10.670  1.00 0.00 ? 41 THR P HG23 6  
ATOM 6658  N N    . GLU A 1 44 ? -2.192  2.979   6.965   1.00 0.00 ? 42 GLU P N    6  
ATOM 6659  C CA   . GLU A 1 44 ? -1.021  3.778   6.574   1.00 0.00 ? 42 GLU P CA   6  
ATOM 6660  C C    . GLU A 1 44 ? 0.231   3.421   7.395   1.00 0.00 ? 42 GLU P C    6  
ATOM 6661  O O    . GLU A 1 44 ? 1.343   3.549   6.892   1.00 0.00 ? 42 GLU P O    6  
ATOM 6662  C CB   . GLU A 1 44 ? -1.315  5.286   6.633   1.00 0.00 ? 42 GLU P CB   6  
ATOM 6663  C CG   . GLU A 1 44 ? -1.659  5.810   8.037   1.00 0.00 ? 42 GLU P CG   6  
ATOM 6664  C CD   . GLU A 1 44 ? -1.542  7.342   8.106   1.00 0.00 ? 42 GLU P CD   6  
ATOM 6665  O OE1  . GLU A 1 44 ? -0.392  7.842   8.167   1.00 0.00 ? 42 GLU P OE1  6  
ATOM 6666  O OE2  . GLU A 1 44 ? -2.582  8.044   8.125   1.00 0.00 ? 42 GLU P OE2  6  
ATOM 6667  H H    . GLU A 1 44 ? -2.985  3.442   7.388   1.00 0.00 ? 42 GLU P H    6  
ATOM 6668  H HA   . GLU A 1 44 ? -0.787  3.546   5.535   1.00 0.00 ? 42 GLU P HA   6  
ATOM 6669  H HB2  . GLU A 1 44 ? -0.428  5.804   6.261   1.00 0.00 ? 42 GLU P HB2  6  
ATOM 6670  H HB3  . GLU A 1 44 ? -2.137  5.513   5.952   1.00 0.00 ? 42 GLU P HB3  6  
ATOM 6671  H HG2  . GLU A 1 44 ? -2.667  5.486   8.306   1.00 0.00 ? 42 GLU P HG2  6  
ATOM 6672  H HG3  . GLU A 1 44 ? -0.970  5.388   8.770   1.00 0.00 ? 42 GLU P HG3  6  
ATOM 6673  N N    . ALA A 1 45 ? 0.068   2.911   8.623   1.00 0.00 ? 43 ALA P N    6  
ATOM 6674  C CA   . ALA A 1 45 ? 1.168   2.445   9.465   1.00 0.00 ? 43 ALA P CA   6  
ATOM 6675  C C    . ALA A 1 45 ? 1.829   1.179   8.892   1.00 0.00 ? 43 ALA P C    6  
ATOM 6676  O O    . ALA A 1 45 ? 3.055   1.132   8.767   1.00 0.00 ? 43 ALA P O    6  
ATOM 6677  C CB   . ALA A 1 45 ? 0.640   2.231   10.888  1.00 0.00 ? 43 ALA P CB   6  
ATOM 6678  H H    . ALA A 1 45 ? -0.872  2.824   8.982   1.00 0.00 ? 43 ALA P H    6  
ATOM 6679  H HA   . ALA A 1 45 ? 1.932   3.224   9.502   1.00 0.00 ? 43 ALA P HA   6  
ATOM 6680  H HB1  . ALA A 1 45 ? 0.225   3.163   11.274  1.00 0.00 ? 43 ALA P HB1  6  
ATOM 6681  H HB2  . ALA A 1 45 ? -0.133  1.462   10.895  1.00 0.00 ? 43 ALA P HB2  6  
ATOM 6682  H HB3  . ALA A 1 45 ? 1.459   1.917   11.538  1.00 0.00 ? 43 ALA P HB3  6  
ATOM 6683  N N    . ARG A 1 46 ? 1.037   0.183   8.460   1.00 0.00 ? 44 ARG P N    6  
ATOM 6684  C CA   . ARG A 1 46 ? 1.549   -1.018  7.772   1.00 0.00 ? 44 ARG P CA   6  
ATOM 6685  C C    . ARG A 1 46 ? 2.253   -0.669  6.467   1.00 0.00 ? 44 ARG P C    6  
ATOM 6686  O O    . ARG A 1 46 ? 3.347   -1.167  6.213   1.00 0.00 ? 44 ARG P O    6  
ATOM 6687  C CB   . ARG A 1 46 ? 0.411   -2.016  7.516   1.00 0.00 ? 44 ARG P CB   6  
ATOM 6688  C CG   . ARG A 1 46 ? 0.097   -2.808  8.789   1.00 0.00 ? 44 ARG P CG   6  
ATOM 6689  C CD   . ARG A 1 46 ? -0.888  -3.940  8.480   1.00 0.00 ? 44 ARG P CD   6  
ATOM 6690  N NE   . ARG A 1 46 ? -1.394  -4.577  9.709   1.00 0.00 ? 44 ARG P NE   6  
ATOM 6691  C CZ   . ARG A 1 46 ? -0.753  -5.371  10.542  1.00 0.00 ? 44 ARG P CZ   6  
ATOM 6692  N NH1  . ARG A 1 46 ? 0.456   -5.800  10.315  1.00 0.00 ? 44 ARG P NH1  6  
ATOM 6693  N NH2  . ARG A 1 46 ? -1.350  -5.756  11.632  1.00 0.00 ? 44 ARG P NH2  6  
ATOM 6694  H H    . ARG A 1 46 ? 0.032   0.280   8.584   1.00 0.00 ? 44 ARG P H    6  
ATOM 6695  H HA   . ARG A 1 46 ? 2.301   -1.499  8.398   1.00 0.00 ? 44 ARG P HA   6  
ATOM 6696  H HB2  . ARG A 1 46 ? -0.481  -1.494  7.167   1.00 0.00 ? 44 ARG P HB2  6  
ATOM 6697  H HB3  . ARG A 1 46 ? 0.717   -2.715  6.740   1.00 0.00 ? 44 ARG P HB3  6  
ATOM 6698  H HG2  . ARG A 1 46 ? 1.023   -3.227  9.185   1.00 0.00 ? 44 ARG P HG2  6  
ATOM 6699  H HG3  . ARG A 1 46 ? -0.327  -2.138  9.535   1.00 0.00 ? 44 ARG P HG3  6  
ATOM 6700  H HD2  . ARG A 1 46 ? -1.733  -3.517  7.936   1.00 0.00 ? 44 ARG P HD2  6  
ATOM 6701  H HD3  . ARG A 1 46 ? -0.411  -4.682  7.835   1.00 0.00 ? 44 ARG P HD3  6  
ATOM 6702  H HE   . ARG A 1 46 ? -2.358  -4.391  9.954   1.00 0.00 ? 44 ARG P HE   6  
ATOM 6703  H HH11 . ARG A 1 46 ? 0.907   -5.540  9.456   1.00 0.00 ? 44 ARG P HH11 6  
ATOM 6704  H HH12 . ARG A 1 46 ? 0.927   -6.387  10.982  1.00 0.00 ? 44 ARG P HH12 6  
ATOM 6705  H HH21 . ARG A 1 46 ? -2.280  -5.398  11.819  1.00 0.00 ? 44 ARG P HH21 6  
ATOM 6706  H HH22 . ARG A 1 46 ? -0.858  -6.291  12.328  1.00 0.00 ? 44 ARG P HH22 6  
ATOM 6707  N N    . VAL A 1 47 ? 1.671   0.234   5.680   1.00 0.00 ? 45 VAL P N    6  
ATOM 6708  C CA   . VAL A 1 47 ? 2.269   0.741   4.435   1.00 0.00 ? 45 VAL P CA   6  
ATOM 6709  C C    . VAL A 1 47 ? 3.580   1.488   4.698   1.00 0.00 ? 45 VAL P C    6  
ATOM 6710  O O    . VAL A 1 47 ? 4.572   1.231   4.018   1.00 0.00 ? 45 VAL P O    6  
ATOM 6711  C CB   . VAL A 1 47 ? 1.238   1.608   3.688   1.00 0.00 ? 45 VAL P CB   6  
ATOM 6712  C CG1  . VAL A 1 47 ? 1.846   2.457   2.570   1.00 0.00 ? 45 VAL P CG1  6  
ATOM 6713  C CG2  . VAL A 1 47 ? 0.167   0.693   3.083   1.00 0.00 ? 45 VAL P CG2  6  
ATOM 6714  H H    . VAL A 1 47 ? 0.755   0.573   5.956   1.00 0.00 ? 45 VAL P H    6  
ATOM 6715  H HA   . VAL A 1 47 ? 2.521   -0.106  3.797   1.00 0.00 ? 45 VAL P HA   6  
ATOM 6716  H HB   . VAL A 1 47 ? 0.762   2.286   4.394   1.00 0.00 ? 45 VAL P HB   6  
ATOM 6717  H HG11 . VAL A 1 47 ? 2.379   1.819   1.866   1.00 0.00 ? 45 VAL P HG11 6  
ATOM 6718  H HG12 . VAL A 1 47 ? 1.051   2.996   2.055   1.00 0.00 ? 45 VAL P HG12 6  
ATOM 6719  H HG13 . VAL A 1 47 ? 2.530   3.197   2.986   1.00 0.00 ? 45 VAL P HG13 6  
ATOM 6720  H HG21 . VAL A 1 47 ? 0.621   -0.026  2.402   1.00 0.00 ? 45 VAL P HG21 6  
ATOM 6721  H HG22 . VAL A 1 47 ? -0.362  0.157   3.870   1.00 0.00 ? 45 VAL P HG22 6  
ATOM 6722  H HG23 . VAL A 1 47 ? -0.555  1.287   2.530   1.00 0.00 ? 45 VAL P HG23 6  
ATOM 6723  N N    . ARG A 1 48 ? 3.635   2.365   5.707   1.00 0.00 ? 46 ARG P N    6  
ATOM 6724  C CA   . ARG A 1 48 ? 4.839   3.136   6.061   1.00 0.00 ? 46 ARG P CA   6  
ATOM 6725  C C    . ARG A 1 48 ? 5.968   2.241   6.581   1.00 0.00 ? 46 ARG P C    6  
ATOM 6726  O O    . ARG A 1 48 ? 7.112   2.430   6.170   1.00 0.00 ? 46 ARG P O    6  
ATOM 6727  C CB   . ARG A 1 48 ? 4.438   4.249   7.045   1.00 0.00 ? 46 ARG P CB   6  
ATOM 6728  C CG   . ARG A 1 48 ? 5.569   5.250   7.333   1.00 0.00 ? 46 ARG P CG   6  
ATOM 6729  C CD   . ARG A 1 48 ? 5.083   6.429   8.189   1.00 0.00 ? 46 ARG P CD   6  
ATOM 6730  N NE   . ARG A 1 48 ? 4.118   7.285   7.463   1.00 0.00 ? 46 ARG P NE   6  
ATOM 6731  C CZ   . ARG A 1 48 ? 2.828   7.446   7.712   1.00 0.00 ? 46 ARG P CZ   6  
ATOM 6732  N NH1  . ARG A 1 48 ? 2.197   6.864   8.687   1.00 0.00 ? 46 ARG P NH1  6  
ATOM 6733  N NH2  . ARG A 1 48 ? 2.094   8.220   6.975   1.00 0.00 ? 46 ARG P NH2  6  
ATOM 6734  H H    . ARG A 1 48 ? 2.777   2.563   6.217   1.00 0.00 ? 46 ARG P H    6  
ATOM 6735  H HA   . ARG A 1 48 ? 5.217   3.607   5.152   1.00 0.00 ? 46 ARG P HA   6  
ATOM 6736  H HB2  . ARG A 1 48 ? 3.605   4.797   6.603   1.00 0.00 ? 46 ARG P HB2  6  
ATOM 6737  H HB3  . ARG A 1 48 ? 4.100   3.805   7.983   1.00 0.00 ? 46 ARG P HB3  6  
ATOM 6738  H HG2  . ARG A 1 48 ? 6.372   4.739   7.867   1.00 0.00 ? 46 ARG P HG2  6  
ATOM 6739  H HG3  . ARG A 1 48 ? 5.967   5.634   6.393   1.00 0.00 ? 46 ARG P HG3  6  
ATOM 6740  H HD2  . ARG A 1 48 ? 4.653   6.044   9.115   1.00 0.00 ? 46 ARG P HD2  6  
ATOM 6741  H HD3  . ARG A 1 48 ? 5.949   7.035   8.458   1.00 0.00 ? 46 ARG P HD3  6  
ATOM 6742  H HE   . ARG A 1 48 ? 4.482   7.816   6.687   1.00 0.00 ? 46 ARG P HE   6  
ATOM 6743  H HH11 . ARG A 1 48 ? 2.683   6.263   9.326   1.00 0.00 ? 46 ARG P HH11 6  
ATOM 6744  H HH12 . ARG A 1 48 ? 1.206   7.074   8.784   1.00 0.00 ? 46 ARG P HH12 6  
ATOM 6745  H HH21 . ARG A 1 48 ? 2.484   8.720   6.195   1.00 0.00 ? 46 ARG P HH21 6  
ATOM 6746  H HH22 . ARG A 1 48 ? 1.107   8.297   7.224   1.00 0.00 ? 46 ARG P HH22 6  
ATOM 6747  N N    . VAL A 1 49 ? 5.656   1.223   7.392   1.00 0.00 ? 47 VAL P N    6  
ATOM 6748  C CA   . VAL A 1 49 ? 6.639   0.203   7.809   1.00 0.00 ? 47 VAL P CA   6  
ATOM 6749  C C    . VAL A 1 49 ? 7.112   -0.619  6.608   1.00 0.00 ? 47 VAL P C    6  
ATOM 6750  O O    . VAL A 1 49 ? 8.317   -0.819  6.457   1.00 0.00 ? 47 VAL P O    6  
ATOM 6751  C CB   . VAL A 1 49 ? 6.081   -0.701  8.929   1.00 0.00 ? 47 VAL P CB   6  
ATOM 6752  C CG1  . VAL A 1 49 ? 6.998   -1.896  9.242   1.00 0.00 ? 47 VAL P CG1  6  
ATOM 6753  C CG2  . VAL A 1 49 ? 5.927   0.099   10.229  1.00 0.00 ? 47 VAL P CG2  6  
ATOM 6754  H H    . VAL A 1 49 ? 4.694   1.131   7.709   1.00 0.00 ? 47 VAL P H    6  
ATOM 6755  H HA   . VAL A 1 49 ? 7.520   0.711   8.205   1.00 0.00 ? 47 VAL P HA   6  
ATOM 6756  H HB   . VAL A 1 49 ? 5.105   -1.084  8.629   1.00 0.00 ? 47 VAL P HB   6  
ATOM 6757  H HG11 . VAL A 1 49 ? 8.009   -1.550  9.467   1.00 0.00 ? 47 VAL P HG11 6  
ATOM 6758  H HG12 . VAL A 1 49 ? 6.609   -2.448  10.098  1.00 0.00 ? 47 VAL P HG12 6  
ATOM 6759  H HG13 . VAL A 1 49 ? 7.038   -2.580  8.394   1.00 0.00 ? 47 VAL P HG13 6  
ATOM 6760  H HG21 . VAL A 1 49 ? 5.470   -0.527  10.996  1.00 0.00 ? 47 VAL P HG21 6  
ATOM 6761  H HG22 . VAL A 1 49 ? 6.903   0.440   10.579  1.00 0.00 ? 47 VAL P HG22 6  
ATOM 6762  H HG23 . VAL A 1 49 ? 5.289   0.967   10.071  1.00 0.00 ? 47 VAL P HG23 6  
ATOM 6763  N N    . TRP A 1 50 ? 6.209   -1.038  5.713   1.00 0.00 ? 48 TRP P N    6  
ATOM 6764  C CA   . TRP A 1 50 ? 6.576   -1.796  4.513   1.00 0.00 ? 48 TRP P CA   6  
ATOM 6765  C C    . TRP A 1 50 ? 7.506   -0.994  3.590   1.00 0.00 ? 48 TRP P C    6  
ATOM 6766  O O    . TRP A 1 50 ? 8.542   -1.514  3.177   1.00 0.00 ? 48 TRP P O    6  
ATOM 6767  C CB   . TRP A 1 50 ? 5.319   -2.275  3.771   1.00 0.00 ? 48 TRP P CB   6  
ATOM 6768  C CG   . TRP A 1 50 ? 5.613   -3.217  2.644   1.00 0.00 ? 48 TRP P CG   6  
ATOM 6769  C CD1  . TRP A 1 50 ? 5.580   -4.567  2.714   1.00 0.00 ? 48 TRP P CD1  6  
ATOM 6770  C CD2  . TRP A 1 50 ? 6.045   -2.902  1.283   1.00 0.00 ? 48 TRP P CD2  6  
ATOM 6771  N NE1  . TRP A 1 50 ? 5.975   -5.106  1.504   1.00 0.00 ? 48 TRP P NE1  6  
ATOM 6772  C CE2  . TRP A 1 50 ? 6.295   -4.125  0.590   1.00 0.00 ? 48 TRP P CE2  6  
ATOM 6773  C CE3  . TRP A 1 50 ? 6.265   -1.704  0.570   1.00 0.00 ? 48 TRP P CE3  6  
ATOM 6774  C CZ2  . TRP A 1 50 ? 6.763   -4.159  -0.732  1.00 0.00 ? 48 TRP P CZ2  6  
ATOM 6775  C CZ3  . TRP A 1 50 ? 6.735   -1.724  -0.753  1.00 0.00 ? 48 TRP P CZ3  6  
ATOM 6776  C CH2  . TRP A 1 50 ? 6.990   -2.946  -1.403  1.00 0.00 ? 48 TRP P CH2  6  
ATOM 6777  H H    . TRP A 1 50 ? 5.224   -0.870  5.891   1.00 0.00 ? 48 TRP P H    6  
ATOM 6778  H HA   . TRP A 1 50 ? 7.127   -2.683  4.826   1.00 0.00 ? 48 TRP P HA   6  
ATOM 6779  H HB2  . TRP A 1 50 ? 4.664   -2.784  4.479   1.00 0.00 ? 48 TRP P HB2  6  
ATOM 6780  H HB3  . TRP A 1 50 ? 4.780   -1.413  3.371   1.00 0.00 ? 48 TRP P HB3  6  
ATOM 6781  H HD1  . TRP A 1 50 ? 5.308   -5.137  3.597   1.00 0.00 ? 48 TRP P HD1  6  
ATOM 6782  H HE1  . TRP A 1 50 ? 6.043   -6.103  1.334   1.00 0.00 ? 48 TRP P HE1  6  
ATOM 6783  H HE3  . TRP A 1 50 ? 6.066   -0.758  1.049   1.00 0.00 ? 48 TRP P HE3  6  
ATOM 6784  H HZ2  . TRP A 1 50 ? 6.942   -5.103  -1.227  1.00 0.00 ? 48 TRP P HZ2  6  
ATOM 6785  H HZ3  . TRP A 1 50 ? 6.895   -0.788  -1.271  1.00 0.00 ? 48 TRP P HZ3  6  
ATOM 6786  H HH2  . TRP A 1 50 ? 7.351   -2.953  -2.422  1.00 0.00 ? 48 TRP P HH2  6  
ATOM 6787  N N    . PHE A 1 51 ? 7.211   0.284   3.325   1.00 0.00 ? 49 PHE P N    6  
ATOM 6788  C CA   . PHE A 1 51 ? 8.075   1.144   2.506   1.00 0.00 ? 49 PHE P CA   6  
ATOM 6789  C C    . PHE A 1 51 ? 9.432   1.411   3.165   1.00 0.00 ? 49 PHE P C    6  
ATOM 6790  O O    . PHE A 1 51 ? 10.451  1.332   2.480   1.00 0.00 ? 49 PHE P O    6  
ATOM 6791  C CB   . PHE A 1 51 ? 7.360   2.454   2.130   1.00 0.00 ? 49 PHE P CB   6  
ATOM 6792  C CG   . PHE A 1 51 ? 6.688   2.378   0.774   1.00 0.00 ? 49 PHE P CG   6  
ATOM 6793  C CD1  . PHE A 1 51 ? 7.424   2.679   -0.390  1.00 0.00 ? 49 PHE P CD1  6  
ATOM 6794  C CD2  . PHE A 1 51 ? 5.352   1.955   0.664   1.00 0.00 ? 49 PHE P CD2  6  
ATOM 6795  C CE1  . PHE A 1 51 ? 6.829   2.541   -1.657  1.00 0.00 ? 49 PHE P CE1  6  
ATOM 6796  C CE2  . PHE A 1 51 ? 4.758   1.814   -0.602  1.00 0.00 ? 49 PHE P CE2  6  
ATOM 6797  C CZ   . PHE A 1 51 ? 5.500   2.097   -1.762  1.00 0.00 ? 49 PHE P CZ   6  
ATOM 6798  H H    . PHE A 1 51 ? 6.333   0.660   3.671   1.00 0.00 ? 49 PHE P H    6  
ATOM 6799  H HA   . PHE A 1 51 ? 8.297   0.614   1.578   1.00 0.00 ? 49 PHE P HA   6  
ATOM 6800  H HB2  . PHE A 1 51 ? 6.632   2.721   2.898   1.00 0.00 ? 49 PHE P HB2  6  
ATOM 6801  H HB3  . PHE A 1 51 ? 8.094   3.262   2.092   1.00 0.00 ? 49 PHE P HB3  6  
ATOM 6802  H HD1  . PHE A 1 51 ? 8.453   3.001   -0.314  1.00 0.00 ? 49 PHE P HD1  6  
ATOM 6803  H HD2  . PHE A 1 51 ? 4.786   1.714   1.550   1.00 0.00 ? 49 PHE P HD2  6  
ATOM 6804  H HE1  . PHE A 1 51 ? 7.392   2.771   -2.551  1.00 0.00 ? 49 PHE P HE1  6  
ATOM 6805  H HE2  . PHE A 1 51 ? 3.735   1.476   -0.680  1.00 0.00 ? 49 PHE P HE2  6  
ATOM 6806  H HZ   . PHE A 1 51 ? 5.048   1.978   -2.735  1.00 0.00 ? 49 PHE P HZ   6  
ATOM 6807  N N    . LYS A 1 52 ? 9.487   1.647   4.484   1.00 0.00 ? 50 LYS P N    6  
ATOM 6808  C CA   . LYS A 1 52 ? 10.754  1.781   5.226   1.00 0.00 ? 50 LYS P CA   6  
ATOM 6809  C C    . LYS A 1 52 ? 11.605  0.508   5.117   1.00 0.00 ? 50 LYS P C    6  
ATOM 6810  O O    . LYS A 1 52 ? 12.794  0.583   4.803   1.00 0.00 ? 50 LYS P O    6  
ATOM 6811  C CB   . LYS A 1 52 ? 10.442  2.155   6.687   1.00 0.00 ? 50 LYS P CB   6  
ATOM 6812  C CG   . LYS A 1 52 ? 11.710  2.435   7.508   1.00 0.00 ? 50 LYS P CG   6  
ATOM 6813  C CD   . LYS A 1 52 ? 11.357  2.858   8.940   1.00 0.00 ? 50 LYS P CD   6  
ATOM 6814  C CE   . LYS A 1 52 ? 12.637  3.128   9.740   1.00 0.00 ? 50 LYS P CE   6  
ATOM 6815  N NZ   . LYS A 1 52 ? 12.336  3.537   11.137  1.00 0.00 ? 50 LYS P NZ   6  
ATOM 6816  H H    . LYS A 1 52 ? 8.612   1.727   4.997   1.00 0.00 ? 50 LYS P H    6  
ATOM 6817  H HA   . LYS A 1 52 ? 11.336  2.589   4.780   1.00 0.00 ? 50 LYS P HA   6  
ATOM 6818  H HB2  . LYS A 1 52 ? 9.821   3.053   6.691   1.00 0.00 ? 50 LYS P HB2  6  
ATOM 6819  H HB3  . LYS A 1 52 ? 9.880   1.348   7.159   1.00 0.00 ? 50 LYS P HB3  6  
ATOM 6820  H HG2  . LYS A 1 52 ? 12.327  1.536   7.548   1.00 0.00 ? 50 LYS P HG2  6  
ATOM 6821  H HG3  . LYS A 1 52 ? 12.280  3.232   7.027   1.00 0.00 ? 50 LYS P HG3  6  
ATOM 6822  H HD2  . LYS A 1 52 ? 10.747  3.763   8.910   1.00 0.00 ? 50 LYS P HD2  6  
ATOM 6823  H HD3  . LYS A 1 52 ? 10.787  2.061   9.421   1.00 0.00 ? 50 LYS P HD3  6  
ATOM 6824  H HE2  . LYS A 1 52 ? 13.249  2.220   9.741   1.00 0.00 ? 50 LYS P HE2  6  
ATOM 6825  H HE3  . LYS A 1 52 ? 13.208  3.915   9.236   1.00 0.00 ? 50 LYS P HE3  6  
ATOM 6826  H HZ1  . LYS A 1 52 ? 11.824  2.818   11.630  1.00 0.00 ? 50 LYS P HZ1  6  
ATOM 6827  H HZ2  . LYS A 1 52 ? 11.784  4.384   11.163  1.00 0.00 ? 50 LYS P HZ2  6  
ATOM 6828  H HZ3  . LYS A 1 52 ? 13.187  3.713   11.656  1.00 0.00 ? 50 LYS P HZ3  6  
ATOM 6829  N N    . ASN A 1 53 ? 10.985  -0.659  5.296   1.00 0.00 ? 51 ASN P N    6  
ATOM 6830  C CA   . ASN A 1 53 ? 11.627  -1.971  5.197   1.00 0.00 ? 51 ASN P CA   6  
ATOM 6831  C C    . ASN A 1 53 ? 12.144  -2.254  3.769   1.00 0.00 ? 51 ASN P C    6  
ATOM 6832  O O    . ASN A 1 53 ? 13.298  -2.649  3.588   1.00 0.00 ? 51 ASN P O    6  
ATOM 6833  C CB   . ASN A 1 53 ? 10.602  -3.017  5.673   1.00 0.00 ? 51 ASN P CB   6  
ATOM 6834  C CG   . ASN A 1 53 ? 11.214  -4.381  5.915   1.00 0.00 ? 51 ASN P CG   6  
ATOM 6835  O OD1  . ASN A 1 53 ? 11.328  -5.209  5.023   1.00 0.00 ? 51 ASN P OD1  6  
ATOM 6836  N ND2  . ASN A 1 53 ? 11.625  -4.658  7.132   1.00 0.00 ? 51 ASN P ND2  6  
ATOM 6837  H H    . ASN A 1 53 ? 10.005  -0.631  5.558   1.00 0.00 ? 51 ASN P H    6  
ATOM 6838  H HA   . ASN A 1 53 ? 12.489  -1.990  5.869   1.00 0.00 ? 51 ASN P HA   6  
ATOM 6839  H HB2  . ASN A 1 53 ? 10.151  -2.682  6.607   1.00 0.00 ? 51 ASN P HB2  6  
ATOM 6840  H HB3  . ASN A 1 53 ? 9.803   -3.122  4.939   1.00 0.00 ? 51 ASN P HB3  6  
ATOM 6841  H HD21 . ASN A 1 53 ? 11.486  -3.990  7.876   1.00 0.00 ? 51 ASN P HD21 6  
ATOM 6842  H HD22 . ASN A 1 53 ? 12.018  -5.567  7.317   1.00 0.00 ? 51 ASN P HD22 6  
ATOM 6843  N N    . ARG A 1 54 ? 11.323  -1.979  2.746   1.00 0.00 ? 52 ARG P N    6  
ATOM 6844  C CA   . ARG A 1 54 ? 11.653  -2.196  1.328   1.00 0.00 ? 52 ARG P CA   6  
ATOM 6845  C C    . ARG A 1 54 ? 12.735  -1.239  0.819   1.00 0.00 ? 52 ARG P C    6  
ATOM 6846  O O    . ARG A 1 54 ? 13.632  -1.684  0.101   1.00 0.00 ? 52 ARG P O    6  
ATOM 6847  C CB   . ARG A 1 54 ? 10.358  -2.101  0.497   1.00 0.00 ? 52 ARG P CB   6  
ATOM 6848  C CG   . ARG A 1 54 ? 10.538  -2.498  -0.975  1.00 0.00 ? 52 ARG P CG   6  
ATOM 6849  C CD   . ARG A 1 54 ? 10.811  -3.994  -1.167  1.00 0.00 ? 52 ARG P CD   6  
ATOM 6850  N NE   . ARG A 1 54 ? 10.978  -4.324  -2.592  1.00 0.00 ? 52 ARG P NE   6  
ATOM 6851  C CZ   . ARG A 1 54 ? 12.060  -4.201  -3.333  1.00 0.00 ? 52 ARG P CZ   6  
ATOM 6852  N NH1  . ARG A 1 54 ? 13.187  -3.741  -2.859  1.00 0.00 ? 52 ARG P NH1  6  
ATOM 6853  N NH2  . ARG A 1 54 ? 12.026  -4.548  -4.585  1.00 0.00 ? 52 ARG P NH2  6  
ATOM 6854  H H    . ARG A 1 54 ? 10.379  -1.678  2.971   1.00 0.00 ? 52 ARG P H    6  
ATOM 6855  H HA   . ARG A 1 54 ? 12.060  -3.202  1.233   1.00 0.00 ? 52 ARG P HA   6  
ATOM 6856  H HB2  . ARG A 1 54 ? 9.596   -2.748  0.935   1.00 0.00 ? 52 ARG P HB2  6  
ATOM 6857  H HB3  . ARG A 1 54 ? 9.986   -1.075  0.534   1.00 0.00 ? 52 ARG P HB3  6  
ATOM 6858  H HG2  . ARG A 1 54 ? 9.633   -2.239  -1.519  1.00 0.00 ? 52 ARG P HG2  6  
ATOM 6859  H HG3  . ARG A 1 54 ? 11.359  -1.930  -1.405  1.00 0.00 ? 52 ARG P HG3  6  
ATOM 6860  H HD2  . ARG A 1 54 ? 11.702  -4.292  -0.613  1.00 0.00 ? 52 ARG P HD2  6  
ATOM 6861  H HD3  . ARG A 1 54 ? 9.962   -4.557  -0.773  1.00 0.00 ? 52 ARG P HD3  6  
ATOM 6862  H HE   . ARG A 1 54 ? 10.174  -4.734  -3.066  1.00 0.00 ? 52 ARG P HE   6  
ATOM 6863  H HH11 . ARG A 1 54 ? 13.224  -3.417  -1.908  1.00 0.00 ? 52 ARG P HH11 6  
ATOM 6864  H HH12 . ARG A 1 54 ? 14.000  -3.688  -3.446  1.00 0.00 ? 52 ARG P HH12 6  
ATOM 6865  H HH21 . ARG A 1 54 ? 11.139  -4.856  -4.993  1.00 0.00 ? 52 ARG P HH21 6  
ATOM 6866  H HH22 . ARG A 1 54 ? 12.839  -4.473  -5.168  1.00 0.00 ? 52 ARG P HH22 6  
ATOM 6867  N N    . ARG A 1 55 ? 12.703  0.038   1.225   1.00 0.00 ? 53 ARG P N    6  
ATOM 6868  C CA   . ARG A 1 55 ? 13.749  1.034   0.916   1.00 0.00 ? 53 ARG P CA   6  
ATOM 6869  C C    . ARG A 1 55 ? 15.078  0.701   1.596   1.00 0.00 ? 53 ARG P C    6  
ATOM 6870  O O    . ARG A 1 55 ? 16.117  0.830   0.955   1.00 0.00 ? 53 ARG P O    6  
ATOM 6871  C CB   . ARG A 1 55 ? 13.287  2.456   1.288   1.00 0.00 ? 53 ARG P CB   6  
ATOM 6872  C CG   . ARG A 1 55 ? 12.249  3.012   0.297   1.00 0.00 ? 53 ARG P CG   6  
ATOM 6873  C CD   . ARG A 1 55 ? 11.749  4.415   0.670   1.00 0.00 ? 53 ARG P CD   6  
ATOM 6874  N NE   . ARG A 1 55 ? 12.842  5.407   0.744   1.00 0.00 ? 53 ARG P NE   6  
ATOM 6875  C CZ   . ARG A 1 55 ? 13.463  6.006   -0.258  1.00 0.00 ? 53 ARG P CZ   6  
ATOM 6876  N NH1  . ARG A 1 55 ? 13.114  5.846   -1.502  1.00 0.00 ? 53 ARG P NH1  6  
ATOM 6877  N NH2  . ARG A 1 55 ? 14.472  6.793   -0.021  1.00 0.00 ? 53 ARG P NH2  6  
ATOM 6878  H H    . ARG A 1 55 ? 11.907  0.331   1.785   1.00 0.00 ? 53 ARG P H    6  
ATOM 6879  H HA   . ARG A 1 55 ? 13.952  1.013   -0.156  1.00 0.00 ? 53 ARG P HA   6  
ATOM 6880  H HB2  . ARG A 1 55 ? 12.880  2.460   2.301   1.00 0.00 ? 53 ARG P HB2  6  
ATOM 6881  H HB3  . ARG A 1 55 ? 14.159  3.113   1.273   1.00 0.00 ? 53 ARG P HB3  6  
ATOM 6882  H HG2  . ARG A 1 55 ? 12.689  3.043   -0.700  1.00 0.00 ? 53 ARG P HG2  6  
ATOM 6883  H HG3  . ARG A 1 55 ? 11.387  2.347   0.269   1.00 0.00 ? 53 ARG P HG3  6  
ATOM 6884  H HD2  . ARG A 1 55 ? 11.003  4.735   -0.061  1.00 0.00 ? 53 ARG P HD2  6  
ATOM 6885  H HD3  . ARG A 1 55 ? 11.253  4.358   1.640   1.00 0.00 ? 53 ARG P HD3  6  
ATOM 6886  H HE   . ARG A 1 55 ? 13.178  5.635   1.668   1.00 0.00 ? 53 ARG P HE   6  
ATOM 6887  H HH11 . ARG A 1 55 ? 12.278  5.315   -1.727  1.00 0.00 ? 53 ARG P HH11 6  
ATOM 6888  H HH12 . ARG A 1 55 ? 13.626  6.304   -2.234  1.00 0.00 ? 53 ARG P HH12 6  
ATOM 6889  H HH21 . ARG A 1 55 ? 14.782  6.953   0.923   1.00 0.00 ? 53 ARG P HH21 6  
ATOM 6890  H HH22 . ARG A 1 55 ? 14.944  7.258   -0.778  1.00 0.00 ? 53 ARG P HH22 6  
ATOM 6891  N N    . ALA A 1 56 ? 15.064  0.206   2.836   1.00 0.00 ? 54 ALA P N    6  
ATOM 6892  C CA   . ALA A 1 56 ? 16.275  -0.257  3.521   1.00 0.00 ? 54 ALA P CA   6  
ATOM 6893  C C    . ALA A 1 56 ? 16.911  -1.475  2.819   1.00 0.00 ? 54 ALA P C    6  
ATOM 6894  O O    . ALA A 1 56 ? 18.121  -1.490  2.582   1.00 0.00 ? 54 ALA P O    6  
ATOM 6895  C CB   . ALA A 1 56 ? 15.934  -0.550  4.988   1.00 0.00 ? 54 ALA P CB   6  
ATOM 6896  H H    . ALA A 1 56 ? 14.184  0.175   3.338   1.00 0.00 ? 54 ALA P H    6  
ATOM 6897  H HA   . ALA A 1 56 ? 17.012  0.549   3.503   1.00 0.00 ? 54 ALA P HA   6  
ATOM 6898  H HB1  . ALA A 1 56 ? 16.834  -0.864  5.517   1.00 0.00 ? 54 ALA P HB1  6  
ATOM 6899  H HB2  . ALA A 1 56 ? 15.544  0.351   5.463   1.00 0.00 ? 54 ALA P HB2  6  
ATOM 6900  H HB3  . ALA A 1 56 ? 15.188  -1.342  5.055   1.00 0.00 ? 54 ALA P HB3  6  
ATOM 6901  N N    . LYS A 1 57 ? 16.098  -2.459  2.403   1.00 0.00 ? 55 LYS P N    6  
ATOM 6902  C CA   . LYS A 1 57 ? 16.546  -3.624  1.612   1.00 0.00 ? 55 LYS P CA   6  
ATOM 6903  C C    . LYS A 1 57 ? 17.092  -3.222  0.238   1.00 0.00 ? 55 LYS P C    6  
ATOM 6904  O O    . LYS A 1 57 ? 18.146  -3.711  -0.168  1.00 0.00 ? 55 LYS P O    6  
ATOM 6905  C CB   . LYS A 1 57 ? 15.389  -4.628  1.481   1.00 0.00 ? 55 LYS P CB   6  
ATOM 6906  C CG   . LYS A 1 57 ? 15.180  -5.406  2.789   1.00 0.00 ? 55 LYS P CG   6  
ATOM 6907  C CD   . LYS A 1 57 ? 13.880  -6.218  2.748   1.00 0.00 ? 55 LYS P CD   6  
ATOM 6908  C CE   . LYS A 1 57 ? 13.778  -7.097  4.000   1.00 0.00 ? 55 LYS P CE   6  
ATOM 6909  N NZ   . LYS A 1 57 ? 12.421  -7.679  4.143   1.00 0.00 ? 55 LYS P NZ   6  
ATOM 6910  H H    . LYS A 1 57 ? 15.121  -2.410  2.677   1.00 0.00 ? 55 LYS P H    6  
ATOM 6911  H HA   . LYS A 1 57 ? 17.371  -4.112  2.133   1.00 0.00 ? 55 LYS P HA   6  
ATOM 6912  H HB2  . LYS A 1 57 ? 14.473  -4.099  1.209   1.00 0.00 ? 55 LYS P HB2  6  
ATOM 6913  H HB3  . LYS A 1 57 ? 15.619  -5.345  0.691   1.00 0.00 ? 55 LYS P HB3  6  
ATOM 6914  H HG2  . LYS A 1 57 ? 16.026  -6.079  2.938   1.00 0.00 ? 55 LYS P HG2  6  
ATOM 6915  H HG3  . LYS A 1 57 ? 15.134  -4.715  3.631   1.00 0.00 ? 55 LYS P HG3  6  
ATOM 6916  H HD2  . LYS A 1 57 ? 13.037  -5.527  2.712   1.00 0.00 ? 55 LYS P HD2  6  
ATOM 6917  H HD3  . LYS A 1 57 ? 13.865  -6.850  1.859   1.00 0.00 ? 55 LYS P HD3  6  
ATOM 6918  H HE2  . LYS A 1 57 ? 14.530  -7.889  3.939   1.00 0.00 ? 55 LYS P HE2  6  
ATOM 6919  H HE3  . LYS A 1 57 ? 14.006  -6.484  4.878   1.00 0.00 ? 55 LYS P HE3  6  
ATOM 6920  H HZ1  . LYS A 1 57 ? 12.375  -8.310  4.931   1.00 0.00 ? 55 LYS P HZ1  6  
ATOM 6921  H HZ2  . LYS A 1 57 ? 12.146  -8.190  3.315   1.00 0.00 ? 55 LYS P HZ2  6  
ATOM 6922  H HZ3  . LYS A 1 57 ? 11.747  -6.935  4.306   1.00 0.00 ? 55 LYS P HZ3  6  
ATOM 6923  N N    . TRP A 1 58 ? 16.439  -2.281  -0.447  1.00 0.00 ? 56 TRP P N    6  
ATOM 6924  C CA   . TRP A 1 58 ? 16.926  -1.704  -1.707  1.00 0.00 ? 56 TRP P CA   6  
ATOM 6925  C C    . TRP A 1 58 ? 18.267  -0.974  -1.525  1.00 0.00 ? 56 TRP P C    6  
ATOM 6926  O O    . TRP A 1 58 ? 19.218  -1.253  -2.254  1.00 0.00 ? 56 TRP P O    6  
ATOM 6927  C CB   . TRP A 1 58 ? 15.844  -0.783  -2.282  1.00 0.00 ? 56 TRP P CB   6  
ATOM 6928  C CG   . TRP A 1 58 ? 16.245  0.011   -3.486  1.00 0.00 ? 56 TRP P CG   6  
ATOM 6929  C CD1  . TRP A 1 58 ? 16.379  -0.470  -4.743  1.00 0.00 ? 56 TRP P CD1  6  
ATOM 6930  C CD2  . TRP A 1 58 ? 16.588  1.430   -3.563  1.00 0.00 ? 56 TRP P CD2  6  
ATOM 6931  N NE1  . TRP A 1 58 ? 16.781  0.546   -5.589  1.00 0.00 ? 56 TRP P NE1  6  
ATOM 6932  C CE2  . TRP A 1 58 ? 16.931  1.739   -4.914  1.00 0.00 ? 56 TRP P CE2  6  
ATOM 6933  C CE3  . TRP A 1 58 ? 16.643  2.489   -2.627  1.00 0.00 ? 56 TRP P CE3  6  
ATOM 6934  C CZ2  . TRP A 1 58 ? 17.313  3.027   -5.316  1.00 0.00 ? 56 TRP P CZ2  6  
ATOM 6935  C CZ3  . TRP A 1 58 ? 17.019  3.788   -3.023  1.00 0.00 ? 56 TRP P CZ3  6  
ATOM 6936  C CH2  . TRP A 1 58 ? 17.356  4.058   -4.362  1.00 0.00 ? 56 TRP P CH2  6  
ATOM 6937  H H    . TRP A 1 58 ? 15.553  -1.955  -0.077  1.00 0.00 ? 56 TRP P H    6  
ATOM 6938  H HA   . TRP A 1 58 ? 17.097  -2.509  -2.424  1.00 0.00 ? 56 TRP P HA   6  
ATOM 6939  H HB2  . TRP A 1 58 ? 14.976  -1.388  -2.540  1.00 0.00 ? 56 TRP P HB2  6  
ATOM 6940  H HB3  . TRP A 1 58 ? 15.533  -0.080  -1.510  1.00 0.00 ? 56 TRP P HB3  6  
ATOM 6941  H HD1  . TRP A 1 58 ? 16.208  -1.500  -5.037  1.00 0.00 ? 56 TRP P HD1  6  
ATOM 6942  H HE1  . TRP A 1 58 ? 16.954  0.410   -6.579  1.00 0.00 ? 56 TRP P HE1  6  
ATOM 6943  H HE3  . TRP A 1 58 ? 16.395  2.293   -1.593  1.00 0.00 ? 56 TRP P HE3  6  
ATOM 6944  H HZ2  . TRP A 1 58 ? 17.577  3.218   -6.348  1.00 0.00 ? 56 TRP P HZ2  6  
ATOM 6945  H HZ3  . TRP A 1 58 ? 17.058  4.583   -2.290  1.00 0.00 ? 56 TRP P HZ3  6  
ATOM 6946  H HH2  . TRP A 1 58 ? 17.653  5.058   -4.654  1.00 0.00 ? 56 TRP P HH2  6  
ATOM 6947  N N    . ARG A 1 59 ? 18.397  -0.121  -0.501  1.00 0.00 ? 57 ARG P N    6  
ATOM 6948  C CA   . ARG A 1 59 ? 19.643  0.592   -0.160  1.00 0.00 ? 57 ARG P CA   6  
ATOM 6949  C C    . ARG A 1 59 ? 20.798  -0.367  0.169   1.00 0.00 ? 57 ARG P C    6  
ATOM 6950  O O    . ARG A 1 59 ? 21.938  -0.098  -0.209  1.00 0.00 ? 57 ARG P O    6  
ATOM 6951  C CB   . ARG A 1 59 ? 19.350  1.563   0.997   1.00 0.00 ? 57 ARG P CB   6  
ATOM 6952  C CG   . ARG A 1 59 ? 20.532  2.494   1.321   1.00 0.00 ? 57 ARG P CG   6  
ATOM 6953  C CD   . ARG A 1 59 ? 20.184  3.486   2.439   1.00 0.00 ? 57 ARG P CD   6  
ATOM 6954  N NE   . ARG A 1 59 ? 20.003  2.813   3.744   1.00 0.00 ? 57 ARG P NE   6  
ATOM 6955  C CZ   . ARG A 1 59 ? 19.523  3.351   4.851   1.00 0.00 ? 57 ARG P CZ   6  
ATOM 6956  N NH1  . ARG A 1 59 ? 19.136  4.594   4.908   1.00 0.00 ? 57 ARG P NH1  6  
ATOM 6957  N NH2  . ARG A 1 59 ? 19.423  2.641   5.938   1.00 0.00 ? 57 ARG P NH2  6  
ATOM 6958  H H    . ARG A 1 59 ? 17.568  0.080   0.053   1.00 0.00 ? 57 ARG P H    6  
ATOM 6959  H HA   . ARG A 1 59 ? 19.957  1.172   -1.031  1.00 0.00 ? 57 ARG P HA   6  
ATOM 6960  H HB2  . ARG A 1 59 ? 18.496  2.185   0.720   1.00 0.00 ? 57 ARG P HB2  6  
ATOM 6961  H HB3  . ARG A 1 59 ? 19.082  0.992   1.885   1.00 0.00 ? 57 ARG P HB3  6  
ATOM 6962  H HG2  . ARG A 1 59 ? 21.401  1.910   1.626   1.00 0.00 ? 57 ARG P HG2  6  
ATOM 6963  H HG3  . ARG A 1 59 ? 20.790  3.060   0.425   1.00 0.00 ? 57 ARG P HG3  6  
ATOM 6964  H HD2  . ARG A 1 59 ? 20.997  4.210   2.522   1.00 0.00 ? 57 ARG P HD2  6  
ATOM 6965  H HD3  . ARG A 1 59 ? 19.273  4.020   2.161   1.00 0.00 ? 57 ARG P HD3  6  
ATOM 6966  H HE   . ARG A 1 59 ? 20.300  1.853   3.809   1.00 0.00 ? 57 ARG P HE   6  
ATOM 6967  H HH11 . ARG A 1 59 ? 19.217  5.172   4.090   1.00 0.00 ? 57 ARG P HH11 6  
ATOM 6968  H HH12 . ARG A 1 59 ? 18.778  4.982   5.764   1.00 0.00 ? 57 ARG P HH12 6  
ATOM 6969  H HH21 . ARG A 1 59 ? 19.724  1.680   5.948   1.00 0.00 ? 57 ARG P HH21 6  
ATOM 6970  H HH22 . ARG A 1 59 ? 19.065  3.056   6.783   1.00 0.00 ? 57 ARG P HH22 6  
ATOM 6971  N N    . LYS A 1 60 ? 20.506  -1.501  0.820   1.00 0.00 ? 58 LYS P N    6  
ATOM 6972  C CA   . LYS A 1 60 ? 21.472  -2.577  1.117   1.00 0.00 ? 58 LYS P CA   6  
ATOM 6973  C C    . LYS A 1 60 ? 21.889  -3.371  -0.134  1.00 0.00 ? 58 LYS P C    6  
ATOM 6974  O O    . LYS A 1 60 ? 23.047  -3.782  -0.231  1.00 0.00 ? 58 LYS P O    6  
ATOM 6975  C CB   . LYS A 1 60 ? 20.866  -3.483  2.210   1.00 0.00 ? 58 LYS P CB   6  
ATOM 6976  C CG   . LYS A 1 60 ? 21.769  -4.627  2.702   1.00 0.00 ? 58 LYS P CG   6  
ATOM 6977  C CD   . LYS A 1 60 ? 23.083  -4.145  3.338   1.00 0.00 ? 58 LYS P CD   6  
ATOM 6978  C CE   . LYS A 1 60 ? 23.865  -5.343  3.889   1.00 0.00 ? 58 LYS P CE   6  
ATOM 6979  N NZ   . LYS A 1 60 ? 25.149  -4.921  4.511   1.00 0.00 ? 58 LYS P NZ   6  
ATOM 6980  H H    . LYS A 1 60 ? 19.557  -1.600  1.165   1.00 0.00 ? 58 LYS P H    6  
ATOM 6981  H HA   . LYS A 1 60 ? 22.379  -2.117  1.510   1.00 0.00 ? 58 LYS P HA   6  
ATOM 6982  H HB2  . LYS A 1 60 ? 20.603  -2.864  3.070   1.00 0.00 ? 58 LYS P HB2  6  
ATOM 6983  H HB3  . LYS A 1 60 ? 19.944  -3.925  1.831   1.00 0.00 ? 58 LYS P HB3  6  
ATOM 6984  H HG2  . LYS A 1 60 ? 21.212  -5.196  3.448   1.00 0.00 ? 58 LYS P HG2  6  
ATOM 6985  H HG3  . LYS A 1 60 ? 21.993  -5.299  1.872   1.00 0.00 ? 58 LYS P HG3  6  
ATOM 6986  H HD2  . LYS A 1 60 ? 23.690  -3.636  2.588   1.00 0.00 ? 58 LYS P HD2  6  
ATOM 6987  H HD3  . LYS A 1 60 ? 22.857  -3.451  4.149   1.00 0.00 ? 58 LYS P HD3  6  
ATOM 6988  H HE2  . LYS A 1 60 ? 23.245  -5.859  4.629   1.00 0.00 ? 58 LYS P HE2  6  
ATOM 6989  H HE3  . LYS A 1 60 ? 24.061  -6.043  3.071   1.00 0.00 ? 58 LYS P HE3  6  
ATOM 6990  H HZ1  . LYS A 1 60 ? 25.747  -4.457  3.841   1.00 0.00 ? 58 LYS P HZ1  6  
ATOM 6991  H HZ2  . LYS A 1 60 ? 25.657  -5.717  4.872   1.00 0.00 ? 58 LYS P HZ2  6  
ATOM 6992  H HZ3  . LYS A 1 60 ? 24.993  -4.286  5.282   1.00 0.00 ? 58 LYS P HZ3  6  
ATOM 6993  N N    . ARG A 1 61 ? 20.975  -3.570  -1.095  1.00 0.00 ? 59 ARG P N    6  
ATOM 6994  C CA   . ARG A 1 61 ? 21.228  -4.270  -2.372  1.00 0.00 ? 59 ARG P CA   6  
ATOM 6995  C C    . ARG A 1 61 ? 21.978  -3.409  -3.400  1.00 0.00 ? 59 ARG P C    6  
ATOM 6996  O O    . ARG A 1 61 ? 22.770  -3.948  -4.176  1.00 0.00 ? 59 ARG P O    6  
ATOM 6997  C CB   . ARG A 1 61 ? 19.886  -4.795  -2.923  1.00 0.00 ? 59 ARG P CB   6  
ATOM 6998  C CG   . ARG A 1 61 ? 19.971  -5.500  -4.289  1.00 0.00 ? 59 ARG P CG   6  
ATOM 6999  C CD   . ARG A 1 61 ? 20.924  -6.706  -4.298  1.00 0.00 ? 59 ARG P CD   6  
ATOM 7000  N NE   . ARG A 1 61 ? 21.103  -7.245  -5.660  1.00 0.00 ? 59 ARG P NE   6  
ATOM 7001  C CZ   . ARG A 1 61 ? 21.959  -6.823  -6.578  1.00 0.00 ? 59 ARG P CZ   6  
ATOM 7002  N NH1  . ARG A 1 61 ? 22.752  -5.805  -6.389  1.00 0.00 ? 59 ARG P NH1  6  
ATOM 7003  N NH2  . ARG A 1 61 ? 22.033  -7.429  -7.728  1.00 0.00 ? 59 ARG P NH2  6  
ATOM 7004  H H    . ARG A 1 61 ? 20.030  -3.255  -0.902  1.00 0.00 ? 59 ARG P H    6  
ATOM 7005  H HA   . ARG A 1 61 ? 21.875  -5.123  -2.163  1.00 0.00 ? 59 ARG P HA   6  
ATOM 7006  H HB2  . ARG A 1 61 ? 19.460  -5.493  -2.199  1.00 0.00 ? 59 ARG P HB2  6  
ATOM 7007  H HB3  . ARG A 1 61 ? 19.193  -3.958  -3.023  1.00 0.00 ? 59 ARG P HB3  6  
ATOM 7008  H HG2  . ARG A 1 61 ? 18.973  -5.844  -4.564  1.00 0.00 ? 59 ARG P HG2  6  
ATOM 7009  H HG3  . ARG A 1 61 ? 20.288  -4.779  -5.043  1.00 0.00 ? 59 ARG P HG3  6  
ATOM 7010  H HD2  . ARG A 1 61 ? 21.897  -6.426  -3.896  1.00 0.00 ? 59 ARG P HD2  6  
ATOM 7011  H HD3  . ARG A 1 61 ? 20.511  -7.483  -3.653  1.00 0.00 ? 59 ARG P HD3  6  
ATOM 7012  H HE   . ARG A 1 61 ? 20.532  -8.036  -5.914  1.00 0.00 ? 59 ARG P HE   6  
ATOM 7013  H HH11 . ARG A 1 61 ? 22.711  -5.282  -5.521  1.00 0.00 ? 59 ARG P HH11 6  
ATOM 7014  H HH12 . ARG A 1 61 ? 23.390  -5.515  -7.110  1.00 0.00 ? 59 ARG P HH12 6  
ATOM 7015  H HH21 . ARG A 1 61 ? 21.442  -8.221  -7.923  1.00 0.00 ? 59 ARG P HH21 6  
ATOM 7016  H HH22 . ARG A 1 61 ? 22.681  -7.112  -8.429  1.00 0.00 ? 59 ARG P HH22 6  
ATOM 7017  N N    . GLU A 1 62 ? 21.740  -2.102  -3.418  1.00 0.00 ? 60 GLU P N    6  
ATOM 7018  C CA   . GLU A 1 62 ? 22.450  -1.133  -4.266  1.00 0.00 ? 60 GLU P CA   6  
ATOM 7019  C C    . GLU A 1 62 ? 23.900  -0.875  -3.798  1.00 0.00 ? 60 GLU P C    6  
ATOM 7020  O O    . GLU A 1 62 ? 24.271  -1.149  -2.654  1.00 0.00 ? 60 GLU P O    6  
ATOM 7021  C CB   . GLU A 1 62 ? 21.658  0.188   -4.323  1.00 0.00 ? 60 GLU P CB   6  
ATOM 7022  C CG   . GLU A 1 62 ? 20.357  0.102   -5.136  1.00 0.00 ? 60 GLU P CG   6  
ATOM 7023  C CD   . GLU A 1 62 ? 20.628  -0.066  -6.644  1.00 0.00 ? 60 GLU P CD   6  
ATOM 7024  O OE1  . GLU A 1 62 ? 20.858  0.951   -7.342  1.00 0.00 ? 60 GLU P OE1  6  
ATOM 7025  O OE2  . GLU A 1 62 ? 20.618  -1.217  -7.143  1.00 0.00 ? 60 GLU P OE2  6  
ATOM 7026  H H    . GLU A 1 62 ? 21.016  -1.751  -2.802  1.00 0.00 ? 60 GLU P H    6  
ATOM 7027  H HA   . GLU A 1 62 ? 22.518  -1.536  -5.277  1.00 0.00 ? 60 GLU P HA   6  
ATOM 7028  H HB2  . GLU A 1 62 ? 21.419  0.501   -3.306  1.00 0.00 ? 60 GLU P HB2  6  
ATOM 7029  H HB3  . GLU A 1 62 ? 22.281  0.965   -4.767  1.00 0.00 ? 60 GLU P HB3  6  
ATOM 7030  H HG2  . GLU A 1 62 ? 19.744  -0.725  -4.772  1.00 0.00 ? 60 GLU P HG2  6  
ATOM 7031  H HG3  . GLU A 1 62 ? 19.793  1.023   -4.971  1.00 0.00 ? 60 GLU P HG3  6  
ATOM 7032  N N    . GLU A 1 63 ? 24.729  -0.326  -4.691  1.00 0.00 ? 61 GLU P N    6  
ATOM 7033  C CA   . GLU A 1 63 ? 26.124  0.061   -4.429  1.00 0.00 ? 61 GLU P CA   6  
ATOM 7034  C C    . GLU A 1 63 ? 26.469  1.386   -5.140  1.00 0.00 ? 61 GLU P C    6  
ATOM 7035  O O    . GLU A 1 63 ? 25.955  1.675   -6.224  1.00 0.00 ? 61 GLU P O    6  
ATOM 7036  C CB   . GLU A 1 63 ? 27.057  -1.093  -4.852  1.00 0.00 ? 61 GLU P CB   6  
ATOM 7037  C CG   . GLU A 1 63 ? 28.551  -0.874  -4.569  1.00 0.00 ? 61 GLU P CG   6  
ATOM 7038  C CD   . GLU A 1 63 ? 28.840  -0.618  -3.078  1.00 0.00 ? 61 GLU P CD   6  
ATOM 7039  O OE1  . GLU A 1 63 ? 28.782  0.562   -2.657  1.00 0.00 ? 61 GLU P OE1  6  
ATOM 7040  O OE2  . GLU A 1 63 ? 29.126  -1.584  -2.330  1.00 0.00 ? 61 GLU P OE2  6  
ATOM 7041  H H    . GLU A 1 63 ? 24.367  -0.103  -5.608  1.00 0.00 ? 61 GLU P H    6  
ATOM 7042  H HA   . GLU A 1 63 ? 26.245  0.228   -3.357  1.00 0.00 ? 61 GLU P HA   6  
ATOM 7043  H HB2  . GLU A 1 63 ? 26.745  -2.000  -4.332  1.00 0.00 ? 61 GLU P HB2  6  
ATOM 7044  H HB3  . GLU A 1 63 ? 26.935  -1.266  -5.923  1.00 0.00 ? 61 GLU P HB3  6  
ATOM 7045  H HG2  . GLU A 1 63 ? 29.097  -1.758  -4.905  1.00 0.00 ? 61 GLU P HG2  6  
ATOM 7046  H HG3  . GLU A 1 63 ? 28.912  -0.034  -5.166  1.00 0.00 ? 61 GLU P HG3  6  
ATOM 7047  N N    . PHE A 1 64 ? 27.340  2.197   -4.533  1.00 0.00 ? 62 PHE P N    6  
ATOM 7048  C CA   . PHE A 1 64 ? 27.680  3.550   -4.998  1.00 0.00 ? 62 PHE P CA   6  
ATOM 7049  C C    . PHE A 1 64 ? 28.751  3.579   -6.105  1.00 0.00 ? 62 PHE P C    6  
ATOM 7050  O O    . PHE A 1 64 ? 28.873  4.581   -6.812  1.00 0.00 ? 62 PHE P O    6  
ATOM 7051  C CB   . PHE A 1 64 ? 28.103  4.398   -3.788  1.00 0.00 ? 62 PHE P CB   6  
ATOM 7052  C CG   . PHE A 1 64 ? 27.045  4.502   -2.702  1.00 0.00 ? 62 PHE P CG   6  
ATOM 7053  C CD1  . PHE A 1 64 ? 25.950  5.371   -2.868  1.00 0.00 ? 62 PHE P CD1  6  
ATOM 7054  C CD2  . PHE A 1 64 ? 27.143  3.718   -1.536  1.00 0.00 ? 62 PHE P CD2  6  
ATOM 7055  C CE1  . PHE A 1 64 ? 24.958  5.456   -1.874  1.00 0.00 ? 62 PHE P CE1  6  
ATOM 7056  C CE2  . PHE A 1 64 ? 26.151  3.803   -0.543  1.00 0.00 ? 62 PHE P CE2  6  
ATOM 7057  C CZ   . PHE A 1 64 ? 25.058  4.672   -0.711  1.00 0.00 ? 62 PHE P CZ   6  
ATOM 7058  H H    . PHE A 1 64 ? 27.766  1.872   -3.666  1.00 0.00 ? 62 PHE P H    6  
ATOM 7059  H HA   . PHE A 1 64 ? 26.783  4.005   -5.421  1.00 0.00 ? 62 PHE P HA   6  
ATOM 7060  H HB2  . PHE A 1 64 ? 29.018  3.981   -3.364  1.00 0.00 ? 62 PHE P HB2  6  
ATOM 7061  H HB3  . PHE A 1 64 ? 28.334  5.407   -4.133  1.00 0.00 ? 62 PHE P HB3  6  
ATOM 7062  H HD1  . PHE A 1 64 ? 25.867  5.973   -3.763  1.00 0.00 ? 62 PHE P HD1  6  
ATOM 7063  H HD2  . PHE A 1 64 ? 27.979  3.044   -1.403  1.00 0.00 ? 62 PHE P HD2  6  
ATOM 7064  H HE1  . PHE A 1 64 ? 24.116  6.124   -2.004  1.00 0.00 ? 62 PHE P HE1  6  
ATOM 7065  H HE2  . PHE A 1 64 ? 26.227  3.198   0.352   1.00 0.00 ? 62 PHE P HE2  6  
ATOM 7066  H HZ   . PHE A 1 64 ? 24.294  4.737   0.054   1.00 0.00 ? 62 PHE P HZ   6  
ATOM 7067  N N    . ILE A 1 65 ? 29.514  2.486   -6.266  1.00 0.00 ? 63 ILE P N    6  
ATOM 7068  C CA   . ILE A 1 65 ? 30.506  2.224   -7.332  1.00 0.00 ? 63 ILE P CA   6  
ATOM 7069  C C    . ILE A 1 65 ? 31.511  3.368   -7.602  1.00 0.00 ? 63 ILE P C    6  
ATOM 7070  O O    . ILE A 1 65 ? 31.935  3.598   -8.737  1.00 0.00 ? 63 ILE P O    6  
ATOM 7071  C CB   . ILE A 1 65 ? 29.850  1.623   -8.605  1.00 0.00 ? 63 ILE P CB   6  
ATOM 7072  C CG1  . ILE A 1 65 ? 28.860  2.581   -9.306  1.00 0.00 ? 63 ILE P CG1  6  
ATOM 7073  C CG2  . ILE A 1 65 ? 29.171  0.283   -8.256  1.00 0.00 ? 63 ILE P CG2  6  
ATOM 7074  C CD1  . ILE A 1 65 ? 28.420  2.106   -10.697 1.00 0.00 ? 63 ILE P CD1  6  
ATOM 7075  H H    . ILE A 1 65 ? 29.331  1.725   -5.626  1.00 0.00 ? 63 ILE P H    6  
ATOM 7076  H HA   . ILE A 1 65 ? 31.142  1.431   -6.938  1.00 0.00 ? 63 ILE P HA   6  
ATOM 7077  H HB   . ILE A 1 65 ? 30.654  1.394   -9.308  1.00 0.00 ? 63 ILE P HB   6  
ATOM 7078  H HG12 . ILE A 1 65 ? 27.970  2.707   -8.689  1.00 0.00 ? 63 ILE P HG12 6  
ATOM 7079  H HG13 . ILE A 1 65 ? 29.331  3.557   -9.426  1.00 0.00 ? 63 ILE P HG13 6  
ATOM 7080  H HG21 . ILE A 1 65 ? 28.887  -0.243  -9.169  1.00 0.00 ? 63 ILE P HG21 6  
ATOM 7081  H HG22 . ILE A 1 65 ? 29.859  -0.355  -7.703  1.00 0.00 ? 63 ILE P HG22 6  
ATOM 7082  H HG23 . ILE A 1 65 ? 28.276  0.454   -7.657  1.00 0.00 ? 63 ILE P HG23 6  
ATOM 7083  H HD11 . ILE A 1 65 ? 29.294  1.927   -11.324 1.00 0.00 ? 63 ILE P HD11 6  
ATOM 7084  H HD12 . ILE A 1 65 ? 27.832  1.192   -10.620 1.00 0.00 ? 63 ILE P HD12 6  
ATOM 7085  H HD13 . ILE A 1 65 ? 27.803  2.875   -11.161 1.00 0.00 ? 63 ILE P HD13 6  
ATOM 7086  N N    . VAL A 1 66 ? 31.912  4.089   -6.546  1.00 0.00 ? 64 VAL P N    6  
ATOM 7087  C CA   . VAL A 1 66 ? 32.860  5.223   -6.620  1.00 0.00 ? 64 VAL P CA   6  
ATOM 7088  C C    . VAL A 1 66 ? 34.290  4.747   -6.923  1.00 0.00 ? 64 VAL P C    6  
ATOM 7089  O O    . VAL A 1 66 ? 35.018  5.397   -7.678  1.00 0.00 ? 64 VAL P O    6  
ATOM 7090  C CB   . VAL A 1 66 ? 32.822  6.049   -5.313  1.00 0.00 ? 64 VAL P CB   6  
ATOM 7091  C CG1  . VAL A 1 66 ? 33.741  7.278   -5.367  1.00 0.00 ? 64 VAL P CG1  6  
ATOM 7092  C CG2  . VAL A 1 66 ? 31.405  6.560   -5.007  1.00 0.00 ? 64 VAL P CG2  6  
ATOM 7093  H H    . VAL A 1 66 ? 31.512  3.859   -5.649  1.00 0.00 ? 64 VAL P H    6  
ATOM 7094  H HA   . VAL A 1 66 ? 32.555  5.878   -7.437  1.00 0.00 ? 64 VAL P HA   6  
ATOM 7095  H HB   . VAL A 1 66 ? 33.144  5.418   -4.484  1.00 0.00 ? 64 VAL P HB   6  
ATOM 7096  H HG11 . VAL A 1 66 ? 33.474  7.908   -6.217  1.00 0.00 ? 64 VAL P HG11 6  
ATOM 7097  H HG12 . VAL A 1 66 ? 33.644  7.856   -4.448  1.00 0.00 ? 64 VAL P HG12 6  
ATOM 7098  H HG13 . VAL A 1 66 ? 34.782  6.970   -5.459  1.00 0.00 ? 64 VAL P HG13 6  
ATOM 7099  H HG21 . VAL A 1 66 ? 31.035  7.156   -5.841  1.00 0.00 ? 64 VAL P HG21 6  
ATOM 7100  H HG22 . VAL A 1 66 ? 30.729  5.724   -4.838  1.00 0.00 ? 64 VAL P HG22 6  
ATOM 7101  H HG23 . VAL A 1 66 ? 31.416  7.171   -4.104  1.00 0.00 ? 64 VAL P HG23 6  
ATOM 7102  N N    . THR A 1 67 ? 34.687  3.598   -6.370  1.00 0.00 ? 65 THR P N    6  
ATOM 7103  C CA   . THR A 1 67 ? 35.993  2.948   -6.589  1.00 0.00 ? 65 THR P CA   6  
ATOM 7104  C C    . THR A 1 67 ? 35.976  1.982   -7.782  1.00 0.00 ? 65 THR P C    6  
ATOM 7105  O O    . THR A 1 67 ? 34.952  1.362   -8.083  1.00 0.00 ? 65 THR P O    6  
ATOM 7106  C CB   . THR A 1 67 ? 36.469  2.216   -5.321  1.00 0.00 ? 65 THR P CB   6  
ATOM 7107  O OG1  . THR A 1 67 ? 35.454  1.382   -4.790  1.00 0.00 ? 65 THR P OG1  6  
ATOM 7108  C CG2  . THR A 1 67 ? 36.855  3.206   -4.219  1.00 0.00 ? 65 THR P CG2  6  
ATOM 7109  H H    . THR A 1 67 ? 34.034  3.108   -5.775  1.00 0.00 ? 65 THR P H    6  
ATOM 7110  H HA   . THR A 1 67 ? 36.733  3.719   -6.813  1.00 0.00 ? 65 THR P HA   6  
ATOM 7111  H HB   . THR A 1 67 ? 37.346  1.612   -5.560  1.00 0.00 ? 65 THR P HB   6  
ATOM 7112  H HG1  . THR A 1 67 ? 35.320  0.643   -5.410  1.00 0.00 ? 65 THR P HG1  6  
ATOM 7113  H HG21 . THR A 1 67 ? 35.994  3.809   -3.930  1.00 0.00 ? 65 THR P HG21 6  
ATOM 7114  H HG22 . THR A 1 67 ? 37.650  3.861   -4.575  1.00 0.00 ? 65 THR P HG22 6  
ATOM 7115  H HG23 . THR A 1 67 ? 37.217  2.657   -3.349  1.00 0.00 ? 65 THR P HG23 6  
ATOM 7116  N N    . ASP A 1 68 ? 37.127  1.829   -8.450  1.00 0.00 ? 66 ASP P N    6  
ATOM 7117  C CA   . ASP A 1 68 ? 37.350  0.941   -9.609  1.00 0.00 ? 66 ASP P CA   6  
ATOM 7118  C C    . ASP A 1 68 ? 38.757  0.305   -9.607  1.00 0.00 ? 66 ASP P C    6  
ATOM 7119  O O    . ASP A 1 68 ? 38.855  -0.923  -9.835  1.00 0.00 ? 66 ASP P O    6  
ATOM 7120  C CB   . ASP A 1 68 ? 37.104  1.729   -10.913 1.00 0.00 ? 66 ASP P CB   6  
ATOM 7121  C CG   . ASP A 1 68 ? 37.288  0.872   -12.185 1.00 0.00 ? 66 ASP P CG   6  
ATOM 7122  O OD1  . ASP A 1 68 ? 36.407  0.028   -12.485 1.00 0.00 ? 66 ASP P OD1  6  
ATOM 7123  O OD2  . ASP A 1 68 ? 38.296  1.063   -12.912 1.00 0.00 ? 66 ASP P OD2  6  
ATOM 7124  O OXT  . ASP A 1 68 ? 39.750  1.026   -9.351  1.00 0.00 ? 66 ASP P OXT  6  
ATOM 7125  H H    . ASP A 1 68 ? 37.928  2.359   -8.135  1.00 0.00 ? 66 ASP P H    6  
ATOM 7126  H HA   . ASP A 1 68 ? 36.630  0.122   -9.576  1.00 0.00 ? 66 ASP P HA   6  
ATOM 7127  H HB2  . ASP A 1 68 ? 36.085  2.125   -10.897 1.00 0.00 ? 66 ASP P HB2  6  
ATOM 7128  H HB3  . ASP A 1 68 ? 37.783  2.584   -10.944 1.00 0.00 ? 66 ASP P HB3  6  
ATOM 7129  N N    . GLY A 1 1  ? 10.395  -33.129 17.613  1.00 0.00 ? -1 GLY P N    7  
ATOM 7130  C CA   . GLY A 1 1  ? 11.111  -31.834 17.600  1.00 0.00 ? -1 GLY P CA   7  
ATOM 7131  C C    . GLY A 1 1  ? 10.143  -30.661 17.559  1.00 0.00 ? -1 GLY P C    7  
ATOM 7132  O O    . GLY A 1 1  ? 9.084   -30.746 16.934  1.00 0.00 ? -1 GLY P O    7  
ATOM 7133  H H1   . GLY A 1 1  ? 9.812   -33.211 16.794  1.00 0.00 ? -1 GLY P H1   7  
ATOM 7134  H H2   . GLY A 1 1  ? 9.812   -33.199 18.432  1.00 0.00 ? -1 GLY P H2   7  
ATOM 7135  H H3   . GLY A 1 1  ? 11.054  -33.891 17.619  1.00 0.00 ? -1 GLY P H3   7  
ATOM 7136  H HA2  . GLY A 1 1  ? 11.730  -31.753 18.493  1.00 0.00 ? -1 GLY P HA2  7  
ATOM 7137  H HA3  . GLY A 1 1  ? 11.752  -31.781 16.721  1.00 0.00 ? -1 GLY P HA3  7  
ATOM 7138  N N    . SER A 1 2  ? 10.493  -29.554 18.221  1.00 0.00 ? 0  SER P N    7  
ATOM 7139  C CA   . SER A 1 2  ? 9.647   -28.351 18.338  1.00 0.00 ? 0  SER P CA   7  
ATOM 7140  C C    . SER A 1 2  ? 9.487   -27.592 17.012  1.00 0.00 ? 0  SER P C    7  
ATOM 7141  O O    . SER A 1 2  ? 10.411  -27.542 16.192  1.00 0.00 ? 0  SER P O    7  
ATOM 7142  C CB   . SER A 1 2  ? 10.215  -27.399 19.400  1.00 0.00 ? 0  SER P CB   7  
ATOM 7143  O OG   . SER A 1 2  ? 10.345  -28.066 20.648  1.00 0.00 ? 0  SER P OG   7  
ATOM 7144  H H    . SER A 1 2  ? 11.365  -29.551 18.734  1.00 0.00 ? 0  SER P H    7  
ATOM 7145  H HA   . SER A 1 2  ? 8.654   -28.659 18.670  1.00 0.00 ? 0  SER P HA   7  
ATOM 7146  H HB2  . SER A 1 2  ? 11.194  -27.037 19.077  1.00 0.00 ? 0  SER P HB2  7  
ATOM 7147  H HB3  . SER A 1 2  ? 9.547   -26.543 19.514  1.00 0.00 ? 0  SER P HB3  7  
ATOM 7148  H HG   . SER A 1 2  ? 10.691  -27.428 21.305  1.00 0.00 ? 0  SER P HG   7  
ATOM 7149  N N    . GLN A 1 3  ? 8.329   -26.955 16.813  1.00 0.00 ? 1  GLN P N    7  
ATOM 7150  C CA   . GLN A 1 3  ? 8.056   -26.104 15.646  1.00 0.00 ? 1  GLN P CA   7  
ATOM 7151  C C    . GLN A 1 3  ? 8.861   -24.790 15.693  1.00 0.00 ? 1  GLN P C    7  
ATOM 7152  O O    . GLN A 1 3  ? 9.181   -24.274 16.769  1.00 0.00 ? 1  GLN P O    7  
ATOM 7153  C CB   . GLN A 1 3  ? 6.547   -25.820 15.521  1.00 0.00 ? 1  GLN P CB   7  
ATOM 7154  C CG   . GLN A 1 3  ? 5.723   -27.091 15.244  1.00 0.00 ? 1  GLN P CG   7  
ATOM 7155  C CD   . GLN A 1 3  ? 4.234   -26.820 15.006  1.00 0.00 ? 1  GLN P CD   7  
ATOM 7156  O OE1  . GLN A 1 3  ? 3.756   -25.692 14.956  1.00 0.00 ? 1  GLN P OE1  7  
ATOM 7157  N NE2  . GLN A 1 3  ? 3.433   -27.852 14.843  1.00 0.00 ? 1  GLN P NE2  7  
ATOM 7158  H H    . GLN A 1 3  ? 7.620   -27.013 17.531  1.00 0.00 ? 1  GLN P H    7  
ATOM 7159  H HA   . GLN A 1 3  ? 8.365   -26.647 14.751  1.00 0.00 ? 1  GLN P HA   7  
ATOM 7160  H HB2  . GLN A 1 3  ? 6.189   -25.347 16.437  1.00 0.00 ? 1  GLN P HB2  7  
ATOM 7161  H HB3  . GLN A 1 3  ? 6.396   -25.125 14.693  1.00 0.00 ? 1  GLN P HB3  7  
ATOM 7162  H HG2  . GLN A 1 3  ? 6.122   -27.590 14.360  1.00 0.00 ? 1  GLN P HG2  7  
ATOM 7163  H HG3  . GLN A 1 3  ? 5.817   -27.775 16.087  1.00 0.00 ? 1  GLN P HG3  7  
ATOM 7164  H HE21 . GLN A 1 3  ? 3.797   -28.793 14.879  1.00 0.00 ? 1  GLN P HE21 7  
ATOM 7165  H HE22 . GLN A 1 3  ? 2.451   -27.677 14.690  1.00 0.00 ? 1  GLN P HE22 7  
ATOM 7166  N N    . ARG A 1 4  ? 9.175   -24.244 14.508  1.00 0.00 ? 2  ARG P N    7  
ATOM 7167  C CA   . ARG A 1 4  ? 9.987   -23.021 14.309  1.00 0.00 ? 2  ARG P CA   7  
ATOM 7168  C C    . ARG A 1 4  ? 9.382   -22.026 13.300  1.00 0.00 ? 2  ARG P C    7  
ATOM 7169  O O    . ARG A 1 4  ? 10.098  -21.249 12.663  1.00 0.00 ? 2  ARG P O    7  
ATOM 7170  C CB   . ARG A 1 4  ? 11.470  -23.383 14.056  1.00 0.00 ? 2  ARG P CB   7  
ATOM 7171  C CG   . ARG A 1 4  ? 11.822  -24.113 12.742  1.00 0.00 ? 2  ARG P CG   7  
ATOM 7172  C CD   . ARG A 1 4  ? 11.329  -25.565 12.604  1.00 0.00 ? 2  ARG P CD   7  
ATOM 7173  N NE   . ARG A 1 4  ? 11.719  -26.423 13.744  1.00 0.00 ? 2  ARG P NE   7  
ATOM 7174  C CZ   . ARG A 1 4  ? 12.880  -27.014 13.959  1.00 0.00 ? 2  ARG P CZ   7  
ATOM 7175  N NH1  . ARG A 1 4  ? 13.892  -26.905 13.145  1.00 0.00 ? 2  ARG P NH1  7  
ATOM 7176  N NH2  . ARG A 1 4  ? 13.029  -27.739 15.028  1.00 0.00 ? 2  ARG P NH2  7  
ATOM 7177  H H    . ARG A 1 4  ? 8.858   -24.732 13.682  1.00 0.00 ? 2  ARG P H    7  
ATOM 7178  H HA   . ARG A 1 4  ? 9.975   -22.464 15.249  1.00 0.00 ? 2  ARG P HA   7  
ATOM 7179  H HB2  . ARG A 1 4  ? 12.045  -22.456 14.076  1.00 0.00 ? 2  ARG P HB2  7  
ATOM 7180  H HB3  . ARG A 1 4  ? 11.829  -23.979 14.896  1.00 0.00 ? 2  ARG P HB3  7  
ATOM 7181  H HG2  . ARG A 1 4  ? 11.440  -23.538 11.899  1.00 0.00 ? 2  ARG P HG2  7  
ATOM 7182  H HG3  . ARG A 1 4  ? 12.909  -24.122 12.655  1.00 0.00 ? 2  ARG P HG3  7  
ATOM 7183  H HD2  . ARG A 1 4  ? 10.243  -25.567 12.508  1.00 0.00 ? 2  ARG P HD2  7  
ATOM 7184  H HD3  . ARG A 1 4  ? 11.723  -25.983 11.676  1.00 0.00 ? 2  ARG P HD3  7  
ATOM 7185  H HE   . ARG A 1 4  ? 11.021  -26.604 14.453  1.00 0.00 ? 2  ARG P HE   7  
ATOM 7186  H HH11 . ARG A 1 4  ? 13.795  -26.354 12.310  1.00 0.00 ? 2  ARG P HH11 7  
ATOM 7187  H HH12 . ARG A 1 4  ? 14.761  -27.372 13.343  1.00 0.00 ? 2  ARG P HH12 7  
ATOM 7188  H HH21 . ARG A 1 4  ? 12.239  -27.833 15.657  1.00 0.00 ? 2  ARG P HH21 7  
ATOM 7189  H HH22 . ARG A 1 4  ? 13.902  -28.198 15.223  1.00 0.00 ? 2  ARG P HH22 7  
ATOM 7190  N N    . ARG A 1 5  ? 8.053   -22.064 13.149  1.00 0.00 ? 3  ARG P N    7  
ATOM 7191  C CA   . ARG A 1 5  ? 7.249   -21.170 12.289  1.00 0.00 ? 3  ARG P CA   7  
ATOM 7192  C C    . ARG A 1 5  ? 7.118   -19.759 12.888  1.00 0.00 ? 3  ARG P C    7  
ATOM 7193  O O    . ARG A 1 5  ? 7.342   -19.562 14.085  1.00 0.00 ? 3  ARG P O    7  
ATOM 7194  C CB   . ARG A 1 5  ? 5.863   -21.802 12.041  1.00 0.00 ? 3  ARG P CB   7  
ATOM 7195  C CG   . ARG A 1 5  ? 5.942   -23.125 11.259  1.00 0.00 ? 3  ARG P CG   7  
ATOM 7196  C CD   . ARG A 1 5  ? 4.544   -23.718 11.049  1.00 0.00 ? 3  ARG P CD   7  
ATOM 7197  N NE   . ARG A 1 5  ? 4.604   -24.979 10.283  1.00 0.00 ? 3  ARG P NE   7  
ATOM 7198  C CZ   . ARG A 1 5  ? 3.585   -25.768 9.983   1.00 0.00 ? 3  ARG P CZ   7  
ATOM 7199  N NH1  . ARG A 1 5  ? 2.365   -25.502 10.361  1.00 0.00 ? 3  ARG P NH1  7  
ATOM 7200  N NH2  . ARG A 1 5  ? 3.775   -26.853 9.288   1.00 0.00 ? 3  ARG P NH2  7  
ATOM 7201  H H    . ARG A 1 5  ? 7.556   -22.698 13.756  1.00 0.00 ? 3  ARG P H    7  
ATOM 7202  H HA   . ARG A 1 5  ? 7.753   -21.055 11.326  1.00 0.00 ? 3  ARG P HA   7  
ATOM 7203  H HB2  . ARG A 1 5  ? 5.371   -21.977 13.000  1.00 0.00 ? 3  ARG P HB2  7  
ATOM 7204  H HB3  . ARG A 1 5  ? 5.249   -21.104 11.468  1.00 0.00 ? 3  ARG P HB3  7  
ATOM 7205  H HG2  . ARG A 1 5  ? 6.405   -22.940 10.289  1.00 0.00 ? 3  ARG P HG2  7  
ATOM 7206  H HG3  . ARG A 1 5  ? 6.548   -23.845 11.809  1.00 0.00 ? 3  ARG P HG3  7  
ATOM 7207  H HD2  . ARG A 1 5  ? 4.092   -23.905 12.026  1.00 0.00 ? 3  ARG P HD2  7  
ATOM 7208  H HD3  . ARG A 1 5  ? 3.930   -22.993 10.509  1.00 0.00 ? 3  ARG P HD3  7  
ATOM 7209  H HE   . ARG A 1 5  ? 5.506   -25.266 9.940   1.00 0.00 ? 3  ARG P HE   7  
ATOM 7210  H HH11 . ARG A 1 5  ? 2.190   -24.671 10.898  1.00 0.00 ? 3  ARG P HH11 7  
ATOM 7211  H HH12 . ARG A 1 5  ? 1.608   -26.117 10.117  1.00 0.00 ? 3  ARG P HH12 7  
ATOM 7212  H HH21 . ARG A 1 5  ? 4.699   -27.097 8.971   1.00 0.00 ? 3  ARG P HH21 7  
ATOM 7213  H HH22 . ARG A 1 5  ? 2.999   -27.450 9.057   1.00 0.00 ? 3  ARG P HH22 7  
ATOM 7214  N N    . GLN A 1 6  ? 6.724   -18.790 12.060  1.00 0.00 ? 4  GLN P N    7  
ATOM 7215  C CA   . GLN A 1 6  ? 6.490   -17.388 12.443  1.00 0.00 ? 4  GLN P CA   7  
ATOM 7216  C C    . GLN A 1 6  ? 5.156   -16.868 11.874  1.00 0.00 ? 4  GLN P C    7  
ATOM 7217  O O    . GLN A 1 6  ? 4.741   -17.256 10.777  1.00 0.00 ? 4  GLN P O    7  
ATOM 7218  C CB   . GLN A 1 6  ? 7.701   -16.544 11.996  1.00 0.00 ? 4  GLN P CB   7  
ATOM 7219  C CG   . GLN A 1 6  ? 7.656   -15.065 12.417  1.00 0.00 ? 4  GLN P CG   7  
ATOM 7220  C CD   . GLN A 1 6  ? 7.553   -14.881 13.931  1.00 0.00 ? 4  GLN P CD   7  
ATOM 7221  O OE1  . GLN A 1 6  ? 6.470   -14.848 14.502  1.00 0.00 ? 4  GLN P OE1  7  
ATOM 7222  N NE2  . GLN A 1 6  ? 8.657   -14.794 14.643  1.00 0.00 ? 4  GLN P NE2  7  
ATOM 7223  H H    . GLN A 1 6  ? 6.536   -19.041 11.101  1.00 0.00 ? 4  GLN P H    7  
ATOM 7224  H HA   . GLN A 1 6  ? 6.420   -17.334 13.530  1.00 0.00 ? 4  GLN P HA   7  
ATOM 7225  H HB2  . GLN A 1 6  ? 8.607   -16.988 12.411  1.00 0.00 ? 4  GLN P HB2  7  
ATOM 7226  H HB3  . GLN A 1 6  ? 7.780   -16.588 10.908  1.00 0.00 ? 4  GLN P HB3  7  
ATOM 7227  H HG2  . GLN A 1 6  ? 8.563   -14.575 12.062  1.00 0.00 ? 4  GLN P HG2  7  
ATOM 7228  H HG3  . GLN A 1 6  ? 6.813   -14.568 11.938  1.00 0.00 ? 4  GLN P HG3  7  
ATOM 7229  H HE21 . GLN A 1 6  ? 9.560   -14.830 14.195  1.00 0.00 ? 4  GLN P HE21 7  
ATOM 7230  H HE22 . GLN A 1 6  ? 8.574   -14.684 15.643  1.00 0.00 ? 4  GLN P HE22 7  
ATOM 7231  N N    . ARG A 1 7  ? 4.478   -15.985 12.619  1.00 0.00 ? 5  ARG P N    7  
ATOM 7232  C CA   . ARG A 1 7  ? 3.176   -15.393 12.259  1.00 0.00 ? 5  ARG P CA   7  
ATOM 7233  C C    . ARG A 1 7  ? 3.332   -14.251 11.243  1.00 0.00 ? 5  ARG P C    7  
ATOM 7234  O O    . ARG A 1 7  ? 4.199   -13.390 11.398  1.00 0.00 ? 5  ARG P O    7  
ATOM 7235  C CB   . ARG A 1 7  ? 2.469   -14.933 13.551  1.00 0.00 ? 5  ARG P CB   7  
ATOM 7236  C CG   . ARG A 1 7  ? 1.053   -14.349 13.369  1.00 0.00 ? 5  ARG P CG   7  
ATOM 7237  C CD   . ARG A 1 7  ? 0.029   -15.304 12.735  1.00 0.00 ? 5  ARG P CD   7  
ATOM 7238  N NE   . ARG A 1 7  ? -0.178  -16.524 13.543  1.00 0.00 ? 5  ARG P NE   7  
ATOM 7239  C CZ   . ARG A 1 7  ? -0.919  -17.569 13.218  1.00 0.00 ? 5  ARG P CZ   7  
ATOM 7240  N NH1  . ARG A 1 7  ? -1.582  -17.630 12.097  1.00 0.00 ? 5  ARG P NH1  7  
ATOM 7241  N NH2  . ARG A 1 7  ? -1.011  -18.587 14.024  1.00 0.00 ? 5  ARG P NH2  7  
ATOM 7242  H H    . ARG A 1 7  ? 4.915   -15.668 13.479  1.00 0.00 ? 5  ARG P H    7  
ATOM 7243  H HA   . ARG A 1 7  ? 2.571   -16.174 11.794  1.00 0.00 ? 5  ARG P HA   7  
ATOM 7244  H HB2  . ARG A 1 7  ? 2.412   -15.779 14.238  1.00 0.00 ? 5  ARG P HB2  7  
ATOM 7245  H HB3  . ARG A 1 7  ? 3.086   -14.170 14.031  1.00 0.00 ? 5  ARG P HB3  7  
ATOM 7246  H HG2  . ARG A 1 7  ? 0.680   -14.047 14.348  1.00 0.00 ? 5  ARG P HG2  7  
ATOM 7247  H HG3  . ARG A 1 7  ? 1.114   -13.450 12.756  1.00 0.00 ? 5  ARG P HG3  7  
ATOM 7248  H HD2  . ARG A 1 7  ? -0.919  -14.772 12.642  1.00 0.00 ? 5  ARG P HD2  7  
ATOM 7249  H HD3  . ARG A 1 7  ? 0.362   -15.576 11.733  1.00 0.00 ? 5  ARG P HD3  7  
ATOM 7250  H HE   . ARG A 1 7  ? 0.274   -16.561 14.443  1.00 0.00 ? 5  ARG P HE   7  
ATOM 7251  H HH11 . ARG A 1 7  ? -1.546  -16.852 11.461  1.00 0.00 ? 5  ARG P HH11 7  
ATOM 7252  H HH12 . ARG A 1 7  ? -2.140  -18.436 11.875  1.00 0.00 ? 5  ARG P HH12 7  
ATOM 7253  H HH21 . ARG A 1 7  ? -0.518  -18.585 14.903  1.00 0.00 ? 5  ARG P HH21 7  
ATOM 7254  H HH22 . ARG A 1 7  ? -1.578  -19.381 13.777  1.00 0.00 ? 5  ARG P HH22 7  
ATOM 7255  N N    . THR A 1 8  ? 2.449   -14.223 10.243  1.00 0.00 ? 6  THR P N    7  
ATOM 7256  C CA   . THR A 1 8  ? 2.319   -13.150 9.238   1.00 0.00 ? 6  THR P CA   7  
ATOM 7257  C C    . THR A 1 8  ? 0.847   -12.740 9.103   1.00 0.00 ? 6  THR P C    7  
ATOM 7258  O O    . THR A 1 8  ? -0.031  -13.603 9.030   1.00 0.00 ? 6  THR P O    7  
ATOM 7259  C CB   . THR A 1 8  ? 2.884   -13.601 7.875   1.00 0.00 ? 6  THR P CB   7  
ATOM 7260  O OG1  . THR A 1 8  ? 4.242   -13.973 8.001   1.00 0.00 ? 6  THR P OG1  7  
ATOM 7261  C CG2  . THR A 1 8  ? 2.835   -12.506 6.806   1.00 0.00 ? 6  THR P CG2  7  
ATOM 7262  H H    . THR A 1 8  ? 1.786   -14.982 10.184  1.00 0.00 ? 6  THR P H    7  
ATOM 7263  H HA   . THR A 1 8  ? 2.885   -12.276 9.560   1.00 0.00 ? 6  THR P HA   7  
ATOM 7264  H HB   . THR A 1 8  ? 2.318   -14.464 7.518   1.00 0.00 ? 6  THR P HB   7  
ATOM 7265  H HG1  . THR A 1 8  ? 4.274   -14.798 8.517   1.00 0.00 ? 6  THR P HG1  7  
ATOM 7266  H HG21 . THR A 1 8  ? 3.291   -11.591 7.183   1.00 0.00 ? 6  THR P HG21 7  
ATOM 7267  H HG22 . THR A 1 8  ? 1.804   -12.317 6.515   1.00 0.00 ? 6  THR P HG22 7  
ATOM 7268  H HG23 . THR A 1 8  ? 3.379   -12.838 5.920   1.00 0.00 ? 6  THR P HG23 7  
ATOM 7269  N N    . HIS A 1 9  ? 0.571   -11.432 9.064   1.00 0.00 ? 7  HIS P N    7  
ATOM 7270  C CA   . HIS A 1 9  ? -0.779  -10.838 9.000   1.00 0.00 ? 7  HIS P CA   7  
ATOM 7271  C C    . HIS A 1 9  ? -1.085  -10.111 7.675   1.00 0.00 ? 7  HIS P C    7  
ATOM 7272  O O    . HIS A 1 9  ? -2.066  -9.369  7.577   1.00 0.00 ? 7  HIS P O    7  
ATOM 7273  C CB   . HIS A 1 9  ? -1.005  -9.950  10.236  1.00 0.00 ? 7  HIS P CB   7  
ATOM 7274  C CG   . HIS A 1 9  ? -0.159  -8.697  10.298  1.00 0.00 ? 7  HIS P CG   7  
ATOM 7275  N ND1  . HIS A 1 9  ? 1.178   -8.585  9.900   1.00 0.00 ? 7  HIS P ND1  7  
ATOM 7276  C CD2  . HIS A 1 9  ? -0.564  -7.500  10.816  1.00 0.00 ? 7  HIS P CD2  7  
ATOM 7277  C CE1  . HIS A 1 9  ? 1.544   -7.323  10.189  1.00 0.00 ? 7  HIS P CE1  7  
ATOM 7278  N NE2  . HIS A 1 9  ? 0.517   -6.650  10.735  1.00 0.00 ? 7  HIS P NE2  7  
ATOM 7279  H H    . HIS A 1 9  ? 1.337   -10.779 9.190   1.00 0.00 ? 7  HIS P H    7  
ATOM 7280  H HA   . HIS A 1 9  ? -1.515  -11.643 9.056   1.00 0.00 ? 7  HIS P HA   7  
ATOM 7281  H HB2  . HIS A 1 9  ? -2.056  -9.658  10.268  1.00 0.00 ? 7  HIS P HB2  7  
ATOM 7282  H HB3  . HIS A 1 9  ? -0.807  -10.539 11.132  1.00 0.00 ? 7  HIS P HB3  7  
ATOM 7283  H HD2  . HIS A 1 9  ? -1.539  -7.279  11.232  1.00 0.00 ? 7  HIS P HD2  7  
ATOM 7284  H HE1  . HIS A 1 9  ? 2.531   -6.911  10.021  1.00 0.00 ? 7  HIS P HE1  7  
ATOM 7285  H HE2  . HIS A 1 9  ? 0.556   -5.690  11.062  1.00 0.00 ? 7  HIS P HE2  7  
ATOM 7286  N N    . PHE A 1 10 ? -0.248  -10.306 6.653   1.00 0.00 ? 8  PHE P N    7  
ATOM 7287  C CA   . PHE A 1 10 ? -0.470  -9.883  5.263   1.00 0.00 ? 8  PHE P CA   7  
ATOM 7288  C C    . PHE A 1 10 ? -0.935  -11.064 4.384   1.00 0.00 ? 8  PHE P C    7  
ATOM 7289  O O    . PHE A 1 10 ? -0.769  -12.230 4.754   1.00 0.00 ? 8  PHE P O    7  
ATOM 7290  C CB   . PHE A 1 10 ? 0.828   -9.303  4.673   1.00 0.00 ? 8  PHE P CB   7  
ATOM 7291  C CG   . PHE A 1 10 ? 1.405   -8.058  5.324   1.00 0.00 ? 8  PHE P CG   7  
ATOM 7292  C CD1  . PHE A 1 10 ? 2.230   -8.167  6.459   1.00 0.00 ? 8  PHE P CD1  7  
ATOM 7293  C CD2  . PHE A 1 10 ? 1.191   -6.791  4.743   1.00 0.00 ? 8  PHE P CD2  7  
ATOM 7294  C CE1  . PHE A 1 10 ? 2.836   -7.023  7.009   1.00 0.00 ? 8  PHE P CE1  7  
ATOM 7295  C CE2  . PHE A 1 10 ? 1.803   -5.648  5.292   1.00 0.00 ? 8  PHE P CE2  7  
ATOM 7296  C CZ   . PHE A 1 10 ? 2.626   -5.763  6.425   1.00 0.00 ? 8  PHE P CZ   7  
ATOM 7297  H H    . PHE A 1 10 ? 0.531   -10.922 6.821   1.00 0.00 ? 8  PHE P H    7  
ATOM 7298  H HA   . PHE A 1 10 ? -1.239  -9.112  5.225   1.00 0.00 ? 8  PHE P HA   7  
ATOM 7299  H HB2  . PHE A 1 10 ? 1.594   -10.081 4.684   1.00 0.00 ? 8  PHE P HB2  7  
ATOM 7300  H HB3  . PHE A 1 10 ? 0.636   -9.064  3.628   1.00 0.00 ? 8  PHE P HB3  7  
ATOM 7301  H HD1  . PHE A 1 10 ? 2.421   -9.136  6.900   1.00 0.00 ? 8  PHE P HD1  7  
ATOM 7302  H HD2  . PHE A 1 10 ? 0.576   -6.697  3.857   1.00 0.00 ? 8  PHE P HD2  7  
ATOM 7303  H HE1  . PHE A 1 10 ? 3.490   -7.119  7.866   1.00 0.00 ? 8  PHE P HE1  7  
ATOM 7304  H HE2  . PHE A 1 10 ? 1.668   -4.682  4.825   1.00 0.00 ? 8  PHE P HE2  7  
ATOM 7305  H HZ   . PHE A 1 10 ? 3.116   -4.887  6.833   1.00 0.00 ? 8  PHE P HZ   7  
ATOM 7306  N N    . THR A 1 11 ? -1.458  -10.767 3.190   1.00 0.00 ? 9  THR P N    7  
ATOM 7307  C CA   . THR A 1 11 ? -1.731  -11.746 2.117   1.00 0.00 ? 9  THR P CA   7  
ATOM 7308  C C    . THR A 1 11 ? -1.004  -11.363 0.824   1.00 0.00 ? 9  THR P C    7  
ATOM 7309  O O    . THR A 1 11 ? -0.739  -10.184 0.578   1.00 0.00 ? 9  THR P O    7  
ATOM 7310  C CB   . THR A 1 11 ? -3.239  -11.973 1.914   1.00 0.00 ? 9  THR P CB   7  
ATOM 7311  O OG1  . THR A 1 11 ? -3.434  -13.024 0.993   1.00 0.00 ? 9  THR P OG1  7  
ATOM 7312  C CG2  . THR A 1 11 ? -4.002  -10.755 1.391   1.00 0.00 ? 9  THR P CG2  7  
ATOM 7313  H H    . THR A 1 11 ? -1.590  -9.784  2.969   1.00 0.00 ? 9  THR P H    7  
ATOM 7314  H HA   . THR A 1 11 ? -1.317  -12.708 2.416   1.00 0.00 ? 9  THR P HA   7  
ATOM 7315  H HB   . THR A 1 11 ? -3.673  -12.269 2.870   1.00 0.00 ? 9  THR P HB   7  
ATOM 7316  H HG1  . THR A 1 11 ? -4.378  -13.262 1.011   1.00 0.00 ? 9  THR P HG1  7  
ATOM 7317  H HG21 . THR A 1 11 ? -5.053  -11.010 1.262   1.00 0.00 ? 9  THR P HG21 7  
ATOM 7318  H HG22 . THR A 1 11 ? -3.594  -10.428 0.435   1.00 0.00 ? 9  THR P HG22 7  
ATOM 7319  H HG23 . THR A 1 11 ? -3.934  -9.947  2.116   1.00 0.00 ? 9  THR P HG23 7  
ATOM 7320  N N    . SER A 1 12 ? -0.668  -12.345 -0.017  1.00 0.00 ? 10 SER P N    7  
ATOM 7321  C CA   . SER A 1 12 ? 0.221   -12.190 -1.184  1.00 0.00 ? 10 SER P CA   7  
ATOM 7322  C C    . SER A 1 12 ? -0.223  -11.120 -2.190  1.00 0.00 ? 10 SER P C    7  
ATOM 7323  O O    . SER A 1 12 ? 0.624   -10.480 -2.811  1.00 0.00 ? 10 SER P O    7  
ATOM 7324  C CB   . SER A 1 12 ? 0.355   -13.533 -1.914  1.00 0.00 ? 10 SER P CB   7  
ATOM 7325  O OG   . SER A 1 12 ? 0.782   -14.548 -1.013  1.00 0.00 ? 10 SER P OG   7  
ATOM 7326  H H    . SER A 1 12 ? -0.944  -13.287 0.225   1.00 0.00 ? 10 SER P H    7  
ATOM 7327  H HA   . SER A 1 12 ? 1.210   -11.907 -0.825  1.00 0.00 ? 10 SER P HA   7  
ATOM 7328  H HB2  . SER A 1 12 ? -0.610  -13.811 -2.343  1.00 0.00 ? 10 SER P HB2  7  
ATOM 7329  H HB3  . SER A 1 12 ? 1.084   -13.432 -2.719  1.00 0.00 ? 10 SER P HB3  7  
ATOM 7330  H HG   . SER A 1 12 ? 0.875   -15.384 -1.514  1.00 0.00 ? 10 SER P HG   7  
ATOM 7331  N N    . GLN A 1 13 ? -1.530  -10.864 -2.319  1.00 0.00 ? 11 GLN P N    7  
ATOM 7332  C CA   . GLN A 1 13 ? -2.067  -9.799  -3.179  1.00 0.00 ? 11 GLN P CA   7  
ATOM 7333  C C    . GLN A 1 13 ? -1.662  -8.391  -2.700  1.00 0.00 ? 11 GLN P C    7  
ATOM 7334  O O    . GLN A 1 13 ? -1.423  -7.504  -3.520  1.00 0.00 ? 11 GLN P O    7  
ATOM 7335  C CB   . GLN A 1 13 ? -3.599  -9.917  -3.256  1.00 0.00 ? 11 GLN P CB   7  
ATOM 7336  C CG   . GLN A 1 13 ? -4.060  -11.206 -3.956  1.00 0.00 ? 11 GLN P CG   7  
ATOM 7337  C CD   . GLN A 1 13 ? -5.583  -11.279 -4.067  1.00 0.00 ? 11 GLN P CD   7  
ATOM 7338  O OE1  . GLN A 1 13 ? -6.263  -11.924 -3.279  1.00 0.00 ? 11 GLN P OE1  7  
ATOM 7339  N NE2  . GLN A 1 13 ? -6.183  -10.617 -5.036  1.00 0.00 ? 11 GLN P NE2  7  
ATOM 7340  H H    . GLN A 1 13 ? -2.176  -11.421 -1.777  1.00 0.00 ? 11 GLN P H    7  
ATOM 7341  H HA   . GLN A 1 13 ? -1.664  -9.923  -4.186  1.00 0.00 ? 11 GLN P HA   7  
ATOM 7342  H HB2  . GLN A 1 13 ? -4.018  -9.882  -2.248  1.00 0.00 ? 11 GLN P HB2  7  
ATOM 7343  H HB3  . GLN A 1 13 ? -3.985  -9.063  -3.816  1.00 0.00 ? 11 GLN P HB3  7  
ATOM 7344  H HG2  . GLN A 1 13 ? -3.629  -11.246 -4.957  1.00 0.00 ? 11 GLN P HG2  7  
ATOM 7345  H HG3  . GLN A 1 13 ? -3.710  -12.076 -3.400  1.00 0.00 ? 11 GLN P HG3  7  
ATOM 7346  H HE21 . GLN A 1 13 ? -5.644  -10.077 -5.698  1.00 0.00 ? 11 GLN P HE21 7  
ATOM 7347  H HE22 . GLN A 1 13 ? -7.188  -10.667 -5.100  1.00 0.00 ? 11 GLN P HE22 7  
ATOM 7348  N N    . GLN A 1 14 ? -1.526  -8.188  -1.384  1.00 0.00 ? 12 GLN P N    7  
ATOM 7349  C CA   . GLN A 1 14 ? -1.082  -6.919  -0.794  1.00 0.00 ? 12 GLN P CA   7  
ATOM 7350  C C    . GLN A 1 14 ? 0.411   -6.689  -1.068  1.00 0.00 ? 12 GLN P C    7  
ATOM 7351  O O    . GLN A 1 14 ? 0.796   -5.595  -1.479  1.00 0.00 ? 12 GLN P O    7  
ATOM 7352  C CB   . GLN A 1 14 ? -1.362  -6.905  0.720   1.00 0.00 ? 12 GLN P CB   7  
ATOM 7353  C CG   . GLN A 1 14 ? -2.857  -7.061  1.056   1.00 0.00 ? 12 GLN P CG   7  
ATOM 7354  C CD   . GLN A 1 14 ? -3.115  -7.288  2.545   1.00 0.00 ? 12 GLN P CD   7  
ATOM 7355  O OE1  . GLN A 1 14 ? -2.375  -7.972  3.241   1.00 0.00 ? 12 GLN P OE1  7  
ATOM 7356  N NE2  . GLN A 1 14 ? -4.195  -6.768  3.082   1.00 0.00 ? 12 GLN P NE2  7  
ATOM 7357  H H    . GLN A 1 14 ? -1.650  -8.977  -0.760  1.00 0.00 ? 12 GLN P H    7  
ATOM 7358  H HA   . GLN A 1 14 ? -1.634  -6.098  -1.253  1.00 0.00 ? 12 GLN P HA   7  
ATOM 7359  H HB2  . GLN A 1 14 ? -0.794  -7.705  1.193   1.00 0.00 ? 12 GLN P HB2  7  
ATOM 7360  H HB3  . GLN A 1 14 ? -1.012  -5.960  1.137   1.00 0.00 ? 12 GLN P HB3  7  
ATOM 7361  H HG2  . GLN A 1 14 ? -3.388  -6.172  0.724   1.00 0.00 ? 12 GLN P HG2  7  
ATOM 7362  H HG3  . GLN A 1 14 ? -3.279  -7.912  0.525   1.00 0.00 ? 12 GLN P HG3  7  
ATOM 7363  H HE21 . GLN A 1 14 ? -4.749  -6.099  2.552   1.00 0.00 ? 12 GLN P HE21 7  
ATOM 7364  H HE22 . GLN A 1 14 ? -4.357  -6.918  4.063   1.00 0.00 ? 12 GLN P HE22 7  
ATOM 7365  N N    . LEU A 1 15 ? 1.239   -7.732  -0.921  1.00 0.00 ? 13 LEU P N    7  
ATOM 7366  C CA   . LEU A 1 15 ? 2.671   -7.677  -1.249  1.00 0.00 ? 13 LEU P CA   7  
ATOM 7367  C C    . LEU A 1 15 ? 2.898   -7.452  -2.751  1.00 0.00 ? 13 LEU P C    7  
ATOM 7368  O O    . LEU A 1 15 ? 3.764   -6.664  -3.123  1.00 0.00 ? 13 LEU P O    7  
ATOM 7369  C CB   . LEU A 1 15 ? 3.393   -8.968  -0.802  1.00 0.00 ? 13 LEU P CB   7  
ATOM 7370  C CG   . LEU A 1 15 ? 3.693   -9.154  0.698   1.00 0.00 ? 13 LEU P CG   7  
ATOM 7371  C CD1  . LEU A 1 15 ? 4.449   -7.969  1.301   1.00 0.00 ? 13 LEU P CD1  7  
ATOM 7372  C CD2  . LEU A 1 15 ? 2.446   -9.416  1.535   1.00 0.00 ? 13 LEU P CD2  7  
ATOM 7373  H H    . LEU A 1 15 ? 0.855   -8.603  -0.574  1.00 0.00 ? 13 LEU P H    7  
ATOM 7374  H HA   . LEU A 1 15 ? 3.113   -6.818  -0.742  1.00 0.00 ? 13 LEU P HA   7  
ATOM 7375  H HB2  . LEU A 1 15 ? 2.834   -9.834  -1.160  1.00 0.00 ? 13 LEU P HB2  7  
ATOM 7376  H HB3  . LEU A 1 15 ? 4.359   -8.991  -1.309  1.00 0.00 ? 13 LEU P HB3  7  
ATOM 7377  H HG   . LEU A 1 15 ? 4.329   -10.034 0.791   1.00 0.00 ? 13 LEU P HG   7  
ATOM 7378  H HD11 . LEU A 1 15 ? 3.802   -7.093  1.348   1.00 0.00 ? 13 LEU P HD11 7  
ATOM 7379  H HD12 . LEU A 1 15 ? 5.327   -7.754  0.692   1.00 0.00 ? 13 LEU P HD12 7  
ATOM 7380  H HD13 . LEU A 1 15 ? 4.771   -8.224  2.311   1.00 0.00 ? 13 LEU P HD13 7  
ATOM 7381  H HD21 . LEU A 1 15 ? 1.890   -10.252 1.114   1.00 0.00 ? 13 LEU P HD21 7  
ATOM 7382  H HD22 . LEU A 1 15 ? 1.814   -8.530  1.570   1.00 0.00 ? 13 LEU P HD22 7  
ATOM 7383  H HD23 . LEU A 1 15 ? 2.753   -9.676  2.546   1.00 0.00 ? 13 LEU P HD23 7  
ATOM 7384  N N    . GLN A 1 16 ? 2.108   -8.098  -3.615  1.00 0.00 ? 14 GLN P N    7  
ATOM 7385  C CA   . GLN A 1 16 ? 2.175   -7.916  -5.068  1.00 0.00 ? 14 GLN P CA   7  
ATOM 7386  C C    . GLN A 1 16 ? 1.820   -6.474  -5.474  1.00 0.00 ? 14 GLN P C    7  
ATOM 7387  O O    . GLN A 1 16 ? 2.527   -5.872  -6.282  1.00 0.00 ? 14 GLN P O    7  
ATOM 7388  C CB   . GLN A 1 16 ? 1.255   -8.948  -5.741  1.00 0.00 ? 14 GLN P CB   7  
ATOM 7389  C CG   . GLN A 1 16 ? 1.341   -8.913  -7.274  1.00 0.00 ? 14 GLN P CG   7  
ATOM 7390  C CD   . GLN A 1 16 ? 0.468   -9.993  -7.911  1.00 0.00 ? 14 GLN P CD   7  
ATOM 7391  O OE1  . GLN A 1 16 ? -0.663  -9.760  -8.317  1.00 0.00 ? 14 GLN P OE1  7  
ATOM 7392  N NE2  . GLN A 1 16 ? 0.943   -11.218 -8.013  1.00 0.00 ? 14 GLN P NE2  7  
ATOM 7393  H H    . GLN A 1 16 ? 1.454   -8.781  -3.247  1.00 0.00 ? 14 GLN P H    7  
ATOM 7394  H HA   . GLN A 1 16 ? 3.199   -8.108  -5.393  1.00 0.00 ? 14 GLN P HA   7  
ATOM 7395  H HB2  . GLN A 1 16 ? 1.542   -9.944  -5.400  1.00 0.00 ? 14 GLN P HB2  7  
ATOM 7396  H HB3  . GLN A 1 16 ? 0.222   -8.766  -5.439  1.00 0.00 ? 14 GLN P HB3  7  
ATOM 7397  H HG2  . GLN A 1 16 ? 1.012   -7.940  -7.639  1.00 0.00 ? 14 GLN P HG2  7  
ATOM 7398  H HG3  . GLN A 1 16 ? 2.377   -9.062  -7.580  1.00 0.00 ? 14 GLN P HG3  7  
ATOM 7399  H HE21 . GLN A 1 16 ? 1.873   -11.435 -7.683  1.00 0.00 ? 14 GLN P HE21 7  
ATOM 7400  H HE22 . GLN A 1 16 ? 0.360   -11.925 -8.433  1.00 0.00 ? 14 GLN P HE22 7  
ATOM 7401  N N    . GLU A 1 17 ? 0.771   -5.891  -4.886  1.00 0.00 ? 15 GLU P N    7  
ATOM 7402  C CA   . GLU A 1 17 ? 0.375   -4.503  -5.149  1.00 0.00 ? 15 GLU P CA   7  
ATOM 7403  C C    . GLU A 1 17 ? 1.409   -3.496  -4.610  1.00 0.00 ? 15 GLU P C    7  
ATOM 7404  O O    . GLU A 1 17 ? 1.747   -2.538  -5.302  1.00 0.00 ? 15 GLU P O    7  
ATOM 7405  C CB   . GLU A 1 17 ? -1.021  -4.253  -4.553  1.00 0.00 ? 15 GLU P CB   7  
ATOM 7406  C CG   . GLU A 1 17 ? -1.677  -2.949  -5.032  1.00 0.00 ? 15 GLU P CG   7  
ATOM 7407  C CD   . GLU A 1 17 ? -2.114  -3.035  -6.508  1.00 0.00 ? 15 GLU P CD   7  
ATOM 7408  O OE1  . GLU A 1 17 ? -3.239  -3.521  -6.784  1.00 0.00 ? 15 GLU P OE1  7  
ATOM 7409  O OE2  . GLU A 1 17 ? -1.345  -2.617  -7.405  1.00 0.00 ? 15 GLU P OE2  7  
ATOM 7410  H H    . GLU A 1 17 ? 0.198   -6.442  -4.254  1.00 0.00 ? 15 GLU P H    7  
ATOM 7411  H HA   . GLU A 1 17 ? 0.318   -4.363  -6.229  1.00 0.00 ? 15 GLU P HA   7  
ATOM 7412  H HB2  . GLU A 1 17 ? -1.680  -5.080  -4.820  1.00 0.00 ? 15 GLU P HB2  7  
ATOM 7413  H HB3  . GLU A 1 17 ? -0.935  -4.229  -3.467  1.00 0.00 ? 15 GLU P HB3  7  
ATOM 7414  H HG2  . GLU A 1 17 ? -2.557  -2.761  -4.412  1.00 0.00 ? 15 GLU P HG2  7  
ATOM 7415  H HG3  . GLU A 1 17 ? -0.994  -2.110  -4.877  1.00 0.00 ? 15 GLU P HG3  7  
ATOM 7416  N N    . LEU A 1 18 ? 1.973   -3.727  -3.418  1.00 0.00 ? 16 LEU P N    7  
ATOM 7417  C CA   . LEU A 1 18 ? 3.030   -2.882  -2.843  1.00 0.00 ? 16 LEU P CA   7  
ATOM 7418  C C    . LEU A 1 18 ? 4.358   -2.985  -3.611  1.00 0.00 ? 16 LEU P C    7  
ATOM 7419  O O    . LEU A 1 18 ? 5.035   -1.976  -3.789  1.00 0.00 ? 16 LEU P O    7  
ATOM 7420  C CB   . LEU A 1 18 ? 3.212   -3.225  -1.356  1.00 0.00 ? 16 LEU P CB   7  
ATOM 7421  C CG   . LEU A 1 18 ? 2.184   -2.514  -0.460  1.00 0.00 ? 16 LEU P CG   7  
ATOM 7422  C CD1  . LEU A 1 18 ? 2.052   -3.235  0.882   1.00 0.00 ? 16 LEU P CD1  7  
ATOM 7423  C CD2  . LEU A 1 18 ? 2.598   -1.068  -0.171  1.00 0.00 ? 16 LEU P CD2  7  
ATOM 7424  H H    . LEU A 1 18 ? 1.645   -4.520  -2.875  1.00 0.00 ? 16 LEU P H    7  
ATOM 7425  H HA   . LEU A 1 18 ? 2.715   -1.842  -2.919  1.00 0.00 ? 16 LEU P HA   7  
ATOM 7426  H HB2  . LEU A 1 18 ? 3.147   -4.306  -1.227  1.00 0.00 ? 16 LEU P HB2  7  
ATOM 7427  H HB3  . LEU A 1 18 ? 4.206   -2.920  -1.037  1.00 0.00 ? 16 LEU P HB3  7  
ATOM 7428  H HG   . LEU A 1 18 ? 1.215   -2.498  -0.958  1.00 0.00 ? 16 LEU P HG   7  
ATOM 7429  H HD11 . LEU A 1 18 ? 1.699   -4.253  0.718   1.00 0.00 ? 16 LEU P HD11 7  
ATOM 7430  H HD12 . LEU A 1 18 ? 1.334   -2.713  1.510   1.00 0.00 ? 16 LEU P HD12 7  
ATOM 7431  H HD13 . LEU A 1 18 ? 3.016   -3.267  1.386   1.00 0.00 ? 16 LEU P HD13 7  
ATOM 7432  H HD21 . LEU A 1 18 ? 2.679   -0.507  -1.102  1.00 0.00 ? 16 LEU P HD21 7  
ATOM 7433  H HD22 . LEU A 1 18 ? 3.558   -1.047  0.342   1.00 0.00 ? 16 LEU P HD22 7  
ATOM 7434  H HD23 . LEU A 1 18 ? 1.847   -0.596  0.460   1.00 0.00 ? 16 LEU P HD23 7  
ATOM 7435  N N    . GLU A 1 19 ? 4.712   -4.159  -4.139  1.00 0.00 ? 17 GLU P N    7  
ATOM 7436  C CA   . GLU A 1 19 ? 5.877   -4.320  -5.016  1.00 0.00 ? 17 GLU P CA   7  
ATOM 7437  C C    . GLU A 1 19 ? 5.666   -3.643  -6.381  1.00 0.00 ? 17 GLU P C    7  
ATOM 7438  O O    . GLU A 1 19 ? 6.565   -2.952  -6.856  1.00 0.00 ? 17 GLU P O    7  
ATOM 7439  C CB   . GLU A 1 19 ? 6.239   -5.806  -5.144  1.00 0.00 ? 17 GLU P CB   7  
ATOM 7440  C CG   . GLU A 1 19 ? 7.451   -6.021  -6.059  1.00 0.00 ? 17 GLU P CG   7  
ATOM 7441  C CD   . GLU A 1 19 ? 8.167   -7.344  -5.742  1.00 0.00 ? 17 GLU P CD   7  
ATOM 7442  O OE1  . GLU A 1 19 ? 7.755   -8.412  -6.253  1.00 0.00 ? 17 GLU P OE1  7  
ATOM 7443  O OE2  . GLU A 1 19 ? 9.161   -7.301  -4.975  1.00 0.00 ? 17 GLU P OE2  7  
ATOM 7444  H H    . GLU A 1 19 ? 4.158   -4.980  -3.916  1.00 0.00 ? 17 GLU P H    7  
ATOM 7445  H HA   . GLU A 1 19 ? 6.727   -3.821  -4.547  1.00 0.00 ? 17 GLU P HA   7  
ATOM 7446  H HB2  . GLU A 1 19 ? 6.476   -6.183  -4.148  1.00 0.00 ? 17 GLU P HB2  7  
ATOM 7447  H HB3  . GLU A 1 19 ? 5.389   -6.368  -5.536  1.00 0.00 ? 17 GLU P HB3  7  
ATOM 7448  H HG2  . GLU A 1 19 ? 7.123   -6.004  -7.102  1.00 0.00 ? 17 GLU P HG2  7  
ATOM 7449  H HG3  . GLU A 1 19 ? 8.155   -5.197  -5.921  1.00 0.00 ? 17 GLU P HG3  7  
ATOM 7450  N N    . ALA A 1 20 ? 4.476   -3.747  -6.980  1.00 0.00 ? 18 ALA P N    7  
ATOM 7451  C CA   . ALA A 1 20 ? 4.133   -2.998  -8.194  1.00 0.00 ? 18 ALA P CA   7  
ATOM 7452  C C    . ALA A 1 20 ? 4.141   -1.473  -7.949  1.00 0.00 ? 18 ALA P C    7  
ATOM 7453  O O    . ALA A 1 20 ? 4.641   -0.710  -8.778  1.00 0.00 ? 18 ALA P O    7  
ATOM 7454  C CB   . ALA A 1 20 ? 2.773   -3.488  -8.702  1.00 0.00 ? 18 ALA P CB   7  
ATOM 7455  H H    . ALA A 1 20 ? 3.768   -4.349  -6.571  1.00 0.00 ? 18 ALA P H    7  
ATOM 7456  H HA   . ALA A 1 20 ? 4.881   -3.214  -8.958  1.00 0.00 ? 18 ALA P HA   7  
ATOM 7457  H HB1  . ALA A 1 20 ? 1.998   -3.293  -7.960  1.00 0.00 ? 18 ALA P HB1  7  
ATOM 7458  H HB2  . ALA A 1 20 ? 2.519   -2.967  -9.626  1.00 0.00 ? 18 ALA P HB2  7  
ATOM 7459  H HB3  . ALA A 1 20 ? 2.817   -4.559  -8.903  1.00 0.00 ? 18 ALA P HB3  7  
ATOM 7460  N N    . THR A 1 21 ? 3.665   -1.031  -6.779  1.00 0.00 ? 19 THR P N    7  
ATOM 7461  C CA   . THR A 1 21 ? 3.718   0.367   -6.321  1.00 0.00 ? 19 THR P CA   7  
ATOM 7462  C C    . THR A 1 21 ? 5.169   0.845   -6.192  1.00 0.00 ? 19 THR P C    7  
ATOM 7463  O O    . THR A 1 21 ? 5.519   1.876   -6.762  1.00 0.00 ? 19 THR P O    7  
ATOM 7464  C CB   . THR A 1 21 ? 2.969   0.523   -4.983  1.00 0.00 ? 19 THR P CB   7  
ATOM 7465  O OG1  . THR A 1 21 ? 1.610   0.180   -5.139  1.00 0.00 ? 19 THR P OG1  7  
ATOM 7466  C CG2  . THR A 1 21 ? 2.966   1.937   -4.411  1.00 0.00 ? 19 THR P CG2  7  
ATOM 7467  H H    . THR A 1 21 ? 3.225   -1.714  -6.172  1.00 0.00 ? 19 THR P H    7  
ATOM 7468  H HA   . THR A 1 21 ? 3.225   1.002   -7.057  1.00 0.00 ? 19 THR P HA   7  
ATOM 7469  H HB   . THR A 1 21 ? 3.419   -0.136  -4.243  1.00 0.00 ? 19 THR P HB   7  
ATOM 7470  H HG1  . THR A 1 21 ? 1.568   -0.787  -5.267  1.00 0.00 ? 19 THR P HG1  7  
ATOM 7471  H HG21 . THR A 1 21 ? 2.370   2.598   -5.041  1.00 0.00 ? 19 THR P HG21 7  
ATOM 7472  H HG22 . THR A 1 21 ? 3.979   2.328   -4.341  1.00 0.00 ? 19 THR P HG22 7  
ATOM 7473  H HG23 . THR A 1 21 ? 2.539   1.891   -3.410  1.00 0.00 ? 19 THR P HG23 7  
ATOM 7474  N N    . PHE A 1 22 ? 6.036   0.071   -5.528  1.00 0.00 ? 20 PHE P N    7  
ATOM 7475  C CA   . PHE A 1 22 ? 7.470   0.349   -5.372  1.00 0.00 ? 20 PHE P CA   7  
ATOM 7476  C C    . PHE A 1 22 ? 8.214   0.397   -6.720  1.00 0.00 ? 20 PHE P C    7  
ATOM 7477  O O    . PHE A 1 22 ? 9.027   1.294   -6.947  1.00 0.00 ? 20 PHE P O    7  
ATOM 7478  C CB   . PHE A 1 22 ? 8.052   -0.726  -4.438  1.00 0.00 ? 20 PHE P CB   7  
ATOM 7479  C CG   . PHE A 1 22 ? 9.555   -0.700  -4.230  1.00 0.00 ? 20 PHE P CG   7  
ATOM 7480  C CD1  . PHE A 1 22 ? 10.396  -1.453  -5.073  1.00 0.00 ? 20 PHE P CD1  7  
ATOM 7481  C CD2  . PHE A 1 22 ? 10.114  0.023   -3.158  1.00 0.00 ? 20 PHE P CD2  7  
ATOM 7482  C CE1  . PHE A 1 22 ? 11.781  -1.502  -4.832  1.00 0.00 ? 20 PHE P CE1  7  
ATOM 7483  C CE2  . PHE A 1 22 ? 11.499  -0.028  -2.915  1.00 0.00 ? 20 PHE P CE2  7  
ATOM 7484  C CZ   . PHE A 1 22 ? 12.331  -0.803  -3.743  1.00 0.00 ? 20 PHE P CZ   7  
ATOM 7485  H H    . PHE A 1 22 ? 5.675   -0.760  -5.070  1.00 0.00 ? 20 PHE P H    7  
ATOM 7486  H HA   . PHE A 1 22 ? 7.595   1.321   -4.895  1.00 0.00 ? 20 PHE P HA   7  
ATOM 7487  H HB2  . PHE A 1 22 ? 7.567   -0.633  -3.466  1.00 0.00 ? 20 PHE P HB2  7  
ATOM 7488  H HB3  . PHE A 1 22 ? 7.790   -1.709  -4.829  1.00 0.00 ? 20 PHE P HB3  7  
ATOM 7489  H HD1  . PHE A 1 22 ? 9.975   -2.002  -5.904  1.00 0.00 ? 20 PHE P HD1  7  
ATOM 7490  H HD2  . PHE A 1 22 ? 9.476   0.598   -2.502  1.00 0.00 ? 20 PHE P HD2  7  
ATOM 7491  H HE1  . PHE A 1 22 ? 12.427  -2.077  -5.484  1.00 0.00 ? 20 PHE P HE1  7  
ATOM 7492  H HE2  . PHE A 1 22 ? 11.915  0.510   -2.073  1.00 0.00 ? 20 PHE P HE2  7  
ATOM 7493  H HZ   . PHE A 1 22 ? 13.394  -0.865  -3.548  1.00 0.00 ? 20 PHE P HZ   7  
ATOM 7494  N N    . GLN A 1 23 ? 7.905   -0.520  -7.645  1.00 0.00 ? 21 GLN P N    7  
ATOM 7495  C CA   . GLN A 1 23 ? 8.483   -0.547  -8.996  1.00 0.00 ? 21 GLN P CA   7  
ATOM 7496  C C    . GLN A 1 23 ? 8.033   0.647   -9.859  1.00 0.00 ? 21 GLN P C    7  
ATOM 7497  O O    . GLN A 1 23 ? 8.820   1.145   -10.669 1.00 0.00 ? 21 GLN P O    7  
ATOM 7498  C CB   . GLN A 1 23 ? 8.121   -1.876  -9.680  1.00 0.00 ? 21 GLN P CB   7  
ATOM 7499  C CG   . GLN A 1 23 ? 8.938   -3.056  -9.120  1.00 0.00 ? 21 GLN P CG   7  
ATOM 7500  C CD   . GLN A 1 23 ? 8.505   -4.418  -9.670  1.00 0.00 ? 21 GLN P CD   7  
ATOM 7501  O OE1  . GLN A 1 23 ? 7.534   -4.572  -10.402 1.00 0.00 ? 21 GLN P OE1  7  
ATOM 7502  N NE2  . GLN A 1 23 ? 9.222   -5.474  -9.344  1.00 0.00 ? 21 GLN P NE2  7  
ATOM 7503  H H    . GLN A 1 23 ? 7.259   -1.260  -7.386  1.00 0.00 ? 21 GLN P H    7  
ATOM 7504  H HA   . GLN A 1 23 ? 9.569   -0.488  -8.914  1.00 0.00 ? 21 GLN P HA   7  
ATOM 7505  H HB2  . GLN A 1 23 ? 7.054   -2.065  -9.553  1.00 0.00 ? 21 GLN P HB2  7  
ATOM 7506  H HB3  . GLN A 1 23 ? 8.331   -1.797  -10.747 1.00 0.00 ? 21 GLN P HB3  7  
ATOM 7507  H HG2  . GLN A 1 23 ? 9.988   -2.901  -9.365  1.00 0.00 ? 21 GLN P HG2  7  
ATOM 7508  H HG3  . GLN A 1 23 ? 8.854   -3.087  -8.035  1.00 0.00 ? 21 GLN P HG3  7  
ATOM 7509  H HE21 . GLN A 1 23 ? 10.038  -5.378  -8.760  1.00 0.00 ? 21 GLN P HE21 7  
ATOM 7510  H HE22 . GLN A 1 23 ? 8.943   -6.371  -9.710  1.00 0.00 ? 21 GLN P HE22 7  
ATOM 7511  N N    . ARG A 1 24 ? 6.801   1.146   -9.670  1.00 0.00 ? 22 ARG P N    7  
ATOM 7512  C CA   . ARG A 1 24 ? 6.283   2.360   -10.327 1.00 0.00 ? 22 ARG P CA   7  
ATOM 7513  C C    . ARG A 1 24 ? 6.876   3.643   -9.726  1.00 0.00 ? 22 ARG P C    7  
ATOM 7514  O O    . ARG A 1 24 ? 7.250   4.550   -10.470 1.00 0.00 ? 22 ARG P O    7  
ATOM 7515  C CB   . ARG A 1 24 ? 4.745   2.338   -10.267 1.00 0.00 ? 22 ARG P CB   7  
ATOM 7516  C CG   . ARG A 1 24 ? 4.101   3.484   -11.063 1.00 0.00 ? 22 ARG P CG   7  
ATOM 7517  C CD   . ARG A 1 24 ? 2.573   3.364   -11.049 1.00 0.00 ? 22 ARG P CD   7  
ATOM 7518  N NE   . ARG A 1 24 ? 1.941   4.457   -11.815 1.00 0.00 ? 22 ARG P NE   7  
ATOM 7519  C CZ   . ARG A 1 24 ? 0.646   4.627   -12.027 1.00 0.00 ? 22 ARG P CZ   7  
ATOM 7520  N NH1  . ARG A 1 24 ? -0.249  3.805   -11.553 1.00 0.00 ? 22 ARG P NH1  7  
ATOM 7521  N NH2  . ARG A 1 24 ? 0.221   5.639   -12.727 1.00 0.00 ? 22 ARG P NH2  7  
ATOM 7522  H H    . ARG A 1 24 ? 6.183   0.640   -9.042  1.00 0.00 ? 22 ARG P H    7  
ATOM 7523  H HA   . ARG A 1 24 ? 6.582   2.343   -11.377 1.00 0.00 ? 22 ARG P HA   7  
ATOM 7524  H HB2  . ARG A 1 24 ? 4.394   1.392   -10.683 1.00 0.00 ? 22 ARG P HB2  7  
ATOM 7525  H HB3  . ARG A 1 24 ? 4.417   2.398   -9.228  1.00 0.00 ? 22 ARG P HB3  7  
ATOM 7526  H HG2  . ARG A 1 24 ? 4.383   4.442   -10.624 1.00 0.00 ? 22 ARG P HG2  7  
ATOM 7527  H HG3  . ARG A 1 24 ? 4.453   3.448   -12.096 1.00 0.00 ? 22 ARG P HG3  7  
ATOM 7528  H HD2  . ARG A 1 24 ? 2.292   2.403   -11.487 1.00 0.00 ? 22 ARG P HD2  7  
ATOM 7529  H HD3  . ARG A 1 24 ? 2.226   3.396   -10.014 1.00 0.00 ? 22 ARG P HD3  7  
ATOM 7530  H HE   . ARG A 1 24 ? 2.553   5.145   -12.224 1.00 0.00 ? 22 ARG P HE   7  
ATOM 7531  H HH11 . ARG A 1 24 ? 0.051   3.014   -11.010 1.00 0.00 ? 22 ARG P HH11 7  
ATOM 7532  H HH12 . ARG A 1 24 ? -1.228  3.956   -11.729 1.00 0.00 ? 22 ARG P HH12 7  
ATOM 7533  H HH21 . ARG A 1 24 ? 0.876   6.299   -13.114 1.00 0.00 ? 22 ARG P HH21 7  
ATOM 7534  H HH22 . ARG A 1 24 ? -0.764  5.767   -12.888 1.00 0.00 ? 22 ARG P HH22 7  
ATOM 7535  N N    . ASN A 1 25 ? 6.979   3.711   -8.397  1.00 0.00 ? 23 ASN P N    7  
ATOM 7536  C CA   . ASN A 1 25 ? 7.541   4.835   -7.644  1.00 0.00 ? 23 ASN P CA   7  
ATOM 7537  C C    . ASN A 1 25 ? 8.152   4.357   -6.308  1.00 0.00 ? 23 ASN P C    7  
ATOM 7538  O O    . ASN A 1 25 ? 7.436   3.871   -5.428  1.00 0.00 ? 23 ASN P O    7  
ATOM 7539  C CB   . ASN A 1 25 ? 6.414   5.866   -7.417  1.00 0.00 ? 23 ASN P CB   7  
ATOM 7540  C CG   . ASN A 1 25 ? 6.868   7.130   -6.705  1.00 0.00 ? 23 ASN P CG   7  
ATOM 7541  O OD1  . ASN A 1 25 ? 8.036   7.335   -6.406  1.00 0.00 ? 23 ASN P OD1  7  
ATOM 7542  N ND2  . ASN A 1 25 ? 5.954   8.025   -6.412  1.00 0.00 ? 23 ASN P ND2  7  
ATOM 7543  H H    . ASN A 1 25 ? 6.609   2.934   -7.861  1.00 0.00 ? 23 ASN P H    7  
ATOM 7544  H HA   . ASN A 1 25 ? 8.330   5.305   -8.234  1.00 0.00 ? 23 ASN P HA   7  
ATOM 7545  H HB2  . ASN A 1 25 ? 5.995   6.161   -8.379  1.00 0.00 ? 23 ASN P HB2  7  
ATOM 7546  H HB3  . ASN A 1 25 ? 5.618   5.407   -6.829  1.00 0.00 ? 23 ASN P HB3  7  
ATOM 7547  H HD21 . ASN A 1 25 ? 4.994   7.878   -6.680  1.00 0.00 ? 23 ASN P HD21 7  
ATOM 7548  H HD22 . ASN A 1 25 ? 6.249   8.874   -5.956  1.00 0.00 ? 23 ASN P HD22 7  
ATOM 7549  N N    . ARG A 1 26 ? 9.466   4.550   -6.121  1.00 0.00 ? 24 ARG P N    7  
ATOM 7550  C CA   . ARG A 1 26 ? 10.183  4.216   -4.871  1.00 0.00 ? 24 ARG P CA   7  
ATOM 7551  C C    . ARG A 1 26 ? 10.039  5.268   -3.760  1.00 0.00 ? 24 ARG P C    7  
ATOM 7552  O O    . ARG A 1 26 ? 10.405  4.995   -2.617  1.00 0.00 ? 24 ARG P O    7  
ATOM 7553  C CB   . ARG A 1 26 ? 11.667  3.940   -5.170  1.00 0.00 ? 24 ARG P CB   7  
ATOM 7554  C CG   . ARG A 1 26 ? 11.881  2.669   -6.010  1.00 0.00 ? 24 ARG P CG   7  
ATOM 7555  C CD   . ARG A 1 26 ? 13.368  2.307   -6.107  1.00 0.00 ? 24 ARG P CD   7  
ATOM 7556  N NE   . ARG A 1 26 ? 13.897  1.884   -4.795  1.00 0.00 ? 24 ARG P NE   7  
ATOM 7557  C CZ   . ARG A 1 26 ? 15.153  1.894   -4.389  1.00 0.00 ? 24 ARG P CZ   7  
ATOM 7558  N NH1  . ARG A 1 26 ? 16.138  2.254   -5.159  1.00 0.00 ? 24 ARG P NH1  7  
ATOM 7559  N NH2  . ARG A 1 26 ? 15.444  1.540   -3.172  1.00 0.00 ? 24 ARG P NH2  7  
ATOM 7560  H H    . ARG A 1 26 ? 9.995   4.953   -6.883  1.00 0.00 ? 24 ARG P H    7  
ATOM 7561  H HA   . ARG A 1 26 ? 9.754   3.304   -4.457  1.00 0.00 ? 24 ARG P HA   7  
ATOM 7562  H HB2  . ARG A 1 26 ? 12.102  4.794   -5.691  1.00 0.00 ? 24 ARG P HB2  7  
ATOM 7563  H HB3  . ARG A 1 26 ? 12.189  3.825   -4.219  1.00 0.00 ? 24 ARG P HB3  7  
ATOM 7564  H HG2  . ARG A 1 26 ? 11.342  1.835   -5.559  1.00 0.00 ? 24 ARG P HG2  7  
ATOM 7565  H HG3  . ARG A 1 26 ? 11.493  2.832   -7.016  1.00 0.00 ? 24 ARG P HG3  7  
ATOM 7566  H HD2  . ARG A 1 26 ? 13.482  1.487   -6.820  1.00 0.00 ? 24 ARG P HD2  7  
ATOM 7567  H HD3  . ARG A 1 26 ? 13.915  3.174   -6.483  1.00 0.00 ? 24 ARG P HD3  7  
ATOM 7568  H HE   . ARG A 1 26 ? 13.216  1.544   -4.135  1.00 0.00 ? 24 ARG P HE   7  
ATOM 7569  H HH11 . ARG A 1 26 ? 15.946  2.510   -6.113  1.00 0.00 ? 24 ARG P HH11 7  
ATOM 7570  H HH12 . ARG A 1 26 ? 17.083  2.234   -4.819  1.00 0.00 ? 24 ARG P HH12 7  
ATOM 7571  H HH21 . ARG A 1 26 ? 14.722  1.245   -2.539  1.00 0.00 ? 24 ARG P HH21 7  
ATOM 7572  H HH22 . ARG A 1 26 ? 16.405  1.529   -2.865  1.00 0.00 ? 24 ARG P HH22 7  
ATOM 7573  N N    . TYR A 1 27 ? 9.502   6.448   -4.081  1.00 0.00 ? 25 TYR P N    7  
ATOM 7574  C CA   . TYR A 1 27 ? 9.390   7.611   -3.190  1.00 0.00 ? 25 TYR P CA   7  
ATOM 7575  C C    . TYR A 1 27 ? 7.967   8.231   -3.191  1.00 0.00 ? 25 TYR P C    7  
ATOM 7576  O O    . TYR A 1 27 ? 7.819   9.428   -3.466  1.00 0.00 ? 25 TYR P O    7  
ATOM 7577  C CB   . TYR A 1 27 ? 10.484  8.627   -3.574  1.00 0.00 ? 25 TYR P CB   7  
ATOM 7578  C CG   . TYR A 1 27 ? 11.904  8.088   -3.529  1.00 0.00 ? 25 TYR P CG   7  
ATOM 7579  C CD1  . TYR A 1 27 ? 12.642  8.151   -2.331  1.00 0.00 ? 25 TYR P CD1  7  
ATOM 7580  C CD2  . TYR A 1 27 ? 12.485  7.521   -4.682  1.00 0.00 ? 25 TYR P CD2  7  
ATOM 7581  C CE1  . TYR A 1 27 ? 13.955  7.646   -2.284  1.00 0.00 ? 25 TYR P CE1  7  
ATOM 7582  C CE2  . TYR A 1 27 ? 13.798  7.014   -4.638  1.00 0.00 ? 25 TYR P CE2  7  
ATOM 7583  C CZ   . TYR A 1 27 ? 14.536  7.071   -3.436  1.00 0.00 ? 25 TYR P CZ   7  
ATOM 7584  O OH   . TYR A 1 27 ? 15.792  6.548   -3.371  1.00 0.00 ? 25 TYR P OH   7  
ATOM 7585  H H    . TYR A 1 27 ? 9.194   6.575   -5.036  1.00 0.00 ? 25 TYR P H    7  
ATOM 7586  H HA   . TYR A 1 27 ? 9.584   7.294   -2.164  1.00 0.00 ? 25 TYR P HA   7  
ATOM 7587  H HB2  . TYR A 1 27 ? 10.284  8.997   -4.582  1.00 0.00 ? 25 TYR P HB2  7  
ATOM 7588  H HB3  . TYR A 1 27 ? 10.422  9.480   -2.898  1.00 0.00 ? 25 TYR P HB3  7  
ATOM 7589  H HD1  . TYR A 1 27 ? 12.198  8.584   -1.444  1.00 0.00 ? 25 TYR P HD1  7  
ATOM 7590  H HD2  . TYR A 1 27 ? 11.914  7.462   -5.601  1.00 0.00 ? 25 TYR P HD2  7  
ATOM 7591  H HE1  . TYR A 1 27 ? 14.523  7.696   -1.367  1.00 0.00 ? 25 TYR P HE1  7  
ATOM 7592  H HE2  . TYR A 1 27 ? 14.238  6.571   -5.521  1.00 0.00 ? 25 TYR P HE2  7  
ATOM 7593  H HH   . TYR A 1 27 ? 16.105  6.243   -4.241  1.00 0.00 ? 25 TYR P HH   7  
ATOM 7594  N N    . PRO A 1 28 ? 6.895   7.458   -2.909  1.00 0.00 ? 26 PRO P N    7  
ATOM 7595  C CA   . PRO A 1 28 ? 5.535   7.992   -2.828  1.00 0.00 ? 26 PRO P CA   7  
ATOM 7596  C C    . PRO A 1 28 ? 5.355   8.909   -1.608  1.00 0.00 ? 26 PRO P C    7  
ATOM 7597  O O    . PRO A 1 28 ? 5.915   8.655   -0.538  1.00 0.00 ? 26 PRO P O    7  
ATOM 7598  C CB   . PRO A 1 28 ? 4.617   6.766   -2.770  1.00 0.00 ? 26 PRO P CB   7  
ATOM 7599  C CG   . PRO A 1 28 ? 5.483   5.707   -2.091  1.00 0.00 ? 26 PRO P CG   7  
ATOM 7600  C CD   . PRO A 1 28 ? 6.892   6.037   -2.578  1.00 0.00 ? 26 PRO P CD   7  
ATOM 7601  H HA   . PRO A 1 28 ? 5.303   8.561   -3.729  1.00 0.00 ? 26 PRO P HA   7  
ATOM 7602  H HB2  . PRO A 1 28 ? 3.701   6.955   -2.211  1.00 0.00 ? 26 PRO P HB2  7  
ATOM 7603  H HB3  . PRO A 1 28 ? 4.382   6.442   -3.786  1.00 0.00 ? 26 PRO P HB3  7  
ATOM 7604  H HG2  . PRO A 1 28 ? 5.433   5.822   -1.010  1.00 0.00 ? 26 PRO P HG2  7  
ATOM 7605  H HG3  . PRO A 1 28 ? 5.183   4.702   -2.382  1.00 0.00 ? 26 PRO P HG3  7  
ATOM 7606  H HD2  . PRO A 1 28 ? 7.622   5.804   -1.802  1.00 0.00 ? 26 PRO P HD2  7  
ATOM 7607  H HD3  . PRO A 1 28 ? 7.099   5.458   -3.476  1.00 0.00 ? 26 PRO P HD3  7  
ATOM 7608  N N    . ASP A 1 29 ? 4.543   9.958   -1.747  1.00 0.00 ? 27 ASP P N    7  
ATOM 7609  C CA   . ASP A 1 29 ? 4.137   10.833  -0.638  1.00 0.00 ? 27 ASP P CA   7  
ATOM 7610  C C    . ASP A 1 29 ? 3.088   10.143  0.260   1.00 0.00 ? 27 ASP P C    7  
ATOM 7611  O O    . ASP A 1 29 ? 2.467   9.154   -0.135  1.00 0.00 ? 27 ASP P O    7  
ATOM 7612  C CB   . ASP A 1 29 ? 3.638   12.172  -1.214  1.00 0.00 ? 27 ASP P CB   7  
ATOM 7613  C CG   . ASP A 1 29 ? 3.532   13.316  -0.183  1.00 0.00 ? 27 ASP P CG   7  
ATOM 7614  O OD1  . ASP A 1 29 ? 4.009   13.167  0.968   1.00 0.00 ? 27 ASP P OD1  7  
ATOM 7615  O OD2  . ASP A 1 29 ? 2.986   14.387  -0.537  1.00 0.00 ? 27 ASP P OD2  7  
ATOM 7616  H H    . ASP A 1 29 ? 4.112   10.115  -2.644  1.00 0.00 ? 27 ASP P H    7  
ATOM 7617  H HA   . ASP A 1 29 ? 5.017   11.036  -0.026  1.00 0.00 ? 27 ASP P HA   7  
ATOM 7618  H HB2  . ASP A 1 29 ? 4.332   12.492  -1.994  1.00 0.00 ? 27 ASP P HB2  7  
ATOM 7619  H HB3  . ASP A 1 29 ? 2.663   12.010  -1.680  1.00 0.00 ? 27 ASP P HB3  7  
ATOM 7620  N N    . MET A 1 30 ? 2.868   10.646  1.474   1.00 0.00 ? 28 MET P N    7  
ATOM 7621  C CA   . MET A 1 30 ? 2.019   9.992   2.482   1.00 0.00 ? 28 MET P CA   7  
ATOM 7622  C C    . MET A 1 30 ? 0.538   9.918   2.068   1.00 0.00 ? 28 MET P C    7  
ATOM 7623  O O    . MET A 1 30 ? -0.162  8.976   2.441   1.00 0.00 ? 28 MET P O    7  
ATOM 7624  C CB   . MET A 1 30 ? 2.188   10.682  3.848   1.00 0.00 ? 28 MET P CB   7  
ATOM 7625  C CG   . MET A 1 30 ? 3.657   10.756  4.295   1.00 0.00 ? 28 MET P CG   7  
ATOM 7626  S SD   . MET A 1 30 ? 4.521   9.160   4.394   1.00 0.00 ? 28 MET P SD   7  
ATOM 7627  C CE   . MET A 1 30 ? 6.189   9.695   3.927   1.00 0.00 ? 28 MET P CE   7  
ATOM 7628  H H    . MET A 1 30 ? 3.358   11.502  1.723   1.00 0.00 ? 28 MET P H    7  
ATOM 7629  H HA   . MET A 1 30 ? 2.362   8.964   2.589   1.00 0.00 ? 28 MET P HA   7  
ATOM 7630  H HB2  . MET A 1 30 ? 1.787   11.695  3.793   1.00 0.00 ? 28 MET P HB2  7  
ATOM 7631  H HB3  . MET A 1 30 ? 1.621   10.127  4.597   1.00 0.00 ? 28 MET P HB3  7  
ATOM 7632  H HG2  . MET A 1 30 ? 4.196   11.401  3.603   1.00 0.00 ? 28 MET P HG2  7  
ATOM 7633  H HG3  . MET A 1 30 ? 3.700   11.229  5.276   1.00 0.00 ? 28 MET P HG3  7  
ATOM 7634  H HE1  . MET A 1 30 ? 6.524   10.488  4.596   1.00 0.00 ? 28 MET P HE1  7  
ATOM 7635  H HE2  . MET A 1 30 ? 6.876   8.852   3.997   1.00 0.00 ? 28 MET P HE2  7  
ATOM 7636  H HE3  . MET A 1 30 ? 6.179   10.065  2.900   1.00 0.00 ? 28 MET P HE3  7  
ATOM 7637  N N    . SER A 1 31 ? 0.069   10.850  1.231   1.00 0.00 ? 29 SER P N    7  
ATOM 7638  C CA   . SER A 1 31 ? -1.251  10.797  0.583   1.00 0.00 ? 29 SER P CA   7  
ATOM 7639  C C    . SER A 1 31 ? -1.340  9.680   -0.469  1.00 0.00 ? 29 SER P C    7  
ATOM 7640  O O    . SER A 1 31 ? -2.304  8.915   -0.475  1.00 0.00 ? 29 SER P O    7  
ATOM 7641  C CB   . SER A 1 31 ? -1.568  12.157  -0.050  1.00 0.00 ? 29 SER P CB   7  
ATOM 7642  O OG   . SER A 1 31 ? -0.501  12.583  -0.885  1.00 0.00 ? 29 SER P OG   7  
ATOM 7643  H H    . SER A 1 31 ? 0.691   11.592  0.943   1.00 0.00 ? 29 SER P H    7  
ATOM 7644  H HA   . SER A 1 31 ? -2.010  10.596  1.340   1.00 0.00 ? 29 SER P HA   7  
ATOM 7645  H HB2  . SER A 1 31 ? -2.490  12.082  -0.630  1.00 0.00 ? 29 SER P HB2  7  
ATOM 7646  H HB3  . SER A 1 31 ? -1.715  12.890  0.745   1.00 0.00 ? 29 SER P HB3  7  
ATOM 7647  H HG   . SER A 1 31 ? -0.731  13.457  -1.255  1.00 0.00 ? 29 SER P HG   7  
ATOM 7648  N N    . THR A 1 32 ? -0.305  9.508   -1.299  1.00 0.00 ? 30 THR P N    7  
ATOM 7649  C CA   . THR A 1 32 ? -0.182  8.395   -2.260  1.00 0.00 ? 30 THR P CA   7  
ATOM 7650  C C    . THR A 1 32 ? -0.137  7.047   -1.533  1.00 0.00 ? 30 THR P C    7  
ATOM 7651  O O    . THR A 1 32 ? -0.831  6.107   -1.930  1.00 0.00 ? 30 THR P O    7  
ATOM 7652  C CB   . THR A 1 32 ? 1.073   8.568   -3.136  1.00 0.00 ? 30 THR P CB   7  
ATOM 7653  O OG1  . THR A 1 32 ? 1.068   9.846   -3.742  1.00 0.00 ? 30 THR P OG1  7  
ATOM 7654  C CG2  . THR A 1 32 ? 1.173   7.537   -4.261  1.00 0.00 ? 30 THR P CG2  7  
ATOM 7655  H H    . THR A 1 32 ? 0.438   10.193  -1.273  1.00 0.00 ? 30 THR P H    7  
ATOM 7656  H HA   . THR A 1 32 ? -1.056  8.396   -2.912  1.00 0.00 ? 30 THR P HA   7  
ATOM 7657  H HB   . THR A 1 32 ? 1.961   8.485   -2.512  1.00 0.00 ? 30 THR P HB   7  
ATOM 7658  H HG1  . THR A 1 32 ? 1.832   9.900   -4.341  1.00 0.00 ? 30 THR P HG1  7  
ATOM 7659  H HG21 . THR A 1 32 ? 2.061   7.732   -4.864  1.00 0.00 ? 30 THR P HG21 7  
ATOM 7660  H HG22 . THR A 1 32 ? 0.286   7.586   -4.893  1.00 0.00 ? 30 THR P HG22 7  
ATOM 7661  H HG23 . THR A 1 32 ? 1.260   6.534   -3.842  1.00 0.00 ? 30 THR P HG23 7  
ATOM 7662  N N    . ARG A 1 33 ? 0.611   6.962   -0.422  1.00 0.00 ? 31 ARG P N    7  
ATOM 7663  C CA   . ARG A 1 33 ? 0.660   5.778   0.456   1.00 0.00 ? 31 ARG P CA   7  
ATOM 7664  C C    . ARG A 1 33 ? -0.702  5.465   1.079   1.00 0.00 ? 31 ARG P C    7  
ATOM 7665  O O    . ARG A 1 33 ? -1.064  4.298   1.168   1.00 0.00 ? 31 ARG P O    7  
ATOM 7666  C CB   . ARG A 1 33 ? 1.719   5.961   1.558   1.00 0.00 ? 31 ARG P CB   7  
ATOM 7667  C CG   . ARG A 1 33 ? 3.149   5.980   0.999   1.00 0.00 ? 31 ARG P CG   7  
ATOM 7668  C CD   . ARG A 1 33 ? 4.187   6.187   2.111   1.00 0.00 ? 31 ARG P CD   7  
ATOM 7669  N NE   . ARG A 1 33 ? 5.413   6.800   1.567   1.00 0.00 ? 31 ARG P NE   7  
ATOM 7670  C CZ   . ARG A 1 33 ? 6.661   6.659   1.962   1.00 0.00 ? 31 ARG P CZ   7  
ATOM 7671  N NH1  . ARG A 1 33 ? 7.007   5.896   2.958   1.00 0.00 ? 31 ARG P NH1  7  
ATOM 7672  N NH2  . ARG A 1 33 ? 7.590   7.321   1.340   1.00 0.00 ? 31 ARG P NH2  7  
ATOM 7673  H H    . ARG A 1 33 ? 1.174   7.773   -0.176  1.00 0.00 ? 31 ARG P H    7  
ATOM 7674  H HA   . ARG A 1 33 ? 0.930   4.908   -0.145  1.00 0.00 ? 31 ARG P HA   7  
ATOM 7675  H HB2  . ARG A 1 33 ? 1.524   6.891   2.092   1.00 0.00 ? 31 ARG P HB2  7  
ATOM 7676  H HB3  . ARG A 1 33 ? 1.634   5.145   2.275   1.00 0.00 ? 31 ARG P HB3  7  
ATOM 7677  H HG2  . ARG A 1 33 ? 3.359   5.040   0.486   1.00 0.00 ? 31 ARG P HG2  7  
ATOM 7678  H HG3  . ARG A 1 33 ? 3.238   6.788   0.277   1.00 0.00 ? 31 ARG P HG3  7  
ATOM 7679  H HD2  . ARG A 1 33 ? 3.772   6.855   2.867   1.00 0.00 ? 31 ARG P HD2  7  
ATOM 7680  H HD3  . ARG A 1 33 ? 4.398   5.223   2.578   1.00 0.00 ? 31 ARG P HD3  7  
ATOM 7681  H HE   . ARG A 1 33 ? 5.292   7.458   0.806   1.00 0.00 ? 31 ARG P HE   7  
ATOM 7682  H HH11 . ARG A 1 33 ? 6.292   5.402   3.455   1.00 0.00 ? 31 ARG P HH11 7  
ATOM 7683  H HH12 . ARG A 1 33 ? 7.970   5.826   3.238   1.00 0.00 ? 31 ARG P HH12 7  
ATOM 7684  H HH21 . ARG A 1 33 ? 7.309   7.936   0.585   1.00 0.00 ? 31 ARG P HH21 7  
ATOM 7685  H HH22 . ARG A 1 33 ? 8.554   7.246   1.612   1.00 0.00 ? 31 ARG P HH22 7  
ATOM 7686  N N    . GLU A 1 34 ? -1.480  6.475   1.465   1.00 0.00 ? 32 GLU P N    7  
ATOM 7687  C CA   . GLU A 1 34 ? -2.834  6.284   2.004   1.00 0.00 ? 32 GLU P CA   7  
ATOM 7688  C C    . GLU A 1 34 ? -3.836  5.792   0.943   1.00 0.00 ? 32 GLU P C    7  
ATOM 7689  O O    . GLU A 1 34 ? -4.666  4.933   1.245   1.00 0.00 ? 32 GLU P O    7  
ATOM 7690  C CB   . GLU A 1 34 ? -3.307  7.586   2.677   1.00 0.00 ? 32 GLU P CB   7  
ATOM 7691  C CG   . GLU A 1 34 ? -4.642  7.425   3.415   1.00 0.00 ? 32 GLU P CG   7  
ATOM 7692  C CD   . GLU A 1 34 ? -5.044  8.733   4.125   1.00 0.00 ? 32 GLU P CD   7  
ATOM 7693  O OE1  . GLU A 1 34 ? -5.575  9.655   3.457   1.00 0.00 ? 32 GLU P OE1  7  
ATOM 7694  O OE2  . GLU A 1 34 ? -4.850  8.845   5.361   1.00 0.00 ? 32 GLU P OE2  7  
ATOM 7695  H H    . GLU A 1 34 ? -1.103  7.412   1.429   1.00 0.00 ? 32 GLU P H    7  
ATOM 7696  H HA   . GLU A 1 34 ? -2.782  5.501   2.763   1.00 0.00 ? 32 GLU P HA   7  
ATOM 7697  H HB2  . GLU A 1 34 ? -2.553  7.902   3.400   1.00 0.00 ? 32 GLU P HB2  7  
ATOM 7698  H HB3  . GLU A 1 34 ? -3.407  8.367   1.923   1.00 0.00 ? 32 GLU P HB3  7  
ATOM 7699  H HG2  . GLU A 1 34 ? -5.422  7.150   2.702   1.00 0.00 ? 32 GLU P HG2  7  
ATOM 7700  H HG3  . GLU A 1 34 ? -4.552  6.614   4.141   1.00 0.00 ? 32 GLU P HG3  7  
ATOM 7701  N N    . GLU A 1 35 ? -3.743  6.258   -0.308  1.00 0.00 ? 33 GLU P N    7  
ATOM 7702  C CA   . GLU A 1 35 ? -4.579  5.732   -1.398  1.00 0.00 ? 33 GLU P CA   7  
ATOM 7703  C C    . GLU A 1 35 ? -4.274  4.254   -1.680  1.00 0.00 ? 33 GLU P C    7  
ATOM 7704  O O    . GLU A 1 35 ? -5.189  3.430   -1.679  1.00 0.00 ? 33 GLU P O    7  
ATOM 7705  C CB   . GLU A 1 35 ? -4.435  6.562   -2.682  1.00 0.00 ? 33 GLU P CB   7  
ATOM 7706  C CG   . GLU A 1 35 ? -5.086  7.945   -2.558  1.00 0.00 ? 33 GLU P CG   7  
ATOM 7707  C CD   . GLU A 1 35 ? -5.034  8.705   -3.897  1.00 0.00 ? 33 GLU P CD   7  
ATOM 7708  O OE1  . GLU A 1 35 ? -3.968  9.267   -4.247  1.00 0.00 ? 33 GLU P OE1  7  
ATOM 7709  O OE2  . GLU A 1 35 ? -6.071  8.763   -4.605  1.00 0.00 ? 33 GLU P OE2  7  
ATOM 7710  H H    . GLU A 1 35 ? -3.076  6.996   -0.509  1.00 0.00 ? 33 GLU P H    7  
ATOM 7711  H HA   . GLU A 1 35 ? -5.624  5.782   -1.091  1.00 0.00 ? 33 GLU P HA   7  
ATOM 7712  H HB2  . GLU A 1 35 ? -3.381  6.666   -2.941  1.00 0.00 ? 33 GLU P HB2  7  
ATOM 7713  H HB3  . GLU A 1 35 ? -4.938  6.023   -3.486  1.00 0.00 ? 33 GLU P HB3  7  
ATOM 7714  H HG2  . GLU A 1 35 ? -6.125  7.817   -2.244  1.00 0.00 ? 33 GLU P HG2  7  
ATOM 7715  H HG3  . GLU A 1 35 ? -4.579  8.523   -1.784  1.00 0.00 ? 33 GLU P HG3  7  
ATOM 7716  N N    . ILE A 1 36 ? -2.999  3.875   -1.832  1.00 0.00 ? 34 ILE P N    7  
ATOM 7717  C CA   . ILE A 1 36 ? -2.643  2.461   -2.045  1.00 0.00 ? 34 ILE P CA   7  
ATOM 7718  C C    . ILE A 1 36 ? -2.902  1.596   -0.797  1.00 0.00 ? 34 ILE P C    7  
ATOM 7719  O O    . ILE A 1 36 ? -3.134  0.393   -0.930  1.00 0.00 ? 34 ILE P O    7  
ATOM 7720  C CB   . ILE A 1 36 ? -1.230  2.287   -2.648  1.00 0.00 ? 34 ILE P CB   7  
ATOM 7721  C CG1  . ILE A 1 36 ? -0.061  2.668   -1.726  1.00 0.00 ? 34 ILE P CG1  7  
ATOM 7722  C CG2  . ILE A 1 36 ? -1.084  3.095   -3.948  1.00 0.00 ? 34 ILE P CG2  7  
ATOM 7723  C CD1  . ILE A 1 36 ? 0.311   1.582   -0.717  1.00 0.00 ? 34 ILE P CD1  7  
ATOM 7724  H H    . ILE A 1 36 ? -2.266  4.578   -1.822  1.00 0.00 ? 34 ILE P H    7  
ATOM 7725  H HA   . ILE A 1 36 ? -3.330  2.081   -2.802  1.00 0.00 ? 34 ILE P HA   7  
ATOM 7726  H HB   . ILE A 1 36 ? -1.119  1.236   -2.913  1.00 0.00 ? 34 ILE P HB   7  
ATOM 7727  H HG12 . ILE A 1 36 ? 0.824   2.860   -2.329  1.00 0.00 ? 34 ILE P HG12 7  
ATOM 7728  H HG13 . ILE A 1 36 ? -0.306  3.585   -1.205  1.00 0.00 ? 34 ILE P HG13 7  
ATOM 7729  H HG21 . ILE A 1 36 ? -1.911  2.878   -4.619  1.00 0.00 ? 34 ILE P HG21 7  
ATOM 7730  H HG22 . ILE A 1 36 ? -1.061  4.163   -3.729  1.00 0.00 ? 34 ILE P HG22 7  
ATOM 7731  H HG23 . ILE A 1 36 ? -0.151  2.822   -4.443  1.00 0.00 ? 34 ILE P HG23 7  
ATOM 7732  H HD11 . ILE A 1 36 ? 1.321   1.769   -0.363  1.00 0.00 ? 34 ILE P HD11 7  
ATOM 7733  H HD12 . ILE A 1 36 ? -0.370  1.605   0.130   1.00 0.00 ? 34 ILE P HD12 7  
ATOM 7734  H HD13 . ILE A 1 36 ? 0.284   0.600   -1.187  1.00 0.00 ? 34 ILE P HD13 7  
ATOM 7735  N N    . ALA A 1 37 ? -2.951  2.192   0.402   1.00 0.00 ? 35 ALA P N    7  
ATOM 7736  C CA   . ALA A 1 37 ? -3.360  1.513   1.632   1.00 0.00 ? 35 ALA P CA   7  
ATOM 7737  C C    . ALA A 1 37 ? -4.837  1.094   1.576   1.00 0.00 ? 35 ALA P C    7  
ATOM 7738  O O    . ALA A 1 37 ? -5.136  -0.088  1.738   1.00 0.00 ? 35 ALA P O    7  
ATOM 7739  C CB   . ALA A 1 37 ? -3.072  2.387   2.863   1.00 0.00 ? 35 ALA P CB   7  
ATOM 7740  H H    . ALA A 1 37 ? -2.671  3.163   0.463   1.00 0.00 ? 35 ALA P H    7  
ATOM 7741  H HA   . ALA A 1 37 ? -2.765  0.603   1.727   1.00 0.00 ? 35 ALA P HA   7  
ATOM 7742  H HB1  . ALA A 1 37 ? -2.042  2.733   2.862   1.00 0.00 ? 35 ALA P HB1  7  
ATOM 7743  H HB2  . ALA A 1 37 ? -3.739  3.246   2.891   1.00 0.00 ? 35 ALA P HB2  7  
ATOM 7744  H HB3  . ALA A 1 37 ? -3.228  1.798   3.763   1.00 0.00 ? 35 ALA P HB3  7  
ATOM 7745  N N    . VAL A 1 38 ? -5.773  2.004   1.269   1.00 0.00 ? 36 VAL P N    7  
ATOM 7746  C CA   . VAL A 1 38 ? -7.202  1.645   1.166   1.00 0.00 ? 36 VAL P CA   7  
ATOM 7747  C C    . VAL A 1 38 ? -7.486  0.683   0.002   1.00 0.00 ? 36 VAL P C    7  
ATOM 7748  O O    . VAL A 1 38 ? -8.366  -0.169  0.122   1.00 0.00 ? 36 VAL P O    7  
ATOM 7749  C CB   . VAL A 1 38 ? -8.145  2.865   1.136   1.00 0.00 ? 36 VAL P CB   7  
ATOM 7750  C CG1  . VAL A 1 38 ? -8.027  3.688   2.422   1.00 0.00 ? 36 VAL P CG1  7  
ATOM 7751  C CG2  . VAL A 1 38 ? -7.928  3.818   -0.040  1.00 0.00 ? 36 VAL P CG2  7  
ATOM 7752  H H    . VAL A 1 38 ? -5.493  2.968   1.134   1.00 0.00 ? 36 VAL P H    7  
ATOM 7753  H HA   . VAL A 1 38 ? -7.458  1.093   2.070   1.00 0.00 ? 36 VAL P HA   7  
ATOM 7754  H HB   . VAL A 1 38 ? -9.169  2.493   1.078   1.00 0.00 ? 36 VAL P HB   7  
ATOM 7755  H HG11 . VAL A 1 38 ? -7.034  4.130   2.497   1.00 0.00 ? 36 VAL P HG11 7  
ATOM 7756  H HG12 . VAL A 1 38 ? -8.769  4.487   2.408   1.00 0.00 ? 36 VAL P HG12 7  
ATOM 7757  H HG13 . VAL A 1 38 ? -8.209  3.050   3.287   1.00 0.00 ? 36 VAL P HG13 7  
ATOM 7758  H HG21 . VAL A 1 38 ? -8.691  4.595   -0.029  1.00 0.00 ? 36 VAL P HG21 7  
ATOM 7759  H HG22 . VAL A 1 38 ? -6.949  4.285   0.039   1.00 0.00 ? 36 VAL P HG22 7  
ATOM 7760  H HG23 . VAL A 1 38 ? -7.999  3.277   -0.979  1.00 0.00 ? 36 VAL P HG23 7  
ATOM 7761  N N    . TRP A 1 39 ? -6.694  0.729   -1.077  1.00 0.00 ? 37 TRP P N    7  
ATOM 7762  C CA   . TRP A 1 39 ? -6.769  -0.225  -2.200  1.00 0.00 ? 37 TRP P CA   7  
ATOM 7763  C C    . TRP A 1 39 ? -6.243  -1.634  -1.850  1.00 0.00 ? 37 TRP P C    7  
ATOM 7764  O O    . TRP A 1 39 ? -6.590  -2.601  -2.532  1.00 0.00 ? 37 TRP P O    7  
ATOM 7765  C CB   . TRP A 1 39 ? -6.025  0.352   -3.417  1.00 0.00 ? 37 TRP P CB   7  
ATOM 7766  C CG   . TRP A 1 39 ? -6.457  1.696   -3.933  1.00 0.00 ? 37 TRP P CG   7  
ATOM 7767  C CD1  . TRP A 1 39 ? -7.573  2.365   -3.569  1.00 0.00 ? 37 TRP P CD1  7  
ATOM 7768  C CD2  . TRP A 1 39 ? -5.763  2.585   -4.866  1.00 0.00 ? 37 TRP P CD2  7  
ATOM 7769  N NE1  . TRP A 1 39 ? -7.599  3.612   -4.157  1.00 0.00 ? 37 TRP P NE1  7  
ATOM 7770  C CE2  . TRP A 1 39 ? -6.511  3.797   -4.983  1.00 0.00 ? 37 TRP P CE2  7  
ATOM 7771  C CE3  . TRP A 1 39 ? -4.569  2.495   -5.616  1.00 0.00 ? 37 TRP P CE3  7  
ATOM 7772  C CZ2  . TRP A 1 39 ? -6.096  4.863   -5.795  1.00 0.00 ? 37 TRP P CZ2  7  
ATOM 7773  C CZ3  . TRP A 1 39 ? -4.143  3.560   -6.435  1.00 0.00 ? 37 TRP P CZ3  7  
ATOM 7774  C CH2  . TRP A 1 39 ? -4.901  4.741   -6.525  1.00 0.00 ? 37 TRP P CH2  7  
ATOM 7775  H H    . TRP A 1 39 ? -6.037  1.500   -1.155  1.00 0.00 ? 37 TRP P H    7  
ATOM 7776  H HA   . TRP A 1 39 ? -7.816  -0.348  -2.480  1.00 0.00 ? 37 TRP P HA   7  
ATOM 7777  H HB2  . TRP A 1 39 ? -4.976  0.439   -3.151  1.00 0.00 ? 37 TRP P HB2  7  
ATOM 7778  H HB3  . TRP A 1 39 ? -6.101  -0.359  -4.241  1.00 0.00 ? 37 TRP P HB3  7  
ATOM 7779  H HD1  . TRP A 1 39 ? -8.293  1.994   -2.855  1.00 0.00 ? 37 TRP P HD1  7  
ATOM 7780  H HE1  . TRP A 1 39 ? -8.306  4.308   -3.943  1.00 0.00 ? 37 TRP P HE1  7  
ATOM 7781  H HE3  . TRP A 1 39 ? -3.977  1.593   -5.553  1.00 0.00 ? 37 TRP P HE3  7  
ATOM 7782  H HZ2  . TRP A 1 39 ? -6.686  5.767   -5.853  1.00 0.00 ? 37 TRP P HZ2  7  
ATOM 7783  H HZ3  . TRP A 1 39 ? -3.224  3.470   -7.000  1.00 0.00 ? 37 TRP P HZ3  7  
ATOM 7784  H HH2  . TRP A 1 39 ? -4.564  5.555   -7.155  1.00 0.00 ? 37 TRP P HH2  7  
ATOM 7785  N N    . THR A 1 40 ? -5.455  -1.774  -0.776  1.00 0.00 ? 38 THR P N    7  
ATOM 7786  C CA   . THR A 1 40 ? -4.966  -3.057  -0.218  1.00 0.00 ? 38 THR P CA   7  
ATOM 7787  C C    . THR A 1 40 ? -5.617  -3.430  1.127   1.00 0.00 ? 38 THR P C    7  
ATOM 7788  O O    . THR A 1 40 ? -5.291  -4.466  1.710   1.00 0.00 ? 38 THR P O    7  
ATOM 7789  C CB   . THR A 1 40 ? -3.429  -3.072  -0.101  1.00 0.00 ? 38 THR P CB   7  
ATOM 7790  O OG1  . THR A 1 40 ? -2.947  -1.961  0.616   1.00 0.00 ? 38 THR P OG1  7  
ATOM 7791  C CG2  . THR A 1 40 ? -2.739  -3.068  -1.464  1.00 0.00 ? 38 THR P CG2  7  
ATOM 7792  H H    . THR A 1 40 ? -5.177  -0.930  -0.288  1.00 0.00 ? 38 THR P H    7  
ATOM 7793  H HA   . THR A 1 40 ? -5.235  -3.863  -0.901  1.00 0.00 ? 38 THR P HA   7  
ATOM 7794  H HB   . THR A 1 40 ? -3.121  -3.976  0.420   1.00 0.00 ? 38 THR P HB   7  
ATOM 7795  H HG1  . THR A 1 40 ? -2.995  -1.193  0.019   1.00 0.00 ? 38 THR P HG1  7  
ATOM 7796  H HG21 . THR A 1 40 ? -3.055  -3.942  -2.033  1.00 0.00 ? 38 THR P HG21 7  
ATOM 7797  H HG22 . THR A 1 40 ? -1.659  -3.110  -1.322  1.00 0.00 ? 38 THR P HG22 7  
ATOM 7798  H HG23 . THR A 1 40 ? -2.995  -2.166  -2.018  1.00 0.00 ? 38 THR P HG23 7  
ATOM 7799  N N    . ASN A 1 41 ? -6.562  -2.614  1.611   1.00 0.00 ? 39 ASN P N    7  
ATOM 7800  C CA   . ASN A 1 41 ? -7.192  -2.672  2.938   1.00 0.00 ? 39 ASN P CA   7  
ATOM 7801  C C    . ASN A 1 41 ? -6.203  -2.573  4.133   1.00 0.00 ? 39 ASN P C    7  
ATOM 7802  O O    . ASN A 1 41 ? -6.455  -3.085  5.225   1.00 0.00 ? 39 ASN P O    7  
ATOM 7803  C CB   . ASN A 1 41 ? -8.198  -3.845  2.979   1.00 0.00 ? 39 ASN P CB   7  
ATOM 7804  C CG   . ASN A 1 41 ? -9.182  -3.769  4.138   1.00 0.00 ? 39 ASN P CG   7  
ATOM 7805  O OD1  . ASN A 1 41 ? -9.194  -4.594  5.042   1.00 0.00 ? 39 ASN P OD1  7  
ATOM 7806  N ND2  . ASN A 1 41 ? -10.069 -2.796  4.137   1.00 0.00 ? 39 ASN P ND2  7  
ATOM 7807  H H    . ASN A 1 41 ? -6.779  -1.803  1.050   1.00 0.00 ? 39 ASN P H    7  
ATOM 7808  H HA   . ASN A 1 41 ? -7.769  -1.747  3.005   1.00 0.00 ? 39 ASN P HA   7  
ATOM 7809  H HB2  . ASN A 1 41 ? -8.775  -3.853  2.055   1.00 0.00 ? 39 ASN P HB2  7  
ATOM 7810  H HB3  . ASN A 1 41 ? -7.653  -4.785  3.046   1.00 0.00 ? 39 ASN P HB3  7  
ATOM 7811  H HD21 . ASN A 1 41 ? -10.105 -2.136  3.375   1.00 0.00 ? 39 ASN P HD21 7  
ATOM 7812  H HD22 . ASN A 1 41 ? -10.731 -2.753  4.896   1.00 0.00 ? 39 ASN P HD22 7  
ATOM 7813  N N    . LEU A 1 42 ? -5.077  -1.886  3.924   1.00 0.00 ? 40 LEU P N    7  
ATOM 7814  C CA   . LEU A 1 42 ? -4.101  -1.469  4.938   1.00 0.00 ? 40 LEU P CA   7  
ATOM 7815  C C    . LEU A 1 42 ? -4.427  -0.055  5.473   1.00 0.00 ? 40 LEU P C    7  
ATOM 7816  O O    . LEU A 1 42 ? -5.331  0.630   4.986   1.00 0.00 ? 40 LEU P O    7  
ATOM 7817  C CB   . LEU A 1 42 ? -2.689  -1.507  4.305   1.00 0.00 ? 40 LEU P CB   7  
ATOM 7818  C CG   . LEU A 1 42 ? -1.929  -2.839  4.437   1.00 0.00 ? 40 LEU P CG   7  
ATOM 7819  C CD1  . LEU A 1 42 ? -2.645  -4.030  3.814   1.00 0.00 ? 40 LEU P CD1  7  
ATOM 7820  C CD2  . LEU A 1 42 ? -0.568  -2.706  3.760   1.00 0.00 ? 40 LEU P CD2  7  
ATOM 7821  H H    . LEU A 1 42 ? -4.968  -1.473  3.003   1.00 0.00 ? 40 LEU P H    7  
ATOM 7822  H HA   . LEU A 1 42 ? -4.127  -2.153  5.789   1.00 0.00 ? 40 LEU P HA   7  
ATOM 7823  H HB2  . LEU A 1 42 ? -2.758  -1.233  3.252   1.00 0.00 ? 40 LEU P HB2  7  
ATOM 7824  H HB3  . LEU A 1 42 ? -2.063  -0.753  4.781   1.00 0.00 ? 40 LEU P HB3  7  
ATOM 7825  H HG   . LEU A 1 42 ? -1.771  -3.051  5.492   1.00 0.00 ? 40 LEU P HG   7  
ATOM 7826  H HD11 . LEU A 1 42 ? -2.032  -4.924  3.924   1.00 0.00 ? 40 LEU P HD11 7  
ATOM 7827  H HD12 . LEU A 1 42 ? -2.825  -3.840  2.757   1.00 0.00 ? 40 LEU P HD12 7  
ATOM 7828  H HD13 . LEU A 1 42 ? -3.594  -4.199  4.319   1.00 0.00 ? 40 LEU P HD13 7  
ATOM 7829  H HD21 . LEU A 1 42 ? 0.032   -1.955  4.276   1.00 0.00 ? 40 LEU P HD21 7  
ATOM 7830  H HD22 . LEU A 1 42 ? -0.704  -2.410  2.719   1.00 0.00 ? 40 LEU P HD22 7  
ATOM 7831  H HD23 . LEU A 1 42 ? -0.043  -3.658  3.788   1.00 0.00 ? 40 LEU P HD23 7  
ATOM 7832  N N    . THR A 1 43 ? -3.650  0.393   6.463   1.00 0.00 ? 41 THR P N    7  
ATOM 7833  C CA   . THR A 1 43 ? -3.601  1.788   6.944   1.00 0.00 ? 41 THR P CA   7  
ATOM 7834  C C    . THR A 1 43 ? -2.263  2.425   6.546   1.00 0.00 ? 41 THR P C    7  
ATOM 7835  O O    . THR A 1 43 ? -1.266  1.718   6.368   1.00 0.00 ? 41 THR P O    7  
ATOM 7836  C CB   . THR A 1 43 ? -3.887  1.882   8.450   1.00 0.00 ? 41 THR P CB   7  
ATOM 7837  O OG1  . THR A 1 43 ? -3.933  3.239   8.835   1.00 0.00 ? 41 THR P OG1  7  
ATOM 7838  C CG2  . THR A 1 43 ? -2.841  1.189   9.323   1.00 0.00 ? 41 THR P CG2  7  
ATOM 7839  H H    . THR A 1 43 ? -2.927  -0.225  6.800   1.00 0.00 ? 41 THR P H    7  
ATOM 7840  H HA   . THR A 1 43 ? -4.382  2.362   6.454   1.00 0.00 ? 41 THR P HA   7  
ATOM 7841  H HB   . THR A 1 43 ? -4.861  1.431   8.645   1.00 0.00 ? 41 THR P HB   7  
ATOM 7842  H HG1  . THR A 1 43 ? -4.284  3.277   9.743   1.00 0.00 ? 41 THR P HG1  7  
ATOM 7843  H HG21 . THR A 1 43 ? -3.138  1.259   10.369  1.00 0.00 ? 41 THR P HG21 7  
ATOM 7844  H HG22 . THR A 1 43 ? -1.871  1.666   9.195   1.00 0.00 ? 41 THR P HG22 7  
ATOM 7845  H HG23 . THR A 1 43 ? -2.772  0.137   9.051   1.00 0.00 ? 41 THR P HG23 7  
ATOM 7846  N N    . GLU A 1 44 ? -2.206  3.751   6.390   1.00 0.00 ? 42 GLU P N    7  
ATOM 7847  C CA   . GLU A 1 44 ? -1.009  4.433   5.872   1.00 0.00 ? 42 GLU P CA   7  
ATOM 7848  C C    . GLU A 1 44 ? 0.226   4.253   6.767   1.00 0.00 ? 42 GLU P C    7  
ATOM 7849  O O    . GLU A 1 44 ? 1.339   4.175   6.253   1.00 0.00 ? 42 GLU P O    7  
ATOM 7850  C CB   . GLU A 1 44 ? -1.300  5.912   5.564   1.00 0.00 ? 42 GLU P CB   7  
ATOM 7851  C CG   . GLU A 1 44 ? -1.581  6.836   6.762   1.00 0.00 ? 42 GLU P CG   7  
ATOM 7852  C CD   . GLU A 1 44 ? -0.329  7.264   7.557   1.00 0.00 ? 42 GLU P CD   7  
ATOM 7853  O OE1  . GLU A 1 44 ? 0.740   7.522   6.953   1.00 0.00 ? 42 GLU P OE1  7  
ATOM 7854  O OE2  . GLU A 1 44 ? -0.417  7.382   8.802   1.00 0.00 ? 42 GLU P OE2  7  
ATOM 7855  H H    . GLU A 1 44 ? -3.029  4.298   6.607   1.00 0.00 ? 42 GLU P H    7  
ATOM 7856  H HA   . GLU A 1 44 ? -0.759  3.967   4.919   1.00 0.00 ? 42 GLU P HA   7  
ATOM 7857  H HB2  . GLU A 1 44 ? -0.470  6.315   4.985   1.00 0.00 ? 42 GLU P HB2  7  
ATOM 7858  H HB3  . GLU A 1 44 ? -2.178  5.935   4.921   1.00 0.00 ? 42 GLU P HB3  7  
ATOM 7859  H HG2  . GLU A 1 44 ? -2.057  7.741   6.376   1.00 0.00 ? 42 GLU P HG2  7  
ATOM 7860  H HG3  . GLU A 1 44 ? -2.302  6.348   7.423   1.00 0.00 ? 42 GLU P HG3  7  
ATOM 7861  N N    . ALA A 1 45 ? 0.046   4.086   8.081   1.00 0.00 ? 43 ALA P N    7  
ATOM 7862  C CA   . ALA A 1 45 ? 1.145   3.818   9.008   1.00 0.00 ? 43 ALA P CA   7  
ATOM 7863  C C    . ALA A 1 45 ? 1.776   2.429   8.781   1.00 0.00 ? 43 ALA P C    7  
ATOM 7864  O O    . ALA A 1 45 ? 2.999   2.288   8.802   1.00 0.00 ? 43 ALA P O    7  
ATOM 7865  C CB   . ALA A 1 45 ? 0.623   3.979   10.441  1.00 0.00 ? 43 ALA P CB   7  
ATOM 7866  H H    . ALA A 1 45 ? -0.891  4.165   8.452   1.00 0.00 ? 43 ALA P H    7  
ATOM 7867  H HA   . ALA A 1 45 ? 1.920   4.568   8.838   1.00 0.00 ? 43 ALA P HA   7  
ATOM 7868  H HB1  . ALA A 1 45 ? 1.439   3.822   11.147  1.00 0.00 ? 43 ALA P HB1  7  
ATOM 7869  H HB2  . ALA A 1 45 ? 0.229   4.987   10.581  1.00 0.00 ? 43 ALA P HB2  7  
ATOM 7870  H HB3  . ALA A 1 45 ? -0.166  3.253   10.642  1.00 0.00 ? 43 ALA P HB3  7  
ATOM 7871  N N    . ARG A 1 46 ? 0.956   1.408   8.484   1.00 0.00 ? 44 ARG P N    7  
ATOM 7872  C CA   . ARG A 1 46 ? 1.415   0.050   8.139   1.00 0.00 ? 44 ARG P CA   7  
ATOM 7873  C C    . ARG A 1 46 ? 2.127   0.029   6.784   1.00 0.00 ? 44 ARG P C    7  
ATOM 7874  O O    . ARG A 1 46 ? 3.155   -0.630  6.642   1.00 0.00 ? 44 ARG P O    7  
ATOM 7875  C CB   . ARG A 1 46 ? 0.214   -0.912  8.207   1.00 0.00 ? 44 ARG P CB   7  
ATOM 7876  C CG   . ARG A 1 46 ? 0.591   -2.373  7.918   1.00 0.00 ? 44 ARG P CG   7  
ATOM 7877  C CD   . ARG A 1 46 ? -0.591  -3.301  8.225   1.00 0.00 ? 44 ARG P CD   7  
ATOM 7878  N NE   . ARG A 1 46 ? -0.328  -4.674  7.760   1.00 0.00 ? 44 ARG P NE   7  
ATOM 7879  C CZ   . ARG A 1 46 ? -1.165  -5.695  7.787   1.00 0.00 ? 44 ARG P CZ   7  
ATOM 7880  N NH1  . ARG A 1 46 ? -2.369  -5.610  8.274   1.00 0.00 ? 44 ARG P NH1  7  
ATOM 7881  N NH2  . ARG A 1 46 ? -0.793  -6.843  7.314   1.00 0.00 ? 44 ARG P NH2  7  
ATOM 7882  H H    . ARG A 1 46 ? -0.032  1.610   8.423   1.00 0.00 ? 44 ARG P H    7  
ATOM 7883  H HA   . ARG A 1 46 ? 2.151   -0.270  8.880   1.00 0.00 ? 44 ARG P HA   7  
ATOM 7884  H HB2  . ARG A 1 46 ? -0.213  -0.854  9.210   1.00 0.00 ? 44 ARG P HB2  7  
ATOM 7885  H HB3  . ARG A 1 46 ? -0.547  -0.598  7.492   1.00 0.00 ? 44 ARG P HB3  7  
ATOM 7886  H HG2  . ARG A 1 46 ? 0.863   -2.474  6.866   1.00 0.00 ? 44 ARG P HG2  7  
ATOM 7887  H HG3  . ARG A 1 46 ? 1.442   -2.664  8.536   1.00 0.00 ? 44 ARG P HG3  7  
ATOM 7888  H HD2  . ARG A 1 46 ? -0.766  -3.306  9.304   1.00 0.00 ? 44 ARG P HD2  7  
ATOM 7889  H HD3  . ARG A 1 46 ? -1.485  -2.914  7.731   1.00 0.00 ? 44 ARG P HD3  7  
ATOM 7890  H HE   . ARG A 1 46 ? 0.580   -4.861  7.364   1.00 0.00 ? 44 ARG P HE   7  
ATOM 7891  H HH11 . ARG A 1 46 ? -2.684  -4.740  8.668   1.00 0.00 ? 44 ARG P HH11 7  
ATOM 7892  H HH12 . ARG A 1 46 ? -2.973  -6.414  8.274   1.00 0.00 ? 44 ARG P HH12 7  
ATOM 7893  H HH21 . ARG A 1 46 ? 0.138   -6.959  6.950   1.00 0.00 ? 44 ARG P HH21 7  
ATOM 7894  H HH22 . ARG A 1 46 ? -1.416  -7.638  7.371   1.00 0.00 ? 44 ARG P HH22 7  
ATOM 7895  N N    . VAL A 1 47 ? 1.650   0.822   5.822   1.00 0.00 ? 45 VAL P N    7  
ATOM 7896  C CA   . VAL A 1 47 ? 2.336   1.059   4.538   1.00 0.00 ? 45 VAL P CA   7  
ATOM 7897  C C    . VAL A 1 47 ? 3.666   1.796   4.732   1.00 0.00 ? 45 VAL P C    7  
ATOM 7898  O O    . VAL A 1 47 ? 4.670   1.405   4.141   1.00 0.00 ? 45 VAL P O    7  
ATOM 7899  C CB   . VAL A 1 47 ? 1.401   1.803   3.565   1.00 0.00 ? 45 VAL P CB   7  
ATOM 7900  C CG1  . VAL A 1 47 ? 2.111   2.302   2.306   1.00 0.00 ? 45 VAL P CG1  7  
ATOM 7901  C CG2  . VAL A 1 47 ? 0.270   0.868   3.129   1.00 0.00 ? 45 VAL P CG2  7  
ATOM 7902  H H    . VAL A 1 47 ? 0.777   1.304   6.007   1.00 0.00 ? 45 VAL P H    7  
ATOM 7903  H HA   . VAL A 1 47 ? 2.579   0.094   4.089   1.00 0.00 ? 45 VAL P HA   7  
ATOM 7904  H HB   . VAL A 1 47 ? 0.968   2.666   4.067   1.00 0.00 ? 45 VAL P HB   7  
ATOM 7905  H HG11 . VAL A 1 47 ? 1.386   2.789   1.656   1.00 0.00 ? 45 VAL P HG11 7  
ATOM 7906  H HG12 . VAL A 1 47 ? 2.869   3.040   2.562   1.00 0.00 ? 45 VAL P HG12 7  
ATOM 7907  H HG13 . VAL A 1 47 ? 2.573   1.465   1.782   1.00 0.00 ? 45 VAL P HG13 7  
ATOM 7908  H HG21 . VAL A 1 47 ? -0.357  1.364   2.393   1.00 0.00 ? 45 VAL P HG21 7  
ATOM 7909  H HG22 . VAL A 1 47 ? 0.680   -0.038  2.681   1.00 0.00 ? 45 VAL P HG22 7  
ATOM 7910  H HG23 . VAL A 1 47 ? -0.346  0.603   3.986   1.00 0.00 ? 45 VAL P HG23 7  
ATOM 7911  N N    . ARG A 1 48 ? 3.725   2.813   5.600   1.00 0.00 ? 46 ARG P N    7  
ATOM 7912  C CA   . ARG A 1 48 ? 4.959   3.549   5.926   1.00 0.00 ? 46 ARG P CA   7  
ATOM 7913  C C    . ARG A 1 48 ? 6.019   2.628   6.543   1.00 0.00 ? 46 ARG P C    7  
ATOM 7914  O O    . ARG A 1 48 ? 7.178   2.668   6.131   1.00 0.00 ? 46 ARG P O    7  
ATOM 7915  C CB   . ARG A 1 48 ? 4.583   4.731   6.838   1.00 0.00 ? 46 ARG P CB   7  
ATOM 7916  C CG   . ARG A 1 48 ? 5.683   5.794   6.957   1.00 0.00 ? 46 ARG P CG   7  
ATOM 7917  C CD   . ARG A 1 48 ? 5.327   6.857   8.007   1.00 0.00 ? 46 ARG P CD   7  
ATOM 7918  N NE   . ARG A 1 48 ? 4.090   7.604   7.685   1.00 0.00 ? 46 ARG P NE   7  
ATOM 7919  C CZ   . ARG A 1 48 ? 3.835   8.876   7.933   1.00 0.00 ? 46 ARG P CZ   7  
ATOM 7920  N NH1  . ARG A 1 48 ? 4.716   9.685   8.453   1.00 0.00 ? 46 ARG P NH1  7  
ATOM 7921  N NH2  . ARG A 1 48 ? 2.660   9.360   7.669   1.00 0.00 ? 46 ARG P NH2  7  
ATOM 7922  H H    . ARG A 1 48 ? 2.858   3.135   6.023   1.00 0.00 ? 46 ARG P H    7  
ATOM 7923  H HA   . ARG A 1 48 ? 5.382   3.937   5.001   1.00 0.00 ? 46 ARG P HA   7  
ATOM 7924  H HB2  . ARG A 1 48 ? 3.700   5.219   6.427   1.00 0.00 ? 46 ARG P HB2  7  
ATOM 7925  H HB3  . ARG A 1 48 ? 4.336   4.357   7.832   1.00 0.00 ? 46 ARG P HB3  7  
ATOM 7926  H HG2  . ARG A 1 48 ? 6.617   5.317   7.257   1.00 0.00 ? 46 ARG P HG2  7  
ATOM 7927  H HG3  . ARG A 1 48 ? 5.832   6.275   5.990   1.00 0.00 ? 46 ARG P HG3  7  
ATOM 7928  H HD2  . ARG A 1 48 ? 5.199   6.360   8.970   1.00 0.00 ? 46 ARG P HD2  7  
ATOM 7929  H HD3  . ARG A 1 48 ? 6.174   7.538   8.085   1.00 0.00 ? 46 ARG P HD3  7  
ATOM 7930  H HE   . ARG A 1 48 ? 3.324   7.089   7.276   1.00 0.00 ? 46 ARG P HE   7  
ATOM 7931  H HH11 . ARG A 1 48 ? 5.632   9.337   8.676   1.00 0.00 ? 46 ARG P HH11 7  
ATOM 7932  H HH12 . ARG A 1 48 ? 4.485   10.647  8.633   1.00 0.00 ? 46 ARG P HH12 7  
ATOM 7933  H HH21 . ARG A 1 48 ? 1.932   8.721   7.339   1.00 0.00 ? 46 ARG P HH21 7  
ATOM 7934  H HH22 . ARG A 1 48 ? 2.434   10.315  7.878   1.00 0.00 ? 46 ARG P HH22 7  
ATOM 7935  N N    . VAL A 1 49 ? 5.608   1.731   7.443   1.00 0.00 ? 47 VAL P N    7  
ATOM 7936  C CA   . VAL A 1 49 ? 6.455   0.661   8.004   1.00 0.00 ? 47 VAL P CA   7  
ATOM 7937  C C    . VAL A 1 49 ? 6.876   -0.357  6.933   1.00 0.00 ? 47 VAL P C    7  
ATOM 7938  O O    . VAL A 1 49 ? 8.032   -0.788  6.942   1.00 0.00 ? 47 VAL P O    7  
ATOM 7939  C CB   . VAL A 1 49 ? 5.749   -0.012  9.202   1.00 0.00 ? 47 VAL P CB   7  
ATOM 7940  C CG1  . VAL A 1 49 ? 6.462   -1.274  9.706   1.00 0.00 ? 47 VAL P CG1  7  
ATOM 7941  C CG2  . VAL A 1 49 ? 5.681   0.959   10.390  1.00 0.00 ? 47 VAL P CG2  7  
ATOM 7942  H H    . VAL A 1 49 ? 4.647   1.801   7.761   1.00 0.00 ? 47 VAL P H    7  
ATOM 7943  H HA   . VAL A 1 49 ? 7.376   1.112   8.377   1.00 0.00 ? 47 VAL P HA   7  
ATOM 7944  H HB   . VAL A 1 49 ? 4.735   -0.286  8.913   1.00 0.00 ? 47 VAL P HB   7  
ATOM 7945  H HG11 . VAL A 1 49 ? 6.435   -2.055  8.946   1.00 0.00 ? 47 VAL P HG11 7  
ATOM 7946  H HG12 . VAL A 1 49 ? 7.497   -1.043  9.960   1.00 0.00 ? 47 VAL P HG12 7  
ATOM 7947  H HG13 . VAL A 1 49 ? 5.954   -1.656  10.593  1.00 0.00 ? 47 VAL P HG13 7  
ATOM 7948  H HG21 . VAL A 1 49 ? 5.185   1.884   10.101  1.00 0.00 ? 47 VAL P HG21 7  
ATOM 7949  H HG22 . VAL A 1 49 ? 5.115   0.507   11.205  1.00 0.00 ? 47 VAL P HG22 7  
ATOM 7950  H HG23 . VAL A 1 49 ? 6.687   1.197   10.740  1.00 0.00 ? 47 VAL P HG23 7  
ATOM 7951  N N    . TRP A 1 50 ? 6.008   -0.704  5.975   1.00 0.00 ? 48 TRP P N    7  
ATOM 7952  C CA   . TRP A 1 50 ? 6.375   -1.573  4.847   1.00 0.00 ? 48 TRP P CA   7  
ATOM 7953  C C    . TRP A 1 50 ? 7.455   -0.939  3.963   1.00 0.00 ? 48 TRP P C    7  
ATOM 7954  O O    . TRP A 1 50 ? 8.470   -1.581  3.707   1.00 0.00 ? 48 TRP P O    7  
ATOM 7955  C CB   . TRP A 1 50 ? 5.146   -1.970  4.015   1.00 0.00 ? 48 TRP P CB   7  
ATOM 7956  C CG   . TRP A 1 50 ? 5.447   -2.966  2.934   1.00 0.00 ? 48 TRP P CG   7  
ATOM 7957  C CD1  . TRP A 1 50 ? 5.330   -4.308  3.057   1.00 0.00 ? 48 TRP P CD1  7  
ATOM 7958  C CD2  . TRP A 1 50 ? 5.964   -2.736  1.580   1.00 0.00 ? 48 TRP P CD2  7  
ATOM 7959  N NE1  . TRP A 1 50 ? 5.744   -4.922  1.891   1.00 0.00 ? 48 TRP P NE1  7  
ATOM 7960  C CE2  . TRP A 1 50 ? 6.161   -4.004  0.951   1.00 0.00 ? 48 TRP P CE2  7  
ATOM 7961  C CE3  . TRP A 1 50 ? 6.293   -1.592  0.817   1.00 0.00 ? 48 TRP P CE3  7  
ATOM 7962  C CZ2  . TRP A 1 50 ? 6.671   -4.133  -0.351  1.00 0.00 ? 48 TRP P CZ2  7  
ATOM 7963  C CZ3  . TRP A 1 50 ? 6.806   -1.708  -0.489  1.00 0.00 ? 48 TRP P CZ3  7  
ATOM 7964  C CH2  . TRP A 1 50 ? 6.999   -2.973  -1.074  1.00 0.00 ? 48 TRP P CH2  7  
ATOM 7965  H H    . TRP A 1 50 ? 5.051   -0.375  6.038   1.00 0.00 ? 48 TRP P H    7  
ATOM 7966  H HA   . TRP A 1 50 ? 6.799   -2.493  5.254   1.00 0.00 ? 48 TRP P HA   7  
ATOM 7967  H HB2  . TRP A 1 50 ? 4.392   -2.395  4.679   1.00 0.00 ? 48 TRP P HB2  7  
ATOM 7968  H HB3  . TRP A 1 50 ? 4.716   -1.084  3.550   1.00 0.00 ? 48 TRP P HB3  7  
ATOM 7969  H HD1  . TRP A 1 50 ? 4.980   -4.822  3.947   1.00 0.00 ? 48 TRP P HD1  7  
ATOM 7970  H HE1  . TRP A 1 50 ? 5.744   -5.927  1.766   1.00 0.00 ? 48 TRP P HE1  7  
ATOM 7971  H HE3  . TRP A 1 50 ? 6.137   -0.611  1.241   1.00 0.00 ? 48 TRP P HE3  7  
ATOM 7972  H HZ2  . TRP A 1 50 ? 6.796   -5.111  -0.794  1.00 0.00 ? 48 TRP P HZ2  7  
ATOM 7973  H HZ3  . TRP A 1 50 ? 7.041   -0.815  -1.054  1.00 0.00 ? 48 TRP P HZ3  7  
ATOM 7974  H HH2  . TRP A 1 50 ? 7.384   -3.048  -2.083  1.00 0.00 ? 48 TRP P HH2  7  
ATOM 7975  N N    . PHE A 1 51 ? 7.306   0.330   3.560   1.00 0.00 ? 49 PHE P N    7  
ATOM 7976  C CA   . PHE A 1 51 ? 8.322   1.038   2.766   1.00 0.00 ? 49 PHE P CA   7  
ATOM 7977  C C    . PHE A 1 51 ? 9.647   1.206   3.529   1.00 0.00 ? 49 PHE P C    7  
ATOM 7978  O O    . PHE A 1 51 ? 10.717  1.042   2.936   1.00 0.00 ? 49 PHE P O    7  
ATOM 7979  C CB   . PHE A 1 51 ? 7.783   2.391   2.274   1.00 0.00 ? 49 PHE P CB   7  
ATOM 7980  C CG   . PHE A 1 51 ? 6.995   2.304   0.979   1.00 0.00 ? 49 PHE P CG   7  
ATOM 7981  C CD1  . PHE A 1 51 ? 7.673   2.196   -0.252  1.00 0.00 ? 49 PHE P CD1  7  
ATOM 7982  C CD2  . PHE A 1 51 ? 5.588   2.326   0.993   1.00 0.00 ? 49 PHE P CD2  7  
ATOM 7983  C CE1  . PHE A 1 51 ? 6.949   2.095   -1.454  1.00 0.00 ? 49 PHE P CE1  7  
ATOM 7984  C CE2  . PHE A 1 51 ? 4.864   2.216   -0.207  1.00 0.00 ? 49 PHE P CE2  7  
ATOM 7985  C CZ   . PHE A 1 51 ? 5.544   2.091   -1.428  1.00 0.00 ? 49 PHE P CZ   7  
ATOM 7986  H H    . PHE A 1 51 ? 6.440   0.809   3.790   1.00 0.00 ? 49 PHE P H    7  
ATOM 7987  H HA   . PHE A 1 51 ? 8.550   0.435   1.887   1.00 0.00 ? 49 PHE P HA   7  
ATOM 7988  H HB2  . PHE A 1 51 ? 7.173   2.849   3.055   1.00 0.00 ? 49 PHE P HB2  7  
ATOM 7989  H HB3  . PHE A 1 51 ? 8.627   3.059   2.093   1.00 0.00 ? 49 PHE P HB3  7  
ATOM 7990  H HD1  . PHE A 1 51 ? 8.754   2.190   -0.275  1.00 0.00 ? 49 PHE P HD1  7  
ATOM 7991  H HD2  . PHE A 1 51 ? 5.062   2.423   1.928   1.00 0.00 ? 49 PHE P HD2  7  
ATOM 7992  H HE1  . PHE A 1 51 ? 7.470   2.018   -2.398  1.00 0.00 ? 49 PHE P HE1  7  
ATOM 7993  H HE2  . PHE A 1 51 ? 3.783   2.224   -0.192  1.00 0.00 ? 49 PHE P HE2  7  
ATOM 7994  H HZ   . PHE A 1 51 ? 4.984   2.001   -2.347  1.00 0.00 ? 49 PHE P HZ   7  
ATOM 7995  N N    . LYS A 1 52 ? 9.598   1.447   4.849   1.00 0.00 ? 50 LYS P N    7  
ATOM 7996  C CA   . LYS A 1 52 ? 10.789  1.481   5.715   1.00 0.00 ? 50 LYS P CA   7  
ATOM 7997  C C    . LYS A 1 52 ? 11.522  0.134   5.722   1.00 0.00 ? 50 LYS P C    7  
ATOM 7998  O O    . LYS A 1 52 ? 12.732  0.101   5.504   1.00 0.00 ? 50 LYS P O    7  
ATOM 7999  C CB   . LYS A 1 52 ? 10.380  1.940   7.126   1.00 0.00 ? 50 LYS P CB   7  
ATOM 8000  C CG   . LYS A 1 52 ? 11.594  2.153   8.044   1.00 0.00 ? 50 LYS P CG   7  
ATOM 8001  C CD   . LYS A 1 52 ? 11.163  2.683   9.418   1.00 0.00 ? 50 LYS P CD   7  
ATOM 8002  C CE   . LYS A 1 52 ? 12.394  2.892   10.309  1.00 0.00 ? 50 LYS P CE   7  
ATOM 8003  N NZ   . LYS A 1 52 ? 12.019  3.419   11.649  1.00 0.00 ? 50 LYS P NZ   7  
ATOM 8004  H H    . LYS A 1 52 ? 8.689   1.627   5.266   1.00 0.00 ? 50 LYS P H    7  
ATOM 8005  H HA   . LYS A 1 52 ? 11.489  2.214   5.307   1.00 0.00 ? 50 LYS P HA   7  
ATOM 8006  H HB2  . LYS A 1 52 ? 9.839   2.884   7.044   1.00 0.00 ? 50 LYS P HB2  7  
ATOM 8007  H HB3  . LYS A 1 52 ? 9.716   1.201   7.576   1.00 0.00 ? 50 LYS P HB3  7  
ATOM 8008  H HG2  . LYS A 1 52 ? 12.120  1.206   8.181   1.00 0.00 ? 50 LYS P HG2  7  
ATOM 8009  H HG3  . LYS A 1 52 ? 12.272  2.870   7.580   1.00 0.00 ? 50 LYS P HG3  7  
ATOM 8010  H HD2  . LYS A 1 52 ? 10.639  3.633   9.290   1.00 0.00 ? 50 LYS P HD2  7  
ATOM 8011  H HD3  . LYS A 1 52 ? 10.488  1.965   9.887   1.00 0.00 ? 50 LYS P HD3  7  
ATOM 8012  H HE2  . LYS A 1 52 ? 12.916  1.937   10.417  1.00 0.00 ? 50 LYS P HE2  7  
ATOM 8013  H HE3  . LYS A 1 52 ? 13.073  3.591   9.812   1.00 0.00 ? 50 LYS P HE3  7  
ATOM 8014  H HZ1  . LYS A 1 52 ? 11.404  2.782   12.137  1.00 0.00 ? 50 LYS P HZ1  7  
ATOM 8015  H HZ2  . LYS A 1 52 ? 11.549  4.311   11.575  1.00 0.00 ? 50 LYS P HZ2  7  
ATOM 8016  H HZ3  . LYS A 1 52 ? 12.838  3.553   12.227  1.00 0.00 ? 50 LYS P HZ3  7  
ATOM 8017  N N    . ASN A 1 53 ? 10.800  -0.977  5.889   1.00 0.00 ? 51 ASN P N    7  
ATOM 8018  C CA   . ASN A 1 53 ? 11.371  -2.330  5.831   1.00 0.00 ? 51 ASN P CA   7  
ATOM 8019  C C    . ASN A 1 53 ? 11.908  -2.671  4.431   1.00 0.00 ? 51 ASN P C    7  
ATOM 8020  O O    . ASN A 1 53 ? 13.026  -3.173  4.313   1.00 0.00 ? 51 ASN P O    7  
ATOM 8021  C CB   . ASN A 1 53 ? 10.327  -3.364  6.294   1.00 0.00 ? 51 ASN P CB   7  
ATOM 8022  C CG   . ASN A 1 53 ? 10.292  -3.506  7.805   1.00 0.00 ? 51 ASN P CG   7  
ATOM 8023  O OD1  . ASN A 1 53 ? 10.966  -4.345  8.384   1.00 0.00 ? 51 ASN P OD1  7  
ATOM 8024  N ND2  . ASN A 1 53 ? 9.532   -2.685  8.491   1.00 0.00 ? 51 ASN P ND2  7  
ATOM 8025  H H    . ASN A 1 53 ? 9.804   -0.873  6.049   1.00 0.00 ? 51 ASN P H    7  
ATOM 8026  H HA   . ASN A 1 53 ? 12.228  -2.381  6.508   1.00 0.00 ? 51 ASN P HA   7  
ATOM 8027  H HB2  . ASN A 1 53 ? 9.337   -3.107  5.919   1.00 0.00 ? 51 ASN P HB2  7  
ATOM 8028  H HB3  . ASN A 1 53 ? 10.588  -4.342  5.887   1.00 0.00 ? 51 ASN P HB3  7  
ATOM 8029  H HD21 . ASN A 1 53 ? 8.973   -1.991  8.006   1.00 0.00 ? 51 ASN P HD21 7  
ATOM 8030  H HD22 . ASN A 1 53 ? 9.509   -2.778  9.494   1.00 0.00 ? 51 ASN P HD22 7  
ATOM 8031  N N    . ARG A 1 54 ? 11.158  -2.349  3.370   1.00 0.00 ? 52 ARG P N    7  
ATOM 8032  C CA   . ARG A 1 54 ? 11.538  -2.566  1.964   1.00 0.00 ? 52 ARG P CA   7  
ATOM 8033  C C    . ARG A 1 54 ? 12.863  -1.879  1.627   1.00 0.00 ? 52 ARG P C    7  
ATOM 8034  O O    . ARG A 1 54 ? 13.746  -2.515  1.053   1.00 0.00 ? 52 ARG P O    7  
ATOM 8035  C CB   . ARG A 1 54 ? 10.381  -2.072  1.070   1.00 0.00 ? 52 ARG P CB   7  
ATOM 8036  C CG   . ARG A 1 54 ? 10.587  -2.267  -0.439  1.00 0.00 ? 52 ARG P CG   7  
ATOM 8037  C CD   . ARG A 1 54 ? 10.568  -3.738  -0.864  1.00 0.00 ? 52 ARG P CD   7  
ATOM 8038  N NE   . ARG A 1 54 ? 10.680  -3.861  -2.329  1.00 0.00 ? 52 ARG P NE   7  
ATOM 8039  C CZ   . ARG A 1 54 ? 10.301  -4.889  -3.065  1.00 0.00 ? 52 ARG P CZ   7  
ATOM 8040  N NH1  . ARG A 1 54 ? 9.730   -5.951  -2.579  1.00 0.00 ? 52 ARG P NH1  7  
ATOM 8041  N NH2  . ARG A 1 54 ? 10.484  -4.904  -4.348  1.00 0.00 ? 52 ARG P NH2  7  
ATOM 8042  H H    . ARG A 1 54 ? 10.234  -1.967  3.553   1.00 0.00 ? 52 ARG P H    7  
ATOM 8043  H HA   . ARG A 1 54 ? 11.683  -3.635  1.804   1.00 0.00 ? 52 ARG P HA   7  
ATOM 8044  H HB2  . ARG A 1 54 ? 9.461   -2.585  1.359   1.00 0.00 ? 52 ARG P HB2  7  
ATOM 8045  H HB3  . ARG A 1 54 ? 10.233  -1.008  1.246   1.00 0.00 ? 52 ARG P HB3  7  
ATOM 8046  H HG2  . ARG A 1 54 ? 9.776   -1.752  -0.956  1.00 0.00 ? 52 ARG P HG2  7  
ATOM 8047  H HG3  . ARG A 1 54 ? 11.529  -1.813  -0.744  1.00 0.00 ? 52 ARG P HG3  7  
ATOM 8048  H HD2  . ARG A 1 54 ? 11.402  -4.261  -0.394  1.00 0.00 ? 52 ARG P HD2  7  
ATOM 8049  H HD3  . ARG A 1 54 ? 9.633   -4.183  -0.519  1.00 0.00 ? 52 ARG P HD3  7  
ATOM 8050  H HE   . ARG A 1 54 ? 11.089  -3.080  -2.823  1.00 0.00 ? 52 ARG P HE   7  
ATOM 8051  H HH11 . ARG A 1 54 ? 9.576   -6.041  -1.593  1.00 0.00 ? 52 ARG P HH11 7  
ATOM 8052  H HH12 . ARG A 1 54 ? 9.465   -6.683  -3.237  1.00 0.00 ? 52 ARG P HH12 7  
ATOM 8053  H HH21 . ARG A 1 54 ? 10.952  -4.149  -4.817  1.00 0.00 ? 52 ARG P HH21 7  
ATOM 8054  H HH22 . ARG A 1 54 ? 10.168  -5.734  -4.847  1.00 0.00 ? 52 ARG P HH22 7  
ATOM 8055  N N    . ARG A 1 55 ? 13.038  -0.616  2.039   1.00 0.00 ? 53 ARG P N    7  
ATOM 8056  C CA   . ARG A 1 55 ? 14.285  0.148   1.845   1.00 0.00 ? 53 ARG P CA   7  
ATOM 8057  C C    . ARG A 1 55 ? 15.425  -0.361  2.732   1.00 0.00 ? 53 ARG P C    7  
ATOM 8058  O O    . ARG A 1 55 ? 16.537  -0.540  2.236   1.00 0.00 ? 53 ARG P O    7  
ATOM 8059  C CB   . ARG A 1 55 ? 14.003  1.644   2.061   1.00 0.00 ? 53 ARG P CB   7  
ATOM 8060  C CG   . ARG A 1 55 ? 15.170  2.514   1.568   1.00 0.00 ? 53 ARG P CG   7  
ATOM 8061  C CD   . ARG A 1 55 ? 14.852  4.005   1.734   1.00 0.00 ? 53 ARG P CD   7  
ATOM 8062  N NE   . ARG A 1 55 ? 15.885  4.852   1.101   1.00 0.00 ? 53 ARG P NE   7  
ATOM 8063  C CZ   . ARG A 1 55 ? 15.951  5.199   -0.173  1.00 0.00 ? 53 ARG P CZ   7  
ATOM 8064  N NH1  . ARG A 1 55 ? 15.093  4.781   -1.058  1.00 0.00 ? 53 ARG P NH1  7  
ATOM 8065  N NH2  . ARG A 1 55 ? 16.887  5.991   -0.604  1.00 0.00 ? 53 ARG P NH2  7  
ATOM 8066  H H    . ARG A 1 55 ? 12.248  -0.155  2.482   1.00 0.00 ? 53 ARG P H    7  
ATOM 8067  H HA   . ARG A 1 55 ? 14.610  0.008   0.813   1.00 0.00 ? 53 ARG P HA   7  
ATOM 8068  H HB2  . ARG A 1 55 ? 13.108  1.919   1.499   1.00 0.00 ? 53 ARG P HB2  7  
ATOM 8069  H HB3  . ARG A 1 55 ? 13.818  1.839   3.119   1.00 0.00 ? 53 ARG P HB3  7  
ATOM 8070  H HG2  . ARG A 1 55 ? 16.075  2.283   2.131   1.00 0.00 ? 53 ARG P HG2  7  
ATOM 8071  H HG3  . ARG A 1 55 ? 15.349  2.300   0.514   1.00 0.00 ? 53 ARG P HG3  7  
ATOM 8072  H HD2  . ARG A 1 55 ? 13.874  4.223   1.301   1.00 0.00 ? 53 ARG P HD2  7  
ATOM 8073  H HD3  . ARG A 1 55 ? 14.800  4.236   2.799   1.00 0.00 ? 53 ARG P HD3  7  
ATOM 8074  H HE   . ARG A 1 55 ? 16.594  5.233   1.708   1.00 0.00 ? 53 ARG P HE   7  
ATOM 8075  H HH11 . ARG A 1 55 ? 14.319  4.211   -0.770  1.00 0.00 ? 53 ARG P HH11 7  
ATOM 8076  H HH12 . ARG A 1 55 ? 15.164  5.119   -2.006  1.00 0.00 ? 53 ARG P HH12 7  
ATOM 8077  H HH21 . ARG A 1 55 ? 17.577  6.364   0.028   1.00 0.00 ? 53 ARG P HH21 7  
ATOM 8078  H HH22 . ARG A 1 55 ? 16.881  6.277   -1.574  1.00 0.00 ? 53 ARG P HH22 7  
ATOM 8079  N N    . ALA A 1 56 ? 15.159  -0.652  4.005   1.00 0.00 ? 54 ALA P N    7  
ATOM 8080  C CA   . ALA A 1 56 ? 16.170  -1.145  4.944   1.00 0.00 ? 54 ALA P CA   7  
ATOM 8081  C C    . ALA A 1 56 ? 16.753  -2.504  4.515   1.00 0.00 ? 54 ALA P C    7  
ATOM 8082  O O    . ALA A 1 56 ? 17.974  -2.654  4.471   1.00 0.00 ? 54 ALA P O    7  
ATOM 8083  C CB   . ALA A 1 56 ? 15.559  -1.208  6.349   1.00 0.00 ? 54 ALA P CB   7  
ATOM 8084  H H    . ALA A 1 56 ? 14.229  -0.459  4.362   1.00 0.00 ? 54 ALA P H    7  
ATOM 8085  H HA   . ALA A 1 56 ? 16.995  -0.431  4.968   1.00 0.00 ? 54 ALA P HA   7  
ATOM 8086  H HB1  . ALA A 1 56 ? 14.712  -1.897  6.363   1.00 0.00 ? 54 ALA P HB1  7  
ATOM 8087  H HB2  . ALA A 1 56 ? 16.311  -1.553  7.060   1.00 0.00 ? 54 ALA P HB2  7  
ATOM 8088  H HB3  . ALA A 1 56 ? 15.221  -0.216  6.651   1.00 0.00 ? 54 ALA P HB3  7  
ATOM 8089  N N    . LYS A 1 57 ? 15.900  -3.466  4.131   1.00 0.00 ? 55 LYS P N    7  
ATOM 8090  C CA   . LYS A 1 57 ? 16.306  -4.814  3.681   1.00 0.00 ? 55 LYS P CA   7  
ATOM 8091  C C    . LYS A 1 57 ? 16.931  -4.824  2.278   1.00 0.00 ? 55 LYS P C    7  
ATOM 8092  O O    . LYS A 1 57 ? 17.692  -5.737  1.955   1.00 0.00 ? 55 LYS P O    7  
ATOM 8093  C CB   . LYS A 1 57 ? 15.110  -5.779  3.772   1.00 0.00 ? 55 LYS P CB   7  
ATOM 8094  C CG   . LYS A 1 57 ? 14.629  -5.979  5.222   1.00 0.00 ? 55 LYS P CG   7  
ATOM 8095  C CD   . LYS A 1 57 ? 13.455  -6.969  5.283   1.00 0.00 ? 55 LYS P CD   7  
ATOM 8096  C CE   . LYS A 1 57 ? 12.765  -7.003  6.655   1.00 0.00 ? 55 LYS P CE   7  
ATOM 8097  N NZ   . LYS A 1 57 ? 13.672  -7.444  7.746   1.00 0.00 ? 55 LYS P NZ   7  
ATOM 8098  H H    . LYS A 1 57 ? 14.904  -3.267  4.195   1.00 0.00 ? 55 LYS P H    7  
ATOM 8099  H HA   . LYS A 1 57 ? 17.085  -5.181  4.351   1.00 0.00 ? 55 LYS P HA   7  
ATOM 8100  H HB2  . LYS A 1 57 ? 14.290  -5.397  3.162   1.00 0.00 ? 55 LYS P HB2  7  
ATOM 8101  H HB3  . LYS A 1 57 ? 15.410  -6.749  3.373   1.00 0.00 ? 55 LYS P HB3  7  
ATOM 8102  H HG2  . LYS A 1 57 ? 15.457  -6.361  5.821   1.00 0.00 ? 55 LYS P HG2  7  
ATOM 8103  H HG3  . LYS A 1 57 ? 14.310  -5.025  5.641   1.00 0.00 ? 55 LYS P HG3  7  
ATOM 8104  H HD2  . LYS A 1 57 ? 12.708  -6.673  4.544   1.00 0.00 ? 55 LYS P HD2  7  
ATOM 8105  H HD3  . LYS A 1 57 ? 13.810  -7.969  5.027   1.00 0.00 ? 55 LYS P HD3  7  
ATOM 8106  H HE2  . LYS A 1 57 ? 12.373  -6.007  6.880   1.00 0.00 ? 55 LYS P HE2  7  
ATOM 8107  H HE3  . LYS A 1 57 ? 11.914  -7.686  6.591   1.00 0.00 ? 55 LYS P HE3  7  
ATOM 8108  H HZ1  . LYS A 1 57 ? 14.428  -6.792  7.885   1.00 0.00 ? 55 LYS P HZ1  7  
ATOM 8109  H HZ2  . LYS A 1 57 ? 14.086  -8.359  7.550   1.00 0.00 ? 55 LYS P HZ2  7  
ATOM 8110  H HZ3  . LYS A 1 57 ? 13.172  -7.526  8.620   1.00 0.00 ? 55 LYS P HZ3  7  
ATOM 8111  N N    . TRP A 1 58 ? 16.661  -3.803  1.458   1.00 0.00 ? 56 TRP P N    7  
ATOM 8112  C CA   . TRP A 1 58 ? 17.352  -3.558  0.184   1.00 0.00 ? 56 TRP P CA   7  
ATOM 8113  C C    . TRP A 1 58 ? 18.773  -3.009  0.407   1.00 0.00 ? 56 TRP P C    7  
ATOM 8114  O O    . TRP A 1 58 ? 19.738  -3.548  -0.144  1.00 0.00 ? 56 TRP P O    7  
ATOM 8115  C CB   . TRP A 1 58 ? 16.504  -2.602  -0.672  1.00 0.00 ? 56 TRP P CB   7  
ATOM 8116  C CG   . TRP A 1 58 ? 17.208  -1.944  -1.820  1.00 0.00 ? 56 TRP P CG   7  
ATOM 8117  C CD1  . TRP A 1 58 ? 17.544  -2.536  -2.989  1.00 0.00 ? 56 TRP P CD1  7  
ATOM 8118  C CD2  . TRP A 1 58 ? 17.684  -0.565  -1.921  1.00 0.00 ? 56 TRP P CD2  7  
ATOM 8119  N NE1  . TRP A 1 58 ? 18.194  -1.623  -3.800  1.00 0.00 ? 56 TRP P NE1  7  
ATOM 8120  C CE2  . TRP A 1 58 ? 18.308  -0.392  -3.192  1.00 0.00 ? 56 TRP P CE2  7  
ATOM 8121  C CE3  . TRP A 1 58 ? 17.646  0.563   -1.069  1.00 0.00 ? 56 TRP P CE3  7  
ATOM 8122  C CZ2  . TRP A 1 58 ? 18.866  0.831   -3.596  1.00 0.00 ? 56 TRP P CZ2  7  
ATOM 8123  C CZ3  . TRP A 1 58 ? 18.203  1.797   -1.463  1.00 0.00 ? 56 TRP P CZ3  7  
ATOM 8124  C CH2  . TRP A 1 58 ? 18.816  1.932   -2.722  1.00 0.00 ? 56 TRP P CH2  7  
ATOM 8125  H H    . TRP A 1 58 ? 15.963  -3.137  1.755   1.00 0.00 ? 56 TRP P H    7  
ATOM 8126  H HA   . TRP A 1 58 ? 17.453  -4.497  -0.363  1.00 0.00 ? 56 TRP P HA   7  
ATOM 8127  H HB2  . TRP A 1 58 ? 15.641  -3.150  -1.055  1.00 0.00 ? 56 TRP P HB2  7  
ATOM 8128  H HB3  . TRP A 1 58 ? 16.122  -1.806  -0.036  1.00 0.00 ? 56 TRP P HB3  7  
ATOM 8129  H HD1  . TRP A 1 58 ? 17.338  -3.570  -3.245  1.00 0.00 ? 56 TRP P HD1  7  
ATOM 8130  H HE1  . TRP A 1 58 ? 18.542  -1.852  -4.727  1.00 0.00 ? 56 TRP P HE1  7  
ATOM 8131  H HE3  . TRP A 1 58 ? 17.184  0.470   -0.096  1.00 0.00 ? 56 TRP P HE3  7  
ATOM 8132  H HZ2  . TRP A 1 58 ? 19.346  0.916   -4.562  1.00 0.00 ? 56 TRP P HZ2  7  
ATOM 8133  H HZ3  . TRP A 1 58 ? 18.166  2.644   -0.789  1.00 0.00 ? 56 TRP P HZ3  7  
ATOM 8134  H HH2  . TRP A 1 58 ? 19.255  2.879   -3.012  1.00 0.00 ? 56 TRP P HH2  7  
ATOM 8135  N N    . ARG A 1 59 ? 18.919  -1.975  1.248   1.00 0.00 ? 57 ARG P N    7  
ATOM 8136  C CA   . ARG A 1 59 ? 20.193  -1.269  1.480   1.00 0.00 ? 57 ARG P CA   7  
ATOM 8137  C C    . ARG A 1 59 ? 21.168  -2.040  2.382   1.00 0.00 ? 57 ARG P C    7  
ATOM 8138  O O    . ARG A 1 59 ? 22.379  -1.974  2.163   1.00 0.00 ? 57 ARG P O    7  
ATOM 8139  C CB   . ARG A 1 59 ? 19.876  0.131   2.033   1.00 0.00 ? 57 ARG P CB   7  
ATOM 8140  C CG   . ARG A 1 59 ? 21.098  1.061   2.026   1.00 0.00 ? 57 ARG P CG   7  
ATOM 8141  C CD   . ARG A 1 59 ? 20.696  2.492   2.408   1.00 0.00 ? 57 ARG P CD   7  
ATOM 8142  N NE   . ARG A 1 59 ? 21.853  3.409   2.389   1.00 0.00 ? 57 ARG P NE   7  
ATOM 8143  C CZ   . ARG A 1 59 ? 22.380  4.018   1.339   1.00 0.00 ? 57 ARG P CZ   7  
ATOM 8144  N NH1  . ARG A 1 59 ? 21.920  3.852   0.130   1.00 0.00 ? 57 ARG P NH1  7  
ATOM 8145  N NH2  . ARG A 1 59 ? 23.396  4.818   1.487   1.00 0.00 ? 57 ARG P NH2  7  
ATOM 8146  H H    . ARG A 1 59 ? 18.076  -1.583  1.659   1.00 0.00 ? 57 ARG P H    7  
ATOM 8147  H HA   . ARG A 1 59 ? 20.694  -1.149  0.516   1.00 0.00 ? 57 ARG P HA   7  
ATOM 8148  H HB2  . ARG A 1 59 ? 19.103  0.585   1.411   1.00 0.00 ? 57 ARG P HB2  7  
ATOM 8149  H HB3  . ARG A 1 59 ? 19.488  0.047   3.050   1.00 0.00 ? 57 ARG P HB3  7  
ATOM 8150  H HG2  . ARG A 1 59 ? 21.842  0.700   2.736   1.00 0.00 ? 57 ARG P HG2  7  
ATOM 8151  H HG3  . ARG A 1 59 ? 21.537  1.067   1.027   1.00 0.00 ? 57 ARG P HG3  7  
ATOM 8152  H HD2  . ARG A 1 59 ? 19.921  2.849   1.726   1.00 0.00 ? 57 ARG P HD2  7  
ATOM 8153  H HD3  . ARG A 1 59 ? 20.269  2.477   3.413   1.00 0.00 ? 57 ARG P HD3  7  
ATOM 8154  H HE   . ARG A 1 59 ? 22.284  3.610   3.279   1.00 0.00 ? 57 ARG P HE   7  
ATOM 8155  H HH11 . ARG A 1 59 ? 21.144  3.232   -0.020  1.00 0.00 ? 57 ARG P HH11 7  
ATOM 8156  H HH12 . ARG A 1 59 ? 22.345  4.328   -0.648  1.00 0.00 ? 57 ARG P HH12 7  
ATOM 8157  H HH21 . ARG A 1 59 ? 23.788  4.979   2.401   1.00 0.00 ? 57 ARG P HH21 7  
ATOM 8158  H HH22 . ARG A 1 59 ? 23.799  5.281   0.689   1.00 0.00 ? 57 ARG P HH22 7  
ATOM 8159  N N    . LYS A 1 60 ? 20.651  -2.771  3.375   1.00 0.00 ? 58 LYS P N    7  
ATOM 8160  C CA   . LYS A 1 60 ? 21.404  -3.532  4.392   1.00 0.00 ? 58 LYS P CA   7  
ATOM 8161  C C    . LYS A 1 60 ? 20.797  -4.922  4.625   1.00 0.00 ? 58 LYS P C    7  
ATOM 8162  O O    . LYS A 1 60 ? 19.673  -5.203  4.208   1.00 0.00 ? 58 LYS P O    7  
ATOM 8163  C CB   . LYS A 1 60 ? 21.435  -2.738  5.716   1.00 0.00 ? 58 LYS P CB   7  
ATOM 8164  C CG   . LYS A 1 60 ? 22.170  -1.392  5.602   1.00 0.00 ? 58 LYS P CG   7  
ATOM 8165  C CD   . LYS A 1 60 ? 22.278  -0.706  6.970   1.00 0.00 ? 58 LYS P CD   7  
ATOM 8166  C CE   . LYS A 1 60 ? 23.018  0.631   6.833   1.00 0.00 ? 58 LYS P CE   7  
ATOM 8167  N NZ   . LYS A 1 60 ? 23.160  1.313   8.146   1.00 0.00 ? 58 LYS P NZ   7  
ATOM 8168  H H    . LYS A 1 60 ? 19.641  -2.759  3.474   1.00 0.00 ? 58 LYS P H    7  
ATOM 8169  H HA   . LYS A 1 60 ? 22.431  -3.684  4.052   1.00 0.00 ? 58 LYS P HA   7  
ATOM 8170  H HB2  . LYS A 1 60 ? 20.412  -2.561  6.053   1.00 0.00 ? 58 LYS P HB2  7  
ATOM 8171  H HB3  . LYS A 1 60 ? 21.938  -3.339  6.475   1.00 0.00 ? 58 LYS P HB3  7  
ATOM 8172  H HG2  . LYS A 1 60 ? 23.173  -1.564  5.207   1.00 0.00 ? 58 LYS P HG2  7  
ATOM 8173  H HG3  . LYS A 1 60 ? 21.628  -0.735  4.921   1.00 0.00 ? 58 LYS P HG3  7  
ATOM 8174  H HD2  . LYS A 1 60 ? 21.275  -0.530  7.365   1.00 0.00 ? 58 LYS P HD2  7  
ATOM 8175  H HD3  . LYS A 1 60 ? 22.823  -1.355  7.657   1.00 0.00 ? 58 LYS P HD3  7  
ATOM 8176  H HE2  . LYS A 1 60 ? 24.006  0.443   6.402   1.00 0.00 ? 58 LYS P HE2  7  
ATOM 8177  H HE3  . LYS A 1 60 ? 22.465  1.270   6.138   1.00 0.00 ? 58 LYS P HE3  7  
ATOM 8178  H HZ1  . LYS A 1 60 ? 23.650  2.194   8.047   1.00 0.00 ? 58 LYS P HZ1  7  
ATOM 8179  H HZ2  . LYS A 1 60 ? 23.685  0.747   8.800   1.00 0.00 ? 58 LYS P HZ2  7  
ATOM 8180  H HZ3  . LYS A 1 60 ? 22.259  1.511   8.560   1.00 0.00 ? 58 LYS P HZ3  7  
ATOM 8181  N N    . ARG A 1 61 ? 21.537  -5.797  5.312   1.00 0.00 ? 59 ARG P N    7  
ATOM 8182  C CA   . ARG A 1 61 ? 21.040  -7.094  5.815   1.00 0.00 ? 59 ARG P CA   7  
ATOM 8183  C C    . ARG A 1 61 ? 20.493  -6.955  7.242   1.00 0.00 ? 59 ARG P C    7  
ATOM 8184  O O    . ARG A 1 61 ? 20.870  -6.042  7.976   1.00 0.00 ? 59 ARG P O    7  
ATOM 8185  C CB   . ARG A 1 61 ? 22.138  -8.170  5.705   1.00 0.00 ? 59 ARG P CB   7  
ATOM 8186  C CG   . ARG A 1 61 ? 22.727  -8.378  4.294   1.00 0.00 ? 59 ARG P CG   7  
ATOM 8187  C CD   . ARG A 1 61 ? 21.727  -8.844  3.218   1.00 0.00 ? 59 ARG P CD   7  
ATOM 8188  N NE   . ARG A 1 61 ? 20.920  -7.745  2.642   1.00 0.00 ? 59 ARG P NE   7  
ATOM 8189  C CZ   . ARG A 1 61 ? 21.269  -6.896  1.691   1.00 0.00 ? 59 ARG P CZ   7  
ATOM 8190  N NH1  . ARG A 1 61 ? 22.449  -6.904  1.138   1.00 0.00 ? 59 ARG P NH1  7  
ATOM 8191  N NH2  . ARG A 1 61 ? 20.419  -6.005  1.281   1.00 0.00 ? 59 ARG P NH2  7  
ATOM 8192  H H    . ARG A 1 61 ? 22.444  -5.487  5.628   1.00 0.00 ? 59 ARG P H    7  
ATOM 8193  H HA   . ARG A 1 61 ? 20.196  -7.415  5.205   1.00 0.00 ? 59 ARG P HA   7  
ATOM 8194  H HB2  . ARG A 1 61 ? 22.956  -7.902  6.377   1.00 0.00 ? 59 ARG P HB2  7  
ATOM 8195  H HB3  . ARG A 1 61 ? 21.732  -9.123  6.049   1.00 0.00 ? 59 ARG P HB3  7  
ATOM 8196  H HG2  . ARG A 1 61 ? 23.224  -7.466  3.962   1.00 0.00 ? 59 ARG P HG2  7  
ATOM 8197  H HG3  . ARG A 1 61 ? 23.495  -9.148  4.380   1.00 0.00 ? 59 ARG P HG3  7  
ATOM 8198  H HD2  . ARG A 1 61 ? 22.282  -9.337  2.418   1.00 0.00 ? 59 ARG P HD2  7  
ATOM 8199  H HD3  . ARG A 1 61 ? 21.063  -9.595  3.655   1.00 0.00 ? 59 ARG P HD3  7  
ATOM 8200  H HE   . ARG A 1 61 ? 19.978  -7.639  2.986   1.00 0.00 ? 59 ARG P HE   7  
ATOM 8201  H HH11 . ARG A 1 61 ? 23.125  -7.587  1.428   1.00 0.00 ? 59 ARG P HH11 7  
ATOM 8202  H HH12 . ARG A 1 61 ? 22.674  -6.248  0.408   1.00 0.00 ? 59 ARG P HH12 7  
ATOM 8203  H HH21 . ARG A 1 61 ? 19.489  -5.974  1.690   1.00 0.00 ? 59 ARG P HH21 7  
ATOM 8204  H HH22 . ARG A 1 61 ? 20.654  -5.334  0.565   1.00 0.00 ? 59 ARG P HH22 7  
ATOM 8205  N N    . GLU A 1 62 ? 19.597  -7.860  7.632   1.00 0.00 ? 60 GLU P N    7  
ATOM 8206  C CA   . GLU A 1 62 ? 18.875  -7.809  8.918   1.00 0.00 ? 60 GLU P CA   7  
ATOM 8207  C C    . GLU A 1 62 ? 19.637  -8.413  10.119  1.00 0.00 ? 60 GLU P C    7  
ATOM 8208  O O    . GLU A 1 62 ? 19.177  -8.312  11.259  1.00 0.00 ? 60 GLU P O    7  
ATOM 8209  C CB   . GLU A 1 62 ? 17.465  -8.400  8.754   1.00 0.00 ? 60 GLU P CB   7  
ATOM 8210  C CG   . GLU A 1 62 ? 17.443  -9.887  8.360   1.00 0.00 ? 60 GLU P CG   7  
ATOM 8211  C CD   . GLU A 1 62 ? 16.003  -10.437 8.307   1.00 0.00 ? 60 GLU P CD   7  
ATOM 8212  O OE1  . GLU A 1 62 ? 15.127  -9.798  7.672   1.00 0.00 ? 60 GLU P OE1  7  
ATOM 8213  O OE2  . GLU A 1 62 ? 15.736  -11.513 8.897   1.00 0.00 ? 60 GLU P OE2  7  
ATOM 8214  H H    . GLU A 1 62 ? 19.337  -8.577  6.973   1.00 0.00 ? 60 GLU P H    7  
ATOM 8215  H HA   . GLU A 1 62 ? 18.730  -6.758  9.175   1.00 0.00 ? 60 GLU P HA   7  
ATOM 8216  H HB2  . GLU A 1 62 ? 16.919  -8.277  9.689   1.00 0.00 ? 60 GLU P HB2  7  
ATOM 8217  H HB3  . GLU A 1 62 ? 16.944  -7.825  7.987   1.00 0.00 ? 60 GLU P HB3  7  
ATOM 8218  H HG2  . GLU A 1 62 ? 17.911  -10.009 7.380   1.00 0.00 ? 60 GLU P HG2  7  
ATOM 8219  H HG3  . GLU A 1 62 ? 18.031  -10.453 9.086   1.00 0.00 ? 60 GLU P HG3  7  
ATOM 8220  N N    . GLU A 1 63 ? 20.811  -9.011  9.896   1.00 0.00 ? 61 GLU P N    7  
ATOM 8221  C CA   . GLU A 1 63 ? 21.724  -9.447  10.964  1.00 0.00 ? 61 GLU P CA   7  
ATOM 8222  C C    . GLU A 1 63 ? 22.414  -8.239  11.636  1.00 0.00 ? 61 GLU P C    7  
ATOM 8223  O O    . GLU A 1 63 ? 22.840  -7.299  10.958  1.00 0.00 ? 61 GLU P O    7  
ATOM 8224  C CB   . GLU A 1 63 ? 22.742  -10.448 10.388  1.00 0.00 ? 61 GLU P CB   7  
ATOM 8225  C CG   . GLU A 1 63 ? 23.639  -11.073 11.465  1.00 0.00 ? 61 GLU P CG   7  
ATOM 8226  C CD   . GLU A 1 63 ? 24.557  -12.153 10.859  1.00 0.00 ? 61 GLU P CD   7  
ATOM 8227  O OE1  . GLU A 1 63 ? 25.666  -11.815 10.376  1.00 0.00 ? 61 GLU P OE1  7  
ATOM 8228  O OE2  . GLU A 1 63 ? 24.180  -13.352 10.868  1.00 0.00 ? 61 GLU P OE2  7  
ATOM 8229  H H    . GLU A 1 63 ? 21.143  -9.056  8.944   1.00 0.00 ? 61 GLU P H    7  
ATOM 8230  H HA   . GLU A 1 63 ? 21.140  -9.969  11.725  1.00 0.00 ? 61 GLU P HA   7  
ATOM 8231  H HB2  . GLU A 1 63 ? 22.194  -11.248 9.888   1.00 0.00 ? 61 GLU P HB2  7  
ATOM 8232  H HB3  . GLU A 1 63 ? 23.364  -9.945  9.648   1.00 0.00 ? 61 GLU P HB3  7  
ATOM 8233  H HG2  . GLU A 1 63 ? 24.247  -10.293 11.929  1.00 0.00 ? 61 GLU P HG2  7  
ATOM 8234  H HG3  . GLU A 1 63 ? 23.009  -11.510 12.242  1.00 0.00 ? 61 GLU P HG3  7  
ATOM 8235  N N    . PHE A 1 64 ? 22.536  -8.263  12.969  1.00 0.00 ? 62 PHE P N    7  
ATOM 8236  C CA   . PHE A 1 64 ? 23.100  -7.172  13.779  1.00 0.00 ? 62 PHE P CA   7  
ATOM 8237  C C    . PHE A 1 64 ? 23.934  -7.681  14.970  1.00 0.00 ? 62 PHE P C    7  
ATOM 8238  O O    . PHE A 1 64 ? 23.898  -8.865  15.320  1.00 0.00 ? 62 PHE P O    7  
ATOM 8239  C CB   . PHE A 1 64 ? 21.962  -6.244  14.248  1.00 0.00 ? 62 PHE P CB   7  
ATOM 8240  C CG   . PHE A 1 64 ? 21.050  -6.828  15.315  1.00 0.00 ? 62 PHE P CG   7  
ATOM 8241  C CD1  . PHE A 1 64 ? 19.954  -7.634  14.949  1.00 0.00 ? 62 PHE P CD1  7  
ATOM 8242  C CD2  . PHE A 1 64 ? 21.297  -6.568  16.679  1.00 0.00 ? 62 PHE P CD2  7  
ATOM 8243  C CE1  . PHE A 1 64 ? 19.118  -8.183  15.938  1.00 0.00 ? 62 PHE P CE1  7  
ATOM 8244  C CE2  . PHE A 1 64 ? 20.461  -7.118  17.667  1.00 0.00 ? 62 PHE P CE2  7  
ATOM 8245  C CZ   . PHE A 1 64 ? 19.372  -7.928  17.297  1.00 0.00 ? 62 PHE P CZ   7  
ATOM 8246  H H    . PHE A 1 64 ? 22.203  -9.075  13.470  1.00 0.00 ? 62 PHE P H    7  
ATOM 8247  H HA   . PHE A 1 64 ? 23.772  -6.581  13.154  1.00 0.00 ? 62 PHE P HA   7  
ATOM 8248  H HB2  . PHE A 1 64 ? 22.404  -5.325  14.638  1.00 0.00 ? 62 PHE P HB2  7  
ATOM 8249  H HB3  . PHE A 1 64 ? 21.359  -5.957  13.386  1.00 0.00 ? 62 PHE P HB3  7  
ATOM 8250  H HD1  . PHE A 1 64 ? 19.752  -7.832  13.905  1.00 0.00 ? 62 PHE P HD1  7  
ATOM 8251  H HD2  . PHE A 1 64 ? 22.131  -5.944  16.970  1.00 0.00 ? 62 PHE P HD2  7  
ATOM 8252  H HE1  . PHE A 1 64 ? 18.278  -8.804  15.652  1.00 0.00 ? 62 PHE P HE1  7  
ATOM 8253  H HE2  . PHE A 1 64 ? 20.655  -6.918  18.713  1.00 0.00 ? 62 PHE P HE2  7  
ATOM 8254  H HZ   . PHE A 1 64 ? 18.728  -8.350  18.058  1.00 0.00 ? 62 PHE P HZ   7  
ATOM 8255  N N    . ILE A 1 65 ? 24.676  -6.768  15.605  1.00 0.00 ? 63 ILE P N    7  
ATOM 8256  C CA   . ILE A 1 65 ? 25.466  -6.997  16.827  1.00 0.00 ? 63 ILE P CA   7  
ATOM 8257  C C    . ILE A 1 65 ? 25.377  -5.775  17.763  1.00 0.00 ? 63 ILE P C    7  
ATOM 8258  O O    . ILE A 1 65 ? 25.136  -4.652  17.314  1.00 0.00 ? 63 ILE P O    7  
ATOM 8259  C CB   . ILE A 1 65 ? 26.921  -7.384  16.450  1.00 0.00 ? 63 ILE P CB   7  
ATOM 8260  C CG1  . ILE A 1 65 ? 27.787  -7.870  17.634  1.00 0.00 ? 63 ILE P CG1  7  
ATOM 8261  C CG2  . ILE A 1 65 ? 27.659  -6.238  15.734  1.00 0.00 ? 63 ILE P CG2  7  
ATOM 8262  C CD1  . ILE A 1 65 ? 27.226  -9.100  18.359  1.00 0.00 ? 63 ILE P CD1  7  
ATOM 8263  H H    . ILE A 1 65 ? 24.645  -5.818  15.262  1.00 0.00 ? 63 ILE P H    7  
ATOM 8264  H HA   . ILE A 1 65 ? 25.018  -7.837  17.356  1.00 0.00 ? 63 ILE P HA   7  
ATOM 8265  H HB   . ILE A 1 65 ? 26.862  -8.215  15.745  1.00 0.00 ? 63 ILE P HB   7  
ATOM 8266  H HG12 . ILE A 1 65 ? 28.773  -8.137  17.251  1.00 0.00 ? 63 ILE P HG12 7  
ATOM 8267  H HG13 . ILE A 1 65 ? 27.926  -7.067  18.356  1.00 0.00 ? 63 ILE P HG13 7  
ATOM 8268  H HG21 . ILE A 1 65 ? 28.651  -6.574  15.427  1.00 0.00 ? 63 ILE P HG21 7  
ATOM 8269  H HG22 . ILE A 1 65 ? 27.114  -5.934  14.840  1.00 0.00 ? 63 ILE P HG22 7  
ATOM 8270  H HG23 . ILE A 1 65 ? 27.771  -5.378  16.395  1.00 0.00 ? 63 ILE P HG23 7  
ATOM 8271  H HD11 . ILE A 1 65 ? 27.052  -9.905  17.644  1.00 0.00 ? 63 ILE P HD11 7  
ATOM 8272  H HD12 . ILE A 1 65 ? 27.949  -9.439  19.102  1.00 0.00 ? 63 ILE P HD12 7  
ATOM 8273  H HD13 . ILE A 1 65 ? 26.294  -8.859  18.869  1.00 0.00 ? 63 ILE P HD13 7  
ATOM 8274  N N    . VAL A 1 66 ? 25.556  -5.988  19.071  1.00 0.00 ? 64 VAL P N    7  
ATOM 8275  C CA   . VAL A 1 66 ? 25.414  -4.948  20.116  1.00 0.00 ? 64 VAL P CA   7  
ATOM 8276  C C    . VAL A 1 66 ? 26.621  -4.002  20.245  1.00 0.00 ? 64 VAL P C    7  
ATOM 8277  O O    . VAL A 1 66 ? 26.528  -2.976  20.922  1.00 0.00 ? 64 VAL P O    7  
ATOM 8278  C CB   . VAL A 1 66 ? 25.080  -5.577  21.486  1.00 0.00 ? 64 VAL P CB   7  
ATOM 8279  C CG1  . VAL A 1 66 ? 23.738  -6.319  21.441  1.00 0.00 ? 64 VAL P CG1  7  
ATOM 8280  C CG2  . VAL A 1 66 ? 26.164  -6.545  21.985  1.00 0.00 ? 64 VAL P CG2  7  
ATOM 8281  H H    . VAL A 1 66 ? 25.734  -6.934  19.376  1.00 0.00 ? 64 VAL P H    7  
ATOM 8282  H HA   . VAL A 1 66 ? 24.569  -4.315  19.845  1.00 0.00 ? 64 VAL P HA   7  
ATOM 8283  H HB   . VAL A 1 66 ? 24.981  -4.776  22.218  1.00 0.00 ? 64 VAL P HB   7  
ATOM 8284  H HG11 . VAL A 1 66 ? 22.955  -5.643  21.098  1.00 0.00 ? 64 VAL P HG11 7  
ATOM 8285  H HG12 . VAL A 1 66 ? 23.790  -7.178  20.771  1.00 0.00 ? 64 VAL P HG12 7  
ATOM 8286  H HG13 . VAL A 1 66 ? 23.481  -6.669  22.442  1.00 0.00 ? 64 VAL P HG13 7  
ATOM 8287  H HG21 . VAL A 1 66 ? 25.896  -6.908  22.978  1.00 0.00 ? 64 VAL P HG21 7  
ATOM 8288  H HG22 . VAL A 1 66 ? 26.264  -7.399  21.316  1.00 0.00 ? 64 VAL P HG22 7  
ATOM 8289  H HG23 . VAL A 1 66 ? 27.122  -6.030  22.059  1.00 0.00 ? 64 VAL P HG23 7  
ATOM 8290  N N    . THR A 1 67 ? 27.753  -4.324  19.613  1.00 0.00 ? 65 THR P N    7  
ATOM 8291  C CA   . THR A 1 67 ? 29.003  -3.542  19.666  1.00 0.00 ? 65 THR P CA   7  
ATOM 8292  C C    . THR A 1 67 ? 29.001  -2.339  18.711  1.00 0.00 ? 65 THR P C    7  
ATOM 8293  O O    . THR A 1 67 ? 28.367  -2.365  17.652  1.00 0.00 ? 65 THR P O    7  
ATOM 8294  C CB   . THR A 1 67 ? 30.229  -4.434  19.392  1.00 0.00 ? 65 THR P CB   7  
ATOM 8295  O OG1  . THR A 1 67 ? 30.069  -5.186  18.205  1.00 0.00 ? 65 THR P OG1  7  
ATOM 8296  C CG2  . THR A 1 67 ? 30.452  -5.438  20.525  1.00 0.00 ? 65 THR P CG2  7  
ATOM 8297  H H    . THR A 1 67 ? 27.763  -5.159  19.047  1.00 0.00 ? 65 THR P H    7  
ATOM 8298  H HA   . THR A 1 67 ? 29.115  -3.145  20.675  1.00 0.00 ? 65 THR P HA   7  
ATOM 8299  H HB   . THR A 1 67 ? 31.119  -3.809  19.309  1.00 0.00 ? 65 THR P HB   7  
ATOM 8300  H HG1  . THR A 1 67 ? 30.168  -4.578  17.452  1.00 0.00 ? 65 THR P HG1  7  
ATOM 8301  H HG21 . THR A 1 67 ? 30.589  -4.906  21.467  1.00 0.00 ? 65 THR P HG21 7  
ATOM 8302  H HG22 . THR A 1 67 ? 31.351  -6.021  20.320  1.00 0.00 ? 65 THR P HG22 7  
ATOM 8303  H HG23 . THR A 1 67 ? 29.601  -6.113  20.611  1.00 0.00 ? 65 THR P HG23 7  
ATOM 8304  N N    . ASP A 1 68 ? 29.732  -1.278  19.077  1.00 0.00 ? 66 ASP P N    7  
ATOM 8305  C CA   . ASP A 1 68 ? 29.910  -0.049  18.275  1.00 0.00 ? 66 ASP P CA   7  
ATOM 8306  C C    . ASP A 1 68 ? 30.897  -0.218  17.097  1.00 0.00 ? 66 ASP P C    7  
ATOM 8307  O O    . ASP A 1 68 ? 31.998  -0.784  17.299  1.00 0.00 ? 66 ASP P O    7  
ATOM 8308  C CB   . ASP A 1 68 ? 30.331  1.106   19.203  1.00 0.00 ? 66 ASP P CB   7  
ATOM 8309  C CG   . ASP A 1 68 ? 30.482  2.455   18.463  1.00 0.00 ? 66 ASP P CG   7  
ATOM 8310  O OD1  . ASP A 1 68 ? 29.447  3.076   18.112  1.00 0.00 ? 66 ASP P OD1  7  
ATOM 8311  O OD2  . ASP A 1 68 ? 31.633  2.920   18.263  1.00 0.00 ? 66 ASP P OD2  7  
ATOM 8312  O OXT  . ASP A 1 68 ? 30.562  0.219   15.973  1.00 0.00 ? 66 ASP P OXT  7  
ATOM 8313  H H    . ASP A 1 68 ? 30.236  -1.332  19.950  1.00 0.00 ? 66 ASP P H    7  
ATOM 8314  H HA   . ASP A 1 68 ? 28.945  0.220   17.843  1.00 0.00 ? 66 ASP P HA   7  
ATOM 8315  H HB2  . ASP A 1 68 ? 29.581  1.216   19.989  1.00 0.00 ? 66 ASP P HB2  7  
ATOM 8316  H HB3  . ASP A 1 68 ? 31.274  0.845   19.688  1.00 0.00 ? 66 ASP P HB3  7  
ATOM 8317  N N    . GLY A 1 1  ? -16.303 -9.641  23.294  1.00 0.00 ? -1 GLY P N    8  
ATOM 8318  C CA   . GLY A 1 1  ? -15.086 -10.396 23.667  1.00 0.00 ? -1 GLY P CA   8  
ATOM 8319  C C    . GLY A 1 1  ? -13.994 -10.246 22.618  1.00 0.00 ? -1 GLY P C    8  
ATOM 8320  O O    . GLY A 1 1  ? -14.285 -10.130 21.426  1.00 0.00 ? -1 GLY P O    8  
ATOM 8321  H H1   . GLY A 1 1  ? -16.660 -9.974  22.412  1.00 0.00 ? -1 GLY P H1   8  
ATOM 8322  H H2   . GLY A 1 1  ? -16.093 -8.660  23.206  1.00 0.00 ? -1 GLY P H2   8  
ATOM 8323  H H3   . GLY A 1 1  ? -17.015 -9.759  23.998  1.00 0.00 ? -1 GLY P H3   8  
ATOM 8324  H HA2  . GLY A 1 1  ? -14.711 -10.031 24.623  1.00 0.00 ? -1 GLY P HA2  8  
ATOM 8325  H HA3  . GLY A 1 1  ? -15.327 -11.454 23.764  1.00 0.00 ? -1 GLY P HA3  8  
ATOM 8326  N N    . SER A 1 2  ? -12.726 -10.264 23.042  1.00 0.00 ? 0  SER P N    8  
ATOM 8327  C CA   . SER A 1 2  ? -11.530 -9.990  22.213  1.00 0.00 ? 0  SER P CA   8  
ATOM 8328  C C    . SER A 1 2  ? -11.098 -11.170 21.317  1.00 0.00 ? 0  SER P C    8  
ATOM 8329  O O    . SER A 1 2  ? -9.933  -11.578 21.309  1.00 0.00 ? 0  SER P O    8  
ATOM 8330  C CB   . SER A 1 2  ? -10.375 -9.505  23.107  1.00 0.00 ? 0  SER P CB   8  
ATOM 8331  O OG   . SER A 1 2  ? -10.780 -8.392  23.895  1.00 0.00 ? 0  SER P OG   8  
ATOM 8332  H H    . SER A 1 2  ? -12.564 -10.358 24.035  1.00 0.00 ? 0  SER P H    8  
ATOM 8333  H HA   . SER A 1 2  ? -11.771 -9.167  21.538  1.00 0.00 ? 0  SER P HA   8  
ATOM 8334  H HB2  . SER A 1 2  ? -10.062 -10.319 23.764  1.00 0.00 ? 0  SER P HB2  8  
ATOM 8335  H HB3  . SER A 1 2  ? -9.530  -9.214  22.480  1.00 0.00 ? 0  SER P HB3  8  
ATOM 8336  H HG   . SER A 1 2  ? -10.017 -8.110  24.439  1.00 0.00 ? 0  SER P HG   8  
ATOM 8337  N N    . GLN A 1 3  ? -12.043 -11.755 20.575  1.00 0.00 ? 1  GLN P N    8  
ATOM 8338  C CA   . GLN A 1 3  ? -11.819 -12.874 19.653  1.00 0.00 ? 1  GLN P CA   8  
ATOM 8339  C C    . GLN A 1 3  ? -11.176 -12.399 18.329  1.00 0.00 ? 1  GLN P C    8  
ATOM 8340  O O    . GLN A 1 3  ? -11.572 -11.366 17.777  1.00 0.00 ? 1  GLN P O    8  
ATOM 8341  C CB   . GLN A 1 3  ? -13.158 -13.616 19.461  1.00 0.00 ? 1  GLN P CB   8  
ATOM 8342  C CG   . GLN A 1 3  ? -13.087 -14.889 18.603  1.00 0.00 ? 1  GLN P CG   8  
ATOM 8343  C CD   . GLN A 1 3  ? -12.067 -15.904 19.114  1.00 0.00 ? 1  GLN P CD   8  
ATOM 8344  O OE1  . GLN A 1 3  ? -10.913 -15.915 18.706  1.00 0.00 ? 1  GLN P OE1  8  
ATOM 8345  N NE2  . GLN A 1 3  ? -12.426 -16.765 20.041  1.00 0.00 ? 1  GLN P NE2  8  
ATOM 8346  H H    . GLN A 1 3  ? -12.973 -11.351 20.609  1.00 0.00 ? 1  GLN P H    8  
ATOM 8347  H HA   . GLN A 1 3  ? -11.122 -13.563 20.133  1.00 0.00 ? 1  GLN P HA   8  
ATOM 8348  H HB2  . GLN A 1 3  ? -13.541 -13.895 20.445  1.00 0.00 ? 1  GLN P HB2  8  
ATOM 8349  H HB3  . GLN A 1 3  ? -13.878 -12.934 19.006  1.00 0.00 ? 1  GLN P HB3  8  
ATOM 8350  H HG2  . GLN A 1 3  ? -14.074 -15.353 18.588  1.00 0.00 ? 1  GLN P HG2  8  
ATOM 8351  H HG3  . GLN A 1 3  ? -12.841 -14.619 17.578  1.00 0.00 ? 1  GLN P HG3  8  
ATOM 8352  H HE21 . GLN A 1 3  ? -13.370 -16.768 20.402  1.00 0.00 ? 1  GLN P HE21 8  
ATOM 8353  H HE22 . GLN A 1 3  ? -11.737 -17.424 20.373  1.00 0.00 ? 1  GLN P HE22 8  
ATOM 8354  N N    . ARG A 1 4  ? -10.202 -13.172 17.820  1.00 0.00 ? 2  ARG P N    8  
ATOM 8355  C CA   . ARG A 1 4  ? -9.287  -12.854 16.693  1.00 0.00 ? 2  ARG P CA   8  
ATOM 8356  C C    . ARG A 1 4  ? -8.477  -11.548 16.869  1.00 0.00 ? 2  ARG P C    8  
ATOM 8357  O O    . ARG A 1 4  ? -8.612  -10.831 17.864  1.00 0.00 ? 2  ARG P O    8  
ATOM 8358  C CB   . ARG A 1 4  ? -10.033 -12.913 15.336  1.00 0.00 ? 2  ARG P CB   8  
ATOM 8359  C CG   . ARG A 1 4  ? -10.853 -14.190 15.063  1.00 0.00 ? 2  ARG P CG   8  
ATOM 8360  C CD   . ARG A 1 4  ? -10.111 -15.511 15.315  1.00 0.00 ? 2  ARG P CD   8  
ATOM 8361  N NE   . ARG A 1 4  ? -8.905  -15.653 14.474  1.00 0.00 ? 2  ARG P NE   8  
ATOM 8362  C CZ   . ARG A 1 4  ? -7.861  -16.428 14.720  1.00 0.00 ? 2  ARG P CZ   8  
ATOM 8363  N NH1  . ARG A 1 4  ? -7.789  -17.179 15.784  1.00 0.00 ? 2  ARG P NH1  8  
ATOM 8364  N NH2  . ARG A 1 4  ? -6.854  -16.460 13.895  1.00 0.00 ? 2  ARG P NH2  8  
ATOM 8365  H H    . ARG A 1 4  ? -10.026 -14.039 18.318  1.00 0.00 ? 2  ARG P H    8  
ATOM 8366  H HA   . ARG A 1 4  ? -8.527  -13.638 16.669  1.00 0.00 ? 2  ARG P HA   8  
ATOM 8367  H HB2  . ARG A 1 4  ? -10.706 -12.058 15.264  1.00 0.00 ? 2  ARG P HB2  8  
ATOM 8368  H HB3  . ARG A 1 4  ? -9.304  -12.815 14.532  1.00 0.00 ? 2  ARG P HB3  8  
ATOM 8369  H HG2  . ARG A 1 4  ? -11.742 -14.172 15.688  1.00 0.00 ? 2  ARG P HG2  8  
ATOM 8370  H HG3  . ARG A 1 4  ? -11.190 -14.169 14.026  1.00 0.00 ? 2  ARG P HG3  8  
ATOM 8371  H HD2  . ARG A 1 4  ? -9.843  -15.565 16.370  1.00 0.00 ? 2  ARG P HD2  8  
ATOM 8372  H HD3  . ARG A 1 4  ? -10.794 -16.337 15.101  1.00 0.00 ? 2  ARG P HD3  8  
ATOM 8373  H HE   . ARG A 1 4  ? -8.888  -15.142 13.606  1.00 0.00 ? 2  ARG P HE   8  
ATOM 8374  H HH11 . ARG A 1 4  ? -8.560  -17.190 16.430  1.00 0.00 ? 2  ARG P HH11 8  
ATOM 8375  H HH12 . ARG A 1 4  ? -6.986  -17.763 15.946  1.00 0.00 ? 2  ARG P HH12 8  
ATOM 8376  H HH21 . ARG A 1 4  ? -6.867  -15.902 13.056  1.00 0.00 ? 2  ARG P HH21 8  
ATOM 8377  H HH22 . ARG A 1 4  ? -6.063  -17.051 14.083  1.00 0.00 ? 2  ARG P HH22 8  
ATOM 8378  N N    . ARG A 1 5  ? -7.586  -11.258 15.909  1.00 0.00 ? 3  ARG P N    8  
ATOM 8379  C CA   . ARG A 1 5  ? -6.762  -10.030 15.851  1.00 0.00 ? 3  ARG P CA   8  
ATOM 8380  C C    . ARG A 1 5  ? -7.605  -8.792  15.499  1.00 0.00 ? 3  ARG P C    8  
ATOM 8381  O O    . ARG A 1 5  ? -8.658  -8.904  14.867  1.00 0.00 ? 3  ARG P O    8  
ATOM 8382  C CB   . ARG A 1 5  ? -5.591  -10.221 14.862  1.00 0.00 ? 3  ARG P CB   8  
ATOM 8383  C CG   . ARG A 1 5  ? -4.561  -11.247 15.374  1.00 0.00 ? 3  ARG P CG   8  
ATOM 8384  C CD   . ARG A 1 5  ? -3.467  -11.573 14.345  1.00 0.00 ? 3  ARG P CD   8  
ATOM 8385  N NE   . ARG A 1 5  ? -2.569  -10.432 14.075  1.00 0.00 ? 3  ARG P NE   8  
ATOM 8386  C CZ   . ARG A 1 5  ? -1.567  -10.418 13.211  1.00 0.00 ? 3  ARG P CZ   8  
ATOM 8387  N NH1  . ARG A 1 5  ? -1.231  -11.462 12.509  1.00 0.00 ? 3  ARG P NH1  8  
ATOM 8388  N NH2  . ARG A 1 5  ? -0.864  -9.340  13.018  1.00 0.00 ? 3  ARG P NH2  8  
ATOM 8389  H H    . ARG A 1 5  ? -7.536  -11.896 15.129  1.00 0.00 ? 3  ARG P H    8  
ATOM 8390  H HA   . ARG A 1 5  ? -6.344  -9.845  16.843  1.00 0.00 ? 3  ARG P HA   8  
ATOM 8391  H HB2  . ARG A 1 5  ? -5.983  -10.546 13.896  1.00 0.00 ? 3  ARG P HB2  8  
ATOM 8392  H HB3  . ARG A 1 5  ? -5.084  -9.266  14.717  1.00 0.00 ? 3  ARG P HB3  8  
ATOM 8393  H HG2  . ARG A 1 5  ? -4.097  -10.873 16.288  1.00 0.00 ? 3  ARG P HG2  8  
ATOM 8394  H HG3  . ARG A 1 5  ? -5.074  -12.179 15.614  1.00 0.00 ? 3  ARG P HG3  8  
ATOM 8395  H HD2  . ARG A 1 5  ? -2.877  -12.405 14.733  1.00 0.00 ? 3  ARG P HD2  8  
ATOM 8396  H HD3  . ARG A 1 5  ? -3.945  -11.896 13.418  1.00 0.00 ? 3  ARG P HD3  8  
ATOM 8397  H HE   . ARG A 1 5  ? -2.730  -9.581  14.589  1.00 0.00 ? 3  ARG P HE   8  
ATOM 8398  H HH11 . ARG A 1 5  ? -1.730  -12.325 12.637  1.00 0.00 ? 3  ARG P HH11 8  
ATOM 8399  H HH12 . ARG A 1 5  ? -0.477  -11.395 11.845  1.00 0.00 ? 3  ARG P HH12 8  
ATOM 8400  H HH21 . ARG A 1 5  ? -1.041  -8.509  13.558  1.00 0.00 ? 3  ARG P HH21 8  
ATOM 8401  H HH22 . ARG A 1 5  ? -0.134  -9.355  12.320  1.00 0.00 ? 3  ARG P HH22 8  
ATOM 8402  N N    . GLN A 1 6  ? -7.127  -7.607  15.889  1.00 0.00 ? 4  GLN P N    8  
ATOM 8403  C CA   . GLN A 1 6  ? -7.844  -6.328  15.733  1.00 0.00 ? 4  GLN P CA   8  
ATOM 8404  C C    . GLN A 1 6  ? -8.026  -5.898  14.260  1.00 0.00 ? 4  GLN P C    8  
ATOM 8405  O O    . GLN A 1 6  ? -9.011  -5.227  13.938  1.00 0.00 ? 4  GLN P O    8  
ATOM 8406  C CB   . GLN A 1 6  ? -7.100  -5.262  16.563  1.00 0.00 ? 4  GLN P CB   8  
ATOM 8407  C CG   . GLN A 1 6  ? -7.714  -3.848  16.563  1.00 0.00 ? 4  GLN P CG   8  
ATOM 8408  C CD   . GLN A 1 6  ? -9.128  -3.787  17.142  1.00 0.00 ? 4  GLN P CD   8  
ATOM 8409  O OE1  . GLN A 1 6  ? -9.340  -3.518  18.318  1.00 0.00 ? 4  GLN P OE1  8  
ATOM 8410  N NE2  . GLN A 1 6  ? -10.150 -4.033  16.349  1.00 0.00 ? 4  GLN P NE2  8  
ATOM 8411  H H    . GLN A 1 6  ? -6.257  -7.599  16.402  1.00 0.00 ? 4  GLN P H    8  
ATOM 8412  H HA   . GLN A 1 6  ? -8.841  -6.452  16.156  1.00 0.00 ? 4  GLN P HA   8  
ATOM 8413  H HB2  . GLN A 1 6  ? -7.046  -5.605  17.598  1.00 0.00 ? 4  GLN P HB2  8  
ATOM 8414  H HB3  . GLN A 1 6  ? -6.078  -5.181  16.190  1.00 0.00 ? 4  GLN P HB3  8  
ATOM 8415  H HG2  . GLN A 1 6  ? -7.072  -3.199  17.160  1.00 0.00 ? 4  GLN P HG2  8  
ATOM 8416  H HG3  . GLN A 1 6  ? -7.718  -3.448  15.549  1.00 0.00 ? 4  GLN P HG3  8  
ATOM 8417  H HE21 . GLN A 1 6  ? -9.985  -4.281  15.378  1.00 0.00 ? 4  GLN P HE21 8  
ATOM 8418  H HE22 . GLN A 1 6  ? -11.083 -3.981  16.729  1.00 0.00 ? 4  GLN P HE22 8  
ATOM 8419  N N    . ARG A 1 7  ? -7.112  -6.304  13.368  1.00 0.00 ? 5  ARG P N    8  
ATOM 8420  C CA   . ARG A 1 7  ? -7.225  -6.179  11.901  1.00 0.00 ? 5  ARG P CA   8  
ATOM 8421  C C    . ARG A 1 7  ? -6.540  -7.349  11.177  1.00 0.00 ? 5  ARG P C    8  
ATOM 8422  O O    . ARG A 1 7  ? -5.846  -8.150  11.808  1.00 0.00 ? 5  ARG P O    8  
ATOM 8423  C CB   . ARG A 1 7  ? -6.698  -4.807  11.429  1.00 0.00 ? 5  ARG P CB   8  
ATOM 8424  C CG   . ARG A 1 7  ? -5.172  -4.601  11.569  1.00 0.00 ? 5  ARG P CG   8  
ATOM 8425  C CD   . ARG A 1 7  ? -4.618  -3.681  10.471  1.00 0.00 ? 5  ARG P CD   8  
ATOM 8426  N NE   . ARG A 1 7  ? -4.741  -4.329  9.148   1.00 0.00 ? 5  ARG P NE   8  
ATOM 8427  C CZ   . ARG A 1 7  ? -5.318  -3.846  8.067   1.00 0.00 ? 5  ARG P CZ   8  
ATOM 8428  N NH1  . ARG A 1 7  ? -5.599  -2.586  7.916   1.00 0.00 ? 5  ARG P NH1  8  
ATOM 8429  N NH2  . ARG A 1 7  ? -5.643  -4.636  7.092   1.00 0.00 ? 5  ARG P NH2  8  
ATOM 8430  H H    . ARG A 1 7  ? -6.339  -6.854  13.721  1.00 0.00 ? 5  ARG P H    8  
ATOM 8431  H HA   . ARG A 1 7  ? -8.282  -6.234  11.632  1.00 0.00 ? 5  ARG P HA   8  
ATOM 8432  H HB2  . ARG A 1 7  ? -6.994  -4.689  10.387  1.00 0.00 ? 5  ARG P HB2  8  
ATOM 8433  H HB3  . ARG A 1 7  ? -7.206  -4.016  11.982  1.00 0.00 ? 5  ARG P HB3  8  
ATOM 8434  H HG2  . ARG A 1 7  ? -4.963  -4.164  12.546  1.00 0.00 ? 5  ARG P HG2  8  
ATOM 8435  H HG3  . ARG A 1 7  ? -4.645  -5.552  11.509  1.00 0.00 ? 5  ARG P HG3  8  
ATOM 8436  H HD2  . ARG A 1 7  ? -5.161  -2.735  10.499  1.00 0.00 ? 5  ARG P HD2  8  
ATOM 8437  H HD3  . ARG A 1 7  ? -3.566  -3.477  10.674  1.00 0.00 ? 5  ARG P HD3  8  
ATOM 8438  H HE   . ARG A 1 7  ? -4.475  -5.308  9.092   1.00 0.00 ? 5  ARG P HE   8  
ATOM 8439  H HH11 . ARG A 1 7  ? -5.275  -1.914  8.604   1.00 0.00 ? 5  ARG P HH11 8  
ATOM 8440  H HH12 . ARG A 1 7  ? -6.122  -2.287  7.111   1.00 0.00 ? 5  ARG P HH12 8  
ATOM 8441  H HH21 . ARG A 1 7  ? -5.617  -5.643  7.210   1.00 0.00 ? 5  ARG P HH21 8  
ATOM 8442  H HH22 . ARG A 1 7  ? -6.080  -4.248  6.264   1.00 0.00 ? 5  ARG P HH22 8  
ATOM 8443  N N    . THR A 1 8  ? -6.705  -7.437  9.856   1.00 0.00 ? 6  THR P N    8  
ATOM 8444  C CA   . THR A 1 8  ? -6.056  -8.460  9.013   1.00 0.00 ? 6  THR P CA   8  
ATOM 8445  C C    . THR A 1 8  ? -4.551  -8.218  8.841   1.00 0.00 ? 6  THR P C    8  
ATOM 8446  O O    . THR A 1 8  ? -4.083  -7.075  8.836   1.00 0.00 ? 6  THR P O    8  
ATOM 8447  C CB   . THR A 1 8  ? -6.718  -8.565  7.630   1.00 0.00 ? 6  THR P CB   8  
ATOM 8448  O OG1  . THR A 1 8  ? -6.745  -7.298  7.006   1.00 0.00 ? 6  THR P OG1  8  
ATOM 8449  C CG2  . THR A 1 8  ? -8.158  -9.070  7.723   1.00 0.00 ? 6  THR P CG2  8  
ATOM 8450  H H    . THR A 1 8  ? -7.273  -6.744  9.391   1.00 0.00 ? 6  THR P H    8  
ATOM 8451  H HA   . THR A 1 8  ? -6.173  -9.428  9.501   1.00 0.00 ? 6  THR P HA   8  
ATOM 8452  H HB   . THR A 1 8  ? -6.148  -9.258  7.010   1.00 0.00 ? 6  THR P HB   8  
ATOM 8453  H HG1  . THR A 1 8  ? -7.190  -7.412  6.148   1.00 0.00 ? 6  THR P HG1  8  
ATOM 8454  H HG21 . THR A 1 8  ? -8.175  -10.035 8.230   1.00 0.00 ? 6  THR P HG21 8  
ATOM 8455  H HG22 . THR A 1 8  ? -8.567  -9.197  6.721   1.00 0.00 ? 6  THR P HG22 8  
ATOM 8456  H HG23 . THR A 1 8  ? -8.776  -8.363  8.276   1.00 0.00 ? 6  THR P HG23 8  
ATOM 8457  N N    . HIS A 1 9  ? -3.788  -9.302  8.683   1.00 0.00 ? 7  HIS P N    8  
ATOM 8458  C CA   . HIS A 1 9  ? -2.344  -9.293  8.401   1.00 0.00 ? 7  HIS P CA   8  
ATOM 8459  C C    . HIS A 1 9  ? -2.062  -9.264  6.884   1.00 0.00 ? 7  HIS P C    8  
ATOM 8460  O O    . HIS A 1 9  ? -2.981  -9.447  6.081   1.00 0.00 ? 7  HIS P O    8  
ATOM 8461  C CB   . HIS A 1 9  ? -1.733  -10.520 9.100   1.00 0.00 ? 7  HIS P CB   8  
ATOM 8462  C CG   . HIS A 1 9  ? -0.235  -10.490 9.272   1.00 0.00 ? 7  HIS P CG   8  
ATOM 8463  N ND1  . HIS A 1 9  ? 0.450   -9.830  10.300  1.00 0.00 ? 7  HIS P ND1  8  
ATOM 8464  C CD2  . HIS A 1 9  ? 0.666   -11.167 8.506   1.00 0.00 ? 7  HIS P CD2  8  
ATOM 8465  C CE1  . HIS A 1 9  ? 1.749   -10.145 10.136  1.00 0.00 ? 7  HIS P CE1  8  
ATOM 8466  N NE2  . HIS A 1 9  ? 1.905   -10.933 9.060   1.00 0.00 ? 7  HIS P NE2  8  
ATOM 8467  H H    . HIS A 1 9  ? -4.246  -10.202 8.691   1.00 0.00 ? 7  HIS P H    8  
ATOM 8468  H HA   . HIS A 1 9  ? -1.903  -8.395  8.835   1.00 0.00 ? 7  HIS P HA   8  
ATOM 8469  H HB2  . HIS A 1 9  ? -2.169  -10.599 10.095  1.00 0.00 ? 7  HIS P HB2  8  
ATOM 8470  H HB3  . HIS A 1 9  ? -2.011  -11.420 8.550   1.00 0.00 ? 7  HIS P HB3  8  
ATOM 8471  H HD2  . HIS A 1 9  ? 0.439   -11.796 7.653   1.00 0.00 ? 7  HIS P HD2  8  
ATOM 8472  H HE1  . HIS A 1 9  ? 2.558   -9.816  10.781  1.00 0.00 ? 7  HIS P HE1  8  
ATOM 8473  H HE2  . HIS A 1 9  ? 2.789   -11.324 8.745   1.00 0.00 ? 7  HIS P HE2  8  
ATOM 8474  N N    . PHE A 1 10 ? -0.803  -9.056  6.479   1.00 0.00 ? 8  PHE P N    8  
ATOM 8475  C CA   . PHE A 1 10 ? -0.395  -9.100  5.067   1.00 0.00 ? 8  PHE P CA   8  
ATOM 8476  C C    . PHE A 1 10 ? -0.713  -10.455 4.400   1.00 0.00 ? 8  PHE P C    8  
ATOM 8477  O O    . PHE A 1 10 ? -0.631  -11.513 5.033   1.00 0.00 ? 8  PHE P O    8  
ATOM 8478  C CB   . PHE A 1 10 ? 1.114   -8.837  4.914   1.00 0.00 ? 8  PHE P CB   8  
ATOM 8479  C CG   . PHE A 1 10 ? 1.651   -7.493  5.376   1.00 0.00 ? 8  PHE P CG   8  
ATOM 8480  C CD1  . PHE A 1 10 ? 1.123   -6.292  4.862   1.00 0.00 ? 8  PHE P CD1  8  
ATOM 8481  C CD2  . PHE A 1 10 ? 2.760   -7.444  6.244   1.00 0.00 ? 8  PHE P CD2  8  
ATOM 8482  C CE1  . PHE A 1 10 ? 1.692   -5.055  5.222   1.00 0.00 ? 8  PHE P CE1  8  
ATOM 8483  C CE2  . PHE A 1 10 ? 3.321   -6.207  6.614   1.00 0.00 ? 8  PHE P CE2  8  
ATOM 8484  C CZ   . PHE A 1 10 ? 2.791   -5.012  6.098   1.00 0.00 ? 8  PHE P CZ   8  
ATOM 8485  H H    . PHE A 1 10 ? -0.082  -8.931  7.173   1.00 0.00 ? 8  PHE P H    8  
ATOM 8486  H HA   . PHE A 1 10 ? -0.936  -8.322  4.530   1.00 0.00 ? 8  PHE P HA   8  
ATOM 8487  H HB2  . PHE A 1 10 ? 1.652   -9.633  5.431   1.00 0.00 ? 8  PHE P HB2  8  
ATOM 8488  H HB3  . PHE A 1 10 ? 1.356   -8.926  3.855   1.00 0.00 ? 8  PHE P HB3  8  
ATOM 8489  H HD1  . PHE A 1 10 ? 0.298   -6.316  4.163   1.00 0.00 ? 8  PHE P HD1  8  
ATOM 8490  H HD2  . PHE A 1 10 ? 3.204   -8.361  6.610   1.00 0.00 ? 8  PHE P HD2  8  
ATOM 8491  H HE1  . PHE A 1 10 ? 1.301   -4.136  4.805   1.00 0.00 ? 8  PHE P HE1  8  
ATOM 8492  H HE2  . PHE A 1 10 ? 4.182   -6.177  7.270   1.00 0.00 ? 8  PHE P HE2  8  
ATOM 8493  H HZ   . PHE A 1 10 ? 3.240   -4.062  6.362   1.00 0.00 ? 8  PHE P HZ   8  
ATOM 8494  N N    . THR A 1 11 ? -0.995  -10.424 3.096   1.00 0.00 ? 9  THR P N    8  
ATOM 8495  C CA   . THR A 1 11 ? -1.111  -11.603 2.218   1.00 0.00 ? 9  THR P CA   8  
ATOM 8496  C C    . THR A 1 11 ? -0.412  -11.351 0.878   1.00 0.00 ? 9  THR P C    8  
ATOM 8497  O O    . THR A 1 11 ? -0.153  -10.199 0.519   1.00 0.00 ? 9  THR P O    8  
ATOM 8498  C CB   . THR A 1 11 ? -2.583  -12.022 2.045   1.00 0.00 ? 9  THR P CB   8  
ATOM 8499  O OG1  . THR A 1 11 ? -2.642  -13.279 1.408   1.00 0.00 ? 9  THR P OG1  8  
ATOM 8500  C CG2  . THR A 1 11 ? -3.426  -11.045 1.222   1.00 0.00 ? 9  THR P CG2  8  
ATOM 8501  H H    . THR A 1 11 ? -1.073  -9.516  2.655   1.00 0.00 ? 9  THR P H    8  
ATOM 8502  H HA   . THR A 1 11 ? -0.596  -12.440 2.689   1.00 0.00 ? 9  THR P HA   8  
ATOM 8503  H HB   . THR A 1 11 ? -3.031  -12.119 3.035   1.00 0.00 ? 9  THR P HB   8  
ATOM 8504  H HG1  . THR A 1 11 ? -3.562  -13.597 1.465   1.00 0.00 ? 9  THR P HG1  8  
ATOM 8505  H HG21 . THR A 1 11 ? -3.038  -10.960 0.208   1.00 0.00 ? 9  THR P HG21 8  
ATOM 8506  H HG22 . THR A 1 11 ? -3.419  -10.068 1.698   1.00 0.00 ? 9  THR P HG22 8  
ATOM 8507  H HG23 . THR A 1 11 ? -4.457  -11.399 1.180   1.00 0.00 ? 9  THR P HG23 8  
ATOM 8508  N N    . SER A 1 12 ? -0.103  -12.406 0.119   1.00 0.00 ? 10 SER P N    8  
ATOM 8509  C CA   . SER A 1 12 ? 0.665   -12.335 -1.138  1.00 0.00 ? 10 SER P CA   8  
ATOM 8510  C C    . SER A 1 12 ? 0.083   -11.347 -2.156  1.00 0.00 ? 10 SER P C    8  
ATOM 8511  O O    . SER A 1 12 ? 0.839   -10.620 -2.800  1.00 0.00 ? 10 SER P O    8  
ATOM 8512  C CB   . SER A 1 12 ? 0.771   -13.728 -1.772  1.00 0.00 ? 10 SER P CB   8  
ATOM 8513  O OG   . SER A 1 12 ? -0.514  -14.305 -1.958  1.00 0.00 ? 10 SER P OG   8  
ATOM 8514  H H    . SER A 1 12 ? -0.443  -13.314 0.411   1.00 0.00 ? 10 SER P H    8  
ATOM 8515  H HA   . SER A 1 12 ? 1.676   -12.002 -0.905  1.00 0.00 ? 10 SER P HA   8  
ATOM 8516  H HB2  . SER A 1 12 ? 1.283   -13.649 -2.735  1.00 0.00 ? 10 SER P HB2  8  
ATOM 8517  H HB3  . SER A 1 12 ? 1.362   -14.371 -1.118  1.00 0.00 ? 10 SER P HB3  8  
ATOM 8518  H HG   . SER A 1 12 ? -0.397  -15.200 -2.334  1.00 0.00 ? 10 SER P HG   8  
ATOM 8519  N N    . GLN A 1 13 ? -1.247  -11.241 -2.239  1.00 0.00 ? 11 GLN P N    8  
ATOM 8520  C CA   . GLN A 1 13 ? -1.946  -10.308 -3.133  1.00 0.00 ? 11 GLN P CA   8  
ATOM 8521  C C    . GLN A 1 13 ? -1.709  -8.833  -2.761  1.00 0.00 ? 11 GLN P C    8  
ATOM 8522  O O    . GLN A 1 13 ? -1.540  -7.998  -3.648  1.00 0.00 ? 11 GLN P O    8  
ATOM 8523  C CB   . GLN A 1 13 ? -3.448  -10.635 -3.155  1.00 0.00 ? 11 GLN P CB   8  
ATOM 8524  C CG   . GLN A 1 13 ? -3.722  -12.018 -3.773  1.00 0.00 ? 11 GLN P CG   8  
ATOM 8525  C CD   . GLN A 1 13 ? -5.210  -12.367 -3.879  1.00 0.00 ? 11 GLN P CD   8  
ATOM 8526  O OE1  . GLN A 1 13 ? -6.105  -11.624 -3.490  1.00 0.00 ? 11 GLN P OE1  8  
ATOM 8527  N NE2  . GLN A 1 13 ? -5.539  -13.525 -4.415  1.00 0.00 ? 11 GLN P NE2  8  
ATOM 8528  H H    . GLN A 1 13 ? -1.794  -11.897 -1.698  1.00 0.00 ? 11 GLN P H    8  
ATOM 8529  H HA   . GLN A 1 13 ? -1.563  -10.447 -4.142  1.00 0.00 ? 11 GLN P HA   8  
ATOM 8530  H HB2  . GLN A 1 13 ? -3.846  -10.599 -2.140  1.00 0.00 ? 11 GLN P HB2  8  
ATOM 8531  H HB3  . GLN A 1 13 ? -3.957  -9.879  -3.754  1.00 0.00 ? 11 GLN P HB3  8  
ATOM 8532  H HG2  . GLN A 1 13 ? -3.289  -12.048 -4.775  1.00 0.00 ? 11 GLN P HG2  8  
ATOM 8533  H HG3  . GLN A 1 13 ? -3.236  -12.789 -3.176  1.00 0.00 ? 11 GLN P HG3  8  
ATOM 8534  H HE21 . GLN A 1 13 ? -4.823  -14.156 -4.742  1.00 0.00 ? 11 GLN P HE21 8  
ATOM 8535  H HE22 . GLN A 1 13 ? -6.517  -13.761 -4.487  1.00 0.00 ? 11 GLN P HE22 8  
ATOM 8536  N N    . GLN A 1 14 ? -1.621  -8.503  -1.468  1.00 0.00 ? 12 GLN P N    8  
ATOM 8537  C CA   . GLN A 1 14 ? -1.285  -7.149  -1.005  1.00 0.00 ? 12 GLN P CA   8  
ATOM 8538  C C    . GLN A 1 14 ? 0.210   -6.857  -1.183  1.00 0.00 ? 12 GLN P C    8  
ATOM 8539  O O    . GLN A 1 14 ? 0.588   -5.771  -1.624  1.00 0.00 ? 12 GLN P O    8  
ATOM 8540  C CB   . GLN A 1 14 ? -1.658  -7.003  0.476   1.00 0.00 ? 12 GLN P CB   8  
ATOM 8541  C CG   . GLN A 1 14 ? -3.173  -7.043  0.738   1.00 0.00 ? 12 GLN P CG   8  
ATOM 8542  C CD   . GLN A 1 14 ? -3.503  -7.174  2.226   1.00 0.00 ? 12 GLN P CD   8  
ATOM 8543  O OE1  . GLN A 1 14 ? -2.814  -7.836  2.990   1.00 0.00 ? 12 GLN P OE1  8  
ATOM 8544  N NE2  . GLN A 1 14 ? -4.572  -6.574  2.698   1.00 0.00 ? 12 GLN P NE2  8  
ATOM 8545  H H    . GLN A 1 14 ? -1.678  -9.241  -0.778  1.00 0.00 ? 12 GLN P H    8  
ATOM 8546  H HA   . GLN A 1 14 ? -1.843  -6.411  -1.583  1.00 0.00 ? 12 GLN P HA   8  
ATOM 8547  H HB2  . GLN A 1 14 ? -1.162  -7.795  1.039   1.00 0.00 ? 12 GLN P HB2  8  
ATOM 8548  H HB3  . GLN A 1 14 ? -1.271  -6.048  0.830   1.00 0.00 ? 12 GLN P HB3  8  
ATOM 8549  H HG2  . GLN A 1 14 ? -3.622  -6.135  0.339   1.00 0.00 ? 12 GLN P HG2  8  
ATOM 8550  H HG3  . GLN A 1 14 ? -3.622  -7.892  0.224   1.00 0.00 ? 12 GLN P HG3  8  
ATOM 8551  H HE21 . GLN A 1 14 ? -5.087  -5.924  2.110   1.00 0.00 ? 12 GLN P HE21 8  
ATOM 8552  H HE22 . GLN A 1 14 ? -4.775  -6.673  3.678   1.00 0.00 ? 12 GLN P HE22 8  
ATOM 8553  N N    . LEU A 1 15 ? 1.065   -7.839  -0.875  1.00 0.00 ? 13 LEU P N    8  
ATOM 8554  C CA   . LEU A 1 15 ? 2.521   -7.714  -0.956  1.00 0.00 ? 13 LEU P CA   8  
ATOM 8555  C C    . LEU A 1 15 ? 3.004   -7.537  -2.405  1.00 0.00 ? 13 LEU P C    8  
ATOM 8556  O O    . LEU A 1 15 ? 3.886   -6.713  -2.651  1.00 0.00 ? 13 LEU P O    8  
ATOM 8557  C CB   . LEU A 1 15 ? 3.168   -8.939  -0.279  1.00 0.00 ? 13 LEU P CB   8  
ATOM 8558  C CG   . LEU A 1 15 ? 2.940   -9.019  1.245   1.00 0.00 ? 13 LEU P CG   8  
ATOM 8559  C CD1  . LEU A 1 15 ? 3.410   -10.374 1.775   1.00 0.00 ? 13 LEU P CD1  8  
ATOM 8560  C CD2  . LEU A 1 15 ? 3.696   -7.925  2.001   1.00 0.00 ? 13 LEU P CD2  8  
ATOM 8561  H H    . LEU A 1 15 ? 0.678   -8.704  -0.510  1.00 0.00 ? 13 LEU P H    8  
ATOM 8562  H HA   . LEU A 1 15 ? 2.825   -6.813  -0.420  1.00 0.00 ? 13 LEU P HA   8  
ATOM 8563  H HB2  . LEU A 1 15 ? 2.770   -9.840  -0.746  1.00 0.00 ? 13 LEU P HB2  8  
ATOM 8564  H HB3  . LEU A 1 15 ? 4.243   -8.919  -0.468  1.00 0.00 ? 13 LEU P HB3  8  
ATOM 8565  H HG   . LEU A 1 15 ? 1.881   -8.918  1.468   1.00 0.00 ? 13 LEU P HG   8  
ATOM 8566  H HD11 . LEU A 1 15 ? 2.853   -11.173 1.285   1.00 0.00 ? 13 LEU P HD11 8  
ATOM 8567  H HD12 . LEU A 1 15 ? 3.229   -10.434 2.849   1.00 0.00 ? 13 LEU P HD12 8  
ATOM 8568  H HD13 . LEU A 1 15 ? 4.475   -10.504 1.582   1.00 0.00 ? 13 LEU P HD13 8  
ATOM 8569  H HD21 . LEU A 1 15 ? 3.290   -6.949  1.741   1.00 0.00 ? 13 LEU P HD21 8  
ATOM 8570  H HD22 . LEU A 1 15 ? 4.757   -7.971  1.755   1.00 0.00 ? 13 LEU P HD22 8  
ATOM 8571  H HD23 . LEU A 1 15 ? 3.574   -8.064  3.076   1.00 0.00 ? 13 LEU P HD23 8  
ATOM 8572  N N    . GLN A 1 16 ? 2.400   -8.234  -3.376  1.00 0.00 ? 14 GLN P N    8  
ATOM 8573  C CA   . GLN A 1 16 ? 2.737   -8.060  -4.796  1.00 0.00 ? 14 GLN P CA   8  
ATOM 8574  C C    . GLN A 1 16 ? 2.227   -6.727  -5.369  1.00 0.00 ? 14 GLN P C    8  
ATOM 8575  O O    . GLN A 1 16 ? 2.899   -6.132  -6.208  1.00 0.00 ? 14 GLN P O    8  
ATOM 8576  C CB   . GLN A 1 16 ? 2.289   -9.275  -5.626  1.00 0.00 ? 14 GLN P CB   8  
ATOM 8577  C CG   . GLN A 1 16 ? 0.782   -9.370  -5.909  1.00 0.00 ? 14 GLN P CG   8  
ATOM 8578  C CD   . GLN A 1 16 ? 0.416   -10.690 -6.588  1.00 0.00 ? 14 GLN P CD   8  
ATOM 8579  O OE1  . GLN A 1 16 ? -0.154  -11.598 -5.997  1.00 0.00 ? 14 GLN P OE1  8  
ATOM 8580  N NE2  . GLN A 1 16 ? 0.732   -10.861 -7.855  1.00 0.00 ? 14 GLN P NE2  8  
ATOM 8581  H H    . GLN A 1 16 ? 1.713   -8.938  -3.121  1.00 0.00 ? 14 GLN P H    8  
ATOM 8582  H HA   . GLN A 1 16 ? 3.825   -8.028  -4.867  1.00 0.00 ? 14 GLN P HA   8  
ATOM 8583  H HB2  . GLN A 1 16 ? 2.808   -9.233  -6.582  1.00 0.00 ? 14 GLN P HB2  8  
ATOM 8584  H HB3  . GLN A 1 16 ? 2.607   -10.179 -5.108  1.00 0.00 ? 14 GLN P HB3  8  
ATOM 8585  H HG2  . GLN A 1 16 ? 0.238   -9.295  -4.973  1.00 0.00 ? 14 GLN P HG2  8  
ATOM 8586  H HG3  . GLN A 1 16 ? 0.474   -8.546  -6.553  1.00 0.00 ? 14 GLN P HG3  8  
ATOM 8587  H HE21 . GLN A 1 16 ? 1.205   -10.133 -8.371  1.00 0.00 ? 14 GLN P HE21 8  
ATOM 8588  H HE22 . GLN A 1 16 ? 0.498   -11.742 -8.288  1.00 0.00 ? 14 GLN P HE22 8  
ATOM 8589  N N    . GLU A 1 17 ? 1.089   -6.214  -4.889  1.00 0.00 ? 15 GLU P N    8  
ATOM 8590  C CA   . GLU A 1 17 ? 0.606   -4.870  -5.248  1.00 0.00 ? 15 GLU P CA   8  
ATOM 8591  C C    . GLU A 1 17 ? 1.481   -3.754  -4.652  1.00 0.00 ? 15 GLU P C    8  
ATOM 8592  O O    . GLU A 1 17 ? 1.760   -2.772  -5.342  1.00 0.00 ? 15 GLU P O    8  
ATOM 8593  C CB   . GLU A 1 17 ? -0.866  -4.678  -4.845  1.00 0.00 ? 15 GLU P CB   8  
ATOM 8594  C CG   . GLU A 1 17 ? -1.820  -5.376  -5.823  1.00 0.00 ? 15 GLU P CG   8  
ATOM 8595  C CD   . GLU A 1 17 ? -3.289  -5.012  -5.530  1.00 0.00 ? 15 GLU P CD   8  
ATOM 8596  O OE1  . GLU A 1 17 ? -3.887  -5.557  -4.570  1.00 0.00 ? 15 GLU P OE1  8  
ATOM 8597  O OE2  . GLU A 1 17 ? -3.865  -4.181  -6.275  1.00 0.00 ? 15 GLU P OE2  8  
ATOM 8598  H H    . GLU A 1 17 ? 0.554   -6.771  -4.236  1.00 0.00 ? 15 GLU P H    8  
ATOM 8599  H HA   . GLU A 1 17 ? 0.670   -4.753  -6.331  1.00 0.00 ? 15 GLU P HA   8  
ATOM 8600  H HB2  . GLU A 1 17 ? -1.030  -5.046  -3.832  1.00 0.00 ? 15 GLU P HB2  8  
ATOM 8601  H HB3  . GLU A 1 17 ? -1.095  -3.612  -4.861  1.00 0.00 ? 15 GLU P HB3  8  
ATOM 8602  H HG2  . GLU A 1 17 ? -1.564  -5.067  -6.841  1.00 0.00 ? 15 GLU P HG2  8  
ATOM 8603  H HG3  . GLU A 1 17 ? -1.678  -6.458  -5.772  1.00 0.00 ? 15 GLU P HG3  8  
ATOM 8604  N N    . LEU A 1 18 ? 1.980   -3.905  -3.421  1.00 0.00 ? 16 LEU P N    8  
ATOM 8605  C CA   . LEU A 1 18 ? 2.950   -2.973  -2.826  1.00 0.00 ? 16 LEU P CA   8  
ATOM 8606  C C    . LEU A 1 18 ? 4.326   -3.044  -3.517  1.00 0.00 ? 16 LEU P C    8  
ATOM 8607  O O    . LEU A 1 18 ? 4.954   -2.009  -3.736  1.00 0.00 ? 16 LEU P O    8  
ATOM 8608  C CB   . LEU A 1 18 ? 3.043   -3.231  -1.311  1.00 0.00 ? 16 LEU P CB   8  
ATOM 8609  C CG   . LEU A 1 18 ? 1.946   -2.501  -0.514  1.00 0.00 ? 16 LEU P CG   8  
ATOM 8610  C CD1  . LEU A 1 18 ? 1.729   -3.162  0.848   1.00 0.00 ? 16 LEU P CD1  8  
ATOM 8611  C CD2  . LEU A 1 18 ? 2.325   -1.040  -0.260  1.00 0.00 ? 16 LEU P CD2  8  
ATOM 8612  H H    . LEU A 1 18 ? 1.680   -4.705  -2.873  1.00 0.00 ? 16 LEU P H    8  
ATOM 8613  H HA   . LEU A 1 18 ? 2.588   -1.957  -2.975  1.00 0.00 ? 16 LEU P HA   8  
ATOM 8614  H HB2  . LEU A 1 18 ? 2.996   -4.304  -1.125  1.00 0.00 ? 16 LEU P HB2  8  
ATOM 8615  H HB3  . LEU A 1 18 ? 4.004   -2.877  -0.950  1.00 0.00 ? 16 LEU P HB3  8  
ATOM 8616  H HG   . LEU A 1 18 ? 1.010   -2.524  -1.074  1.00 0.00 ? 16 LEU P HG   8  
ATOM 8617  H HD11 . LEU A 1 18 ? 0.936   -2.643  1.387   1.00 0.00 ? 16 LEU P HD11 8  
ATOM 8618  H HD12 . LEU A 1 18 ? 2.648   -3.123  1.432   1.00 0.00 ? 16 LEU P HD12 8  
ATOM 8619  H HD13 . LEU A 1 18 ? 1.434   -4.201  0.708   1.00 0.00 ? 16 LEU P HD13 8  
ATOM 8620  H HD21 . LEU A 1 18 ? 1.531   -0.552  0.305   1.00 0.00 ? 16 LEU P HD21 8  
ATOM 8621  H HD22 . LEU A 1 18 ? 2.460   -0.517  -1.205  1.00 0.00 ? 16 LEU P HD22 8  
ATOM 8622  H HD23 . LEU A 1 18 ? 3.252   -0.984  0.311   1.00 0.00 ? 16 LEU P HD23 8  
ATOM 8623  N N    . GLU A 1 19 ? 4.772   -4.227  -3.951  1.00 0.00 ? 17 GLU P N    8  
ATOM 8624  C CA   . GLU A 1 19 ? 5.989   -4.377  -4.764  1.00 0.00 ? 17 GLU P CA   8  
ATOM 8625  C C    . GLU A 1 19 ? 5.835   -3.758  -6.166  1.00 0.00 ? 17 GLU P C    8  
ATOM 8626  O O    . GLU A 1 19 ? 6.728   -3.040  -6.620  1.00 0.00 ? 17 GLU P O    8  
ATOM 8627  C CB   . GLU A 1 19 ? 6.387   -5.861  -4.816  1.00 0.00 ? 17 GLU P CB   8  
ATOM 8628  C CG   . GLU A 1 19 ? 7.700   -6.087  -5.575  1.00 0.00 ? 17 GLU P CG   8  
ATOM 8629  C CD   . GLU A 1 19 ? 8.262   -7.491  -5.297  1.00 0.00 ? 17 GLU P CD   8  
ATOM 8630  O OE1  . GLU A 1 19 ? 9.003   -7.642  -4.292  1.00 0.00 ? 17 GLU P OE1  8  
ATOM 8631  O OE2  . GLU A 1 19 ? 7.980   -8.437  -6.072  1.00 0.00 ? 17 GLU P OE2  8  
ATOM 8632  H H    . GLU A 1 19 ? 4.261   -5.062  -3.685  1.00 0.00 ? 17 GLU P H    8  
ATOM 8633  H HA   . GLU A 1 19 ? 6.800   -3.837  -4.275  1.00 0.00 ? 17 GLU P HA   8  
ATOM 8634  H HB2  . GLU A 1 19 ? 6.512   -6.214  -3.792  1.00 0.00 ? 17 GLU P HB2  8  
ATOM 8635  H HB3  . GLU A 1 19 ? 5.594   -6.441  -5.289  1.00 0.00 ? 17 GLU P HB3  8  
ATOM 8636  H HG2  . GLU A 1 19 ? 7.526   -5.952  -6.647  1.00 0.00 ? 17 GLU P HG2  8  
ATOM 8637  H HG3  . GLU A 1 19 ? 8.428   -5.337  -5.259  1.00 0.00 ? 17 GLU P HG3  8  
ATOM 8638  N N    . ALA A 1 20 ? 4.682   -3.948  -6.820  1.00 0.00 ? 18 ALA P N    8  
ATOM 8639  C CA   . ALA A 1 20 ? 4.341   -3.284  -8.081  1.00 0.00 ? 18 ALA P CA   8  
ATOM 8640  C C    . ALA A 1 20 ? 4.270   -1.751  -7.922  1.00 0.00 ? 18 ALA P C    8  
ATOM 8641  O O    . ALA A 1 20 ? 4.766   -1.012  -8.774  1.00 0.00 ? 18 ALA P O    8  
ATOM 8642  C CB   . ALA A 1 20 ? 3.022   -3.861  -8.605  1.00 0.00 ? 18 ALA P CB   8  
ATOM 8643  H H    . ALA A 1 20 ? 3.997   -4.583  -6.422  1.00 0.00 ? 18 ALA P H    8  
ATOM 8644  H HA   . ALA A 1 20 ? 5.114   -3.512  -8.813  1.00 0.00 ? 18 ALA P HA   8  
ATOM 8645  H HB1  . ALA A 1 20 ? 3.124   -4.937  -8.762  1.00 0.00 ? 18 ALA P HB1  8  
ATOM 8646  H HB2  . ALA A 1 20 ? 2.218   -3.677  -7.894  1.00 0.00 ? 18 ALA P HB2  8  
ATOM 8647  H HB3  . ALA A 1 20 ? 2.768   -3.391  -9.556  1.00 0.00 ? 18 ALA P HB3  8  
ATOM 8648  N N    . THR A 1 21 ? 3.724   -1.273  -6.798  1.00 0.00 ? 19 THR P N    8  
ATOM 8649  C CA   . THR A 1 21 ? 3.687   0.151   -6.422  1.00 0.00 ? 19 THR P CA   8  
ATOM 8650  C C    . THR A 1 21 ? 5.103   0.712   -6.267  1.00 0.00 ? 19 THR P C    8  
ATOM 8651  O O    . THR A 1 21 ? 5.423   1.728   -6.883  1.00 0.00 ? 19 THR P O    8  
ATOM 8652  C CB   . THR A 1 21 ? 2.866   0.341   -5.131  1.00 0.00 ? 19 THR P CB   8  
ATOM 8653  O OG1  . THR A 1 21 ? 1.522   -0.029  -5.354  1.00 0.00 ? 19 THR P OG1  8  
ATOM 8654  C CG2  . THR A 1 21 ? 2.824   1.773   -4.603  1.00 0.00 ? 19 THR P CG2  8  
ATOM 8655  H H    . THR A 1 21 ? 3.294   -1.942  -6.169  1.00 0.00 ? 19 THR P H    8  
ATOM 8656  H HA   . THR A 1 21 ? 3.196   0.713   -7.216  1.00 0.00 ? 19 THR P HA   8  
ATOM 8657  H HB   . THR A 1 21 ? 3.277   -0.289  -4.346  1.00 0.00 ? 19 THR P HB   8  
ATOM 8658  H HG1  . THR A 1 21 ? 1.502   -1.003  -5.425  1.00 0.00 ? 19 THR P HG1  8  
ATOM 8659  H HG21 . THR A 1 21 ? 2.206   1.791   -3.705  1.00 0.00 ? 19 THR P HG21 8  
ATOM 8660  H HG22 . THR A 1 21 ? 2.403   2.439   -5.356  1.00 0.00 ? 19 THR P HG22 8  
ATOM 8661  H HG23 . THR A 1 21 ? 3.827   2.107   -4.337  1.00 0.00 ? 19 THR P HG23 8  
ATOM 8662  N N    . PHE A 1 22 ? 5.982   0.032   -5.520  1.00 0.00 ? 20 PHE P N    8  
ATOM 8663  C CA   . PHE A 1 22 ? 7.363   0.468   -5.288  1.00 0.00 ? 20 PHE P CA   8  
ATOM 8664  C C    . PHE A 1 22 ? 8.208   0.488   -6.570  1.00 0.00 ? 20 PHE P C    8  
ATOM 8665  O O    . PHE A 1 22 ? 8.887   1.478   -6.837  1.00 0.00 ? 20 PHE P O    8  
ATOM 8666  C CB   . PHE A 1 22 ? 8.006   -0.422  -4.215  1.00 0.00 ? 20 PHE P CB   8  
ATOM 8667  C CG   . PHE A 1 22 ? 9.431   -0.037  -3.852  1.00 0.00 ? 20 PHE P CG   8  
ATOM 8668  C CD1  . PHE A 1 22 ? 9.679   1.107   -3.070  1.00 0.00 ? 20 PHE P CD1  8  
ATOM 8669  C CD2  . PHE A 1 22 ? 10.514  -0.828  -4.286  1.00 0.00 ? 20 PHE P CD2  8  
ATOM 8670  C CE1  . PHE A 1 22 ? 10.995  1.451   -2.711  1.00 0.00 ? 20 PHE P CE1  8  
ATOM 8671  C CE2  . PHE A 1 22 ? 11.830  -0.489  -3.923  1.00 0.00 ? 20 PHE P CE2  8  
ATOM 8672  C CZ   . PHE A 1 22 ? 12.071  0.651   -3.134  1.00 0.00 ? 20 PHE P CZ   8  
ATOM 8673  H H    . PHE A 1 22 ? 5.660   -0.799  -5.032  1.00 0.00 ? 20 PHE P H    8  
ATOM 8674  H HA   . PHE A 1 22 ? 7.338   1.489   -4.903  1.00 0.00 ? 20 PHE P HA   8  
ATOM 8675  H HB2  . PHE A 1 22 ? 7.398   -0.371  -3.312  1.00 0.00 ? 20 PHE P HB2  8  
ATOM 8676  H HB3  . PHE A 1 22 ? 7.992   -1.457  -4.557  1.00 0.00 ? 20 PHE P HB3  8  
ATOM 8677  H HD1  . PHE A 1 22 ? 8.858   1.728   -2.741  1.00 0.00 ? 20 PHE P HD1  8  
ATOM 8678  H HD2  . PHE A 1 22 ? 10.334  -1.707  -4.891  1.00 0.00 ? 20 PHE P HD2  8  
ATOM 8679  H HE1  . PHE A 1 22 ? 11.181  2.332   -2.108  1.00 0.00 ? 20 PHE P HE1  8  
ATOM 8680  H HE2  . PHE A 1 22 ? 12.656  -1.110  -4.239  1.00 0.00 ? 20 PHE P HE2  8  
ATOM 8681  H HZ   . PHE A 1 22 ? 13.082  0.911   -2.852  1.00 0.00 ? 20 PHE P HZ   8  
ATOM 8682  N N    . GLN A 1 23 ? 8.147   -0.554  -7.408  1.00 0.00 ? 21 GLN P N    8  
ATOM 8683  C CA   . GLN A 1 23 ? 8.939   -0.591  -8.649  1.00 0.00 ? 21 GLN P CA   8  
ATOM 8684  C C    . GLN A 1 23 ? 8.448   0.411   -9.716  1.00 0.00 ? 21 GLN P C    8  
ATOM 8685  O O    . GLN A 1 23 ? 9.236   0.834   -10.564 1.00 0.00 ? 21 GLN P O    8  
ATOM 8686  C CB   . GLN A 1 23 ? 9.069   -2.029  -9.173  1.00 0.00 ? 21 GLN P CB   8  
ATOM 8687  C CG   . GLN A 1 23 ? 7.799   -2.547  -9.856  1.00 0.00 ? 21 GLN P CG   8  
ATOM 8688  C CD   . GLN A 1 23 ? 7.876   -4.014  -10.271 1.00 0.00 ? 21 GLN P CD   8  
ATOM 8689  O OE1  . GLN A 1 23 ? 8.804   -4.757  -9.977  1.00 0.00 ? 21 GLN P OE1  8  
ATOM 8690  N NE2  . GLN A 1 23 ? 6.883   -4.487  -10.992 1.00 0.00 ? 21 GLN P NE2  8  
ATOM 8691  H H    . GLN A 1 23 ? 7.594   -1.366  -7.149  1.00 0.00 ? 21 GLN P H    8  
ATOM 8692  H HA   . GLN A 1 23 ? 9.951   -0.287  -8.394  1.00 0.00 ? 21 GLN P HA   8  
ATOM 8693  H HB2  . GLN A 1 23 ? 9.887   -2.063  -9.894  1.00 0.00 ? 21 GLN P HB2  8  
ATOM 8694  H HB3  . GLN A 1 23 ? 9.328   -2.682  -8.337  1.00 0.00 ? 21 GLN P HB3  8  
ATOM 8695  H HG2  . GLN A 1 23 ? 6.961   -2.425  -9.178  1.00 0.00 ? 21 GLN P HG2  8  
ATOM 8696  H HG3  . GLN A 1 23 ? 7.600   -1.952  -10.748 1.00 0.00 ? 21 GLN P HG3  8  
ATOM 8697  H HE21 . GLN A 1 23 ? 6.130   -3.877  -11.267 1.00 0.00 ? 21 GLN P HE21 8  
ATOM 8698  H HE22 . GLN A 1 23 ? 6.923   -5.450  -11.288 1.00 0.00 ? 21 GLN P HE22 8  
ATOM 8699  N N    . ARG A 1 24 ? 7.171   0.830   -9.655  1.00 0.00 ? 22 ARG P N    8  
ATOM 8700  C CA   . ARG A 1 24 ? 6.604   1.914   -10.481 1.00 0.00 ? 22 ARG P CA   8  
ATOM 8701  C C    . ARG A 1 24 ? 6.983   3.303   -9.949  1.00 0.00 ? 22 ARG P C    8  
ATOM 8702  O O    . ARG A 1 24 ? 7.339   4.178   -10.740 1.00 0.00 ? 22 ARG P O    8  
ATOM 8703  C CB   . ARG A 1 24 ? 5.077   1.721   -10.576 1.00 0.00 ? 22 ARG P CB   8  
ATOM 8704  C CG   . ARG A 1 24 ? 4.337   2.759   -11.437 1.00 0.00 ? 22 ARG P CG   8  
ATOM 8705  C CD   . ARG A 1 24 ? 4.795   2.765   -12.904 1.00 0.00 ? 22 ARG P CD   8  
ATOM 8706  N NE   . ARG A 1 24 ? 4.015   3.728   -13.708 1.00 0.00 ? 22 ARG P NE   8  
ATOM 8707  C CZ   . ARG A 1 24 ? 2.857   3.519   -14.314 1.00 0.00 ? 22 ARG P CZ   8  
ATOM 8708  N NH1  . ARG A 1 24 ? 2.244   2.370   -14.273 1.00 0.00 ? 22 ARG P NH1  8  
ATOM 8709  N NH2  . ARG A 1 24 ? 2.284   4.480   -14.981 1.00 0.00 ? 22 ARG P NH2  8  
ATOM 8710  H H    . ARG A 1 24 ? 6.566   0.389   -8.972  1.00 0.00 ? 22 ARG P H    8  
ATOM 8711  H HA   . ARG A 1 24 ? 7.028   1.838   -11.484 1.00 0.00 ? 22 ARG P HA   8  
ATOM 8712  H HB2  . ARG A 1 24 ? 4.875   0.729   -10.987 1.00 0.00 ? 22 ARG P HB2  8  
ATOM 8713  H HB3  . ARG A 1 24 ? 4.653   1.754   -9.571  1.00 0.00 ? 22 ARG P HB3  8  
ATOM 8714  H HG2  . ARG A 1 24 ? 3.271   2.527   -11.402 1.00 0.00 ? 22 ARG P HG2  8  
ATOM 8715  H HG3  . ARG A 1 24 ? 4.474   3.753   -11.013 1.00 0.00 ? 22 ARG P HG3  8  
ATOM 8716  H HD2  . ARG A 1 24 ? 5.846   3.052   -12.948 1.00 0.00 ? 22 ARG P HD2  8  
ATOM 8717  H HD3  . ARG A 1 24 ? 4.707   1.760   -13.320 1.00 0.00 ? 22 ARG P HD3  8  
ATOM 8718  H HE   . ARG A 1 24 ? 4.407   4.650   -13.811 1.00 0.00 ? 22 ARG P HE   8  
ATOM 8719  H HH11 . ARG A 1 24 ? 2.662   1.606   -13.772 1.00 0.00 ? 22 ARG P HH11 8  
ATOM 8720  H HH12 . ARG A 1 24 ? 1.364   2.241   -14.746 1.00 0.00 ? 22 ARG P HH12 8  
ATOM 8721  H HH21 . ARG A 1 24 ? 2.721   5.386   -15.039 1.00 0.00 ? 22 ARG P HH21 8  
ATOM 8722  H HH22 . ARG A 1 24 ? 1.402   4.325   -15.438 1.00 0.00 ? 22 ARG P HH22 8  
ATOM 8723  N N    . ASN A 1 25 ? 6.932   3.503   -8.631  1.00 0.00 ? 23 ASN P N    8  
ATOM 8724  C CA   . ASN A 1 25 ? 7.330   4.734   -7.945  1.00 0.00 ? 23 ASN P CA   8  
ATOM 8725  C C    . ASN A 1 25 ? 7.948   4.422   -6.566  1.00 0.00 ? 23 ASN P C    8  
ATOM 8726  O O    . ASN A 1 25 ? 7.250   3.985   -5.648  1.00 0.00 ? 23 ASN P O    8  
ATOM 8727  C CB   . ASN A 1 25 ? 6.094   5.651   -7.823  1.00 0.00 ? 23 ASN P CB   8  
ATOM 8728  C CG   . ASN A 1 25 ? 6.393   6.993   -7.169  1.00 0.00 ? 23 ASN P CG   8  
ATOM 8729  O OD1  . ASN A 1 25 ? 7.519   7.326   -6.826  1.00 0.00 ? 23 ASN P OD1  8  
ATOM 8730  N ND2  . ASN A 1 25 ? 5.389   7.816   -6.977  1.00 0.00 ? 23 ASN P ND2  8  
ATOM 8731  H H    . ASN A 1 25 ? 6.585   2.743   -8.055  1.00 0.00 ? 23 ASN P H    8  
ATOM 8732  H HA   . ASN A 1 25 ? 8.083   5.252   -8.544  1.00 0.00 ? 23 ASN P HA   8  
ATOM 8733  H HB2  . ASN A 1 25 ? 5.690   5.845   -8.816  1.00 0.00 ? 23 ASN P HB2  8  
ATOM 8734  H HB3  . ASN A 1 25 ? 5.325   5.146   -7.237  1.00 0.00 ? 23 ASN P HB3  8  
ATOM 8735  H HD21 . ASN A 1 25 ? 4.459   7.564   -7.273  1.00 0.00 ? 23 ASN P HD21 8  
ATOM 8736  H HD22 . ASN A 1 25 ? 5.587   8.718   -6.576  1.00 0.00 ? 23 ASN P HD22 8  
ATOM 8737  N N    . ARG A 1 26 ? 9.249   4.703   -6.400  1.00 0.00 ? 24 ARG P N    8  
ATOM 8738  C CA   . ARG A 1 26 ? 9.983   4.495   -5.135  1.00 0.00 ? 24 ARG P CA   8  
ATOM 8739  C C    . ARG A 1 26 ? 9.815   5.626   -4.119  1.00 0.00 ? 24 ARG P C    8  
ATOM 8740  O O    . ARG A 1 26 ? 10.203  5.453   -2.964  1.00 0.00 ? 24 ARG P O    8  
ATOM 8741  C CB   . ARG A 1 26 ? 11.469  4.197   -5.416  1.00 0.00 ? 24 ARG P CB   8  
ATOM 8742  C CG   . ARG A 1 26 ? 11.637  2.841   -6.116  1.00 0.00 ? 24 ARG P CG   8  
ATOM 8743  C CD   . ARG A 1 26 ? 13.108  2.442   -6.264  1.00 0.00 ? 24 ARG P CD   8  
ATOM 8744  N NE   . ARG A 1 26 ? 13.231  1.050   -6.744  1.00 0.00 ? 24 ARG P NE   8  
ATOM 8745  C CZ   . ARG A 1 26 ? 13.075  0.601   -7.976  1.00 0.00 ? 24 ARG P CZ   8  
ATOM 8746  N NH1  . ARG A 1 26 ? 12.832  1.391   -8.984  1.00 0.00 ? 24 ARG P NH1  8  
ATOM 8747  N NH2  . ARG A 1 26 ? 13.160  -0.674  -8.223  1.00 0.00 ? 24 ARG P NH2  8  
ATOM 8748  H H    . ARG A 1 26 ? 9.760   5.063   -7.195  1.00 0.00 ? 24 ARG P H    8  
ATOM 8749  H HA   . ARG A 1 26 ? 9.568   3.617   -4.639  1.00 0.00 ? 24 ARG P HA   8  
ATOM 8750  H HB2  . ARG A 1 26 ? 11.900  4.989   -6.031  1.00 0.00 ? 24 ARG P HB2  8  
ATOM 8751  H HB3  . ARG A 1 26 ? 12.009  4.162   -4.470  1.00 0.00 ? 24 ARG P HB3  8  
ATOM 8752  H HG2  . ARG A 1 26 ? 11.133  2.078   -5.526  1.00 0.00 ? 24 ARG P HG2  8  
ATOM 8753  H HG3  . ARG A 1 26 ? 11.177  2.880   -7.103  1.00 0.00 ? 24 ARG P HG3  8  
ATOM 8754  H HD2  . ARG A 1 26 ? 13.614  3.131   -6.943  1.00 0.00 ? 24 ARG P HD2  8  
ATOM 8755  H HD3  . ARG A 1 26 ? 13.590  2.517   -5.288  1.00 0.00 ? 24 ARG P HD3  8  
ATOM 8756  H HE   . ARG A 1 26 ? 13.445  0.360   -6.042  1.00 0.00 ? 24 ARG P HE   8  
ATOM 8757  H HH11 . ARG A 1 26 ? 12.776  2.381   -8.827  1.00 0.00 ? 24 ARG P HH11 8  
ATOM 8758  H HH12 . ARG A 1 26 ? 12.714  1.021   -9.911  1.00 0.00 ? 24 ARG P HH12 8  
ATOM 8759  H HH21 . ARG A 1 26 ? 13.328  -1.327  -7.476  1.00 0.00 ? 24 ARG P HH21 8  
ATOM 8760  H HH22 . ARG A 1 26 ? 13.064  -1.015  -9.164  1.00 0.00 ? 24 ARG P HH22 8  
ATOM 8761  N N    . TYR A 1 27 ? 9.222   6.759   -4.500  1.00 0.00 ? 25 TYR P N    8  
ATOM 8762  C CA   . TYR A 1 27 ? 9.026   7.936   -3.638  1.00 0.00 ? 25 TYR P CA   8  
ATOM 8763  C C    . TYR A 1 27 ? 7.599   8.532   -3.748  1.00 0.00 ? 25 TYR P C    8  
ATOM 8764  O O    . TYR A 1 27 ? 7.437   9.701   -4.116  1.00 0.00 ? 25 TYR P O    8  
ATOM 8765  C CB   . TYR A 1 27 ? 10.161  8.941   -3.907  1.00 0.00 ? 25 TYR P CB   8  
ATOM 8766  C CG   . TYR A 1 27 ? 11.540  8.397   -3.570  1.00 0.00 ? 25 TYR P CG   8  
ATOM 8767  C CD1  . TYR A 1 27 ? 12.017  8.463   -2.246  1.00 0.00 ? 25 TYR P CD1  8  
ATOM 8768  C CD2  . TYR A 1 27 ? 12.326  7.782   -4.566  1.00 0.00 ? 25 TYR P CD2  8  
ATOM 8769  C CE1  . TYR A 1 27 ? 13.276  7.923   -1.917  1.00 0.00 ? 25 TYR P CE1  8  
ATOM 8770  C CE2  . TYR A 1 27 ? 13.585  7.236   -4.241  1.00 0.00 ? 25 TYR P CE2  8  
ATOM 8771  C CZ   . TYR A 1 27 ? 14.064  7.307   -2.914  1.00 0.00 ? 25 TYR P CZ   8  
ATOM 8772  O OH   . TYR A 1 27 ? 15.275  6.779   -2.585  1.00 0.00 ? 25 TYR P OH   8  
ATOM 8773  H H    . TYR A 1 27 ? 8.884   6.819   -5.453  1.00 0.00 ? 25 TYR P H    8  
ATOM 8774  H HA   . TYR A 1 27 ? 9.129   7.631   -2.597  1.00 0.00 ? 25 TYR P HA   8  
ATOM 8775  H HB2  . TYR A 1 27 ? 10.135  9.238   -4.955  1.00 0.00 ? 25 TYR P HB2  8  
ATOM 8776  H HB3  . TYR A 1 27 ? 9.991   9.834   -3.302  1.00 0.00 ? 25 TYR P HB3  8  
ATOM 8777  H HD1  . TYR A 1 27 ? 11.413  8.925   -1.475  1.00 0.00 ? 25 TYR P HD1  8  
ATOM 8778  H HD2  . TYR A 1 27 ? 11.955  7.710   -5.580  1.00 0.00 ? 25 TYR P HD2  8  
ATOM 8779  H HE1  . TYR A 1 27 ? 13.647  7.974   -0.903  1.00 0.00 ? 25 TYR P HE1  8  
ATOM 8780  H HE2  . TYR A 1 27 ? 14.184  6.760   -5.006  1.00 0.00 ? 25 TYR P HE2  8  
ATOM 8781  H HH   . TYR A 1 27 ? 15.732  6.402   -3.355  1.00 0.00 ? 25 TYR P HH   8  
ATOM 8782  N N    . PRO A 1 28 ? 6.543   7.755   -3.431  1.00 0.00 ? 26 PRO P N    8  
ATOM 8783  C CA   . PRO A 1 28 ? 5.180   8.273   -3.342  1.00 0.00 ? 26 PRO P CA   8  
ATOM 8784  C C    . PRO A 1 28 ? 5.024   9.251   -2.165  1.00 0.00 ? 26 PRO P C    8  
ATOM 8785  O O    . PRO A 1 28 ? 5.632   9.072   -1.105  1.00 0.00 ? 26 PRO P O    8  
ATOM 8786  C CB   . PRO A 1 28 ? 4.291   7.039   -3.184  1.00 0.00 ? 26 PRO P CB   8  
ATOM 8787  C CG   . PRO A 1 28 ? 5.197   6.040   -2.464  1.00 0.00 ? 26 PRO P CG   8  
ATOM 8788  C CD   . PRO A 1 28 ? 6.577   6.352   -3.032  1.00 0.00 ? 26 PRO P CD   8  
ATOM 8789  H HA   . PRO A 1 28 ? 4.912   8.788   -4.263  1.00 0.00 ? 26 PRO P HA   8  
ATOM 8790  H HB2  . PRO A 1 28 ? 3.389   7.248   -2.607  1.00 0.00 ? 26 PRO P HB2  8  
ATOM 8791  H HB3  . PRO A 1 28 ? 4.032   6.649   -4.171  1.00 0.00 ? 26 PRO P HB3  8  
ATOM 8792  H HG2  . PRO A 1 28 ? 5.194   6.241   -1.393  1.00 0.00 ? 26 PRO P HG2  8  
ATOM 8793  H HG3  . PRO A 1 28 ? 4.902   5.009   -2.664  1.00 0.00 ? 26 PRO P HG3  8  
ATOM 8794  H HD2  . PRO A 1 28 ? 7.342   6.166   -2.277  1.00 0.00 ? 26 PRO P HD2  8  
ATOM 8795  H HD3  . PRO A 1 28 ? 6.752   5.736   -3.911  1.00 0.00 ? 26 PRO P HD3  8  
ATOM 8796  N N    . ASP A 1 29 ? 4.169   10.261  -2.322  1.00 0.00 ? 27 ASP P N    8  
ATOM 8797  C CA   . ASP A 1 29 ? 3.748   11.150  -1.231  1.00 0.00 ? 27 ASP P CA   8  
ATOM 8798  C C    . ASP A 1 29 ? 2.917   10.386  -0.182  1.00 0.00 ? 27 ASP P C    8  
ATOM 8799  O O    . ASP A 1 29 ? 2.280   9.382   -0.495  1.00 0.00 ? 27 ASP P O    8  
ATOM 8800  C CB   . ASP A 1 29 ? 2.961   12.329  -1.824  1.00 0.00 ? 27 ASP P CB   8  
ATOM 8801  C CG   . ASP A 1 29 ? 2.563   13.347  -0.746  1.00 0.00 ? 27 ASP P CG   8  
ATOM 8802  O OD1  . ASP A 1 29 ? 3.408   14.194  -0.373  1.00 0.00 ? 27 ASP P OD1  8  
ATOM 8803  O OD2  . ASP A 1 29 ? 1.421   13.258  -0.238  1.00 0.00 ? 27 ASP P OD2  8  
ATOM 8804  H H    . ASP A 1 29 ? 3.702   10.365  -3.210  1.00 0.00 ? 27 ASP P H    8  
ATOM 8805  H HA   . ASP A 1 29 ? 4.638   11.546  -0.739  1.00 0.00 ? 27 ASP P HA   8  
ATOM 8806  H HB2  . ASP A 1 29 ? 3.575   12.826  -2.578  1.00 0.00 ? 27 ASP P HB2  8  
ATOM 8807  H HB3  . ASP A 1 29 ? 2.064   11.950  -2.317  1.00 0.00 ? 27 ASP P HB3  8  
ATOM 8808  N N    . MET A 1 30 ? 2.883   10.861  1.066   1.00 0.00 ? 28 MET P N    8  
ATOM 8809  C CA   . MET A 1 30 ? 2.111   10.238  2.152   1.00 0.00 ? 28 MET P CA   8  
ATOM 8810  C C    . MET A 1 30 ? 0.602   10.139  1.847   1.00 0.00 ? 28 MET P C    8  
ATOM 8811  O O    . MET A 1 30 ? -0.042  9.179   2.272   1.00 0.00 ? 28 MET P O    8  
ATOM 8812  C CB   . MET A 1 30 ? 2.356   11.021  3.451   1.00 0.00 ? 28 MET P CB   8  
ATOM 8813  C CG   . MET A 1 30 ? 3.808   10.882  3.940   1.00 0.00 ? 28 MET P CG   8  
ATOM 8814  S SD   . MET A 1 30 ? 4.570   12.413  4.550   1.00 0.00 ? 28 MET P SD   8  
ATOM 8815  C CE   . MET A 1 30 ? 4.805   13.301  2.982   1.00 0.00 ? 28 MET P CE   8  
ATOM 8816  H H    . MET A 1 30 ? 3.391   11.708  1.272   1.00 0.00 ? 28 MET P H    8  
ATOM 8817  H HA   . MET A 1 30 ? 2.473   9.219   2.296   1.00 0.00 ? 28 MET P HA   8  
ATOM 8818  H HB2  . MET A 1 30 ? 2.116   12.072  3.281   1.00 0.00 ? 28 MET P HB2  8  
ATOM 8819  H HB3  . MET A 1 30 ? 1.693   10.649  4.232   1.00 0.00 ? 28 MET P HB3  8  
ATOM 8820  H HG2  . MET A 1 30 ? 3.826   10.145  4.744   1.00 0.00 ? 28 MET P HG2  8  
ATOM 8821  H HG3  . MET A 1 30 ? 4.438   10.494  3.138   1.00 0.00 ? 28 MET P HG3  8  
ATOM 8822  H HE1  . MET A 1 30 ? 5.318   14.244  3.169   1.00 0.00 ? 28 MET P HE1  8  
ATOM 8823  H HE2  . MET A 1 30 ? 5.408   12.698  2.300   1.00 0.00 ? 28 MET P HE2  8  
ATOM 8824  H HE3  . MET A 1 30 ? 3.840   13.510  2.520   1.00 0.00 ? 28 MET P HE3  8  
ATOM 8825  N N    . SER A 1 31 ? 0.043   11.061  1.054   1.00 0.00 ? 29 SER P N    8  
ATOM 8826  C CA   . SER A 1 31 ? -1.338  10.964  0.548   1.00 0.00 ? 29 SER P CA   8  
ATOM 8827  C C    . SER A 1 31 ? -1.509  9.849   -0.494  1.00 0.00 ? 29 SER P C    8  
ATOM 8828  O O    . SER A 1 31 ? -2.495  9.113   -0.450  1.00 0.00 ? 29 SER P O    8  
ATOM 8829  C CB   . SER A 1 31 ? -1.811  12.313  -0.010  1.00 0.00 ? 29 SER P CB   8  
ATOM 8830  O OG   . SER A 1 31 ? -1.033  12.743  -1.116  1.00 0.00 ? 29 SER P OG   8  
ATOM 8831  H H    . SER A 1 31 ? 0.622   11.829  0.723   1.00 0.00 ? 29 SER P H    8  
ATOM 8832  H HA   . SER A 1 31 ? -1.991  10.721  1.387   1.00 0.00 ? 29 SER P HA   8  
ATOM 8833  H HB2  . SER A 1 31 ? -2.852  12.217  -0.324  1.00 0.00 ? 29 SER P HB2  8  
ATOM 8834  H HB3  . SER A 1 31 ? -1.761  13.065  0.778   1.00 0.00 ? 29 SER P HB3  8  
ATOM 8835  H HG   . SER A 1 31 ? -0.143  13.001  -0.777  1.00 0.00 ? 29 SER P HG   8  
ATOM 8836  N N    . THR A 1 32 ? -0.520  9.639   -1.372  1.00 0.00 ? 30 THR P N    8  
ATOM 8837  C CA   . THR A 1 32 ? -0.483  8.508   -2.315  1.00 0.00 ? 30 THR P CA   8  
ATOM 8838  C C    . THR A 1 32 ? -0.340  7.179   -1.569  1.00 0.00 ? 30 THR P C    8  
ATOM 8839  O O    . THR A 1 32 ? -1.056  6.226   -1.881  1.00 0.00 ? 30 THR P O    8  
ATOM 8840  C CB   . THR A 1 32 ? 0.659   8.674   -3.336  1.00 0.00 ? 30 THR P CB   8  
ATOM 8841  O OG1  . THR A 1 32 ? 0.529   9.911   -4.007  1.00 0.00 ? 30 THR P OG1  8  
ATOM 8842  C CG2  . THR A 1 32 ? 0.673   7.580   -4.406  1.00 0.00 ? 30 THR P CG2  8  
ATOM 8843  H H    . THR A 1 32 ? 0.264   10.275  -1.368  1.00 0.00 ? 30 THR P H    8  
ATOM 8844  H HA   . THR A 1 32 ? -1.422  8.479   -2.867  1.00 0.00 ? 30 THR P HA   8  
ATOM 8845  H HB   . THR A 1 32 ? 1.614   8.661   -2.814  1.00 0.00 ? 30 THR P HB   8  
ATOM 8846  H HG1  . THR A 1 32 ? 1.229   9.967   -4.679  1.00 0.00 ? 30 THR P HG1  8  
ATOM 8847  H HG21 . THR A 1 32 ? -0.292  7.543   -4.914  1.00 0.00 ? 30 THR P HG21 8  
ATOM 8848  H HG22 . THR A 1 32 ? 0.875   6.611   -3.949  1.00 0.00 ? 30 THR P HG22 8  
ATOM 8849  H HG23 . THR A 1 32 ? 1.460   7.783   -5.134  1.00 0.00 ? 30 THR P HG23 8  
ATOM 8850  N N    . ARG A 1 33 ? 0.518   7.122   -0.536  1.00 0.00 ? 31 ARG P N    8  
ATOM 8851  C CA   . ARG A 1 33 ? 0.667   5.948   0.346   1.00 0.00 ? 31 ARG P CA   8  
ATOM 8852  C C    . ARG A 1 33 ? -0.642  5.606   1.056   1.00 0.00 ? 31 ARG P C    8  
ATOM 8853  O O    . ARG A 1 33 ? -0.982  4.432   1.158   1.00 0.00 ? 31 ARG P O    8  
ATOM 8854  C CB   . ARG A 1 33 ? 1.796   6.151   1.375   1.00 0.00 ? 31 ARG P CB   8  
ATOM 8855  C CG   . ARG A 1 33 ? 3.177   6.298   0.720   1.00 0.00 ? 31 ARG P CG   8  
ATOM 8856  C CD   . ARG A 1 33 ? 4.276   6.543   1.766   1.00 0.00 ? 31 ARG P CD   8  
ATOM 8857  N NE   . ARG A 1 33 ? 5.347   7.397   1.219   1.00 0.00 ? 31 ARG P NE   8  
ATOM 8858  C CZ   . ARG A 1 33 ? 6.511   7.688   1.762   1.00 0.00 ? 31 ARG P CZ   8  
ATOM 8859  N NH1  . ARG A 1 33 ? 6.902   7.190   2.899   1.00 0.00 ? 31 ARG P NH1  8  
ATOM 8860  N NH2  . ARG A 1 33 ? 7.304   8.509   1.141   1.00 0.00 ? 31 ARG P NH2  8  
ATOM 8861  H H    . ARG A 1 33 ? 1.098   7.940   -0.366  1.00 0.00 ? 31 ARG P H    8  
ATOM 8862  H HA   . ARG A 1 33 ? 0.909   5.080   -0.262  1.00 0.00 ? 31 ARG P HA   8  
ATOM 8863  H HB2  . ARG A 1 33 ? 1.584   7.037   1.975   1.00 0.00 ? 31 ARG P HB2  8  
ATOM 8864  H HB3  . ARG A 1 33 ? 1.824   5.287   2.042   1.00 0.00 ? 31 ARG P HB3  8  
ATOM 8865  H HG2  . ARG A 1 33 ? 3.416   5.398   0.151   1.00 0.00 ? 31 ARG P HG2  8  
ATOM 8866  H HG3  . ARG A 1 33 ? 3.155   7.134   0.025   1.00 0.00 ? 31 ARG P HG3  8  
ATOM 8867  H HD2  . ARG A 1 33 ? 3.844   7.038   2.638   1.00 0.00 ? 31 ARG P HD2  8  
ATOM 8868  H HD3  . ARG A 1 33 ? 4.678   5.577   2.080   1.00 0.00 ? 31 ARG P HD3  8  
ATOM 8869  H HE   . ARG A 1 33 ? 5.161   7.869   0.341   1.00 0.00 ? 31 ARG P HE   8  
ATOM 8870  H HH11 . ARG A 1 33 ? 6.295   6.563   3.393   1.00 0.00 ? 31 ARG P HH11 8  
ATOM 8871  H HH12 . ARG A 1 33 ? 7.787   7.456   3.296   1.00 0.00 ? 31 ARG P HH12 8  
ATOM 8872  H HH21 . ARG A 1 33 ? 6.983   8.915   0.268   1.00 0.00 ? 31 ARG P HH21 8  
ATOM 8873  H HH22 . ARG A 1 33 ? 8.190   8.775   1.535   1.00 0.00 ? 31 ARG P HH22 8  
ATOM 8874  N N    . GLU A 1 34 ? -1.398  6.612   1.496   1.00 0.00 ? 32 GLU P N    8  
ATOM 8875  C CA   . GLU A 1 34 ? -2.720  6.432   2.107   1.00 0.00 ? 32 GLU P CA   8  
ATOM 8876  C C    . GLU A 1 34 ? -3.772  5.933   1.101   1.00 0.00 ? 32 GLU P C    8  
ATOM 8877  O O    . GLU A 1 34 ? -4.529  5.019   1.423   1.00 0.00 ? 32 GLU P O    8  
ATOM 8878  C CB   . GLU A 1 34 ? -3.147  7.743   2.794   1.00 0.00 ? 32 GLU P CB   8  
ATOM 8879  C CG   . GLU A 1 34 ? -4.451  7.606   3.589   1.00 0.00 ? 32 GLU P CG   8  
ATOM 8880  C CD   . GLU A 1 34 ? -4.812  8.932   4.290   1.00 0.00 ? 32 GLU P CD   8  
ATOM 8881  O OE1  . GLU A 1 34 ? -5.529  9.768   3.685   1.00 0.00 ? 32 GLU P OE1  8  
ATOM 8882  O OE2  . GLU A 1 34 ? -4.391  9.148   5.452   1.00 0.00 ? 32 GLU P OE2  8  
ATOM 8883  H H    . GLU A 1 34 ? -1.022  7.551   1.430   1.00 0.00 ? 32 GLU P H    8  
ATOM 8884  H HA   . GLU A 1 34 ? -2.624  5.661   2.873   1.00 0.00 ? 32 GLU P HA   8  
ATOM 8885  H HB2  . GLU A 1 34 ? -2.359  8.050   3.482   1.00 0.00 ? 32 GLU P HB2  8  
ATOM 8886  H HB3  . GLU A 1 34 ? -3.271  8.524   2.046   1.00 0.00 ? 32 GLU P HB3  8  
ATOM 8887  H HG2  . GLU A 1 34 ? -5.262  7.319   2.915   1.00 0.00 ? 32 GLU P HG2  8  
ATOM 8888  H HG3  . GLU A 1 34 ? -4.338  6.811   4.330   1.00 0.00 ? 32 GLU P HG3  8  
ATOM 8889  N N    . GLU A 1 35 ? -3.802  6.452   -0.131  1.00 0.00 ? 33 GLU P N    8  
ATOM 8890  C CA   . GLU A 1 35 ? -4.698  5.935   -1.178  1.00 0.00 ? 33 GLU P CA   8  
ATOM 8891  C C    . GLU A 1 35 ? -4.389  4.469   -1.526  1.00 0.00 ? 33 GLU P C    8  
ATOM 8892  O O    . GLU A 1 35 ? -5.308  3.652   -1.557  1.00 0.00 ? 33 GLU P O    8  
ATOM 8893  C CB   . GLU A 1 35 ? -4.647  6.812   -2.441  1.00 0.00 ? 33 GLU P CB   8  
ATOM 8894  C CG   . GLU A 1 35 ? -5.390  8.141   -2.255  1.00 0.00 ? 33 GLU P CG   8  
ATOM 8895  C CD   . GLU A 1 35 ? -5.480  8.916   -3.586  1.00 0.00 ? 33 GLU P CD   8  
ATOM 8896  O OE1  . GLU A 1 35 ? -4.464  9.507   -4.028  1.00 0.00 ? 33 GLU P OE1  8  
ATOM 8897  O OE2  . GLU A 1 35 ? -6.578  8.952   -4.195  1.00 0.00 ? 33 GLU P OE2  8  
ATOM 8898  H H    . GLU A 1 35 ? -3.184  7.224   -0.355  1.00 0.00 ? 33 GLU P H    8  
ATOM 8899  H HA   . GLU A 1 35 ? -5.725  5.941   -0.801  1.00 0.00 ? 33 GLU P HA   8  
ATOM 8900  H HB2  . GLU A 1 35 ? -3.611  7.000   -2.721  1.00 0.00 ? 33 GLU P HB2  8  
ATOM 8901  H HB3  . GLU A 1 35 ? -5.129  6.270   -3.255  1.00 0.00 ? 33 GLU P HB3  8  
ATOM 8902  H HG2  . GLU A 1 35 ? -6.396  7.933   -1.881  1.00 0.00 ? 33 GLU P HG2  8  
ATOM 8903  H HG3  . GLU A 1 35 ? -4.882  8.749   -1.505  1.00 0.00 ? 33 GLU P HG3  8  
ATOM 8904  N N    . ILE A 1 36 ? -3.117  4.084   -1.702  1.00 0.00 ? 34 ILE P N    8  
ATOM 8905  C CA   . ILE A 1 36 ? -2.780  2.675   -1.976  1.00 0.00 ? 34 ILE P CA   8  
ATOM 8906  C C    . ILE A 1 36 ? -2.992  1.770   -0.749  1.00 0.00 ? 34 ILE P C    8  
ATOM 8907  O O    . ILE A 1 36 ? -3.303  0.590   -0.923  1.00 0.00 ? 34 ILE P O    8  
ATOM 8908  C CB   . ILE A 1 36 ? -1.403  2.506   -2.660  1.00 0.00 ? 34 ILE P CB   8  
ATOM 8909  C CG1  . ILE A 1 36 ? -0.178  2.881   -1.808  1.00 0.00 ? 34 ILE P CG1  8  
ATOM 8910  C CG2  . ILE A 1 36 ? -1.354  3.334   -3.955  1.00 0.00 ? 34 ILE P CG2  8  
ATOM 8911  C CD1  . ILE A 1 36 ? 0.259   1.804   -0.813  1.00 0.00 ? 34 ILE P CD1  8  
ATOM 8912  H H    . ILE A 1 36 ? -2.377  4.778   -1.679  1.00 0.00 ? 34 ILE P H    8  
ATOM 8913  H HA   . ILE A 1 36 ? -3.504  2.323   -2.710  1.00 0.00 ? 34 ILE P HA   8  
ATOM 8914  H HB   . ILE A 1 36 ? -1.305  1.460   -2.948  1.00 0.00 ? 34 ILE P HB   8  
ATOM 8915  H HG12 . ILE A 1 36 ? 0.671   3.072   -2.464  1.00 0.00 ? 34 ILE P HG12 8  
ATOM 8916  H HG13 . ILE A 1 36 ? -0.395  3.797   -1.276  1.00 0.00 ? 34 ILE P HG13 8  
ATOM 8917  H HG21 . ILE A 1 36 ? -0.457  3.081   -4.520  1.00 0.00 ? 34 ILE P HG21 8  
ATOM 8918  H HG22 . ILE A 1 36 ? -2.225  3.115   -4.571  1.00 0.00 ? 34 ILE P HG22 8  
ATOM 8919  H HG23 . ILE A 1 36 ? -1.332  4.398   -3.723  1.00 0.00 ? 34 ILE P HG23 8  
ATOM 8920  H HD11 . ILE A 1 36 ? 0.293   0.834   -1.308  1.00 0.00 ? 34 ILE P HD11 8  
ATOM 8921  H HD12 . ILE A 1 36 ? 1.254   2.049   -0.446  1.00 0.00 ? 34 ILE P HD12 8  
ATOM 8922  H HD13 . ILE A 1 36 ? -0.417  1.761   0.037   1.00 0.00 ? 34 ILE P HD13 8  
ATOM 8923  N N    . ALA A 1 37 ? -2.927  2.306   0.478   1.00 0.00 ? 35 ALA P N    8  
ATOM 8924  C CA   . ALA A 1 37 ? -3.322  1.595   1.699   1.00 0.00 ? 35 ALA P CA   8  
ATOM 8925  C C    . ALA A 1 37 ? -4.831  1.297   1.695   1.00 0.00 ? 35 ALA P C    8  
ATOM 8926  O O    . ALA A 1 37 ? -5.233  0.162   1.936   1.00 0.00 ? 35 ALA P O    8  
ATOM 8927  C CB   . ALA A 1 37 ? -2.904  2.407   2.934   1.00 0.00 ? 35 ALA P CB   8  
ATOM 8928  H H    . ALA A 1 37 ? -2.606  3.262   0.568   1.00 0.00 ? 35 ALA P H    8  
ATOM 8929  H HA   . ALA A 1 37 ? -2.799  0.638   1.743   1.00 0.00 ? 35 ALA P HA   8  
ATOM 8930  H HB1  . ALA A 1 37 ? -3.499  3.314   3.016   1.00 0.00 ? 35 ALA P HB1  8  
ATOM 8931  H HB2  . ALA A 1 37 ? -3.059  1.808   3.830   1.00 0.00 ? 35 ALA P HB2  8  
ATOM 8932  H HB3  . ALA A 1 37 ? -1.851  2.674   2.873   1.00 0.00 ? 35 ALA P HB3  8  
ATOM 8933  N N    . VAL A 1 38 ? -5.671  2.271   1.323   1.00 0.00 ? 36 VAL P N    8  
ATOM 8934  C CA   . VAL A 1 38 ? -7.121  2.080   1.126   1.00 0.00 ? 36 VAL P CA   8  
ATOM 8935  C C    . VAL A 1 38 ? -7.400  1.028   0.045   1.00 0.00 ? 36 VAL P C    8  
ATOM 8936  O O    . VAL A 1 38 ? -8.211  0.127   0.265   1.00 0.00 ? 36 VAL P O    8  
ATOM 8937  C CB   . VAL A 1 38 ? -7.800  3.427   0.791   1.00 0.00 ? 36 VAL P CB   8  
ATOM 8938  C CG1  . VAL A 1 38 ? -9.248  3.298   0.305   1.00 0.00 ? 36 VAL P CG1  8  
ATOM 8939  C CG2  . VAL A 1 38 ? -7.830  4.335   2.024   1.00 0.00 ? 36 VAL P CG2  8  
ATOM 8940  H H    . VAL A 1 38 ? -5.279  3.191   1.147   1.00 0.00 ? 36 VAL P H    8  
ATOM 8941  H HA   . VAL A 1 38 ? -7.553  1.705   2.054   1.00 0.00 ? 36 VAL P HA   8  
ATOM 8942  H HB   . VAL A 1 38 ? -7.239  3.933   0.011   1.00 0.00 ? 36 VAL P HB   8  
ATOM 8943  H HG11 . VAL A 1 38 ? -9.856  2.790   1.055   1.00 0.00 ? 36 VAL P HG11 8  
ATOM 8944  H HG12 . VAL A 1 38 ? -9.654  4.292   0.116   1.00 0.00 ? 36 VAL P HG12 8  
ATOM 8945  H HG13 . VAL A 1 38 ? -9.288  2.743   -0.631  1.00 0.00 ? 36 VAL P HG13 8  
ATOM 8946  H HG21 . VAL A 1 38 ? -8.441  3.883   2.805   1.00 0.00 ? 36 VAL P HG21 8  
ATOM 8947  H HG22 . VAL A 1 38 ? -6.824  4.487   2.404   1.00 0.00 ? 36 VAL P HG22 8  
ATOM 8948  H HG23 . VAL A 1 38 ? -8.248  5.304   1.749   1.00 0.00 ? 36 VAL P HG23 8  
ATOM 8949  N N    . TRP A 1 39 ? -6.703  1.087   -1.095  1.00 0.00 ? 37 TRP P N    8  
ATOM 8950  C CA   . TRP A 1 39 ? -6.918  0.168   -2.225  1.00 0.00 ? 37 TRP P CA   8  
ATOM 8951  C C    . TRP A 1 39 ? -6.492  -1.282  -1.916  1.00 0.00 ? 37 TRP P C    8  
ATOM 8952  O O    . TRP A 1 39 ? -7.133  -2.223  -2.387  1.00 0.00 ? 37 TRP P O    8  
ATOM 8953  C CB   . TRP A 1 39 ? -6.181  0.702   -3.462  1.00 0.00 ? 37 TRP P CB   8  
ATOM 8954  C CG   . TRP A 1 39 ? -6.537  2.072   -3.970  1.00 0.00 ? 37 TRP P CG   8  
ATOM 8955  C CD1  . TRP A 1 39 ? -7.546  2.861   -3.529  1.00 0.00 ? 37 TRP P CD1  8  
ATOM 8956  C CD2  . TRP A 1 39 ? -5.847  2.859   -4.992  1.00 0.00 ? 37 TRP P CD2  8  
ATOM 8957  N NE1  . TRP A 1 39 ? -7.531  4.067   -4.202  1.00 0.00 ? 37 TRP P NE1  8  
ATOM 8958  C CE2  . TRP A 1 39 ? -6.495  4.127   -5.107  1.00 0.00 ? 37 TRP P CE2  8  
ATOM 8959  C CE3  . TRP A 1 39 ? -4.728  2.635   -5.825  1.00 0.00 ? 37 TRP P CE3  8  
ATOM 8960  C CZ2  . TRP A 1 39 ? -6.053  5.121   -5.993  1.00 0.00 ? 37 TRP P CZ2  8  
ATOM 8961  C CZ3  . TRP A 1 39 ? -4.276  3.626   -6.719  1.00 0.00 ? 37 TRP P CZ3  8  
ATOM 8962  C CH2  . TRP A 1 39 ? -4.934  4.868   -6.804  1.00 0.00 ? 37 TRP P CH2  8  
ATOM 8963  H H    . TRP A 1 39 ? -6.077  1.875   -1.234  1.00 0.00 ? 37 TRP P H    8  
ATOM 8964  H HA   . TRP A 1 39 ? -7.984  0.140   -2.456  1.00 0.00 ? 37 TRP P HA   8  
ATOM 8965  H HB2  . TRP A 1 39 ? -5.119  0.715   -3.236  1.00 0.00 ? 37 TRP P HB2  8  
ATOM 8966  H HB3  . TRP A 1 39 ? -6.334  -0.002  -4.282  1.00 0.00 ? 37 TRP P HB3  8  
ATOM 8967  H HD1  . TRP A 1 39 ? -8.226  2.598   -2.729  1.00 0.00 ? 37 TRP P HD1  8  
ATOM 8968  H HE1  . TRP A 1 39 ? -8.192  4.814   -4.021  1.00 0.00 ? 37 TRP P HE1  8  
ATOM 8969  H HE3  . TRP A 1 39 ? -4.210  1.687   -5.766  1.00 0.00 ? 37 TRP P HE3  8  
ATOM 8970  H HZ2  . TRP A 1 39 ? -6.567  6.071   -6.047  1.00 0.00 ? 37 TRP P HZ2  8  
ATOM 8971  H HZ3  . TRP A 1 39 ? -3.413  3.434   -7.346  1.00 0.00 ? 37 TRP P HZ3  8  
ATOM 8972  H HH2  . TRP A 1 39 ? -4.578  5.623   -7.493  1.00 0.00 ? 37 TRP P HH2  8  
ATOM 8973  N N    . THR A 1 40 ? -5.457  -1.474  -1.088  1.00 0.00 ? 38 THR P N    8  
ATOM 8974  C CA   . THR A 1 40 ? -5.014  -2.791  -0.574  1.00 0.00 ? 38 THR P CA   8  
ATOM 8975  C C    . THR A 1 40 ? -5.704  -3.213  0.733   1.00 0.00 ? 38 THR P C    8  
ATOM 8976  O O    . THR A 1 40 ? -5.506  -4.335  1.200   1.00 0.00 ? 38 THR P O    8  
ATOM 8977  C CB   . THR A 1 40 ? -3.488  -2.847  -0.387  1.00 0.00 ? 38 THR P CB   8  
ATOM 8978  O OG1  . THR A 1 40 ? -3.034  -1.781  0.416   1.00 0.00 ? 38 THR P OG1  8  
ATOM 8979  C CG2  . THR A 1 40 ? -2.732  -2.798  -1.715  1.00 0.00 ? 38 THR P CG2  8  
ATOM 8980  H H    . THR A 1 40 ? -4.946  -0.654  -0.780  1.00 0.00 ? 38 THR P H    8  
ATOM 8981  H HA   . THR A 1 40 ? -5.272  -3.555  -1.307  1.00 0.00 ? 38 THR P HA   8  
ATOM 8982  H HB   . THR A 1 40 ? -3.228  -3.783  0.109   1.00 0.00 ? 38 THR P HB   8  
ATOM 8983  H HG1  . THR A 1 40 ? -3.042  -0.977  -0.134  1.00 0.00 ? 38 THR P HG1  8  
ATOM 8984  H HG21 . THR A 1 40 ? -2.952  -1.873  -2.248  1.00 0.00 ? 38 THR P HG21 8  
ATOM 8985  H HG22 . THR A 1 40 ? -3.030  -3.646  -2.332  1.00 0.00 ? 38 THR P HG22 8  
ATOM 8986  H HG23 . THR A 1 40 ? -1.660  -2.862  -1.527  1.00 0.00 ? 38 THR P HG23 8  
ATOM 8987  N N    . ASN A 1 41 ? -6.533  -2.342  1.317   1.00 0.00 ? 39 ASN P N    8  
ATOM 8988  C CA   . ASN A 1 41 ? -7.166  -2.473  2.635   1.00 0.00 ? 39 ASN P CA   8  
ATOM 8989  C C    . ASN A 1 41 ? -6.180  -2.597  3.826   1.00 0.00 ? 39 ASN P C    8  
ATOM 8990  O O    . ASN A 1 41 ? -6.514  -3.170  4.867   1.00 0.00 ? 39 ASN P O    8  
ATOM 8991  C CB   . ASN A 1 41 ? -8.269  -3.552  2.574   1.00 0.00 ? 39 ASN P CB   8  
ATOM 8992  C CG   . ASN A 1 41 ? -9.284  -3.475  3.707   1.00 0.00 ? 39 ASN P CG   8  
ATOM 8993  O OD1  . ASN A 1 41 ? -9.500  -2.449  4.340   1.00 0.00 ? 39 ASN P OD1  8  
ATOM 8994  N ND2  . ASN A 1 41 ? -9.978  -4.560  3.975   1.00 0.00 ? 39 ASN P ND2  8  
ATOM 8995  H H    . ASN A 1 41 ? -6.640  -1.444  0.864   1.00 0.00 ? 39 ASN P H    8  
ATOM 8996  H HA   . ASN A 1 41 ? -7.664  -1.515  2.796   1.00 0.00 ? 39 ASN P HA   8  
ATOM 8997  H HB2  . ASN A 1 41 ? -8.822  -3.451  1.640   1.00 0.00 ? 39 ASN P HB2  8  
ATOM 8998  H HB3  . ASN A 1 41 ? -7.802  -4.537  2.585   1.00 0.00 ? 39 ASN P HB3  8  
ATOM 8999  H HD21 . ASN A 1 41 ? -9.820  -5.406  3.448   1.00 0.00 ? 39 ASN P HD21 8  
ATOM 9000  H HD22 . ASN A 1 41 ? -10.661 -4.523  4.715   1.00 0.00 ? 39 ASN P HD22 8  
ATOM 9001  N N    . LEU A 1 42 ? -4.959  -2.062  3.696   1.00 0.00 ? 40 LEU P N    8  
ATOM 9002  C CA   . LEU A 1 42 ? -4.008  -1.882  4.802   1.00 0.00 ? 40 LEU P CA   8  
ATOM 9003  C C    . LEU A 1 42 ? -4.230  -0.540  5.526   1.00 0.00 ? 40 LEU P C    8  
ATOM 9004  O O    . LEU A 1 42 ? -4.943  0.350   5.060   1.00 0.00 ? 40 LEU P O    8  
ATOM 9005  C CB   . LEU A 1 42 ? -2.541  -2.016  4.322   1.00 0.00 ? 40 LEU P CB   8  
ATOM 9006  C CG   . LEU A 1 42 ? -1.937  -3.425  4.167   1.00 0.00 ? 40 LEU P CG   8  
ATOM 9007  C CD1  . LEU A 1 42 ? -2.418  -4.430  5.212   1.00 0.00 ? 40 LEU P CD1  8  
ATOM 9008  C CD2  . LEU A 1 42 ? -2.187  -4.017  2.792   1.00 0.00 ? 40 LEU P CD2  8  
ATOM 9009  H H    . LEU A 1 42 ? -4.778  -1.544  2.843   1.00 0.00 ? 40 LEU P H    8  
ATOM 9010  H HA   . LEU A 1 42 ? -4.192  -2.648  5.552   1.00 0.00 ? 40 LEU P HA   8  
ATOM 9011  H HB2  . LEU A 1 42 ? -2.417  -1.468  3.388   1.00 0.00 ? 40 LEU P HB2  8  
ATOM 9012  H HB3  . LEU A 1 42 ? -1.906  -1.521  5.055   1.00 0.00 ? 40 LEU P HB3  8  
ATOM 9013  H HG   . LEU A 1 42 ? -0.858  -3.326  4.278   1.00 0.00 ? 40 LEU P HG   8  
ATOM 9014  H HD11 . LEU A 1 42 ? -1.818  -5.338  5.152   1.00 0.00 ? 40 LEU P HD11 8  
ATOM 9015  H HD12 . LEU A 1 42 ? -3.459  -4.689  5.025   1.00 0.00 ? 40 LEU P HD12 8  
ATOM 9016  H HD13 . LEU A 1 42 ? -2.315  -4.005  6.209   1.00 0.00 ? 40 LEU P HD13 8  
ATOM 9017  H HD21 . LEU A 1 42 ? -1.702  -3.397  2.038   1.00 0.00 ? 40 LEU P HD21 8  
ATOM 9018  H HD22 . LEU A 1 42 ? -3.256  -4.062  2.596   1.00 0.00 ? 40 LEU P HD22 8  
ATOM 9019  H HD23 . LEU A 1 42 ? -1.757  -5.014  2.754   1.00 0.00 ? 40 LEU P HD23 8  
ATOM 9020  N N    . THR A 1 43 ? -3.587  -0.397  6.685   1.00 0.00 ? 41 THR P N    8  
ATOM 9021  C CA   . THR A 1 43 ? -3.499  0.855   7.453   1.00 0.00 ? 41 THR P CA   8  
ATOM 9022  C C    . THR A 1 43 ? -2.299  1.663   6.951   1.00 0.00 ? 41 THR P C    8  
ATOM 9023  O O    . THR A 1 43 ? -1.232  1.101   6.705   1.00 0.00 ? 41 THR P O    8  
ATOM 9024  C CB   . THR A 1 43 ? -3.394  0.547   8.957   1.00 0.00 ? 41 THR P CB   8  
ATOM 9025  O OG1  . THR A 1 43 ? -4.461  -0.297  9.351   1.00 0.00 ? 41 THR P OG1  8  
ATOM 9026  C CG2  . THR A 1 43 ? -3.452  1.792   9.839   1.00 0.00 ? 41 THR P CG2  8  
ATOM 9027  H H    . THR A 1 43 ? -3.010  -1.164  6.991   1.00 0.00 ? 41 THR P H    8  
ATOM 9028  H HA   . THR A 1 43 ? -4.402  1.445   7.291   1.00 0.00 ? 41 THR P HA   8  
ATOM 9029  H HB   . THR A 1 43 ? -2.455  0.024   9.148   1.00 0.00 ? 41 THR P HB   8  
ATOM 9030  H HG1  . THR A 1 43 ? -5.230  0.276   9.524   1.00 0.00 ? 41 THR P HG1  8  
ATOM 9031  H HG21 . THR A 1 43 ? -4.336  2.384   9.600   1.00 0.00 ? 41 THR P HG21 8  
ATOM 9032  H HG22 . THR A 1 43 ? -2.563  2.402   9.685   1.00 0.00 ? 41 THR P HG22 8  
ATOM 9033  H HG23 . THR A 1 43 ? -3.487  1.497   10.888  1.00 0.00 ? 41 THR P HG23 8  
ATOM 9034  N N    . GLU A 1 44 ? -2.429  2.982   6.803   1.00 0.00 ? 42 GLU P N    8  
ATOM 9035  C CA   . GLU A 1 44 ? -1.384  3.829   6.204   1.00 0.00 ? 42 GLU P CA   8  
ATOM 9036  C C    . GLU A 1 44 ? -0.066  3.846   6.998   1.00 0.00 ? 42 GLU P C    8  
ATOM 9037  O O    . GLU A 1 44 ? 1.011   3.898   6.404   1.00 0.00 ? 42 GLU P O    8  
ATOM 9038  C CB   . GLU A 1 44 ? -1.922  5.247   5.942   1.00 0.00 ? 42 GLU P CB   8  
ATOM 9039  C CG   . GLU A 1 44 ? -2.184  6.132   7.175   1.00 0.00 ? 42 GLU P CG   8  
ATOM 9040  C CD   . GLU A 1 44 ? -3.184  5.536   8.188   1.00 0.00 ? 42 GLU P CD   8  
ATOM 9041  O OE1  . GLU A 1 44 ? -4.239  4.998   7.772   1.00 0.00 ? 42 GLU P OE1  8  
ATOM 9042  O OE2  . GLU A 1 44 ? -2.896  5.572   9.407   1.00 0.00 ? 42 GLU P OE2  8  
ATOM 9043  H H    . GLU A 1 44 ? -3.316  3.422   7.041   1.00 0.00 ? 42 GLU P H    8  
ATOM 9044  H HA   . GLU A 1 44 ? -1.144  3.407   5.228   1.00 0.00 ? 42 GLU P HA   8  
ATOM 9045  H HB2  . GLU A 1 44 ? -1.188  5.762   5.321   1.00 0.00 ? 42 GLU P HB2  8  
ATOM 9046  H HB3  . GLU A 1 44 ? -2.839  5.165   5.358   1.00 0.00 ? 42 GLU P HB3  8  
ATOM 9047  H HG2  . GLU A 1 44 ? -1.229  6.330   7.666   1.00 0.00 ? 42 GLU P HG2  8  
ATOM 9048  H HG3  . GLU A 1 44 ? -2.568  7.094   6.826   1.00 0.00 ? 42 GLU P HG3  8  
ATOM 9049  N N    . ALA A 1 45 ? -0.126  3.706   8.326   1.00 0.00 ? 43 ALA P N    8  
ATOM 9050  C CA   . ALA A 1 45 ? 1.058   3.554   9.171   1.00 0.00 ? 43 ALA P CA   8  
ATOM 9051  C C    . ALA A 1 45 ? 1.763   2.196   8.960   1.00 0.00 ? 43 ALA P C    8  
ATOM 9052  O O    . ALA A 1 45 ? 2.992   2.127   8.941   1.00 0.00 ? 43 ALA P O    8  
ATOM 9053  C CB   . ALA A 1 45 ? 0.631   3.752   10.630  1.00 0.00 ? 43 ALA P CB   8  
ATOM 9054  H H    . ALA A 1 45 ? -1.034  3.717   8.771   1.00 0.00 ? 43 ALA P H    8  
ATOM 9055  H HA   . ALA A 1 45 ? 1.766   4.342   8.907   1.00 0.00 ? 43 ALA P HA   8  
ATOM 9056  H HB1  . ALA A 1 45 ? -0.096  2.991   10.919  1.00 0.00 ? 43 ALA P HB1  8  
ATOM 9057  H HB2  . ALA A 1 45 ? 1.504   3.676   11.281  1.00 0.00 ? 43 ALA P HB2  8  
ATOM 9058  H HB3  . ALA A 1 45 ? 0.185   4.740   10.755  1.00 0.00 ? 43 ALA P HB3  8  
ATOM 9059  N N    . ARG A 1 46 ? 1.000   1.118   8.722   1.00 0.00 ? 44 ARG P N    8  
ATOM 9060  C CA   . ARG A 1 46 ? 1.536   -0.212  8.376   1.00 0.00 ? 44 ARG P CA   8  
ATOM 9061  C C    . ARG A 1 46 ? 2.163   -0.218  6.978   1.00 0.00 ? 44 ARG P C    8  
ATOM 9062  O O    . ARG A 1 46 ? 3.212   -0.827  6.782   1.00 0.00 ? 44 ARG P O    8  
ATOM 9063  C CB   . ARG A 1 46 ? 0.423   -1.264  8.546   1.00 0.00 ? 44 ARG P CB   8  
ATOM 9064  C CG   . ARG A 1 46 ? 0.926   -2.691  8.291   1.00 0.00 ? 44 ARG P CG   8  
ATOM 9065  C CD   . ARG A 1 46 ? -0.141  -3.730  8.652   1.00 0.00 ? 44 ARG P CD   8  
ATOM 9066  N NE   . ARG A 1 46 ? 0.348   -5.091  8.361   1.00 0.00 ? 44 ARG P NE   8  
ATOM 9067  C CZ   . ARG A 1 46 ? 0.166   -6.181  9.081   1.00 0.00 ? 44 ARG P CZ   8  
ATOM 9068  N NH1  . ARG A 1 46 ? -0.637  -6.227  10.104  1.00 0.00 ? 44 ARG P NH1  8  
ATOM 9069  N NH2  . ARG A 1 46 ? 0.812   -7.266  8.777   1.00 0.00 ? 44 ARG P NH2  8  
ATOM 9070  H H    . ARG A 1 46 ? -0.002  1.250   8.698   1.00 0.00 ? 44 ARG P H    8  
ATOM 9071  H HA   . ARG A 1 46 ? 2.341   -0.454  9.073   1.00 0.00 ? 44 ARG P HA   8  
ATOM 9072  H HB2  . ARG A 1 46 ? 0.046   -1.203  9.568   1.00 0.00 ? 44 ARG P HB2  8  
ATOM 9073  H HB3  . ARG A 1 46 ? -0.397  -1.054  7.861   1.00 0.00 ? 44 ARG P HB3  8  
ATOM 9074  H HG2  . ARG A 1 46 ? 1.181   -2.799  7.236   1.00 0.00 ? 44 ARG P HG2  8  
ATOM 9075  H HG3  . ARG A 1 46 ? 1.817   -2.876  8.893   1.00 0.00 ? 44 ARG P HG3  8  
ATOM 9076  H HD2  . ARG A 1 46 ? -0.375  -3.625  9.713   1.00 0.00 ? 44 ARG P HD2  8  
ATOM 9077  H HD3  . ARG A 1 46 ? -1.047  -3.536  8.075   1.00 0.00 ? 44 ARG P HD3  8  
ATOM 9078  H HE   . ARG A 1 46 ? 0.939   -5.193  7.548   1.00 0.00 ? 44 ARG P HE   8  
ATOM 9079  H HH11 . ARG A 1 46 ? -1.164  -5.408  10.349  1.00 0.00 ? 44 ARG P HH11 8  
ATOM 9080  H HH12 . ARG A 1 46 ? -0.727  -7.066  10.649  1.00 0.00 ? 44 ARG P HH12 8  
ATOM 9081  H HH21 . ARG A 1 46 ? 1.520   -7.228  8.060   1.00 0.00 ? 44 ARG P HH21 8  
ATOM 9082  H HH22 . ARG A 1 46 ? 0.749   -8.076  9.379   1.00 0.00 ? 44 ARG P HH22 8  
ATOM 9083  N N    . VAL A 1 47 ? 1.589   0.533   6.036   1.00 0.00 ? 45 VAL P N    8  
ATOM 9084  C CA   . VAL A 1 47 ? 2.184   0.801   4.713   1.00 0.00 ? 45 VAL P CA   8  
ATOM 9085  C C    . VAL A 1 47 ? 3.475   1.623   4.829   1.00 0.00 ? 45 VAL P C    8  
ATOM 9086  O O    . VAL A 1 47 ? 4.463   1.288   4.177   1.00 0.00 ? 45 VAL P O    8  
ATOM 9087  C CB   . VAL A 1 47 ? 1.139   1.456   3.789   1.00 0.00 ? 45 VAL P CB   8  
ATOM 9088  C CG1  . VAL A 1 47 ? 1.724   2.077   2.522   1.00 0.00 ? 45 VAL P CG1  8  
ATOM 9089  C CG2  . VAL A 1 47 ? 0.116   0.395   3.366   1.00 0.00 ? 45 VAL P CG2  8  
ATOM 9090  H H    . VAL A 1 47 ? 0.693   0.952   6.262   1.00 0.00 ? 45 VAL P H    8  
ATOM 9091  H HA   . VAL A 1 47 ? 2.472   -0.150  4.264   1.00 0.00 ? 45 VAL P HA   8  
ATOM 9092  H HB   . VAL A 1 47 ? 0.619   2.243   4.330   1.00 0.00 ? 45 VAL P HB   8  
ATOM 9093  H HG11 . VAL A 1 47 ? 0.918   2.496   1.921   1.00 0.00 ? 45 VAL P HG11 8  
ATOM 9094  H HG12 . VAL A 1 47 ? 2.399   2.892   2.778   1.00 0.00 ? 45 VAL P HG12 8  
ATOM 9095  H HG13 . VAL A 1 47 ? 2.257   1.319   1.946   1.00 0.00 ? 45 VAL P HG13 8  
ATOM 9096  H HG21 . VAL A 1 47 ? 0.620   -0.467  2.927   1.00 0.00 ? 45 VAL P HG21 8  
ATOM 9097  H HG22 . VAL A 1 47 ? -0.458  0.077   4.234   1.00 0.00 ? 45 VAL P HG22 8  
ATOM 9098  H HG23 . VAL A 1 47 ? -0.568  0.802   2.624   1.00 0.00 ? 45 VAL P HG23 8  
ATOM 9099  N N    . ARG A 1 48 ? 3.537   2.634   5.707   1.00 0.00 ? 46 ARG P N    8  
ATOM 9100  C CA   . ARG A 1 48 ? 4.775   3.388   5.989   1.00 0.00 ? 46 ARG P CA   8  
ATOM 9101  C C    . ARG A 1 48 ? 5.891   2.477   6.525   1.00 0.00 ? 46 ARG P C    8  
ATOM 9102  O O    . ARG A 1 48 ? 7.027   2.555   6.055   1.00 0.00 ? 46 ARG P O    8  
ATOM 9103  C CB   . ARG A 1 48 ? 4.439   4.541   6.951   1.00 0.00 ? 46 ARG P CB   8  
ATOM 9104  C CG   . ARG A 1 48 ? 5.578   5.565   7.083   1.00 0.00 ? 46 ARG P CG   8  
ATOM 9105  C CD   . ARG A 1 48 ? 5.236   6.659   8.104   1.00 0.00 ? 46 ARG P CD   8  
ATOM 9106  N NE   . ARG A 1 48 ? 4.084   7.486   7.687   1.00 0.00 ? 46 ARG P NE   8  
ATOM 9107  C CZ   . ARG A 1 48 ? 3.491   8.426   8.403   1.00 0.00 ? 46 ARG P CZ   8  
ATOM 9108  N NH1  . ARG A 1 48 ? 3.914   8.768   9.588   1.00 0.00 ? 46 ARG P NH1  8  
ATOM 9109  N NH2  . ARG A 1 48 ? 2.446   9.049   7.939   1.00 0.00 ? 46 ARG P NH2  8  
ATOM 9110  H H    . ARG A 1 48 ? 2.681   2.922   6.173   1.00 0.00 ? 46 ARG P H    8  
ATOM 9111  H HA   . ARG A 1 48 ? 5.139   3.815   5.051   1.00 0.00 ? 46 ARG P HA   8  
ATOM 9112  H HB2  . ARG A 1 48 ? 3.551   5.054   6.580   1.00 0.00 ? 46 ARG P HB2  8  
ATOM 9113  H HB3  . ARG A 1 48 ? 4.211   4.140   7.938   1.00 0.00 ? 46 ARG P HB3  8  
ATOM 9114  H HG2  . ARG A 1 48 ? 6.482   5.057   7.420   1.00 0.00 ? 46 ARG P HG2  8  
ATOM 9115  H HG3  . ARG A 1 48 ? 5.777   6.021   6.113   1.00 0.00 ? 46 ARG P HG3  8  
ATOM 9116  H HD2  . ARG A 1 48 ? 5.015   6.177   9.059   1.00 0.00 ? 46 ARG P HD2  8  
ATOM 9117  H HD3  . ARG A 1 48 ? 6.113   7.297   8.229   1.00 0.00 ? 46 ARG P HD3  8  
ATOM 9118  H HE   . ARG A 1 48 ? 3.702   7.318   6.771   1.00 0.00 ? 46 ARG P HE   8  
ATOM 9119  H HH11 . ARG A 1 48 ? 4.727   8.314   9.967   1.00 0.00 ? 46 ARG P HH11 8  
ATOM 9120  H HH12 . ARG A 1 48 ? 3.449   9.489   10.111  1.00 0.00 ? 46 ARG P HH12 8  
ATOM 9121  H HH21 . ARG A 1 48 ? 2.066   8.807   7.039   1.00 0.00 ? 46 ARG P HH21 8  
ATOM 9122  H HH22 . ARG A 1 48 ? 1.994   9.759   8.491   1.00 0.00 ? 46 ARG P HH22 8  
ATOM 9123  N N    . VAL A 1 49 ? 5.558   1.555   7.434   1.00 0.00 ? 47 VAL P N    8  
ATOM 9124  C CA   . VAL A 1 49 ? 6.483   0.517   7.938   1.00 0.00 ? 47 VAL P CA   8  
ATOM 9125  C C    . VAL A 1 49 ? 6.875   -0.485  6.839   1.00 0.00 ? 47 VAL P C    8  
ATOM 9126  O O    . VAL A 1 49 ? 8.039   -0.885  6.776   1.00 0.00 ? 47 VAL P O    8  
ATOM 9127  C CB   . VAL A 1 49 ? 5.890   -0.179  9.184   1.00 0.00 ? 47 VAL P CB   8  
ATOM 9128  C CG1  . VAL A 1 49 ? 6.698   -1.398  9.647   1.00 0.00 ? 47 VAL P CG1  8  
ATOM 9129  C CG2  . VAL A 1 49 ? 5.853   0.802   10.366  1.00 0.00 ? 47 VAL P CG2  8  
ATOM 9130  H H    . VAL A 1 49 ? 4.616   1.590   7.808   1.00 0.00 ? 47 VAL P H    8  
ATOM 9131  H HA   . VAL A 1 49 ? 7.407   1.004   8.248   1.00 0.00 ? 47 VAL P HA   8  
ATOM 9132  H HB   . VAL A 1 49 ? 4.874   -0.505  8.967   1.00 0.00 ? 47 VAL P HB   8  
ATOM 9133  H HG11 . VAL A 1 49 ? 6.273   -1.795  10.569  1.00 0.00 ? 47 VAL P HG11 8  
ATOM 9134  H HG12 . VAL A 1 49 ? 6.658   -2.188  8.896   1.00 0.00 ? 47 VAL P HG12 8  
ATOM 9135  H HG13 . VAL A 1 49 ? 7.737   -1.116  9.826   1.00 0.00 ? 47 VAL P HG13 8  
ATOM 9136  H HG21 . VAL A 1 49 ? 6.863   1.120   10.622  1.00 0.00 ? 47 VAL P HG21 8  
ATOM 9137  H HG22 . VAL A 1 49 ? 5.261   1.680   10.116  1.00 0.00 ? 47 VAL P HG22 8  
ATOM 9138  H HG23 . VAL A 1 49 ? 5.399   0.320   11.234  1.00 0.00 ? 47 VAL P HG23 8  
ATOM 9139  N N    . TRP A 1 50 ? 5.966   -0.841  5.924   1.00 0.00 ? 48 TRP P N    8  
ATOM 9140  C CA   . TRP A 1 50 ? 6.288   -1.676  4.758   1.00 0.00 ? 48 TRP P CA   8  
ATOM 9141  C C    . TRP A 1 50 ? 7.333   -1.006  3.856   1.00 0.00 ? 48 TRP P C    8  
ATOM 9142  O O    . TRP A 1 50 ? 8.342   -1.631  3.528   1.00 0.00 ? 48 TRP P O    8  
ATOM 9143  C CB   . TRP A 1 50 ? 5.020   -2.030  3.963   1.00 0.00 ? 48 TRP P CB   8  
ATOM 9144  C CG   . TRP A 1 50 ? 5.248   -3.034  2.873   1.00 0.00 ? 48 TRP P CG   8  
ATOM 9145  C CD1  . TRP A 1 50 ? 5.040   -4.365  2.979   1.00 0.00 ? 48 TRP P CD1  8  
ATOM 9146  C CD2  . TRP A 1 50 ? 5.765   -2.818  1.519   1.00 0.00 ? 48 TRP P CD2  8  
ATOM 9147  N NE1  . TRP A 1 50 ? 5.399   -4.988  1.799   1.00 0.00 ? 48 TRP P NE1  8  
ATOM 9148  C CE2  . TRP A 1 50 ? 5.873   -4.086  0.870   1.00 0.00 ? 48 TRP P CE2  8  
ATOM 9149  C CE3  . TRP A 1 50 ? 6.153   -1.684  0.772   1.00 0.00 ? 48 TRP P CE3  8  
ATOM 9150  C CZ2  . TRP A 1 50 ? 6.362   -4.227  -0.438  1.00 0.00 ? 48 TRP P CZ2  8  
ATOM 9151  C CZ3  . TRP A 1 50 ? 6.660   -1.814  -0.535  1.00 0.00 ? 48 TRP P CZ3  8  
ATOM 9152  C CH2  . TRP A 1 50 ? 6.774   -3.079  -1.136  1.00 0.00 ? 48 TRP P CH2  8  
ATOM 9153  H H    . TRP A 1 50 ? 5.006   -0.539  6.048   1.00 0.00 ? 48 TRP P H    8  
ATOM 9154  H HA   . TRP A 1 50 ? 6.724   -2.610  5.114   1.00 0.00 ? 48 TRP P HA   8  
ATOM 9155  H HB2  . TRP A 1 50 ? 4.272   -2.427  4.649   1.00 0.00 ? 48 TRP P HB2  8  
ATOM 9156  H HB3  . TRP A 1 50 ? 4.610   -1.131  3.503   1.00 0.00 ? 48 TRP P HB3  8  
ATOM 9157  H HD1  . TRP A 1 50 ? 4.663   -4.869  3.864   1.00 0.00 ? 48 TRP P HD1  8  
ATOM 9158  H HE1  . TRP A 1 50 ? 5.332   -5.988  1.659   1.00 0.00 ? 48 TRP P HE1  8  
ATOM 9159  H HE3  . TRP A 1 50 ? 6.054   -0.701  1.207   1.00 0.00 ? 48 TRP P HE3  8  
ATOM 9160  H HZ2  . TRP A 1 50 ? 6.390   -5.199  -0.908  1.00 0.00 ? 48 TRP P HZ2  8  
ATOM 9161  H HZ3  . TRP A 1 50 ? 6.948   -0.929  -1.085  1.00 0.00 ? 48 TRP P HZ3  8  
ATOM 9162  H HH2  . TRP A 1 50 ? 7.151   -3.161  -2.147  1.00 0.00 ? 48 TRP P HH2  8  
ATOM 9163  N N    . PHE A 1 51 ? 7.162   0.281   3.523   1.00 0.00 ? 49 PHE P N    8  
ATOM 9164  C CA   . PHE A 1 51 ? 8.145   1.028   2.729   1.00 0.00 ? 49 PHE P CA   8  
ATOM 9165  C C    . PHE A 1 51 ? 9.495   1.163   3.447   1.00 0.00 ? 49 PHE P C    8  
ATOM 9166  O O    . PHE A 1 51 ? 10.535  0.996   2.812   1.00 0.00 ? 49 PHE P O    8  
ATOM 9167  C CB   . PHE A 1 51 ? 7.591   2.401   2.318   1.00 0.00 ? 49 PHE P CB   8  
ATOM 9168  C CG   . PHE A 1 51 ? 6.623   2.359   1.149   1.00 0.00 ? 49 PHE P CG   8  
ATOM 9169  C CD1  . PHE A 1 51 ? 7.089   2.026   -0.139  1.00 0.00 ? 49 PHE P CD1  8  
ATOM 9170  C CD2  . PHE A 1 51 ? 5.262   2.662   1.335   1.00 0.00 ? 49 PHE P CD2  8  
ATOM 9171  C CE1  . PHE A 1 51 ? 6.196   1.985   -1.227  1.00 0.00 ? 49 PHE P CE1  8  
ATOM 9172  C CE2  . PHE A 1 51 ? 4.372   2.620   0.248   1.00 0.00 ? 49 PHE P CE2  8  
ATOM 9173  C CZ   . PHE A 1 51 ? 4.837   2.279   -1.033  1.00 0.00 ? 49 PHE P CZ   8  
ATOM 9174  H H    . PHE A 1 51 ? 6.302   0.743   3.802   1.00 0.00 ? 49 PHE P H    8  
ATOM 9175  H HA   . PHE A 1 51 ? 8.340   0.466   1.815   1.00 0.00 ? 49 PHE P HA   8  
ATOM 9176  H HB2  . PHE A 1 51 ? 7.120   2.877   3.180   1.00 0.00 ? 49 PHE P HB2  8  
ATOM 9177  H HB3  . PHE A 1 51 ? 8.427   3.034   2.018   1.00 0.00 ? 49 PHE P HB3  8  
ATOM 9178  H HD1  . PHE A 1 51 ? 8.134   1.795   -0.294  1.00 0.00 ? 49 PHE P HD1  8  
ATOM 9179  H HD2  . PHE A 1 51 ? 4.894   2.925   2.315   1.00 0.00 ? 49 PHE P HD2  8  
ATOM 9180  H HE1  . PHE A 1 51 ? 6.551   1.723   -2.214  1.00 0.00 ? 49 PHE P HE1  8  
ATOM 9181  H HE2  . PHE A 1 51 ? 3.327   2.842   0.397   1.00 0.00 ? 49 PHE P HE2  8  
ATOM 9182  H HZ   . PHE A 1 51 ? 4.149   2.242   -1.865  1.00 0.00 ? 49 PHE P HZ   8  
ATOM 9183  N N    . LYS A 1 52 ? 9.510   1.381   4.770   1.00 0.00 ? 50 LYS P N    8  
ATOM 9184  C CA   . LYS A 1 52 ? 10.749  1.416   5.573   1.00 0.00 ? 50 LYS P CA   8  
ATOM 9185  C C    . LYS A 1 52 ? 11.533  0.097   5.489   1.00 0.00 ? 50 LYS P C    8  
ATOM 9186  O O    . LYS A 1 52 ? 12.749  0.112   5.297   1.00 0.00 ? 50 LYS P O    8  
ATOM 9187  C CB   . LYS A 1 52 ? 10.388  1.797   7.020   1.00 0.00 ? 50 LYS P CB   8  
ATOM 9188  C CG   . LYS A 1 52 ? 11.626  2.040   7.899   1.00 0.00 ? 50 LYS P CG   8  
ATOM 9189  C CD   . LYS A 1 52 ? 11.206  2.462   9.317   1.00 0.00 ? 50 LYS P CD   8  
ATOM 9190  C CE   . LYS A 1 52 ? 12.404  2.648   10.261  1.00 0.00 ? 50 LYS P CE   8  
ATOM 9191  N NZ   . LYS A 1 52 ? 13.220  3.845   9.921   1.00 0.00 ? 50 LYS P NZ   8  
ATOM 9192  H H    . LYS A 1 52 ? 8.624   1.556   5.234   1.00 0.00 ? 50 LYS P H    8  
ATOM 9193  H HA   . LYS A 1 52 ? 11.401  2.193   5.166   1.00 0.00 ? 50 LYS P HA   8  
ATOM 9194  H HB2  . LYS A 1 52 ? 9.793   2.712   7.002   1.00 0.00 ? 50 LYS P HB2  8  
ATOM 9195  H HB3  . LYS A 1 52 ? 9.785   1.005   7.465   1.00 0.00 ? 50 LYS P HB3  8  
ATOM 9196  H HG2  . LYS A 1 52 ? 12.214  1.124   7.964   1.00 0.00 ? 50 LYS P HG2  8  
ATOM 9197  H HG3  . LYS A 1 52 ? 12.234  2.823   7.447   1.00 0.00 ? 50 LYS P HG3  8  
ATOM 9198  H HD2  . LYS A 1 52 ? 10.627  3.387   9.272   1.00 0.00 ? 50 LYS P HD2  8  
ATOM 9199  H HD3  . LYS A 1 52 ? 10.566  1.684   9.735   1.00 0.00 ? 50 LYS P HD3  8  
ATOM 9200  H HE2  . LYS A 1 52 ? 12.020  2.748   11.281  1.00 0.00 ? 50 LYS P HE2  8  
ATOM 9201  H HE3  . LYS A 1 52 ? 13.022  1.746   10.230  1.00 0.00 ? 50 LYS P HE3  8  
ATOM 9202  H HZ1  . LYS A 1 52 ? 12.666  4.690   9.956   1.00 0.00 ? 50 LYS P HZ1  8  
ATOM 9203  H HZ2  . LYS A 1 52 ? 13.624  3.771   8.998   1.00 0.00 ? 50 LYS P HZ2  8  
ATOM 9204  H HZ3  . LYS A 1 52 ? 13.983  3.958   10.577  1.00 0.00 ? 50 LYS P HZ3  8  
ATOM 9205  N N    . ASN A 1 53 ? 10.838  -1.044  5.549   1.00 0.00 ? 51 ASN P N    8  
ATOM 9206  C CA   . ASN A 1 53 ? 11.442  -2.372  5.374   1.00 0.00 ? 51 ASN P CA   8  
ATOM 9207  C C    . ASN A 1 53 ? 11.893  -2.619  3.921   1.00 0.00 ? 51 ASN P C    8  
ATOM 9208  O O    . ASN A 1 53 ? 13.006  -3.097  3.695   1.00 0.00 ? 51 ASN P O    8  
ATOM 9209  C CB   . ASN A 1 53 ? 10.460  -3.454  5.860   1.00 0.00 ? 51 ASN P CB   8  
ATOM 9210  C CG   . ASN A 1 53 ? 10.468  -3.601  7.373   1.00 0.00 ? 51 ASN P CG   8  
ATOM 9211  O OD1  . ASN A 1 53 ? 11.197  -4.406  7.934   1.00 0.00 ? 51 ASN P OD1  8  
ATOM 9212  N ND2  . ASN A 1 53 ? 9.683   -2.827  8.087   1.00 0.00 ? 51 ASN P ND2  8  
ATOM 9213  H H    . ASN A 1 53 ? 9.839   -0.976  5.700   1.00 0.00 ? 51 ASN P H    8  
ATOM 9214  H HA   . ASN A 1 53 ? 12.345  -2.434  5.987   1.00 0.00 ? 51 ASN P HA   8  
ATOM 9215  H HB2  . ASN A 1 53 ? 9.449   -3.239  5.513   1.00 0.00 ? 51 ASN P HB2  8  
ATOM 9216  H HB3  . ASN A 1 53 ? 10.756  -4.416  5.442   1.00 0.00 ? 51 ASN P HB3  8  
ATOM 9217  H HD21 . ASN A 1 53 ? 9.080   -2.151  7.629   1.00 0.00 ? 51 ASN P HD21 8  
ATOM 9218  H HD22 . ASN A 1 53 ? 9.693   -2.929  9.088   1.00 0.00 ? 51 ASN P HD22 8  
ATOM 9219  N N    . ARG A 1 54 ? 11.077  -2.239  2.928   1.00 0.00 ? 52 ARG P N    8  
ATOM 9220  C CA   . ARG A 1 54 ? 11.401  -2.356  1.496   1.00 0.00 ? 52 ARG P CA   8  
ATOM 9221  C C    . ARG A 1 54 ? 12.661  -1.569  1.127   1.00 0.00 ? 52 ARG P C    8  
ATOM 9222  O O    . ARG A 1 54 ? 13.512  -2.109  0.427   1.00 0.00 ? 52 ARG P O    8  
ATOM 9223  C CB   . ARG A 1 54 ? 10.176  -1.925  0.667   1.00 0.00 ? 52 ARG P CB   8  
ATOM 9224  C CG   . ARG A 1 54 ? 10.393  -1.899  -0.858  1.00 0.00 ? 52 ARG P CG   8  
ATOM 9225  C CD   . ARG A 1 54 ? 10.897  -3.207  -1.482  1.00 0.00 ? 52 ARG P CD   8  
ATOM 9226  N NE   . ARG A 1 54 ? 9.958   -4.329  -1.281  1.00 0.00 ? 52 ARG P NE   8  
ATOM 9227  C CZ   . ARG A 1 54 ? 9.793   -5.366  -2.083  1.00 0.00 ? 52 ARG P CZ   8  
ATOM 9228  N NH1  . ARG A 1 54 ? 10.459  -5.529  -3.186  1.00 0.00 ? 52 ARG P NH1  8  
ATOM 9229  N NH2  . ARG A 1 54 ? 8.934   -6.301  -1.819  1.00 0.00 ? 52 ARG P NH2  8  
ATOM 9230  H H    . ARG A 1 54 ? 10.157  -1.887  3.183   1.00 0.00 ? 52 ARG P H    8  
ATOM 9231  H HA   . ARG A 1 54 ? 11.618  -3.403  1.276   1.00 0.00 ? 52 ARG P HA   8  
ATOM 9232  H HB2  . ARG A 1 54 ? 9.344   -2.593  0.895   1.00 0.00 ? 52 ARG P HB2  8  
ATOM 9233  H HB3  . ARG A 1 54 ? 9.881   -0.922  0.969   1.00 0.00 ? 52 ARG P HB3  8  
ATOM 9234  H HG2  . ARG A 1 54 ? 9.451   -1.626  -1.335  1.00 0.00 ? 52 ARG P HG2  8  
ATOM 9235  H HG3  . ARG A 1 54 ? 11.110  -1.113  -1.091  1.00 0.00 ? 52 ARG P HG3  8  
ATOM 9236  H HD2  . ARG A 1 54 ? 11.033  -3.025  -2.549  1.00 0.00 ? 52 ARG P HD2  8  
ATOM 9237  H HD3  . ARG A 1 54 ? 11.870  -3.466  -1.062  1.00 0.00 ? 52 ARG P HD3  8  
ATOM 9238  H HE   . ARG A 1 54 ? 9.360   -4.290  -0.470  1.00 0.00 ? 52 ARG P HE   8  
ATOM 9239  H HH11 . ARG A 1 54 ? 11.164  -4.871  -3.462  1.00 0.00 ? 52 ARG P HH11 8  
ATOM 9240  H HH12 . ARG A 1 54 ? 10.220  -6.336  -3.759  1.00 0.00 ? 52 ARG P HH12 8  
ATOM 9241  H HH21 . ARG A 1 54 ? 8.413   -6.308  -0.961  1.00 0.00 ? 52 ARG P HH21 8  
ATOM 9242  H HH22 . ARG A 1 54 ? 8.825   -7.038  -2.514  1.00 0.00 ? 52 ARG P HH22 8  
ATOM 9243  N N    . ARG A 1 55 ? 12.836  -0.348  1.644   1.00 0.00 ? 53 ARG P N    8  
ATOM 9244  C CA   . ARG A 1 55 ? 14.049  0.473   1.434   1.00 0.00 ? 53 ARG P CA   8  
ATOM 9245  C C    . ARG A 1 55 ? 15.301  -0.185  2.013   1.00 0.00 ? 53 ARG P C    8  
ATOM 9246  O O    . ARG A 1 55 ? 16.319  -0.248  1.327   1.00 0.00 ? 53 ARG P O    8  
ATOM 9247  C CB   . ARG A 1 55 ? 13.847  1.874   2.034   1.00 0.00 ? 53 ARG P CB   8  
ATOM 9248  C CG   . ARG A 1 55 ? 12.841  2.693   1.216   1.00 0.00 ? 53 ARG P CG   8  
ATOM 9249  C CD   . ARG A 1 55 ? 12.503  4.020   1.912   1.00 0.00 ? 53 ARG P CD   8  
ATOM 9250  N NE   . ARG A 1 55 ? 11.241  4.589   1.402   1.00 0.00 ? 53 ARG P NE   8  
ATOM 9251  C CZ   . ARG A 1 55 ? 10.991  5.001   0.174   1.00 0.00 ? 53 ARG P CZ   8  
ATOM 9252  N NH1  . ARG A 1 55 ? 11.912  5.124   -0.735  1.00 0.00 ? 53 ARG P NH1  8  
ATOM 9253  N NH2  . ARG A 1 55 ? 9.781   5.288   -0.198  1.00 0.00 ? 53 ARG P NH2  8  
ATOM 9254  H H    . ARG A 1 55 ? 12.070  0.042   2.186   1.00 0.00 ? 53 ARG P H    8  
ATOM 9255  H HA   . ARG A 1 55 ? 14.230  0.576   0.363   1.00 0.00 ? 53 ARG P HA   8  
ATOM 9256  H HB2  . ARG A 1 55 ? 13.499  1.780   3.065   1.00 0.00 ? 53 ARG P HB2  8  
ATOM 9257  H HB3  . ARG A 1 55 ? 14.801  2.407   2.040   1.00 0.00 ? 53 ARG P HB3  8  
ATOM 9258  H HG2  . ARG A 1 55 ? 13.262  2.890   0.229   1.00 0.00 ? 53 ARG P HG2  8  
ATOM 9259  H HG3  . ARG A 1 55 ? 11.926  2.122   1.078   1.00 0.00 ? 53 ARG P HG3  8  
ATOM 9260  H HD2  . ARG A 1 55 ? 12.384  3.835   2.982   1.00 0.00 ? 53 ARG P HD2  8  
ATOM 9261  H HD3  . ARG A 1 55 ? 13.325  4.727   1.784   1.00 0.00 ? 53 ARG P HD3  8  
ATOM 9262  H HE   . ARG A 1 55 ? 10.461  4.593   2.040   1.00 0.00 ? 53 ARG P HE   8  
ATOM 9263  H HH11 . ARG A 1 55 ? 12.876  4.975   -0.499  1.00 0.00 ? 53 ARG P HH11 8  
ATOM 9264  H HH12 . ARG A 1 55 ? 11.639  5.415   -1.666  1.00 0.00 ? 53 ARG P HH12 8  
ATOM 9265  H HH21 . ARG A 1 55 ? 9.004   5.195   0.432   1.00 0.00 ? 53 ARG P HH21 8  
ATOM 9266  H HH22 . ARG A 1 55 ? 9.635   5.490   -1.179  1.00 0.00 ? 53 ARG P HH22 8  
ATOM 9267  N N    . ALA A 1 56 ? 15.219  -0.738  3.224   1.00 0.00 ? 54 ALA P N    8  
ATOM 9268  C CA   . ALA A 1 56 ? 16.333  -1.445  3.865   1.00 0.00 ? 54 ALA P CA   8  
ATOM 9269  C C    . ALA A 1 56 ? 16.751  -2.719  3.099   1.00 0.00 ? 54 ALA P C    8  
ATOM 9270  O O    . ALA A 1 56 ? 17.943  -3.029  3.019   1.00 0.00 ? 54 ALA P O    8  
ATOM 9271  C CB   . ALA A 1 56 ? 15.938  -1.752  5.314   1.00 0.00 ? 54 ALA P CB   8  
ATOM 9272  H H    . ALA A 1 56 ? 14.355  -0.636  3.740   1.00 0.00 ? 54 ALA P H    8  
ATOM 9273  H HA   . ALA A 1 56 ? 17.199  -0.779  3.884   1.00 0.00 ? 54 ALA P HA   8  
ATOM 9274  H HB1  . ALA A 1 56 ? 15.082  -2.426  5.339   1.00 0.00 ? 54 ALA P HB1  8  
ATOM 9275  H HB2  . ALA A 1 56 ? 16.777  -2.222  5.829   1.00 0.00 ? 54 ALA P HB2  8  
ATOM 9276  H HB3  . ALA A 1 56 ? 15.683  -0.826  5.833   1.00 0.00 ? 54 ALA P HB3  8  
ATOM 9277  N N    . LYS A 1 57 ? 15.793  -3.425  2.481   1.00 0.00 ? 55 LYS P N    8  
ATOM 9278  C CA   . LYS A 1 57 ? 16.045  -4.590  1.610   1.00 0.00 ? 55 LYS P CA   8  
ATOM 9279  C C    . LYS A 1 57 ? 16.598  -4.188  0.236   1.00 0.00 ? 55 LYS P C    8  
ATOM 9280  O O    . LYS A 1 57 ? 17.580  -4.770  -0.224  1.00 0.00 ? 55 LYS P O    8  
ATOM 9281  C CB   . LYS A 1 57 ? 14.752  -5.413  1.472   1.00 0.00 ? 55 LYS P CB   8  
ATOM 9282  C CG   . LYS A 1 57 ? 14.376  -6.116  2.786   1.00 0.00 ? 55 LYS P CG   8  
ATOM 9283  C CD   . LYS A 1 57 ? 13.007  -6.804  2.672   1.00 0.00 ? 55 LYS P CD   8  
ATOM 9284  C CE   . LYS A 1 57 ? 12.567  -7.454  3.992   1.00 0.00 ? 55 LYS P CE   8  
ATOM 9285  N NZ   . LYS A 1 57 ? 13.395  -8.637  4.351   1.00 0.00 ? 55 LYS P NZ   8  
ATOM 9286  H H    . LYS A 1 57 ? 14.830  -3.153  2.652   1.00 0.00 ? 55 LYS P H    8  
ATOM 9287  H HA   . LYS A 1 57 ? 16.805  -5.224  2.071   1.00 0.00 ? 55 LYS P HA   8  
ATOM 9288  H HB2  . LYS A 1 57 ? 13.937  -4.759  1.157   1.00 0.00 ? 55 LYS P HB2  8  
ATOM 9289  H HB3  . LYS A 1 57 ? 14.894  -6.176  0.703   1.00 0.00 ? 55 LYS P HB3  8  
ATOM 9290  H HG2  . LYS A 1 57 ? 15.143  -6.855  3.019   1.00 0.00 ? 55 LYS P HG2  8  
ATOM 9291  H HG3  . LYS A 1 57 ? 14.336  -5.391  3.598   1.00 0.00 ? 55 LYS P HG3  8  
ATOM 9292  H HD2  . LYS A 1 57 ? 12.263  -6.053  2.400   1.00 0.00 ? 55 LYS P HD2  8  
ATOM 9293  H HD3  . LYS A 1 57 ? 13.035  -7.556  1.881   1.00 0.00 ? 55 LYS P HD3  8  
ATOM 9294  H HE2  . LYS A 1 57 ? 12.615  -6.703  4.787   1.00 0.00 ? 55 LYS P HE2  8  
ATOM 9295  H HE3  . LYS A 1 57 ? 11.521  -7.760  3.891   1.00 0.00 ? 55 LYS P HE3  8  
ATOM 9296  H HZ1  . LYS A 1 57 ? 14.365  -8.385  4.490   1.00 0.00 ? 55 LYS P HZ1  8  
ATOM 9297  H HZ2  . LYS A 1 57 ? 13.355  -9.346  3.631   1.00 0.00 ? 55 LYS P HZ2  8  
ATOM 9298  H HZ3  . LYS A 1 57 ? 13.068  -9.060  5.210   1.00 0.00 ? 55 LYS P HZ3  8  
ATOM 9299  N N    . TRP A 1 58 ? 16.013  -3.169  -0.395  1.00 0.00 ? 56 TRP P N    8  
ATOM 9300  C CA   . TRP A 1 58 ? 16.375  -2.682  -1.734  1.00 0.00 ? 56 TRP P CA   8  
ATOM 9301  C C    . TRP A 1 58 ? 17.761  -2.014  -1.777  1.00 0.00 ? 56 TRP P C    8  
ATOM 9302  O O    . TRP A 1 58 ? 18.556  -2.297  -2.676  1.00 0.00 ? 56 TRP P O    8  
ATOM 9303  C CB   . TRP A 1 58 ? 15.279  -1.720  -2.218  1.00 0.00 ? 56 TRP P CB   8  
ATOM 9304  C CG   . TRP A 1 58 ? 15.567  -1.013  -3.508  1.00 0.00 ? 56 TRP P CG   8  
ATOM 9305  C CD1  . TRP A 1 58 ? 15.633  -1.595  -4.728  1.00 0.00 ? 56 TRP P CD1  8  
ATOM 9306  C CD2  . TRP A 1 58 ? 15.876  0.399   -3.720  1.00 0.00 ? 56 TRP P CD2  8  
ATOM 9307  N NE1  . TRP A 1 58 ? 15.975  -0.648  -5.674  1.00 0.00 ? 56 TRP P NE1  8  
ATOM 9308  C CE2  . TRP A 1 58 ? 16.142  0.598   -5.109  1.00 0.00 ? 56 TRP P CE2  8  
ATOM 9309  C CE3  . TRP A 1 58 ? 15.972  1.532   -2.880  1.00 0.00 ? 56 TRP P CE3  8  
ATOM 9310  C CZ2  . TRP A 1 58 ? 16.489  1.850   -5.636  1.00 0.00 ? 56 TRP P CZ2  8  
ATOM 9311  C CZ3  . TRP A 1 58 ? 16.311  2.796   -3.400  1.00 0.00 ? 56 TRP P CZ3  8  
ATOM 9312  C CH2  . TRP A 1 58 ? 16.572  2.957   -4.774  1.00 0.00 ? 56 TRP P CH2  8  
ATOM 9313  H H    . TRP A 1 58 ? 15.196  -2.759  0.045   1.00 0.00 ? 56 TRP P H    8  
ATOM 9314  H HA   . TRP A 1 58 ? 16.408  -3.529  -2.423  1.00 0.00 ? 56 TRP P HA   8  
ATOM 9315  H HB2  . TRP A 1 58 ? 14.347  -2.276  -2.328  1.00 0.00 ? 56 TRP P HB2  8  
ATOM 9316  H HB3  . TRP A 1 58 ? 15.120  -0.960  -1.453  1.00 0.00 ? 56 TRP P HB3  8  
ATOM 9317  H HD1  . TRP A 1 58 ? 15.477  -2.652  -4.922  1.00 0.00 ? 56 TRP P HD1  8  
ATOM 9318  H HE1  . TRP A 1 58 ? 16.145  -0.872  -6.650  1.00 0.00 ? 56 TRP P HE1  8  
ATOM 9319  H HE3  . TRP A 1 58 ? 15.785  1.421   -1.820  1.00 0.00 ? 56 TRP P HE3  8  
ATOM 9320  H HZ2  . TRP A 1 58 ? 16.689  1.960   -6.693  1.00 0.00 ? 56 TRP P HZ2  8  
ATOM 9321  H HZ3  . TRP A 1 58 ? 16.378  3.652   -2.738  1.00 0.00 ? 56 TRP P HZ3  8  
ATOM 9322  H HH2  . TRP A 1 58 ? 16.837  3.932   -5.165  1.00 0.00 ? 56 TRP P HH2  8  
ATOM 9323  N N    . ARG A 1 59 ? 18.082  -1.177  -0.778  1.00 0.00 ? 57 ARG P N    8  
ATOM 9324  C CA   . ARG A 1 59 ? 19.381  -0.489  -0.639  1.00 0.00 ? 57 ARG P CA   8  
ATOM 9325  C C    . ARG A 1 59 ? 20.436  -1.316  0.119   1.00 0.00 ? 57 ARG P C    8  
ATOM 9326  O O    . ARG A 1 59 ? 21.583  -0.879  0.221   1.00 0.00 ? 57 ARG P O    8  
ATOM 9327  C CB   . ARG A 1 59 ? 19.141  0.895   -0.002  1.00 0.00 ? 57 ARG P CB   8  
ATOM 9328  C CG   . ARG A 1 59 ? 20.261  1.917   -0.299  1.00 0.00 ? 57 ARG P CG   8  
ATOM 9329  C CD   . ARG A 1 59 ? 20.852  2.563   0.962   1.00 0.00 ? 57 ARG P CD   8  
ATOM 9330  N NE   . ARG A 1 59 ? 21.540  1.576   1.814   1.00 0.00 ? 57 ARG P NE   8  
ATOM 9331  C CZ   . ARG A 1 59 ? 22.228  1.815   2.914   1.00 0.00 ? 57 ARG P CZ   8  
ATOM 9332  N NH1  . ARG A 1 59 ? 22.431  3.021   3.370   1.00 0.00 ? 57 ARG P NH1  8  
ATOM 9333  N NH2  . ARG A 1 59 ? 22.706  0.820   3.597   1.00 0.00 ? 57 ARG P NH2  8  
ATOM 9334  H H    . ARG A 1 59 ? 17.364  -0.974  -0.086  1.00 0.00 ? 57 ARG P H    8  
ATOM 9335  H HA   . ARG A 1 59 ? 19.784  -0.331  -1.642  1.00 0.00 ? 57 ARG P HA   8  
ATOM 9336  H HB2  . ARG A 1 59 ? 18.213  1.311   -0.400  1.00 0.00 ? 57 ARG P HB2  8  
ATOM 9337  H HB3  . ARG A 1 59 ? 19.003  0.775   1.074   1.00 0.00 ? 57 ARG P HB3  8  
ATOM 9338  H HG2  . ARG A 1 59 ? 21.068  1.452   -0.867  1.00 0.00 ? 57 ARG P HG2  8  
ATOM 9339  H HG3  . ARG A 1 59 ? 19.845  2.709   -0.924  1.00 0.00 ? 57 ARG P HG3  8  
ATOM 9340  H HD2  . ARG A 1 59 ? 21.563  3.330   0.649   1.00 0.00 ? 57 ARG P HD2  8  
ATOM 9341  H HD3  . ARG A 1 59 ? 20.048  3.043   1.525   1.00 0.00 ? 57 ARG P HD3  8  
ATOM 9342  H HE   . ARG A 1 59 ? 21.550  0.617   1.488   1.00 0.00 ? 57 ARG P HE   8  
ATOM 9343  H HH11 . ARG A 1 59 ? 22.080  3.805   2.849   1.00 0.00 ? 57 ARG P HH11 8  
ATOM 9344  H HH12 . ARG A 1 59 ? 22.962  3.167   4.210   1.00 0.00 ? 57 ARG P HH12 8  
ATOM 9345  H HH21 . ARG A 1 59 ? 22.427  -0.118  3.332   1.00 0.00 ? 57 ARG P HH21 8  
ATOM 9346  H HH22 . ARG A 1 59 ? 23.240  0.970   4.435   1.00 0.00 ? 57 ARG P HH22 8  
ATOM 9347  N N    . LYS A 1 60 ? 20.055  -2.496  0.632   1.00 0.00 ? 58 LYS P N    8  
ATOM 9348  C CA   . LYS A 1 60 ? 20.833  -3.416  1.495   1.00 0.00 ? 58 LYS P CA   8  
ATOM 9349  C C    . LYS A 1 60 ? 21.319  -2.796  2.818   1.00 0.00 ? 58 LYS P C    8  
ATOM 9350  O O    . LYS A 1 60 ? 21.395  -1.575  2.971   1.00 0.00 ? 58 LYS P O    8  
ATOM 9351  C CB   . LYS A 1 60 ? 21.992  -4.061  0.704   1.00 0.00 ? 58 LYS P CB   8  
ATOM 9352  C CG   . LYS A 1 60 ? 21.532  -4.815  -0.555  1.00 0.00 ? 58 LYS P CG   8  
ATOM 9353  C CD   . LYS A 1 60 ? 22.695  -5.471  -1.316  1.00 0.00 ? 58 LYS P CD   8  
ATOM 9354  C CE   . LYS A 1 60 ? 23.348  -6.603  -0.511  1.00 0.00 ? 58 LYS P CE   8  
ATOM 9355  N NZ   . LYS A 1 60 ? 24.359  -7.340  -1.316  1.00 0.00 ? 58 LYS P NZ   8  
ATOM 9356  H H    . LYS A 1 60 ? 19.093  -2.746  0.462   1.00 0.00 ? 58 LYS P H    8  
ATOM 9357  H HA   . LYS A 1 60 ? 20.155  -4.222  1.785   1.00 0.00 ? 58 LYS P HA   8  
ATOM 9358  H HB2  . LYS A 1 60 ? 22.708  -3.290  0.414   1.00 0.00 ? 58 LYS P HB2  8  
ATOM 9359  H HB3  . LYS A 1 60 ? 22.508  -4.763  1.360   1.00 0.00 ? 58 LYS P HB3  8  
ATOM 9360  H HG2  . LYS A 1 60 ? 20.809  -5.583  -0.275  1.00 0.00 ? 58 LYS P HG2  8  
ATOM 9361  H HG3  . LYS A 1 60 ? 21.040  -4.117  -1.234  1.00 0.00 ? 58 LYS P HG3  8  
ATOM 9362  H HD2  . LYS A 1 60 ? 22.302  -5.877  -2.250  1.00 0.00 ? 58 LYS P HD2  8  
ATOM 9363  H HD3  . LYS A 1 60 ? 23.441  -4.712  -1.556  1.00 0.00 ? 58 LYS P HD3  8  
ATOM 9364  H HE2  . LYS A 1 60 ? 23.821  -6.180  0.381   1.00 0.00 ? 58 LYS P HE2  8  
ATOM 9365  H HE3  . LYS A 1 60 ? 22.565  -7.293  -0.183  1.00 0.00 ? 58 LYS P HE3  8  
ATOM 9366  H HZ1  . LYS A 1 60 ? 23.949  -7.725  -2.156  1.00 0.00 ? 58 LYS P HZ1  8  
ATOM 9367  H HZ2  . LYS A 1 60 ? 24.743  -8.111  -0.787  1.00 0.00 ? 58 LYS P HZ2  8  
ATOM 9368  H HZ3  . LYS A 1 60 ? 25.127  -6.739  -1.582  1.00 0.00 ? 58 LYS P HZ3  8  
ATOM 9369  N N    . ARG A 1 61 ? 21.720  -3.645  3.775   1.00 0.00 ? 59 ARG P N    8  
ATOM 9370  C CA   . ARG A 1 61 ? 22.416  -3.223  5.012   1.00 0.00 ? 59 ARG P CA   8  
ATOM 9371  C C    . ARG A 1 61 ? 23.790  -2.610  4.703   1.00 0.00 ? 59 ARG P C    8  
ATOM 9372  O O    . ARG A 1 61 ? 24.165  -1.596  5.290   1.00 0.00 ? 59 ARG P O    8  
ATOM 9373  C CB   . ARG A 1 61 ? 22.514  -4.426  5.968   1.00 0.00 ? 59 ARG P CB   8  
ATOM 9374  C CG   . ARG A 1 61 ? 23.067  -4.039  7.350   1.00 0.00 ? 59 ARG P CG   8  
ATOM 9375  C CD   . ARG A 1 61 ? 23.074  -5.251  8.289   1.00 0.00 ? 59 ARG P CD   8  
ATOM 9376  N NE   . ARG A 1 61 ? 23.618  -4.899  9.617   1.00 0.00 ? 59 ARG P NE   8  
ATOM 9377  C CZ   . ARG A 1 61 ? 23.762  -5.713  10.649  1.00 0.00 ? 59 ARG P CZ   8  
ATOM 9378  N NH1  . ARG A 1 61 ? 23.412  -6.968  10.599  1.00 0.00 ? 59 ARG P NH1  8  
ATOM 9379  N NH2  . ARG A 1 61 ? 24.270  -5.276  11.765  1.00 0.00 ? 59 ARG P NH2  8  
ATOM 9380  H H    . ARG A 1 61 ? 21.589  -4.633  3.607   1.00 0.00 ? 59 ARG P H    8  
ATOM 9381  H HA   . ARG A 1 61 ? 21.824  -2.443  5.498   1.00 0.00 ? 59 ARG P HA   8  
ATOM 9382  H HB2  . ARG A 1 61 ? 21.516  -4.847  6.102   1.00 0.00 ? 59 ARG P HB2  8  
ATOM 9383  H HB3  . ARG A 1 61 ? 23.155  -5.191  5.526   1.00 0.00 ? 59 ARG P HB3  8  
ATOM 9384  H HG2  . ARG A 1 61 ? 24.087  -3.668  7.247   1.00 0.00 ? 59 ARG P HG2  8  
ATOM 9385  H HG3  . ARG A 1 61 ? 22.443  -3.255  7.781   1.00 0.00 ? 59 ARG P HG3  8  
ATOM 9386  H HD2  . ARG A 1 61 ? 22.051  -5.617  8.399   1.00 0.00 ? 59 ARG P HD2  8  
ATOM 9387  H HD3  . ARG A 1 61 ? 23.686  -6.038  7.842   1.00 0.00 ? 59 ARG P HD3  8  
ATOM 9388  H HE   . ARG A 1 61 ? 23.912  -3.946  9.755   1.00 0.00 ? 59 ARG P HE   8  
ATOM 9389  H HH11 . ARG A 1 61 ? 23.014  -7.333  9.749   1.00 0.00 ? 59 ARG P HH11 8  
ATOM 9390  H HH12 . ARG A 1 61 ? 23.531  -7.567  11.398  1.00 0.00 ? 59 ARG P HH12 8  
ATOM 9391  H HH21 . ARG A 1 61 ? 24.558  -4.315  11.850  1.00 0.00 ? 59 ARG P HH21 8  
ATOM 9392  H HH22 . ARG A 1 61 ? 24.382  -5.897  12.550  1.00 0.00 ? 59 ARG P HH22 8  
ATOM 9393  N N    . GLU A 1 62 ? 24.493  -3.184  3.728   1.00 0.00 ? 60 GLU P N    8  
ATOM 9394  C CA   . GLU A 1 62 ? 25.720  -2.657  3.119   1.00 0.00 ? 60 GLU P CA   8  
ATOM 9395  C C    . GLU A 1 62 ? 25.729  -2.973  1.612   1.00 0.00 ? 60 GLU P C    8  
ATOM 9396  O O    . GLU A 1 62 ? 25.389  -4.087  1.201   1.00 0.00 ? 60 GLU P O    8  
ATOM 9397  C CB   . GLU A 1 62 ? 26.944  -3.257  3.835   1.00 0.00 ? 60 GLU P CB   8  
ATOM 9398  C CG   . GLU A 1 62 ? 28.273  -2.681  3.328   1.00 0.00 ? 60 GLU P CG   8  
ATOM 9399  C CD   . GLU A 1 62 ? 29.457  -3.209  4.162   1.00 0.00 ? 60 GLU P CD   8  
ATOM 9400  O OE1  . GLU A 1 62 ? 29.986  -4.305  3.851   1.00 0.00 ? 60 GLU P OE1  8  
ATOM 9401  O OE2  . GLU A 1 62 ? 29.872  -2.531  5.133   1.00 0.00 ? 60 GLU P OE2  8  
ATOM 9402  H H    . GLU A 1 62 ? 24.109  -4.021  3.316   1.00 0.00 ? 60 GLU P H    8  
ATOM 9403  H HA   . GLU A 1 62 ? 25.749  -1.572  3.238   1.00 0.00 ? 60 GLU P HA   8  
ATOM 9404  H HB2  . GLU A 1 62 ? 26.862  -3.045  4.901   1.00 0.00 ? 60 GLU P HB2  8  
ATOM 9405  H HB3  . GLU A 1 62 ? 26.948  -4.340  3.700   1.00 0.00 ? 60 GLU P HB3  8  
ATOM 9406  H HG2  . GLU A 1 62 ? 28.412  -2.955  2.279   1.00 0.00 ? 60 GLU P HG2  8  
ATOM 9407  H HG3  . GLU A 1 62 ? 28.233  -1.590  3.386   1.00 0.00 ? 60 GLU P HG3  8  
ATOM 9408  N N    . GLU A 1 63 ? 26.109  -1.999  0.785   1.00 0.00 ? 61 GLU P N    8  
ATOM 9409  C CA   . GLU A 1 63 ? 26.145  -2.096  -0.678  1.00 0.00 ? 61 GLU P CA   8  
ATOM 9410  C C    . GLU A 1 63 ? 27.576  -2.229  -1.237  1.00 0.00 ? 61 GLU P C    8  
ATOM 9411  O O    . GLU A 1 63 ? 28.513  -1.574  -0.773  1.00 0.00 ? 61 GLU P O    8  
ATOM 9412  C CB   . GLU A 1 63 ? 25.358  -0.937  -1.325  1.00 0.00 ? 61 GLU P CB   8  
ATOM 9413  C CG   . GLU A 1 63 ? 25.911  0.488   -1.127  1.00 0.00 ? 61 GLU P CG   8  
ATOM 9414  C CD   . GLU A 1 63 ? 25.620  1.082   0.268   1.00 0.00 ? 61 GLU P CD   8  
ATOM 9415  O OE1  . GLU A 1 63 ? 26.347  0.763   1.241   1.00 0.00 ? 61 GLU P OE1  8  
ATOM 9416  O OE2  . GLU A 1 63 ? 24.678  1.902   0.393   1.00 0.00 ? 61 GLU P OE2  8  
ATOM 9417  H H    . GLU A 1 63 ? 26.372  -1.099  1.184   1.00 0.00 ? 61 GLU P H    8  
ATOM 9418  H HA   . GLU A 1 63 ? 25.615  -3.005  -0.966  1.00 0.00 ? 61 GLU P HA   8  
ATOM 9419  H HB2  . GLU A 1 63 ? 25.327  -1.129  -2.399  1.00 0.00 ? 61 GLU P HB2  8  
ATOM 9420  H HB3  . GLU A 1 63 ? 24.328  -0.965  -0.967  1.00 0.00 ? 61 GLU P HB3  8  
ATOM 9421  H HG2  . GLU A 1 63 ? 26.983  0.505   -1.329  1.00 0.00 ? 61 GLU P HG2  8  
ATOM 9422  H HG3  . GLU A 1 63 ? 25.448  1.126   -1.884  1.00 0.00 ? 61 GLU P HG3  8  
ATOM 9423  N N    . PHE A 1 64 ? 27.738  -3.082  -2.255  1.00 0.00 ? 62 PHE P N    8  
ATOM 9424  C CA   . PHE A 1 64 ? 29.013  -3.349  -2.947  1.00 0.00 ? 62 PHE P CA   8  
ATOM 9425  C C    . PHE A 1 64 ? 28.828  -3.708  -4.442  1.00 0.00 ? 62 PHE P C    8  
ATOM 9426  O O    . PHE A 1 64 ? 29.715  -4.296  -5.068  1.00 0.00 ? 62 PHE P O    8  
ATOM 9427  C CB   . PHE A 1 64 ? 29.803  -4.415  -2.161  1.00 0.00 ? 62 PHE P CB   8  
ATOM 9428  C CG   . PHE A 1 64 ? 29.068  -5.718  -1.891  1.00 0.00 ? 62 PHE P CG   8  
ATOM 9429  C CD1  . PHE A 1 64 ? 29.107  -6.768  -2.831  1.00 0.00 ? 62 PHE P CD1  8  
ATOM 9430  C CD2  . PHE A 1 64 ? 28.367  -5.896  -0.682  1.00 0.00 ? 62 PHE P CD2  8  
ATOM 9431  C CE1  . PHE A 1 64 ? 28.450  -7.982  -2.563  1.00 0.00 ? 62 PHE P CE1  8  
ATOM 9432  C CE2  . PHE A 1 64 ? 27.717  -7.113  -0.409  1.00 0.00 ? 62 PHE P CE2  8  
ATOM 9433  C CZ   . PHE A 1 64 ? 27.761  -8.159  -1.350  1.00 0.00 ? 62 PHE P CZ   8  
ATOM 9434  H H    . PHE A 1 64 ? 26.944  -3.642  -2.528  1.00 0.00 ? 62 PHE P H    8  
ATOM 9435  H HA   . PHE A 1 64 ? 29.604  -2.432  -2.940  1.00 0.00 ? 62 PHE P HA   8  
ATOM 9436  H HB2  . PHE A 1 64 ? 30.734  -4.634  -2.685  1.00 0.00 ? 62 PHE P HB2  8  
ATOM 9437  H HB3  . PHE A 1 64 ? 30.090  -3.982  -1.201  1.00 0.00 ? 62 PHE P HB3  8  
ATOM 9438  H HD1  . PHE A 1 64 ? 29.651  -6.647  -3.758  1.00 0.00 ? 62 PHE P HD1  8  
ATOM 9439  H HD2  . PHE A 1 64 ? 28.340  -5.099  0.051   1.00 0.00 ? 62 PHE P HD2  8  
ATOM 9440  H HE1  . PHE A 1 64 ? 28.488  -8.787  -3.285  1.00 0.00 ? 62 PHE P HE1  8  
ATOM 9441  H HE2  . PHE A 1 64 ? 27.201  -7.248  0.533   1.00 0.00 ? 62 PHE P HE2  8  
ATOM 9442  H HZ   . PHE A 1 64 ? 27.277  -9.103  -1.136  1.00 0.00 ? 62 PHE P HZ   8  
ATOM 9443  N N    . ILE A 1 65 ? 27.667  -3.367  -5.016  1.00 0.00 ? 63 ILE P N    8  
ATOM 9444  C CA   . ILE A 1 65 ? 27.230  -3.711  -6.383  1.00 0.00 ? 63 ILE P CA   8  
ATOM 9445  C C    . ILE A 1 65 ? 26.639  -2.496  -7.119  1.00 0.00 ? 63 ILE P C    8  
ATOM 9446  O O    . ILE A 1 65 ? 26.245  -1.508  -6.494  1.00 0.00 ? 63 ILE P O    8  
ATOM 9447  C CB   . ILE A 1 65 ? 26.240  -4.906  -6.391  1.00 0.00 ? 63 ILE P CB   8  
ATOM 9448  C CG1  . ILE A 1 65 ? 24.810  -4.612  -5.870  1.00 0.00 ? 63 ILE P CG1  8  
ATOM 9449  C CG2  . ILE A 1 65 ? 26.834  -6.146  -5.700  1.00 0.00 ? 63 ILE P CG2  8  
ATOM 9450  C CD1  . ILE A 1 65 ? 24.668  -4.152  -4.411  1.00 0.00 ? 63 ILE P CD1  8  
ATOM 9451  H H    . ILE A 1 65 ? 27.036  -2.793  -4.476  1.00 0.00 ? 63 ILE P H    8  
ATOM 9452  H HA   . ILE A 1 65 ? 28.107  -4.020  -6.954  1.00 0.00 ? 63 ILE P HA   8  
ATOM 9453  H HB   . ILE A 1 65 ? 26.116  -5.188  -7.438  1.00 0.00 ? 63 ILE P HB   8  
ATOM 9454  H HG12 . ILE A 1 65 ? 24.351  -3.856  -6.508  1.00 0.00 ? 63 ILE P HG12 8  
ATOM 9455  H HG13 . ILE A 1 65 ? 24.217  -5.520  -5.990  1.00 0.00 ? 63 ILE P HG13 8  
ATOM 9456  H HG21 . ILE A 1 65 ? 26.175  -7.003  -5.847  1.00 0.00 ? 63 ILE P HG21 8  
ATOM 9457  H HG22 . ILE A 1 65 ? 27.807  -6.379  -6.135  1.00 0.00 ? 63 ILE P HG22 8  
ATOM 9458  H HG23 . ILE A 1 65 ? 26.958  -5.978  -4.631  1.00 0.00 ? 63 ILE P HG23 8  
ATOM 9459  H HD11 . ILE A 1 65 ? 23.608  -4.090  -4.162  1.00 0.00 ? 63 ILE P HD11 8  
ATOM 9460  H HD12 . ILE A 1 65 ? 25.143  -4.863  -3.736  1.00 0.00 ? 63 ILE P HD12 8  
ATOM 9461  H HD13 . ILE A 1 65 ? 25.104  -3.163  -4.280  1.00 0.00 ? 63 ILE P HD13 8  
ATOM 9462  N N    . VAL A 1 66 ? 26.554  -2.584  -8.450  1.00 0.00 ? 64 VAL P N    8  
ATOM 9463  C CA   . VAL A 1 66 ? 25.952  -1.573  -9.346  1.00 0.00 ? 64 VAL P CA   8  
ATOM 9464  C C    . VAL A 1 66 ? 24.957  -2.205  -10.330 1.00 0.00 ? 64 VAL P C    8  
ATOM 9465  O O    . VAL A 1 66 ? 25.029  -3.402  -10.622 1.00 0.00 ? 64 VAL P O    8  
ATOM 9466  C CB   . VAL A 1 66 ? 27.024  -0.755  -10.101 1.00 0.00 ? 64 VAL P CB   8  
ATOM 9467  C CG1  . VAL A 1 66 ? 27.867  0.090   -9.138  1.00 0.00 ? 64 VAL P CG1  8  
ATOM 9468  C CG2  . VAL A 1 66 ? 27.969  -1.617  -10.950 1.00 0.00 ? 64 VAL P CG2  8  
ATOM 9469  H H    . VAL A 1 66 ? 26.880  -3.436  -8.887  1.00 0.00 ? 64 VAL P H    8  
ATOM 9470  H HA   . VAL A 1 66 ? 25.379  -0.868  -8.743  1.00 0.00 ? 64 VAL P HA   8  
ATOM 9471  H HB   . VAL A 1 66 ? 26.511  -0.064  -10.771 1.00 0.00 ? 64 VAL P HB   8  
ATOM 9472  H HG11 . VAL A 1 66 ? 28.537  0.736   -9.707  1.00 0.00 ? 64 VAL P HG11 8  
ATOM 9473  H HG12 . VAL A 1 66 ? 27.215  0.714   -8.529  1.00 0.00 ? 64 VAL P HG12 8  
ATOM 9474  H HG13 . VAL A 1 66 ? 28.462  -0.552  -8.488  1.00 0.00 ? 64 VAL P HG13 8  
ATOM 9475  H HG21 . VAL A 1 66 ? 28.549  -2.289  -10.315 1.00 0.00 ? 64 VAL P HG21 8  
ATOM 9476  H HG22 . VAL A 1 66 ? 27.398  -2.205  -11.669 1.00 0.00 ? 64 VAL P HG22 8  
ATOM 9477  H HG23 . VAL A 1 66 ? 28.655  -0.973  -11.500 1.00 0.00 ? 64 VAL P HG23 8  
ATOM 9478  N N    . THR A 1 67 ? 24.019  -1.404  -10.840 1.00 0.00 ? 65 THR P N    8  
ATOM 9479  C CA   . THR A 1 67 ? 22.960  -1.841  -11.771 1.00 0.00 ? 65 THR P CA   8  
ATOM 9480  C C    . THR A 1 67 ? 23.526  -2.217  -13.151 1.00 0.00 ? 65 THR P C    8  
ATOM 9481  O O    . THR A 1 67 ? 24.373  -1.501  -13.690 1.00 0.00 ? 65 THR P O    8  
ATOM 9482  C CB   . THR A 1 67 ? 21.890  -0.743  -11.928 1.00 0.00 ? 65 THR P CB   8  
ATOM 9483  O OG1  . THR A 1 67 ? 21.475  -0.287  -10.654 1.00 0.00 ? 65 THR P OG1  8  
ATOM 9484  C CG2  . THR A 1 67 ? 20.633  -1.225  -12.655 1.00 0.00 ? 65 THR P CG2  8  
ATOM 9485  H H    . THR A 1 67 ? 23.988  -0.443  -10.532 1.00 0.00 ? 65 THR P H    8  
ATOM 9486  H HA   . THR A 1 67 ? 22.474  -2.719  -11.347 1.00 0.00 ? 65 THR P HA   8  
ATOM 9487  H HB   . THR A 1 67 ? 22.319  0.098   -12.477 1.00 0.00 ? 65 THR P HB   8  
ATOM 9488  H HG1  . THR A 1 67 ? 20.868  0.461   -10.793 1.00 0.00 ? 65 THR P HG1  8  
ATOM 9489  H HG21 . THR A 1 67 ? 19.896  -0.422  -12.689 1.00 0.00 ? 65 THR P HG21 8  
ATOM 9490  H HG22 . THR A 1 67 ? 20.206  -2.085  -12.138 1.00 0.00 ? 65 THR P HG22 8  
ATOM 9491  H HG23 . THR A 1 67 ? 20.876  -1.502  -13.681 1.00 0.00 ? 65 THR P HG23 8  
ATOM 9492  N N    . ASP A 1 68 ? 23.019  -3.315  -13.731 1.00 0.00 ? 66 ASP P N    8  
ATOM 9493  C CA   . ASP A 1 68 ? 23.340  -3.853  -15.073 1.00 0.00 ? 66 ASP P CA   8  
ATOM 9494  C C    . ASP A 1 68 ? 24.853  -3.956  -15.399 1.00 0.00 ? 66 ASP P C    8  
ATOM 9495  O O    . ASP A 1 68 ? 25.517  -4.838  -14.805 1.00 0.00 ? 66 ASP P O    8  
ATOM 9496  C CB   . ASP A 1 68 ? 22.507  -3.108  -16.142 1.00 0.00 ? 66 ASP P CB   8  
ATOM 9497  C CG   . ASP A 1 68 ? 22.653  -3.682  -17.572 1.00 0.00 ? 66 ASP P CG   8  
ATOM 9498  O OD1  . ASP A 1 68 ? 22.673  -4.928  -17.740 1.00 0.00 ? 66 ASP P OD1  8  
ATOM 9499  O OD2  . ASP A 1 68 ? 22.678  -2.889  -18.547 1.00 0.00 ? 66 ASP P OD2  8  
ATOM 9500  O OXT  . ASP A 1 68 ? 25.373  -3.197  -16.251 1.00 0.00 ? 66 ASP P OXT  8  
ATOM 9501  H H    . ASP A 1 68 ? 22.340  -3.834  -13.192 1.00 0.00 ? 66 ASP P H    8  
ATOM 9502  H HA   . ASP A 1 68 ? 22.984  -4.883  -15.087 1.00 0.00 ? 66 ASP P HA   8  
ATOM 9503  H HB2  . ASP A 1 68 ? 21.454  -3.160  -15.858 1.00 0.00 ? 66 ASP P HB2  8  
ATOM 9504  H HB3  . ASP A 1 68 ? 22.791  -2.053  -16.139 1.00 0.00 ? 66 ASP P HB3  8  
ATOM 9505  N N    . GLY A 1 1  ? -7.680  -5.447  20.864  1.00 0.00 ? -1 GLY P N    9  
ATOM 9506  C CA   . GLY A 1 1  ? -7.360  -6.889  20.780  1.00 0.00 ? -1 GLY P CA   9  
ATOM 9507  C C    . GLY A 1 1  ? -6.336  -7.152  19.691  1.00 0.00 ? -1 GLY P C    9  
ATOM 9508  O O    . GLY A 1 1  ? -6.604  -6.877  18.519  1.00 0.00 ? -1 GLY P O    9  
ATOM 9509  H H1   . GLY A 1 1  ? -6.854  -4.915  21.091  1.00 0.00 ? -1 GLY P H1   9  
ATOM 9510  H H2   . GLY A 1 1  ? -8.373  -5.286  21.578  1.00 0.00 ? -1 GLY P H2   9  
ATOM 9511  H H3   . GLY A 1 1  ? -8.043  -5.120  19.981  1.00 0.00 ? -1 GLY P H3   9  
ATOM 9512  H HA2  . GLY A 1 1  ? -6.968  -7.238  21.736  1.00 0.00 ? -1 GLY P HA2  9  
ATOM 9513  H HA3  . GLY A 1 1  ? -8.263  -7.450  20.543  1.00 0.00 ? -1 GLY P HA3  9  
ATOM 9514  N N    . SER A 1 2  ? -5.167  -7.685  20.064  1.00 0.00 ? 0  SER P N    9  
ATOM 9515  C CA   . SER A 1 2  ? -3.999  -7.859  19.171  1.00 0.00 ? 0  SER P CA   9  
ATOM 9516  C C    . SER A 1 2  ? -3.438  -9.291  19.141  1.00 0.00 ? 0  SER P C    9  
ATOM 9517  O O    . SER A 1 2  ? -2.707  -9.653  18.218  1.00 0.00 ? 0  SER P O    9  
ATOM 9518  C CB   . SER A 1 2  ? -2.883  -6.890  19.590  1.00 0.00 ? 0  SER P CB   9  
ATOM 9519  O OG   . SER A 1 2  ? -3.350  -5.547  19.577  1.00 0.00 ? 0  SER P OG   9  
ATOM 9520  H H    . SER A 1 2  ? -5.036  -7.888  21.047  1.00 0.00 ? 0  SER P H    9  
ATOM 9521  H HA   . SER A 1 2  ? -4.273  -7.601  18.151  1.00 0.00 ? 0  SER P HA   9  
ATOM 9522  H HB2  . SER A 1 2  ? -2.539  -7.146  20.594  1.00 0.00 ? 0  SER P HB2  9  
ATOM 9523  H HB3  . SER A 1 2  ? -2.044  -6.985  18.898  1.00 0.00 ? 0  SER P HB3  9  
ATOM 9524  H HG   . SER A 1 2  ? -2.611  -4.962  19.837  1.00 0.00 ? 0  SER P HG   9  
ATOM 9525  N N    . GLN A 1 3  ? -3.772  -10.117 20.137  1.00 0.00 ? 1  GLN P N    9  
ATOM 9526  C CA   . GLN A 1 3  ? -3.221  -11.457 20.352  1.00 0.00 ? 1  GLN P CA   9  
ATOM 9527  C C    . GLN A 1 3  ? -3.743  -12.502 19.346  1.00 0.00 ? 1  GLN P C    9  
ATOM 9528  O O    . GLN A 1 3  ? -4.927  -12.507 19.004  1.00 0.00 ? 1  GLN P O    9  
ATOM 9529  C CB   . GLN A 1 3  ? -3.423  -11.884 21.824  1.00 0.00 ? 1  GLN P CB   9  
ATOM 9530  C CG   . GLN A 1 3  ? -4.863  -12.207 22.287  1.00 0.00 ? 1  GLN P CG   9  
ATOM 9531  C CD   . GLN A 1 3  ? -5.822  -11.019 22.448  1.00 0.00 ? 1  GLN P CD   9  
ATOM 9532  O OE1  . GLN A 1 3  ? -5.479  -9.847  22.342  1.00 0.00 ? 1  GLN P OE1  9  
ATOM 9533  N NE2  . GLN A 1 3  ? -7.081  -11.277 22.725  1.00 0.00 ? 1  GLN P NE2  9  
ATOM 9534  H H    . GLN A 1 3  ? -4.407  -9.767  20.843  1.00 0.00 ? 1  GLN P H    9  
ATOM 9535  H HA   . GLN A 1 3  ? -2.142  -11.383 20.200  1.00 0.00 ? 1  GLN P HA   9  
ATOM 9536  H HB2  . GLN A 1 3  ? -2.827  -12.784 21.981  1.00 0.00 ? 1  GLN P HB2  9  
ATOM 9537  H HB3  . GLN A 1 3  ? -3.007  -11.115 22.476  1.00 0.00 ? 1  GLN P HB3  9  
ATOM 9538  H HG2  . GLN A 1 3  ? -5.311  -12.931 21.609  1.00 0.00 ? 1  GLN P HG2  9  
ATOM 9539  H HG3  . GLN A 1 3  ? -4.793  -12.693 23.260  1.00 0.00 ? 1  GLN P HG3  9  
ATOM 9540  H HE21 . GLN A 1 3  ? -7.399  -12.231 22.827  1.00 0.00 ? 1  GLN P HE21 9  
ATOM 9541  H HE22 . GLN A 1 3  ? -7.714  -10.501 22.852  1.00 0.00 ? 1  GLN P HE22 9  
ATOM 9542  N N    . ARG A 1 4  ? -2.852  -13.397 18.888  1.00 0.00 ? 2  ARG P N    9  
ATOM 9543  C CA   . ARG A 1 4  ? -3.095  -14.525 17.953  1.00 0.00 ? 2  ARG P CA   9  
ATOM 9544  C C    . ARG A 1 4  ? -3.885  -14.206 16.665  1.00 0.00 ? 2  ARG P C    9  
ATOM 9545  O O    . ARG A 1 4  ? -4.505  -15.096 16.078  1.00 0.00 ? 2  ARG P O    9  
ATOM 9546  C CB   . ARG A 1 4  ? -3.580  -15.782 18.713  1.00 0.00 ? 2  ARG P CB   9  
ATOM 9547  C CG   . ARG A 1 4  ? -4.991  -15.679 19.322  1.00 0.00 ? 2  ARG P CG   9  
ATOM 9548  C CD   . ARG A 1 4  ? -5.489  -17.018 19.887  1.00 0.00 ? 2  ARG P CD   9  
ATOM 9549  N NE   . ARG A 1 4  ? -4.692  -17.465 21.051  1.00 0.00 ? 2  ARG P NE   9  
ATOM 9550  C CZ   . ARG A 1 4  ? -3.818  -18.457 21.104  1.00 0.00 ? 2  ARG P CZ   9  
ATOM 9551  N NH1  . ARG A 1 4  ? -3.531  -19.195 20.069  1.00 0.00 ? 2  ARG P NH1  9  
ATOM 9552  N NH2  . ARG A 1 4  ? -3.202  -18.728 22.219  1.00 0.00 ? 2  ARG P NH2  9  
ATOM 9553  H H    . ARG A 1 4  ? -1.909  -13.305 19.244  1.00 0.00 ? 2  ARG P H    9  
ATOM 9554  H HA   . ARG A 1 4  ? -2.111  -14.794 17.565  1.00 0.00 ? 2  ARG P HA   9  
ATOM 9555  H HB2  . ARG A 1 4  ? -3.558  -16.629 18.025  1.00 0.00 ? 2  ARG P HB2  9  
ATOM 9556  H HB3  . ARG A 1 4  ? -2.868  -15.996 19.513  1.00 0.00 ? 2  ARG P HB3  9  
ATOM 9557  H HG2  . ARG A 1 4  ? -4.989  -14.944 20.125  1.00 0.00 ? 2  ARG P HG2  9  
ATOM 9558  H HG3  . ARG A 1 4  ? -5.694  -15.354 18.554  1.00 0.00 ? 2  ARG P HG3  9  
ATOM 9559  H HD2  . ARG A 1 4  ? -6.524  -16.886 20.206  1.00 0.00 ? 2  ARG P HD2  9  
ATOM 9560  H HD3  . ARG A 1 4  ? -5.488  -17.765 19.093  1.00 0.00 ? 2  ARG P HD3  9  
ATOM 9561  H HE   . ARG A 1 4  ? -4.845  -16.968 21.914  1.00 0.00 ? 2  ARG P HE   9  
ATOM 9562  H HH11 . ARG A 1 4  ? -3.997  -19.022 19.197  1.00 0.00 ? 2  ARG P HH11 9  
ATOM 9563  H HH12 . ARG A 1 4  ? -2.863  -19.945 20.144  1.00 0.00 ? 2  ARG P HH12 9  
ATOM 9564  H HH21 . ARG A 1 4  ? -3.392  -18.188 23.048  1.00 0.00 ? 2  ARG P HH21 9  
ATOM 9565  H HH22 . ARG A 1 4  ? -2.538  -19.483 22.261  1.00 0.00 ? 2  ARG P HH22 9  
ATOM 9566  N N    . ARG A 1 5  ? -3.841  -12.955 16.185  1.00 0.00 ? 3  ARG P N    9  
ATOM 9567  C CA   . ARG A 1 5  ? -4.556  -12.461 14.985  1.00 0.00 ? 3  ARG P CA   9  
ATOM 9568  C C    . ARG A 1 5  ? -3.873  -12.857 13.665  1.00 0.00 ? 3  ARG P C    9  
ATOM 9569  O O    . ARG A 1 5  ? -3.491  -12.006 12.861  1.00 0.00 ? 3  ARG P O    9  
ATOM 9570  C CB   . ARG A 1 5  ? -4.798  -10.943 15.103  1.00 0.00 ? 3  ARG P CB   9  
ATOM 9571  C CG   . ARG A 1 5  ? -5.897  -10.597 16.117  1.00 0.00 ? 3  ARG P CG   9  
ATOM 9572  C CD   . ARG A 1 5  ? -6.139  -9.087  16.222  1.00 0.00 ? 3  ARG P CD   9  
ATOM 9573  N NE   . ARG A 1 5  ? -6.570  -8.490  14.945  1.00 0.00 ? 3  ARG P NE   9  
ATOM 9574  C CZ   . ARG A 1 5  ? -7.087  -7.292  14.758  1.00 0.00 ? 3  ARG P CZ   9  
ATOM 9575  N NH1  . ARG A 1 5  ? -7.303  -6.456  15.734  1.00 0.00 ? 3  ARG P NH1  9  
ATOM 9576  N NH2  . ARG A 1 5  ? -7.389  -6.924  13.548  1.00 0.00 ? 3  ARG P NH2  9  
ATOM 9577  H H    . ARG A 1 5  ? -3.295  -12.292 16.716  1.00 0.00 ? 3  ARG P H    9  
ATOM 9578  H HA   . ARG A 1 5  ? -5.536  -12.942 14.950  1.00 0.00 ? 3  ARG P HA   9  
ATOM 9579  H HB2  . ARG A 1 5  ? -3.868  -10.438 15.372  1.00 0.00 ? 3  ARG P HB2  9  
ATOM 9580  H HB3  . ARG A 1 5  ? -5.121  -10.571 14.134  1.00 0.00 ? 3  ARG P HB3  9  
ATOM 9581  H HG2  . ARG A 1 5  ? -6.828  -11.086 15.826  1.00 0.00 ? 3  ARG P HG2  9  
ATOM 9582  H HG3  . ARG A 1 5  ? -5.609  -10.961 17.100  1.00 0.00 ? 3  ARG P HG3  9  
ATOM 9583  H HD2  . ARG A 1 5  ? -6.906  -8.923  16.981  1.00 0.00 ? 3  ARG P HD2  9  
ATOM 9584  H HD3  . ARG A 1 5  ? -5.215  -8.607  16.543  1.00 0.00 ? 3  ARG P HD3  9  
ATOM 9585  H HE   . ARG A 1 5  ? -6.424  -9.026  14.100  1.00 0.00 ? 3  ARG P HE   9  
ATOM 9586  H HH11 . ARG A 1 5  ? -7.039  -6.714  16.680  1.00 0.00 ? 3  ARG P HH11 9  
ATOM 9587  H HH12 . ARG A 1 5  ? -7.695  -5.548  15.553  1.00 0.00 ? 3  ARG P HH12 9  
ATOM 9588  H HH21 . ARG A 1 5  ? -7.169  -7.557  12.786  1.00 0.00 ? 3  ARG P HH21 9  
ATOM 9589  H HH22 . ARG A 1 5  ? -7.787  -6.019  13.365  1.00 0.00 ? 3  ARG P HH22 9  
ATOM 9590  N N    . GLN A 1 6  ? -3.760  -14.160 13.405  1.00 0.00 ? 4  GLN P N    9  
ATOM 9591  C CA   . GLN A 1 6  ? -3.171  -14.706 12.168  1.00 0.00 ? 4  GLN P CA   9  
ATOM 9592  C C    . GLN A 1 6  ? -3.927  -14.259 10.897  1.00 0.00 ? 4  GLN P C    9  
ATOM 9593  O O    . GLN A 1 6  ? -3.312  -14.067 9.847   1.00 0.00 ? 4  GLN P O    9  
ATOM 9594  C CB   . GLN A 1 6  ? -3.122  -16.241 12.254  1.00 0.00 ? 4  GLN P CB   9  
ATOM 9595  C CG   . GLN A 1 6  ? -2.169  -16.744 13.355  1.00 0.00 ? 4  GLN P CG   9  
ATOM 9596  C CD   . GLN A 1 6  ? -2.062  -18.270 13.429  1.00 0.00 ? 4  GLN P CD   9  
ATOM 9597  O OE1  . GLN A 1 6  ? -2.717  -19.025 12.721  1.00 0.00 ? 4  GLN P OE1  9  
ATOM 9598  N NE2  . GLN A 1 6  ? -1.225  -18.792 14.302  1.00 0.00 ? 4  GLN P NE2  9  
ATOM 9599  H H    . GLN A 1 6  ? -4.092  -14.805 14.113  1.00 0.00 ? 4  GLN P H    9  
ATOM 9600  H HA   . GLN A 1 6  ? -2.148  -14.337 12.077  1.00 0.00 ? 4  GLN P HA   9  
ATOM 9601  H HB2  . GLN A 1 6  ? -4.128  -16.625 12.439  1.00 0.00 ? 4  GLN P HB2  9  
ATOM 9602  H HB3  . GLN A 1 6  ? -2.776  -16.631 11.296  1.00 0.00 ? 4  GLN P HB3  9  
ATOM 9603  H HG2  . GLN A 1 6  ? -1.174  -16.338 13.171  1.00 0.00 ? 4  GLN P HG2  9  
ATOM 9604  H HG3  . GLN A 1 6  ? -2.505  -16.382 14.326  1.00 0.00 ? 4  GLN P HG3  9  
ATOM 9605  H HE21 . GLN A 1 6  ? -0.668  -18.195 14.897  1.00 0.00 ? 4  GLN P HE21 9  
ATOM 9606  H HE22 . GLN A 1 6  ? -1.151  -19.798 14.353  1.00 0.00 ? 4  GLN P HE22 9  
ATOM 9607  N N    . ARG A 1 7  ? -5.242  -14.008 10.999  1.00 0.00 ? 5  ARG P N    9  
ATOM 9608  C CA   . ARG A 1 7  ? -6.099  -13.490 9.911   1.00 0.00 ? 5  ARG P CA   9  
ATOM 9609  C C    . ARG A 1 7  ? -5.813  -12.022 9.537   1.00 0.00 ? 5  ARG P C    9  
ATOM 9610  O O    . ARG A 1 7  ? -6.136  -11.598 8.429   1.00 0.00 ? 5  ARG P O    9  
ATOM 9611  C CB   . ARG A 1 7  ? -7.569  -13.719 10.322  1.00 0.00 ? 5  ARG P CB   9  
ATOM 9612  C CG   . ARG A 1 7  ? -8.577  -13.495 9.183   1.00 0.00 ? 5  ARG P CG   9  
ATOM 9613  C CD   . ARG A 1 7  ? -9.992  -13.884 9.626   1.00 0.00 ? 5  ARG P CD   9  
ATOM 9614  N NE   . ARG A 1 7  ? -10.973 -13.679 8.541   1.00 0.00 ? 5  ARG P NE   9  
ATOM 9615  C CZ   . ARG A 1 7  ? -12.270 -13.930 8.592   1.00 0.00 ? 5  ARG P CZ   9  
ATOM 9616  N NH1  . ARG A 1 7  ? -12.843 -14.408 9.662   1.00 0.00 ? 5  ARG P NH1  9  
ATOM 9617  N NH2  . ARG A 1 7  ? -13.027 -13.705 7.556   1.00 0.00 ? 5  ARG P NH2  9  
ATOM 9618  H H    . ARG A 1 7  ? -5.680  -14.218 11.886  1.00 0.00 ? 5  ARG P H    9  
ATOM 9619  H HA   . ARG A 1 7  ? -5.902  -14.077 9.011   1.00 0.00 ? 5  ARG P HA   9  
ATOM 9620  H HB2  . ARG A 1 7  ? -7.674  -14.751 10.663  1.00 0.00 ? 5  ARG P HB2  9  
ATOM 9621  H HB3  . ARG A 1 7  ? -7.818  -13.060 11.156  1.00 0.00 ? 5  ARG P HB3  9  
ATOM 9622  H HG2  . ARG A 1 7  ? -8.578  -12.444 8.892   1.00 0.00 ? 5  ARG P HG2  9  
ATOM 9623  H HG3  . ARG A 1 7  ? -8.292  -14.104 8.324   1.00 0.00 ? 5  ARG P HG3  9  
ATOM 9624  H HD2  . ARG A 1 7  ? -9.992  -14.935 9.921   1.00 0.00 ? 5  ARG P HD2  9  
ATOM 9625  H HD3  . ARG A 1 7  ? -10.270 -13.275 10.489  1.00 0.00 ? 5  ARG P HD3  9  
ATOM 9626  H HE   . ARG A 1 7  ? -10.624 -13.311 7.669   1.00 0.00 ? 5  ARG P HE   9  
ATOM 9627  H HH11 . ARG A 1 7  ? -12.284 -14.591 10.477  1.00 0.00 ? 5  ARG P HH11 9  
ATOM 9628  H HH12 . ARG A 1 7  ? -13.832 -14.591 9.676   1.00 0.00 ? 5  ARG P HH12 9  
ATOM 9629  H HH21 . ARG A 1 7  ? -12.627 -13.338 6.707   1.00 0.00 ? 5  ARG P HH21 9  
ATOM 9630  H HH22 . ARG A 1 7  ? -14.013 -13.899 7.596   1.00 0.00 ? 5  ARG P HH22 9  
ATOM 9631  N N    . THR A 1 8  ? -5.183  -11.256 10.433  1.00 0.00 ? 6  THR P N    9  
ATOM 9632  C CA   . THR A 1 8  ? -4.789  -9.844  10.220  1.00 0.00 ? 6  THR P CA   9  
ATOM 9633  C C    . THR A 1 8  ? -3.423  -9.708  9.519   1.00 0.00 ? 6  THR P C    9  
ATOM 9634  O O    . THR A 1 8  ? -3.076  -8.624  9.042   1.00 0.00 ? 6  THR P O    9  
ATOM 9635  C CB   . THR A 1 8  ? -4.835  -9.092  11.566  1.00 0.00 ? 6  THR P CB   9  
ATOM 9636  O OG1  . THR A 1 8  ? -6.146  -9.171  12.099  1.00 0.00 ? 6  THR P OG1  9  
ATOM 9637  C CG2  . THR A 1 8  ? -4.520  -7.597  11.509  1.00 0.00 ? 6  THR P CG2  9  
ATOM 9638  H H    . THR A 1 8  ? -4.910  -11.689 11.306  1.00 0.00 ? 6  THR P H    9  
ATOM 9639  H HA   . THR A 1 8  ? -5.519  -9.369  9.564   1.00 0.00 ? 6  THR P HA   9  
ATOM 9640  H HB   . THR A 1 8  ? -4.141  -9.562  12.261  1.00 0.00 ? 6  THR P HB   9  
ATOM 9641  H HG1  . THR A 1 8  ? -6.523  -10.026 11.822  1.00 0.00 ? 6  THR P HG1  9  
ATOM 9642  H HG21 . THR A 1 8  ? -4.726  -7.143  12.478  1.00 0.00 ? 6  THR P HG21 9  
ATOM 9643  H HG22 . THR A 1 8  ? -5.129  -7.116  10.744  1.00 0.00 ? 6  THR P HG22 9  
ATOM 9644  H HG23 . THR A 1 8  ? -3.465  -7.447  11.293  1.00 0.00 ? 6  THR P HG23 9  
ATOM 9645  N N    . HIS A 1 9  ? -2.648  -10.794 9.397   1.00 0.00 ? 7  HIS P N    9  
ATOM 9646  C CA   . HIS A 1 9  ? -1.368  -10.823 8.669   1.00 0.00 ? 7  HIS P CA   9  
ATOM 9647  C C    . HIS A 1 9  ? -1.532  -10.520 7.165   1.00 0.00 ? 7  HIS P C    9  
ATOM 9648  O O    . HIS A 1 9  ? -2.621  -10.657 6.601   1.00 0.00 ? 7  HIS P O    9  
ATOM 9649  C CB   . HIS A 1 9  ? -0.681  -12.179 8.899   1.00 0.00 ? 7  HIS P CB   9  
ATOM 9650  C CG   . HIS A 1 9  ? 0.729   -12.252 8.357   1.00 0.00 ? 7  HIS P CG   9  
ATOM 9651  N ND1  . HIS A 1 9  ? 1.686   -11.236 8.443   1.00 0.00 ? 7  HIS P ND1  9  
ATOM 9652  C CD2  . HIS A 1 9  ? 1.262   -13.301 7.668   1.00 0.00 ? 7  HIS P CD2  9  
ATOM 9653  C CE1  . HIS A 1 9  ? 2.779   -11.704 7.815   1.00 0.00 ? 7  HIS P CE1  9  
ATOM 9654  N NE2  . HIS A 1 9  ? 2.550   -12.940 7.338   1.00 0.00 ? 7  HIS P NE2  9  
ATOM 9655  H H    . HIS A 1 9  ? -2.989  -11.666 9.777   1.00 0.00 ? 7  HIS P H    9  
ATOM 9656  H HA   . HIS A 1 9  ? -0.721  -10.051 9.089   1.00 0.00 ? 7  HIS P HA   9  
ATOM 9657  H HB2  . HIS A 1 9  ? -0.638  -12.381 9.970   1.00 0.00 ? 7  HIS P HB2  9  
ATOM 9658  H HB3  . HIS A 1 9  ? -1.278  -12.962 8.428   1.00 0.00 ? 7  HIS P HB3  9  
ATOM 9659  H HD2  . HIS A 1 9  ? 0.760   -14.231 7.425   1.00 0.00 ? 7  HIS P HD2  9  
ATOM 9660  H HE1  . HIS A 1 9  ? 3.713   -11.164 7.706   1.00 0.00 ? 7  HIS P HE1  9  
ATOM 9661  H HE2  . HIS A 1 9  ? 3.221   -13.502 6.823   1.00 0.00 ? 7  HIS P HE2  9  
ATOM 9662  N N    . PHE A 1 10 ? -0.450  -10.083 6.514   1.00 0.00 ? 8  PHE P N    9  
ATOM 9663  C CA   . PHE A 1 10 ? -0.431  -9.741  5.086   1.00 0.00 ? 8  PHE P CA   9  
ATOM 9664  C C    . PHE A 1 10 ? -0.762  -10.951 4.191   1.00 0.00 ? 8  PHE P C    9  
ATOM 9665  O O    . PHE A 1 10 ? -0.389  -12.087 4.500   1.00 0.00 ? 8  PHE P O    9  
ATOM 9666  C CB   . PHE A 1 10 ? 0.950   -9.197  4.691   1.00 0.00 ? 8  PHE P CB   9  
ATOM 9667  C CG   . PHE A 1 10 ? 1.363   -7.878  5.319   1.00 0.00 ? 8  PHE P CG   9  
ATOM 9668  C CD1  . PHE A 1 10 ? 1.056   -6.663  4.676   1.00 0.00 ? 8  PHE P CD1  9  
ATOM 9669  C CD2  . PHE A 1 10 ? 2.124   -7.862  6.505   1.00 0.00 ? 8  PHE P CD2  9  
ATOM 9670  C CE1  . PHE A 1 10 ? 1.534   -5.447  5.196   1.00 0.00 ? 8  PHE P CE1  9  
ATOM 9671  C CE2  . PHE A 1 10 ? 2.590   -6.645  7.032   1.00 0.00 ? 8  PHE P CE2  9  
ATOM 9672  C CZ   . PHE A 1 10 ? 2.312   -5.437  6.367   1.00 0.00 ? 8  PHE P CZ   9  
ATOM 9673  H H    . PHE A 1 10 ? 0.431   -10.092 7.011   1.00 0.00 ? 8  PHE P H    9  
ATOM 9674  H HA   . PHE A 1 10 ? -1.175  -8.966  4.901   1.00 0.00 ? 8  PHE P HA   9  
ATOM 9675  H HB2  . PHE A 1 10 ? 1.706   -9.950  4.923   1.00 0.00 ? 8  PHE P HB2  9  
ATOM 9676  H HB3  . PHE A 1 10 ? 0.962   -9.064  3.609   1.00 0.00 ? 8  PHE P HB3  9  
ATOM 9677  H HD1  . PHE A 1 10 ? 0.482   -6.666  3.758   1.00 0.00 ? 8  PHE P HD1  9  
ATOM 9678  H HD2  . PHE A 1 10 ? 2.382   -8.790  6.998   1.00 0.00 ? 8  PHE P HD2  9  
ATOM 9679  H HE1  . PHE A 1 10 ? 1.330   -4.521  4.677   1.00 0.00 ? 8  PHE P HE1  9  
ATOM 9680  H HE2  . PHE A 1 10 ? 3.192   -6.640  7.931   1.00 0.00 ? 8  PHE P HE2  9  
ATOM 9681  H HZ   . PHE A 1 10 ? 2.707   -4.505  6.750   1.00 0.00 ? 8  PHE P HZ   9  
ATOM 9682  N N    . THR A 1 11 ? -1.398  -10.694 3.044   1.00 0.00 ? 9  THR P N    9  
ATOM 9683  C CA   . THR A 1 11 ? -1.597  -11.678 1.964   1.00 0.00 ? 9  THR P CA   9  
ATOM 9684  C C    . THR A 1 11 ? -0.862  -11.272 0.682   1.00 0.00 ? 9  THR P C    9  
ATOM 9685  O O    . THR A 1 11 ? -0.511  -10.103 0.490   1.00 0.00 ? 9  THR P O    9  
ATOM 9686  C CB   . THR A 1 11 ? -3.085  -11.992 1.741   1.00 0.00 ? 9  THR P CB   9  
ATOM 9687  O OG1  . THR A 1 11 ? -3.194  -13.161 0.960   1.00 0.00 ? 9  THR P OG1  9  
ATOM 9688  C CG2  . THR A 1 11 ? -3.872  -10.880 1.046   1.00 0.00 ? 9  THR P CG2  9  
ATOM 9689  H H    . THR A 1 11 ? -1.697  -9.738  2.872   1.00 0.00 ? 9  THR P H    9  
ATOM 9690  H HA   . THR A 1 11 ? -1.145  -12.620 2.275   1.00 0.00 ? 9  THR P HA   9  
ATOM 9691  H HB   . THR A 1 11 ? -3.545  -12.188 2.711   1.00 0.00 ? 9  THR P HB   9  
ATOM 9692  H HG1  . THR A 1 11 ? -4.137  -13.397 0.910   1.00 0.00 ? 9  THR P HG1  9  
ATOM 9693  H HG21 . THR A 1 11 ? -3.834  -9.978  1.651   1.00 0.00 ? 9  THR P HG21 9  
ATOM 9694  H HG22 . THR A 1 11 ? -4.916  -11.181 0.945   1.00 0.00 ? 9  THR P HG22 9  
ATOM 9695  H HG23 . THR A 1 11 ? -3.464  -10.679 0.056   1.00 0.00 ? 9  THR P HG23 9  
ATOM 9696  N N    . SER A 1 12 ? -0.607  -12.235 -0.207  1.00 0.00 ? 10 SER P N    9  
ATOM 9697  C CA   . SER A 1 12 ? 0.269   -12.073 -1.376  1.00 0.00 ? 10 SER P CA   9  
ATOM 9698  C C    . SER A 1 12 ? -0.173  -10.953 -2.326  1.00 0.00 ? 10 SER P C    9  
ATOM 9699  O O    . SER A 1 12 ? 0.667   -10.220 -2.841  1.00 0.00 ? 10 SER P O    9  
ATOM 9700  C CB   . SER A 1 12 ? 0.365   -13.409 -2.118  1.00 0.00 ? 10 SER P CB   9  
ATOM 9701  O OG   . SER A 1 12 ? 1.335   -13.340 -3.149  1.00 0.00 ? 10 SER P OG   9  
ATOM 9702  H H    . SER A 1 12 ? -1.002  -13.148 -0.022  1.00 0.00 ? 10 SER P H    9  
ATOM 9703  H HA   . SER A 1 12 ? 1.268   -11.821 -1.020  1.00 0.00 ? 10 SER P HA   9  
ATOM 9704  H HB2  . SER A 1 12 ? 0.660   -14.183 -1.407  1.00 0.00 ? 10 SER P HB2  9  
ATOM 9705  H HB3  . SER A 1 12 ? -0.608  -13.666 -2.541  1.00 0.00 ? 10 SER P HB3  9  
ATOM 9706  H HG   . SER A 1 12 ? 1.524   -14.252 -3.447  1.00 0.00 ? 10 SER P HG   9  
ATOM 9707  N N    . GLN A 1 13 ? -1.480  -10.739 -2.508  1.00 0.00 ? 11 GLN P N    9  
ATOM 9708  C CA   . GLN A 1 13 ? -2.010  -9.669  -3.365  1.00 0.00 ? 11 GLN P CA   9  
ATOM 9709  C C    . GLN A 1 13 ? -1.696  -8.264  -2.818  1.00 0.00 ? 11 GLN P C    9  
ATOM 9710  O O    . GLN A 1 13 ? -1.393  -7.358  -3.595  1.00 0.00 ? 11 GLN P O    9  
ATOM 9711  C CB   . GLN A 1 13 ? -3.527  -9.848  -3.562  1.00 0.00 ? 11 GLN P CB   9  
ATOM 9712  C CG   . GLN A 1 13 ? -3.901  -11.074 -4.420  1.00 0.00 ? 11 GLN P CG   9  
ATOM 9713  C CD   . GLN A 1 13 ? -3.856  -12.427 -3.705  1.00 0.00 ? 11 GLN P CD   9  
ATOM 9714  O OE1  . GLN A 1 13 ? -3.673  -12.545 -2.501  1.00 0.00 ? 11 GLN P OE1  9  
ATOM 9715  N NE2  . GLN A 1 13 ? -4.026  -13.517 -4.424  1.00 0.00 ? 11 GLN P NE2  9  
ATOM 9716  H H    . GLN A 1 13 ? -2.138  -11.383 -2.083  1.00 0.00 ? 11 GLN P H    9  
ATOM 9717  H HA   . GLN A 1 13 ? -1.531  -9.739  -4.343  1.00 0.00 ? 11 GLN P HA   9  
ATOM 9718  H HB2  . GLN A 1 13 ? -4.033  -9.893  -2.596  1.00 0.00 ? 11 GLN P HB2  9  
ATOM 9719  H HB3  . GLN A 1 13 ? -3.897  -8.965  -4.085  1.00 0.00 ? 11 GLN P HB3  9  
ATOM 9720  H HG2  . GLN A 1 13 ? -4.918  -10.932 -4.786  1.00 0.00 ? 11 GLN P HG2  9  
ATOM 9721  H HG3  . GLN A 1 13 ? -3.244  -11.108 -5.290  1.00 0.00 ? 11 GLN P HG3  9  
ATOM 9722  H HE21 . GLN A 1 13 ? -4.186  -13.455 -5.419  1.00 0.00 ? 11 GLN P HE21 9  
ATOM 9723  H HE22 . GLN A 1 13 ? -4.006  -14.408 -3.952  1.00 0.00 ? 11 GLN P HE22 9  
ATOM 9724  N N    . GLN A 1 14 ? -1.695  -8.081  -1.491  1.00 0.00 ? 12 GLN P N    9  
ATOM 9725  C CA   . GLN A 1 14 ? -1.300  -6.817  -0.851  1.00 0.00 ? 12 GLN P CA   9  
ATOM 9726  C C    . GLN A 1 14 ? 0.203   -6.569  -1.031  1.00 0.00 ? 12 GLN P C    9  
ATOM 9727  O O    . GLN A 1 14 ? 0.618   -5.479  -1.423  1.00 0.00 ? 12 GLN P O    9  
ATOM 9728  C CB   . GLN A 1 14 ? -1.639  -6.846  0.649   1.00 0.00 ? 12 GLN P CB   9  
ATOM 9729  C CG   . GLN A 1 14 ? -3.137  -7.018  0.949   1.00 0.00 ? 12 GLN P CG   9  
ATOM 9730  C CD   . GLN A 1 14 ? -3.396  -7.224  2.441   1.00 0.00 ? 12 GLN P CD   9  
ATOM 9731  O OE1  . GLN A 1 14 ? -2.730  -8.000  3.115   1.00 0.00 ? 12 GLN P OE1  9  
ATOM 9732  N NE2  . GLN A 1 14 ? -4.377  -6.562  3.013   1.00 0.00 ? 12 GLN P NE2  9  
ATOM 9733  H H    . GLN A 1 14 ? -1.877  -8.881  -0.899  1.00 0.00 ? 12 GLN P H    9  
ATOM 9734  H HA   . GLN A 1 14 ? -1.838  -5.991  -1.317  1.00 0.00 ? 12 GLN P HA   9  
ATOM 9735  H HB2  . GLN A 1 14 ? -1.083  -7.654  1.121   1.00 0.00 ? 12 GLN P HB2  9  
ATOM 9736  H HB3  . GLN A 1 14 ? -1.308  -5.909  1.098   1.00 0.00 ? 12 GLN P HB3  9  
ATOM 9737  H HG2  . GLN A 1 14 ? -3.674  -6.140  0.595   1.00 0.00 ? 12 GLN P HG2  9  
ATOM 9738  H HG3  . GLN A 1 14 ? -3.531  -7.884  0.420   1.00 0.00 ? 12 GLN P HG3  9  
ATOM 9739  H HE21 . GLN A 1 14 ? -4.904  -5.870  2.484   1.00 0.00 ? 12 GLN P HE21 9  
ATOM 9740  H HE22 . GLN A 1 14 ? -4.541  -6.708  3.994   1.00 0.00 ? 12 GLN P HE22 9  
ATOM 9741  N N    . LEU A 1 15 ? 1.017   -7.606  -0.804  1.00 0.00 ? 13 LEU P N    9  
ATOM 9742  C CA   . LEU A 1 15 ? 2.474   -7.553  -0.952  1.00 0.00 ? 13 LEU P CA   9  
ATOM 9743  C C    . LEU A 1 15 ? 2.897   -7.306  -2.411  1.00 0.00 ? 13 LEU P C    9  
ATOM 9744  O O    . LEU A 1 15 ? 3.838   -6.552  -2.656  1.00 0.00 ? 13 LEU P O    9  
ATOM 9745  C CB   . LEU A 1 15 ? 3.077   -8.858  -0.395  1.00 0.00 ? 13 LEU P CB   9  
ATOM 9746  C CG   . LEU A 1 15 ? 2.865   -9.060  1.121   1.00 0.00 ? 13 LEU P CG   9  
ATOM 9747  C CD1  . LEU A 1 15 ? 3.345   -10.452 1.530   1.00 0.00 ? 13 LEU P CD1  9  
ATOM 9748  C CD2  . LEU A 1 15 ? 3.621   -8.028  1.961   1.00 0.00 ? 13 LEU P CD2  9  
ATOM 9749  H H    . LEU A 1 15 ? 0.597   -8.475  -0.493  1.00 0.00 ? 13 LEU P H    9  
ATOM 9750  H HA   . LEU A 1 15 ? 2.857   -6.712  -0.374  1.00 0.00 ? 13 LEU P HA   9  
ATOM 9751  H HB2  . LEU A 1 15 ? 2.634   -9.702  -0.929  1.00 0.00 ? 13 LEU P HB2  9  
ATOM 9752  H HB3  . LEU A 1 15 ? 4.148   -8.864  -0.600  1.00 0.00 ? 13 LEU P HB3  9  
ATOM 9753  H HG   . LEU A 1 15 ? 1.805   -8.988  1.355   1.00 0.00 ? 13 LEU P HG   9  
ATOM 9754  H HD11 . LEU A 1 15 ? 4.409   -10.561 1.318   1.00 0.00 ? 13 LEU P HD11 9  
ATOM 9755  H HD12 . LEU A 1 15 ? 2.788   -11.209 0.979   1.00 0.00 ? 13 LEU P HD12 9  
ATOM 9756  H HD13 . LEU A 1 15 ? 3.173   -10.603 2.596   1.00 0.00 ? 13 LEU P HD13 9  
ATOM 9757  H HD21 . LEU A 1 15 ? 3.228   -7.029  1.776   1.00 0.00 ? 13 LEU P HD21 9  
ATOM 9758  H HD22 . LEU A 1 15 ? 4.683   -8.054  1.718   1.00 0.00 ? 13 LEU P HD22 9  
ATOM 9759  H HD23 . LEU A 1 15 ? 3.493   -8.249  3.021   1.00 0.00 ? 13 LEU P HD23 9  
ATOM 9760  N N    . GLN A 1 16 ? 2.173   -7.866  -3.384  1.00 0.00 ? 14 GLN P N    9  
ATOM 9761  C CA   . GLN A 1 16 ? 2.408   -7.626  -4.812  1.00 0.00 ? 14 GLN P CA   9  
ATOM 9762  C C    . GLN A 1 16 ? 1.974   -6.227  -5.257  1.00 0.00 ? 14 GLN P C    9  
ATOM 9763  O O    . GLN A 1 16 ? 2.687   -5.608  -6.042  1.00 0.00 ? 14 GLN P O    9  
ATOM 9764  C CB   . GLN A 1 16 ? 1.708   -8.699  -5.653  1.00 0.00 ? 14 GLN P CB   9  
ATOM 9765  C CG   . GLN A 1 16 ? 2.487   -10.017 -5.591  1.00 0.00 ? 14 GLN P CG   9  
ATOM 9766  C CD   . GLN A 1 16 ? 1.812   -11.107 -6.421  1.00 0.00 ? 14 GLN P CD   9  
ATOM 9767  O OE1  . GLN A 1 16 ? 1.768   -11.058 -7.644  1.00 0.00 ? 14 GLN P OE1  9  
ATOM 9768  N NE2  . GLN A 1 16 ? 1.246   -12.124 -5.809  1.00 0.00 ? 14 GLN P NE2  9  
ATOM 9769  H H    . GLN A 1 16 ? 1.447   -8.526  -3.125  1.00 0.00 ? 14 GLN P H    9  
ATOM 9770  H HA   . GLN A 1 16 ? 3.480   -7.691  -5.004  1.00 0.00 ? 14 GLN P HA   9  
ATOM 9771  H HB2  . GLN A 1 16 ? 0.686   -8.846  -5.302  1.00 0.00 ? 14 GLN P HB2  9  
ATOM 9772  H HB3  . GLN A 1 16 ? 1.674   -8.369  -6.693  1.00 0.00 ? 14 GLN P HB3  9  
ATOM 9773  H HG2  . GLN A 1 16 ? 3.492   -9.848  -5.976  1.00 0.00 ? 14 GLN P HG2  9  
ATOM 9774  H HG3  . GLN A 1 16 ? 2.578   -10.335 -4.553  1.00 0.00 ? 14 GLN P HG3  9  
ATOM 9775  H HE21 . GLN A 1 16 ? 1.302   -12.218 -4.798  1.00 0.00 ? 14 GLN P HE21 9  
ATOM 9776  H HE22 . GLN A 1 16 ? 0.812   -12.839 -6.370  1.00 0.00 ? 14 GLN P HE22 9  
ATOM 9777  N N    . GLU A 1 17 ? 0.869   -5.684  -4.740  1.00 0.00 ? 15 GLU P N    9  
ATOM 9778  C CA   . GLU A 1 17 ? 0.477   -4.291  -5.014  1.00 0.00 ? 15 GLU P CA   9  
ATOM 9779  C C    . GLU A 1 17 ? 1.505   -3.296  -4.440  1.00 0.00 ? 15 GLU P C    9  
ATOM 9780  O O    . GLU A 1 17 ? 1.819   -2.285  -5.072  1.00 0.00 ? 15 GLU P O    9  
ATOM 9781  C CB   . GLU A 1 17 ? -0.929  -4.042  -4.441  1.00 0.00 ? 15 GLU P CB   9  
ATOM 9782  C CG   . GLU A 1 17 ? -1.570  -2.724  -4.899  1.00 0.00 ? 15 GLU P CG   9  
ATOM 9783  C CD   . GLU A 1 17 ? -1.944  -2.755  -6.394  1.00 0.00 ? 15 GLU P CD   9  
ATOM 9784  O OE1  . GLU A 1 17 ? -3.049  -3.244  -6.736  1.00 0.00 ? 15 GLU P OE1  9  
ATOM 9785  O OE2  . GLU A 1 17 ? -1.142  -2.291  -7.240  1.00 0.00 ? 15 GLU P OE2  9  
ATOM 9786  H H    . GLU A 1 17 ? 0.277   -6.244  -4.136  1.00 0.00 ? 15 GLU P H    9  
ATOM 9787  H HA   . GLU A 1 17 ? 0.445   -4.148  -6.094  1.00 0.00 ? 15 GLU P HA   9  
ATOM 9788  H HB2  . GLU A 1 17 ? -1.587  -4.858  -4.740  1.00 0.00 ? 15 GLU P HB2  9  
ATOM 9789  H HB3  . GLU A 1 17 ? -0.866  -4.043  -3.353  1.00 0.00 ? 15 GLU P HB3  9  
ATOM 9790  H HG2  . GLU A 1 17 ? -2.475  -2.561  -4.308  1.00 0.00 ? 15 GLU P HG2  9  
ATOM 9791  H HG3  . GLU A 1 17 ? -0.897  -1.889  -4.685  1.00 0.00 ? 15 GLU P HG3  9  
ATOM 9792  N N    . LEU A 1 18 ? 2.096   -3.617  -3.280  1.00 0.00 ? 16 LEU P N    9  
ATOM 9793  C CA   . LEU A 1 18 ? 3.153   -2.816  -2.651  1.00 0.00 ? 16 LEU P CA   9  
ATOM 9794  C C    . LEU A 1 18 ? 4.470   -2.893  -3.445  1.00 0.00 ? 16 LEU P C    9  
ATOM 9795  O O    . LEU A 1 18 ? 5.079   -1.866  -3.748  1.00 0.00 ? 16 LEU P O    9  
ATOM 9796  C CB   . LEU A 1 18 ? 3.330   -3.270  -1.190  1.00 0.00 ? 16 LEU P CB   9  
ATOM 9797  C CG   . LEU A 1 18 ? 2.218   -2.773  -0.245  1.00 0.00 ? 16 LEU P CG   9  
ATOM 9798  C CD1  . LEU A 1 18 ? 2.224   -3.569  1.060   1.00 0.00 ? 16 LEU P CD1  9  
ATOM 9799  C CD2  . LEU A 1 18 ? 2.407   -1.297  0.113   1.00 0.00 ? 16 LEU P CD2  9  
ATOM 9800  H H    . LEU A 1 18 ? 1.815   -4.487  -2.835  1.00 0.00 ? 16 LEU P H    9  
ATOM 9801  H HA   . LEU A 1 18 ? 2.848   -1.771  -2.652  1.00 0.00 ? 16 LEU P HA   9  
ATOM 9802  H HB2  . LEU A 1 18 ? 3.373   -4.358  -1.161  1.00 0.00 ? 16 LEU P HB2  9  
ATOM 9803  H HB3  . LEU A 1 18 ? 4.281   -2.895  -0.819  1.00 0.00 ? 16 LEU P HB3  9  
ATOM 9804  H HG   . LEU A 1 18 ? 1.244   -2.898  -0.719  1.00 0.00 ? 16 LEU P HG   9  
ATOM 9805  H HD11 . LEU A 1 18 ? 1.441   -3.200  1.721   1.00 0.00 ? 16 LEU P HD11 9  
ATOM 9806  H HD12 . LEU A 1 18 ? 3.188   -3.465  1.554   1.00 0.00 ? 16 LEU P HD12 9  
ATOM 9807  H HD13 . LEU A 1 18 ? 2.039   -4.621  0.850   1.00 0.00 ? 16 LEU P HD13 9  
ATOM 9808  H HD21 . LEU A 1 18 ? 3.351   -1.155  0.639   1.00 0.00 ? 16 LEU P HD21 9  
ATOM 9809  H HD22 . LEU A 1 18 ? 1.587   -0.972  0.753   1.00 0.00 ? 16 LEU P HD22 9  
ATOM 9810  H HD23 . LEU A 1 18 ? 2.409   -0.688  -0.788  1.00 0.00 ? 16 LEU P HD23 9  
ATOM 9811  N N    . GLU A 1 19 ? 4.875   -4.094  -3.866  1.00 0.00 ? 17 GLU P N    9  
ATOM 9812  C CA   . GLU A 1 19 ? 6.055   -4.309  -4.713  1.00 0.00 ? 17 GLU P CA   9  
ATOM 9813  C C    . GLU A 1 19 ? 5.899   -3.694  -6.118  1.00 0.00 ? 17 GLU P C    9  
ATOM 9814  O O    . GLU A 1 19 ? 6.874   -3.189  -6.680  1.00 0.00 ? 17 GLU P O    9  
ATOM 9815  C CB   . GLU A 1 19 ? 6.339   -5.820  -4.774  1.00 0.00 ? 17 GLU P CB   9  
ATOM 9816  C CG   . GLU A 1 19 ? 7.668   -6.154  -5.459  1.00 0.00 ? 17 GLU P CG   9  
ATOM 9817  C CD   . GLU A 1 19 ? 7.952   -7.668  -5.403  1.00 0.00 ? 17 GLU P CD   9  
ATOM 9818  O OE1  . GLU A 1 19 ? 7.493   -8.408  -6.307  1.00 0.00 ? 17 GLU P OE1  9  
ATOM 9819  O OE2  . GLU A 1 19 ? 8.649   -8.126  -4.466  1.00 0.00 ? 17 GLU P OE2  9  
ATOM 9820  H H    . GLU A 1 19 ? 4.359   -4.908  -3.549  1.00 0.00 ? 17 GLU P H    9  
ATOM 9821  H HA   . GLU A 1 19 ? 6.911   -3.823  -4.243  1.00 0.00 ? 17 GLU P HA   9  
ATOM 9822  H HB2  . GLU A 1 19 ? 6.380   -6.207  -3.754  1.00 0.00 ? 17 GLU P HB2  9  
ATOM 9823  H HB3  . GLU A 1 19 ? 5.526   -6.321  -5.301  1.00 0.00 ? 17 GLU P HB3  9  
ATOM 9824  H HG2  . GLU A 1 19 ? 7.628   -5.829  -6.500  1.00 0.00 ? 17 GLU P HG2  9  
ATOM 9825  H HG3  . GLU A 1 19 ? 8.473   -5.602  -4.967  1.00 0.00 ? 17 GLU P HG3  9  
ATOM 9826  N N    . ALA A 1 20 ? 4.684   -3.684  -6.679  1.00 0.00 ? 18 ALA P N    9  
ATOM 9827  C CA   . ALA A 1 20 ? 4.374   -3.073  -7.971  1.00 0.00 ? 18 ALA P CA   9  
ATOM 9828  C C    . ALA A 1 20 ? 4.353   -1.536  -7.913  1.00 0.00 ? 18 ALA P C    9  
ATOM 9829  O O    . ALA A 1 20 ? 4.964   -0.887  -8.764  1.00 0.00 ? 18 ALA P O    9  
ATOM 9830  C CB   . ALA A 1 20 ? 3.042   -3.632  -8.486  1.00 0.00 ? 18 ALA P CB   9  
ATOM 9831  H H    . ALA A 1 20 ? 3.936   -4.181  -6.205  1.00 0.00 ? 18 ALA P H    9  
ATOM 9832  H HA   . ALA A 1 20 ? 5.146   -3.363  -8.685  1.00 0.00 ? 18 ALA P HA   9  
ATOM 9833  H HB1  . ALA A 1 20 ? 2.816   -3.200  -9.462  1.00 0.00 ? 18 ALA P HB1  9  
ATOM 9834  H HB2  . ALA A 1 20 ? 3.110   -4.715  -8.591  1.00 0.00 ? 18 ALA P HB2  9  
ATOM 9835  H HB3  . ALA A 1 20 ? 2.236   -3.387  -7.793  1.00 0.00 ? 18 ALA P HB3  9  
ATOM 9836  N N    . THR A 1 21 ? 3.715   -0.929  -6.902  1.00 0.00 ? 19 THR P N    9  
ATOM 9837  C CA   . THR A 1 21 ? 3.682   0.541   -6.785  1.00 0.00 ? 19 THR P CA   9  
ATOM 9838  C C    . THR A 1 21 ? 5.070   1.116   -6.482  1.00 0.00 ? 19 THR P C    9  
ATOM 9839  O O    . THR A 1 21 ? 5.430   2.154   -7.036  1.00 0.00 ? 19 THR P O    9  
ATOM 9840  C CB   . THR A 1 21 ? 2.606   1.026   -5.795  1.00 0.00 ? 19 THR P CB   9  
ATOM 9841  O OG1  . THR A 1 21 ? 2.288   2.378   -6.052  1.00 0.00 ? 19 THR P OG1  9  
ATOM 9842  C CG2  . THR A 1 21 ? 2.981   0.920   -4.319  1.00 0.00 ? 19 THR P CG2  9  
ATOM 9843  H H    . THR A 1 21 ? 3.198   -1.492  -6.232  1.00 0.00 ? 19 THR P H    9  
ATOM 9844  H HA   . THR A 1 21 ? 3.390   0.934   -7.759  1.00 0.00 ? 19 THR P HA   9  
ATOM 9845  H HB   . THR A 1 21 ? 1.703   0.437   -5.955  1.00 0.00 ? 19 THR P HB   9  
ATOM 9846  H HG1  . THR A 1 21 ? 3.061   2.921   -5.830  1.00 0.00 ? 19 THR P HG1  9  
ATOM 9847  H HG21 . THR A 1 21 ? 3.253   -0.105  -4.091  1.00 0.00 ? 19 THR P HG21 9  
ATOM 9848  H HG22 . THR A 1 21 ? 2.121   1.193   -3.709  1.00 0.00 ? 19 THR P HG22 9  
ATOM 9849  H HG23 . THR A 1 21 ? 3.815   1.580   -4.088  1.00 0.00 ? 19 THR P HG23 9  
ATOM 9850  N N    . PHE A 1 22 ? 5.901   0.406   -5.706  1.00 0.00 ? 20 PHE P N    9  
ATOM 9851  C CA   . PHE A 1 22 ? 7.284   0.805   -5.420  1.00 0.00 ? 20 PHE P CA   9  
ATOM 9852  C C    . PHE A 1 22 ? 8.157   0.919   -6.685  1.00 0.00 ? 20 PHE P C    9  
ATOM 9853  O O    . PHE A 1 22 ? 8.997   1.815   -6.763  1.00 0.00 ? 20 PHE P O    9  
ATOM 9854  C CB   . PHE A 1 22 ? 7.895   -0.197  -4.428  1.00 0.00 ? 20 PHE P CB   9  
ATOM 9855  C CG   . PHE A 1 22 ? 9.341   0.098   -4.070  1.00 0.00 ? 20 PHE P CG   9  
ATOM 9856  C CD1  . PHE A 1 22 ? 9.654   1.204   -3.256  1.00 0.00 ? 20 PHE P CD1  9  
ATOM 9857  C CD2  . PHE A 1 22 ? 10.378  -0.706  -4.581  1.00 0.00 ? 20 PHE P CD2  9  
ATOM 9858  C CE1  . PHE A 1 22 ? 10.994  1.505   -2.956  1.00 0.00 ? 20 PHE P CE1  9  
ATOM 9859  C CE2  . PHE A 1 22 ? 11.719  -0.405  -4.280  1.00 0.00 ? 20 PHE P CE2  9  
ATOM 9860  C CZ   . PHE A 1 22 ? 12.029  0.704   -3.472  1.00 0.00 ? 20 PHE P CZ   9  
ATOM 9861  H H    . PHE A 1 22 ? 5.548   -0.434  -5.260  1.00 0.00 ? 20 PHE P H    9  
ATOM 9862  H HA   . PHE A 1 22 ? 7.269   1.790   -4.949  1.00 0.00 ? 20 PHE P HA   9  
ATOM 9863  H HB2  . PHE A 1 22 ? 7.305   -0.193  -3.511  1.00 0.00 ? 20 PHE P HB2  9  
ATOM 9864  H HB3  . PHE A 1 22 ? 7.831   -1.200  -4.852  1.00 0.00 ? 20 PHE P HB3  9  
ATOM 9865  H HD1  . PHE A 1 22 ? 8.867   1.833   -2.866  1.00 0.00 ? 20 PHE P HD1  9  
ATOM 9866  H HD2  . PHE A 1 22 ? 10.149  -1.553  -5.214  1.00 0.00 ? 20 PHE P HD2  9  
ATOM 9867  H HE1  . PHE A 1 22 ? 11.228  2.354   -2.331  1.00 0.00 ? 20 PHE P HE1  9  
ATOM 9868  H HE2  . PHE A 1 22 ? 12.515  -1.021  -4.678  1.00 0.00 ? 20 PHE P HE2  9  
ATOM 9869  H HZ   . PHE A 1 22 ? 13.060  0.940   -3.248  1.00 0.00 ? 20 PHE P HZ   9  
ATOM 9870  N N    . GLN A 1 23 ? 7.941   0.057   -7.689  1.00 0.00 ? 21 GLN P N    9  
ATOM 9871  C CA   . GLN A 1 23 ? 8.733   0.019   -8.932  1.00 0.00 ? 21 GLN P CA   9  
ATOM 9872  C C    . GLN A 1 23 ? 8.112   0.771   -10.129 1.00 0.00 ? 21 GLN P C    9  
ATOM 9873  O O    . GLN A 1 23 ? 8.738   0.837   -11.192 1.00 0.00 ? 21 GLN P O    9  
ATOM 9874  C CB   . GLN A 1 23 ? 9.116   -1.434  -9.264  1.00 0.00 ? 21 GLN P CB   9  
ATOM 9875  C CG   . GLN A 1 23 ? 7.939   -2.287  -9.755  1.00 0.00 ? 21 GLN P CG   9  
ATOM 9876  C CD   . GLN A 1 23 ? 8.338   -3.748  -9.928  1.00 0.00 ? 21 GLN P CD   9  
ATOM 9877  O OE1  . GLN A 1 23 ? 8.772   -4.185  -10.986 1.00 0.00 ? 21 GLN P OE1  9  
ATOM 9878  N NE2  . GLN A 1 23 ? 8.217   -4.546  -8.890  1.00 0.00 ? 21 GLN P NE2  9  
ATOM 9879  H H    . GLN A 1 23 ? 7.242   -0.660  -7.549  1.00 0.00 ? 21 GLN P H    9  
ATOM 9880  H HA   . GLN A 1 23 ? 9.678   0.527   -8.733  1.00 0.00 ? 21 GLN P HA   9  
ATOM 9881  H HB2  . GLN A 1 23 ? 9.887   -1.429  -10.036 1.00 0.00 ? 21 GLN P HB2  9  
ATOM 9882  H HB3  . GLN A 1 23 ? 9.543   -1.894  -8.371  1.00 0.00 ? 21 GLN P HB3  9  
ATOM 9883  H HG2  . GLN A 1 23 ? 7.128   -2.230  -9.037  1.00 0.00 ? 21 GLN P HG2  9  
ATOM 9884  H HG3  . GLN A 1 23 ? 7.571   -1.909  -10.705 1.00 0.00 ? 21 GLN P HG3  9  
ATOM 9885  H HE21 . GLN A 1 23 ? 7.849   -4.174  -8.019  1.00 0.00 ? 21 GLN P HE21 9  
ATOM 9886  H HE22 . GLN A 1 23 ? 8.481   -5.514  -8.988  1.00 0.00 ? 21 GLN P HE22 9  
ATOM 9887  N N    . ARG A 1 24 ? 6.912   1.353   -9.984  1.00 0.00 ? 22 ARG P N    9  
ATOM 9888  C CA   . ARG A 1 24 ? 6.217   2.134   -11.039 1.00 0.00 ? 22 ARG P CA   9  
ATOM 9889  C C    . ARG A 1 24 ? 5.868   3.574   -10.639 1.00 0.00 ? 22 ARG P C    9  
ATOM 9890  O O    . ARG A 1 24 ? 5.766   4.436   -11.511 1.00 0.00 ? 22 ARG P O    9  
ATOM 9891  C CB   . ARG A 1 24 ? 4.965   1.368   -11.515 1.00 0.00 ? 22 ARG P CB   9  
ATOM 9892  C CG   . ARG A 1 24 ? 5.260   -0.010  -12.135 1.00 0.00 ? 22 ARG P CG   9  
ATOM 9893  C CD   . ARG A 1 24 ? 6.113   0.067   -13.411 1.00 0.00 ? 22 ARG P CD   9  
ATOM 9894  N NE   . ARG A 1 24 ? 6.475   -1.279  -13.898 1.00 0.00 ? 22 ARG P NE   9  
ATOM 9895  C CZ   . ARG A 1 24 ? 7.632   -1.904  -13.747 1.00 0.00 ? 22 ARG P CZ   9  
ATOM 9896  N NH1  . ARG A 1 24 ? 8.644   -1.381  -13.112 1.00 0.00 ? 22 ARG P NH1  9  
ATOM 9897  N NH2  . ARG A 1 24 ? 7.795   -3.099  -14.237 1.00 0.00 ? 22 ARG P NH2  9  
ATOM 9898  H H    . ARG A 1 24 ? 6.424   1.183   -9.112  1.00 0.00 ? 22 ARG P H    9  
ATOM 9899  H HA   . ARG A 1 24 ? 6.884   2.260   -11.892 1.00 0.00 ? 22 ARG P HA   9  
ATOM 9900  H HB2  . ARG A 1 24 ? 4.292   1.229   -10.668 1.00 0.00 ? 22 ARG P HB2  9  
ATOM 9901  H HB3  . ARG A 1 24 ? 4.441   1.971   -12.259 1.00 0.00 ? 22 ARG P HB3  9  
ATOM 9902  H HG2  . ARG A 1 24 ? 5.762   -0.637  -11.401 1.00 0.00 ? 22 ARG P HG2  9  
ATOM 9903  H HG3  . ARG A 1 24 ? 4.311   -0.488  -12.382 1.00 0.00 ? 22 ARG P HG3  9  
ATOM 9904  H HD2  . ARG A 1 24 ? 5.541   0.585   -14.183 1.00 0.00 ? 22 ARG P HD2  9  
ATOM 9905  H HD3  . ARG A 1 24 ? 7.016   0.648   -13.227 1.00 0.00 ? 22 ARG P HD3  9  
ATOM 9906  H HE   . ARG A 1 24 ? 5.766   -1.777  -14.413 1.00 0.00 ? 22 ARG P HE   9  
ATOM 9907  H HH11 . ARG A 1 24 ? 8.551   -0.474  -12.673 1.00 0.00 ? 22 ARG P HH11 9  
ATOM 9908  H HH12 . ARG A 1 24 ? 9.501   -1.899  -13.018 1.00 0.00 ? 22 ARG P HH12 9  
ATOM 9909  H HH21 . ARG A 1 24 ? 7.047   -3.551  -14.736 1.00 0.00 ? 22 ARG P HH21 9  
ATOM 9910  H HH22 . ARG A 1 24 ? 8.657   -3.594  -14.084 1.00 0.00 ? 22 ARG P HH22 9  
ATOM 9911  N N    . ASN A 1 25 ? 5.758   3.855   -9.341  1.00 0.00 ? 23 ASN P N    9  
ATOM 9912  C CA   . ASN A 1 25 ? 5.639   5.192   -8.756  1.00 0.00 ? 23 ASN P CA   9  
ATOM 9913  C C    . ASN A 1 25 ? 6.726   5.335   -7.669  1.00 0.00 ? 23 ASN P C    9  
ATOM 9914  O O    . ASN A 1 25 ? 6.432   5.317   -6.471  1.00 0.00 ? 23 ASN P O    9  
ATOM 9915  C CB   . ASN A 1 25 ? 4.190   5.384   -8.260  1.00 0.00 ? 23 ASN P CB   9  
ATOM 9916  C CG   . ASN A 1 25 ? 3.883   6.826   -7.888  1.00 0.00 ? 23 ASN P CG   9  
ATOM 9917  O OD1  . ASN A 1 25 ? 3.171   7.537   -8.584  1.00 0.00 ? 23 ASN P OD1  9  
ATOM 9918  N ND2  . ASN A 1 25 ? 4.423   7.315   -6.796  1.00 0.00 ? 23 ASN P ND2  9  
ATOM 9919  H H    . ASN A 1 25 ? 5.798   3.082   -8.688  1.00 0.00 ? 23 ASN P H    9  
ATOM 9920  H HA   . ASN A 1 25 ? 5.839   5.948   -9.519  1.00 0.00 ? 23 ASN P HA   9  
ATOM 9921  H HB2  . ASN A 1 25 ? 3.501   5.091   -9.053  1.00 0.00 ? 23 ASN P HB2  9  
ATOM 9922  H HB3  . ASN A 1 25 ? 4.003   4.744   -7.399  1.00 0.00 ? 23 ASN P HB3  9  
ATOM 9923  H HD21 . ASN A 1 25 ? 5.060   6.731   -6.265  1.00 0.00 ? 23 ASN P HD21 9  
ATOM 9924  H HD22 . ASN A 1 25 ? 4.256   8.283   -6.568  1.00 0.00 ? 23 ASN P HD22 9  
ATOM 9925  N N    . ARG A 1 26 ? 7.994   5.410   -8.105  1.00 0.00 ? 24 ARG P N    9  
ATOM 9926  C CA   . ARG A 1 26 ? 9.201   5.319   -7.260  1.00 0.00 ? 24 ARG P CA   9  
ATOM 9927  C C    . ARG A 1 26 ? 9.124   6.232   -6.030  1.00 0.00 ? 24 ARG P C    9  
ATOM 9928  O O    . ARG A 1 26 ? 8.903   7.436   -6.169  1.00 0.00 ? 24 ARG P O    9  
ATOM 9929  C CB   . ARG A 1 26 ? 10.465  5.650   -8.084  1.00 0.00 ? 24 ARG P CB   9  
ATOM 9930  C CG   . ARG A 1 26 ? 10.662  4.854   -9.388  1.00 0.00 ? 24 ARG P CG   9  
ATOM 9931  C CD   . ARG A 1 26 ? 10.665  3.335   -9.177  1.00 0.00 ? 24 ARG P CD   9  
ATOM 9932  N NE   . ARG A 1 26 ? 10.941  2.604   -10.430 1.00 0.00 ? 24 ARG P NE   9  
ATOM 9933  C CZ   . ARG A 1 26 ? 12.118  2.311   -10.955 1.00 0.00 ? 24 ARG P CZ   9  
ATOM 9934  N NH1  . ARG A 1 26 ? 13.241  2.682   -10.408 1.00 0.00 ? 24 ARG P NH1  9  
ATOM 9935  N NH2  . ARG A 1 26 ? 12.182  1.627   -12.059 1.00 0.00 ? 24 ARG P NH2  9  
ATOM 9936  H H    . ARG A 1 26 ? 8.137   5.477   -9.101  1.00 0.00 ? 24 ARG P H    9  
ATOM 9937  H HA   . ARG A 1 26 ? 9.287   4.295   -6.897  1.00 0.00 ? 24 ARG P HA   9  
ATOM 9938  H HB2  . ARG A 1 26 ? 10.449  6.710   -8.344  1.00 0.00 ? 24 ARG P HB2  9  
ATOM 9939  H HB3  . ARG A 1 26 ? 11.339  5.482   -7.453  1.00 0.00 ? 24 ARG P HB3  9  
ATOM 9940  H HG2  . ARG A 1 26 ? 9.875   5.112   -10.098 1.00 0.00 ? 24 ARG P HG2  9  
ATOM 9941  H HG3  . ARG A 1 26 ? 11.614  5.153   -9.829  1.00 0.00 ? 24 ARG P HG3  9  
ATOM 9942  H HD2  . ARG A 1 26 ? 11.396  3.070   -8.411  1.00 0.00 ? 24 ARG P HD2  9  
ATOM 9943  H HD3  . ARG A 1 26 ? 9.680   3.040   -8.818  1.00 0.00 ? 24 ARG P HD3  9  
ATOM 9944  H HE   . ARG A 1 26 ? 10.140  2.242   -10.933 1.00 0.00 ? 24 ARG P HE   9  
ATOM 9945  H HH11 . ARG A 1 26 ? 13.221  3.211   -9.554  1.00 0.00 ? 24 ARG P HH11 9  
ATOM 9946  H HH12 . ARG A 1 26 ? 14.121  2.444   -10.833 1.00 0.00 ? 24 ARG P HH12 9  
ATOM 9947  H HH21 . ARG A 1 26 ? 11.335  1.324   -12.513 1.00 0.00 ? 24 ARG P HH21 9  
ATOM 9948  H HH22 . ARG A 1 26 ? 13.073  1.402   -12.468 1.00 0.00 ? 24 ARG P HH22 9  
ATOM 9949  N N    . TYR A 1 27 ? 9.337   5.648   -4.848  1.00 0.00 ? 25 TYR P N    9  
ATOM 9950  C CA   . TYR A 1 27 ? 9.353   6.326   -3.540  1.00 0.00 ? 25 TYR P CA   9  
ATOM 9951  C C    . TYR A 1 27 ? 8.125   7.249   -3.326  1.00 0.00 ? 25 TYR P C    9  
ATOM 9952  O O    . TYR A 1 27 ? 8.266   8.478   -3.306  1.00 0.00 ? 25 TYR P O    9  
ATOM 9953  C CB   . TYR A 1 27 ? 10.716  7.014   -3.348  1.00 0.00 ? 25 TYR P CB   9  
ATOM 9954  C CG   . TYR A 1 27 ? 11.894  6.089   -3.605  1.00 0.00 ? 25 TYR P CG   9  
ATOM 9955  C CD1  . TYR A 1 27 ? 12.242  5.112   -2.651  1.00 0.00 ? 25 TYR P CD1  9  
ATOM 9956  C CD2  . TYR A 1 27 ? 12.592  6.161   -4.827  1.00 0.00 ? 25 TYR P CD2  9  
ATOM 9957  C CE1  . TYR A 1 27 ? 13.294  4.214   -2.917  1.00 0.00 ? 25 TYR P CE1  9  
ATOM 9958  C CE2  . TYR A 1 27 ? 13.653  5.271   -5.089  1.00 0.00 ? 25 TYR P CE2  9  
ATOM 9959  C CZ   . TYR A 1 27 ? 14.008  4.294   -4.131  1.00 0.00 ? 25 TYR P CZ   9  
ATOM 9960  O OH   . TYR A 1 27 ? 15.030  3.429   -4.372  1.00 0.00 ? 25 TYR P OH   9  
ATOM 9961  H H    . TYR A 1 27 ? 9.535   4.658   -4.855  1.00 0.00 ? 25 TYR P H    9  
ATOM 9962  H HA   . TYR A 1 27 ? 9.301   5.553   -2.774  1.00 0.00 ? 25 TYR P HA   9  
ATOM 9963  H HB2  . TYR A 1 27 ? 10.787  7.872   -4.020  1.00 0.00 ? 25 TYR P HB2  9  
ATOM 9964  H HB3  . TYR A 1 27 ? 10.780  7.391   -2.326  1.00 0.00 ? 25 TYR P HB3  9  
ATOM 9965  H HD1  . TYR A 1 27 ? 11.691  5.041   -1.722  1.00 0.00 ? 25 TYR P HD1  9  
ATOM 9966  H HD2  . TYR A 1 27 ? 12.301  6.889   -5.575  1.00 0.00 ? 25 TYR P HD2  9  
ATOM 9967  H HE1  . TYR A 1 27 ? 13.565  3.457   -2.195  1.00 0.00 ? 25 TYR P HE1  9  
ATOM 9968  H HE2  . TYR A 1 27 ? 14.190  5.329   -6.025  1.00 0.00 ? 25 TYR P HE2  9  
ATOM 9969  H HH   . TYR A 1 27 ? 15.444  3.578   -5.237  1.00 0.00 ? 25 TYR P HH   9  
ATOM 9970  N N    . PRO A 1 28 ? 6.907   6.677   -3.207  1.00 0.00 ? 26 PRO P N    9  
ATOM 9971  C CA   . PRO A 1 28 ? 5.645   7.422   -3.223  1.00 0.00 ? 26 PRO P CA   9  
ATOM 9972  C C    . PRO A 1 28 ? 5.507   8.440   -2.083  1.00 0.00 ? 26 PRO P C    9  
ATOM 9973  O O    . PRO A 1 28 ? 5.997   8.228   -0.973  1.00 0.00 ? 26 PRO P O    9  
ATOM 9974  C CB   . PRO A 1 28 ? 4.534   6.364   -3.169  1.00 0.00 ? 26 PRO P CB   9  
ATOM 9975  C CG   . PRO A 1 28 ? 5.209   5.154   -2.529  1.00 0.00 ? 26 PRO P CG   9  
ATOM 9976  C CD   . PRO A 1 28 ? 6.645   5.252   -3.032  1.00 0.00 ? 26 PRO P CD   9  
ATOM 9977  H HA   . PRO A 1 28 ? 5.553   7.962   -4.163  1.00 0.00 ? 26 PRO P HA   9  
ATOM 9978  H HB2  . PRO A 1 28 ? 3.675   6.689   -2.584  1.00 0.00 ? 26 PRO P HB2  9  
ATOM 9979  H HB3  . PRO A 1 28 ? 4.224   6.105   -4.183  1.00 0.00 ? 26 PRO P HB3  9  
ATOM 9980  H HG2  . PRO A 1 28 ? 5.198   5.254   -1.444  1.00 0.00 ? 26 PRO P HG2  9  
ATOM 9981  H HG3  . PRO A 1 28 ? 4.736   4.222   -2.839  1.00 0.00 ? 26 PRO P HG3  9  
ATOM 9982  H HD2  . PRO A 1 28 ? 7.317   4.804   -2.300  1.00 0.00 ? 26 PRO P HD2  9  
ATOM 9983  H HD3  . PRO A 1 28 ? 6.736   4.738   -3.988  1.00 0.00 ? 26 PRO P HD3  9  
ATOM 9984  N N    . ASP A 1 29 ? 4.783   9.529   -2.349  1.00 0.00 ? 27 ASP P N    9  
ATOM 9985  C CA   . ASP A 1 29 ? 4.351   10.496  -1.335  1.00 0.00 ? 27 ASP P CA   9  
ATOM 9986  C C    . ASP A 1 29 ? 3.328   9.860   -0.378  1.00 0.00 ? 27 ASP P C    9  
ATOM 9987  O O    . ASP A 1 29 ? 2.574   8.966   -0.763  1.00 0.00 ? 27 ASP P O    9  
ATOM 9988  C CB   . ASP A 1 29 ? 3.755   11.731  -2.033  1.00 0.00 ? 27 ASP P CB   9  
ATOM 9989  C CG   . ASP A 1 29 ? 3.328   12.810  -1.026  1.00 0.00 ? 27 ASP P CG   9  
ATOM 9990  O OD1  . ASP A 1 29 ? 4.196   13.600  -0.587  1.00 0.00 ? 27 ASP P OD1  9  
ATOM 9991  O OD2  . ASP A 1 29 ? 2.134   12.838  -0.643  1.00 0.00 ? 27 ASP P OD2  9  
ATOM 9992  H H    . ASP A 1 29 ? 4.416   9.647   -3.280  1.00 0.00 ? 27 ASP P H    9  
ATOM 9993  H HA   . ASP A 1 29 ? 5.218   10.812  -0.753  1.00 0.00 ? 27 ASP P HA   9  
ATOM 9994  H HB2  . ASP A 1 29 ? 4.499   12.148  -2.715  1.00 0.00 ? 27 ASP P HB2  9  
ATOM 9995  H HB3  . ASP A 1 29 ? 2.891   11.424  -2.627  1.00 0.00 ? 27 ASP P HB3  9  
ATOM 9996  N N    . MET A 1 30 ? 3.266   10.338  0.864   1.00 0.00 ? 28 MET P N    9  
ATOM 9997  C CA   . MET A 1 30 ? 2.359   9.846   1.908   1.00 0.00 ? 28 MET P CA   9  
ATOM 9998  C C    . MET A 1 30 ? 0.874   9.888   1.495   1.00 0.00 ? 28 MET P C    9  
ATOM 9999  O O    . MET A 1 30 ? 0.098   9.032   1.924   1.00 0.00 ? 28 MET P O    9  
ATOM 10000 C CB   . MET A 1 30 ? 2.592   10.657  3.194   1.00 0.00 ? 28 MET P CB   9  
ATOM 10001 C CG   . MET A 1 30 ? 3.904   10.299  3.917   1.00 0.00 ? 28 MET P CG   9  
ATOM 10002 S SD   . MET A 1 30 ? 5.481   10.534  3.036   1.00 0.00 ? 28 MET P SD   9  
ATOM 10003 C CE   . MET A 1 30 ? 5.468   12.328  2.760   1.00 0.00 ? 28 MET P CE   9  
ATOM 10004 H H    . MET A 1 30 ? 3.921   11.061  1.126   1.00 0.00 ? 28 MET P H    9  
ATOM 10005 H HA   . MET A 1 30 ? 2.603   8.805   2.112   1.00 0.00 ? 28 MET P HA   9  
ATOM 10006 H HB2  . MET A 1 30 ? 2.570   11.724  2.969   1.00 0.00 ? 28 MET P HB2  9  
ATOM 10007 H HB3  . MET A 1 30 ? 1.773   10.450  3.886   1.00 0.00 ? 28 MET P HB3  9  
ATOM 10008 H HG2  . MET A 1 30 ? 3.947   10.884  4.835   1.00 0.00 ? 28 MET P HG2  9  
ATOM 10009 H HG3  . MET A 1 30 ? 3.848   9.248   4.200   1.00 0.00 ? 28 MET P HG3  9  
ATOM 10010 H HE1  . MET A 1 30 ? 5.403   12.849  3.715   1.00 0.00 ? 28 MET P HE1  9  
ATOM 10011 H HE2  . MET A 1 30 ? 6.388   12.623  2.253   1.00 0.00 ? 28 MET P HE2  9  
ATOM 10012 H HE3  . MET A 1 30 ? 4.620   12.607  2.136   1.00 0.00 ? 28 MET P HE3  9  
ATOM 10013 N N    . SER A 1 31 ? 0.481   10.813  0.612   1.00 0.00 ? 29 SER P N    9  
ATOM 10014 C CA   . SER A 1 31 ? -0.865  10.862  0.014   1.00 0.00 ? 29 SER P CA   9  
ATOM 10015 C C    . SER A 1 31 ? -1.135  9.632   -0.866  1.00 0.00 ? 29 SER P C    9  
ATOM 10016 O O    . SER A 1 31 ? -2.184  8.996   -0.756  1.00 0.00 ? 29 SER P O    9  
ATOM 10017 C CB   . SER A 1 31 ? -1.043  12.129  -0.841  1.00 0.00 ? 29 SER P CB   9  
ATOM 10018 O OG   . SER A 1 31 ? -0.567  13.291  -0.182  1.00 0.00 ? 29 SER P OG   9  
ATOM 10019 H H    . SER A 1 31 ? 1.167   11.492  0.295   1.00 0.00 ? 29 SER P H    9  
ATOM 10020 H HA   . SER A 1 31 ? -1.608  10.881  0.812   1.00 0.00 ? 29 SER P HA   9  
ATOM 10021 H HB2  . SER A 1 31 ? -0.497  12.015  -1.780  1.00 0.00 ? 29 SER P HB2  9  
ATOM 10022 H HB3  . SER A 1 31 ? -2.101  12.251  -1.074  1.00 0.00 ? 29 SER P HB3  9  
ATOM 10023 H HG   . SER A 1 31 ? 0.411   13.285  -0.283  1.00 0.00 ? 29 SER P HG   9  
ATOM 10024 N N    . THR A 1 32 ? -0.158  9.245   -1.692  1.00 0.00 ? 30 THR P N    9  
ATOM 10025 C CA   . THR A 1 32 ? -0.207  8.045   -2.541  1.00 0.00 ? 30 THR P CA   9  
ATOM 10026 C C    . THR A 1 32 ? -0.138  6.772   -1.694  1.00 0.00 ? 30 THR P C    9  
ATOM 10027 O O    . THR A 1 32 ? -0.907  5.843   -1.939  1.00 0.00 ? 30 THR P O    9  
ATOM 10028 C CB   . THR A 1 32 ? 0.932   8.064   -3.577  1.00 0.00 ? 30 THR P CB   9  
ATOM 10029 O OG1  . THR A 1 32 ? 0.895   9.275   -4.304  1.00 0.00 ? 30 THR P OG1  9  
ATOM 10030 C CG2  . THR A 1 32 ? 0.833   6.922   -4.591  1.00 0.00 ? 30 THR P CG2  9  
ATOM 10031 H H    . THR A 1 32 ? 0.698   9.784   -1.704  1.00 0.00 ? 30 THR P H    9  
ATOM 10032 H HA   . THR A 1 32 ? -1.153  8.035   -3.081  1.00 0.00 ? 30 THR P HA   9  
ATOM 10033 H HB   . THR A 1 32 ? 1.888   7.996   -3.064  1.00 0.00 ? 30 THR P HB   9  
ATOM 10034 H HG1  . THR A 1 32 ? 1.618   9.258   -4.955  1.00 0.00 ? 30 THR P HG1  9  
ATOM 10035 H HG21 . THR A 1 32 ? 0.953   5.962   -4.089  1.00 0.00 ? 30 THR P HG21 9  
ATOM 10036 H HG22 . THR A 1 32 ? 1.624   7.017   -5.335  1.00 0.00 ? 30 THR P HG22 9  
ATOM 10037 H HG23 . THR A 1 32 ? -0.137  6.947   -5.089  1.00 0.00 ? 30 THR P HG23 9  
ATOM 10038 N N    . ARG A 1 33 ? 0.710   6.741   -0.651  1.00 0.00 ? 31 ARG P N    9  
ATOM 10039 C CA   . ARG A 1 33 ? 0.765   5.629   0.324   1.00 0.00 ? 31 ARG P CA   9  
ATOM 10040 C C    . ARG A 1 33 ? -0.589  5.388   1.000   1.00 0.00 ? 31 ARG P C    9  
ATOM 10041 O O    . ARG A 1 33 ? -0.989  4.239   1.162   1.00 0.00 ? 31 ARG P O    9  
ATOM 10042 C CB   . ARG A 1 33 ? 1.841   5.864   1.401   1.00 0.00 ? 31 ARG P CB   9  
ATOM 10043 C CG   . ARG A 1 33 ? 3.260   5.953   0.827   1.00 0.00 ? 31 ARG P CG   9  
ATOM 10044 C CD   . ARG A 1 33 ? 4.304   6.166   1.930   1.00 0.00 ? 31 ARG P CD   9  
ATOM 10045 N NE   . ARG A 1 33 ? 5.545   6.710   1.354   1.00 0.00 ? 31 ARG P NE   9  
ATOM 10046 C CZ   . ARG A 1 33 ? 6.750   6.763   1.879   1.00 0.00 ? 31 ARG P CZ   9  
ATOM 10047 N NH1  . ARG A 1 33 ? 7.041   6.250   3.040   1.00 0.00 ? 31 ARG P NH1  9  
ATOM 10048 N NH2  . ARG A 1 33 ? 7.690   7.362   1.211   1.00 0.00 ? 31 ARG P NH2  9  
ATOM 10049 H H    . ARG A 1 33 ? 1.353   7.524   -0.548  1.00 0.00 ? 31 ARG P H    9  
ATOM 10050 H HA   . ARG A 1 33 ? 1.011   4.712   -0.212  1.00 0.00 ? 31 ARG P HA   9  
ATOM 10051 H HB2  . ARG A 1 33 ? 1.612   6.777   1.951   1.00 0.00 ? 31 ARG P HB2  9  
ATOM 10052 H HB3  . ARG A 1 33 ? 1.809   5.035   2.110   1.00 0.00 ? 31 ARG P HB3  9  
ATOM 10053 H HG2  . ARG A 1 33 ? 3.493   5.038   0.283   1.00 0.00 ? 31 ARG P HG2  9  
ATOM 10054 H HG3  . ARG A 1 33 ? 3.312   6.782   0.129   1.00 0.00 ? 31 ARG P HG3  9  
ATOM 10055 H HD2  . ARG A 1 33 ? 3.918   6.880   2.661   1.00 0.00 ? 31 ARG P HD2  9  
ATOM 10056 H HD3  . ARG A 1 33 ? 4.491   5.214   2.430   1.00 0.00 ? 31 ARG P HD3  9  
ATOM 10057 H HE   . ARG A 1 33 ? 5.466   7.170   0.454   1.00 0.00 ? 31 ARG P HE   9  
ATOM 10058 H HH11 . ARG A 1 33 ? 6.317   5.805   3.570   1.00 0.00 ? 31 ARG P HH11 9  
ATOM 10059 H HH12 . ARG A 1 33 ? 7.972   6.329   3.413   1.00 0.00 ? 31 ARG P HH12 9  
ATOM 10060 H HH21 . ARG A 1 33 ? 7.439   7.804   0.334   1.00 0.00 ? 31 ARG P HH21 9  
ATOM 10061 H HH22 . ARG A 1 33 ? 8.619   7.449   1.583   1.00 0.00 ? 31 ARG P HH22 9  
ATOM 10062 N N    . GLU A 1 34 ? -1.320  6.445   1.354   1.00 0.00 ? 32 GLU P N    9  
ATOM 10063 C CA   . GLU A 1 34 ? -2.662  6.326   1.940   1.00 0.00 ? 32 GLU P CA   9  
ATOM 10064 C C    . GLU A 1 34 ? -3.699  5.799   0.930   1.00 0.00 ? 32 GLU P C    9  
ATOM 10065 O O    . GLU A 1 34 ? -4.499  4.932   1.280   1.00 0.00 ? 32 GLU P O    9  
ATOM 10066 C CB   . GLU A 1 34 ? -3.080  7.680   2.541   1.00 0.00 ? 32 GLU P CB   9  
ATOM 10067 C CG   . GLU A 1 34 ? -4.418  7.610   3.289   1.00 0.00 ? 32 GLU P CG   9  
ATOM 10068 C CD   . GLU A 1 34 ? -4.792  8.977   3.894   1.00 0.00 ? 32 GLU P CD   9  
ATOM 10069 O OE1  . GLU A 1 34 ? -5.301  9.855   3.154   1.00 0.00 ? 32 GLU P OE1  9  
ATOM 10070 O OE2  . GLU A 1 34 ? -4.602  9.180   5.118   1.00 0.00 ? 32 GLU P OE2  9  
ATOM 10071 H H    . GLU A 1 34 ? -0.912  7.368   1.253   1.00 0.00 ? 32 GLU P H    9  
ATOM 10072 H HA   . GLU A 1 34 ? -2.610  5.593   2.747   1.00 0.00 ? 32 GLU P HA   9  
ATOM 10073 H HB2  . GLU A 1 34 ? -2.310  8.005   3.242   1.00 0.00 ? 32 GLU P HB2  9  
ATOM 10074 H HB3  . GLU A 1 34 ? -3.155  8.419   1.744   1.00 0.00 ? 32 GLU P HB3  9  
ATOM 10075 H HG2  . GLU A 1 34 ? -5.206  7.296   2.600   1.00 0.00 ? 32 GLU P HG2  9  
ATOM 10076 H HG3  . GLU A 1 34 ? -4.345  6.856   4.076   1.00 0.00 ? 32 GLU P HG3  9  
ATOM 10077 N N    . GLU A 1 35 ? -3.668  6.241   -0.331  1.00 0.00 ? 33 GLU P N    9  
ATOM 10078 C CA   . GLU A 1 35 ? -4.554  5.696   -1.373  1.00 0.00 ? 33 GLU P CA   9  
ATOM 10079 C C    . GLU A 1 35 ? -4.276  4.209   -1.642  1.00 0.00 ? 33 GLU P C    9  
ATOM 10080 O O    . GLU A 1 35 ? -5.215  3.413   -1.653  1.00 0.00 ? 33 GLU P O    9  
ATOM 10081 C CB   . GLU A 1 35 ? -4.448  6.507   -2.675  1.00 0.00 ? 33 GLU P CB   9  
ATOM 10082 C CG   . GLU A 1 35 ? -5.121  7.879   -2.553  1.00 0.00 ? 33 GLU P CG   9  
ATOM 10083 C CD   . GLU A 1 35 ? -5.107  8.624   -3.902  1.00 0.00 ? 33 GLU P CD   9  
ATOM 10084 O OE1  . GLU A 1 35 ? -4.095  9.289   -4.230  1.00 0.00 ? 33 GLU P OE1  9  
ATOM 10085 O OE2  . GLU A 1 35 ? -6.120  8.562   -4.642  1.00 0.00 ? 33 GLU P OE2  9  
ATOM 10086 H H    . GLU A 1 35 ? -3.009  6.971   -0.581  1.00 0.00 ? 33 GLU P H    9  
ATOM 10087 H HA   . GLU A 1 35 ? -5.591  5.747   -1.024  1.00 0.00 ? 33 GLU P HA   9  
ATOM 10088 H HB2  . GLU A 1 35 ? -3.401  6.630   -2.951  1.00 0.00 ? 33 GLU P HB2  9  
ATOM 10089 H HB3  . GLU A 1 35 ? -4.949  5.953   -3.469  1.00 0.00 ? 33 GLU P HB3  9  
ATOM 10090 H HG2  . GLU A 1 35 ? -6.153  7.737   -2.221  1.00 0.00 ? 33 GLU P HG2  9  
ATOM 10091 H HG3  . GLU A 1 35 ? -4.611  8.473   -1.793  1.00 0.00 ? 33 GLU P HG3  9  
ATOM 10092 N N    . ILE A 1 36 ? -3.011  3.784   -1.768  1.00 0.00 ? 34 ILE P N    9  
ATOM 10093 C CA   . ILE A 1 36 ? -2.705  2.355   -1.952  1.00 0.00 ? 34 ILE P CA   9  
ATOM 10094 C C    . ILE A 1 36 ? -2.984  1.529   -0.684  1.00 0.00 ? 34 ILE P C    9  
ATOM 10095 O O    . ILE A 1 36 ? -3.307  0.347   -0.797  1.00 0.00 ? 34 ILE P O    9  
ATOM 10096 C CB   . ILE A 1 36 ? -1.313  2.105   -2.576  1.00 0.00 ? 34 ILE P CB   9  
ATOM 10097 C CG1  . ILE A 1 36 ? -0.101  2.446   -1.693  1.00 0.00 ? 34 ILE P CG1  9  
ATOM 10098 C CG2  . ILE A 1 36 ? -1.177  2.874   -3.901  1.00 0.00 ? 34 ILE P CG2  9  
ATOM 10099 C CD1  . ILE A 1 36 ? 0.222   1.395   -0.629  1.00 0.00 ? 34 ILE P CD1  9  
ATOM 10100 H H    . ILE A 1 36 ? -2.253  4.460   -1.758  1.00 0.00 ? 34 ILE P H    9  
ATOM 10101 H HA   . ILE A 1 36 ? -3.416  1.982   -2.690  1.00 0.00 ? 34 ILE P HA   9  
ATOM 10102 H HB   . ILE A 1 36 ? -1.255  1.045   -2.817  1.00 0.00 ? 34 ILE P HB   9  
ATOM 10103 H HG12 . ILE A 1 36 ? 0.783   2.543   -2.324  1.00 0.00 ? 34 ILE P HG12 9  
ATOM 10104 H HG13 . ILE A 1 36 ? -0.274  3.403   -1.217  1.00 0.00 ? 34 ILE P HG13 9  
ATOM 10105 H HG21 . ILE A 1 36 ? -0.277  2.551   -4.425  1.00 0.00 ? 34 ILE P HG21 9  
ATOM 10106 H HG22 . ILE A 1 36 ? -2.038  2.676   -4.537  1.00 0.00 ? 34 ILE P HG22 9  
ATOM 10107 H HG23 . ILE A 1 36 ? -1.104  3.944   -3.714  1.00 0.00 ? 34 ILE P HG23 9  
ATOM 10108 H HD11 . ILE A 1 36 ? 1.234   1.562   -0.270  1.00 0.00 ? 34 ILE P HD11 9  
ATOM 10109 H HD12 . ILE A 1 36 ? -0.458  1.478   0.215   1.00 0.00 ? 34 ILE P HD12 9  
ATOM 10110 H HD13 . ILE A 1 36 ? 0.160   0.394   -1.055  1.00 0.00 ? 34 ILE P HD13 9  
ATOM 10111 N N    . ALA A 1 37 ? -2.960  2.135   0.511   1.00 0.00 ? 35 ALA P N    9  
ATOM 10112 C CA   . ALA A 1 37 ? -3.404  1.494   1.752   1.00 0.00 ? 35 ALA P CA   9  
ATOM 10113 C C    . ALA A 1 37 ? -4.919  1.221   1.723   1.00 0.00 ? 35 ALA P C    9  
ATOM 10114 O O    . ALA A 1 37 ? -5.348  0.105   2.003   1.00 0.00 ? 35 ALA P O    9  
ATOM 10115 C CB   . ALA A 1 37 ? -2.999  2.351   2.961   1.00 0.00 ? 35 ALA P CB   9  
ATOM 10116 H H    . ALA A 1 37 ? -2.619  3.087   0.560   1.00 0.00 ? 35 ALA P H    9  
ATOM 10117 H HA   . ALA A 1 37 ? -2.898  0.533   1.845   1.00 0.00 ? 35 ALA P HA   9  
ATOM 10118 H HB1  . ALA A 1 37 ? -3.194  1.798   3.878   1.00 0.00 ? 35 ALA P HB1  9  
ATOM 10119 H HB2  . ALA A 1 37 ? -1.938  2.588   2.919   1.00 0.00 ? 35 ALA P HB2  9  
ATOM 10120 H HB3  . ALA A 1 37 ? -3.570  3.277   2.984   1.00 0.00 ? 35 ALA P HB3  9  
ATOM 10121 N N    . VAL A 1 38 ? -5.731  2.190   1.285   1.00 0.00 ? 36 VAL P N    9  
ATOM 10122 C CA   . VAL A 1 38 ? -7.174  2.015   1.034   1.00 0.00 ? 36 VAL P CA   9  
ATOM 10123 C C    . VAL A 1 38 ? -7.425  0.910   -0.001  1.00 0.00 ? 36 VAL P C    9  
ATOM 10124 O O    . VAL A 1 38 ? -8.266  0.039   0.227   1.00 0.00 ? 36 VAL P O    9  
ATOM 10125 C CB   . VAL A 1 38 ? -7.804  3.357   0.595   1.00 0.00 ? 36 VAL P CB   9  
ATOM 10126 C CG1  . VAL A 1 38 ? -9.232  3.238   0.054   1.00 0.00 ? 36 VAL P CG1  9  
ATOM 10127 C CG2  . VAL A 1 38 ? -7.860  4.337   1.772   1.00 0.00 ? 36 VAL P CG2  9  
ATOM 10128 H H    . VAL A 1 38 ? -5.319  3.095   1.091   1.00 0.00 ? 36 VAL P H    9  
ATOM 10129 H HA   . VAL A 1 38 ? -7.656  1.702   1.960   1.00 0.00 ? 36 VAL P HA   9  
ATOM 10130 H HB   . VAL A 1 38 ? -7.196  3.804   -0.186  1.00 0.00 ? 36 VAL P HB   9  
ATOM 10131 H HG11 . VAL A 1 38 ? -9.885  2.789   0.801   1.00 0.00 ? 36 VAL P HG11 9  
ATOM 10132 H HG12 . VAL A 1 38 ? -9.600  4.232   -0.205  1.00 0.00 ? 36 VAL P HG12 9  
ATOM 10133 H HG13 . VAL A 1 38 ? -9.246  2.635   -0.852  1.00 0.00 ? 36 VAL P HG13 9  
ATOM 10134 H HG21 . VAL A 1 38 ? -8.226  5.301   1.421   1.00 0.00 ? 36 VAL P HG21 9  
ATOM 10135 H HG22 . VAL A 1 38 ? -8.526  3.954   2.545   1.00 0.00 ? 36 VAL P HG22 9  
ATOM 10136 H HG23 . VAL A 1 38 ? -6.867  4.478   2.194   1.00 0.00 ? 36 VAL P HG23 9  
ATOM 10137 N N    . TRP A 1 39 ? -6.669  0.883   -1.104  1.00 0.00 ? 37 TRP P N    9  
ATOM 10138 C CA   . TRP A 1 39 ? -6.839  -0.101  -2.185  1.00 0.00 ? 37 TRP P CA   9  
ATOM 10139 C C    . TRP A 1 39 ? -6.430  -1.531  -1.776  1.00 0.00 ? 37 TRP P C    9  
ATOM 10140 O O    . TRP A 1 39 ? -7.042  -2.499  -2.230  1.00 0.00 ? 37 TRP P O    9  
ATOM 10141 C CB   . TRP A 1 39 ? -6.051  0.357   -3.422  1.00 0.00 ? 37 TRP P CB   9  
ATOM 10142 C CG   . TRP A 1 39 ? -6.374  1.697   -4.021  1.00 0.00 ? 37 TRP P CG   9  
ATOM 10143 C CD1  . TRP A 1 39 ? -7.386  2.521   -3.662  1.00 0.00 ? 37 TRP P CD1  9  
ATOM 10144 C CD2  . TRP A 1 39 ? -5.641  2.414   -5.064  1.00 0.00 ? 37 TRP P CD2  9  
ATOM 10145 N NE1  . TRP A 1 39 ? -7.333  3.686   -4.404  1.00 0.00 ? 37 TRP P NE1  9  
ATOM 10146 C CE2  . TRP A 1 39 ? -6.266  3.682   -5.274  1.00 0.00 ? 37 TRP P CE2  9  
ATOM 10147 C CE3  . TRP A 1 39 ? -4.499  2.127   -5.846  1.00 0.00 ? 37 TRP P CE3  9  
ATOM 10148 C CZ2  . TRP A 1 39 ? -5.780  4.617   -6.200  1.00 0.00 ? 37 TRP P CZ2  9  
ATOM 10149 C CZ3  . TRP A 1 39 ? -4.005  3.058   -6.781  1.00 0.00 ? 37 TRP P CZ3  9  
ATOM 10150 C CH2  . TRP A 1 39 ? -4.639  4.301   -6.957  1.00 0.00 ? 37 TRP P CH2  9  
ATOM 10151 H H    . TRP A 1 39 ? -6.019  1.650   -1.256  1.00 0.00 ? 37 TRP P H    9  
ATOM 10152 H HA   . TRP A 1 39 ? -7.895  -0.142  -2.458  1.00 0.00 ? 37 TRP P HA   9  
ATOM 10153 H HB2  . TRP A 1 39 ? -4.998  0.375   -3.154  1.00 0.00 ? 37 TRP P HB2  9  
ATOM 10154 H HB3  . TRP A 1 39 ? -6.176  -0.393  -4.205  1.00 0.00 ? 37 TRP P HB3  9  
ATOM 10155 H HD1  . TRP A 1 39 ? -8.097  2.314   -2.873  1.00 0.00 ? 37 TRP P HD1  9  
ATOM 10156 H HE1  . TRP A 1 39 ? -7.990  4.451   -4.289  1.00 0.00 ? 37 TRP P HE1  9  
ATOM 10157 H HE3  . TRP A 1 39 ? -4.000  1.177   -5.717  1.00 0.00 ? 37 TRP P HE3  9  
ATOM 10158 H HZ2  . TRP A 1 39 ? -6.278  5.569   -6.325  1.00 0.00 ? 37 TRP P HZ2  9  
ATOM 10159 H HZ3  . TRP A 1 39 ? -3.125  2.818   -7.367  1.00 0.00 ? 37 TRP P HZ3  9  
ATOM 10160 H HH2  . TRP A 1 39 ? -4.249  5.012   -7.676  1.00 0.00 ? 37 TRP P HH2  9  
ATOM 10161 N N    . THR A 1 40 ? -5.439  -1.675  -0.889  1.00 0.00 ? 38 THR P N    9  
ATOM 10162 C CA   . THR A 1 40 ? -5.013  -2.961  -0.288  1.00 0.00 ? 38 THR P CA   9  
ATOM 10163 C C    . THR A 1 40 ? -5.768  -3.323  1.000   1.00 0.00 ? 38 THR P C    9  
ATOM 10164 O O    . THR A 1 40 ? -5.560  -4.405  1.551   1.00 0.00 ? 38 THR P O    9  
ATOM 10165 C CB   . THR A 1 40 ? -3.497  -2.990  -0.017  1.00 0.00 ? 38 THR P CB   9  
ATOM 10166 O OG1  . THR A 1 40 ? -3.101  -1.892  0.767   1.00 0.00 ? 38 THR P OG1  9  
ATOM 10167 C CG2  . THR A 1 40 ? -2.668  -2.975  -1.299  1.00 0.00 ? 38 THR P CG2  9  
ATOM 10168 H H    . THR A 1 40 ? -4.945  -0.837  -0.601  1.00 0.00 ? 38 THR P H    9  
ATOM 10169 H HA   . THR A 1 40 ? -5.225  -3.763  -0.996  1.00 0.00 ? 38 THR P HA   9  
ATOM 10170 H HB   . THR A 1 40 ? -3.250  -3.903  0.524   1.00 0.00 ? 38 THR P HB   9  
ATOM 10171 H HG1  . THR A 1 40 ? -3.076  -1.117  0.177   1.00 0.00 ? 38 THR P HG1  9  
ATOM 10172 H HG21 . THR A 1 40 ? -2.857  -2.065  -1.868  1.00 0.00 ? 38 THR P HG21 9  
ATOM 10173 H HG22 . THR A 1 40 ? -2.932  -3.837  -1.911  1.00 0.00 ? 38 THR P HG22 9  
ATOM 10174 H HG23 . THR A 1 40 ? -1.609  -3.030  -1.048  1.00 0.00 ? 38 THR P HG23 9  
ATOM 10175 N N    . ASN A 1 41 ? -6.657  -2.446  1.480   1.00 0.00 ? 39 ASN P N    9  
ATOM 10176 C CA   . ASN A 1 41 ? -7.338  -2.513  2.781   1.00 0.00 ? 39 ASN P CA   9  
ATOM 10177 C C    . ASN A 1 41 ? -6.377  -2.623  3.993   1.00 0.00 ? 39 ASN P C    9  
ATOM 10178 O O    . ASN A 1 41 ? -6.695  -3.249  5.008   1.00 0.00 ? 39 ASN P O    9  
ATOM 10179 C CB   . ASN A 1 41 ? -8.457  -3.574  2.760   1.00 0.00 ? 39 ASN P CB   9  
ATOM 10180 C CG   . ASN A 1 41 ? -9.521  -3.299  1.709   1.00 0.00 ? 39 ASN P CG   9  
ATOM 10181 O OD1  . ASN A 1 41 ? -10.480 -2.575  1.938   1.00 0.00 ? 39 ASN P OD1  9  
ATOM 10182 N ND2  . ASN A 1 41 ? -9.397  -3.866  0.528   1.00 0.00 ? 39 ASN P ND2  9  
ATOM 10183 H H    . ASN A 1 41 ? -6.773  -1.586  0.960   1.00 0.00 ? 39 ASN P H    9  
ATOM 10184 H HA   . ASN A 1 41 ? -7.816  -1.537  2.905   1.00 0.00 ? 39 ASN P HA   9  
ATOM 10185 H HB2  . ASN A 1 41 ? -8.025  -4.561  2.599   1.00 0.00 ? 39 ASN P HB2  9  
ATOM 10186 H HB3  . ASN A 1 41 ? -8.954  -3.588  3.730   1.00 0.00 ? 39 ASN P HB3  9  
ATOM 10187 H HD21 . ASN A 1 41 ? -8.608  -4.459  0.332   1.00 0.00 ? 39 ASN P HD21 9  
ATOM 10188 H HD22 . ASN A 1 41 ? -10.095 -3.671  -0.172  1.00 0.00 ? 39 ASN P HD22 9  
ATOM 10189 N N    . LEU A 1 42 ? -5.199  -2.004  3.886   1.00 0.00 ? 40 LEU P N    9  
ATOM 10190 C CA   . LEU A 1 42 ? -4.215  -1.824  4.959   1.00 0.00 ? 40 LEU P CA   9  
ATOM 10191 C C    . LEU A 1 42 ? -4.380  -0.462  5.663   1.00 0.00 ? 40 LEU P C    9  
ATOM 10192 O O    . LEU A 1 42 ? -5.085  0.432   5.186   1.00 0.00 ? 40 LEU P O    9  
ATOM 10193 C CB   . LEU A 1 42 ? -2.798  -1.983  4.367   1.00 0.00 ? 40 LEU P CB   9  
ATOM 10194 C CG   . LEU A 1 42 ? -2.458  -3.382  3.823   1.00 0.00 ? 40 LEU P CG   9  
ATOM 10195 C CD1  . LEU A 1 42 ? -1.054  -3.356  3.220   1.00 0.00 ? 40 LEU P CD1  9  
ATOM 10196 C CD2  . LEU A 1 42 ? -2.477  -4.438  4.928   1.00 0.00 ? 40 LEU P CD2  9  
ATOM 10197 H H    . LEU A 1 42 ? -5.049  -1.464  3.040   1.00 0.00 ? 40 LEU P H    9  
ATOM 10198 H HA   . LEU A 1 42 ? -4.364  -2.590  5.721   1.00 0.00 ? 40 LEU P HA   9  
ATOM 10199 H HB2  . LEU A 1 42 ? -2.682  -1.261  3.559   1.00 0.00 ? 40 LEU P HB2  9  
ATOM 10200 H HB3  . LEU A 1 42 ? -2.066  -1.734  5.136   1.00 0.00 ? 40 LEU P HB3  9  
ATOM 10201 H HG   . LEU A 1 42 ? -3.166  -3.669  3.046   1.00 0.00 ? 40 LEU P HG   9  
ATOM 10202 H HD11 . LEU A 1 42 ? -1.035  -2.663  2.379   1.00 0.00 ? 40 LEU P HD11 9  
ATOM 10203 H HD12 . LEU A 1 42 ? -0.784  -4.347  2.860   1.00 0.00 ? 40 LEU P HD12 9  
ATOM 10204 H HD13 . LEU A 1 42 ? -0.331  -3.030  3.966   1.00 0.00 ? 40 LEU P HD13 9  
ATOM 10205 H HD21 . LEU A 1 42 ? -1.834  -4.124  5.748   1.00 0.00 ? 40 LEU P HD21 9  
ATOM 10206 H HD22 . LEU A 1 42 ? -2.120  -5.391  4.537   1.00 0.00 ? 40 LEU P HD22 9  
ATOM 10207 H HD23 . LEU A 1 42 ? -3.495  -4.577  5.288   1.00 0.00 ? 40 LEU P HD23 9  
ATOM 10208 N N    . THR A 1 43 ? -3.692  -0.288  6.795   1.00 0.00 ? 41 THR P N    9  
ATOM 10209 C CA   . THR A 1 43 ? -3.555  1.008   7.489   1.00 0.00 ? 41 THR P CA   9  
ATOM 10210 C C    . THR A 1 43 ? -2.338  1.764   6.945   1.00 0.00 ? 41 THR P C    9  
ATOM 10211 O O    . THR A 1 43 ? -1.293  1.162   6.695   1.00 0.00 ? 41 THR P O    9  
ATOM 10212 C CB   . THR A 1 43 ? -3.456  0.803   9.013   1.00 0.00 ? 41 THR P CB   9  
ATOM 10213 O OG1  . THR A 1 43 ? -4.599  0.116   9.481   1.00 0.00 ? 41 THR P OG1  9  
ATOM 10214 C CG2  . THR A 1 43 ? -3.397  2.111   9.805   1.00 0.00 ? 41 THR P CG2  9  
ATOM 10215 H H    . THR A 1 43 ? -3.116  -1.053  7.112   1.00 0.00 ? 41 THR P H    9  
ATOM 10216 H HA   . THR A 1 43 ? -4.442  1.614   7.299   1.00 0.00 ? 41 THR P HA   9  
ATOM 10217 H HB   . THR A 1 43 ? -2.569  0.211   9.242   1.00 0.00 ? 41 THR P HB   9  
ATOM 10218 H HG1  . THR A 1 43 ? -4.657  -0.731  9.003   1.00 0.00 ? 41 THR P HG1  9  
ATOM 10219 H HG21 . THR A 1 43 ? -4.240  2.750   9.540   1.00 0.00 ? 41 THR P HG21 9  
ATOM 10220 H HG22 . THR A 1 43 ? -2.465  2.633   9.604   1.00 0.00 ? 41 THR P HG22 9  
ATOM 10221 H HG23 . THR A 1 43 ? -3.439  1.891   10.874  1.00 0.00 ? 41 THR P HG23 9  
ATOM 10222 N N    . GLU A 1 44 ? -2.427  3.087   6.783   1.00 0.00 ? 42 GLU P N    9  
ATOM 10223 C CA   . GLU A 1 44 ? -1.345  3.888   6.179   1.00 0.00 ? 42 GLU P CA   9  
ATOM 10224 C C    . GLU A 1 44 ? -0.032  3.871   6.983   1.00 0.00 ? 42 GLU P C    9  
ATOM 10225 O O    . GLU A 1 44 ? 1.046   3.936   6.394   1.00 0.00 ? 42 GLU P O    9  
ATOM 10226 C CB   . GLU A 1 44 ? -1.839  5.312   5.868   1.00 0.00 ? 42 GLU P CB   9  
ATOM 10227 C CG   . GLU A 1 44 ? -2.243  6.179   7.076   1.00 0.00 ? 42 GLU P CG   9  
ATOM 10228 C CD   . GLU A 1 44 ? -1.079  7.042   7.594   1.00 0.00 ? 42 GLU P CD   9  
ATOM 10229 O OE1  . GLU A 1 44 ? -0.717  8.048   6.942   1.00 0.00 ? 42 GLU P OE1  9  
ATOM 10230 O OE2  . GLU A 1 44 ? -0.487  6.722   8.650   1.00 0.00 ? 42 GLU P OE2  9  
ATOM 10231 H H    . GLU A 1 44 ? -3.303  3.547   6.992   1.00 0.00 ? 42 GLU P H    9  
ATOM 10232 H HA   . GLU A 1 44 ? -1.108  3.435   5.216   1.00 0.00 ? 42 GLU P HA   9  
ATOM 10233 H HB2  . GLU A 1 44 ? -1.069  5.828   5.295   1.00 0.00 ? 42 GLU P HB2  9  
ATOM 10234 H HB3  . GLU A 1 44 ? -2.711  5.214   5.220   1.00 0.00 ? 42 GLU P HB3  9  
ATOM 10235 H HG2  . GLU A 1 44 ? -3.051  6.841   6.762   1.00 0.00 ? 42 GLU P HG2  9  
ATOM 10236 H HG3  . GLU A 1 44 ? -2.639  5.548   7.875   1.00 0.00 ? 42 GLU P HG3  9  
ATOM 10237 N N    . ALA A 1 45 ? -0.097  3.683   8.306   1.00 0.00 ? 43 ALA P N    9  
ATOM 10238 C CA   . ALA A 1 45 ? 1.084   3.521   9.157   1.00 0.00 ? 43 ALA P CA   9  
ATOM 10239 C C    . ALA A 1 45 ? 1.768   2.154   8.958   1.00 0.00 ? 43 ALA P C    9  
ATOM 10240 O O    . ALA A 1 45 ? 2.995   2.076   8.886   1.00 0.00 ? 43 ALA P O    9  
ATOM 10241 C CB   . ALA A 1 45 ? 0.668   3.747   10.616  1.00 0.00 ? 43 ALA P CB   9  
ATOM 10242 H H    . ALA A 1 45 ? -1.005  3.703   8.744   1.00 0.00 ? 43 ALA P H    9  
ATOM 10243 H HA   . ALA A 1 45 ? 1.804   4.290   8.882   1.00 0.00 ? 43 ALA P HA   9  
ATOM 10244 H HB1  . ALA A 1 45 ? 0.232   4.741   10.727  1.00 0.00 ? 43 ALA P HB1  9  
ATOM 10245 H HB2  . ALA A 1 45 ? -0.060  2.997   10.926  1.00 0.00 ? 43 ALA P HB2  9  
ATOM 10246 H HB3  . ALA A 1 45 ? 1.546   3.677   11.261  1.00 0.00 ? 43 ALA P HB3  9  
ATOM 10247 N N    . ARG A 1 46 ? 0.985   1.081   8.784   1.00 0.00 ? 44 ARG P N    9  
ATOM 10248 C CA   . ARG A 1 46 ? 1.476   -0.269  8.442   1.00 0.00 ? 44 ARG P CA   9  
ATOM 10249 C C    . ARG A 1 46 ? 2.124   -0.291  7.053   1.00 0.00 ? 44 ARG P C    9  
ATOM 10250 O O    . ARG A 1 46 ? 3.172   -0.907  6.866   1.00 0.00 ? 44 ARG P O    9  
ATOM 10251 C CB   . ARG A 1 46 ? 0.297   -1.247  8.579   1.00 0.00 ? 44 ARG P CB   9  
ATOM 10252 C CG   . ARG A 1 46 ? 0.627   -2.698  8.208   1.00 0.00 ? 44 ARG P CG   9  
ATOM 10253 C CD   . ARG A 1 46 ? -0.582  -3.583  8.538   1.00 0.00 ? 44 ARG P CD   9  
ATOM 10254 N NE   . ARG A 1 46 ? -0.413  -4.955  8.031   1.00 0.00 ? 44 ARG P NE   9  
ATOM 10255 C CZ   . ARG A 1 46 ? -1.244  -5.960  8.222   1.00 0.00 ? 44 ARG P CZ   9  
ATOM 10256 N NH1  . ARG A 1 46 ? -2.322  -5.864  8.942   1.00 0.00 ? 44 ARG P NH1  9  
ATOM 10257 N NH2  . ARG A 1 46 ? -1.019  -7.117  7.685   1.00 0.00 ? 44 ARG P NH2  9  
ATOM 10258 H H    . ARG A 1 46 ? -0.013  1.229   8.819   1.00 0.00 ? 44 ARG P H    9  
ATOM 10259 H HA   . ARG A 1 46 ? 2.253   -0.559  9.153   1.00 0.00 ? 44 ARG P HA   9  
ATOM 10260 H HB2  . ARG A 1 46 ? -0.046  -1.221  9.616   1.00 0.00 ? 44 ARG P HB2  9  
ATOM 10261 H HB3  . ARG A 1 46 ? -0.524  -0.916  7.945   1.00 0.00 ? 44 ARG P HB3  9  
ATOM 10262 H HG2  . ARG A 1 46 ? 0.839   -2.762  7.140   1.00 0.00 ? 44 ARG P HG2  9  
ATOM 10263 H HG3  . ARG A 1 46 ? 1.494   -3.041  8.774   1.00 0.00 ? 44 ARG P HG3  9  
ATOM 10264 H HD2  . ARG A 1 46 ? -0.713  -3.603  9.622   1.00 0.00 ? 44 ARG P HD2  9  
ATOM 10265 H HD3  . ARG A 1 46 ? -1.474  -3.146  8.086   1.00 0.00 ? 44 ARG P HD3  9  
ATOM 10266 H HE   . ARG A 1 46 ? 0.400   -5.148  7.466   1.00 0.00 ? 44 ARG P HE   9  
ATOM 10267 H HH11 . ARG A 1 46 ? -2.552  -4.996  9.393   1.00 0.00 ? 44 ARG P HH11 9  
ATOM 10268 H HH12 . ARG A 1 46 ? -2.890  -6.692  9.078   1.00 0.00 ? 44 ARG P HH12 9  
ATOM 10269 H HH21 . ARG A 1 46 ? -0.209  -7.260  7.104   1.00 0.00 ? 44 ARG P HH21 9  
ATOM 10270 H HH22 . ARG A 1 46 ? -1.686  -7.855  7.863   1.00 0.00 ? 44 ARG P HH22 9  
ATOM 10271 N N    . VAL A 1 47 ? 1.560   0.461   6.106   1.00 0.00 ? 45 VAL P N    9  
ATOM 10272 C CA   . VAL A 1 47 ? 2.150   0.704   4.778   1.00 0.00 ? 45 VAL P CA   9  
ATOM 10273 C C    . VAL A 1 47 ? 3.444   1.526   4.869   1.00 0.00 ? 45 VAL P C    9  
ATOM 10274 O O    . VAL A 1 47 ? 4.433   1.167   4.232   1.00 0.00 ? 45 VAL P O    9  
ATOM 10275 C CB   . VAL A 1 47 ? 1.097   1.349   3.857   1.00 0.00 ? 45 VAL P CB   9  
ATOM 10276 C CG1  . VAL A 1 47 ? 1.683   1.938   2.576   1.00 0.00 ? 45 VAL P CG1  9  
ATOM 10277 C CG2  . VAL A 1 47 ? 0.058   0.291   3.466   1.00 0.00 ? 45 VAL P CG2  9  
ATOM 10278 H H    . VAL A 1 47 ? 0.668   0.891   6.327   1.00 0.00 ? 45 VAL P H    9  
ATOM 10279 H HA   . VAL A 1 47 ? 2.431   -0.255  4.340   1.00 0.00 ? 45 VAL P HA   9  
ATOM 10280 H HB   . VAL A 1 47 ? 0.595   2.153   4.389   1.00 0.00 ? 45 VAL P HB   9  
ATOM 10281 H HG11 . VAL A 1 47 ? 0.879   2.358   1.974   1.00 0.00 ? 45 VAL P HG11 9  
ATOM 10282 H HG12 . VAL A 1 47 ? 2.371   2.749   2.811   1.00 0.00 ? 45 VAL P HG12 9  
ATOM 10283 H HG13 . VAL A 1 47 ? 2.203   1.161   2.016   1.00 0.00 ? 45 VAL P HG13 9  
ATOM 10284 H HG21 . VAL A 1 47 ? -0.490  -0.035  4.348   1.00 0.00 ? 45 VAL P HG21 9  
ATOM 10285 H HG22 . VAL A 1 47 ? -0.647  0.704   2.748   1.00 0.00 ? 45 VAL P HG22 9  
ATOM 10286 H HG23 . VAL A 1 47 ? 0.549   -0.569  3.009   1.00 0.00 ? 45 VAL P HG23 9  
ATOM 10287 N N    . ARG A 1 48 ? 3.503   2.572   5.704   1.00 0.00 ? 46 ARG P N    9  
ATOM 10288 C CA   . ARG A 1 48 ? 4.735   3.348   5.952   1.00 0.00 ? 46 ARG P CA   9  
ATOM 10289 C C    . ARG A 1 48 ? 5.854   2.479   6.543   1.00 0.00 ? 46 ARG P C    9  
ATOM 10290 O O    . ARG A 1 48 ? 6.998   2.583   6.104   1.00 0.00 ? 46 ARG P O    9  
ATOM 10291 C CB   . ARG A 1 48 ? 4.383   4.555   6.839   1.00 0.00 ? 46 ARG P CB   9  
ATOM 10292 C CG   . ARG A 1 48 ? 5.545   5.546   7.022   1.00 0.00 ? 46 ARG P CG   9  
ATOM 10293 C CD   . ARG A 1 48 ? 5.143   6.746   7.895   1.00 0.00 ? 46 ARG P CD   9  
ATOM 10294 N NE   . ARG A 1 48 ? 4.113   7.587   7.246   1.00 0.00 ? 46 ARG P NE   9  
ATOM 10295 C CZ   . ARG A 1 48 ? 2.815   7.620   7.506   1.00 0.00 ? 46 ARG P CZ   9  
ATOM 10296 N NH1  . ARG A 1 48 ? 2.275   6.943   8.475   1.00 0.00 ? 46 ARG P NH1  9  
ATOM 10297 N NH2  . ARG A 1 48 ? 2.018   8.339   6.776   1.00 0.00 ? 46 ARG P NH2  9  
ATOM 10298 H H    . ARG A 1 48 ? 2.646   2.875   6.159   1.00 0.00 ? 46 ARG P H    9  
ATOM 10299 H HA   . ARG A 1 48 ? 5.106   3.719   4.995   1.00 0.00 ? 46 ARG P HA   9  
ATOM 10300 H HB2  . ARG A 1 48 ? 3.549   5.080   6.375   1.00 0.00 ? 46 ARG P HB2  9  
ATOM 10301 H HB3  . ARG A 1 48 ? 4.064   4.204   7.820   1.00 0.00 ? 46 ARG P HB3  9  
ATOM 10302 H HG2  . ARG A 1 48 ? 6.380   5.038   7.504   1.00 0.00 ? 46 ARG P HG2  9  
ATOM 10303 H HG3  . ARG A 1 48 ? 5.874   5.907   6.047   1.00 0.00 ? 46 ARG P HG3  9  
ATOM 10304 H HD2  . ARG A 1 48 ? 4.802   6.381   8.865   1.00 0.00 ? 46 ARG P HD2  9  
ATOM 10305 H HD3  . ARG A 1 48 ? 6.031   7.355   8.069   1.00 0.00 ? 46 ARG P HD3  9  
ATOM 10306 H HE   . ARG A 1 48 ? 4.428   8.175   6.490   1.00 0.00 ? 46 ARG P HE   9  
ATOM 10307 H HH11 . ARG A 1 48 ? 2.857   6.429   9.106   1.00 0.00 ? 46 ARG P HH11 9  
ATOM 10308 H HH12 . ARG A 1 48 ? 1.259   6.951   8.593   1.00 0.00 ? 46 ARG P HH12 9  
ATOM 10309 H HH21 . ARG A 1 48 ? 2.367   8.905   6.029   1.00 0.00 ? 46 ARG P HH21 9  
ATOM 10310 H HH22 . ARG A 1 48 ? 1.010   8.291   6.942   1.00 0.00 ? 46 ARG P HH22 9  
ATOM 10311 N N    . VAL A 1 49 ? 5.521   1.563   7.455   1.00 0.00 ? 47 VAL P N    9  
ATOM 10312 C CA   . VAL A 1 49 ? 6.450   0.545   7.983   1.00 0.00 ? 47 VAL P CA   9  
ATOM 10313 C C    . VAL A 1 49 ? 6.897   -0.437  6.892   1.00 0.00 ? 47 VAL P C    9  
ATOM 10314 O O    . VAL A 1 49 ? 8.077   -0.797  6.858   1.00 0.00 ? 47 VAL P O    9  
ATOM 10315 C CB   . VAL A 1 49 ? 5.834   -0.176  9.204   1.00 0.00 ? 47 VAL P CB   9  
ATOM 10316 C CG1  . VAL A 1 49 ? 6.639   -1.398  9.663   1.00 0.00 ? 47 VAL P CG1  9  
ATOM 10317 C CG2  . VAL A 1 49 ? 5.760   0.783   10.401  1.00 0.00 ? 47 VAL P CG2  9  
ATOM 10318 H H    . VAL A 1 49 ? 4.569   1.582   7.808   1.00 0.00 ? 47 VAL P H    9  
ATOM 10319 H HA   . VAL A 1 49 ? 7.352   1.051   8.327   1.00 0.00 ? 47 VAL P HA   9  
ATOM 10320 H HB   . VAL A 1 49 ? 4.825   -0.506  8.956   1.00 0.00 ? 47 VAL P HB   9  
ATOM 10321 H HG11 . VAL A 1 49 ? 6.199   -1.810  10.573  1.00 0.00 ? 47 VAL P HG11 9  
ATOM 10322 H HG12 . VAL A 1 49 ? 6.616   -2.176  8.901   1.00 0.00 ? 47 VAL P HG12 9  
ATOM 10323 H HG13 . VAL A 1 49 ? 7.673   -1.112  9.866   1.00 0.00 ? 47 VAL P HG13 9  
ATOM 10324 H HG21 . VAL A 1 49 ? 5.201   1.680   10.141  1.00 0.00 ? 47 VAL P HG21 9  
ATOM 10325 H HG22 . VAL A 1 49 ? 5.254   0.294   11.234  1.00 0.00 ? 47 VAL P HG22 9  
ATOM 10326 H HG23 . VAL A 1 49 ? 6.763   1.073   10.713  1.00 0.00 ? 47 VAL P HG23 9  
ATOM 10327 N N    . TRP A 1 50 ? 6.029   -0.823  5.948   1.00 0.00 ? 48 TRP P N    9  
ATOM 10328 C CA   . TRP A 1 50 ? 6.440   -1.627  4.789   1.00 0.00 ? 48 TRP P CA   9  
ATOM 10329 C C    . TRP A 1 50 ? 7.446   -0.878  3.901   1.00 0.00 ? 48 TRP P C    9  
ATOM 10330 O O    . TRP A 1 50 ? 8.489   -1.438  3.567   1.00 0.00 ? 48 TRP P O    9  
ATOM 10331 C CB   . TRP A 1 50 ? 5.230   -2.109  3.976   1.00 0.00 ? 48 TRP P CB   9  
ATOM 10332 C CG   . TRP A 1 50 ? 5.589   -3.076  2.886   1.00 0.00 ? 48 TRP P CG   9  
ATOM 10333 C CD1  . TRP A 1 50 ? 5.551   -4.424  2.994   1.00 0.00 ? 48 TRP P CD1  9  
ATOM 10334 C CD2  . TRP A 1 50 ? 6.090   -2.799  1.536   1.00 0.00 ? 48 TRP P CD2  9  
ATOM 10335 N NE1  . TRP A 1 50 ? 5.999   -4.999  1.821   1.00 0.00 ? 48 TRP P NE1  9  
ATOM 10336 C CE2  . TRP A 1 50 ? 6.369   -4.046  0.895   1.00 0.00 ? 48 TRP P CE2  9  
ATOM 10337 C CE3  . TRP A 1 50 ? 6.347   -1.627  0.789   1.00 0.00 ? 48 TRP P CE3  9  
ATOM 10338 C CZ2  . TRP A 1 50 ? 6.898   -4.127  -0.402  1.00 0.00 ? 48 TRP P CZ2  9  
ATOM 10339 C CZ3  . TRP A 1 50 ? 6.879   -1.697  -0.513  1.00 0.00 ? 48 TRP P CZ3  9  
ATOM 10340 C CH2  . TRP A 1 50 ? 7.162   -2.940  -1.107  1.00 0.00 ? 48 TRP P CH2  9  
ATOM 10341 H H    . TRP A 1 50 ? 5.057   -0.550  6.033   1.00 0.00 ? 48 TRP P H    9  
ATOM 10342 H HA   . TRP A 1 50 ? 6.951   -2.517  5.160   1.00 0.00 ? 48 TRP P HA   9  
ATOM 10343 H HB2  . TRP A 1 50 ? 4.522   -2.591  4.651   1.00 0.00 ? 48 TRP P HB2  9  
ATOM 10344 H HB3  . TRP A 1 50 ? 4.729   -1.256  3.521   1.00 0.00 ? 48 TRP P HB3  9  
ATOM 10345 H HD1  . TRP A 1 50 ? 5.231   -4.968  3.877   1.00 0.00 ? 48 TRP P HD1  9  
ATOM 10346 H HE1  . TRP A 1 50 ? 6.063   -6.001  1.682   1.00 0.00 ? 48 TRP P HE1  9  
ATOM 10347 H HE3  . TRP A 1 50 ? 6.125   -0.663  1.222   1.00 0.00 ? 48 TRP P HE3  9  
ATOM 10348 H HZ2  . TRP A 1 50 ? 7.093   -5.089  -0.853  1.00 0.00 ? 48 TRP P HZ2  9  
ATOM 10349 H HZ3  . TRP A 1 50 ? 7.065   -0.787  -1.067  1.00 0.00 ? 48 TRP P HZ3  9  
ATOM 10350 H HH2  . TRP A 1 50 ? 7.568   -2.978  -2.109  1.00 0.00 ? 48 TRP P HH2  9  
ATOM 10351 N N    . PHE A 1 51 ? 7.213   0.403   3.588   1.00 0.00 ? 49 PHE P N    9  
ATOM 10352 C CA   . PHE A 1 51 ? 8.166   1.214   2.814   1.00 0.00 ? 49 PHE P CA   9  
ATOM 10353 C C    . PHE A 1 51 ? 9.496   1.449   3.556   1.00 0.00 ? 49 PHE P C    9  
ATOM 10354 O O    . PHE A 1 51 ? 10.556  1.440   2.926   1.00 0.00 ? 49 PHE P O    9  
ATOM 10355 C CB   . PHE A 1 51 ? 7.518   2.533   2.365   1.00 0.00 ? 49 PHE P CB   9  
ATOM 10356 C CG   . PHE A 1 51 ? 6.574   2.381   1.185   1.00 0.00 ? 49 PHE P CG   9  
ATOM 10357 C CD1  . PHE A 1 51 ? 7.088   2.076   -0.092  1.00 0.00 ? 49 PHE P CD1  9  
ATOM 10358 C CD2  . PHE A 1 51 ? 5.186   2.540   1.351   1.00 0.00 ? 49 PHE P CD2  9  
ATOM 10359 C CE1  . PHE A 1 51 ? 6.218   1.906   -1.184  1.00 0.00 ? 49 PHE P CE1  9  
ATOM 10360 C CE2  . PHE A 1 51 ? 4.319   2.374   0.257   1.00 0.00 ? 49 PHE P CE2  9  
ATOM 10361 C CZ   . PHE A 1 51 ? 4.830   2.043   -1.007  1.00 0.00 ? 49 PHE P CZ   9  
ATOM 10362 H H    . PHE A 1 51 ? 6.324   0.812   3.862   1.00 0.00 ? 49 PHE P H    9  
ATOM 10363 H HA   . PHE A 1 51 ? 8.418   0.657   1.912   1.00 0.00 ? 49 PHE P HA   9  
ATOM 10364 H HB2  . PHE A 1 51 ? 6.996   2.989   3.210   1.00 0.00 ? 49 PHE P HB2  9  
ATOM 10365 H HB3  . PHE A 1 51 ? 8.308   3.224   2.062   1.00 0.00 ? 49 PHE P HB3  9  
ATOM 10366 H HD1  . PHE A 1 51 ? 8.153   1.960   -0.233  1.00 0.00 ? 49 PHE P HD1  9  
ATOM 10367 H HD2  . PHE A 1 51 ? 4.782   2.784   2.321   1.00 0.00 ? 49 PHE P HD2  9  
ATOM 10368 H HE1  . PHE A 1 51 ? 6.608   1.662   -2.161  1.00 0.00 ? 49 PHE P HE1  9  
ATOM 10369 H HE2  . PHE A 1 51 ? 3.255   2.500   0.383   1.00 0.00 ? 49 PHE P HE2  9  
ATOM 10370 H HZ   . PHE A 1 51 ? 4.158   1.903   -1.841  1.00 0.00 ? 49 PHE P HZ   9  
ATOM 10371 N N    . LYS A 1 52 ? 9.477   1.564   4.892   1.00 0.00 ? 50 LYS P N    9  
ATOM 10372 C CA   . LYS A 1 52 ? 10.693  1.597   5.728   1.00 0.00 ? 50 LYS P CA   9  
ATOM 10373 C C    . LYS A 1 52 ? 11.489  0.288   5.634   1.00 0.00 ? 50 LYS P C    9  
ATOM 10374 O O    . LYS A 1 52 ? 12.705  0.318   5.450   1.00 0.00 ? 50 LYS P O    9  
ATOM 10375 C CB   . LYS A 1 52 ? 10.294  1.943   7.175   1.00 0.00 ? 50 LYS P CB   9  
ATOM 10376 C CG   . LYS A 1 52 ? 11.512  2.176   8.084   1.00 0.00 ? 50 LYS P CG   9  
ATOM 10377 C CD   . LYS A 1 52 ? 11.063  2.562   9.503   1.00 0.00 ? 50 LYS P CD   9  
ATOM 10378 C CE   . LYS A 1 52 ? 12.243  2.719   10.475  1.00 0.00 ? 50 LYS P CE   9  
ATOM 10379 N NZ   . LYS A 1 52 ? 13.082  3.909   10.170  1.00 0.00 ? 50 LYS P NZ   9  
ATOM 10380 H H    . LYS A 1 52 ? 8.571   1.639   5.346   1.00 0.00 ? 50 LYS P H    9  
ATOM 10381 H HA   . LYS A 1 52 ? 11.346  2.389   5.355   1.00 0.00 ? 50 LYS P HA   9  
ATOM 10382 H HB2  . LYS A 1 52 ? 9.692   2.853   7.164   1.00 0.00 ? 50 LYS P HB2  9  
ATOM 10383 H HB3  . LYS A 1 52 ? 9.691   1.136   7.591   1.00 0.00 ? 50 LYS P HB3  9  
ATOM 10384 H HG2  . LYS A 1 52 ? 12.108  1.264   8.139   1.00 0.00 ? 50 LYS P HG2  9  
ATOM 10385 H HG3  . LYS A 1 52 ? 12.122  2.975   7.662   1.00 0.00 ? 50 LYS P HG3  9  
ATOM 10386 H HD2  . LYS A 1 52 ? 10.488  3.490   9.471   1.00 0.00 ? 50 LYS P HD2  9  
ATOM 10387 H HD3  . LYS A 1 52 ? 10.412  1.774   9.889   1.00 0.00 ? 50 LYS P HD3  9  
ATOM 10388 H HE2  . LYS A 1 52 ? 11.840  2.809   11.489  1.00 0.00 ? 50 LYS P HE2  9  
ATOM 10389 H HE3  . LYS A 1 52 ? 12.851  1.809   10.444  1.00 0.00 ? 50 LYS P HE3  9  
ATOM 10390 H HZ1  . LYS A 1 52 ? 13.831  4.003   10.843  1.00 0.00 ? 50 LYS P HZ1  9  
ATOM 10391 H HZ2  . LYS A 1 52 ? 12.538  4.761   10.203  1.00 0.00 ? 50 LYS P HZ2  9  
ATOM 10392 H HZ3  . LYS A 1 52 ? 13.507  3.842   9.256   1.00 0.00 ? 50 LYS P HZ3  9  
ATOM 10393 N N    . ASN A 1 53 ? 10.810  -0.862  5.668   1.00 0.00 ? 51 ASN P N    9  
ATOM 10394 C CA   . ASN A 1 53 ? 11.433  -2.177  5.461   1.00 0.00 ? 51 ASN P CA   9  
ATOM 10395 C C    . ASN A 1 53 ? 11.939  -2.362  4.016   1.00 0.00 ? 51 ASN P C    9  
ATOM 10396 O O    . ASN A 1 53 ? 13.010  -2.931  3.814   1.00 0.00 ? 51 ASN P O    9  
ATOM 10397 C CB   . ASN A 1 53 ? 10.455  -3.292  5.876   1.00 0.00 ? 51 ASN P CB   9  
ATOM 10398 C CG   . ASN A 1 53 ? 10.454  -3.527  7.379   1.00 0.00 ? 51 ASN P CG   9  
ATOM 10399 O OD1  . ASN A 1 53 ? 11.165  -4.377  7.896   1.00 0.00 ? 51 ASN P OD1  9  
ATOM 10400 N ND2  . ASN A 1 53 ? 9.680   -2.781  8.132   1.00 0.00 ? 51 ASN P ND2  9  
ATOM 10401 H H    . ASN A 1 53 ? 9.809   -0.813  5.822   1.00 0.00 ? 51 ASN P H    9  
ATOM 10402 H HA   . ASN A 1 53 ? 12.316  -2.250  6.101   1.00 0.00 ? 51 ASN P HA   9  
ATOM 10403 H HB2  . ASN A 1 53 ? 9.446   -3.066  5.534   1.00 0.00 ? 51 ASN P HB2  9  
ATOM 10404 H HB3  . ASN A 1 53 ? 10.762  -4.227  5.406   1.00 0.00 ? 51 ASN P HB3  9  
ATOM 10405 H HD21 . ASN A 1 53 ? 9.092   -2.069  7.710   1.00 0.00 ? 51 ASN P HD21 9  
ATOM 10406 H HD22 . ASN A 1 53 ? 9.684   -2.939  9.126   1.00 0.00 ? 51 ASN P HD22 9  
ATOM 10407 N N    . ARG A 1 54 ? 11.237  -1.823  3.012   1.00 0.00 ? 52 ARG P N    9  
ATOM 10408 C CA   . ARG A 1 54 ? 11.666  -1.816  1.602   1.00 0.00 ? 52 ARG P CA   9  
ATOM 10409 C C    . ARG A 1 54 ? 12.942  -0.986  1.397   1.00 0.00 ? 52 ARG P C    9  
ATOM 10410 O O    . ARG A 1 54 ? 13.842  -1.446  0.693   1.00 0.00 ? 52 ARG P O    9  
ATOM 10411 C CB   . ARG A 1 54 ? 10.473  -1.358  0.738   1.00 0.00 ? 52 ARG P CB   9  
ATOM 10412 C CG   . ARG A 1 54 ? 10.667  -1.338  -0.788  1.00 0.00 ? 52 ARG P CG   9  
ATOM 10413 C CD   . ARG A 1 54 ? 11.052  -2.682  -1.424  1.00 0.00 ? 52 ARG P CD   9  
ATOM 10414 N NE   . ARG A 1 54 ? 12.504  -2.909  -1.339  1.00 0.00 ? 52 ARG P NE   9  
ATOM 10415 C CZ   . ARG A 1 54 ? 13.236  -3.778  -2.005  1.00 0.00 ? 52 ARG P CZ   9  
ATOM 10416 N NH1  . ARG A 1 54 ? 12.763  -4.655  -2.836  1.00 0.00 ? 52 ARG P NH1  9  
ATOM 10417 N NH2  . ARG A 1 54 ? 14.520  -3.788  -1.848  1.00 0.00 ? 52 ARG P NH2  9  
ATOM 10418 H H    . ARG A 1 54 ? 10.321  -1.443  3.235   1.00 0.00 ? 52 ARG P H    9  
ATOM 10419 H HA   . ARG A 1 54 ? 11.914  -2.842  1.324   1.00 0.00 ? 52 ARG P HA   9  
ATOM 10420 H HB2  . ARG A 1 54 ? 9.623   -2.008  0.955   1.00 0.00 ? 52 ARG P HB2  9  
ATOM 10421 H HB3  . ARG A 1 54 ? 10.196  -0.349  1.037   1.00 0.00 ? 52 ARG P HB3  9  
ATOM 10422 H HG2  . ARG A 1 54 ? 9.722   -1.020  -1.230  1.00 0.00 ? 52 ARG P HG2  9  
ATOM 10423 H HG3  . ARG A 1 54 ? 11.415  -0.588  -1.044  1.00 0.00 ? 52 ARG P HG3  9  
ATOM 10424 H HD2  . ARG A 1 54 ? 10.507  -3.491  -0.934  1.00 0.00 ? 52 ARG P HD2  9  
ATOM 10425 H HD3  . ARG A 1 54 ? 10.759  -2.654  -2.475  1.00 0.00 ? 52 ARG P HD3  9  
ATOM 10426 H HE   . ARG A 1 54 ? 13.023  -2.289  -0.732  1.00 0.00 ? 52 ARG P HE   9  
ATOM 10427 H HH11 . ARG A 1 54 ? 11.777  -4.719  -3.008  1.00 0.00 ? 52 ARG P HH11 9  
ATOM 10428 H HH12 . ARG A 1 54 ? 13.436  -5.256  -3.309  1.00 0.00 ? 52 ARG P HH12 9  
ATOM 10429 H HH21 . ARG A 1 54 ? 14.971  -3.118  -1.257  1.00 0.00 ? 52 ARG P HH21 9  
ATOM 10430 H HH22 . ARG A 1 54 ? 15.040  -4.466  -2.408  1.00 0.00 ? 52 ARG P HH22 9  
ATOM 10431 N N    . ARG A 1 55 ? 13.084  0.165   2.070   1.00 0.00 ? 53 ARG P N    9  
ATOM 10432 C CA   . ARG A 1 55 ? 14.341  0.948   2.122   1.00 0.00 ? 53 ARG P CA   9  
ATOM 10433 C C    . ARG A 1 55 ? 15.469  0.229   2.873   1.00 0.00 ? 53 ARG P C    9  
ATOM 10434 O O    . ARG A 1 55 ? 16.616  0.299   2.437   1.00 0.00 ? 53 ARG P O    9  
ATOM 10435 C CB   . ARG A 1 55 ? 14.080  2.340   2.733   1.00 0.00 ? 53 ARG P CB   9  
ATOM 10436 C CG   . ARG A 1 55 ? 13.740  3.422   1.694   1.00 0.00 ? 53 ARG P CG   9  
ATOM 10437 C CD   . ARG A 1 55 ? 14.950  3.793   0.817   1.00 0.00 ? 53 ARG P CD   9  
ATOM 10438 N NE   . ARG A 1 55 ? 14.701  5.020   0.035   1.00 0.00 ? 53 ARG P NE   9  
ATOM 10439 C CZ   . ARG A 1 55 ? 15.500  5.555   -0.872  1.00 0.00 ? 53 ARG P CZ   9  
ATOM 10440 N NH1  . ARG A 1 55 ? 16.640  5.021   -1.200  1.00 0.00 ? 53 ARG P NH1  9  
ATOM 10441 N NH2  . ARG A 1 55 ? 15.165  6.658   -1.478  1.00 0.00 ? 53 ARG P NH2  9  
ATOM 10442 H H    . ARG A 1 55 ? 12.274  0.508   2.577   1.00 0.00 ? 53 ARG P H    9  
ATOM 10443 H HA   . ARG A 1 55 ? 14.710  1.070   1.104   1.00 0.00 ? 53 ARG P HA   9  
ATOM 10444 H HB2  . ARG A 1 55 ? 13.267  2.275   3.458   1.00 0.00 ? 53 ARG P HB2  9  
ATOM 10445 H HB3  . ARG A 1 55 ? 14.967  2.671   3.278   1.00 0.00 ? 53 ARG P HB3  9  
ATOM 10446 H HG2  . ARG A 1 55 ? 12.916  3.083   1.064   1.00 0.00 ? 53 ARG P HG2  9  
ATOM 10447 H HG3  . ARG A 1 55 ? 13.416  4.313   2.234   1.00 0.00 ? 53 ARG P HG3  9  
ATOM 10448 H HD2  . ARG A 1 55 ? 15.816  3.957   1.463   1.00 0.00 ? 53 ARG P HD2  9  
ATOM 10449 H HD3  . ARG A 1 55 ? 15.172  2.967   0.140   1.00 0.00 ? 53 ARG P HD3  9  
ATOM 10450 H HE   . ARG A 1 55 ? 13.845  5.517   0.223   1.00 0.00 ? 53 ARG P HE   9  
ATOM 10451 H HH11 . ARG A 1 55 ? 16.949  4.176   -0.749  1.00 0.00 ? 53 ARG P HH11 9  
ATOM 10452 H HH12 . ARG A 1 55 ? 17.217  5.439   -1.907  1.00 0.00 ? 53 ARG P HH12 9  
ATOM 10453 H HH21 . ARG A 1 55 ? 14.279  7.092   -1.286  1.00 0.00 ? 53 ARG P HH21 9  
ATOM 10454 H HH22 . ARG A 1 55 ? 15.768  7.054   -2.178  1.00 0.00 ? 53 ARG P HH22 9  
ATOM 10455 N N    . ALA A 1 56 ? 15.163  -0.512  3.939   1.00 0.00 ? 54 ALA P N    9  
ATOM 10456 C CA   . ALA A 1 56 ? 16.155  -1.343  4.629   1.00 0.00 ? 54 ALA P CA   9  
ATOM 10457 C C    . ALA A 1 56 ? 16.672  -2.478  3.722   1.00 0.00 ? 54 ALA P C    9  
ATOM 10458 O O    . ALA A 1 56 ? 17.881  -2.616  3.537   1.00 0.00 ? 54 ALA P O    9  
ATOM 10459 C CB   . ALA A 1 56 ? 15.559  -1.861  5.945   1.00 0.00 ? 54 ALA P CB   9  
ATOM 10460 H H    . ALA A 1 56 ? 14.220  -0.468  4.305   1.00 0.00 ? 54 ALA P H    9  
ATOM 10461 H HA   . ALA A 1 56 ? 17.012  -0.716  4.881   1.00 0.00 ? 54 ALA P HA   9  
ATOM 10462 H HB1  . ALA A 1 56 ? 14.722  -2.532  5.750   1.00 0.00 ? 54 ALA P HB1  9  
ATOM 10463 H HB2  . ALA A 1 56 ? 16.323  -2.405  6.501   1.00 0.00 ? 54 ALA P HB2  9  
ATOM 10464 H HB3  . ALA A 1 56 ? 15.213  -1.022  6.550   1.00 0.00 ? 54 ALA P HB3  9  
ATOM 10465 N N    . LYS A 1 57 ? 15.775  -3.231  3.068   1.00 0.00 ? 55 LYS P N    9  
ATOM 10466 C CA   . LYS A 1 57 ? 16.123  -4.301  2.110   1.00 0.00 ? 55 LYS P CA   9  
ATOM 10467 C C    . LYS A 1 57 ? 16.885  -3.778  0.890   1.00 0.00 ? 55 LYS P C    9  
ATOM 10468 O O    . LYS A 1 57 ? 17.821  -4.432  0.435   1.00 0.00 ? 55 LYS P O    9  
ATOM 10469 C CB   . LYS A 1 57 ? 14.845  -5.042  1.677   1.00 0.00 ? 55 LYS P CB   9  
ATOM 10470 C CG   . LYS A 1 57 ? 14.277  -5.916  2.806   1.00 0.00 ? 55 LYS P CG   9  
ATOM 10471 C CD   . LYS A 1 57 ? 12.943  -6.552  2.393   1.00 0.00 ? 55 LYS P CD   9  
ATOM 10472 C CE   . LYS A 1 57 ? 12.387  -7.404  3.542   1.00 0.00 ? 55 LYS P CE   9  
ATOM 10473 N NZ   . LYS A 1 57 ? 11.101  -8.053  3.171   1.00 0.00 ? 55 LYS P NZ   9  
ATOM 10474 H H    . LYS A 1 57 ? 14.793  -3.078  3.283   1.00 0.00 ? 55 LYS P H    9  
ATOM 10475 H HA   . LYS A 1 57 ? 16.788  -5.014  2.602   1.00 0.00 ? 55 LYS P HA   9  
ATOM 10476 H HB2  . LYS A 1 57 ? 14.094  -4.316  1.359   1.00 0.00 ? 55 LYS P HB2  9  
ATOM 10477 H HB3  . LYS A 1 57 ? 15.075  -5.690  0.829   1.00 0.00 ? 55 LYS P HB3  9  
ATOM 10478 H HG2  . LYS A 1 57 ? 14.995  -6.703  3.043   1.00 0.00 ? 55 LYS P HG2  9  
ATOM 10479 H HG3  . LYS A 1 57 ? 14.120  -5.313  3.701   1.00 0.00 ? 55 LYS P HG3  9  
ATOM 10480 H HD2  . LYS A 1 57 ? 12.230  -5.764  2.146   1.00 0.00 ? 55 LYS P HD2  9  
ATOM 10481 H HD3  . LYS A 1 57 ? 13.101  -7.180  1.513   1.00 0.00 ? 55 LYS P HD3  9  
ATOM 10482 H HE2  . LYS A 1 57 ? 13.127  -8.166  3.805   1.00 0.00 ? 55 LYS P HE2  9  
ATOM 10483 H HE3  . LYS A 1 57 ? 12.244  -6.762  4.416   1.00 0.00 ? 55 LYS P HE3  9  
ATOM 10484 H HZ1  . LYS A 1 57 ? 10.395  -7.368  2.938   1.00 0.00 ? 55 LYS P HZ1  9  
ATOM 10485 H HZ2  . LYS A 1 57 ? 10.744  -8.610  3.937   1.00 0.00 ? 55 LYS P HZ2  9  
ATOM 10486 H HZ3  . LYS A 1 57 ? 11.215  -8.668  2.376   1.00 0.00 ? 55 LYS P HZ3  9  
ATOM 10487 N N    . TRP A 1 58 ? 16.548  -2.583  0.398   1.00 0.00 ? 56 TRP P N    9  
ATOM 10488 C CA   . TRP A 1 58 ? 17.260  -1.909  -0.701  1.00 0.00 ? 56 TRP P CA   9  
ATOM 10489 C C    . TRP A 1 58 ? 18.762  -1.730  -0.416  1.00 0.00 ? 56 TRP P C    9  
ATOM 10490 O O    . TRP A 1 58 ? 19.572  -1.912  -1.323  1.00 0.00 ? 56 TRP P O    9  
ATOM 10491 C CB   . TRP A 1 58 ? 16.574  -0.562  -0.976  1.00 0.00 ? 56 TRP P CB   9  
ATOM 10492 C CG   . TRP A 1 58 ? 17.331  0.404   -1.833  1.00 0.00 ? 56 TRP P CG   9  
ATOM 10493 C CD1  . TRP A 1 58 ? 17.460  0.330   -3.176  1.00 0.00 ? 56 TRP P CD1  9  
ATOM 10494 C CD2  . TRP A 1 58 ? 18.091  1.584   -1.423  1.00 0.00 ? 56 TRP P CD2  9  
ATOM 10495 N NE1  . TRP A 1 58 ? 18.227  1.388   -3.629  1.00 0.00 ? 56 TRP P NE1  9  
ATOM 10496 C CE2  . TRP A 1 58 ? 18.646  2.191   -2.590  1.00 0.00 ? 56 TRP P CE2  9  
ATOM 10497 C CE3  . TRP A 1 58 ? 18.375  2.198   -0.182  1.00 0.00 ? 56 TRP P CE3  9  
ATOM 10498 C CZ2  . TRP A 1 58 ? 19.438  3.349   -2.530  1.00 0.00 ? 56 TRP P CZ2  9  
ATOM 10499 C CZ3  . TRP A 1 58 ? 19.184  3.350   -0.109  1.00 0.00 ? 56 TRP P CZ3  9  
ATOM 10500 C CH2  . TRP A 1 58 ? 19.715  3.925   -1.278  1.00 0.00 ? 56 TRP P CH2  9  
ATOM 10501 H H    . TRP A 1 58 ? 15.768  -2.102  0.833   1.00 0.00 ? 56 TRP P H    9  
ATOM 10502 H HA   . TRP A 1 58 ? 17.192  -2.515  -1.605  1.00 0.00 ? 56 TRP P HA   9  
ATOM 10503 H HB2  . TRP A 1 58 ? 15.604  -0.748  -1.438  1.00 0.00 ? 56 TRP P HB2  9  
ATOM 10504 H HB3  . TRP A 1 58 ? 16.388  -0.065  -0.030  1.00 0.00 ? 56 TRP P HB3  9  
ATOM 10505 H HD1  . TRP A 1 58 ? 17.028  -0.448  -3.794  1.00 0.00 ? 56 TRP P HD1  9  
ATOM 10506 H HE1  . TRP A 1 58 ? 18.444  1.536   -4.608  1.00 0.00 ? 56 TRP P HE1  9  
ATOM 10507 H HE3  . TRP A 1 58 ? 17.984  1.759   0.726   1.00 0.00 ? 56 TRP P HE3  9  
ATOM 10508 H HZ2  . TRP A 1 58 ? 19.849  3.775   -3.435  1.00 0.00 ? 56 TRP P HZ2  9  
ATOM 10509 H HZ3  . TRP A 1 58 ? 19.405  3.794   0.854   1.00 0.00 ? 56 TRP P HZ3  9  
ATOM 10510 H HH2  . TRP A 1 58 ? 20.340  4.807   -1.213  1.00 0.00 ? 56 TRP P HH2  9  
ATOM 10511 N N    . ARG A 1 59 ? 19.138  -1.442  0.841   1.00 0.00 ? 57 ARG P N    9  
ATOM 10512 C CA   . ARG A 1 59 ? 20.541  -1.281  1.270   1.00 0.00 ? 57 ARG P CA   9  
ATOM 10513 C C    . ARG A 1 59 ? 21.192  -2.565  1.811   1.00 0.00 ? 57 ARG P C    9  
ATOM 10514 O O    . ARG A 1 59 ? 22.385  -2.777  1.592   1.00 0.00 ? 57 ARG P O    9  
ATOM 10515 C CB   . ARG A 1 59 ? 20.621  -0.111  2.268   1.00 0.00 ? 57 ARG P CB   9  
ATOM 10516 C CG   . ARG A 1 59 ? 22.066  0.361   2.485   1.00 0.00 ? 57 ARG P CG   9  
ATOM 10517 C CD   . ARG A 1 59 ? 22.124  1.620   3.355   1.00 0.00 ? 57 ARG P CD   9  
ATOM 10518 N NE   . ARG A 1 59 ? 23.513  2.104   3.487   1.00 0.00 ? 57 ARG P NE   9  
ATOM 10519 C CZ   . ARG A 1 59 ? 23.924  3.157   4.172   1.00 0.00 ? 57 ARG P CZ   9  
ATOM 10520 N NH1  . ARG A 1 59 ? 23.100  3.909   4.847   1.00 0.00 ? 57 ARG P NH1  9  
ATOM 10521 N NH2  . ARG A 1 59 ? 25.186  3.476   4.194   1.00 0.00 ? 57 ARG P NH2  9  
ATOM 10522 H H    . ARG A 1 59 ? 18.402  -1.269  1.514   1.00 0.00 ? 57 ARG P H    9  
ATOM 10523 H HA   . ARG A 1 59 ? 21.130  -1.001  0.398   1.00 0.00 ? 57 ARG P HA   9  
ATOM 10524 H HB2  . ARG A 1 59 ? 20.045  0.727   1.871   1.00 0.00 ? 57 ARG P HB2  9  
ATOM 10525 H HB3  . ARG A 1 59 ? 20.182  -0.409  3.223   1.00 0.00 ? 57 ARG P HB3  9  
ATOM 10526 H HG2  . ARG A 1 59 ? 22.646  -0.427  2.964   1.00 0.00 ? 57 ARG P HG2  9  
ATOM 10527 H HG3  . ARG A 1 59 ? 22.512  0.591   1.518   1.00 0.00 ? 57 ARG P HG3  9  
ATOM 10528 H HD2  . ARG A 1 59 ? 21.512  2.397   2.892   1.00 0.00 ? 57 ARG P HD2  9  
ATOM 10529 H HD3  . ARG A 1 59 ? 21.718  1.388   4.341   1.00 0.00 ? 57 ARG P HD3  9  
ATOM 10530 H HE   . ARG A 1 59 ? 24.224  1.592   2.986   1.00 0.00 ? 57 ARG P HE   9  
ATOM 10531 H HH11 . ARG A 1 59 ? 22.120  3.689   4.845   1.00 0.00 ? 57 ARG P HH11 9  
ATOM 10532 H HH12 . ARG A 1 59 ? 23.438  4.706   5.360   1.00 0.00 ? 57 ARG P HH12 9  
ATOM 10533 H HH21 . ARG A 1 59 ? 25.858  2.923   3.688   1.00 0.00 ? 57 ARG P HH21 9  
ATOM 10534 H HH22 . ARG A 1 59 ? 25.497  4.278   4.715   1.00 0.00 ? 57 ARG P HH22 9  
ATOM 10535 N N    . LYS A 1 60 ? 20.438  -3.415  2.521   1.00 0.00 ? 58 LYS P N    9  
ATOM 10536 C CA   . LYS A 1 60 ? 20.962  -4.574  3.280   1.00 0.00 ? 58 LYS P CA   9  
ATOM 10537 C C    . LYS A 1 60 ? 20.835  -5.932  2.572   1.00 0.00 ? 58 LYS P C    9  
ATOM 10538 O O    . LYS A 1 60 ? 21.579  -6.855  2.916   1.00 0.00 ? 58 LYS P O    9  
ATOM 10539 C CB   . LYS A 1 60 ? 20.290  -4.625  4.668   1.00 0.00 ? 58 LYS P CB   9  
ATOM 10540 C CG   . LYS A 1 60 ? 20.525  -3.387  5.554   1.00 0.00 ? 58 LYS P CG   9  
ATOM 10541 C CD   . LYS A 1 60 ? 22.000  -3.179  5.927   1.00 0.00 ? 58 LYS P CD   9  
ATOM 10542 C CE   . LYS A 1 60 ? 22.133  -2.025  6.928   1.00 0.00 ? 58 LYS P CE   9  
ATOM 10543 N NZ   . LYS A 1 60 ? 23.543  -1.833  7.359   1.00 0.00 ? 58 LYS P NZ   9  
ATOM 10544 H H    . LYS A 1 60 ? 19.479  -3.131  2.697   1.00 0.00 ? 58 LYS P H    9  
ATOM 10545 H HA   . LYS A 1 60 ? 22.034  -4.442  3.433   1.00 0.00 ? 58 LYS P HA   9  
ATOM 10546 H HB2  . LYS A 1 60 ? 19.215  -4.756  4.535   1.00 0.00 ? 58 LYS P HB2  9  
ATOM 10547 H HB3  . LYS A 1 60 ? 20.659  -5.500  5.206   1.00 0.00 ? 58 LYS P HB3  9  
ATOM 10548 H HG2  . LYS A 1 60 ? 20.152  -2.493  5.053   1.00 0.00 ? 58 LYS P HG2  9  
ATOM 10549 H HG3  . LYS A 1 60 ? 19.949  -3.520  6.472   1.00 0.00 ? 58 LYS P HG3  9  
ATOM 10550 H HD2  . LYS A 1 60 ? 22.389  -4.095  6.376   1.00 0.00 ? 58 LYS P HD2  9  
ATOM 10551 H HD3  . LYS A 1 60 ? 22.578  -2.945  5.031   1.00 0.00 ? 58 LYS P HD3  9  
ATOM 10552 H HE2  . LYS A 1 60 ? 21.754  -1.110  6.464   1.00 0.00 ? 58 LYS P HE2  9  
ATOM 10553 H HE3  . LYS A 1 60 ? 21.506  -2.242  7.798   1.00 0.00 ? 58 LYS P HE3  9  
ATOM 10554 H HZ1  . LYS A 1 60 ? 23.621  -1.070  8.019   1.00 0.00 ? 58 LYS P HZ1  9  
ATOM 10555 H HZ2  . LYS A 1 60 ? 24.145  -1.621  6.574   1.00 0.00 ? 58 LYS P HZ2  9  
ATOM 10556 H HZ3  . LYS A 1 60 ? 23.905  -2.662  7.811   1.00 0.00 ? 58 LYS P HZ3  9  
ATOM 10557 N N    . ARG A 1 61 ? 19.921  -6.071  1.603   1.00 0.00 ? 59 ARG P N    9  
ATOM 10558 C CA   . ARG A 1 61 ? 19.635  -7.321  0.863   1.00 0.00 ? 59 ARG P CA   9  
ATOM 10559 C C    . ARG A 1 61 ? 19.891  -7.200  -0.644  1.00 0.00 ? 59 ARG P C    9  
ATOM 10560 O O    . ARG A 1 61 ? 20.355  -8.156  -1.265  1.00 0.00 ? 59 ARG P O    9  
ATOM 10561 C CB   . ARG A 1 61 ? 18.195  -7.759  1.189   1.00 0.00 ? 59 ARG P CB   9  
ATOM 10562 C CG   . ARG A 1 61 ? 17.823  -9.126  0.588   1.00 0.00 ? 59 ARG P CG   9  
ATOM 10563 C CD   . ARG A 1 61 ? 16.436  -9.599  1.049   1.00 0.00 ? 59 ARG P CD   9  
ATOM 10564 N NE   . ARG A 1 61 ? 16.413  -9.957  2.485   1.00 0.00 ? 59 ARG P NE   9  
ATOM 10565 C CZ   . ARG A 1 61 ? 16.738  -11.120 3.025   1.00 0.00 ? 59 ARG P CZ   9  
ATOM 10566 N NH1  . ARG A 1 61 ? 17.138  -12.135 2.312   1.00 0.00 ? 59 ARG P NH1  9  
ATOM 10567 N NH2  . ARG A 1 61 ? 16.669  -11.287 4.315   1.00 0.00 ? 59 ARG P NH2  9  
ATOM 10568 H H    . ARG A 1 61 ? 19.354  -5.259  1.391   1.00 0.00 ? 59 ARG P H    9  
ATOM 10569 H HA   . ARG A 1 61 ? 20.307  -8.109  1.214   1.00 0.00 ? 59 ARG P HA   9  
ATOM 10570 H HB2  . ARG A 1 61 ? 18.094  -7.814  2.275   1.00 0.00 ? 59 ARG P HB2  9  
ATOM 10571 H HB3  . ARG A 1 61 ? 17.492  -7.014  0.819   1.00 0.00 ? 59 ARG P HB3  9  
ATOM 10572 H HG2  . ARG A 1 61 ? 17.810  -9.044  -0.500  1.00 0.00 ? 59 ARG P HG2  9  
ATOM 10573 H HG3  . ARG A 1 61 ? 18.571  -9.867  0.871   1.00 0.00 ? 59 ARG P HG3  9  
ATOM 10574 H HD2  . ARG A 1 61 ? 15.711  -8.805  0.862   1.00 0.00 ? 59 ARG P HD2  9  
ATOM 10575 H HD3  . ARG A 1 61 ? 16.136  -10.458 0.446   1.00 0.00 ? 59 ARG P HD3  9  
ATOM 10576 H HE   . ARG A 1 61 ? 16.116  -9.239  3.127   1.00 0.00 ? 59 ARG P HE   9  
ATOM 10577 H HH11 . ARG A 1 61 ? 17.202  -12.039 1.314   1.00 0.00 ? 59 ARG P HH11 9  
ATOM 10578 H HH12 . ARG A 1 61 ? 17.378  -13.008 2.751   1.00 0.00 ? 59 ARG P HH12 9  
ATOM 10579 H HH21 . ARG A 1 61 ? 16.370  -10.533 4.912   1.00 0.00 ? 59 ARG P HH21 9  
ATOM 10580 H HH22 . ARG A 1 61 ? 16.918  -12.172 4.725   1.00 0.00 ? 59 ARG P HH22 9  
ATOM 10581 N N    . GLU A 1 62 ? 19.630  -6.029  -1.221  1.00 0.00 ? 60 GLU P N    9  
ATOM 10582 C CA   . GLU A 1 62 ? 19.878  -5.692  -2.632  1.00 0.00 ? 60 GLU P CA   9  
ATOM 10583 C C    . GLU A 1 62 ? 20.976  -4.611  -2.789  1.00 0.00 ? 60 GLU P C    9  
ATOM 10584 O O    . GLU A 1 62 ? 21.608  -4.197  -1.813  1.00 0.00 ? 60 GLU P O    9  
ATOM 10585 C CB   . GLU A 1 62 ? 18.542  -5.309  -3.303  1.00 0.00 ? 60 GLU P CB   9  
ATOM 10586 C CG   . GLU A 1 62 ? 17.567  -6.497  -3.343  1.00 0.00 ? 60 GLU P CG   9  
ATOM 10587 C CD   . GLU A 1 62 ? 16.319  -6.177  -4.185  1.00 0.00 ? 60 GLU P CD   9  
ATOM 10588 O OE1  . GLU A 1 62 ? 16.347  -6.371  -5.424  1.00 0.00 ? 60 GLU P OE1  9  
ATOM 10589 O OE2  . GLU A 1 62 ? 15.298  -5.735  -3.604  1.00 0.00 ? 60 GLU P OE2  9  
ATOM 10590 H H    . GLU A 1 62 ? 19.217  -5.311  -0.640  1.00 0.00 ? 60 GLU P H    9  
ATOM 10591 H HA   . GLU A 1 62 ? 20.256  -6.570  -3.157  1.00 0.00 ? 60 GLU P HA   9  
ATOM 10592 H HB2  . GLU A 1 62 ? 18.084  -4.477  -2.767  1.00 0.00 ? 60 GLU P HB2  9  
ATOM 10593 H HB3  . GLU A 1 62 ? 18.735  -4.996  -4.329  1.00 0.00 ? 60 GLU P HB3  9  
ATOM 10594 H HG2  . GLU A 1 62 ? 18.078  -7.365  -3.766  1.00 0.00 ? 60 GLU P HG2  9  
ATOM 10595 H HG3  . GLU A 1 62 ? 17.264  -6.754  -2.324  1.00 0.00 ? 60 GLU P HG3  9  
ATOM 10596 N N    . GLU A 1 63 ? 21.256  -4.191  -4.027  1.00 0.00 ? 61 GLU P N    9  
ATOM 10597 C CA   . GLU A 1 63 ? 22.284  -3.192  -4.359  1.00 0.00 ? 61 GLU P CA   9  
ATOM 10598 C C    . GLU A 1 63 ? 21.727  -1.751  -4.349  1.00 0.00 ? 61 GLU P C    9  
ATOM 10599 O O    . GLU A 1 63 ? 20.635  -1.492  -4.861  1.00 0.00 ? 61 GLU P O    9  
ATOM 10600 C CB   . GLU A 1 63 ? 22.920  -3.566  -5.710  1.00 0.00 ? 61 GLU P CB   9  
ATOM 10601 C CG   . GLU A 1 63 ? 24.119  -2.684  -6.078  1.00 0.00 ? 61 GLU P CG   9  
ATOM 10602 C CD   . GLU A 1 63 ? 24.807  -3.203  -7.357  1.00 0.00 ? 61 GLU P CD   9  
ATOM 10603 O OE1  . GLU A 1 63 ? 24.305  -2.934  -8.475  1.00 0.00 ? 61 GLU P OE1  9  
ATOM 10604 O OE2  . GLU A 1 63 ? 25.855  -3.886  -7.252  1.00 0.00 ? 61 GLU P OE2  9  
ATOM 10605 H H    . GLU A 1 63 ? 20.702  -4.553  -4.790  1.00 0.00 ? 61 GLU P H    9  
ATOM 10606 H HA   . GLU A 1 63 ? 23.075  -3.247  -3.608  1.00 0.00 ? 61 GLU P HA   9  
ATOM 10607 H HB2  . GLU A 1 63 ? 23.262  -4.601  -5.656  1.00 0.00 ? 61 GLU P HB2  9  
ATOM 10608 H HB3  . GLU A 1 63 ? 22.167  -3.495  -6.496  1.00 0.00 ? 61 GLU P HB3  9  
ATOM 10609 H HG2  . GLU A 1 63 ? 23.776  -1.660  -6.231  1.00 0.00 ? 61 GLU P HG2  9  
ATOM 10610 H HG3  . GLU A 1 63 ? 24.827  -2.678  -5.246  1.00 0.00 ? 61 GLU P HG3  9  
ATOM 10611 N N    . PHE A 1 64 ? 22.502  -0.809  -3.793  1.00 0.00 ? 62 PHE P N    9  
ATOM 10612 C CA   . PHE A 1 64 ? 22.086  0.578   -3.512  1.00 0.00 ? 62 PHE P CA   9  
ATOM 10613 C C    . PHE A 1 64 ? 22.975  1.666   -4.158  1.00 0.00 ? 62 PHE P C    9  
ATOM 10614 O O    . PHE A 1 64 ? 22.798  2.855   -3.882  1.00 0.00 ? 62 PHE P O    9  
ATOM 10615 C CB   . PHE A 1 64 ? 21.981  0.757   -1.988  1.00 0.00 ? 62 PHE P CB   9  
ATOM 10616 C CG   . PHE A 1 64 ? 23.278  0.550   -1.221  1.00 0.00 ? 62 PHE P CG   9  
ATOM 10617 C CD1  . PHE A 1 64 ? 23.650  -0.739  -0.791  1.00 0.00 ? 62 PHE P CD1  9  
ATOM 10618 C CD2  . PHE A 1 64 ? 24.104  1.650   -0.920  1.00 0.00 ? 62 PHE P CD2  9  
ATOM 10619 C CE1  . PHE A 1 64 ? 24.840  -0.925  -0.065  1.00 0.00 ? 62 PHE P CE1  9  
ATOM 10620 C CE2  . PHE A 1 64 ? 25.296  1.462   -0.197  1.00 0.00 ? 62 PHE P CE2  9  
ATOM 10621 C CZ   . PHE A 1 64 ? 25.664  0.174   0.231   1.00 0.00 ? 62 PHE P CZ   9  
ATOM 10622 H H    . PHE A 1 64 ? 23.383  -1.102  -3.396  1.00 0.00 ? 62 PHE P H    9  
ATOM 10623 H HA   . PHE A 1 64 ? 21.088  0.735   -3.920  1.00 0.00 ? 62 PHE P HA   9  
ATOM 10624 H HB2  . PHE A 1 64 ? 21.607  1.757   -1.770  1.00 0.00 ? 62 PHE P HB2  9  
ATOM 10625 H HB3  . PHE A 1 64 ? 21.236  0.061   -1.611  1.00 0.00 ? 62 PHE P HB3  9  
ATOM 10626 H HD1  . PHE A 1 64 ? 23.016  -1.589  -1.005  1.00 0.00 ? 62 PHE P HD1  9  
ATOM 10627 H HD2  . PHE A 1 64 ? 23.824  2.644   -1.243  1.00 0.00 ? 62 PHE P HD2  9  
ATOM 10628 H HE1  . PHE A 1 64 ? 25.118  -1.917  0.269   1.00 0.00 ? 62 PHE P HE1  9  
ATOM 10629 H HE2  . PHE A 1 64 ? 25.930  2.309   0.029   1.00 0.00 ? 62 PHE P HE2  9  
ATOM 10630 H HZ   . PHE A 1 64 ? 26.582  0.028   0.787   1.00 0.00 ? 62 PHE P HZ   9  
ATOM 10631 N N    . ILE A 1 65 ? 23.938  1.285   -5.008  1.00 0.00 ? 63 ILE P N    9  
ATOM 10632 C CA   . ILE A 1 65 ? 24.887  2.220   -5.640  1.00 0.00 ? 63 ILE P CA   9  
ATOM 10633 C C    . ILE A 1 65 ? 24.194  3.188   -6.623  1.00 0.00 ? 63 ILE P C    9  
ATOM 10634 O O    . ILE A 1 65 ? 23.231  2.825   -7.306  1.00 0.00 ? 63 ILE P O    9  
ATOM 10635 C CB   . ILE A 1 65 ? 26.075  1.452   -6.271  1.00 0.00 ? 63 ILE P CB   9  
ATOM 10636 C CG1  . ILE A 1 65 ? 27.265  2.402   -6.540  1.00 0.00 ? 63 ILE P CG1  9  
ATOM 10637 C CG2  . ILE A 1 65 ? 25.667  0.689   -7.544  1.00 0.00 ? 63 ILE P CG2  9  
ATOM 10638 C CD1  . ILE A 1 65 ? 28.561  1.676   -6.919  1.00 0.00 ? 63 ILE P CD1  9  
ATOM 10639 H H    . ILE A 1 65 ? 24.013  0.305   -5.232  1.00 0.00 ? 63 ILE P H    9  
ATOM 10640 H HA   . ILE A 1 65 ? 25.299  2.830   -4.834  1.00 0.00 ? 63 ILE P HA   9  
ATOM 10641 H HB   . ILE A 1 65 ? 26.407  0.717   -5.535  1.00 0.00 ? 63 ILE P HB   9  
ATOM 10642 H HG12 . ILE A 1 65 ? 27.011  3.095   -7.342  1.00 0.00 ? 63 ILE P HG12 9  
ATOM 10643 H HG13 . ILE A 1 65 ? 27.463  2.981   -5.637  1.00 0.00 ? 63 ILE P HG13 9  
ATOM 10644 H HG21 . ILE A 1 65 ? 24.749  0.129   -7.377  1.00 0.00 ? 63 ILE P HG21 9  
ATOM 10645 H HG22 . ILE A 1 65 ? 25.507  1.385   -8.369  1.00 0.00 ? 63 ILE P HG22 9  
ATOM 10646 H HG23 . ILE A 1 65 ? 26.449  -0.016  -7.825  1.00 0.00 ? 63 ILE P HG23 9  
ATOM 10647 H HD11 . ILE A 1 65 ? 28.819  0.947   -6.150  1.00 0.00 ? 63 ILE P HD11 9  
ATOM 10648 H HD12 . ILE A 1 65 ? 28.450  1.172   -7.878  1.00 0.00 ? 63 ILE P HD12 9  
ATOM 10649 H HD13 . ILE A 1 65 ? 29.369  2.404   -7.001  1.00 0.00 ? 63 ILE P HD13 9  
ATOM 10650 N N    . VAL A 1 66 ? 24.688  4.428   -6.691  1.00 0.00 ? 64 VAL P N    9  
ATOM 10651 C CA   . VAL A 1 66 ? 24.180  5.509   -7.556  1.00 0.00 ? 64 VAL P CA   9  
ATOM 10652 C C    . VAL A 1 66 ? 25.327  6.429   -8.006  1.00 0.00 ? 64 VAL P C    9  
ATOM 10653 O O    . VAL A 1 66 ? 26.344  6.542   -7.314  1.00 0.00 ? 64 VAL P O    9  
ATOM 10654 C CB   . VAL A 1 66 ? 23.043  6.271   -6.833  1.00 0.00 ? 64 VAL P CB   9  
ATOM 10655 C CG1  . VAL A 1 66 ? 23.519  7.087   -5.624  1.00 0.00 ? 64 VAL P CG1  9  
ATOM 10656 C CG2  . VAL A 1 66 ? 22.252  7.187   -7.774  1.00 0.00 ? 64 VAL P CG2  9  
ATOM 10657 H H    . VAL A 1 66 ? 25.487  4.651   -6.113  1.00 0.00 ? 64 VAL P H    9  
ATOM 10658 H HA   . VAL A 1 66 ? 23.757  5.057   -8.453  1.00 0.00 ? 64 VAL P HA   9  
ATOM 10659 H HB   . VAL A 1 66 ? 22.336  5.527   -6.462  1.00 0.00 ? 64 VAL P HB   9  
ATOM 10660 H HG11 . VAL A 1 66 ? 22.658  7.521   -5.116  1.00 0.00 ? 64 VAL P HG11 9  
ATOM 10661 H HG12 . VAL A 1 66 ? 24.044  6.440   -4.921  1.00 0.00 ? 64 VAL P HG12 9  
ATOM 10662 H HG13 . VAL A 1 66 ? 24.183  7.891   -5.942  1.00 0.00 ? 64 VAL P HG13 9  
ATOM 10663 H HG21 . VAL A 1 66 ? 22.861  8.033   -8.092  1.00 0.00 ? 64 VAL P HG21 9  
ATOM 10664 H HG22 . VAL A 1 66 ? 21.918  6.624   -8.647  1.00 0.00 ? 64 VAL P HG22 9  
ATOM 10665 H HG23 . VAL A 1 66 ? 21.374  7.569   -7.252  1.00 0.00 ? 64 VAL P HG23 9  
ATOM 10666 N N    . THR A 1 67 ? 25.176  7.080   -9.165  1.00 0.00 ? 65 THR P N    9  
ATOM 10667 C CA   . THR A 1 67 ? 26.179  7.984   -9.774  1.00 0.00 ? 65 THR P CA   9  
ATOM 10668 C C    . THR A 1 67 ? 27.544  7.295   -9.981  1.00 0.00 ? 65 THR P C    9  
ATOM 10669 O O    . THR A 1 67 ? 28.597  7.793   -9.572  1.00 0.00 ? 65 THR P O    9  
ATOM 10670 C CB   . THR A 1 67 ? 26.270  9.335   -9.027  1.00 0.00 ? 65 THR P CB   9  
ATOM 10671 O OG1  . THR A 1 67 ? 24.978  9.799   -8.670  1.00 0.00 ? 65 THR P OG1  9  
ATOM 10672 C CG2  . THR A 1 67 ? 26.878  10.448  -9.887  1.00 0.00 ? 65 THR P CG2  9  
ATOM 10673 H H    . THR A 1 67 ? 24.298  6.972   -9.653  1.00 0.00 ? 65 THR P H    9  
ATOM 10674 H HA   . THR A 1 67 ? 25.814  8.216   -10.774 1.00 0.00 ? 65 THR P HA   9  
ATOM 10675 H HB   . THR A 1 67 ? 26.859  9.211   -8.117  1.00 0.00 ? 65 THR P HB   9  
ATOM 10676 H HG1  . THR A 1 67 ? 25.095  10.596  -8.123  1.00 0.00 ? 65 THR P HG1  9  
ATOM 10677 H HG21 . THR A 1 67 ? 26.911  11.377  -9.319  1.00 0.00 ? 65 THR P HG21 9  
ATOM 10678 H HG22 . THR A 1 67 ? 26.278  10.597  -10.786 1.00 0.00 ? 65 THR P HG22 9  
ATOM 10679 H HG23 . THR A 1 67 ? 27.895  10.192  -10.178 1.00 0.00 ? 65 THR P HG23 9  
ATOM 10680 N N    . ASP A 1 68 ? 27.516  6.110   -10.606 1.00 0.00 ? 66 ASP P N    9  
ATOM 10681 C CA   . ASP A 1 68 ? 28.680  5.258   -10.925 1.00 0.00 ? 66 ASP P CA   9  
ATOM 10682 C C    . ASP A 1 68 ? 28.628  4.691   -12.361 1.00 0.00 ? 66 ASP P C    9  
ATOM 10683 O O    . ASP A 1 68 ? 29.657  4.772   -13.068 1.00 0.00 ? 66 ASP P O    9  
ATOM 10684 C CB   . ASP A 1 68 ? 28.794  4.128   -9.883  1.00 0.00 ? 66 ASP P CB   9  
ATOM 10685 C CG   . ASP A 1 68 ? 30.023  3.222   -10.116 1.00 0.00 ? 66 ASP P CG   9  
ATOM 10686 O OD1  . ASP A 1 68 ? 31.158  3.639   -9.774  1.00 0.00 ? 66 ASP P OD1  9  
ATOM 10687 O OD2  . ASP A 1 68 ? 29.862  2.083   -10.622 1.00 0.00 ? 66 ASP P OD2  9  
ATOM 10688 O OXT  . ASP A 1 68 ? 27.554  4.200   -12.783 1.00 0.00 ? 66 ASP P OXT  9  
ATOM 10689 H H    . ASP A 1 68 ? 26.615  5.773   -10.912 1.00 0.00 ? 66 ASP P H    9  
ATOM 10690 H HA   . ASP A 1 68 ? 29.589  5.857   -10.856 1.00 0.00 ? 66 ASP P HA   9  
ATOM 10691 H HB2  . ASP A 1 68 ? 28.862  4.571   -8.887  1.00 0.00 ? 66 ASP P HB2  9  
ATOM 10692 H HB3  . ASP A 1 68 ? 27.882  3.525   -9.909  1.00 0.00 ? 66 ASP P HB3  9  
ATOM 10693 N N    . GLY A 1 1  ? -20.894 -4.503  11.459  1.00 0.00 ? -1 GLY P N    10 
ATOM 10694 C CA   . GLY A 1 1  ? -22.132 -5.053  10.863  1.00 0.00 ? -1 GLY P CA   10 
ATOM 10695 C C    . GLY A 1 1  ? -21.985 -6.535  10.553  1.00 0.00 ? -1 GLY P C    10 
ATOM 10696 O O    . GLY A 1 1  ? -20.948 -6.963  10.045  1.00 0.00 ? -1 GLY P O    10 
ATOM 10697 H H1   . GLY A 1 1  ? -21.001 -3.515  11.633  1.00 0.00 ? -1 GLY P H1   10 
ATOM 10698 H H2   . GLY A 1 1  ? -20.117 -4.640  10.831  1.00 0.00 ? -1 GLY P H2   10 
ATOM 10699 H H3   . GLY A 1 1  ? -20.689 -4.964  12.332  1.00 0.00 ? -1 GLY P H3   10 
ATOM 10700 H HA2  . GLY A 1 1  ? -22.963 -4.913  11.555  1.00 0.00 ? -1 GLY P HA2  10 
ATOM 10701 H HA3  . GLY A 1 1  ? -22.355 -4.529  9.934   1.00 0.00 ? -1 GLY P HA3  10 
ATOM 10702 N N    . SER A 1 2  ? -23.021 -7.331  10.830  1.00 0.00 ? 0  SER P N    10 
ATOM 10703 C CA   . SER A 1 2  ? -23.016 -8.810  10.766  1.00 0.00 ? 0  SER P CA   10 
ATOM 10704 C C    . SER A 1 2  ? -23.152 -9.386  9.341   1.00 0.00 ? 0  SER P C    10 
ATOM 10705 O O    . SER A 1 2  ? -23.941 -10.300 9.093   1.00 0.00 ? 0  SER P O    10 
ATOM 10706 C CB   . SER A 1 2  ? -24.088 -9.379  11.712  1.00 0.00 ? 0  SER P CB   10 
ATOM 10707 O OG   . SER A 1 2  ? -23.923 -8.860  13.026  1.00 0.00 ? 0  SER P OG   10 
ATOM 10708 H H    . SER A 1 2  ? -23.842 -6.909  11.242  1.00 0.00 ? 0  SER P H    10 
ATOM 10709 H HA   . SER A 1 2  ? -22.052 -9.157  11.141  1.00 0.00 ? 0  SER P HA   10 
ATOM 10710 H HB2  . SER A 1 2  ? -25.078 -9.113  11.339  1.00 0.00 ? 0  SER P HB2  10 
ATOM 10711 H HB3  . SER A 1 2  ? -24.004 -10.467 11.742  1.00 0.00 ? 0  SER P HB3  10 
ATOM 10712 H HG   . SER A 1 2  ? -24.609 -9.256  13.600  1.00 0.00 ? 0  SER P HG   10 
ATOM 10713 N N    . GLN A 1 3  ? -22.413 -8.824  8.378   1.00 0.00 ? 1  GLN P N    10 
ATOM 10714 C CA   . GLN A 1 3  ? -22.411 -9.197  6.949   1.00 0.00 ? 1  GLN P CA   10 
ATOM 10715 C C    . GLN A 1 3  ? -20.989 -9.424  6.383   1.00 0.00 ? 1  GLN P C    10 
ATOM 10716 O O    . GLN A 1 3  ? -20.821 -9.582  5.170   1.00 0.00 ? 1  GLN P O    10 
ATOM 10717 C CB   . GLN A 1 3  ? -23.183 -8.129  6.144   1.00 0.00 ? 1  GLN P CB   10 
ATOM 10718 C CG   . GLN A 1 3  ? -24.683 -8.014  6.479   1.00 0.00 ? 1  GLN P CG   10 
ATOM 10719 C CD   . GLN A 1 3  ? -25.505 -9.207  5.985   1.00 0.00 ? 1  GLN P CD   10 
ATOM 10720 O OE1  . GLN A 1 3  ? -26.071 -9.197  4.897   1.00 0.00 ? 1  GLN P OE1  10 
ATOM 10721 N NE2  . GLN A 1 3  ? -25.608 -10.279 6.741   1.00 0.00 ? 1  GLN P NE2  10 
ATOM 10722 H H    . GLN A 1 3  ? -21.811 -8.059  8.660   1.00 0.00 ? 1  GLN P H    10 
ATOM 10723 H HA   . GLN A 1 3  ? -22.922 -10.152 6.829   1.00 0.00 ? 1  GLN P HA   10 
ATOM 10724 H HB2  . GLN A 1 3  ? -22.716 -7.159  6.321   1.00 0.00 ? 1  GLN P HB2  10 
ATOM 10725 H HB3  . GLN A 1 3  ? -23.099 -8.345  5.079   1.00 0.00 ? 1  GLN P HB3  10 
ATOM 10726 H HG2  . GLN A 1 3  ? -24.824 -7.890  7.552   1.00 0.00 ? 1  GLN P HG2  10 
ATOM 10727 H HG3  . GLN A 1 3  ? -25.070 -7.115  5.997   1.00 0.00 ? 1  GLN P HG3  10 
ATOM 10728 H HE21 . GLN A 1 3  ? -25.126 -10.322 7.636   1.00 0.00 ? 1  GLN P HE21 10 
ATOM 10729 H HE22 . GLN A 1 3  ? -26.154 -11.057 6.405   1.00 0.00 ? 1  GLN P HE22 10 
ATOM 10730 N N    . ARG A 1 4  ? -19.959 -9.442  7.245   1.00 0.00 ? 2  ARG P N    10 
ATOM 10731 C CA   . ARG A 1 4  ? -18.535 -9.624  6.894   1.00 0.00 ? 2  ARG P CA   10 
ATOM 10732 C C    . ARG A 1 4  ? -17.861 -10.686 7.776   1.00 0.00 ? 2  ARG P C    10 
ATOM 10733 O O    . ARG A 1 4  ? -18.284 -10.919 8.911   1.00 0.00 ? 2  ARG P O    10 
ATOM 10734 C CB   . ARG A 1 4  ? -17.788 -8.278  6.995   1.00 0.00 ? 2  ARG P CB   10 
ATOM 10735 C CG   . ARG A 1 4  ? -18.284 -7.239  5.976   1.00 0.00 ? 2  ARG P CG   10 
ATOM 10736 C CD   . ARG A 1 4  ? -17.466 -5.946  6.071   1.00 0.00 ? 2  ARG P CD   10 
ATOM 10737 N NE   . ARG A 1 4  ? -17.933 -4.940  5.096   1.00 0.00 ? 2  ARG P NE   10 
ATOM 10738 C CZ   . ARG A 1 4  ? -17.480 -3.707  4.955   1.00 0.00 ? 2  ARG P CZ   10 
ATOM 10739 N NH1  . ARG A 1 4  ? -16.524 -3.228  5.701   1.00 0.00 ? 2  ARG P NH1  10 
ATOM 10740 N NH2  . ARG A 1 4  ? -17.986 -2.919  4.049   1.00 0.00 ? 2  ARG P NH2  10 
ATOM 10741 H H    . ARG A 1 4  ? -20.181 -9.351  8.227   1.00 0.00 ? 2  ARG P H    10 
ATOM 10742 H HA   . ARG A 1 4  ? -18.458 -9.981  5.865   1.00 0.00 ? 2  ARG P HA   10 
ATOM 10743 H HB2  . ARG A 1 4  ? -17.902 -7.877  8.004   1.00 0.00 ? 2  ARG P HB2  10 
ATOM 10744 H HB3  . ARG A 1 4  ? -16.725 -8.451  6.817   1.00 0.00 ? 2  ARG P HB3  10 
ATOM 10745 H HG2  . ARG A 1 4  ? -18.190 -7.649  4.969   1.00 0.00 ? 2  ARG P HG2  10 
ATOM 10746 H HG3  . ARG A 1 4  ? -19.331 -7.006  6.169   1.00 0.00 ? 2  ARG P HG3  10 
ATOM 10747 H HD2  . ARG A 1 4  ? -17.561 -5.546  7.083   1.00 0.00 ? 2  ARG P HD2  10 
ATOM 10748 H HD3  . ARG A 1 4  ? -16.416 -6.177  5.880   1.00 0.00 ? 2  ARG P HD3  10 
ATOM 10749 H HE   . ARG A 1 4  ? -18.671 -5.219  4.468   1.00 0.00 ? 2  ARG P HE   10 
ATOM 10750 H HH11 . ARG A 1 4  ? -16.112 -3.815  6.405   1.00 0.00 ? 2  ARG P HH11 10 
ATOM 10751 H HH12 . ARG A 1 4  ? -16.196 -2.286  5.574   1.00 0.00 ? 2  ARG P HH12 10 
ATOM 10752 H HH21 . ARG A 1 4  ? -18.726 -3.245  3.448   1.00 0.00 ? 2  ARG P HH21 10 
ATOM 10753 H HH22 . ARG A 1 4  ? -17.640 -1.980  3.942   1.00 0.00 ? 2  ARG P HH22 10 
ATOM 10754 N N    . ARG A 1 5  ? -16.802 -11.316 7.254   1.00 0.00 ? 3  ARG P N    10 
ATOM 10755 C CA   . ARG A 1 5  ? -15.968 -12.318 7.952   1.00 0.00 ? 3  ARG P CA   10 
ATOM 10756 C C    . ARG A 1 5  ? -14.849 -11.661 8.775   1.00 0.00 ? 3  ARG P C    10 
ATOM 10757 O O    . ARG A 1 5  ? -14.469 -10.515 8.522   1.00 0.00 ? 3  ARG P O    10 
ATOM 10758 C CB   . ARG A 1 5  ? -15.390 -13.323 6.933   1.00 0.00 ? 3  ARG P CB   10 
ATOM 10759 C CG   . ARG A 1 5  ? -16.438 -14.084 6.097   1.00 0.00 ? 3  ARG P CG   10 
ATOM 10760 C CD   . ARG A 1 5  ? -17.460 -14.885 6.920   1.00 0.00 ? 3  ARG P CD   10 
ATOM 10761 N NE   . ARG A 1 5  ? -16.821 -15.949 7.721   1.00 0.00 ? 3  ARG P NE   10 
ATOM 10762 C CZ   . ARG A 1 5  ? -17.404 -16.710 8.632   1.00 0.00 ? 3  ARG P CZ   10 
ATOM 10763 N NH1  . ARG A 1 5  ? -18.665 -16.585 8.937   1.00 0.00 ? 3  ARG P NH1  10 
ATOM 10764 N NH2  . ARG A 1 5  ? -16.721 -17.622 9.262   1.00 0.00 ? 3  ARG P NH2  10 
ATOM 10765 H H    . ARG A 1 5  ? -16.513 -11.027 6.329   1.00 0.00 ? 3  ARG P H    10 
ATOM 10766 H HA   . ARG A 1 5  ? -16.589 -12.864 8.665   1.00 0.00 ? 3  ARG P HA   10 
ATOM 10767 H HB2  . ARG A 1 5  ? -14.732 -12.788 6.247   1.00 0.00 ? 3  ARG P HB2  10 
ATOM 10768 H HB3  . ARG A 1 5  ? -14.777 -14.052 7.464   1.00 0.00 ? 3  ARG P HB3  10 
ATOM 10769 H HG2  . ARG A 1 5  ? -16.982 -13.373 5.474   1.00 0.00 ? 3  ARG P HG2  10 
ATOM 10770 H HG3  . ARG A 1 5  ? -15.916 -14.770 5.428   1.00 0.00 ? 3  ARG P HG3  10 
ATOM 10771 H HD2  . ARG A 1 5  ? -18.009 -14.201 7.568   1.00 0.00 ? 3  ARG P HD2  10 
ATOM 10772 H HD3  . ARG A 1 5  ? -18.171 -15.340 6.229   1.00 0.00 ? 3  ARG P HD3  10 
ATOM 10773 H HE   . ARG A 1 5  ? -15.850 -16.145 7.534   1.00 0.00 ? 3  ARG P HE   10 
ATOM 10774 H HH11 . ARG A 1 5  ? -19.221 -15.899 8.457   1.00 0.00 ? 3  ARG P HH11 10 
ATOM 10775 H HH12 . ARG A 1 5  ? -19.086 -17.179 9.632   1.00 0.00 ? 3  ARG P HH12 10 
ATOM 10776 H HH21 . ARG A 1 5  ? -15.745 -17.759 9.057   1.00 0.00 ? 3  ARG P HH21 10 
ATOM 10777 H HH22 . ARG A 1 5  ? -17.168 -18.202 9.953   1.00 0.00 ? 3  ARG P HH22 10 
ATOM 10778 N N    . GLN A 1 6  ? -14.298 -12.402 9.738   1.00 0.00 ? 4  GLN P N    10 
ATOM 10779 C CA   . GLN A 1 6  ? -13.116 -11.990 10.511  1.00 0.00 ? 4  GLN P CA   10 
ATOM 10780 C C    . GLN A 1 6  ? -11.841 -11.992 9.644   1.00 0.00 ? 4  GLN P C    10 
ATOM 10781 O O    . GLN A 1 6  ? -11.712 -12.791 8.709   1.00 0.00 ? 4  GLN P O    10 
ATOM 10782 C CB   . GLN A 1 6  ? -12.937 -12.902 11.740  1.00 0.00 ? 4  GLN P CB   10 
ATOM 10783 C CG   . GLN A 1 6  ? -14.056 -12.766 12.790  1.00 0.00 ? 4  GLN P CG   10 
ATOM 10784 C CD   . GLN A 1 6  ? -14.084 -11.421 13.525  1.00 0.00 ? 4  GLN P CD   10 
ATOM 10785 O OE1  . GLN A 1 6  ? -13.223 -10.560 13.385  1.00 0.00 ? 4  GLN P OE1  10 
ATOM 10786 N NE2  . GLN A 1 6  ? -15.081 -11.186 14.354  1.00 0.00 ? 4  GLN P NE2  10 
ATOM 10787 H H    . GLN A 1 6  ? -14.647 -13.338 9.872   1.00 0.00 ? 4  GLN P H    10 
ATOM 10788 H HA   . GLN A 1 6  ? -13.269 -10.967 10.855  1.00 0.00 ? 4  GLN P HA   10 
ATOM 10789 H HB2  . GLN A 1 6  ? -12.899 -13.940 11.404  1.00 0.00 ? 4  GLN P HB2  10 
ATOM 10790 H HB3  . GLN A 1 6  ? -11.983 -12.679 12.219  1.00 0.00 ? 4  GLN P HB3  10 
ATOM 10791 H HG2  . GLN A 1 6  ? -15.025 -12.933 12.318  1.00 0.00 ? 4  GLN P HG2  10 
ATOM 10792 H HG3  . GLN A 1 6  ? -13.920 -13.549 13.537  1.00 0.00 ? 4  GLN P HG3  10 
ATOM 10793 H HE21 . GLN A 1 6  ? -15.801 -11.879 14.497  1.00 0.00 ? 4  GLN P HE21 10 
ATOM 10794 H HE22 . GLN A 1 6  ? -15.098 -10.304 14.845  1.00 0.00 ? 4  GLN P HE22 10 
ATOM 10795 N N    . ARG A 1 7  ? -10.888 -11.104 9.959   1.00 0.00 ? 5  ARG P N    10 
ATOM 10796 C CA   . ARG A 1 7  ? -9.609  -10.965 9.232   1.00 0.00 ? 5  ARG P CA   10 
ATOM 10797 C C    . ARG A 1 7  ? -8.576  -12.028 9.646   1.00 0.00 ? 5  ARG P C    10 
ATOM 10798 O O    . ARG A 1 7  ? -8.702  -12.665 10.696  1.00 0.00 ? 5  ARG P O    10 
ATOM 10799 C CB   . ARG A 1 7  ? -9.054  -9.534  9.406   1.00 0.00 ? 5  ARG P CB   10 
ATOM 10800 C CG   . ARG A 1 7  ? -8.440  -8.981  8.103   1.00 0.00 ? 5  ARG P CG   10 
ATOM 10801 C CD   . ARG A 1 7  ? -7.377  -7.909  8.371   1.00 0.00 ? 5  ARG P CD   10 
ATOM 10802 N NE   . ARG A 1 7  ? -6.132  -8.529  8.868   1.00 0.00 ? 5  ARG P NE   10 
ATOM 10803 C CZ   . ARG A 1 7  ? -5.301  -8.084  9.789   1.00 0.00 ? 5  ARG P CZ   10 
ATOM 10804 N NH1  . ARG A 1 7  ? -5.447  -6.931  10.376  1.00 0.00 ? 5  ARG P NH1  10 
ATOM 10805 N NH2  . ARG A 1 7  ? -4.291  -8.828  10.127  1.00 0.00 ? 5  ARG P NH2  10 
ATOM 10806 H H    . ARG A 1 7  ? -11.050 -10.504 10.757  1.00 0.00 ? 5  ARG P H    10 
ATOM 10807 H HA   . ARG A 1 7  ? -9.819  -11.125 8.172   1.00 0.00 ? 5  ARG P HA   10 
ATOM 10808 H HB2  . ARG A 1 7  ? -9.852  -8.854  9.707   1.00 0.00 ? 5  ARG P HB2  10 
ATOM 10809 H HB3  . ARG A 1 7  ? -8.310  -9.539  10.205  1.00 0.00 ? 5  ARG P HB3  10 
ATOM 10810 H HG2  . ARG A 1 7  ? -7.981  -9.782  7.522   1.00 0.00 ? 5  ARG P HG2  10 
ATOM 10811 H HG3  . ARG A 1 7  ? -9.238  -8.548  7.501   1.00 0.00 ? 5  ARG P HG3  10 
ATOM 10812 H HD2  . ARG A 1 7  ? -7.161  -7.388  7.437   1.00 0.00 ? 5  ARG P HD2  10 
ATOM 10813 H HD3  . ARG A 1 7  ? -7.775  -7.186  9.086   1.00 0.00 ? 5  ARG P HD3  10 
ATOM 10814 H HE   . ARG A 1 7  ? -5.880  -9.430  8.475   1.00 0.00 ? 5  ARG P HE   10 
ATOM 10815 H HH11 . ARG A 1 7  ? -6.218  -6.342  10.114  1.00 0.00 ? 5  ARG P HH11 10 
ATOM 10816 H HH12 . ARG A 1 7  ? -4.798  -6.628  11.082  1.00 0.00 ? 5  ARG P HH12 10 
ATOM 10817 H HH21 . ARG A 1 7  ? -4.192  -9.733  9.687   1.00 0.00 ? 5  ARG P HH21 10 
ATOM 10818 H HH22 . ARG A 1 7  ? -3.653  -8.536  10.848  1.00 0.00 ? 5  ARG P HH22 10 
ATOM 10819 N N    . THR A 1 8  ? -7.534  -12.187 8.832   1.00 0.00 ? 6  THR P N    10 
ATOM 10820 C CA   . THR A 1 8  ? -6.374  -13.072 9.067   1.00 0.00 ? 6  THR P CA   10 
ATOM 10821 C C    . THR A 1 8  ? -5.066  -12.380 8.629   1.00 0.00 ? 6  THR P C    10 
ATOM 10822 O O    . THR A 1 8  ? -5.044  -11.158 8.441   1.00 0.00 ? 6  THR P O    10 
ATOM 10823 C CB   . THR A 1 8  ? -6.634  -14.441 8.399   1.00 0.00 ? 6  THR P CB   10 
ATOM 10824 O OG1  . THR A 1 8  ? -5.654  -15.381 8.789   1.00 0.00 ? 6  THR P OG1  10 
ATOM 10825 C CG2  . THR A 1 8  ? -6.684  -14.406 6.870   1.00 0.00 ? 6  THR P CG2  10 
ATOM 10826 H H    . THR A 1 8  ? -7.508  -11.619 7.999   1.00 0.00 ? 6  THR P H    10 
ATOM 10827 H HA   . THR A 1 8  ? -6.278  -13.259 10.136  1.00 0.00 ? 6  THR P HA   10 
ATOM 10828 H HB   . THR A 1 8  ? -7.599  -14.804 8.756   1.00 0.00 ? 6  THR P HB   10 
ATOM 10829 H HG1  . THR A 1 8  ? -5.962  -16.262 8.506   1.00 0.00 ? 6  THR P HG1  10 
ATOM 10830 H HG21 . THR A 1 8  ? -5.718  -14.115 6.462   1.00 0.00 ? 6  THR P HG21 10 
ATOM 10831 H HG22 . THR A 1 8  ? -7.444  -13.700 6.536   1.00 0.00 ? 6  THR P HG22 10 
ATOM 10832 H HG23 . THR A 1 8  ? -6.943  -15.395 6.492   1.00 0.00 ? 6  THR P HG23 10 
ATOM 10833 N N    . HIS A 1 9  ? -3.956  -13.112 8.502   1.00 0.00 ? 7  HIS P N    10 
ATOM 10834 C CA   . HIS A 1 9  ? -2.679  -12.599 7.981   1.00 0.00 ? 7  HIS P CA   10 
ATOM 10835 C C    . HIS A 1 9  ? -2.788  -12.137 6.512   1.00 0.00 ? 7  HIS P C    10 
ATOM 10836 O O    . HIS A 1 9  ? -3.671  -12.578 5.770   1.00 0.00 ? 7  HIS P O    10 
ATOM 10837 C CB   . HIS A 1 9  ? -1.586  -13.663 8.162   1.00 0.00 ? 7  HIS P CB   10 
ATOM 10838 C CG   . HIS A 1 9  ? -0.202  -13.173 7.802   1.00 0.00 ? 7  HIS P CG   10 
ATOM 10839 N ND1  . HIS A 1 9  ? 0.346   -11.942 8.180   1.00 0.00 ? 7  HIS P ND1  10 
ATOM 10840 C CD2  . HIS A 1 9  ? 0.698   -13.832 7.017   1.00 0.00 ? 7  HIS P CD2  10 
ATOM 10841 C CE1  . HIS A 1 9  ? 1.566   -11.892 7.618   1.00 0.00 ? 7  HIS P CE1  10 
ATOM 10842 N NE2  . HIS A 1 9  ? 1.803   -13.014 6.915   1.00 0.00 ? 7  HIS P NE2  10 
ATOM 10843 H H    . HIS A 1 9  ? -4.047  -14.111 8.662   1.00 0.00 ? 7  HIS P H    10 
ATOM 10844 H HA   . HIS A 1 9  ? -2.393  -11.727 8.572   1.00 0.00 ? 7  HIS P HA   10 
ATOM 10845 H HB2  . HIS A 1 9  ? -1.568  -13.982 9.205   1.00 0.00 ? 7  HIS P HB2  10 
ATOM 10846 H HB3  . HIS A 1 9  ? -1.828  -14.531 7.546   1.00 0.00 ? 7  HIS P HB3  10 
ATOM 10847 H HD2  . HIS A 1 9  ? 0.558   -14.803 6.555   1.00 0.00 ? 7  HIS P HD2  10 
ATOM 10848 H HE1  . HIS A 1 9  ? 2.262   -11.065 7.715   1.00 0.00 ? 7  HIS P HE1  10 
ATOM 10849 H HE2  . HIS A 1 9  ? 2.654   -13.211 6.398   1.00 0.00 ? 7  HIS P HE2  10 
ATOM 10850 N N    . PHE A 1 10 ? -1.898  -11.240 6.085   1.00 0.00 ? 8  PHE P N    10 
ATOM 10851 C CA   . PHE A 1 10 ? -1.926  -10.641 4.745   1.00 0.00 ? 8  PHE P CA   10 
ATOM 10852 C C    . PHE A 1 10 ? -1.669  -11.672 3.632   1.00 0.00 ? 8  PHE P C    10 
ATOM 10853 O O    . PHE A 1 10 ? -0.854  -12.587 3.779   1.00 0.00 ? 8  PHE P O    10 
ATOM 10854 C CB   . PHE A 1 10 ? -0.931  -9.470  4.664   1.00 0.00 ? 8  PHE P CB   10 
ATOM 10855 C CG   . PHE A 1 10 ? -1.238  -8.220  5.484   1.00 0.00 ? 8  PHE P CG   10 
ATOM 10856 C CD1  . PHE A 1 10 ? -2.414  -8.081  6.256   1.00 0.00 ? 8  PHE P CD1  10 
ATOM 10857 C CD2  . PHE A 1 10 ? -0.317  -7.156  5.444   1.00 0.00 ? 8  PHE P CD2  10 
ATOM 10858 C CE1  . PHE A 1 10 ? -2.652  -6.903  6.986   1.00 0.00 ? 8  PHE P CE1  10 
ATOM 10859 C CE2  . PHE A 1 10 ? -0.556  -5.977  6.172   1.00 0.00 ? 8  PHE P CE2  10 
ATOM 10860 C CZ   . PHE A 1 10 ? -1.724  -5.851  6.945   1.00 0.00 ? 8  PHE P CZ   10 
ATOM 10861 H H    . PHE A 1 10 ? -1.150  -10.971 6.712   1.00 0.00 ? 8  PHE P H    10 
ATOM 10862 H HA   . PHE A 1 10 ? -2.926  -10.243 4.573   1.00 0.00 ? 8  PHE P HA   10 
ATOM 10863 H HB2  . PHE A 1 10 ? 0.054   -9.837  4.956   1.00 0.00 ? 8  PHE P HB2  10 
ATOM 10864 H HB3  . PHE A 1 10 ? -0.855  -9.161  3.620   1.00 0.00 ? 8  PHE P HB3  10 
ATOM 10865 H HD1  . PHE A 1 10 ? -3.152  -8.868  6.298   1.00 0.00 ? 8  PHE P HD1  10 
ATOM 10866 H HD2  . PHE A 1 10 ? 0.577   -7.238  4.840   1.00 0.00 ? 8  PHE P HD2  10 
ATOM 10867 H HE1  . PHE A 1 10 ? -3.557  -6.801  7.569   1.00 0.00 ? 8  PHE P HE1  10 
ATOM 10868 H HE2  . PHE A 1 10 ? 0.151   -5.162  6.113   1.00 0.00 ? 8  PHE P HE2  10 
ATOM 10869 H HZ   . PHE A 1 10 ? -1.923  -4.939  7.493   1.00 0.00 ? 8  PHE P HZ   10 
ATOM 10870 N N    . THR A 1 11 ? -2.368  -11.507 2.506   1.00 0.00 ? 9  THR P N    10 
ATOM 10871 C CA   . THR A 1 11 ? -2.292  -12.386 1.324   1.00 0.00 ? 9  THR P CA   10 
ATOM 10872 C C    . THR A 1 11 ? -1.407  -11.795 0.226   1.00 0.00 ? 9  THR P C    10 
ATOM 10873 O O    . THR A 1 11 ? -1.263  -10.575 0.123   1.00 0.00 ? 9  THR P O    10 
ATOM 10874 C CB   . THR A 1 11 ? -3.697  -12.750 0.811   1.00 0.00 ? 9  THR P CB   10 
ATOM 10875 O OG1  . THR A 1 11 ? -3.595  -13.715 -0.213  1.00 0.00 ? 9  THR P OG1  10 
ATOM 10876 C CG2  . THR A 1 11 ? -4.493  -11.569 0.251   1.00 0.00 ? 9  THR P CG2  10 
ATOM 10877 H H    . THR A 1 11 ? -2.961  -10.684 2.443   1.00 0.00 ? 9  THR P H    10 
ATOM 10878 H HA   . THR A 1 11 ? -1.825  -13.322 1.623   1.00 0.00 ? 9  THR P HA   10 
ATOM 10879 H HB   . THR A 1 11 ? -4.261  -13.186 1.638   1.00 0.00 ? 9  THR P HB   10 
ATOM 10880 H HG1  . THR A 1 11 ? -4.491  -14.049 -0.395  1.00 0.00 ? 9  THR P HG1  10 
ATOM 10881 H HG21 . THR A 1 11 ? -4.661  -10.832 1.035   1.00 0.00 ? 9  THR P HG21 10 
ATOM 10882 H HG22 . THR A 1 11 ? -5.464  -11.915 -0.102  1.00 0.00 ? 9  THR P HG22 10 
ATOM 10883 H HG23 . THR A 1 11 ? -3.960  -11.101 -0.577  1.00 0.00 ? 9  THR P HG23 10 
ATOM 10884 N N    . SER A 1 12 ? -0.831  -12.651 -0.624  1.00 0.00 ? 10 SER P N    10 
ATOM 10885 C CA   . SER A 1 12 ? 0.113   -12.291 -1.696  1.00 0.00 ? 10 SER P CA   10 
ATOM 10886 C C    . SER A 1 12 ? -0.370  -11.138 -2.578  1.00 0.00 ? 10 SER P C    10 
ATOM 10887 O O    . SER A 1 12 ? 0.436   -10.302 -2.985  1.00 0.00 ? 10 SER P O    10 
ATOM 10888 C CB   . SER A 1 12 ? 0.345   -13.498 -2.610  1.00 0.00 ? 10 SER P CB   10 
ATOM 10889 O OG   . SER A 1 12 ? 0.771   -14.625 -1.855  1.00 0.00 ? 10 SER P OG   10 
ATOM 10890 H H    . SER A 1 12 ? -1.024  -13.636 -0.502  1.00 0.00 ? 10 SER P H    10 
ATOM 10891 H HA   . SER A 1 12 ? 1.066   -12.002 -1.251  1.00 0.00 ? 10 SER P HA   10 
ATOM 10892 H HB2  . SER A 1 12 ? -0.585  -13.734 -3.134  1.00 0.00 ? 10 SER P HB2  10 
ATOM 10893 H HB3  . SER A 1 12 ? 1.105   -13.242 -3.350  1.00 0.00 ? 10 SER P HB3  10 
ATOM 10894 H HG   . SER A 1 12 ? 0.926   -15.369 -2.471  1.00 0.00 ? 10 SER P HG   10 
ATOM 10895 N N    . GLN A 1 13 ? -1.683  -11.045 -2.819  1.00 0.00 ? 11 GLN P N    10 
ATOM 10896 C CA   . GLN A 1 13 ? -2.306  -9.992  -3.625  1.00 0.00 ? 11 GLN P CA   10 
ATOM 10897 C C    . GLN A 1 13 ? -2.090  -8.576  -3.048  1.00 0.00 ? 11 GLN P C    10 
ATOM 10898 O O    . GLN A 1 13 ? -2.000  -7.610  -3.804  1.00 0.00 ? 11 GLN P O    10 
ATOM 10899 C CB   . GLN A 1 13 ? -3.801  -10.325 -3.778  1.00 0.00 ? 11 GLN P CB   10 
ATOM 10900 C CG   . GLN A 1 13 ? -4.403  -9.645  -5.016  1.00 0.00 ? 11 GLN P CG   10 
ATOM 10901 C CD   . GLN A 1 13 ? -5.887  -9.955  -5.233  1.00 0.00 ? 11 GLN P CD   10 
ATOM 10902 O OE1  . GLN A 1 13 ? -6.547  -10.653 -4.473  1.00 0.00 ? 11 GLN P OE1  10 
ATOM 10903 N NE2  . GLN A 1 13 ? -6.481  -9.439  -6.290  1.00 0.00 ? 11 GLN P NE2  10 
ATOM 10904 H H    . GLN A 1 13 ? -2.279  -11.766 -2.437  1.00 0.00 ? 11 GLN P H    10 
ATOM 10905 H HA   . GLN A 1 13 ? -1.852  -10.020 -4.613  1.00 0.00 ? 11 GLN P HA   10 
ATOM 10906 H HB2  . GLN A 1 13 ? -3.917  -11.404 -3.899  1.00 0.00 ? 11 GLN P HB2  10 
ATOM 10907 H HB3  . GLN A 1 13 ? -4.339  -10.015 -2.880  1.00 0.00 ? 11 GLN P HB3  10 
ATOM 10908 H HG2  . GLN A 1 13 ? -4.285  -8.566  -4.932  1.00 0.00 ? 11 GLN P HG2  10 
ATOM 10909 H HG3  . GLN A 1 13 ? -3.847  -9.983  -5.894  1.00 0.00 ? 11 GLN P HG3  10 
ATOM 10910 H HE21 . GLN A 1 13 ? -5.965  -8.859  -6.935  1.00 0.00 ? 11 GLN P HE21 10 
ATOM 10911 H HE22 . GLN A 1 13 ? -7.459  -9.640  -6.436  1.00 0.00 ? 11 GLN P HE22 10 
ATOM 10912 N N    . GLN A 1 14 ? -1.946  -8.448  -1.724  1.00 0.00 ? 12 GLN P N    10 
ATOM 10913 C CA   . GLN A 1 14 ? -1.636  -7.186  -1.041  1.00 0.00 ? 12 GLN P CA   10 
ATOM 10914 C C    . GLN A 1 14 ? -0.133  -6.866  -1.128  1.00 0.00 ? 12 GLN P C    10 
ATOM 10915 O O    . GLN A 1 14 ? 0.247   -5.741  -1.460  1.00 0.00 ? 12 GLN P O    10 
ATOM 10916 C CB   . GLN A 1 14 ? -2.094  -7.258  0.429   1.00 0.00 ? 12 GLN P CB   10 
ATOM 10917 C CG   . GLN A 1 14 ? -3.597  -7.541  0.597   1.00 0.00 ? 12 GLN P CG   10 
ATOM 10918 C CD   . GLN A 1 14 ? -3.949  -7.821  2.056   1.00 0.00 ? 12 GLN P CD   10 
ATOM 10919 O OE1  . GLN A 1 14 ? -3.696  -8.896  2.584   1.00 0.00 ? 12 GLN P OE1  10 
ATOM 10920 N NE2  . GLN A 1 14 ? -4.532  -6.884  2.768   1.00 0.00 ? 12 GLN P NE2  10 
ATOM 10921 H H    . GLN A 1 14 ? -1.978  -9.290  -1.158  1.00 0.00 ? 12 GLN P H    10 
ATOM 10922 H HA   . GLN A 1 14 ? -2.177  -6.371  -1.527  1.00 0.00 ? 12 GLN P HA   10 
ATOM 10923 H HB2  . GLN A 1 14 ? -1.532  -8.041  0.937   1.00 0.00 ? 12 GLN P HB2  10 
ATOM 10924 H HB3  . GLN A 1 14 ? -1.862  -6.310  0.918   1.00 0.00 ? 12 GLN P HB3  10 
ATOM 10925 H HG2  . GLN A 1 14 ? -4.168  -6.687  0.231   1.00 0.00 ? 12 GLN P HG2  10 
ATOM 10926 H HG3  . GLN A 1 14 ? -3.887  -8.415  0.015   1.00 0.00 ? 12 GLN P HG3  10 
ATOM 10927 H HE21 . GLN A 1 14 ? -4.752  -5.985  2.346   1.00 0.00 ? 12 GLN P HE21 10 
ATOM 10928 H HE22 . GLN A 1 14 ? -4.696  -7.057  3.744   1.00 0.00 ? 12 GLN P HE22 10 
ATOM 10929 N N    . LEU A 1 15 ? 0.734   -7.860  -0.886  1.00 0.00 ? 13 LEU P N    10 
ATOM 10930 C CA   . LEU A 1 15 ? 2.192   -7.671  -0.884  1.00 0.00 ? 13 LEU P CA   10 
ATOM 10931 C C    . LEU A 1 15 ? 2.762   -7.428  -2.295  1.00 0.00 ? 13 LEU P C    10 
ATOM 10932 O O    . LEU A 1 15 ? 3.672   -6.613  -2.456  1.00 0.00 ? 13 LEU P O    10 
ATOM 10933 C CB   . LEU A 1 15 ? 2.897   -8.863  -0.199  1.00 0.00 ? 13 LEU P CB   10 
ATOM 10934 C CG   . LEU A 1 15 ? 2.685   -9.069  1.318   1.00 0.00 ? 13 LEU P CG   10 
ATOM 10935 C CD1  . LEU A 1 15 ? 2.759   -7.774  2.127   1.00 0.00 ? 13 LEU P CD1  10 
ATOM 10936 C CD2  . LEU A 1 15 ? 1.378   -9.779  1.661   1.00 0.00 ? 13 LEU P CD2  10 
ATOM 10937 H H    . LEU A 1 15 ? 0.363   -8.770  -0.641  1.00 0.00 ? 13 LEU P H    10 
ATOM 10938 H HA   . LEU A 1 15 ? 2.421   -6.770  -0.315  1.00 0.00 ? 13 LEU P HA   10 
ATOM 10939 H HB2  . LEU A 1 15 ? 2.637   -9.784  -0.725  1.00 0.00 ? 13 LEU P HB2  10 
ATOM 10940 H HB3  . LEU A 1 15 ? 3.969   -8.716  -0.340  1.00 0.00 ? 13 LEU P HB3  10 
ATOM 10941 H HG   . LEU A 1 15 ? 3.485   -9.720  1.669   1.00 0.00 ? 13 LEU P HG   10 
ATOM 10942 H HD11 . LEU A 1 15 ? 2.775   -8.010  3.191   1.00 0.00 ? 13 LEU P HD11 10 
ATOM 10943 H HD12 . LEU A 1 15 ? 1.892   -7.146  1.920   1.00 0.00 ? 13 LEU P HD12 10 
ATOM 10944 H HD13 . LEU A 1 15 ? 3.669   -7.234  1.872   1.00 0.00 ? 13 LEU P HD13 10 
ATOM 10945 H HD21 . LEU A 1 15 ? 0.527   -9.130  1.471   1.00 0.00 ? 13 LEU P HD21 10 
ATOM 10946 H HD22 . LEU A 1 15 ? 1.383   -10.052 2.717   1.00 0.00 ? 13 LEU P HD22 10 
ATOM 10947 H HD23 . LEU A 1 15 ? 1.288   -10.690 1.071   1.00 0.00 ? 13 LEU P HD23 10 
ATOM 10948 N N    . GLN A 1 16 ? 2.210   -8.072  -3.330  1.00 0.00 ? 14 GLN P N    10 
ATOM 10949 C CA   . GLN A 1 16 ? 2.635   -7.846  -4.718  1.00 0.00 ? 14 GLN P CA   10 
ATOM 10950 C C    . GLN A 1 16 ? 2.202   -6.472  -5.251  1.00 0.00 ? 14 GLN P C    10 
ATOM 10951 O O    . GLN A 1 16 ? 2.906   -5.883  -6.066  1.00 0.00 ? 14 GLN P O    10 
ATOM 10952 C CB   . GLN A 1 16 ? 2.173   -8.997  -5.626  1.00 0.00 ? 14 GLN P CB   10 
ATOM 10953 C CG   . GLN A 1 16 ? 0.686   -8.977  -6.017  1.00 0.00 ? 14 GLN P CG   10 
ATOM 10954 C CD   . GLN A 1 16 ? 0.294   -10.238 -6.785  1.00 0.00 ? 14 GLN P CD   10 
ATOM 10955 O OE1  . GLN A 1 16 ? -0.233  -11.200 -6.242  1.00 0.00 ? 14 GLN P OE1  10 
ATOM 10956 N NE2  . GLN A 1 16 ? 0.544   -10.296 -8.077  1.00 0.00 ? 14 GLN P NE2  10 
ATOM 10957 H H    . GLN A 1 16 ? 1.498   -8.770  -3.146  1.00 0.00 ? 14 GLN P H    10 
ATOM 10958 H HA   . GLN A 1 16 ? 3.726   -7.858  -4.732  1.00 0.00 ? 14 GLN P HA   10 
ATOM 10959 H HB2  . GLN A 1 16 ? 2.760   -8.955  -6.542  1.00 0.00 ? 14 GLN P HB2  10 
ATOM 10960 H HB3  . GLN A 1 16 ? 2.395   -9.939  -5.126  1.00 0.00 ? 14 GLN P HB3  10 
ATOM 10961 H HG2  . GLN A 1 16 ? 0.075   -8.897  -5.122  1.00 0.00 ? 14 GLN P HG2  10 
ATOM 10962 H HG3  . GLN A 1 16 ? 0.484   -8.107  -6.643  1.00 0.00 ? 14 GLN P HG3  10 
ATOM 10963 H HE21 . GLN A 1 16 ? 0.981   -9.520  -8.551  1.00 0.00 ? 14 GLN P HE21 10 
ATOM 10964 H HE22 . GLN A 1 16 ? 0.287   -11.135 -8.577  1.00 0.00 ? 14 GLN P HE22 10 
ATOM 10965 N N    . GLU A 1 17 ? 1.084   -5.929  -4.763  1.00 0.00 ? 15 GLU P N    10 
ATOM 10966 C CA   . GLU A 1 17 ? 0.640   -4.562  -5.079  1.00 0.00 ? 15 GLU P CA   10 
ATOM 10967 C C    . GLU A 1 17 ? 1.551   -3.506  -4.425  1.00 0.00 ? 15 GLU P C    10 
ATOM 10968 O O    . GLU A 1 17 ? 1.925   -2.529  -5.077  1.00 0.00 ? 15 GLU P O    10 
ATOM 10969 C CB   . GLU A 1 17 ? -0.828  -4.391  -4.650  1.00 0.00 ? 15 GLU P CB   10 
ATOM 10970 C CG   . GLU A 1 17 ? -1.480  -3.090  -5.139  1.00 0.00 ? 15 GLU P CG   10 
ATOM 10971 C CD   . GLU A 1 17 ? -1.698  -3.091  -6.666  1.00 0.00 ? 15 GLU P CD   10 
ATOM 10972 O OE1  . GLU A 1 17 ? -2.732  -3.626  -7.134  1.00 0.00 ? 15 GLU P OE1  10 
ATOM 10973 O OE2  . GLU A 1 17 ? -0.841  -2.554  -7.409  1.00 0.00 ? 15 GLU P OE2  10 
ATOM 10974 H H    . GLU A 1 17 ? 0.532   -6.485  -4.125  1.00 0.00 ? 15 GLU P H    10 
ATOM 10975 H HA   . GLU A 1 17 ? 0.699   -4.422  -6.159  1.00 0.00 ? 15 GLU P HA   10 
ATOM 10976 H HB2  . GLU A 1 17 ? -1.411  -5.228  -5.037  1.00 0.00 ? 15 GLU P HB2  10 
ATOM 10977 H HB3  . GLU A 1 17 ? -0.882  -4.420  -3.563  1.00 0.00 ? 15 GLU P HB3  10 
ATOM 10978 H HG2  . GLU A 1 17 ? -2.447  -2.985  -4.640  1.00 0.00 ? 15 GLU P HG2  10 
ATOM 10979 H HG3  . GLU A 1 17 ? -0.872  -2.235  -4.835  1.00 0.00 ? 15 GLU P HG3  10 
ATOM 10980 N N    . LEU A 1 18 ? 1.985   -3.733  -3.176  1.00 0.00 ? 16 LEU P N    10 
ATOM 10981 C CA   . LEU A 1 18 ? 2.993   -2.902  -2.501  1.00 0.00 ? 16 LEU P CA   10 
ATOM 10982 C C    . LEU A 1 18 ? 4.341   -2.910  -3.248  1.00 0.00 ? 16 LEU P C    10 
ATOM 10983 O O    . LEU A 1 18 ? 4.948   -1.857  -3.447  1.00 0.00 ? 16 LEU P O    10 
ATOM 10984 C CB   . LEU A 1 18 ? 3.176   -3.381  -1.049  1.00 0.00 ? 16 LEU P CB   10 
ATOM 10985 C CG   . LEU A 1 18 ? 2.014   -3.043  -0.099  1.00 0.00 ? 16 LEU P CG   10 
ATOM 10986 C CD1  . LEU A 1 18 ? 2.197   -3.797  1.218   1.00 0.00 ? 16 LEU P CD1  10 
ATOM 10987 C CD2  . LEU A 1 18 ? 1.956   -1.549  0.222   1.00 0.00 ? 16 LEU P CD2  10 
ATOM 10988 H H    . LEU A 1 18 ? 1.620   -4.540  -2.683  1.00 0.00 ? 16 LEU P H    10 
ATOM 10989 H HA   . LEU A 1 18 ? 2.646   -1.870  -2.490  1.00 0.00 ? 16 LEU P HA   10 
ATOM 10990 H HB2  . LEU A 1 18 ? 3.334   -4.458  -1.052  1.00 0.00 ? 16 LEU P HB2  10 
ATOM 10991 H HB3  . LEU A 1 18 ? 4.076   -2.922  -0.647  1.00 0.00 ? 16 LEU P HB3  10 
ATOM 10992 H HG   . LEU A 1 18 ? 1.068   -3.345  -0.546  1.00 0.00 ? 16 LEU P HG   10 
ATOM 10993 H HD11 . LEU A 1 18 ? 2.209   -4.869  1.030   1.00 0.00 ? 16 LEU P HD11 10 
ATOM 10994 H HD12 . LEU A 1 18 ? 1.372   -3.573  1.889   1.00 0.00 ? 16 LEU P HD12 10 
ATOM 10995 H HD13 . LEU A 1 18 ? 3.133   -3.503  1.690   1.00 0.00 ? 16 LEU P HD13 10 
ATOM 10996 H HD21 . LEU A 1 18 ? 2.891   -1.224  0.681   1.00 0.00 ? 16 LEU P HD21 10 
ATOM 10997 H HD22 . LEU A 1 18 ? 1.133   -1.354  0.909   1.00 0.00 ? 16 LEU P HD22 10 
ATOM 10998 H HD23 . LEU A 1 18 ? 1.790   -0.977  -0.687  1.00 0.00 ? 16 LEU P HD23 10 
ATOM 10999 N N    . GLU A 1 19 ? 4.787   -4.074  -3.731  1.00 0.00 ? 17 GLU P N    10 
ATOM 11000 C CA   . GLU A 1 19 ? 5.996   -4.176  -4.555  1.00 0.00 ? 17 GLU P CA   10 
ATOM 11001 C C    . GLU A 1 19 ? 5.826   -3.521  -5.937  1.00 0.00 ? 17 GLU P C    10 
ATOM 11002 O O    . GLU A 1 19 ? 6.705   -2.774  -6.371  1.00 0.00 ? 17 GLU P O    10 
ATOM 11003 C CB   . GLU A 1 19 ? 6.436   -5.646  -4.647  1.00 0.00 ? 17 GLU P CB   10 
ATOM 11004 C CG   . GLU A 1 19 ? 7.709   -5.807  -5.488  1.00 0.00 ? 17 GLU P CG   10 
ATOM 11005 C CD   . GLU A 1 19 ? 8.422   -7.141  -5.203  1.00 0.00 ? 17 GLU P CD   10 
ATOM 11006 O OE1  . GLU A 1 19 ? 7.910   -8.214  -5.601  1.00 0.00 ? 17 GLU P OE1  10 
ATOM 11007 O OE2  . GLU A 1 19 ? 9.521   -7.103  -4.594  1.00 0.00 ? 17 GLU P OE2  10 
ATOM 11008 H H    . GLU A 1 19 ? 4.283   -4.920  -3.489  1.00 0.00 ? 17 GLU P H    10 
ATOM 11009 H HA   . GLU A 1 19 ? 6.797   -3.627  -4.057  1.00 0.00 ? 17 GLU P HA   10 
ATOM 11010 H HB2  . GLU A 1 19 ? 6.632   -6.008  -3.637  1.00 0.00 ? 17 GLU P HB2  10 
ATOM 11011 H HB3  . GLU A 1 19 ? 5.637   -6.247  -5.084  1.00 0.00 ? 17 GLU P HB3  10 
ATOM 11012 H HG2  . GLU A 1 19 ? 7.454   -5.739  -6.548  1.00 0.00 ? 17 GLU P HG2  10 
ATOM 11013 H HG3  . GLU A 1 19 ? 8.383   -4.980  -5.257  1.00 0.00 ? 17 GLU P HG3  10 
ATOM 11014 N N    . ALA A 1 20 ? 4.692   -3.723  -6.613  1.00 0.00 ? 18 ALA P N    10 
ATOM 11015 C CA   . ALA A 1 20 ? 4.422   -3.119  -7.916  1.00 0.00 ? 18 ALA P CA   10 
ATOM 11016 C C    . ALA A 1 20 ? 4.369   -1.584  -7.841  1.00 0.00 ? 18 ALA P C    10 
ATOM 11017 O O    . ALA A 1 20 ? 5.002   -0.910  -8.655  1.00 0.00 ? 18 ALA P O    10 
ATOM 11018 C CB   . ALA A 1 20 ? 3.122   -3.705  -8.482  1.00 0.00 ? 18 ALA P CB   10 
ATOM 11019 H H    . ALA A 1 20 ? 4.002   -4.362  -6.232  1.00 0.00 ? 18 ALA P H    10 
ATOM 11020 H HA   . ALA A 1 20 ? 5.235   -3.384  -8.594  1.00 0.00 ? 18 ALA P HA   10 
ATOM 11021 H HB1  . ALA A 1 20 ? 3.218   -4.787  -8.585  1.00 0.00 ? 18 ALA P HB1  10 
ATOM 11022 H HB2  . ALA A 1 20 ? 2.286   -3.478  -7.820  1.00 0.00 ? 18 ALA P HB2  10 
ATOM 11023 H HB3  . ALA A 1 20 ? 2.926   -3.275  -9.465  1.00 0.00 ? 18 ALA P HB3  10 
ATOM 11024 N N    . THR A 1 21 ? 3.686   -1.010  -6.842  1.00 0.00 ? 19 THR P N    10 
ATOM 11025 C CA   . THR A 1 21 ? 3.624   0.452   -6.680  1.00 0.00 ? 19 THR P CA   10 
ATOM 11026 C C    . THR A 1 21 ? 4.972   1.047   -6.254  1.00 0.00 ? 19 THR P C    10 
ATOM 11027 O O    . THR A 1 21 ? 5.300   2.151   -6.692  1.00 0.00 ? 19 THR P O    10 
ATOM 11028 C CB   . THR A 1 21 ? 2.463   0.882   -5.767  1.00 0.00 ? 19 THR P CB   10 
ATOM 11029 O OG1  . THR A 1 21 ? 2.131   2.232   -6.013  1.00 0.00 ? 19 THR P OG1  10 
ATOM 11030 C CG2  . THR A 1 21 ? 2.731   0.733   -4.272  1.00 0.00 ? 19 THR P CG2  10 
ATOM 11031 H H    . THR A 1 21 ? 3.168   -1.602  -6.197  1.00 0.00 ? 19 THR P H    10 
ATOM 11032 H HA   . THR A 1 21 ? 3.401   0.870   -7.661  1.00 0.00 ? 19 THR P HA   10 
ATOM 11033 H HB   . THR A 1 21 ? 1.591   0.276   -6.019  1.00 0.00 ? 19 THR P HB   10 
ATOM 11034 H HG1  . THR A 1 21 ? 2.907   2.780   -5.809  1.00 0.00 ? 19 THR P HG1  10 
ATOM 11035 H HG21 . THR A 1 21 ? 3.033   -0.287  -4.062  1.00 0.00 ? 19 THR P HG21 10 
ATOM 11036 H HG22 . THR A 1 21 ? 1.820   0.943   -3.716  1.00 0.00 ? 19 THR P HG22 10 
ATOM 11037 H HG23 . THR A 1 21 ? 3.516   1.418   -3.952  1.00 0.00 ? 19 THR P HG23 10 
ATOM 11038 N N    . PHE A 1 22 ? 5.804   0.312   -5.499  1.00 0.00 ? 20 PHE P N    10 
ATOM 11039 C CA   . PHE A 1 22 ? 7.189   0.715   -5.230  1.00 0.00 ? 20 PHE P CA   10 
ATOM 11040 C C    . PHE A 1 22 ? 8.018   0.756   -6.520  1.00 0.00 ? 20 PHE P C    10 
ATOM 11041 O O    . PHE A 1 22 ? 8.607   1.786   -6.832  1.00 0.00 ? 20 PHE P O    10 
ATOM 11042 C CB   . PHE A 1 22 ? 7.843   -0.209  -4.191  1.00 0.00 ? 20 PHE P CB   10 
ATOM 11043 C CG   . PHE A 1 22 ? 9.297   0.134   -3.911  1.00 0.00 ? 20 PHE P CG   10 
ATOM 11044 C CD1  . PHE A 1 22 ? 9.616   1.146   -2.987  1.00 0.00 ? 20 PHE P CD1  10 
ATOM 11045 C CD2  . PHE A 1 22 ? 10.332  -0.522  -4.608  1.00 0.00 ? 20 PHE P CD2  10 
ATOM 11046 C CE1  . PHE A 1 22 ? 10.959  1.492   -2.755  1.00 0.00 ? 20 PHE P CE1  10 
ATOM 11047 C CE2  . PHE A 1 22 ? 11.677  -0.176  -4.375  1.00 0.00 ? 20 PHE P CE2  10 
ATOM 11048 C CZ   . PHE A 1 22 ? 11.991  0.826   -3.441  1.00 0.00 ? 20 PHE P CZ   10 
ATOM 11049 H H    . PHE A 1 22 ? 5.483   -0.577  -5.133  1.00 0.00 ? 20 PHE P H    10 
ATOM 11050 H HA   . PHE A 1 22 ? 7.182   1.727   -4.820  1.00 0.00 ? 20 PHE P HA   10 
ATOM 11051 H HB2  . PHE A 1 22 ? 7.285   -0.143  -3.258  1.00 0.00 ? 20 PHE P HB2  10 
ATOM 11052 H HB3  . PHE A 1 22 ? 7.786   -1.242  -4.532  1.00 0.00 ? 20 PHE P HB3  10 
ATOM 11053 H HD1  . PHE A 1 22 ? 8.828   1.667   -2.462  1.00 0.00 ? 20 PHE P HD1  10 
ATOM 11054 H HD2  . PHE A 1 22 ? 10.092  -1.283  -5.337  1.00 0.00 ? 20 PHE P HD2  10 
ATOM 11055 H HE1  . PHE A 1 22 ? 11.198  2.279   -2.056  1.00 0.00 ? 20 PHE P HE1  10 
ATOM 11056 H HE2  . PHE A 1 22 ? 12.472  -0.668  -4.921  1.00 0.00 ? 20 PHE P HE2  10 
ATOM 11057 H HZ   . PHE A 1 22 ? 13.023  1.098   -3.264  1.00 0.00 ? 20 PHE P HZ   10 
ATOM 11058 N N    . GLN A 1 23 ? 8.034   -0.321  -7.315  1.00 0.00 ? 21 GLN P N    10 
ATOM 11059 C CA   . GLN A 1 23 ? 8.851   -0.376  -8.537  1.00 0.00 ? 21 GLN P CA   10 
ATOM 11060 C C    . GLN A 1 23 ? 8.370   0.606   -9.626  1.00 0.00 ? 21 GLN P C    10 
ATOM 11061 O O    . GLN A 1 23 ? 9.182   1.068   -10.433 1.00 0.00 ? 21 GLN P O    10 
ATOM 11062 C CB   . GLN A 1 23 ? 8.918   -1.818  -9.072  1.00 0.00 ? 21 GLN P CB   10 
ATOM 11063 C CG   . GLN A 1 23 ? 9.568   -2.855  -8.131  1.00 0.00 ? 21 GLN P CG   10 
ATOM 11064 C CD   . GLN A 1 23 ? 11.077  -2.708  -7.921  1.00 0.00 ? 21 GLN P CD   10 
ATOM 11065 O OE1  . GLN A 1 23 ? 11.644  -1.626  -7.839  1.00 0.00 ? 21 GLN P OE1  10 
ATOM 11066 N NE2  . GLN A 1 23 ? 11.798  -3.799  -7.781  1.00 0.00 ? 21 GLN P NE2  10 
ATOM 11067 H H    . GLN A 1 23 ? 7.516   -1.148  -7.032  1.00 0.00 ? 21 GLN P H    10 
ATOM 11068 H HA   . GLN A 1 23 ? 9.860   -0.058  -8.278  1.00 0.00 ? 21 GLN P HA   10 
ATOM 11069 H HB2  . GLN A 1 23 ? 7.901   -2.147  -9.291  1.00 0.00 ? 21 GLN P HB2  10 
ATOM 11070 H HB3  . GLN A 1 23 ? 9.472   -1.819  -10.012 1.00 0.00 ? 21 GLN P HB3  10 
ATOM 11071 H HG2  . GLN A 1 23 ? 9.093   -2.829  -7.154  1.00 0.00 ? 21 GLN P HG2  10 
ATOM 11072 H HG3  . GLN A 1 23 ? 9.377   -3.842  -8.554  1.00 0.00 ? 21 GLN P HG3  10 
ATOM 11073 H HE21 . GLN A 1 23 ? 11.383  -4.706  -7.942  1.00 0.00 ? 21 GLN P HE21 10 
ATOM 11074 H HE22 . GLN A 1 23 ? 12.801  -3.696  -7.720  1.00 0.00 ? 21 GLN P HE22 10 
ATOM 11075 N N    . ARG A 1 24 ? 7.080   0.981   -9.626  1.00 0.00 ? 22 ARG P N    10 
ATOM 11076 C CA   . ARG A 1 24 ? 6.518   2.058   -10.467 1.00 0.00 ? 22 ARG P CA   10 
ATOM 11077 C C    . ARG A 1 24 ? 6.881   3.463   -9.965  1.00 0.00 ? 22 ARG P C    10 
ATOM 11078 O O    . ARG A 1 24 ? 7.174   4.335   -10.784 1.00 0.00 ? 22 ARG P O    10 
ATOM 11079 C CB   . ARG A 1 24 ? 4.991   1.895   -10.562 1.00 0.00 ? 22 ARG P CB   10 
ATOM 11080 C CG   . ARG A 1 24 ? 4.583   0.706   -11.453 1.00 0.00 ? 22 ARG P CG   10 
ATOM 11081 C CD   . ARG A 1 24 ? 3.087   0.387   -11.338 1.00 0.00 ? 22 ARG P CD   10 
ATOM 11082 N NE   . ARG A 1 24 ? 2.236   1.483   -11.845 1.00 0.00 ? 22 ARG P NE   10 
ATOM 11083 C CZ   . ARG A 1 24 ? 0.925   1.589   -11.722 1.00 0.00 ? 22 ARG P CZ   10 
ATOM 11084 N NH1  . ARG A 1 24 ? 0.208   0.686   -11.113 1.00 0.00 ? 22 ARG P NH1  10 
ATOM 11085 N NH2  . ARG A 1 24 ? 0.298   2.619   -12.216 1.00 0.00 ? 22 ARG P NH2  10 
ATOM 11086 H H    . ARG A 1 24 ? 6.455   0.487   -8.996  1.00 0.00 ? 22 ARG P H    10 
ATOM 11087 H HA   . ARG A 1 24 ? 6.934   1.981   -11.473 1.00 0.00 ? 22 ARG P HA   10 
ATOM 11088 H HB2  . ARG A 1 24 ? 4.580   1.765   -9.560  1.00 0.00 ? 22 ARG P HB2  10 
ATOM 11089 H HB3  . ARG A 1 24 ? 4.563   2.805   -10.986 1.00 0.00 ? 22 ARG P HB3  10 
ATOM 11090 H HG2  . ARG A 1 24 ? 4.828   0.931   -12.492 1.00 0.00 ? 22 ARG P HG2  10 
ATOM 11091 H HG3  . ARG A 1 24 ? 5.143   -0.182  -11.162 1.00 0.00 ? 22 ARG P HG3  10 
ATOM 11092 H HD2  . ARG A 1 24 ? 2.883   -0.519  -11.914 1.00 0.00 ? 22 ARG P HD2  10 
ATOM 11093 H HD3  . ARG A 1 24 ? 2.854   0.187   -10.289 1.00 0.00 ? 22 ARG P HD3  10 
ATOM 11094 H HE   . ARG A 1 24 ? 2.696   2.222   -12.356 1.00 0.00 ? 22 ARG P HE   10 
ATOM 11095 H HH11 . ARG A 1 24 ? 0.661   -0.127  -10.734 1.00 0.00 ? 22 ARG P HH11 10 
ATOM 11096 H HH12 . ARG A 1 24 ? -0.789  0.791   -11.034 1.00 0.00 ? 22 ARG P HH12 10 
ATOM 11097 H HH21 . ARG A 1 24 ? 0.809   3.342   -12.695 1.00 0.00 ? 22 ARG P HH21 10 
ATOM 11098 H HH22 . ARG A 1 24 ? -0.700  2.697   -12.123 1.00 0.00 ? 22 ARG P HH22 10 
ATOM 11099 N N    . ASN A 1 25 ? 6.870   3.691   -8.648  1.00 0.00 ? 23 ASN P N    10 
ATOM 11100 C CA   . ASN A 1 25 ? 7.169   4.982   -8.017  1.00 0.00 ? 23 ASN P CA   10 
ATOM 11101 C C    . ASN A 1 25 ? 7.837   4.794   -6.635  1.00 0.00 ? 23 ASN P C    10 
ATOM 11102 O O    . ASN A 1 25 ? 7.160   4.735   -5.601  1.00 0.00 ? 23 ASN P O    10 
ATOM 11103 C CB   . ASN A 1 25 ? 5.856   5.793   -7.943  1.00 0.00 ? 23 ASN P CB   10 
ATOM 11104 C CG   . ASN A 1 25 ? 6.078   7.226   -7.481  1.00 0.00 ? 23 ASN P CG   10 
ATOM 11105 O OD1  . ASN A 1 25 ? 6.056   8.167   -8.261  1.00 0.00 ? 23 ASN P OD1  10 
ATOM 11106 N ND2  . ASN A 1 25 ? 6.316   7.438   -6.208  1.00 0.00 ? 23 ASN P ND2  10 
ATOM 11107 H H    . ASN A 1 25 ? 6.587   2.932   -8.040  1.00 0.00 ? 23 ASN P H    10 
ATOM 11108 H HA   . ASN A 1 25 ? 7.870   5.535   -8.646  1.00 0.00 ? 23 ASN P HA   10 
ATOM 11109 H HB2  . ASN A 1 25 ? 5.397   5.828   -8.931  1.00 0.00 ? 23 ASN P HB2  10 
ATOM 11110 H HB3  . ASN A 1 25 ? 5.156   5.303   -7.265  1.00 0.00 ? 23 ASN P HB3  10 
ATOM 11111 H HD21 . ASN A 1 25 ? 6.408   6.640   -5.590  1.00 0.00 ? 23 ASN P HD21 10 
ATOM 11112 H HD22 . ASN A 1 25 ? 6.515   8.378   -5.906  1.00 0.00 ? 23 ASN P HD22 10 
ATOM 11113 N N    . ARG A 1 26 ? 9.176   4.753   -6.604  1.00 0.00 ? 24 ARG P N    10 
ATOM 11114 C CA   . ARG A 1 26 ? 9.970   4.656   -5.361  1.00 0.00 ? 24 ARG P CA   10 
ATOM 11115 C C    . ARG A 1 26 ? 9.896   5.961   -4.558  1.00 0.00 ? 24 ARG P C    10 
ATOM 11116 O O    . ARG A 1 26 ? 9.680   7.029   -5.132  1.00 0.00 ? 24 ARG P O    10 
ATOM 11117 C CB   . ARG A 1 26 ? 11.424  4.241   -5.669  1.00 0.00 ? 24 ARG P CB   10 
ATOM 11118 C CG   . ARG A 1 26 ? 11.489  2.902   -6.420  1.00 0.00 ? 24 ARG P CG   10 
ATOM 11119 C CD   . ARG A 1 26 ? 12.921  2.410   -6.632  1.00 0.00 ? 24 ARG P CD   10 
ATOM 11120 N NE   . ARG A 1 26 ? 12.931  1.227   -7.519  1.00 0.00 ? 24 ARG P NE   10 
ATOM 11121 C CZ   . ARG A 1 26 ? 13.406  1.143   -8.748  1.00 0.00 ? 24 ARG P CZ   10 
ATOM 11122 N NH1  . ARG A 1 26 ? 13.991  2.138   -9.353  1.00 0.00 ? 24 ARG P NH1  10 
ATOM 11123 N NH2  . ARG A 1 26 ? 13.291  0.026   -9.400  1.00 0.00 ? 24 ARG P NH2  10 
ATOM 11124 H H    . ARG A 1 26 ? 9.669   4.809   -7.483  1.00 0.00 ? 24 ARG P H    10 
ATOM 11125 H HA   . ARG A 1 26 ? 9.526   3.874   -4.741  1.00 0.00 ? 24 ARG P HA   10 
ATOM 11126 H HB2  . ARG A 1 26 ? 11.906  5.016   -6.267  1.00 0.00 ? 24 ARG P HB2  10 
ATOM 11127 H HB3  . ARG A 1 26 ? 11.970  4.139   -4.729  1.00 0.00 ? 24 ARG P HB3  10 
ATOM 11128 H HG2  . ARG A 1 26 ? 10.949  2.149   -5.850  1.00 0.00 ? 24 ARG P HG2  10 
ATOM 11129 H HG3  . ARG A 1 26 ? 11.019  3.012   -7.397  1.00 0.00 ? 24 ARG P HG3  10 
ATOM 11130 H HD2  . ARG A 1 26 ? 13.518  3.219   -7.053  1.00 0.00 ? 24 ARG P HD2  10 
ATOM 11131 H HD3  . ARG A 1 26 ? 13.352  2.142   -5.666  1.00 0.00 ? 24 ARG P HD3  10 
ATOM 11132 H HE   . ARG A 1 26 ? 12.491  0.387   -7.169  1.00 0.00 ? 24 ARG P HE   10 
ATOM 11133 H HH11 . ARG A 1 26 ? 14.083  3.016   -8.876  1.00 0.00 ? 24 ARG P HH11 10 
ATOM 11134 H HH12 . ARG A 1 26 ? 14.328  2.037   -10.295 1.00 0.00 ? 24 ARG P HH12 10 
ATOM 11135 H HH21 . ARG A 1 26 ? 12.784  -0.736  -8.959  1.00 0.00 ? 24 ARG P HH21 10 
ATOM 11136 H HH22 . ARG A 1 26 ? 13.631  -0.062  -10.342 1.00 0.00 ? 24 ARG P HH22 10 
ATOM 11137 N N    . TYR A 1 27 ? 10.070  5.873   -3.234  1.00 0.00 ? 25 TYR P N    10 
ATOM 11138 C CA   . TYR A 1 27 ? 9.842   6.979   -2.282  1.00 0.00 ? 25 TYR P CA   10 
ATOM 11139 C C    . TYR A 1 27 ? 8.457   7.660   -2.482  1.00 0.00 ? 25 TYR P C    10 
ATOM 11140 O O    . TYR A 1 27 ? 8.394   8.859   -2.779  1.00 0.00 ? 25 TYR P O    10 
ATOM 11141 C CB   . TYR A 1 27 ? 11.031  7.967   -2.300  1.00 0.00 ? 25 TYR P CB   10 
ATOM 11142 C CG   . TYR A 1 27 ? 12.351  7.443   -1.748  1.00 0.00 ? 25 TYR P CG   10 
ATOM 11143 C CD1  . TYR A 1 27 ? 13.116  6.515   -2.482  1.00 0.00 ? 25 TYR P CD1  10 
ATOM 11144 C CD2  . TYR A 1 27 ? 12.844  7.934   -0.521  1.00 0.00 ? 25 TYR P CD2  10 
ATOM 11145 C CE1  . TYR A 1 27 ? 14.354  6.065   -1.985  1.00 0.00 ? 25 TYR P CE1  10 
ATOM 11146 C CE2  . TYR A 1 27 ? 14.090  7.497   -0.027  1.00 0.00 ? 25 TYR P CE2  10 
ATOM 11147 C CZ   . TYR A 1 27 ? 14.849  6.558   -0.761  1.00 0.00 ? 25 TYR P CZ   10 
ATOM 11148 O OH   . TYR A 1 27 ? 16.060  6.135   -0.303  1.00 0.00 ? 25 TYR P OH   10 
ATOM 11149 H H    . TYR A 1 27 ? 10.284  4.964   -2.854  1.00 0.00 ? 25 TYR P H    10 
ATOM 11150 H HA   . TYR A 1 27 ? 9.818   6.551   -1.279  1.00 0.00 ? 25 TYR P HA   10 
ATOM 11151 H HB2  . TYR A 1 27 ? 11.196  8.319   -3.319  1.00 0.00 ? 25 TYR P HB2  10 
ATOM 11152 H HB3  . TYR A 1 27 ? 10.753  8.842   -1.709  1.00 0.00 ? 25 TYR P HB3  10 
ATOM 11153 H HD1  . TYR A 1 27 ? 12.765  6.159   -3.440  1.00 0.00 ? 25 TYR P HD1  10 
ATOM 11154 H HD2  . TYR A 1 27 ? 12.279  8.677   0.030   1.00 0.00 ? 25 TYR P HD2  10 
ATOM 11155 H HE1  . TYR A 1 27 ? 14.938  5.351   -2.545  1.00 0.00 ? 25 TYR P HE1  10 
ATOM 11156 H HE2  . TYR A 1 27 ? 14.479  7.894   0.901   1.00 0.00 ? 25 TYR P HE2  10 
ATOM 11157 H HH   . TYR A 1 27 ? 16.274  6.512   0.568   1.00 0.00 ? 25 TYR P HH   10 
ATOM 11158 N N    . PRO A 1 28 ? 7.332   6.917   -2.361  1.00 0.00 ? 26 PRO P N    10 
ATOM 11159 C CA   . PRO A 1 28 ? 5.980   7.455   -2.550  1.00 0.00 ? 26 PRO P CA   10 
ATOM 11160 C C    . PRO A 1 28 ? 5.637   8.558   -1.537  1.00 0.00 ? 26 PRO P C    10 
ATOM 11161 O O    . PRO A 1 28 ? 6.051   8.500   -0.377  1.00 0.00 ? 26 PRO P O    10 
ATOM 11162 C CB   . PRO A 1 28 ? 5.036   6.252   -2.428  1.00 0.00 ? 26 PRO P CB   10 
ATOM 11163 C CG   . PRO A 1 28 ? 5.809   5.278   -1.541  1.00 0.00 ? 26 PRO P CG   10 
ATOM 11164 C CD   . PRO A 1 28 ? 7.257   5.517   -1.958  1.00 0.00 ? 26 PRO P CD   10 
ATOM 11165 H HA   . PRO A 1 28 ? 5.877   7.874   -3.549  1.00 0.00 ? 26 PRO P HA   10 
ATOM 11166 H HB2  . PRO A 1 28 ? 4.076   6.518   -1.985  1.00 0.00 ? 26 PRO P HB2  10 
ATOM 11167 H HB3  . PRO A 1 28 ? 4.887   5.805   -3.413  1.00 0.00 ? 26 PRO P HB3  10 
ATOM 11168 H HG2  . PRO A 1 28 ? 5.679   5.545   -0.492  1.00 0.00 ? 26 PRO P HG2  10 
ATOM 11169 H HG3  . PRO A 1 28 ? 5.506   4.245   -1.717  1.00 0.00 ? 26 PRO P HG3  10 
ATOM 11170 H HD2  . PRO A 1 28 ? 7.923   5.300   -1.122  1.00 0.00 ? 26 PRO P HD2  10 
ATOM 11171 H HD3  . PRO A 1 28 ? 7.499   4.879   -2.809  1.00 0.00 ? 26 PRO P HD3  10 
ATOM 11172 N N    . ASP A 1 29 ? 4.845   9.546   -1.958  1.00 0.00 ? 27 ASP P N    10 
ATOM 11173 C CA   . ASP A 1 29 ? 4.321   10.614  -1.096  1.00 0.00 ? 27 ASP P CA   10 
ATOM 11174 C C    . ASP A 1 29 ? 3.212   10.099  -0.163  1.00 0.00 ? 27 ASP P C    10 
ATOM 11175 O O    . ASP A 1 29 ? 2.582   9.075   -0.429  1.00 0.00 ? 27 ASP P O    10 
ATOM 11176 C CB   . ASP A 1 29 ? 3.805   11.776  -1.958  1.00 0.00 ? 27 ASP P CB   10 
ATOM 11177 C CG   . ASP A 1 29 ? 4.943   12.500  -2.697  1.00 0.00 ? 27 ASP P CG   10 
ATOM 11178 O OD1  . ASP A 1 29 ? 5.683   13.276  -2.047  1.00 0.00 ? 27 ASP P OD1  10 
ATOM 11179 O OD2  . ASP A 1 29 ? 5.090   12.311  -3.929  1.00 0.00 ? 27 ASP P OD2  10 
ATOM 11180 H H    . ASP A 1 29 ? 4.521   9.526   -2.914  1.00 0.00 ? 27 ASP P H    10 
ATOM 11181 H HA   . ASP A 1 29 ? 5.129   10.992  -0.468  1.00 0.00 ? 27 ASP P HA   10 
ATOM 11182 H HB2  . ASP A 1 29 ? 3.068   11.400  -2.671  1.00 0.00 ? 27 ASP P HB2  10 
ATOM 11183 H HB3  . ASP A 1 29 ? 3.297   12.498  -1.314  1.00 0.00 ? 27 ASP P HB3  10 
ATOM 11184 N N    . MET A 1 30 ? 2.938   10.812  0.932   1.00 0.00 ? 28 MET P N    10 
ATOM 11185 C CA   . MET A 1 30 ? 1.991   10.374  1.970   1.00 0.00 ? 28 MET P CA   10 
ATOM 11186 C C    . MET A 1 30 ? 0.553   10.216  1.442   1.00 0.00 ? 28 MET P C    10 
ATOM 11187 O O    . MET A 1 30 ? -0.173  9.326   1.885   1.00 0.00 ? 28 MET P O    10 
ATOM 11188 C CB   . MET A 1 30 ? 2.027   11.341  3.170   1.00 0.00 ? 28 MET P CB   10 
ATOM 11189 C CG   . MET A 1 30 ? 3.443   11.553  3.729   1.00 0.00 ? 28 MET P CG   10 
ATOM 11190 S SD   . MET A 1 30 ? 4.430   12.801  2.845   1.00 0.00 ? 28 MET P SD   10 
ATOM 11191 C CE   . MET A 1 30 ? 6.094   12.139  3.117   1.00 0.00 ? 28 MET P CE   10 
ATOM 11192 H H    . MET A 1 30 ? 3.472   11.653  1.106   1.00 0.00 ? 28 MET P H    10 
ATOM 11193 H HA   . MET A 1 30 ? 2.310   9.393   2.323   1.00 0.00 ? 28 MET P HA   10 
ATOM 11194 H HB2  . MET A 1 30 ? 1.604   12.306  2.885   1.00 0.00 ? 28 MET P HB2  10 
ATOM 11195 H HB3  . MET A 1 30 ? 1.407   10.919  3.961   1.00 0.00 ? 28 MET P HB3  10 
ATOM 11196 H HG2  . MET A 1 30 ? 3.359   11.872  4.767   1.00 0.00 ? 28 MET P HG2  10 
ATOM 11197 H HG3  . MET A 1 30 ? 3.969   10.598  3.717   1.00 0.00 ? 28 MET P HG3  10 
ATOM 11198 H HE1  . MET A 1 30 ? 6.285   12.041  4.187   1.00 0.00 ? 28 MET P HE1  10 
ATOM 11199 H HE2  . MET A 1 30 ? 6.178   11.164  2.638   1.00 0.00 ? 28 MET P HE2  10 
ATOM 11200 H HE3  . MET A 1 30 ? 6.831   12.814  2.680   1.00 0.00 ? 28 MET P HE3  10 
ATOM 11201 N N    . SER A 1 31 ? 0.162   11.018  0.447   1.00 0.00 ? 29 SER P N    10 
ATOM 11202 C CA   . SER A 1 31 ? -1.098  10.868  -0.295  1.00 0.00 ? 29 SER P CA   10 
ATOM 11203 C C    . SER A 1 31 ? -1.129  9.585   -1.137  1.00 0.00 ? 29 SER P C    10 
ATOM 11204 O O    . SER A 1 31 ? -2.119  8.852   -1.100  1.00 0.00 ? 29 SER P O    10 
ATOM 11205 C CB   . SER A 1 31 ? -1.323  12.099  -1.182  1.00 0.00 ? 29 SER P CB   10 
ATOM 11206 O OG   . SER A 1 31 ? -0.169  12.374  -1.966  1.00 0.00 ? 29 SER P OG   10 
ATOM 11207 H H    . SER A 1 31 ? 0.813   11.712  0.107   1.00 0.00 ? 29 SER P H    10 
ATOM 11208 H HA   . SER A 1 31 ? -1.923  10.814  0.417   1.00 0.00 ? 29 SER P HA   10 
ATOM 11209 H HB2  . SER A 1 31 ? -2.184  11.928  -1.830  1.00 0.00 ? 29 SER P HB2  10 
ATOM 11210 H HB3  . SER A 1 31 ? -1.533  12.959  -0.544  1.00 0.00 ? 29 SER P HB3  10 
ATOM 11211 H HG   . SER A 1 31 ? -0.351  13.161  -2.516  1.00 0.00 ? 29 SER P HG   10 
ATOM 11212 N N    . THR A 1 32 ? -0.030  9.249   -1.822  1.00 0.00 ? 30 THR P N    10 
ATOM 11213 C CA   . THR A 1 32 ? 0.131   7.985   -2.563  1.00 0.00 ? 30 THR P CA   10 
ATOM 11214 C C    . THR A 1 32 ? 0.043   6.784   -1.618  1.00 0.00 ? 30 THR P C    10 
ATOM 11215 O O    . THR A 1 32 ? -0.707  5.847   -1.891  1.00 0.00 ? 30 THR P O    10 
ATOM 11216 C CB   . THR A 1 32 ? 1.472   7.945   -3.320  1.00 0.00 ? 30 THR P CB   10 
ATOM 11217 O OG1  . THR A 1 32 ? 1.689   9.136   -4.048  1.00 0.00 ? 30 THR P OG1  10 
ATOM 11218 C CG2  . THR A 1 32 ? 1.560   6.780   -4.308  1.00 0.00 ? 30 THR P CG2  10 
ATOM 11219 H H    . THR A 1 32 ? 0.746   9.897   -1.824  1.00 0.00 ? 30 THR P H    10 
ATOM 11220 H HA   . THR A 1 32 ? -0.679  7.898   -3.288  1.00 0.00 ? 30 THR P HA   10 
ATOM 11221 H HB   . THR A 1 32 ? 2.283   7.841   -2.602  1.00 0.00 ? 30 THR P HB   10 
ATOM 11222 H HG1  . THR A 1 32 ? 0.973   9.224   -4.700  1.00 0.00 ? 30 THR P HG1  10 
ATOM 11223 H HG21 . THR A 1 32 ? 1.523   5.832   -3.772  1.00 0.00 ? 30 THR P HG21 10 
ATOM 11224 H HG22 . THR A 1 32 ? 2.503   6.833   -4.851  1.00 0.00 ? 30 THR P HG22 10 
ATOM 11225 H HG23 . THR A 1 32 ? 0.732   6.823   -5.016  1.00 0.00 ? 30 THR P HG23 10 
ATOM 11226 N N    . ARG A 1 33 ? 0.745   6.827   -0.473  1.00 0.00 ? 31 ARG P N    10 
ATOM 11227 C CA   . ARG A 1 33 ? 0.688   5.784   0.572   1.00 0.00 ? 31 ARG P CA   10 
ATOM 11228 C C    . ARG A 1 33 ? -0.736  5.583   1.104   1.00 0.00 ? 31 ARG P C    10 
ATOM 11229 O O    . ARG A 1 33 ? -1.173  4.447   1.259   1.00 0.00 ? 31 ARG P O    10 
ATOM 11230 C CB   . ARG A 1 33 ? 1.628   6.129   1.745   1.00 0.00 ? 31 ARG P CB   10 
ATOM 11231 C CG   . ARG A 1 33 ? 3.112   6.227   1.359   1.00 0.00 ? 31 ARG P CG   10 
ATOM 11232 C CD   . ARG A 1 33 ? 3.967   6.685   2.549   1.00 0.00 ? 31 ARG P CD   10 
ATOM 11233 N NE   . ARG A 1 33 ? 5.191   7.369   2.091   1.00 0.00 ? 31 ARG P NE   10 
ATOM 11234 C CZ   . ARG A 1 33 ? 6.123   7.943   2.825   1.00 0.00 ? 31 ARG P CZ   10 
ATOM 11235 N NH1  . ARG A 1 33 ? 6.096   7.931   4.126   1.00 0.00 ? 31 ARG P NH1  10 
ATOM 11236 N NH2  . ARG A 1 33 ? 7.101   8.561   2.236   1.00 0.00 ? 31 ARG P NH2  10 
ATOM 11237 H H    . ARG A 1 33 ? 1.363   7.625   -0.338  1.00 0.00 ? 31 ARG P H    10 
ATOM 11238 H HA   . ARG A 1 33 ? 0.988   4.829   0.130   1.00 0.00 ? 31 ARG P HA   10 
ATOM 11239 H HB2  . ARG A 1 33 ? 1.315   7.078   2.182   1.00 0.00 ? 31 ARG P HB2  10 
ATOM 11240 H HB3  . ARG A 1 33 ? 1.523   5.365   2.515   1.00 0.00 ? 31 ARG P HB3  10 
ATOM 11241 H HG2  . ARG A 1 33 ? 3.469   5.262   1.006   1.00 0.00 ? 31 ARG P HG2  10 
ATOM 11242 H HG3  . ARG A 1 33 ? 3.228   6.937   0.546   1.00 0.00 ? 31 ARG P HG3  10 
ATOM 11243 H HD2  . ARG A 1 33 ? 3.388   7.381   3.160   1.00 0.00 ? 31 ARG P HD2  10 
ATOM 11244 H HD3  . ARG A 1 33 ? 4.222   5.817   3.160   1.00 0.00 ? 31 ARG P HD3  10 
ATOM 11245 H HE   . ARG A 1 33 ? 5.308   7.496   1.092   1.00 0.00 ? 31 ARG P HE   10 
ATOM 11246 H HH11 . ARG A 1 33 ? 5.328   7.485   4.589   1.00 0.00 ? 31 ARG P HH11 10 
ATOM 11247 H HH12 . ARG A 1 33 ? 6.814   8.396   4.657   1.00 0.00 ? 31 ARG P HH12 10 
ATOM 11248 H HH21 . ARG A 1 33 ? 7.072   8.635   1.224   1.00 0.00 ? 31 ARG P HH21 10 
ATOM 11249 H HH22 . ARG A 1 33 ? 7.829   9.011   2.763   1.00 0.00 ? 31 ARG P HH22 10 
ATOM 11250 N N    . GLU A 1 34 ? -1.474  6.665   1.348   1.00 0.00 ? 32 GLU P N    10 
ATOM 11251 C CA   . GLU A 1 34 ? -2.865  6.607   1.819   1.00 0.00 ? 32 GLU P CA   10 
ATOM 11252 C C    . GLU A 1 34 ? -3.821  6.014   0.765   1.00 0.00 ? 32 GLU P C    10 
ATOM 11253 O O    . GLU A 1 34 ? -4.683  5.204   1.109   1.00 0.00 ? 32 GLU P O    10 
ATOM 11254 C CB   . GLU A 1 34 ? -3.302  8.015   2.255   1.00 0.00 ? 32 GLU P CB   10 
ATOM 11255 C CG   . GLU A 1 34 ? -4.700  8.054   2.884   1.00 0.00 ? 32 GLU P CG   10 
ATOM 11256 C CD   . GLU A 1 34 ? -5.075  9.491   3.297   1.00 0.00 ? 32 GLU P CD   10 
ATOM 11257 O OE1  . GLU A 1 34 ? -4.694  9.931   4.410   1.00 0.00 ? 32 GLU P OE1  10 
ATOM 11258 O OE2  . GLU A 1 34 ? -5.760  10.193  2.514   1.00 0.00 ? 32 GLU P OE2  10 
ATOM 11259 H H    . GLU A 1 34 ? -1.038  7.575   1.245   1.00 0.00 ? 32 GLU P H    10 
ATOM 11260 H HA   . GLU A 1 34 ? -2.901  5.947   2.688   1.00 0.00 ? 32 GLU P HA   10 
ATOM 11261 H HB2  . GLU A 1 34 ? -2.586  8.390   2.989   1.00 0.00 ? 32 GLU P HB2  10 
ATOM 11262 H HB3  . GLU A 1 34 ? -3.286  8.681   1.391   1.00 0.00 ? 32 GLU P HB3  10 
ATOM 11263 H HG2  . GLU A 1 34 ? -5.433  7.680   2.165   1.00 0.00 ? 32 GLU P HG2  10 
ATOM 11264 H HG3  . GLU A 1 34 ? -4.719  7.394   3.754   1.00 0.00 ? 32 GLU P HG3  10 
ATOM 11265 N N    . GLU A 1 35 ? -3.650  6.347   -0.519  1.00 0.00 ? 33 GLU P N    10 
ATOM 11266 C CA   . GLU A 1 35 ? -4.441  5.745   -1.602  1.00 0.00 ? 33 GLU P CA   10 
ATOM 11267 C C    . GLU A 1 35 ? -4.161  4.243   -1.750  1.00 0.00 ? 33 GLU P C    10 
ATOM 11268 O O    . GLU A 1 35 ? -5.101  3.447   -1.776  1.00 0.00 ? 33 GLU P O    10 
ATOM 11269 C CB   . GLU A 1 35 ? -4.204  6.470   -2.936  1.00 0.00 ? 33 GLU P CB   10 
ATOM 11270 C CG   . GLU A 1 35 ? -4.895  7.839   -2.981  1.00 0.00 ? 33 GLU P CG   10 
ATOM 11271 C CD   . GLU A 1 35 ? -4.724  8.507   -4.360  1.00 0.00 ? 33 GLU P CD   10 
ATOM 11272 O OE1  . GLU A 1 35 ? -3.618  9.013   -4.670  1.00 0.00 ? 33 GLU P OE1  10 
ATOM 11273 O OE2  . GLU A 1 35 ? -5.707  8.550   -5.141  1.00 0.00 ? 33 GLU P OE2  10 
ATOM 11274 H H    . GLU A 1 35 ? -2.950  7.043   -0.756  1.00 0.00 ? 33 GLU P H    10 
ATOM 11275 H HA   . GLU A 1 35 ? -5.499  5.839   -1.355  1.00 0.00 ? 33 GLU P HA   10 
ATOM 11276 H HB2  . GLU A 1 35 ? -3.134  6.583   -3.113  1.00 0.00 ? 33 GLU P HB2  10 
ATOM 11277 H HB3  . GLU A 1 35 ? -4.622  5.857   -3.733  1.00 0.00 ? 33 GLU P HB3  10 
ATOM 11278 H HG2  . GLU A 1 35 ? -5.958  7.701   -2.766  1.00 0.00 ? 33 GLU P HG2  10 
ATOM 11279 H HG3  . GLU A 1 35 ? -4.487  8.487   -2.203  1.00 0.00 ? 33 GLU P HG3  10 
ATOM 11280 N N    . ILE A 1 36 ? -2.892  3.814   -1.766  1.00 0.00 ? 34 ILE P N    10 
ATOM 11281 C CA   . ILE A 1 36 ? -2.581  2.379   -1.872  1.00 0.00 ? 34 ILE P CA   10 
ATOM 11282 C C    . ILE A 1 36 ? -2.983  1.599   -0.610  1.00 0.00 ? 34 ILE P C    10 
ATOM 11283 O O    . ILE A 1 36 ? -3.295  0.412   -0.707  1.00 0.00 ? 34 ILE P O    10 
ATOM 11284 C CB   . ILE A 1 36 ? -1.138  2.103   -2.353  1.00 0.00 ? 34 ILE P CB   10 
ATOM 11285 C CG1  . ILE A 1 36 ? -0.004  2.434   -1.368  1.00 0.00 ? 34 ILE P CG1  10 
ATOM 11286 C CG2  . ILE A 1 36 ? -0.871  2.835   -3.678  1.00 0.00 ? 34 ILE P CG2  10 
ATOM 11287 C CD1  . ILE A 1 36 ? 0.114   1.457   -0.195  1.00 0.00 ? 34 ILE P CD1  10 
ATOM 11288 H H    . ILE A 1 36 ? -2.134  4.490   -1.742  1.00 0.00 ? 34 ILE P H    10 
ATOM 11289 H HA   . ILE A 1 36 ? -3.221  1.985   -2.662  1.00 0.00 ? 34 ILE P HA   10 
ATOM 11290 H HB   . ILE A 1 36 ? -1.068  1.040   -2.562  1.00 0.00 ? 34 ILE P HB   10 
ATOM 11291 H HG12 . ILE A 1 36 ? 0.943   2.403   -1.909  1.00 0.00 ? 34 ILE P HG12 10 
ATOM 11292 H HG13 . ILE A 1 36 ? -0.143  3.440   -0.992  1.00 0.00 ? 34 ILE P HG13 10 
ATOM 11293 H HG21 . ILE A 1 36 ? 0.073   2.503   -4.105  1.00 0.00 ? 34 ILE P HG21 10 
ATOM 11294 H HG22 . ILE A 1 36 ? -1.667  2.622   -4.390  1.00 0.00 ? 34 ILE P HG22 10 
ATOM 11295 H HG23 . ILE A 1 36 ? -0.813  3.910   -3.514  1.00 0.00 ? 34 ILE P HG23 10 
ATOM 11296 H HD11 . ILE A 1 36 ? -0.169  0.451   -0.503  1.00 0.00 ? 34 ILE P HD11 10 
ATOM 11297 H HD12 . ILE A 1 36 ? 1.146   1.437   0.146   1.00 0.00 ? 34 ILE P HD12 10 
ATOM 11298 H HD13 . ILE A 1 36 ? -0.514  1.777   0.633   1.00 0.00 ? 34 ILE P HD13 10 
ATOM 11299 N N    . ALA A 1 37 ? -3.065  2.253   0.556   1.00 0.00 ? 35 ALA P N    10 
ATOM 11300 C CA   . ALA A 1 37 ? -3.550  1.647   1.795   1.00 0.00 ? 35 ALA P CA   10 
ATOM 11301 C C    . ALA A 1 37 ? -5.040  1.277   1.701   1.00 0.00 ? 35 ALA P C    10 
ATOM 11302 O O    . ALA A 1 37 ? -5.408  0.158   2.056   1.00 0.00 ? 35 ALA P O    10 
ATOM 11303 C CB   . ALA A 1 37 ? -3.279  2.590   2.974   1.00 0.00 ? 35 ALA P CB   10 
ATOM 11304 H H    . ALA A 1 37 ? -2.733  3.210   0.591   1.00 0.00 ? 35 ALA P H    10 
ATOM 11305 H HA   . ALA A 1 37 ? -2.994  0.725   1.969   1.00 0.00 ? 35 ALA P HA   10 
ATOM 11306 H HB1  . ALA A 1 37 ? -3.867  3.499   2.876   1.00 0.00 ? 35 ALA P HB1  10 
ATOM 11307 H HB2  . ALA A 1 37 ? -3.552  2.095   3.906   1.00 0.00 ? 35 ALA P HB2  10 
ATOM 11308 H HB3  . ALA A 1 37 ? -2.222  2.850   3.017   1.00 0.00 ? 35 ALA P HB3  10 
ATOM 11309 N N    . VAL A 1 38 ? -5.903  2.151   1.162   1.00 0.00 ? 36 VAL P N    10 
ATOM 11310 C CA   . VAL A 1 38 ? -7.328  1.820   0.960   1.00 0.00 ? 36 VAL P CA   10 
ATOM 11311 C C    . VAL A 1 38 ? -7.543  0.806   -0.174  1.00 0.00 ? 36 VAL P C    10 
ATOM 11312 O O    . VAL A 1 38 ? -8.451  -0.020  -0.081  1.00 0.00 ? 36 VAL P O    10 
ATOM 11313 C CB   . VAL A 1 38 ? -8.233  3.059   0.804   1.00 0.00 ? 36 VAL P CB   10 
ATOM 11314 C CG1  . VAL A 1 38 ? -8.198  3.934   2.060   1.00 0.00 ? 36 VAL P CG1  10 
ATOM 11315 C CG2  . VAL A 1 38 ? -7.896  3.960   -0.384  1.00 0.00 ? 36 VAL P CG2  10 
ATOM 11316 H H    . VAL A 1 38 ? -5.562  3.063   0.881   1.00 0.00 ? 36 VAL P H    10 
ATOM 11317 H HA   . VAL A 1 38 ? -7.673  1.318   1.865   1.00 0.00 ? 36 VAL P HA   10 
ATOM 11318 H HB   . VAL A 1 38 ? -9.258  2.708   0.675   1.00 0.00 ? 36 VAL P HB   10 
ATOM 11319 H HG11 . VAL A 1 38 ? -8.465  3.339   2.933   1.00 0.00 ? 36 VAL P HG11 10 
ATOM 11320 H HG12 . VAL A 1 38 ? -7.202  4.356   2.195   1.00 0.00 ? 36 VAL P HG12 10 
ATOM 11321 H HG13 . VAL A 1 38 ? -8.915  4.748   1.953   1.00 0.00 ? 36 VAL P HG13 10 
ATOM 11322 H HG21 . VAL A 1 38 ? -7.885  3.382   -1.302  1.00 0.00 ? 36 VAL P HG21 10 
ATOM 11323 H HG22 . VAL A 1 38 ? -8.649  4.743   -0.476  1.00 0.00 ? 36 VAL P HG22 10 
ATOM 11324 H HG23 . VAL A 1 38 ? -6.925  4.424   -0.231  1.00 0.00 ? 36 VAL P HG23 10 
ATOM 11325 N N    . TRP A 1 39 ? -6.683  0.792   -1.200  1.00 0.00 ? 37 TRP P N    10 
ATOM 11326 C CA   . TRP A 1 39 ? -6.737  -0.188  -2.301  1.00 0.00 ? 37 TRP P CA   10 
ATOM 11327 C C    . TRP A 1 39 ? -6.285  -1.600  -1.881  1.00 0.00 ? 37 TRP P C    10 
ATOM 11328 O O    . TRP A 1 39 ? -6.838  -2.589  -2.366  1.00 0.00 ? 37 TRP P O    10 
ATOM 11329 C CB   . TRP A 1 39 ? -5.899  0.319   -3.487  1.00 0.00 ? 37 TRP P CB   10 
ATOM 11330 C CG   . TRP A 1 39 ? -6.264  1.652   -4.076  1.00 0.00 ? 37 TRP P CG   10 
ATOM 11331 C CD1  . TRP A 1 39 ? -7.388  2.351   -3.814  1.00 0.00 ? 37 TRP P CD1  10 
ATOM 11332 C CD2  . TRP A 1 39 ? -5.488  2.491   -4.990  1.00 0.00 ? 37 TRP P CD2  10 
ATOM 11333 N NE1  . TRP A 1 39 ? -7.354  3.571   -4.456  1.00 0.00 ? 37 TRP P NE1  10 
ATOM 11334 C CE2  . TRP A 1 39 ? -6.208  3.707   -5.211  1.00 0.00 ? 37 TRP P CE2  10 
ATOM 11335 C CE3  . TRP A 1 39 ? -4.245  2.355   -5.645  1.00 0.00 ? 37 TRP P CE3  10 
ATOM 11336 C CZ2  . TRP A 1 39 ? -5.720  4.729   -6.038  1.00 0.00 ? 37 TRP P CZ2  10 
ATOM 11337 C CZ3  . TRP A 1 39 ? -3.744  3.378   -6.475  1.00 0.00 ? 37 TRP P CZ3  10 
ATOM 11338 C CH2  . TRP A 1 39 ? -4.477  4.563   -6.672  1.00 0.00 ? 37 TRP P CH2  10 
ATOM 11339 H H    . TRP A 1 39 ? -6.012  1.549   -1.275  1.00 0.00 ? 37 TRP P H    10 
ATOM 11340 H HA   . TRP A 1 39 ? -7.770  -0.280  -2.639  1.00 0.00 ? 37 TRP P HA   10 
ATOM 11341 H HB2  . TRP A 1 39 ? -4.867  0.389   -3.158  1.00 0.00 ? 37 TRP P HB2  10 
ATOM 11342 H HB3  . TRP A 1 39 ? -5.944  -0.422  -4.286  1.00 0.00 ? 37 TRP P HB3  10 
ATOM 11343 H HD1  . TRP A 1 39 ? -8.162  2.018   -3.138  1.00 0.00 ? 37 TRP P HD1  10 
ATOM 11344 H HE1  . TRP A 1 39 ? -8.064  4.284   -4.326  1.00 0.00 ? 37 TRP P HE1  10 
ATOM 11345 H HE3  . TRP A 1 39 ? -3.671  1.449   -5.501  1.00 0.00 ? 37 TRP P HE3  10 
ATOM 11346 H HZ2  . TRP A 1 39 ? -6.292  5.637   -6.178  1.00 0.00 ? 37 TRP P HZ2  10 
ATOM 11347 H HZ3  . TRP A 1 39 ? -2.786  3.254   -6.965  1.00 0.00 ? 37 TRP P HZ3  10 
ATOM 11348 H HH2  . TRP A 1 39 ? -4.083  5.344   -7.310  1.00 0.00 ? 37 TRP P HH2  10 
ATOM 11349 N N    . THR A 1 40 ? -5.324  -1.709  -0.954  1.00 0.00 ? 38 THR P N    10 
ATOM 11350 C CA   . THR A 1 40 ? -4.849  -2.989  -0.375  1.00 0.00 ? 38 THR P CA   10 
ATOM 11351 C C    . THR A 1 40 ? -5.544  -3.374  0.941   1.00 0.00 ? 38 THR P C    10 
ATOM 11352 O O    . THR A 1 40 ? -5.292  -4.454  1.475   1.00 0.00 ? 38 THR P O    10 
ATOM 11353 C CB   . THR A 1 40 ? -3.320  -3.005  -0.187  1.00 0.00 ? 38 THR P CB   10 
ATOM 11354 O OG1  . THR A 1 40 ? -2.895  -1.948  0.641   1.00 0.00 ? 38 THR P OG1  10 
ATOM 11355 C CG2  . THR A 1 40 ? -2.562  -2.903  -1.510  1.00 0.00 ? 38 THR P CG2  10 
ATOM 11356 H H    . THR A 1 40 ? -4.871  -0.856  -0.646  1.00 0.00 ? 38 THR P H    10 
ATOM 11357 H HA   . THR A 1 40 ? -5.081  -3.791  -1.075  1.00 0.00 ? 38 THR P HA   10 
ATOM 11358 H HB   . THR A 1 40 ? -3.036  -3.947  0.281   1.00 0.00 ? 38 THR P HB   10 
ATOM 11359 H HG1  . THR A 1 40 ? -2.957  -1.127  0.118   1.00 0.00 ? 38 THR P HG1  10 
ATOM 11360 H HG21 . THR A 1 40 ? -2.851  -3.731  -2.156  1.00 0.00 ? 38 THR P HG21 10 
ATOM 11361 H HG22 . THR A 1 40 ? -1.490  -2.962  -1.319  1.00 0.00 ? 38 THR P HG22 10 
ATOM 11362 H HG23 . THR A 1 40 ? -2.786  -1.961  -2.012  1.00 0.00 ? 38 THR P HG23 10 
ATOM 11363 N N    . ASN A 1 41 ? -6.442  -2.523  1.453   1.00 0.00 ? 39 ASN P N    10 
ATOM 11364 C CA   . ASN A 1 41 ? -7.117  -2.637  2.753   1.00 0.00 ? 39 ASN P CA   10 
ATOM 11365 C C    . ASN A 1 41 ? -6.143  -2.782  3.952   1.00 0.00 ? 39 ASN P C    10 
ATOM 11366 O O    . ASN A 1 41 ? -6.305  -3.640  4.824   1.00 0.00 ? 39 ASN P O    10 
ATOM 11367 C CB   . ASN A 1 41 ? -8.229  -3.704  2.672   1.00 0.00 ? 39 ASN P CB   10 
ATOM 11368 C CG   . ASN A 1 41 ? -9.214  -3.646  3.833   1.00 0.00 ? 39 ASN P CG   10 
ATOM 11369 O OD1  . ASN A 1 41 ? -9.341  -2.661  4.549   1.00 0.00 ? 39 ASN P OD1  10 
ATOM 11370 N ND2  . ASN A 1 41 ? -9.981  -4.695  4.035   1.00 0.00 ? 39 ASN P ND2  10 
ATOM 11371 H H    . ASN A 1 41 ? -6.579  -1.657  0.951   1.00 0.00 ? 39 ASN P H    10 
ATOM 11372 H HA   . ASN A 1 41 ? -7.606  -1.672  2.904   1.00 0.00 ? 39 ASN P HA   10 
ATOM 11373 H HB2  . ASN A 1 41 ? -8.797  -3.567  1.752   1.00 0.00 ? 39 ASN P HB2  10 
ATOM 11374 H HB3  . ASN A 1 41 ? -7.773  -4.694  2.645   1.00 0.00 ? 39 ASN P HB3  10 
ATOM 11375 H HD21 . ASN A 1 41 ? -9.897  -5.507  3.443   1.00 0.00 ? 39 ASN P HD21 10 
ATOM 11376 H HD22 . ASN A 1 41 ? -10.646 -4.664  4.792   1.00 0.00 ? 39 ASN P HD22 10 
ATOM 11377 N N    . LEU A 1 42 ? -5.113  -1.931  3.968   1.00 0.00 ? 40 LEU P N    10 
ATOM 11378 C CA   . LEU A 1 42 ? -4.089  -1.788  5.012   1.00 0.00 ? 40 LEU P CA   10 
ATOM 11379 C C    . LEU A 1 42 ? -4.262  -0.483  5.815   1.00 0.00 ? 40 LEU P C    10 
ATOM 11380 O O    . LEU A 1 42 ? -5.017  0.413   5.432   1.00 0.00 ? 40 LEU P O    10 
ATOM 11381 C CB   . LEU A 1 42 ? -2.693  -1.839  4.348   1.00 0.00 ? 40 LEU P CB   10 
ATOM 11382 C CG   . LEU A 1 42 ? -1.999  -3.208  4.415   1.00 0.00 ? 40 LEU P CG   10 
ATOM 11383 C CD1  . LEU A 1 42 ? -2.759  -4.313  3.688   1.00 0.00 ? 40 LEU P CD1  10 
ATOM 11384 C CD2  . LEU A 1 42 ? -0.609  -3.107  3.794   1.00 0.00 ? 40 LEU P CD2  10 
ATOM 11385 H H    . LEU A 1 42 ? -5.084  -1.253  3.215   1.00 0.00 ? 40 LEU P H    10 
ATOM 11386 H HA   . LEU A 1 42 ? -4.170  -2.612  5.725   1.00 0.00 ? 40 LEU P HA   10 
ATOM 11387 H HB2  . LEU A 1 42 ? -2.761  -1.510  3.311   1.00 0.00 ? 40 LEU P HB2  10 
ATOM 11388 H HB3  . LEU A 1 42 ? -2.039  -1.132  4.856   1.00 0.00 ? 40 LEU P HB3  10 
ATOM 11389 H HG   . LEU A 1 42 ? -1.889  -3.486  5.462   1.00 0.00 ? 40 LEU P HG   10 
ATOM 11390 H HD11 . LEU A 1 42 ? -3.728  -4.466  4.157   1.00 0.00 ? 40 LEU P HD11 10 
ATOM 11391 H HD12 . LEU A 1 42 ? -2.199  -5.246  3.745   1.00 0.00 ? 40 LEU P HD12 10 
ATOM 11392 H HD13 . LEU A 1 42 ? -2.896  -4.037  2.645   1.00 0.00 ? 40 LEU P HD13 10 
ATOM 11393 H HD21 . LEU A 1 42 ? -0.006  -2.388  4.347   1.00 0.00 ? 40 LEU P HD21 10 
ATOM 11394 H HD22 . LEU A 1 42 ? -0.697  -2.785  2.755   1.00 0.00 ? 40 LEU P HD22 10 
ATOM 11395 H HD23 . LEU A 1 42 ? -0.119  -4.079  3.830   1.00 0.00 ? 40 LEU P HD23 10 
ATOM 11396 N N    . THR A 1 43 ? -3.518  -0.368  6.921   1.00 0.00 ? 41 THR P N    10 
ATOM 11397 C CA   . THR A 1 43 ? -3.353  0.878   7.691   1.00 0.00 ? 41 THR P CA   10 
ATOM 11398 C C    . THR A 1 43 ? -2.100  1.632   7.234   1.00 0.00 ? 41 THR P C    10 
ATOM 11399 O O    . THR A 1 43 ? -1.045  1.031   7.005   1.00 0.00 ? 41 THR P O    10 
ATOM 11400 C CB   . THR A 1 43 ? -3.370  0.632   9.209   1.00 0.00 ? 41 THR P CB   10 
ATOM 11401 O OG1  . THR A 1 43 ? -3.137  1.844   9.896   1.00 0.00 ? 41 THR P OG1  10 
ATOM 11402 C CG2  . THR A 1 43 ? -2.319  -0.365  9.697   1.00 0.00 ? 41 THR P CG2  10 
ATOM 11403 H H    . THR A 1 43 ? -2.908  -1.137  7.155   1.00 0.00 ? 41 THR P H    10 
ATOM 11404 H HA   . THR A 1 43 ? -4.204  1.525   7.495   1.00 0.00 ? 41 THR P HA   10 
ATOM 11405 H HB   . THR A 1 43 ? -4.356  0.255   9.484   1.00 0.00 ? 41 THR P HB   10 
ATOM 11406 H HG1  . THR A 1 43 ? -3.357  1.698   10.833  1.00 0.00 ? 41 THR P HG1  10 
ATOM 11407 H HG21 . THR A 1 43 ? -2.414  -0.498  10.775  1.00 0.00 ? 41 THR P HG21 10 
ATOM 11408 H HG22 . THR A 1 43 ? -1.322  0.004   9.470   1.00 0.00 ? 41 THR P HG22 10 
ATOM 11409 H HG23 . THR A 1 43 ? -2.470  -1.331  9.216   1.00 0.00 ? 41 THR P HG23 10 
ATOM 11410 N N    . GLU A 1 44 ? -2.195  2.957   7.103   1.00 0.00 ? 42 GLU P N    10 
ATOM 11411 C CA   . GLU A 1 44 ? -1.123  3.809   6.569   1.00 0.00 ? 42 GLU P CA   10 
ATOM 11412 C C    . GLU A 1 44 ? 0.170   3.740   7.404   1.00 0.00 ? 42 GLU P C    10 
ATOM 11413 O O    . GLU A 1 44 ? 1.265   3.880   6.858   1.00 0.00 ? 42 GLU P O    10 
ATOM 11414 C CB   . GLU A 1 44 ? -1.570  5.279   6.455   1.00 0.00 ? 42 GLU P CB   10 
ATOM 11415 C CG   . GLU A 1 44 ? -2.902  5.518   5.724   1.00 0.00 ? 42 GLU P CG   10 
ATOM 11416 C CD   . GLU A 1 44 ? -4.106  5.486   6.690   1.00 0.00 ? 42 GLU P CD   10 
ATOM 11417 O OE1  . GLU A 1 44 ? -4.635  4.384   6.967   1.00 0.00 ? 42 GLU P OE1  10 
ATOM 11418 O OE2  . GLU A 1 44 ? -4.516  6.559   7.193   1.00 0.00 ? 42 GLU P OE2  10 
ATOM 11419 H H    . GLU A 1 44 ? -3.105  3.381   7.274   1.00 0.00 ? 42 GLU P H    10 
ATOM 11420 H HA   . GLU A 1 44 ? -0.888  3.464   5.562   1.00 0.00 ? 42 GLU P HA   10 
ATOM 11421 H HB2  . GLU A 1 44 ? -1.624  5.723   7.449   1.00 0.00 ? 42 GLU P HB2  10 
ATOM 11422 H HB3  . GLU A 1 44 ? -0.791  5.801   5.898   1.00 0.00 ? 42 GLU P HB3  10 
ATOM 11423 H HG2  . GLU A 1 44 ? -2.852  6.500   5.247   1.00 0.00 ? 42 GLU P HG2  10 
ATOM 11424 H HG3  . GLU A 1 44 ? -3.022  4.781   4.928   1.00 0.00 ? 42 GLU P HG3  10 
ATOM 11425 N N    . ALA A 1 45 ? 0.069   3.468   8.710   1.00 0.00 ? 43 ALA P N    10 
ATOM 11426 C CA   . ALA A 1 45 ? 1.221   3.299   9.597   1.00 0.00 ? 43 ALA P CA   10 
ATOM 11427 C C    . ALA A 1 45 ? 2.049   2.044   9.253   1.00 0.00 ? 43 ALA P C    10 
ATOM 11428 O O    . ALA A 1 45 ? 3.281   2.099   9.223   1.00 0.00 ? 43 ALA P O    10 
ATOM 11429 C CB   . ALA A 1 45 ? 0.711   3.264   11.043  1.00 0.00 ? 43 ALA P CB   10 
ATOM 11430 H H    . ALA A 1 45 ? -0.858  3.352   9.100   1.00 0.00 ? 43 ALA P H    10 
ATOM 11431 H HA   . ALA A 1 45 ? 1.876   4.165   9.487   1.00 0.00 ? 43 ALA P HA   10 
ATOM 11432 H HB1  . ALA A 1 45 ? 0.177   4.187   11.270  1.00 0.00 ? 43 ALA P HB1  10 
ATOM 11433 H HB2  . ALA A 1 45 ? 0.040   2.415   11.188  1.00 0.00 ? 43 ALA P HB2  10 
ATOM 11434 H HB3  . ALA A 1 45 ? 1.557   3.170   11.727  1.00 0.00 ? 43 ALA P HB3  10 
ATOM 11435 N N    . ARG A 1 46 ? 1.389   0.925   8.916   1.00 0.00 ? 44 ARG P N    10 
ATOM 11436 C CA   . ARG A 1 46 ? 2.061   -0.305  8.459   1.00 0.00 ? 44 ARG P CA   10 
ATOM 11437 C C    . ARG A 1 46 ? 2.611   -0.151  7.040   1.00 0.00 ? 44 ARG P C    10 
ATOM 11438 O O    . ARG A 1 46 ? 3.707   -0.626  6.762   1.00 0.00 ? 44 ARG P O    10 
ATOM 11439 C CB   . ARG A 1 46 ? 1.121   -1.510  8.611   1.00 0.00 ? 44 ARG P CB   10 
ATOM 11440 C CG   . ARG A 1 46 ? 1.869   -2.829  8.352   1.00 0.00 ? 44 ARG P CG   10 
ATOM 11441 C CD   . ARG A 1 46 ? 1.000   -4.049  8.664   1.00 0.00 ? 44 ARG P CD   10 
ATOM 11442 N NE   . ARG A 1 46 ? 0.842   -4.277  10.114  1.00 0.00 ? 44 ARG P NE   10 
ATOM 11443 C CZ   . ARG A 1 46 ? 0.350   -5.360  10.690  1.00 0.00 ? 44 ARG P CZ   10 
ATOM 11444 N NH1  . ARG A 1 46 ? -0.101  -6.372  10.002  1.00 0.00 ? 44 ARG P NH1  10 
ATOM 11445 N NH2  . ARG A 1 46 ? 0.303   -5.450  11.989  1.00 0.00 ? 44 ARG P NH2  10 
ATOM 11446 H H    . ARG A 1 46 ? 0.378   0.961   8.903   1.00 0.00 ? 44 ARG P H    10 
ATOM 11447 H HA   . ARG A 1 46 ? 2.922   -0.489  9.103   1.00 0.00 ? 44 ARG P HA   10 
ATOM 11448 H HB2  . ARG A 1 46 ? 0.729   -1.518  9.629   1.00 0.00 ? 44 ARG P HB2  10 
ATOM 11449 H HB3  . ARG A 1 46 ? 0.286   -1.419  7.915   1.00 0.00 ? 44 ARG P HB3  10 
ATOM 11450 H HG2  . ARG A 1 46 ? 2.151   -2.876  7.299   1.00 0.00 ? 44 ARG P HG2  10 
ATOM 11451 H HG3  . ARG A 1 46 ? 2.779   -2.872  8.954   1.00 0.00 ? 44 ARG P HG3  10 
ATOM 11452 H HD2  . ARG A 1 46 ? 0.024   -3.892  8.208   1.00 0.00 ? 44 ARG P HD2  10 
ATOM 11453 H HD3  . ARG A 1 46 ? 1.473   -4.924  8.212   1.00 0.00 ? 44 ARG P HD3  10 
ATOM 11454 H HE   . ARG A 1 46 ? 1.167   -3.551  10.734  1.00 0.00 ? 44 ARG P HE   10 
ATOM 11455 H HH11 . ARG A 1 46 ? -0.090  -6.330  8.997   1.00 0.00 ? 44 ARG P HH11 10 
ATOM 11456 H HH12 . ARG A 1 46 ? -0.443  -7.194  10.467  1.00 0.00 ? 44 ARG P HH12 10 
ATOM 11457 H HH21 . ARG A 1 46 ? 0.643   -4.696  12.562  1.00 0.00 ? 44 ARG P HH21 10 
ATOM 11458 H HH22 . ARG A 1 46 ? -0.066  -6.276  12.428  1.00 0.00 ? 44 ARG P HH22 10 
ATOM 11459 N N    . VAL A 1 47 ? 1.911   0.584   6.174   1.00 0.00 ? 45 VAL P N    10 
ATOM 11460 C CA   . VAL A 1 47 ? 2.391   0.959   4.828   1.00 0.00 ? 45 VAL P CA   10 
ATOM 11461 C C    . VAL A 1 47 ? 3.672   1.803   4.896   1.00 0.00 ? 45 VAL P C    10 
ATOM 11462 O O    . VAL A 1 47 ? 4.628   1.529   4.168   1.00 0.00 ? 45 VAL P O    10 
ATOM 11463 C CB   . VAL A 1 47 ? 1.269   1.690   4.065   1.00 0.00 ? 45 VAL P CB   10 
ATOM 11464 C CG1  . VAL A 1 47 ? 1.750   2.371   2.788   1.00 0.00 ? 45 VAL P CG1  10 
ATOM 11465 C CG2  . VAL A 1 47 ? 0.162   0.702   3.690   1.00 0.00 ? 45 VAL P CG2  10 
ATOM 11466 H H    . VAL A 1 47 ? 0.996   0.904   6.471   1.00 0.00 ? 45 VAL P H    10 
ATOM 11467 H HA   . VAL A 1 47 ? 2.640   0.052   4.275   1.00 0.00 ? 45 VAL P HA   10 
ATOM 11468 H HB   . VAL A 1 47 ? 0.845   2.459   4.704   1.00 0.00 ? 45 VAL P HB   10 
ATOM 11469 H HG11 . VAL A 1 47 ? 0.902   2.818   2.270   1.00 0.00 ? 45 VAL P HG11 10 
ATOM 11470 H HG12 . VAL A 1 47 ? 2.452   3.170   3.023   1.00 0.00 ? 45 VAL P HG12 10 
ATOM 11471 H HG13 . VAL A 1 47 ? 2.233   1.632   2.151   1.00 0.00 ? 45 VAL P HG13 10 
ATOM 11472 H HG21 . VAL A 1 47 ? 0.560   -0.086  3.049   1.00 0.00 ? 45 VAL P HG21 10 
ATOM 11473 H HG22 . VAL A 1 47 ? -0.256  0.256   4.589   1.00 0.00 ? 45 VAL P HG22 10 
ATOM 11474 H HG23 . VAL A 1 47 ? -0.634  1.220   3.158   1.00 0.00 ? 45 VAL P HG23 10 
ATOM 11475 N N    . ARG A 1 48 ? 3.737   2.782   5.809   1.00 0.00 ? 46 ARG P N    10 
ATOM 11476 C CA   . ARG A 1 48 ? 4.930   3.611   6.061   1.00 0.00 ? 46 ARG P CA   10 
ATOM 11477 C C    . ARG A 1 48 ? 6.134   2.759   6.481   1.00 0.00 ? 46 ARG P C    10 
ATOM 11478 O O    . ARG A 1 48 ? 7.219   2.914   5.920   1.00 0.00 ? 46 ARG P O    10 
ATOM 11479 C CB   . ARG A 1 48 ? 4.559   4.670   7.117   1.00 0.00 ? 46 ARG P CB   10 
ATOM 11480 C CG   . ARG A 1 48 ? 5.665   5.708   7.362   1.00 0.00 ? 46 ARG P CG   10 
ATOM 11481 C CD   . ARG A 1 48 ? 5.266   6.726   8.442   1.00 0.00 ? 46 ARG P CD   10 
ATOM 11482 N NE   . ARG A 1 48 ? 4.077   7.526   8.068   1.00 0.00 ? 46 ARG P NE   10 
ATOM 11483 C CZ   . ARG A 1 48 ? 3.527   8.491   8.786   1.00 0.00 ? 46 ARG P CZ   10 
ATOM 11484 N NH1  . ARG A 1 48 ? 4.017   8.868   9.934   1.00 0.00 ? 46 ARG P NH1  10 
ATOM 11485 N NH2  . ARG A 1 48 ? 2.459   9.103   8.362   1.00 0.00 ? 46 ARG P NH2  10 
ATOM 11486 H H    . ARG A 1 48 ? 2.892   2.991   6.336   1.00 0.00 ? 46 ARG P H    10 
ATOM 11487 H HA   . ARG A 1 48 ? 5.207   4.119   5.135   1.00 0.00 ? 46 ARG P HA   10 
ATOM 11488 H HB2  . ARG A 1 48 ? 3.662   5.189   6.776   1.00 0.00 ? 46 ARG P HB2  10 
ATOM 11489 H HB3  . ARG A 1 48 ? 4.326   4.178   8.060   1.00 0.00 ? 46 ARG P HB3  10 
ATOM 11490 H HG2  . ARG A 1 48 ? 6.571   5.201   7.695   1.00 0.00 ? 46 ARG P HG2  10 
ATOM 11491 H HG3  . ARG A 1 48 ? 5.889   6.233   6.434   1.00 0.00 ? 46 ARG P HG3  10 
ATOM 11492 H HD2  . ARG A 1 48 ? 5.065   6.186   9.370   1.00 0.00 ? 46 ARG P HD2  10 
ATOM 11493 H HD3  . ARG A 1 48 ? 6.113   7.394   8.608   1.00 0.00 ? 46 ARG P HD3  10 
ATOM 11494 H HE   . ARG A 1 48 ? 3.617   7.301   7.201   1.00 0.00 ? 46 ARG P HE   10 
ATOM 11495 H HH11 . ARG A 1 48 ? 4.841   8.414   10.289  1.00 0.00 ? 46 ARG P HH11 10 
ATOM 11496 H HH12 . ARG A 1 48 ? 3.581   9.604   10.462  1.00 0.00 ? 46 ARG P HH12 10 
ATOM 11497 H HH21 . ARG A 1 48 ? 2.034   8.844   7.488   1.00 0.00 ? 46 ARG P HH21 10 
ATOM 11498 H HH22 . ARG A 1 48 ? 2.043   9.835   8.915   1.00 0.00 ? 46 ARG P HH22 10 
ATOM 11499 N N    . VAL A 1 49 ? 5.925   1.809   7.398   1.00 0.00 ? 47 VAL P N    10 
ATOM 11500 C CA   . VAL A 1 49 ? 6.945   0.821   7.801   1.00 0.00 ? 47 VAL P CA   10 
ATOM 11501 C C    . VAL A 1 49 ? 7.340   -0.087  6.631   1.00 0.00 ? 47 VAL P C    10 
ATOM 11502 O O    . VAL A 1 49 ? 8.528   -0.334  6.437   1.00 0.00 ? 47 VAL P O    10 
ATOM 11503 C CB   . VAL A 1 49 ? 6.470   -0.002  9.019   1.00 0.00 ? 47 VAL P CB   10 
ATOM 11504 C CG1  . VAL A 1 49 ? 7.407   -1.168  9.365   1.00 0.00 ? 47 VAL P CG1  10 
ATOM 11505 C CG2  . VAL A 1 49 ? 6.382   0.891   10.264  1.00 0.00 ? 47 VAL P CG2  10 
ATOM 11506 H H    . VAL A 1 49 ? 5.011   1.767   7.831   1.00 0.00 ? 47 VAL P H    10 
ATOM 11507 H HA   . VAL A 1 49 ? 7.849   1.356   8.098   1.00 0.00 ? 47 VAL P HA   10 
ATOM 11508 H HB   . VAL A 1 49 ? 5.480   -0.410  8.813   1.00 0.00 ? 47 VAL P HB   10 
ATOM 11509 H HG11 . VAL A 1 49 ? 7.067   -1.661  10.276  1.00 0.00 ? 47 VAL P HG11 10 
ATOM 11510 H HG12 . VAL A 1 49 ? 7.409   -1.910  8.565   1.00 0.00 ? 47 VAL P HG12 10 
ATOM 11511 H HG13 . VAL A 1 49 ? 8.424   -0.802  9.515   1.00 0.00 ? 47 VAL P HG13 10 
ATOM 11512 H HG21 . VAL A 1 49 ? 5.990   0.317   11.103  1.00 0.00 ? 47 VAL P HG21 10 
ATOM 11513 H HG22 . VAL A 1 49 ? 7.371   1.274   10.522  1.00 0.00 ? 47 VAL P HG22 10 
ATOM 11514 H HG23 . VAL A 1 49 ? 5.716   1.733   10.086  1.00 0.00 ? 47 VAL P HG23 10 
ATOM 11515 N N    . TRP A 1 50 ? 6.388   -0.537  5.807   1.00 0.00 ? 48 TRP P N    10 
ATOM 11516 C CA   . TRP A 1 50 ? 6.671   -1.411  4.663   1.00 0.00 ? 48 TRP P CA   10 
ATOM 11517 C C    . TRP A 1 50 ? 7.566   -0.729  3.624   1.00 0.00 ? 48 TRP P C    10 
ATOM 11518 O O    . TRP A 1 50 ? 8.580   -1.305  3.232   1.00 0.00 ? 48 TRP P O    10 
ATOM 11519 C CB   . TRP A 1 50 ? 5.374   -1.931  4.028   1.00 0.00 ? 48 TRP P CB   10 
ATOM 11520 C CG   . TRP A 1 50 ? 5.591   -3.096  3.109   1.00 0.00 ? 48 TRP P CG   10 
ATOM 11521 C CD1  . TRP A 1 50 ? 5.461   -4.396  3.460   1.00 0.00 ? 48 TRP P CD1  10 
ATOM 11522 C CD2  . TRP A 1 50 ? 6.036   -3.104  1.714   1.00 0.00 ? 48 TRP P CD2  10 
ATOM 11523 N NE1  . TRP A 1 50 ? 5.799   -5.205  2.392   1.00 0.00 ? 48 TRP P NE1  10 
ATOM 11524 C CE2  . TRP A 1 50 ? 6.177   -4.463  1.294   1.00 0.00 ? 48 TRP P CE2  10 
ATOM 11525 C CE3  . TRP A 1 50 ? 6.349   -2.107  0.762   1.00 0.00 ? 48 TRP P CE3  10 
ATOM 11526 C CZ2  . TRP A 1 50 ? 6.624   -4.815  0.011   1.00 0.00 ? 48 TRP P CZ2  10 
ATOM 11527 C CZ3  . TRP A 1 50 ? 6.802   -2.448  -0.528  1.00 0.00 ? 48 TRP P CZ3  10 
ATOM 11528 C CH2  . TRP A 1 50 ? 6.947   -3.797  -0.901  1.00 0.00 ? 48 TRP P CH2  10 
ATOM 11529 H H    . TRP A 1 50 ? 5.418   -0.336  6.027   1.00 0.00 ? 48 TRP P H    10 
ATOM 11530 H HA   . TRP A 1 50 ? 7.220   -2.277  5.035   1.00 0.00 ? 48 TRP P HA   10 
ATOM 11531 H HB2  . TRP A 1 50 ? 4.695   -2.250  4.820   1.00 0.00 ? 48 TRP P HB2  10 
ATOM 11532 H HB3  . TRP A 1 50 ? 4.887   -1.128  3.473   1.00 0.00 ? 48 TRP P HB3  10 
ATOM 11533 H HD1  . TRP A 1 50 ? 5.160   -4.747  4.441   1.00 0.00 ? 48 TRP P HD1  10 
ATOM 11534 H HE1  . TRP A 1 50 ? 5.797   -6.217  2.439   1.00 0.00 ? 48 TRP P HE1  10 
ATOM 11535 H HE3  . TRP A 1 50 ? 6.233   -1.069  1.033   1.00 0.00 ? 48 TRP P HE3  10 
ATOM 11536 H HZ2  . TRP A 1 50 ? 6.719   -5.854  -0.267  1.00 0.00 ? 48 TRP P HZ2  10 
ATOM 11537 H HZ3  . TRP A 1 50 ? 7.031   -1.669  -1.242  1.00 0.00 ? 48 TRP P HZ3  10 
ATOM 11538 H HH2  . TRP A 1 50 ? 7.301   -4.051  -1.889  1.00 0.00 ? 48 TRP P HH2  10 
ATOM 11539 N N    . PHE A 1 51 ? 7.277   0.516   3.227   1.00 0.00 ? 49 PHE P N    10 
ATOM 11540 C CA   . PHE A 1 51 ? 8.136   1.252   2.289   1.00 0.00 ? 49 PHE P CA   10 
ATOM 11541 C C    . PHE A 1 51 ? 9.492   1.641   2.896   1.00 0.00 ? 49 PHE P C    10 
ATOM 11542 O O    . PHE A 1 51 ? 10.482  1.706   2.167   1.00 0.00 ? 49 PHE P O    10 
ATOM 11543 C CB   . PHE A 1 51 ? 7.406   2.486   1.733   1.00 0.00 ? 49 PHE P CB   10 
ATOM 11544 C CG   . PHE A 1 51 ? 6.236   2.187   0.809   1.00 0.00 ? 49 PHE P CG   10 
ATOM 11545 C CD1  . PHE A 1 51 ? 6.403   1.350   -0.314  1.00 0.00 ? 49 PHE P CD1  10 
ATOM 11546 C CD2  . PHE A 1 51 ? 4.984   2.784   1.046   1.00 0.00 ? 49 PHE P CD2  10 
ATOM 11547 C CE1  . PHE A 1 51 ? 5.315   1.082   -1.165  1.00 0.00 ? 49 PHE P CE1  10 
ATOM 11548 C CE2  . PHE A 1 51 ? 3.909   2.544   0.173   1.00 0.00 ? 49 PHE P CE2  10 
ATOM 11549 C CZ   . PHE A 1 51 ? 4.068   1.678   -0.920  1.00 0.00 ? 49 PHE P CZ   10 
ATOM 11550 H H    . PHE A 1 51 ? 6.417   0.948   3.557   1.00 0.00 ? 49 PHE P H    10 
ATOM 11551 H HA   . PHE A 1 51 ? 8.367   0.593   1.452   1.00 0.00 ? 49 PHE P HA   10 
ATOM 11552 H HB2  . PHE A 1 51 ? 7.067   3.099   2.570   1.00 0.00 ? 49 PHE P HB2  10 
ATOM 11553 H HB3  . PHE A 1 51 ? 8.120   3.081   1.162   1.00 0.00 ? 49 PHE P HB3  10 
ATOM 11554 H HD1  . PHE A 1 51 ? 7.360   0.896   -0.521  1.00 0.00 ? 49 PHE P HD1  10 
ATOM 11555 H HD2  . PHE A 1 51 ? 4.847   3.432   1.901   1.00 0.00 ? 49 PHE P HD2  10 
ATOM 11556 H HE1  . PHE A 1 51 ? 5.434   0.417   -2.008  1.00 0.00 ? 49 PHE P HE1  10 
ATOM 11557 H HE2  . PHE A 1 51 ? 2.953   3.013   0.347   1.00 0.00 ? 49 PHE P HE2  10 
ATOM 11558 H HZ   . PHE A 1 51 ? 3.231   1.472   -1.571  1.00 0.00 ? 49 PHE P HZ   10 
ATOM 11559 N N    . LYS A 1 52 ? 9.590   1.875   4.212   1.00 0.00 ? 50 LYS P N    10 
ATOM 11560 C CA   . LYS A 1 52 ? 10.885  2.048   4.906   1.00 0.00 ? 50 LYS P CA   10 
ATOM 11561 C C    . LYS A 1 52 ? 11.720  0.761   4.855   1.00 0.00 ? 50 LYS P C    10 
ATOM 11562 O O    . LYS A 1 52 ? 12.898  0.803   4.505   1.00 0.00 ? 50 LYS P O    10 
ATOM 11563 C CB   . LYS A 1 52 ? 10.629  2.528   6.347   1.00 0.00 ? 50 LYS P CB   10 
ATOM 11564 C CG   . LYS A 1 52 ? 11.928  2.880   7.086   1.00 0.00 ? 50 LYS P CG   10 
ATOM 11565 C CD   . LYS A 1 52 ? 11.637  3.395   8.502   1.00 0.00 ? 50 LYS P CD   10 
ATOM 11566 C CE   . LYS A 1 52 ? 12.951  3.730   9.220   1.00 0.00 ? 50 LYS P CE   10 
ATOM 11567 N NZ   . LYS A 1 52 ? 12.711  4.228   10.600  1.00 0.00 ? 50 LYS P NZ   10 
ATOM 11568 H H    . LYS A 1 52 ? 8.740   1.854   4.769   1.00 0.00 ? 50 LYS P H    10 
ATOM 11569 H HA   . LYS A 1 52 ? 11.475  2.810   4.393   1.00 0.00 ? 50 LYS P HA   10 
ATOM 11570 H HB2  . LYS A 1 52 ? 9.997   3.418   6.315   1.00 0.00 ? 50 LYS P HB2  10 
ATOM 11571 H HB3  . LYS A 1 52 ? 10.099  1.754   6.904   1.00 0.00 ? 50 LYS P HB3  10 
ATOM 11572 H HG2  . LYS A 1 52 ? 12.560  1.994   7.157   1.00 0.00 ? 50 LYS P HG2  10 
ATOM 11573 H HG3  . LYS A 1 52 ? 12.462  3.650   6.526   1.00 0.00 ? 50 LYS P HG3  10 
ATOM 11574 H HD2  . LYS A 1 52 ? 11.015  4.290   8.440   1.00 0.00 ? 50 LYS P HD2  10 
ATOM 11575 H HD3  . LYS A 1 52 ? 11.101  2.626   9.062   1.00 0.00 ? 50 LYS P HD3  10 
ATOM 11576 H HE2  . LYS A 1 52 ? 13.573  2.831   9.252   1.00 0.00 ? 50 LYS P HE2  10 
ATOM 11577 H HE3  . LYS A 1 52 ? 13.486  4.487   8.639   1.00 0.00 ? 50 LYS P HE3  10 
ATOM 11578 H HZ1  . LYS A 1 52 ? 13.584  4.447   11.063  1.00 0.00 ? 50 LYS P HZ1  10 
ATOM 11579 H HZ2  . LYS A 1 52 ? 12.233  3.538   11.164  1.00 0.00 ? 50 LYS P HZ2  10 
ATOM 11580 H HZ3  . LYS A 1 52 ? 12.151  5.070   10.596  1.00 0.00 ? 50 LYS P HZ3  10 
ATOM 11581 N N    . ASN A 1 53 ? 11.093  -0.386  5.115   1.00 0.00 ? 51 ASN P N    10 
ATOM 11582 C CA   . ASN A 1 53 ? 11.714  -1.710  5.041   1.00 0.00 ? 51 ASN P CA   10 
ATOM 11583 C C    . ASN A 1 53 ? 12.148  -2.054  3.598   1.00 0.00 ? 51 ASN P C    10 
ATOM 11584 O O    . ASN A 1 53 ? 13.284  -2.478  3.380   1.00 0.00 ? 51 ASN P O    10 
ATOM 11585 C CB   . ASN A 1 53 ? 10.713  -2.720  5.637   1.00 0.00 ? 51 ASN P CB   10 
ATOM 11586 C CG   . ASN A 1 53 ? 11.281  -4.101  5.913   1.00 0.00 ? 51 ASN P CG   10 
ATOM 11587 O OD1  . ASN A 1 53 ? 12.477  -4.351  5.877   1.00 0.00 ? 51 ASN P OD1  10 
ATOM 11588 N ND2  . ASN A 1 53 ? 10.431  -5.046  6.240   1.00 0.00 ? 51 ASN P ND2  10 
ATOM 11589 H H    . ASN A 1 53 ? 10.126  -0.333  5.417   1.00 0.00 ? 51 ASN P H    10 
ATOM 11590 H HA   . ASN A 1 53 ? 12.613  -1.705  5.660   1.00 0.00 ? 51 ASN P HA   10 
ATOM 11591 H HB2  . ASN A 1 53 ? 10.346  -2.337  6.590   1.00 0.00 ? 51 ASN P HB2  10 
ATOM 11592 H HB3  . ASN A 1 53 ? 9.859   -2.825  4.968   1.00 0.00 ? 51 ASN P HB3  10 
ATOM 11593 H HD21 . ASN A 1 53 ? 9.445   -4.840  6.309   1.00 0.00 ? 51 ASN P HD21 10 
ATOM 11594 H HD22 . ASN A 1 53 ? 10.787  -5.967  6.441   1.00 0.00 ? 51 ASN P HD22 10 
ATOM 11595 N N    . ARG A 1 54 ? 11.301  -1.775  2.593   1.00 0.00 ? 52 ARG P N    10 
ATOM 11596 C CA   . ARG A 1 54 ? 11.628  -1.969  1.168   1.00 0.00 ? 52 ARG P CA   10 
ATOM 11597 C C    . ARG A 1 54 ? 12.841  -1.128  0.762   1.00 0.00 ? 52 ARG P C    10 
ATOM 11598 O O    . ARG A 1 54 ? 13.783  -1.672  0.190   1.00 0.00 ? 52 ARG P O    10 
ATOM 11599 C CB   . ARG A 1 54 ? 10.402  -1.665  0.274   1.00 0.00 ? 52 ARG P CB   10 
ATOM 11600 C CG   . ARG A 1 54 ? 10.311  -2.496  -1.023  1.00 0.00 ? 52 ARG P CG   10 
ATOM 11601 C CD   . ARG A 1 54 ? 11.638  -2.673  -1.783  1.00 0.00 ? 52 ARG P CD   10 
ATOM 11602 N NE   . ARG A 1 54 ? 11.476  -3.225  -3.142  1.00 0.00 ? 52 ARG P NE   10 
ATOM 11603 C CZ   . ARG A 1 54 ? 11.047  -4.420  -3.508  1.00 0.00 ? 52 ARG P CZ   10 
ATOM 11604 N NH1  . ARG A 1 54 ? 10.591  -5.315  -2.686  1.00 0.00 ? 52 ARG P NH1  10 
ATOM 11605 N NH2  . ARG A 1 54 ? 11.053  -4.776  -4.755  1.00 0.00 ? 52 ARG P NH2  10 
ATOM 11606 H H    . ARG A 1 54 ? 10.365  -1.466  2.838   1.00 0.00 ? 52 ARG P H    10 
ATOM 11607 H HA   . ARG A 1 54 ? 11.907  -3.016  1.038   1.00 0.00 ? 52 ARG P HA   10 
ATOM 11608 H HB2  . ARG A 1 54 ? 9.489   -1.865  0.835   1.00 0.00 ? 52 ARG P HB2  10 
ATOM 11609 H HB3  . ARG A 1 54 ? 10.393  -0.604  0.016   1.00 0.00 ? 52 ARG P HB3  10 
ATOM 11610 H HG2  . ARG A 1 54 ? 9.927   -3.482  -0.761  1.00 0.00 ? 52 ARG P HG2  10 
ATOM 11611 H HG3  . ARG A 1 54 ? 9.588   -2.019  -1.683  1.00 0.00 ? 52 ARG P HG3  10 
ATOM 11612 H HD2  . ARG A 1 54 ? 12.110  -1.694  -1.875  1.00 0.00 ? 52 ARG P HD2  10 
ATOM 11613 H HD3  . ARG A 1 54 ? 12.304  -3.322  -1.212  1.00 0.00 ? 52 ARG P HD3  10 
ATOM 11614 H HE   . ARG A 1 54 ? 11.764  -2.619  -3.893  1.00 0.00 ? 52 ARG P HE   10 
ATOM 11615 H HH11 . ARG A 1 54 ? 10.573  -5.142  -1.699  1.00 0.00 ? 52 ARG P HH11 10 
ATOM 11616 H HH12 . ARG A 1 54 ? 10.225  -6.177  -3.087  1.00 0.00 ? 52 ARG P HH12 10 
ATOM 11617 H HH21 . ARG A 1 54 ? 11.439  -4.190  -5.476  1.00 0.00 ? 52 ARG P HH21 10 
ATOM 11618 H HH22 . ARG A 1 54 ? 10.665  -5.693  -4.968  1.00 0.00 ? 52 ARG P HH22 10 
ATOM 11619 N N    . ARG A 1 55 ? 12.873  0.164   1.116   1.00 0.00 ? 53 ARG P N    10 
ATOM 11620 C CA   . ARG A 1 55 ? 14.023  1.054   0.851   1.00 0.00 ? 53 ARG P CA   10 
ATOM 11621 C C    . ARG A 1 55 ? 15.303  0.577   1.540   1.00 0.00 ? 53 ARG P C    10 
ATOM 11622 O O    . ARG A 1 55 ? 16.358  0.592   0.912   1.00 0.00 ? 53 ARG P O    10 
ATOM 11623 C CB   . ARG A 1 55 ? 13.684  2.497   1.259   1.00 0.00 ? 53 ARG P CB   10 
ATOM 11624 C CG   . ARG A 1 55 ? 12.733  3.152   0.245   1.00 0.00 ? 53 ARG P CG   10 
ATOM 11625 C CD   . ARG A 1 55 ? 12.296  4.548   0.696   1.00 0.00 ? 53 ARG P CD   10 
ATOM 11626 N NE   . ARG A 1 55 ? 11.363  4.485   1.837   1.00 0.00 ? 53 ARG P NE   10 
ATOM 11627 C CZ   . ARG A 1 55 ? 11.026  5.485   2.632   1.00 0.00 ? 53 ARG P CZ   10 
ATOM 11628 N NH1  . ARG A 1 55 ? 11.506  6.684   2.464   1.00 0.00 ? 53 ARG P NH1  10 
ATOM 11629 N NH2  . ARG A 1 55 ? 10.195  5.305   3.620   1.00 0.00 ? 53 ARG P NH2  10 
ATOM 11630 H H    . ARG A 1 55 ? 12.055  0.546   1.580   1.00 0.00 ? 53 ARG P H    10 
ATOM 11631 H HA   . ARG A 1 55 ? 14.243  1.043   -0.218  1.00 0.00 ? 53 ARG P HA   10 
ATOM 11632 H HB2  . ARG A 1 55 ? 13.240  2.501   2.256   1.00 0.00 ? 53 ARG P HB2  10 
ATOM 11633 H HB3  . ARG A 1 55 ? 14.603  3.086   1.293   1.00 0.00 ? 53 ARG P HB3  10 
ATOM 11634 H HG2  . ARG A 1 55 ? 13.250  3.241   -0.712  1.00 0.00 ? 53 ARG P HG2  10 
ATOM 11635 H HG3  . ARG A 1 55 ? 11.850  2.531   0.104   1.00 0.00 ? 53 ARG P HG3  10 
ATOM 11636 H HD2  . ARG A 1 55 ? 13.187  5.115   0.969   1.00 0.00 ? 53 ARG P HD2  10 
ATOM 11637 H HD3  . ARG A 1 55 ? 11.803  5.046   -0.141  1.00 0.00 ? 53 ARG P HD3  10 
ATOM 11638 H HE   . ARG A 1 55 ? 10.958  3.578   2.031   1.00 0.00 ? 53 ARG P HE   10 
ATOM 11639 H HH11 . ARG A 1 55 ? 12.149  6.846   1.709   1.00 0.00 ? 53 ARG P HH11 10 
ATOM 11640 H HH12 . ARG A 1 55 ? 11.262  7.431   3.092   1.00 0.00 ? 53 ARG P HH12 10 
ATOM 11641 H HH21 . ARG A 1 55 ? 9.783   4.405   3.790   1.00 0.00 ? 53 ARG P HH21 10 
ATOM 11642 H HH22 . ARG A 1 55 ? 9.961   6.074   4.224   1.00 0.00 ? 53 ARG P HH22 10 
ATOM 11643 N N    . ALA A 1 56 ? 15.216  0.078   2.775   1.00 0.00 ? 54 ALA P N    10 
ATOM 11644 C CA   . ALA A 1 56 ? 16.363  -0.477  3.498   1.00 0.00 ? 54 ALA P CA   10 
ATOM 11645 C C    . ALA A 1 56 ? 16.965  -1.727  2.817   1.00 0.00 ? 54 ALA P C    10 
ATOM 11646 O O    . ALA A 1 56 ? 18.188  -1.885  2.813   1.00 0.00 ? 54 ALA P O    10 
ATOM 11647 C CB   . ALA A 1 56 ? 15.941  -0.766  4.944   1.00 0.00 ? 54 ALA P CB   10 
ATOM 11648 H H    . ALA A 1 56 ? 14.326  0.136   3.256   1.00 0.00 ? 54 ALA P H    10 
ATOM 11649 H HA   . ALA A 1 56 ? 17.147  0.283   3.526   1.00 0.00 ? 54 ALA P HA   10 
ATOM 11650 H HB1  . ALA A 1 56 ? 15.558  0.144   5.408   1.00 0.00 ? 54 ALA P HB1  10 
ATOM 11651 H HB2  . ALA A 1 56 ? 15.170  -1.535  4.968   1.00 0.00 ? 54 ALA P HB2  10 
ATOM 11652 H HB3  . ALA A 1 56 ? 16.805  -1.113  5.512   1.00 0.00 ? 54 ALA P HB3  10 
ATOM 11653 N N    . LYS A 1 57 ? 16.138  -2.585  2.197   1.00 0.00 ? 55 LYS P N    10 
ATOM 11654 C CA   . LYS A 1 57 ? 16.595  -3.751  1.408   1.00 0.00 ? 55 LYS P CA   10 
ATOM 11655 C C    . LYS A 1 57 ? 17.070  -3.367  0.001   1.00 0.00 ? 55 LYS P C    10 
ATOM 11656 O O    . LYS A 1 57 ? 18.100  -3.869  -0.449  1.00 0.00 ? 55 LYS P O    10 
ATOM 11657 C CB   . LYS A 1 57 ? 15.490  -4.825  1.345   1.00 0.00 ? 55 LYS P CB   10 
ATOM 11658 C CG   . LYS A 1 57 ? 15.541  -5.840  2.501   1.00 0.00 ? 55 LYS P CG   10 
ATOM 11659 C CD   . LYS A 1 57 ? 15.260  -5.234  3.882   1.00 0.00 ? 55 LYS P CD   10 
ATOM 11660 C CE   . LYS A 1 57 ? 15.246  -6.324  4.957   1.00 0.00 ? 55 LYS P CE   10 
ATOM 11661 N NZ   . LYS A 1 57 ? 14.913  -5.756  6.288   1.00 0.00 ? 55 LYS P NZ   10 
ATOM 11662 H H    . LYS A 1 57 ? 15.139  -2.421  2.288   1.00 0.00 ? 55 LYS P H    10 
ATOM 11663 H HA   . LYS A 1 57 ? 17.465  -4.191  1.897   1.00 0.00 ? 55 LYS P HA   10 
ATOM 11664 H HB2  . LYS A 1 57 ? 14.505  -4.354  1.307   1.00 0.00 ? 55 LYS P HB2  10 
ATOM 11665 H HB3  . LYS A 1 57 ? 15.611  -5.397  0.422   1.00 0.00 ? 55 LYS P HB3  10 
ATOM 11666 H HG2  . LYS A 1 57 ? 14.796  -6.612  2.305   1.00 0.00 ? 55 LYS P HG2  10 
ATOM 11667 H HG3  . LYS A 1 57 ? 16.523  -6.316  2.512   1.00 0.00 ? 55 LYS P HG3  10 
ATOM 11668 H HD2  . LYS A 1 57 ? 16.026  -4.498  4.128   1.00 0.00 ? 55 LYS P HD2  10 
ATOM 11669 H HD3  . LYS A 1 57 ? 14.285  -4.749  3.857   1.00 0.00 ? 55 LYS P HD3  10 
ATOM 11670 H HE2  . LYS A 1 57 ? 14.503  -7.077  4.681   1.00 0.00 ? 55 LYS P HE2  10 
ATOM 11671 H HE3  . LYS A 1 57 ? 16.225  -6.811  4.988   1.00 0.00 ? 55 LYS P HE3  10 
ATOM 11672 H HZ1  . LYS A 1 57 ? 15.616  -5.098  6.595   1.00 0.00 ? 55 LYS P HZ1  10 
ATOM 11673 H HZ2  . LYS A 1 57 ? 14.837  -6.480  6.988   1.00 0.00 ? 55 LYS P HZ2  10 
ATOM 11674 H HZ3  . LYS A 1 57 ? 14.023  -5.261  6.248   1.00 0.00 ? 55 LYS P HZ3  10 
ATOM 11675 N N    . TRP A 1 58 ? 16.366  -2.462  -0.682  1.00 0.00 ? 56 TRP P N    10 
ATOM 11676 C CA   . TRP A 1 58 ? 16.692  -2.006  -2.041  1.00 0.00 ? 56 TRP P CA   10 
ATOM 11677 C C    . TRP A 1 58 ? 17.995  -1.195  -2.090  1.00 0.00 ? 56 TRP P C    10 
ATOM 11678 O O    . TRP A 1 58 ? 18.853  -1.437  -2.941  1.00 0.00 ? 56 TRP P O    10 
ATOM 11679 C CB   . TRP A 1 58 ? 15.514  -1.186  -2.590  1.00 0.00 ? 56 TRP P CB   10 
ATOM 11680 C CG   . TRP A 1 58 ? 15.699  -0.650  -3.978  1.00 0.00 ? 56 TRP P CG   10 
ATOM 11681 C CD1  . TRP A 1 58 ? 15.722  -1.400  -5.103  1.00 0.00 ? 56 TRP P CD1  10 
ATOM 11682 C CD2  . TRP A 1 58 ? 15.902  0.731   -4.419  1.00 0.00 ? 56 TRP P CD2  10 
ATOM 11683 N NE1  . TRP A 1 58 ? 15.922  -0.590  -6.203  1.00 0.00 ? 56 TRP P NE1  10 
ATOM 11684 C CE2  . TRP A 1 58 ? 16.035  0.734   -5.841  1.00 0.00 ? 56 TRP P CE2  10 
ATOM 11685 C CE3  . TRP A 1 58 ? 16.003  1.982   -3.767  1.00 0.00 ? 56 TRP P CE3  10 
ATOM 11686 C CZ2  . TRP A 1 58 ? 16.254  1.909   -6.577  1.00 0.00 ? 56 TRP P CZ2  10 
ATOM 11687 C CZ3  . TRP A 1 58 ? 16.207  3.169   -4.500  1.00 0.00 ? 56 TRP P CZ3  10 
ATOM 11688 C CH2  . TRP A 1 58 ? 16.319  3.139   -5.901  1.00 0.00 ? 56 TRP P CH2  10 
ATOM 11689 H H    . TRP A 1 58 ? 15.509  -2.123  -0.259  1.00 0.00 ? 56 TRP P H    10 
ATOM 11690 H HA   . TRP A 1 58 ? 16.829  -2.877  -2.683  1.00 0.00 ? 56 TRP P HA   10 
ATOM 11691 H HB2  . TRP A 1 58 ? 14.622  -1.813  -2.586  1.00 0.00 ? 56 TRP P HB2  10 
ATOM 11692 H HB3  . TRP A 1 58 ? 15.325  -0.346  -1.921  1.00 0.00 ? 56 TRP P HB3  10 
ATOM 11693 H HD1  . TRP A 1 58 ? 15.607  -2.479  -5.127  1.00 0.00 ? 56 TRP P HD1  10 
ATOM 11694 H HE1  . TRP A 1 58 ? 15.964  -0.943  -7.154  1.00 0.00 ? 56 TRP P HE1  10 
ATOM 11695 H HE3  . TRP A 1 58 ? 15.916  2.023   -2.691  1.00 0.00 ? 56 TRP P HE3  10 
ATOM 11696 H HZ2  . TRP A 1 58 ? 16.357  1.865   -7.652  1.00 0.00 ? 56 TRP P HZ2  10 
ATOM 11697 H HZ3  . TRP A 1 58 ? 16.278  4.117   -3.982  1.00 0.00 ? 56 TRP P HZ3  10 
ATOM 11698 H HH2  . TRP A 1 58 ? 16.471  4.059   -6.454  1.00 0.00 ? 56 TRP P HH2  10 
ATOM 11699 N N    . ARG A 1 59 ? 18.176  -0.267  -1.139  1.00 0.00 ? 57 ARG P N    10 
ATOM 11700 C CA   . ARG A 1 59 ? 19.328  0.650   -1.050  1.00 0.00 ? 57 ARG P CA   10 
ATOM 11701 C C    . ARG A 1 59 ? 20.465  0.146   -0.142  1.00 0.00 ? 57 ARG P C    10 
ATOM 11702 O O    . ARG A 1 59 ? 21.400  0.890   0.154   1.00 0.00 ? 57 ARG P O    10 
ATOM 11703 C CB   . ARG A 1 59 ? 18.828  2.079   -0.739  1.00 0.00 ? 57 ARG P CB   10 
ATOM 11704 C CG   . ARG A 1 59 ? 19.495  3.109   -1.664  1.00 0.00 ? 57 ARG P CG   10 
ATOM 11705 C CD   . ARG A 1 59 ? 18.809  4.479   -1.609  1.00 0.00 ? 57 ARG P CD   10 
ATOM 11706 N NE   . ARG A 1 59 ? 19.307  5.341   -2.696  1.00 0.00 ? 57 ARG P NE   10 
ATOM 11707 C CZ   . ARG A 1 59 ? 18.828  6.503   -3.091  1.00 0.00 ? 57 ARG P CZ   10 
ATOM 11708 N NH1  . ARG A 1 59 ? 17.799  7.066   -2.523  1.00 0.00 ? 57 ARG P NH1  10 
ATOM 11709 N NH2  . ARG A 1 59 ? 19.390  7.126   -4.084  1.00 0.00 ? 57 ARG P NH2  10 
ATOM 11710 H H    . ARG A 1 59 ? 17.420  -0.131  -0.473  1.00 0.00 ? 57 ARG P H    10 
ATOM 11711 H HA   . ARG A 1 59 ? 19.775  0.675   -2.043  1.00 0.00 ? 57 ARG P HA   10 
ATOM 11712 H HB2  . ARG A 1 59 ? 17.751  2.130   -0.912  1.00 0.00 ? 57 ARG P HB2  10 
ATOM 11713 H HB3  . ARG A 1 59 ? 19.013  2.334   0.305   1.00 0.00 ? 57 ARG P HB3  10 
ATOM 11714 H HG2  . ARG A 1 59 ? 20.548  3.213   -1.404  1.00 0.00 ? 57 ARG P HG2  10 
ATOM 11715 H HG3  . ARG A 1 59 ? 19.422  2.747   -2.688  1.00 0.00 ? 57 ARG P HG3  10 
ATOM 11716 H HD2  . ARG A 1 59 ? 17.732  4.339   -1.724  1.00 0.00 ? 57 ARG P HD2  10 
ATOM 11717 H HD3  . ARG A 1 59 ? 19.004  4.943   -0.640  1.00 0.00 ? 57 ARG P HD3  10 
ATOM 11718 H HE   . ARG A 1 59 ? 20.060  4.968   -3.268  1.00 0.00 ? 57 ARG P HE   10 
ATOM 11719 H HH11 . ARG A 1 59 ? 17.344  6.600   -1.749  1.00 0.00 ? 57 ARG P HH11 10 
ATOM 11720 H HH12 . ARG A 1 59 ? 17.454  7.951   -2.848  1.00 0.00 ? 57 ARG P HH12 10 
ATOM 11721 H HH21 . ARG A 1 59 ? 20.247  6.745   -4.493  1.00 0.00 ? 57 ARG P HH21 10 
ATOM 11722 H HH22 . ARG A 1 59 ? 19.038  8.010   -4.403  1.00 0.00 ? 57 ARG P HH22 10 
ATOM 11723 N N    . LYS A 1 60 ? 20.439  -1.148  0.216   1.00 0.00 ? 58 LYS P N    10 
ATOM 11724 C CA   . LYS A 1 60 ? 21.484  -1.898  0.954   1.00 0.00 ? 58 LYS P CA   10 
ATOM 11725 C C    . LYS A 1 60 ? 22.881  -1.833  0.301   1.00 0.00 ? 58 LYS P C    10 
ATOM 11726 O O    . LYS A 1 60 ? 23.892  -2.046  0.969   1.00 0.00 ? 58 LYS P O    10 
ATOM 11727 C CB   . LYS A 1 60 ? 20.990  -3.351  1.099   1.00 0.00 ? 58 LYS P CB   10 
ATOM 11728 C CG   . LYS A 1 60 ? 21.841  -4.215  2.046   1.00 0.00 ? 58 LYS P CG   10 
ATOM 11729 C CD   . LYS A 1 60 ? 21.202  -5.582  2.340   1.00 0.00 ? 58 LYS P CD   10 
ATOM 11730 C CE   . LYS A 1 60 ? 21.056  -6.442  1.077   1.00 0.00 ? 58 LYS P CE   10 
ATOM 11731 N NZ   . LYS A 1 60 ? 20.551  -7.804  1.395   1.00 0.00 ? 58 LYS P NZ   10 
ATOM 11732 H H    . LYS A 1 60 ? 19.615  -1.662  -0.060  1.00 0.00 ? 58 LYS P H    10 
ATOM 11733 H HA   . LYS A 1 60 ? 21.581  -1.463  1.951   1.00 0.00 ? 58 LYS P HA   10 
ATOM 11734 H HB2  . LYS A 1 60 ? 19.975  -3.331  1.495   1.00 0.00 ? 58 LYS P HB2  10 
ATOM 11735 H HB3  . LYS A 1 60 ? 20.960  -3.815  0.112   1.00 0.00 ? 58 LYS P HB3  10 
ATOM 11736 H HG2  . LYS A 1 60 ? 22.826  -4.379  1.610   1.00 0.00 ? 58 LYS P HG2  10 
ATOM 11737 H HG3  . LYS A 1 60 ? 21.965  -3.684  2.991   1.00 0.00 ? 58 LYS P HG3  10 
ATOM 11738 H HD2  . LYS A 1 60 ? 21.837  -6.105  3.058   1.00 0.00 ? 58 LYS P HD2  10 
ATOM 11739 H HD3  . LYS A 1 60 ? 20.223  -5.431  2.797   1.00 0.00 ? 58 LYS P HD3  10 
ATOM 11740 H HE2  . LYS A 1 60 ? 20.370  -5.943  0.385   1.00 0.00 ? 58 LYS P HE2  10 
ATOM 11741 H HE3  . LYS A 1 60 ? 22.032  -6.514  0.587   1.00 0.00 ? 58 LYS P HE3  10 
ATOM 11742 H HZ1  . LYS A 1 60 ? 21.182  -8.294  2.015   1.00 0.00 ? 58 LYS P HZ1  10 
ATOM 11743 H HZ2  . LYS A 1 60 ? 20.456  -8.361  0.556   1.00 0.00 ? 58 LYS P HZ2  10 
ATOM 11744 H HZ3  . LYS A 1 60 ? 19.644  -7.768  1.840   1.00 0.00 ? 58 LYS P HZ3  10 
ATOM 11745 N N    . ARG A 1 61 ? 22.939  -1.476  -0.988  1.00 0.00 ? 59 ARG P N    10 
ATOM 11746 C CA   . ARG A 1 61 ? 24.150  -1.137  -1.764  1.00 0.00 ? 59 ARG P CA   10 
ATOM 11747 C C    . ARG A 1 61 ? 24.955  0.063   -1.224  1.00 0.00 ? 59 ARG P C    10 
ATOM 11748 O O    . ARG A 1 61 ? 26.123  0.199   -1.581  1.00 0.00 ? 59 ARG P O    10 
ATOM 11749 C CB   . ARG A 1 61 ? 23.746  -0.919  -3.238  1.00 0.00 ? 59 ARG P CB   10 
ATOM 11750 C CG   . ARG A 1 61 ? 22.761  0.247   -3.437  1.00 0.00 ? 59 ARG P CG   10 
ATOM 11751 C CD   . ARG A 1 61 ? 22.297  0.361   -4.892  1.00 0.00 ? 59 ARG P CD   10 
ATOM 11752 N NE   . ARG A 1 61 ? 21.280  1.422   -5.029  1.00 0.00 ? 59 ARG P NE   10 
ATOM 11753 C CZ   . ARG A 1 61 ? 19.996  1.306   -5.308  1.00 0.00 ? 59 ARG P CZ   10 
ATOM 11754 N NH1  . ARG A 1 61 ? 19.394  0.167   -5.487  1.00 0.00 ? 59 ARG P NH1  10 
ATOM 11755 N NH2  . ARG A 1 61 ? 19.293  2.390   -5.391  1.00 0.00 ? 59 ARG P NH2  10 
ATOM 11756 H H    . ARG A 1 61 ? 22.051  -1.414  -1.464  1.00 0.00 ? 59 ARG P H    10 
ATOM 11757 H HA   . ARG A 1 61 ? 24.830  -1.989  -1.726  1.00 0.00 ? 59 ARG P HA   10 
ATOM 11758 H HB2  . ARG A 1 61 ? 24.643  -0.731  -3.831  1.00 0.00 ? 59 ARG P HB2  10 
ATOM 11759 H HB3  . ARG A 1 61 ? 23.288  -1.838  -3.611  1.00 0.00 ? 59 ARG P HB3  10 
ATOM 11760 H HG2  . ARG A 1 61 ? 21.880  0.092   -2.816  1.00 0.00 ? 59 ARG P HG2  10 
ATOM 11761 H HG3  . ARG A 1 61 ? 23.234  1.184   -3.141  1.00 0.00 ? 59 ARG P HG3  10 
ATOM 11762 H HD2  . ARG A 1 61 ? 23.156  0.605   -5.519  1.00 0.00 ? 59 ARG P HD2  10 
ATOM 11763 H HD3  . ARG A 1 61 ? 21.900  -0.600  -5.221  1.00 0.00 ? 59 ARG P HD3  10 
ATOM 11764 H HE   . ARG A 1 61 ? 21.578  2.381   -4.873  1.00 0.00 ? 59 ARG P HE   10 
ATOM 11765 H HH11 . ARG A 1 61 ? 19.898  -0.687  -5.319  1.00 0.00 ? 59 ARG P HH11 10 
ATOM 11766 H HH12 . ARG A 1 61 ? 18.404  0.135   -5.654  1.00 0.00 ? 59 ARG P HH12 10 
ATOM 11767 H HH21 . ARG A 1 61 ? 19.777  3.265   -5.188  1.00 0.00 ? 59 ARG P HH21 10 
ATOM 11768 H HH22 . ARG A 1 61 ? 18.300  2.364   -5.547  1.00 0.00 ? 59 ARG P HH22 10 
ATOM 11769 N N    . GLU A 1 62 ? 24.355  0.906   -0.374  1.00 0.00 ? 60 GLU P N    10 
ATOM 11770 C CA   . GLU A 1 62 ? 24.963  2.086   0.272   1.00 0.00 ? 60 GLU P CA   10 
ATOM 11771 C C    . GLU A 1 62 ? 25.628  3.067   -0.719  1.00 0.00 ? 60 GLU P C    10 
ATOM 11772 O O    . GLU A 1 62 ? 26.853  3.161   -0.826  1.00 0.00 ? 60 GLU P O    10 
ATOM 11773 C CB   . GLU A 1 62 ? 25.898  1.676   1.429   1.00 0.00 ? 60 GLU P CB   10 
ATOM 11774 C CG   . GLU A 1 62 ? 25.146  1.037   2.603   1.00 0.00 ? 60 GLU P CG   10 
ATOM 11775 C CD   . GLU A 1 62 ? 26.104  0.741   3.774   1.00 0.00 ? 60 GLU P CD   10 
ATOM 11776 O OE1  . GLU A 1 62 ? 26.780  -0.318  3.767   1.00 0.00 ? 60 GLU P OE1  10 
ATOM 11777 O OE2  . GLU A 1 62 ? 26.186  1.563   4.719   1.00 0.00 ? 60 GLU P OE2  10 
ATOM 11778 H H    . GLU A 1 62 ? 23.382  0.725   -0.162  1.00 0.00 ? 60 GLU P H    10 
ATOM 11779 H HA   . GLU A 1 62 ? 24.151  2.652   0.730   1.00 0.00 ? 60 GLU P HA   10 
ATOM 11780 H HB2  . GLU A 1 62 ? 26.660  0.985   1.066   1.00 0.00 ? 60 GLU P HB2  10 
ATOM 11781 H HB3  . GLU A 1 62 ? 26.397  2.571   1.803   1.00 0.00 ? 60 GLU P HB3  10 
ATOM 11782 H HG2  . GLU A 1 62 ? 24.357  1.718   2.932   1.00 0.00 ? 60 GLU P HG2  10 
ATOM 11783 H HG3  . GLU A 1 62 ? 24.668  0.114   2.274   1.00 0.00 ? 60 GLU P HG3  10 
ATOM 11784 N N    . GLU A 1 63 ? 24.801  3.826   -1.444  1.00 0.00 ? 61 GLU P N    10 
ATOM 11785 C CA   . GLU A 1 63 ? 25.248  4.920   -2.324  1.00 0.00 ? 61 GLU P CA   10 
ATOM 11786 C C    . GLU A 1 63 ? 25.988  6.029   -1.547  1.00 0.00 ? 61 GLU P C    10 
ATOM 11787 O O    . GLU A 1 63 ? 25.545  6.461   -0.480  1.00 0.00 ? 61 GLU P O    10 
ATOM 11788 C CB   . GLU A 1 63 ? 24.036  5.527   -3.052  1.00 0.00 ? 61 GLU P CB   10 
ATOM 11789 C CG   . GLU A 1 63 ? 23.497  4.620   -4.165  1.00 0.00 ? 61 GLU P CG   10 
ATOM 11790 C CD   . GLU A 1 63 ? 22.091  5.052   -4.603  1.00 0.00 ? 61 GLU P CD   10 
ATOM 11791 O OE1  . GLU A 1 63 ? 21.874  6.222   -4.991  1.00 0.00 ? 61 GLU P OE1  10 
ATOM 11792 O OE2  . GLU A 1 63 ? 21.156  4.224   -4.506  1.00 0.00 ? 61 GLU P OE2  10 
ATOM 11793 H H    . GLU A 1 63 ? 23.808  3.701   -1.318  1.00 0.00 ? 61 GLU P H    10 
ATOM 11794 H HA   . GLU A 1 63 ? 25.934  4.516   -3.070  1.00 0.00 ? 61 GLU P HA   10 
ATOM 11795 H HB2  . GLU A 1 63 ? 23.245  5.719   -2.323  1.00 0.00 ? 61 GLU P HB2  10 
ATOM 11796 H HB3  . GLU A 1 63 ? 24.325  6.480   -3.496  1.00 0.00 ? 61 GLU P HB3  10 
ATOM 11797 H HG2  . GLU A 1 63 ? 24.180  4.649   -5.017  1.00 0.00 ? 61 GLU P HG2  10 
ATOM 11798 H HG3  . GLU A 1 63 ? 23.455  3.589   -3.806  1.00 0.00 ? 61 GLU P HG3  10 
ATOM 11799 N N    . PHE A 1 64 ? 27.090  6.538   -2.110  1.00 0.00 ? 62 PHE P N    10 
ATOM 11800 C CA   . PHE A 1 64 ? 27.902  7.608   -1.506  1.00 0.00 ? 62 PHE P CA   10 
ATOM 11801 C C    . PHE A 1 64 ? 27.433  9.030   -1.877  1.00 0.00 ? 62 PHE P C    10 
ATOM 11802 O O    . PHE A 1 64 ? 27.856  10.002  -1.251  1.00 0.00 ? 62 PHE P O    10 
ATOM 11803 C CB   . PHE A 1 64 ? 29.376  7.394   -1.882  1.00 0.00 ? 62 PHE P CB   10 
ATOM 11804 C CG   . PHE A 1 64 ? 29.963  6.083   -1.387  1.00 0.00 ? 62 PHE P CG   10 
ATOM 11805 C CD1  . PHE A 1 64 ? 30.251  5.915   -0.018  1.00 0.00 ? 62 PHE P CD1  10 
ATOM 11806 C CD2  . PHE A 1 64 ? 30.222  5.031   -2.288  1.00 0.00 ? 62 PHE P CD2  10 
ATOM 11807 C CE1  . PHE A 1 64 ? 30.789  4.702   0.447   1.00 0.00 ? 62 PHE P CE1  10 
ATOM 11808 C CE2  . PHE A 1 64 ? 30.760  3.818   -1.821  1.00 0.00 ? 62 PHE P CE2  10 
ATOM 11809 C CZ   . PHE A 1 64 ? 31.044  3.653   -0.453  1.00 0.00 ? 62 PHE P CZ   10 
ATOM 11810 H H    . PHE A 1 64 ? 27.430  6.120   -2.965  1.00 0.00 ? 62 PHE P H    10 
ATOM 11811 H HA   . PHE A 1 64 ? 27.828  7.534   -0.419  1.00 0.00 ? 62 PHE P HA   10 
ATOM 11812 H HB2  . PHE A 1 64 ? 29.479  7.455   -2.967  1.00 0.00 ? 62 PHE P HB2  10 
ATOM 11813 H HB3  . PHE A 1 64 ? 29.968  8.206   -1.456  1.00 0.00 ? 62 PHE P HB3  10 
ATOM 11814 H HD1  . PHE A 1 64 ? 30.055  6.719   0.679   1.00 0.00 ? 62 PHE P HD1  10 
ATOM 11815 H HD2  . PHE A 1 64 ? 30.006  5.151   -3.341  1.00 0.00 ? 62 PHE P HD2  10 
ATOM 11816 H HE1  . PHE A 1 64 ? 31.007  4.576   1.501   1.00 0.00 ? 62 PHE P HE1  10 
ATOM 11817 H HE2  . PHE A 1 64 ? 30.956  3.010   -2.514  1.00 0.00 ? 62 PHE P HE2  10 
ATOM 11818 H HZ   . PHE A 1 64 ? 31.456  2.719   -0.094  1.00 0.00 ? 62 PHE P HZ   10 
ATOM 11819 N N    . ILE A 1 65 ? 26.555  9.168   -2.880  1.00 0.00 ? 63 ILE P N    10 
ATOM 11820 C CA   . ILE A 1 65 ? 26.107  10.465  -3.431  1.00 0.00 ? 63 ILE P CA   10 
ATOM 11821 C C    . ILE A 1 65 ? 24.941  11.116  -2.660  1.00 0.00 ? 63 ILE P C    10 
ATOM 11822 O O    . ILE A 1 65 ? 24.578  12.258  -2.948  1.00 0.00 ? 63 ILE P O    10 
ATOM 11823 C CB   . ILE A 1 65 ? 25.796  10.339  -4.942  1.00 0.00 ? 63 ILE P CB   10 
ATOM 11824 C CG1  . ILE A 1 65 ? 24.624  9.370   -5.222  1.00 0.00 ? 63 ILE P CG1  10 
ATOM 11825 C CG2  . ILE A 1 65 ? 27.071  9.934   -5.708  1.00 0.00 ? 63 ILE P CG2  10 
ATOM 11826 C CD1  . ILE A 1 65 ? 24.176  9.345   -6.688  1.00 0.00 ? 63 ILE P CD1  10 
ATOM 11827 H H    . ILE A 1 65 ? 26.256  8.328   -3.352  1.00 0.00 ? 63 ILE P H    10 
ATOM 11828 H HA   . ILE A 1 65 ? 26.938  11.166  -3.341  1.00 0.00 ? 63 ILE P HA   10 
ATOM 11829 H HB   . ILE A 1 65 ? 25.508  11.328  -5.302  1.00 0.00 ? 63 ILE P HB   10 
ATOM 11830 H HG12 . ILE A 1 65 ? 24.902  8.358   -4.930  1.00 0.00 ? 63 ILE P HG12 10 
ATOM 11831 H HG13 . ILE A 1 65 ? 23.763  9.672   -4.625  1.00 0.00 ? 63 ILE P HG13 10 
ATOM 11832 H HG21 . ILE A 1 65 ? 26.914  10.039  -6.782  1.00 0.00 ? 63 ILE P HG21 10 
ATOM 11833 H HG22 . ILE A 1 65 ? 27.897  10.588  -5.425  1.00 0.00 ? 63 ILE P HG22 10 
ATOM 11834 H HG23 . ILE A 1 65 ? 27.342  8.901   -5.488  1.00 0.00 ? 63 ILE P HG23 10 
ATOM 11835 H HD11 . ILE A 1 65 ? 23.285  8.723   -6.782  1.00 0.00 ? 63 ILE P HD11 10 
ATOM 11836 H HD12 . ILE A 1 65 ? 23.940  10.355  -7.024  1.00 0.00 ? 63 ILE P HD12 10 
ATOM 11837 H HD13 . ILE A 1 65 ? 24.959  8.923   -7.319  1.00 0.00 ? 63 ILE P HD13 10 
ATOM 11838 N N    . VAL A 1 66 ? 24.355  10.