data_2L7M
# 
_entry.id   2L7M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L7M         
RCSB  RCSB102057   
BMRB  17145        
WWPDB D_1000102057 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2L7F  PDB  'Solution Structure of the Pitx2 Homeodomain' 
unspecified 17145 BMRB .                                             
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L7M 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-14 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doerdelmann, T.'   1 
'Rance, M.'         2 
'Kojetin, D.J.'     3 
'Baird-Titus, J.M.' 4 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the Pitx2 Homeodomain R24H mutant' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Doerdelmann, T.'   1 
primary 'Kojetin, D.J.'     2 
primary 'Baird-Titus, J.M.' 3 
primary 'Rance, M.'         4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Pituitary homeobox 2' 
_entity.formula_weight             8467.477 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              R24H 
_entity.pdbx_fragment              'Homeobox domain residues 85-144' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ALL1-responsive protein ARP1 
Homeobox protein PITX2, Paired-like homeodomain transcription factor 2, RIEG bicoid-related homeobox transcription factor, Solurshin
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSQRRQRTHFTSQQLQELEATFQRNHYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD 
_entity_poly.pdbx_seq_one_letter_code_can   GSQRRQRTHFTSQQLQELEATFQRNHYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD 
_entity_poly.pdbx_strand_id                 P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  GLN n 
1 4  ARG n 
1 5  ARG n 
1 6  GLN n 
1 7  ARG n 
1 8  THR n 
1 9  HIS n 
1 10 PHE n 
1 11 THR n 
1 12 SER n 
1 13 GLN n 
1 14 GLN n 
1 15 LEU n 
1 16 GLN n 
1 17 GLU n 
1 18 LEU n 
1 19 GLU n 
1 20 ALA n 
1 21 THR n 
1 22 PHE n 
1 23 GLN n 
1 24 ARG n 
1 25 ASN n 
1 26 HIS n 
1 27 TYR n 
1 28 PRO n 
1 29 ASP n 
1 30 MET n 
1 31 SER n 
1 32 THR n 
1 33 ARG n 
1 34 GLU n 
1 35 GLU n 
1 36 ILE n 
1 37 ALA n 
1 38 VAL n 
1 39 TRP n 
1 40 THR n 
1 41 ASN n 
1 42 LEU n 
1 43 THR n 
1 44 GLU n 
1 45 ALA n 
1 46 ARG n 
1 47 VAL n 
1 48 ARG n 
1 49 VAL n 
1 50 TRP n 
1 51 PHE n 
1 52 LYS n 
1 53 ASN n 
1 54 ARG n 
1 55 ARG n 
1 56 ALA n 
1 57 LYS n 
1 58 TRP n 
1 59 ARG n 
1 60 LYS n 
1 61 ARG n 
1 62 GLU n 
1 63 GLU n 
1 64 PHE n 
1 65 ILE n 
1 66 VAL n 
1 67 THR n 
1 68 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PITX2, ARP1, RGS, RIEG, RIEG1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pet28 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PITX2_HUMAN 
_struct_ref.pdbx_db_accession          Q99697 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRE 
_struct_ref.pdbx_align_begin           85 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2L7M 
_struct_ref_seq.pdbx_strand_id                P 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 62 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99697 
_struct_ref_seq.db_align_beg                  85 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  144 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       60 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L7M GLY P 1  ? UNP Q99697 ?   ?   'EXPRESSION TAG'      -1 1 
1 2L7M SER P 2  ? UNP Q99697 ?   ?   'EXPRESSION TAG'      0  2 
1 2L7M HIS P 26 ? UNP Q99697 ARG 108 'ENGINEERED MUTATION' 24 3 
1 2L7M GLU P 63 ? UNP Q99697 ?   ?   'SEE REMARK 999'      61 4 
1 2L7M PHE P 64 ? UNP Q99697 ?   ?   'SEE REMARK 999'      62 5 
1 2L7M ILE P 65 ? UNP Q99697 ?   ?   'SEE REMARK 999'      63 6 
1 2L7M VAL P 66 ? UNP Q99697 ?   ?   'SEE REMARK 999'      64 7 
1 2L7M THR P 67 ? UNP Q99697 ?   ?   'SEE REMARK 999'      65 8 
1 2L7M ASP P 68 ? UNP Q99697 ?   ?   'SEE REMARK 999'      66 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  1 '3D CBCA(CO)NH'   
1 4  1 '3D C(CO)NH'      
1 5  1 '3D HNCA'         
1 6  1 '3D HNCACB'       
1 7  1 '3D 1H-15N NOESY' 
1 8  1 '3D 1H-13C NOESY' 
1 9  1 '3D HCCH-TOCSY'   
1 10 1 '3D H(CCO)NH'     
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.15 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'10 mM sodium phosphate, 150 mM sodium sulphate, 1 mM EDTA, 2 mM [U-98% 13C; U-98% 15N] Pitx2 R24H, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Varian INOVA 1 'Varian INOVA' 
600 Varian INOVA 2 'Varian INOVA' 
500 Varian INOVA 3 'Varian INOVA' 
400 Varian INOVA 4 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2L7M 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L7M 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.156 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L7M 
_pdbx_nmr_representative.selection_criteria   'minimized average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement                  AMBER   11 1 
'Guntert, Mumenthaler and Wuthrich'                                       'structure solution'        CYANA   ?  2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                       processing                  NMRPipe ?  3 
'Johnson, One Moon Scientific'                                            'chemical shift assignment' NMRView ?  4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L7M 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L7M 
_struct.title                     'Solution Structure of the Pitx2 Homeodomain R24H mutant' 
_struct.pdbx_descriptor           'Pituitary homeobox 2' 
_struct.pdbx_model_details        'minimized average, model 20' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L7M 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Homeodomain, DNA-binding, Transcription' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 13 ? ASN A 25 ? GLN P 11 ASN P 23 1 ? 13 
HELX_P HELX_P2 2 ASP A 29 ? VAL A 38 ? ASP P 27 VAL P 36 1 ? 10 
HELX_P HELX_P3 3 THR A 43 ? GLU A 62 ? THR P 41 GLU P 60 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2L7M 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 2.495   -6.731  22.113  1.00 0.00 ? -1 GLY P N    1  
ATOM 2     C CA   . GLY A 1 1  ? 3.369   -5.571  21.831  1.00 0.00 ? -1 GLY P CA   1  
ATOM 3     C C    . GLY A 1 1  ? 2.577   -4.275  21.709  1.00 0.00 ? -1 GLY P C    1  
ATOM 4     O O    . GLY A 1 1  ? 1.420   -4.200  22.131  1.00 0.00 ? -1 GLY P O    1  
ATOM 5     H H1   . GLY A 1 1  ? 1.829   -6.856  21.367  1.00 0.00 ? -1 GLY P H1   1  
ATOM 6     H H2   . GLY A 1 1  ? 1.991   -6.585  22.973  1.00 0.00 ? -1 GLY P H2   1  
ATOM 7     H H3   . GLY A 1 1  ? 3.048   -7.570  22.198  1.00 0.00 ? -1 GLY P H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? 4.093   -5.456  22.638  1.00 0.00 ? -1 GLY P HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? 3.907   -5.740  20.898  1.00 0.00 ? -1 GLY P HA3  1  
ATOM 10    N N    . SER A 1 2  ? 3.199   -3.238  21.138  1.00 0.00 ? 0  SER P N    1  
ATOM 11    C CA   . SER A 1 2  ? 2.596   -1.914  20.890  1.00 0.00 ? 0  SER P CA   1  
ATOM 12    C C    . SER A 1 2  ? 3.198   -1.243  19.641  1.00 0.00 ? 0  SER P C    1  
ATOM 13    O O    . SER A 1 2  ? 4.206   -1.705  19.097  1.00 0.00 ? 0  SER P O    1  
ATOM 14    C CB   . SER A 1 2  ? 2.782   -1.024  22.127  1.00 0.00 ? 0  SER P CB   1  
ATOM 15    O OG   . SER A 1 2  ? 1.946   0.120   22.047  1.00 0.00 ? 0  SER P OG   1  
ATOM 16    H H    . SER A 1 2  ? 4.145   -3.373  20.804  1.00 0.00 ? 0  SER P H    1  
ATOM 17    H HA   . SER A 1 2  ? 1.526   -2.034  20.716  1.00 0.00 ? 0  SER P HA   1  
ATOM 18    H HB2  . SER A 1 2  ? 2.511   -1.590  23.020  1.00 0.00 ? 0  SER P HB2  1  
ATOM 19    H HB3  . SER A 1 2  ? 3.827   -0.721  22.209  1.00 0.00 ? 0  SER P HB3  1  
ATOM 20    H HG   . SER A 1 2  ? 2.062   0.644   22.865  1.00 0.00 ? 0  SER P HG   1  
ATOM 21    N N    . GLN A 1 3  ? 2.584   -0.153  19.170  1.00 0.00 ? 1  GLN P N    1  
ATOM 22    C CA   . GLN A 1 3  ? 3.016   0.595   17.983  1.00 0.00 ? 1  GLN P CA   1  
ATOM 23    C C    . GLN A 1 3  ? 4.295   1.411   18.258  1.00 0.00 ? 1  GLN P C    1  
ATOM 24    O O    . GLN A 1 3  ? 4.463   1.985   19.340  1.00 0.00 ? 1  GLN P O    1  
ATOM 25    C CB   . GLN A 1 3  ? 1.885   1.510   17.470  1.00 0.00 ? 1  GLN P CB   1  
ATOM 26    C CG   . GLN A 1 3  ? 0.680   0.769   16.860  1.00 0.00 ? 1  GLN P CG   1  
ATOM 27    C CD   . GLN A 1 3  ? -0.178  0.023   17.883  1.00 0.00 ? 1  GLN P CD   1  
ATOM 28    O OE1  . GLN A 1 3  ? -0.188  -1.199  17.959  1.00 0.00 ? 1  GLN P OE1  1  
ATOM 29    N NE2  . GLN A 1 3  ? -0.927  0.720   18.712  1.00 0.00 ? 1  GLN P NE2  1  
ATOM 30    H H    . GLN A 1 3  ? 1.821   0.216   19.722  1.00 0.00 ? 1  GLN P H    1  
ATOM 31    H HA   . GLN A 1 3  ? 3.249   -0.121  17.192  1.00 0.00 ? 1  GLN P HA   1  
ATOM 32    H HB2  . GLN A 1 3  ? 1.547   2.163   18.278  1.00 0.00 ? 1  GLN P HB2  1  
ATOM 33    H HB3  . GLN A 1 3  ? 2.299   2.146   16.687  1.00 0.00 ? 1  GLN P HB3  1  
ATOM 34    H HG2  . GLN A 1 3  ? 0.048   1.501   16.358  1.00 0.00 ? 1  GLN P HG2  1  
ATOM 35    H HG3  . GLN A 1 3  ? 1.035   0.065   16.106  1.00 0.00 ? 1  GLN P HG3  1  
ATOM 36    H HE21 . GLN A 1 3  ? -0.946  1.728   18.660  1.00 0.00 ? 1  GLN P HE21 1  
ATOM 37    H HE22 . GLN A 1 3  ? -1.493  0.222   19.383  1.00 0.00 ? 1  GLN P HE22 1  
ATOM 38    N N    . ARG A 1 4  ? 5.186   1.505   17.259  1.00 0.00 ? 2  ARG P N    1  
ATOM 39    C CA   . ARG A 1 4  ? 6.469   2.241   17.347  1.00 0.00 ? 2  ARG P CA   1  
ATOM 40    C C    . ARG A 1 4  ? 6.329   3.762   17.161  1.00 0.00 ? 2  ARG P C    1  
ATOM 41    O O    . ARG A 1 4  ? 7.240   4.506   17.528  1.00 0.00 ? 2  ARG P O    1  
ATOM 42    C CB   . ARG A 1 4  ? 7.481   1.654   16.344  1.00 0.00 ? 2  ARG P CB   1  
ATOM 43    C CG   . ARG A 1 4  ? 7.861   0.199   16.678  1.00 0.00 ? 2  ARG P CG   1  
ATOM 44    C CD   . ARG A 1 4  ? 8.911   -0.366  15.710  1.00 0.00 ? 2  ARG P CD   1  
ATOM 45    N NE   . ARG A 1 4  ? 10.228  0.286   15.868  1.00 0.00 ? 2  ARG P NE   1  
ATOM 46    C CZ   . ARG A 1 4  ? 11.301  0.089   15.122  1.00 0.00 ? 2  ARG P CZ   1  
ATOM 47    N NH1  . ARG A 1 4  ? 11.306  -0.744  14.118  1.00 0.00 ? 2  ARG P NH1  1  
ATOM 48    N NH2  . ARG A 1 4  ? 12.406  0.730   15.374  1.00 0.00 ? 2  ARG P NH2  1  
ATOM 49    H H    . ARG A 1 4  ? 4.985   1.002   16.404  1.00 0.00 ? 2  ARG P H    1  
ATOM 50    H HA   . ARG A 1 4  ? 6.879   2.110   18.351  1.00 0.00 ? 2  ARG P HA   1  
ATOM 51    H HB2  . ARG A 1 4  ? 7.065   1.700   15.337  1.00 0.00 ? 2  ARG P HB2  1  
ATOM 52    H HB3  . ARG A 1 4  ? 8.385   2.264   16.365  1.00 0.00 ? 2  ARG P HB3  1  
ATOM 53    H HG2  . ARG A 1 4  ? 8.247   0.145   17.697  1.00 0.00 ? 2  ARG P HG2  1  
ATOM 54    H HG3  . ARG A 1 4  ? 6.972   -0.429  16.615  1.00 0.00 ? 2  ARG P HG3  1  
ATOM 55    H HD2  . ARG A 1 4  ? 9.018   -1.435  15.907  1.00 0.00 ? 2  ARG P HD2  1  
ATOM 56    H HD3  . ARG A 1 4  ? 8.550   -0.238  14.687  1.00 0.00 ? 2  ARG P HD3  1  
ATOM 57    H HE   . ARG A 1 4  ? 10.331  0.935   16.633  1.00 0.00 ? 2  ARG P HE   1  
ATOM 58    H HH11 . ARG A 1 4  ? 10.469  -1.259  13.906  1.00 0.00 ? 2  ARG P HH11 1  
ATOM 59    H HH12 . ARG A 1 4  ? 12.135  -0.878  13.566  1.00 0.00 ? 2  ARG P HH12 1  
ATOM 60    H HH21 . ARG A 1 4  ? 12.451  1.383   16.140  1.00 0.00 ? 2  ARG P HH21 1  
ATOM 61    H HH22 . ARG A 1 4  ? 13.223  0.577   14.807  1.00 0.00 ? 2  ARG P HH22 1  
ATOM 62    N N    . ARG A 1 5  ? 5.200   4.222   16.606  1.00 0.00 ? 3  ARG P N    1  
ATOM 63    C CA   . ARG A 1 5  ? 4.842   5.637   16.375  1.00 0.00 ? 3  ARG P CA   1  
ATOM 64    C C    . ARG A 1 5  ? 3.389   5.908   16.783  1.00 0.00 ? 3  ARG P C    1  
ATOM 65    O O    . ARG A 1 5  ? 2.548   5.009   16.733  1.00 0.00 ? 3  ARG P O    1  
ATOM 66    C CB   . ARG A 1 5  ? 5.066   6.012   14.896  1.00 0.00 ? 3  ARG P CB   1  
ATOM 67    C CG   . ARG A 1 5  ? 6.541   5.933   14.469  1.00 0.00 ? 3  ARG P CG   1  
ATOM 68    C CD   . ARG A 1 5  ? 6.712   6.386   13.013  1.00 0.00 ? 3  ARG P CD   1  
ATOM 69    N NE   . ARG A 1 5  ? 8.121   6.300   12.576  1.00 0.00 ? 3  ARG P NE   1  
ATOM 70    C CZ   . ARG A 1 5  ? 9.068   7.211   12.726  1.00 0.00 ? 3  ARG P CZ   1  
ATOM 71    N NH1  . ARG A 1 5  ? 8.856   8.351   13.322  1.00 0.00 ? 3  ARG P NH1  1  
ATOM 72    N NH2  . ARG A 1 5  ? 10.268  6.990   12.270  1.00 0.00 ? 3  ARG P NH2  1  
ATOM 73    H H    . ARG A 1 5  ? 4.512   3.527   16.357  1.00 0.00 ? 3  ARG P H    1  
ATOM 74    H HA   . ARG A 1 5  ? 5.472   6.277   16.998  1.00 0.00 ? 3  ARG P HA   1  
ATOM 75    H HB2  . ARG A 1 5  ? 4.473   5.349   14.263  1.00 0.00 ? 3  ARG P HB2  1  
ATOM 76    H HB3  . ARG A 1 5  ? 4.718   7.034   14.735  1.00 0.00 ? 3  ARG P HB3  1  
ATOM 77    H HG2  . ARG A 1 5  ? 7.140   6.571   15.121  1.00 0.00 ? 3  ARG P HG2  1  
ATOM 78    H HG3  . ARG A 1 5  ? 6.897   4.905   14.557  1.00 0.00 ? 3  ARG P HG3  1  
ATOM 79    H HD2  . ARG A 1 5  ? 6.106   5.739   12.376  1.00 0.00 ? 3  ARG P HD2  1  
ATOM 80    H HD3  . ARG A 1 5  ? 6.341   7.406   12.901  1.00 0.00 ? 3  ARG P HD3  1  
ATOM 81    H HE   . ARG A 1 5  ? 8.394   5.452   12.104  1.00 0.00 ? 3  ARG P HE   1  
ATOM 82    H HH11 . ARG A 1 5  ? 7.944   8.551   13.693  1.00 0.00 ? 3  ARG P HH11 1  
ATOM 83    H HH12 . ARG A 1 5  ? 9.598   9.022   13.421  1.00 0.00 ? 3  ARG P HH12 1  
ATOM 84    H HH21 . ARG A 1 5  ? 10.481  6.125   11.801  1.00 0.00 ? 3  ARG P HH21 1  
ATOM 85    H HH22 . ARG A 1 5  ? 10.989  7.682   12.383  1.00 0.00 ? 3  ARG P HH22 1  
ATOM 86    N N    . GLN A 1 6  ? 3.081   7.156   17.143  1.00 0.00 ? 4  GLN P N    1  
ATOM 87    C CA   . GLN A 1 6  ? 1.728   7.605   17.497  1.00 0.00 ? 4  GLN P CA   1  
ATOM 88    C C    . GLN A 1 6  ? 0.898   7.865   16.223  1.00 0.00 ? 4  GLN P C    1  
ATOM 89    O O    . GLN A 1 6  ? 0.810   8.995   15.734  1.00 0.00 ? 4  GLN P O    1  
ATOM 90    C CB   . GLN A 1 6  ? 1.836   8.819   18.442  1.00 0.00 ? 4  GLN P CB   1  
ATOM 91    C CG   . GLN A 1 6  ? 0.487   9.309   18.999  1.00 0.00 ? 4  GLN P CG   1  
ATOM 92    C CD   . GLN A 1 6  ? -0.248  8.239   19.805  1.00 0.00 ? 4  GLN P CD   1  
ATOM 93    O OE1  . GLN A 1 6  ? -1.120  7.540   19.304  1.00 0.00 ? 4  GLN P OE1  1  
ATOM 94    N NE2  . GLN A 1 6  ? 0.084   8.046   21.064  1.00 0.00 ? 4  GLN P NE2  1  
ATOM 95    H H    . GLN A 1 6  ? 3.821   7.843   17.146  1.00 0.00 ? 4  GLN P H    1  
ATOM 96    H HA   . GLN A 1 6  ? 1.238   6.801   18.051  1.00 0.00 ? 4  GLN P HA   1  
ATOM 97    H HB2  . GLN A 1 6  ? 2.476   8.550   19.285  1.00 0.00 ? 4  GLN P HB2  1  
ATOM 98    H HB3  . GLN A 1 6  ? 2.316   9.645   17.914  1.00 0.00 ? 4  GLN P HB3  1  
ATOM 99    H HG2  . GLN A 1 6  ? 0.670   10.170  19.643  1.00 0.00 ? 4  GLN P HG2  1  
ATOM 100   H HG3  . GLN A 1 6  ? -0.152  9.643   18.182  1.00 0.00 ? 4  GLN P HG3  1  
ATOM 101   H HE21 . GLN A 1 6  ? 0.803   8.609   21.495  1.00 0.00 ? 4  GLN P HE21 1  
ATOM 102   H HE22 . GLN A 1 6  ? -0.406  7.335   21.587  1.00 0.00 ? 4  GLN P HE22 1  
ATOM 103   N N    . ARG A 1 7  ? 0.326   6.794   15.658  1.00 0.00 ? 5  ARG P N    1  
ATOM 104   C CA   . ARG A 1 7  ? -0.455  6.786   14.404  1.00 0.00 ? 5  ARG P CA   1  
ATOM 105   C C    . ARG A 1 7  ? -1.747  5.978   14.553  1.00 0.00 ? 5  ARG P C    1  
ATOM 106   O O    . ARG A 1 7  ? -1.772  4.955   15.236  1.00 0.00 ? 5  ARG P O    1  
ATOM 107   C CB   . ARG A 1 7  ? 0.399   6.213   13.255  1.00 0.00 ? 5  ARG P CB   1  
ATOM 108   C CG   . ARG A 1 7  ? 1.572   7.126   12.863  1.00 0.00 ? 5  ARG P CG   1  
ATOM 109   C CD   . ARG A 1 7  ? 2.402   6.494   11.740  1.00 0.00 ? 5  ARG P CD   1  
ATOM 110   N NE   . ARG A 1 7  ? 3.464   7.411   11.279  1.00 0.00 ? 5  ARG P NE   1  
ATOM 111   C CZ   . ARG A 1 7  ? 4.377   7.162   10.356  1.00 0.00 ? 5  ARG P CZ   1  
ATOM 112   N NH1  . ARG A 1 7  ? 4.458   6.010   9.755   1.00 0.00 ? 5  ARG P NH1  1  
ATOM 113   N NH2  . ARG A 1 7  ? 5.238   8.077   10.020  1.00 0.00 ? 5  ARG P NH2  1  
ATOM 114   H H    . ARG A 1 7  ? 0.479   5.900   16.113  1.00 0.00 ? 5  ARG P H    1  
ATOM 115   H HA   . ARG A 1 7  ? -0.743  7.808   14.148  1.00 0.00 ? 5  ARG P HA   1  
ATOM 116   H HB2  . ARG A 1 7  ? 0.786   5.234   13.549  1.00 0.00 ? 5  ARG P HB2  1  
ATOM 117   H HB3  . ARG A 1 7  ? -0.234  6.076   12.377  1.00 0.00 ? 5  ARG P HB3  1  
ATOM 118   H HG2  . ARG A 1 7  ? 1.176   8.085   12.524  1.00 0.00 ? 5  ARG P HG2  1  
ATOM 119   H HG3  . ARG A 1 7  ? 2.219   7.292   13.724  1.00 0.00 ? 5  ARG P HG3  1  
ATOM 120   H HD2  . ARG A 1 7  ? 2.847   5.569   12.113  1.00 0.00 ? 5  ARG P HD2  1  
ATOM 121   H HD3  . ARG A 1 7  ? 1.740   6.254   10.905  1.00 0.00 ? 5  ARG P HD3  1  
ATOM 122   H HE   . ARG A 1 7  ? 3.478   8.335   11.684  1.00 0.00 ? 5  ARG P HE   1  
ATOM 123   H HH11 . ARG A 1 7  ? 3.799   5.287   9.987   1.00 0.00 ? 5  ARG P HH11 1  
ATOM 124   H HH12 . ARG A 1 7  ? 5.157   5.847   9.051   1.00 0.00 ? 5  ARG P HH12 1  
ATOM 125   H HH21 . ARG A 1 7  ? 5.200   8.993   10.438  1.00 0.00 ? 5  ARG P HH21 1  
ATOM 126   H HH22 . ARG A 1 7  ? 5.927   7.890   9.311   1.00 0.00 ? 5  ARG P HH22 1  
ATOM 127   N N    . THR A 1 8  ? -2.801  6.391   13.846  1.00 0.00 ? 6  THR P N    1  
ATOM 128   C CA   . THR A 1 8  ? -4.111  5.706   13.793  1.00 0.00 ? 6  THR P CA   1  
ATOM 129   C C    . THR A 1 8  ? -4.119  4.592   12.726  1.00 0.00 ? 6  THR P C    1  
ATOM 130   O O    . THR A 1 8  ? -4.933  4.562   11.803  1.00 0.00 ? 6  THR P O    1  
ATOM 131   C CB   . THR A 1 8  ? -5.256  6.739   13.717  1.00 0.00 ? 6  THR P CB   1  
ATOM 132   O OG1  . THR A 1 8  ? -6.510  6.112   13.890  1.00 0.00 ? 6  THR P OG1  1  
ATOM 133   C CG2  . THR A 1 8  ? -5.292  7.599   12.447  1.00 0.00 ? 6  THR P CG2  1  
ATOM 134   H H    . THR A 1 8  ? -2.682  7.218   13.279  1.00 0.00 ? 6  THR P H    1  
ATOM 135   H HA   . THR A 1 8  ? -4.254  5.192   14.744  1.00 0.00 ? 6  THR P HA   1  
ATOM 136   H HB   . THR A 1 8  ? -5.119  7.420   14.559  1.00 0.00 ? 6  THR P HB   1  
ATOM 137   H HG1  . THR A 1 8  ? -7.181  6.814   13.964  1.00 0.00 ? 6  THR P HG1  1  
ATOM 138   H HG21 . THR A 1 8  ? -5.524  6.995   11.571  1.00 0.00 ? 6  THR P HG21 1  
ATOM 139   H HG22 . THR A 1 8  ? -4.331  8.091   12.298  1.00 0.00 ? 6  THR P HG22 1  
ATOM 140   H HG23 . THR A 1 8  ? -6.056  8.368   12.553  1.00 0.00 ? 6  THR P HG23 1  
ATOM 141   N N    . HIS A 1 9  ? -3.107  3.715   12.796  1.00 0.00 ? 7  HIS P N    1  
ATOM 142   C CA   . HIS A 1 9  ? -2.727  2.676   11.813  1.00 0.00 ? 7  HIS P CA   1  
ATOM 143   C C    . HIS A 1 9  ? -2.380  3.163   10.389  1.00 0.00 ? 7  HIS P C    1  
ATOM 144   O O    . HIS A 1 9  ? -1.867  2.370   9.596   1.00 0.00 ? 7  HIS P O    1  
ATOM 145   C CB   . HIS A 1 9  ? -3.758  1.532   11.808  1.00 0.00 ? 7  HIS P CB   1  
ATOM 146   C CG   . HIS A 1 9  ? -3.930  0.870   13.154  1.00 0.00 ? 7  HIS P CG   1  
ATOM 147   N ND1  . HIS A 1 9  ? -5.005  1.063   14.029  1.00 0.00 ? 7  HIS P ND1  1  
ATOM 148   C CD2  . HIS A 1 9  ? -3.052  -0.006  13.724  1.00 0.00 ? 7  HIS P CD2  1  
ATOM 149   C CE1  . HIS A 1 9  ? -4.748  0.298   15.105  1.00 0.00 ? 7  HIS P CE1  1  
ATOM 150   N NE2  . HIS A 1 9  ? -3.581  -0.354  14.948  1.00 0.00 ? 7  HIS P NE2  1  
ATOM 151   H H    . HIS A 1 9  ? -2.516  3.794   13.616  1.00 0.00 ? 7  HIS P H    1  
ATOM 152   H HA   . HIS A 1 9  ? -1.796  2.239   12.175  1.00 0.00 ? 7  HIS P HA   1  
ATOM 153   H HB2  . HIS A 1 9  ? -4.723  1.909   11.468  1.00 0.00 ? 7  HIS P HB2  1  
ATOM 154   H HB3  . HIS A 1 9  ? -3.439  0.768   11.098  1.00 0.00 ? 7  HIS P HB3  1  
ATOM 155   H HD2  . HIS A 1 9  ? -2.120  -0.353  13.295  1.00 0.00 ? 7  HIS P HD2  1  
ATOM 156   H HE1  . HIS A 1 9  ? -5.388  0.215   15.977  1.00 0.00 ? 7  HIS P HE1  1  
ATOM 157   H HE2  . HIS A 1 9  ? -3.177  -0.996  15.623  1.00 0.00 ? 7  HIS P HE2  1  
ATOM 158   N N    . PHE A 1 10 ? -2.585  4.447   10.077  1.00 0.00 ? 8  PHE P N    1  
ATOM 159   C CA   . PHE A 1 10 ? -2.265  5.091   8.800   1.00 0.00 ? 8  PHE P CA   1  
ATOM 160   C C    . PHE A 1 10 ? -1.721  6.515   8.994   1.00 0.00 ? 8  PHE P C    1  
ATOM 161   O O    . PHE A 1 10 ? -1.870  7.111   10.066  1.00 0.00 ? 8  PHE P O    1  
ATOM 162   C CB   . PHE A 1 10 ? -3.519  5.143   7.913   1.00 0.00 ? 8  PHE P CB   1  
ATOM 163   C CG   . PHE A 1 10 ? -4.180  3.800   7.685   1.00 0.00 ? 8  PHE P CG   1  
ATOM 164   C CD1  . PHE A 1 10 ? -3.709  2.950   6.671   1.00 0.00 ? 8  PHE P CD1  1  
ATOM 165   C CD2  . PHE A 1 10 ? -5.232  3.381   8.523   1.00 0.00 ? 8  PHE P CD2  1  
ATOM 166   C CE1  . PHE A 1 10 ? -4.282  1.677   6.501   1.00 0.00 ? 8  PHE P CE1  1  
ATOM 167   C CE2  . PHE A 1 10 ? -5.787  2.100   8.371   1.00 0.00 ? 8  PHE P CE2  1  
ATOM 168   C CZ   . PHE A 1 10 ? -5.304  1.246   7.366   1.00 0.00 ? 8  PHE P CZ   1  
ATOM 169   H H    . PHE A 1 10 ? -3.068  5.020   10.752  1.00 0.00 ? 8  PHE P H    1  
ATOM 170   H HA   . PHE A 1 10 ? -1.508  4.499   8.291   1.00 0.00 ? 8  PHE P HA   1  
ATOM 171   H HB2  . PHE A 1 10 ? -4.242  5.823   8.366   1.00 0.00 ? 8  PHE P HB2  1  
ATOM 172   H HB3  . PHE A 1 10 ? -3.236  5.557   6.945   1.00 0.00 ? 8  PHE P HB3  1  
ATOM 173   H HD1  . PHE A 1 10 ? -2.896  3.272   6.033   1.00 0.00 ? 8  PHE P HD1  1  
ATOM 174   H HD2  . PHE A 1 10 ? -5.594  4.034   9.305   1.00 0.00 ? 8  PHE P HD2  1  
ATOM 175   H HE1  . PHE A 1 10 ? -3.929  1.029   5.712   1.00 0.00 ? 8  PHE P HE1  1  
ATOM 176   H HE2  . PHE A 1 10 ? -6.580  1.770   9.029   1.00 0.00 ? 8  PHE P HE2  1  
ATOM 177   H HZ   . PHE A 1 10 ? -5.728  0.259   7.257   1.00 0.00 ? 8  PHE P HZ   1  
ATOM 178   N N    . THR A 1 11 ? -1.140  7.082   7.934   1.00 0.00 ? 9  THR P N    1  
ATOM 179   C CA   . THR A 1 11 ? -0.744  8.500   7.839   1.00 0.00 ? 9  THR P CA   1  
ATOM 180   C C    . THR A 1 11 ? -1.674  9.278   6.913   1.00 0.00 ? 9  THR P C    1  
ATOM 181   O O    . THR A 1 11 ? -2.308  8.706   6.021   1.00 0.00 ? 9  THR P O    1  
ATOM 182   C CB   . THR A 1 11 ? 0.706   8.688   7.349   1.00 0.00 ? 9  THR P CB   1  
ATOM 183   O OG1  . THR A 1 11 ? 0.794   8.542   5.947   1.00 0.00 ? 9  THR P OG1  1  
ATOM 184   C CG2  . THR A 1 11 ? 1.682   7.706   7.986   1.00 0.00 ? 9  THR P CG2  1  
ATOM 185   H H    . THR A 1 11 ? -1.016  6.512   7.108   1.00 0.00 ? 9  THR P H    1  
ATOM 186   H HA   . THR A 1 11 ? -0.807  8.956   8.826   1.00 0.00 ? 9  THR P HA   1  
ATOM 187   H HB   . THR A 1 11 ? 1.021   9.700   7.603   1.00 0.00 ? 9  THR P HB   1  
ATOM 188   H HG1  . THR A 1 11 ? 1.732   8.651   5.709   1.00 0.00 ? 9  THR P HG1  1  
ATOM 189   H HG21 . THR A 1 11 ? 2.700   7.962   7.696   1.00 0.00 ? 9  THR P HG21 1  
ATOM 190   H HG22 . THR A 1 11 ? 1.457   6.693   7.654   1.00 0.00 ? 9  THR P HG22 1  
ATOM 191   H HG23 . THR A 1 11 ? 1.587   7.761   9.067   1.00 0.00 ? 9  THR P HG23 1  
ATOM 192   N N    . SER A 1 12 ? -1.685  10.606  7.041   1.00 0.00 ? 10 SER P N    1  
ATOM 193   C CA   . SER A 1 12 ? -2.439  11.508  6.156   1.00 0.00 ? 10 SER P CA   1  
ATOM 194   C C    . SER A 1 12 ? -2.029  11.431  4.676   1.00 0.00 ? 10 SER P C    1  
ATOM 195   O O    . SER A 1 12 ? -2.757  11.954  3.833   1.00 0.00 ? 10 SER P O    1  
ATOM 196   C CB   . SER A 1 12 ? -2.327  12.955  6.644   1.00 0.00 ? 10 SER P CB   1  
ATOM 197   O OG   . SER A 1 12 ? -2.587  13.047  8.040   1.00 0.00 ? 10 SER P OG   1  
ATOM 198   H H    . SER A 1 12 ? -1.186  11.030  7.811   1.00 0.00 ? 10 SER P H    1  
ATOM 199   H HA   . SER A 1 12 ? -3.491  11.237  6.207   1.00 0.00 ? 10 SER P HA   1  
ATOM 200   H HB2  . SER A 1 12 ? -1.323  13.329  6.436   1.00 0.00 ? 10 SER P HB2  1  
ATOM 201   H HB3  . SER A 1 12 ? -3.057  13.556  6.101   1.00 0.00 ? 10 SER P HB3  1  
ATOM 202   H HG   . SER A 1 12 ? -2.536  13.987  8.301   1.00 0.00 ? 10 SER P HG   1  
ATOM 203   N N    . GLN A 1 13 ? -0.910  10.770  4.342   1.00 0.00 ? 11 GLN P N    1  
ATOM 204   C CA   . GLN A 1 13 ? -0.469  10.490  2.970   1.00 0.00 ? 11 GLN P CA   1  
ATOM 205   C C    . GLN A 1 13 ? -0.891  9.088   2.488   1.00 0.00 ? 11 GLN P C    1  
ATOM 206   O O    . GLN A 1 13 ? -1.368  8.949   1.362   1.00 0.00 ? 11 GLN P O    1  
ATOM 207   C CB   . GLN A 1 13 ? 1.053   10.698  2.894   1.00 0.00 ? 11 GLN P CB   1  
ATOM 208   C CG   . GLN A 1 13 ? 1.583   10.651  1.453   1.00 0.00 ? 11 GLN P CG   1  
ATOM 209   C CD   . GLN A 1 13 ? 3.084   10.929  1.392   1.00 0.00 ? 11 GLN P CD   1  
ATOM 210   O OE1  . GLN A 1 13 ? 3.912   10.027  1.338   1.00 0.00 ? 11 GLN P OE1  1  
ATOM 211   N NE2  . GLN A 1 13 ? 3.502   12.179  1.411   1.00 0.00 ? 11 GLN P NE2  1  
ATOM 212   H H    . GLN A 1 13 ? -0.366  10.363  5.092   1.00 0.00 ? 11 GLN P H    1  
ATOM 213   H HA   . GLN A 1 13 ? -0.929  11.215  2.297   1.00 0.00 ? 11 GLN P HA   1  
ATOM 214   H HB2  . GLN A 1 13 ? 1.294   11.673  3.320   1.00 0.00 ? 11 GLN P HB2  1  
ATOM 215   H HB3  . GLN A 1 13 ? 1.557   9.932   3.487   1.00 0.00 ? 11 GLN P HB3  1  
ATOM 216   H HG2  . GLN A 1 13 ? 1.392   9.668   1.022   1.00 0.00 ? 11 GLN P HG2  1  
ATOM 217   H HG3  . GLN A 1 13 ? 1.058   11.396  0.853   1.00 0.00 ? 11 GLN P HG3  1  
ATOM 218   H HE21 . GLN A 1 13 ? 2.840   12.939  1.456   1.00 0.00 ? 11 GLN P HE21 1  
ATOM 219   H HE22 . GLN A 1 13 ? 4.495   12.354  1.374   1.00 0.00 ? 11 GLN P HE22 1  
ATOM 220   N N    . GLN A 1 14 ? -0.789  8.052   3.333   1.00 0.00 ? 12 GLN P N    1  
ATOM 221   C CA   . GLN A 1 14 ? -1.186  6.673   2.985   1.00 0.00 ? 12 GLN P CA   1  
ATOM 222   C C    . GLN A 1 14 ? -2.676  6.583   2.636   1.00 0.00 ? 12 GLN P C    1  
ATOM 223   O O    . GLN A 1 14 ? -3.062  5.937   1.660   1.00 0.00 ? 12 GLN P O    1  
ATOM 224   C CB   . GLN A 1 14 ? -0.903  5.736   4.167   1.00 0.00 ? 12 GLN P CB   1  
ATOM 225   C CG   . GLN A 1 14 ? 0.595   5.517   4.388   1.00 0.00 ? 12 GLN P CG   1  
ATOM 226   C CD   . GLN A 1 14 ? 0.882   4.686   5.635   1.00 0.00 ? 12 GLN P CD   1  
ATOM 227   O OE1  . GLN A 1 14 ? 0.176   4.730   6.629   1.00 0.00 ? 12 GLN P OE1  1  
ATOM 228   N NE2  . GLN A 1 14 ? 1.930   3.899   5.629   1.00 0.00 ? 12 GLN P NE2  1  
ATOM 229   H H    . GLN A 1 14 ? -0.440  8.226   4.270   1.00 0.00 ? 12 GLN P H    1  
ATOM 230   H HA   . GLN A 1 14 ? -0.613  6.331   2.121   1.00 0.00 ? 12 GLN P HA   1  
ATOM 231   H HB2  . GLN A 1 14 ? -1.357  6.149   5.067   1.00 0.00 ? 12 GLN P HB2  1  
ATOM 232   H HB3  . GLN A 1 14 ? -1.351  4.762   3.968   1.00 0.00 ? 12 GLN P HB3  1  
ATOM 233   H HG2  . GLN A 1 14 ? 0.998   5.012   3.512   1.00 0.00 ? 12 GLN P HG2  1  
ATOM 234   H HG3  . GLN A 1 14 ? 1.098   6.474   4.492   1.00 0.00 ? 12 GLN P HG3  1  
ATOM 235   H HE21 . GLN A 1 14 ? 2.427   3.766   4.753   1.00 0.00 ? 12 GLN P HE21 1  
ATOM 236   H HE22 . GLN A 1 14 ? 2.097   3.294   6.412   1.00 0.00 ? 12 GLN P HE22 1  
ATOM 237   N N    . LEU A 1 15 ? -3.504  7.298   3.403   1.00 0.00 ? 13 LEU P N    1  
ATOM 238   C CA   . LEU A 1 15 ? -4.954  7.398   3.208   1.00 0.00 ? 13 LEU P CA   1  
ATOM 239   C C    . LEU A 1 15 ? -5.342  7.929   1.816   1.00 0.00 ? 13 LEU P C    1  
ATOM 240   O O    . LEU A 1 15 ? -6.379  7.541   1.276   1.00 0.00 ? 13 LEU P O    1  
ATOM 241   C CB   . LEU A 1 15 ? -5.512  8.321   4.301   1.00 0.00 ? 13 LEU P CB   1  
ATOM 242   C CG   . LEU A 1 15 ? -5.362  7.765   5.734   1.00 0.00 ? 13 LEU P CG   1  
ATOM 243   C CD1  . LEU A 1 15 ? -5.607  8.876   6.749   1.00 0.00 ? 13 LEU P CD1  1  
ATOM 244   C CD2  . LEU A 1 15 ? -6.317  6.610   5.998   1.00 0.00 ? 13 LEU P CD2  1  
ATOM 245   H H    . LEU A 1 15 ? -3.093  7.778   4.199   1.00 0.00 ? 13 LEU P H    1  
ATOM 246   H HA   . LEU A 1 15 ? -5.405  6.412   3.310   1.00 0.00 ? 13 LEU P HA   1  
ATOM 247   H HB2  . LEU A 1 15 ? -4.995  9.281   4.234   1.00 0.00 ? 13 LEU P HB2  1  
ATOM 248   H HB3  . LEU A 1 15 ? -6.569  8.499   4.090   1.00 0.00 ? 13 LEU P HB3  1  
ATOM 249   H HG   . LEU A 1 15 ? -4.358  7.384   5.896   1.00 0.00 ? 13 LEU P HG   1  
ATOM 250   H HD11 . LEU A 1 15 ? -6.622  9.261   6.650   1.00 0.00 ? 13 LEU P HD11 1  
ATOM 251   H HD12 . LEU A 1 15 ? -5.448  8.491   7.755   1.00 0.00 ? 13 LEU P HD12 1  
ATOM 252   H HD13 . LEU A 1 15 ? -4.895  9.681   6.572   1.00 0.00 ? 13 LEU P HD13 1  
ATOM 253   H HD21 . LEU A 1 15 ? -6.025  5.766   5.372   1.00 0.00 ? 13 LEU P HD21 1  
ATOM 254   H HD22 . LEU A 1 15 ? -6.237  6.301   7.040   1.00 0.00 ? 13 LEU P HD22 1  
ATOM 255   H HD23 . LEU A 1 15 ? -7.338  6.920   5.787   1.00 0.00 ? 13 LEU P HD23 1  
ATOM 256   N N    . GLN A 1 16 ? -4.497  8.773   1.216   1.00 0.00 ? 14 GLN P N    1  
ATOM 257   C CA   . GLN A 1 16 ? -4.718  9.319   -0.129  1.00 0.00 ? 14 GLN P CA   1  
ATOM 258   C C    . GLN A 1 16 ? -4.523  8.248   -1.208  1.00 0.00 ? 14 GLN P C    1  
ATOM 259   O O    . GLN A 1 16 ? -5.319  8.160   -2.141  1.00 0.00 ? 14 GLN P O    1  
ATOM 260   C CB   . GLN A 1 16 ? -3.790  10.515  -0.414  1.00 0.00 ? 14 GLN P CB   1  
ATOM 261   C CG   . GLN A 1 16 ? -3.717  11.561  0.706   1.00 0.00 ? 14 GLN P CG   1  
ATOM 262   C CD   . GLN A 1 16 ? -5.067  12.134  1.135   1.00 0.00 ? 14 GLN P CD   1  
ATOM 263   O OE1  . GLN A 1 16 ? -5.993  12.318  0.355   1.00 0.00 ? 14 GLN P OE1  1  
ATOM 264   N NE2  . GLN A 1 16 ? -5.217  12.451  2.402   1.00 0.00 ? 14 GLN P NE2  1  
ATOM 265   H H    . GLN A 1 16 ? -3.635  8.997   1.694   1.00 0.00 ? 14 GLN P H    1  
ATOM 266   H HA   . GLN A 1 16 ? -5.749  9.669   -0.196  1.00 0.00 ? 14 GLN P HA   1  
ATOM 267   H HB2  . GLN A 1 16 ? -2.778  10.148  -0.583  1.00 0.00 ? 14 GLN P HB2  1  
ATOM 268   H HB3  . GLN A 1 16 ? -4.123  11.000  -1.330  1.00 0.00 ? 14 GLN P HB3  1  
ATOM 269   H HG2  . GLN A 1 16 ? -3.241  11.095  1.564   1.00 0.00 ? 14 GLN P HG2  1  
ATOM 270   H HG3  . GLN A 1 16 ? -3.078  12.383  0.385   1.00 0.00 ? 14 GLN P HG3  1  
ATOM 271   H HE21 . GLN A 1 16 ? -4.432  12.313  3.034   1.00 0.00 ? 14 GLN P HE21 1  
ATOM 272   H HE22 . GLN A 1 16 ? -6.091  12.846  2.708   1.00 0.00 ? 14 GLN P HE22 1  
ATOM 273   N N    . GLU A 1 17 ? -3.501  7.396   -1.069  1.00 0.00 ? 15 GLU P N    1  
ATOM 274   C CA   . GLU A 1 17 ? -3.240  6.298   -2.009  1.00 0.00 ? 15 GLU P CA   1  
ATOM 275   C C    . GLU A 1 17 ? -4.286  5.185   -1.893  1.00 0.00 ? 15 GLU P C    1  
ATOM 276   O O    . GLU A 1 17 ? -4.674  4.589   -2.899  1.00 0.00 ? 15 GLU P O    1  
ATOM 277   C CB   . GLU A 1 17 ? -1.826  5.731   -1.806  1.00 0.00 ? 15 GLU P CB   1  
ATOM 278   C CG   . GLU A 1 17 ? -0.707  6.784   -1.860  1.00 0.00 ? 15 GLU P CG   1  
ATOM 279   C CD   . GLU A 1 17 ? -0.758  7.703   -3.101  1.00 0.00 ? 15 GLU P CD   1  
ATOM 280   O OE1  . GLU A 1 17 ? -1.053  7.225   -4.223  1.00 0.00 ? 15 GLU P OE1  1  
ATOM 281   O OE2  . GLU A 1 17 ? -0.479  8.919   -2.963  1.00 0.00 ? 15 GLU P OE2  1  
ATOM 282   H H    . GLU A 1 17 ? -2.900  7.491   -0.260  1.00 0.00 ? 15 GLU P H    1  
ATOM 283   H HA   . GLU A 1 17 ? -3.312  6.675   -3.026  1.00 0.00 ? 15 GLU P HA   1  
ATOM 284   H HB2  . GLU A 1 17 ? -1.779  5.231   -0.838  1.00 0.00 ? 15 GLU P HB2  1  
ATOM 285   H HB3  . GLU A 1 17 ? -1.641  4.980   -2.575  1.00 0.00 ? 15 GLU P HB3  1  
ATOM 286   H HG2  . GLU A 1 17 ? -0.763  7.385   -0.951  1.00 0.00 ? 15 GLU P HG2  1  
ATOM 287   H HG3  . GLU A 1 17 ? 0.251   6.262   -1.834  1.00 0.00 ? 15 GLU P HG3  1  
ATOM 288   N N    . LEU A 1 18 ? -4.802  4.957   -0.681  1.00 0.00 ? 16 LEU P N    1  
ATOM 289   C CA   . LEU A 1 18 ? -5.909  4.043   -0.416  1.00 0.00 ? 16 LEU P CA   1  
ATOM 290   C C    . LEU A 1 18 ? -7.209  4.522   -1.080  1.00 0.00 ? 16 LEU P C    1  
ATOM 291   O O    . LEU A 1 18 ? -7.810  3.771   -1.849  1.00 0.00 ? 16 LEU P O    1  
ATOM 292   C CB   . LEU A 1 18 ? -6.057  3.888   1.104   1.00 0.00 ? 16 LEU P CB   1  
ATOM 293   C CG   . LEU A 1 18 ? -4.945  3.022   1.721   1.00 0.00 ? 16 LEU P CG   1  
ATOM 294   C CD1  . LEU A 1 18 ? -4.781  3.332   3.203   1.00 0.00 ? 16 LEU P CD1  1  
ATOM 295   C CD2  . LEU A 1 18 ? -5.268  1.537   1.560   1.00 0.00 ? 16 LEU P CD2  1  
ATOM 296   H H    . LEU A 1 18 ? -4.408  5.469   0.101   1.00 0.00 ? 16 LEU P H    1  
ATOM 297   H HA   . LEU A 1 18 ? -5.677  3.068   -0.847  1.00 0.00 ? 16 LEU P HA   1  
ATOM 298   H HB2  . LEU A 1 18 ? -6.054  4.877   1.562   1.00 0.00 ? 16 LEU P HB2  1  
ATOM 299   H HB3  . LEU A 1 18 ? -7.019  3.430   1.318   1.00 0.00 ? 16 LEU P HB3  1  
ATOM 300   H HG   . LEU A 1 18 ? -3.992  3.227   1.234   1.00 0.00 ? 16 LEU P HG   1  
ATOM 301   H HD11 . LEU A 1 18 ? -4.490  4.374   3.320   1.00 0.00 ? 16 LEU P HD11 1  
ATOM 302   H HD12 . LEU A 1 18 ? -5.718  3.156   3.724   1.00 0.00 ? 16 LEU P HD12 1  
ATOM 303   H HD13 . LEU A 1 18 ? -4.004  2.701   3.627   1.00 0.00 ? 16 LEU P HD13 1  
ATOM 304   H HD21 . LEU A 1 18 ? -4.485  0.941   2.028   1.00 0.00 ? 16 LEU P HD21 1  
ATOM 305   H HD22 . LEU A 1 18 ? -6.224  1.308   2.029   1.00 0.00 ? 16 LEU P HD22 1  
ATOM 306   H HD23 . LEU A 1 18 ? -5.316  1.288   0.501   1.00 0.00 ? 16 LEU P HD23 1  
ATOM 307   N N    . GLU A 1 19 ? -7.622  5.780   -0.879  1.00 0.00 ? 17 GLU P N    1  
ATOM 308   C CA   . GLU A 1 19 ? -8.844  6.281   -1.531  1.00 0.00 ? 17 GLU P CA   1  
ATOM 309   C C    . GLU A 1 19 ? -8.703  6.551   -3.037  1.00 0.00 ? 17 GLU P C    1  
ATOM 310   O O    . GLU A 1 19 ? -9.708  6.536   -3.750  1.00 0.00 ? 17 GLU P O    1  
ATOM 311   C CB   . GLU A 1 19 ? -9.487  7.439   -0.757  1.00 0.00 ? 17 GLU P CB   1  
ATOM 312   C CG   . GLU A 1 19 ? -8.911  8.845   -0.965  1.00 0.00 ? 17 GLU P CG   1  
ATOM 313   C CD   . GLU A 1 19 ? -9.791  9.917   -0.279  1.00 0.00 ? 17 GLU P CD   1  
ATOM 314   O OE1  . GLU A 1 19 ? -10.571 9.585   0.652   1.00 0.00 ? 17 GLU P OE1  1  
ATOM 315   O OE2  . GLU A 1 19 ? -9.731  11.100  -0.690  1.00 0.00 ? 17 GLU P OE2  1  
ATOM 316   H H    . GLU A 1 19 ? -7.142  6.353   -0.191  1.00 0.00 ? 17 GLU P H    1  
ATOM 317   H HA   . GLU A 1 19 ? -9.571  5.472   -1.472  1.00 0.00 ? 17 GLU P HA   1  
ATOM 318   H HB2  . GLU A 1 19 ? -10.539 7.465   -1.045  1.00 0.00 ? 17 GLU P HB2  1  
ATOM 319   H HB3  . GLU A 1 19 ? -9.431  7.205   0.304   1.00 0.00 ? 17 GLU P HB3  1  
ATOM 320   H HG2  . GLU A 1 19 ? -7.898  8.881   -0.563  1.00 0.00 ? 17 GLU P HG2  1  
ATOM 321   H HG3  . GLU A 1 19 ? -8.861  9.053   -2.036  1.00 0.00 ? 17 GLU P HG3  1  
ATOM 322   N N    . ALA A 1 20 ? -7.478  6.718   -3.545  1.00 0.00 ? 18 ALA P N    1  
ATOM 323   C CA   . ALA A 1 20 ? -7.195  6.761   -4.980  1.00 0.00 ? 18 ALA P CA   1  
ATOM 324   C C    . ALA A 1 20 ? -7.258  5.362   -5.621  1.00 0.00 ? 18 ALA P C    1  
ATOM 325   O O    . ALA A 1 20 ? -7.930  5.185   -6.639  1.00 0.00 ? 18 ALA P O    1  
ATOM 326   C CB   . ALA A 1 20 ? -5.837  7.432   -5.211  1.00 0.00 ? 18 ALA P CB   1  
ATOM 327   H H    . ALA A 1 20 ? -6.704  6.812   -2.897  1.00 0.00 ? 18 ALA P H    1  
ATOM 328   H HA   . ALA A 1 20 ? -7.955  7.373   -5.470  1.00 0.00 ? 18 ALA P HA   1  
ATOM 329   H HB1  . ALA A 1 20 ? -5.851  8.445   -4.807  1.00 0.00 ? 18 ALA P HB1  1  
ATOM 330   H HB2  . ALA A 1 20 ? -5.044  6.861   -4.726  1.00 0.00 ? 18 ALA P HB2  1  
ATOM 331   H HB3  . ALA A 1 20 ? -5.632  7.485   -6.281  1.00 0.00 ? 18 ALA P HB3  1  
ATOM 332   N N    . THR A 1 21 ? -6.630  4.340   -5.024  1.00 0.00 ? 19 THR P N    1  
ATOM 333   C CA   . THR A 1 21 ? -6.664  2.977   -5.589  1.00 0.00 ? 19 THR P CA   1  
ATOM 334   C C    . THR A 1 21 ? -8.043  2.313   -5.452  1.00 0.00 ? 19 THR P C    1  
ATOM 335   O O    . THR A 1 21 ? -8.411  1.479   -6.276  1.00 0.00 ? 19 THR P O    1  
ATOM 336   C CB   . THR A 1 21 ? -5.520  2.096   -5.070  1.00 0.00 ? 19 THR P CB   1  
ATOM 337   O OG1  . THR A 1 21 ? -5.302  1.049   -5.999  1.00 0.00 ? 19 THR P OG1  1  
ATOM 338   C CG2  . THR A 1 21 ? -5.783  1.483   -3.697  1.00 0.00 ? 19 THR P CG2  1  
ATOM 339   H H    . THR A 1 21 ? -6.072  4.515   -4.192  1.00 0.00 ? 19 THR P H    1  
ATOM 340   H HA   . THR A 1 21 ? -6.472  3.092   -6.651  1.00 0.00 ? 19 THR P HA   1  
ATOM 341   H HB   . THR A 1 21 ? -4.614  2.701   -5.020  1.00 0.00 ? 19 THR P HB   1  
ATOM 342   H HG1  . THR A 1 21 ? -6.083  0.468   -5.968  1.00 0.00 ? 19 THR P HG1  1  
ATOM 343   H HG21 . THR A 1 21 ? -6.389  0.581   -3.795  1.00 0.00 ? 19 THR P HG21 1  
ATOM 344   H HG22 . THR A 1 21 ? -6.292  2.199   -3.060  1.00 0.00 ? 19 THR P HG22 1  
ATOM 345   H HG23 . THR A 1 21 ? -4.835  1.243   -3.221  1.00 0.00 ? 19 THR P HG23 1  
ATOM 346   N N    . PHE A 1 22 ? -8.857  2.757   -4.490  1.00 0.00 ? 20 PHE P N    1  
ATOM 347   C CA   . PHE A 1 22 ? -10.274 2.406   -4.343  1.00 0.00 ? 20 PHE P CA   1  
ATOM 348   C C    . PHE A 1 22 ? -11.112 2.789   -5.581  1.00 0.00 ? 20 PHE P C    1  
ATOM 349   O O    . PHE A 1 22 ? -12.135 2.160   -5.845  1.00 0.00 ? 20 PHE P O    1  
ATOM 350   C CB   . PHE A 1 22 ? -10.784 3.081   -3.055  1.00 0.00 ? 20 PHE P CB   1  
ATOM 351   C CG   . PHE A 1 22 ? -12.261 2.963   -2.702  1.00 0.00 ? 20 PHE P CG   1  
ATOM 352   C CD1  . PHE A 1 22 ? -12.950 1.740   -2.826  1.00 0.00 ? 20 PHE P CD1  1  
ATOM 353   C CD2  . PHE A 1 22 ? -12.939 4.085   -2.181  1.00 0.00 ? 20 PHE P CD2  1  
ATOM 354   C CE1  . PHE A 1 22 ? -14.302 1.643   -2.448  1.00 0.00 ? 20 PHE P CE1  1  
ATOM 355   C CE2  . PHE A 1 22 ? -14.291 3.989   -1.802  1.00 0.00 ? 20 PHE P CE2  1  
ATOM 356   C CZ   . PHE A 1 22 ? -14.973 2.767   -1.936  1.00 0.00 ? 20 PHE P CZ   1  
ATOM 357   H H    . PHE A 1 22 ? -8.467  3.396   -3.810  1.00 0.00 ? 20 PHE P H    1  
ATOM 358   H HA   . PHE A 1 22 ? -10.353 1.328   -4.223  1.00 0.00 ? 20 PHE P HA   1  
ATOM 359   H HB2  . PHE A 1 22 ? -10.221 2.671   -2.217  1.00 0.00 ? 20 PHE P HB2  1  
ATOM 360   H HB3  . PHE A 1 22 ? -10.540 4.140   -3.120  1.00 0.00 ? 20 PHE P HB3  1  
ATOM 361   H HD1  . PHE A 1 22 ? -12.448 0.872   -3.218  1.00 0.00 ? 20 PHE P HD1  1  
ATOM 362   H HD2  . PHE A 1 22 ? -12.420 5.025   -2.060  1.00 0.00 ? 20 PHE P HD2  1  
ATOM 363   H HE1  . PHE A 1 22 ? -14.826 0.702   -2.553  1.00 0.00 ? 20 PHE P HE1  1  
ATOM 364   H HE2  . PHE A 1 22 ? -14.805 4.853   -1.402  1.00 0.00 ? 20 PHE P HE2  1  
ATOM 365   H HZ   . PHE A 1 22 ? -16.013 2.693   -1.645  1.00 0.00 ? 20 PHE P HZ   1  
ATOM 366   N N    . GLN A 1 23 ? -10.664 3.762   -6.389  1.00 0.00 ? 21 GLN P N    1  
ATOM 367   C CA   . GLN A 1 23 ? -11.350 4.154   -7.627  1.00 0.00 ? 21 GLN P CA   1  
ATOM 368   C C    . GLN A 1 23 ? -11.099 3.175   -8.791  1.00 0.00 ? 21 GLN P C    1  
ATOM 369   O O    . GLN A 1 23 ? -12.023 2.884   -9.555  1.00 0.00 ? 21 GLN P O    1  
ATOM 370   C CB   . GLN A 1 23 ? -10.943 5.578   -8.043  1.00 0.00 ? 21 GLN P CB   1  
ATOM 371   C CG   . GLN A 1 23 ? -11.074 6.655   -6.954  1.00 0.00 ? 21 GLN P CG   1  
ATOM 372   C CD   . GLN A 1 23 ? -12.396 6.605   -6.194  1.00 0.00 ? 21 GLN P CD   1  
ATOM 373   O OE1  . GLN A 1 23 ? -13.482 6.611   -6.760  1.00 0.00 ? 21 GLN P OE1  1  
ATOM 374   N NE2  . GLN A 1 23 ? -12.352 6.545   -4.881  1.00 0.00 ? 21 GLN P NE2  1  
ATOM 375   H H    . GLN A 1 23 ? -9.809  4.245   -6.142  1.00 0.00 ? 21 GLN P H    1  
ATOM 376   H HA   . GLN A 1 23 ? -12.422 4.147   -7.431  1.00 0.00 ? 21 GLN P HA   1  
ATOM 377   H HB2  . GLN A 1 23 ? -9.901  5.558   -8.358  1.00 0.00 ? 21 GLN P HB2  1  
ATOM 378   H HB3  . GLN A 1 23 ? -11.552 5.874   -8.898  1.00 0.00 ? 21 GLN P HB3  1  
ATOM 379   H HG2  . GLN A 1 23 ? -10.250 6.537   -6.254  1.00 0.00 ? 21 GLN P HG2  1  
ATOM 380   H HG3  . GLN A 1 23 ? -10.968 7.639   -7.410  1.00 0.00 ? 21 GLN P HG3  1  
ATOM 381   H HE21 . GLN A 1 23 ? -11.450 6.552   -4.410  1.00 0.00 ? 21 GLN P HE21 1  
ATOM 382   H HE22 . GLN A 1 23 ? -13.218 6.484   -4.377  1.00 0.00 ? 21 GLN P HE22 1  
ATOM 383   N N    . ARG A 1 24 ? -9.870  2.646   -8.918  1.00 0.00 ? 22 ARG P N    1  
ATOM 384   C CA   . ARG A 1 24 ? -9.483  1.641   -9.936  1.00 0.00 ? 22 ARG P CA   1  
ATOM 385   C C    . ARG A 1 24 ? -9.834  0.207   -9.526  1.00 0.00 ? 22 ARG P C    1  
ATOM 386   O O    . ARG A 1 24 ? -10.033 -0.643  -10.394 1.00 0.00 ? 22 ARG P O    1  
ATOM 387   C CB   . ARG A 1 24 ? -7.990  1.768   -10.312 1.00 0.00 ? 22 ARG P CB   1  
ATOM 388   C CG   . ARG A 1 24 ? -7.031  1.624   -9.117  1.00 0.00 ? 22 ARG P CG   1  
ATOM 389   C CD   . ARG A 1 24 ? -5.544  1.665   -9.486  1.00 0.00 ? 22 ARG P CD   1  
ATOM 390   N NE   . ARG A 1 24 ? -5.071  0.389   -10.065 1.00 0.00 ? 22 ARG P NE   1  
ATOM 391   C CZ   . ARG A 1 24 ? -4.356  -0.550  -9.462  1.00 0.00 ? 22 ARG P CZ   1  
ATOM 392   N NH1  . ARG A 1 24 ? -4.042  -0.542  -8.199  1.00 0.00 ? 22 ARG P NH1  1  
ATOM 393   N NH2  . ARG A 1 24 ? -3.907  -1.573  -10.124 1.00 0.00 ? 22 ARG P NH2  1  
ATOM 394   H H    . ARG A 1 24 ? -9.177  2.929   -8.238  1.00 0.00 ? 22 ARG P H    1  
ATOM 395   H HA   . ARG A 1 24 ? -10.058 1.831   -10.844 1.00 0.00 ? 22 ARG P HA   1  
ATOM 396   H HB2  . ARG A 1 24 ? -7.749  1.008   -11.057 1.00 0.00 ? 22 ARG P HB2  1  
ATOM 397   H HB3  . ARG A 1 24 ? -7.829  2.746   -10.768 1.00 0.00 ? 22 ARG P HB3  1  
ATOM 398   H HG2  . ARG A 1 24 ? -7.225  2.466   -8.460  1.00 0.00 ? 22 ARG P HG2  1  
ATOM 399   H HG3  . ARG A 1 24 ? -7.233  0.698   -8.578  1.00 0.00 ? 22 ARG P HG3  1  
ATOM 400   H HD2  . ARG A 1 24 ? -5.374  2.474   -10.199 1.00 0.00 ? 22 ARG P HD2  1  
ATOM 401   H HD3  . ARG A 1 24 ? -4.969  1.899   -8.588  1.00 0.00 ? 22 ARG P HD3  1  
ATOM 402   H HE   . ARG A 1 24 ? -5.246  0.246   -11.047 1.00 0.00 ? 22 ARG P HE   1  
ATOM 403   H HH11 . ARG A 1 24 ? -4.387  0.177   -7.575  1.00 0.00 ? 22 ARG P HH11 1  
ATOM 404   H HH12 . ARG A 1 24 ? -3.458  -1.302  -7.863  1.00 0.00 ? 22 ARG P HH12 1  
ATOM 405   H HH21 . ARG A 1 24 ? -4.076  -1.679  -11.108 1.00 0.00 ? 22 ARG P HH21 1  
ATOM 406   H HH22 . ARG A 1 24 ? -3.326  -2.239  -9.612  1.00 0.00 ? 22 ARG P HH22 1  
ATOM 407   N N    . ASN A 1 25 ? -9.923  -0.057  -8.221  1.00 0.00 ? 23 ASN P N    1  
ATOM 408   C CA   . ASN A 1 25 ? -10.207 -1.370  -7.653  1.00 0.00 ? 23 ASN P CA   1  
ATOM 409   C C    . ASN A 1 25 ? -11.146 -1.238  -6.446  1.00 0.00 ? 23 ASN P C    1  
ATOM 410   O O    . ASN A 1 25 ? -10.734 -0.794  -5.379  1.00 0.00 ? 23 ASN P O    1  
ATOM 411   C CB   . ASN A 1 25 ? -8.867  -2.031  -7.276  1.00 0.00 ? 23 ASN P CB   1  
ATOM 412   C CG   . ASN A 1 25 ? -9.030  -3.495  -6.901  1.00 0.00 ? 23 ASN P CG   1  
ATOM 413   O OD1  . ASN A 1 25 ? -10.119 -4.000  -6.668  1.00 0.00 ? 23 ASN P OD1  1  
ATOM 414   N ND2  . ASN A 1 25 ? -7.945  -4.230  -6.862  1.00 0.00 ? 23 ASN P ND2  1  
ATOM 415   H H    . ASN A 1 25 ? -9.692  0.687   -7.570  1.00 0.00 ? 23 ASN P H    1  
ATOM 416   H HA   . ASN A 1 25 ? -10.703 -1.996  -8.396  1.00 0.00 ? 23 ASN P HA   1  
ATOM 417   H HB2  . ASN A 1 25 ? -8.188  -1.974  -8.127  1.00 0.00 ? 23 ASN P HB2  1  
ATOM 418   H HB3  . ASN A 1 25 ? -8.407  -1.491  -6.441  1.00 0.00 ? 23 ASN P HB3  1  
ATOM 419   H HD21 . ASN A 1 25 ? -7.051  -3.818  -7.070  1.00 0.00 ? 23 ASN P HD21 1  
ATOM 420   H HD22 . ASN A 1 25 ? -8.038  -5.211  -6.652  1.00 0.00 ? 23 ASN P HD22 1  
ATOM 421   N N    . HIS A 1 26 ? -12.408 -1.645  -6.605  1.00 0.00 ? 24 HIS P N    1  
ATOM 422   C CA   . HIS A 1 26 ? -13.432 -1.556  -5.551  1.00 0.00 ? 24 HIS P CA   1  
ATOM 423   C C    . HIS A 1 26 ? -13.452 -2.790  -4.625  1.00 0.00 ? 24 HIS P C    1  
ATOM 424   O O    . HIS A 1 26 ? -14.195 -2.805  -3.640  1.00 0.00 ? 24 HIS P O    1  
ATOM 425   C CB   . HIS A 1 26 ? -14.803 -1.299  -6.203  1.00 0.00 ? 24 HIS P CB   1  
ATOM 426   C CG   . HIS A 1 26 ? -14.993 0.087   -6.791  1.00 0.00 ? 24 HIS P CG   1  
ATOM 427   N ND1  . HIS A 1 26 ? -16.015 0.975   -6.436  1.00 0.00 ? 24 HIS P ND1  1  
ATOM 428   C CD2  . HIS A 1 26 ? -14.244 0.663   -7.780  1.00 0.00 ? 24 HIS P CD2  1  
ATOM 429   C CE1  . HIS A 1 26 ? -15.846 2.066   -7.204  1.00 0.00 ? 24 HIS P CE1  1  
ATOM 430   N NE2  . HIS A 1 26 ? -14.791 1.904   -8.019  1.00 0.00 ? 24 HIS P NE2  1  
ATOM 431   H H    . HIS A 1 26 ? -12.682 -2.022  -7.502  1.00 0.00 ? 24 HIS P H    1  
ATOM 432   H HA   . HIS A 1 26 ? -13.212 -0.701  -4.909  1.00 0.00 ? 24 HIS P HA   1  
ATOM 433   H HB2  . HIS A 1 26 ? -14.976 -2.035  -6.988  1.00 0.00 ? 24 HIS P HB2  1  
ATOM 434   H HB3  . HIS A 1 26 ? -15.579 -1.440  -5.449  1.00 0.00 ? 24 HIS P HB3  1  
ATOM 435   H HD2  . HIS A 1 26 ? -13.380 0.239   -8.272  1.00 0.00 ? 24 HIS P HD2  1  
ATOM 436   H HE1  . HIS A 1 26 ? -16.474 2.950   -7.173  1.00 0.00 ? 24 HIS P HE1  1  
ATOM 437   H HE2  . HIS A 1 26 ? -14.451 2.588   -8.689  1.00 0.00 ? 24 HIS P HE2  1  
ATOM 438   N N    . TYR A 1 27 ? -12.681 -3.838  -4.935  1.00 0.00 ? 25 TYR P N    1  
ATOM 439   C CA   . TYR A 1 27 ? -12.692 -5.136  -4.239  1.00 0.00 ? 25 TYR P CA   1  
ATOM 440   C C    . TYR A 1 27 ? -11.328 -5.866  -4.350  1.00 0.00 ? 25 TYR P C    1  
ATOM 441   O O    . TYR A 1 27 ? -11.237 -6.928  -4.973  1.00 0.00 ? 25 TYR P O    1  
ATOM 442   C CB   . TYR A 1 27 ? -13.889 -5.982  -4.743  1.00 0.00 ? 25 TYR P CB   1  
ATOM 443   C CG   . TYR A 1 27 ? -14.134 -6.000  -6.248  1.00 0.00 ? 25 TYR P CG   1  
ATOM 444   C CD1  . TYR A 1 27 ? -14.979 -5.032  -6.830  1.00 0.00 ? 25 TYR P CD1  1  
ATOM 445   C CD2  . TYR A 1 27 ? -13.548 -6.987  -7.066  1.00 0.00 ? 25 TYR P CD2  1  
ATOM 446   C CE1  . TYR A 1 27 ? -15.203 -5.021  -8.221  1.00 0.00 ? 25 TYR P CE1  1  
ATOM 447   C CE2  . TYR A 1 27 ? -13.771 -6.984  -8.458  1.00 0.00 ? 25 TYR P CE2  1  
ATOM 448   C CZ   . TYR A 1 27 ? -14.595 -5.997  -9.040  1.00 0.00 ? 25 TYR P CZ   1  
ATOM 449   O OH   . TYR A 1 27 ? -14.804 -6.000  -10.386 1.00 0.00 ? 25 TYR P OH   1  
ATOM 450   H H    . TYR A 1 27 ? -12.065 -3.752  -5.737  1.00 0.00 ? 25 TYR P H    1  
ATOM 451   H HA   . TYR A 1 27 ? -12.853 -4.960  -3.175  1.00 0.00 ? 25 TYR P HA   1  
ATOM 452   H HB2  . TYR A 1 27 ? -13.783 -7.007  -4.383  1.00 0.00 ? 25 TYR P HB2  1  
ATOM 453   H HB3  . TYR A 1 27 ? -14.789 -5.594  -4.268  1.00 0.00 ? 25 TYR P HB3  1  
ATOM 454   H HD1  . TYR A 1 27 ? -15.458 -4.291  -6.205  1.00 0.00 ? 25 TYR P HD1  1  
ATOM 455   H HD2  . TYR A 1 27 ? -12.921 -7.753  -6.629  1.00 0.00 ? 25 TYR P HD2  1  
ATOM 456   H HE1  . TYR A 1 27 ? -15.842 -4.268  -8.660  1.00 0.00 ? 25 TYR P HE1  1  
ATOM 457   H HE2  . TYR A 1 27 ? -13.314 -7.735  -9.086  1.00 0.00 ? 25 TYR P HE2  1  
ATOM 458   H HH   . TYR A 1 27 ? -15.392 -5.278  -10.669 1.00 0.00 ? 25 TYR P HH   1  
ATOM 459   N N    . PRO A 1 28 ? -10.240 -5.321  -3.765  1.00 0.00 ? 26 PRO P N    1  
ATOM 460   C CA   . PRO A 1 28 ? -8.911  -5.920  -3.869  1.00 0.00 ? 26 PRO P CA   1  
ATOM 461   C C    . PRO A 1 28 ? -8.809  -7.262  -3.126  1.00 0.00 ? 26 PRO P C    1  
ATOM 462   O O    . PRO A 1 28 ? -9.525  -7.533  -2.156  1.00 0.00 ? 26 PRO P O    1  
ATOM 463   C CB   . PRO A 1 28 ? -7.941  -4.862  -3.337  1.00 0.00 ? 26 PRO P CB   1  
ATOM 464   C CG   . PRO A 1 28 ? -8.787  -4.128  -2.303  1.00 0.00 ? 26 PRO P CG   1  
ATOM 465   C CD   . PRO A 1 28 ? -10.175 -4.114  -2.950  1.00 0.00 ? 26 PRO P CD   1  
ATOM 466   H HA   . PRO A 1 28 ? -8.680  -6.100  -4.919  1.00 0.00 ? 26 PRO P HA   1  
ATOM 467   H HB2  . PRO A 1 28 ? -7.040  -5.294  -2.905  1.00 0.00 ? 26 PRO P HB2  1  
ATOM 468   H HB3  . PRO A 1 28 ? -7.670  -4.176  -4.138  1.00 0.00 ? 26 PRO P HB3  1  
ATOM 469   H HG2  . PRO A 1 28 ? -8.806  -4.713  -1.383  1.00 0.00 ? 26 PRO P HG2  1  
ATOM 470   H HG3  . PRO A 1 28 ? -8.413  -3.121  -2.115  1.00 0.00 ? 26 PRO P HG3  1  
ATOM 471   H HD2  . PRO A 1 28 ? -10.949 -4.105  -2.181  1.00 0.00 ? 26 PRO P HD2  1  
ATOM 472   H HD3  . PRO A 1 28 ? -10.270 -3.237  -3.592  1.00 0.00 ? 26 PRO P HD3  1  
ATOM 473   N N    . ASP A 1 29 ? -7.873  -8.091  -3.580  1.00 0.00 ? 27 ASP P N    1  
ATOM 474   C CA   . ASP A 1 29 ? -7.595  -9.464  -3.125  1.00 0.00 ? 27 ASP P CA   1  
ATOM 475   C C    . ASP A 1 29 ? -6.172  -9.556  -2.558  1.00 0.00 ? 27 ASP P C    1  
ATOM 476   O O    . ASP A 1 29 ? -5.431  -8.583  -2.628  1.00 0.00 ? 27 ASP P O    1  
ATOM 477   C CB   . ASP A 1 29 ? -7.798  -10.428 -4.308  1.00 0.00 ? 27 ASP P CB   1  
ATOM 478   C CG   . ASP A 1 29 ? -7.839  -11.920 -3.925  1.00 0.00 ? 27 ASP P CG   1  
ATOM 479   O OD1  . ASP A 1 29 ? -8.024  -12.247 -2.728  1.00 0.00 ? 27 ASP P OD1  1  
ATOM 480   O OD2  . ASP A 1 29 ? -7.677  -12.772 -4.830  1.00 0.00 ? 27 ASP P OD2  1  
ATOM 481   H H    . ASP A 1 29 ? -7.243  -7.707  -4.281  1.00 0.00 ? 27 ASP P H    1  
ATOM 482   H HA   . ASP A 1 29 ? -8.290  -9.732  -2.335  1.00 0.00 ? 27 ASP P HA   1  
ATOM 483   H HB2  . ASP A 1 29 ? -8.740  -10.186 -4.790  1.00 0.00 ? 27 ASP P HB2  1  
ATOM 484   H HB3  . ASP A 1 29 ? -6.998  -10.261 -5.031  1.00 0.00 ? 27 ASP P HB3  1  
ATOM 485   N N    . MET A 1 30 ? -5.738  -10.705 -2.037  1.00 0.00 ? 28 MET P N    1  
ATOM 486   C CA   . MET A 1 30 ? -4.381  -10.881 -1.481  1.00 0.00 ? 28 MET P CA   1  
ATOM 487   C C    . MET A 1 30 ? -3.257  -10.355 -2.398  1.00 0.00 ? 28 MET P C    1  
ATOM 488   O O    . MET A 1 30 ? -2.266  -9.821  -1.905  1.00 0.00 ? 28 MET P O    1  
ATOM 489   C CB   . MET A 1 30 ? -4.132  -12.357 -1.127  1.00 0.00 ? 28 MET P CB   1  
ATOM 490   C CG   . MET A 1 30 ? -4.161  -13.308 -2.335  1.00 0.00 ? 28 MET P CG   1  
ATOM 491   S SD   . MET A 1 30 ? -3.537  -14.979 -2.007  1.00 0.00 ? 28 MET P SD   1  
ATOM 492   C CE   . MET A 1 30 ? -1.755  -14.622 -2.016  1.00 0.00 ? 28 MET P CE   1  
ATOM 493   H H    . MET A 1 30 ? -6.388  -11.488 -2.027  1.00 0.00 ? 28 MET P H    1  
ATOM 494   H HA   . MET A 1 30 ? -4.312  -10.305 -0.557  1.00 0.00 ? 28 MET P HA   1  
ATOM 495   H HB2  . MET A 1 30 ? -3.155  -12.426 -0.650  1.00 0.00 ? 28 MET P HB2  1  
ATOM 496   H HB3  . MET A 1 30 ? -4.879  -12.684 -0.404  1.00 0.00 ? 28 MET P HB3  1  
ATOM 497   H HG2  . MET A 1 30 ? -5.186  -13.379 -2.697  1.00 0.00 ? 28 MET P HG2  1  
ATOM 498   H HG3  . MET A 1 30 ? -3.557  -12.901 -3.143  1.00 0.00 ? 28 MET P HG3  1  
ATOM 499   H HE1  . MET A 1 30 ? -1.483  -14.121 -2.947  1.00 0.00 ? 28 MET P HE1  1  
ATOM 500   H HE2  . MET A 1 30 ? -1.500  -13.973 -1.178  1.00 0.00 ? 28 MET P HE2  1  
ATOM 501   H HE3  . MET A 1 30 ? -1.194  -15.553 -1.929  1.00 0.00 ? 28 MET P HE3  1  
ATOM 502   N N    . SER A 1 31 ? -3.428  -10.434 -3.722  1.00 0.00 ? 29 SER P N    1  
ATOM 503   C CA   . SER A 1 31 ? -2.427  -9.971  -4.695  1.00 0.00 ? 29 SER P CA   1  
ATOM 504   C C    . SER A 1 31 ? -2.470  -8.451  -4.897  1.00 0.00 ? 29 SER P C    1  
ATOM 505   O O    . SER A 1 31 ? -1.427  -7.798  -4.945  1.00 0.00 ? 29 SER P O    1  
ATOM 506   C CB   . SER A 1 31 ? -2.617  -10.681 -6.041  1.00 0.00 ? 29 SER P CB   1  
ATOM 507   O OG   . SER A 1 31 ? -2.559  -12.092 -5.875  1.00 0.00 ? 29 SER P OG   1  
ATOM 508   H H    . SER A 1 31 ? -4.284  -10.844 -4.065  1.00 0.00 ? 29 SER P H    1  
ATOM 509   H HA   . SER A 1 31 ? -1.438  -10.236 -4.318  1.00 0.00 ? 29 SER P HA   1  
ATOM 510   H HB2  . SER A 1 31 ? -3.584  -10.406 -6.467  1.00 0.00 ? 29 SER P HB2  1  
ATOM 511   H HB3  . SER A 1 31 ? -1.829  -10.364 -6.726  1.00 0.00 ? 29 SER P HB3  1  
ATOM 512   H HG   . SER A 1 31 ? -2.653  -12.510 -6.754  1.00 0.00 ? 29 SER P HG   1  
ATOM 513   N N    . THR A 1 32 ? -3.670  -7.864  -4.983  1.00 0.00 ? 30 THR P N    1  
ATOM 514   C CA   . THR A 1 32 ? -3.868  -6.419  -5.199  1.00 0.00 ? 30 THR P CA   1  
ATOM 515   C C    . THR A 1 32 ? -3.760  -5.600  -3.913  1.00 0.00 ? 30 THR P C    1  
ATOM 516   O O    . THR A 1 32 ? -3.217  -4.502  -3.942  1.00 0.00 ? 30 THR P O    1  
ATOM 517   C CB   . THR A 1 32 ? -5.182  -6.109  -5.931  1.00 0.00 ? 30 THR P CB   1  
ATOM 518   O OG1  . THR A 1 32 ? -6.189  -7.057  -5.661  1.00 0.00 ? 30 THR P OG1  1  
ATOM 519   C CG2  . THR A 1 32 ? -4.979  -6.105  -7.445  1.00 0.00 ? 30 THR P CG2  1  
ATOM 520   H H    . THR A 1 32 ? -4.498  -8.431  -4.859  1.00 0.00 ? 30 THR P H    1  
ATOM 521   H HA   . THR A 1 32 ? -3.065  -6.064  -5.840  1.00 0.00 ? 30 THR P HA   1  
ATOM 522   H HB   . THR A 1 32 ? -5.543  -5.131  -5.616  1.00 0.00 ? 30 THR P HB   1  
ATOM 523   H HG1  . THR A 1 32 ? -6.186  -7.698  -6.393  1.00 0.00 ? 30 THR P HG1  1  
ATOM 524   H HG21 . THR A 1 32 ? -4.545  -7.051  -7.769  1.00 0.00 ? 30 THR P HG21 1  
ATOM 525   H HG22 . THR A 1 32 ? -4.305  -5.293  -7.719  1.00 0.00 ? 30 THR P HG22 1  
ATOM 526   H HG23 . THR A 1 32 ? -5.932  -5.954  -7.951  1.00 0.00 ? 30 THR P HG23 1  
ATOM 527   N N    . ARG A 1 33 ? -4.178  -6.132  -2.761  1.00 0.00 ? 31 ARG P N    1  
ATOM 528   C CA   . ARG A 1 33 ? -3.921  -5.536  -1.440  1.00 0.00 ? 31 ARG P CA   1  
ATOM 529   C C    . ARG A 1 33 ? -2.420  -5.357  -1.197  1.00 0.00 ? 31 ARG P C    1  
ATOM 530   O O    . ARG A 1 33 ? -1.995  -4.285  -0.776  1.00 0.00 ? 31 ARG P O    1  
ATOM 531   C CB   . ARG A 1 33 ? -4.519  -6.430  -0.337  1.00 0.00 ? 31 ARG P CB   1  
ATOM 532   C CG   . ARG A 1 33 ? -6.055  -6.477  -0.325  1.00 0.00 ? 31 ARG P CG   1  
ATOM 533   C CD   . ARG A 1 33 ? -6.570  -7.529  0.668   1.00 0.00 ? 31 ARG P CD   1  
ATOM 534   N NE   . ARG A 1 33 ? -7.920  -7.997  0.298   1.00 0.00 ? 31 ARG P NE   1  
ATOM 535   C CZ   . ARG A 1 33 ? -8.419  -9.206  0.467   1.00 0.00 ? 31 ARG P CZ   1  
ATOM 536   N NH1  . ARG A 1 33 ? -7.794  -10.143 1.122   1.00 0.00 ? 31 ARG P NH1  1  
ATOM 537   N NH2  . ARG A 1 33 ? -9.574  -9.495  -0.052  1.00 0.00 ? 31 ARG P NH2  1  
ATOM 538   H H    . ARG A 1 33 ? -4.687  -7.009  -2.804  1.00 0.00 ? 31 ARG P H    1  
ATOM 539   H HA   . ARG A 1 33 ? -4.369  -4.541  -1.419  1.00 0.00 ? 31 ARG P HA   1  
ATOM 540   H HB2  . ARG A 1 33 ? -4.130  -7.441  -0.479  1.00 0.00 ? 31 ARG P HB2  1  
ATOM 541   H HB3  . ARG A 1 33 ? -4.186  -6.065  0.635   1.00 0.00 ? 31 ARG P HB3  1  
ATOM 542   H HG2  . ARG A 1 33 ? -6.456  -5.498  -0.061  1.00 0.00 ? 31 ARG P HG2  1  
ATOM 543   H HG3  . ARG A 1 33 ? -6.413  -6.733  -1.317  1.00 0.00 ? 31 ARG P HG3  1  
ATOM 544   H HD2  . ARG A 1 33 ? -5.894  -8.384  0.674   1.00 0.00 ? 31 ARG P HD2  1  
ATOM 545   H HD3  . ARG A 1 33 ? -6.579  -7.093  1.666   1.00 0.00 ? 31 ARG P HD3  1  
ATOM 546   H HE   . ARG A 1 33 ? -8.492  -7.370  -0.251  1.00 0.00 ? 31 ARG P HE   1  
ATOM 547   H HH11 . ARG A 1 33 ? -6.890  -9.950  1.517   1.00 0.00 ? 31 ARG P HH11 1  
ATOM 548   H HH12 . ARG A 1 33 ? -8.181  -11.069 1.190   1.00 0.00 ? 31 ARG P HH12 1  
ATOM 549   H HH21 . ARG A 1 33 ? -9.994  -8.821  -0.684  1.00 0.00 ? 31 ARG P HH21 1  
ATOM 550   H HH22 . ARG A 1 33 ? -9.948  -10.427 0.002   1.00 0.00 ? 31 ARG P HH22 1  
ATOM 551   N N    . GLU A 1 34 ? -1.603  -6.366  -1.515  1.00 0.00 ? 32 GLU P N    1  
ATOM 552   C CA   . GLU A 1 34 ? -0.143  -6.234  -1.468  1.00 0.00 ? 32 GLU P CA   1  
ATOM 553   C C    . GLU A 1 34 ? 0.379   -5.227  -2.503  1.00 0.00 ? 32 GLU P C    1  
ATOM 554   O O    . GLU A 1 34 ? 1.218   -4.399  -2.162  1.00 0.00 ? 32 GLU P O    1  
ATOM 555   C CB   . GLU A 1 34 ? 0.555   -7.589  -1.665  1.00 0.00 ? 32 GLU P CB   1  
ATOM 556   C CG   . GLU A 1 34 ? 0.447   -8.497  -0.436  1.00 0.00 ? 32 GLU P CG   1  
ATOM 557   C CD   . GLU A 1 34 ? 1.409   -9.699  -0.554  1.00 0.00 ? 32 GLU P CD   1  
ATOM 558   O OE1  . GLU A 1 34 ? 1.178   -10.608 -1.390  1.00 0.00 ? 32 GLU P OE1  1  
ATOM 559   O OE2  . GLU A 1 34 ? 2.431   -9.732  0.177   1.00 0.00 ? 32 GLU P OE2  1  
ATOM 560   H H    . GLU A 1 34 ? -2.004  -7.238  -1.830  1.00 0.00 ? 32 GLU P H    1  
ATOM 561   H HA   . GLU A 1 34 ? 0.137   -5.845  -0.487  1.00 0.00 ? 32 GLU P HA   1  
ATOM 562   H HB2  . GLU A 1 34 ? 0.146   -8.094  -2.540  1.00 0.00 ? 32 GLU P HB2  1  
ATOM 563   H HB3  . GLU A 1 34 ? 1.613   -7.400  -1.846  1.00 0.00 ? 32 GLU P HB3  1  
ATOM 564   H HG2  . GLU A 1 34 ? 0.700   -7.912  0.452   1.00 0.00 ? 32 GLU P HG2  1  
ATOM 565   H HG3  . GLU A 1 34 ? -0.584  -8.838  -0.321  1.00 0.00 ? 32 GLU P HG3  1  
ATOM 566   N N    . GLU A 1 35 ? -0.141  -5.237  -3.736  1.00 0.00 ? 33 GLU P N    1  
ATOM 567   C CA   . GLU A 1 35 ? 0.283   -4.321  -4.814  1.00 0.00 ? 33 GLU P CA   1  
ATOM 568   C C    . GLU A 1 35 ? 0.265   -2.845  -4.386  1.00 0.00 ? 33 GLU P C    1  
ATOM 569   O O    . GLU A 1 35 ? 1.201   -2.117  -4.715  1.00 0.00 ? 33 GLU P O    1  
ATOM 570   C CB   . GLU A 1 35 ? -0.614  -4.513  -6.056  1.00 0.00 ? 33 GLU P CB   1  
ATOM 571   C CG   . GLU A 1 35 ? -0.272  -3.614  -7.255  1.00 0.00 ? 33 GLU P CG   1  
ATOM 572   C CD   . GLU A 1 35 ? -1.384  -3.670  -8.318  1.00 0.00 ? 33 GLU P CD   1  
ATOM 573   O OE1  . GLU A 1 35 ? -2.355  -2.877  -8.224  1.00 0.00 ? 33 GLU P OE1  1  
ATOM 574   O OE2  . GLU A 1 35 ? -1.290  -4.487  -9.266  1.00 0.00 ? 33 GLU P OE2  1  
ATOM 575   H H    . GLU A 1 35 ? -0.809  -5.966  -3.958  1.00 0.00 ? 33 GLU P H    1  
ATOM 576   H HA   . GLU A 1 35 ? 1.316   -4.557  -5.076  1.00 0.00 ? 33 GLU P HA   1  
ATOM 577   H HB2  . GLU A 1 35 ? -0.563  -5.553  -6.377  1.00 0.00 ? 33 GLU P HB2  1  
ATOM 578   H HB3  . GLU A 1 35 ? -1.638  -4.290  -5.780  1.00 0.00 ? 33 GLU P HB3  1  
ATOM 579   H HG2  . GLU A 1 35 ? -0.169  -2.577  -6.931  1.00 0.00 ? 33 GLU P HG2  1  
ATOM 580   H HG3  . GLU A 1 35 ? 0.685   -3.926  -7.677  1.00 0.00 ? 33 GLU P HG3  1  
ATOM 581   N N    . ILE A 1 36 ? -0.750  -2.400  -3.636  1.00 0.00 ? 34 ILE P N    1  
ATOM 582   C CA   . ILE A 1 36 ? -0.833  -1.009  -3.151  1.00 0.00 ? 34 ILE P CA   1  
ATOM 583   C C    . ILE A 1 36 ? 0.008   -0.805  -1.881  1.00 0.00 ? 34 ILE P C    1  
ATOM 584   O O    . ILE A 1 36 ? 0.588   0.262   -1.683  1.00 0.00 ? 34 ILE P O    1  
ATOM 585   C CB   . ILE A 1 36 ? -2.300  -0.511  -3.027  1.00 0.00 ? 34 ILE P CB   1  
ATOM 586   C CG1  . ILE A 1 36 ? -2.972  -0.754  -1.658  1.00 0.00 ? 34 ILE P CG1  1  
ATOM 587   C CG2  . ILE A 1 36 ? -3.190  -1.133  -4.121  1.00 0.00 ? 34 ILE P CG2  1  
ATOM 588   C CD1  . ILE A 1 36 ? -2.746  0.384   -0.652  1.00 0.00 ? 34 ILE P CD1  1  
ATOM 589   H H    . ILE A 1 36 ? -1.512  -3.038  -3.433  1.00 0.00 ? 34 ILE P H    1  
ATOM 590   H HA   . ILE A 1 36 ? -0.380  -0.373  -3.911  1.00 0.00 ? 34 ILE P HA   1  
ATOM 591   H HB   . ILE A 1 36 ? -2.291  0.567   -3.197  1.00 0.00 ? 34 ILE P HB   1  
ATOM 592   H HG12 . ILE A 1 36 ? -4.052  -0.843  -1.792  1.00 0.00 ? 34 ILE P HG12 1  
ATOM 593   H HG13 . ILE A 1 36 ? -2.614  -1.695  -1.243  1.00 0.00 ? 34 ILE P HG13 1  
ATOM 594   H HG21 . ILE A 1 36 ? -4.116  -0.578  -4.220  1.00 0.00 ? 34 ILE P HG21 1  
ATOM 595   H HG22 . ILE A 1 36 ? -2.681  -1.128  -5.085  1.00 0.00 ? 34 ILE P HG22 1  
ATOM 596   H HG23 . ILE A 1 36 ? -3.459  -2.149  -3.840  1.00 0.00 ? 34 ILE P HG23 1  
ATOM 597   H HD11 . ILE A 1 36 ? -3.185  1.310   -1.030  1.00 0.00 ? 34 ILE P HD11 1  
ATOM 598   H HD12 . ILE A 1 36 ? -1.691  0.549   -0.454  1.00 0.00 ? 34 ILE P HD12 1  
ATOM 599   H HD13 . ILE A 1 36 ? -3.224  0.119   0.287   1.00 0.00 ? 34 ILE P HD13 1  
ATOM 600   N N    . ALA A 1 37 ? 0.124   -1.832  -1.032  1.00 0.00 ? 35 ALA P N    1  
ATOM 601   C CA   . ALA A 1 37 ? 0.841   -1.774  0.243   1.00 0.00 ? 35 ALA P CA   1  
ATOM 602   C C    . ALA A 1 37 ? 2.371   -1.693  0.066   1.00 0.00 ? 35 ALA P C    1  
ATOM 603   O O    . ALA A 1 37 ? 3.079   -1.117  0.897   1.00 0.00 ? 35 ALA P O    1  
ATOM 604   C CB   . ALA A 1 37 ? 0.438   -3.005  1.062   1.00 0.00 ? 35 ALA P CB   1  
ATOM 605   H H    . ALA A 1 37 ? -0.297  -2.714  -1.292  1.00 0.00 ? 35 ALA P H    1  
ATOM 606   H HA   . ALA A 1 37 ? 0.516   -0.889  0.784   1.00 0.00 ? 35 ALA P HA   1  
ATOM 607   H HB1  . ALA A 1 37 ? 0.944   -2.987  2.021   1.00 0.00 ? 35 ALA P HB1  1  
ATOM 608   H HB2  . ALA A 1 37 ? -0.636  -3.006  1.236   1.00 0.00 ? 35 ALA P HB2  1  
ATOM 609   H HB3  . ALA A 1 37 ? 0.724   -3.916  0.536   1.00 0.00 ? 35 ALA P HB3  1  
ATOM 610   N N    . VAL A 1 38 ? 2.868   -2.250  -1.043  1.00 0.00 ? 36 VAL P N    1  
ATOM 611   C CA   . VAL A 1 38 ? 4.286   -2.454  -1.377  1.00 0.00 ? 36 VAL P CA   1  
ATOM 612   C C    . VAL A 1 38 ? 5.099   -1.159  -1.474  1.00 0.00 ? 36 VAL P C    1  
ATOM 613   O O    . VAL A 1 38 ? 6.283   -1.157  -1.131  1.00 0.00 ? 36 VAL P O    1  
ATOM 614   C CB   . VAL A 1 38 ? 4.334   -3.294  -2.679  1.00 0.00 ? 36 VAL P CB   1  
ATOM 615   C CG1  . VAL A 1 38 ? 5.486   -3.011  -3.647  1.00 0.00 ? 36 VAL P CG1  1  
ATOM 616   C CG2  . VAL A 1 38 ? 4.360   -4.785  -2.325  1.00 0.00 ? 36 VAL P CG2  1  
ATOM 617   H H    . VAL A 1 38 ? 2.193   -2.703  -1.655  1.00 0.00 ? 36 VAL P H    1  
ATOM 618   H HA   . VAL A 1 38 ? 4.740   -3.024  -0.567  1.00 0.00 ? 36 VAL P HA   1  
ATOM 619   H HB   . VAL A 1 38 ? 3.422   -3.103  -3.246  1.00 0.00 ? 36 VAL P HB   1  
ATOM 620   H HG11 . VAL A 1 38 ? 5.402   -3.676  -4.506  1.00 0.00 ? 36 VAL P HG11 1  
ATOM 621   H HG12 . VAL A 1 38 ? 5.415   -1.987  -4.013  1.00 0.00 ? 36 VAL P HG12 1  
ATOM 622   H HG13 . VAL A 1 38 ? 6.445   -3.169  -3.154  1.00 0.00 ? 36 VAL P HG13 1  
ATOM 623   H HG21 . VAL A 1 38 ? 3.574   -5.010  -1.604  1.00 0.00 ? 36 VAL P HG21 1  
ATOM 624   H HG22 . VAL A 1 38 ? 4.184   -5.378  -3.223  1.00 0.00 ? 36 VAL P HG22 1  
ATOM 625   H HG23 . VAL A 1 38 ? 5.324   -5.052  -1.892  1.00 0.00 ? 36 VAL P HG23 1  
ATOM 626   N N    . TRP A 1 39 ? 4.476   -0.054  -1.893  1.00 0.00 ? 37 TRP P N    1  
ATOM 627   C CA   . TRP A 1 39 ? 5.114   1.264   -2.049  1.00 0.00 ? 37 TRP P CA   1  
ATOM 628   C C    . TRP A 1 39 ? 4.549   2.334   -1.102  1.00 0.00 ? 37 TRP P C    1  
ATOM 629   O O    . TRP A 1 39 ? 4.940   3.501   -1.174  1.00 0.00 ? 37 TRP P O    1  
ATOM 630   C CB   . TRP A 1 39 ? 5.067   1.687   -3.523  1.00 0.00 ? 37 TRP P CB   1  
ATOM 631   C CG   . TRP A 1 39 ? 3.734   1.535   -4.178  1.00 0.00 ? 37 TRP P CG   1  
ATOM 632   C CD1  . TRP A 1 39 ? 3.268   0.390   -4.717  1.00 0.00 ? 37 TRP P CD1  1  
ATOM 633   C CD2  . TRP A 1 39 ? 2.657   2.507   -4.312  1.00 0.00 ? 37 TRP P CD2  1  
ATOM 634   N NE1  . TRP A 1 39 ? 1.964   0.565   -5.119  1.00 0.00 ? 37 TRP P NE1  1  
ATOM 635   C CE2  . TRP A 1 39 ? 1.525   1.853   -4.886  1.00 0.00 ? 37 TRP P CE2  1  
ATOM 636   C CE3  . TRP A 1 39 ? 2.524   3.870   -3.983  1.00 0.00 ? 37 TRP P CE3  1  
ATOM 637   C CZ2  . TRP A 1 39 ? 0.304   2.514   -5.090  1.00 0.00 ? 37 TRP P CZ2  1  
ATOM 638   C CZ3  . TRP A 1 39 ? 1.310   4.548   -4.203  1.00 0.00 ? 37 TRP P CZ3  1  
ATOM 639   C CH2  . TRP A 1 39 ? 0.199   3.873   -4.742  1.00 0.00 ? 37 TRP P CH2  1  
ATOM 640   H H    . TRP A 1 39 ? 3.506   -0.133  -2.169  1.00 0.00 ? 37 TRP P H    1  
ATOM 641   H HA   . TRP A 1 39 ? 6.162   1.176   -1.779  1.00 0.00 ? 37 TRP P HA   1  
ATOM 642   H HB2  . TRP A 1 39 ? 5.391   2.722   -3.607  1.00 0.00 ? 37 TRP P HB2  1  
ATOM 643   H HB3  . TRP A 1 39 ? 5.782   1.085   -4.078  1.00 0.00 ? 37 TRP P HB3  1  
ATOM 644   H HD1  . TRP A 1 39 ? 3.810   -0.547  -4.759  1.00 0.00 ? 37 TRP P HD1  1  
ATOM 645   H HE1  . TRP A 1 39 ? 1.400   -0.228  -5.413  1.00 0.00 ? 37 TRP P HE1  1  
ATOM 646   H HE3  . TRP A 1 39 ? 3.373   4.384   -3.553  1.00 0.00 ? 37 TRP P HE3  1  
ATOM 647   H HZ2  . TRP A 1 39 ? -0.539  1.985   -5.513  1.00 0.00 ? 37 TRP P HZ2  1  
ATOM 648   H HZ3  . TRP A 1 39 ? 1.228   5.596   -3.949  1.00 0.00 ? 37 TRP P HZ3  1  
ATOM 649   H HH2  . TRP A 1 39 ? -0.732  4.406   -4.888  1.00 0.00 ? 37 TRP P HH2  1  
ATOM 650   N N    . THR A 1 40 ? 3.658   1.939   -0.188  1.00 0.00 ? 38 THR P N    1  
ATOM 651   C CA   . THR A 1 40 ? 3.014   2.828   0.799   1.00 0.00 ? 38 THR P CA   1  
ATOM 652   C C    . THR A 1 40 ? 3.412   2.514   2.242   1.00 0.00 ? 38 THR P C    1  
ATOM 653   O O    . THR A 1 40 ? 2.923   3.167   3.160   1.00 0.00 ? 38 THR P O    1  
ATOM 654   C CB   . THR A 1 40 ? 1.486   2.836   0.636   1.00 0.00 ? 38 THR P CB   1  
ATOM 655   O OG1  . THR A 1 40 ? 0.969   1.537   0.773   1.00 0.00 ? 38 THR P OG1  1  
ATOM 656   C CG2  . THR A 1 40 ? 1.081   3.348   -0.745  1.00 0.00 ? 38 THR P CG2  1  
ATOM 657   H H    . THR A 1 40 ? 3.385   0.962   -0.185  1.00 0.00 ? 38 THR P H    1  
ATOM 658   H HA   . THR A 1 40 ? 3.345   3.851   0.628   1.00 0.00 ? 38 THR P HA   1  
ATOM 659   H HB   . THR A 1 40 ? 1.040   3.477   1.402   1.00 0.00 ? 38 THR P HB   1  
ATOM 660   H HG1  . THR A 1 40 ? 0.844   1.193   -0.130  1.00 0.00 ? 38 THR P HG1  1  
ATOM 661   H HG21 . THR A 1 40 ? 1.440   4.367   -0.875  1.00 0.00 ? 38 THR P HG21 1  
ATOM 662   H HG22 . THR A 1 40 ? -0.005  3.333   -0.840  1.00 0.00 ? 38 THR P HG22 1  
ATOM 663   H HG23 . THR A 1 40 ? 1.519   2.722   -1.526  1.00 0.00 ? 38 THR P HG23 1  
ATOM 664   N N    . ASN A 1 41 ? 4.327   1.561   2.461   1.00 0.00 ? 39 ASN P N    1  
ATOM 665   C CA   . ASN A 1 41 ? 4.764   1.079   3.781   1.00 0.00 ? 39 ASN P CA   1  
ATOM 666   C C    . ASN A 1 41 ? 3.609   0.532   4.656   1.00 0.00 ? 39 ASN P C    1  
ATOM 667   O O    . ASN A 1 41 ? 3.497   0.834   5.848   1.00 0.00 ? 39 ASN P O    1  
ATOM 668   C CB   . ASN A 1 41 ? 5.636   2.151   4.466   1.00 0.00 ? 39 ASN P CB   1  
ATOM 669   C CG   . ASN A 1 41 ? 6.488   1.615   5.610   1.00 0.00 ? 39 ASN P CG   1  
ATOM 670   O OD1  . ASN A 1 41 ? 6.666   0.419   5.806   1.00 0.00 ? 39 ASN P OD1  1  
ATOM 671   N ND2  . ASN A 1 41 ? 7.083   2.492   6.387   1.00 0.00 ? 39 ASN P ND2  1  
ATOM 672   H H    . ASN A 1 41 ? 4.706   1.098   1.646   1.00 0.00 ? 39 ASN P H    1  
ATOM 673   H HA   . ASN A 1 41 ? 5.407   0.219   3.586   1.00 0.00 ? 39 ASN P HA   1  
ATOM 674   H HB2  . ASN A 1 41 ? 6.304   2.603   3.736   1.00 0.00 ? 39 ASN P HB2  1  
ATOM 675   H HB3  . ASN A 1 41 ? 4.982   2.931   4.852   1.00 0.00 ? 39 ASN P HB3  1  
ATOM 676   H HD21 . ASN A 1 41 ? 6.964   3.480   6.223   1.00 0.00 ? 39 ASN P HD21 1  
ATOM 677   H HD22 . ASN A 1 41 ? 7.663   2.152   7.138   1.00 0.00 ? 39 ASN P HD22 1  
ATOM 678   N N    . LEU A 1 42 ? 2.733   -0.261  4.035   1.00 0.00 ? 40 LEU P N    1  
ATOM 679   C CA   . LEU A 1 42 ? 1.623   -0.992  4.663   1.00 0.00 ? 40 LEU P CA   1  
ATOM 680   C C    . LEU A 1 42 ? 1.800   -2.518  4.509   1.00 0.00 ? 40 LEU P C    1  
ATOM 681   O O    . LEU A 1 42 ? 2.791   -2.997  3.951   1.00 0.00 ? 40 LEU P O    1  
ATOM 682   C CB   . LEU A 1 42 ? 0.298   -0.501  4.034   1.00 0.00 ? 40 LEU P CB   1  
ATOM 683   C CG   . LEU A 1 42 ? -0.063  0.970   4.303   1.00 0.00 ? 40 LEU P CG   1  
ATOM 684   C CD1  . LEU A 1 42 ? -1.352  1.320   3.560   1.00 0.00 ? 40 LEU P CD1  1  
ATOM 685   C CD2  . LEU A 1 42 ? -0.291  1.219   5.792   1.00 0.00 ? 40 LEU P CD2  1  
ATOM 686   H H    . LEU A 1 42 ? 2.888   -0.422  3.049   1.00 0.00 ? 40 LEU P H    1  
ATOM 687   H HA   . LEU A 1 42 ? 1.602   -0.793  5.735   1.00 0.00 ? 40 LEU P HA   1  
ATOM 688   H HB2  . LEU A 1 42 ? 0.359   -0.640  2.959   1.00 0.00 ? 40 LEU P HB2  1  
ATOM 689   H HB3  . LEU A 1 42 ? -0.527  -1.115  4.393   1.00 0.00 ? 40 LEU P HB3  1  
ATOM 690   H HG   . LEU A 1 42 ? 0.730   1.624   3.944   1.00 0.00 ? 40 LEU P HG   1  
ATOM 691   H HD11 . LEU A 1 42 ? -1.207  1.165   2.490   1.00 0.00 ? 40 LEU P HD11 1  
ATOM 692   H HD12 . LEU A 1 42 ? -2.172  0.695   3.910   1.00 0.00 ? 40 LEU P HD12 1  
ATOM 693   H HD13 . LEU A 1 42 ? -1.593  2.369   3.726   1.00 0.00 ? 40 LEU P HD13 1  
ATOM 694   H HD21 . LEU A 1 42 ? -0.645  2.237   5.944   1.00 0.00 ? 40 LEU P HD21 1  
ATOM 695   H HD22 . LEU A 1 42 ? -1.031  0.523   6.181   1.00 0.00 ? 40 LEU P HD22 1  
ATOM 696   H HD23 . LEU A 1 42 ? 0.648   1.099   6.329   1.00 0.00 ? 40 LEU P HD23 1  
ATOM 697   N N    . THR A 1 43 ? 0.818   -3.289  4.986   1.00 0.00 ? 41 THR P N    1  
ATOM 698   C CA   . THR A 1 43 ? 0.674   -4.734  4.724   1.00 0.00 ? 41 THR P CA   1  
ATOM 699   C C    . THR A 1 43 ? -0.757  -5.036  4.269   1.00 0.00 ? 41 THR P C    1  
ATOM 700   O O    . THR A 1 43 ? -1.657  -4.223  4.483   1.00 0.00 ? 41 THR P O    1  
ATOM 701   C CB   . THR A 1 43 ? 1.105   -5.573  5.940   1.00 0.00 ? 41 THR P CB   1  
ATOM 702   O OG1  . THR A 1 43 ? 1.083   -6.942  5.604   1.00 0.00 ? 41 THR P OG1  1  
ATOM 703   C CG2  . THR A 1 43 ? 0.215   -5.379  7.167   1.00 0.00 ? 41 THR P CG2  1  
ATOM 704   H H    . THR A 1 43 ? 0.033   -2.835  5.438   1.00 0.00 ? 41 THR P H    1  
ATOM 705   H HA   . THR A 1 43 ? 1.329   -5.014  3.899   1.00 0.00 ? 41 THR P HA   1  
ATOM 706   H HB   . THR A 1 43 ? 2.128   -5.299  6.202   1.00 0.00 ? 41 THR P HB   1  
ATOM 707   H HG1  . THR A 1 43 ? 1.526   -7.431  6.322   1.00 0.00 ? 41 THR P HG1  1  
ATOM 708   H HG21 . THR A 1 43 ? 0.562   -6.022  7.977   1.00 0.00 ? 41 THR P HG21 1  
ATOM 709   H HG22 . THR A 1 43 ? -0.818  -5.628  6.931   1.00 0.00 ? 41 THR P HG22 1  
ATOM 710   H HG23 . THR A 1 43 ? 0.276   -4.344  7.502   1.00 0.00 ? 41 THR P HG23 1  
ATOM 711   N N    . GLU A 1 44 ? -1.004  -6.191  3.647   1.00 0.00 ? 42 GLU P N    1  
ATOM 712   C CA   . GLU A 1 44 ? -2.313  -6.523  3.055   1.00 0.00 ? 42 GLU P CA   1  
ATOM 713   C C    . GLU A 1 44 ? -3.477  -6.474  4.058   1.00 0.00 ? 42 GLU P C    1  
ATOM 714   O O    . GLU A 1 44 ? -4.594  -6.118  3.684   1.00 0.00 ? 42 GLU P O    1  
ATOM 715   C CB   . GLU A 1 44 ? -2.258  -7.886  2.345   1.00 0.00 ? 42 GLU P CB   1  
ATOM 716   C CG   . GLU A 1 44 ? -2.007  -9.087  3.270   1.00 0.00 ? 42 GLU P CG   1  
ATOM 717   C CD   . GLU A 1 44 ? -2.070  -10.416 2.492   1.00 0.00 ? 42 GLU P CD   1  
ATOM 718   O OE1  . GLU A 1 44 ? -3.187  -10.834 2.103   1.00 0.00 ? 42 GLU P OE1  1  
ATOM 719   O OE2  . GLU A 1 44 ? -1.011  -11.062 2.298   1.00 0.00 ? 42 GLU P OE2  1  
ATOM 720   H H    . GLU A 1 44 ? -0.247  -6.860  3.568   1.00 0.00 ? 42 GLU P H    1  
ATOM 721   H HA   . GLU A 1 44 ? -2.525  -5.769  2.297   1.00 0.00 ? 42 GLU P HA   1  
ATOM 722   H HB2  . GLU A 1 44 ? -3.206  -8.038  1.829   1.00 0.00 ? 42 GLU P HB2  1  
ATOM 723   H HB3  . GLU A 1 44 ? -1.471  -7.849  1.597   1.00 0.00 ? 42 GLU P HB3  1  
ATOM 724   H HG2  . GLU A 1 44 ? -1.031  -8.974  3.749   1.00 0.00 ? 42 GLU P HG2  1  
ATOM 725   H HG3  . GLU A 1 44 ? -2.763  -9.109  4.056   1.00 0.00 ? 42 GLU P HG3  1  
ATOM 726   N N    . ALA A 1 45 ? -3.214  -6.758  5.339   1.00 0.00 ? 43 ALA P N    1  
ATOM 727   C CA   . ALA A 1 45 ? -4.202  -6.681  6.413   1.00 0.00 ? 43 ALA P CA   1  
ATOM 728   C C    . ALA A 1 45 ? -4.662  -5.236  6.681   1.00 0.00 ? 43 ALA P C    1  
ATOM 729   O O    . ALA A 1 45 ? -5.860  -4.999  6.832   1.00 0.00 ? 43 ALA P O    1  
ATOM 730   C CB   . ALA A 1 45 ? -3.612  -7.337  7.668   1.00 0.00 ? 43 ALA P CB   1  
ATOM 731   H H    . ALA A 1 45 ? -2.274  -7.048  5.568   1.00 0.00 ? 43 ALA P H    1  
ATOM 732   H HA   . ALA A 1 45 ? -5.083  -7.253  6.115   1.00 0.00 ? 43 ALA P HA   1  
ATOM 733   H HB1  . ALA A 1 45 ? -3.335  -8.369  7.451   1.00 0.00 ? 43 ALA P HB1  1  
ATOM 734   H HB2  . ALA A 1 45 ? -2.731  -6.790  8.006   1.00 0.00 ? 43 ALA P HB2  1  
ATOM 735   H HB3  . ALA A 1 45 ? -4.357  -7.335  8.465   1.00 0.00 ? 43 ALA P HB3  1  
ATOM 736   N N    . ARG A 1 46 ? -3.746  -4.254  6.654   1.00 0.00 ? 44 ARG P N    1  
ATOM 737   C CA   . ARG A 1 46 ? -4.076  -2.816  6.750   1.00 0.00 ? 44 ARG P CA   1  
ATOM 738   C C    . ARG A 1 46 ? -5.003  -2.408  5.609   1.00 0.00 ? 44 ARG P C    1  
ATOM 739   O O    . ARG A 1 46 ? -6.030  -1.784  5.850   1.00 0.00 ? 44 ARG P O    1  
ATOM 740   C CB   . ARG A 1 46 ? -2.804  -1.946  6.706   1.00 0.00 ? 44 ARG P CB   1  
ATOM 741   C CG   . ARG A 1 46 ? -1.841  -2.118  7.889   1.00 0.00 ? 44 ARG P CG   1  
ATOM 742   C CD   . ARG A 1 46 ? -2.345  -1.406  9.149   1.00 0.00 ? 44 ARG P CD   1  
ATOM 743   N NE   . ARG A 1 46 ? -1.456  -1.684  10.296  1.00 0.00 ? 44 ARG P NE   1  
ATOM 744   C CZ   . ARG A 1 46 ? -0.420  -0.977  10.708  1.00 0.00 ? 44 ARG P CZ   1  
ATOM 745   N NH1  . ARG A 1 46 ? -0.135  0.206   10.241  1.00 0.00 ? 44 ARG P NH1  1  
ATOM 746   N NH2  . ARG A 1 46 ? 0.368   -1.455  11.627  1.00 0.00 ? 44 ARG P NH2  1  
ATOM 747   H H    . ARG A 1 46 ? -2.792  -4.516  6.450   1.00 0.00 ? 44 ARG P H    1  
ATOM 748   H HA   . ARG A 1 46 ? -4.615  -2.625  7.678   1.00 0.00 ? 44 ARG P HA   1  
ATOM 749   H HB2  . ARG A 1 46 ? -2.270  -2.164  5.786   1.00 0.00 ? 44 ARG P HB2  1  
ATOM 750   H HB3  . ARG A 1 46 ? -3.096  -0.897  6.659   1.00 0.00 ? 44 ARG P HB3  1  
ATOM 751   H HG2  . ARG A 1 46 ? -1.707  -3.178  8.102   1.00 0.00 ? 44 ARG P HG2  1  
ATOM 752   H HG3  . ARG A 1 46 ? -0.874  -1.695  7.618   1.00 0.00 ? 44 ARG P HG3  1  
ATOM 753   H HD2  . ARG A 1 46 ? -2.417  -0.334  8.955   1.00 0.00 ? 44 ARG P HD2  1  
ATOM 754   H HD3  . ARG A 1 46 ? -3.342  -1.779  9.377   1.00 0.00 ? 44 ARG P HD3  1  
ATOM 755   H HE   . ARG A 1 46 ? -1.606  -2.560  10.771  1.00 0.00 ? 44 ARG P HE   1  
ATOM 756   H HH11 . ARG A 1 46 ? -0.797  0.687   9.643   1.00 0.00 ? 44 ARG P HH11 1  
ATOM 757   H HH12 . ARG A 1 46 ? 0.682   0.695   10.560  1.00 0.00 ? 44 ARG P HH12 1  
ATOM 758   H HH21 . ARG A 1 46 ? 0.207   -2.373  12.008  1.00 0.00 ? 44 ARG P HH21 1  
ATOM 759   H HH22 . ARG A 1 46 ? 1.169   -0.930  11.935  1.00 0.00 ? 44 ARG P HH22 1  
ATOM 760   N N    . VAL A 1 47 ? -4.681  -2.822  4.381   1.00 0.00 ? 45 VAL P N    1  
ATOM 761   C CA   . VAL A 1 47 ? -5.505  -2.533  3.195   1.00 0.00 ? 45 VAL P CA   1  
ATOM 762   C C    . VAL A 1 47 ? -6.886  -3.187  3.315   1.00 0.00 ? 45 VAL P C    1  
ATOM 763   O O    . VAL A 1 47 ? -7.897  -2.517  3.115   1.00 0.00 ? 45 VAL P O    1  
ATOM 764   C CB   . VAL A 1 47 ? -4.792  -2.955  1.896   1.00 0.00 ? 45 VAL P CB   1  
ATOM 765   C CG1  . VAL A 1 47 ? -5.543  -2.444  0.663   1.00 0.00 ? 45 VAL P CG1  1  
ATOM 766   C CG2  . VAL A 1 47 ? -3.365  -2.396  1.848   1.00 0.00 ? 45 VAL P CG2  1  
ATOM 767   H H    . VAL A 1 47 ? -3.810  -3.329  4.263   1.00 0.00 ? 45 VAL P H    1  
ATOM 768   H HA   . VAL A 1 47 ? -5.664  -1.454  3.149   1.00 0.00 ? 45 VAL P HA   1  
ATOM 769   H HB   . VAL A 1 47 ? -4.737  -4.042  1.847   1.00 0.00 ? 45 VAL P HB   1  
ATOM 770   H HG11 . VAL A 1 47 ? -5.633  -1.359  0.703   1.00 0.00 ? 45 VAL P HG11 1  
ATOM 771   H HG12 . VAL A 1 47 ? -5.003  -2.718  -0.242  1.00 0.00 ? 45 VAL P HG12 1  
ATOM 772   H HG13 . VAL A 1 47 ? -6.538  -2.887  0.613   1.00 0.00 ? 45 VAL P HG13 1  
ATOM 773   H HG21 . VAL A 1 47 ? -2.932  -2.568  0.866   1.00 0.00 ? 45 VAL P HG21 1  
ATOM 774   H HG22 . VAL A 1 47 ? -3.369  -1.328  2.059   1.00 0.00 ? 45 VAL P HG22 1  
ATOM 775   H HG23 . VAL A 1 47 ? -2.734  -2.900  2.577   1.00 0.00 ? 45 VAL P HG23 1  
ATOM 776   N N    . ARG A 1 48 ? -6.957  -4.460  3.729   1.00 0.00 ? 46 ARG P N    1  
ATOM 777   C CA   . ARG A 1 48 ? -8.223  -5.187  3.938   1.00 0.00 ? 46 ARG P CA   1  
ATOM 778   C C    . ARG A 1 48 ? -9.120  -4.498  4.971   1.00 0.00 ? 46 ARG P C    1  
ATOM 779   O O    . ARG A 1 48 ? -10.303 -4.279  4.713   1.00 0.00 ? 46 ARG P O    1  
ATOM 780   C CB   . ARG A 1 48 ? -7.913  -6.639  4.344   1.00 0.00 ? 46 ARG P CB   1  
ATOM 781   C CG   . ARG A 1 48 ? -9.087  -7.574  4.030   1.00 0.00 ? 46 ARG P CG   1  
ATOM 782   C CD   . ARG A 1 48 ? -8.742  -9.017  4.414   1.00 0.00 ? 46 ARG P CD   1  
ATOM 783   N NE   . ARG A 1 48 ? -9.739  -9.958  3.871   1.00 0.00 ? 46 ARG P NE   1  
ATOM 784   C CZ   . ARG A 1 48 ? -10.039 -11.160 4.334   1.00 0.00 ? 46 ARG P CZ   1  
ATOM 785   N NH1  . ARG A 1 48 ? -9.421  -11.686 5.355   1.00 0.00 ? 46 ARG P NH1  1  
ATOM 786   N NH2  . ARG A 1 48 ? -10.972 -11.872 3.769   1.00 0.00 ? 46 ARG P NH2  1  
ATOM 787   H H    . ARG A 1 48 ? -6.084  -4.962  3.871   1.00 0.00 ? 46 ARG P H    1  
ATOM 788   H HA   . ARG A 1 48 ? -8.771  -5.188  2.993   1.00 0.00 ? 46 ARG P HA   1  
ATOM 789   H HB2  . ARG A 1 48 ? -7.047  -6.995  3.790   1.00 0.00 ? 46 ARG P HB2  1  
ATOM 790   H HB3  . ARG A 1 48 ? -7.673  -6.688  5.408   1.00 0.00 ? 46 ARG P HB3  1  
ATOM 791   H HG2  . ARG A 1 48 ? -9.974  -7.257  4.580   1.00 0.00 ? 46 ARG P HG2  1  
ATOM 792   H HG3  . ARG A 1 48 ? -9.297  -7.525  2.961   1.00 0.00 ? 46 ARG P HG3  1  
ATOM 793   H HD2  . ARG A 1 48 ? -7.760  -9.273  4.011   1.00 0.00 ? 46 ARG P HD2  1  
ATOM 794   H HD3  . ARG A 1 48 ? -8.702  -9.084  5.503   1.00 0.00 ? 46 ARG P HD3  1  
ATOM 795   H HE   . ARG A 1 48 ? -10.224 -9.664  3.037   1.00 0.00 ? 46 ARG P HE   1  
ATOM 796   H HH11 . ARG A 1 48 ? -8.683  -11.172 5.801   1.00 0.00 ? 46 ARG P HH11 1  
ATOM 797   H HH12 . ARG A 1 48 ? -9.667  -12.604 5.685   1.00 0.00 ? 46 ARG P HH12 1  
ATOM 798   H HH21 . ARG A 1 48 ? -11.504 -11.497 3.002   1.00 0.00 ? 46 ARG P HH21 1  
ATOM 799   H HH22 . ARG A 1 48 ? -11.197 -12.785 4.125   1.00 0.00 ? 46 ARG P HH22 1  
ATOM 800   N N    . VAL A 1 49 ? -8.548  -4.101  6.108   1.00 0.00 ? 47 VAL P N    1  
ATOM 801   C CA   . VAL A 1 49 ? -9.230  -3.359  7.184   1.00 0.00 ? 47 VAL P CA   1  
ATOM 802   C C    . VAL A 1 49 ? -9.710  -1.992  6.698   1.00 0.00 ? 47 VAL P C    1  
ATOM 803   O O    . VAL A 1 49 ? -10.853 -1.614  6.966   1.00 0.00 ? 47 VAL P O    1  
ATOM 804   C CB   . VAL A 1 49 ? -8.292  -3.214  8.400   1.00 0.00 ? 47 VAL P CB   1  
ATOM 805   C CG1  . VAL A 1 49 ? -8.802  -2.230  9.459   1.00 0.00 ? 47 VAL P CG1  1  
ATOM 806   C CG2  . VAL A 1 49 ? -8.122  -4.575  9.084   1.00 0.00 ? 47 VAL P CG2  1  
ATOM 807   H H    . VAL A 1 49 ? -7.569  -4.338  6.241   1.00 0.00 ? 47 VAL P H    1  
ATOM 808   H HA   . VAL A 1 49 ? -10.115 -3.914  7.497   1.00 0.00 ? 47 VAL P HA   1  
ATOM 809   H HB   . VAL A 1 49 ? -7.315  -2.867  8.060   1.00 0.00 ? 47 VAL P HB   1  
ATOM 810   H HG11 . VAL A 1 49 ? -8.810  -1.215  9.059   1.00 0.00 ? 47 VAL P HG11 1  
ATOM 811   H HG12 . VAL A 1 49 ? -9.807  -2.505  9.776   1.00 0.00 ? 47 VAL P HG12 1  
ATOM 812   H HG13 . VAL A 1 49 ? -8.133  -2.242  10.321  1.00 0.00 ? 47 VAL P HG13 1  
ATOM 813   H HG21 . VAL A 1 49 ? -7.802  -5.324  8.363   1.00 0.00 ? 47 VAL P HG21 1  
ATOM 814   H HG22 . VAL A 1 49 ? -7.358  -4.498  9.858   1.00 0.00 ? 47 VAL P HG22 1  
ATOM 815   H HG23 . VAL A 1 49 ? -9.068  -4.891  9.522   1.00 0.00 ? 47 VAL P HG23 1  
ATOM 816   N N    . TRP A 1 50 ? -8.878  -1.263  5.950   1.00 0.00 ? 48 TRP P N    1  
ATOM 817   C CA   . TRP A 1 50 ? -9.231  0.055   5.430   1.00 0.00 ? 48 TRP P CA   1  
ATOM 818   C C    . TRP A 1 50 ? -10.396 -0.017  4.444   1.00 0.00 ? 48 TRP P C    1  
ATOM 819   O O    . TRP A 1 50 ? -11.384 0.689   4.621   1.00 0.00 ? 48 TRP P O    1  
ATOM 820   C CB   . TRP A 1 50 ? -8.014  0.710   4.780   1.00 0.00 ? 48 TRP P CB   1  
ATOM 821   C CG   . TRP A 1 50 ? -8.233  2.153   4.461   1.00 0.00 ? 48 TRP P CG   1  
ATOM 822   C CD1  . TRP A 1 50 ? -7.910  3.188   5.269   1.00 0.00 ? 48 TRP P CD1  1  
ATOM 823   C CD2  . TRP A 1 50 ? -8.861  2.745   3.282   1.00 0.00 ? 48 TRP P CD2  1  
ATOM 824   N NE1  . TRP A 1 50 ? -8.270  4.373   4.663   1.00 0.00 ? 48 TRP P NE1  1  
ATOM 825   C CE2  . TRP A 1 50 ? -8.852  4.162   3.433   1.00 0.00 ? 48 TRP P CE2  1  
ATOM 826   C CE3  . TRP A 1 50 ? -9.427  2.230   2.097   1.00 0.00 ? 48 TRP P CE3  1  
ATOM 827   C CZ2  . TRP A 1 50 ? -9.362  5.025   2.455   1.00 0.00 ? 48 TRP P CZ2  1  
ATOM 828   C CZ3  . TRP A 1 50 ? -9.972  3.081   1.120   1.00 0.00 ? 48 TRP P CZ3  1  
ATOM 829   C CH2  . TRP A 1 50 ? -9.948  4.473   1.303   1.00 0.00 ? 48 TRP P CH2  1  
ATOM 830   H H    . TRP A 1 50 ? -7.938  -1.611  5.781   1.00 0.00 ? 48 TRP P H    1  
ATOM 831   H HA   . TRP A 1 50 ? -9.544  0.685   6.264   1.00 0.00 ? 48 TRP P HA   1  
ATOM 832   H HB2  . TRP A 1 50 ? -7.164  0.636   5.454   1.00 0.00 ? 48 TRP P HB2  1  
ATOM 833   H HB3  . TRP A 1 50 ? -7.762  0.175   3.863   1.00 0.00 ? 48 TRP P HB3  1  
ATOM 834   H HD1  . TRP A 1 50 ? -7.429  3.095   6.237   1.00 0.00 ? 48 TRP P HD1  1  
ATOM 835   H HE1  . TRP A 1 50 ? -8.118  5.279   5.088   1.00 0.00 ? 48 TRP P HE1  1  
ATOM 836   H HE3  . TRP A 1 50 ? -9.441  1.165   1.938   1.00 0.00 ? 48 TRP P HE3  1  
ATOM 837   H HZ2  . TRP A 1 50 ? -9.288  6.094   2.590   1.00 0.00 ? 48 TRP P HZ2  1  
ATOM 838   H HZ3  . TRP A 1 50 ? -10.408 2.661   0.223   1.00 0.00 ? 48 TRP P HZ3  1  
ATOM 839   H HH2  . TRP A 1 50 ? -10.385 5.112   0.552   1.00 0.00 ? 48 TRP P HH2  1  
ATOM 840   N N    . PHE A 1 51 ? -10.337 -0.915  3.456   1.00 0.00 ? 49 PHE P N    1  
ATOM 841   C CA   . PHE A 1 51 ? -11.406 -1.111  2.469   1.00 0.00 ? 49 PHE P CA   1  
ATOM 842   C C    . PHE A 1 51 ? -12.713 -1.604  3.111   1.00 0.00 ? 49 PHE P C    1  
ATOM 843   O O    . PHE A 1 51 ? -13.796 -1.201  2.682   1.00 0.00 ? 49 PHE P O    1  
ATOM 844   C CB   . PHE A 1 51 ? -10.918 -2.071  1.370   1.00 0.00 ? 49 PHE P CB   1  
ATOM 845   C CG   . PHE A 1 51 ? -10.188 -1.384  0.228   1.00 0.00 ? 49 PHE P CG   1  
ATOM 846   C CD1  . PHE A 1 51 ? -8.878  -0.888  0.386   1.00 0.00 ? 49 PHE P CD1  1  
ATOM 847   C CD2  . PHE A 1 51 ? -10.838 -1.219  -1.009  1.00 0.00 ? 49 PHE P CD2  1  
ATOM 848   C CE1  . PHE A 1 51 ? -8.227  -0.230  -0.673  1.00 0.00 ? 49 PHE P CE1  1  
ATOM 849   C CE2  . PHE A 1 51 ? -10.181 -0.577  -2.068  1.00 0.00 ? 49 PHE P CE2  1  
ATOM 850   C CZ   . PHE A 1 51 ? -8.882  -0.075  -1.903  1.00 0.00 ? 49 PHE P CZ   1  
ATOM 851   H H    . PHE A 1 51 ? -9.494  -1.472  3.367   1.00 0.00 ? 49 PHE P H    1  
ATOM 852   H HA   . PHE A 1 51 ? -11.634 -0.152  2.001   1.00 0.00 ? 49 PHE P HA   1  
ATOM 853   H HB2  . PHE A 1 51 ? -10.278 -2.841  1.803   1.00 0.00 ? 49 PHE P HB2  1  
ATOM 854   H HB3  . PHE A 1 51 ? -11.785 -2.585  0.953   1.00 0.00 ? 49 PHE P HB3  1  
ATOM 855   H HD1  . PHE A 1 51 ? -8.368  -0.984  1.329   1.00 0.00 ? 49 PHE P HD1  1  
ATOM 856   H HD2  . PHE A 1 51 ? -11.846 -1.581  -1.156  1.00 0.00 ? 49 PHE P HD2  1  
ATOM 857   H HE1  . PHE A 1 51 ? -7.228  0.163   -0.541  1.00 0.00 ? 49 PHE P HE1  1  
ATOM 858   H HE2  . PHE A 1 51 ? -10.684 -0.470  -3.011  1.00 0.00 ? 49 PHE P HE2  1  
ATOM 859   H HZ   . PHE A 1 51 ? -8.392  0.434   -2.720  1.00 0.00 ? 49 PHE P HZ   1  
ATOM 860   N N    . LYS A 1 52 ? -12.630 -2.405  4.185   1.00 0.00 ? 50 LYS P N    1  
ATOM 861   C CA   . LYS A 1 52 ? -13.801 -2.853  4.963   1.00 0.00 ? 50 LYS P CA   1  
ATOM 862   C C    . LYS A 1 52 ? -14.487 -1.675  5.658   1.00 0.00 ? 50 LYS P C    1  
ATOM 863   O O    . LYS A 1 52 ? -15.696 -1.486  5.517   1.00 0.00 ? 50 LYS P O    1  
ATOM 864   C CB   . LYS A 1 52 ? -13.372 -3.936  5.962   1.00 0.00 ? 50 LYS P CB   1  
ATOM 865   C CG   . LYS A 1 52 ? -14.590 -4.638  6.581   1.00 0.00 ? 50 LYS P CG   1  
ATOM 866   C CD   . LYS A 1 52 ? -14.214 -5.524  7.774   1.00 0.00 ? 50 LYS P CD   1  
ATOM 867   C CE   . LYS A 1 52 ? -13.141 -6.563  7.424   1.00 0.00 ? 50 LYS P CE   1  
ATOM 868   N NZ   . LYS A 1 52 ? -12.875 -7.477  8.568   1.00 0.00 ? 50 LYS P NZ   1  
ATOM 869   H H    . LYS A 1 52 ? -11.700 -2.681  4.490   1.00 0.00 ? 50 LYS P H    1  
ATOM 870   H HA   . LYS A 1 52 ? -14.534 -3.300  4.291   1.00 0.00 ? 50 LYS P HA   1  
ATOM 871   H HB2  . LYS A 1 52 ? -12.779 -4.682  5.435   1.00 0.00 ? 50 LYS P HB2  1  
ATOM 872   H HB3  . LYS A 1 52 ? -12.762 -3.492  6.749   1.00 0.00 ? 50 LYS P HB3  1  
ATOM 873   H HG2  . LYS A 1 52 ? -15.308 -3.898  6.935   1.00 0.00 ? 50 LYS P HG2  1  
ATOM 874   H HG3  . LYS A 1 52 ? -15.077 -5.248  5.818   1.00 0.00 ? 50 LYS P HG3  1  
ATOM 875   H HD2  . LYS A 1 52 ? -13.849 -4.881  8.576   1.00 0.00 ? 50 LYS P HD2  1  
ATOM 876   H HD3  . LYS A 1 52 ? -15.119 -6.028  8.114   1.00 0.00 ? 50 LYS P HD3  1  
ATOM 877   H HE2  . LYS A 1 52 ? -13.480 -7.138  6.557   1.00 0.00 ? 50 LYS P HE2  1  
ATOM 878   H HE3  . LYS A 1 52 ? -12.225 -6.033  7.142   1.00 0.00 ? 50 LYS P HE3  1  
ATOM 879   H HZ1  . LYS A 1 52 ? -13.707 -7.986  8.831   1.00 0.00 ? 50 LYS P HZ1  1  
ATOM 880   H HZ2  . LYS A 1 52 ? -12.556 -6.968  9.381   1.00 0.00 ? 50 LYS P HZ2  1  
ATOM 881   H HZ3  . LYS A 1 52 ? -12.165 -8.159  8.335   1.00 0.00 ? 50 LYS P HZ3  1  
ATOM 882   N N    . ASN A 1 53 ? -13.703 -0.839  6.343   1.00 0.00 ? 51 ASN P N    1  
ATOM 883   C CA   . ASN A 1 53 ? -14.202 0.388   6.970   1.00 0.00 ? 51 ASN P CA   1  
ATOM 884   C C    . ASN A 1 53 ? -14.712 1.392   5.922   1.00 0.00 ? 51 ASN P C    1  
ATOM 885   O O    . ASN A 1 53 ? -15.750 2.019   6.128   1.00 0.00 ? 51 ASN P O    1  
ATOM 886   C CB   . ASN A 1 53 ? -13.105 1.003   7.858   1.00 0.00 ? 51 ASN P CB   1  
ATOM 887   C CG   . ASN A 1 53 ? -13.004 0.317   9.207   1.00 0.00 ? 51 ASN P CG   1  
ATOM 888   O OD1  . ASN A 1 53 ? -13.647 0.704   10.173  1.00 0.00 ? 51 ASN P OD1  1  
ATOM 889   N ND2  . ASN A 1 53 ? -12.216 -0.725  9.318   1.00 0.00 ? 51 ASN P ND2  1  
ATOM 890   H H    . ASN A 1 53 ? -12.713 -1.056  6.396   1.00 0.00 ? 51 ASN P H    1  
ATOM 891   H HA   . ASN A 1 53 ? -15.060 0.142   7.599   1.00 0.00 ? 51 ASN P HA   1  
ATOM 892   H HB2  . ASN A 1 53 ? -12.138 0.965   7.355   1.00 0.00 ? 51 ASN P HB2  1  
ATOM 893   H HB3  . ASN A 1 53 ? -13.341 2.050   8.045   1.00 0.00 ? 51 ASN P HB3  1  
ATOM 894   H HD21 . ASN A 1 53 ? -11.687 -1.050  8.516   1.00 0.00 ? 51 ASN P HD21 1  
ATOM 895   H HD22 . ASN A 1 53 ? -12.143 -1.171  10.216  1.00 0.00 ? 51 ASN P HD22 1  
ATOM 896   N N    . ARG A 1 54 ? -14.039 1.515   4.772   1.00 0.00 ? 52 ARG P N    1  
ATOM 897   C CA   . ARG A 1 54 ? -14.415 2.468   3.721   1.00 0.00 ? 52 ARG P CA   1  
ATOM 898   C C    . ARG A 1 54 ? -15.730 2.109   3.048   1.00 0.00 ? 52 ARG P C    1  
ATOM 899   O O    . ARG A 1 54 ? -16.529 3.007   2.823   1.00 0.00 ? 52 ARG P O    1  
ATOM 900   C CB   . ARG A 1 54 ? -13.280 2.628   2.693   1.00 0.00 ? 52 ARG P CB   1  
ATOM 901   C CG   . ARG A 1 54 ? -13.487 3.841   1.754   1.00 0.00 ? 52 ARG P CG   1  
ATOM 902   C CD   . ARG A 1 54 ? -13.608 5.188   2.490   1.00 0.00 ? 52 ARG P CD   1  
ATOM 903   N NE   . ARG A 1 54 ? -13.732 6.335   1.567   1.00 0.00 ? 52 ARG P NE   1  
ATOM 904   C CZ   . ARG A 1 54 ? -12.855 7.302   1.365   1.00 0.00 ? 52 ARG P CZ   1  
ATOM 905   N NH1  . ARG A 1 54 ? -11.670 7.323   1.892   1.00 0.00 ? 52 ARG P NH1  1  
ATOM 906   N NH2  . ARG A 1 54 ? -13.131 8.325   0.622   1.00 0.00 ? 52 ARG P NH2  1  
ATOM 907   H H    . ARG A 1 54 ? -13.158 1.015   4.677   1.00 0.00 ? 52 ARG P H    1  
ATOM 908   H HA   . ARG A 1 54 ? -14.593 3.416   4.225   1.00 0.00 ? 52 ARG P HA   1  
ATOM 909   H HB2  . ARG A 1 54 ? -12.327 2.708   3.222   1.00 0.00 ? 52 ARG P HB2  1  
ATOM 910   H HB3  . ARG A 1 54 ? -13.226 1.726   2.082   1.00 0.00 ? 52 ARG P HB3  1  
ATOM 911   H HG2  . ARG A 1 54 ? -12.651 3.891   1.060   1.00 0.00 ? 52 ARG P HG2  1  
ATOM 912   H HG3  . ARG A 1 54 ? -14.390 3.686   1.162   1.00 0.00 ? 52 ARG P HG3  1  
ATOM 913   H HD2  . ARG A 1 54 ? -14.503 5.176   3.112   1.00 0.00 ? 52 ARG P HD2  1  
ATOM 914   H HD3  . ARG A 1 54 ? -12.745 5.308   3.148   1.00 0.00 ? 52 ARG P HD3  1  
ATOM 915   H HE   . ARG A 1 54 ? -14.613 6.439   1.063   1.00 0.00 ? 52 ARG P HE   1  
ATOM 916   H HH11 . ARG A 1 54 ? -11.368 6.571   2.481   1.00 0.00 ? 52 ARG P HH11 1  
ATOM 917   H HH12 . ARG A 1 54 ? -11.067 8.108   1.649   1.00 0.00 ? 52 ARG P HH12 1  
ATOM 918   H HH21 . ARG A 1 54 ? -14.101 8.490   0.349   1.00 0.00 ? 52 ARG P HH21 1  
ATOM 919   H HH22 . ARG A 1 54 ? -12.413 9.033   0.509   1.00 0.00 ? 52 ARG P HH22 1  
ATOM 920   N N    . ARG A 1 55 ? -16.014 0.824   2.814   1.00 0.00 ? 53 ARG P N    1  
ATOM 921   C CA   . ARG A 1 55 ? -17.331 0.357   2.336   1.00 0.00 ? 53 ARG P CA   1  
ATOM 922   C C    . ARG A 1 55 ? -18.449 0.662   3.334   1.00 0.00 ? 53 ARG P C    1  
ATOM 923   O O    . ARG A 1 55 ? -19.508 1.153   2.950   1.00 0.00 ? 53 ARG P O    1  
ATOM 924   C CB   . ARG A 1 55 ? -17.252 -1.145  2.044   1.00 0.00 ? 53 ARG P CB   1  
ATOM 925   C CG   . ARG A 1 55 ? -16.570 -1.400  0.695   1.00 0.00 ? 53 ARG P CG   1  
ATOM 926   C CD   . ARG A 1 55 ? -16.278 -2.892  0.535   1.00 0.00 ? 53 ARG P CD   1  
ATOM 927   N NE   . ARG A 1 55 ? -16.092 -3.240  -0.888  1.00 0.00 ? 53 ARG P NE   1  
ATOM 928   C CZ   . ARG A 1 55 ? -16.996 -3.744  -1.711  1.00 0.00 ? 53 ARG P CZ   1  
ATOM 929   N NH1  . ARG A 1 55 ? -18.187 -4.102  -1.320  1.00 0.00 ? 53 ARG P NH1  1  
ATOM 930   N NH2  . ARG A 1 55 ? -16.711 -3.889  -2.969  1.00 0.00 ? 53 ARG P NH2  1  
ATOM 931   H H    . ARG A 1 55 ? -15.284 0.142   2.993   1.00 0.00 ? 53 ARG P H    1  
ATOM 932   H HA   . ARG A 1 55 ? -17.591 0.883   1.415   1.00 0.00 ? 53 ARG P HA   1  
ATOM 933   H HB2  . ARG A 1 55 ? -16.709 -1.650  2.844   1.00 0.00 ? 53 ARG P HB2  1  
ATOM 934   H HB3  . ARG A 1 55 ? -18.262 -1.560  1.998   1.00 0.00 ? 53 ARG P HB3  1  
ATOM 935   H HG2  . ARG A 1 55 ? -17.238 -1.066  -0.100  1.00 0.00 ? 53 ARG P HG2  1  
ATOM 936   H HG3  . ARG A 1 55 ? -15.633 -0.846  0.623   1.00 0.00 ? 53 ARG P HG3  1  
ATOM 937   H HD2  . ARG A 1 55 ? -15.376 -3.130  1.102   1.00 0.00 ? 53 ARG P HD2  1  
ATOM 938   H HD3  . ARG A 1 55 ? -17.098 -3.461  0.977   1.00 0.00 ? 53 ARG P HD3  1  
ATOM 939   H HE   . ARG A 1 55 ? -15.201 -3.011  -1.304  1.00 0.00 ? 53 ARG P HE   1  
ATOM 940   H HH11 . ARG A 1 55 ? -18.435 -4.008  -0.351  1.00 0.00 ? 53 ARG P HH11 1  
ATOM 941   H HH12 . ARG A 1 55 ? -18.848 -4.483  -1.975  1.00 0.00 ? 53 ARG P HH12 1  
ATOM 942   H HH21 . ARG A 1 55 ? -15.810 -3.563  -3.303  1.00 0.00 ? 53 ARG P HH21 1  
ATOM 943   H HH22 . ARG A 1 55 ? -17.390 -4.261  -3.609  1.00 0.00 ? 53 ARG P HH22 1  
ATOM 944   N N    . ALA A 1 56 ? -18.188 0.451   4.622   1.00 0.00 ? 54 ALA P N    1  
ATOM 945   C CA   . ALA A 1 56 ? -19.145 0.773   5.686   1.00 0.00 ? 54 ALA P CA   1  
ATOM 946   C C    . ALA A 1 56 ? -19.408 2.283   5.835   1.00 0.00 ? 54 ALA P C    1  
ATOM 947   O O    . ALA A 1 56 ? -20.533 2.670   6.159   1.00 0.00 ? 54 ALA P O    1  
ATOM 948   C CB   . ALA A 1 56 ? -18.640 0.168   7.001   1.00 0.00 ? 54 ALA P CB   1  
ATOM 949   H H    . ALA A 1 56 ? -17.305 0.011   4.853   1.00 0.00 ? 54 ALA P H    1  
ATOM 950   H HA   . ALA A 1 56 ? -20.106 0.318   5.433   1.00 0.00 ? 54 ALA P HA   1  
ATOM 951   H HB1  . ALA A 1 56 ? -18.482 -0.906  6.884   1.00 0.00 ? 54 ALA P HB1  1  
ATOM 952   H HB2  . ALA A 1 56 ? -17.704 0.645   7.296   1.00 0.00 ? 54 ALA P HB2  1  
ATOM 953   H HB3  . ALA A 1 56 ? -19.379 0.337   7.785   1.00 0.00 ? 54 ALA P HB3  1  
ATOM 954   N N    . LYS A 1 57 ? -18.407 3.133   5.570   1.00 0.00 ? 55 LYS P N    1  
ATOM 955   C CA   . LYS A 1 57 ? -18.518 4.605   5.584   1.00 0.00 ? 55 LYS P CA   1  
ATOM 956   C C    . LYS A 1 57 ? -19.092 5.179   4.281   1.00 0.00 ? 55 LYS P C    1  
ATOM 957   O O    . LYS A 1 57 ? -19.859 6.141   4.319   1.00 0.00 ? 55 LYS P O    1  
ATOM 958   C CB   . LYS A 1 57 ? -17.138 5.214   5.890   1.00 0.00 ? 55 LYS P CB   1  
ATOM 959   C CG   . LYS A 1 57 ? -16.703 4.962   7.342   1.00 0.00 ? 55 LYS P CG   1  
ATOM 960   C CD   . LYS A 1 57 ? -15.249 5.406   7.557   1.00 0.00 ? 55 LYS P CD   1  
ATOM 961   C CE   . LYS A 1 57 ? -14.736 5.036   8.955   1.00 0.00 ? 55 LYS P CE   1  
ATOM 962   N NZ   . LYS A 1 57 ? -15.380 5.835   10.033  1.00 0.00 ? 55 LYS P NZ   1  
ATOM 963   H H    . LYS A 1 57 ? -17.487 2.727   5.422   1.00 0.00 ? 55 LYS P H    1  
ATOM 964   H HA   . LYS A 1 57 ? -19.206 4.894   6.381   1.00 0.00 ? 55 LYS P HA   1  
ATOM 965   H HB2  . LYS A 1 57 ? -16.398 4.791   5.208   1.00 0.00 ? 55 LYS P HB2  1  
ATOM 966   H HB3  . LYS A 1 57 ? -17.173 6.293   5.729   1.00 0.00 ? 55 LYS P HB3  1  
ATOM 967   H HG2  . LYS A 1 57 ? -17.364 5.518   8.006   1.00 0.00 ? 55 LYS P HG2  1  
ATOM 968   H HG3  . LYS A 1 57 ? -16.788 3.902   7.578   1.00 0.00 ? 55 LYS P HG3  1  
ATOM 969   H HD2  . LYS A 1 57 ? -14.617 4.899   6.825   1.00 0.00 ? 55 LYS P HD2  1  
ATOM 970   H HD3  . LYS A 1 57 ? -15.160 6.482   7.399   1.00 0.00 ? 55 LYS P HD3  1  
ATOM 971   H HE2  . LYS A 1 57 ? -14.913 3.969   9.117   1.00 0.00 ? 55 LYS P HE2  1  
ATOM 972   H HE3  . LYS A 1 57 ? -13.654 5.201   8.974   1.00 0.00 ? 55 LYS P HE3  1  
ATOM 973   H HZ1  . LYS A 1 57 ? -16.377 5.676   10.071  1.00 0.00 ? 55 LYS P HZ1  1  
ATOM 974   H HZ2  . LYS A 1 57 ? -15.223 6.825   9.901   1.00 0.00 ? 55 LYS P HZ2  1  
ATOM 975   H HZ3  . LYS A 1 57 ? -15.002 5.589   10.939  1.00 0.00 ? 55 LYS P HZ3  1  
ATOM 976   N N    . TRP A 1 58 ? -18.787 4.561   3.138   1.00 0.00 ? 56 TRP P N    1  
ATOM 977   C CA   . TRP A 1 58 ? -19.268 4.940   1.803   1.00 0.00 ? 56 TRP P CA   1  
ATOM 978   C C    . TRP A 1 58 ? -20.794 4.988   1.766   1.00 0.00 ? 56 TRP P C    1  
ATOM 979   O O    . TRP A 1 58 ? -21.367 5.938   1.245   1.00 0.00 ? 56 TRP P O    1  
ATOM 980   C CB   . TRP A 1 58 ? -18.732 3.941   0.758   1.00 0.00 ? 56 TRP P CB   1  
ATOM 981   C CG   . TRP A 1 58 ? -19.592 3.750   -0.457  1.00 0.00 ? 56 TRP P CG   1  
ATOM 982   C CD1  . TRP A 1 58 ? -19.931 4.717   -1.333  1.00 0.00 ? 56 TRP P CD1  1  
ATOM 983   C CD2  . TRP A 1 58 ? -20.324 2.558   -0.882  1.00 0.00 ? 56 TRP P CD2  1  
ATOM 984   N NE1  . TRP A 1 58 ? -20.826 4.219   -2.261  1.00 0.00 ? 56 TRP P NE1  1  
ATOM 985   C CE2  . TRP A 1 58 ? -21.129 2.901   -2.008  1.00 0.00 ? 56 TRP P CE2  1  
ATOM 986   C CE3  . TRP A 1 58 ? -20.426 1.238   -0.400  1.00 0.00 ? 56 TRP P CE3  1  
ATOM 987   C CZ2  . TRP A 1 58 ? -22.010 1.993   -2.610  1.00 0.00 ? 56 TRP P CZ2  1  
ATOM 988   C CZ3  . TRP A 1 58 ? -21.286 0.303   -1.013  1.00 0.00 ? 56 TRP P CZ3  1  
ATOM 989   C CH2  . TRP A 1 58 ? -22.082 0.679   -2.112  1.00 0.00 ? 56 TRP P CH2  1  
ATOM 990   H H    . TRP A 1 58 ? -18.147 3.777   3.183   1.00 0.00 ? 56 TRP P H    1  
ATOM 991   H HA   . TRP A 1 58 ? -18.901 5.934   1.549   1.00 0.00 ? 56 TRP P HA   1  
ATOM 992   H HB2  . TRP A 1 58 ? -17.734 4.255   0.445   1.00 0.00 ? 56 TRP P HB2  1  
ATOM 993   H HB3  . TRP A 1 58 ? -18.633 2.964   1.225   1.00 0.00 ? 56 TRP P HB3  1  
ATOM 994   H HD1  . TRP A 1 58 ? -19.589 5.735   -1.255  1.00 0.00 ? 56 TRP P HD1  1  
ATOM 995   H HE1  . TRP A 1 58 ? -21.232 4.759   -3.024  1.00 0.00 ? 56 TRP P HE1  1  
ATOM 996   H HE3  . TRP A 1 58 ? -19.856 0.963   0.477   1.00 0.00 ? 56 TRP P HE3  1  
ATOM 997   H HZ2  . TRP A 1 58 ? -22.628 2.311   -3.439  1.00 0.00 ? 56 TRP P HZ2  1  
ATOM 998   H HZ3  . TRP A 1 58 ? -21.349 -0.706  -0.627  1.00 0.00 ? 56 TRP P HZ3  1  
ATOM 999   H HH2  . TRP A 1 58 ? -22.751 -0.038  -2.569  1.00 0.00 ? 56 TRP P HH2  1  
ATOM 1000  N N    . ARG A 1 59 ? -21.456 4.012   2.387   1.00 0.00 ? 57 ARG P N    1  
ATOM 1001  C CA   . ARG A 1 59 ? -22.922 3.889   2.423   1.00 0.00 ? 57 ARG P CA   1  
ATOM 1002  C C    . ARG A 1 59 ? -23.652 5.036   3.139   1.00 0.00 ? 57 ARG P C    1  
ATOM 1003  O O    . ARG A 1 59 ? -24.816 5.295   2.831   1.00 0.00 ? 57 ARG P O    1  
ATOM 1004  C CB   . ARG A 1 59 ? -23.259 2.523   3.042   1.00 0.00 ? 57 ARG P CB   1  
ATOM 1005  C CG   . ARG A 1 59 ? -22.953 1.398   2.046   1.00 0.00 ? 57 ARG P CG   1  
ATOM 1006  C CD   . ARG A 1 59 ? -23.097 0.013   2.687   1.00 0.00 ? 57 ARG P CD   1  
ATOM 1007  N NE   . ARG A 1 59 ? -24.496 -0.306  3.044   1.00 0.00 ? 57 ARG P NE   1  
ATOM 1008  C CZ   . ARG A 1 59 ? -25.449 -0.744  2.238   1.00 0.00 ? 57 ARG P CZ   1  
ATOM 1009  N NH1  . ARG A 1 59 ? -25.252 -0.942  0.965   1.00 0.00 ? 57 ARG P NH1  1  
ATOM 1010  N NH2  . ARG A 1 59 ? -26.639 -0.994  2.704   1.00 0.00 ? 57 ARG P NH2  1  
ATOM 1011  H H    . ARG A 1 59 ? -20.894 3.248   2.744   1.00 0.00 ? 57 ARG P H    1  
ATOM 1012  H HA   . ARG A 1 59 ? -23.290 3.920   1.394   1.00 0.00 ? 57 ARG P HA   1  
ATOM 1013  H HB2  . ARG A 1 59 ? -22.648 2.377   3.938   1.00 0.00 ? 57 ARG P HB2  1  
ATOM 1014  H HB3  . ARG A 1 59 ? -24.316 2.487   3.309   1.00 0.00 ? 57 ARG P HB3  1  
ATOM 1015  H HG2  . ARG A 1 59 ? -23.604 1.490   1.175   1.00 0.00 ? 57 ARG P HG2  1  
ATOM 1016  H HG3  . ARG A 1 59 ? -21.925 1.501   1.712   1.00 0.00 ? 57 ARG P HG3  1  
ATOM 1017  H HD2  . ARG A 1 59 ? -22.703 -0.739  2.001   1.00 0.00 ? 57 ARG P HD2  1  
ATOM 1018  H HD3  . ARG A 1 59 ? -22.476 -0.009  3.586   1.00 0.00 ? 57 ARG P HD3  1  
ATOM 1019  H HE   . ARG A 1 59 ? -24.751 -0.199  4.014   1.00 0.00 ? 57 ARG P HE   1  
ATOM 1020  H HH11 . ARG A 1 59 ? -24.344 -0.756  0.574   1.00 0.00 ? 57 ARG P HH11 1  
ATOM 1021  H HH12 . ARG A 1 59 ? -25.996 -1.277  0.377   1.00 0.00 ? 57 ARG P HH12 1  
ATOM 1022  H HH21 . ARG A 1 59 ? -26.840 -0.859  3.681   1.00 0.00 ? 57 ARG P HH21 1  
ATOM 1023  H HH22 . ARG A 1 59 ? -27.364 -1.328  2.091   1.00 0.00 ? 57 ARG P HH22 1  
ATOM 1024  N N    . LYS A 1 60 ? -22.974 5.753   4.046   1.00 0.00 ? 58 LYS P N    1  
ATOM 1025  C CA   . LYS A 1 60 ? -23.481 6.986   4.694   1.00 0.00 ? 58 LYS P CA   1  
ATOM 1026  C C    . LYS A 1 60 ? -23.201 8.245   3.856   1.00 0.00 ? 58 LYS P C    1  
ATOM 1027  O O    . LYS A 1 60 ? -23.976 9.202   3.903   1.00 0.00 ? 58 LYS P O    1  
ATOM 1028  C CB   . LYS A 1 60 ? -22.873 7.161   6.102   1.00 0.00 ? 58 LYS P CB   1  
ATOM 1029  C CG   . LYS A 1 60 ? -23.392 6.202   7.187   1.00 0.00 ? 58 LYS P CG   1  
ATOM 1030  C CD   . LYS A 1 60 ? -22.974 4.743   6.969   1.00 0.00 ? 58 LYS P CD   1  
ATOM 1031  C CE   . LYS A 1 60 ? -23.147 3.913   8.244   1.00 0.00 ? 58 LYS P CE   1  
ATOM 1032  N NZ   . LYS A 1 60 ? -22.751 2.501   8.008   1.00 0.00 ? 58 LYS P NZ   1  
ATOM 1033  H H    . LYS A 1 60 ? -22.034 5.440   4.253   1.00 0.00 ? 58 LYS P H    1  
ATOM 1034  H HA   . LYS A 1 60 ? -24.565 6.925   4.800   1.00 0.00 ? 58 LYS P HA   1  
ATOM 1035  H HB2  . LYS A 1 60 ? -21.786 7.089   6.045   1.00 0.00 ? 58 LYS P HB2  1  
ATOM 1036  H HB3  . LYS A 1 60 ? -23.107 8.172   6.445   1.00 0.00 ? 58 LYS P HB3  1  
ATOM 1037  H HG2  . LYS A 1 60 ? -22.986 6.538   8.143   1.00 0.00 ? 58 LYS P HG2  1  
ATOM 1038  H HG3  . LYS A 1 60 ? -24.479 6.264   7.242   1.00 0.00 ? 58 LYS P HG3  1  
ATOM 1039  H HD2  . LYS A 1 60 ? -23.579 4.306   6.173   1.00 0.00 ? 58 LYS P HD2  1  
ATOM 1040  H HD3  . LYS A 1 60 ? -21.924 4.725   6.677   1.00 0.00 ? 58 LYS P HD3  1  
ATOM 1041  H HE2  . LYS A 1 60 ? -22.523 4.351   9.028   1.00 0.00 ? 58 LYS P HE2  1  
ATOM 1042  H HE3  . LYS A 1 60 ? -24.190 3.966   8.572   1.00 0.00 ? 58 LYS P HE3  1  
ATOM 1043  H HZ1  . LYS A 1 60 ? -21.839 2.458   7.561   1.00 0.00 ? 58 LYS P HZ1  1  
ATOM 1044  H HZ2  . LYS A 1 60 ? -23.409 2.034   7.401   1.00 0.00 ? 58 LYS P HZ2  1  
ATOM 1045  H HZ3  . LYS A 1 60 ? -22.709 1.983   8.876   1.00 0.00 ? 58 LYS P HZ3  1  
ATOM 1046  N N    . ARG A 1 61 ? -22.096 8.244   3.102   1.00 0.00 ? 59 ARG P N    1  
ATOM 1047  C CA   . ARG A 1 61 ? -21.575 9.379   2.308   1.00 0.00 ? 59 ARG P CA   1  
ATOM 1048  C C    . ARG A 1 61 ? -22.089 9.407   0.859   1.00 0.00 ? 59 ARG P C    1  
ATOM 1049  O O    . ARG A 1 61 ? -22.112 10.466  0.235   1.00 0.00 ? 59 ARG P O    1  
ATOM 1050  C CB   . ARG A 1 61 ? -20.038 9.316   2.343   1.00 0.00 ? 59 ARG P CB   1  
ATOM 1051  C CG   . ARG A 1 61 ? -19.461 9.637   3.734   1.00 0.00 ? 59 ARG P CG   1  
ATOM 1052  C CD   . ARG A 1 61 ? -17.984 9.239   3.866   1.00 0.00 ? 59 ARG P CD   1  
ATOM 1053  N NE   . ARG A 1 61 ? -17.109 9.876   2.860   1.00 0.00 ? 59 ARG P NE   1  
ATOM 1054  C CZ   . ARG A 1 61 ? -16.663 11.116  2.817   1.00 0.00 ? 59 ARG P CZ   1  
ATOM 1055  N NH1  . ARG A 1 61 ? -16.950 12.010  3.720   1.00 0.00 ? 59 ARG P NH1  1  
ATOM 1056  N NH2  . ARG A 1 61 ? -15.899 11.457  1.824   1.00 0.00 ? 59 ARG P NH2  1  
ATOM 1057  H H    . ARG A 1 61 ? -21.533 7.403   3.141   1.00 0.00 ? 59 ARG P H    1  
ATOM 1058  H HA   . ARG A 1 61 ? -21.892 10.321  2.761   1.00 0.00 ? 59 ARG P HA   1  
ATOM 1059  H HB2  . ARG A 1 61 ? -19.721 8.315   2.045   1.00 0.00 ? 59 ARG P HB2  1  
ATOM 1060  H HB3  . ARG A 1 61 ? -19.633 10.033  1.628   1.00 0.00 ? 59 ARG P HB3  1  
ATOM 1061  H HG2  . ARG A 1 61 ? -19.578 10.703  3.930   1.00 0.00 ? 59 ARG P HG2  1  
ATOM 1062  H HG3  . ARG A 1 61 ? -20.015 9.092   4.498   1.00 0.00 ? 59 ARG P HG3  1  
ATOM 1063  H HD2  . ARG A 1 61 ? -17.636 9.485   4.871   1.00 0.00 ? 59 ARG P HD2  1  
ATOM 1064  H HD3  . ARG A 1 61 ? -17.916 8.155   3.750   1.00 0.00 ? 59 ARG P HD3  1  
ATOM 1065  H HE   . ARG A 1 61 ? -16.755 9.293   2.110   1.00 0.00 ? 59 ARG P HE   1  
ATOM 1066  H HH11 . ARG A 1 61 ? -17.528 11.753  4.501   1.00 0.00 ? 59 ARG P HH11 1  
ATOM 1067  H HH12 . ARG A 1 61 ? -16.585 12.945  3.647   1.00 0.00 ? 59 ARG P HH12 1  
ATOM 1068  H HH21 . ARG A 1 61 ? -15.690 10.740  1.128   1.00 0.00 ? 59 ARG P HH21 1  
ATOM 1069  H HH22 . ARG A 1 61 ? -15.530 12.388  1.741   1.00 0.00 ? 59 ARG P HH22 1  
ATOM 1070  N N    . GLU A 1 62 ? -22.487 8.248   0.338   1.00 0.00 ? 60 GLU P N    1  
ATOM 1071  C CA   . GLU A 1 62 ? -22.875 7.967   -1.054  1.00 0.00 ? 60 GLU P CA   1  
ATOM 1072  C C    . GLU A 1 62 ? -21.833 8.473   -2.077  1.00 0.00 ? 60 GLU P C    1  
ATOM 1073  O O    . GLU A 1 62 ? -22.157 9.123   -3.071  1.00 0.00 ? 60 GLU P O    1  
ATOM 1074  C CB   . GLU A 1 62 ? -24.326 8.409   -1.322  1.00 0.00 ? 60 GLU P CB   1  
ATOM 1075  C CG   . GLU A 1 62 ? -25.323 7.577   -0.500  1.00 0.00 ? 60 GLU P CG   1  
ATOM 1076  C CD   . GLU A 1 62 ? -26.773 8.022   -0.770  1.00 0.00 ? 60 GLU P CD   1  
ATOM 1077  O OE1  . GLU A 1 62 ? -27.221 9.040   -0.186  1.00 0.00 ? 60 GLU P OE1  1  
ATOM 1078  O OE2  . GLU A 1 62 ? -27.485 7.355   -1.560  1.00 0.00 ? 60 GLU P OE2  1  
ATOM 1079  H H    . GLU A 1 62 ? -22.371 7.440   0.937   1.00 0.00 ? 60 GLU P H    1  
ATOM 1080  H HA   . GLU A 1 62 ? -22.862 6.879   -1.164  1.00 0.00 ? 60 GLU P HA   1  
ATOM 1081  H HB2  . GLU A 1 62 ? -24.442 9.466   -1.085  1.00 0.00 ? 60 GLU P HB2  1  
ATOM 1082  H HB3  . GLU A 1 62 ? -24.558 8.263   -2.377  1.00 0.00 ? 60 GLU P HB3  1  
ATOM 1083  H HG2  . GLU A 1 62 ? -25.195 6.520   -0.757  1.00 0.00 ? 60 GLU P HG2  1  
ATOM 1084  H HG3  . GLU A 1 62 ? -25.102 7.685   0.566   1.00 0.00 ? 60 GLU P HG3  1  
ATOM 1085  N N    . GLU A 1 63 ? -20.554 8.179   -1.805  1.00 0.00 ? 61 GLU P N    1  
ATOM 1086  C CA   . GLU A 1 63 ? -19.390 8.675   -2.574  1.00 0.00 ? 61 GLU P CA   1  
ATOM 1087  C C    . GLU A 1 63 ? -19.435 8.295   -4.065  1.00 0.00 ? 61 GLU P C    1  
ATOM 1088  O O    . GLU A 1 63 ? -19.074 9.093   -4.933  1.00 0.00 ? 61 GLU P O    1  
ATOM 1089  C CB   . GLU A 1 63 ? -18.078 8.129   -1.980  1.00 0.00 ? 61 GLU P CB   1  
ATOM 1090  C CG   . GLU A 1 63 ? -17.929 8.400   -0.480  1.00 0.00 ? 61 GLU P CG   1  
ATOM 1091  C CD   . GLU A 1 63 ? -16.508 8.100   0.018   1.00 0.00 ? 61 GLU P CD   1  
ATOM 1092  O OE1  . GLU A 1 63 ? -16.094 6.922   0.084   1.00 0.00 ? 61 GLU P OE1  1  
ATOM 1093  O OE2  . GLU A 1 63 ? -15.803 9.056   0.418   1.00 0.00 ? 61 GLU P OE2  1  
ATOM 1094  H H    . GLU A 1 63 ? -20.379 7.676   -0.946  1.00 0.00 ? 61 GLU P H    1  
ATOM 1095  H HA   . GLU A 1 63 ? -19.369 9.765   -2.511  1.00 0.00 ? 61 GLU P HA   1  
ATOM 1096  H HB2  . GLU A 1 63 ? -18.015 7.054   -2.151  1.00 0.00 ? 61 GLU P HB2  1  
ATOM 1097  H HB3  . GLU A 1 63 ? -17.249 8.595   -2.508  1.00 0.00 ? 61 GLU P HB3  1  
ATOM 1098  H HG2  . GLU A 1 63 ? -18.168 9.448   -0.286  1.00 0.00 ? 61 GLU P HG2  1  
ATOM 1099  H HG3  . GLU A 1 63 ? -18.641 7.781   0.067   1.00 0.00 ? 61 GLU P HG3  1  
ATOM 1100  N N    . PHE A 1 64 ? -19.911 7.081   -4.353  1.00 0.00 ? 62 PHE P N    1  
ATOM 1101  C CA   . PHE A 1 64 ? -20.234 6.570   -5.682  1.00 0.00 ? 62 PHE P CA   1  
ATOM 1102  C C    . PHE A 1 64 ? -21.625 5.921   -5.678  1.00 0.00 ? 62 PHE P C    1  
ATOM 1103  O O    . PHE A 1 64 ? -21.962 5.182   -4.750  1.00 0.00 ? 62 PHE P O    1  
ATOM 1104  C CB   . PHE A 1 64 ? -19.160 5.564   -6.109  1.00 0.00 ? 62 PHE P CB   1  
ATOM 1105  C CG   . PHE A 1 64 ? -19.423 4.945   -7.469  1.00 0.00 ? 62 PHE P CG   1  
ATOM 1106  C CD1  . PHE A 1 64 ? -19.170 5.681   -8.642  1.00 0.00 ? 62 PHE P CD1  1  
ATOM 1107  C CD2  . PHE A 1 64 ? -19.979 3.653   -7.561  1.00 0.00 ? 62 PHE P CD2  1  
ATOM 1108  C CE1  . PHE A 1 64 ? -19.471 5.128   -9.901  1.00 0.00 ? 62 PHE P CE1  1  
ATOM 1109  C CE2  . PHE A 1 64 ? -20.279 3.102   -8.820  1.00 0.00 ? 62 PHE P CE2  1  
ATOM 1110  C CZ   . PHE A 1 64 ? -20.027 3.840   -9.990  1.00 0.00 ? 62 PHE P CZ   1  
ATOM 1111  H H    . PHE A 1 64 ? -20.132 6.480   -3.579  1.00 0.00 ? 62 PHE P H    1  
ATOM 1112  H HA   . PHE A 1 64 ? -20.243 7.393   -6.399  1.00 0.00 ? 62 PHE P HA   1  
ATOM 1113  H HB2  . PHE A 1 64 ? -18.196 6.073   -6.119  1.00 0.00 ? 62 PHE P HB2  1  
ATOM 1114  H HB3  . PHE A 1 64 ? -19.098 4.770   -5.362  1.00 0.00 ? 62 PHE P HB3  1  
ATOM 1115  H HD1  . PHE A 1 64 ? -18.750 6.676   -8.578  1.00 0.00 ? 62 PHE P HD1  1  
ATOM 1116  H HD2  . PHE A 1 64 ? -20.188 3.087   -6.663  1.00 0.00 ? 62 PHE P HD2  1  
ATOM 1117  H HE1  . PHE A 1 64 ? -19.279 5.698   -10.800 1.00 0.00 ? 62 PHE P HE1  1  
ATOM 1118  H HE2  . PHE A 1 64 ? -20.706 2.110   -8.887  1.00 0.00 ? 62 PHE P HE2  1  
ATOM 1119  H HZ   . PHE A 1 64 ? -20.260 3.417   -10.958 1.00 0.00 ? 62 PHE P HZ   1  
ATOM 1120  N N    . ILE A 1 65 ? -22.411 6.187   -6.726  1.00 0.00 ? 63 ILE P N    1  
ATOM 1121  C CA   . ILE A 1 65 ? -23.731 5.611   -7.019  1.00 0.00 ? 63 ILE P CA   1  
ATOM 1122  C C    . ILE A 1 65 ? -23.825 5.406   -8.539  1.00 0.00 ? 63 ILE P C    1  
ATOM 1123  O O    . ILE A 1 65 ? -23.397 6.270   -9.311  1.00 0.00 ? 63 ILE P O    1  
ATOM 1124  C CB   . ILE A 1 65 ? -24.866 6.540   -6.511  1.00 0.00 ? 63 ILE P CB   1  
ATOM 1125  C CG1  . ILE A 1 65 ? -24.860 6.743   -4.979  1.00 0.00 ? 63 ILE P CG1  1  
ATOM 1126  C CG2  . ILE A 1 65 ? -26.260 6.059   -6.960  1.00 0.00 ? 63 ILE P CG2  1  
ATOM 1127  C CD1  . ILE A 1 65 ? -25.182 5.499   -4.136  1.00 0.00 ? 63 ILE P CD1  1  
ATOM 1128  H H    . ILE A 1 65 ? -22.032 6.787   -7.445  1.00 0.00 ? 63 ILE P H    1  
ATOM 1129  H HA   . ILE A 1 65 ? -23.822 4.639   -6.534  1.00 0.00 ? 63 ILE P HA   1  
ATOM 1130  H HB   . ILE A 1 65 ? -24.710 7.523   -6.960  1.00 0.00 ? 63 ILE P HB   1  
ATOM 1131  H HG12 . ILE A 1 65 ? -23.889 7.132   -4.675  1.00 0.00 ? 63 ILE P HG12 1  
ATOM 1132  H HG13 . ILE A 1 65 ? -25.592 7.512   -4.732  1.00 0.00 ? 63 ILE P HG13 1  
ATOM 1133  H HG21 . ILE A 1 65 ? -26.417 5.019   -6.677  1.00 0.00 ? 63 ILE P HG21 1  
ATOM 1134  H HG22 . ILE A 1 65 ? -27.032 6.675   -6.497  1.00 0.00 ? 63 ILE P HG22 1  
ATOM 1135  H HG23 . ILE A 1 65 ? -26.366 6.156   -8.040  1.00 0.00 ? 63 ILE P HG23 1  
ATOM 1136  H HD11 . ILE A 1 65 ? -25.047 5.735   -3.082  1.00 0.00 ? 63 ILE P HD11 1  
ATOM 1137  H HD12 . ILE A 1 65 ? -24.522 4.672   -4.394  1.00 0.00 ? 63 ILE P HD12 1  
ATOM 1138  H HD13 . ILE A 1 65 ? -26.217 5.194   -4.293  1.00 0.00 ? 63 ILE P HD13 1  
ATOM 1139  N N    . VAL A 1 66 ? -24.393 4.282   -8.982  1.00 0.00 ? 64 VAL P N    1  
ATOM 1140  C CA   . VAL A 1 66 ? -24.592 3.983   -10.412 1.00 0.00 ? 64 VAL P CA   1  
ATOM 1141  C C    . VAL A 1 66 ? -25.789 4.772   -10.952 1.00 0.00 ? 64 VAL P C    1  
ATOM 1142  O O    . VAL A 1 66 ? -26.899 4.664   -10.427 1.00 0.00 ? 64 VAL P O    1  
ATOM 1143  C CB   . VAL A 1 66 ? -24.777 2.473   -10.654 1.00 0.00 ? 64 VAL P CB   1  
ATOM 1144  C CG1  . VAL A 1 66 ? -24.898 2.148   -12.149 1.00 0.00 ? 64 VAL P CG1  1  
ATOM 1145  C CG2  . VAL A 1 66 ? -23.590 1.671   -10.100 1.00 0.00 ? 64 VAL P CG2  1  
ATOM 1146  H H    . VAL A 1 66 ? -24.746 3.622   -8.304  1.00 0.00 ? 64 VAL P H    1  
ATOM 1147  H HA   . VAL A 1 66 ? -23.699 4.294   -10.957 1.00 0.00 ? 64 VAL P HA   1  
ATOM 1148  H HB   . VAL A 1 66 ? -25.691 2.147   -10.155 1.00 0.00 ? 64 VAL P HB   1  
ATOM 1149  H HG11 . VAL A 1 66 ? -24.967 1.069   -12.288 1.00 0.00 ? 64 VAL P HG11 1  
ATOM 1150  H HG12 . VAL A 1 66 ? -25.803 2.594   -12.560 1.00 0.00 ? 64 VAL P HG12 1  
ATOM 1151  H HG13 . VAL A 1 66 ? -24.027 2.522   -12.688 1.00 0.00 ? 64 VAL P HG13 1  
ATOM 1152  H HG21 . VAL A 1 66 ? -23.506 1.807   -9.022  1.00 0.00 ? 64 VAL P HG21 1  
ATOM 1153  H HG22 . VAL A 1 66 ? -23.734 0.609   -10.299 1.00 0.00 ? 64 VAL P HG22 1  
ATOM 1154  H HG23 . VAL A 1 66 ? -22.666 2.004   -10.573 1.00 0.00 ? 64 VAL P HG23 1  
ATOM 1155  N N    . THR A 1 67 ? -25.569 5.556   -12.011 1.00 0.00 ? 65 THR P N    1  
ATOM 1156  C CA   . THR A 1 67 ? -26.583 6.448   -12.615 1.00 0.00 ? 65 THR P CA   1  
ATOM 1157  C C    . THR A 1 67 ? -27.237 5.888   -13.887 1.00 0.00 ? 65 THR P C    1  
ATOM 1158  O O    . THR A 1 67 ? -28.200 6.465   -14.395 1.00 0.00 ? 65 THR P O    1  
ATOM 1159  C CB   . THR A 1 67 ? -25.981 7.836   -12.899 1.00 0.00 ? 65 THR P CB   1  
ATOM 1160  O OG1  . THR A 1 67 ? -24.818 7.733   -13.703 1.00 0.00 ? 65 THR P OG1  1  
ATOM 1161  C CG2  . THR A 1 67 ? -25.567 8.532   -11.603 1.00 0.00 ? 65 THR P CG2  1  
ATOM 1162  H H    . THR A 1 67 ? -24.622 5.644   -12.356 1.00 0.00 ? 65 THR P H    1  
ATOM 1163  H HA   . THR A 1 67 ? -27.391 6.582   -11.897 1.00 0.00 ? 65 THR P HA   1  
ATOM 1164  H HB   . THR A 1 67 ? -26.719 8.460   -13.403 1.00 0.00 ? 65 THR P HB   1  
ATOM 1165  H HG1  . THR A 1 67 ? -25.101 7.594   -14.626 1.00 0.00 ? 65 THR P HG1  1  
ATOM 1166  H HG21 . THR A 1 67 ? -25.206 9.535   -11.829 1.00 0.00 ? 65 THR P HG21 1  
ATOM 1167  H HG22 . THR A 1 67 ? -24.775 7.969   -11.110 1.00 0.00 ? 65 THR P HG22 1  
ATOM 1168  H HG23 . THR A 1 67 ? -26.426 8.605   -10.937 1.00 0.00 ? 65 THR P HG23 1  
ATOM 1169  N N    . ASP A 1 68 ? -26.725 4.765   -14.402 1.00 0.00 ? 66 ASP P N    1  
ATOM 1170  C CA   . ASP A 1 68 ? -27.235 4.042   -15.584 1.00 0.00 ? 66 ASP P CA   1  
ATOM 1171  C C    . ASP A 1 68 ? -28.613 3.376   -15.362 1.00 0.00 ? 66 ASP P C    1  
ATOM 1172  O O    . ASP A 1 68 ? -29.496 3.538   -16.235 1.00 0.00 ? 66 ASP P O    1  
ATOM 1173  C CB   . ASP A 1 68 ? -26.182 3.013   -16.038 1.00 0.00 ? 66 ASP P CB   1  
ATOM 1174  C CG   . ASP A 1 68 ? -26.595 2.248   -17.316 1.00 0.00 ? 66 ASP P CG   1  
ATOM 1175  O OD1  . ASP A 1 68 ? -26.545 2.841   -18.423 1.00 0.00 ? 66 ASP P OD1  1  
ATOM 1176  O OD2  . ASP A 1 68 ? -26.936 1.042   -17.227 1.00 0.00 ? 66 ASP P OD2  1  
ATOM 1177  O OXT  . ASP A 1 68 ? -28.808 2.700   -14.324 1.00 0.00 ? 66 ASP P OXT  1  
ATOM 1178  H H    . ASP A 1 68 ? -25.941 4.368   -13.909 1.00 0.00 ? 66 ASP P H    1  
ATOM 1179  H HA   . ASP A 1 68 ? -27.357 4.762   -16.395 1.00 0.00 ? 66 ASP P HA   1  
ATOM 1180  H HB2  . ASP A 1 68 ? -25.240 3.535   -16.226 1.00 0.00 ? 66 ASP P HB2  1  
ATOM 1181  H HB3  . ASP A 1 68 ? -26.005 2.305   -15.226 1.00 0.00 ? 66 ASP P HB3  1  
ATOM 1182  N N    . GLY A 1 1  ? -0.125  18.951  29.533  1.00 0.00 ? -1 GLY P N    2  
ATOM 1183  C CA   . GLY A 1 1  ? 0.929   18.418  28.641  1.00 0.00 ? -1 GLY P CA   2  
ATOM 1184  C C    . GLY A 1 1  ? 0.362   17.435  27.626  1.00 0.00 ? -1 GLY P C    2  
ATOM 1185  O O    . GLY A 1 1  ? -0.629  16.754  27.899  1.00 0.00 ? -1 GLY P O    2  
ATOM 1186  H H1   . GLY A 1 1  ? -0.577  18.195  30.025  1.00 0.00 ? -1 GLY P H1   2  
ATOM 1187  H H2   . GLY A 1 1  ? -0.821  19.447  28.996  1.00 0.00 ? -1 GLY P H2   2  
ATOM 1188  H H3   . GLY A 1 1  ? 0.275   19.583  30.206  1.00 0.00 ? -1 GLY P H3   2  
ATOM 1189  H HA2  . GLY A 1 1  ? 1.403   19.242  28.109  1.00 0.00 ? -1 GLY P HA2  2  
ATOM 1190  H HA3  . GLY A 1 1  ? 1.682   17.902  29.236  1.00 0.00 ? -1 GLY P HA3  2  
ATOM 1191  N N    . SER A 1 2  ? 0.983   17.348  26.445  1.00 0.00 ? 0  SER P N    2  
ATOM 1192  C CA   . SER A 1 2  ? 0.533   16.493  25.331  1.00 0.00 ? 0  SER P CA   2  
ATOM 1193  C C    . SER A 1 2  ? 0.678   14.992  25.626  1.00 0.00 ? 0  SER P C    2  
ATOM 1194  O O    . SER A 1 2  ? 1.660   14.560  26.240  1.00 0.00 ? 0  SER P O    2  
ATOM 1195  C CB   . SER A 1 2  ? 1.306   16.832  24.049  1.00 0.00 ? 0  SER P CB   2  
ATOM 1196  O OG   . SER A 1 2  ? 1.166   18.212  23.735  1.00 0.00 ? 0  SER P OG   2  
ATOM 1197  H H    . SER A 1 2  ? 1.778   17.947  26.270  1.00 0.00 ? 0  SER P H    2  
ATOM 1198  H HA   . SER A 1 2  ? -0.521  16.700  25.143  1.00 0.00 ? 0  SER P HA   2  
ATOM 1199  H HB2  . SER A 1 2  ? 2.363   16.597  24.188  1.00 0.00 ? 0  SER P HB2  2  
ATOM 1200  H HB3  . SER A 1 2  ? 0.918   16.231  23.224  1.00 0.00 ? 0  SER P HB3  2  
ATOM 1201  H HG   . SER A 1 2  ? 1.651   18.389  22.905  1.00 0.00 ? 0  SER P HG   2  
ATOM 1202  N N    . GLN A 1 3  ? -0.279  14.189  25.151  1.00 0.00 ? 1  GLN P N    2  
ATOM 1203  C CA   . GLN A 1 3  ? -0.279  12.723  25.281  1.00 0.00 ? 1  GLN P CA   2  
ATOM 1204  C C    . GLN A 1 3  ? 0.723   12.063  24.312  1.00 0.00 ? 1  GLN P C    2  
ATOM 1205  O O    . GLN A 1 3  ? 1.000   12.590  23.231  1.00 0.00 ? 1  GLN P O    2  
ATOM 1206  C CB   . GLN A 1 3  ? -1.702  12.169  25.077  1.00 0.00 ? 1  GLN P CB   2  
ATOM 1207  C CG   . GLN A 1 3  ? -2.686  12.664  26.154  1.00 0.00 ? 1  GLN P CG   2  
ATOM 1208  C CD   . GLN A 1 3  ? -4.099  12.092  26.015  1.00 0.00 ? 1  GLN P CD   2  
ATOM 1209  O OE1  . GLN A 1 3  ? -4.426  11.310  25.128  1.00 0.00 ? 1  GLN P OE1  2  
ATOM 1210  N NE2  . GLN A 1 3  ? -5.005  12.458  26.898  1.00 0.00 ? 1  GLN P NE2  2  
ATOM 1211  H H    . GLN A 1 3  ? -1.037  14.609  24.632  1.00 0.00 ? 1  GLN P H    2  
ATOM 1212  H HA   . GLN A 1 3  ? 0.034   12.471  26.296  1.00 0.00 ? 1  GLN P HA   2  
ATOM 1213  H HB2  . GLN A 1 3  ? -2.066  12.459  24.090  1.00 0.00 ? 1  GLN P HB2  2  
ATOM 1214  H HB3  . GLN A 1 3  ? -1.662  11.080  25.123  1.00 0.00 ? 1  GLN P HB3  2  
ATOM 1215  H HG2  . GLN A 1 3  ? -2.302  12.391  27.137  1.00 0.00 ? 1  GLN P HG2  2  
ATOM 1216  H HG3  . GLN A 1 3  ? -2.759  13.751  26.111  1.00 0.00 ? 1  GLN P HG3  2  
ATOM 1217  H HE21 . GLN A 1 3  ? -4.760  13.099  27.639  1.00 0.00 ? 1  GLN P HE21 2  
ATOM 1218  H HE22 . GLN A 1 3  ? -5.939  12.087  26.821  1.00 0.00 ? 1  GLN P HE22 2  
ATOM 1219  N N    . ARG A 1 4  ? 1.271   10.901  24.702  1.00 0.00 ? 2  ARG P N    2  
ATOM 1220  C CA   . ARG A 1 4  ? 2.390   10.218  24.004  1.00 0.00 ? 2  ARG P CA   2  
ATOM 1221  C C    . ARG A 1 4  ? 1.973   8.995   23.171  1.00 0.00 ? 2  ARG P C    2  
ATOM 1222  O O    . ARG A 1 4  ? 2.793   8.450   22.429  1.00 0.00 ? 2  ARG P O    2  
ATOM 1223  C CB   . ARG A 1 4  ? 3.507   9.872   25.014  1.00 0.00 ? 2  ARG P CB   2  
ATOM 1224  C CG   . ARG A 1 4  ? 3.902   11.014  25.972  1.00 0.00 ? 2  ARG P CG   2  
ATOM 1225  C CD   . ARG A 1 4  ? 4.339   12.305  25.264  1.00 0.00 ? 2  ARG P CD   2  
ATOM 1226  N NE   . ARG A 1 4  ? 4.338   13.447  26.199  1.00 0.00 ? 2  ARG P NE   2  
ATOM 1227  C CZ   . ARG A 1 4  ? 5.334   13.894  26.941  1.00 0.00 ? 2  ARG P CZ   2  
ATOM 1228  N NH1  . ARG A 1 4  ? 6.519   13.353  26.924  1.00 0.00 ? 2  ARG P NH1  2  
ATOM 1229  N NH2  . ARG A 1 4  ? 5.145   14.912  27.730  1.00 0.00 ? 2  ARG P NH2  2  
ATOM 1230  H H    . ARG A 1 4  ? 0.991   10.536  25.605  1.00 0.00 ? 2  ARG P H    2  
ATOM 1231  H HA   . ARG A 1 4  ? 2.816   10.906  23.271  1.00 0.00 ? 2  ARG P HA   2  
ATOM 1232  H HB2  . ARG A 1 4  ? 3.181   9.025   25.619  1.00 0.00 ? 2  ARG P HB2  2  
ATOM 1233  H HB3  . ARG A 1 4  ? 4.396   9.563   24.461  1.00 0.00 ? 2  ARG P HB3  2  
ATOM 1234  H HG2  . ARG A 1 4  ? 3.056   11.236  26.623  1.00 0.00 ? 2  ARG P HG2  2  
ATOM 1235  H HG3  . ARG A 1 4  ? 4.719   10.670  26.608  1.00 0.00 ? 2  ARG P HG3  2  
ATOM 1236  H HD2  . ARG A 1 4  ? 5.322   12.164  24.811  1.00 0.00 ? 2  ARG P HD2  2  
ATOM 1237  H HD3  . ARG A 1 4  ? 3.638   12.539  24.464  1.00 0.00 ? 2  ARG P HD3  2  
ATOM 1238  H HE   . ARG A 1 4  ? 3.454   13.935  26.298  1.00 0.00 ? 2  ARG P HE   2  
ATOM 1239  H HH11 . ARG A 1 4  ? 6.690   12.564  26.326  1.00 0.00 ? 2  ARG P HH11 2  
ATOM 1240  H HH12 . ARG A 1 4  ? 7.257   13.716  27.502  1.00 0.00 ? 2  ARG P HH12 2  
ATOM 1241  H HH21 . ARG A 1 4  ? 4.238   15.346  27.776  1.00 0.00 ? 2  ARG P HH21 2  
ATOM 1242  H HH22 . ARG A 1 4  ? 5.897   15.259  28.302  1.00 0.00 ? 2  ARG P HH22 2  
ATOM 1243  N N    . ARG A 1 5  ? 0.707   8.573   23.270  1.00 0.00 ? 3  ARG P N    2  
ATOM 1244  C CA   . ARG A 1 5  ? 0.095   7.486   22.476  1.00 0.00 ? 3  ARG P CA   2  
ATOM 1245  C C    . ARG A 1 5  ? -0.132  7.880   21.009  1.00 0.00 ? 3  ARG P C    2  
ATOM 1246  O O    . ARG A 1 5  ? -0.179  9.065   20.673  1.00 0.00 ? 3  ARG P O    2  
ATOM 1247  C CB   . ARG A 1 5  ? -1.206  7.000   23.151  1.00 0.00 ? 3  ARG P CB   2  
ATOM 1248  C CG   . ARG A 1 5  ? -2.287  8.087   23.283  1.00 0.00 ? 3  ARG P CG   2  
ATOM 1249  C CD   . ARG A 1 5  ? -3.578  7.513   23.878  1.00 0.00 ? 3  ARG P CD   2  
ATOM 1250  N NE   . ARG A 1 5  ? -4.564  8.584   24.119  1.00 0.00 ? 3  ARG P NE   2  
ATOM 1251  C CZ   . ARG A 1 5  ? -5.879  8.498   24.102  1.00 0.00 ? 3  ARG P CZ   2  
ATOM 1252  N NH1  . ARG A 1 5  ? -6.515  7.386   23.856  1.00 0.00 ? 3  ARG P NH1  2  
ATOM 1253  N NH2  . ARG A 1 5  ? -6.579  9.565   24.345  1.00 0.00 ? 3  ARG P NH2  2  
ATOM 1254  H H    . ARG A 1 5  ? 0.114   9.093   23.897  1.00 0.00 ? 3  ARG P H    2  
ATOM 1255  H HA   . ARG A 1 5  ? 0.791   6.644   22.463  1.00 0.00 ? 3  ARG P HA   2  
ATOM 1256  H HB2  . ARG A 1 5  ? -1.612  6.167   22.575  1.00 0.00 ? 3  ARG P HB2  2  
ATOM 1257  H HB3  . ARG A 1 5  ? -0.962  6.624   24.148  1.00 0.00 ? 3  ARG P HB3  2  
ATOM 1258  H HG2  . ARG A 1 5  ? -1.925  8.883   23.932  1.00 0.00 ? 3  ARG P HG2  2  
ATOM 1259  H HG3  . ARG A 1 5  ? -2.513  8.507   22.302  1.00 0.00 ? 3  ARG P HG3  2  
ATOM 1260  H HD2  . ARG A 1 5  ? -3.979  6.771   23.185  1.00 0.00 ? 3  ARG P HD2  2  
ATOM 1261  H HD3  . ARG A 1 5  ? -3.347  7.020   24.825  1.00 0.00 ? 3  ARG P HD3  2  
ATOM 1262  H HE   . ARG A 1 5  ? -4.204  9.501   24.359  1.00 0.00 ? 3  ARG P HE   2  
ATOM 1263  H HH11 . ARG A 1 5  ? -5.988  6.545   23.694  1.00 0.00 ? 3  ARG P HH11 2  
ATOM 1264  H HH12 . ARG A 1 5  ? -7.520  7.357   23.869  1.00 0.00 ? 3  ARG P HH12 2  
ATOM 1265  H HH21 . ARG A 1 5  ? -6.077  10.419  24.562  1.00 0.00 ? 3  ARG P HH21 2  
ATOM 1266  H HH22 . ARG A 1 5  ? -7.584  9.540   24.350  1.00 0.00 ? 3  ARG P HH22 2  
ATOM 1267  N N    . GLN A 1 6  ? -0.310  6.883   20.141  1.00 0.00 ? 4  GLN P N    2  
ATOM 1268  C CA   . GLN A 1 6  ? -0.677  7.043   18.726  1.00 0.00 ? 4  GLN P CA   2  
ATOM 1269  C C    . GLN A 1 6  ? -1.831  6.084   18.381  1.00 0.00 ? 4  GLN P C    2  
ATOM 1270  O O    . GLN A 1 6  ? -1.621  4.889   18.159  1.00 0.00 ? 4  GLN P O    2  
ATOM 1271  C CB   . GLN A 1 6  ? 0.558   6.802   17.831  1.00 0.00 ? 4  GLN P CB   2  
ATOM 1272  C CG   . GLN A 1 6  ? 1.675   7.854   17.963  1.00 0.00 ? 4  GLN P CG   2  
ATOM 1273  C CD   . GLN A 1 6  ? 1.297   9.216   17.377  1.00 0.00 ? 4  GLN P CD   2  
ATOM 1274  O OE1  . GLN A 1 6  ? 1.542   9.512   16.214  1.00 0.00 ? 4  GLN P OE1  2  
ATOM 1275  N NE2  . GLN A 1 6  ? 0.681   10.097  18.138  1.00 0.00 ? 4  GLN P NE2  2  
ATOM 1276  H H    . GLN A 1 6  ? -0.240  5.941   20.497  1.00 0.00 ? 4  GLN P H    2  
ATOM 1277  H HA   . GLN A 1 6  ? -1.035  8.056   18.544  1.00 0.00 ? 4  GLN P HA   2  
ATOM 1278  H HB2  . GLN A 1 6  ? 0.981   5.826   18.073  1.00 0.00 ? 4  GLN P HB2  2  
ATOM 1279  H HB3  . GLN A 1 6  ? 0.238   6.774   16.788  1.00 0.00 ? 4  GLN P HB3  2  
ATOM 1280  H HG2  . GLN A 1 6  ? 1.960   7.970   19.009  1.00 0.00 ? 4  GLN P HG2  2  
ATOM 1281  H HG3  . GLN A 1 6  ? 2.552   7.489   17.427  1.00 0.00 ? 4  GLN P HG3  2  
ATOM 1282  H HE21 . GLN A 1 6  ? 0.449   9.867   19.102  1.00 0.00 ? 4  GLN P HE21 2  
ATOM 1283  H HE22 . GLN A 1 6  ? 0.444   10.993  17.743  1.00 0.00 ? 4  GLN P HE22 2  
ATOM 1284  N N    . ARG A 1 7  ? -3.066  6.609   18.364  1.00 0.00 ? 5  ARG P N    2  
ATOM 1285  C CA   . ARG A 1 7  ? -4.305  5.830   18.143  1.00 0.00 ? 5  ARG P CA   2  
ATOM 1286  C C    . ARG A 1 7  ? -4.602  5.499   16.673  1.00 0.00 ? 5  ARG P C    2  
ATOM 1287  O O    . ARG A 1 7  ? -5.368  4.574   16.399  1.00 0.00 ? 5  ARG P O    2  
ATOM 1288  C CB   . ARG A 1 7  ? -5.493  6.540   18.824  1.00 0.00 ? 5  ARG P CB   2  
ATOM 1289  C CG   . ARG A 1 7  ? -5.883  7.881   18.174  1.00 0.00 ? 5  ARG P CG   2  
ATOM 1290  C CD   . ARG A 1 7  ? -7.056  8.529   18.918  1.00 0.00 ? 5  ARG P CD   2  
ATOM 1291  N NE   . ARG A 1 7  ? -7.443  9.810   18.295  1.00 0.00 ? 5  ARG P NE   2  
ATOM 1292  C CZ   . ARG A 1 7  ? -8.421  10.612  18.679  1.00 0.00 ? 5  ARG P CZ   2  
ATOM 1293  N NH1  . ARG A 1 7  ? -9.187  10.336  19.697  1.00 0.00 ? 5  ARG P NH1  2  
ATOM 1294  N NH2  . ARG A 1 7  ? -8.653  11.722  18.036  1.00 0.00 ? 5  ARG P NH2  2  
ATOM 1295  H H    . ARG A 1 7  ? -3.156  7.590   18.596  1.00 0.00 ? 5  ARG P H    2  
ATOM 1296  H HA   . ARG A 1 7  ? -4.188  4.863   18.637  1.00 0.00 ? 5  ARG P HA   2  
ATOM 1297  H HB2  . ARG A 1 7  ? -6.358  5.875   18.793  1.00 0.00 ? 5  ARG P HB2  2  
ATOM 1298  H HB3  . ARG A 1 7  ? -5.246  6.711   19.873  1.00 0.00 ? 5  ARG P HB3  2  
ATOM 1299  H HG2  . ARG A 1 7  ? -5.031  8.562   18.196  1.00 0.00 ? 5  ARG P HG2  2  
ATOM 1300  H HG3  . ARG A 1 7  ? -6.177  7.715   17.138  1.00 0.00 ? 5  ARG P HG3  2  
ATOM 1301  H HD2  . ARG A 1 7  ? -7.906  7.843   18.900  1.00 0.00 ? 5  ARG P HD2  2  
ATOM 1302  H HD3  . ARG A 1 7  ? -6.763  8.702   19.957  1.00 0.00 ? 5  ARG P HD3  2  
ATOM 1303  H HE   . ARG A 1 7  ? -6.911  10.107  17.491  1.00 0.00 ? 5  ARG P HE   2  
ATOM 1304  H HH11 . ARG A 1 7  ? -9.037  9.483   20.206  1.00 0.00 ? 5  ARG P HH11 2  
ATOM 1305  H HH12 . ARG A 1 7  ? -9.928  10.962  19.967  1.00 0.00 ? 5  ARG P HH12 2  
ATOM 1306  H HH21 . ARG A 1 7  ? -8.087  11.976  17.243  1.00 0.00 ? 5  ARG P HH21 2  
ATOM 1307  H HH22 . ARG A 1 7  ? -9.398  12.332  18.329  1.00 0.00 ? 5  ARG P HH22 2  
ATOM 1308  N N    . THR A 1 8  ? -4.015  6.244   15.736  1.00 0.00 ? 6  THR P N    2  
ATOM 1309  C CA   . THR A 1 8  ? -4.277  6.138   14.287  1.00 0.00 ? 6  THR P CA   2  
ATOM 1310  C C    . THR A 1 8  ? -3.301  5.164   13.616  1.00 0.00 ? 6  THR P C    2  
ATOM 1311  O O    . THR A 1 8  ? -2.094  5.218   13.858  1.00 0.00 ? 6  THR P O    2  
ATOM 1312  C CB   . THR A 1 8  ? -4.219  7.525   13.617  1.00 0.00 ? 6  THR P CB   2  
ATOM 1313  O OG1  . THR A 1 8  ? -4.967  8.458   14.373  1.00 0.00 ? 6  THR P OG1  2  
ATOM 1314  C CG2  . THR A 1 8  ? -4.815  7.523   12.209  1.00 0.00 ? 6  THR P CG2  2  
ATOM 1315  H H    . THR A 1 8  ? -3.416  6.991   16.047  1.00 0.00 ? 6  THR P H    2  
ATOM 1316  H HA   . THR A 1 8  ? -5.289  5.757   14.146  1.00 0.00 ? 6  THR P HA   2  
ATOM 1317  H HB   . THR A 1 8  ? -3.181  7.861   13.571  1.00 0.00 ? 6  THR P HB   2  
ATOM 1318  H HG1  . THR A 1 8  ? -4.840  9.334   13.968  1.00 0.00 ? 6  THR P HG1  2  
ATOM 1319  H HG21 . THR A 1 8  ? -5.851  7.179   12.239  1.00 0.00 ? 6  THR P HG21 2  
ATOM 1320  H HG22 . THR A 1 8  ? -4.237  6.875   11.556  1.00 0.00 ? 6  THR P HG22 2  
ATOM 1321  H HG23 . THR A 1 8  ? -4.786  8.532   11.796  1.00 0.00 ? 6  THR P HG23 2  
ATOM 1322  N N    . HIS A 1 9  ? -3.813  4.278   12.751  1.00 0.00 ? 7  HIS P N    2  
ATOM 1323  C CA   . HIS A 1 9  ? -3.039  3.193   12.111  1.00 0.00 ? 7  HIS P CA   2  
ATOM 1324  C C    . HIS A 1 9  ? -2.416  3.563   10.751  1.00 0.00 ? 7  HIS P C    2  
ATOM 1325  O O    . HIS A 1 9  ? -1.685  2.752   10.175  1.00 0.00 ? 7  HIS P O    2  
ATOM 1326  C CB   . HIS A 1 9  ? -3.930  1.944   12.008  1.00 0.00 ? 7  HIS P CB   2  
ATOM 1327  C CG   . HIS A 1 9  ? -4.355  1.410   13.354  1.00 0.00 ? 7  HIS P CG   2  
ATOM 1328  N ND1  . HIS A 1 9  ? -3.533  0.711   14.244  1.00 0.00 ? 7  HIS P ND1  2  
ATOM 1329  C CD2  . HIS A 1 9  ? -5.586  1.564   13.920  1.00 0.00 ? 7  HIS P CD2  2  
ATOM 1330  C CE1  . HIS A 1 9  ? -4.291  0.460   15.326  1.00 0.00 ? 7  HIS P CE1  2  
ATOM 1331  N NE2  . HIS A 1 9  ? -5.528  0.960   15.156  1.00 0.00 ? 7  HIS P NE2  2  
ATOM 1332  H H    . HIS A 1 9  ? -4.813  4.283   12.609  1.00 0.00 ? 7  HIS P H    2  
ATOM 1333  H HA   . HIS A 1 9  ? -2.202  2.933   12.760  1.00 0.00 ? 7  HIS P HA   2  
ATOM 1334  H HB2  . HIS A 1 9  ? -4.814  2.174   11.414  1.00 0.00 ? 7  HIS P HB2  2  
ATOM 1335  H HB3  . HIS A 1 9  ? -3.384  1.153   11.496  1.00 0.00 ? 7  HIS P HB3  2  
ATOM 1336  H HD2  . HIS A 1 9  ? -6.434  2.075   13.481  1.00 0.00 ? 7  HIS P HD2  2  
ATOM 1337  H HE1  . HIS A 1 9  ? -3.955  -0.068  16.212  1.00 0.00 ? 7  HIS P HE1  2  
ATOM 1338  H HE2  . HIS A 1 9  ? -6.277  0.908   15.840  1.00 0.00 ? 7  HIS P HE2  2  
ATOM 1339  N N    . PHE A 1 10 ? -2.692  4.768   10.247  1.00 0.00 ? 8  PHE P N    2  
ATOM 1340  C CA   . PHE A 1 10 ? -2.290  5.279   8.929   1.00 0.00 ? 8  PHE P CA   2  
ATOM 1341  C C    . PHE A 1 10 ? -1.734  6.710   9.017   1.00 0.00 ? 8  PHE P C    2  
ATOM 1342  O O    . PHE A 1 10 ? -1.957  7.414   10.007  1.00 0.00 ? 8  PHE P O    2  
ATOM 1343  C CB   . PHE A 1 10 ? -3.498  5.259   7.980   1.00 0.00 ? 8  PHE P CB   2  
ATOM 1344  C CG   . PHE A 1 10 ? -4.138  3.899   7.781   1.00 0.00 ? 8  PHE P CG   2  
ATOM 1345  C CD1  . PHE A 1 10 ? -5.173  3.470   8.637   1.00 0.00 ? 8  PHE P CD1  2  
ATOM 1346  C CD2  . PHE A 1 10 ? -3.703  3.062   6.737   1.00 0.00 ? 8  PHE P CD2  2  
ATOM 1347  C CE1  . PHE A 1 10 ? -5.751  2.200   8.466   1.00 0.00 ? 8  PHE P CE1  2  
ATOM 1348  C CE2  . PHE A 1 10 ? -4.298  1.802   6.552   1.00 0.00 ? 8  PHE P CE2  2  
ATOM 1349  C CZ   . PHE A 1 10 ? -5.311  1.366   7.426   1.00 0.00 ? 8  PHE P CZ   2  
ATOM 1350  H H    . PHE A 1 10 ? -3.247  5.387   10.818  1.00 0.00 ? 8  PHE P H    2  
ATOM 1351  H HA   . PHE A 1 10 ? -1.514  4.642   8.505   1.00 0.00 ? 8  PHE P HA   2  
ATOM 1352  H HB2  . PHE A 1 10 ? -4.252  5.949   8.361   1.00 0.00 ? 8  PHE P HB2  2  
ATOM 1353  H HB3  . PHE A 1 10 ? -3.177  5.631   7.006   1.00 0.00 ? 8  PHE P HB3  2  
ATOM 1354  H HD1  . PHE A 1 10 ? -5.517  4.115   9.434   1.00 0.00 ? 8  PHE P HD1  2  
ATOM 1355  H HD2  . PHE A 1 10 ? -2.915  3.392   6.074   1.00 0.00 ? 8  PHE P HD2  2  
ATOM 1356  H HE1  . PHE A 1 10 ? -6.537  1.867   9.131   1.00 0.00 ? 8  PHE P HE1  2  
ATOM 1357  H HE2  . PHE A 1 10 ? -3.979  1.171   5.735   1.00 0.00 ? 8  PHE P HE2  2  
ATOM 1358  H HZ   . PHE A 1 10 ? -5.758  0.391   7.296   1.00 0.00 ? 8  PHE P HZ   2  
ATOM 1359  N N    . THR A 1 11 ? -1.061  7.165   7.958   1.00 0.00 ? 9  THR P N    2  
ATOM 1360  C CA   . THR A 1 11 ? -0.621  8.564   7.786   1.00 0.00 ? 9  THR P CA   2  
ATOM 1361  C C    . THR A 1 11 ? -1.557  9.327   6.854   1.00 0.00 ? 9  THR P C    2  
ATOM 1362  O O    . THR A 1 11 ? -2.218  8.737   5.995   1.00 0.00 ? 9  THR P O    2  
ATOM 1363  C CB   . THR A 1 11 ? 0.824   8.695   7.267   1.00 0.00 ? 9  THR P CB   2  
ATOM 1364  O OG1  . THR A 1 11 ? 0.882   8.530   5.865   1.00 0.00 ? 9  THR P OG1  2  
ATOM 1365  C CG2  . THR A 1 11 ? 1.792   7.700   7.899   1.00 0.00 ? 9  THR P CG2  2  
ATOM 1366  H H    . THR A 1 11 ? -0.923  6.532   7.180   1.00 0.00 ? 9  THR P H    2  
ATOM 1367  H HA   . THR A 1 11 ? -0.648  9.063   8.755   1.00 0.00 ? 9  THR P HA   2  
ATOM 1368  H HB   . THR A 1 11 ? 1.172   9.702   7.498   1.00 0.00 ? 9  THR P HB   2  
ATOM 1369  H HG1  . THR A 1 11 ? 1.817   8.617   5.609   1.00 0.00 ? 9  THR P HG1  2  
ATOM 1370  H HG21 . THR A 1 11 ? 1.729   7.767   8.984   1.00 0.00 ? 9  THR P HG21 2  
ATOM 1371  H HG22 . THR A 1 11 ? 2.809   7.927   7.582   1.00 0.00 ? 9  THR P HG22 2  
ATOM 1372  H HG23 . THR A 1 11 ? 1.539   6.688   7.586   1.00 0.00 ? 9  THR P HG23 2  
ATOM 1373  N N    . SER A 1 12 ? -1.547  10.659  6.944   1.00 0.00 ? 10 SER P N    2  
ATOM 1374  C CA   . SER A 1 12 ? -2.312  11.540  6.050   1.00 0.00 ? 10 SER P CA   2  
ATOM 1375  C C    . SER A 1 12 ? -1.925  11.424  4.566   1.00 0.00 ? 10 SER P C    2  
ATOM 1376  O O    . SER A 1 12 ? -2.662  11.931  3.721   1.00 0.00 ? 10 SER P O    2  
ATOM 1377  C CB   . SER A 1 12 ? -2.191  12.999  6.501   1.00 0.00 ? 10 SER P CB   2  
ATOM 1378  O OG   . SER A 1 12 ? -2.435  13.126  7.896   1.00 0.00 ? 10 SER P OG   2  
ATOM 1379  H H    . SER A 1 12 ? -1.025  11.099  7.690   1.00 0.00 ? 10 SER P H    2  
ATOM 1380  H HA   . SER A 1 12 ? -3.364  11.273  6.124   1.00 0.00 ? 10 SER P HA   2  
ATOM 1381  H HB2  . SER A 1 12 ? -1.189  13.365  6.272   1.00 0.00 ? 10 SER P HB2  2  
ATOM 1382  H HB3  . SER A 1 12 ? -2.925  13.589  5.951   1.00 0.00 ? 10 SER P HB3  2  
ATOM 1383  H HG   . SER A 1 12 ? -2.376  14.073  8.134   1.00 0.00 ? 10 SER P HG   2  
ATOM 1384  N N    . GLN A 1 13 ? -0.815  10.747  4.235   1.00 0.00 ? 11 GLN P N    2  
ATOM 1385  C CA   . GLN A 1 13 ? -0.384  10.443  2.864   1.00 0.00 ? 11 GLN P CA   2  
ATOM 1386  C C    . GLN A 1 13 ? -0.815  9.034   2.408   1.00 0.00 ? 11 GLN P C    2  
ATOM 1387  O O    . GLN A 1 13 ? -1.286  8.879   1.282   1.00 0.00 ? 11 GLN P O    2  
ATOM 1388  C CB   . GLN A 1 13 ? 1.138   10.643  2.773   1.00 0.00 ? 11 GLN P CB   2  
ATOM 1389  C CG   . GLN A 1 13 ? 1.655   10.568  1.328   1.00 0.00 ? 11 GLN P CG   2  
ATOM 1390  C CD   . GLN A 1 13 ? 3.147   10.892  1.243   1.00 0.00 ? 11 GLN P CD   2  
ATOM 1391  O OE1  . GLN A 1 13 ? 3.555   11.998  0.911   1.00 0.00 ? 11 GLN P OE1  2  
ATOM 1392  N NE2  . GLN A 1 13 ? 4.021   9.954   1.548   1.00 0.00 ? 11 GLN P NE2  2  
ATOM 1393  H H    . GLN A 1 13 ? -0.265  10.353  4.987   1.00 0.00 ? 11 GLN P H    2  
ATOM 1394  H HA   . GLN A 1 13 ? -0.847  11.159  2.184   1.00 0.00 ? 11 GLN P HA   2  
ATOM 1395  H HB2  . GLN A 1 13 ? 1.384   11.628  3.174   1.00 0.00 ? 11 GLN P HB2  2  
ATOM 1396  H HB3  . GLN A 1 13 ? 1.643   9.890   3.379   1.00 0.00 ? 11 GLN P HB3  2  
ATOM 1397  H HG2  . GLN A 1 13 ? 1.487   9.568   0.928   1.00 0.00 ? 11 GLN P HG2  2  
ATOM 1398  H HG3  . GLN A 1 13 ? 1.105   11.280  0.712   1.00 0.00 ? 11 GLN P HG3  2  
ATOM 1399  H HE21 . GLN A 1 13 ? 3.710   9.035   1.827   1.00 0.00 ? 11 GLN P HE21 2  
ATOM 1400  H HE22 . GLN A 1 13 ? 5.002   10.179  1.493   1.00 0.00 ? 11 GLN P HE22 2  
ATOM 1401  N N    . GLN A 1 14 ? -0.727  8.013   3.272   1.00 0.00 ? 12 GLN P N    2  
ATOM 1402  C CA   . GLN A 1 14 ? -1.141  6.633   2.949   1.00 0.00 ? 12 GLN P CA   2  
ATOM 1403  C C    . GLN A 1 14 ? -2.630  6.558   2.592   1.00 0.00 ? 12 GLN P C    2  
ATOM 1404  O O    . GLN A 1 14 ? -3.020  5.915   1.616   1.00 0.00 ? 12 GLN P O    2  
ATOM 1405  C CB   . GLN A 1 14 ? -0.886  5.717   4.153   1.00 0.00 ? 12 GLN P CB   2  
ATOM 1406  C CG   . GLN A 1 14 ? 0.603   5.474   4.398   1.00 0.00 ? 12 GLN P CG   2  
ATOM 1407  C CD   . GLN A 1 14 ? 0.850   4.655   5.662   1.00 0.00 ? 12 GLN P CD   2  
ATOM 1408  O OE1  . GLN A 1 14 ? 0.128   4.730   6.647   1.00 0.00 ? 12 GLN P OE1  2  
ATOM 1409  N NE2  . GLN A 1 14 ? 1.876   3.839   5.674   1.00 0.00 ? 12 GLN P NE2  2  
ATOM 1410  H H    . GLN A 1 14 ? -0.373  8.200   4.205   1.00 0.00 ? 12 GLN P H    2  
ATOM 1411  H HA   . GLN A 1 14 ? -0.568  6.265   2.096   1.00 0.00 ? 12 GLN P HA   2  
ATOM 1412  H HB2  . GLN A 1 14 ? -1.345  6.157   5.041   1.00 0.00 ? 12 GLN P HB2  2  
ATOM 1413  H HB3  . GLN A 1 14 ? -1.350  4.748   3.964   1.00 0.00 ? 12 GLN P HB3  2  
ATOM 1414  H HG2  . GLN A 1 14 ? 1.007   4.946   3.536   1.00 0.00 ? 12 GLN P HG2  2  
ATOM 1415  H HG3  . GLN A 1 14 ? 1.129   6.419   4.491   1.00 0.00 ? 12 GLN P HG3  2  
ATOM 1416  H HE21 . GLN A 1 14 ? 2.390   3.697   4.810   1.00 0.00 ? 12 GLN P HE21 2  
ATOM 1417  H HE22 . GLN A 1 14 ? 2.008   3.225   6.457   1.00 0.00 ? 12 GLN P HE22 2  
ATOM 1418  N N    . LEU A 1 15 ? -3.453  7.278   3.360   1.00 0.00 ? 13 LEU P N    2  
ATOM 1419  C CA   . LEU A 1 15 ? -4.900  7.400   3.157   1.00 0.00 ? 13 LEU P CA   2  
ATOM 1420  C C    . LEU A 1 15 ? -5.275  7.906   1.751   1.00 0.00 ? 13 LEU P C    2  
ATOM 1421  O O    . LEU A 1 15 ? -6.298  7.494   1.207   1.00 0.00 ? 13 LEU P O    2  
ATOM 1422  C CB   . LEU A 1 15 ? -5.448  8.356   4.227   1.00 0.00 ? 13 LEU P CB   2  
ATOM 1423  C CG   . LEU A 1 15 ? -5.300  7.825   5.668   1.00 0.00 ? 13 LEU P CG   2  
ATOM 1424  C CD1  . LEU A 1 15 ? -5.522  8.949   6.674   1.00 0.00 ? 13 LEU P CD1  2  
ATOM 1425  C CD2  . LEU A 1 15 ? -6.265  6.683   5.961   1.00 0.00 ? 13 LEU P CD2  2  
ATOM 1426  H H    . LEU A 1 15 ? -3.040  7.734   4.171   1.00 0.00 ? 13 LEU P H    2  
ATOM 1427  H HA   . LEU A 1 15 ? -5.369  6.425   3.278   1.00 0.00 ? 13 LEU P HA   2  
ATOM 1428  H HB2  . LEU A 1 15 ? -4.919  9.307   4.141   1.00 0.00 ? 13 LEU P HB2  2  
ATOM 1429  H HB3  . LEU A 1 15 ? -6.503  8.544   4.015   1.00 0.00 ? 13 LEU P HB3  2  
ATOM 1430  H HG   . LEU A 1 15 ? -4.297  7.439   5.820   1.00 0.00 ? 13 LEU P HG   2  
ATOM 1431  H HD11 . LEU A 1 15 ? -5.340  8.575   7.682   1.00 0.00 ? 13 LEU P HD11 2  
ATOM 1432  H HD12 . LEU A 1 15 ? -4.811  9.750   6.475   1.00 0.00 ? 13 LEU P HD12 2  
ATOM 1433  H HD13 . LEU A 1 15 ? -6.537  9.335   6.594   1.00 0.00 ? 13 LEU P HD13 2  
ATOM 1434  H HD21 . LEU A 1 15 ? -6.184  6.396   7.009   1.00 0.00 ? 13 LEU P HD21 2  
ATOM 1435  H HD22 . LEU A 1 15 ? -7.285  6.999   5.749   1.00 0.00 ? 13 LEU P HD22 2  
ATOM 1436  H HD23 . LEU A 1 15 ? -5.986  5.823   5.353   1.00 0.00 ? 13 LEU P HD23 2  
ATOM 1437  N N    . GLN A 1 16 ? -4.429  8.748   1.147   1.00 0.00 ? 14 GLN P N    2  
ATOM 1438  C CA   . GLN A 1 16 ? -4.651  9.295   -0.199  1.00 0.00 ? 14 GLN P CA   2  
ATOM 1439  C C    . GLN A 1 16 ? -4.511  8.214   -1.276  1.00 0.00 ? 14 GLN P C    2  
ATOM 1440  O O    . GLN A 1 16 ? -5.308  8.158   -2.211  1.00 0.00 ? 14 GLN P O    2  
ATOM 1441  C CB   . GLN A 1 16 ? -3.678  10.448  -0.509  1.00 0.00 ? 14 GLN P CB   2  
ATOM 1442  C CG   . GLN A 1 16 ? -3.578  11.520  0.583   1.00 0.00 ? 14 GLN P CG   2  
ATOM 1443  C CD   . GLN A 1 16 ? -4.910  12.160  0.970   1.00 0.00 ? 14 GLN P CD   2  
ATOM 1444  O OE1  . GLN A 1 16 ? -5.801  12.387  0.161   1.00 0.00 ? 14 GLN P OE1  2  
ATOM 1445  N NE2  . GLN A 1 16 ? -5.082  12.488  2.232   1.00 0.00 ? 14 GLN P NE2  2  
ATOM 1446  H H    . GLN A 1 16 ? -3.567  8.967   1.626   1.00 0.00 ? 14 GLN P H    2  
ATOM 1447  H HA   . GLN A 1 16 ? -5.665  9.688   -0.250  1.00 0.00 ? 14 GLN P HA   2  
ATOM 1448  H HB2  . GLN A 1 16 ? -2.680  10.042  -0.664  1.00 0.00 ? 14 GLN P HB2  2  
ATOM 1449  H HB3  . GLN A 1 16 ? -3.990  10.921  -1.440  1.00 0.00 ? 14 GLN P HB3  2  
ATOM 1450  H HG2  . GLN A 1 16 ? -3.135  11.058  1.460   1.00 0.00 ? 14 GLN P HG2  2  
ATOM 1451  H HG3  . GLN A 1 16 ? -2.901  12.307  0.249   1.00 0.00 ? 14 GLN P HG3  2  
ATOM 1452  H HE21 . GLN A 1 16 ? -4.324  12.316  2.888   1.00 0.00 ? 14 GLN P HE21 2  
ATOM 1453  H HE22 . GLN A 1 16 ? -5.948  12.919  2.512   1.00 0.00 ? 14 GLN P HE22 2  
ATOM 1454  N N    . GLU A 1 17 ? -3.528  7.322   -1.135  1.00 0.00 ? 15 GLU P N    2  
ATOM 1455  C CA   . GLU A 1 17 ? -3.299  6.218   -2.075  1.00 0.00 ? 15 GLU P CA   2  
ATOM 1456  C C    . GLU A 1 17 ? -4.362  5.119   -1.935  1.00 0.00 ? 15 GLU P C    2  
ATOM 1457  O O    . GLU A 1 17 ? -4.746  4.499   -2.927  1.00 0.00 ? 15 GLU P O    2  
ATOM 1458  C CB   . GLU A 1 17 ? -1.886  5.640   -1.894  1.00 0.00 ? 15 GLU P CB   2  
ATOM 1459  C CG   . GLU A 1 17 ? -0.761  6.688   -1.957  1.00 0.00 ? 15 GLU P CG   2  
ATOM 1460  C CD   . GLU A 1 17 ? -0.820  7.604   -3.201  1.00 0.00 ? 15 GLU P CD   2  
ATOM 1461  O OE1  . GLU A 1 17 ? -1.120  7.122   -4.320  1.00 0.00 ? 15 GLU P OE1  2  
ATOM 1462  O OE2  . GLU A 1 17 ? -0.540  8.821   -3.068  1.00 0.00 ? 15 GLU P OE2  2  
ATOM 1463  H H    . GLU A 1 17 ? -2.925  7.397   -0.325  1.00 0.00 ? 15 GLU P H    2  
ATOM 1464  H HA   . GLU A 1 17 ? -3.381  6.596   -3.092  1.00 0.00 ? 15 GLU P HA   2  
ATOM 1465  H HB2  . GLU A 1 17 ? -1.830  5.135   -0.929  1.00 0.00 ? 15 GLU P HB2  2  
ATOM 1466  H HB3  . GLU A 1 17 ? -1.715  4.892   -2.669  1.00 0.00 ? 15 GLU P HB3  2  
ATOM 1467  H HG2  . GLU A 1 17 ? -0.803  7.293   -1.049  1.00 0.00 ? 15 GLU P HG2  2  
ATOM 1468  H HG3  . GLU A 1 17 ? 0.196   6.164   -1.940  1.00 0.00 ? 15 GLU P HG3  2  
ATOM 1469  N N    . LEU A 1 18 ? -4.893  4.930   -0.723  1.00 0.00 ? 16 LEU P N    2  
ATOM 1470  C CA   . LEU A 1 18 ? -6.001  4.020   -0.440  1.00 0.00 ? 16 LEU P CA   2  
ATOM 1471  C C    . LEU A 1 18 ? -7.309  4.505   -1.084  1.00 0.00 ? 16 LEU P C    2  
ATOM 1472  O O    . LEU A 1 18 ? -7.924  3.761   -1.846  1.00 0.00 ? 16 LEU P O    2  
ATOM 1473  C CB   . LEU A 1 18 ? -6.125  3.860   1.082   1.00 0.00 ? 16 LEU P CB   2  
ATOM 1474  C CG   . LEU A 1 18 ? -4.992  3.007   1.684   1.00 0.00 ? 16 LEU P CG   2  
ATOM 1475  C CD1  . LEU A 1 18 ? -4.816  3.312   3.166   1.00 0.00 ? 16 LEU P CD1  2  
ATOM 1476  C CD2  . LEU A 1 18 ? -5.301  1.518   1.530   1.00 0.00 ? 16 LEU P CD2  2  
ATOM 1477  H H    . LEU A 1 18 ? -4.516  5.471   0.046   1.00 0.00 ? 16 LEU P H    2  
ATOM 1478  H HA   . LEU A 1 18 ? -5.780  3.044   -0.875  1.00 0.00 ? 16 LEU P HA   2  
ATOM 1479  H HB2  . LEU A 1 18 ? -6.127  4.848   1.541   1.00 0.00 ? 16 LEU P HB2  2  
ATOM 1480  H HB3  . LEU A 1 18 ? -7.078  3.390   1.308   1.00 0.00 ? 16 LEU P HB3  2  
ATOM 1481  H HG   . LEU A 1 18 ? -4.049  3.224   1.186   1.00 0.00 ? 16 LEU P HG   2  
ATOM 1482  H HD11 . LEU A 1 18 ? -4.559  4.362   3.290   1.00 0.00 ? 16 LEU P HD11 2  
ATOM 1483  H HD12 . LEU A 1 18 ? -5.738  3.095   3.697   1.00 0.00 ? 16 LEU P HD12 2  
ATOM 1484  H HD13 . LEU A 1 18 ? -4.014  2.703   3.574   1.00 0.00 ? 16 LEU P HD13 2  
ATOM 1485  H HD21 . LEU A 1 18 ? -6.247  1.277   2.014   1.00 0.00 ? 16 LEU P HD21 2  
ATOM 1486  H HD22 . LEU A 1 18 ? -5.361  1.265   0.472   1.00 0.00 ? 16 LEU P HD22 2  
ATOM 1487  H HD23 . LEU A 1 18 ? -4.505  0.934   1.988   1.00 0.00 ? 16 LEU P HD23 2  
ATOM 1488  N N    . GLU A 1 19 ? -7.707  5.766   -0.879  1.00 0.00 ? 17 GLU P N    2  
ATOM 1489  C CA   . GLU A 1 19 ? -8.907  6.310   -1.536  1.00 0.00 ? 17 GLU P CA   2  
ATOM 1490  C C    . GLU A 1 19 ? -8.746  6.510   -3.053  1.00 0.00 ? 17 GLU P C    2  
ATOM 1491  O O    . GLU A 1 19 ? -9.745  6.467   -3.770  1.00 0.00 ? 17 GLU P O    2  
ATOM 1492  C CB   . GLU A 1 19 ? -9.422  7.579   -0.832  1.00 0.00 ? 17 GLU P CB   2  
ATOM 1493  C CG   . GLU A 1 19 ? -8.603  8.850   -1.088  1.00 0.00 ? 17 GLU P CG   2  
ATOM 1494  C CD   . GLU A 1 19 ? -9.259  10.068  -0.406  1.00 0.00 ? 17 GLU P CD   2  
ATOM 1495  O OE1  . GLU A 1 19 ? -9.126  10.232  0.831   1.00 0.00 ? 17 GLU P OE1  2  
ATOM 1496  O OE2  . GLU A 1 19 ? -9.927  10.868  -1.106  1.00 0.00 ? 17 GLU P OE2  2  
ATOM 1497  H H    . GLU A 1 19 ? -7.201  6.334   -0.208  1.00 0.00 ? 17 GLU P H    2  
ATOM 1498  H HA   . GLU A 1 19 ? -9.700  5.563   -1.436  1.00 0.00 ? 17 GLU P HA   2  
ATOM 1499  H HB2  . GLU A 1 19 ? -10.442 7.760   -1.172  1.00 0.00 ? 17 GLU P HB2  2  
ATOM 1500  H HB3  . GLU A 1 19 ? -9.459  7.393   0.242   1.00 0.00 ? 17 GLU P HB3  2  
ATOM 1501  H HG2  . GLU A 1 19 ? -7.593  8.708   -0.710  1.00 0.00 ? 17 GLU P HG2  2  
ATOM 1502  H HG3  . GLU A 1 19 ? -8.533  9.027   -2.164  1.00 0.00 ? 17 GLU P HG3  2  
ATOM 1503  N N    . ALA A 1 20 ? -7.518  6.664   -3.563  1.00 0.00 ? 18 ALA P N    2  
ATOM 1504  C CA   . ALA A 1 20 ? -7.243  6.696   -5.001  1.00 0.00 ? 18 ALA P CA   2  
ATOM 1505  C C    . ALA A 1 20 ? -7.339  5.301   -5.643  1.00 0.00 ? 18 ALA P C    2  
ATOM 1506  O O    . ALA A 1 20 ? -8.023  5.135   -6.654  1.00 0.00 ? 18 ALA P O    2  
ATOM 1507  C CB   . ALA A 1 20 ? -5.872  7.338   -5.244  1.00 0.00 ? 18 ALA P CB   2  
ATOM 1508  H H    . ALA A 1 20 ? -6.742  6.782   -2.923  1.00 0.00 ? 18 ALA P H    2  
ATOM 1509  H HA   . ALA A 1 20 ? -7.990  7.328   -5.484  1.00 0.00 ? 18 ALA P HA   2  
ATOM 1510  H HB1  . ALA A 1 20 ? -5.089  6.753   -4.761  1.00 0.00 ? 18 ALA P HB1  2  
ATOM 1511  H HB2  . ALA A 1 20 ? -5.673  7.381   -6.315  1.00 0.00 ? 18 ALA P HB2  2  
ATOM 1512  H HB3  . ALA A 1 20 ? -5.864  8.354   -4.847  1.00 0.00 ? 18 ALA P HB3  2  
ATOM 1513  N N    . THR A 1 21 ? -6.722  4.270   -5.050  1.00 0.00 ? 19 THR P N    2  
ATOM 1514  C CA   . THR A 1 21 ? -6.776  2.903   -5.603  1.00 0.00 ? 19 THR P CA   2  
ATOM 1515  C C    . THR A 1 21 ? -8.162  2.263   -5.456  1.00 0.00 ? 19 THR P C    2  
ATOM 1516  O O    . THR A 1 21 ? -8.558  1.454   -6.294  1.00 0.00 ? 19 THR P O    2  
ATOM 1517  C CB   . THR A 1 21 ? -5.655  2.016   -5.041  1.00 0.00 ? 19 THR P CB   2  
ATOM 1518  O OG1  . THR A 1 21 ? -5.422  0.959   -5.949  1.00 0.00 ? 19 THR P OG1  2  
ATOM 1519  C CG2  . THR A 1 21 ? -5.960  1.399   -3.678  1.00 0.00 ? 19 THR P CG2  2  
ATOM 1520  H H    . THR A 1 21 ? -6.156  4.442   -4.222  1.00 0.00 ? 19 THR P H    2  
ATOM 1521  H HA   . THR A 1 21 ? -6.581  2.991   -6.669  1.00 0.00 ? 19 THR P HA   2  
ATOM 1522  H HB   . THR A 1 21 ? -4.744  2.611   -4.969  1.00 0.00 ? 19 THR P HB   2  
ATOM 1523  H HG1  . THR A 1 21 ? -6.191  0.363   -5.904  1.00 0.00 ? 19 THR P HG1  2  
ATOM 1524  H HG21 . THR A 1 21 ? -5.029  1.129   -3.185  1.00 0.00 ? 19 THR P HG21 2  
ATOM 1525  H HG22 . THR A 1 21 ? -6.584  0.511   -3.799  1.00 0.00 ? 19 THR P HG22 2  
ATOM 1526  H HG23 . THR A 1 21 ? -6.465  2.122   -3.046  1.00 0.00 ? 19 THR P HG23 2  
ATOM 1527  N N    . PHE A 1 22 ? -8.949  2.702   -4.468  1.00 0.00 ? 20 PHE P N    2  
ATOM 1528  C CA   . PHE A 1 22 ? -10.366 2.362   -4.298  1.00 0.00 ? 20 PHE P CA   2  
ATOM 1529  C C    . PHE A 1 22 ? -11.203 2.746   -5.534  1.00 0.00 ? 20 PHE P C    2  
ATOM 1530  O O    . PHE A 1 22 ? -12.176 2.063   -5.845  1.00 0.00 ? 20 PHE P O    2  
ATOM 1531  C CB   . PHE A 1 22 ? -10.868 3.056   -3.016  1.00 0.00 ? 20 PHE P CB   2  
ATOM 1532  C CG   . PHE A 1 22 ? -12.325 2.817   -2.649  1.00 0.00 ? 20 PHE P CG   2  
ATOM 1533  C CD1  . PHE A 1 22 ? -13.344 3.579   -3.251  1.00 0.00 ? 20 PHE P CD1  2  
ATOM 1534  C CD2  . PHE A 1 22 ? -12.664 1.854   -1.680  1.00 0.00 ? 20 PHE P CD2  2  
ATOM 1535  C CE1  . PHE A 1 22 ? -14.691 3.353   -2.917  1.00 0.00 ? 20 PHE P CE1  2  
ATOM 1536  C CE2  . PHE A 1 22 ? -14.011 1.620   -1.351  1.00 0.00 ? 20 PHE P CE2  2  
ATOM 1537  C CZ   . PHE A 1 22 ? -15.027 2.368   -1.971  1.00 0.00 ? 20 PHE P CZ   2  
ATOM 1538  H H    . PHE A 1 22 ? -8.542  3.335   -3.793  1.00 0.00 ? 20 PHE P H    2  
ATOM 1539  H HA   . PHE A 1 22 ? -10.459 1.283   -4.163  1.00 0.00 ? 20 PHE P HA   2  
ATOM 1540  H HB2  . PHE A 1 22 ? -10.258 2.709   -2.184  1.00 0.00 ? 20 PHE P HB2  2  
ATOM 1541  H HB3  . PHE A 1 22 ? -10.703 4.130   -3.099  1.00 0.00 ? 20 PHE P HB3  2  
ATOM 1542  H HD1  . PHE A 1 22 ? -13.087 4.335   -3.976  1.00 0.00 ? 20 PHE P HD1  2  
ATOM 1543  H HD2  . PHE A 1 22 ? -11.888 1.299   -1.180  1.00 0.00 ? 20 PHE P HD2  2  
ATOM 1544  H HE1  . PHE A 1 22 ? -15.471 3.933   -3.392  1.00 0.00 ? 20 PHE P HE1  2  
ATOM 1545  H HE2  . PHE A 1 22 ? -14.265 0.865   -0.618  1.00 0.00 ? 20 PHE P HE2  2  
ATOM 1546  H HZ   . PHE A 1 22 ? -16.064 2.191   -1.719  1.00 0.00 ? 20 PHE P HZ   2  
ATOM 1547  N N    . GLN A 1 23 ? -10.810 3.789   -6.285  1.00 0.00 ? 21 GLN P N    2  
ATOM 1548  C CA   . GLN A 1 23 ? -11.524 4.209   -7.499  1.00 0.00 ? 21 GLN P CA   2  
ATOM 1549  C C    . GLN A 1 23 ? -11.336 3.236   -8.677  1.00 0.00 ? 21 GLN P C    2  
ATOM 1550  O O    . GLN A 1 23 ? -12.296 2.969   -9.404  1.00 0.00 ? 21 GLN P O    2  
ATOM 1551  C CB   . GLN A 1 23 ? -11.088 5.617   -7.946  1.00 0.00 ? 21 GLN P CB   2  
ATOM 1552  C CG   . GLN A 1 23 ? -11.144 6.722   -6.884  1.00 0.00 ? 21 GLN P CG   2  
ATOM 1553  C CD   . GLN A 1 23 ? -12.453 6.767   -6.104  1.00 0.00 ? 21 GLN P CD   2  
ATOM 1554  O OE1  . GLN A 1 23 ? -13.549 6.777   -6.651  1.00 0.00 ? 21 GLN P OE1  2  
ATOM 1555  N NE2  . GLN A 1 23 ? -12.385 6.792   -4.793  1.00 0.00 ? 21 GLN P NE2  2  
ATOM 1556  H H    . GLN A 1 23 ? -9.985  4.306   -6.009  1.00 0.00 ? 21 GLN P H    2  
ATOM 1557  H HA   . GLN A 1 23 ? -12.589 4.228   -7.268  1.00 0.00 ? 21 GLN P HA   2  
ATOM 1558  H HB2  . GLN A 1 23 ? -10.060 5.562   -8.295  1.00 0.00 ? 21 GLN P HB2  2  
ATOM 1559  H HB3  . GLN A 1 23 ? -11.714 5.919   -8.788  1.00 0.00 ? 21 GLN P HB3  2  
ATOM 1560  H HG2  . GLN A 1 23 ? -10.315 6.574   -6.198  1.00 0.00 ? 21 GLN P HG2  2  
ATOM 1561  H HG3  . GLN A 1 23 ? -10.992 7.687   -7.366  1.00 0.00 ? 21 GLN P HG3  2  
ATOM 1562  H HE21 . GLN A 1 23 ? -11.473 6.761   -4.340  1.00 0.00 ? 21 GLN P HE21 2  
ATOM 1563  H HE22 . GLN A 1 23 ? -13.239 6.810   -4.266  1.00 0.00 ? 21 GLN P HE22 2  
ATOM 1564  N N    . ARG A 1 24 ? -10.121 2.692   -8.863  1.00 0.00 ? 22 ARG P N    2  
ATOM 1565  C CA   . ARG A 1 24 ? -9.823  1.697   -9.917  1.00 0.00 ? 22 ARG P CA   2  
ATOM 1566  C C    . ARG A 1 24 ? -10.202 0.271   -9.511  1.00 0.00 ? 22 ARG P C    2  
ATOM 1567  O O    . ARG A 1 24 ? -10.490 -0.552  -10.379 1.00 0.00 ? 22 ARG P O    2  
ATOM 1568  C CB   . ARG A 1 24 ? -8.353  1.782   -10.390 1.00 0.00 ? 22 ARG P CB   2  
ATOM 1569  C CG   . ARG A 1 24 ? -7.321  1.390   -9.320  1.00 0.00 ? 22 ARG P CG   2  
ATOM 1570  C CD   . ARG A 1 24 ? -5.910  1.175   -9.882  1.00 0.00 ? 22 ARG P CD   2  
ATOM 1571  N NE   . ARG A 1 24 ? -5.020  0.705   -8.803  1.00 0.00 ? 22 ARG P NE   2  
ATOM 1572  C CZ   . ARG A 1 24 ? -4.168  -0.303  -8.806  1.00 0.00 ? 22 ARG P CZ   2  
ATOM 1573  N NH1  . ARG A 1 24 ? -3.841  -0.997  -9.854  1.00 0.00 ? 22 ARG P NH1  2  
ATOM 1574  N NH2  . ARG A 1 24 ? -3.607  -0.671  -7.699  1.00 0.00 ? 22 ARG P NH2  2  
ATOM 1575  H H    . ARG A 1 24 ? -9.388  2.948   -8.212  1.00 0.00 ? 22 ARG P H    2  
ATOM 1576  H HA   . ARG A 1 24 ? -10.444 1.926   -10.785 1.00 0.00 ? 22 ARG P HA   2  
ATOM 1577  H HB2  . ARG A 1 24 ? -8.238  1.111   -11.243 1.00 0.00 ? 22 ARG P HB2  2  
ATOM 1578  H HB3  . ARG A 1 24 ? -8.142  2.796   -10.735 1.00 0.00 ? 22 ARG P HB3  2  
ATOM 1579  H HG2  . ARG A 1 24 ? -7.285  2.176   -8.569  1.00 0.00 ? 22 ARG P HG2  2  
ATOM 1580  H HG3  . ARG A 1 24 ? -7.622  0.461   -8.840  1.00 0.00 ? 22 ARG P HG3  2  
ATOM 1581  H HD2  . ARG A 1 24 ? -5.959  0.437   -10.684 1.00 0.00 ? 22 ARG P HD2  2  
ATOM 1582  H HD3  . ARG A 1 24 ? -5.533  2.114   -10.289 1.00 0.00 ? 22 ARG P HD3  2  
ATOM 1583  H HE   . ARG A 1 24 ? -5.146  1.133   -7.894  1.00 0.00 ? 22 ARG P HE   2  
ATOM 1584  H HH11 . ARG A 1 24 ? -4.212  -0.767  -10.758 1.00 0.00 ? 22 ARG P HH11 2  
ATOM 1585  H HH12 . ARG A 1 24 ? -3.185  -1.763  -9.715  1.00 0.00 ? 22 ARG P HH12 2  
ATOM 1586  H HH21 . ARG A 1 24 ? -3.876  -0.220  -6.834  1.00 0.00 ? 22 ARG P HH21 2  
ATOM 1587  H HH22 . ARG A 1 24 ? -2.978  -1.471  -7.736  1.00 0.00 ? 22 ARG P HH22 2  
ATOM 1588  N N    . ASN A 1 25 ? -10.200 -0.020  -8.208  1.00 0.00 ? 23 ASN P N    2  
ATOM 1589  C CA   . ASN A 1 25 ? -10.434 -1.348  -7.655  1.00 0.00 ? 23 ASN P CA   2  
ATOM 1590  C C    . ASN A 1 25 ? -11.331 -1.262  -6.411  1.00 0.00 ? 23 ASN P C    2  
ATOM 1591  O O    . ASN A 1 25 ? -10.867 -0.940  -5.319  1.00 0.00 ? 23 ASN P O    2  
ATOM 1592  C CB   . ASN A 1 25 ? -9.068  -1.994  -7.353  1.00 0.00 ? 23 ASN P CB   2  
ATOM 1593  C CG   . ASN A 1 25 ? -9.193  -3.476  -7.035  1.00 0.00 ? 23 ASN P CG   2  
ATOM 1594  O OD1  . ASN A 1 25 ? -10.268 -4.013  -6.809  1.00 0.00 ? 23 ASN P OD1  2  
ATOM 1595  N ND2  . ASN A 1 25 ? -8.090  -4.186  -7.039  1.00 0.00 ? 23 ASN P ND2  2  
ATOM 1596  H H    . ASN A 1 25 ? -9.910  0.702   -7.555  1.00 0.00 ? 23 ASN P H    2  
ATOM 1597  H HA   . ASN A 1 25 ? -10.945 -1.963  -8.399  1.00 0.00 ? 23 ASN P HA   2  
ATOM 1598  H HB2  . ASN A 1 25 ? -8.419  -1.889  -8.220  1.00 0.00 ? 23 ASN P HB2  2  
ATOM 1599  H HB3  . ASN A 1 25 ? -8.589  -1.484  -6.512  1.00 0.00 ? 23 ASN P HB3  2  
ATOM 1600  H HD21 . ASN A 1 25 ? -7.208  -3.747  -7.244  1.00 0.00 ? 23 ASN P HD21 2  
ATOM 1601  H HD22 . ASN A 1 25 ? -8.157  -5.176  -6.864  1.00 0.00 ? 23 ASN P HD22 2  
ATOM 1602  N N    . HIS A 1 26 ? -12.619 -1.569  -6.574  1.00 0.00 ? 24 HIS P N    2  
ATOM 1603  C CA   . HIS A 1 26 ? -13.620 -1.512  -5.497  1.00 0.00 ? 24 HIS P CA   2  
ATOM 1604  C C    . HIS A 1 26 ? -13.649 -2.792  -4.636  1.00 0.00 ? 24 HIS P C    2  
ATOM 1605  O O    . HIS A 1 26 ? -14.389 -2.855  -3.650  1.00 0.00 ? 24 HIS P O    2  
ATOM 1606  C CB   . HIS A 1 26 ? -14.999 -1.194  -6.105  1.00 0.00 ? 24 HIS P CB   2  
ATOM 1607  C CG   . HIS A 1 26 ? -15.160 0.221   -6.627  1.00 0.00 ? 24 HIS P CG   2  
ATOM 1608  N ND1  . HIS A 1 26 ? -16.095 1.149   -6.153  1.00 0.00 ? 24 HIS P ND1  2  
ATOM 1609  C CD2  . HIS A 1 26 ? -14.456 0.799   -7.647  1.00 0.00 ? 24 HIS P CD2  2  
ATOM 1610  C CE1  . HIS A 1 26 ? -15.918 2.264   -6.884  1.00 0.00 ? 24 HIS P CE1  2  
ATOM 1611  N NE2  . HIS A 1 26 ? -14.943 2.078   -7.791  1.00 0.00 ? 24 HIS P NE2  2  
ATOM 1612  H H    . HIS A 1 26 ? -12.932 -1.851  -7.492  1.00 0.00 ? 24 HIS P H    2  
ATOM 1613  H HA   . HIS A 1 26 ? -13.366 -0.696  -4.817  1.00 0.00 ? 24 HIS P HA   2  
ATOM 1614  H HB2  . HIS A 1 26 ? -15.207 -1.892  -6.917  1.00 0.00 ? 24 HIS P HB2  2  
ATOM 1615  H HB3  . HIS A 1 26 ? -15.761 -1.348  -5.342  1.00 0.00 ? 24 HIS P HB3  2  
ATOM 1616  H HD2  . HIS A 1 26 ? -13.652 0.356   -8.216  1.00 0.00 ? 24 HIS P HD2  2  
ATOM 1617  H HE1  . HIS A 1 26 ? -16.482 3.183   -6.764  1.00 0.00 ? 24 HIS P HE1  2  
ATOM 1618  H HE2  . HIS A 1 26 ? -14.611 2.773   -8.453  1.00 0.00 ? 24 HIS P HE2  2  
ATOM 1619  N N    . TYR A 1 27 ? -12.874 -3.822  -4.998  1.00 0.00 ? 25 TYR P N    2  
ATOM 1620  C CA   . TYR A 1 27 ? -12.857 -5.147  -4.363  1.00 0.00 ? 25 TYR P CA   2  
ATOM 1621  C C    . TYR A 1 27 ? -11.479 -5.845  -4.507  1.00 0.00 ? 25 TYR P C    2  
ATOM 1622  O O    . TYR A 1 27 ? -11.375 -6.893  -5.153  1.00 0.00 ? 25 TYR P O    2  
ATOM 1623  C CB   . TYR A 1 27 ? -14.046 -5.986  -4.894  1.00 0.00 ? 25 TYR P CB   2  
ATOM 1624  C CG   . TYR A 1 27 ? -14.310 -5.927  -6.395  1.00 0.00 ? 25 TYR P CG   2  
ATOM 1625  C CD1  . TYR A 1 27 ? -13.701 -6.846  -7.274  1.00 0.00 ? 25 TYR P CD1  2  
ATOM 1626  C CD2  . TYR A 1 27 ? -15.193 -4.955  -6.911  1.00 0.00 ? 25 TYR P CD2  2  
ATOM 1627  C CE1  . TYR A 1 27 ? -13.945 -6.773  -8.659  1.00 0.00 ? 25 TYR P CE1  2  
ATOM 1628  C CE2  . TYR A 1 27 ? -15.438 -4.875  -8.295  1.00 0.00 ? 25 TYR P CE2  2  
ATOM 1629  C CZ   . TYR A 1 27 ? -14.811 -5.785  -9.176  1.00 0.00 ? 25 TYR P CZ   2  
ATOM 1630  O OH   . TYR A 1 27 ? -15.041 -5.722  -10.516 1.00 0.00 ? 25 TYR P OH   2  
ATOM 1631  H H    . TYR A 1 27 ? -12.275 -3.697  -5.805  1.00 0.00 ? 25 TYR P H    2  
ATOM 1632  H HA   . TYR A 1 27 ? -13.009 -5.022  -3.294  1.00 0.00 ? 25 TYR P HA   2  
ATOM 1633  H HB2  . TYR A 1 27 ? -13.921 -7.027  -4.589  1.00 0.00 ? 25 TYR P HB2  2  
ATOM 1634  H HB3  . TYR A 1 27 ? -14.946 -5.634  -4.388  1.00 0.00 ? 25 TYR P HB3  2  
ATOM 1635  H HD1  . TYR A 1 27 ? -13.041 -7.612  -6.888  1.00 0.00 ? 25 TYR P HD1  2  
ATOM 1636  H HD2  . TYR A 1 27 ? -15.685 -4.265  -6.238  1.00 0.00 ? 25 TYR P HD2  2  
ATOM 1637  H HE1  . TYR A 1 27 ? -13.473 -7.472  -9.335  1.00 0.00 ? 25 TYR P HE1  2  
ATOM 1638  H HE2  . TYR A 1 27 ? -16.109 -4.123  -8.684  1.00 0.00 ? 25 TYR P HE2  2  
ATOM 1639  H HH   . TYR A 1 27 ? -15.658 -5.007  -10.752 1.00 0.00 ? 25 TYR P HH   2  
ATOM 1640  N N    . PRO A 1 28 ? -10.396 -5.291  -3.918  1.00 0.00 ? 26 PRO P N    2  
ATOM 1641  C CA   . PRO A 1 28 ? -9.055  -5.860  -4.043  1.00 0.00 ? 26 PRO P CA   2  
ATOM 1642  C C    . PRO A 1 28 ? -8.919  -7.203  -3.308  1.00 0.00 ? 26 PRO P C    2  
ATOM 1643  O O    . PRO A 1 28 ? -9.637  -7.503  -2.348  1.00 0.00 ? 26 PRO P O    2  
ATOM 1644  C CB   . PRO A 1 28 ? -8.103  -4.788  -3.509  1.00 0.00 ? 26 PRO P CB   2  
ATOM 1645  C CG   . PRO A 1 28 ? -8.949  -4.097  -2.444  1.00 0.00 ? 26 PRO P CG   2  
ATOM 1646  C CD   . PRO A 1 28 ? -10.346 -4.103  -3.073  1.00 0.00 ? 26 PRO P CD   2  
ATOM 1647  H HA   . PRO A 1 28 ? -8.831  -6.029  -5.095  1.00 0.00 ? 26 PRO P HA   2  
ATOM 1648  H HB2  . PRO A 1 28 ? -7.183  -5.204  -3.104  1.00 0.00 ? 26 PRO P HB2  2  
ATOM 1649  H HB3  . PRO A 1 28 ? -7.867  -4.079  -4.301  1.00 0.00 ? 26 PRO P HB3  2  
ATOM 1650  H HG2  . PRO A 1 28 ? -8.940  -4.702  -1.536  1.00 0.00 ? 26 PRO P HG2  2  
ATOM 1651  H HG3  . PRO A 1 28 ? -8.595  -3.088  -2.239  1.00 0.00 ? 26 PRO P HG3  2  
ATOM 1652  H HD2  . PRO A 1 28 ? -11.109 -4.131  -2.294  1.00 0.00 ? 26 PRO P HD2  2  
ATOM 1653  H HD3  . PRO A 1 28 ? -10.470 -3.213  -3.691  1.00 0.00 ? 26 PRO P HD3  2  
ATOM 1654  N N    . ASP A 1 29 ? -7.954  -7.998  -3.757  1.00 0.00 ? 27 ASP P N    2  
ATOM 1655  C CA   . ASP A 1 29 ? -7.669  -9.376  -3.329  1.00 0.00 ? 27 ASP P CA   2  
ATOM 1656  C C    . ASP A 1 29 ? -6.253  -9.474  -2.747  1.00 0.00 ? 27 ASP P C    2  
ATOM 1657  O O    . ASP A 1 29 ? -5.511  -8.498  -2.786  1.00 0.00 ? 27 ASP P O    2  
ATOM 1658  C CB   . ASP A 1 29 ? -7.854  -10.316 -4.536  1.00 0.00 ? 27 ASP P CB   2  
ATOM 1659  C CG   . ASP A 1 29 ? -7.888  -11.816 -4.190  1.00 0.00 ? 27 ASP P CG   2  
ATOM 1660  O OD1  . ASP A 1 29 ? -8.093  -12.173 -3.005  1.00 0.00 ? 27 ASP P OD1  2  
ATOM 1661  O OD2  . ASP A 1 29 ? -7.699  -12.644 -5.111  1.00 0.00 ? 27 ASP P OD2  2  
ATOM 1662  H H    . ASP A 1 29 ? -7.320  -7.593  -4.446  1.00 0.00 ? 27 ASP P H    2  
ATOM 1663  H HA   . ASP A 1 29 ? -8.370  -9.665  -2.552  1.00 0.00 ? 27 ASP P HA   2  
ATOM 1664  H HB2  . ASP A 1 29 ? -8.793  -10.068 -5.023  1.00 0.00 ? 27 ASP P HB2  2  
ATOM 1665  H HB3  . ASP A 1 29 ? -7.048  -10.127 -5.248  1.00 0.00 ? 27 ASP P HB3  2  
ATOM 1666  N N    . MET A 1 30 ? -5.830  -10.634 -2.242  1.00 0.00 ? 28 MET P N    2  
ATOM 1667  C CA   . MET A 1 30 ? -4.492  -10.819 -1.651  1.00 0.00 ? 28 MET P CA   2  
ATOM 1668  C C    . MET A 1 30 ? -3.340  -10.302 -2.537  1.00 0.00 ? 28 MET P C    2  
ATOM 1669  O O    . MET A 1 30 ? -2.340  -9.812  -2.016  1.00 0.00 ? 28 MET P O    2  
ATOM 1670  C CB   . MET A 1 30 ? -4.264  -12.296 -1.290  1.00 0.00 ? 28 MET P CB   2  
ATOM 1671  C CG   . MET A 1 30 ? -4.258  -13.242 -2.501  1.00 0.00 ? 28 MET P CG   2  
ATOM 1672  S SD   . MET A 1 30 ? -3.635  -14.911 -2.162  1.00 0.00 ? 28 MET P SD   2  
ATOM 1673  C CE   . MET A 1 30 ? -1.854  -14.546 -2.135  1.00 0.00 ? 28 MET P CE   2  
ATOM 1674  H H    . MET A 1 30 ? -6.482  -11.415 -2.256  1.00 0.00 ? 28 MET P H    2  
ATOM 1675  H HA   . MET A 1 30 ? -4.450  -10.243 -0.729  1.00 0.00 ? 28 MET P HA   2  
ATOM 1676  H HB2  . MET A 1 30 ? -3.304  -12.370 -0.779  1.00 0.00 ? 28 MET P HB2  2  
ATOM 1677  H HB3  . MET A 1 30 ? -5.037  -12.619 -0.592  1.00 0.00 ? 28 MET P HB3  2  
ATOM 1678  H HG2  . MET A 1 30 ? -5.271  -13.315 -2.892  1.00 0.00 ? 28 MET P HG2  2  
ATOM 1679  H HG3  . MET A 1 30 ? -3.635  -12.830 -3.291  1.00 0.00 ? 28 MET P HG3  2  
ATOM 1680  H HE1  . MET A 1 30 ? -1.620  -13.894 -1.293  1.00 0.00 ? 28 MET P HE1  2  
ATOM 1681  H HE2  . MET A 1 30 ? -1.291  -15.474 -2.035  1.00 0.00 ? 28 MET P HE2  2  
ATOM 1682  H HE3  . MET A 1 30 ? -1.565  -14.045 -3.062  1.00 0.00 ? 28 MET P HE3  2  
ATOM 1683  N N    . SER A 1 31 ? -3.494  -10.352 -3.865  1.00 0.00 ? 29 SER P N    2  
ATOM 1684  C CA   . SER A 1 31 ? -2.478  -9.886  -4.817  1.00 0.00 ? 29 SER P CA   2  
ATOM 1685  C C    . SER A 1 31 ? -2.519  -8.365  -5.014  1.00 0.00 ? 29 SER P C    2  
ATOM 1686  O O    . SER A 1 31 ? -1.476  -7.708  -5.029  1.00 0.00 ? 29 SER P O    2  
ATOM 1687  C CB   . SER A 1 31 ? -2.645  -10.593 -6.169  1.00 0.00 ? 29 SER P CB   2  
ATOM 1688  O OG   . SER A 1 31 ? -2.588  -12.003 -6.008  1.00 0.00 ? 29 SER P OG   2  
ATOM 1689  H H    . SER A 1 31 ? -4.356  -10.735 -4.225  1.00 0.00 ? 29 SER P H    2  
ATOM 1690  H HA   . SER A 1 31 ? -1.497  -10.156 -4.426  1.00 0.00 ? 29 SER P HA   2  
ATOM 1691  H HB2  . SER A 1 31 ? -3.605  -10.316 -6.610  1.00 0.00 ? 29 SER P HB2  2  
ATOM 1692  H HB3  . SER A 1 31 ? -1.846  -10.272 -6.841  1.00 0.00 ? 29 SER P HB3  2  
ATOM 1693  H HG   . SER A 1 31 ? -2.670  -12.418 -6.888  1.00 0.00 ? 29 SER P HG   2  
ATOM 1694  N N    . THR A 1 32 ? -3.718  -7.781  -5.131  1.00 0.00 ? 30 THR P N    2  
ATOM 1695  C CA   . THR A 1 32 ? -3.914  -6.336  -5.352  1.00 0.00 ? 30 THR P CA   2  
ATOM 1696  C C    . THR A 1 32 ? -3.803  -5.515  -4.068  1.00 0.00 ? 30 THR P C    2  
ATOM 1697  O O    . THR A 1 32 ? -3.234  -4.430  -4.098  1.00 0.00 ? 30 THR P O    2  
ATOM 1698  C CB   . THR A 1 32 ? -5.228  -6.022  -6.087  1.00 0.00 ? 30 THR P CB   2  
ATOM 1699  O OG1  . THR A 1 32 ? -6.240  -6.963  -5.811  1.00 0.00 ? 30 THR P OG1  2  
ATOM 1700  C CG2  . THR A 1 32 ? -5.024  -6.032  -7.601  1.00 0.00 ? 30 THR P CG2  2  
ATOM 1701  H H    . THR A 1 32 ? -4.548  -8.350  -5.032  1.00 0.00 ? 30 THR P H    2  
ATOM 1702  H HA   . THR A 1 32 ? -3.110  -5.985  -5.993  1.00 0.00 ? 30 THR P HA   2  
ATOM 1703  H HB   . THR A 1 32 ? -5.585  -5.039  -5.784  1.00 0.00 ? 30 THR P HB   2  
ATOM 1704  H HG1  . THR A 1 32 ? -6.248  -7.602  -6.544  1.00 0.00 ? 30 THR P HG1  2  
ATOM 1705  H HG21 . THR A 1 32 ? -5.975  -5.869  -8.108  1.00 0.00 ? 30 THR P HG21 2  
ATOM 1706  H HG22 . THR A 1 32 ? -4.604  -6.988  -7.919  1.00 0.00 ? 30 THR P HG22 2  
ATOM 1707  H HG23 . THR A 1 32 ? -4.338  -5.231  -7.882  1.00 0.00 ? 30 THR P HG23 2  
ATOM 1708  N N    . ARG A 1 33 ? -4.243  -6.035  -2.917  1.00 0.00 ? 31 ARG P N    2  
ATOM 1709  C CA   . ARG A 1 33 ? -3.991  -5.439  -1.593  1.00 0.00 ? 31 ARG P CA   2  
ATOM 1710  C C    . ARG A 1 33 ? -2.492  -5.259  -1.336  1.00 0.00 ? 31 ARG P C    2  
ATOM 1711  O O    . ARG A 1 33 ? -2.066  -4.185  -0.920  1.00 0.00 ? 31 ARG P O    2  
ATOM 1712  C CB   . ARG A 1 33 ? -4.586  -6.339  -0.495  1.00 0.00 ? 31 ARG P CB   2  
ATOM 1713  C CG   . ARG A 1 33 ? -6.121  -6.425  -0.495  1.00 0.00 ? 31 ARG P CG   2  
ATOM 1714  C CD   . ARG A 1 33 ? -6.579  -7.608  0.368   1.00 0.00 ? 31 ARG P CD   2  
ATOM 1715  N NE   . ARG A 1 33 ? -7.948  -8.033  0.033   1.00 0.00 ? 31 ARG P NE   2  
ATOM 1716  C CZ   . ARG A 1 33 ? -8.482  -9.223  0.241   1.00 0.00 ? 31 ARG P CZ   2  
ATOM 1717  N NH1  . ARG A 1 33 ? -7.848  -10.195 0.835   1.00 0.00 ? 31 ARG P NH1  2  
ATOM 1718  N NH2  . ARG A 1 33 ? -9.685  -9.455  -0.187  1.00 0.00 ? 31 ARG P NH2  2  
ATOM 1719  H H    . ARG A 1 33 ? -4.779  -6.898  -2.963  1.00 0.00 ? 31 ARG P H    2  
ATOM 1720  H HA   . ARG A 1 33 ? -4.443  -4.445  -1.570  1.00 0.00 ? 31 ARG P HA   2  
ATOM 1721  H HB2  . ARG A 1 33 ? -4.173  -7.343  -0.631  1.00 0.00 ? 31 ARG P HB2  2  
ATOM 1722  H HB3  . ARG A 1 33 ? -4.266  -5.971  0.480   1.00 0.00 ? 31 ARG P HB3  2  
ATOM 1723  H HG2  . ARG A 1 33 ? -6.551  -5.497  -0.117  1.00 0.00 ? 31 ARG P HG2  2  
ATOM 1724  H HG3  . ARG A 1 33 ? -6.476  -6.581  -1.509  1.00 0.00 ? 31 ARG P HG3  2  
ATOM 1725  H HD2  . ARG A 1 33 ? -5.905  -8.445  0.186   1.00 0.00 ? 31 ARG P HD2  2  
ATOM 1726  H HD3  . ARG A 1 33 ? -6.519  -7.328  1.422   1.00 0.00 ? 31 ARG P HD3  2  
ATOM 1727  H HE   . ARG A 1 33 ? -8.525  -7.385  -0.483  1.00 0.00 ? 31 ARG P HE   2  
ATOM 1728  H HH11 . ARG A 1 33 ? -6.861  -10.098 1.074   1.00 0.00 ? 31 ARG P HH11 2  
ATOM 1729  H HH12 . ARG A 1 33 ? -8.287  -11.094 0.932   1.00 0.00 ? 31 ARG P HH12 2  
ATOM 1730  H HH21 . ARG A 1 33 ? -10.127 -8.764  -0.783  1.00 0.00 ? 31 ARG P HH21 2  
ATOM 1731  H HH22 . ARG A 1 33 ? -10.118 -10.353 -0.051  1.00 0.00 ? 31 ARG P HH22 2  
ATOM 1732  N N    . GLU A 1 34 ? -1.678  -6.277  -1.624  1.00 0.00 ? 32 GLU P N    2  
ATOM 1733  C CA   . GLU A 1 34 ? -0.218  -6.167  -1.528  1.00 0.00 ? 32 GLU P CA   2  
ATOM 1734  C C    . GLU A 1 34 ? 0.359   -5.191  -2.563  1.00 0.00 ? 32 GLU P C    2  
ATOM 1735  O O    . GLU A 1 34 ? 1.213   -4.382  -2.209  1.00 0.00 ? 32 GLU P O    2  
ATOM 1736  C CB   . GLU A 1 34 ? 0.455   -7.543  -1.648  1.00 0.00 ? 32 GLU P CB   2  
ATOM 1737  C CG   . GLU A 1 34 ? 0.244   -8.392  -0.387  1.00 0.00 ? 32 GLU P CG   2  
ATOM 1738  C CD   . GLU A 1 34 ? 1.130   -9.657  -0.387  1.00 0.00 ? 32 GLU P CD   2  
ATOM 1739  O OE1  . GLU A 1 34 ? 1.148   -10.416 -1.387  1.00 0.00 ? 32 GLU P OE1  2  
ATOM 1740  O OE2  . GLU A 1 34 ? 1.835   -9.899  0.625   1.00 0.00 ? 32 GLU P OE2  2  
ATOM 1741  H H    . GLU A 1 34 ? -2.081  -7.149  -1.930  1.00 0.00 ? 32 GLU P H    2  
ATOM 1742  H HA   . GLU A 1 34 ? 0.036   -5.761  -0.548  1.00 0.00 ? 32 GLU P HA   2  
ATOM 1743  H HB2  . GLU A 1 34 ? 0.074   -8.065  -2.526  1.00 0.00 ? 32 GLU P HB2  2  
ATOM 1744  H HB3  . GLU A 1 34 ? 1.527   -7.388  -1.774  1.00 0.00 ? 32 GLU P HB3  2  
ATOM 1745  H HG2  . GLU A 1 34 ? 0.487   -7.777  0.484   1.00 0.00 ? 32 GLU P HG2  2  
ATOM 1746  H HG3  . GLU A 1 34 ? -0.808  -8.667  -0.304  1.00 0.00 ? 32 GLU P HG3  2  
ATOM 1747  N N    . GLU A 1 35 ? -0.138  -5.190  -3.805  1.00 0.00 ? 33 GLU P N    2  
ATOM 1748  C CA   . GLU A 1 35 ? 0.314   -4.272  -4.868  1.00 0.00 ? 33 GLU P CA   2  
ATOM 1749  C C    . GLU A 1 35 ? 0.287   -2.797  -4.435  1.00 0.00 ? 33 GLU P C    2  
ATOM 1750  O O    . GLU A 1 35 ? 1.220   -2.065  -4.765  1.00 0.00 ? 33 GLU P O    2  
ATOM 1751  C CB   . GLU A 1 35 ? -0.542  -4.464  -6.139  1.00 0.00 ? 33 GLU P CB   2  
ATOM 1752  C CG   . GLU A 1 35 ? -0.146  -3.561  -7.319  1.00 0.00 ? 33 GLU P CG   2  
ATOM 1753  C CD   . GLU A 1 35 ? -1.147  -3.687  -8.482  1.00 0.00 ? 33 GLU P CD   2  
ATOM 1754  O OE1  . GLU A 1 35 ? -1.005  -4.610  -9.320  1.00 0.00 ? 33 GLU P OE1  2  
ATOM 1755  O OE2  . GLU A 1 35 ? -2.076  -2.844  -8.571  1.00 0.00 ? 33 GLU P OE2  2  
ATOM 1756  H H    . GLU A 1 35 ? -0.813  -5.906  -4.043  1.00 0.00 ? 33 GLU P H    2  
ATOM 1757  H HA   . GLU A 1 35 ? 1.354   -4.510  -5.099  1.00 0.00 ? 33 GLU P HA   2  
ATOM 1758  H HB2  . GLU A 1 35 ? -0.474  -5.504  -6.458  1.00 0.00 ? 33 GLU P HB2  2  
ATOM 1759  H HB3  . GLU A 1 35 ? -1.578  -4.245  -5.904  1.00 0.00 ? 33 GLU P HB3  2  
ATOM 1760  H HG2  . GLU A 1 35 ? -0.129  -2.519  -6.997  1.00 0.00 ? 33 GLU P HG2  2  
ATOM 1761  H HG3  . GLU A 1 35 ? 0.860   -3.823  -7.648  1.00 0.00 ? 33 GLU P HG3  2  
ATOM 1762  N N    . ILE A 1 36 ? -0.727  -2.356  -3.680  1.00 0.00 ? 34 ILE P N    2  
ATOM 1763  C CA   . ILE A 1 36 ? -0.811  -0.968  -3.184  1.00 0.00 ? 34 ILE P CA   2  
ATOM 1764  C C    . ILE A 1 36 ? 0.009   -0.770  -1.901  1.00 0.00 ? 34 ILE P C    2  
ATOM 1765  O O    . ILE A 1 36 ? 0.568   0.303   -1.678  1.00 0.00 ? 34 ILE P O    2  
ATOM 1766  C CB   . ILE A 1 36 ? -2.279  -0.469  -3.070  1.00 0.00 ? 34 ILE P CB   2  
ATOM 1767  C CG1  . ILE A 1 36 ? -2.987  -0.770  -1.731  1.00 0.00 ? 34 ILE P CG1  2  
ATOM 1768  C CG2  . ILE A 1 36 ? -3.139  -1.049  -4.206  1.00 0.00 ? 34 ILE P CG2  2  
ATOM 1769  C CD1  . ILE A 1 36 ? -2.805  0.330   -0.679  1.00 0.00 ? 34 ILE P CD1  2  
ATOM 1770  H H    . ILE A 1 36 ? -1.485  -2.997  -3.473  1.00 0.00 ? 34 ILE P H    2  
ATOM 1771  H HA   . ILE A 1 36 ? -0.346  -0.323  -3.931  1.00 0.00 ? 34 ILE P HA   2  
ATOM 1772  H HB   . ILE A 1 36 ? -2.266  0.615   -3.198  1.00 0.00 ? 34 ILE P HB   2  
ATOM 1773  H HG12 . ILE A 1 36 ? -4.061  -0.868  -1.898  1.00 0.00 ? 34 ILE P HG12 2  
ATOM 1774  H HG13 . ILE A 1 36 ? -2.630  -1.719  -1.338  1.00 0.00 ? 34 ILE P HG13 2  
ATOM 1775  H HG21 . ILE A 1 36 ? -3.429  -2.069  -3.963  1.00 0.00 ? 34 ILE P HG21 2  
ATOM 1776  H HG22 . ILE A 1 36 ? -4.052  -0.476  -4.314  1.00 0.00 ? 34 ILE P HG22 2  
ATOM 1777  H HG23 . ILE A 1 36 ? -2.588  -1.028  -5.147  1.00 0.00 ? 34 ILE P HG23 2  
ATOM 1778  H HD11 . ILE A 1 36 ? -1.760  0.470   -0.419  1.00 0.00 ? 34 ILE P HD11 2  
ATOM 1779  H HD12 . ILE A 1 36 ? -3.342  0.040   0.218   1.00 0.00 ? 34 ILE P HD12 2  
ATOM 1780  H HD13 . ILE A 1 36 ? -3.217  1.272   -1.049  1.00 0.00 ? 34 ILE P HD13 2  
ATOM 1781  N N    . ALA A 1 37 ? 0.123   -1.808  -1.066  1.00 0.00 ? 35 ALA P N    2  
ATOM 1782  C CA   . ALA A 1 37 ? 0.821   -1.762  0.219   1.00 0.00 ? 35 ALA P CA   2  
ATOM 1783  C C    . ALA A 1 37 ? 2.355   -1.694  0.068   1.00 0.00 ? 35 ALA P C    2  
ATOM 1784  O O    . ALA A 1 37 ? 3.055   -1.131  0.914   1.00 0.00 ? 35 ALA P O    2  
ATOM 1785  C CB   . ALA A 1 37 ? 0.389   -2.992  1.026   1.00 0.00 ? 35 ALA P CB   2  
ATOM 1786  H H    . ALA A 1 37 ? -0.296  -2.687  -1.341  1.00 0.00 ? 35 ALA P H    2  
ATOM 1787  H HA   . ALA A 1 37 ? 0.496   -0.873  0.752   1.00 0.00 ? 35 ALA P HA   2  
ATOM 1788  H HB1  . ALA A 1 37 ? 0.870   -2.978  1.998   1.00 0.00 ? 35 ALA P HB1  2  
ATOM 1789  H HB2  . ALA A 1 37 ? -0.690  -2.989  1.175   1.00 0.00 ? 35 ALA P HB2  2  
ATOM 1790  H HB3  . ALA A 1 37 ? 0.684   -3.903  0.509   1.00 0.00 ? 35 ALA P HB3  2  
ATOM 1791  N N    . VAL A 1 38 ? 2.865   -2.247  -1.038  1.00 0.00 ? 36 VAL P N    2  
ATOM 1792  C CA   . VAL A 1 38 ? 4.286   -2.471  -1.348  1.00 0.00 ? 36 VAL P CA   2  
ATOM 1793  C C    . VAL A 1 38 ? 5.118   -1.186  -1.427  1.00 0.00 ? 36 VAL P C    2  
ATOM 1794  O O    . VAL A 1 38 ? 6.297   -1.199  -1.064  1.00 0.00 ? 36 VAL P O    2  
ATOM 1795  C CB   . VAL A 1 38 ? 4.347   -3.309  -2.652  1.00 0.00 ? 36 VAL P CB   2  
ATOM 1796  C CG1  . VAL A 1 38 ? 5.524   -3.043  -3.592  1.00 0.00 ? 36 VAL P CG1  2  
ATOM 1797  C CG2  . VAL A 1 38 ? 4.345   -4.802  -2.303  1.00 0.00 ? 36 VAL P CG2  2  
ATOM 1798  H H    . VAL A 1 38 ? 2.194   -2.684  -1.664  1.00 0.00 ? 36 VAL P H    2  
ATOM 1799  H HA   . VAL A 1 38 ? 4.720   -3.050  -0.534  1.00 0.00 ? 36 VAL P HA   2  
ATOM 1800  H HB   . VAL A 1 38 ? 3.450   -3.101  -3.237  1.00 0.00 ? 36 VAL P HB   2  
ATOM 1801  H HG11 . VAL A 1 38 ? 5.482   -2.017  -3.956  1.00 0.00 ? 36 VAL P HG11 2  
ATOM 1802  H HG12 . VAL A 1 38 ? 6.470   -3.222  -3.080  1.00 0.00 ? 36 VAL P HG12 2  
ATOM 1803  H HG13 . VAL A 1 38 ? 5.445   -3.704  -4.457  1.00 0.00 ? 36 VAL P HG13 2  
ATOM 1804  H HG21 . VAL A 1 38 ? 4.172   -5.388  -3.204  1.00 0.00 ? 36 VAL P HG21 2  
ATOM 1805  H HG22 . VAL A 1 38 ? 5.298   -5.086  -1.856  1.00 0.00 ? 36 VAL P HG22 2  
ATOM 1806  H HG23 . VAL A 1 38 ? 3.546   -5.019  -1.593  1.00 0.00 ? 36 VAL P HG23 2  
ATOM 1807  N N    . TRP A 1 39 ? 4.517   -0.071  -1.850  1.00 0.00 ? 37 TRP P N    2  
ATOM 1808  C CA   . TRP A 1 39 ? 5.174   1.238   -1.995  1.00 0.00 ? 37 TRP P CA   2  
ATOM 1809  C C    . TRP A 1 39 ? 4.616   2.315   -1.051  1.00 0.00 ? 37 TRP P C    2  
ATOM 1810  O O    . TRP A 1 39 ? 5.016   3.479   -1.125  1.00 0.00 ? 37 TRP P O    2  
ATOM 1811  C CB   . TRP A 1 39 ? 5.152   1.669   -3.469  1.00 0.00 ? 37 TRP P CB   2  
ATOM 1812  C CG   . TRP A 1 39 ? 3.831   1.523   -4.152  1.00 0.00 ? 37 TRP P CG   2  
ATOM 1813  C CD1  . TRP A 1 39 ? 3.372   0.381   -4.703  1.00 0.00 ? 37 TRP P CD1  2  
ATOM 1814  C CD2  . TRP A 1 39 ? 2.765   2.503   -4.317  1.00 0.00 ? 37 TRP P CD2  2  
ATOM 1815  N NE1  . TRP A 1 39 ? 2.082   0.566   -5.143  1.00 0.00 ? 37 TRP P NE1  2  
ATOM 1816  C CE2  . TRP A 1 39 ? 1.648   1.857   -4.930  1.00 0.00 ? 37 TRP P CE2  2  
ATOM 1817  C CE3  . TRP A 1 39 ? 2.629   3.869   -3.996  1.00 0.00 ? 37 TRP P CE3  2  
ATOM 1818  C CZ2  . TRP A 1 39 ? 0.441   2.525   -5.183  1.00 0.00 ? 37 TRP P CZ2  2  
ATOM 1819  C CZ3  . TRP A 1 39 ? 1.428   4.555   -4.263  1.00 0.00 ? 37 TRP P CZ3  2  
ATOM 1820  C CH2  . TRP A 1 39 ? 0.334   3.887   -4.845  1.00 0.00 ? 37 TRP P CH2  2  
ATOM 1821  H H    . TRP A 1 39 ? 3.549   -0.138  -2.142  1.00 0.00 ? 37 TRP P H    2  
ATOM 1822  H HA   . TRP A 1 39 ? 6.218   1.136   -1.713  1.00 0.00 ? 37 TRP P HA   2  
ATOM 1823  H HB2  . TRP A 1 39 ? 5.481   2.703   -3.544  1.00 0.00 ? 37 TRP P HB2  2  
ATOM 1824  H HB3  . TRP A 1 39 ? 5.874   1.067   -4.013  1.00 0.00 ? 37 TRP P HB3  2  
ATOM 1825  H HD1  . TRP A 1 39 ? 3.910   -0.559  -4.733  1.00 0.00 ? 37 TRP P HD1  2  
ATOM 1826  H HE1  . TRP A 1 39 ? 1.518   -0.223  -5.451  1.00 0.00 ? 37 TRP P HE1  2  
ATOM 1827  H HE3  . TRP A 1 39 ? 3.465   4.377   -3.536  1.00 0.00 ? 37 TRP P HE3  2  
ATOM 1828  H HZ2  . TRP A 1 39 ? -0.389  2.003   -5.637  1.00 0.00 ? 37 TRP P HZ2  2  
ATOM 1829  H HZ3  . TRP A 1 39 ? 1.343   5.605   -4.016  1.00 0.00 ? 37 TRP P HZ3  2  
ATOM 1830  H HH2  . TRP A 1 39 ? -0.586  4.425   -5.036  1.00 0.00 ? 37 TRP P HH2  2  
ATOM 1831  N N    . THR A 1 40 ? 3.718   1.930   -0.140  1.00 0.00 ? 38 THR P N    2  
ATOM 1832  C CA   . THR A 1 40 ? 3.068   2.834   0.832   1.00 0.00 ? 38 THR P CA   2  
ATOM 1833  C C    . THR A 1 40 ? 3.440   2.530   2.284   1.00 0.00 ? 38 THR P C    2  
ATOM 1834  O O    . THR A 1 40 ? 2.921   3.175   3.191   1.00 0.00 ? 38 THR P O    2  
ATOM 1835  C CB   . THR A 1 40 ? 1.543   2.850   0.647   1.00 0.00 ? 38 THR P CB   2  
ATOM 1836  O OG1  . THR A 1 40 ? 1.021   1.552   0.772   1.00 0.00 ? 38 THR P OG1  2  
ATOM 1837  C CG2  . THR A 1 40 ? 1.155   3.366   -0.739  1.00 0.00 ? 38 THR P CG2  2  
ATOM 1838  H H    . THR A 1 40 ? 3.434   0.957   -0.135  1.00 0.00 ? 38 THR P H    2  
ATOM 1839  H HA   . THR A 1 40 ? 3.412   3.853   0.656   1.00 0.00 ? 38 THR P HA   2  
ATOM 1840  H HB   . THR A 1 40 ? 1.088   3.490   1.408   1.00 0.00 ? 38 THR P HB   2  
ATOM 1841  H HG1  . THR A 1 40 ? 0.872   1.223   -0.134  1.00 0.00 ? 38 THR P HG1  2  
ATOM 1842  H HG21 . THR A 1 40 ? 1.598   2.739   -1.517  1.00 0.00 ? 38 THR P HG21 2  
ATOM 1843  H HG22 . THR A 1 40 ? 1.522   4.385   -0.863  1.00 0.00 ? 38 THR P HG22 2  
ATOM 1844  H HG23 . THR A 1 40 ? 0.071   3.359   -0.846  1.00 0.00 ? 38 THR P HG23 2  
ATOM 1845  N N    . ASN A 1 41 ? 4.360   1.587   2.527   1.00 0.00 ? 39 ASN P N    2  
ATOM 1846  C CA   . ASN A 1 41 ? 4.755   1.103   3.860   1.00 0.00 ? 39 ASN P CA   2  
ATOM 1847  C C    . ASN A 1 41 ? 3.573   0.540   4.687   1.00 0.00 ? 39 ASN P C    2  
ATOM 1848  O O    . ASN A 1 41 ? 3.426   0.817   5.881   1.00 0.00 ? 39 ASN P O    2  
ATOM 1849  C CB   . ASN A 1 41 ? 5.587   2.180   4.584   1.00 0.00 ? 39 ASN P CB   2  
ATOM 1850  C CG   . ASN A 1 41 ? 6.380   1.650   5.773   1.00 0.00 ? 39 ASN P CG   2  
ATOM 1851  O OD1  . ASN A 1 41 ? 6.613   0.459   5.940   1.00 0.00 ? 39 ASN P OD1  2  
ATOM 1852  N ND2  . ASN A 1 41 ? 6.858   2.527   6.626   1.00 0.00 ? 39 ASN P ND2  2  
ATOM 1853  H H    . ASN A 1 41 ? 4.770   1.132   1.722   1.00 0.00 ? 39 ASN P H    2  
ATOM 1854  H HA   . ASN A 1 41 ? 5.414   0.250   3.685   1.00 0.00 ? 39 ASN P HA   2  
ATOM 1855  H HB2  . ASN A 1 41 ? 6.293   2.630   3.888   1.00 0.00 ? 39 ASN P HB2  2  
ATOM 1856  H HB3  . ASN A 1 41 ? 4.913   2.960   4.932   1.00 0.00 ? 39 ASN P HB3  2  
ATOM 1857  H HD21 . ASN A 1 41 ? 6.686   3.512   6.495   1.00 0.00 ? 39 ASN P HD21 2  
ATOM 1858  H HD22 . ASN A 1 41 ? 7.393   2.191   7.413   1.00 0.00 ? 39 ASN P HD22 2  
ATOM 1859  N N    . LEU A 1 42 ? 2.713   -0.237  4.025   1.00 0.00 ? 40 LEU P N    2  
ATOM 1860  C CA   . LEU A 1 42 ? 1.589   -0.983  4.611   1.00 0.00 ? 40 LEU P CA   2  
ATOM 1861  C C    . LEU A 1 42 ? 1.789   -2.507  4.447   1.00 0.00 ? 40 LEU P C    2  
ATOM 1862  O O    . LEU A 1 42 ? 2.792   -2.970  3.898   1.00 0.00 ? 40 LEU P O    2  
ATOM 1863  C CB   . LEU A 1 42 ? 0.277   -0.497  3.949   1.00 0.00 ? 40 LEU P CB   2  
ATOM 1864  C CG   . LEU A 1 42 ? -0.092  0.980   4.169   1.00 0.00 ? 40 LEU P CG   2  
ATOM 1865  C CD1  . LEU A 1 42 ? -1.360  1.317   3.384   1.00 0.00 ? 40 LEU P CD1  2  
ATOM 1866  C CD2  . LEU A 1 42 ? -0.368  1.276   5.640   1.00 0.00 ? 40 LEU P CD2  2  
ATOM 1867  H H    . LEU A 1 42 ? 2.899   -0.387  3.042   1.00 0.00 ? 40 LEU P H    2  
ATOM 1868  H HA   . LEU A 1 42 ? 1.531   -0.792  5.683   1.00 0.00 ? 40 LEU P HA   2  
ATOM 1869  H HB2  . LEU A 1 42 ? 0.359   -0.662  2.880   1.00 0.00 ? 40 LEU P HB2  2  
ATOM 1870  H HB3  . LEU A 1 42 ? -0.556  -1.105  4.304   1.00 0.00 ? 40 LEU P HB3  2  
ATOM 1871  H HG   . LEU A 1 42 ? 0.713   1.623   3.816   1.00 0.00 ? 40 LEU P HG   2  
ATOM 1872  H HD11 . LEU A 1 42 ? -2.196  0.711   3.735   1.00 0.00 ? 40 LEU P HD11 2  
ATOM 1873  H HD12 . LEU A 1 42 ? -1.595  2.372   3.509   1.00 0.00 ? 40 LEU P HD12 2  
ATOM 1874  H HD13 . LEU A 1 42 ? -1.196  1.122   2.325   1.00 0.00 ? 40 LEU P HD13 2  
ATOM 1875  H HD21 . LEU A 1 42 ? -0.687  2.309   5.752   1.00 0.00 ? 40 LEU P HD21 2  
ATOM 1876  H HD22 . LEU A 1 42 ? -1.155  0.626   6.010   1.00 0.00 ? 40 LEU P HD22 2  
ATOM 1877  H HD23 . LEU A 1 42 ? 0.540   1.127   6.223   1.00 0.00 ? 40 LEU P HD23 2  
ATOM 1878  N N    . THR A 1 43 ? 0.812   -3.293  4.905   1.00 0.00 ? 41 THR P N    2  
ATOM 1879  C CA   . THR A 1 43 ? 0.685   -4.743  4.645   1.00 0.00 ? 41 THR P CA   2  
ATOM 1880  C C    . THR A 1 43 ? -0.743  -5.068  4.188   1.00 0.00 ? 41 THR P C    2  
ATOM 1881  O O    . THR A 1 43 ? -1.628  -4.221  4.325   1.00 0.00 ? 41 THR P O    2  
ATOM 1882  C CB   . THR A 1 43 ? 1.122   -5.557  5.877   1.00 0.00 ? 41 THR P CB   2  
ATOM 1883  O OG1  . THR A 1 43 ? 1.116   -6.934  5.572   1.00 0.00 ? 41 THR P OG1  2  
ATOM 1884  C CG2  . THR A 1 43 ? 0.233   -5.344  7.104   1.00 0.00 ? 41 THR P CG2  2  
ATOM 1885  H H    . THR A 1 43 ? 0.021   -2.847  5.354   1.00 0.00 ? 41 THR P H    2  
ATOM 1886  H HA   . THR A 1 43 ? 1.346   -5.024  3.826   1.00 0.00 ? 41 THR P HA   2  
ATOM 1887  H HB   . THR A 1 43 ? 2.143   -5.267  6.134   1.00 0.00 ? 41 THR P HB   2  
ATOM 1888  H HG1  . THR A 1 43 ? 1.569   -7.400  6.298   1.00 0.00 ? 41 THR P HG1  2  
ATOM 1889  H HG21 . THR A 1 43 ? 0.268   -4.299  7.409   1.00 0.00 ? 41 THR P HG21 2  
ATOM 1890  H HG22 . THR A 1 43 ? 0.597   -5.956  7.929   1.00 0.00 ? 41 THR P HG22 2  
ATOM 1891  H HG23 . THR A 1 43 ? -0.795  -5.625  6.879   1.00 0.00 ? 41 THR P HG23 2  
ATOM 1892  N N    . GLU A 1 44 ? -1.012  -6.272  3.667   1.00 0.00 ? 42 GLU P N    2  
ATOM 1893  C CA   . GLU A 1 44 ? -2.359  -6.671  3.215   1.00 0.00 ? 42 GLU P CA   2  
ATOM 1894  C C    . GLU A 1 44 ? -3.431  -6.393  4.280   1.00 0.00 ? 42 GLU P C    2  
ATOM 1895  O O    . GLU A 1 44 ? -4.511  -5.904  3.953   1.00 0.00 ? 42 GLU P O    2  
ATOM 1896  C CB   . GLU A 1 44 ? -2.391  -8.167  2.824   1.00 0.00 ? 42 GLU P CB   2  
ATOM 1897  C CG   . GLU A 1 44 ? -3.844  -8.638  2.608   1.00 0.00 ? 42 GLU P CG   2  
ATOM 1898  C CD   . GLU A 1 44 ? -4.045  -10.043 2.030   1.00 0.00 ? 42 GLU P CD   2  
ATOM 1899  O OE1  . GLU A 1 44 ? -3.079  -10.823 1.875   1.00 0.00 ? 42 GLU P OE1  2  
ATOM 1900  O OE2  . GLU A 1 44 ? -5.233  -10.368 1.776   1.00 0.00 ? 42 GLU P OE2  2  
ATOM 1901  H H    . GLU A 1 44 ? -0.265  -6.956  3.647   1.00 0.00 ? 42 GLU P H    2  
ATOM 1902  H HA   . GLU A 1 44 ? -2.618  -6.083  2.331   1.00 0.00 ? 42 GLU P HA   2  
ATOM 1903  H HB2  . GLU A 1 44 ? -1.819  -8.300  1.905   1.00 0.00 ? 42 GLU P HB2  2  
ATOM 1904  H HB3  . GLU A 1 44 ? -1.938  -8.763  3.617   1.00 0.00 ? 42 GLU P HB3  2  
ATOM 1905  H HG2  . GLU A 1 44 ? -4.367  -8.622  3.566   1.00 0.00 ? 42 GLU P HG2  2  
ATOM 1906  H HG3  . GLU A 1 44 ? -4.330  -7.922  1.947   1.00 0.00 ? 42 GLU P HG3  2  
ATOM 1907  N N    . ALA A 1 45 ? -3.135  -6.681  5.550   1.00 0.00 ? 43 ALA P N    2  
ATOM 1908  C CA   . ALA A 1 45 ? -4.096  -6.561  6.643   1.00 0.00 ? 43 ALA P CA   2  
ATOM 1909  C C    . ALA A 1 45 ? -4.551  -5.107  6.856   1.00 0.00 ? 43 ALA P C    2  
ATOM 1910  O O    . ALA A 1 45 ? -5.742  -4.866  7.038   1.00 0.00 ? 43 ALA P O    2  
ATOM 1911  C CB   . ALA A 1 45 ? -3.479  -7.177  7.902   1.00 0.00 ? 43 ALA P CB   2  
ATOM 1912  H H    . ALA A 1 45 ? -2.212  -7.037  5.749   1.00 0.00 ? 43 ALA P H    2  
ATOM 1913  H HA   . ALA A 1 45 ? -4.983  -7.143  6.385   1.00 0.00 ? 43 ALA P HA   2  
ATOM 1914  H HB1  . ALA A 1 45 ? -2.590  -6.621  8.203   1.00 0.00 ? 43 ALA P HB1  2  
ATOM 1915  H HB2  . ALA A 1 45 ? -4.207  -7.152  8.714   1.00 0.00 ? 43 ALA P HB2  2  
ATOM 1916  H HB3  . ALA A 1 45 ? -3.207  -8.215  7.704   1.00 0.00 ? 43 ALA P HB3  2  
ATOM 1917  N N    . ARG A 1 46 ? -3.642  -4.127  6.731   1.00 0.00 ? 44 ARG P N    2  
ATOM 1918  C CA   . ARG A 1 46 ? -3.981  -2.691  6.726   1.00 0.00 ? 44 ARG P CA   2  
ATOM 1919  C C    . ARG A 1 46 ? -4.958  -2.356  5.604   1.00 0.00 ? 44 ARG P C    2  
ATOM 1920  O O    . ARG A 1 46 ? -5.973  -1.709  5.850   1.00 0.00 ? 44 ARG P O    2  
ATOM 1921  C CB   . ARG A 1 46 ? -2.714  -1.837  6.545   1.00 0.00 ? 44 ARG P CB   2  
ATOM 1922  C CG   . ARG A 1 46 ? -1.813  -1.718  7.780   1.00 0.00 ? 44 ARG P CG   2  
ATOM 1923  C CD   . ARG A 1 46 ? -2.556  -1.003  8.914   1.00 0.00 ? 44 ARG P CD   2  
ATOM 1924  N NE   . ARG A 1 46 ? -1.673  -0.126  9.705   1.00 0.00 ? 44 ARG P NE   2  
ATOM 1925  C CZ   . ARG A 1 46 ? -0.815  -0.453  10.651  1.00 0.00 ? 44 ARG P CZ   2  
ATOM 1926  N NH1  . ARG A 1 46 ? -0.605  -1.683  11.023  1.00 0.00 ? 44 ARG P NH1  2  
ATOM 1927  N NH2  . ARG A 1 46 ? -0.146  0.494   11.241  1.00 0.00 ? 44 ARG P NH2  2  
ATOM 1928  H H    . ARG A 1 46 ? -2.694  -4.399  6.516   1.00 0.00 ? 44 ARG P H    2  
ATOM 1929  H HA   . ARG A 1 46 ? -4.484  -2.429  7.659   1.00 0.00 ? 44 ARG P HA   2  
ATOM 1930  H HB2  . ARG A 1 46 ? -2.133  -2.235  5.721   1.00 0.00 ? 44 ARG P HB2  2  
ATOM 1931  H HB3  . ARG A 1 46 ? -3.012  -0.829  6.256   1.00 0.00 ? 44 ARG P HB3  2  
ATOM 1932  H HG2  . ARG A 1 46 ? -1.497  -2.707  8.112   1.00 0.00 ? 44 ARG P HG2  2  
ATOM 1933  H HG3  . ARG A 1 46 ? -0.926  -1.148  7.506   1.00 0.00 ? 44 ARG P HG3  2  
ATOM 1934  H HD2  . ARG A 1 46 ? -3.337  -0.373  8.487   1.00 0.00 ? 44 ARG P HD2  2  
ATOM 1935  H HD3  . ARG A 1 46 ? -3.040  -1.756  9.533   1.00 0.00 ? 44 ARG P HD3  2  
ATOM 1936  H HE   . ARG A 1 46 ? -1.754  0.870   9.533   1.00 0.00 ? 44 ARG P HE   2  
ATOM 1937  H HH11 . ARG A 1 46 ? -1.125  -2.425  10.590  1.00 0.00 ? 44 ARG P HH11 2  
ATOM 1938  H HH12 . ARG A 1 46 ? 0.056   -1.890  11.754  1.00 0.00 ? 44 ARG P HH12 2  
ATOM 1939  H HH21 . ARG A 1 46 ? -0.324  1.451   10.964  1.00 0.00 ? 44 ARG P HH21 2  
ATOM 1940  H HH22 . ARG A 1 46 ? 0.518   0.283   11.966  1.00 0.00 ? 44 ARG P HH22 2  
ATOM 1941  N N    . VAL A 1 47 ? -4.679  -2.823  4.387   1.00 0.00 ? 45 VAL P N    2  
ATOM 1942  C CA   . VAL A 1 47 ? -5.522  -2.540  3.212   1.00 0.00 ? 45 VAL P CA   2  
ATOM 1943  C C    . VAL A 1 47 ? -6.895  -3.204  3.350   1.00 0.00 ? 45 VAL P C    2  
ATOM 1944  O O    . VAL A 1 47 ? -7.917  -2.545  3.168   1.00 0.00 ? 45 VAL P O    2  
ATOM 1945  C CB   . VAL A 1 47 ? -4.820  -2.951  1.904   1.00 0.00 ? 45 VAL P CB   2  
ATOM 1946  C CG1  . VAL A 1 47 ? -5.607  -2.467  0.680   1.00 0.00 ? 45 VAL P CG1  2  
ATOM 1947  C CG2  . VAL A 1 47 ? -3.415  -2.344  1.832   1.00 0.00 ? 45 VAL P CG2  2  
ATOM 1948  H H    . VAL A 1 47 ? -3.826  -3.365  4.274   1.00 0.00 ? 45 VAL P H    2  
ATOM 1949  H HA   . VAL A 1 47 ? -5.692  -1.463  3.169   1.00 0.00 ? 45 VAL P HA   2  
ATOM 1950  H HB   . VAL A 1 47 ? -4.733  -4.036  1.858   1.00 0.00 ? 45 VAL P HB   2  
ATOM 1951  H HG11 . VAL A 1 47 ? -6.588  -2.941  0.647   1.00 0.00 ? 45 VAL P HG11 2  
ATOM 1952  H HG12 . VAL A 1 47 ? -5.730  -1.386  0.720   1.00 0.00 ? 45 VAL P HG12 2  
ATOM 1953  H HG13 . VAL A 1 47 ? -5.072  -2.728  -0.232  1.00 0.00 ? 45 VAL P HG13 2  
ATOM 1954  H HG21 . VAL A 1 47 ? -2.994  -2.497  0.841   1.00 0.00 ? 45 VAL P HG21 2  
ATOM 1955  H HG22 . VAL A 1 47 ? -3.453  -1.278  2.051   1.00 0.00 ? 45 VAL P HG22 2  
ATOM 1956  H HG23 . VAL A 1 47 ? -2.757  -2.827  2.550   1.00 0.00 ? 45 VAL P HG23 2  
ATOM 1957  N N    . ARG A 1 48 ? -6.939  -4.474  3.772   1.00 0.00 ? 46 ARG P N    2  
ATOM 1958  C CA   . ARG A 1 48 ? -8.176  -5.225  4.040   1.00 0.00 ? 46 ARG P CA   2  
ATOM 1959  C C    . ARG A 1 48 ? -9.037  -4.522  5.096   1.00 0.00 ? 46 ARG P C    2  
ATOM 1960  O O    . ARG A 1 48 ? -10.228 -4.316  4.873   1.00 0.00 ? 46 ARG P O    2  
ATOM 1961  C CB   . ARG A 1 48 ? -7.797  -6.661  4.452   1.00 0.00 ? 46 ARG P CB   2  
ATOM 1962  C CG   . ARG A 1 48 ? -9.003  -7.612  4.417   1.00 0.00 ? 46 ARG P CG   2  
ATOM 1963  C CD   . ARG A 1 48 ? -8.699  -8.967  5.072   1.00 0.00 ? 46 ARG P CD   2  
ATOM 1964  N NE   . ARG A 1 48 ? -7.701  -9.774  4.336   1.00 0.00 ? 46 ARG P NE   2  
ATOM 1965  C CZ   . ARG A 1 48 ? -7.314  -11.001 4.651   1.00 0.00 ? 46 ARG P CZ   2  
ATOM 1966  N NH1  . ARG A 1 48 ? -7.784  -11.629 5.692   1.00 0.00 ? 46 ARG P NH1  2  
ATOM 1967  N NH2  . ARG A 1 48 ? -6.442  -11.635 3.923   1.00 0.00 ? 46 ARG P NH2  2  
ATOM 1968  H H    . ARG A 1 48 ? -6.053  -4.952  3.916   1.00 0.00 ? 46 ARG P H    2  
ATOM 1969  H HA   . ARG A 1 48 ? -8.765  -5.262  3.121   1.00 0.00 ? 46 ARG P HA   2  
ATOM 1970  H HB2  . ARG A 1 48 ? -7.039  -7.045  3.767   1.00 0.00 ? 46 ARG P HB2  2  
ATOM 1971  H HB3  . ARG A 1 48 ? -7.370  -6.647  5.457   1.00 0.00 ? 46 ARG P HB3  2  
ATOM 1972  H HG2  . ARG A 1 48 ? -9.831  -7.159  4.962   1.00 0.00 ? 46 ARG P HG2  2  
ATOM 1973  H HG3  . ARG A 1 48 ? -9.318  -7.766  3.384   1.00 0.00 ? 46 ARG P HG3  2  
ATOM 1974  H HD2  . ARG A 1 48 ? -8.344  -8.787  6.090   1.00 0.00 ? 46 ARG P HD2  2  
ATOM 1975  H HD3  . ARG A 1 48 ? -9.635  -9.526  5.131   1.00 0.00 ? 46 ARG P HD3  2  
ATOM 1976  H HE   . ARG A 1 48 ? -7.284  -9.373  3.511   1.00 0.00 ? 46 ARG P HE   2  
ATOM 1977  H HH11 . ARG A 1 48 ? -8.460  -11.173 6.279   1.00 0.00 ? 46 ARG P HH11 2  
ATOM 1978  H HH12 . ARG A 1 48 ? -7.477  -12.562 5.909   1.00 0.00 ? 46 ARG P HH12 2  
ATOM 1979  H HH21 . ARG A 1 48 ? -6.027  -11.189 3.106   1.00 0.00 ? 46 ARG P HH21 2  
ATOM 1980  H HH22 . ARG A 1 48 ? -6.156  -12.566 4.170   1.00 0.00 ? 46 ARG P HH22 2  
ATOM 1981  N N    . VAL A 1 49 ? -8.433  -4.082  6.204   1.00 0.00 ? 47 VAL P N    2  
ATOM 1982  C CA   . VAL A 1 49 ? -9.093  -3.309  7.275   1.00 0.00 ? 47 VAL P CA   2  
ATOM 1983  C C    . VAL A 1 49 ? -9.617  -1.966  6.763   1.00 0.00 ? 47 VAL P C    2  
ATOM 1984  O O    . VAL A 1 49 ? -10.762 -1.612  7.055   1.00 0.00 ? 47 VAL P O    2  
ATOM 1985  C CB   . VAL A 1 49 ? -8.123  -3.124  8.464   1.00 0.00 ? 47 VAL P CB   2  
ATOM 1986  C CG1  . VAL A 1 49 ? -8.567  -2.071  9.488   1.00 0.00 ? 47 VAL P CG1  2  
ATOM 1987  C CG2  . VAL A 1 49 ? -7.966  -4.448  9.222   1.00 0.00 ? 47 VAL P CG2  2  
ATOM 1988  H H    . VAL A 1 49 ? -7.450  -4.306  6.319   1.00 0.00 ? 47 VAL P H    2  
ATOM 1989  H HA   . VAL A 1 49 ? -9.959  -3.868  7.630   1.00 0.00 ? 47 VAL P HA   2  
ATOM 1990  H HB   . VAL A 1 49 ? -7.149  -2.818  8.083   1.00 0.00 ? 47 VAL P HB   2  
ATOM 1991  H HG11 . VAL A 1 49 ? -8.568  -1.079  9.037   1.00 0.00 ? 47 VAL P HG11 2  
ATOM 1992  H HG12 . VAL A 1 49 ? -9.561  -2.307  9.865   1.00 0.00 ? 47 VAL P HG12 2  
ATOM 1993  H HG13 . VAL A 1 49 ? -7.861  -2.054  10.321  1.00 0.00 ? 47 VAL P HG13 2  
ATOM 1994  H HG21 . VAL A 1 49 ? -7.160  -4.356  9.952   1.00 0.00 ? 47 VAL P HG21 2  
ATOM 1995  H HG22 . VAL A 1 49 ? -8.895  -4.703  9.732   1.00 0.00 ? 47 VAL P HG22 2  
ATOM 1996  H HG23 . VAL A 1 49 ? -7.713  -5.253  8.535   1.00 0.00 ? 47 VAL P HG23 2  
ATOM 1997  N N    . TRP A 1 50 ? -8.833  -1.229  5.974   1.00 0.00 ? 48 TRP P N    2  
ATOM 1998  C CA   . TRP A 1 50 ? -9.225  0.088   5.462   1.00 0.00 ? 48 TRP P CA   2  
ATOM 1999  C C    . TRP A 1 50 ? -10.410 0.016   4.496   1.00 0.00 ? 48 TRP P C    2  
ATOM 2000  O O    . TRP A 1 50 ? -11.352 0.802   4.629   1.00 0.00 ? 48 TRP P O    2  
ATOM 2001  C CB   . TRP A 1 50 ? -8.032  0.755   4.777   1.00 0.00 ? 48 TRP P CB   2  
ATOM 2002  C CG   . TRP A 1 50 ? -8.253  2.200   4.452   1.00 0.00 ? 48 TRP P CG   2  
ATOM 2003  C CD1  . TRP A 1 50 ? -7.882  3.238   5.235   1.00 0.00 ? 48 TRP P CD1  2  
ATOM 2004  C CD2  . TRP A 1 50 ? -8.910  2.794   3.289   1.00 0.00 ? 48 TRP P CD2  2  
ATOM 2005  N NE1  . TRP A 1 50 ? -8.240  4.426   4.628   1.00 0.00 ? 48 TRP P NE1  2  
ATOM 2006  C CE2  . TRP A 1 50 ? -8.875  4.214   3.426   1.00 0.00 ? 48 TRP P CE2  2  
ATOM 2007  C CE3  . TRP A 1 50 ? -9.537  2.281   2.132   1.00 0.00 ? 48 TRP P CE3  2  
ATOM 2008  C CZ2  . TRP A 1 50 ? -9.427  5.080   2.471   1.00 0.00 ? 48 TRP P CZ2  2  
ATOM 2009  C CZ3  . TRP A 1 50 ? -10.107 3.138   1.173   1.00 0.00 ? 48 TRP P CZ3  2  
ATOM 2010  C CH2  . TRP A 1 50 ? -10.063 4.531   1.344   1.00 0.00 ? 48 TRP P CH2  2  
ATOM 2011  H H    . TRP A 1 50 ? -7.889  -1.554  5.784   1.00 0.00 ? 48 TRP P H    2  
ATOM 2012  H HA   . TRP A 1 50 ? -9.521  0.711   6.309   1.00 0.00 ? 48 TRP P HA   2  
ATOM 2013  H HB2  . TRP A 1 50 ? -7.161  0.685   5.426   1.00 0.00 ? 48 TRP P HB2  2  
ATOM 2014  H HB3  . TRP A 1 50 ? -7.806  0.212   3.858   1.00 0.00 ? 48 TRP P HB3  2  
ATOM 2015  H HD1  . TRP A 1 50 ? -7.360  3.147   6.183   1.00 0.00 ? 48 TRP P HD1  2  
ATOM 2016  H HE1  . TRP A 1 50 ? -8.045  5.333   5.033   1.00 0.00 ? 48 TRP P HE1  2  
ATOM 2017  H HE3  . TRP A 1 50 ? -9.573  1.215   1.979   1.00 0.00 ? 48 TRP P HE3  2  
ATOM 2018  H HZ2  . TRP A 1 50 ? -9.367  6.149   2.604   1.00 0.00 ? 48 TRP P HZ2  2  
ATOM 2019  H HZ3  . TRP A 1 50 ? -10.580 2.719   0.294   1.00 0.00 ? 48 TRP P HZ3  2  
ATOM 2020  H HH2  . TRP A 1 50 ? -10.523 5.179   0.612   1.00 0.00 ? 48 TRP P HH2  2  
ATOM 2021  N N    . PHE A 1 51 ? -10.386 -0.939  3.561   1.00 0.00 ? 49 PHE P N    2  
ATOM 2022  C CA   . PHE A 1 51 ? -11.471 -1.195  2.606   1.00 0.00 ? 49 PHE P CA   2  
ATOM 2023  C C    . PHE A 1 51 ? -12.721 -1.774  3.295   1.00 0.00 ? 49 PHE P C    2  
ATOM 2024  O O    . PHE A 1 51 ? -13.845 -1.451  2.909   1.00 0.00 ? 49 PHE P O    2  
ATOM 2025  C CB   . PHE A 1 51 ? -10.963 -2.119  1.482   1.00 0.00 ? 49 PHE P CB   2  
ATOM 2026  C CG   . PHE A 1 51 ? -10.265 -1.411  0.327   1.00 0.00 ? 49 PHE P CG   2  
ATOM 2027  C CD1  . PHE A 1 51 ? -8.961  -0.892  0.464   1.00 0.00 ? 49 PHE P CD1  2  
ATOM 2028  C CD2  . PHE A 1 51 ? -10.928 -1.272  -0.909  1.00 0.00 ? 49 PHE P CD2  2  
ATOM 2029  C CE1  . PHE A 1 51 ? -8.331  -0.239  -0.612  1.00 0.00 ? 49 PHE P CE1  2  
ATOM 2030  C CE2  . PHE A 1 51 ? -10.296 -0.628  -1.983  1.00 0.00 ? 49 PHE P CE2  2  
ATOM 2031  C CZ   . PHE A 1 51 ? -9.003  -0.103  -1.836  1.00 0.00 ? 49 PHE P CZ   2  
ATOM 2032  H H    . PHE A 1 51 ? -9.555  -1.523  3.503   1.00 0.00 ? 49 PHE P H    2  
ATOM 2033  H HA   . PHE A 1 51 ? -11.774 -0.254  2.147   1.00 0.00 ? 49 PHE P HA   2  
ATOM 2034  H HB2  . PHE A 1 51 ? -10.296 -2.876  1.898   1.00 0.00 ? 49 PHE P HB2  2  
ATOM 2035  H HB3  . PHE A 1 51 ? -11.817 -2.655  1.068   1.00 0.00 ? 49 PHE P HB3  2  
ATOM 2036  H HD1  . PHE A 1 51 ? -8.437  -0.976  1.402   1.00 0.00 ? 49 PHE P HD1  2  
ATOM 2037  H HD2  . PHE A 1 51 ? -11.931 -1.645  -1.047  1.00 0.00 ? 49 PHE P HD2  2  
ATOM 2038  H HE1  . PHE A 1 51 ? -7.332  0.164   -0.499  1.00 0.00 ? 49 PHE P HE1  2  
ATOM 2039  H HE2  . PHE A 1 51 ? -10.820 -0.518  -2.918  1.00 0.00 ? 49 PHE P HE2  2  
ATOM 2040  H HZ   . PHE A 1 51 ? -8.533  0.408   -2.660  1.00 0.00 ? 49 PHE P HZ   2  
ATOM 2041  N N    . LYS A 1 52 ? -12.561 -2.573  4.357   1.00 0.00 ? 50 LYS P N    2  
ATOM 2042  C CA   . LYS A 1 52 ? -13.686 -3.094  5.164   1.00 0.00 ? 50 LYS P CA   2  
ATOM 2043  C C    . LYS A 1 52 ? -14.394 -1.968  5.920   1.00 0.00 ? 50 LYS P C    2  
ATOM 2044  O O    . LYS A 1 52 ? -15.619 -1.855  5.855   1.00 0.00 ? 50 LYS P O    2  
ATOM 2045  C CB   . LYS A 1 52 ? -13.187 -4.213  6.098   1.00 0.00 ? 50 LYS P CB   2  
ATOM 2046  C CG   . LYS A 1 52 ? -14.337 -4.868  6.882   1.00 0.00 ? 50 LYS P CG   2  
ATOM 2047  C CD   . LYS A 1 52 ? -13.897 -6.097  7.693   1.00 0.00 ? 50 LYS P CD   2  
ATOM 2048  C CE   . LYS A 1 52 ? -12.921 -5.736  8.822   1.00 0.00 ? 50 LYS P CE   2  
ATOM 2049  N NZ   . LYS A 1 52 ? -12.601 -6.921  9.664   1.00 0.00 ? 50 LYS P NZ   2  
ATOM 2050  H H    . LYS A 1 52 ? -11.610 -2.819  4.613   1.00 0.00 ? 50 LYS P H    2  
ATOM 2051  H HA   . LYS A 1 52 ? -14.427 -3.527  4.491   1.00 0.00 ? 50 LYS P HA   2  
ATOM 2052  H HB2  . LYS A 1 52 ? -12.707 -4.981  5.490   1.00 0.00 ? 50 LYS P HB2  2  
ATOM 2053  H HB3  . LYS A 1 52 ? -12.451 -3.807  6.793   1.00 0.00 ? 50 LYS P HB3  2  
ATOM 2054  H HG2  . LYS A 1 52 ? -14.782 -4.140  7.561   1.00 0.00 ? 50 LYS P HG2  2  
ATOM 2055  H HG3  . LYS A 1 52 ? -15.105 -5.187  6.174   1.00 0.00 ? 50 LYS P HG3  2  
ATOM 2056  H HD2  . LYS A 1 52 ? -14.790 -6.552  8.128   1.00 0.00 ? 50 LYS P HD2  2  
ATOM 2057  H HD3  . LYS A 1 52 ? -13.434 -6.825  7.024   1.00 0.00 ? 50 LYS P HD3  2  
ATOM 2058  H HE2  . LYS A 1 52 ? -12.005 -5.331  8.385   1.00 0.00 ? 50 LYS P HE2  2  
ATOM 2059  H HE3  . LYS A 1 52 ? -13.374 -4.954  9.441   1.00 0.00 ? 50 LYS P HE3  2  
ATOM 2060  H HZ1  . LYS A 1 52 ? -12.173 -7.657  9.119   1.00 0.00 ? 50 LYS P HZ1  2  
ATOM 2061  H HZ2  . LYS A 1 52 ? -13.433 -7.300  10.095  1.00 0.00 ? 50 LYS P HZ2  2  
ATOM 2062  H HZ3  . LYS A 1 52 ? -11.960 -6.679  10.409  1.00 0.00 ? 50 LYS P HZ3  2  
ATOM 2063  N N    . ASN A 1 53 ? -13.626 -1.070  6.542   1.00 0.00 ? 51 ASN P N    2  
ATOM 2064  C CA   . ASN A 1 53 ? -14.154 0.158   7.148   1.00 0.00 ? 51 ASN P CA   2  
ATOM 2065  C C    . ASN A 1 53 ? -14.833 1.062   6.106   1.00 0.00 ? 51 ASN P C    2  
ATOM 2066  O O    . ASN A 1 53 ? -15.844 1.689   6.411   1.00 0.00 ? 51 ASN P O    2  
ATOM 2067  C CB   . ASN A 1 53 ? -13.028 0.900   7.893   1.00 0.00 ? 51 ASN P CB   2  
ATOM 2068  C CG   . ASN A 1 53 ? -12.813 0.359   9.295   1.00 0.00 ? 51 ASN P CG   2  
ATOM 2069  O OD1  . ASN A 1 53 ? -13.397 0.828   10.261  1.00 0.00 ? 51 ASN P OD1  2  
ATOM 2070  N ND2  . ASN A 1 53 ? -11.989 -0.647  9.451   1.00 0.00 ? 51 ASN P ND2  2  
ATOM 2071  H H    . ASN A 1 53 ? -12.626 -1.236  6.557   1.00 0.00 ? 51 ASN P H    2  
ATOM 2072  H HA   . ASN A 1 53 ? -14.926 -0.111  7.872   1.00 0.00 ? 51 ASN P HA   2  
ATOM 2073  H HB2  . ASN A 1 53 ? -12.094 0.847   7.334   1.00 0.00 ? 51 ASN P HB2  2  
ATOM 2074  H HB3  . ASN A 1 53 ? -13.296 1.952   7.994   1.00 0.00 ? 51 ASN P HB3  2  
ATOM 2075  H HD21 . ASN A 1 53 ? -11.504 -1.035  8.648   1.00 0.00 ? 51 ASN P HD21 2  
ATOM 2076  H HD22 . ASN A 1 53 ? -11.837 -0.996  10.381  1.00 0.00 ? 51 ASN P HD22 2  
ATOM 2077  N N    . ARG A 1 54 ? -14.346 1.093   4.860   1.00 0.00 ? 52 ARG P N    2  
ATOM 2078  C CA   . ARG A 1 54 ? -14.931 1.908   3.778   1.00 0.00 ? 52 ARG P CA   2  
ATOM 2079  C C    . ARG A 1 54 ? -16.344 1.475   3.394   1.00 0.00 ? 52 ARG P C    2  
ATOM 2080  O O    . ARG A 1 54 ? -17.237 2.315   3.290   1.00 0.00 ? 52 ARG P O    2  
ATOM 2081  C CB   . ARG A 1 54 ? -13.983 1.889   2.559   1.00 0.00 ? 52 ARG P CB   2  
ATOM 2082  C CG   . ARG A 1 54 ? -13.765 3.273   1.919   1.00 0.00 ? 52 ARG P CG   2  
ATOM 2083  C CD   . ARG A 1 54 ? -13.248 4.339   2.905   1.00 0.00 ? 52 ARG P CD   2  
ATOM 2084  N NE   . ARG A 1 54 ? -12.280 3.775   3.867   1.00 0.00 ? 52 ARG P NE   2  
ATOM 2085  C CZ   . ARG A 1 54 ? -11.898 4.277   5.021   1.00 0.00 ? 52 ARG P CZ   2  
ATOM 2086  N NH1  . ARG A 1 54 ? -12.181 5.496   5.383   1.00 0.00 ? 52 ARG P NH1  2  
ATOM 2087  N NH2  . ARG A 1 54 ? -11.226 3.525   5.838   1.00 0.00 ? 52 ARG P NH2  2  
ATOM 2088  H H    . ARG A 1 54 ? -13.479 0.598   4.680   1.00 0.00 ? 52 ARG P H    2  
ATOM 2089  H HA   . ARG A 1 54 ? -15.046 2.920   4.171   1.00 0.00 ? 52 ARG P HA   2  
ATOM 2090  H HB2  . ARG A 1 54 ? -13.008 1.512   2.855   1.00 0.00 ? 52 ARG P HB2  2  
ATOM 2091  H HB3  . ARG A 1 54 ? -14.343 1.178   1.815   1.00 0.00 ? 52 ARG P HB3  2  
ATOM 2092  H HG2  . ARG A 1 54 ? -13.036 3.162   1.116   1.00 0.00 ? 52 ARG P HG2  2  
ATOM 2093  H HG3  . ARG A 1 54 ? -14.699 3.622   1.477   1.00 0.00 ? 52 ARG P HG3  2  
ATOM 2094  H HD2  . ARG A 1 54 ? -12.782 5.149   2.339   1.00 0.00 ? 52 ARG P HD2  2  
ATOM 2095  H HD3  . ARG A 1 54 ? -14.101 4.750   3.448   1.00 0.00 ? 52 ARG P HD3  2  
ATOM 2096  H HE   . ARG A 1 54 ? -11.906 2.863   3.650   1.00 0.00 ? 52 ARG P HE   2  
ATOM 2097  H HH11 . ARG A 1 54 ? -12.654 6.096   4.730   1.00 0.00 ? 52 ARG P HH11 2  
ATOM 2098  H HH12 . ARG A 1 54 ? -11.825 5.871   6.244   1.00 0.00 ? 52 ARG P HH12 2  
ATOM 2099  H HH21 . ARG A 1 54 ? -11.023 2.575   5.558   1.00 0.00 ? 52 ARG P HH21 2  
ATOM 2100  H HH22 . ARG A 1 54 ? -10.868 3.893   6.703   1.00 0.00 ? 52 ARG P HH22 2  
ATOM 2101  N N    . ARG A 1 55 ? -16.576 0.164   3.275   1.00 0.00 ? 53 ARG P N    2  
ATOM 2102  C CA   . ARG A 1 55 ? -17.915 -0.419  3.053   1.00 0.00 ? 53 ARG P CA   2  
ATOM 2103  C C    . ARG A 1 55 ? -18.821 -0.209  4.271   1.00 0.00 ? 53 ARG P C    2  
ATOM 2104  O O    . ARG A 1 55 ? -19.996 0.120   4.114   1.00 0.00 ? 53 ARG P O    2  
ATOM 2105  C CB   . ARG A 1 55 ? -17.787 -1.913  2.706   1.00 0.00 ? 53 ARG P CB   2  
ATOM 2106  C CG   . ARG A 1 55 ? -17.522 -2.208  1.218   1.00 0.00 ? 53 ARG P CG   2  
ATOM 2107  C CD   . ARG A 1 55 ? -16.316 -1.478  0.600   1.00 0.00 ? 53 ARG P CD   2  
ATOM 2108  N NE   . ARG A 1 55 ? -15.616 -2.307  -0.403  1.00 0.00 ? 53 ARG P NE   2  
ATOM 2109  C CZ   . ARG A 1 55 ? -14.817 -3.328  -0.147  1.00 0.00 ? 53 ARG P CZ   2  
ATOM 2110  N NH1  . ARG A 1 55 ? -14.475 -3.659  1.066   1.00 0.00 ? 53 ARG P NH1  2  
ATOM 2111  N NH2  . ARG A 1 55 ? -14.339 -4.045  -1.115  1.00 0.00 ? 53 ARG P NH2  2  
ATOM 2112  H H    . ARG A 1 55 ? -15.780 -0.456  3.375   1.00 0.00 ? 53 ARG P H    2  
ATOM 2113  H HA   . ARG A 1 55 ? -18.402 0.093   2.221   1.00 0.00 ? 53 ARG P HA   2  
ATOM 2114  H HB2  . ARG A 1 55 ? -16.999 -2.365  3.312   1.00 0.00 ? 53 ARG P HB2  2  
ATOM 2115  H HB3  . ARG A 1 55 ? -18.721 -2.415  2.966   1.00 0.00 ? 53 ARG P HB3  2  
ATOM 2116  H HG2  . ARG A 1 55 ? -17.378 -3.285  1.132   1.00 0.00 ? 53 ARG P HG2  2  
ATOM 2117  H HG3  . ARG A 1 55 ? -18.411 -1.949  0.645   1.00 0.00 ? 53 ARG P HG3  2  
ATOM 2118  H HD2  . ARG A 1 55 ? -16.663 -0.548  0.146   1.00 0.00 ? 53 ARG P HD2  2  
ATOM 2119  H HD3  . ARG A 1 55 ? -15.607 -1.209  1.374   1.00 0.00 ? 53 ARG P HD3  2  
ATOM 2120  H HE   . ARG A 1 55 ? -15.801 -2.115  -1.378  1.00 0.00 ? 53 ARG P HE   2  
ATOM 2121  H HH11 . ARG A 1 55 ? -14.711 -3.031  1.820   1.00 0.00 ? 53 ARG P HH11 2  
ATOM 2122  H HH12 . ARG A 1 55 ? -13.905 -4.469  1.236   1.00 0.00 ? 53 ARG P HH12 2  
ATOM 2123  H HH21 . ARG A 1 55 ? -14.515 -3.751  -2.072  1.00 0.00 ? 53 ARG P HH21 2  
ATOM 2124  H HH22 . ARG A 1 55 ? -13.769 -4.848  -0.920  1.00 0.00 ? 53 ARG P HH22 2  
ATOM 2125  N N    . ALA A 1 56 ? -18.266 -0.302  5.479   1.00 0.00 ? 54 ALA P N    2  
ATOM 2126  C CA   . ALA A 1 56 ? -19.007 -0.036  6.716   1.00 0.00 ? 54 ALA P CA   2  
ATOM 2127  C C    . ALA A 1 56 ? -19.430 1.439   6.856   1.00 0.00 ? 54 ALA P C    2  
ATOM 2128  O O    . ALA A 1 56 ? -20.489 1.715   7.422   1.00 0.00 ? 54 ALA P O    2  
ATOM 2129  C CB   . ALA A 1 56 ? -18.157 -0.484  7.911   1.00 0.00 ? 54 ALA P CB   2  
ATOM 2130  H H    . ALA A 1 56 ? -17.296 -0.587  5.533   1.00 0.00 ? 54 ALA P H    2  
ATOM 2131  H HA   . ALA A 1 56 ? -19.921 -0.631  6.703   1.00 0.00 ? 54 ALA P HA   2  
ATOM 2132  H HB1  . ALA A 1 56 ? -17.276 0.151   8.001   1.00 0.00 ? 54 ALA P HB1  2  
ATOM 2133  H HB2  . ALA A 1 56 ? -18.743 -0.391  8.826   1.00 0.00 ? 54 ALA P HB2  2  
ATOM 2134  H HB3  . ALA A 1 56 ? -17.852 -1.523  7.786   1.00 0.00 ? 54 ALA P HB3  2  
ATOM 2135  N N    . LYS A 1 57 ? -18.638 2.379   6.321   1.00 0.00 ? 55 LYS P N    2  
ATOM 2136  C CA   . LYS A 1 57 ? -18.926 3.824   6.294   1.00 0.00 ? 55 LYS P CA   2  
ATOM 2137  C C    . LYS A 1 57 ? -19.895 4.222   5.174   1.00 0.00 ? 55 LYS P C    2  
ATOM 2138  O O    . LYS A 1 57 ? -20.763 5.064   5.395   1.00 0.00 ? 55 LYS P O    2  
ATOM 2139  C CB   . LYS A 1 57 ? -17.599 4.597   6.179   1.00 0.00 ? 55 LYS P CB   2  
ATOM 2140  C CG   . LYS A 1 57 ? -16.817 4.577   7.499   1.00 0.00 ? 55 LYS P CG   2  
ATOM 2141  C CD   . LYS A 1 57 ? -15.400 5.134   7.311   1.00 0.00 ? 55 LYS P CD   2  
ATOM 2142  C CE   . LYS A 1 57 ? -14.577 5.027   8.602   1.00 0.00 ? 55 LYS P CE   2  
ATOM 2143  N NZ   . LYS A 1 57 ? -15.047 5.963   9.660   1.00 0.00 ? 55 LYS P NZ   2  
ATOM 2144  H H    . LYS A 1 57 ? -17.729 2.076   5.980   1.00 0.00 ? 55 LYS P H    2  
ATOM 2145  H HA   . LYS A 1 57 ? -19.406 4.102   7.234   1.00 0.00 ? 55 LYS P HA   2  
ATOM 2146  H HB2  . LYS A 1 57 ? -16.988 4.163   5.387   1.00 0.00 ? 55 LYS P HB2  2  
ATOM 2147  H HB3  . LYS A 1 57 ? -17.802 5.638   5.924   1.00 0.00 ? 55 LYS P HB3  2  
ATOM 2148  H HG2  . LYS A 1 57 ? -17.355 5.180   8.225   1.00 0.00 ? 55 LYS P HG2  2  
ATOM 2149  H HG3  . LYS A 1 57 ? -16.752 3.559   7.883   1.00 0.00 ? 55 LYS P HG3  2  
ATOM 2150  H HD2  . LYS A 1 57 ? -14.895 4.549   6.539   1.00 0.00 ? 55 LYS P HD2  2  
ATOM 2151  H HD3  . LYS A 1 57 ? -15.446 6.173   6.981   1.00 0.00 ? 55 LYS P HD3  2  
ATOM 2152  H HE2  . LYS A 1 57 ? -14.631 3.994   8.958   1.00 0.00 ? 55 LYS P HE2  2  
ATOM 2153  H HE3  . LYS A 1 57 ? -13.534 5.244   8.360   1.00 0.00 ? 55 LYS P HE3  2  
ATOM 2154  H HZ1  . LYS A 1 57 ? -15.007 6.924   9.348   1.00 0.00 ? 55 LYS P HZ1  2  
ATOM 2155  H HZ2  . LYS A 1 57 ? -14.471 5.891   10.490  1.00 0.00 ? 55 LYS P HZ2  2  
ATOM 2156  H HZ3  . LYS A 1 57 ? -15.999 5.765   9.939   1.00 0.00 ? 55 LYS P HZ3  2  
ATOM 2157  N N    . TRP A 1 58 ? -19.802 3.586   4.003   1.00 0.00 ? 56 TRP P N    2  
ATOM 2158  C CA   . TRP A 1 58 ? -20.680 3.817   2.842   1.00 0.00 ? 56 TRP P CA   2  
ATOM 2159  C C    . TRP A 1 58 ? -22.162 3.629   3.191   1.00 0.00 ? 56 TRP P C    2  
ATOM 2160  O O    . TRP A 1 58 ? -23.001 4.474   2.867   1.00 0.00 ? 56 TRP P O    2  
ATOM 2161  C CB   . TRP A 1 58 ? -20.254 2.870   1.703   1.00 0.00 ? 56 TRP P CB   2  
ATOM 2162  C CG   . TRP A 1 58 ? -21.331 2.432   0.751   1.00 0.00 ? 56 TRP P CG   2  
ATOM 2163  C CD1  . TRP A 1 58 ? -22.072 3.245   -0.034  1.00 0.00 ? 56 TRP P CD1  2  
ATOM 2164  C CD2  . TRP A 1 58 ? -21.831 1.079   0.504   1.00 0.00 ? 56 TRP P CD2  2  
ATOM 2165  N NE1  . TRP A 1 58 ? -22.993 2.493   -0.740  1.00 0.00 ? 56 TRP P NE1  2  
ATOM 2166  C CE2  . TRP A 1 58 ? -22.879 1.151   -0.459  1.00 0.00 ? 56 TRP P CE2  2  
ATOM 2167  C CE3  . TRP A 1 58 ? -21.518 -0.201  1.007   1.00 0.00 ? 56 TRP P CE3  2  
ATOM 2168  C CZ2  . TRP A 1 58 ? -23.565 0.017   -0.918  1.00 0.00 ? 56 TRP P CZ2  2  
ATOM 2169  C CZ3  . TRP A 1 58 ? -22.201 -1.350  0.561   1.00 0.00 ? 56 TRP P CZ3  2  
ATOM 2170  C CH2  . TRP A 1 58 ? -23.219 -1.244  -0.405  1.00 0.00 ? 56 TRP P CH2  2  
ATOM 2171  H H    . TRP A 1 58 ? -19.046 2.920   3.896   1.00 0.00 ? 56 TRP P H    2  
ATOM 2172  H HA   . TRP A 1 58 ? -20.563 4.843   2.494   1.00 0.00 ? 56 TRP P HA   2  
ATOM 2173  H HB2  . TRP A 1 58 ? -19.452 3.344   1.136   1.00 0.00 ? 56 TRP P HB2  2  
ATOM 2174  H HB3  . TRP A 1 58 ? -19.838 1.962   2.140   1.00 0.00 ? 56 TRP P HB3  2  
ATOM 2175  H HD1  . TRP A 1 58 ? -21.963 4.322   -0.066  1.00 0.00 ? 56 TRP P HD1  2  
ATOM 2176  H HE1  . TRP A 1 58 ? -23.673 2.869   -1.401  1.00 0.00 ? 56 TRP P HE1  2  
ATOM 2177  H HE3  . TRP A 1 58 ? -20.757 -0.288  1.768   1.00 0.00 ? 56 TRP P HE3  2  
ATOM 2178  H HZ2  . TRP A 1 58 ? -24.353 0.119   -1.652  1.00 0.00 ? 56 TRP P HZ2  2  
ATOM 2179  H HZ3  . TRP A 1 58 ? -21.944 -2.320  0.965   1.00 0.00 ? 56 TRP P HZ3  2  
ATOM 2180  H HH2  . TRP A 1 58 ? -23.738 -2.132  -0.746  1.00 0.00 ? 56 TRP P HH2  2  
ATOM 2181  N N    . ARG A 1 59 ? -22.482 2.550   3.910   1.00 0.00 ? 57 ARG P N    2  
ATOM 2182  C CA   . ARG A 1 59 ? -23.854 2.131   4.254   1.00 0.00 ? 57 ARG P CA   2  
ATOM 2183  C C    . ARG A 1 59 ? -24.653 3.142   5.091   1.00 0.00 ? 57 ARG P C    2  
ATOM 2184  O O    . ARG A 1 59 ? -25.883 3.107   5.068   1.00 0.00 ? 57 ARG P O    2  
ATOM 2185  C CB   . ARG A 1 59 ? -23.756 0.783   4.982   1.00 0.00 ? 57 ARG P CB   2  
ATOM 2186  C CG   . ARG A 1 59 ? -23.430 -0.359  4.011   1.00 0.00 ? 57 ARG P CG   2  
ATOM 2187  C CD   . ARG A 1 59 ? -23.141 -1.668  4.756   1.00 0.00 ? 57 ARG P CD   2  
ATOM 2188  N NE   . ARG A 1 59 ? -24.341 -2.218  5.422   1.00 0.00 ? 57 ARG P NE   2  
ATOM 2189  C CZ   . ARG A 1 59 ? -25.305 -2.937  4.869   1.00 0.00 ? 57 ARG P CZ   2  
ATOM 2190  N NH1  . ARG A 1 59 ? -25.307 -3.246  3.603   1.00 0.00 ? 57 ARG P NH1  2  
ATOM 2191  N NH2  . ARG A 1 59 ? -26.302 -3.363  5.591   1.00 0.00 ? 57 ARG P NH2  2  
ATOM 2192  H H    . ARG A 1 59 ? -21.724 1.910   4.119   1.00 0.00 ? 57 ARG P H    2  
ATOM 2193  H HA   . ARG A 1 59 ? -24.419 2.001   3.327   1.00 0.00 ? 57 ARG P HA   2  
ATOM 2194  H HB2  . ARG A 1 59 ? -22.961 0.851   5.728   1.00 0.00 ? 57 ARG P HB2  2  
ATOM 2195  H HB3  . ARG A 1 59 ? -24.701 0.562   5.481   1.00 0.00 ? 57 ARG P HB3  2  
ATOM 2196  H HG2  . ARG A 1 59 ? -24.255 -0.498  3.310   1.00 0.00 ? 57 ARG P HG2  2  
ATOM 2197  H HG3  . ARG A 1 59 ? -22.541 -0.097  3.445   1.00 0.00 ? 57 ARG P HG3  2  
ATOM 2198  H HD2  . ARG A 1 59 ? -22.735 -2.396  4.052   1.00 0.00 ? 57 ARG P HD2  2  
ATOM 2199  H HD3  . ARG A 1 59 ? -22.371 -1.467  5.504   1.00 0.00 ? 57 ARG P HD3  2  
ATOM 2200  H HE   . ARG A 1 59 ? -24.429 -2.044  6.410   1.00 0.00 ? 57 ARG P HE   2  
ATOM 2201  H HH11 . ARG A 1 59 ? -24.554 -2.931  3.019   1.00 0.00 ? 57 ARG P HH11 2  
ATOM 2202  H HH12 . ARG A 1 59 ? -26.053 -3.795  3.211   1.00 0.00 ? 57 ARG P HH12 2  
ATOM 2203  H HH21 . ARG A 1 59 ? -26.345 -3.150  6.574   1.00 0.00 ? 57 ARG P HH21 2  
ATOM 2204  H HH22 . ARG A 1 59 ? -27.036 -3.909  5.171   1.00 0.00 ? 57 ARG P HH22 2  
ATOM 2205  N N    . LYS A 1 60 ? -23.980 4.070   5.784   1.00 0.00 ? 58 LYS P N    2  
ATOM 2206  C CA   . LYS A 1 60 ? -24.610 5.179   6.539   1.00 0.00 ? 58 LYS P CA   2  
ATOM 2207  C C    . LYS A 1 60 ? -25.220 6.266   5.639   1.00 0.00 ? 58 LYS P C    2  
ATOM 2208  O O    . LYS A 1 60 ? -26.040 7.051   6.119   1.00 0.00 ? 58 LYS P O    2  
ATOM 2209  C CB   . LYS A 1 60 ? -23.601 5.814   7.522   1.00 0.00 ? 58 LYS P CB   2  
ATOM 2210  C CG   . LYS A 1 60 ? -23.415 5.057   8.847   1.00 0.00 ? 58 LYS P CG   2  
ATOM 2211  C CD   . LYS A 1 60 ? -22.862 3.638   8.678   1.00 0.00 ? 58 LYS P CD   2  
ATOM 2212  C CE   . LYS A 1 60 ? -22.449 3.050   10.031  1.00 0.00 ? 58 LYS P CE   2  
ATOM 2213  N NZ   . LYS A 1 60 ? -21.970 1.653   9.876   1.00 0.00 ? 58 LYS P NZ   2  
ATOM 2214  H H    . LYS A 1 60 ? -22.970 4.000   5.762   1.00 0.00 ? 58 LYS P H    2  
ATOM 2215  H HA   . LYS A 1 60 ? -25.445 4.783   7.120   1.00 0.00 ? 58 LYS P HA   2  
ATOM 2216  H HB2  . LYS A 1 60 ? -22.634 5.939   7.031   1.00 0.00 ? 58 LYS P HB2  2  
ATOM 2217  H HB3  . LYS A 1 60 ? -23.950 6.813   7.787   1.00 0.00 ? 58 LYS P HB3  2  
ATOM 2218  H HG2  . LYS A 1 60 ? -22.721 5.631   9.463   1.00 0.00 ? 58 LYS P HG2  2  
ATOM 2219  H HG3  . LYS A 1 60 ? -24.371 5.009   9.370   1.00 0.00 ? 58 LYS P HG3  2  
ATOM 2220  H HD2  . LYS A 1 60 ? -23.625 3.002   8.229   1.00 0.00 ? 58 LYS P HD2  2  
ATOM 2221  H HD3  . LYS A 1 60 ? -21.991 3.681   8.024   1.00 0.00 ? 58 LYS P HD3  2  
ATOM 2222  H HE2  . LYS A 1 60 ? -21.654 3.672   10.453  1.00 0.00 ? 58 LYS P HE2  2  
ATOM 2223  H HE3  . LYS A 1 60 ? -23.302 3.082   10.715  1.00 0.00 ? 58 LYS P HE3  2  
ATOM 2224  H HZ1  . LYS A 1 60 ? -22.728 1.034   9.619   1.00 0.00 ? 58 LYS P HZ1  2  
ATOM 2225  H HZ2  . LYS A 1 60 ? -21.564 1.306   10.734  1.00 0.00 ? 58 LYS P HZ2  2  
ATOM 2226  H HZ3  . LYS A 1 60 ? -21.270 1.599   9.140   1.00 0.00 ? 58 LYS P HZ3  2  
ATOM 2227  N N    . ARG A 1 61 ? -24.820 6.345   4.361   1.00 0.00 ? 59 ARG P N    2  
ATOM 2228  C CA   . ARG A 1 61 ? -25.281 7.356   3.380   1.00 0.00 ? 59 ARG P CA   2  
ATOM 2229  C C    . ARG A 1 61 ? -25.750 6.776   2.039   1.00 0.00 ? 59 ARG P C    2  
ATOM 2230  O O    . ARG A 1 61 ? -26.474 7.456   1.315   1.00 0.00 ? 59 ARG P O    2  
ATOM 2231  C CB   . ARG A 1 61 ? -24.162 8.397   3.167   1.00 0.00 ? 59 ARG P CB   2  
ATOM 2232  C CG   . ARG A 1 61 ? -23.776 9.194   4.428   1.00 0.00 ? 59 ARG P CG   2  
ATOM 2233  C CD   . ARG A 1 61 ? -24.938 10.038  4.969   1.00 0.00 ? 59 ARG P CD   2  
ATOM 2234  N NE   . ARG A 1 61 ? -24.558 10.764  6.198   1.00 0.00 ? 59 ARG P NE   2  
ATOM 2235  C CZ   . ARG A 1 61 ? -24.849 10.438  7.446   1.00 0.00 ? 59 ARG P CZ   2  
ATOM 2236  N NH1  . ARG A 1 61 ? -25.497 9.351   7.763   1.00 0.00 ? 59 ARG P NH1  2  
ATOM 2237  N NH2  . ARG A 1 61 ? -24.483 11.216  8.424   1.00 0.00 ? 59 ARG P NH2  2  
ATOM 2238  H H    . ARG A 1 61 ? -24.084 5.712   4.077   1.00 0.00 ? 59 ARG P H    2  
ATOM 2239  H HA   . ARG A 1 61 ? -26.164 7.862   3.771   1.00 0.00 ? 59 ARG P HA   2  
ATOM 2240  H HB2  . ARG A 1 61 ? -23.272 7.883   2.801   1.00 0.00 ? 59 ARG P HB2  2  
ATOM 2241  H HB3  . ARG A 1 61 ? -24.477 9.106   2.400   1.00 0.00 ? 59 ARG P HB3  2  
ATOM 2242  H HG2  . ARG A 1 61 ? -23.428 8.512   5.204   1.00 0.00 ? 59 ARG P HG2  2  
ATOM 2243  H HG3  . ARG A 1 61 ? -22.950 9.860   4.175   1.00 0.00 ? 59 ARG P HG3  2  
ATOM 2244  H HD2  . ARG A 1 61 ? -25.229 10.761  4.204   1.00 0.00 ? 59 ARG P HD2  2  
ATOM 2245  H HD3  . ARG A 1 61 ? -25.799 9.401   5.163   1.00 0.00 ? 59 ARG P HD3  2  
ATOM 2246  H HE   . ARG A 1 61 ? -24.047 11.623  6.072   1.00 0.00 ? 59 ARG P HE   2  
ATOM 2247  H HH11 . ARG A 1 61 ? -25.777 8.700   7.039   1.00 0.00 ? 59 ARG P HH11 2  
ATOM 2248  H HH12 . ARG A 1 61 ? -25.715 9.149   8.723   1.00 0.00 ? 59 ARG P HH12 2  
ATOM 2249  H HH21 . ARG A 1 61 ? -23.983 12.069  8.234   1.00 0.00 ? 59 ARG P HH21 2  
ATOM 2250  H HH22 . ARG A 1 61 ? -24.703 10.973  9.376   1.00 0.00 ? 59 ARG P HH22 2  
ATOM 2251  N N    . GLU A 1 62 ? -25.381 5.532   1.723   1.00 0.00 ? 60 GLU P N    2  
ATOM 2252  C CA   . GLU A 1 62 ? -25.734 4.817   0.483   1.00 0.00 ? 60 GLU P CA   2  
ATOM 2253  C C    . GLU A 1 62 ? -25.338 5.595   -0.792  1.00 0.00 ? 60 GLU P C    2  
ATOM 2254  O O    . GLU A 1 62 ? -26.100 5.701   -1.755  1.00 0.00 ? 60 GLU P O    2  
ATOM 2255  C CB   . GLU A 1 62 ? -27.199 4.337   0.504   1.00 0.00 ? 60 GLU P CB   2  
ATOM 2256  C CG   . GLU A 1 62 ? -27.510 3.434   1.707   1.00 0.00 ? 60 GLU P CG   2  
ATOM 2257  C CD   . GLU A 1 62 ? -28.950 2.892   1.632   1.00 0.00 ? 60 GLU P CD   2  
ATOM 2258  O OE1  . GLU A 1 62 ? -29.894 3.594   2.074   1.00 0.00 ? 60 GLU P OE1  2  
ATOM 2259  O OE2  . GLU A 1 62 ? -29.154 1.755   1.138   1.00 0.00 ? 60 GLU P OE2  2  
ATOM 2260  H H    . GLU A 1 62 ? -24.744 5.065   2.356   1.00 0.00 ? 60 GLU P H    2  
ATOM 2261  H HA   . GLU A 1 62 ? -25.123 3.914   0.460   1.00 0.00 ? 60 GLU P HA   2  
ATOM 2262  H HB2  . GLU A 1 62 ? -27.870 5.197   0.518   1.00 0.00 ? 60 GLU P HB2  2  
ATOM 2263  H HB3  . GLU A 1 62 ? -27.392 3.766   -0.404  1.00 0.00 ? 60 GLU P HB3  2  
ATOM 2264  H HG2  . GLU A 1 62 ? -26.797 2.604   1.723   1.00 0.00 ? 60 GLU P HG2  2  
ATOM 2265  H HG3  . GLU A 1 62 ? -27.382 4.000   2.632   1.00 0.00 ? 60 GLU P HG3  2  
ATOM 2266  N N    . GLU A 1 63 ? -24.127 6.169   -0.787  1.00 0.00 ? 61 GLU P N    2  
ATOM 2267  C CA   . GLU A 1 63 ? -23.587 6.986   -1.893  1.00 0.00 ? 61 GLU P CA   2  
ATOM 2268  C C    . GLU A 1 63 ? -23.468 6.198   -3.213  1.00 0.00 ? 61 GLU P C    2  
ATOM 2269  O O    . GLU A 1 63 ? -23.753 6.728   -4.289  1.00 0.00 ? 61 GLU P O    2  
ATOM 2270  C CB   . GLU A 1 63 ? -22.205 7.530   -1.493  1.00 0.00 ? 61 GLU P CB   2  
ATOM 2271  C CG   . GLU A 1 63 ? -22.256 8.609   -0.402  1.00 0.00 ? 61 GLU P CG   2  
ATOM 2272  C CD   . GLU A 1 63 ? -22.805 9.947   -0.939  1.00 0.00 ? 61 GLU P CD   2  
ATOM 2273  O OE1  . GLU A 1 63 ? -22.019 10.745  -1.506  1.00 0.00 ? 61 GLU P OE1  2  
ATOM 2274  O OE2  . GLU A 1 63 ? -24.023 10.215  -0.796  1.00 0.00 ? 61 GLU P OE2  2  
ATOM 2275  H H    . GLU A 1 63 ? -23.582 6.088   0.061   1.00 0.00 ? 61 GLU P H    2  
ATOM 2276  H HA   . GLU A 1 63 ? -24.260 7.824   -2.081  1.00 0.00 ? 61 GLU P HA   2  
ATOM 2277  H HB2  . GLU A 1 63 ? -21.590 6.702   -1.137  1.00 0.00 ? 61 GLU P HB2  2  
ATOM 2278  H HB3  . GLU A 1 63 ? -21.717 7.946   -2.374  1.00 0.00 ? 61 GLU P HB3  2  
ATOM 2279  H HG2  . GLU A 1 63 ? -22.860 8.256   0.436   1.00 0.00 ? 61 GLU P HG2  2  
ATOM 2280  H HG3  . GLU A 1 63 ? -21.242 8.760   -0.024  1.00 0.00 ? 61 GLU P HG3  2  
ATOM 2281  N N    . PHE A 1 64 ? -23.080 4.922   -3.120  1.00 0.00 ? 62 PHE P N    2  
ATOM 2282  C CA   . PHE A 1 64 ? -23.128 3.933   -4.202  1.00 0.00 ? 62 PHE P CA   2  
ATOM 2283  C C    . PHE A 1 64 ? -24.366 3.030   -4.045  1.00 0.00 ? 62 PHE P C    2  
ATOM 2284  O O    . PHE A 1 64 ? -24.801 2.764   -2.921  1.00 0.00 ? 62 PHE P O    2  
ATOM 2285  C CB   . PHE A 1 64 ? -21.816 3.132   -4.214  1.00 0.00 ? 62 PHE P CB   2  
ATOM 2286  C CG   . PHE A 1 64 ? -21.769 2.038   -5.263  1.00 0.00 ? 62 PHE P CG   2  
ATOM 2287  C CD1  . PHE A 1 64 ? -21.583 2.369   -6.618  1.00 0.00 ? 62 PHE P CD1  2  
ATOM 2288  C CD2  . PHE A 1 64 ? -21.942 0.690   -4.891  1.00 0.00 ? 62 PHE P CD2  2  
ATOM 2289  C CE1  . PHE A 1 64 ? -21.570 1.359   -7.598  1.00 0.00 ? 62 PHE P CE1  2  
ATOM 2290  C CE2  . PHE A 1 64 ? -21.923 -0.319  -5.870  1.00 0.00 ? 62 PHE P CE2  2  
ATOM 2291  C CZ   . PHE A 1 64 ? -21.739 0.014   -7.223  1.00 0.00 ? 62 PHE P CZ   2  
ATOM 2292  H H    . PHE A 1 64 ? -22.841 4.586   -2.202  1.00 0.00 ? 62 PHE P H    2  
ATOM 2293  H HA   . PHE A 1 64 ? -23.213 4.448   -5.161  1.00 0.00 ? 62 PHE P HA   2  
ATOM 2294  H HB2  . PHE A 1 64 ? -20.988 3.819   -4.393  1.00 0.00 ? 62 PHE P HB2  2  
ATOM 2295  H HB3  . PHE A 1 64 ? -21.661 2.685   -3.231  1.00 0.00 ? 62 PHE P HB3  2  
ATOM 2296  H HD1  . PHE A 1 64 ? -21.452 3.402   -6.912  1.00 0.00 ? 62 PHE P HD1  2  
ATOM 2297  H HD2  . PHE A 1 64 ? -22.090 0.426   -3.852  1.00 0.00 ? 62 PHE P HD2  2  
ATOM 2298  H HE1  . PHE A 1 64 ? -21.429 1.616   -8.640  1.00 0.00 ? 62 PHE P HE1  2  
ATOM 2299  H HE2  . PHE A 1 64 ? -22.049 -1.355  -5.582  1.00 0.00 ? 62 PHE P HE2  2  
ATOM 2300  H HZ   . PHE A 1 64 ? -21.729 -0.763  -7.976  1.00 0.00 ? 62 PHE P HZ   2  
ATOM 2301  N N    . ILE A 1 65 ? -24.916 2.540   -5.160  1.00 0.00 ? 63 ILE P N    2  
ATOM 2302  C CA   . ILE A 1 65 ? -26.098 1.664   -5.215  1.00 0.00 ? 63 ILE P CA   2  
ATOM 2303  C C    . ILE A 1 65 ? -25.778 0.429   -6.069  1.00 0.00 ? 63 ILE P C    2  
ATOM 2304  O O    . ILE A 1 65 ? -25.269 0.548   -7.185  1.00 0.00 ? 63 ILE P O    2  
ATOM 2305  C CB   . ILE A 1 65 ? -27.325 2.435   -5.764  1.00 0.00 ? 63 ILE P CB   2  
ATOM 2306  C CG1  . ILE A 1 65 ? -27.725 3.656   -4.900  1.00 0.00 ? 63 ILE P CG1  2  
ATOM 2307  C CG2  . ILE A 1 65 ? -28.543 1.512   -5.959  1.00 0.00 ? 63 ILE P CG2  2  
ATOM 2308  C CD1  . ILE A 1 65 ? -28.237 3.342   -3.486  1.00 0.00 ? 63 ILE P CD1  2  
ATOM 2309  H H    . ILE A 1 65 ? -24.457 2.738   -6.038  1.00 0.00 ? 63 ILE P H    2  
ATOM 2310  H HA   . ILE A 1 65 ? -26.339 1.315   -4.211  1.00 0.00 ? 63 ILE P HA   2  
ATOM 2311  H HB   . ILE A 1 65 ? -27.057 2.820   -6.750  1.00 0.00 ? 63 ILE P HB   2  
ATOM 2312  H HG12 . ILE A 1 65 ? -26.873 4.331   -4.814  1.00 0.00 ? 63 ILE P HG12 2  
ATOM 2313  H HG13 . ILE A 1 65 ? -28.507 4.207   -5.425  1.00 0.00 ? 63 ILE P HG13 2  
ATOM 2314  H HG21 . ILE A 1 65 ? -29.413 2.101   -6.252  1.00 0.00 ? 63 ILE P HG21 2  
ATOM 2315  H HG22 . ILE A 1 65 ? -28.349 0.790   -6.752  1.00 0.00 ? 63 ILE P HG22 2  
ATOM 2316  H HG23 . ILE A 1 65 ? -28.770 0.974   -5.038  1.00 0.00 ? 63 ILE P HG23 2  
ATOM 2317  H HD11 . ILE A 1 65 ? -28.447 4.277   -2.966  1.00 0.00 ? 63 ILE P HD11 2  
ATOM 2318  H HD12 . ILE A 1 65 ? -27.491 2.787   -2.920  1.00 0.00 ? 63 ILE P HD12 2  
ATOM 2319  H HD13 . ILE A 1 65 ? -29.159 2.762   -3.536  1.00 0.00 ? 63 ILE P HD13 2  
ATOM 2320  N N    . VAL A 1 66 ? -26.102 -0.759  -5.551  1.00 0.00 ? 64 VAL P N    2  
ATOM 2321  C CA   . VAL A 1 66 ? -25.898 -2.048  -6.235  1.00 0.00 ? 64 VAL P CA   2  
ATOM 2322  C C    . VAL A 1 66 ? -27.045 -2.309  -7.219  1.00 0.00 ? 64 VAL P C    2  
ATOM 2323  O O    . VAL A 1 66 ? -28.217 -2.259  -6.838  1.00 0.00 ? 64 VAL P O    2  
ATOM 2324  C CB   . VAL A 1 66 ? -25.766 -3.200  -5.217  1.00 0.00 ? 64 VAL P CB   2  
ATOM 2325  C CG1  . VAL A 1 66 ? -25.492 -4.542  -5.907  1.00 0.00 ? 64 VAL P CG1  2  
ATOM 2326  C CG2  . VAL A 1 66 ? -24.619 -2.947  -4.227  1.00 0.00 ? 64 VAL P CG2  2  
ATOM 2327  H H    . VAL A 1 66 ? -26.547 -0.774  -4.645  1.00 0.00 ? 64 VAL P H    2  
ATOM 2328  H HA   . VAL A 1 66 ? -24.965 -1.999  -6.799  1.00 0.00 ? 64 VAL P HA   2  
ATOM 2329  H HB   . VAL A 1 66 ? -26.695 -3.284  -4.652  1.00 0.00 ? 64 VAL P HB   2  
ATOM 2330  H HG11 . VAL A 1 66 ? -25.364 -5.323  -5.156  1.00 0.00 ? 64 VAL P HG11 2  
ATOM 2331  H HG12 . VAL A 1 66 ? -26.334 -4.822  -6.541  1.00 0.00 ? 64 VAL P HG12 2  
ATOM 2332  H HG13 . VAL A 1 66 ? -24.588 -4.477  -6.513  1.00 0.00 ? 64 VAL P HG13 2  
ATOM 2333  H HG21 . VAL A 1 66 ? -24.790 -2.030  -3.663  1.00 0.00 ? 64 VAL P HG21 2  
ATOM 2334  H HG22 . VAL A 1 66 ? -24.553 -3.772  -3.518  1.00 0.00 ? 64 VAL P HG22 2  
ATOM 2335  H HG23 . VAL A 1 66 ? -23.674 -2.864  -4.765  1.00 0.00 ? 64 VAL P HG23 2  
ATOM 2336  N N    . THR A 1 67 ? -26.711 -2.602  -8.479  1.00 0.00 ? 65 THR P N    2  
ATOM 2337  C CA   . THR A 1 67 ? -27.678 -2.781  -9.586  1.00 0.00 ? 65 THR P CA   2  
ATOM 2338  C C    . THR A 1 67 ? -27.669 -4.181  -10.218 1.00 0.00 ? 65 THR P C    2  
ATOM 2339  O O    . THR A 1 67 ? -28.597 -4.528  -10.952 1.00 0.00 ? 65 THR P O    2  
ATOM 2340  C CB   . THR A 1 67 ? -27.439 -1.731  -10.685 1.00 0.00 ? 65 THR P CB   2  
ATOM 2341  O OG1  . THR A 1 67 ? -26.102 -1.793  -11.145 1.00 0.00 ? 65 THR P OG1  2  
ATOM 2342  C CG2  . THR A 1 67 ? -27.689 -0.311  -10.173 1.00 0.00 ? 65 THR P CG2  2  
ATOM 2343  H H    . THR A 1 67 ? -25.736 -2.552  -8.735  1.00 0.00 ? 65 THR P H    2  
ATOM 2344  H HA   . THR A 1 67 ? -28.689 -2.630  -9.210  1.00 0.00 ? 65 THR P HA   2  
ATOM 2345  H HB   . THR A 1 67 ? -28.118 -1.923  -11.517 1.00 0.00 ? 65 THR P HB   2  
ATOM 2346  H HG1  . THR A 1 67 ? -26.022 -1.180  -11.898 1.00 0.00 ? 65 THR P HG1  2  
ATOM 2347  H HG21 . THR A 1 67 ? -28.695 -0.246  -9.759  1.00 0.00 ? 65 THR P HG21 2  
ATOM 2348  H HG22 . THR A 1 67 ? -27.599 0.395   -10.997 1.00 0.00 ? 65 THR P HG22 2  
ATOM 2349  H HG23 . THR A 1 67 ? -26.965 -0.057  -9.400  1.00 0.00 ? 65 THR P HG23 2  
ATOM 2350  N N    . ASP A 1 68 ? -26.651 -5.000  -9.923  1.00 0.00 ? 66 ASP P N    2  
ATOM 2351  C CA   . ASP A 1 68 ? -26.462 -6.377  -10.424 1.00 0.00 ? 66 ASP P CA   2  
ATOM 2352  C C    . ASP A 1 68 ? -25.772 -7.298  -9.395  1.00 0.00 ? 66 ASP P C    2  
ATOM 2353  O O    . ASP A 1 68 ? -26.299 -8.406  -9.147  1.00 0.00 ? 66 ASP P O    2  
ATOM 2354  C CB   . ASP A 1 68 ? -25.664 -6.336  -11.745 1.00 0.00 ? 66 ASP P CB   2  
ATOM 2355  C CG   . ASP A 1 68 ? -25.451 -7.736  -12.366 1.00 0.00 ? 66 ASP P CG   2  
ATOM 2356  O OD1  . ASP A 1 68 ? -26.426 -8.317  -12.906 1.00 0.00 ? 66 ASP P OD1  2  
ATOM 2357  O OD2  . ASP A 1 68 ? -24.303 -8.247  -12.350 1.00 0.00 ? 66 ASP P OD2  2  
ATOM 2358  O OXT  . ASP A 1 68 ? -24.726 -6.903  -8.831  1.00 0.00 ? 66 ASP P OXT  2  
ATOM 2359  H H    . ASP A 1 68 ? -25.942 -4.636  -9.304  1.00 0.00 ? 66 ASP P H    2  
ATOM 2360  H HA   . ASP A 1 68 ? -27.438 -6.813  -10.641 1.00 0.00 ? 66 ASP P HA   2  
ATOM 2361  H HB2  . ASP A 1 68 ? -26.201 -5.710  -12.462 1.00 0.00 ? 66 ASP P HB2  2  
ATOM 2362  H HB3  . ASP A 1 68 ? -24.696 -5.863  -11.562 1.00 0.00 ? 66 ASP P HB3  2  
ATOM 2363  N N    . GLY A 1 1  ? 11.083  4.814   25.576  1.00 0.00 ? -1 GLY P N    3  
ATOM 2364  C CA   . GLY A 1 1  ? 10.386  6.023   26.072  1.00 0.00 ? -1 GLY P CA   3  
ATOM 2365  C C    . GLY A 1 1  ? 11.022  7.301   25.541  1.00 0.00 ? -1 GLY P C    3  
ATOM 2366  O O    . GLY A 1 1  ? 11.660  7.290   24.489  1.00 0.00 ? -1 GLY P O    3  
ATOM 2367  H H1   . GLY A 1 1  ? 11.066  4.794   24.568  1.00 0.00 ? -1 GLY P H1   3  
ATOM 2368  H H2   . GLY A 1 1  ? 10.632  3.984   25.927  1.00 0.00 ? -1 GLY P H2   3  
ATOM 2369  H H3   . GLY A 1 1  ? 12.045  4.815   25.880  1.00 0.00 ? -1 GLY P H3   3  
ATOM 2370  H HA2  . GLY A 1 1  ? 9.344   5.999   25.753  1.00 0.00 ? -1 GLY P HA2  3  
ATOM 2371  H HA3  . GLY A 1 1  ? 10.420  6.038   27.161  1.00 0.00 ? -1 GLY P HA3  3  
ATOM 2372  N N    . SER A 1 2  ? 10.849  8.415   26.265  1.00 0.00 ? 0  SER P N    3  
ATOM 2373  C CA   . SER A 1 2  ? 11.396  9.756   25.942  1.00 0.00 ? 0  SER P CA   3  
ATOM 2374  C C    . SER A 1 2  ? 11.023  10.308  24.547  1.00 0.00 ? 0  SER P C    3  
ATOM 2375  O O    . SER A 1 2  ? 11.762  11.106  23.966  1.00 0.00 ? 0  SER P O    3  
ATOM 2376  C CB   . SER A 1 2  ? 12.909  9.820   26.212  1.00 0.00 ? 0  SER P CB   3  
ATOM 2377  O OG   . SER A 1 2  ? 13.206  9.454   27.554  1.00 0.00 ? 0  SER P OG   3  
ATOM 2378  H H    . SER A 1 2  ? 10.313  8.341   27.121  1.00 0.00 ? 0  SER P H    3  
ATOM 2379  H HA   . SER A 1 2  ? 10.936  10.452  26.645  1.00 0.00 ? 0  SER P HA   3  
ATOM 2380  H HB2  . SER A 1 2  ? 13.435  9.155   25.524  1.00 0.00 ? 0  SER P HB2  3  
ATOM 2381  H HB3  . SER A 1 2  ? 13.263  10.838  26.046  1.00 0.00 ? 0  SER P HB3  3  
ATOM 2382  H HG   . SER A 1 2  ? 13.000  8.506   27.668  1.00 0.00 ? 0  SER P HG   3  
ATOM 2383  N N    . GLN A 1 3  ? 9.874   9.889   24.002  1.00 0.00 ? 1  GLN P N    3  
ATOM 2384  C CA   . GLN A 1 3  ? 9.339   10.295  22.692  1.00 0.00 ? 1  GLN P CA   3  
ATOM 2385  C C    . GLN A 1 3  ? 7.815   10.516  22.753  1.00 0.00 ? 1  GLN P C    3  
ATOM 2386  O O    . GLN A 1 3  ? 7.124   9.938   23.599  1.00 0.00 ? 1  GLN P O    3  
ATOM 2387  C CB   . GLN A 1 3  ? 9.676   9.235   21.625  1.00 0.00 ? 1  GLN P CB   3  
ATOM 2388  C CG   . GLN A 1 3  ? 11.180  9.135   21.311  1.00 0.00 ? 1  GLN P CG   3  
ATOM 2389  C CD   . GLN A 1 3  ? 11.516  8.132   20.205  1.00 0.00 ? 1  GLN P CD   3  
ATOM 2390  O OE1  . GLN A 1 3  ? 10.674  7.443   19.640  1.00 0.00 ? 1  GLN P OE1  3  
ATOM 2391  N NE2  . GLN A 1 3  ? 12.777  8.007   19.842  1.00 0.00 ? 1  GLN P NE2  3  
ATOM 2392  H H    . GLN A 1 3  ? 9.301   9.265   24.552  1.00 0.00 ? 1  GLN P H    3  
ATOM 2393  H HA   . GLN A 1 3  ? 9.791   11.242  22.392  1.00 0.00 ? 1  GLN P HA   3  
ATOM 2394  H HB2  . GLN A 1 3  ? 9.311   8.261   21.958  1.00 0.00 ? 1  GLN P HB2  3  
ATOM 2395  H HB3  . GLN A 1 3  ? 9.156   9.495   20.700  1.00 0.00 ? 1  GLN P HB3  3  
ATOM 2396  H HG2  . GLN A 1 3  ? 11.544  10.119  21.008  1.00 0.00 ? 1  GLN P HG2  3  
ATOM 2397  H HG3  . GLN A 1 3  ? 11.721  8.837   22.208  1.00 0.00 ? 1  GLN P HG3  3  
ATOM 2398  H HE21 . GLN A 1 3  ? 13.493  8.559   20.290  1.00 0.00 ? 1  GLN P HE21 3  
ATOM 2399  H HE22 . GLN A 1 3  ? 13.004  7.347   19.113  1.00 0.00 ? 1  GLN P HE22 3  
ATOM 2400  N N    . ARG A 1 4  ? 7.280   11.335  21.836  1.00 0.00 ? 2  ARG P N    3  
ATOM 2401  C CA   . ARG A 1 4  ? 5.835   11.602  21.689  1.00 0.00 ? 2  ARG P CA   3  
ATOM 2402  C C    . ARG A 1 4  ? 5.087   10.373  21.143  1.00 0.00 ? 2  ARG P C    3  
ATOM 2403  O O    . ARG A 1 4  ? 5.619   9.638   20.306  1.00 0.00 ? 2  ARG P O    3  
ATOM 2404  C CB   . ARG A 1 4  ? 5.649   12.851  20.804  1.00 0.00 ? 2  ARG P CB   3  
ATOM 2405  C CG   . ARG A 1 4  ? 4.200   13.365  20.762  1.00 0.00 ? 2  ARG P CG   3  
ATOM 2406  C CD   . ARG A 1 4  ? 4.102   14.656  19.940  1.00 0.00 ? 2  ARG P CD   3  
ATOM 2407  N NE   . ARG A 1 4  ? 2.714   15.158  19.890  1.00 0.00 ? 2  ARG P NE   3  
ATOM 2408  C CZ   . ARG A 1 4  ? 2.292   16.247  19.270  1.00 0.00 ? 2  ARG P CZ   3  
ATOM 2409  N NH1  . ARG A 1 4  ? 3.099   17.024  18.603  1.00 0.00 ? 2  ARG P NH1  3  
ATOM 2410  N NH2  . ARG A 1 4  ? 1.033   16.579  19.307  1.00 0.00 ? 2  ARG P NH2  3  
ATOM 2411  H H    . ARG A 1 4  ? 7.908   11.758  21.166  1.00 0.00 ? 2  ARG P H    3  
ATOM 2412  H HA   . ARG A 1 4  ? 5.430   11.821  22.680  1.00 0.00 ? 2  ARG P HA   3  
ATOM 2413  H HB2  . ARG A 1 4  ? 6.280   13.650  21.197  1.00 0.00 ? 2  ARG P HB2  3  
ATOM 2414  H HB3  . ARG A 1 4  ? 5.978   12.626  19.788  1.00 0.00 ? 2  ARG P HB3  3  
ATOM 2415  H HG2  . ARG A 1 4  ? 3.555   12.613  20.306  1.00 0.00 ? 2  ARG P HG2  3  
ATOM 2416  H HG3  . ARG A 1 4  ? 3.857   13.562  21.779  1.00 0.00 ? 2  ARG P HG3  3  
ATOM 2417  H HD2  . ARG A 1 4  ? 4.747   15.412  20.395  1.00 0.00 ? 2  ARG P HD2  3  
ATOM 2418  H HD3  . ARG A 1 4  ? 4.454   14.454  18.926  1.00 0.00 ? 2  ARG P HD3  3  
ATOM 2419  H HE   . ARG A 1 4  ? 2.014   14.621  20.377  1.00 0.00 ? 2  ARG P HE   3  
ATOM 2420  H HH11 . ARG A 1 4  ? 4.076   16.792  18.557  1.00 0.00 ? 2  ARG P HH11 3  
ATOM 2421  H HH12 . ARG A 1 4  ? 2.753   17.847  18.139  1.00 0.00 ? 2  ARG P HH12 3  
ATOM 2422  H HH21 . ARG A 1 4  ? 0.373   16.010  19.812  1.00 0.00 ? 2  ARG P HH21 3  
ATOM 2423  H HH22 . ARG A 1 4  ? 0.713   17.408  18.836  1.00 0.00 ? 2  ARG P HH22 3  
ATOM 2424  N N    . ARG A 1 5  ? 3.844   10.163  21.593  1.00 0.00 ? 3  ARG P N    3  
ATOM 2425  C CA   . ARG A 1 5  ? 2.953   9.076   21.132  1.00 0.00 ? 3  ARG P CA   3  
ATOM 2426  C C    . ARG A 1 5  ? 2.567   9.232   19.656  1.00 0.00 ? 3  ARG P C    3  
ATOM 2427  O O    . ARG A 1 5  ? 2.510   10.348  19.135  1.00 0.00 ? 3  ARG P O    3  
ATOM 2428  C CB   . ARG A 1 5  ? 1.685   9.007   22.005  1.00 0.00 ? 3  ARG P CB   3  
ATOM 2429  C CG   . ARG A 1 5  ? 1.988   8.615   23.461  1.00 0.00 ? 3  ARG P CG   3  
ATOM 2430  C CD   . ARG A 1 5  ? 0.692   8.519   24.280  1.00 0.00 ? 3  ARG P CD   3  
ATOM 2431  N NE   . ARG A 1 5  ? 0.966   8.187   25.694  1.00 0.00 ? 3  ARG P NE   3  
ATOM 2432  C CZ   . ARG A 1 5  ? 1.100   6.986   26.229  1.00 0.00 ? 3  ARG P CZ   3  
ATOM 2433  N NH1  . ARG A 1 5  ? 1.009   5.892   25.526  1.00 0.00 ? 3  ARG P NH1  3  
ATOM 2434  N NH2  . ARG A 1 5  ? 1.331   6.858   27.505  1.00 0.00 ? 3  ARG P NH2  3  
ATOM 2435  H H    . ARG A 1 5  ? 3.480   10.821  22.268  1.00 0.00 ? 3  ARG P H    3  
ATOM 2436  H HA   . ARG A 1 5  ? 3.488   8.127   21.222  1.00 0.00 ? 3  ARG P HA   3  
ATOM 2437  H HB2  . ARG A 1 5  ? 1.179   9.975   21.984  1.00 0.00 ? 3  ARG P HB2  3  
ATOM 2438  H HB3  . ARG A 1 5  ? 1.004   8.266   21.579  1.00 0.00 ? 3  ARG P HB3  3  
ATOM 2439  H HG2  . ARG A 1 5  ? 2.498   7.652   23.476  1.00 0.00 ? 3  ARG P HG2  3  
ATOM 2440  H HG3  . ARG A 1 5  ? 2.637   9.364   23.917  1.00 0.00 ? 3  ARG P HG3  3  
ATOM 2441  H HD2  . ARG A 1 5  ? 0.180   9.481   24.238  1.00 0.00 ? 3  ARG P HD2  3  
ATOM 2442  H HD3  . ARG A 1 5  ? 0.032   7.773   23.834  1.00 0.00 ? 3  ARG P HD3  3  
ATOM 2443  H HE   . ARG A 1 5  ? 1.053   8.966   26.330  1.00 0.00 ? 3  ARG P HE   3  
ATOM 2444  H HH11 . ARG A 1 5  ? 0.829   5.955   24.540  1.00 0.00 ? 3  ARG P HH11 3  
ATOM 2445  H HH12 . ARG A 1 5  ? 1.113   4.992   25.963  1.00 0.00 ? 3  ARG P HH12 3  
ATOM 2446  H HH21 . ARG A 1 5  ? 1.409   7.675   28.090  1.00 0.00 ? 3  ARG P HH21 3  
ATOM 2447  H HH22 . ARG A 1 5  ? 1.431   5.944   27.915  1.00 0.00 ? 3  ARG P HH22 3  
ATOM 2448  N N    . GLN A 1 6  ? 2.258   8.115   18.997  1.00 0.00 ? 4  GLN P N    3  
ATOM 2449  C CA   . GLN A 1 6  ? 1.729   8.058   17.628  1.00 0.00 ? 4  GLN P CA   3  
ATOM 2450  C C    . GLN A 1 6  ? 0.543   7.079   17.569  1.00 0.00 ? 4  GLN P C    3  
ATOM 2451  O O    . GLN A 1 6  ? 0.712   5.870   17.760  1.00 0.00 ? 4  GLN P O    3  
ATOM 2452  C CB   . GLN A 1 6  ? 2.843   7.649   16.642  1.00 0.00 ? 4  GLN P CB   3  
ATOM 2453  C CG   . GLN A 1 6  ? 3.976   8.677   16.469  1.00 0.00 ? 4  GLN P CG   3  
ATOM 2454  C CD   . GLN A 1 6  ? 3.543   9.935   15.715  1.00 0.00 ? 4  GLN P CD   3  
ATOM 2455  O OE1  . GLN A 1 6  ? 3.657   10.035  14.500  1.00 0.00 ? 4  GLN P OE1  3  
ATOM 2456  N NE2  . GLN A 1 6  ? 3.027   10.944  16.387  1.00 0.00 ? 4  GLN P NE2  3  
ATOM 2457  H H    . GLN A 1 6  ? 2.336   7.242   19.498  1.00 0.00 ? 4  GLN P H    3  
ATOM 2458  H HA   . GLN A 1 6  ? 1.354   9.040   17.334  1.00 0.00 ? 4  GLN P HA   3  
ATOM 2459  H HB2  . GLN A 1 6  ? 3.283   6.711   16.984  1.00 0.00 ? 4  GLN P HB2  3  
ATOM 2460  H HB3  . GLN A 1 6  ? 2.396   7.466   15.663  1.00 0.00 ? 4  GLN P HB3  3  
ATOM 2461  H HG2  . GLN A 1 6  ? 4.387   8.952   17.440  1.00 0.00 ? 4  GLN P HG2  3  
ATOM 2462  H HG3  . GLN A 1 6  ? 4.779   8.206   15.902  1.00 0.00 ? 4  GLN P HG3  3  
ATOM 2463  H HE21 . GLN A 1 6  ? 2.906   10.875  17.395  1.00 0.00 ? 4  GLN P HE21 3  
ATOM 2464  H HE22 . GLN A 1 6  ? 2.748   11.768  15.880  1.00 0.00 ? 4  GLN P HE22 3  
ATOM 2465  N N    . ARG A 1 7  ? -0.659  7.610   17.310  1.00 0.00 ? 5  ARG P N    3  
ATOM 2466  C CA   . ARG A 1 7  ? -1.922  6.857   17.160  1.00 0.00 ? 5  ARG P CA   3  
ATOM 2467  C C    . ARG A 1 7  ? -2.356  6.683   15.692  1.00 0.00 ? 5  ARG P C    3  
ATOM 2468  O O    . ARG A 1 7  ? -1.774  7.294   14.793  1.00 0.00 ? 5  ARG P O    3  
ATOM 2469  C CB   . ARG A 1 7  ? -3.019  7.494   18.031  1.00 0.00 ? 5  ARG P CB   3  
ATOM 2470  C CG   . ARG A 1 7  ? -3.391  8.935   17.626  1.00 0.00 ? 5  ARG P CG   3  
ATOM 2471  C CD   . ARG A 1 7  ? -4.860  9.222   17.943  1.00 0.00 ? 5  ARG P CD   3  
ATOM 2472  N NE   . ARG A 1 7  ? -5.745  8.531   16.984  1.00 0.00 ? 5  ARG P NE   3  
ATOM 2473  C CZ   . ARG A 1 7  ? -7.025  8.246   17.113  1.00 0.00 ? 5  ARG P CZ   3  
ATOM 2474  N NH1  . ARG A 1 7  ? -7.719  8.580   18.165  1.00 0.00 ? 5  ARG P NH1  3  
ATOM 2475  N NH2  . ARG A 1 7  ? -7.625  7.602   16.156  1.00 0.00 ? 5  ARG P NH2  3  
ATOM 2476  H H    . ARG A 1 7  ? -0.697  8.614   17.195  1.00 0.00 ? 5  ARG P H    3  
ATOM 2477  H HA   . ARG A 1 7  ? -1.779  5.848   17.547  1.00 0.00 ? 5  ARG P HA   3  
ATOM 2478  H HB2  . ARG A 1 7  ? -3.903  6.857   17.984  1.00 0.00 ? 5  ARG P HB2  3  
ATOM 2479  H HB3  . ARG A 1 7  ? -2.692  7.500   19.072  1.00 0.00 ? 5  ARG P HB3  3  
ATOM 2480  H HG2  . ARG A 1 7  ? -2.759  9.631   18.179  1.00 0.00 ? 5  ARG P HG2  3  
ATOM 2481  H HG3  . ARG A 1 7  ? -3.226  9.097   16.561  1.00 0.00 ? 5  ARG P HG3  3  
ATOM 2482  H HD2  . ARG A 1 7  ? -5.064  8.889   18.963  1.00 0.00 ? 5  ARG P HD2  3  
ATOM 2483  H HD3  . ARG A 1 7  ? -5.030  10.299  17.878  1.00 0.00 ? 5  ARG P HD3  3  
ATOM 2484  H HE   . ARG A 1 7  ? -5.334  8.237   16.105  1.00 0.00 ? 5  ARG P HE   3  
ATOM 2485  H HH11 . ARG A 1 7  ? -7.271  9.094   18.905  1.00 0.00 ? 5  ARG P HH11 3  
ATOM 2486  H HH12 . ARG A 1 7  ? -8.695  8.347   18.231  1.00 0.00 ? 5  ARG P HH12 3  
ATOM 2487  H HH21 . ARG A 1 7  ? -7.087  7.354   15.334  1.00 0.00 ? 5  ARG P HH21 3  
ATOM 2488  H HH22 . ARG A 1 7  ? -8.601  7.372   16.219  1.00 0.00 ? 5  ARG P HH22 3  
ATOM 2489  N N    . THR A 1 8  ? -3.415  5.892   15.484  1.00 0.00 ? 6  THR P N    3  
ATOM 2490  C CA   . THR A 1 8  ? -4.010  5.509   14.181  1.00 0.00 ? 6  THR P CA   3  
ATOM 2491  C C    . THR A 1 8  ? -3.103  4.606   13.322  1.00 0.00 ? 6  THR P C    3  
ATOM 2492  O O    . THR A 1 8  ? -1.875  4.706   13.348  1.00 0.00 ? 6  THR P O    3  
ATOM 2493  C CB   . THR A 1 8  ? -4.536  6.739   13.406  1.00 0.00 ? 6  THR P CB   3  
ATOM 2494  O OG1  . THR A 1 8  ? -5.340  7.543   14.251  1.00 0.00 ? 6  THR P OG1  3  
ATOM 2495  C CG2  . THR A 1 8  ? -5.431  6.389   12.216  1.00 0.00 ? 6  THR P CG2  3  
ATOM 2496  H H    . THR A 1 8  ? -3.826  5.474   16.305  1.00 0.00 ? 6  THR P H    3  
ATOM 2497  H HA   . THR A 1 8  ? -4.891  4.913   14.418  1.00 0.00 ? 6  THR P HA   3  
ATOM 2498  H HB   . THR A 1 8  ? -3.694  7.333   13.050  1.00 0.00 ? 6  THR P HB   3  
ATOM 2499  H HG1  . THR A 1 8  ? -5.522  8.364   13.756  1.00 0.00 ? 6  THR P HG1  3  
ATOM 2500  H HG21 . THR A 1 8  ? -4.849  5.908   11.432  1.00 0.00 ? 6  THR P HG21 3  
ATOM 2501  H HG22 . THR A 1 8  ? -5.859  7.301   11.797  1.00 0.00 ? 6  THR P HG22 3  
ATOM 2502  H HG23 . THR A 1 8  ? -6.240  5.731   12.533  1.00 0.00 ? 6  THR P HG23 3  
ATOM 2503  N N    . HIS A 1 9  ? -3.709  3.697   12.548  1.00 0.00 ? 7  HIS P N    3  
ATOM 2504  C CA   . HIS A 1 9  ? -3.007  2.695   11.720  1.00 0.00 ? 7  HIS P CA   3  
ATOM 2505  C C    . HIS A 1 9  ? -2.502  3.218   10.361  1.00 0.00 ? 7  HIS P C    3  
ATOM 2506  O O    . HIS A 1 9  ? -1.905  2.453   9.600   1.00 0.00 ? 7  HIS P O    3  
ATOM 2507  C CB   . HIS A 1 9  ? -3.911  1.462   11.547  1.00 0.00 ? 7  HIS P CB   3  
ATOM 2508  C CG   . HIS A 1 9  ? -4.150  0.717   12.837  1.00 0.00 ? 7  HIS P CG   3  
ATOM 2509  N ND1  . HIS A 1 9  ? -3.209  -0.082  13.495  1.00 0.00 ? 7  HIS P ND1  3  
ATOM 2510  C CD2  . HIS A 1 9  ? -5.308  0.721   13.559  1.00 0.00 ? 7  HIS P CD2  3  
ATOM 2511  C CE1  . HIS A 1 9  ? -3.824  -0.541  14.598  1.00 0.00 ? 7  HIS P CE1  3  
ATOM 2512  N NE2  . HIS A 1 9  ? -5.084  -0.075  14.662  1.00 0.00 ? 7  HIS P NE2  3  
ATOM 2513  H H    . HIS A 1 9  ? -4.717  3.646   12.578  1.00 0.00 ? 7  HIS P H    3  
ATOM 2514  H HA   . HIS A 1 9  ? -2.116  2.365   12.258  1.00 0.00 ? 7  HIS P HA   3  
ATOM 2515  H HB2  . HIS A 1 9  ? -4.867  1.767   11.121  1.00 0.00 ? 7  HIS P HB2  3  
ATOM 2516  H HB3  . HIS A 1 9  ? -3.445  0.765   10.851  1.00 0.00 ? 7  HIS P HB3  3  
ATOM 2517  H HD2  . HIS A 1 9  ? -6.219  1.249   13.307  1.00 0.00 ? 7  HIS P HD2  3  
ATOM 2518  H HE1  . HIS A 1 9  ? -3.371  -1.196  15.336  1.00 0.00 ? 7  HIS P HE1  3  
ATOM 2519  H HE2  . HIS A 1 9  ? -5.748  -0.283  15.401  1.00 0.00 ? 7  HIS P HE2  3  
ATOM 2520  N N    . PHE A 1 10 ? -2.728  4.501   10.051  1.00 0.00 ? 8  PHE P N    3  
ATOM 2521  C CA   . PHE A 1 10 ? -2.385  5.137   8.776   1.00 0.00 ? 8  PHE P CA   3  
ATOM 2522  C C    . PHE A 1 10 ? -1.849  6.565   8.956   1.00 0.00 ? 8  PHE P C    3  
ATOM 2523  O O    . PHE A 1 10 ? -2.086  7.208   9.983   1.00 0.00 ? 8  PHE P O    3  
ATOM 2524  C CB   . PHE A 1 10 ? -3.617  5.181   7.862   1.00 0.00 ? 8  PHE P CB   3  
ATOM 2525  C CG   . PHE A 1 10 ? -4.300  3.845   7.666   1.00 0.00 ? 8  PHE P CG   3  
ATOM 2526  C CD1  . PHE A 1 10 ? -3.833  2.958   6.680   1.00 0.00 ? 8  PHE P CD1  3  
ATOM 2527  C CD2  . PHE A 1 10 ? -5.369  3.470   8.503   1.00 0.00 ? 8  PHE P CD2  3  
ATOM 2528  C CE1  . PHE A 1 10 ? -4.427  1.691   6.540   1.00 0.00 ? 8  PHE P CE1  3  
ATOM 2529  C CE2  . PHE A 1 10 ? -5.947  2.196   8.378   1.00 0.00 ? 8  PHE P CE2  3  
ATOM 2530  C CZ   . PHE A 1 10 ? -5.468  1.305   7.404   1.00 0.00 ? 8  PHE P CZ   3  
ATOM 2531  H H    . PHE A 1 10 ? -3.183  5.081   10.737  1.00 0.00 ? 8  PHE P H    3  
ATOM 2532  H HA   . PHE A 1 10 ? -1.616  4.545   8.285   1.00 0.00 ? 8  PHE P HA   3  
ATOM 2533  H HB2  . PHE A 1 10 ? -4.337  5.887   8.278   1.00 0.00 ? 8  PHE P HB2  3  
ATOM 2534  H HB3  . PHE A 1 10 ? -3.305  5.558   6.888   1.00 0.00 ? 8  PHE P HB3  3  
ATOM 2535  H HD1  . PHE A 1 10 ? -3.009  3.250   6.042   1.00 0.00 ? 8  PHE P HD1  3  
ATOM 2536  H HD2  . PHE A 1 10 ? -5.728  4.152   9.261   1.00 0.00 ? 8  PHE P HD2  3  
ATOM 2537  H HE1  . PHE A 1 10 ? -4.078  1.015   5.772   1.00 0.00 ? 8  PHE P HE1  3  
ATOM 2538  H HE2  . PHE A 1 10 ? -6.756  1.900   9.032   1.00 0.00 ? 8  PHE P HE2  3  
ATOM 2539  H HZ   . PHE A 1 10 ? -5.912  0.324   7.318   1.00 0.00 ? 8  PHE P HZ   3  
ATOM 2540  N N    . THR A 1 11 ? -1.184  7.083   7.921   1.00 0.00 ? 9  THR P N    3  
ATOM 2541  C CA   . THR A 1 11 ? -0.747  8.486   7.811   1.00 0.00 ? 9  THR P CA   3  
ATOM 2542  C C    . THR A 1 11 ? -1.657  9.275   6.874   1.00 0.00 ? 9  THR P C    3  
ATOM 2543  O O    . THR A 1 11 ? -2.302  8.708   5.987   1.00 0.00 ? 9  THR P O    3  
ATOM 2544  C CB   . THR A 1 11 ? 0.709   8.628   7.330   1.00 0.00 ? 9  THR P CB   3  
ATOM 2545  O OG1  . THR A 1 11 ? 0.800   8.483   5.927   1.00 0.00 ? 9  THR P OG1  3  
ATOM 2546  C CG2  . THR A 1 11 ? 1.655   7.614   7.967   1.00 0.00 ? 9  THR P CG2  3  
ATOM 2547  H H    . THR A 1 11 ? -1.024  6.484   7.121   1.00 0.00 ? 9  THR P H    3  
ATOM 2548  H HA   . THR A 1 11 ? -0.802  8.953   8.794   1.00 0.00 ? 9  THR P HA   3  
ATOM 2549  H HB   . THR A 1 11 ? 1.055   9.629   7.588   1.00 0.00 ? 9  THR P HB   3  
ATOM 2550  H HG1  . THR A 1 11 ? 1.741   8.570   5.694   1.00 0.00 ? 9  THR P HG1  3  
ATOM 2551  H HG21 . THR A 1 11 ? 2.682   7.841   7.682   1.00 0.00 ? 9  THR P HG21 3  
ATOM 2552  H HG22 . THR A 1 11 ? 1.402   6.610   7.629   1.00 0.00 ? 9  THR P HG22 3  
ATOM 2553  H HG23 . THR A 1 11 ? 1.563   7.660   9.051   1.00 0.00 ? 9  THR P HG23 3  
ATOM 2554  N N    . SER A 1 12 ? -1.641  10.604  6.990   1.00 0.00 ? 10 SER P N    3  
ATOM 2555  C CA   . SER A 1 12 ? -2.383  11.509  6.099   1.00 0.00 ? 10 SER P CA   3  
ATOM 2556  C C    . SER A 1 12 ? -1.971  11.416  4.620   1.00 0.00 ? 10 SER P C    3  
ATOM 2557  O O    . SER A 1 12 ? -2.689  11.942  3.771   1.00 0.00 ? 10 SER P O    3  
ATOM 2558  C CB   . SER A 1 12 ? -2.254  12.958  6.577   1.00 0.00 ? 10 SER P CB   3  
ATOM 2559  O OG   . SER A 1 12 ? -2.515  13.064  7.971   1.00 0.00 ? 10 SER P OG   3  
ATOM 2560  H H    . SER A 1 12 ? -1.134  11.027  7.757   1.00 0.00 ? 10 SER P H    3  
ATOM 2561  H HA   . SER A 1 12 ? -3.437  11.250  6.149   1.00 0.00 ? 10 SER P HA   3  
ATOM 2562  H HB2  . SER A 1 12 ? -1.248  13.320  6.366   1.00 0.00 ? 10 SER P HB2  3  
ATOM 2563  H HB3  . SER A 1 12 ? -2.978  13.563  6.028   1.00 0.00 ? 10 SER P HB3  3  
ATOM 2564  H HG   . SER A 1 12 ? -2.450  14.005  8.226   1.00 0.00 ? 10 SER P HG   3  
ATOM 2565  N N    . GLN A 1 13 ? -0.860  10.736  4.294   1.00 0.00 ? 11 GLN P N    3  
ATOM 2566  C CA   . GLN A 1 13 ? -0.418  10.442  2.925   1.00 0.00 ? 11 GLN P CA   3  
ATOM 2567  C C    . GLN A 1 13 ? -0.870  9.047   2.446   1.00 0.00 ? 11 GLN P C    3  
ATOM 2568  O O    . GLN A 1 13 ? -1.343  8.914   1.318   1.00 0.00 ? 11 GLN P O    3  
ATOM 2569  C CB   . GLN A 1 13 ? 1.109   10.613  2.857   1.00 0.00 ? 11 GLN P CB   3  
ATOM 2570  C CG   . GLN A 1 13 ? 1.644   10.552  1.418   1.00 0.00 ? 11 GLN P CG   3  
ATOM 2571  C CD   . GLN A 1 13 ? 3.154   10.782  1.364   1.00 0.00 ? 11 GLN P CD   3  
ATOM 2572  O OE1  . GLN A 1 13 ? 3.952   9.855   1.304   1.00 0.00 ? 11 GLN P OE1  3  
ATOM 2573  N NE2  . GLN A 1 13 ? 3.611   12.017  1.396   1.00 0.00 ? 11 GLN P NE2  3  
ATOM 2574  H H    . GLN A 1 13 ? -0.322  10.330  5.049   1.00 0.00 ? 11 GLN P H    3  
ATOM 2575  H HA   . GLN A 1 13 ? -0.858  11.175  2.248   1.00 0.00 ? 11 GLN P HA   3  
ATOM 2576  H HB2  . GLN A 1 13 ? 1.372   11.583  3.282   1.00 0.00 ? 11 GLN P HB2  3  
ATOM 2577  H HB3  . GLN A 1 13 ? 1.590   9.835   3.453   1.00 0.00 ? 11 GLN P HB3  3  
ATOM 2578  H HG2  . GLN A 1 13 ? 1.425   9.576   0.984   1.00 0.00 ? 11 GLN P HG2  3  
ATOM 2579  H HG3  . GLN A 1 13 ? 1.145   11.313  0.818   1.00 0.00 ? 11 GLN P HG3  3  
ATOM 2580  H HE21 . GLN A 1 13 ? 2.973   12.798  1.447   1.00 0.00 ? 11 GLN P HE21 3  
ATOM 2581  H HE22 . GLN A 1 13 ? 4.609   12.161  1.364   1.00 0.00 ? 11 GLN P HE22 3  
ATOM 2582  N N    . GLN A 1 14 ? -0.795  8.012   3.295   1.00 0.00 ? 12 GLN P N    3  
ATOM 2583  C CA   . GLN A 1 14 ? -1.214  6.640   2.947   1.00 0.00 ? 12 GLN P CA   3  
ATOM 2584  C C    . GLN A 1 14 ? -2.703  6.574   2.592   1.00 0.00 ? 12 GLN P C    3  
ATOM 2585  O O    . GLN A 1 14 ? -3.097  5.938   1.612   1.00 0.00 ? 12 GLN P O    3  
ATOM 2586  C CB   . GLN A 1 14 ? -0.955  5.702   4.132   1.00 0.00 ? 12 GLN P CB   3  
ATOM 2587  C CG   . GLN A 1 14 ? 0.537   5.463   4.366   1.00 0.00 ? 12 GLN P CG   3  
ATOM 2588  C CD   . GLN A 1 14 ? 0.796   4.639   5.623   1.00 0.00 ? 12 GLN P CD   3  
ATOM 2589  O OE1  . GLN A 1 14 ? 0.070   4.696   6.605   1.00 0.00 ? 12 GLN P OE1  3  
ATOM 2590  N NE2  . GLN A 1 14 ? 1.837   3.845   5.639   1.00 0.00 ? 12 GLN P NE2  3  
ATOM 2591  H H    . GLN A 1 14 ? -0.445  8.181   4.232   1.00 0.00 ? 12 GLN P H    3  
ATOM 2592  H HA   . GLN A 1 14 ? -0.641  6.285   2.087   1.00 0.00 ? 12 GLN P HA   3  
ATOM 2593  H HB2  . GLN A 1 14 ? -1.411  6.125   5.027   1.00 0.00 ? 12 GLN P HB2  3  
ATOM 2594  H HB3  . GLN A 1 14 ? -1.412  4.733   3.929   1.00 0.00 ? 12 GLN P HB3  3  
ATOM 2595  H HG2  . GLN A 1 14 ? 0.940   4.942   3.499   1.00 0.00 ? 12 GLN P HG2  3  
ATOM 2596  H HG3  . GLN A 1 14 ? 1.058   6.411   4.465   1.00 0.00 ? 12 GLN P HG3  3  
ATOM 2597  H HE21 . GLN A 1 14 ? 2.350   3.708   4.775   1.00 0.00 ? 12 GLN P HE21 3  
ATOM 2598  H HE22 . GLN A 1 14 ? 1.983   3.246   6.432   1.00 0.00 ? 12 GLN P HE22 3  
ATOM 2599  N N    . LEU A 1 15 ? -3.522  7.293   3.364   1.00 0.00 ? 13 LEU P N    3  
ATOM 2600  C CA   . LEU A 1 15 ? -4.970  7.418   3.169   1.00 0.00 ? 13 LEU P CA   3  
ATOM 2601  C C    . LEU A 1 15 ? -5.350  7.947   1.774   1.00 0.00 ? 13 LEU P C    3  
ATOM 2602  O O    . LEU A 1 15 ? -6.391  7.566   1.236   1.00 0.00 ? 13 LEU P O    3  
ATOM 2603  C CB   . LEU A 1 15 ? -5.508  8.362   4.256   1.00 0.00 ? 13 LEU P CB   3  
ATOM 2604  C CG   . LEU A 1 15 ? -5.374  7.806   5.690   1.00 0.00 ? 13 LEU P CG   3  
ATOM 2605  C CD1  . LEU A 1 15 ? -5.594  8.921   6.705   1.00 0.00 ? 13 LEU P CD1  3  
ATOM 2606  C CD2  . LEU A 1 15 ? -6.353  6.669   5.952   1.00 0.00 ? 13 LEU P CD2  3  
ATOM 2607  H H    . LEU A 1 15 ? -3.107  7.759   4.166   1.00 0.00 ? 13 LEU P H    3  
ATOM 2608  H HA   . LEU A 1 15 ? -5.439  6.442   3.278   1.00 0.00 ? 13 LEU P HA   3  
ATOM 2609  H HB2  . LEU A 1 15 ? -4.968  9.308   4.187   1.00 0.00 ? 13 LEU P HB2  3  
ATOM 2610  H HB3  . LEU A 1 15 ? -6.560  8.567   4.045   1.00 0.00 ? 13 LEU P HB3  3  
ATOM 2611  H HG   . LEU A 1 15 ? -4.376  7.405   5.851   1.00 0.00 ? 13 LEU P HG   3  
ATOM 2612  H HD11 . LEU A 1 15 ? -6.603  9.324   6.613   1.00 0.00 ? 13 LEU P HD11 3  
ATOM 2613  H HD12 . LEU A 1 15 ? -5.434  8.535   7.711   1.00 0.00 ? 13 LEU P HD12 3  
ATOM 2614  H HD13 . LEU A 1 15 ? -4.869  9.714   6.525   1.00 0.00 ? 13 LEU P HD13 3  
ATOM 2615  H HD21 . LEU A 1 15 ? -6.066  5.813   5.341   1.00 0.00 ? 13 LEU P HD21 3  
ATOM 2616  H HD22 . LEU A 1 15 ? -6.298  6.372   6.998   1.00 0.00 ? 13 LEU P HD22 3  
ATOM 2617  H HD23 . LEU A 1 15 ? -7.367  6.994   5.720   1.00 0.00 ? 13 LEU P HD23 3  
ATOM 2618  N N    . GLN A 1 16 ? -4.494  8.779   1.172   1.00 0.00 ? 14 GLN P N    3  
ATOM 2619  C CA   . GLN A 1 16 ? -4.708  9.327   -0.173  1.00 0.00 ? 14 GLN P CA   3  
ATOM 2620  C C    . GLN A 1 16 ? -4.550  8.246   -1.250  1.00 0.00 ? 14 GLN P C    3  
ATOM 2621  O O    . GLN A 1 16 ? -5.362  8.167   -2.169  1.00 0.00 ? 14 GLN P O    3  
ATOM 2622  C CB   . GLN A 1 16 ? -3.743  10.490  -0.469  1.00 0.00 ? 14 GLN P CB   3  
ATOM 2623  C CG   . GLN A 1 16 ? -3.635  11.543  0.641   1.00 0.00 ? 14 GLN P CG   3  
ATOM 2624  C CD   . GLN A 1 16 ? -4.962  12.179  1.049   1.00 0.00 ? 14 GLN P CD   3  
ATOM 2625  O OE1  . GLN A 1 16 ? -5.865  12.407  0.254   1.00 0.00 ? 14 GLN P OE1  3  
ATOM 2626  N NE2  . GLN A 1 16 ? -5.118  12.500  2.315   1.00 0.00 ? 14 GLN P NE2  3  
ATOM 2627  H H    . GLN A 1 16 ? -3.629  8.989   1.650   1.00 0.00 ? 14 GLN P H    3  
ATOM 2628  H HA   . GLN A 1 16 ? -5.728  9.708   -0.235  1.00 0.00 ? 14 GLN P HA   3  
ATOM 2629  H HB2  . GLN A 1 16 ? -2.744  10.091  -0.637  1.00 0.00 ? 14 GLN P HB2  3  
ATOM 2630  H HB3  . GLN A 1 16 ? -4.061  10.978  -1.390  1.00 0.00 ? 14 GLN P HB3  3  
ATOM 2631  H HG2  . GLN A 1 16 ? -3.185  11.068  1.509   1.00 0.00 ? 14 GLN P HG2  3  
ATOM 2632  H HG3  . GLN A 1 16 ? -2.959  12.335  0.318   1.00 0.00 ? 14 GLN P HG3  3  
ATOM 2633  H HE21 . GLN A 1 16 ? -4.350  12.330  2.959   1.00 0.00 ? 14 GLN P HE21 3  
ATOM 2634  H HE22 . GLN A 1 16 ? -5.979  12.935  2.608   1.00 0.00 ? 14 GLN P HE22 3  
ATOM 2635  N N    . GLU A 1 17 ? -3.542  7.378   -1.121  1.00 0.00 ? 15 GLU P N    3  
ATOM 2636  C CA   . GLU A 1 17 ? -3.303  6.275   -2.063  1.00 0.00 ? 15 GLU P CA   3  
ATOM 2637  C C    . GLU A 1 17 ? -4.368  5.180   -1.937  1.00 0.00 ? 15 GLU P C    3  
ATOM 2638  O O    . GLU A 1 17 ? -4.789  4.605   -2.944  1.00 0.00 ? 15 GLU P O    3  
ATOM 2639  C CB   . GLU A 1 17 ? -1.894  5.692   -1.868  1.00 0.00 ? 15 GLU P CB   3  
ATOM 2640  C CG   . GLU A 1 17 ? -0.764  6.734   -1.941  1.00 0.00 ? 15 GLU P CG   3  
ATOM 2641  C CD   . GLU A 1 17 ? -0.814  7.634   -3.195  1.00 0.00 ? 15 GLU P CD   3  
ATOM 2642  O OE1  . GLU A 1 17 ? -1.108  7.138   -4.311  1.00 0.00 ? 15 GLU P OE1  3  
ATOM 2643  O OE2  . GLU A 1 17 ? -0.534  8.852   -3.077  1.00 0.00 ? 15 GLU P OE2  3  
ATOM 2644  H H    . GLU A 1 17 ? -2.930  7.466   -0.319  1.00 0.00 ? 15 GLU P H    3  
ATOM 2645  H HA   . GLU A 1 17 ? -3.374  6.649   -3.082  1.00 0.00 ? 15 GLU P HA   3  
ATOM 2646  H HB2  . GLU A 1 17 ? -1.843  5.200   -0.896  1.00 0.00 ? 15 GLU P HB2  3  
ATOM 2647  H HB3  . GLU A 1 17 ? -1.724  4.933   -2.632  1.00 0.00 ? 15 GLU P HB3  3  
ATOM 2648  H HG2  . GLU A 1 17 ? -0.809  7.351   -1.041  1.00 0.00 ? 15 GLU P HG2  3  
ATOM 2649  H HG3  . GLU A 1 17 ? 0.190   6.206   -1.912  1.00 0.00 ? 15 GLU P HG3  3  
ATOM 2650  N N    . LEU A 1 18 ? -4.863  4.949   -0.718  1.00 0.00 ? 16 LEU P N    3  
ATOM 2651  C CA   . LEU A 1 18 ? -5.968  4.035   -0.438  1.00 0.00 ? 16 LEU P CA   3  
ATOM 2652  C C    . LEU A 1 18 ? -7.274  4.526   -1.079  1.00 0.00 ? 16 LEU P C    3  
ATOM 2653  O O    . LEU A 1 18 ? -7.889  3.785   -1.845  1.00 0.00 ? 16 LEU P O    3  
ATOM 2654  C CB   . LEU A 1 18 ? -6.093  3.873   1.083   1.00 0.00 ? 16 LEU P CB   3  
ATOM 2655  C CG   . LEU A 1 18 ? -4.949  3.036   1.687   1.00 0.00 ? 16 LEU P CG   3  
ATOM 2656  C CD1  . LEU A 1 18 ? -4.791  3.331   3.173   1.00 0.00 ? 16 LEU P CD1  3  
ATOM 2657  C CD2  . LEU A 1 18 ? -5.222  1.543   1.513   1.00 0.00 ? 16 LEU P CD2  3  
ATOM 2658  H H    . LEU A 1 18 ? -4.463  5.459   0.061   1.00 0.00 ? 16 LEU P H    3  
ATOM 2659  H HA   . LEU A 1 18 ? -5.748  3.062   -0.879  1.00 0.00 ? 16 LEU P HA   3  
ATOM 2660  H HB2  . LEU A 1 18 ? -6.110  4.862   1.542   1.00 0.00 ? 16 LEU P HB2  3  
ATOM 2661  H HB3  . LEU A 1 18 ? -7.040  3.390   1.307   1.00 0.00 ? 16 LEU P HB3  3  
ATOM 2662  H HG   . LEU A 1 18 ? -4.006  3.277   1.199   1.00 0.00 ? 16 LEU P HG   3  
ATOM 2663  H HD11 . LEU A 1 18 ? -5.710  3.095   3.697   1.00 0.00 ? 16 LEU P HD11 3  
ATOM 2664  H HD12 . LEU A 1 18 ? -3.978  2.734   3.581   1.00 0.00 ? 16 LEU P HD12 3  
ATOM 2665  H HD13 . LEU A 1 18 ? -4.555  4.385   3.308   1.00 0.00 ? 16 LEU P HD13 3  
ATOM 2666  H HD21 . LEU A 1 18 ? -4.419  0.972   1.976   1.00 0.00 ? 16 LEU P HD21 3  
ATOM 2667  H HD22 . LEU A 1 18 ? -6.170  1.277   1.980   1.00 0.00 ? 16 LEU P HD22 3  
ATOM 2668  H HD23 . LEU A 1 18 ? -5.261  1.302   0.451   1.00 0.00 ? 16 LEU P HD23 3  
ATOM 2669  N N    . GLU A 1 19 ? -7.674  5.785   -0.860  1.00 0.00 ? 17 GLU P N    3  
ATOM 2670  C CA   . GLU A 1 19 ? -8.908  6.298   -1.473  1.00 0.00 ? 17 GLU P CA   3  
ATOM 2671  C C    . GLU A 1 19 ? -8.805  6.594   -2.976  1.00 0.00 ? 17 GLU P C    3  
ATOM 2672  O O    . GLU A 1 19 ? -9.830  6.593   -3.658  1.00 0.00 ? 17 GLU P O    3  
ATOM 2673  C CB   . GLU A 1 19 ? -9.534  7.447   -0.672  1.00 0.00 ? 17 GLU P CB   3  
ATOM 2674  C CG   . GLU A 1 19 ? -8.967  8.857   -0.885  1.00 0.00 ? 17 GLU P CG   3  
ATOM 2675  C CD   . GLU A 1 19 ? -9.801  9.928   -0.143  1.00 0.00 ? 17 GLU P CD   3  
ATOM 2676  O OE1  . GLU A 1 19 ? -10.712 9.582   0.654   1.00 0.00 ? 17 GLU P OE1  3  
ATOM 2677  O OE2  . GLU A 1 19 ? -9.570  11.139  -0.378  1.00 0.00 ? 17 GLU P OE2  3  
ATOM 2678  H H    . GLU A 1 19 ? -7.171  6.354   -0.184  1.00 0.00 ? 17 GLU P H    3  
ATOM 2679  H HA   . GLU A 1 19 ? -9.635  5.490   -1.412  1.00 0.00 ? 17 GLU P HA   3  
ATOM 2680  H HB2  . GLU A 1 19 ? -10.589 7.471   -0.944  1.00 0.00 ? 17 GLU P HB2  3  
ATOM 2681  H HB3  . GLU A 1 19 ? -9.461  7.205   0.386   1.00 0.00 ? 17 GLU P HB3  3  
ATOM 2682  H HG2  . GLU A 1 19 ? -7.934  8.884   -0.538  1.00 0.00 ? 17 GLU P HG2  3  
ATOM 2683  H HG3  . GLU A 1 19 ? -8.972  9.083   -1.954  1.00 0.00 ? 17 GLU P HG3  3  
ATOM 2684  N N    . ALA A 1 20 ? -7.595  6.774   -3.513  1.00 0.00 ? 18 ALA P N    3  
ATOM 2685  C CA   . ALA A 1 20 ? -7.361  6.871   -4.955  1.00 0.00 ? 18 ALA P CA   3  
ATOM 2686  C C    . ALA A 1 20 ? -7.440  5.499   -5.649  1.00 0.00 ? 18 ALA P C    3  
ATOM 2687  O O    . ALA A 1 20 ? -8.139  5.357   -6.655  1.00 0.00 ? 18 ALA P O    3  
ATOM 2688  C CB   . ALA A 1 20 ? -6.014  7.558   -5.209  1.00 0.00 ? 18 ALA P CB   3  
ATOM 2689  H H    . ALA A 1 20 ? -6.801  6.845   -2.887  1.00 0.00 ? 18 ALA P H    3  
ATOM 2690  H HA   . ALA A 1 20 ? -8.140  7.497   -5.393  1.00 0.00 ? 18 ALA P HA   3  
ATOM 2691  H HB1  . ALA A 1 20 ? -6.022  8.558   -4.774  1.00 0.00 ? 18 ALA P HB1  3  
ATOM 2692  H HB2  . ALA A 1 20 ? -5.204  6.977   -4.768  1.00 0.00 ? 18 ALA P HB2  3  
ATOM 2693  H HB3  . ALA A 1 20 ? -5.845  7.647   -6.283  1.00 0.00 ? 18 ALA P HB3  3  
ATOM 2694  N N    . THR A 1 21 ? -6.790  4.462   -5.106  1.00 0.00 ? 19 THR P N    3  
ATOM 2695  C CA   . THR A 1 21 ? -6.825  3.114   -5.706  1.00 0.00 ? 19 THR P CA   3  
ATOM 2696  C C    . THR A 1 21 ? -8.200  2.443   -5.553  1.00 0.00 ? 19 THR P C    3  
ATOM 2697  O O    . THR A 1 21 ? -8.633  1.695   -6.428  1.00 0.00 ? 19 THR P O    3  
ATOM 2698  C CB   . THR A 1 21 ? -5.662  2.249   -5.196  1.00 0.00 ? 19 THR P CB   3  
ATOM 2699  O OG1  . THR A 1 21 ? -5.380  1.263   -6.165  1.00 0.00 ? 19 THR P OG1  3  
ATOM 2700  C CG2  . THR A 1 21 ? -5.930  1.552   -3.863  1.00 0.00 ? 19 THR P CG2  3  
ATOM 2701  H H    . THR A 1 21 ? -6.216  4.616   -4.280  1.00 0.00 ? 19 THR P H    3  
ATOM 2702  H HA   . THR A 1 21 ? -6.657  3.240   -6.773  1.00 0.00 ? 19 THR P HA   3  
ATOM 2703  H HB   . THR A 1 21 ? -4.783  2.886   -5.092  1.00 0.00 ? 19 THR P HB   3  
ATOM 2704  H HG1  . THR A 1 21 ? -4.510  0.884   -5.958  1.00 0.00 ? 19 THR P HG1  3  
ATOM 2705  H HG21 . THR A 1 21 ? -6.539  0.660   -4.023  1.00 0.00 ? 19 THR P HG21 3  
ATOM 2706  H HG22 . THR A 1 21 ? -6.442  2.230   -3.185  1.00 0.00 ? 19 THR P HG22 3  
ATOM 2707  H HG23 . THR A 1 21 ? -4.987  1.280   -3.398  1.00 0.00 ? 19 THR P HG23 3  
ATOM 2708  N N    . PHE A 1 22 ? -8.958  2.821   -4.516  1.00 0.00 ? 20 PHE P N    3  
ATOM 2709  C CA   . PHE A 1 22 ? -10.369 2.461   -4.315  1.00 0.00 ? 20 PHE P CA   3  
ATOM 2710  C C    . PHE A 1 22 ? -11.264 2.876   -5.497  1.00 0.00 ? 20 PHE P C    3  
ATOM 2711  O O    . PHE A 1 22 ? -12.247 2.194   -5.785  1.00 0.00 ? 20 PHE P O    3  
ATOM 2712  C CB   . PHE A 1 22 ? -10.844 3.101   -2.997  1.00 0.00 ? 20 PHE P CB   3  
ATOM 2713  C CG   . PHE A 1 22 ? -12.325 2.992   -2.657  1.00 0.00 ? 20 PHE P CG   3  
ATOM 2714  C CD1  . PHE A 1 22 ? -12.978 1.743   -2.652  1.00 0.00 ? 20 PHE P CD1  3  
ATOM 2715  C CD2  . PHE A 1 22 ? -13.050 4.150   -2.308  1.00 0.00 ? 20 PHE P CD2  3  
ATOM 2716  C CE1  . PHE A 1 22 ? -14.341 1.653   -2.319  1.00 0.00 ? 20 PHE P CE1  3  
ATOM 2717  C CE2  . PHE A 1 22 ? -14.416 4.061   -1.981  1.00 0.00 ? 20 PHE P CE2  3  
ATOM 2718  C CZ   . PHE A 1 22 ? -15.063 2.813   -1.987  1.00 0.00 ? 20 PHE P CZ   3  
ATOM 2719  H H    . PHE A 1 22 ? -8.526  3.419   -3.826  1.00 0.00 ? 20 PHE P H    3  
ATOM 2720  H HA   . PHE A 1 22 ? -10.443 1.380   -4.215  1.00 0.00 ? 20 PHE P HA   3  
ATOM 2721  H HB2  . PHE A 1 22 ? -10.284 2.652   -2.178  1.00 0.00 ? 20 PHE P HB2  3  
ATOM 2722  H HB3  . PHE A 1 22 ? -10.584 4.157   -3.030  1.00 0.00 ? 20 PHE P HB3  3  
ATOM 2723  H HD1  . PHE A 1 22 ? -12.437 0.849   -2.913  1.00 0.00 ? 20 PHE P HD1  3  
ATOM 2724  H HD2  . PHE A 1 22 ? -12.557 5.111   -2.288  1.00 0.00 ? 20 PHE P HD2  3  
ATOM 2725  H HE1  . PHE A 1 22 ? -14.836 0.690   -2.327  1.00 0.00 ? 20 PHE P HE1  3  
ATOM 2726  H HE2  . PHE A 1 22 ? -14.973 4.953   -1.730  1.00 0.00 ? 20 PHE P HE2  3  
ATOM 2727  H HZ   . PHE A 1 22 ? -16.112 2.743   -1.737  1.00 0.00 ? 20 PHE P HZ   3  
ATOM 2728  N N    . GLN A 1 23 ? -10.913 3.942   -6.234  1.00 0.00 ? 21 GLN P N    3  
ATOM 2729  C CA   . GLN A 1 23 ? -11.692 4.387   -7.397  1.00 0.00 ? 21 GLN P CA   3  
ATOM 2730  C C    . GLN A 1 23 ? -11.565 3.443   -8.604  1.00 0.00 ? 21 GLN P C    3  
ATOM 2731  O O    . GLN A 1 23 ? -12.550 3.205   -9.307  1.00 0.00 ? 21 GLN P O    3  
ATOM 2732  C CB   . GLN A 1 23 ? -11.280 5.808   -7.826  1.00 0.00 ? 21 GLN P CB   3  
ATOM 2733  C CG   . GLN A 1 23 ? -11.331 6.883   -6.735  1.00 0.00 ? 21 GLN P CG   3  
ATOM 2734  C CD   . GLN A 1 23 ? -12.621 6.868   -5.921  1.00 0.00 ? 21 GLN P CD   3  
ATOM 2735  O OE1  . GLN A 1 23 ? -13.729 6.917   -6.441  1.00 0.00 ? 21 GLN P OE1  3  
ATOM 2736  N NE2  . GLN A 1 23 ? -12.525 6.791   -4.613  1.00 0.00 ? 21 GLN P NE2  3  
ATOM 2737  H H    . GLN A 1 23 ? -10.080 4.458   -5.982  1.00 0.00 ? 21 GLN P H    3  
ATOM 2738  H HA   . GLN A 1 23 ? -12.740 4.393   -7.107  1.00 0.00 ? 21 GLN P HA   3  
ATOM 2739  H HB2  . GLN A 1 23 ? -10.257 5.770   -8.197  1.00 0.00 ? 21 GLN P HB2  3  
ATOM 2740  H HB3  . GLN A 1 23 ? -11.927 6.120   -8.647  1.00 0.00 ? 21 GLN P HB3  3  
ATOM 2741  H HG2  . GLN A 1 23 ? -10.481 6.740   -6.074  1.00 0.00 ? 21 GLN P HG2  3  
ATOM 2742  H HG3  . GLN A 1 23 ? -11.218 7.865   -7.193  1.00 0.00 ? 21 GLN P HG3  3  
ATOM 2743  H HE21 . GLN A 1 23 ? -11.602 6.751   -4.185  1.00 0.00 ? 21 GLN P HE21 3  
ATOM 2744  H HE22 . GLN A 1 23 ? -13.371 6.750   -4.074  1.00 0.00 ? 21 GLN P HE22 3  
ATOM 2745  N N    . ARG A 1 24 ? -10.362 2.896   -8.841  1.00 0.00 ? 22 ARG P N    3  
ATOM 2746  C CA   . ARG A 1 24 ? -10.071 1.947   -9.935  1.00 0.00 ? 22 ARG P CA   3  
ATOM 2747  C C    . ARG A 1 24 ? -10.301 0.481   -9.557  1.00 0.00 ? 22 ARG P C    3  
ATOM 2748  O O    . ARG A 1 24 ? -10.542 -0.345  -10.438 1.00 0.00 ? 22 ARG P O    3  
ATOM 2749  C CB   . ARG A 1 24 ? -8.657  2.182   -10.496 1.00 0.00 ? 22 ARG P CB   3  
ATOM 2750  C CG   . ARG A 1 24 ? -7.525  2.017   -9.464  1.00 0.00 ? 22 ARG P CG   3  
ATOM 2751  C CD   . ARG A 1 24 ? -6.131  2.180   -10.081 1.00 0.00 ? 22 ARG P CD   3  
ATOM 2752  N NE   . ARG A 1 24 ? -5.881  3.562   -10.541 1.00 0.00 ? 22 ARG P NE   3  
ATOM 2753  C CZ   . ARG A 1 24 ? -4.811  3.996   -11.184 1.00 0.00 ? 22 ARG P CZ   3  
ATOM 2754  N NH1  . ARG A 1 24 ? -3.815  3.210   -11.485 1.00 0.00 ? 22 ARG P NH1  3  
ATOM 2755  N NH2  . ARG A 1 24 ? -4.718  5.245   -11.540 1.00 0.00 ? 22 ARG P NH2  3  
ATOM 2756  H H    . ARG A 1 24 ? -9.611  3.146   -8.208  1.00 0.00 ? 22 ARG P H    3  
ATOM 2757  H HA   . ARG A 1 24 ? -10.768 2.141   -10.754 1.00 0.00 ? 22 ARG P HA   3  
ATOM 2758  H HB2  . ARG A 1 24 ? -8.492  1.474   -11.310 1.00 0.00 ? 22 ARG P HB2  3  
ATOM 2759  H HB3  . ARG A 1 24 ? -8.617  3.192   -10.909 1.00 0.00 ? 22 ARG P HB3  3  
ATOM 2760  H HG2  . ARG A 1 24 ? -7.645  2.760   -8.679  1.00 0.00 ? 22 ARG P HG2  3  
ATOM 2761  H HG3  . ARG A 1 24 ? -7.585  1.023   -9.020  1.00 0.00 ? 22 ARG P HG3  3  
ATOM 2762  H HD2  . ARG A 1 24 ? -5.391  1.918   -9.320  1.00 0.00 ? 22 ARG P HD2  3  
ATOM 2763  H HD3  . ARG A 1 24 ? -6.031  1.483   -10.915 1.00 0.00 ? 22 ARG P HD3  3  
ATOM 2764  H HE   . ARG A 1 24 ? -6.590  4.249   -10.343 1.00 0.00 ? 22 ARG P HE   3  
ATOM 2765  H HH11 . ARG A 1 24 ? -3.856  2.242   -11.217 1.00 0.00 ? 22 ARG P HH11 3  
ATOM 2766  H HH12 . ARG A 1 24 ? -3.012  3.565   -11.976 1.00 0.00 ? 22 ARG P HH12 3  
ATOM 2767  H HH21 . ARG A 1 24 ? -5.464  5.890   -11.334 1.00 0.00 ? 22 ARG P HH21 3  
ATOM 2768  H HH22 . ARG A 1 24 ? -3.903  5.573   -12.031 1.00 0.00 ? 22 ARG P HH22 3  
ATOM 2769  N N    . ASN A 1 25 ? -10.254 0.163   -8.263  1.00 0.00 ? 23 ASN P N    3  
ATOM 2770  C CA   . ASN A 1 25 ? -10.482 -1.171  -7.717  1.00 0.00 ? 23 ASN P CA   3  
ATOM 2771  C C    . ASN A 1 25 ? -11.323 -1.075  -6.434  1.00 0.00 ? 23 ASN P C    3  
ATOM 2772  O O    . ASN A 1 25 ? -10.803 -0.763  -5.366  1.00 0.00 ? 23 ASN P O    3  
ATOM 2773  C CB   . ASN A 1 25 ? -9.119  -1.844  -7.469  1.00 0.00 ? 23 ASN P CB   3  
ATOM 2774  C CG   . ASN A 1 25 ? -9.253  -3.317  -7.108  1.00 0.00 ? 23 ASN P CG   3  
ATOM 2775  O OD1  . ASN A 1 25 ? -10.332 -3.838  -6.854  1.00 0.00 ? 23 ASN P OD1  3  
ATOM 2776  N ND2  . ASN A 1 25 ? -8.159  -4.040  -7.099  1.00 0.00 ? 23 ASN P ND2  3  
ATOM 2777  H H    . ASN A 1 25 ? -9.998  0.894   -7.608  1.00 0.00 ? 23 ASN P H    3  
ATOM 2778  H HA   . ASN A 1 25 ? -11.034 -1.772  -8.443  1.00 0.00 ? 23 ASN P HA   3  
ATOM 2779  H HB2  . ASN A 1 25 ? -8.508  -1.767  -8.369  1.00 0.00 ? 23 ASN P HB2  3  
ATOM 2780  H HB3  . ASN A 1 25 ? -8.590  -1.328  -6.665  1.00 0.00 ? 23 ASN P HB3  3  
ATOM 2781  H HD21 . ASN A 1 25 ? -7.272  -3.618  -7.317  1.00 0.00 ? 23 ASN P HD21 3  
ATOM 2782  H HD22 . ASN A 1 25 ? -8.238  -5.025  -6.898  1.00 0.00 ? 23 ASN P HD22 3  
ATOM 2783  N N    . HIS A 1 26 ? -12.626 -1.354  -6.530  1.00 0.00 ? 24 HIS P N    3  
ATOM 2784  C CA   . HIS A 1 26 ? -13.563 -1.249  -5.400  1.00 0.00 ? 24 HIS P CA   3  
ATOM 2785  C C    . HIS A 1 26 ? -13.505 -2.467  -4.456  1.00 0.00 ? 24 HIS P C    3  
ATOM 2786  O O    . HIS A 1 26 ? -14.095 -2.429  -3.374  1.00 0.00 ? 24 HIS P O    3  
ATOM 2787  C CB   . HIS A 1 26 ? -14.986 -1.021  -5.940  1.00 0.00 ? 24 HIS P CB   3  
ATOM 2788  C CG   . HIS A 1 26 ? -15.254 0.368   -6.484  1.00 0.00 ? 24 HIS P CG   3  
ATOM 2789  N ND1  . HIS A 1 26 ? -16.235 1.243   -6.004  1.00 0.00 ? 24 HIS P ND1  3  
ATOM 2790  C CD2  . HIS A 1 26 ? -14.622 0.962   -7.540  1.00 0.00 ? 24 HIS P CD2  3  
ATOM 2791  C CE1  . HIS A 1 26 ? -16.160 2.343   -6.772  1.00 0.00 ? 24 HIS P CE1  3  
ATOM 2792  N NE2  . HIS A 1 26 ? -15.199 2.202   -7.701  1.00 0.00 ? 24 HIS P NE2  3  
ATOM 2793  H H    . HIS A 1 26 ? -12.992 -1.648  -7.423  1.00 0.00 ? 24 HIS P H    3  
ATOM 2794  H HA   . HIS A 1 26 ? -13.297 -0.379  -4.798  1.00 0.00 ? 24 HIS P HA   3  
ATOM 2795  H HB2  . HIS A 1 26 ? -15.202 -1.749  -6.722  1.00 0.00 ? 24 HIS P HB2  3  
ATOM 2796  H HB3  . HIS A 1 26 ? -15.697 -1.194  -5.130  1.00 0.00 ? 24 HIS P HB3  3  
ATOM 2797  H HD2  . HIS A 1 26 ? -13.812 0.552   -8.127  1.00 0.00 ? 24 HIS P HD2  3  
ATOM 2798  H HE1  . HIS A 1 26 ? -16.787 3.221   -6.660  1.00 0.00 ? 24 HIS P HE1  3  
ATOM 2799  H HE2  . HIS A 1 26 ? -14.937 2.898   -8.392  1.00 0.00 ? 24 HIS P HE2  3  
ATOM 2800  N N    . TYR A 1 27 ? -12.821 -3.547  -4.852  1.00 0.00 ? 25 TYR P N    3  
ATOM 2801  C CA   . TYR A 1 27 ? -12.797 -4.839  -4.152  1.00 0.00 ? 25 TYR P CA   3  
ATOM 2802  C C    . TYR A 1 27 ? -11.460 -5.594  -4.373  1.00 0.00 ? 25 TYR P C    3  
ATOM 2803  O O    . TYR A 1 27 ? -11.438 -6.657  -5.002  1.00 0.00 ? 25 TYR P O    3  
ATOM 2804  C CB   . TYR A 1 27 ? -14.053 -5.660  -4.535  1.00 0.00 ? 25 TYR P CB   3  
ATOM 2805  C CG   . TYR A 1 27 ? -14.461 -5.649  -6.005  1.00 0.00 ? 25 TYR P CG   3  
ATOM 2806  C CD1  . TYR A 1 27 ? -13.947 -6.602  -6.908  1.00 0.00 ? 25 TYR P CD1  3  
ATOM 2807  C CD2  . TYR A 1 27 ? -15.382 -4.685  -6.466  1.00 0.00 ? 25 TYR P CD2  3  
ATOM 2808  C CE1  . TYR A 1 27 ? -14.324 -6.572  -8.264  1.00 0.00 ? 25 TYR P CE1  3  
ATOM 2809  C CE2  . TYR A 1 27 ? -15.761 -4.649  -7.822  1.00 0.00 ? 25 TYR P CE2  3  
ATOM 2810  C CZ   . TYR A 1 27 ? -15.229 -5.593  -8.728  1.00 0.00 ? 25 TYR P CZ   3  
ATOM 2811  O OH   . TYR A 1 27 ? -15.587 -5.570  -10.041 1.00 0.00 ? 25 TYR P OH   3  
ATOM 2812  H H    . TYR A 1 27 ? -12.307 -3.487  -5.721  1.00 0.00 ? 25 TYR P H    3  
ATOM 2813  H HA   . TYR A 1 27 ? -12.861 -4.650  -3.082  1.00 0.00 ? 25 TYR P HA   3  
ATOM 2814  H HB2  . TYR A 1 27 ? -13.929 -6.691  -4.203  1.00 0.00 ? 25 TYR P HB2  3  
ATOM 2815  H HB3  . TYR A 1 27 ? -14.890 -5.260  -3.961  1.00 0.00 ? 25 TYR P HB3  3  
ATOM 2816  H HD1  . TYR A 1 27 ? -13.260 -7.363  -6.562  1.00 0.00 ? 25 TYR P HD1  3  
ATOM 2817  H HD2  . TYR A 1 27 ? -15.801 -3.968  -5.772  1.00 0.00 ? 25 TYR P HD2  3  
ATOM 2818  H HE1  . TYR A 1 27 ? -13.925 -7.299  -8.958  1.00 0.00 ? 25 TYR P HE1  3  
ATOM 2819  H HE2  . TYR A 1 27 ? -16.462 -3.903  -8.168  1.00 0.00 ? 25 TYR P HE2  3  
ATOM 2820  H HH   . TYR A 1 27 ? -16.217 -4.856  -10.241 1.00 0.00 ? 25 TYR P HH   3  
ATOM 2821  N N    . PRO A 1 28 ? -10.323 -5.067  -3.873  1.00 0.00 ? 26 PRO P N    3  
ATOM 2822  C CA   . PRO A 1 28 ? -9.013  -5.697  -4.037  1.00 0.00 ? 26 PRO P CA   3  
ATOM 2823  C C    . PRO A 1 28 ? -8.907  -7.037  -3.286  1.00 0.00 ? 26 PRO P C    3  
ATOM 2824  O O    . PRO A 1 28 ? -9.609  -7.297  -2.303  1.00 0.00 ? 26 PRO P O    3  
ATOM 2825  C CB   . PRO A 1 28 ? -7.996  -4.661  -3.550  1.00 0.00 ? 26 PRO P CB   3  
ATOM 2826  C CG   . PRO A 1 28 ? -8.779  -3.902  -2.484  1.00 0.00 ? 26 PRO P CG   3  
ATOM 2827  C CD   . PRO A 1 28 ? -10.188 -3.853  -3.078  1.00 0.00 ? 26 PRO P CD   3  
ATOM 2828  H HA   . PRO A 1 28 ? -8.833  -5.888  -5.094  1.00 0.00 ? 26 PRO P HA   3  
ATOM 2829  H HB2  . PRO A 1 28 ? -7.088  -5.113  -3.155  1.00 0.00 ? 26 PRO P HB2  3  
ATOM 2830  H HB3  . PRO A 1 28 ? -7.745  -3.982  -4.364  1.00 0.00 ? 26 PRO P HB3  3  
ATOM 2831  H HG2  . PRO A 1 28 ? -8.789  -4.482  -1.561  1.00 0.00 ? 26 PRO P HG2  3  
ATOM 2832  H HG3  . PRO A 1 28 ? -8.372  -2.906  -2.313  1.00 0.00 ? 26 PRO P HG3  3  
ATOM 2833  H HD2  . PRO A 1 28 ? -10.929 -3.812  -2.279  1.00 0.00 ? 26 PRO P HD2  3  
ATOM 2834  H HD3  . PRO A 1 28 ? -10.282 -2.982  -3.727  1.00 0.00 ? 26 PRO P HD3  3  
ATOM 2835  N N    . ASP A 1 29 ? -7.985  -7.876  -3.747  1.00 0.00 ? 27 ASP P N    3  
ATOM 2836  C CA   . ASP A 1 29 ? -7.734  -9.256  -3.302  1.00 0.00 ? 27 ASP P CA   3  
ATOM 2837  C C    . ASP A 1 29 ? -6.320  -9.386  -2.724  1.00 0.00 ? 27 ASP P C    3  
ATOM 2838  O O    . ASP A 1 29 ? -5.550  -8.433  -2.780  1.00 0.00 ? 27 ASP P O    3  
ATOM 2839  C CB   . ASP A 1 29 ? -7.949  -10.207 -4.495  1.00 0.00 ? 27 ASP P CB   3  
ATOM 2840  C CG   . ASP A 1 29 ? -8.025  -11.701 -4.128  1.00 0.00 ? 27 ASP P CG   3  
ATOM 2841  O OD1  . ASP A 1 29 ? -8.236  -12.035 -2.937  1.00 0.00 ? 27 ASP P OD1  3  
ATOM 2842  O OD2  . ASP A 1 29 ? -7.864  -12.547 -5.038  1.00 0.00 ? 27 ASP P OD2  3  
ATOM 2843  H H    . ASP A 1 29 ? -7.351  -7.505  -4.452  1.00 0.00 ? 27 ASP P H    3  
ATOM 2844  H HA   . ASP A 1 29 ? -8.440  -9.516  -2.518  1.00 0.00 ? 27 ASP P HA   3  
ATOM 2845  H HB2  . ASP A 1 29 ? -8.881  -9.940  -4.985  1.00 0.00 ? 27 ASP P HB2  3  
ATOM 2846  H HB3  . ASP A 1 29 ? -7.139  -10.051 -5.211  1.00 0.00 ? 27 ASP P HB3  3  
ATOM 2847  N N    . MET A 1 30 ? -5.927  -10.550 -2.204  1.00 0.00 ? 28 MET P N    3  
ATOM 2848  C CA   . MET A 1 30 ? -4.592  -10.764 -1.615  1.00 0.00 ? 28 MET P CA   3  
ATOM 2849  C C    . MET A 1 30 ? -3.429  -10.287 -2.506  1.00 0.00 ? 28 MET P C    3  
ATOM 2850  O O    . MET A 1 30 ? -2.419  -9.810  -1.991  1.00 0.00 ? 28 MET P O    3  
ATOM 2851  C CB   . MET A 1 30 ? -4.402  -12.243 -1.237  1.00 0.00 ? 28 MET P CB   3  
ATOM 2852  C CG   . MET A 1 30 ? -4.424  -13.203 -2.439  1.00 0.00 ? 28 MET P CG   3  
ATOM 2853  S SD   . MET A 1 30 ? -3.847  -14.884 -2.083  1.00 0.00 ? 28 MET P SD   3  
ATOM 2854  C CE   . MET A 1 30 ? -2.057  -14.566 -2.063  1.00 0.00 ? 28 MET P CE   3  
ATOM 2855  H H    . MET A 1 30 ? -6.601  -11.312 -2.205  1.00 0.00 ? 28 MET P H    3  
ATOM 2856  H HA   . MET A 1 30 ? -4.532  -10.179 -0.699  1.00 0.00 ? 28 MET P HA   3  
ATOM 2857  H HB2  . MET A 1 30 ? -3.443  -12.337 -0.728  1.00 0.00 ? 28 MET P HB2  3  
ATOM 2858  H HB3  . MET A 1 30 ? -5.182  -12.538 -0.535  1.00 0.00 ? 28 MET P HB3  3  
ATOM 2859  H HG2  . MET A 1 30 ? -5.441  -13.251 -2.827  1.00 0.00 ? 28 MET P HG2  3  
ATOM 2860  H HG3  . MET A 1 30 ? -3.791  -12.816 -3.235  1.00 0.00 ? 28 MET P HG3  3  
ATOM 2861  H HE1  . MET A 1 30 ? -1.757  -14.084 -2.996  1.00 0.00 ? 28 MET P HE1  3  
ATOM 2862  H HE2  . MET A 1 30 ? -1.804  -13.912 -1.228  1.00 0.00 ? 28 MET P HE2  3  
ATOM 2863  H HE3  . MET A 1 30 ? -1.519  -15.508 -1.954  1.00 0.00 ? 28 MET P HE3  3  
ATOM 2864  N N    . SER A 1 31 ? -3.584  -10.351 -3.833  1.00 0.00 ? 29 SER P N    3  
ATOM 2865  C CA   . SER A 1 31 ? -2.557  -9.919  -4.790  1.00 0.00 ? 29 SER P CA   3  
ATOM 2866  C C    . SER A 1 31 ? -2.561  -8.398  -4.995  1.00 0.00 ? 29 SER P C    3  
ATOM 2867  O O    . SER A 1 31 ? -1.504  -7.766  -4.994  1.00 0.00 ? 29 SER P O    3  
ATOM 2868  C CB   . SER A 1 31 ? -2.742  -10.629 -6.137  1.00 0.00 ? 29 SER P CB   3  
ATOM 2869  O OG   . SER A 1 31 ? -2.720  -12.040 -5.966  1.00 0.00 ? 29 SER P OG   3  
ATOM 2870  H H    . SER A 1 31 ? -4.454  -10.719 -4.190  1.00 0.00 ? 29 SER P H    3  
ATOM 2871  H HA   . SER A 1 31 ? -1.582  -10.209 -4.396  1.00 0.00 ? 29 SER P HA   3  
ATOM 2872  H HB2  . SER A 1 31 ? -3.695  -10.332 -6.579  1.00 0.00 ? 29 SER P HB2  3  
ATOM 2873  H HB3  . SER A 1 31 ? -1.935  -10.334 -6.811  1.00 0.00 ? 29 SER P HB3  3  
ATOM 2874  H HG   . SER A 1 31 ? -2.812  -12.458 -6.844  1.00 0.00 ? 29 SER P HG   3  
ATOM 2875  N N    . THR A 1 32 ? -3.745  -7.789  -5.133  1.00 0.00 ? 30 THR P N    3  
ATOM 2876  C CA   . THR A 1 32 ? -3.904  -6.341  -5.363  1.00 0.00 ? 30 THR P CA   3  
ATOM 2877  C C    . THR A 1 32 ? -3.756  -5.515  -4.087  1.00 0.00 ? 30 THR P C    3  
ATOM 2878  O O    . THR A 1 32 ? -3.150  -4.448  -4.130  1.00 0.00 ? 30 THR P O    3  
ATOM 2879  C CB   . THR A 1 32 ? -5.217  -5.996  -6.087  1.00 0.00 ? 30 THR P CB   3  
ATOM 2880  O OG1  . THR A 1 32 ? -6.246  -6.916  -5.802  1.00 0.00 ? 30 THR P OG1  3  
ATOM 2881  C CG2  . THR A 1 32 ? -5.032  -6.014  -7.603  1.00 0.00 ? 30 THR P CG2  3  
ATOM 2882  H H    . THR A 1 32 ? -4.590  -8.337  -5.045  1.00 0.00 ? 30 THR P H    3  
ATOM 2883  H HA   . THR A 1 32 ? -3.098  -6.019  -6.017  1.00 0.00 ? 30 THR P HA   3  
ATOM 2884  H HB   . THR A 1 32 ? -5.548  -5.004  -5.784  1.00 0.00 ? 30 THR P HB   3  
ATOM 2885  H HG1  . THR A 1 32 ? -6.294  -7.535  -6.552  1.00 0.00 ? 30 THR P HG1  3  
ATOM 2886  H HG21 . THR A 1 32 ? -5.985  -5.819  -8.097  1.00 0.00 ? 30 THR P HG21 3  
ATOM 2887  H HG22 . THR A 1 32 ? -4.647  -6.981  -7.925  1.00 0.00 ? 30 THR P HG22 3  
ATOM 2888  H HG23 . THR A 1 32 ? -4.326  -5.235  -7.892  1.00 0.00 ? 30 THR P HG23 3  
ATOM 2889  N N    . ARG A 1 33 ? -4.209  -6.012  -2.929  1.00 0.00 ? 31 ARG P N    3  
ATOM 2890  C CA   . ARG A 1 33 ? -3.958  -5.408  -1.607  1.00 0.00 ? 31 ARG P CA   3  
ATOM 2891  C C    . ARG A 1 33 ? -2.459  -5.244  -1.337  1.00 0.00 ? 31 ARG P C    3  
ATOM 2892  O O    . ARG A 1 33 ? -2.021  -4.166  -0.949  1.00 0.00 ? 31 ARG P O    3  
ATOM 2893  C CB   . ARG A 1 33 ? -4.569  -6.290  -0.504  1.00 0.00 ? 31 ARG P CB   3  
ATOM 2894  C CG   . ARG A 1 33 ? -6.106  -6.345  -0.499  1.00 0.00 ? 31 ARG P CG   3  
ATOM 2895  C CD   . ARG A 1 33 ? -6.580  -7.517  0.370   1.00 0.00 ? 31 ARG P CD   3  
ATOM 2896  N NE   . ARG A 1 33 ? -7.960  -7.914  0.049   1.00 0.00 ? 31 ARG P NE   3  
ATOM 2897  C CZ   . ARG A 1 33 ? -8.517  -9.090  0.266   1.00 0.00 ? 31 ARG P CZ   3  
ATOM 2898  N NH1  . ARG A 1 33 ? -7.898  -10.076 0.855   1.00 0.00 ? 31 ARG P NH1  3  
ATOM 2899  N NH2  . ARG A 1 33 ? -9.730  -9.296  -0.149  1.00 0.00 ? 31 ARG P NH2  3  
ATOM 2900  H H    . ARG A 1 33 ? -4.754  -6.871  -2.968  1.00 0.00 ? 31 ARG P H    3  
ATOM 2901  H HA   . ARG A 1 33 ? -4.399  -4.410  -1.594  1.00 0.00 ? 31 ARG P HA   3  
ATOM 2902  H HB2  . ARG A 1 33 ? -4.177  -7.303  -0.633  1.00 0.00 ? 31 ARG P HB2  3  
ATOM 2903  H HB3  . ARG A 1 33 ? -4.239  -5.924  0.470   1.00 0.00 ? 31 ARG P HB3  3  
ATOM 2904  H HG2  . ARG A 1 33 ? -6.515  -5.409  -0.118  1.00 0.00 ? 31 ARG P HG2  3  
ATOM 2905  H HG3  . ARG A 1 33 ? -6.469  -6.494  -1.511  1.00 0.00 ? 31 ARG P HG3  3  
ATOM 2906  H HD2  . ARG A 1 33 ? -5.926  -8.370  0.182   1.00 0.00 ? 31 ARG P HD2  3  
ATOM 2907  H HD3  . ARG A 1 33 ? -6.505  -7.241  1.422   1.00 0.00 ? 31 ARG P HD3  3  
ATOM 2908  H HE   . ARG A 1 33 ? -8.525  -7.259  -0.473  1.00 0.00 ? 31 ARG P HE   3  
ATOM 2909  H HH11 . ARG A 1 33 ? -6.906  -9.998  1.083   1.00 0.00 ? 31 ARG P HH11 3  
ATOM 2910  H HH12 . ARG A 1 33 ? -8.353  -10.966 0.957   1.00 0.00 ? 31 ARG P HH12 3  
ATOM 2911  H HH21 . ARG A 1 33 ? -10.167 -8.593  -0.731  1.00 0.00 ? 31 ARG P HH21 3  
ATOM 2912  H HH22 . ARG A 1 33 ? -10.179 -10.186 -0.009  1.00 0.00 ? 31 ARG P HH22 3  
ATOM 2913  N N    . GLU A 1 34 ? -1.661  -6.286  -1.582  1.00 0.00 ? 32 GLU P N    3  
ATOM 2914  C CA   . GLU A 1 34 ? -0.200  -6.198  -1.470  1.00 0.00 ? 32 GLU P CA   3  
ATOM 2915  C C    . GLU A 1 34 ? 0.393   -5.239  -2.513  1.00 0.00 ? 32 GLU P C    3  
ATOM 2916  O O    . GLU A 1 34 ? 1.243   -4.422  -2.168  1.00 0.00 ? 32 GLU P O    3  
ATOM 2917  C CB   . GLU A 1 34 ? 0.451   -7.585  -1.578  1.00 0.00 ? 32 GLU P CB   3  
ATOM 2918  C CG   . GLU A 1 34 ? 0.208   -8.435  -0.323  1.00 0.00 ? 32 GLU P CG   3  
ATOM 2919  C CD   . GLU A 1 34 ? 1.086   -9.705  -0.314  1.00 0.00 ? 32 GLU P CD   3  
ATOM 2920  O OE1  . GLU A 1 34 ? 1.056   -10.501 -1.285  1.00 0.00 ? 32 GLU P OE1  3  
ATOM 2921  O OE2  . GLU A 1 34 ? 1.833   -9.916  0.674   1.00 0.00 ? 32 GLU P OE2  3  
ATOM 2922  H H    . GLU A 1 34 ? -2.078  -7.155  -1.879  1.00 0.00 ? 32 GLU P H    3  
ATOM 2923  H HA   . GLU A 1 34 ? 0.052   -5.790  -0.492  1.00 0.00 ? 32 GLU P HA   3  
ATOM 2924  H HB2  . GLU A 1 34 ? 0.075   -8.103  -2.462  1.00 0.00 ? 32 GLU P HB2  3  
ATOM 2925  H HB3  . GLU A 1 34 ? 1.526   -7.449  -1.689  1.00 0.00 ? 32 GLU P HB3  3  
ATOM 2926  H HG2  . GLU A 1 34 ? 0.438   -7.827  0.555   1.00 0.00 ? 32 GLU P HG2  3  
ATOM 2927  H HG3  . GLU A 1 34 ? -0.847  -8.707  -0.261  1.00 0.00 ? 32 GLU P HG3  3  
ATOM 2928  N N    . GLU A 1 35 ? -0.092  -5.261  -3.757  1.00 0.00 ? 33 GLU P N    3  
ATOM 2929  C CA   . GLU A 1 35 ? 0.381   -4.372  -4.832  1.00 0.00 ? 33 GLU P CA   3  
ATOM 2930  C C    . GLU A 1 35 ? 0.280   -2.873  -4.491  1.00 0.00 ? 33 GLU P C    3  
ATOM 2931  O O    . GLU A 1 35 ? 1.151   -2.116  -4.918  1.00 0.00 ? 33 GLU P O    3  
ATOM 2932  C CB   . GLU A 1 35 ? -0.360  -4.703  -6.140  1.00 0.00 ? 33 GLU P CB   3  
ATOM 2933  C CG   . GLU A 1 35 ? 0.081   -3.835  -7.325  1.00 0.00 ? 33 GLU P CG   3  
ATOM 2934  C CD   . GLU A 1 35 ? -0.446  -4.404  -8.656  1.00 0.00 ? 33 GLU P CD   3  
ATOM 2935  O OE1  . GLU A 1 35 ? -1.594  -4.081  -9.049  1.00 0.00 ? 33 GLU P OE1  3  
ATOM 2936  O OE2  . GLU A 1 35 ? 0.289   -5.169  -9.328  1.00 0.00 ? 33 GLU P OE2  3  
ATOM 2937  H H    . GLU A 1 35 ? -0.763  -5.980  -3.994  1.00 0.00 ? 33 GLU P H    3  
ATOM 2938  H HA   . GLU A 1 35 ? 1.441   -4.581  -4.991  1.00 0.00 ? 33 GLU P HA   3  
ATOM 2939  H HB2  . GLU A 1 35 ? -0.174  -5.749  -6.384  1.00 0.00 ? 33 GLU P HB2  3  
ATOM 2940  H HB3  . GLU A 1 35 ? -1.428  -4.563  -6.001  1.00 0.00 ? 33 GLU P HB3  3  
ATOM 2941  H HG2  . GLU A 1 35 ? -0.293  -2.818  -7.186  1.00 0.00 ? 33 GLU P HG2  3  
ATOM 2942  H HG3  . GLU A 1 35 ? 1.170   -3.784  -7.344  1.00 0.00 ? 33 GLU P HG3  3  
ATOM 2943  N N    . ILE A 1 36 ? -0.709  -2.430  -3.699  1.00 0.00 ? 34 ILE P N    3  
ATOM 2944  C CA   . ILE A 1 36 ? -0.776  -1.034  -3.207  1.00 0.00 ? 34 ILE P CA   3  
ATOM 2945  C C    . ILE A 1 36 ? 0.051   -0.835  -1.924  1.00 0.00 ? 34 ILE P C    3  
ATOM 2946  O O    . ILE A 1 36 ? 0.631   0.231   -1.719  1.00 0.00 ? 34 ILE P O    3  
ATOM 2947  C CB   . ILE A 1 36 ? -2.232  -0.503  -3.095  1.00 0.00 ? 34 ILE P CB   3  
ATOM 2948  C CG1  . ILE A 1 36 ? -2.943  -0.775  -1.751  1.00 0.00 ? 34 ILE P CG1  3  
ATOM 2949  C CG2  . ILE A 1 36 ? -3.112  -1.044  -4.237  1.00 0.00 ? 34 ILE P CG2  3  
ATOM 2950  C CD1  . ILE A 1 36 ? -2.732  0.331   -0.706  1.00 0.00 ? 34 ILE P CD1  3  
ATOM 2951  H H    . ILE A 1 36 ? -1.440  -3.077  -3.431  1.00 0.00 ? 34 ILE P H    3  
ATOM 2952  H HA   . ILE A 1 36 ? -0.305  -0.400  -3.958  1.00 0.00 ? 34 ILE P HA   3  
ATOM 2953  H HB   . ILE A 1 36 ? -2.187  0.579   -3.221  1.00 0.00 ? 34 ILE P HB   3  
ATOM 2954  H HG12 . ILE A 1 36 ? -4.019  -0.850  -1.914  1.00 0.00 ? 34 ILE P HG12 3  
ATOM 2955  H HG13 . ILE A 1 36 ? -2.604  -1.727  -1.350  1.00 0.00 ? 34 ILE P HG13 3  
ATOM 2956  H HG21 . ILE A 1 36 ? -2.576  -1.004  -5.187  1.00 0.00 ? 34 ILE P HG21 3  
ATOM 2957  H HG22 . ILE A 1 36 ? -3.402  -2.071  -4.021  1.00 0.00 ? 34 ILE P HG22 3  
ATOM 2958  H HG23 . ILE A 1 36 ? -4.027  -0.461  -4.319  1.00 0.00 ? 34 ILE P HG23 3  
ATOM 2959  H HD11 . ILE A 1 36 ? -3.133  1.277   -1.073  1.00 0.00 ? 34 ILE P HD11 3  
ATOM 2960  H HD12 . ILE A 1 36 ? -1.681  0.459   -0.463  1.00 0.00 ? 34 ILE P HD12 3  
ATOM 2961  H HD13 . ILE A 1 36 ? -3.251  0.048   0.206   1.00 0.00 ? 34 ILE P HD13 3  
ATOM 2962  N N    . ALA A 1 37 ? 0.148   -1.857  -1.069  1.00 0.00 ? 35 ALA P N    3  
ATOM 2963  C CA   . ALA A 1 37 ? 0.831   -1.793  0.226   1.00 0.00 ? 35 ALA P CA   3  
ATOM 2964  C C    . ALA A 1 37 ? 2.366   -1.700  0.091   1.00 0.00 ? 35 ALA P C    3  
ATOM 2965  O O    . ALA A 1 37 ? 3.050   -1.103  0.927   1.00 0.00 ? 35 ALA P O    3  
ATOM 2966  C CB   . ALA A 1 37 ? 0.418   -3.028  1.035   1.00 0.00 ? 35 ALA P CB   3  
ATOM 2967  H H    . ALA A 1 37 ? -0.278  -2.738  -1.328  1.00 0.00 ? 35 ALA P H    3  
ATOM 2968  H HA   . ALA A 1 37 ? 0.482   -0.910  0.756   1.00 0.00 ? 35 ALA P HA   3  
ATOM 2969  H HB1  . ALA A 1 37 ? 0.867   -2.985  2.021   1.00 0.00 ? 35 ALA P HB1  3  
ATOM 2970  H HB2  . ALA A 1 37 ? -0.664  -3.062  1.151   1.00 0.00 ? 35 ALA P HB2  3  
ATOM 2971  H HB3  . ALA A 1 37 ? 0.761   -3.933  0.537   1.00 0.00 ? 35 ALA P HB3  3  
ATOM 2972  N N    . VAL A 1 38 ? 2.889   -2.269  -0.999  1.00 0.00 ? 36 VAL P N    3  
ATOM 2973  C CA   . VAL A 1 38 ? 4.312   -2.458  -1.324  1.00 0.00 ? 36 VAL P CA   3  
ATOM 2974  C C    . VAL A 1 38 ? 5.113   -1.155  -1.400  1.00 0.00 ? 36 VAL P C    3  
ATOM 2975  O O    . VAL A 1 38 ? 6.280   -1.133  -1.007  1.00 0.00 ? 36 VAL P O    3  
ATOM 2976  C CB   . VAL A 1 38 ? 4.379   -3.274  -2.640  1.00 0.00 ? 36 VAL P CB   3  
ATOM 2977  C CG1  . VAL A 1 38 ? 5.557   -2.980  -3.573  1.00 0.00 ? 36 VAL P CG1  3  
ATOM 2978  C CG2  . VAL A 1 38 ? 4.393   -4.773  -2.316  1.00 0.00 ? 36 VAL P CG2  3  
ATOM 2979  H H    . VAL A 1 38 ? 2.223   -2.732  -1.609  1.00 0.00 ? 36 VAL P H    3  
ATOM 2980  H HA   . VAL A 1 38 ? 4.768   -3.038  -0.523  1.00 0.00 ? 36 VAL P HA   3  
ATOM 2981  H HB   . VAL A 1 38 ? 3.480   -3.066  -3.222  1.00 0.00 ? 36 VAL P HB   3  
ATOM 2982  H HG11 . VAL A 1 38 ? 5.496   -1.952  -3.931  1.00 0.00 ? 36 VAL P HG11 3  
ATOM 2983  H HG12 . VAL A 1 38 ? 6.502   -3.141  -3.055  1.00 0.00 ? 36 VAL P HG12 3  
ATOM 2984  H HG13 . VAL A 1 38 ? 5.500   -3.636  -4.442  1.00 0.00 ? 36 VAL P HG13 3  
ATOM 2985  H HG21 . VAL A 1 38 ? 3.597   -5.009  -1.610  1.00 0.00 ? 36 VAL P HG21 3  
ATOM 2986  H HG22 . VAL A 1 38 ? 4.226   -5.347  -3.228  1.00 0.00 ? 36 VAL P HG22 3  
ATOM 2987  H HG23 . VAL A 1 38 ? 5.349   -5.053  -1.875  1.00 0.00 ? 36 VAL P HG23 3  
ATOM 2988  N N    . TRP A 1 39 ? 4.495   -0.063  -1.860  1.00 0.00 ? 37 TRP P N    3  
ATOM 2989  C CA   . TRP A 1 39 ? 5.130   1.255   -2.020  1.00 0.00 ? 37 TRP P CA   3  
ATOM 2990  C C    . TRP A 1 39 ? 4.554   2.328   -1.083  1.00 0.00 ? 37 TRP P C    3  
ATOM 2991  O O    . TRP A 1 39 ? 4.935   3.497   -1.161  1.00 0.00 ? 37 TRP P O    3  
ATOM 2992  C CB   . TRP A 1 39 ? 5.097   1.670   -3.496  1.00 0.00 ? 37 TRP P CB   3  
ATOM 2993  C CG   . TRP A 1 39 ? 3.772   1.507   -4.166  1.00 0.00 ? 37 TRP P CG   3  
ATOM 2994  C CD1  . TRP A 1 39 ? 3.320   0.360   -4.711  1.00 0.00 ? 37 TRP P CD1  3  
ATOM 2995  C CD2  . TRP A 1 39 ? 2.693   2.473   -4.316  1.00 0.00 ? 37 TRP P CD2  3  
ATOM 2996  N NE1  . TRP A 1 39 ? 2.023   0.529   -5.134  1.00 0.00 ? 37 TRP P NE1  3  
ATOM 2997  C CE2  . TRP A 1 39 ? 1.573   1.813   -4.909  1.00 0.00 ? 37 TRP P CE2  3  
ATOM 2998  C CE3  . TRP A 1 39 ? 2.546   3.836   -3.992  1.00 0.00 ? 37 TRP P CE3  3  
ATOM 2999  C CZ2  . TRP A 1 39 ? 0.352   2.467   -5.134  1.00 0.00 ? 37 TRP P CZ2  3  
ATOM 3000  C CZ3  . TRP A 1 39 ? 1.332   4.507   -4.232  1.00 0.00 ? 37 TRP P CZ3  3  
ATOM 3001  C CH2  . TRP A 1 39 ? 0.234   3.826   -4.790  1.00 0.00 ? 37 TRP P CH2  3  
ATOM 3002  H H    . TRP A 1 39 ? 3.532   -0.151  -2.163  1.00 0.00 ? 37 TRP P H    3  
ATOM 3003  H HA   . TRP A 1 39 ? 6.176   1.170   -1.742  1.00 0.00 ? 37 TRP P HA   3  
ATOM 3004  H HB2  . TRP A 1 39 ? 5.418   2.706   -3.586  1.00 0.00 ? 37 TRP P HB2  3  
ATOM 3005  H HB3  . TRP A 1 39 ? 5.820   1.067   -4.040  1.00 0.00 ? 37 TRP P HB3  3  
ATOM 3006  H HD1  . TRP A 1 39 ? 3.868   -0.574  -4.747  1.00 0.00 ? 37 TRP P HD1  3  
ATOM 3007  H HE1  . TRP A 1 39 ? 1.467   -0.268  -5.441  1.00 0.00 ? 37 TRP P HE1  3  
ATOM 3008  H HE3  . TRP A 1 39 ? 3.385   4.355   -3.548  1.00 0.00 ? 37 TRP P HE3  3  
ATOM 3009  H HZ2  . TRP A 1 39 ? -0.480  1.933   -5.572  1.00 0.00 ? 37 TRP P HZ2  3  
ATOM 3010  H HZ3  . TRP A 1 39 ? 1.240   5.555   -3.982  1.00 0.00 ? 37 TRP P HZ3  3  
ATOM 3011  H HH2  . TRP A 1 39 ? -0.697  4.353   -4.954  1.00 0.00 ? 37 TRP P HH2  3  
ATOM 3012  N N    . THR A 1 40 ? 3.664   1.929   -0.170  1.00 0.00 ? 38 THR P N    3  
ATOM 3013  C CA   . THR A 1 40 ? 3.009   2.817   0.811   1.00 0.00 ? 38 THR P CA   3  
ATOM 3014  C C    . THR A 1 40 ? 3.400   2.506   2.258   1.00 0.00 ? 38 THR P C    3  
ATOM 3015  O O    . THR A 1 40 ? 2.894   3.149   3.174   1.00 0.00 ? 38 THR P O    3  
ATOM 3016  C CB   . THR A 1 40 ? 1.482   2.815   0.635   1.00 0.00 ? 38 THR P CB   3  
ATOM 3017  O OG1  . THR A 1 40 ? 0.970   1.514   0.763   1.00 0.00 ? 38 THR P OG1  3  
ATOM 3018  C CG2  . THR A 1 40 ? 1.084   3.324   -0.751  1.00 0.00 ? 38 THR P CG2  3  
ATOM 3019  H H    . THR A 1 40 ? 3.400   0.950   -0.162  1.00 0.00 ? 38 THR P H    3  
ATOM 3020  H HA   . THR A 1 40 ? 3.335   3.841   0.641   1.00 0.00 ? 38 THR P HA   3  
ATOM 3021  H HB   . THR A 1 40 ? 1.025   3.452   1.397   1.00 0.00 ? 38 THR P HB   3  
ATOM 3022  H HG1  . THR A 1 40 ? 0.862   1.168   -0.142  1.00 0.00 ? 38 THR P HG1  3  
ATOM 3023  H HG21 . THR A 1 40 ? 1.530   2.699   -1.528  1.00 0.00 ? 38 THR P HG21 3  
ATOM 3024  H HG22 . THR A 1 40 ? 1.440   4.344   -0.879  1.00 0.00 ? 38 THR P HG22 3  
ATOM 3025  H HG23 . THR A 1 40 ? -0.001  3.306   -0.854  1.00 0.00 ? 38 THR P HG23 3  
ATOM 3026  N N    . ASN A 1 41 ? 4.329   1.567   2.482   1.00 0.00 ? 39 ASN P N    3  
ATOM 3027  C CA   . ASN A 1 41 ? 4.766   1.096   3.806   1.00 0.00 ? 39 ASN P CA   3  
ATOM 3028  C C    . ASN A 1 41 ? 3.607   0.524   4.660   1.00 0.00 ? 39 ASN P C    3  
ATOM 3029  O O    . ASN A 1 41 ? 3.487   0.796   5.859   1.00 0.00 ? 39 ASN P O    3  
ATOM 3030  C CB   . ASN A 1 41 ? 5.615   2.190   4.488   1.00 0.00 ? 39 ASN P CB   3  
ATOM 3031  C CG   . ASN A 1 41 ? 6.613   1.643   5.499   1.00 0.00 ? 39 ASN P CG   3  
ATOM 3032  O OD1  . ASN A 1 41 ? 7.815   1.623   5.273   1.00 0.00 ? 39 ASN P OD1  3  
ATOM 3033  N ND2  . ASN A 1 41 ? 6.161   1.177   6.640   1.00 0.00 ? 39 ASN P ND2  3  
ATOM 3034  H H    . ASN A 1 41 ? 4.723   1.112   1.669   1.00 0.00 ? 39 ASN P H    3  
ATOM 3035  H HA   . ASN A 1 41 ? 5.431   0.250   3.619   1.00 0.00 ? 39 ASN P HA   3  
ATOM 3036  H HB2  . ASN A 1 41 ? 6.179   2.736   3.732   1.00 0.00 ? 39 ASN P HB2  3  
ATOM 3037  H HB3  . ASN A 1 41 ? 4.951   2.896   4.983   1.00 0.00 ? 39 ASN P HB3  3  
ATOM 3038  H HD21 . ASN A 1 41 ? 5.157   1.133   6.785   1.00 0.00 ? 39 ASN P HD21 3  
ATOM 3039  H HD22 . ASN A 1 41 ? 6.815   0.809   7.313   1.00 0.00 ? 39 ASN P HD22 3  
ATOM 3040  N N    . LEU A 1 42 ? 2.738   -0.262  4.021   1.00 0.00 ? 40 LEU P N    3  
ATOM 3041  C CA   . LEU A 1 42 ? 1.633   -1.013  4.631   1.00 0.00 ? 40 LEU P CA   3  
ATOM 3042  C C    . LEU A 1 42 ? 1.827   -2.536  4.456   1.00 0.00 ? 40 LEU P C    3  
ATOM 3043  O O    . LEU A 1 42 ? 2.815   -2.999  3.883   1.00 0.00 ? 40 LEU P O    3  
ATOM 3044  C CB   . LEU A 1 42 ? 0.306   -0.524  4.003   1.00 0.00 ? 40 LEU P CB   3  
ATOM 3045  C CG   . LEU A 1 42 ? -0.069  0.942   4.281   1.00 0.00 ? 40 LEU P CG   3  
ATOM 3046  C CD1  . LEU A 1 42 ? -1.360  1.287   3.540   1.00 0.00 ? 40 LEU P CD1  3  
ATOM 3047  C CD2  . LEU A 1 42 ? -0.298  1.182   5.772   1.00 0.00 ? 40 LEU P CD2  3  
ATOM 3048  H H    . LEU A 1 42 ? 2.897   -0.401  3.030   1.00 0.00 ? 40 LEU P H    3  
ATOM 3049  H HA   . LEU A 1 42 ? 1.603   -0.829  5.704   1.00 0.00 ? 40 LEU P HA   3  
ATOM 3050  H HB2  . LEU A 1 42 ? 0.368   -0.653  2.928   1.00 0.00 ? 40 LEU P HB2  3  
ATOM 3051  H HB3  . LEU A 1 42 ? -0.514  -1.148  4.355   1.00 0.00 ? 40 LEU P HB3  3  
ATOM 3052  H HG   . LEU A 1 42 ? 0.721   1.604   3.926   1.00 0.00 ? 40 LEU P HG   3  
ATOM 3053  H HD11 . LEU A 1 42 ? -2.179  0.660   3.892   1.00 0.00 ? 40 LEU P HD11 3  
ATOM 3054  H HD12 . LEU A 1 42 ? -1.604  2.334   3.706   1.00 0.00 ? 40 LEU P HD12 3  
ATOM 3055  H HD13 . LEU A 1 42 ? -1.217  1.133   2.470   1.00 0.00 ? 40 LEU P HD13 3  
ATOM 3056  H HD21 . LEU A 1 42 ? 0.641   1.072   6.310   1.00 0.00 ? 40 LEU P HD21 3  
ATOM 3057  H HD22 . LEU A 1 42 ? -0.670  2.194   5.929   1.00 0.00 ? 40 LEU P HD22 3  
ATOM 3058  H HD23 . LEU A 1 42 ? -1.028  0.477   6.157   1.00 0.00 ? 40 LEU P HD23 3  
ATOM 3059  N N    . THR A 1 43 ? 0.857   -3.319  4.936   1.00 0.00 ? 41 THR P N    3  
ATOM 3060  C CA   . THR A 1 43 ? 0.716   -4.766  4.670   1.00 0.00 ? 41 THR P CA   3  
ATOM 3061  C C    . THR A 1 43 ? -0.724  -5.071  4.239   1.00 0.00 ? 41 THR P C    3  
ATOM 3062  O O    . THR A 1 43 ? -1.600  -4.219  4.406   1.00 0.00 ? 41 THR P O    3  
ATOM 3063  C CB   . THR A 1 43 ? 1.170   -5.597  5.884   1.00 0.00 ? 41 THR P CB   3  
ATOM 3064  O OG1  . THR A 1 43 ? 1.150   -6.970  5.562   1.00 0.00 ? 41 THR P OG1  3  
ATOM 3065  C CG2  . THR A 1 43 ? 0.301   -5.395  7.128   1.00 0.00 ? 41 THR P CG2  3  
ATOM 3066  H H    . THR A 1 43 ? 0.075   -2.873  5.398   1.00 0.00 ? 41 THR P H    3  
ATOM 3067  H HA   . THR A 1 43 ? 1.357   -5.046  3.837   1.00 0.00 ? 41 THR P HA   3  
ATOM 3068  H HB   . THR A 1 43 ? 2.195   -5.315  6.128   1.00 0.00 ? 41 THR P HB   3  
ATOM 3069  H HG1  . THR A 1 43 ? 1.610   -7.448  6.275   1.00 0.00 ? 41 THR P HG1  3  
ATOM 3070  H HG21 . THR A 1 43 ? 0.364   -4.357  7.453   1.00 0.00 ? 41 THR P HG21 3  
ATOM 3071  H HG22 . THR A 1 43 ? 0.664   -6.031  7.935   1.00 0.00 ? 41 THR P HG22 3  
ATOM 3072  H HG23 . THR A 1 43 ? -0.736  -5.648  6.912   1.00 0.00 ? 41 THR P HG23 3  
ATOM 3073  N N    . GLU A 1 44 ? -1.005  -6.267  3.704   1.00 0.00 ? 42 GLU P N    3  
ATOM 3074  C CA   . GLU A 1 44 ? -2.353  -6.651  3.246   1.00 0.00 ? 42 GLU P CA   3  
ATOM 3075  C C    . GLU A 1 44 ? -3.422  -6.374  4.312   1.00 0.00 ? 42 GLU P C    3  
ATOM 3076  O O    . GLU A 1 44 ? -4.495  -5.877  3.983   1.00 0.00 ? 42 GLU P O    3  
ATOM 3077  C CB   . GLU A 1 44 ? -2.402  -8.143  2.842   1.00 0.00 ? 42 GLU P CB   3  
ATOM 3078  C CG   . GLU A 1 44 ? -3.861  -8.594  2.619   1.00 0.00 ? 42 GLU P CG   3  
ATOM 3079  C CD   . GLU A 1 44 ? -4.082  -9.993  2.036   1.00 0.00 ? 42 GLU P CD   3  
ATOM 3080  O OE1  . GLU A 1 44 ? -3.129  -10.792 1.891   1.00 0.00 ? 42 GLU P OE1  3  
ATOM 3081  O OE2  . GLU A 1 44 ? -5.275  -10.299 1.778   1.00 0.00 ? 42 GLU P OE2  3  
ATOM 3082  H H    . GLU A 1 44 ? -0.262  -6.954  3.668   1.00 0.00 ? 42 GLU P H    3  
ATOM 3083  H HA   . GLU A 1 44 ? -2.605  -6.052  2.370   1.00 0.00 ? 42 GLU P HA   3  
ATOM 3084  H HB2  . GLU A 1 44 ? -1.831  -8.275  1.923   1.00 0.00 ? 42 GLU P HB2  3  
ATOM 3085  H HB3  . GLU A 1 44 ? -1.957  -8.752  3.630   1.00 0.00 ? 42 GLU P HB3  3  
ATOM 3086  H HG2  . GLU A 1 44 ? -4.387  -8.576  3.578   1.00 0.00 ? 42 GLU P HG2  3  
ATOM 3087  H HG3  . GLU A 1 44 ? -4.336  -7.869  1.959   1.00 0.00 ? 42 GLU P HG3  3  
ATOM 3088  N N    . ALA A 1 45 ? -3.134  -6.676  5.578   1.00 0.00 ? 43 ALA P N    3  
ATOM 3089  C CA   . ALA A 1 45 ? -4.104  -6.566  6.665   1.00 0.00 ? 43 ALA P CA   3  
ATOM 3090  C C    . ALA A 1 45 ? -4.565  -5.115  6.882   1.00 0.00 ? 43 ALA P C    3  
ATOM 3091  O O    . ALA A 1 45 ? -5.756  -4.874  7.063   1.00 0.00 ? 43 ALA P O    3  
ATOM 3092  C CB   . ALA A 1 45 ? -3.488  -7.185  7.923   1.00 0.00 ? 43 ALA P CB   3  
ATOM 3093  H H    . ALA A 1 45 ? -2.212  -7.033  5.780   1.00 0.00 ? 43 ALA P H    3  
ATOM 3094  H HA   . ALA A 1 45 ? -4.987  -7.151  6.399   1.00 0.00 ? 43 ALA P HA   3  
ATOM 3095  H HB1  . ALA A 1 45 ? -4.217  -7.164  8.735   1.00 0.00 ? 43 ALA P HB1  3  
ATOM 3096  H HB2  . ALA A 1 45 ? -3.215  -8.222  7.721   1.00 0.00 ? 43 ALA P HB2  3  
ATOM 3097  H HB3  . ALA A 1 45 ? -2.599  -6.629  8.225   1.00 0.00 ? 43 ALA P HB3  3  
ATOM 3098  N N    . ARG A 1 46 ? -3.655  -4.137  6.761   1.00 0.00 ? 44 ARG P N    3  
ATOM 3099  C CA   . ARG A 1 46 ? -3.982  -2.699  6.783   1.00 0.00 ? 44 ARG P CA   3  
ATOM 3100  C C    . ARG A 1 46 ? -4.921  -2.338  5.633   1.00 0.00 ? 44 ARG P C    3  
ATOM 3101  O O    . ARG A 1 46 ? -5.942  -1.696  5.862   1.00 0.00 ? 44 ARG P O    3  
ATOM 3102  C CB   . ARG A 1 46 ? -2.700  -1.849  6.700   1.00 0.00 ? 44 ARG P CB   3  
ATOM 3103  C CG   . ARG A 1 46 ? -1.727  -2.007  7.880   1.00 0.00 ? 44 ARG P CG   3  
ATOM 3104  C CD   . ARG A 1 46 ? -2.246  -1.317  9.147   1.00 0.00 ? 44 ARG P CD   3  
ATOM 3105  N NE   . ARG A 1 46 ? -1.380  -1.611  10.306  1.00 0.00 ? 44 ARG P NE   3  
ATOM 3106  C CZ   . ARG A 1 46 ? -0.424  -0.858  10.824  1.00 0.00 ? 44 ARG P CZ   3  
ATOM 3107  N NH1  . ARG A 1 46 ? -0.179  0.358   10.429  1.00 0.00 ? 44 ARG P NH1  3  
ATOM 3108  N NH2  . ARG A 1 46 ? 0.329   -1.332  11.775  1.00 0.00 ? 44 ARG P NH2  3  
ATOM 3109  H H    . ARG A 1 46 ? -2.709  -4.413  6.543   1.00 0.00 ? 44 ARG P H    3  
ATOM 3110  H HA   . ARG A 1 46 ? -4.516  -2.462  7.704   1.00 0.00 ? 44 ARG P HA   3  
ATOM 3111  H HB2  . ARG A 1 46 ? -2.180  -2.105  5.781   1.00 0.00 ? 44 ARG P HB2  3  
ATOM 3112  H HB3  . ARG A 1 46 ? -2.981  -0.799  6.630   1.00 0.00 ? 44 ARG P HB3  3  
ATOM 3113  H HG2  . ARG A 1 46 ? -1.565  -3.065  8.085   1.00 0.00 ? 44 ARG P HG2  3  
ATOM 3114  H HG3  . ARG A 1 46 ? -0.769  -1.561  7.611   1.00 0.00 ? 44 ARG P HG3  3  
ATOM 3115  H HD2  . ARG A 1 46 ? -2.318  -0.242  8.967   1.00 0.00 ? 44 ARG P HD2  3  
ATOM 3116  H HD3  . ARG A 1 46 ? -3.245  -1.694  9.355   1.00 0.00 ? 44 ARG P HD3  3  
ATOM 3117  H HE   . ARG A 1 46 ? -1.503  -2.515  10.734  1.00 0.00 ? 44 ARG P HE   3  
ATOM 3118  H HH11 . ARG A 1 46 ? -0.817  0.824   9.795   1.00 0.00 ? 44 ARG P HH11 3  
ATOM 3119  H HH12 . ARG A 1 46 ? 0.571   0.884   10.841  1.00 0.00 ? 44 ARG P HH12 3  
ATOM 3120  H HH21 . ARG A 1 46 ? 0.179   -2.265  12.123  1.00 0.00 ? 44 ARG P HH21 3  
ATOM 3121  H HH22 . ARG A 1 46 ? 1.055   -0.765  12.180  1.00 0.00 ? 44 ARG P HH22 3  
ATOM 3122  N N    . VAL A 1 47 ? -4.624  -2.795  4.413   1.00 0.00 ? 45 VAL P N    3  
ATOM 3123  C CA   . VAL A 1 47 ? -5.464  -2.515  3.233   1.00 0.00 ? 45 VAL P CA   3  
ATOM 3124  C C    . VAL A 1 47 ? -6.839  -3.182  3.358   1.00 0.00 ? 45 VAL P C    3  
ATOM 3125  O O    . VAL A 1 47 ? -7.859  -2.529  3.153   1.00 0.00 ? 45 VAL P O    3  
ATOM 3126  C CB   . VAL A 1 47 ? -4.753  -2.927  1.929   1.00 0.00 ? 45 VAL P CB   3  
ATOM 3127  C CG1  . VAL A 1 47 ? -5.533  -2.451  0.699   1.00 0.00 ? 45 VAL P CG1  3  
ATOM 3128  C CG2  . VAL A 1 47 ? -3.348  -2.319  1.862   1.00 0.00 ? 45 VAL P CG2  3  
ATOM 3129  H H    . VAL A 1 47 ? -3.773  -3.337  4.296   1.00 0.00 ? 45 VAL P H    3  
ATOM 3130  H HA   . VAL A 1 47 ? -5.635  -1.438  3.188   1.00 0.00 ? 45 VAL P HA   3  
ATOM 3131  H HB   . VAL A 1 47 ? -4.663  -4.012  1.889   1.00 0.00 ? 45 VAL P HB   3  
ATOM 3132  H HG11 . VAL A 1 47 ? -4.992  -2.717  -0.209  1.00 0.00 ? 45 VAL P HG11 3  
ATOM 3133  H HG12 . VAL A 1 47 ? -6.514  -2.922  0.662   1.00 0.00 ? 45 VAL P HG12 3  
ATOM 3134  H HG13 . VAL A 1 47 ? -5.653  -1.368  0.730   1.00 0.00 ? 45 VAL P HG13 3  
ATOM 3135  H HG21 . VAL A 1 47 ? -3.389  -1.250  2.072   1.00 0.00 ? 45 VAL P HG21 3  
ATOM 3136  H HG22 . VAL A 1 47 ? -2.693  -2.796  2.588   1.00 0.00 ? 45 VAL P HG22 3  
ATOM 3137  H HG23 . VAL A 1 47 ? -2.923  -2.477  0.874   1.00 0.00 ? 45 VAL P HG23 3  
ATOM 3138  N N    . ARG A 1 48 ? -6.891  -4.451  3.783   1.00 0.00 ? 46 ARG P N    3  
ATOM 3139  C CA   . ARG A 1 48 ? -8.131  -5.205  4.023   1.00 0.00 ? 46 ARG P CA   3  
ATOM 3140  C C    . ARG A 1 48 ? -9.014  -4.509  5.066   1.00 0.00 ? 46 ARG P C    3  
ATOM 3141  O O    . ARG A 1 48 ? -10.202 -4.307  4.823   1.00 0.00 ? 46 ARG P O    3  
ATOM 3142  C CB   . ARG A 1 48 ? -7.762  -6.643  4.438   1.00 0.00 ? 46 ARG P CB   3  
ATOM 3143  C CG   . ARG A 1 48 ? -8.968  -7.593  4.397   1.00 0.00 ? 46 ARG P CG   3  
ATOM 3144  C CD   . ARG A 1 48 ? -8.673  -8.948  5.057   1.00 0.00 ? 46 ARG P CD   3  
ATOM 3145  N NE   . ARG A 1 48 ? -7.681  -9.762  4.321   1.00 0.00 ? 46 ARG P NE   3  
ATOM 3146  C CZ   . ARG A 1 48 ? -7.319  -10.999 4.624   1.00 0.00 ? 46 ARG P CZ   3  
ATOM 3147  N NH1  . ARG A 1 48 ? -7.802  -11.630 5.658   1.00 0.00 ? 46 ARG P NH1  3  
ATOM 3148  N NH2  . ARG A 1 48 ? -6.458  -11.639 3.891   1.00 0.00 ? 46 ARG P NH2  3  
ATOM 3149  H H    . ARG A 1 48 ? -6.008  -4.926  3.945   1.00 0.00 ? 46 ARG P H    3  
ATOM 3150  H HA   . ARG A 1 48 ? -8.703  -5.240  3.094   1.00 0.00 ? 46 ARG P HA   3  
ATOM 3151  H HB2  . ARG A 1 48 ? -6.999  -7.029  3.760   1.00 0.00 ? 46 ARG P HB2  3  
ATOM 3152  H HB3  . ARG A 1 48 ? -7.342  -6.629  5.446   1.00 0.00 ? 46 ARG P HB3  3  
ATOM 3153  H HG2  . ARG A 1 48 ? -9.799  -7.138  4.937   1.00 0.00 ? 46 ARG P HG2  3  
ATOM 3154  H HG3  . ARG A 1 48 ? -9.278  -7.747  3.363   1.00 0.00 ? 46 ARG P HG3  3  
ATOM 3155  H HD2  . ARG A 1 48 ? -8.317  -8.768  6.074   1.00 0.00 ? 46 ARG P HD2  3  
ATOM 3156  H HD3  . ARG A 1 48 ? -9.613  -9.501  5.115   1.00 0.00 ? 46 ARG P HD3  3  
ATOM 3157  H HE   . ARG A 1 48 ? -7.250  -9.360  3.505   1.00 0.00 ? 46 ARG P HE   3  
ATOM 3158  H HH11 . ARG A 1 48 ? -8.470  -11.166 6.250   1.00 0.00 ? 46 ARG P HH11 3  
ATOM 3159  H HH12 . ARG A 1 48 ? -7.513  -12.571 5.866   1.00 0.00 ? 46 ARG P HH12 3  
ATOM 3160  H HH21 . ARG A 1 48 ? -6.036  -11.188 3.079   1.00 0.00 ? 46 ARG P HH21 3  
ATOM 3161  H HH22 . ARG A 1 48 ? -6.186  -12.578 4.126   1.00 0.00 ? 46 ARG P HH22 3  
ATOM 3162  N N    . VAL A 1 49 ? -8.430  -4.073  6.186   1.00 0.00 ? 47 VAL P N    3  
ATOM 3163  C CA   . VAL A 1 49 ? -9.111  -3.296  7.241   1.00 0.00 ? 47 VAL P CA   3  
ATOM 3164  C C    . VAL A 1 49 ? -9.619  -1.954  6.714   1.00 0.00 ? 47 VAL P C    3  
ATOM 3165  O O    . VAL A 1 49 ? -10.764 -1.589  6.987   1.00 0.00 ? 47 VAL P O    3  
ATOM 3166  C CB   . VAL A 1 49 ? -8.170  -3.096  8.448   1.00 0.00 ? 47 VAL P CB   3  
ATOM 3167  C CG1  . VAL A 1 49 ? -8.661  -2.044  9.450   1.00 0.00 ? 47 VAL P CG1  3  
ATOM 3168  C CG2  . VAL A 1 49 ? -8.017  -4.415  9.214   1.00 0.00 ? 47 VAL P CG2  3  
ATOM 3169  H H    . VAL A 1 49 ? -7.448  -4.294  6.318   1.00 0.00 ? 47 VAL P H    3  
ATOM 3170  H HA   . VAL A 1 49 ? -9.985  -3.852  7.581   1.00 0.00 ? 47 VAL P HA   3  
ATOM 3171  H HB   . VAL A 1 49 ? -7.189  -2.780  8.090   1.00 0.00 ? 47 VAL P HB   3  
ATOM 3172  H HG11 . VAL A 1 49 ? -9.674  -2.280  9.777   1.00 0.00 ? 47 VAL P HG11 3  
ATOM 3173  H HG12 . VAL A 1 49 ? -7.997  -2.023  10.315  1.00 0.00 ? 47 VAL P HG12 3  
ATOM 3174  H HG13 . VAL A 1 49 ? -8.647  -1.053  8.995   1.00 0.00 ? 47 VAL P HG13 3  
ATOM 3175  H HG21 . VAL A 1 49 ? -8.956  -4.677  9.700   1.00 0.00 ? 47 VAL P HG21 3  
ATOM 3176  H HG22 . VAL A 1 49 ? -7.739  -5.219  8.533   1.00 0.00 ? 47 VAL P HG22 3  
ATOM 3177  H HG23 . VAL A 1 49 ? -7.229  -4.311  9.959   1.00 0.00 ? 47 VAL P HG23 3  
ATOM 3178  N N    . TRP A 1 50 ? -8.812  -1.229  5.935   1.00 0.00 ? 48 TRP P N    3  
ATOM 3179  C CA   . TRP A 1 50 ? -9.202  0.072   5.392   1.00 0.00 ? 48 TRP P CA   3  
ATOM 3180  C C    . TRP A 1 50 ? -10.386 -0.045  4.429   1.00 0.00 ? 48 TRP P C    3  
ATOM 3181  O O    . TRP A 1 50 ? -11.382 0.654   4.598   1.00 0.00 ? 48 TRP P O    3  
ATOM 3182  C CB   . TRP A 1 50 ? -8.014  0.740   4.701   1.00 0.00 ? 48 TRP P CB   3  
ATOM 3183  C CG   . TRP A 1 50 ? -8.258  2.177   4.376   1.00 0.00 ? 48 TRP P CG   3  
ATOM 3184  C CD1  . TRP A 1 50 ? -7.915  3.224   5.159   1.00 0.00 ? 48 TRP P CD1  3  
ATOM 3185  C CD2  . TRP A 1 50 ? -8.932  2.752   3.213   1.00 0.00 ? 48 TRP P CD2  3  
ATOM 3186  N NE1  . TRP A 1 50 ? -8.297  4.402   4.550   1.00 0.00 ? 48 TRP P NE1  3  
ATOM 3187  C CE2  . TRP A 1 50 ? -8.922  4.171   3.345   1.00 0.00 ? 48 TRP P CE2  3  
ATOM 3188  C CE3  . TRP A 1 50 ? -9.541  2.221   2.056   1.00 0.00 ? 48 TRP P CE3  3  
ATOM 3189  C CZ2  . TRP A 1 50 ? -9.473  5.020   2.376   1.00 0.00 ? 48 TRP P CZ2  3  
ATOM 3190  C CZ3  . TRP A 1 50 ? -10.129 3.059   1.092   1.00 0.00 ? 48 TRP P CZ3  3  
ATOM 3191  C CH2  . TRP A 1 50 ? -10.105 4.453   1.256   1.00 0.00 ? 48 TRP P CH2  3  
ATOM 3192  H H    . TRP A 1 50 ? -7.867  -1.558  5.763   1.00 0.00 ? 48 TRP P H    3  
ATOM 3193  H HA   . TRP A 1 50 ? -9.514  0.714   6.218   1.00 0.00 ? 48 TRP P HA   3  
ATOM 3194  H HB2  . TRP A 1 50 ? -7.143  0.682   5.349   1.00 0.00 ? 48 TRP P HB2  3  
ATOM 3195  H HB3  . TRP A 1 50 ? -7.779  0.199   3.783   1.00 0.00 ? 48 TRP P HB3  3  
ATOM 3196  H HD1  . TRP A 1 50 ? -7.399  3.146   6.111   1.00 0.00 ? 48 TRP P HD1  3  
ATOM 3197  H HE1  . TRP A 1 50 ? -8.133  5.314   4.957   1.00 0.00 ? 48 TRP P HE1  3  
ATOM 3198  H HE3  . TRP A 1 50 ? -9.561  1.156   1.914   1.00 0.00 ? 48 TRP P HE3  3  
ATOM 3199  H HZ2  . TRP A 1 50 ? -9.400  6.090   2.493   1.00 0.00 ? 48 TRP P HZ2  3  
ATOM 3200  H HZ3  . TRP A 1 50 ? -10.600 2.625   0.219   1.00 0.00 ? 48 TRP P HZ3  3  
ATOM 3201  H HH2  . TRP A 1 50 ? -10.578 5.084   0.519   1.00 0.00 ? 48 TRP P HH2  3  
ATOM 3202  N N    . PHE A 1 51 ? -10.327 -0.971  3.467   1.00 0.00 ? 49 PHE P N    3  
ATOM 3203  C CA   . PHE A 1 51 ? -11.412 -1.205  2.509   1.00 0.00 ? 49 PHE P CA   3  
ATOM 3204  C C    . PHE A 1 51 ? -12.679 -1.755  3.191   1.00 0.00 ? 49 PHE P C    3  
ATOM 3205  O O    . PHE A 1 51 ? -13.791 -1.398  2.792   1.00 0.00 ? 49 PHE P O    3  
ATOM 3206  C CB   . PHE A 1 51 ? -10.914 -2.122  1.378   1.00 0.00 ? 49 PHE P CB   3  
ATOM 3207  C CG   . PHE A 1 51 ? -10.187 -1.391  0.257   1.00 0.00 ? 49 PHE P CG   3  
ATOM 3208  C CD1  . PHE A 1 51 ? -8.880  -0.890  0.434   1.00 0.00 ? 49 PHE P CD1  3  
ATOM 3209  C CD2  . PHE A 1 51 ? -10.829 -1.201  -0.982  1.00 0.00 ? 49 PHE P CD2  3  
ATOM 3210  C CE1  . PHE A 1 51 ? -8.229  -0.199  -0.604  1.00 0.00 ? 49 PHE P CE1  3  
ATOM 3211  C CE2  . PHE A 1 51 ? -10.166 -0.534  -2.024  1.00 0.00 ? 49 PHE P CE2  3  
ATOM 3212  C CZ   . PHE A 1 51 ? -8.874  -0.022  -1.836  1.00 0.00 ? 49 PHE P CZ   3  
ATOM 3213  H H    . PHE A 1 51 ? -9.481  -1.528  3.386   1.00 0.00 ? 49 PHE P H    3  
ATOM 3214  H HA   . PHE A 1 51 ? -11.696 -0.252  2.061   1.00 0.00 ? 49 PHE P HA   3  
ATOM 3215  H HB2  . PHE A 1 51 ? -10.266 -2.898  1.788   1.00 0.00 ? 49 PHE P HB2  3  
ATOM 3216  H HB3  . PHE A 1 51 ? -11.776 -2.629  0.943   1.00 0.00 ? 49 PHE P HB3  3  
ATOM 3217  H HD1  . PHE A 1 51 ? -8.373  -1.004  1.376   1.00 0.00 ? 49 PHE P HD1  3  
ATOM 3218  H HD2  . PHE A 1 51 ? -11.831 -1.569  -1.147  1.00 0.00 ? 49 PHE P HD2  3  
ATOM 3219  H HE1  . PHE A 1 51 ? -7.234  0.197   -0.455  1.00 0.00 ? 49 PHE P HE1  3  
ATOM 3220  H HE2  . PHE A 1 51 ? -10.654 -0.419  -2.974  1.00 0.00 ? 49 PHE P HE2  3  
ATOM 3221  H HZ   . PHE A 1 51 ? -8.381  0.507   -2.639  1.00 0.00 ? 49 PHE P HZ   3  
ATOM 3222  N N    . LYS A 1 52 ? -12.534 -2.541  4.269   1.00 0.00 ? 50 LYS P N    3  
ATOM 3223  C CA   . LYS A 1 52 ? -13.657 -3.025  5.095   1.00 0.00 ? 50 LYS P CA   3  
ATOM 3224  C C    . LYS A 1 52 ? -14.354 -1.882  5.843   1.00 0.00 ? 50 LYS P C    3  
ATOM 3225  O O    . LYS A 1 52 ? -15.583 -1.839  5.887   1.00 0.00 ? 50 LYS P O    3  
ATOM 3226  C CB   . LYS A 1 52 ? -13.162 -4.135  6.042   1.00 0.00 ? 50 LYS P CB   3  
ATOM 3227  C CG   . LYS A 1 52 ? -14.303 -4.749  6.873   1.00 0.00 ? 50 LYS P CG   3  
ATOM 3228  C CD   . LYS A 1 52 ? -13.872 -5.986  7.677   1.00 0.00 ? 50 LYS P CD   3  
ATOM 3229  C CE   . LYS A 1 52 ? -12.838 -5.649  8.762   1.00 0.00 ? 50 LYS P CE   3  
ATOM 3230  N NZ   . LYS A 1 52 ? -12.526 -6.836  9.602   1.00 0.00 ? 50 LYS P NZ   3  
ATOM 3231  H H    . LYS A 1 52 ? -11.586 -2.796  4.536   1.00 0.00 ? 50 LYS P H    3  
ATOM 3232  H HA   . LYS A 1 52 ? -14.404 -3.462  4.430   1.00 0.00 ? 50 LYS P HA   3  
ATOM 3233  H HB2  . LYS A 1 52 ? -12.712 -4.926  5.440   1.00 0.00 ? 50 LYS P HB2  3  
ATOM 3234  H HB3  . LYS A 1 52 ? -12.404 -3.729  6.711   1.00 0.00 ? 50 LYS P HB3  3  
ATOM 3235  H HG2  . LYS A 1 52 ? -14.698 -4.003  7.564   1.00 0.00 ? 50 LYS P HG2  3  
ATOM 3236  H HG3  . LYS A 1 52 ? -15.107 -5.046  6.198   1.00 0.00 ? 50 LYS P HG3  3  
ATOM 3237  H HD2  . LYS A 1 52 ? -14.761 -6.406  8.152   1.00 0.00 ? 50 LYS P HD2  3  
ATOM 3238  H HD3  . LYS A 1 52 ? -13.461 -6.733  6.995   1.00 0.00 ? 50 LYS P HD3  3  
ATOM 3239  H HE2  . LYS A 1 52 ? -11.927 -5.281  8.281   1.00 0.00 ? 50 LYS P HE2  3  
ATOM 3240  H HE3  . LYS A 1 52 ? -13.237 -4.846  9.389   1.00 0.00 ? 50 LYS P HE3  3  
ATOM 3241  H HZ1  . LYS A 1 52 ? -12.146 -7.593  9.049   1.00 0.00 ? 50 LYS P HZ1  3  
ATOM 3242  H HZ2  . LYS A 1 52 ? -13.353 -7.182  10.071  1.00 0.00 ? 50 LYS P HZ2  3  
ATOM 3243  H HZ3  . LYS A 1 52 ? -11.847 -6.610  10.318  1.00 0.00 ? 50 LYS P HZ3  3  
ATOM 3244  N N    . ASN A 1 53 ? -13.593 -0.913  6.358   1.00 0.00 ? 51 ASN P N    3  
ATOM 3245  C CA   . ASN A 1 53 ? -14.158 0.322   6.911   1.00 0.00 ? 51 ASN P CA   3  
ATOM 3246  C C    . ASN A 1 53 ? -14.771 1.215   5.818   1.00 0.00 ? 51 ASN P C    3  
ATOM 3247  O O    . ASN A 1 53 ? -15.881 1.720   5.992   1.00 0.00 ? 51 ASN P O    3  
ATOM 3248  C CB   . ASN A 1 53 ? -13.085 1.067   7.728   1.00 0.00 ? 51 ASN P CB   3  
ATOM 3249  C CG   . ASN A 1 53 ? -12.917 0.492   9.122   1.00 0.00 ? 51 ASN P CG   3  
ATOM 3250  O OD1  . ASN A 1 53 ? -13.533 0.936   10.080  1.00 0.00 ? 51 ASN P OD1  3  
ATOM 3251  N ND2  . ASN A 1 53 ? -12.095 -0.517  9.283   1.00 0.00 ? 51 ASN P ND2  3  
ATOM 3252  H H    . ASN A 1 53 ? -12.585 -1.030  6.333   1.00 0.00 ? 51 ASN P H    3  
ATOM 3253  H HA   . ASN A 1 53 ? -14.981 0.065   7.579   1.00 0.00 ? 51 ASN P HA   3  
ATOM 3254  H HB2  . ASN A 1 53 ? -12.126 1.050   7.211   1.00 0.00 ? 51 ASN P HB2  3  
ATOM 3255  H HB3  . ASN A 1 53 ? -13.384 2.109   7.845   1.00 0.00 ? 51 ASN P HB3  3  
ATOM 3256  H HD21 . ASN A 1 53 ? -11.588 -0.894  8.488   1.00 0.00 ? 51 ASN P HD21 3  
ATOM 3257  H HD22 . ASN A 1 53 ? -11.973 -0.885  10.210  1.00 0.00 ? 51 ASN P HD22 3  
ATOM 3258  N N    . ARG A 1 54 ? -14.107 1.379   4.667   1.00 0.00 ? 52 ARG P N    3  
ATOM 3259  C CA   . ARG A 1 54 ? -14.565 2.266   3.584   1.00 0.00 ? 52 ARG P CA   3  
ATOM 3260  C C    . ARG A 1 54 ? -15.897 1.821   2.983   1.00 0.00 ? 52 ARG P C    3  
ATOM 3261  O O    . ARG A 1 54 ? -16.767 2.663   2.774   1.00 0.00 ? 52 ARG P O    3  
ATOM 3262  C CB   . ARG A 1 54 ? -13.469 2.378   2.505   1.00 0.00 ? 52 ARG P CB   3  
ATOM 3263  C CG   . ARG A 1 54 ? -13.668 3.569   1.547   1.00 0.00 ? 52 ARG P CG   3  
ATOM 3264  C CD   . ARG A 1 54 ? -13.469 4.932   2.231   1.00 0.00 ? 52 ARG P CD   3  
ATOM 3265  N NE   . ARG A 1 54 ? -13.601 6.046   1.266   1.00 0.00 ? 52 ARG P NE   3  
ATOM 3266  C CZ   . ARG A 1 54 ? -12.851 7.133   1.184   1.00 0.00 ? 52 ARG P CZ   3  
ATOM 3267  N NH1  . ARG A 1 54 ? -11.870 7.393   1.993   1.00 0.00 ? 52 ARG P NH1  3  
ATOM 3268  N NH2  . ARG A 1 54 ? -13.044 8.027   0.264   1.00 0.00 ? 52 ARG P NH2  3  
ATOM 3269  H H    . ARG A 1 54 ? -13.180 0.968   4.594   1.00 0.00 ? 52 ARG P H    3  
ATOM 3270  H HA   . ARG A 1 54 ? -14.744 3.247   4.026   1.00 0.00 ? 52 ARG P HA   3  
ATOM 3271  H HB2  . ARG A 1 54 ? -12.491 2.463   2.982   1.00 0.00 ? 52 ARG P HB2  3  
ATOM 3272  H HB3  . ARG A 1 54 ? -13.464 1.460   1.916   1.00 0.00 ? 52 ARG P HB3  3  
ATOM 3273  H HG2  . ARG A 1 54 ? -12.944 3.481   0.737   1.00 0.00 ? 52 ARG P HG2  3  
ATOM 3274  H HG3  . ARG A 1 54 ? -14.665 3.525   1.109   1.00 0.00 ? 52 ARG P HG3  3  
ATOM 3275  H HD2  . ARG A 1 54 ? -14.220 5.061   3.011   1.00 0.00 ? 52 ARG P HD2  3  
ATOM 3276  H HD3  . ARG A 1 54 ? -12.483 4.940   2.698   1.00 0.00 ? 52 ARG P HD3  3  
ATOM 3277  H HE   . ARG A 1 54 ? -14.348 5.974   0.595   1.00 0.00 ? 52 ARG P HE   3  
ATOM 3278  H HH11 . ARG A 1 54 ? -11.661 6.773   2.751   1.00 0.00 ? 52 ARG P HH11 3  
ATOM 3279  H HH12 . ARG A 1 54 ? -11.314 8.225   1.800   1.00 0.00 ? 52 ARG P HH12 3  
ATOM 3280  H HH21 . ARG A 1 54 ? -13.797 7.952   -0.397  1.00 0.00 ? 52 ARG P HH21 3  
ATOM 3281  H HH22 . ARG A 1 54 ? -12.391 8.808   0.239   1.00 0.00 ? 52 ARG P HH22 3  
ATOM 3282  N N    . ARG A 1 55 ? -16.109 0.513   2.783   1.00 0.00 ? 53 ARG P N    3  
ATOM 3283  C CA   . ARG A 1 55 ? -17.395 -0.024  2.290   1.00 0.00 ? 53 ARG P CA   3  
ATOM 3284  C C    . ARG A 1 55 ? -18.521 0.096   3.326   1.00 0.00 ? 53 ARG P C    3  
ATOM 3285  O O    . ARG A 1 55 ? -19.665 0.355   2.959   1.00 0.00 ? 53 ARG P O    3  
ATOM 3286  C CB   . ARG A 1 55 ? -17.215 -1.448  1.729   1.00 0.00 ? 53 ARG P CB   3  
ATOM 3287  C CG   . ARG A 1 55 ? -17.012 -2.531  2.798   1.00 0.00 ? 53 ARG P CG   3  
ATOM 3288  C CD   . ARG A 1 55 ? -16.604 -3.866  2.167   1.00 0.00 ? 53 ARG P CD   3  
ATOM 3289  N NE   . ARG A 1 55 ? -16.511 -4.933  3.184   1.00 0.00 ? 53 ARG P NE   3  
ATOM 3290  C CZ   . ARG A 1 55 ? -15.904 -6.100  3.055   1.00 0.00 ? 53 ARG P CZ   3  
ATOM 3291  N NH1  . ARG A 1 55 ? -15.256 -6.431  1.973   1.00 0.00 ? 53 ARG P NH1  3  
ATOM 3292  N NH2  . ARG A 1 55 ? -15.936 -6.969  4.024   1.00 0.00 ? 53 ARG P NH2  3  
ATOM 3293  H H    . ARG A 1 55 ? -15.335 -0.123  2.961   1.00 0.00 ? 53 ARG P H    3  
ATOM 3294  H HA   . ARG A 1 55 ? -17.705 0.598   1.448   1.00 0.00 ? 53 ARG P HA   3  
ATOM 3295  H HB2  . ARG A 1 55 ? -18.098 -1.707  1.143   1.00 0.00 ? 53 ARG P HB2  3  
ATOM 3296  H HB3  . ARG A 1 55 ? -16.359 -1.446  1.052   1.00 0.00 ? 53 ARG P HB3  3  
ATOM 3297  H HG2  . ARG A 1 55 ? -16.225 -2.218  3.479   1.00 0.00 ? 53 ARG P HG2  3  
ATOM 3298  H HG3  . ARG A 1 55 ? -17.936 -2.666  3.360   1.00 0.00 ? 53 ARG P HG3  3  
ATOM 3299  H HD2  . ARG A 1 55 ? -17.347 -4.148  1.417   1.00 0.00 ? 53 ARG P HD2  3  
ATOM 3300  H HD3  . ARG A 1 55 ? -15.639 -3.732  1.674   1.00 0.00 ? 53 ARG P HD3  3  
ATOM 3301  H HE   . ARG A 1 55 ? -16.999 -4.779  4.052   1.00 0.00 ? 53 ARG P HE   3  
ATOM 3302  H HH11 . ARG A 1 55 ? -15.233 -5.789  1.201   1.00 0.00 ? 53 ARG P HH11 3  
ATOM 3303  H HH12 . ARG A 1 55 ? -14.810 -7.329  1.898   1.00 0.00 ? 53 ARG P HH12 3  
ATOM 3304  H HH21 . ARG A 1 55 ? -16.459 -6.779  4.861   1.00 0.00 ? 53 ARG P HH21 3  
ATOM 3305  H HH22 . ARG A 1 55 ? -15.484 -7.863  3.917   1.00 0.00 ? 53 ARG P HH22 3  
ATOM 3306  N N    . ALA A 1 56 ? -18.199 0.007   4.619   1.00 0.00 ? 54 ALA P N    3  
ATOM 3307  C CA   . ALA A 1 56 ? -19.160 0.253   5.697   1.00 0.00 ? 54 ALA P CA   3  
ATOM 3308  C C    . ALA A 1 56 ? -19.548 1.738   5.818   1.00 0.00 ? 54 ALA P C    3  
ATOM 3309  O O    . ALA A 1 56 ? -20.688 2.040   6.176   1.00 0.00 ? 54 ALA P O    3  
ATOM 3310  C CB   . ALA A 1 56 ? -18.574 -0.279  7.010   1.00 0.00 ? 54 ALA P CB   3  
ATOM 3311  H H    . ALA A 1 56 ? -17.243 -0.207  4.866   1.00 0.00 ? 54 ALA P H    3  
ATOM 3312  H HA   . ALA A 1 56 ? -20.076 -0.298  5.478   1.00 0.00 ? 54 ALA P HA   3  
ATOM 3313  H HB1  . ALA A 1 56 ? -19.311 -0.170  7.807   1.00 0.00 ? 54 ALA P HB1  3  
ATOM 3314  H HB2  . ALA A 1 56 ? -18.319 -1.335  6.905   1.00 0.00 ? 54 ALA P HB2  3  
ATOM 3315  H HB3  . ALA A 1 56 ? -17.682 0.286   7.280   1.00 0.00 ? 54 ALA P HB3  3  
ATOM 3316  N N    . LYS A 1 57 ? -18.630 2.661   5.495   1.00 0.00 ? 55 LYS P N    3  
ATOM 3317  C CA   . LYS A 1 57 ? -18.867 4.116   5.478   1.00 0.00 ? 55 LYS P CA   3  
ATOM 3318  C C    . LYS A 1 57 ? -19.594 4.593   4.214   1.00 0.00 ? 55 LYS P C    3  
ATOM 3319  O O    . LYS A 1 57 ? -20.483 5.439   4.310   1.00 0.00 ? 55 LYS P O    3  
ATOM 3320  C CB   . LYS A 1 57 ? -17.529 4.857   5.660   1.00 0.00 ? 55 LYS P CB   3  
ATOM 3321  C CG   . LYS A 1 57 ? -16.986 4.715   7.091   1.00 0.00 ? 55 LYS P CG   3  
ATOM 3322  C CD   . LYS A 1 57 ? -15.618 5.392   7.240   1.00 0.00 ? 55 LYS P CD   3  
ATOM 3323  C CE   . LYS A 1 57 ? -15.126 5.256   8.687   1.00 0.00 ? 55 LYS P CE   3  
ATOM 3324  N NZ   . LYS A 1 57 ? -13.833 5.959   8.897   1.00 0.00 ? 55 LYS P NZ   3  
ATOM 3325  H H    . LYS A 1 57 ? -17.686 2.330   5.317   1.00 0.00 ? 55 LYS P H    3  
ATOM 3326  H HA   . LYS A 1 57 ? -19.514 4.370   6.321   1.00 0.00 ? 55 LYS P HA   3  
ATOM 3327  H HB2  . LYS A 1 57 ? -16.798 4.474   4.947   1.00 0.00 ? 55 LYS P HB2  3  
ATOM 3328  H HB3  . LYS A 1 57 ? -17.681 5.919   5.457   1.00 0.00 ? 55 LYS P HB3  3  
ATOM 3329  H HG2  . LYS A 1 57 ? -17.691 5.180   7.779   1.00 0.00 ? 55 LYS P HG2  3  
ATOM 3330  H HG3  . LYS A 1 57 ? -16.893 3.663   7.354   1.00 0.00 ? 55 LYS P HG3  3  
ATOM 3331  H HD2  . LYS A 1 57 ? -14.903 4.920   6.563   1.00 0.00 ? 55 LYS P HD2  3  
ATOM 3332  H HD3  . LYS A 1 57 ? -15.710 6.449   6.983   1.00 0.00 ? 55 LYS P HD3  3  
ATOM 3333  H HE2  . LYS A 1 57 ? -15.886 5.672   9.355   1.00 0.00 ? 55 LYS P HE2  3  
ATOM 3334  H HE3  . LYS A 1 57 ? -15.019 4.193   8.924   1.00 0.00 ? 55 LYS P HE3  3  
ATOM 3335  H HZ1  . LYS A 1 57 ? -13.107 5.591   8.296   1.00 0.00 ? 55 LYS P HZ1  3  
ATOM 3336  H HZ2  . LYS A 1 57 ? -13.517 5.860   9.853   1.00 0.00 ? 55 LYS P HZ2  3  
ATOM 3337  H HZ3  . LYS A 1 57 ? -13.919 6.949   8.710   1.00 0.00 ? 55 LYS P HZ3  3  
ATOM 3338  N N    . TRP A 1 58 ? -19.281 4.018   3.048   1.00 0.00 ? 56 TRP P N    3  
ATOM 3339  C CA   . TRP A 1 58 ? -19.904 4.339   1.751   1.00 0.00 ? 56 TRP P CA   3  
ATOM 3340  C C    . TRP A 1 58 ? -21.430 4.210   1.799   1.00 0.00 ? 56 TRP P C    3  
ATOM 3341  O O    . TRP A 1 58 ? -22.148 5.100   1.343   1.00 0.00 ? 56 TRP P O    3  
ATOM 3342  C CB   . TRP A 1 58 ? -19.314 3.416   0.666   1.00 0.00 ? 56 TRP P CB   3  
ATOM 3343  C CG   . TRP A 1 58 ? -20.218 3.067   -0.483  1.00 0.00 ? 56 TRP P CG   3  
ATOM 3344  C CD1  . TRP A 1 58 ? -20.782 3.942   -1.348  1.00 0.00 ? 56 TRP P CD1  3  
ATOM 3345  C CD2  . TRP A 1 58 ? -20.727 1.750   -0.869  1.00 0.00 ? 56 TRP P CD2  3  
ATOM 3346  N NE1  . TRP A 1 58 ? -21.607 3.261   -2.225  1.00 0.00 ? 56 TRP P NE1  3  
ATOM 3347  C CE2  . TRP A 1 58 ? -21.597 1.907   -1.986  1.00 0.00 ? 56 TRP P CE2  3  
ATOM 3348  C CE3  . TRP A 1 58 ? -20.561 0.440   -0.372  1.00 0.00 ? 56 TRP P CE3  3  
ATOM 3349  C CZ2  . TRP A 1 58 ? -22.249 0.824   -2.595  1.00 0.00 ? 56 TRP P CZ2  3  
ATOM 3350  C CZ3  . TRP A 1 58 ? -21.210 -0.657  -0.971  1.00 0.00 ? 56 TRP P CZ3  3  
ATOM 3351  C CH2  . TRP A 1 58 ? -22.049 -0.470  -2.085  1.00 0.00 ? 56 TRP P CH2  3  
ATOM 3352  H H    . TRP A 1 58 ? -18.524 3.344   3.050   1.00 0.00 ? 56 TRP P H    3  
ATOM 3353  H HA   . TRP A 1 58 ? -19.680 5.371   1.482   1.00 0.00 ? 56 TRP P HA   3  
ATOM 3354  H HB2  . TRP A 1 58 ? -18.403 3.870   0.275   1.00 0.00 ? 56 TRP P HB2  3  
ATOM 3355  H HB3  . TRP A 1 58 ? -19.027 2.474   1.132   1.00 0.00 ? 56 TRP P HB3  3  
ATOM 3356  H HD1  . TRP A 1 58 ? -20.630 5.014   -1.312  1.00 0.00 ? 56 TRP P HD1  3  
ATOM 3357  H HE1  . TRP A 1 58 ? -22.170 3.694   -2.957  1.00 0.00 ? 56 TRP P HE1  3  
ATOM 3358  H HE3  . TRP A 1 58 ? -19.945 0.292   0.502   1.00 0.00 ? 56 TRP P HE3  3  
ATOM 3359  H HZ2  . TRP A 1 58 ? -22.901 0.989   -3.441  1.00 0.00 ? 56 TRP P HZ2  3  
ATOM 3360  H HZ3  . TRP A 1 58 ? -21.069 -1.653  -0.568  1.00 0.00 ? 56 TRP P HZ3  3  
ATOM 3361  H HH2  . TRP A 1 58 ? -22.545 -1.317  -2.540  1.00 0.00 ? 56 TRP P HH2  3  
ATOM 3362  N N    . ARG A 1 59 ? -21.930 3.131   2.408   1.00 0.00 ? 57 ARG P N    3  
ATOM 3363  C CA   . ARG A 1 59 ? -23.361 2.783   2.472   1.00 0.00 ? 57 ARG P CA   3  
ATOM 3364  C C    . ARG A 1 59 ? -24.249 3.822   3.176   1.00 0.00 ? 57 ARG P C    3  
ATOM 3365  O O    . ARG A 1 59 ? -25.448 3.867   2.909   1.00 0.00 ? 57 ARG P O    3  
ATOM 3366  C CB   . ARG A 1 59 ? -23.469 1.416   3.166   1.00 0.00 ? 57 ARG P CB   3  
ATOM 3367  C CG   . ARG A 1 59 ? -23.060 0.267   2.232   1.00 0.00 ? 57 ARG P CG   3  
ATOM 3368  C CD   . ARG A 1 59 ? -22.943 -1.061  2.987   1.00 0.00 ? 57 ARG P CD   3  
ATOM 3369  N NE   . ARG A 1 59 ? -24.255 -1.558  3.453   1.00 0.00 ? 57 ARG P NE   3  
ATOM 3370  C CZ   . ARG A 1 59 ? -24.474 -2.624  4.203   1.00 0.00 ? 57 ARG P CZ   3  
ATOM 3371  N NH1  . ARG A 1 59 ? -23.504 -3.384  4.629   1.00 0.00 ? 57 ARG P NH1  3  
ATOM 3372  N NH2  . ARG A 1 59 ? -25.686 -2.951  4.545   1.00 0.00 ? 57 ARG P NH2  3  
ATOM 3373  H H    . ARG A 1 59 ? -21.259 2.448   2.740   1.00 0.00 ? 57 ARG P H    3  
ATOM 3374  H HA   . ARG A 1 59 ? -23.744 2.713   1.450   1.00 0.00 ? 57 ARG P HA   3  
ATOM 3375  H HB2  . ARG A 1 59 ? -22.803 1.416   4.032   1.00 0.00 ? 57 ARG P HB2  3  
ATOM 3376  H HB3  . ARG A 1 59 ? -24.493 1.250   3.502   1.00 0.00 ? 57 ARG P HB3  3  
ATOM 3377  H HG2  . ARG A 1 59 ? -23.780 0.171   1.418   1.00 0.00 ? 57 ARG P HG2  3  
ATOM 3378  H HG3  . ARG A 1 59 ? -22.087 0.491   1.804   1.00 0.00 ? 57 ARG P HG3  3  
ATOM 3379  H HD2  . ARG A 1 59 ? -22.497 -1.797  2.316   1.00 0.00 ? 57 ARG P HD2  3  
ATOM 3380  H HD3  . ARG A 1 59 ? -22.274 -0.912  3.837   1.00 0.00 ? 57 ARG P HD3  3  
ATOM 3381  H HE   . ARG A 1 59 ? -25.071 -1.049  3.155   1.00 0.00 ? 57 ARG P HE   3  
ATOM 3382  H HH11 . ARG A 1 59 ? -22.558 -3.165  4.369   1.00 0.00 ? 57 ARG P HH11 3  
ATOM 3383  H HH12 . ARG A 1 59 ? -23.697 -4.192  5.197   1.00 0.00 ? 57 ARG P HH12 3  
ATOM 3384  H HH21 . ARG A 1 59 ? -26.469 -2.395  4.238   1.00 0.00 ? 57 ARG P HH21 3  
ATOM 3385  H HH22 . ARG A 1 59 ? -25.851 -3.764  5.116   1.00 0.00 ? 57 ARG P HH22 3  
ATOM 3386  N N    . LYS A 1 60 ? -23.674 4.682   4.029   1.00 0.00 ? 58 LYS P N    3  
ATOM 3387  C CA   . LYS A 1 60 ? -24.379 5.817   4.674   1.00 0.00 ? 58 LYS P CA   3  
ATOM 3388  C C    . LYS A 1 60 ? -24.624 6.994   3.715   1.00 0.00 ? 58 LYS P C    3  
ATOM 3389  O O    . LYS A 1 60 ? -25.529 7.794   3.957   1.00 0.00 ? 58 LYS P O    3  
ATOM 3390  C CB   . LYS A 1 60 ? -23.601 6.308   5.914   1.00 0.00 ? 58 LYS P CB   3  
ATOM 3391  C CG   . LYS A 1 60 ? -23.759 5.447   7.179   1.00 0.00 ? 58 LYS P CG   3  
ATOM 3392  C CD   . LYS A 1 60 ? -23.220 4.020   7.033   1.00 0.00 ? 58 LYS P CD   3  
ATOM 3393  C CE   . LYS A 1 60 ? -23.132 3.327   8.397   1.00 0.00 ? 58 LYS P CE   3  
ATOM 3394  N NZ   . LYS A 1 60 ? -22.668 1.925   8.249   1.00 0.00 ? 58 LYS P NZ   3  
ATOM 3395  H H    . LYS A 1 60 ? -22.686 4.554   4.204   1.00 0.00 ? 58 LYS P H    3  
ATOM 3396  H HA   . LYS A 1 60 ? -25.367 5.488   5.000   1.00 0.00 ? 58 LYS P HA   3  
ATOM 3397  H HB2  . LYS A 1 60 ? -22.544 6.410   5.671   1.00 0.00 ? 58 LYS P HB2  3  
ATOM 3398  H HB3  . LYS A 1 60 ? -23.963 7.305   6.174   1.00 0.00 ? 58 LYS P HB3  3  
ATOM 3399  H HG2  . LYS A 1 60 ? -23.217 5.944   7.985   1.00 0.00 ? 58 LYS P HG2  3  
ATOM 3400  H HG3  . LYS A 1 60 ? -24.813 5.405   7.457   1.00 0.00 ? 58 LYS P HG3  3  
ATOM 3401  H HD2  . LYS A 1 60 ? -23.882 3.446   6.385   1.00 0.00 ? 58 LYS P HD2  3  
ATOM 3402  H HD3  . LYS A 1 60 ? -22.224 4.065   6.591   1.00 0.00 ? 58 LYS P HD3  3  
ATOM 3403  H HE2  . LYS A 1 60 ? -22.433 3.888   9.027   1.00 0.00 ? 58 LYS P HE2  3  
ATOM 3404  H HE3  . LYS A 1 60 ? -24.114 3.353   8.879   1.00 0.00 ? 58 LYS P HE3  3  
ATOM 3405  H HZ1  . LYS A 1 60 ? -22.470 1.506   9.148   1.00 0.00 ? 58 LYS P HZ1  3  
ATOM 3406  H HZ2  . LYS A 1 60 ? -21.826 1.887   7.681   1.00 0.00 ? 58 LYS P HZ2  3  
ATOM 3407  H HZ3  . LYS A 1 60 ? -23.368 1.356   7.792   1.00 0.00 ? 58 LYS P HZ3  3  
ATOM 3408  N N    . ARG A 1 61 ? -23.826 7.111   2.644   1.00 0.00 ? 59 ARG P N    3  
ATOM 3409  C CA   . ARG A 1 61 ? -23.837 8.226   1.673   1.00 0.00 ? 59 ARG P CA   3  
ATOM 3410  C C    . ARG A 1 61 ? -24.268 7.815   0.257   1.00 0.00 ? 59 ARG P C    3  
ATOM 3411  O O    . ARG A 1 61 ? -24.732 8.663   -0.502  1.00 0.00 ? 59 ARG P O    3  
ATOM 3412  C CB   . ARG A 1 61 ? -22.444 8.886   1.651   1.00 0.00 ? 59 ARG P CB   3  
ATOM 3413  C CG   . ARG A 1 61 ? -21.938 9.409   3.009   1.00 0.00 ? 59 ARG P CG   3  
ATOM 3414  C CD   . ARG A 1 61 ? -22.864 10.464  3.631   1.00 0.00 ? 59 ARG P CD   3  
ATOM 3415  N NE   . ARG A 1 61 ? -22.304 10.994  4.890   1.00 0.00 ? 59 ARG P NE   3  
ATOM 3416  C CZ   . ARG A 1 61 ? -22.871 11.877  5.693   1.00 0.00 ? 59 ARG P CZ   3  
ATOM 3417  N NH1  . ARG A 1 61 ? -24.040 12.397  5.440   1.00 0.00 ? 59 ARG P NH1  3  
ATOM 3418  N NH2  . ARG A 1 61 ? -22.265 12.264  6.779   1.00 0.00 ? 59 ARG P NH2  3  
ATOM 3419  H H    . ARG A 1 61 ? -23.109 6.403   2.535   1.00 0.00 ? 59 ARG P H    3  
ATOM 3420  H HA   . ARG A 1 61 ? -24.568 8.975   1.982   1.00 0.00 ? 59 ARG P HA   3  
ATOM 3421  H HB2  . ARG A 1 61 ? -21.720 8.157   1.283   1.00 0.00 ? 59 ARG P HB2  3  
ATOM 3422  H HB3  . ARG A 1 61 ? -22.463 9.721   0.949   1.00 0.00 ? 59 ARG P HB3  3  
ATOM 3423  H HG2  . ARG A 1 61 ? -21.824 8.577   3.703   1.00 0.00 ? 59 ARG P HG2  3  
ATOM 3424  H HG3  . ARG A 1 61 ? -20.955 9.855   2.854   1.00 0.00 ? 59 ARG P HG3  3  
ATOM 3425  H HD2  . ARG A 1 61 ? -22.995 11.281  2.918   1.00 0.00 ? 59 ARG P HD2  3  
ATOM 3426  H HD3  . ARG A 1 61 ? -23.835 10.011  3.833   1.00 0.00 ? 59 ARG P HD3  3  
ATOM 3427  H HE   . ARG A 1 61 ? -21.397 10.654  5.169   1.00 0.00 ? 59 ARG P HE   3  
ATOM 3428  H HH11 . ARG A 1 61 ? -24.530 12.120  4.608   1.00 0.00 ? 59 ARG P HH11 3  
ATOM 3429  H HH12 . ARG A 1 61 ? -24.449 13.069  6.066   1.00 0.00 ? 59 ARG P HH12 3  
ATOM 3430  H HH21 . ARG A 1 61 ? -21.360 11.892  7.016   1.00 0.00 ? 59 ARG P HH21 3  
ATOM 3431  H HH22 . ARG A 1 61 ? -22.698 12.938  7.389   1.00 0.00 ? 59 ARG P HH22 3  
ATOM 3432  N N    . GLU A 1 62 ? -24.140 6.530   -0.084  1.00 0.00 ? 60 GLU P N    3  
ATOM 3433  C CA   . GLU A 1 62 ? -24.509 5.928   -1.379  1.00 0.00 ? 60 GLU P CA   3  
ATOM 3434  C C    . GLU A 1 62 ? -23.847 6.629   -2.588  1.00 0.00 ? 60 GLU P C    3  
ATOM 3435  O O    . GLU A 1 62 ? -24.473 6.861   -3.622  1.00 0.00 ? 60 GLU P O    3  
ATOM 3436  C CB   . GLU A 1 62 ? -26.038 5.765   -1.505  1.00 0.00 ? 60 GLU P CB   3  
ATOM 3437  C CG   . GLU A 1 62 ? -26.643 4.928   -0.368  1.00 0.00 ? 60 GLU P CG   3  
ATOM 3438  C CD   . GLU A 1 62 ? -28.150 4.700   -0.596  1.00 0.00 ? 60 GLU P CD   3  
ATOM 3439  O OE1  . GLU A 1 62 ? -28.969 5.564   -0.196  1.00 0.00 ? 60 GLU P OE1  3  
ATOM 3440  O OE2  . GLU A 1 62 ? -28.530 3.651   -1.173  1.00 0.00 ? 60 GLU P OE2  3  
ATOM 3441  H H    . GLU A 1 62 ? -23.690 5.925   0.592   1.00 0.00 ? 60 GLU P H    3  
ATOM 3442  H HA   . GLU A 1 62 ? -24.094 4.918   -1.383  1.00 0.00 ? 60 GLU P HA   3  
ATOM 3443  H HB2  . GLU A 1 62 ? -26.511 6.747   -1.520  1.00 0.00 ? 60 GLU P HB2  3  
ATOM 3444  H HB3  . GLU A 1 62 ? -26.258 5.262   -2.448  1.00 0.00 ? 60 GLU P HB3  3  
ATOM 3445  H HG2  . GLU A 1 62 ? -26.122 3.968   -0.316  1.00 0.00 ? 60 GLU P HG2  3  
ATOM 3446  H HG3  . GLU A 1 62 ? -26.492 5.443   0.585   1.00 0.00 ? 60 GLU P HG3  3  
ATOM 3447  N N    . GLU A 1 63 ? -22.567 6.995   -2.445  1.00 0.00 ? 61 GLU P N    3  
ATOM 3448  C CA   . GLU A 1 63 ? -21.815 7.752   -3.468  1.00 0.00 ? 61 GLU P CA   3  
ATOM 3449  C C    . GLU A 1 63 ? -21.615 6.948   -4.767  1.00 0.00 ? 61 GLU P C    3  
ATOM 3450  O O    . GLU A 1 63 ? -21.774 7.480   -5.869  1.00 0.00 ? 61 GLU P O    3  
ATOM 3451  C CB   . GLU A 1 63 ? -20.453 8.196   -2.912  1.00 0.00 ? 61 GLU P CB   3  
ATOM 3452  C CG   . GLU A 1 63 ? -20.592 9.216   -1.775  1.00 0.00 ? 61 GLU P CG   3  
ATOM 3453  C CD   . GLU A 1 63 ? -19.212 9.730   -1.321  1.00 0.00 ? 61 GLU P CD   3  
ATOM 3454  O OE1  . GLU A 1 63 ? -18.576 9.084   -0.452  1.00 0.00 ? 61 GLU P OE1  3  
ATOM 3455  O OE2  . GLU A 1 63 ? -18.757 10.786  -1.824  1.00 0.00 ? 61 GLU P OE2  3  
ATOM 3456  H H    . GLU A 1 63 ? -22.129 6.803   -1.554  1.00 0.00 ? 61 GLU P H    3  
ATOM 3457  H HA   . GLU A 1 63 ? -22.382 8.646   -3.732  1.00 0.00 ? 61 GLU P HA   3  
ATOM 3458  H HB2  . GLU A 1 63 ? -19.903 7.325   -2.552  1.00 0.00 ? 61 GLU P HB2  3  
ATOM 3459  H HB3  . GLU A 1 63 ? -19.881 8.652   -3.719  1.00 0.00 ? 61 GLU P HB3  3  
ATOM 3460  H HG2  . GLU A 1 63 ? -21.206 10.053  -2.119  1.00 0.00 ? 61 GLU P HG2  3  
ATOM 3461  H HG3  . GLU A 1 63 ? -21.107 8.748   -0.935  1.00 0.00 ? 61 GLU P HG3  3  
ATOM 3462  N N    . PHE A 1 64 ? -21.303 5.655   -4.633  1.00 0.00 ? 62 PHE P N    3  
ATOM 3463  C CA   . PHE A 1 64 ? -21.310 4.661   -5.711  1.00 0.00 ? 62 PHE P CA   3  
ATOM 3464  C C    . PHE A 1 64 ? -22.629 3.866   -5.678  1.00 0.00 ? 62 PHE P C    3  
ATOM 3465  O O    . PHE A 1 64 ? -23.169 3.612   -4.597  1.00 0.00 ? 62 PHE P O    3  
ATOM 3466  C CB   . PHE A 1 64 ? -20.071 3.763   -5.582  1.00 0.00 ? 62 PHE P CB   3  
ATOM 3467  C CG   . PHE A 1 64 ? -20.006 2.651   -6.610  1.00 0.00 ? 62 PHE P CG   3  
ATOM 3468  C CD1  . PHE A 1 64 ? -19.691 2.946   -7.951  1.00 0.00 ? 62 PHE P CD1  3  
ATOM 3469  C CD2  . PHE A 1 64 ? -20.287 1.323   -6.234  1.00 0.00 ? 62 PHE P CD2  3  
ATOM 3470  C CE1  . PHE A 1 64 ? -19.659 1.918   -8.910  1.00 0.00 ? 62 PHE P CE1  3  
ATOM 3471  C CE2  . PHE A 1 64 ? -20.250 0.297   -7.193  1.00 0.00 ? 62 PHE P CE2  3  
ATOM 3472  C CZ   . PHE A 1 64 ? -19.938 0.593   -8.532  1.00 0.00 ? 62 PHE P CZ   3  
ATOM 3473  H H    . PHE A 1 64 ? -21.157 5.317   -3.696  1.00 0.00 ? 62 PHE P H    3  
ATOM 3474  H HA   . PHE A 1 64 ? -21.252 5.170   -6.674  1.00 0.00 ? 62 PHE P HA   3  
ATOM 3475  H HB2  . PHE A 1 64 ? -19.177 4.381   -5.684  1.00 0.00 ? 62 PHE P HB2  3  
ATOM 3476  H HB3  . PHE A 1 64 ? -20.049 3.323   -4.584  1.00 0.00 ? 62 PHE P HB3  3  
ATOM 3477  H HD1  . PHE A 1 64 ? -19.477 3.964   -8.247  1.00 0.00 ? 62 PHE P HD1  3  
ATOM 3478  H HD2  . PHE A 1 64 ? -20.533 1.089   -5.207  1.00 0.00 ? 62 PHE P HD2  3  
ATOM 3479  H HE1  . PHE A 1 64 ? -19.421 2.146   -9.942  1.00 0.00 ? 62 PHE P HE1  3  
ATOM 3480  H HE2  . PHE A 1 64 ? -20.466 -0.722  -6.900  1.00 0.00 ? 62 PHE P HE2  3  
ATOM 3481  H HZ   . PHE A 1 64 ? -19.914 -0.198  -9.269  1.00 0.00 ? 62 PHE P HZ   3  
ATOM 3482  N N    . ILE A 1 65 ? -23.160 3.488   -6.847  1.00 0.00 ? 63 ILE P N    3  
ATOM 3483  C CA   . ILE A 1 65 ? -24.480 2.845   -7.004  1.00 0.00 ? 63 ILE P CA   3  
ATOM 3484  C C    . ILE A 1 65 ? -24.395 1.674   -7.997  1.00 0.00 ? 63 ILE P C    3  
ATOM 3485  O O    . ILE A 1 65 ? -23.742 1.777   -9.040  1.00 0.00 ? 63 ILE P O    3  
ATOM 3486  C CB   . ILE A 1 65 ? -25.553 3.887   -7.427  1.00 0.00 ? 63 ILE P CB   3  
ATOM 3487  C CG1  . ILE A 1 65 ? -25.674 5.002   -6.356  1.00 0.00 ? 63 ILE P CG1  3  
ATOM 3488  C CG2  . ILE A 1 65 ? -26.925 3.220   -7.671  1.00 0.00 ? 63 ILE P CG2  3  
ATOM 3489  C CD1  . ILE A 1 65 ? -26.729 6.075   -6.642  1.00 0.00 ? 63 ILE P CD1  3  
ATOM 3490  H H    . ILE A 1 65 ? -22.637 3.676   -7.691  1.00 0.00 ? 63 ILE P H    3  
ATOM 3491  H HA   . ILE A 1 65 ? -24.790 2.436   -6.043  1.00 0.00 ? 63 ILE P HA   3  
ATOM 3492  H HB   . ILE A 1 65 ? -25.235 4.348   -8.363  1.00 0.00 ? 63 ILE P HB   3  
ATOM 3493  H HG12 . ILE A 1 65 ? -25.895 4.550   -5.388  1.00 0.00 ? 63 ILE P HG12 3  
ATOM 3494  H HG13 . ILE A 1 65 ? -24.720 5.522   -6.277  1.00 0.00 ? 63 ILE P HG13 3  
ATOM 3495  H HG21 . ILE A 1 65 ? -27.655 3.958   -8.000  1.00 0.00 ? 63 ILE P HG21 3  
ATOM 3496  H HG22 . ILE A 1 65 ? -26.861 2.481   -8.468  1.00 0.00 ? 63 ILE P HG22 3  
ATOM 3497  H HG23 . ILE A 1 65 ? -27.282 2.745   -6.757  1.00 0.00 ? 63 ILE P HG23 3  
ATOM 3498  H HD11 . ILE A 1 65 ? -26.597 6.464   -7.652  1.00 0.00 ? 63 ILE P HD11 3  
ATOM 3499  H HD12 . ILE A 1 65 ? -26.613 6.889   -5.927  1.00 0.00 ? 63 ILE P HD12 3  
ATOM 3500  H HD13 . ILE A 1 65 ? -27.729 5.659   -6.531  1.00 0.00 ? 63 ILE P HD13 3  
ATOM 3501  N N    . VAL A 1 66 ? -25.102 0.578   -7.692  1.00 0.00 ? 64 VAL P N    3  
ATOM 3502  C CA   . VAL A 1 66 ? -25.307 -0.588  -8.573  1.00 0.00 ? 64 VAL P CA   3  
ATOM 3503  C C    . VAL A 1 66 ? -26.809 -0.814  -8.778  1.00 0.00 ? 64 VAL P C    3  
ATOM 3504  O O    . VAL A 1 66 ? -27.576 -0.812  -7.812  1.00 0.00 ? 64 VAL P O    3  
ATOM 3505  C CB   . VAL A 1 66 ? -24.639 -1.856  -8.000  1.00 0.00 ? 64 VAL P CB   3  
ATOM 3506  C CG1  . VAL A 1 66 ? -24.772 -3.052  -8.954  1.00 0.00 ? 64 VAL P CG1  3  
ATOM 3507  C CG2  . VAL A 1 66 ? -23.142 -1.642  -7.737  1.00 0.00 ? 64 VAL P CG2  3  
ATOM 3508  H H    . VAL A 1 66 ? -25.616 0.585   -6.823  1.00 0.00 ? 64 VAL P H    3  
ATOM 3509  H HA   . VAL A 1 66 ? -24.859 -0.388  -9.547  1.00 0.00 ? 64 VAL P HA   3  
ATOM 3510  H HB   . VAL A 1 66 ? -25.121 -2.114  -7.057  1.00 0.00 ? 64 VAL P HB   3  
ATOM 3511  H HG11 . VAL A 1 66 ? -24.356 -2.805  -9.931  1.00 0.00 ? 64 VAL P HG11 3  
ATOM 3512  H HG12 . VAL A 1 66 ? -24.238 -3.911  -8.547  1.00 0.00 ? 64 VAL P HG12 3  
ATOM 3513  H HG13 . VAL A 1 66 ? -25.819 -3.335  -9.059  1.00 0.00 ? 64 VAL P HG13 3  
ATOM 3514  H HG21 . VAL A 1 66 ? -23.003 -0.877  -6.974  1.00 0.00 ? 64 VAL P HG21 3  
ATOM 3515  H HG22 . VAL A 1 66 ? -22.691 -2.565  -7.374  1.00 0.00 ? 64 VAL P HG22 3  
ATOM 3516  H HG23 . VAL A 1 66 ? -22.642 -1.332  -8.654  1.00 0.00 ? 64 VAL P HG23 3  
ATOM 3517  N N    . THR A 1 67 ? -27.232 -1.010  -10.029 1.00 0.00 ? 65 THR P N    3  
ATOM 3518  C CA   . THR A 1 67 ? -28.650 -1.140  -10.432 1.00 0.00 ? 65 THR P CA   3  
ATOM 3519  C C    . THR A 1 67 ? -29.063 -2.560  -10.847 1.00 0.00 ? 65 THR P C    3  
ATOM 3520  O O    . THR A 1 67 ? -30.252 -2.832  -11.036 1.00 0.00 ? 65 THR P O    3  
ATOM 3521  C CB   . THR A 1 67 ? -28.977 -0.157  -11.568 1.00 0.00 ? 65 THR P CB   3  
ATOM 3522  O OG1  . THR A 1 67 ? -28.098 -0.359  -12.660 1.00 0.00 ? 65 THR P OG1  3  
ATOM 3523  C CG2  . THR A 1 67 ? -28.818 1.294   -11.112 1.00 0.00 ? 65 THR P CG2  3  
ATOM 3524  H H    . THR A 1 67 ? -26.556 -0.948  -10.779 1.00 0.00 ? 65 THR P H    3  
ATOM 3525  H HA   . THR A 1 67 ? -29.284 -0.879  -9.585  1.00 0.00 ? 65 THR P HA   3  
ATOM 3526  H HB   . THR A 1 67 ? -30.007 -0.309  -11.894 1.00 0.00 ? 65 THR P HB   3  
ATOM 3527  H HG1  . THR A 1 67 ? -28.402 0.211   -13.389 1.00 0.00 ? 65 THR P HG1  3  
ATOM 3528  H HG21 . THR A 1 67 ? -27.776 1.500   -10.863 1.00 0.00 ? 65 THR P HG21 3  
ATOM 3529  H HG22 . THR A 1 67 ? -29.438 1.469   -10.232 1.00 0.00 ? 65 THR P HG22 3  
ATOM 3530  H HG23 . THR A 1 67 ? -29.139 1.965   -11.908 1.00 0.00 ? 65 THR P HG23 3  
ATOM 3531  N N    . ASP A 1 68 ? -28.096 -3.477  -10.971 1.00 0.00 ? 66 ASP P N    3  
ATOM 3532  C CA   . ASP A 1 68 ? -28.289 -4.901  -11.314 1.00 0.00 ? 66 ASP P CA   3  
ATOM 3533  C C    . ASP A 1 68 ? -28.969 -5.726  -10.197 1.00 0.00 ? 66 ASP P C    3  
ATOM 3534  O O    . ASP A 1 68 ? -28.562 -5.616  -9.017  1.00 0.00 ? 66 ASP P O    3  
ATOM 3535  C CB   . ASP A 1 68 ? -26.933 -5.513  -11.717 1.00 0.00 ? 66 ASP P CB   3  
ATOM 3536  C CG   . ASP A 1 68 ? -27.045 -6.987  -12.169 1.00 0.00 ? 66 ASP P CG   3  
ATOM 3537  O OD1  . ASP A 1 68 ? -27.536 -7.241  -13.298 1.00 0.00 ? 66 ASP P OD1  3  
ATOM 3538  O OD2  . ASP A 1 68 ? -26.609 -7.894  -11.417 1.00 0.00 ? 66 ASP P OD2  3  
ATOM 3539  O OXT  . ASP A 1 68 ? -29.915 -6.484  -10.512 1.00 0.00 ? 66 ASP P OXT  3  
ATOM 3540  H H    . ASP A 1 68 ? -27.156 -3.161  -10.788 1.00 0.00 ? 66 ASP P H    3  
ATOM 3541  H HA   . ASP A 1 68 ? -28.941 -4.953  -12.187 1.00 0.00 ? 66 ASP P HA   3  
ATOM 3542  H HB2  . ASP A 1 68 ? -26.512 -4.923  -12.534 1.00 0.00 ? 66 ASP P HB2  3  
ATOM 3543  H HB3  . ASP A 1 68 ? -26.245 -5.437  -10.872 1.00 0.00 ? 66 ASP P HB3  3  
ATOM 3544  N N    . GLY A 1 1  ? 2.252   3.074   35.203  1.00 0.00 ? -1 GLY P N    4  
ATOM 3545  C CA   . GLY A 1 1  ? 2.459   3.430   33.781  1.00 0.00 ? -1 GLY P CA   4  
ATOM 3546  C C    . GLY A 1 1  ? 1.356   2.879   32.886  1.00 0.00 ? -1 GLY P C    4  
ATOM 3547  O O    . GLY A 1 1  ? 0.315   2.431   33.372  1.00 0.00 ? -1 GLY P O    4  
ATOM 3548  H H1   . GLY A 1 1  ? 1.370   3.437   35.527  1.00 0.00 ? -1 GLY P H1   4  
ATOM 3549  H H2   . GLY A 1 1  ? 2.990   3.460   35.770  1.00 0.00 ? -1 GLY P H2   4  
ATOM 3550  H H3   . GLY A 1 1  ? 2.247   2.072   35.315  1.00 0.00 ? -1 GLY P H3   4  
ATOM 3551  H HA2  . GLY A 1 1  ? 2.476   4.515   33.677  1.00 0.00 ? -1 GLY P HA2  4  
ATOM 3552  H HA3  . GLY A 1 1  ? 3.415   3.029   33.443  1.00 0.00 ? -1 GLY P HA3  4  
ATOM 3553  N N    . SER A 1 2  ? 1.571   2.910   31.566  1.00 0.00 ? 0  SER P N    4  
ATOM 3554  C CA   . SER A 1 2  ? 0.640   2.394   30.546  1.00 0.00 ? 0  SER P CA   4  
ATOM 3555  C C    . SER A 1 2  ? 1.375   1.890   29.298  1.00 0.00 ? 0  SER P C    4  
ATOM 3556  O O    . SER A 1 2  ? 2.417   2.431   28.915  1.00 0.00 ? 0  SER P O    4  
ATOM 3557  C CB   . SER A 1 2  ? -0.360  3.491   30.151  1.00 0.00 ? 0  SER P CB   4  
ATOM 3558  O OG   . SER A 1 2  ? -1.273  3.009   29.174  1.00 0.00 ? 0  SER P OG   4  
ATOM 3559  H H    . SER A 1 2  ? 2.450   3.287   31.232  1.00 0.00 ? 0  SER P H    4  
ATOM 3560  H HA   . SER A 1 2  ? 0.077   1.559   30.965  1.00 0.00 ? 0  SER P HA   4  
ATOM 3561  H HB2  . SER A 1 2  ? -0.914  3.803   31.037  1.00 0.00 ? 0  SER P HB2  4  
ATOM 3562  H HB3  . SER A 1 2  ? 0.180   4.351   29.751  1.00 0.00 ? 0  SER P HB3  4  
ATOM 3563  H HG   . SER A 1 2  ? -2.004  3.654   29.100  1.00 0.00 ? 0  SER P HG   4  
ATOM 3564  N N    . GLN A 1 3  ? 0.802   0.887   28.625  1.00 0.00 ? 1  GLN P N    4  
ATOM 3565  C CA   . GLN A 1 3  ? 1.252   0.407   27.311  1.00 0.00 ? 1  GLN P CA   4  
ATOM 3566  C C    . GLN A 1 3  ? 0.848   1.350   26.158  1.00 0.00 ? 1  GLN P C    4  
ATOM 3567  O O    . GLN A 1 3  ? 1.432   1.267   25.076  1.00 0.00 ? 1  GLN P O    4  
ATOM 3568  C CB   . GLN A 1 3  ? 0.711   -1.014  27.068  1.00 0.00 ? 1  GLN P CB   4  
ATOM 3569  C CG   . GLN A 1 3  ? 1.291   -2.043  28.054  1.00 0.00 ? 1  GLN P CG   4  
ATOM 3570  C CD   . GLN A 1 3  ? 0.808   -3.459  27.746  1.00 0.00 ? 1  GLN P CD   4  
ATOM 3571  O OE1  . GLN A 1 3  ? 1.475   -4.247  27.088  1.00 0.00 ? 1  GLN P OE1  4  
ATOM 3572  N NE2  . GLN A 1 3  ? -0.373  -3.841  28.193  1.00 0.00 ? 1  GLN P NE2  4  
ATOM 3573  H H    . GLN A 1 3  ? -0.059  0.508   28.998  1.00 0.00 ? 1  GLN P H    4  
ATOM 3574  H HA   . GLN A 1 3  ? 2.343   0.357   27.309  1.00 0.00 ? 1  GLN P HA   4  
ATOM 3575  H HB2  . GLN A 1 3  ? -0.378  -1.007  27.143  1.00 0.00 ? 1  GLN P HB2  4  
ATOM 3576  H HB3  . GLN A 1 3  ? 0.981   -1.324  26.056  1.00 0.00 ? 1  GLN P HB3  4  
ATOM 3577  H HG2  . GLN A 1 3  ? 2.379   -2.022  27.997  1.00 0.00 ? 1  GLN P HG2  4  
ATOM 3578  H HG3  . GLN A 1 3  ? 0.999   -1.784  29.072  1.00 0.00 ? 1  GLN P HG3  4  
ATOM 3579  H HE21 . GLN A 1 3  ? -0.938  -3.214  28.746  1.00 0.00 ? 1  GLN P HE21 4  
ATOM 3580  H HE22 . GLN A 1 3  ? -0.677  -4.782  27.998  1.00 0.00 ? 1  GLN P HE22 4  
ATOM 3581  N N    . ARG A 1 4  ? -0.113  2.263   26.397  1.00 0.00 ? 2  ARG P N    4  
ATOM 3582  C CA   . ARG A 1 4  ? -0.650  3.329   25.513  1.00 0.00 ? 2  ARG P CA   4  
ATOM 3583  C C    . ARG A 1 4  ? -1.326  2.882   24.206  1.00 0.00 ? 2  ARG P C    4  
ATOM 3584  O O    . ARG A 1 4  ? -2.438  3.344   23.938  1.00 0.00 ? 2  ARG P O    4  
ATOM 3585  C CB   . ARG A 1 4  ? 0.421   4.409   25.267  1.00 0.00 ? 2  ARG P CB   4  
ATOM 3586  C CG   . ARG A 1 4  ? 0.855   5.119   26.561  1.00 0.00 ? 2  ARG P CG   4  
ATOM 3587  C CD   . ARG A 1 4  ? 1.985   6.116   26.278  1.00 0.00 ? 2  ARG P CD   4  
ATOM 3588  N NE   . ARG A 1 4  ? 2.365   6.882   27.483  1.00 0.00 ? 2  ARG P NE   4  
ATOM 3589  C CZ   . ARG A 1 4  ? 3.196   6.516   28.443  1.00 0.00 ? 2  ARG P CZ   4  
ATOM 3590  N NH1  . ARG A 1 4  ? 3.736   5.329   28.494  1.00 0.00 ? 2  ARG P NH1  4  
ATOM 3591  N NH2  . ARG A 1 4  ? 3.506   7.351   29.393  1.00 0.00 ? 2  ARG P NH2  4  
ATOM 3592  H H    . ARG A 1 4  ? -0.502  2.240   27.335  1.00 0.00 ? 2  ARG P H    4  
ATOM 3593  H HA   . ARG A 1 4  ? -1.452  3.819   26.068  1.00 0.00 ? 2  ARG P HA   4  
ATOM 3594  H HB2  . ARG A 1 4  ? 1.293   3.959   24.790  1.00 0.00 ? 2  ARG P HB2  4  
ATOM 3595  H HB3  . ARG A 1 4  ? 0.015   5.158   24.584  1.00 0.00 ? 2  ARG P HB3  4  
ATOM 3596  H HG2  . ARG A 1 4  ? 0.001   5.651   26.983  1.00 0.00 ? 2  ARG P HG2  4  
ATOM 3597  H HG3  . ARG A 1 4  ? 1.205   4.388   27.288  1.00 0.00 ? 2  ARG P HG3  4  
ATOM 3598  H HD2  . ARG A 1 4  ? 2.852   5.582   25.882  1.00 0.00 ? 2  ARG P HD2  4  
ATOM 3599  H HD3  . ARG A 1 4  ? 1.648   6.815   25.510  1.00 0.00 ? 2  ARG P HD3  4  
ATOM 3600  H HE   . ARG A 1 4  ? 1.991   7.815   27.556  1.00 0.00 ? 2  ARG P HE   4  
ATOM 3601  H HH11 . ARG A 1 4  ? 3.468   4.634   27.818  1.00 0.00 ? 2  ARG P HH11 4  
ATOM 3602  H HH12 . ARG A 1 4  ? 4.377   5.087   29.229  1.00 0.00 ? 2  ARG P HH12 4  
ATOM 3603  H HH21 . ARG A 1 4  ? 3.121   8.282   29.395  1.00 0.00 ? 2  ARG P HH21 4  
ATOM 3604  H HH22 . ARG A 1 4  ? 4.148   7.081   30.120  1.00 0.00 ? 2  ARG P HH22 4  
ATOM 3605  N N    . ARG A 1 5  ? -0.712  1.971   23.440  1.00 0.00 ? 3  ARG P N    4  
ATOM 3606  C CA   . ARG A 1 5  ? -1.080  1.513   22.078  1.00 0.00 ? 3  ARG P CA   4  
ATOM 3607  C C    . ARG A 1 5  ? -1.047  2.622   21.009  1.00 0.00 ? 3  ARG P C    4  
ATOM 3608  O O    . ARG A 1 5  ? -0.990  3.812   21.319  1.00 0.00 ? 3  ARG P O    4  
ATOM 3609  C CB   . ARG A 1 5  ? -2.406  0.719   22.092  1.00 0.00 ? 3  ARG P CB   4  
ATOM 3610  C CG   . ARG A 1 5  ? -2.371  -0.495  23.036  1.00 0.00 ? 3  ARG P CG   4  
ATOM 3611  C CD   . ARG A 1 5  ? -3.690  -1.276  22.966  1.00 0.00 ? 3  ARG P CD   4  
ATOM 3612  N NE   . ARG A 1 5  ? -3.664  -2.455  23.855  1.00 0.00 ? 3  ARG P NE   4  
ATOM 3613  C CZ   . ARG A 1 5  ? -4.641  -3.327  24.036  1.00 0.00 ? 3  ARG P CZ   4  
ATOM 3614  N NH1  . ARG A 1 5  ? -5.786  -3.226  23.420  1.00 0.00 ? 3  ARG P NH1  4  
ATOM 3615  N NH2  . ARG A 1 5  ? -4.485  -4.332  24.850  1.00 0.00 ? 3  ARG P NH2  4  
ATOM 3616  H H    . ARG A 1 5  ? 0.178   1.653   23.805  1.00 0.00 ? 3  ARG P H    4  
ATOM 3617  H HA   . ARG A 1 5  ? -0.303  0.810   21.768  1.00 0.00 ? 3  ARG P HA   4  
ATOM 3618  H HB2  . ARG A 1 5  ? -3.225  1.376   22.384  1.00 0.00 ? 3  ARG P HB2  4  
ATOM 3619  H HB3  . ARG A 1 5  ? -2.615  0.358   21.083  1.00 0.00 ? 3  ARG P HB3  4  
ATOM 3620  H HG2  . ARG A 1 5  ? -1.550  -1.151  22.746  1.00 0.00 ? 3  ARG P HG2  4  
ATOM 3621  H HG3  . ARG A 1 5  ? -2.215  -0.161  24.063  1.00 0.00 ? 3  ARG P HG3  4  
ATOM 3622  H HD2  . ARG A 1 5  ? -4.506  -0.613  23.261  1.00 0.00 ? 3  ARG P HD2  4  
ATOM 3623  H HD3  . ARG A 1 5  ? -3.852  -1.601  21.936  1.00 0.00 ? 3  ARG P HD3  4  
ATOM 3624  H HE   . ARG A 1 5  ? -2.816  -2.623  24.372  1.00 0.00 ? 3  ARG P HE   4  
ATOM 3625  H HH11 . ARG A 1 5  ? -5.935  -2.463  22.782  1.00 0.00 ? 3  ARG P HH11 4  
ATOM 3626  H HH12 . ARG A 1 5  ? -6.513  -3.903  23.575  1.00 0.00 ? 3  ARG P HH12 4  
ATOM 3627  H HH21 . ARG A 1 5  ? -3.616  -4.454  25.345  1.00 0.00 ? 3  ARG P HH21 4  
ATOM 3628  H HH22 . ARG A 1 5  ? -5.229  -4.995  24.986  1.00 0.00 ? 3  ARG P HH22 4  
ATOM 3629  N N    . GLN A 1 6  ? -1.055  2.223   19.734  1.00 0.00 ? 4  GLN P N    4  
ATOM 3630  C CA   . GLN A 1 6  ? -0.875  3.128   18.584  1.00 0.00 ? 4  GLN P CA   4  
ATOM 3631  C C    . GLN A 1 6  ? -2.116  3.980   18.258  1.00 0.00 ? 4  GLN P C    4  
ATOM 3632  O O    . GLN A 1 6  ? -1.976  5.115   17.800  1.00 0.00 ? 4  GLN P O    4  
ATOM 3633  C CB   . GLN A 1 6  ? -0.469  2.308   17.344  1.00 0.00 ? 4  GLN P CB   4  
ATOM 3634  C CG   . GLN A 1 6  ? 0.884   1.587   17.483  1.00 0.00 ? 4  GLN P CG   4  
ATOM 3635  C CD   . GLN A 1 6  ? 2.033   2.537   17.819  1.00 0.00 ? 4  GLN P CD   4  
ATOM 3636  O OE1  . GLN A 1 6  ? 2.659   2.459   18.868  1.00 0.00 ? 4  GLN P OE1  4  
ATOM 3637  N NE2  . GLN A 1 6  ? 2.338   3.485   16.958  1.00 0.00 ? 4  GLN P NE2  4  
ATOM 3638  H H    . GLN A 1 6  ? -1.090  1.229   19.555  1.00 0.00 ? 4  GLN P H    4  
ATOM 3639  H HA   . GLN A 1 6  ? -0.072  3.831   18.814  1.00 0.00 ? 4  GLN P HA   4  
ATOM 3640  H HB2  . GLN A 1 6  ? -1.242  1.566   17.134  1.00 0.00 ? 4  GLN P HB2  4  
ATOM 3641  H HB3  . GLN A 1 6  ? -0.417  2.978   16.484  1.00 0.00 ? 4  GLN P HB3  4  
ATOM 3642  H HG2  . GLN A 1 6  ? 0.814   0.821   18.255  1.00 0.00 ? 4  GLN P HG2  4  
ATOM 3643  H HG3  . GLN A 1 6  ? 1.109   1.089   16.538  1.00 0.00 ? 4  GLN P HG3  4  
ATOM 3644  H HE21 . GLN A 1 6  ? 1.808   3.582   16.104  1.00 0.00 ? 4  GLN P HE21 4  
ATOM 3645  H HE22 . GLN A 1 6  ? 3.085   4.123   17.189  1.00 0.00 ? 4  GLN P HE22 4  
ATOM 3646  N N    . ARG A 1 7  ? -3.318  3.433   18.496  1.00 0.00 ? 5  ARG P N    4  
ATOM 3647  C CA   . ARG A 1 7  ? -4.672  4.012   18.275  1.00 0.00 ? 5  ARG P CA   4  
ATOM 3648  C C    . ARG A 1 7  ? -5.050  4.376   16.825  1.00 0.00 ? 5  ARG P C    4  
ATOM 3649  O O    . ARG A 1 7  ? -6.235  4.335   16.490  1.00 0.00 ? 5  ARG P O    4  
ATOM 3650  C CB   . ARG A 1 7  ? -4.917  5.204   19.229  1.00 0.00 ? 5  ARG P CB   4  
ATOM 3651  C CG   . ARG A 1 7  ? -4.610  4.941   20.714  1.00 0.00 ? 5  ARG P CG   4  
ATOM 3652  C CD   . ARG A 1 7  ? -5.469  3.827   21.326  1.00 0.00 ? 5  ARG P CD   4  
ATOM 3653  N NE   . ARG A 1 7  ? -5.030  3.526   22.699  1.00 0.00 ? 5  ARG P NE   4  
ATOM 3654  C CZ   . ARG A 1 7  ? -5.735  2.991   23.678  1.00 0.00 ? 5  ARG P CZ   4  
ATOM 3655  N NH1  . ARG A 1 7  ? -6.993  2.675   23.552  1.00 0.00 ? 5  ARG P NH1  4  
ATOM 3656  N NH2  . ARG A 1 7  ? -5.154  2.759   24.816  1.00 0.00 ? 5  ARG P NH2  4  
ATOM 3657  H H    . ARG A 1 7  ? -3.284  2.485   18.843  1.00 0.00 ? 5  ARG P H    4  
ATOM 3658  H HA   . ARG A 1 7  ? -5.396  3.240   18.541  1.00 0.00 ? 5  ARG P HA   4  
ATOM 3659  H HB2  . ARG A 1 7  ? -4.305  6.046   18.902  1.00 0.00 ? 5  ARG P HB2  4  
ATOM 3660  H HB3  . ARG A 1 7  ? -5.961  5.512   19.144  1.00 0.00 ? 5  ARG P HB3  4  
ATOM 3661  H HG2  . ARG A 1 7  ? -3.557  4.689   20.827  1.00 0.00 ? 5  ARG P HG2  4  
ATOM 3662  H HG3  . ARG A 1 7  ? -4.790  5.861   21.272  1.00 0.00 ? 5  ARG P HG3  4  
ATOM 3663  H HD2  . ARG A 1 7  ? -6.512  4.150   21.317  1.00 0.00 ? 5  ARG P HD2  4  
ATOM 3664  H HD3  . ARG A 1 7  ? -5.377  2.921   20.727  1.00 0.00 ? 5  ARG P HD3  4  
ATOM 3665  H HE   . ARG A 1 7  ? -4.058  3.708   22.924  1.00 0.00 ? 5  ARG P HE   4  
ATOM 3666  H HH11 . ARG A 1 7  ? -7.457  2.844   22.677  1.00 0.00 ? 5  ARG P HH11 4  
ATOM 3667  H HH12 . ARG A 1 7  ? -7.500  2.274   24.324  1.00 0.00 ? 5  ARG P HH12 4  
ATOM 3668  H HH21 . ARG A 1 7  ? -4.171  2.983   24.903  1.00 0.00 ? 5  ARG P HH21 4  
ATOM 3669  H HH22 . ARG A 1 7  ? -5.663  2.361   25.588  1.00 0.00 ? 5  ARG P HH22 4  
ATOM 3670  N N    . THR A 1 8  ? -4.076  4.664   15.965  1.00 0.00 ? 6  THR P N    4  
ATOM 3671  C CA   . THR A 1 8  ? -4.236  5.006   14.539  1.00 0.00 ? 6  THR P CA   4  
ATOM 3672  C C    . THR A 1 8  ? -3.259  4.183   13.693  1.00 0.00 ? 6  THR P C    4  
ATOM 3673  O O    . THR A 1 8  ? -2.093  4.022   14.066  1.00 0.00 ? 6  THR P O    4  
ATOM 3674  C CB   . THR A 1 8  ? -4.017  6.515   14.313  1.00 0.00 ? 6  THR P CB   4  
ATOM 3675  O OG1  . THR A 1 8  ? -4.890  7.263   15.140  1.00 0.00 ? 6  THR P OG1  4  
ATOM 3676  C CG2  . THR A 1 8  ? -4.298  6.951   12.873  1.00 0.00 ? 6  THR P CG2  4  
ATOM 3677  H H    . THR A 1 8  ? -3.143  4.726   16.350  1.00 0.00 ? 6  THR P H    4  
ATOM 3678  H HA   . THR A 1 8  ? -5.250  4.765   14.220  1.00 0.00 ? 6  THR P HA   4  
ATOM 3679  H HB   . THR A 1 8  ? -2.987  6.771   14.568  1.00 0.00 ? 6  THR P HB   4  
ATOM 3680  H HG1  . THR A 1 8  ? -4.642  8.201   15.058  1.00 0.00 ? 6  THR P HG1  4  
ATOM 3681  H HG21 . THR A 1 8  ? -3.567  6.506   12.200  1.00 0.00 ? 6  THR P HG21 4  
ATOM 3682  H HG22 . THR A 1 8  ? -4.212  8.035   12.791  1.00 0.00 ? 6  THR P HG22 4  
ATOM 3683  H HG23 . THR A 1 8  ? -5.303  6.647   12.577  1.00 0.00 ? 6  THR P HG23 4  
ATOM 3684  N N    . HIS A 1 9  ? -3.725  3.658   12.553  1.00 0.00 ? 7  HIS P N    4  
ATOM 3685  C CA   . HIS A 1 9  ? -2.998  2.670   11.730  1.00 0.00 ? 7  HIS P CA   4  
ATOM 3686  C C    . HIS A 1 9  ? -2.538  3.182   10.353  1.00 0.00 ? 7  HIS P C    4  
ATOM 3687  O O    . HIS A 1 9  ? -1.966  2.409   9.580   1.00 0.00 ? 7  HIS P O    4  
ATOM 3688  C CB   . HIS A 1 9  ? -3.852  1.396   11.621  1.00 0.00 ? 7  HIS P CB   4  
ATOM 3689  C CG   . HIS A 1 9  ? -4.072  0.724   12.955  1.00 0.00 ? 7  HIS P CG   4  
ATOM 3690  N ND1  . HIS A 1 9  ? -3.118  -0.030  13.646  1.00 0.00 ? 7  HIS P ND1  4  
ATOM 3691  C CD2  . HIS A 1 9  ? -5.213  0.784   13.701  1.00 0.00 ? 7  HIS P CD2  4  
ATOM 3692  C CE1  . HIS A 1 9  ? -3.708  -0.409  14.793  1.00 0.00 ? 7  HIS P CE1  4  
ATOM 3693  N NE2  . HIS A 1 9  ? -4.966  0.065   14.851  1.00 0.00 ? 7  HIS P NE2  4  
ATOM 3694  H H    . HIS A 1 9  ? -4.691  3.835   12.314  1.00 0.00 ? 7  HIS P H    4  
ATOM 3695  H HA   . HIS A 1 9  ? -2.079  2.385   12.247  1.00 0.00 ? 7  HIS P HA   4  
ATOM 3696  H HB2  . HIS A 1 9  ? -4.816  1.639   11.173  1.00 0.00 ? 7  HIS P HB2  4  
ATOM 3697  H HB3  . HIS A 1 9  ? -3.354  0.678   10.970  1.00 0.00 ? 7  HIS P HB3  4  
ATOM 3698  H HD2  . HIS A 1 9  ? -6.126  1.302   13.438  1.00 0.00 ? 7  HIS P HD2  4  
ATOM 3699  H HE1  . HIS A 1 9  ? -3.239  -1.013  15.562  1.00 0.00 ? 7  HIS P HE1  4  
ATOM 3700  H HE2  . HIS A 1 9  ? -5.614  -0.091  15.616  1.00 0.00 ? 7  HIS P HE2  4  
ATOM 3701  N N    . PHE A 1 10 ? -2.760  4.467   10.048  1.00 0.00 ? 8  PHE P N    4  
ATOM 3702  C CA   . PHE A 1 10 ? -2.406  5.101   8.771   1.00 0.00 ? 8  PHE P CA   4  
ATOM 3703  C C    . PHE A 1 10 ? -1.838  6.518   8.952   1.00 0.00 ? 8  PHE P C    4  
ATOM 3704  O O    . PHE A 1 10 ? -2.025  7.149   9.996   1.00 0.00 ? 8  PHE P O    4  
ATOM 3705  C CB   . PHE A 1 10 ? -3.637  5.163   7.857   1.00 0.00 ? 8  PHE P CB   4  
ATOM 3706  C CG   . PHE A 1 10 ? -4.332  3.834   7.651   1.00 0.00 ? 8  PHE P CG   4  
ATOM 3707  C CD1  . PHE A 1 10 ? -3.855  2.937   6.679   1.00 0.00 ? 8  PHE P CD1  4  
ATOM 3708  C CD2  . PHE A 1 10 ? -5.422  3.476   8.468   1.00 0.00 ? 8  PHE P CD2  4  
ATOM 3709  C CE1  . PHE A 1 10 ? -4.461  1.676   6.532   1.00 0.00 ? 8  PHE P CE1  4  
ATOM 3710  C CE2  . PHE A 1 10 ? -6.016  2.210   8.333   1.00 0.00 ? 8  PHE P CE2  4  
ATOM 3711  C CZ   . PHE A 1 10 ? -5.527  1.309   7.373   1.00 0.00 ? 8  PHE P CZ   4  
ATOM 3712  H H    . PHE A 1 10 ? -3.209  5.051   10.734  1.00 0.00 ? 8  PHE P H    4  
ATOM 3713  H HA   . PHE A 1 10 ? -1.647  4.497   8.281   1.00 0.00 ? 8  PHE P HA   4  
ATOM 3714  H HB2  . PHE A 1 10 ? -4.349  5.875   8.276   1.00 0.00 ? 8  PHE P HB2  4  
ATOM 3715  H HB3  . PHE A 1 10 ? -3.320  5.543   6.884   1.00 0.00 ? 8  PHE P HB3  4  
ATOM 3716  H HD1  . PHE A 1 10 ? -3.013  3.214   6.057   1.00 0.00 ? 8  PHE P HD1  4  
ATOM 3717  H HD2  . PHE A 1 10 ? -5.789  4.165   9.215   1.00 0.00 ? 8  PHE P HD2  4  
ATOM 3718  H HE1  . PHE A 1 10 ? -4.101  0.991   5.778   1.00 0.00 ? 8  PHE P HE1  4  
ATOM 3719  H HE2  . PHE A 1 10 ? -6.844  1.927   8.970   1.00 0.00 ? 8  PHE P HE2  4  
ATOM 3720  H HZ   . PHE A 1 10 ? -5.985  0.335   7.279   1.00 0.00 ? 8  PHE P HZ   4  
ATOM 3721  N N    . THR A 1 11 ? -1.200  7.043   7.904   1.00 0.00 ? 9  THR P N    4  
ATOM 3722  C CA   . THR A 1 11 ? -0.765  8.448   7.794   1.00 0.00 ? 9  THR P CA   4  
ATOM 3723  C C    . THR A 1 11 ? -1.680  9.236   6.860   1.00 0.00 ? 9  THR P C    4  
ATOM 3724  O O    . THR A 1 11 ? -2.330  8.668   5.978   1.00 0.00 ? 9  THR P O    4  
ATOM 3725  C CB   . THR A 1 11 ? 0.690   8.595   7.311   1.00 0.00 ? 9  THR P CB   4  
ATOM 3726  O OG1  . THR A 1 11 ? 0.778   8.451   5.908   1.00 0.00 ? 9  THR P OG1  4  
ATOM 3727  C CG2  . THR A 1 11 ? 1.642   7.587   7.947   1.00 0.00 ? 9  THR P CG2  4  
ATOM 3728  H H    . THR A 1 11 ? -1.067  6.451   7.094   1.00 0.00 ? 9  THR P H    4  
ATOM 3729  H HA   . THR A 1 11 ? -0.820  8.915   8.778   1.00 0.00 ? 9  THR P HA   4  
ATOM 3730  H HB   . THR A 1 11 ? 1.032   9.598   7.568   1.00 0.00 ? 9  THR P HB   4  
ATOM 3731  H HG1  . THR A 1 11 ? 1.718   8.548   5.671   1.00 0.00 ? 9  THR P HG1  4  
ATOM 3732  H HG21 . THR A 1 11 ? 2.666   7.816   7.658   1.00 0.00 ? 9  THR P HG21 4  
ATOM 3733  H HG22 . THR A 1 11 ? 1.391   6.582   7.611   1.00 0.00 ? 9  THR P HG22 4  
ATOM 3734  H HG23 . THR A 1 11 ? 1.553   7.635   9.031   1.00 0.00 ? 9  THR P HG23 4  
ATOM 3735  N N    . SER A 1 12 ? -1.663  10.564  6.976   1.00 0.00 ? 10 SER P N    4  
ATOM 3736  C CA   . SER A 1 12 ? -2.410  11.469  6.089   1.00 0.00 ? 10 SER P CA   4  
ATOM 3737  C C    . SER A 1 12 ? -2.005  11.375  4.608   1.00 0.00 ? 10 SER P C    4  
ATOM 3738  O O    . SER A 1 12 ? -2.731  11.896  3.762   1.00 0.00 ? 10 SER P O    4  
ATOM 3739  C CB   . SER A 1 12 ? -2.280  12.919  6.566   1.00 0.00 ? 10 SER P CB   4  
ATOM 3740  O OG   . SER A 1 12 ? -2.530  13.023  7.961   1.00 0.00 ? 10 SER P OG   4  
ATOM 3741  H H    . SER A 1 12 ? -1.152  10.987  7.739   1.00 0.00 ? 10 SER P H    4  
ATOM 3742  H HA   . SER A 1 12 ? -3.463  11.209  6.144   1.00 0.00 ? 10 SER P HA   4  
ATOM 3743  H HB2  . SER A 1 12 ? -1.276  13.282  6.347   1.00 0.00 ? 10 SER P HB2  4  
ATOM 3744  H HB3  . SER A 1 12 ? -3.009  13.522  6.021   1.00 0.00 ? 10 SER P HB3  4  
ATOM 3745  H HG   . SER A 1 12 ? -2.465  13.966  8.215   1.00 0.00 ? 10 SER P HG   4  
ATOM 3746  N N    . GLN A 1 13 ? -0.893  10.700  4.277   1.00 0.00 ? 11 GLN P N    4  
ATOM 3747  C CA   . GLN A 1 13 ? -0.459  10.402  2.905   1.00 0.00 ? 11 GLN P CA   4  
ATOM 3748  C C    . GLN A 1 13 ? -0.906  9.003   2.436   1.00 0.00 ? 11 GLN P C    4  
ATOM 3749  O O    . GLN A 1 13 ? -1.382  8.864   1.310   1.00 0.00 ? 11 GLN P O    4  
ATOM 3750  C CB   . GLN A 1 13 ? 1.066   10.582  2.824   1.00 0.00 ? 11 GLN P CB   4  
ATOM 3751  C CG   . GLN A 1 13 ? 1.587   10.515  1.376   1.00 0.00 ? 11 GLN P CG   4  
ATOM 3752  C CD   . GLN A 1 13 ? 3.092   10.763  1.248   1.00 0.00 ? 11 GLN P CD   4  
ATOM 3753  O OE1  . GLN A 1 13 ? 3.824   10.976  2.209   1.00 0.00 ? 11 GLN P OE1  4  
ATOM 3754  N NE2  . GLN A 1 13 ? 3.623   10.745  0.043   1.00 0.00 ? 11 GLN P NE2  4  
ATOM 3755  H H    . GLN A 1 13 ? -0.348  10.297  5.029   1.00 0.00 ? 11 GLN P H    4  
ATOM 3756  H HA   . GLN A 1 13 ? -0.910  11.130  2.229   1.00 0.00 ? 11 GLN P HA   4  
ATOM 3757  H HB2  . GLN A 1 13 ? 1.324   11.559  3.238   1.00 0.00 ? 11 GLN P HB2  4  
ATOM 3758  H HB3  . GLN A 1 13 ? 1.556   9.812   3.421   1.00 0.00 ? 11 GLN P HB3  4  
ATOM 3759  H HG2  . GLN A 1 13 ? 1.368   9.534   0.956   1.00 0.00 ? 11 GLN P HG2  4  
ATOM 3760  H HG3  . GLN A 1 13 ? 1.064   11.264  0.779   1.00 0.00 ? 11 GLN P HG3  4  
ATOM 3761  H HE21 . GLN A 1 13 ? 3.045   10.572  -0.766  1.00 0.00 ? 11 GLN P HE21 4  
ATOM 3762  H HE22 . GLN A 1 13 ? 4.615   10.907  -0.048  1.00 0.00 ? 11 GLN P HE22 4  
ATOM 3763  N N    . GLN A 1 14 ? -0.823  7.972   3.289   1.00 0.00 ? 12 GLN P N    4  
ATOM 3764  C CA   . GLN A 1 14 ? -1.237  6.596   2.948   1.00 0.00 ? 12 GLN P CA   4  
ATOM 3765  C C    . GLN A 1 14 ? -2.726  6.527   2.588   1.00 0.00 ? 12 GLN P C    4  
ATOM 3766  O O    . GLN A 1 14 ? -3.115  5.889   1.608   1.00 0.00 ? 12 GLN P O    4  
ATOM 3767  C CB   . GLN A 1 14 ? -0.978  5.667   4.141   1.00 0.00 ? 12 GLN P CB   4  
ATOM 3768  C CG   . GLN A 1 14 ? 0.514   5.427   4.375   1.00 0.00 ? 12 GLN P CG   4  
ATOM 3769  C CD   . GLN A 1 14 ? 0.775   4.610   5.635   1.00 0.00 ? 12 GLN P CD   4  
ATOM 3770  O OE1  . GLN A 1 14 ? 0.043   4.656   6.612   1.00 0.00 ? 12 GLN P OE1  4  
ATOM 3771  N NE2  . GLN A 1 14 ? 1.829   3.834   5.661   1.00 0.00 ? 12 GLN P NE2  4  
ATOM 3772  H H    . GLN A 1 14 ? -0.474  8.147   4.224   1.00 0.00 ? 12 GLN P H    4  
ATOM 3773  H HA   . GLN A 1 14 ? -0.662  6.238   2.092   1.00 0.00 ? 12 GLN P HA   4  
ATOM 3774  H HB2  . GLN A 1 14 ? -1.435  6.096   5.034   1.00 0.00 ? 12 GLN P HB2  4  
ATOM 3775  H HB3  . GLN A 1 14 ? -1.433  4.695   3.947   1.00 0.00 ? 12 GLN P HB3  4  
ATOM 3776  H HG2  . GLN A 1 14 ? 0.914   4.901   3.509   1.00 0.00 ? 12 GLN P HG2  4  
ATOM 3777  H HG3  . GLN A 1 14 ? 1.036   6.376   4.467   1.00 0.00 ? 12 GLN P HG3  4  
ATOM 3778  H HE21 . GLN A 1 14 ? 2.343   3.697   4.796   1.00 0.00 ? 12 GLN P HE21 4  
ATOM 3779  H HE22 . GLN A 1 14 ? 1.985   3.239   6.455   1.00 0.00 ? 12 GLN P HE22 4  
ATOM 3780  N N    . LEU A 1 15 ? -3.548  7.250   3.353   1.00 0.00 ? 13 LEU P N    4  
ATOM 3781  C CA   . LEU A 1 15 ? -4.996  7.374   3.149   1.00 0.00 ? 13 LEU P CA   4  
ATOM 3782  C C    . LEU A 1 15 ? -5.368  7.903   1.753   1.00 0.00 ? 13 LEU P C    4  
ATOM 3783  O O    . LEU A 1 15 ? -6.404  7.520   1.208   1.00 0.00 ? 13 LEU P O    4  
ATOM 3784  C CB   . LEU A 1 15 ? -5.542  8.315   4.234   1.00 0.00 ? 13 LEU P CB   4  
ATOM 3785  C CG   . LEU A 1 15 ? -5.408  7.764   5.670   1.00 0.00 ? 13 LEU P CG   4  
ATOM 3786  C CD1  . LEU A 1 15 ? -5.636  8.885   6.679   1.00 0.00 ? 13 LEU P CD1  4  
ATOM 3787  C CD2  . LEU A 1 15 ? -6.385  6.626   5.935   1.00 0.00 ? 13 LEU P CD2  4  
ATOM 3788  H H    . LEU A 1 15 ? -3.136  7.717   4.157   1.00 0.00 ? 13 LEU P H    4  
ATOM 3789  H HA   . LEU A 1 15 ? -5.464  6.397   3.255   1.00 0.00 ? 13 LEU P HA   4  
ATOM 3790  H HB2  . LEU A 1 15 ? -5.007  9.265   4.164   1.00 0.00 ? 13 LEU P HB2  4  
ATOM 3791  H HB3  . LEU A 1 15 ? -6.594  8.511   4.016   1.00 0.00 ? 13 LEU P HB3  4  
ATOM 3792  H HG   . LEU A 1 15 ? -4.410  7.368   5.836   1.00 0.00 ? 13 LEU P HG   4  
ATOM 3793  H HD11 . LEU A 1 15 ? -4.909  9.677   6.499   1.00 0.00 ? 13 LEU P HD11 4  
ATOM 3794  H HD12 . LEU A 1 15 ? -6.643  9.287   6.579   1.00 0.00 ? 13 LEU P HD12 4  
ATOM 3795  H HD13 . LEU A 1 15 ? -5.481  8.502   7.688   1.00 0.00 ? 13 LEU P HD13 4  
ATOM 3796  H HD21 . LEU A 1 15 ? -6.104  5.772   5.319   1.00 0.00 ? 13 LEU P HD21 4  
ATOM 3797  H HD22 . LEU A 1 15 ? -6.320  6.325   6.980   1.00 0.00 ? 13 LEU P HD22 4  
ATOM 3798  H HD23 . LEU A 1 15 ? -7.401  6.950   5.714   1.00 0.00 ? 13 LEU P HD23 4  
ATOM 3799  N N    . GLN A 1 16 ? -4.513  8.739   1.154   1.00 0.00 ? 14 GLN P N    4  
ATOM 3800  C CA   . GLN A 1 16 ? -4.725  9.286   -0.192  1.00 0.00 ? 14 GLN P CA   4  
ATOM 3801  C C    . GLN A 1 16 ? -4.555  8.207   -1.267  1.00 0.00 ? 14 GLN P C    4  
ATOM 3802  O O    . GLN A 1 16 ? -5.352  8.129   -2.198  1.00 0.00 ? 14 GLN P O    4  
ATOM 3803  C CB   . GLN A 1 16 ? -3.769  10.457  -0.483  1.00 0.00 ? 14 GLN P CB   4  
ATOM 3804  C CG   . GLN A 1 16 ? -3.671  11.509  0.628   1.00 0.00 ? 14 GLN P CG   4  
ATOM 3805  C CD   . GLN A 1 16 ? -5.007  12.127  1.041   1.00 0.00 ? 14 GLN P CD   4  
ATOM 3806  O OE1  . GLN A 1 16 ? -5.915  12.343  0.250   1.00 0.00 ? 14 GLN P OE1  4  
ATOM 3807  N NE2  . GLN A 1 16 ? -5.162  12.446  2.307   1.00 0.00 ? 14 GLN P NE2  4  
ATOM 3808  H H    . GLN A 1 16 ? -3.651  8.955   1.636   1.00 0.00 ? 14 GLN P H    4  
ATOM 3809  H HA   . GLN A 1 16 ? -5.748  9.659   -0.258  1.00 0.00 ? 14 GLN P HA   4  
ATOM 3810  H HB2  . GLN A 1 16 ? -2.765  10.065  -0.649  1.00 0.00 ? 14 GLN P HB2  4  
ATOM 3811  H HB3  . GLN A 1 16 ? -4.088  10.943  -1.404  1.00 0.00 ? 14 GLN P HB3  4  
ATOM 3812  H HG2  . GLN A 1 16 ? -3.214  11.038  1.494   1.00 0.00 ? 14 GLN P HG2  4  
ATOM 3813  H HG3  . GLN A 1 16 ? -3.006  12.310  0.304   1.00 0.00 ? 14 GLN P HG3  4  
ATOM 3814  H HE21 . GLN A 1 16 ? -4.390  12.284  2.949   1.00 0.00 ? 14 GLN P HE21 4  
ATOM 3815  H HE22 . GLN A 1 16 ? -6.027  12.870  2.603   1.00 0.00 ? 14 GLN P HE22 4  
ATOM 3816  N N    . GLU A 1 17 ? -3.548  7.337   -1.124  1.00 0.00 ? 15 GLU P N    4  
ATOM 3817  C CA   . GLU A 1 17 ? -3.297  6.235   -2.064  1.00 0.00 ? 15 GLU P CA   4  
ATOM 3818  C C    . GLU A 1 17 ? -4.350  5.125   -1.940  1.00 0.00 ? 15 GLU P C    4  
ATOM 3819  O O    . GLU A 1 17 ? -4.739  4.521   -2.942  1.00 0.00 ? 15 GLU P O    4  
ATOM 3820  C CB   . GLU A 1 17 ? -1.882  5.667   -1.865  1.00 0.00 ? 15 GLU P CB   4  
ATOM 3821  C CG   . GLU A 1 17 ? -0.760  6.720   -1.910  1.00 0.00 ? 15 GLU P CG   4  
ATOM 3822  C CD   . GLU A 1 17 ? -0.806  7.645   -3.147  1.00 0.00 ? 15 GLU P CD   4  
ATOM 3823  O OE1  . GLU A 1 17 ? -1.112  7.176   -4.269  1.00 0.00 ? 15 GLU P OE1  4  
ATOM 3824  O OE2  . GLU A 1 17 ? -0.507  8.856   -3.008  1.00 0.00 ? 15 GLU P OE2  4  
ATOM 3825  H H    . GLU A 1 17 ? -2.944  7.430   -0.318  1.00 0.00 ? 15 GLU P H    4  
ATOM 3826  H HA   . GLU A 1 17 ? -3.369  6.613   -3.082  1.00 0.00 ? 15 GLU P HA   4  
ATOM 3827  H HB2  . GLU A 1 17 ? -1.835  5.160   -0.901  1.00 0.00 ? 15 GLU P HB2  4  
ATOM 3828  H HB3  . GLU A 1 17 ? -1.697  4.922   -2.638  1.00 0.00 ? 15 GLU P HB3  4  
ATOM 3829  H HG2  . GLU A 1 17 ? -0.818  7.319   -1.000  1.00 0.00 ? 15 GLU P HG2  4  
ATOM 3830  H HG3  . GLU A 1 17 ? 0.198   6.199   -1.884  1.00 0.00 ? 15 GLU P HG3  4  
ATOM 3831  N N    . LEU A 1 18 ? -4.870  4.909   -0.728  1.00 0.00 ? 16 LEU P N    4  
ATOM 3832  C CA   . LEU A 1 18 ? -5.982  4.000   -0.454  1.00 0.00 ? 16 LEU P CA   4  
ATOM 3833  C C    . LEU A 1 18 ? -7.280  4.493   -1.110  1.00 0.00 ? 16 LEU P C    4  
ATOM 3834  O O    . LEU A 1 18 ? -7.901  3.743   -1.862  1.00 0.00 ? 16 LEU P O    4  
ATOM 3835  C CB   . LEU A 1 18 ? -6.116  3.845   1.068   1.00 0.00 ? 16 LEU P CB   4  
ATOM 3836  C CG   . LEU A 1 18 ? -4.979  3.002   1.678   1.00 0.00 ? 16 LEU P CG   4  
ATOM 3837  C CD1  . LEU A 1 18 ? -4.812  3.303   3.163   1.00 0.00 ? 16 LEU P CD1  4  
ATOM 3838  C CD2  . LEU A 1 18 ? -5.268  1.511   1.517   1.00 0.00 ? 16 LEU P CD2  4  
ATOM 3839  H H    . LEU A 1 18 ? -4.485  5.433   0.050   1.00 0.00 ? 16 LEU P H    4  
ATOM 3840  H HA   . LEU A 1 18 ? -5.763  3.021   -0.884  1.00 0.00 ? 16 LEU P HA   4  
ATOM 3841  H HB2  . LEU A 1 18 ? -6.130  4.833   1.524   1.00 0.00 ? 16 LEU P HB2  4  
ATOM 3842  H HB3  . LEU A 1 18 ? -7.067  3.365   1.287   1.00 0.00 ? 16 LEU P HB3  4  
ATOM 3843  H HG   . LEU A 1 18 ? -4.034  3.231   1.185   1.00 0.00 ? 16 LEU P HG   4  
ATOM 3844  H HD11 . LEU A 1 18 ? -3.994  2.711   3.567   1.00 0.00 ? 16 LEU P HD11 4  
ATOM 3845  H HD12 . LEU A 1 18 ? -4.582  4.357   3.293   1.00 0.00 ? 16 LEU P HD12 4  
ATOM 3846  H HD13 . LEU A 1 18 ? -5.727  3.062   3.693   1.00 0.00 ? 16 LEU P HD13 4  
ATOM 3847  H HD21 . LEU A 1 18 ? -6.216  1.259   1.995   1.00 0.00 ? 16 LEU P HD21 4  
ATOM 3848  H HD22 . LEU A 1 18 ? -5.321  1.262   0.458   1.00 0.00 ? 16 LEU P HD22 4  
ATOM 3849  H HD23 . LEU A 1 18 ? -4.469  0.933   1.978   1.00 0.00 ? 16 LEU P HD23 4  
ATOM 3850  N N    . GLU A 1 19 ? -7.662  5.763   -0.929  1.00 0.00 ? 17 GLU P N    4  
ATOM 3851  C CA   . GLU A 1 19 ? -8.866  6.285   -1.604  1.00 0.00 ? 17 GLU P CA   4  
ATOM 3852  C C    . GLU A 1 19 ? -8.706  6.558   -3.109  1.00 0.00 ? 17 GLU P C    4  
ATOM 3853  O O    . GLU A 1 19 ? -9.708  6.625   -3.824  1.00 0.00 ? 17 GLU P O    4  
ATOM 3854  C CB   . GLU A 1 19 ? -9.520  7.440   -0.841  1.00 0.00 ? 17 GLU P CB   4  
ATOM 3855  C CG   . GLU A 1 19 ? -8.928  8.844   -1.012  1.00 0.00 ? 17 GLU P CG   4  
ATOM 3856  C CD   . GLU A 1 19 ? -9.813  9.917   -0.332  1.00 0.00 ? 17 GLU P CD   4  
ATOM 3857  O OE1  . GLU A 1 19 ? -10.733 9.572   0.456   1.00 0.00 ? 17 GLU P OE1  4  
ATOM 3858  O OE2  . GLU A 1 19 ? -9.613  11.124  -0.609  1.00 0.00 ? 17 GLU P OE2  4  
ATOM 3859  H H    . GLU A 1 19 ? -7.171  6.335   -0.247  1.00 0.00 ? 17 GLU P H    4  
ATOM 3860  H HA   . GLU A 1 19 ? -9.602  5.485   -1.558  1.00 0.00 ? 17 GLU P HA   4  
ATOM 3861  H HB2  . GLU A 1 19 ? -10.556 7.477   -1.173  1.00 0.00 ? 17 GLU P HB2  4  
ATOM 3862  H HB3  . GLU A 1 19 ? -9.508  7.191   0.217   1.00 0.00 ? 17 GLU P HB3  4  
ATOM 3863  H HG2  . GLU A 1 19 ? -7.925  8.865   -0.585  1.00 0.00 ? 17 GLU P HG2  4  
ATOM 3864  H HG3  . GLU A 1 19 ? -8.851  9.068   -2.078  1.00 0.00 ? 17 GLU P HG3  4  
ATOM 3865  N N    . ALA A 1 20 ? -7.472  6.643   -3.612  1.00 0.00 ? 18 ALA P N    4  
ATOM 3866  C CA   . ALA A 1 20 ? -7.177  6.676   -5.047  1.00 0.00 ? 18 ALA P CA   4  
ATOM 3867  C C    . ALA A 1 20 ? -7.284  5.282   -5.695  1.00 0.00 ? 18 ALA P C    4  
ATOM 3868  O O    . ALA A 1 20 ? -7.960  5.134   -6.713  1.00 0.00 ? 18 ALA P O    4  
ATOM 3869  C CB   . ALA A 1 20 ? -5.797  7.304   -5.270  1.00 0.00 ? 18 ALA P CB   4  
ATOM 3870  H H    . ALA A 1 20 ? -6.705  6.697   -2.955  1.00 0.00 ? 18 ALA P H    4  
ATOM 3871  H HA   . ALA A 1 20 ? -7.913  7.314   -5.543  1.00 0.00 ? 18 ALA P HA   4  
ATOM 3872  H HB1  . ALA A 1 20 ? -5.585  7.351   -6.339  1.00 0.00 ? 18 ALA P HB1  4  
ATOM 3873  H HB2  . ALA A 1 20 ? -5.782  8.317   -4.867  1.00 0.00 ? 18 ALA P HB2  4  
ATOM 3874  H HB3  . ALA A 1 20 ? -5.027  6.708   -4.782  1.00 0.00 ? 18 ALA P HB3  4  
ATOM 3875  N N    . THR A 1 21 ? -6.694  4.236   -5.101  1.00 0.00 ? 19 THR P N    4  
ATOM 3876  C CA   . THR A 1 21 ? -6.798  2.867   -5.650  1.00 0.00 ? 19 THR P CA   4  
ATOM 3877  C C    . THR A 1 21 ? -8.212  2.284   -5.503  1.00 0.00 ? 19 THR P C    4  
ATOM 3878  O O    . THR A 1 21 ? -8.642  1.488   -6.338  1.00 0.00 ? 19 THR P O    4  
ATOM 3879  C CB   . THR A 1 21 ? -5.712  1.941   -5.084  1.00 0.00 ? 19 THR P CB   4  
ATOM 3880  O OG1  . THR A 1 21 ? -5.534  0.854   -5.971  1.00 0.00 ? 19 THR P OG1  4  
ATOM 3881  C CG2  . THR A 1 21 ? -6.023  1.369   -3.703  1.00 0.00 ? 19 THR P CG2  4  
ATOM 3882  H H    . THR A 1 21 ? -6.129  4.393   -4.270  1.00 0.00 ? 19 THR P H    4  
ATOM 3883  H HA   . THR A 1 21 ? -6.601  2.941   -6.718  1.00 0.00 ? 19 THR P HA   4  
ATOM 3884  H HB   . THR A 1 21 ? -4.775  2.498   -5.036  1.00 0.00 ? 19 THR P HB   4  
ATOM 3885  H HG1  . THR A 1 21 ? -6.320  0.283   -5.891  1.00 0.00 ? 19 THR P HG1  4  
ATOM 3886  H HG21 . THR A 1 21 ? -5.100  1.078   -3.210  1.00 0.00 ? 19 THR P HG21 4  
ATOM 3887  H HG22 . THR A 1 21 ? -6.680  0.502   -3.793  1.00 0.00 ? 19 THR P HG22 4  
ATOM 3888  H HG23 . THR A 1 21 ? -6.493  2.126   -3.086  1.00 0.00 ? 19 THR P HG23 4  
ATOM 3889  N N    . PHE A 1 22 ? -8.982  2.764   -4.522  1.00 0.00 ? 20 PHE P N    4  
ATOM 3890  C CA   . PHE A 1 22 ? -10.417 2.501   -4.351  1.00 0.00 ? 20 PHE P CA   4  
ATOM 3891  C C    . PHE A 1 22 ? -11.235 2.884   -5.597  1.00 0.00 ? 20 PHE P C    4  
ATOM 3892  O O    . PHE A 1 22 ? -12.248 2.248   -5.879  1.00 0.00 ? 20 PHE P O    4  
ATOM 3893  C CB   . PHE A 1 22 ? -10.894 3.267   -3.103  1.00 0.00 ? 20 PHE P CB   4  
ATOM 3894  C CG   . PHE A 1 22 ? -12.388 3.299   -2.812  1.00 0.00 ? 20 PHE P CG   4  
ATOM 3895  C CD1  . PHE A 1 22 ? -13.141 2.110   -2.745  1.00 0.00 ? 20 PHE P CD1  4  
ATOM 3896  C CD2  . PHE A 1 22 ? -13.026 4.532   -2.569  1.00 0.00 ? 20 PHE P CD2  4  
ATOM 3897  C CE1  . PHE A 1 22 ? -14.516 2.153   -2.459  1.00 0.00 ? 20 PHE P CE1  4  
ATOM 3898  C CE2  . PHE A 1 22 ? -14.404 4.578   -2.290  1.00 0.00 ? 20 PHE P CE2  4  
ATOM 3899  C CZ   . PHE A 1 22 ? -15.150 3.387   -2.236  1.00 0.00 ? 20 PHE P CZ   4  
ATOM 3900  H H    . PHE A 1 22 ? -8.540  3.376   -3.849  1.00 0.00 ? 20 PHE P H    4  
ATOM 3901  H HA   . PHE A 1 22 ? -10.563 1.438   -4.176  1.00 0.00 ? 20 PHE P HA   4  
ATOM 3902  H HB2  . PHE A 1 22 ? -10.396 2.845   -2.231  1.00 0.00 ? 20 PHE P HB2  4  
ATOM 3903  H HB3  . PHE A 1 22 ? -10.556 4.293   -3.204  1.00 0.00 ? 20 PHE P HB3  4  
ATOM 3904  H HD1  . PHE A 1 22 ? -12.668 1.159   -2.918  1.00 0.00 ? 20 PHE P HD1  4  
ATOM 3905  H HD2  . PHE A 1 22 ? -12.456 5.450   -2.596  1.00 0.00 ? 20 PHE P HD2  4  
ATOM 3906  H HE1  . PHE A 1 22 ? -15.090 1.236   -2.422  1.00 0.00 ? 20 PHE P HE1  4  
ATOM 3907  H HE2  . PHE A 1 22 ? -14.895 5.528   -2.127  1.00 0.00 ? 20 PHE P HE2  4  
ATOM 3908  H HZ   . PHE A 1 22 ? -16.211 3.421   -2.025  1.00 0.00 ? 20 PHE P HZ   4  
ATOM 3909  N N    . GLN A 1 23 ? -10.780 3.864   -6.392  1.00 0.00 ? 21 GLN P N    4  
ATOM 3910  C CA   . GLN A 1 23 ? -11.471 4.278   -7.617  1.00 0.00 ? 21 GLN P CA   4  
ATOM 3911  C C    . GLN A 1 23 ? -11.354 3.248   -8.755  1.00 0.00 ? 21 GLN P C    4  
ATOM 3912  O O    . GLN A 1 23 ? -12.324 3.033   -9.485  1.00 0.00 ? 21 GLN P O    4  
ATOM 3913  C CB   . GLN A 1 23 ? -10.950 5.643   -8.103  1.00 0.00 ? 21 GLN P CB   4  
ATOM 3914  C CG   . GLN A 1 23 ? -10.983 6.778   -7.069  1.00 0.00 ? 21 GLN P CG   4  
ATOM 3915  C CD   . GLN A 1 23 ? -12.316 6.903   -6.339  1.00 0.00 ? 21 GLN P CD   4  
ATOM 3916  O OE1  . GLN A 1 23 ? -13.387 6.979   -6.929  1.00 0.00 ? 21 GLN P OE1  4  
ATOM 3917  N NE2  . GLN A 1 23 ? -12.299 6.914   -5.027  1.00 0.00 ? 21 GLN P NE2  4  
ATOM 3918  H H    . GLN A 1 23 ? -9.923  4.341   -6.140  1.00 0.00 ? 21 GLN P H    4  
ATOM 3919  H HA   . GLN A 1 23 ? -12.531 4.369   -7.381  1.00 0.00 ? 21 GLN P HA   4  
ATOM 3920  H HB2  . GLN A 1 23 ? -9.915  5.522   -8.419  1.00 0.00 ? 21 GLN P HB2  4  
ATOM 3921  H HB3  . GLN A 1 23 ? -11.537 5.948   -8.970  1.00 0.00 ? 21 GLN P HB3  4  
ATOM 3922  H HG2  . GLN A 1 23 ? -10.189 6.610   -6.346  1.00 0.00 ? 21 GLN P HG2  4  
ATOM 3923  H HG3  . GLN A 1 23 ? -10.768 7.723   -7.569  1.00 0.00 ? 21 GLN P HG3  4  
ATOM 3924  H HE21 . GLN A 1 23 ? -11.408 6.852   -4.537  1.00 0.00 ? 21 GLN P HE21 4  
ATOM 3925  H HE22 . GLN A 1 23 ? -13.176 6.957   -4.538  1.00 0.00 ? 21 GLN P HE22 4  
ATOM 3926  N N    . ARG A 1 24 ? -10.188 2.592   -8.900  1.00 0.00 ? 22 ARG P N    4  
ATOM 3927  C CA   . ARG A 1 24 ? -9.959  1.530   -9.904  1.00 0.00 ? 22 ARG P CA   4  
ATOM 3928  C C    . ARG A 1 24 ? -10.380 0.139   -9.416  1.00 0.00 ? 22 ARG P C    4  
ATOM 3929  O O    . ARG A 1 24 ? -10.712 -0.721  -10.233 1.00 0.00 ? 22 ARG P O    4  
ATOM 3930  C CB   . ARG A 1 24 ? -8.499  1.533   -10.408 1.00 0.00 ? 22 ARG P CB   4  
ATOM 3931  C CG   . ARG A 1 24 ? -7.454  1.200   -9.330  1.00 0.00 ? 22 ARG P CG   4  
ATOM 3932  C CD   . ARG A 1 24 ? -6.064  0.907   -9.904  1.00 0.00 ? 22 ARG P CD   4  
ATOM 3933  N NE   . ARG A 1 24 ? -5.167  0.469   -8.818  1.00 0.00 ? 22 ARG P NE   4  
ATOM 3934  C CZ   . ARG A 1 24 ? -4.305  -0.530  -8.809  1.00 0.00 ? 22 ARG P CZ   4  
ATOM 3935  N NH1  . ARG A 1 24 ? -3.976  -1.231  -9.852  1.00 0.00 ? 22 ARG P NH1  4  
ATOM 3936  N NH2  . ARG A 1 24 ? -3.736  -0.878  -7.701  1.00 0.00 ? 22 ARG P NH2  4  
ATOM 3937  H H    . ARG A 1 24 ? -9.448  2.812   -8.245  1.00 0.00 ? 22 ARG P H    4  
ATOM 3938  H HA   . ARG A 1 24 ? -10.590 1.734   -10.772 1.00 0.00 ? 22 ARG P HA   4  
ATOM 3939  H HB2  . ARG A 1 24 ? -8.422  0.791   -11.206 1.00 0.00 ? 22 ARG P HB2  4  
ATOM 3940  H HB3  . ARG A 1 24 ? -8.269  2.510   -10.837 1.00 0.00 ? 22 ARG P HB3  4  
ATOM 3941  H HG2  . ARG A 1 24 ? -7.382  2.041   -8.641  1.00 0.00 ? 22 ARG P HG2  4  
ATOM 3942  H HG3  . ARG A 1 24 ? -7.770  0.318   -8.775  1.00 0.00 ? 22 ARG P HG3  4  
ATOM 3943  H HD2  . ARG A 1 24 ? -6.155  0.126   -10.660 1.00 0.00 ? 22 ARG P HD2  4  
ATOM 3944  H HD3  . ARG A 1 24 ? -5.666  1.809   -10.373 1.00 0.00 ? 22 ARG P HD3  4  
ATOM 3945  H HE   . ARG A 1 24 ? -5.293  0.914   -7.917  1.00 0.00 ? 22 ARG P HE   4  
ATOM 3946  H HH11 . ARG A 1 24 ? -4.353  -1.016  -10.757 1.00 0.00 ? 22 ARG P HH11 4  
ATOM 3947  H HH12 . ARG A 1 24 ? -3.309  -1.989  -9.708  1.00 0.00 ? 22 ARG P HH12 4  
ATOM 3948  H HH21 . ARG A 1 24 ? -3.996  -0.416  -6.841  1.00 0.00 ? 22 ARG P HH21 4  
ATOM 3949  H HH22 . ARG A 1 24 ? -3.097  -1.670  -7.733  1.00 0.00 ? 22 ARG P HH22 4  
ATOM 3950  N N    . ASN A 1 25 ? -10.361 -0.082  -8.101  1.00 0.00 ? 23 ASN P N    4  
ATOM 3951  C CA   . ASN A 1 25 ? -10.609 -1.372  -7.465  1.00 0.00 ? 23 ASN P CA   4  
ATOM 3952  C C    . ASN A 1 25 ? -11.403 -1.179  -6.165  1.00 0.00 ? 23 ASN P C    4  
ATOM 3953  O O    . ASN A 1 25 ? -10.847 -0.775  -5.146  1.00 0.00 ? 23 ASN P O    4  
ATOM 3954  C CB   . ASN A 1 25 ? -9.250  -2.053  -7.211  1.00 0.00 ? 23 ASN P CB   4  
ATOM 3955  C CG   . ASN A 1 25 ? -9.396  -3.508  -6.796  1.00 0.00 ? 23 ASN P CG   4  
ATOM 3956  O OD1  . ASN A 1 25 ? -10.464 -3.991  -6.444  1.00 0.00 ? 23 ASN P OD1  4  
ATOM 3957  N ND2  . ASN A 1 25 ? -8.320  -4.259  -6.848  1.00 0.00 ? 23 ASN P ND2  4  
ATOM 3958  H H    . ASN A 1 25 ? -10.041 0.673   -7.505  1.00 0.00 ? 23 ASN P H    4  
ATOM 3959  H HA   . ASN A 1 25 ? -11.197 -2.008  -8.131  1.00 0.00 ? 23 ASN P HA   4  
ATOM 3960  H HB2  . ASN A 1 25 ? -8.647  -2.015  -8.118  1.00 0.00 ? 23 ASN P HB2  4  
ATOM 3961  H HB3  . ASN A 1 25 ? -8.704  -1.516  -6.433  1.00 0.00 ? 23 ASN P HB3  4  
ATOM 3962  H HD21 . ASN A 1 25 ? -7.447  -3.865  -7.158  1.00 0.00 ? 23 ASN P HD21 4  
ATOM 3963  H HD22 . ASN A 1 25 ? -8.400  -5.233  -6.604  1.00 0.00 ? 23 ASN P HD22 4  
ATOM 3964  N N    . HIS A 1 26 ? -12.702 -1.484  -6.187  1.00 0.00 ? 24 HIS P N    4  
ATOM 3965  C CA   . HIS A 1 26 ? -13.593 -1.309  -5.028  1.00 0.00 ? 24 HIS P CA   4  
ATOM 3966  C C    . HIS A 1 26 ? -13.491 -2.462  -4.009  1.00 0.00 ? 24 HIS P C    4  
ATOM 3967  O O    . HIS A 1 26 ? -14.023 -2.350  -2.903  1.00 0.00 ? 24 HIS P O    4  
ATOM 3968  C CB   . HIS A 1 26 ? -15.037 -1.110  -5.527  1.00 0.00 ? 24 HIS P CB   4  
ATOM 3969  C CG   . HIS A 1 26 ? -15.333 0.253   -6.118  1.00 0.00 ? 24 HIS P CG   4  
ATOM 3970  N ND1  . HIS A 1 26 ? -16.355 1.105   -5.685  1.00 0.00 ? 24 HIS P ND1  4  
ATOM 3971  C CD2  . HIS A 1 26 ? -14.681 0.854   -7.160  1.00 0.00 ? 24 HIS P CD2  4  
ATOM 3972  C CE1  . HIS A 1 26 ? -16.281 2.202   -6.459  1.00 0.00 ? 24 HIS P CE1  4  
ATOM 3973  N NE2  . HIS A 1 26 ? -15.288 2.075   -7.356  1.00 0.00 ? 24 HIS P NE2  4  
ATOM 3974  H H    . HIS A 1 26 ? -13.099 -1.847  -7.041  1.00 0.00 ? 24 HIS P H    4  
ATOM 3975  H HA   . HIS A 1 26 ? -13.306 -0.403  -4.493  1.00 0.00 ? 24 HIS P HA   4  
ATOM 3976  H HB2  . HIS A 1 26 ? -15.275 -1.873  -6.269  1.00 0.00 ? 24 HIS P HB2  4  
ATOM 3977  H HB3  . HIS A 1 26 ? -15.715 -1.253  -4.685  1.00 0.00 ? 24 HIS P HB3  4  
ATOM 3978  H HD2  . HIS A 1 26 ? -13.828 0.471   -7.702  1.00 0.00 ? 24 HIS P HD2  4  
ATOM 3979  H HE1  . HIS A 1 26 ? -16.928 3.069   -6.375  1.00 0.00 ? 24 HIS P HE1  4  
ATOM 3980  H HE2  . HIS A 1 26 ? -15.025 2.773   -8.043  1.00 0.00 ? 24 HIS P HE2  4  
ATOM 3981  N N    . TYR A 1 27 ? -12.827 -3.568  -4.366  1.00 0.00 ? 25 TYR P N    4  
ATOM 3982  C CA   . TYR A 1 27 ? -12.762 -4.807  -3.578  1.00 0.00 ? 25 TYR P CA   4  
ATOM 3983  C C    . TYR A 1 27 ? -11.444 -5.585  -3.827  1.00 0.00 ? 25 TYR P C    4  
ATOM 3984  O O    . TYR A 1 27 ? -11.460 -6.684  -4.395  1.00 0.00 ? 25 TYR P O    4  
ATOM 3985  C CB   . TYR A 1 27 ? -14.042 -5.645  -3.822  1.00 0.00 ? 25 TYR P CB   4  
ATOM 3986  C CG   . TYR A 1 27 ? -14.546 -5.725  -5.260  1.00 0.00 ? 25 TYR P CG   4  
ATOM 3987  C CD1  . TYR A 1 27 ? -14.096 -6.739  -6.130  1.00 0.00 ? 25 TYR P CD1  4  
ATOM 3988  C CD2  . TYR A 1 27 ? -15.491 -4.784  -5.720  1.00 0.00 ? 25 TYR P CD2  4  
ATOM 3989  C CE1  . TYR A 1 27 ? -14.561 -6.795  -7.459  1.00 0.00 ? 25 TYR P CE1  4  
ATOM 3990  C CE2  . TYR A 1 27 ? -15.956 -4.834  -7.048  1.00 0.00 ? 25 TYR P CE2  4  
ATOM 3991  C CZ   . TYR A 1 27 ? -15.491 -5.837  -7.924  1.00 0.00 ? 25 TYR P CZ   4  
ATOM 3992  O OH   . TYR A 1 27 ? -15.946 -5.880  -9.206  1.00 0.00 ? 25 TYR P OH   4  
ATOM 3993  H H    . TYR A 1 27 ? -12.357 -3.570  -5.263  1.00 0.00 ? 25 TYR P H    4  
ATOM 3994  H HA   . TYR A 1 27 ? -12.758 -4.543  -2.522  1.00 0.00 ? 25 TYR P HA   4  
ATOM 3995  H HB2  . TYR A 1 27 ? -13.896 -6.654  -3.434  1.00 0.00 ? 25 TYR P HB2  4  
ATOM 3996  H HB3  . TYR A 1 27 ? -14.839 -5.205  -3.221  1.00 0.00 ? 25 TYR P HB3  4  
ATOM 3997  H HD1  . TYR A 1 27 ? -13.390 -7.480  -5.782  1.00 0.00 ? 25 TYR P HD1  4  
ATOM 3998  H HD2  . TYR A 1 27 ? -15.859 -4.020  -5.048  1.00 0.00 ? 25 TYR P HD2  4  
ATOM 3999  H HE1  . TYR A 1 27 ? -14.207 -7.569  -8.124  1.00 0.00 ? 25 TYR P HE1  4  
ATOM 4000  H HE2  . TYR A 1 27 ? -16.673 -4.107  -7.403  1.00 0.00 ? 25 TYR P HE2  4  
ATOM 4001  H HH   . TYR A 1 27 ? -15.559 -6.616  -9.711  1.00 0.00 ? 25 TYR P HH   4  
ATOM 4002  N N    . PRO A 1 28 ? -10.280 -5.039  -3.419  1.00 0.00 ? 26 PRO P N    4  
ATOM 4003  C CA   . PRO A 1 28 ? -8.980  -5.677  -3.630  1.00 0.00 ? 26 PRO P CA   4  
ATOM 4004  C C    . PRO A 1 28 ? -8.817  -6.976  -2.822  1.00 0.00 ? 26 PRO P C    4  
ATOM 4005  O O    . PRO A 1 28 ? -9.448  -7.186  -1.780  1.00 0.00 ? 26 PRO P O    4  
ATOM 4006  C CB   . PRO A 1 28 ? -7.939  -4.612  -3.274  1.00 0.00 ? 26 PRO P CB   4  
ATOM 4007  C CG   . PRO A 1 28 ? -8.655  -3.784  -2.213  1.00 0.00 ? 26 PRO P CG   4  
ATOM 4008  C CD   . PRO A 1 28 ? -10.099 -3.776  -2.713  1.00 0.00 ? 26 PRO P CD   4  
ATOM 4009  H HA   . PRO A 1 28 ? -8.872  -5.928  -4.686  1.00 0.00 ? 26 PRO P HA   4  
ATOM 4010  H HB2  . PRO A 1 28 ? -7.007  -5.039  -2.909  1.00 0.00 ? 26 PRO P HB2  4  
ATOM 4011  H HB3  . PRO A 1 28 ? -7.740  -3.989  -4.145  1.00 0.00 ? 26 PRO P HB3  4  
ATOM 4012  H HG2  . PRO A 1 28 ? -8.602  -4.298  -1.253  1.00 0.00 ? 26 PRO P HG2  4  
ATOM 4013  H HG3  . PRO A 1 28 ? -8.244  -2.777  -2.139  1.00 0.00 ? 26 PRO P HG3  4  
ATOM 4014  H HD2  . PRO A 1 28 ? -10.785 -3.687  -1.870  1.00 0.00 ? 26 PRO P HD2  4  
ATOM 4015  H HD3  . PRO A 1 28 ? -10.242 -2.947  -3.408  1.00 0.00 ? 26 PRO P HD3  4  
ATOM 4016  N N    . ASP A 1 29 ? -7.928  -7.840  -3.306  1.00 0.00 ? 27 ASP P N    4  
ATOM 4017  C CA   . ASP A 1 29 ? -7.655  -9.202  -2.820  1.00 0.00 ? 27 ASP P CA   4  
ATOM 4018  C C    . ASP A 1 29 ? -6.211  -9.321  -2.311  1.00 0.00 ? 27 ASP P C    4  
ATOM 4019  O O    . ASP A 1 29 ? -5.443  -8.371  -2.424  1.00 0.00 ? 27 ASP P O    4  
ATOM 4020  C CB   . ASP A 1 29 ? -7.946  -10.194 -3.962  1.00 0.00 ? 27 ASP P CB   4  
ATOM 4021  C CG   . ASP A 1 29 ? -8.018  -11.674 -3.536  1.00 0.00 ? 27 ASP P CG   4  
ATOM 4022  O OD1  . ASP A 1 29 ? -8.140  -11.964 -2.322  1.00 0.00 ? 27 ASP P OD1  4  
ATOM 4023  O OD2  . ASP A 1 29 ? -7.951  -12.555 -4.425  1.00 0.00 ? 27 ASP P OD2  4  
ATOM 4024  H H    . ASP A 1 29 ? -7.355  -7.510  -4.080  1.00 0.00 ? 27 ASP P H    4  
ATOM 4025  H HA   . ASP A 1 29 ? -8.318  -9.427  -1.988  1.00 0.00 ? 27 ASP P HA   4  
ATOM 4026  H HB2  . ASP A 1 29 ? -8.903  -9.934  -4.407  1.00 0.00 ? 27 ASP P HB2  4  
ATOM 4027  H HB3  . ASP A 1 29 ? -7.178  -10.074 -4.729  1.00 0.00 ? 27 ASP P HB3  4  
ATOM 4028  N N    . MET A 1 30 ? -5.795  -10.472 -1.779  1.00 0.00 ? 28 MET P N    4  
ATOM 4029  C CA   . MET A 1 30 ? -4.435  -10.678 -1.248  1.00 0.00 ? 28 MET P CA   4  
ATOM 4030  C C    . MET A 1 30 ? -3.309  -10.247 -2.213  1.00 0.00 ? 28 MET P C    4  
ATOM 4031  O O    . MET A 1 30 ? -2.240  -9.834  -1.766  1.00 0.00 ? 28 MET P O    4  
ATOM 4032  C CB   . MET A 1 30 ? -4.240  -12.149 -0.844  1.00 0.00 ? 28 MET P CB   4  
ATOM 4033  C CG   . MET A 1 30 ? -4.306  -13.129 -2.030  1.00 0.00 ? 28 MET P CG   4  
ATOM 4034  S SD   . MET A 1 30 ? -3.693  -14.797 -1.677  1.00 0.00 ? 28 MET P SD   4  
ATOM 4035  C CE   . MET A 1 30 ? -1.908  -14.456 -1.748  1.00 0.00 ? 28 MET P CE   4  
ATOM 4036  H H    . MET A 1 30 ? -6.472  -11.230 -1.722  1.00 0.00 ? 28 MET P H    4  
ATOM 4037  H HA   . MET A 1 30 ? -4.331  -10.071 -0.347  1.00 0.00 ? 28 MET P HA   4  
ATOM 4038  H HB2  . MET A 1 30 ? -3.265  -12.239 -0.364  1.00 0.00 ? 28 MET P HB2  4  
ATOM 4039  H HB3  . MET A 1 30 ? -4.999  -12.427 -0.112  1.00 0.00 ? 28 MET P HB3  4  
ATOM 4040  H HG2  . MET A 1 30 ? -5.337  -13.189 -2.374  1.00 0.00 ? 28 MET P HG2  4  
ATOM 4041  H HG3  . MET A 1 30 ? -3.713  -12.750 -2.858  1.00 0.00 ? 28 MET P HG3  4  
ATOM 4042  H HE1  . MET A 1 30 ? -1.622  -13.793 -0.931  1.00 0.00 ? 28 MET P HE1  4  
ATOM 4043  H HE2  . MET A 1 30 ? -1.353  -15.390 -1.660  1.00 0.00 ? 28 MET P HE2  4  
ATOM 4044  H HE3  . MET A 1 30 ? -1.660  -13.975 -2.697  1.00 0.00 ? 28 MET P HE3  4  
ATOM 4045  N N    . SER A 1 31 ? -3.545  -10.309 -3.527  1.00 0.00 ? 29 SER P N    4  
ATOM 4046  C CA   . SER A 1 31 ? -2.614  -9.880  -4.570  1.00 0.00 ? 29 SER P CA   4  
ATOM 4047  C C    . SER A 1 31 ? -2.635  -8.361  -4.795  1.00 0.00 ? 29 SER P C    4  
ATOM 4048  O O    . SER A 1 31 ? -1.591  -7.705  -4.770  1.00 0.00 ? 29 SER P O    4  
ATOM 4049  C CB   . SER A 1 31 ? -2.963  -10.621 -5.864  1.00 0.00 ? 29 SER P CB   4  
ATOM 4050  O OG   . SER A 1 31 ? -4.341  -10.472 -6.181  1.00 0.00 ? 29 SER P OG   4  
ATOM 4051  H H    . SER A 1 31 ? -4.446  -10.643 -3.844  1.00 0.00 ? 29 SER P H    4  
ATOM 4052  H HA   . SER A 1 31 ? -1.605  -10.169 -4.273  1.00 0.00 ? 29 SER P HA   4  
ATOM 4053  H HB2  . SER A 1 31 ? -2.349  -10.237 -6.680  1.00 0.00 ? 29 SER P HB2  4  
ATOM 4054  H HB3  . SER A 1 31 ? -2.751  -11.680 -5.720  1.00 0.00 ? 29 SER P HB3  4  
ATOM 4055  H HG   . SER A 1 31 ? -4.524  -10.972 -6.999  1.00 0.00 ? 29 SER P HG   4  
ATOM 4056  N N    . THR A 1 32 ? -3.824  -7.780  -4.975  1.00 0.00 ? 30 THR P N    4  
ATOM 4057  C CA   . THR A 1 32 ? -4.012  -6.344  -5.250  1.00 0.00 ? 30 THR P CA   4  
ATOM 4058  C C    . THR A 1 32 ? -3.820  -5.466  -4.015  1.00 0.00 ? 30 THR P C    4  
ATOM 4059  O O    . THR A 1 32 ? -3.263  -4.379  -4.130  1.00 0.00 ? 30 THR P O    4  
ATOM 4060  C CB   . THR A 1 32 ? -5.361  -6.042  -5.922  1.00 0.00 ? 30 THR P CB   4  
ATOM 4061  O OG1  . THR A 1 32 ? -6.373  -6.952  -5.556  1.00 0.00 ? 30 THR P OG1  4  
ATOM 4062  C CG2  . THR A 1 32 ? -5.241  -6.111  -7.444  1.00 0.00 ? 30 THR P CG2  4  
ATOM 4063  H H    . THR A 1 32 ? -4.639  -8.380  -4.974  1.00 0.00 ? 30 THR P H    4  
ATOM 4064  H HA   . THR A 1 32 ? -3.237  -6.037  -5.948  1.00 0.00 ? 30 THR P HA   4  
ATOM 4065  H HB   . THR A 1 32 ? -5.687  -5.043  -5.637  1.00 0.00 ? 30 THR P HB   4  
ATOM 4066  H HG1  . THR A 1 32 ? -6.382  -7.657  -6.227  1.00 0.00 ? 30 THR P HG1  4  
ATOM 4067  H HG21 . THR A 1 32 ? -4.850  -7.083  -7.746  1.00 0.00 ? 30 THR P HG21 4  
ATOM 4068  H HG22 . THR A 1 32 ? -4.564  -5.331  -7.791  1.00 0.00 ? 30 THR P HG22 4  
ATOM 4069  H HG23 . THR A 1 32 ? -6.218  -5.956  -7.904  1.00 0.00 ? 30 THR P HG23 4  
ATOM 4070  N N    . ARG A 1 33 ? -4.183  -5.933  -2.817  1.00 0.00 ? 31 ARG P N    4  
ATOM 4071  C CA   . ARG A 1 33 ? -3.849  -5.283  -1.538  1.00 0.00 ? 31 ARG P CA   4  
ATOM 4072  C C    . ARG A 1 33 ? -2.339  -5.141  -1.363  1.00 0.00 ? 31 ARG P C    4  
ATOM 4073  O O    . ARG A 1 33 ? -1.860  -4.061  -1.035  1.00 0.00 ? 31 ARG P O    4  
ATOM 4074  C CB   . ARG A 1 33 ? -4.399  -6.107  -0.364  1.00 0.00 ? 31 ARG P CB   4  
ATOM 4075  C CG   . ARG A 1 33 ? -5.929  -6.151  -0.263  1.00 0.00 ? 31 ARG P CG   4  
ATOM 4076  C CD   . ARG A 1 33 ? -6.334  -7.253  0.719   1.00 0.00 ? 31 ARG P CD   4  
ATOM 4077  N NE   . ARG A 1 33 ? -7.732  -7.662  0.524   1.00 0.00 ? 31 ARG P NE   4  
ATOM 4078  C CZ   . ARG A 1 33 ? -8.261  -8.819  0.869   1.00 0.00 ? 31 ARG P CZ   4  
ATOM 4079  N NH1  . ARG A 1 33 ? -7.611  -9.718  1.550   1.00 0.00 ? 31 ARG P NH1  4  
ATOM 4080  N NH2  . ARG A 1 33 ? -9.474  -9.093  0.492   1.00 0.00 ? 31 ARG P NH2  4  
ATOM 4081  H H    . ARG A 1 33 ? -4.699  -6.807  -2.796  1.00 0.00 ? 31 ARG P H    4  
ATOM 4082  H HA   . ARG A 1 33 ? -4.272  -4.277  -1.535  1.00 0.00 ? 31 ARG P HA   4  
ATOM 4083  H HB2  . ARG A 1 33 ? -4.017  -7.124  -0.467  1.00 0.00 ? 31 ARG P HB2  4  
ATOM 4084  H HB3  . ARG A 1 33 ? -4.007  -5.702  0.567   1.00 0.00 ? 31 ARG P HB3  4  
ATOM 4085  H HG2  . ARG A 1 33 ? -6.318  -5.191  0.070   1.00 0.00 ? 31 ARG P HG2  4  
ATOM 4086  H HG3  . ARG A 1 33 ? -6.353  -6.376  -1.237  1.00 0.00 ? 31 ARG P HG3  4  
ATOM 4087  H HD2  . ARG A 1 33 ? -5.698  -8.120  0.534   1.00 0.00 ? 31 ARG P HD2  4  
ATOM 4088  H HD3  . ARG A 1 33 ? -6.174  -6.911  1.742   1.00 0.00 ? 31 ARG P HD3  4  
ATOM 4089  H HE   . ARG A 1 33 ? -8.319  -7.072  -0.051  1.00 0.00 ? 31 ARG P HE   4  
ATOM 4090  H HH11 . ARG A 1 33 ? -6.635  -9.549  1.814   1.00 0.00 ? 31 ARG P HH11 4  
ATOM 4091  H HH12 . ARG A 1 33 ? -8.027  -10.607 1.750   1.00 0.00 ? 31 ARG P HH12 4  
ATOM 4092  H HH21 . ARG A 1 33 ? -9.938  -8.453  -0.141  1.00 0.00 ? 31 ARG P HH21 4  
ATOM 4093  H HH22 . ARG A 1 33 ? -9.902  -9.972  0.725   1.00 0.00 ? 31 ARG P HH22 4  
ATOM 4094  N N    . GLU A 1 34 ? -1.574  -6.204  -1.616  1.00 0.00 ? 32 GLU P N    4  
ATOM 4095  C CA   . GLU A 1 34 ? -0.109  -6.143  -1.566  1.00 0.00 ? 32 GLU P CA   4  
ATOM 4096  C C    . GLU A 1 34 ? 0.445   -5.179  -2.621  1.00 0.00 ? 32 GLU P C    4  
ATOM 4097  O O    . GLU A 1 34 ? 1.301   -4.361  -2.296  1.00 0.00 ? 32 GLU P O    4  
ATOM 4098  C CB   . GLU A 1 34 ? 0.512   -7.538  -1.727  1.00 0.00 ? 32 GLU P CB   4  
ATOM 4099  C CG   . GLU A 1 34 ? 0.355   -8.372  -0.448  1.00 0.00 ? 32 GLU P CG   4  
ATOM 4100  C CD   . GLU A 1 34 ? 0.988   -9.781  -0.535  1.00 0.00 ? 32 GLU P CD   4  
ATOM 4101  O OE1  . GLU A 1 34 ? 1.654   -10.125 -1.544  1.00 0.00 ? 32 GLU P OE1  4  
ATOM 4102  O OE2  . GLU A 1 34 ? 0.856   -10.555 0.444   1.00 0.00 ? 32 GLU P OE2  4  
ATOM 4103  H H    . GLU A 1 34 ? -2.015  -7.073  -1.873  1.00 0.00 ? 32 GLU P H    4  
ATOM 4104  H HA   . GLU A 1 34 ? 0.185   -5.749  -0.593  1.00 0.00 ? 32 GLU P HA   4  
ATOM 4105  H HB2  . GLU A 1 34 ? 0.051   -8.053  -2.570  1.00 0.00 ? 32 GLU P HB2  4  
ATOM 4106  H HB3  . GLU A 1 34 ? 1.577   -7.417  -1.930  1.00 0.00 ? 32 GLU P HB3  4  
ATOM 4107  H HG2  . GLU A 1 34 ? 0.820   -7.822  0.374   1.00 0.00 ? 32 GLU P HG2  4  
ATOM 4108  H HG3  . GLU A 1 34 ? -0.706  -8.463  -0.218  1.00 0.00 ? 32 GLU P HG3  4  
ATOM 4109  N N    . GLU A 1 35 ? -0.091  -5.188  -3.846  1.00 0.00 ? 33 GLU P N    4  
ATOM 4110  C CA   . GLU A 1 35 ? 0.327   -4.272  -4.921  1.00 0.00 ? 33 GLU P CA   4  
ATOM 4111  C C    . GLU A 1 35 ? 0.277   -2.789  -4.512  1.00 0.00 ? 33 GLU P C    4  
ATOM 4112  O O    . GLU A 1 35 ? 1.166   -2.039  -4.911  1.00 0.00 ? 33 GLU P O    4  
ATOM 4113  C CB   . GLU A 1 35 ? -0.536  -4.519  -6.177  1.00 0.00 ? 33 GLU P CB   4  
ATOM 4114  C CG   . GLU A 1 35 ? -0.194  -3.624  -7.377  1.00 0.00 ? 33 GLU P CG   4  
ATOM 4115  C CD   . GLU A 1 35 ? -1.202  -3.819  -8.524  1.00 0.00 ? 33 GLU P CD   4  
ATOM 4116  O OE1  . GLU A 1 35 ? -1.016  -4.737  -9.359  1.00 0.00 ? 33 GLU P OE1  4  
ATOM 4117  O OE2  . GLU A 1 35 ? -2.181  -3.033  -8.602  1.00 0.00 ? 33 GLU P OE2  4  
ATOM 4118  H H    . GLU A 1 35 ? -0.769  -5.911  -4.061  1.00 0.00 ? 33 GLU P H    4  
ATOM 4119  H HA   . GLU A 1 35 ? 1.371   -4.488  -5.152  1.00 0.00 ? 33 GLU P HA   4  
ATOM 4120  H HB2  . GLU A 1 35 ? -0.432  -5.562  -6.477  1.00 0.00 ? 33 GLU P HB2  4  
ATOM 4121  H HB3  . GLU A 1 35 ? -1.578  -4.341  -5.929  1.00 0.00 ? 33 GLU P HB3  4  
ATOM 4122  H HG2  . GLU A 1 35 ? -0.220  -2.575  -7.077  1.00 0.00 ? 33 GLU P HG2  4  
ATOM 4123  H HG3  . GLU A 1 35 ? 0.820   -3.848  -7.714  1.00 0.00 ? 33 GLU P HG3  4  
ATOM 4124  N N    . ILE A 1 36 ? -0.698  -2.358  -3.698  1.00 0.00 ? 34 ILE P N    4  
ATOM 4125  C CA   . ILE A 1 36 ? -0.766  -0.971  -3.193  1.00 0.00 ? 34 ILE P CA   4  
ATOM 4126  C C    . ILE A 1 36 ? 0.053   -0.787  -1.907  1.00 0.00 ? 34 ILE P C    4  
ATOM 4127  O O    . ILE A 1 36 ? 0.626   0.278   -1.684  1.00 0.00 ? 34 ILE P O    4  
ATOM 4128  C CB   . ILE A 1 36 ? -2.225  -0.449  -3.081  1.00 0.00 ? 34 ILE P CB   4  
ATOM 4129  C CG1  . ILE A 1 36 ? -2.953  -0.757  -1.755  1.00 0.00 ? 34 ILE P CG1  4  
ATOM 4130  C CG2  . ILE A 1 36 ? -3.080  -0.982  -4.243  1.00 0.00 ? 34 ILE P CG2  4  
ATOM 4131  C CD1  . ILE A 1 36 ? -2.776  0.336   -0.693  1.00 0.00 ? 34 ILE P CD1  4  
ATOM 4132  H H    . ILE A 1 36 ? -1.427  -3.008  -3.432  1.00 0.00 ? 34 ILE P H    4  
ATOM 4133  H HA   . ILE A 1 36 ? -0.292  -0.330  -3.936  1.00 0.00 ? 34 ILE P HA   4  
ATOM 4134  H HB   . ILE A 1 36 ? -2.188  0.636   -3.189  1.00 0.00 ? 34 ILE P HB   4  
ATOM 4135  H HG12 . ILE A 1 36 ? -4.024  -0.850  -1.935  1.00 0.00 ? 34 ILE P HG12 4  
ATOM 4136  H HG13 . ILE A 1 36 ? -2.601  -1.706  -1.361  1.00 0.00 ? 34 ILE P HG13 4  
ATOM 4137  H HG21 . ILE A 1 36 ? -3.373  -2.011  -4.043  1.00 0.00 ? 34 ILE P HG21 4  
ATOM 4138  H HG22 . ILE A 1 36 ? -3.989  -0.399  -4.335  1.00 0.00 ? 34 ILE P HG22 4  
ATOM 4139  H HG23 . ILE A 1 36 ? -2.522  -0.925  -5.179  1.00 0.00 ? 34 ILE P HG23 4  
ATOM 4140  H HD11 . ILE A 1 36 ? -1.729  0.486   -0.442  1.00 0.00 ? 34 ILE P HD11 4  
ATOM 4141  H HD12 . ILE A 1 36 ? -3.300  0.030   0.207   1.00 0.00 ? 34 ILE P HD12 4  
ATOM 4142  H HD13 . ILE A 1 36 ? -3.201  1.275   -1.050  1.00 0.00 ? 34 ILE P HD13 4  
ATOM 4143  N N    . ALA A 1 37 ? 0.154   -1.825  -1.070  1.00 0.00 ? 35 ALA P N    4  
ATOM 4144  C CA   . ALA A 1 37 ? 0.848   -1.782  0.218   1.00 0.00 ? 35 ALA P CA   4  
ATOM 4145  C C    . ALA A 1 37 ? 2.382   -1.713  0.065   1.00 0.00 ? 35 ALA P C    4  
ATOM 4146  O O    . ALA A 1 37 ? 3.082   -1.152  0.913   1.00 0.00 ? 35 ALA P O    4  
ATOM 4147  C CB   . ALA A 1 37 ? 0.413   -3.008  1.027   1.00 0.00 ? 35 ALA P CB   4  
ATOM 4148  H H    . ALA A 1 37 ? -0.276  -2.702  -1.341  1.00 0.00 ? 35 ALA P H    4  
ATOM 4149  H HA   . ALA A 1 37 ? 0.524   -0.894  0.755   1.00 0.00 ? 35 ALA P HA   4  
ATOM 4150  H HB1  . ALA A 1 37 ? 0.891   -2.992  2.001   1.00 0.00 ? 35 ALA P HB1  4  
ATOM 4151  H HB2  . ALA A 1 37 ? -0.667  -3.003  1.174   1.00 0.00 ? 35 ALA P HB2  4  
ATOM 4152  H HB3  . ALA A 1 37 ? 0.708   -3.921  0.513   1.00 0.00 ? 35 ALA P HB3  4  
ATOM 4153  N N    . VAL A 1 38 ? 2.891   -2.254  -1.047  1.00 0.00 ? 36 VAL P N    4  
ATOM 4154  C CA   . VAL A 1 38 ? 4.313   -2.453  -1.372  1.00 0.00 ? 36 VAL P CA   4  
ATOM 4155  C C    . VAL A 1 38 ? 5.127   -1.156  -1.445  1.00 0.00 ? 36 VAL P C    4  
ATOM 4156  O O    . VAL A 1 38 ? 6.307   -1.158  -1.090  1.00 0.00 ? 36 VAL P O    4  
ATOM 4157  C CB   . VAL A 1 38 ? 4.373   -3.274  -2.686  1.00 0.00 ? 36 VAL P CB   4  
ATOM 4158  C CG1  . VAL A 1 38 ? 5.538   -2.986  -3.635  1.00 0.00 ? 36 VAL P CG1  4  
ATOM 4159  C CG2  . VAL A 1 38 ? 4.388   -4.770  -2.354  1.00 0.00 ? 36 VAL P CG2  4  
ATOM 4160  H H    . VAL A 1 38 ? 2.223   -2.695  -1.676  1.00 0.00 ? 36 VAL P H    4  
ATOM 4161  H HA   . VAL A 1 38 ? 4.763   -3.033  -0.568  1.00 0.00 ? 36 VAL P HA   4  
ATOM 4162  H HB   . VAL A 1 38 ? 3.470   -3.067  -3.262  1.00 0.00 ? 36 VAL P HB   4  
ATOM 4163  H HG11 . VAL A 1 38 ? 6.490   -3.163  -3.134  1.00 0.00 ? 36 VAL P HG11 4  
ATOM 4164  H HG12 . VAL A 1 38 ? 5.454   -3.636  -4.507  1.00 0.00 ? 36 VAL P HG12 4  
ATOM 4165  H HG13 . VAL A 1 38 ? 5.483   -1.956  -3.984  1.00 0.00 ? 36 VAL P HG13 4  
ATOM 4166  H HG21 . VAL A 1 38 ? 3.607   -4.999  -1.630  1.00 0.00 ? 36 VAL P HG21 4  
ATOM 4167  H HG22 . VAL A 1 38 ? 4.199   -5.347  -3.260  1.00 0.00 ? 36 VAL P HG22 4  
ATOM 4168  H HG23 . VAL A 1 38 ? 5.353   -5.054  -1.931  1.00 0.00 ? 36 VAL P HG23 4  
ATOM 4169  N N    . TRP A 1 39 ? 4.508   -0.046  -1.857  1.00 0.00 ? 37 TRP P N    4  
ATOM 4170  C CA   . TRP A 1 39 ? 5.148   1.272   -1.993  1.00 0.00 ? 37 TRP P CA   4  
ATOM 4171  C C    . TRP A 1 39 ? 4.571   2.334   -1.043  1.00 0.00 ? 37 TRP P C    4  
ATOM 4172  O O    . TRP A 1 39 ? 4.955   3.504   -1.105  1.00 0.00 ? 37 TRP P O    4  
ATOM 4173  C CB   . TRP A 1 39 ? 5.122   1.711   -3.464  1.00 0.00 ? 37 TRP P CB   4  
ATOM 4174  C CG   . TRP A 1 39 ? 3.801   1.560   -4.144  1.00 0.00 ? 37 TRP P CG   4  
ATOM 4175  C CD1  . TRP A 1 39 ? 3.347   0.420   -4.701  1.00 0.00 ? 37 TRP P CD1  4  
ATOM 4176  C CD2  . TRP A 1 39 ? 2.728   2.535   -4.301  1.00 0.00 ? 37 TRP P CD2  4  
ATOM 4177  N NE1  . TRP A 1 39 ? 2.056   0.600   -5.138  1.00 0.00 ? 37 TRP P NE1  4  
ATOM 4178  C CE2  . TRP A 1 39 ? 1.613   1.886   -4.914  1.00 0.00 ? 37 TRP P CE2  4  
ATOM 4179  C CE3  . TRP A 1 39 ? 2.585   3.897   -3.969  1.00 0.00 ? 37 TRP P CE3  4  
ATOM 4180  C CZ2  . TRP A 1 39 ? 0.401   2.549   -5.156  1.00 0.00 ? 37 TRP P CZ2  4  
ATOM 4181  C CZ3  . TRP A 1 39 ? 1.379   4.578   -4.227  1.00 0.00 ? 37 TRP P CZ3  4  
ATOM 4182  C CH2  . TRP A 1 39 ? 0.286   3.907   -4.808  1.00 0.00 ? 37 TRP P CH2  4  
ATOM 4183  H H    . TRP A 1 39 ? 3.540   -0.118  -2.142  1.00 0.00 ? 37 TRP P H    4  
ATOM 4184  H HA   . TRP A 1 39 ? 6.193   1.183   -1.710  1.00 0.00 ? 37 TRP P HA   4  
ATOM 4185  H HB2  . TRP A 1 39 ? 5.444   2.749   -3.533  1.00 0.00 ? 37 TRP P HB2  4  
ATOM 4186  H HB3  . TRP A 1 39 ? 5.847   1.117   -4.012  1.00 0.00 ? 37 TRP P HB3  4  
ATOM 4187  H HD1  . TRP A 1 39 ? 3.892   -0.516  -4.738  1.00 0.00 ? 37 TRP P HD1  4  
ATOM 4188  H HE1  . TRP A 1 39 ? 1.498   -0.190  -5.458  1.00 0.00 ? 37 TRP P HE1  4  
ATOM 4189  H HE3  . TRP A 1 39 ? 3.420   4.407   -3.510  1.00 0.00 ? 37 TRP P HE3  4  
ATOM 4190  H HZ2  . TRP A 1 39 ? -0.427  2.024   -5.612  1.00 0.00 ? 37 TRP P HZ2  4  
ATOM 4191  H HZ3  . TRP A 1 39 ? 1.290   5.626   -3.973  1.00 0.00 ? 37 TRP P HZ3  4  
ATOM 4192  H HH2  . TRP A 1 39 ? -0.637  4.441   -4.990  1.00 0.00 ? 37 TRP P HH2  4  
ATOM 4193  N N    . THR A 1 40 ? 3.675   1.928   -0.139  1.00 0.00 ? 38 THR P N    4  
ATOM 4194  C CA   . THR A 1 40 ? 3.019   2.808   0.849   1.00 0.00 ? 38 THR P CA   4  
ATOM 4195  C C    . THR A 1 40 ? 3.392   2.476   2.294   1.00 0.00 ? 38 THR P C    4  
ATOM 4196  O O    . THR A 1 40 ? 2.872   3.104   3.212   1.00 0.00 ? 38 THR P O    4  
ATOM 4197  C CB   . THR A 1 40 ? 1.494   2.828   0.660   1.00 0.00 ? 38 THR P CB   4  
ATOM 4198  O OG1  . THR A 1 40 ? 0.966   1.532   0.774   1.00 0.00 ? 38 THR P OG1  4  
ATOM 4199  C CG2  . THR A 1 40 ? 1.113   3.361   -0.721  1.00 0.00 ? 38 THR P CG2  4  
ATOM 4200  H H    . THR A 1 40 ? 3.408   0.950   -0.144  1.00 0.00 ? 38 THR P H    4  
ATOM 4201  H HA   . THR A 1 40 ? 3.358   3.831   0.695   1.00 0.00 ? 38 THR P HA   4  
ATOM 4202  H HB   . THR A 1 40 ? 1.039   3.463   1.424   1.00 0.00 ? 38 THR P HB   4  
ATOM 4203  H HG1  . THR A 1 40 ? 0.858   1.194   -0.133  1.00 0.00 ? 38 THR P HG1  4  
ATOM 4204  H HG21 . THR A 1 40 ? 1.560   2.744   -1.504  1.00 0.00 ? 38 THR P HG21 4  
ATOM 4205  H HG22 . THR A 1 40 ? 1.478   4.381   -0.830  1.00 0.00 ? 38 THR P HG22 4  
ATOM 4206  H HG23 . THR A 1 40 ? 0.029   3.354   -0.832  1.00 0.00 ? 38 THR P HG23 4  
ATOM 4207  N N    . ASN A 1 41 ? 4.320   1.536   2.519   1.00 0.00 ? 39 ASN P N    4  
ATOM 4208  C CA   . ASN A 1 41 ? 4.740   1.046   3.842   1.00 0.00 ? 39 ASN P CA   4  
ATOM 4209  C C    . ASN A 1 41 ? 3.581   0.461   4.686   1.00 0.00 ? 39 ASN P C    4  
ATOM 4210  O O    . ASN A 1 41 ? 3.453   0.731   5.885   1.00 0.00 ? 39 ASN P O    4  
ATOM 4211  C CB   . ASN A 1 41 ? 5.570   2.129   4.560   1.00 0.00 ? 39 ASN P CB   4  
ATOM 4212  C CG   . ASN A 1 41 ? 6.398   1.599   5.726   1.00 0.00 ? 39 ASN P CG   4  
ATOM 4213  O OD1  . ASN A 1 41 ? 6.649   0.410   5.877   1.00 0.00 ? 39 ASN P OD1  4  
ATOM 4214  N ND2  . ASN A 1 41 ? 6.887   2.475   6.574   1.00 0.00 ? 39 ASN P ND2  4  
ATOM 4215  H H    . ASN A 1 41 ? 4.726   1.094   1.706   1.00 0.00 ? 39 ASN P H    4  
ATOM 4216  H HA   . ASN A 1 41 ? 5.408   0.203   3.649   1.00 0.00 ? 39 ASN P HA   4  
ATOM 4217  H HB2  . ASN A 1 41 ? 6.252   2.600   3.855   1.00 0.00 ? 39 ASN P HB2  4  
ATOM 4218  H HB3  . ASN A 1 41 ? 4.890   2.893   4.933   1.00 0.00 ? 39 ASN P HB3  4  
ATOM 4219  H HD21 . ASN A 1 41 ? 6.699   3.459   6.453   1.00 0.00 ? 39 ASN P HD21 4  
ATOM 4220  H HD22 . ASN A 1 41 ? 7.445   2.139   7.343   1.00 0.00 ? 39 ASN P HD22 4  
ATOM 4221  N N    . LEU A 1 42 ? 2.719   -0.326  4.038   1.00 0.00 ? 40 LEU P N    4  
ATOM 4222  C CA   . LEU A 1 42 ? 1.605   -1.071  4.641   1.00 0.00 ? 40 LEU P CA   4  
ATOM 4223  C C    . LEU A 1 42 ? 1.787   -2.596  4.471   1.00 0.00 ? 40 LEU P C    4  
ATOM 4224  O O    . LEU A 1 42 ? 2.772   -3.068  3.896   1.00 0.00 ? 40 LEU P O    4  
ATOM 4225  C CB   . LEU A 1 42 ? 0.283   -0.572  4.010   1.00 0.00 ? 40 LEU P CB   4  
ATOM 4226  C CG   . LEU A 1 42 ? -0.081  0.897   4.286   1.00 0.00 ? 40 LEU P CG   4  
ATOM 4227  C CD1  . LEU A 1 42 ? -1.365  1.253   3.537   1.00 0.00 ? 40 LEU P CD1  4  
ATOM 4228  C CD2  . LEU A 1 42 ? -0.317  1.140   5.775   1.00 0.00 ? 40 LEU P CD2  4  
ATOM 4229  H H    . LEU A 1 42 ? 2.886   -0.467  3.050   1.00 0.00 ? 40 LEU P H    4  
ATOM 4230  H HA   . LEU A 1 42 ? 1.571   -0.887  5.715   1.00 0.00 ? 40 LEU P HA   4  
ATOM 4231  H HB2  . LEU A 1 42 ? 0.345   -0.702  2.934   1.00 0.00 ? 40 LEU P HB2  4  
ATOM 4232  H HB3  . LEU A 1 42 ? -0.543  -1.190  4.360   1.00 0.00 ? 40 LEU P HB3  4  
ATOM 4233  H HG   . LEU A 1 42 ? 0.715   1.552   3.936   1.00 0.00 ? 40 LEU P HG   4  
ATOM 4234  H HD11 . LEU A 1 42 ? -1.603  2.302   3.703   1.00 0.00 ? 40 LEU P HD11 4  
ATOM 4235  H HD12 . LEU A 1 42 ? -1.215  1.099   2.468   1.00 0.00 ? 40 LEU P HD12 4  
ATOM 4236  H HD13 . LEU A 1 42 ? -2.190  0.631   3.882   1.00 0.00 ? 40 LEU P HD13 4  
ATOM 4237  H HD21 . LEU A 1 42 ? -1.052  0.438   6.158   1.00 0.00 ? 40 LEU P HD21 4  
ATOM 4238  H HD22 . LEU A 1 42 ? 0.620   1.024   6.317   1.00 0.00 ? 40 LEU P HD22 4  
ATOM 4239  H HD23 . LEU A 1 42 ? -0.682  2.153   5.930   1.00 0.00 ? 40 LEU P HD23 4  
ATOM 4240  N N    . THR A 1 43 ? 0.814   -3.371  4.957   1.00 0.00 ? 41 THR P N    4  
ATOM 4241  C CA   . THR A 1 43 ? 0.660   -4.816  4.697   1.00 0.00 ? 41 THR P CA   4  
ATOM 4242  C C    . THR A 1 43 ? -0.782  -5.111  4.268   1.00 0.00 ? 41 THR P C    4  
ATOM 4243  O O    . THR A 1 43 ? -1.663  -4.268  4.457   1.00 0.00 ? 41 THR P O    4  
ATOM 4244  C CB   . THR A 1 43 ? 1.106   -5.651  5.911   1.00 0.00 ? 41 THR P CB   4  
ATOM 4245  O OG1  . THR A 1 43 ? 1.078   -7.024  5.583   1.00 0.00 ? 41 THR P OG1  4  
ATOM 4246  C CG2  . THR A 1 43 ? 0.237   -5.448  7.153   1.00 0.00 ? 41 THR P CG2  4  
ATOM 4247  H H    . THR A 1 43 ? 0.037   -2.915  5.419   1.00 0.00 ? 41 THR P H    4  
ATOM 4248  H HA   . THR A 1 43 ? 1.301   -5.100  3.862   1.00 0.00 ? 41 THR P HA   4  
ATOM 4249  H HB   . THR A 1 43 ? 2.134   -5.378  6.155   1.00 0.00 ? 41 THR P HB   4  
ATOM 4250  H HG1  . THR A 1 43 ? 1.529   -7.508  6.297   1.00 0.00 ? 41 THR P HG1  4  
ATOM 4251  H HG21 . THR A 1 43 ? 0.301   -4.410  7.478   1.00 0.00 ? 41 THR P HG21 4  
ATOM 4252  H HG22 . THR A 1 43 ? 0.601   -6.083  7.961   1.00 0.00 ? 41 THR P HG22 4  
ATOM 4253  H HG23 . THR A 1 43 ? -0.800  -5.703  6.938   1.00 0.00 ? 41 THR P HG23 4  
ATOM 4254  N N    . GLU A 1 44 ? -1.067  -6.285  3.692   1.00 0.00 ? 42 GLU P N    4  
ATOM 4255  C CA   . GLU A 1 44 ? -2.386  -6.583  3.104   1.00 0.00 ? 42 GLU P CA   4  
ATOM 4256  C C    . GLU A 1 44 ? -3.537  -6.458  4.112   1.00 0.00 ? 42 GLU P C    4  
ATOM 4257  O O    . GLU A 1 44 ? -4.633  -6.043  3.745   1.00 0.00 ? 42 GLU P O    4  
ATOM 4258  C CB   . GLU A 1 44 ? -2.376  -7.949  2.391   1.00 0.00 ? 42 GLU P CB   4  
ATOM 4259  C CG   . GLU A 1 44 ? -2.721  -9.190  3.231   1.00 0.00 ? 42 GLU P CG   4  
ATOM 4260  C CD   . GLU A 1 44 ? -4.239  -9.430  3.382   1.00 0.00 ? 42 GLU P CD   4  
ATOM 4261  O OE1  . GLU A 1 44 ? -4.948  -9.607  2.366   1.00 0.00 ? 42 GLU P OE1  4  
ATOM 4262  O OE2  . GLU A 1 44 ? -4.750  -9.510  4.523   1.00 0.00 ? 42 GLU P OE2  4  
ATOM 4263  H H    . GLU A 1 44 ? -0.330  -6.976  3.629   1.00 0.00 ? 42 GLU P H    4  
ATOM 4264  H HA   . GLU A 1 44 ? -2.561  -5.836  2.333   1.00 0.00 ? 42 GLU P HA   4  
ATOM 4265  H HB2  . GLU A 1 44 ? -3.077  -7.898  1.564   1.00 0.00 ? 42 GLU P HB2  4  
ATOM 4266  H HB3  . GLU A 1 44 ? -1.386  -8.095  1.962   1.00 0.00 ? 42 GLU P HB3  4  
ATOM 4267  H HG2  . GLU A 1 44 ? -2.292  -10.054 2.723   1.00 0.00 ? 42 GLU P HG2  4  
ATOM 4268  H HG3  . GLU A 1 44 ? -2.237  -9.116  4.208   1.00 0.00 ? 42 GLU P HG3  4  
ATOM 4269  N N    . ALA A 1 45 ? -3.266  -6.742  5.389   1.00 0.00 ? 43 ALA P N    4  
ATOM 4270  C CA   . ALA A 1 45 ? -4.226  -6.627  6.483   1.00 0.00 ? 43 ALA P CA   4  
ATOM 4271  C C    . ALA A 1 45 ? -4.635  -5.168  6.755   1.00 0.00 ? 43 ALA P C    4  
ATOM 4272  O O    . ALA A 1 45 ? -5.811  -4.901  6.988   1.00 0.00 ? 43 ALA P O    4  
ATOM 4273  C CB   . ALA A 1 45 ? -3.629  -7.296  7.727   1.00 0.00 ? 43 ALA P CB   4  
ATOM 4274  H H    . ALA A 1 45 ? -2.342  -7.091  5.593   1.00 0.00 ? 43 ALA P H    4  
ATOM 4275  H HA   . ALA A 1 45 ? -5.128  -7.176  6.206   1.00 0.00 ? 43 ALA P HA   4  
ATOM 4276  H HB1  . ALA A 1 45 ? -2.726  -6.775  8.044   1.00 0.00 ? 43 ALA P HB1  4  
ATOM 4277  H HB2  . ALA A 1 45 ? -4.357  -7.268  8.540   1.00 0.00 ? 43 ALA P HB2  4  
ATOM 4278  H HB3  . ALA A 1 45 ? -3.390  -8.337  7.508   1.00 0.00 ? 43 ALA P HB3  4  
ATOM 4279  N N    . ARG A 1 46 ? -3.708  -4.203  6.649   1.00 0.00 ? 44 ARG P N    4  
ATOM 4280  C CA   . ARG A 1 46 ? -4.017  -2.761  6.732   1.00 0.00 ? 44 ARG P CA   4  
ATOM 4281  C C    . ARG A 1 46 ? -4.951  -2.350  5.596   1.00 0.00 ? 44 ARG P C    4  
ATOM 4282  O O    . ARG A 1 46 ? -5.952  -1.682  5.839   1.00 0.00 ? 44 ARG P O    4  
ATOM 4283  C CB   . ARG A 1 46 ? -2.731  -1.913  6.681   1.00 0.00 ? 44 ARG P CB   4  
ATOM 4284  C CG   . ARG A 1 46 ? -1.787  -2.090  7.881   1.00 0.00 ? 44 ARG P CG   4  
ATOM 4285  C CD   . ARG A 1 46 ? -2.321  -1.388  9.135   1.00 0.00 ? 44 ARG P CD   4  
ATOM 4286  N NE   . ARG A 1 46 ? -1.471  -1.676  10.307  1.00 0.00 ? 44 ARG P NE   4  
ATOM 4287  C CZ   . ARG A 1 46 ? -0.516  -0.924  10.829  1.00 0.00 ? 44 ARG P CZ   4  
ATOM 4288  N NH1  . ARG A 1 46 ? -0.258  0.286   10.423  1.00 0.00 ? 44 ARG P NH1  4  
ATOM 4289  N NH2  . ARG A 1 46 ? 0.226   -1.395  11.790  1.00 0.00 ? 44 ARG P NH2  4  
ATOM 4290  H H    . ARG A 1 46 ? -2.775  -4.484  6.385   1.00 0.00 ? 44 ARG P H    4  
ATOM 4291  H HA   . ARG A 1 46 ? -4.553  -2.556  7.660   1.00 0.00 ? 44 ARG P HA   4  
ATOM 4292  H HB2  . ARG A 1 46 ? -2.189  -2.151  5.768   1.00 0.00 ? 44 ARG P HB2  4  
ATOM 4293  H HB3  . ARG A 1 46 ? -3.007  -0.861  6.621   1.00 0.00 ? 44 ARG P HB3  4  
ATOM 4294  H HG2  . ARG A 1 46 ? -1.652  -3.151  8.088   1.00 0.00 ? 44 ARG P HG2  4  
ATOM 4295  H HG3  . ARG A 1 46 ? -0.815  -1.661  7.633   1.00 0.00 ? 44 ARG P HG3  4  
ATOM 4296  H HD2  . ARG A 1 46 ? -2.385  -0.314  8.947   1.00 0.00 ? 44 ARG P HD2  4  
ATOM 4297  H HD3  . ARG A 1 46 ? -3.326  -1.756  9.334   1.00 0.00 ? 44 ARG P HD3  4  
ATOM 4298  H HE   . ARG A 1 46 ? -1.603  -2.576  10.742  1.00 0.00 ? 44 ARG P HE   4  
ATOM 4299  H HH11 . ARG A 1 46 ? -0.888  0.750   9.779   1.00 0.00 ? 44 ARG P HH11 4  
ATOM 4300  H HH12 . ARG A 1 46 ? 0.492   0.810   10.834  1.00 0.00 ? 44 ARG P HH12 4  
ATOM 4301  H HH21 . ARG A 1 46 ? 0.066   -2.322  12.147  1.00 0.00 ? 44 ARG P HH21 4  
ATOM 4302  H HH22 . ARG A 1 46 ? 0.952   -0.829  12.195  1.00 0.00 ? 44 ARG P HH22 4  
ATOM 4303  N N    . VAL A 1 47 ? -4.672  -2.806  4.373   1.00 0.00 ? 45 VAL P N    4  
ATOM 4304  C CA   . VAL A 1 47 ? -5.526  -2.520  3.207   1.00 0.00 ? 45 VAL P CA   4  
ATOM 4305  C C    . VAL A 1 47 ? -6.905  -3.175  3.365   1.00 0.00 ? 45 VAL P C    4  
ATOM 4306  O O    . VAL A 1 47 ? -7.922  -2.508  3.183   1.00 0.00 ? 45 VAL P O    4  
ATOM 4307  C CB   . VAL A 1 47 ? -4.844  -2.942  1.893   1.00 0.00 ? 45 VAL P CB   4  
ATOM 4308  C CG1  . VAL A 1 47 ? -5.606  -2.388  0.684   1.00 0.00 ? 45 VAL P CG1  4  
ATOM 4309  C CG2  . VAL A 1 47 ? -3.398  -2.439  1.811   1.00 0.00 ? 45 VAL P CG2  4  
ATOM 4310  H H    . VAL A 1 47 ? -3.826  -3.351  4.248   1.00 0.00 ? 45 VAL P H    4  
ATOM 4311  H HA   . VAL A 1 47 ? -5.685  -1.441  3.163   1.00 0.00 ? 45 VAL P HA   4  
ATOM 4312  H HB   . VAL A 1 47 ? -4.826  -4.027  1.830   1.00 0.00 ? 45 VAL P HB   4  
ATOM 4313  H HG11 . VAL A 1 47 ? -5.095  -2.659  -0.239  1.00 0.00 ? 45 VAL P HG11 4  
ATOM 4314  H HG12 . VAL A 1 47 ? -6.615  -2.802  0.649   1.00 0.00 ? 45 VAL P HG12 4  
ATOM 4315  H HG13 . VAL A 1 47 ? -5.664  -1.302  0.746   1.00 0.00 ? 45 VAL P HG13 4  
ATOM 4316  H HG21 . VAL A 1 47 ? -2.996  -2.623  0.817   1.00 0.00 ? 45 VAL P HG21 4  
ATOM 4317  H HG22 . VAL A 1 47 ? -3.357  -1.371  2.028   1.00 0.00 ? 45 VAL P HG22 4  
ATOM 4318  H HG23 . VAL A 1 47 ? -2.771  -2.971  2.522   1.00 0.00 ? 45 VAL P HG23 4  
ATOM 4319  N N    . ARG A 1 48 ? -6.965  -4.440  3.805   1.00 0.00 ? 46 ARG P N    4  
ATOM 4320  C CA   . ARG A 1 48 ? -8.209  -5.169  4.113   1.00 0.00 ? 46 ARG P CA   4  
ATOM 4321  C C    . ARG A 1 48 ? -9.061  -4.412  5.141   1.00 0.00 ? 46 ARG P C    4  
ATOM 4322  O O    . ARG A 1 48 ? -10.248 -4.191  4.911   1.00 0.00 ? 46 ARG P O    4  
ATOM 4323  C CB   . ARG A 1 48 ? -7.839  -6.581  4.611   1.00 0.00 ? 46 ARG P CB   4  
ATOM 4324  C CG   . ARG A 1 48 ? -9.049  -7.514  4.771   1.00 0.00 ? 46 ARG P CG   4  
ATOM 4325  C CD   . ARG A 1 48 ? -8.722  -8.735  5.643   1.00 0.00 ? 46 ARG P CD   4  
ATOM 4326  N NE   . ARG A 1 48 ? -7.671  -9.601  5.065   1.00 0.00 ? 46 ARG P NE   4  
ATOM 4327  C CZ   . ARG A 1 48 ? -7.744  -10.890 4.796   1.00 0.00 ? 46 ARG P CZ   4  
ATOM 4328  N NH1  . ARG A 1 48 ? -8.836  -11.592 4.925   1.00 0.00 ? 46 ARG P NH1  4  
ATOM 4329  N NH2  . ARG A 1 48 ? -6.680  -11.498 4.375   1.00 0.00 ? 46 ARG P NH2  4  
ATOM 4330  H H    . ARG A 1 48 ? -6.085  -4.933  3.934   1.00 0.00 ? 46 ARG P H    4  
ATOM 4331  H HA   . ARG A 1 48 ? -8.806  -5.257  3.203   1.00 0.00 ? 46 ARG P HA   4  
ATOM 4332  H HB2  . ARG A 1 48 ? -7.147  -7.043  3.905   1.00 0.00 ? 46 ARG P HB2  4  
ATOM 4333  H HB3  . ARG A 1 48 ? -7.332  -6.494  5.571   1.00 0.00 ? 46 ARG P HB3  4  
ATOM 4334  H HG2  . ARG A 1 48 ? -9.865  -6.975  5.253   1.00 0.00 ? 46 ARG P HG2  4  
ATOM 4335  H HG3  . ARG A 1 48 ? -9.390  -7.840  3.787   1.00 0.00 ? 46 ARG P HG3  4  
ATOM 4336  H HD2  . ARG A 1 48 ? -8.391  -8.387  6.623   1.00 0.00 ? 46 ARG P HD2  4  
ATOM 4337  H HD3  . ARG A 1 48 ? -9.644  -9.297  5.795   1.00 0.00 ? 46 ARG P HD3  4  
ATOM 4338  H HE   . ARG A 1 48 ? -6.747  -9.201  4.929   1.00 0.00 ? 46 ARG P HE   4  
ATOM 4339  H HH11 . ARG A 1 48 ? -9.673  -11.145 5.256   1.00 0.00 ? 46 ARG P HH11 4  
ATOM 4340  H HH12 . ARG A 1 48 ? -8.838  -12.578 4.725   1.00 0.00 ? 46 ARG P HH12 4  
ATOM 4341  H HH21 . ARG A 1 48 ? -5.832  -10.933 4.303   1.00 0.00 ? 46 ARG P HH21 4  
ATOM 4342  H HH22 . ARG A 1 48 ? -6.671  -12.483 4.184   1.00 0.00 ? 46 ARG P HH22 4  
ATOM 4343  N N    . VAL A 1 49 ? -8.450  -3.962  6.240   1.00 0.00 ? 47 VAL P N    4  
ATOM 4344  C CA   . VAL A 1 49 ? -9.100  -3.164  7.296   1.00 0.00 ? 47 VAL P CA   4  
ATOM 4345  C C    . VAL A 1 49 ? -9.601  -1.823  6.758   1.00 0.00 ? 47 VAL P C    4  
ATOM 4346  O O    . VAL A 1 49 ? -10.733 -1.440  7.057   1.00 0.00 ? 47 VAL P O    4  
ATOM 4347  C CB   . VAL A 1 49 ? -8.137  -2.969  8.489   1.00 0.00 ? 47 VAL P CB   4  
ATOM 4348  C CG1  . VAL A 1 49 ? -8.613  -1.918  9.500   1.00 0.00 ? 47 VAL P CG1  4  
ATOM 4349  C CG2  . VAL A 1 49 ? -7.980  -4.290  9.254   1.00 0.00 ? 47 VAL P CG2  4  
ATOM 4350  H H    . VAL A 1 49 ? -7.473  -4.207  6.362   1.00 0.00 ? 47 VAL P H    4  
ATOM 4351  H HA   . VAL A 1 49 ? -9.976  -3.704  7.655   1.00 0.00 ? 47 VAL P HA   4  
ATOM 4352  H HB   . VAL A 1 49 ? -7.161  -2.660  8.115   1.00 0.00 ? 47 VAL P HB   4  
ATOM 4353  H HG11 . VAL A 1 49 ? -7.933  -1.895  10.351  1.00 0.00 ? 47 VAL P HG11 4  
ATOM 4354  H HG12 . VAL A 1 49 ? -8.614  -0.927  9.046   1.00 0.00 ? 47 VAL P HG12 4  
ATOM 4355  H HG13 . VAL A 1 49 ? -9.617  -2.160  9.849   1.00 0.00 ? 47 VAL P HG13 4  
ATOM 4356  H HG21 . VAL A 1 49 ? -8.916  -4.552  9.746   1.00 0.00 ? 47 VAL P HG21 4  
ATOM 4357  H HG22 . VAL A 1 49 ? -7.704  -5.094  8.575   1.00 0.00 ? 47 VAL P HG22 4  
ATOM 4358  H HG23 . VAL A 1 49 ? -7.190  -4.186  9.998   1.00 0.00 ? 47 VAL P HG23 4  
ATOM 4359  N N    . TRP A 1 50 ? -8.818  -1.121  5.935   1.00 0.00 ? 48 TRP P N    4  
ATOM 4360  C CA   . TRP A 1 50 ? -9.231  0.163   5.362   1.00 0.00 ? 48 TRP P CA   4  
ATOM 4361  C C    . TRP A 1 50 ? -10.429 0.017   4.418   1.00 0.00 ? 48 TRP P C    4  
ATOM 4362  O O    . TRP A 1 50 ? -11.418 0.732   4.563   1.00 0.00 ? 48 TRP P O    4  
ATOM 4363  C CB   . TRP A 1 50 ? -8.060  0.820   4.635   1.00 0.00 ? 48 TRP P CB   4  
ATOM 4364  C CG   . TRP A 1 50 ? -8.328  2.245   4.269   1.00 0.00 ? 48 TRP P CG   4  
ATOM 4365  C CD1  . TRP A 1 50 ? -7.990  3.319   5.017   1.00 0.00 ? 48 TRP P CD1  4  
ATOM 4366  C CD2  . TRP A 1 50 ? -9.018  2.777   3.095   1.00 0.00 ? 48 TRP P CD2  4  
ATOM 4367  N NE1  . TRP A 1 50 ? -8.386  4.474   4.373   1.00 0.00 ? 48 TRP P NE1  4  
ATOM 4368  C CE2  . TRP A 1 50 ? -9.018  4.200   3.181   1.00 0.00 ? 48 TRP P CE2  4  
ATOM 4369  C CE3  . TRP A 1 50 ? -9.635  2.208   1.961   1.00 0.00 ? 48 TRP P CE3  4  
ATOM 4370  C CZ2  . TRP A 1 50 ? -9.575  5.014   2.187   1.00 0.00 ? 48 TRP P CZ2  4  
ATOM 4371  C CZ3  . TRP A 1 50 ? -10.232 3.010   0.972   1.00 0.00 ? 48 TRP P CZ3  4  
ATOM 4372  C CH2  . TRP A 1 50 ? -10.206 4.410   1.084   1.00 0.00 ? 48 TRP P CH2  4  
ATOM 4373  H H    . TRP A 1 50 ? -7.883  -1.461  5.738   1.00 0.00 ? 48 TRP P H    4  
ATOM 4374  H HA   . TRP A 1 50 ? -9.533  0.824   6.175   1.00 0.00 ? 48 TRP P HA   4  
ATOM 4375  H HB2  . TRP A 1 50 ? -7.178  0.790   5.271   1.00 0.00 ? 48 TRP P HB2  4  
ATOM 4376  H HB3  . TRP A 1 50 ? -7.833  0.254   3.731   1.00 0.00 ? 48 TRP P HB3  4  
ATOM 4377  H HD1  . TRP A 1 50 ? -7.465  3.275   5.967   1.00 0.00 ? 48 TRP P HD1  4  
ATOM 4378  H HE1  . TRP A 1 50 ? -8.227  5.400   4.750   1.00 0.00 ? 48 TRP P HE1  4  
ATOM 4379  H HE3  . TRP A 1 50 ? -9.651  1.137   1.853   1.00 0.00 ? 48 TRP P HE3  4  
ATOM 4380  H HZ2  . TRP A 1 50 ? -9.509  6.088   2.271   1.00 0.00 ? 48 TRP P HZ2  4  
ATOM 4381  H HZ3  . TRP A 1 50 ? -10.707 2.544   0.118   1.00 0.00 ? 48 TRP P HZ3  4  
ATOM 4382  H HH2  . TRP A 1 50 ? -10.674 5.015   0.323   1.00 0.00 ? 48 TRP P HH2  4  
ATOM 4383  N N    . PHE A 1 51 ? -10.392 -0.952  3.499   1.00 0.00 ? 49 PHE P N    4  
ATOM 4384  C CA   . PHE A 1 51 ? -11.487 -1.222  2.560   1.00 0.00 ? 49 PHE P CA   4  
ATOM 4385  C C    . PHE A 1 51 ? -12.742 -1.788  3.253   1.00 0.00 ? 49 PHE P C    4  
ATOM 4386  O O    . PHE A 1 51 ? -13.856 -1.591  2.756   1.00 0.00 ? 49 PHE P O    4  
ATOM 4387  C CB   . PHE A 1 51 ? -10.966 -2.119  1.425   1.00 0.00 ? 49 PHE P CB   4  
ATOM 4388  C CG   . PHE A 1 51 ? -10.281 -1.354  0.301   1.00 0.00 ? 49 PHE P CG   4  
ATOM 4389  C CD1  . PHE A 1 51 ? -8.938  -0.931  0.404   1.00 0.00 ? 49 PHE P CD1  4  
ATOM 4390  C CD2  . PHE A 1 51 ? -11.007 -1.045  -0.864  1.00 0.00 ? 49 PHE P CD2  4  
ATOM 4391  C CE1  . PHE A 1 51 ? -8.328  -0.213  -0.641  1.00 0.00 ? 49 PHE P CE1  4  
ATOM 4392  C CE2  . PHE A 1 51 ? -10.392 -0.343  -1.909  1.00 0.00 ? 49 PHE P CE2  4  
ATOM 4393  C CZ   . PHE A 1 51 ? -9.061  0.083   -1.800  1.00 0.00 ? 49 PHE P CZ   4  
ATOM 4394  H H    . PHE A 1 51 ? -9.550  -1.510  3.427   1.00 0.00 ? 49 PHE P H    4  
ATOM 4395  H HA   . PHE A 1 51 ? -11.798 -0.276  2.111   1.00 0.00 ? 49 PHE P HA   4  
ATOM 4396  H HB2  . PHE A 1 51 ? -10.286 -2.872  1.827   1.00 0.00 ? 49 PHE P HB2  4  
ATOM 4397  H HB3  . PHE A 1 51 ? -11.811 -2.659  0.995   1.00 0.00 ? 49 PHE P HB3  4  
ATOM 4398  H HD1  . PHE A 1 51 ? -8.369  -1.127  1.293   1.00 0.00 ? 49 PHE P HD1  4  
ATOM 4399  H HD2  . PHE A 1 51 ? -12.038 -1.346  -0.973  1.00 0.00 ? 49 PHE P HD2  4  
ATOM 4400  H HE1  . PHE A 1 51 ? -7.298  0.111   -0.556  1.00 0.00 ? 49 PHE P HE1  4  
ATOM 4401  H HE2  . PHE A 1 51 ? -10.951 -0.140  -2.803  1.00 0.00 ? 49 PHE P HE2  4  
ATOM 4402  H HZ   . PHE A 1 51 ? -8.606  0.639   -2.605  1.00 0.00 ? 49 PHE P HZ   4  
ATOM 4403  N N    . LYS A 1 52 ? -12.596 -2.422  4.427   1.00 0.00 ? 50 LYS P N    4  
ATOM 4404  C CA   . LYS A 1 52 ? -13.713 -2.812  5.311   1.00 0.00 ? 50 LYS P CA   4  
ATOM 4405  C C    . LYS A 1 52 ? -14.311 -1.604  6.050   1.00 0.00 ? 50 LYS P C    4  
ATOM 4406  O O    . LYS A 1 52 ? -15.530 -1.503  6.176   1.00 0.00 ? 50 LYS P O    4  
ATOM 4407  C CB   . LYS A 1 52 ? -13.239 -3.917  6.274   1.00 0.00 ? 50 LYS P CB   4  
ATOM 4408  C CG   . LYS A 1 52 ? -14.400 -4.502  7.099   1.00 0.00 ? 50 LYS P CG   4  
ATOM 4409  C CD   . LYS A 1 52 ? -13.990 -5.716  7.947   1.00 0.00 ? 50 LYS P CD   4  
ATOM 4410  C CE   . LYS A 1 52 ? -12.986 -5.350  9.050   1.00 0.00 ? 50 LYS P CE   4  
ATOM 4411  N NZ   . LYS A 1 52 ? -12.693 -6.516  9.927   1.00 0.00 ? 50 LYS P NZ   4  
ATOM 4412  H H    . LYS A 1 52 ? -11.649 -2.633  4.728   1.00 0.00 ? 50 LYS P H    4  
ATOM 4413  H HA   . LYS A 1 52 ? -14.510 -3.231  4.696   1.00 0.00 ? 50 LYS P HA   4  
ATOM 4414  H HB2  . LYS A 1 52 ? -12.796 -4.723  5.687   1.00 0.00 ? 50 LYS P HB2  4  
ATOM 4415  H HB3  . LYS A 1 52 ? -12.477 -3.515  6.943   1.00 0.00 ? 50 LYS P HB3  4  
ATOM 4416  H HG2  . LYS A 1 52 ? -14.806 -3.735  7.759   1.00 0.00 ? 50 LYS P HG2  4  
ATOM 4417  H HG3  . LYS A 1 52 ? -15.189 -4.817  6.415   1.00 0.00 ? 50 LYS P HG3  4  
ATOM 4418  H HD2  . LYS A 1 52 ? -14.891 -6.125  8.408   1.00 0.00 ? 50 LYS P HD2  4  
ATOM 4419  H HD3  . LYS A 1 52 ? -13.561 -6.482  7.297   1.00 0.00 ? 50 LYS P HD3  4  
ATOM 4420  H HE2  . LYS A 1 52 ? -12.063 -4.990  8.587   1.00 0.00 ? 50 LYS P HE2  4  
ATOM 4421  H HE3  . LYS A 1 52 ? -13.405 -4.534  9.647   1.00 0.00 ? 50 LYS P HE3  4  
ATOM 4422  H HZ1  . LYS A 1 52 ? -13.531 -6.854  10.381  1.00 0.00 ? 50 LYS P HZ1  4  
ATOM 4423  H HZ2  . LYS A 1 52 ? -12.035 -6.270  10.655  1.00 0.00 ? 50 LYS P HZ2  4  
ATOM 4424  H HZ3  . LYS A 1 52 ? -12.296 -7.283  9.402   1.00 0.00 ? 50 LYS P HZ3  4  
ATOM 4425  N N    . ASN A 1 53 ? -13.484 -0.643  6.467   1.00 0.00 ? 51 ASN P N    4  
ATOM 4426  C CA   . ASN A 1 53 ? -13.957 0.634   7.017   1.00 0.00 ? 51 ASN P CA   4  
ATOM 4427  C C    . ASN A 1 53 ? -14.622 1.522   5.949   1.00 0.00 ? 51 ASN P C    4  
ATOM 4428  O O    . ASN A 1 53 ? -15.650 2.135   6.228   1.00 0.00 ? 51 ASN P O    4  
ATOM 4429  C CB   . ASN A 1 53 ? -12.802 1.359   7.733   1.00 0.00 ? 51 ASN P CB   4  
ATOM 4430  C CG   . ASN A 1 53 ? -12.613 0.872   9.156   1.00 0.00 ? 51 ASN P CG   4  
ATOM 4431  O OD1  . ASN A 1 53 ? -13.135 1.437   10.107  1.00 0.00 ? 51 ASN P OD1  4  
ATOM 4432  N ND2  . ASN A 1 53 ? -11.877 -0.196  9.354   1.00 0.00 ? 51 ASN P ND2  4  
ATOM 4433  H H    . ASN A 1 53 ? -12.486 -0.808  6.387   1.00 0.00 ? 51 ASN P H    4  
ATOM 4434  H HA   . ASN A 1 53 ? -14.735 0.428   7.755   1.00 0.00 ? 51 ASN P HA   4  
ATOM 4435  H HB2  . ASN A 1 53 ? -11.870 1.243   7.183   1.00 0.00 ? 51 ASN P HB2  4  
ATOM 4436  H HB3  . ASN A 1 53 ? -13.026 2.425   7.786   1.00 0.00 ? 51 ASN P HB3  4  
ATOM 4437  H HD21 . ASN A 1 53 ? -11.450 -0.669  8.565   1.00 0.00 ? 51 ASN P HD21 4  
ATOM 4438  H HD22 . ASN A 1 53 ? -11.740 -0.510  10.298  1.00 0.00 ? 51 ASN P HD22 4  
ATOM 4439  N N    . ARG A 1 54 ? -14.106 1.570   4.714   1.00 0.00 ? 52 ARG P N    4  
ATOM 4440  C CA   . ARG A 1 54 ? -14.652 2.420   3.637   1.00 0.00 ? 52 ARG P CA   4  
ATOM 4441  C C    . ARG A 1 54 ? -16.069 2.012   3.230   1.00 0.00 ? 52 ARG P C    4  
ATOM 4442  O O    . ARG A 1 54 ? -16.936 2.874   3.092   1.00 0.00 ? 52 ARG P O    4  
ATOM 4443  C CB   . ARG A 1 54 ? -13.694 2.408   2.429   1.00 0.00 ? 52 ARG P CB   4  
ATOM 4444  C CG   . ARG A 1 54 ? -13.895 3.581   1.450   1.00 0.00 ? 52 ARG P CG   4  
ATOM 4445  C CD   . ARG A 1 54 ? -13.540 4.948   2.056   1.00 0.00 ? 52 ARG P CD   4  
ATOM 4446  N NE   . ARG A 1 54 ? -13.626 6.025   1.046   1.00 0.00 ? 52 ARG P NE   4  
ATOM 4447  C CZ   . ARG A 1 54 ? -12.879 7.115   0.967   1.00 0.00 ? 52 ARG P CZ   4  
ATOM 4448  N NH1  . ARG A 1 54 ? -11.945 7.411   1.818   1.00 0.00 ? 52 ARG P NH1  4  
ATOM 4449  N NH2  . ARG A 1 54 ? -13.026 7.976   0.007   1.00 0.00 ? 52 ARG P NH2  4  
ATOM 4450  H H    . ARG A 1 54 ? -13.216 1.102   4.559   1.00 0.00 ? 52 ARG P H    4  
ATOM 4451  H HA   . ARG A 1 54 ? -14.729 3.432   4.032   1.00 0.00 ? 52 ARG P HA   4  
ATOM 4452  H HB2  . ARG A 1 54 ? -12.658 2.414   2.776   1.00 0.00 ? 52 ARG P HB2  4  
ATOM 4453  H HB3  . ARG A 1 54 ? -13.858 1.479   1.883   1.00 0.00 ? 52 ARG P HB3  4  
ATOM 4454  H HG2  . ARG A 1 54 ? -13.254 3.411   0.584   1.00 0.00 ? 52 ARG P HG2  4  
ATOM 4455  H HG3  . ARG A 1 54 ? -14.930 3.596   1.105   1.00 0.00 ? 52 ARG P HG3  4  
ATOM 4456  H HD2  . ARG A 1 54 ? -14.230 5.178   2.869   1.00 0.00 ? 52 ARG P HD2  4  
ATOM 4457  H HD3  . ARG A 1 54 ? -12.531 4.890   2.466   1.00 0.00 ? 52 ARG P HD3  4  
ATOM 4458  H HE   . ARG A 1 54 ? -14.326 5.915   0.329   1.00 0.00 ? 52 ARG P HE   4  
ATOM 4459  H HH11 . ARG A 1 54 ? -11.773 6.819   2.609   1.00 0.00 ? 52 ARG P HH11 4  
ATOM 4460  H HH12 . ARG A 1 54 ? -11.385 8.240   1.629   1.00 0.00 ? 52 ARG P HH12 4  
ATOM 4461  H HH21 . ARG A 1 54 ? -13.742 7.874   -0.690  1.00 0.00 ? 52 ARG P HH21 4  
ATOM 4462  H HH22 . ARG A 1 54 ? -12.378 8.761   -0.008  1.00 0.00 ? 52 ARG P HH22 4  
ATOM 4463  N N    . ARG A 1 55 ? -16.341 0.704   3.125   1.00 0.00 ? 53 ARG P N    4  
ATOM 4464  C CA   . ARG A 1 55 ? -17.699 0.184   2.859   1.00 0.00 ? 53 ARG P CA   4  
ATOM 4465  C C    . ARG A 1 55 ? -18.649 0.386   4.046   1.00 0.00 ? 53 ARG P C    4  
ATOM 4466  O O    . ARG A 1 55 ? -19.822 0.684   3.837   1.00 0.00 ? 53 ARG P O    4  
ATOM 4467  C CB   . ARG A 1 55 ? -17.646 -1.270  2.353   1.00 0.00 ? 53 ARG P CB   4  
ATOM 4468  C CG   . ARG A 1 55 ? -17.204 -2.288  3.416   1.00 0.00 ? 53 ARG P CG   4  
ATOM 4469  C CD   . ARG A 1 55 ? -16.955 -3.679  2.827   1.00 0.00 ? 53 ARG P CD   4  
ATOM 4470  N NE   . ARG A 1 55 ? -15.752 -3.690  1.973   1.00 0.00 ? 53 ARG P NE   4  
ATOM 4471  C CZ   . ARG A 1 55 ? -15.338 -4.679  1.202   1.00 0.00 ? 53 ARG P CZ   4  
ATOM 4472  N NH1  . ARG A 1 55 ? -15.949 -5.829  1.160   1.00 0.00 ? 53 ARG P NH1  4  
ATOM 4473  N NH2  . ARG A 1 55 ? -14.286 -4.526  0.453   1.00 0.00 ? 53 ARG P NH2  4  
ATOM 4474  H H    . ARG A 1 55 ? -15.569 0.056   3.230   1.00 0.00 ? 53 ARG P H    4  
ATOM 4475  H HA   . ARG A 1 55 ? -18.120 0.776   2.045   1.00 0.00 ? 53 ARG P HA   4  
ATOM 4476  H HB2  . ARG A 1 55 ? -18.636 -1.556  1.993   1.00 0.00 ? 53 ARG P HB2  4  
ATOM 4477  H HB3  . ARG A 1 55 ? -16.963 -1.308  1.503   1.00 0.00 ? 53 ARG P HB3  4  
ATOM 4478  H HG2  . ARG A 1 55 ? -16.284 -1.942  3.874   1.00 0.00 ? 53 ARG P HG2  4  
ATOM 4479  H HG3  . ARG A 1 55 ? -17.973 -2.365  4.185   1.00 0.00 ? 53 ARG P HG3  4  
ATOM 4480  H HD2  . ARG A 1 55 ? -16.815 -4.382  3.652   1.00 0.00 ? 53 ARG P HD2  4  
ATOM 4481  H HD3  . ARG A 1 55 ? -17.833 -3.980  2.254   1.00 0.00 ? 53 ARG P HD3  4  
ATOM 4482  H HE   . ARG A 1 55 ? -15.165 -2.864  1.999   1.00 0.00 ? 53 ARG P HE   4  
ATOM 4483  H HH11 . ARG A 1 55 ? -16.760 -5.975  1.736   1.00 0.00 ? 53 ARG P HH11 4  
ATOM 4484  H HH12 . ARG A 1 55 ? -15.618 -6.569  0.564   1.00 0.00 ? 53 ARG P HH12 4  
ATOM 4485  H HH21 . ARG A 1 55 ? -13.836 -3.629  0.403   1.00 0.00 ? 53 ARG P HH21 4  
ATOM 4486  H HH22 . ARG A 1 55 ? -13.964 -5.286  -0.120  1.00 0.00 ? 53 ARG P HH22 4  
ATOM 4487  N N    . ALA A 1 56 ? -18.147 0.339   5.281   1.00 0.00 ? 54 ALA P N    4  
ATOM 4488  C CA   . ALA A 1 56 ? -18.936 0.700   6.462   1.00 0.00 ? 54 ALA P CA   4  
ATOM 4489  C C    . ALA A 1 56 ? -19.301 2.199   6.462   1.00 0.00 ? 54 ALA P C    4  
ATOM 4490  O O    . ALA A 1 56 ? -20.454 2.553   6.708   1.00 0.00 ? 54 ALA P O    4  
ATOM 4491  C CB   . ALA A 1 56 ? -18.175 0.281   7.725   1.00 0.00 ? 54 ALA P CB   4  
ATOM 4492  H H    . ALA A 1 56 ? -17.176 0.087   5.402   1.00 0.00 ? 54 ALA P H    4  
ATOM 4493  H HA   . ALA A 1 56 ? -19.871 0.138   6.439   1.00 0.00 ? 54 ALA P HA   4  
ATOM 4494  H HB1  . ALA A 1 56 ? -17.245 0.841   7.818   1.00 0.00 ? 54 ALA P HB1  4  
ATOM 4495  H HB2  . ALA A 1 56 ? -18.791 0.476   8.604   1.00 0.00 ? 54 ALA P HB2  4  
ATOM 4496  H HB3  . ALA A 1 56 ? -17.949 -0.786  7.686   1.00 0.00 ? 54 ALA P HB3  4  
ATOM 4497  N N    . LYS A 1 57 ? -18.362 3.083   6.094   1.00 0.00 ? 55 LYS P N    4  
ATOM 4498  C CA   . LYS A 1 57 ? -18.586 4.535   5.979   1.00 0.00 ? 55 LYS P CA   4  
ATOM 4499  C C    . LYS A 1 57 ? -19.572 4.870   4.856   1.00 0.00 ? 55 LYS P C    4  
ATOM 4500  O O    . LYS A 1 57 ? -20.413 5.748   5.038   1.00 0.00 ? 55 LYS P O    4  
ATOM 4501  C CB   . LYS A 1 57 ? -17.243 5.261   5.791   1.00 0.00 ? 55 LYS P CB   4  
ATOM 4502  C CG   . LYS A 1 57 ? -16.430 5.302   7.093   1.00 0.00 ? 55 LYS P CG   4  
ATOM 4503  C CD   . LYS A 1 57 ? -15.034 5.887   6.838   1.00 0.00 ? 55 LYS P CD   4  
ATOM 4504  C CE   . LYS A 1 57 ? -14.153 5.846   8.093   1.00 0.00 ? 55 LYS P CE   4  
ATOM 4505  N NZ   . LYS A 1 57 ? -14.602 6.805   9.140   1.00 0.00 ? 55 LYS P NZ   4  
ATOM 4506  H H    . LYS A 1 57 ? -17.436 2.723   5.881   1.00 0.00 ? 55 LYS P H    4  
ATOM 4507  H HA   . LYS A 1 57 ? -19.047 4.892   6.904   1.00 0.00 ? 55 LYS P HA   4  
ATOM 4508  H HB2  . LYS A 1 57 ? -16.662 4.765   5.013   1.00 0.00 ? 55 LYS P HB2  4  
ATOM 4509  H HB3  . LYS A 1 57 ? -17.429 6.290   5.477   1.00 0.00 ? 55 LYS P HB3  4  
ATOM 4510  H HG2  . LYS A 1 57 ? -16.963 5.915   7.821   1.00 0.00 ? 55 LYS P HG2  4  
ATOM 4511  H HG3  . LYS A 1 57 ? -16.327 4.296   7.498   1.00 0.00 ? 55 LYS P HG3  4  
ATOM 4512  H HD2  . LYS A 1 57 ? -14.543 5.293   6.065   1.00 0.00 ? 55 LYS P HD2  4  
ATOM 4513  H HD3  . LYS A 1 57 ? -15.119 6.913   6.477   1.00 0.00 ? 55 LYS P HD3  4  
ATOM 4514  H HE2  . LYS A 1 57 ? -14.161 4.825   8.487   1.00 0.00 ? 55 LYS P HE2  4  
ATOM 4515  H HE3  . LYS A 1 57 ? -13.128 6.082   7.796   1.00 0.00 ? 55 LYS P HE3  4  
ATOM 4516  H HZ1  . LYS A 1 57 ? -13.988 6.776   9.944   1.00 0.00 ? 55 LYS P HZ1  4  
ATOM 4517  H HZ2  . LYS A 1 57 ? -15.535 6.593   9.465   1.00 0.00 ? 55 LYS P HZ2  4  
ATOM 4518  H HZ3  . LYS A 1 57 ? -14.600 7.755   8.793   1.00 0.00 ? 55 LYS P HZ3  4  
ATOM 4519  N N    . TRP A 1 58 ? -19.545 4.125   3.743   1.00 0.00 ? 56 TRP P N    4  
ATOM 4520  C CA   . TRP A 1 58 ? -20.596 4.201   2.720   1.00 0.00 ? 56 TRP P CA   4  
ATOM 4521  C C    . TRP A 1 58 ? -21.962 3.797   3.303   1.00 0.00 ? 56 TRP P C    4  
ATOM 4522  O O    . TRP A 1 58 ? -22.926 4.555   3.187   1.00 0.00 ? 56 TRP P O    4  
ATOM 4523  C CB   . TRP A 1 58 ? -20.217 3.339   1.505   1.00 0.00 ? 56 TRP P CB   4  
ATOM 4524  C CG   . TRP A 1 58 ? -21.381 2.811   0.716   1.00 0.00 ? 56 TRP P CG   4  
ATOM 4525  C CD1  . TRP A 1 58 ? -22.340 3.557   0.119   1.00 0.00 ? 56 TRP P CD1  4  
ATOM 4526  C CD2  . TRP A 1 58 ? -21.792 1.421   0.530   1.00 0.00 ? 56 TRP P CD2  4  
ATOM 4527  N NE1  . TRP A 1 58 ? -23.323 2.726   -0.386  1.00 0.00 ? 56 TRP P NE1  4  
ATOM 4528  C CE2  . TRP A 1 58 ? -23.045 1.401   -0.149  1.00 0.00 ? 56 TRP P CE2  4  
ATOM 4529  C CE3  . TRP A 1 58 ? -21.254 0.173   0.905   1.00 0.00 ? 56 TRP P CE3  4  
ATOM 4530  C CZ2  . TRP A 1 58 ? -23.740 0.215   -0.423  1.00 0.00 ? 56 TRP P CZ2  4  
ATOM 4531  C CZ3  . TRP A 1 58 ? -21.935 -1.028  0.631   1.00 0.00 ? 56 TRP P CZ3  4  
ATOM 4532  C CH2  . TRP A 1 58 ? -23.177 -1.012  -0.030  1.00 0.00 ? 56 TRP P CH2  4  
ATOM 4533  H H    . TRP A 1 58 ? -18.781 3.469   3.613   1.00 0.00 ? 56 TRP P H    4  
ATOM 4534  H HA   . TRP A 1 58 ? -20.690 5.233   2.383   1.00 0.00 ? 56 TRP P HA   4  
ATOM 4535  H HB2  . TRP A 1 58 ? -19.574 3.921   0.845   1.00 0.00 ? 56 TRP P HB2  4  
ATOM 4536  H HB3  . TRP A 1 58 ? -19.636 2.487   1.858   1.00 0.00 ? 56 TRP P HB3  4  
ATOM 4537  H HD1  . TRP A 1 58 ? -22.359 4.642   0.108   1.00 0.00 ? 56 TRP P HD1  4  
ATOM 4538  H HE1  . TRP A 1 58 ? -24.185 3.047   -0.820  1.00 0.00 ? 56 TRP P HE1  4  
ATOM 4539  H HE3  . TRP A 1 58 ? -20.320 0.158   1.443   1.00 0.00 ? 56 TRP P HE3  4  
ATOM 4540  H HZ2  . TRP A 1 58 ? -24.700 0.252   -0.918  1.00 0.00 ? 56 TRP P HZ2  4  
ATOM 4541  H HZ3  . TRP A 1 58 ? -21.504 -1.966  0.949   1.00 0.00 ? 56 TRP P HZ3  4  
ATOM 4542  H HH2  . TRP A 1 58 ? -23.699 -1.939  -0.232  1.00 0.00 ? 56 TRP P HH2  4  
ATOM 4543  N N    . ARG A 1 59 ? -22.048 2.652   3.994   1.00 0.00 ? 57 ARG P N    4  
ATOM 4544  C CA   . ARG A 1 59 ? -23.291 2.142   4.608   1.00 0.00 ? 57 ARG P CA   4  
ATOM 4545  C C    . ARG A 1 59 ? -23.891 3.060   5.685   1.00 0.00 ? 57 ARG P C    4  
ATOM 4546  O O    . ARG A 1 59 ? -25.106 3.042   5.873   1.00 0.00 ? 57 ARG P O    4  
ATOM 4547  C CB   . ARG A 1 59 ? -23.033 0.737   5.182   1.00 0.00 ? 57 ARG P CB   4  
ATOM 4548  C CG   . ARG A 1 59 ? -23.025 -0.332  4.084   1.00 0.00 ? 57 ARG P CG   4  
ATOM 4549  C CD   . ARG A 1 59 ? -22.590 -1.688  4.647   1.00 0.00 ? 57 ARG P CD   4  
ATOM 4550  N NE   . ARG A 1 59 ? -22.649 -2.740  3.614   1.00 0.00 ? 57 ARG P NE   4  
ATOM 4551  C CZ   . ARG A 1 59 ? -22.254 -3.994  3.741   1.00 0.00 ? 57 ARG P CZ   4  
ATOM 4552  N NH1  . ARG A 1 59 ? -21.739 -4.451  4.848   1.00 0.00 ? 57 ARG P NH1  4  
ATOM 4553  N NH2  . ARG A 1 59 ? -22.371 -4.825  2.745   1.00 0.00 ? 57 ARG P NH2  4  
ATOM 4554  H H    . ARG A 1 59 ? -21.224 2.059   4.019   1.00 0.00 ? 57 ARG P H    4  
ATOM 4555  H HA   . ARG A 1 59 ? -24.045 2.062   3.820   1.00 0.00 ? 57 ARG P HA   4  
ATOM 4556  H HB2  . ARG A 1 59 ? -22.076 0.729   5.702   1.00 0.00 ? 57 ARG P HB2  4  
ATOM 4557  H HB3  . ARG A 1 59 ? -23.819 0.482   5.897   1.00 0.00 ? 57 ARG P HB3  4  
ATOM 4558  H HG2  . ARG A 1 59 ? -24.024 -0.416  3.654   1.00 0.00 ? 57 ARG P HG2  4  
ATOM 4559  H HG3  . ARG A 1 59 ? -22.329 -0.039  3.303   1.00 0.00 ? 57 ARG P HG3  4  
ATOM 4560  H HD2  . ARG A 1 59 ? -21.569 -1.594  5.020   1.00 0.00 ? 57 ARG P HD2  4  
ATOM 4561  H HD3  . ARG A 1 59 ? -23.250 -1.955  5.476   1.00 0.00 ? 57 ARG P HD3  4  
ATOM 4562  H HE   . ARG A 1 59 ? -23.043 -2.478  2.724   1.00 0.00 ? 57 ARG P HE   4  
ATOM 4563  H HH11 . ARG A 1 59 ? -21.655 -3.838  5.639   1.00 0.00 ? 57 ARG P HH11 4  
ATOM 4564  H HH12 . ARG A 1 59 ? -21.457 -5.414  4.923   1.00 0.00 ? 57 ARG P HH12 4  
ATOM 4565  H HH21 . ARG A 1 59 ? -22.779 -4.525  1.875   1.00 0.00 ? 57 ARG P HH21 4  
ATOM 4566  H HH22 . ARG A 1 59 ? -22.076 -5.782  2.847   1.00 0.00 ? 57 ARG P HH22 4  
ATOM 4567  N N    . LYS A 1 60 ? -23.085 3.903   6.349   1.00 0.00 ? 58 LYS P N    4  
ATOM 4568  C CA   . LYS A 1 60 ? -23.566 4.969   7.261   1.00 0.00 ? 58 LYS P CA   4  
ATOM 4569  C C    . LYS A 1 60 ? -24.316 6.101   6.537   1.00 0.00 ? 58 LYS P C    4  
ATOM 4570  O O    . LYS A 1 60 ? -25.155 6.756   7.156   1.00 0.00 ? 58 LYS P O    4  
ATOM 4571  C CB   . LYS A 1 60 ? -22.397 5.561   8.083   1.00 0.00 ? 58 LYS P CB   4  
ATOM 4572  C CG   . LYS A 1 60 ? -22.225 4.937   9.478   1.00 0.00 ? 58 LYS P CG   4  
ATOM 4573  C CD   . LYS A 1 60 ? -21.602 3.535   9.447   1.00 0.00 ? 58 LYS P CD   4  
ATOM 4574  C CE   . LYS A 1 60 ? -21.349 2.963   10.848  1.00 0.00 ? 58 LYS P CE   4  
ATOM 4575  N NZ   . LYS A 1 60 ? -22.607 2.640   11.573  1.00 0.00 ? 58 LYS P NZ   4  
ATOM 4576  H H    . LYS A 1 60 ? -22.088 3.791   6.205   1.00 0.00 ? 58 LYS P H    4  
ATOM 4577  H HA   . LYS A 1 60 ? -24.293 4.537   7.951   1.00 0.00 ? 58 LYS P HA   4  
ATOM 4578  H HB2  . LYS A 1 60 ? -21.462 5.491   7.527   1.00 0.00 ? 58 LYS P HB2  4  
ATOM 4579  H HB3  . LYS A 1 60 ? -22.589 6.624   8.246   1.00 0.00 ? 58 LYS P HB3  4  
ATOM 4580  H HG2  . LYS A 1 60 ? -21.570 5.587   10.060  1.00 0.00 ? 58 LYS P HG2  4  
ATOM 4581  H HG3  . LYS A 1 60 ? -23.195 4.905   9.975   1.00 0.00 ? 58 LYS P HG3  4  
ATOM 4582  H HD2  . LYS A 1 60 ? -22.234 2.852   8.876   1.00 0.00 ? 58 LYS P HD2  4  
ATOM 4583  H HD3  . LYS A 1 60 ? -20.634 3.613   8.954   1.00 0.00 ? 58 LYS P HD3  4  
ATOM 4584  H HE2  . LYS A 1 60 ? -20.745 2.058   10.737  1.00 0.00 ? 58 LYS P HE2  4  
ATOM 4585  H HE3  . LYS A 1 60 ? -20.756 3.687   11.416  1.00 0.00 ? 58 LYS P HE3  4  
ATOM 4586  H HZ1  . LYS A 1 60 ? -22.407 2.237   12.479  1.00 0.00 ? 58 LYS P HZ1  4  
ATOM 4587  H HZ2  . LYS A 1 60 ? -23.165 1.970   11.062  1.00 0.00 ? 58 LYS P HZ2  4  
ATOM 4588  H HZ3  . LYS A 1 60 ? -23.170 3.465   11.729  1.00 0.00 ? 58 LYS P HZ3  4  
ATOM 4589  N N    . ARG A 1 61 ? -24.021 6.343   5.252   1.00 0.00 ? 59 ARG P N    4  
ATOM 4590  C CA   . ARG A 1 61 ? -24.570 7.452   4.441   1.00 0.00 ? 59 ARG P CA   4  
ATOM 4591  C C    . ARG A 1 61 ? -25.567 7.008   3.361   1.00 0.00 ? 59 ARG P C    4  
ATOM 4592  O O    . ARG A 1 61 ? -26.415 7.804   2.961   1.00 0.00 ? 59 ARG P O    4  
ATOM 4593  C CB   . ARG A 1 61 ? -23.406 8.248   3.819   1.00 0.00 ? 59 ARG P CB   4  
ATOM 4594  C CG   . ARG A 1 61 ? -22.414 8.857   4.829   1.00 0.00 ? 59 ARG P CG   4  
ATOM 4595  C CD   . ARG A 1 61 ? -23.048 9.821   5.847   1.00 0.00 ? 59 ARG P CD   4  
ATOM 4596  N NE   . ARG A 1 61 ? -23.721 10.968  5.200   1.00 0.00 ? 59 ARG P NE   4  
ATOM 4597  C CZ   . ARG A 1 61 ? -23.166 12.089  4.769   1.00 0.00 ? 59 ARG P CZ   4  
ATOM 4598  N NH1  . ARG A 1 61 ? -21.886 12.318  4.868   1.00 0.00 ? 59 ARG P NH1  4  
ATOM 4599  N NH2  . ARG A 1 61 ? -23.898 13.015  4.221   1.00 0.00 ? 59 ARG P NH2  4  
ATOM 4600  H H    . ARG A 1 61 ? -23.312 5.756   4.828   1.00 0.00 ? 59 ARG P H    4  
ATOM 4601  H HA   . ARG A 1 61 ? -25.138 8.126   5.084   1.00 0.00 ? 59 ARG P HA   4  
ATOM 4602  H HB2  . ARG A 1 61 ? -22.849 7.589   3.150   1.00 0.00 ? 59 ARG P HB2  4  
ATOM 4603  H HB3  . ARG A 1 61 ? -23.820 9.057   3.215   1.00 0.00 ? 59 ARG P HB3  4  
ATOM 4604  H HG2  . ARG A 1 61 ? -21.922 8.053   5.378   1.00 0.00 ? 59 ARG P HG2  4  
ATOM 4605  H HG3  . ARG A 1 61 ? -21.643 9.390   4.272   1.00 0.00 ? 59 ARG P HG3  4  
ATOM 4606  H HD2  . ARG A 1 61 ? -23.772 9.274   6.453   1.00 0.00 ? 59 ARG P HD2  4  
ATOM 4607  H HD3  . ARG A 1 61 ? -22.271 10.178  6.526   1.00 0.00 ? 59 ARG P HD3  4  
ATOM 4608  H HE   . ARG A 1 61 ? -24.721 10.901  5.090   1.00 0.00 ? 59 ARG P HE   4  
ATOM 4609  H HH11 . ARG A 1 61 ? -21.294 11.625  5.292   1.00 0.00 ? 59 ARG P HH11 4  
ATOM 4610  H HH12 . ARG A 1 61 ? -21.493 13.181  4.532   1.00 0.00 ? 59 ARG P HH12 4  
ATOM 4611  H HH21 . ARG A 1 61 ? -24.892 12.886  4.124   1.00 0.00 ? 59 ARG P HH21 4  
ATOM 4612  H HH22 . ARG A 1 61 ? -23.477 13.868  3.894   1.00 0.00 ? 59 ARG P HH22 4  
ATOM 4613  N N    . GLU A 1 62 ? -25.484 5.754   2.911   1.00 0.00 ? 60 GLU P N    4  
ATOM 4614  C CA   . GLU A 1 62 ? -26.348 5.136   1.886   1.00 0.00 ? 60 GLU P CA   4  
ATOM 4615  C C    . GLU A 1 62 ? -26.405 5.933   0.562   1.00 0.00 ? 60 GLU P C    4  
ATOM 4616  O O    . GLU A 1 62 ? -27.456 6.073   -0.068  1.00 0.00 ? 60 GLU P O    4  
ATOM 4617  C CB   . GLU A 1 62 ? -27.733 4.776   2.462   1.00 0.00 ? 60 GLU P CB   4  
ATOM 4618  C CG   . GLU A 1 62 ? -27.644 3.814   3.654   1.00 0.00 ? 60 GLU P CG   4  
ATOM 4619  C CD   . GLU A 1 62 ? -29.048 3.389   4.126   1.00 0.00 ? 60 GLU P CD   4  
ATOM 4620  O OE1  . GLU A 1 62 ? -29.695 4.148   4.888   1.00 0.00 ? 60 GLU P OE1  4  
ATOM 4621  O OE2  . GLU A 1 62 ? -29.517 2.288   3.743   1.00 0.00 ? 60 GLU P OE2  4  
ATOM 4622  H H    . GLU A 1 62 ? -24.715 5.198   3.265   1.00 0.00 ? 60 GLU P H    4  
ATOM 4623  H HA   . GLU A 1 62 ? -25.878 4.189   1.614   1.00 0.00 ? 60 GLU P HA   4  
ATOM 4624  H HB2  . GLU A 1 62 ? -28.252 5.686   2.768   1.00 0.00 ? 60 GLU P HB2  4  
ATOM 4625  H HB3  . GLU A 1 62 ? -28.321 4.291   1.684   1.00 0.00 ? 60 GLU P HB3  4  
ATOM 4626  H HG2  . GLU A 1 62 ? -27.065 2.935   3.356   1.00 0.00 ? 60 GLU P HG2  4  
ATOM 4627  H HG3  . GLU A 1 62 ? -27.118 4.304   4.475   1.00 0.00 ? 60 GLU P HG3  4  
ATOM 4628  N N    . GLU A 1 63 ? -25.257 6.468   0.130   1.00 0.00 ? 61 GLU P N    4  
ATOM 4629  C CA   . GLU A 1 63 ? -25.130 7.281   -1.101  1.00 0.00 ? 61 GLU P CA   4  
ATOM 4630  C C    . GLU A 1 63 ? -25.379 6.477   -2.394  1.00 0.00 ? 61 GLU P C    4  
ATOM 4631  O O    . GLU A 1 63 ? -25.766 7.033   -3.425  1.00 0.00 ? 61 GLU P O    4  
ATOM 4632  C CB   . GLU A 1 63 ? -23.731 7.915   -1.157  1.00 0.00 ? 61 GLU P CB   4  
ATOM 4633  C CG   . GLU A 1 63 ? -23.520 8.966   -0.060  1.00 0.00 ? 61 GLU P CG   4  
ATOM 4634  C CD   . GLU A 1 63 ? -22.159 9.670   -0.225  1.00 0.00 ? 61 GLU P CD   4  
ATOM 4635  O OE1  . GLU A 1 63 ? -21.138 9.155   0.291   1.00 0.00 ? 61 GLU P OE1  4  
ATOM 4636  O OE2  . GLU A 1 63 ? -22.102 10.747  -0.869  1.00 0.00 ? 61 GLU P OE2  4  
ATOM 4637  H H    . GLU A 1 63 ? -24.438 6.335   0.708   1.00 0.00 ? 61 GLU P H    4  
ATOM 4638  H HA   . GLU A 1 63 ? -25.872 8.082   -1.075  1.00 0.00 ? 61 GLU P HA   4  
ATOM 4639  H HB2  . GLU A 1 63 ? -22.974 7.134   -1.064  1.00 0.00 ? 61 GLU P HB2  4  
ATOM 4640  H HB3  . GLU A 1 63 ? -23.605 8.395   -2.127  1.00 0.00 ? 61 GLU P HB3  4  
ATOM 4641  H HG2  . GLU A 1 63 ? -24.328 9.701   -0.110  1.00 0.00 ? 61 GLU P HG2  4  
ATOM 4642  H HG3  . GLU A 1 63 ? -23.570 8.481   0.915   1.00 0.00 ? 61 GLU P HG3  4  
ATOM 4643  N N    . PHE A 1 64 ? -25.183 5.160   -2.320  1.00 0.00 ? 62 PHE P N    4  
ATOM 4644  C CA   . PHE A 1 64 ? -25.496 4.150   -3.330  1.00 0.00 ? 62 PHE P CA   4  
ATOM 4645  C C    . PHE A 1 64 ? -26.209 2.958   -2.667  1.00 0.00 ? 62 PHE P C    4  
ATOM 4646  O O    . PHE A 1 64 ? -25.988 2.703   -1.480  1.00 0.00 ? 62 PHE P O    4  
ATOM 4647  C CB   . PHE A 1 64 ? -24.184 3.729   -4.005  1.00 0.00 ? 62 PHE P CB   4  
ATOM 4648  C CG   . PHE A 1 64 ? -24.359 2.699   -5.101  1.00 0.00 ? 62 PHE P CG   4  
ATOM 4649  C CD1  . PHE A 1 64 ? -24.798 3.095   -6.379  1.00 0.00 ? 62 PHE P CD1  4  
ATOM 4650  C CD2  . PHE A 1 64 ? -24.120 1.338   -4.833  1.00 0.00 ? 62 PHE P CD2  4  
ATOM 4651  C CE1  . PHE A 1 64 ? -24.996 2.132   -7.386  1.00 0.00 ? 62 PHE P CE1  4  
ATOM 4652  C CE2  . PHE A 1 64 ? -24.321 0.376   -5.838  1.00 0.00 ? 62 PHE P CE2  4  
ATOM 4653  C CZ   . PHE A 1 64 ? -24.758 0.772   -7.115  1.00 0.00 ? 62 PHE P CZ   4  
ATOM 4654  H H    . PHE A 1 64 ? -24.862 4.811   -1.433  1.00 0.00 ? 62 PHE P H    4  
ATOM 4655  H HA   . PHE A 1 64 ? -26.162 4.574   -4.083  1.00 0.00 ? 62 PHE P HA   4  
ATOM 4656  H HB2  . PHE A 1 64 ? -23.714 4.619   -4.423  1.00 0.00 ? 62 PHE P HB2  4  
ATOM 4657  H HB3  . PHE A 1 64 ? -23.505 3.331   -3.250  1.00 0.00 ? 62 PHE P HB3  4  
ATOM 4658  H HD1  . PHE A 1 64 ? -24.988 4.140   -6.586  1.00 0.00 ? 62 PHE P HD1  4  
ATOM 4659  H HD2  . PHE A 1 64 ? -23.794 1.029   -3.848  1.00 0.00 ? 62 PHE P HD2  4  
ATOM 4660  H HE1  . PHE A 1 64 ? -25.335 2.437   -8.367  1.00 0.00 ? 62 PHE P HE1  4  
ATOM 4661  H HE2  . PHE A 1 64 ? -24.147 -0.669  -5.628  1.00 0.00 ? 62 PHE P HE2  4  
ATOM 4662  H HZ   . PHE A 1 64 ? -24.916 0.032   -7.887  1.00 0.00 ? 62 PHE P HZ   4  
ATOM 4663  N N    . ILE A 1 65 ? -27.041 2.226   -3.415  1.00 0.00 ? 63 ILE P N    4  
ATOM 4664  C CA   . ILE A 1 65 ? -27.859 1.107   -2.915  1.00 0.00 ? 63 ILE P CA   4  
ATOM 4665  C C    . ILE A 1 65 ? -27.555 -0.185  -3.690  1.00 0.00 ? 63 ILE P C    4  
ATOM 4666  O O    . ILE A 1 65 ? -27.558 -0.198  -4.923  1.00 0.00 ? 63 ILE P O    4  
ATOM 4667  C CB   . ILE A 1 65 ? -29.366 1.463   -2.978  1.00 0.00 ? 63 ILE P CB   4  
ATOM 4668  C CG1  . ILE A 1 65 ? -29.732 2.755   -2.206  1.00 0.00 ? 63 ILE P CG1  4  
ATOM 4669  C CG2  . ILE A 1 65 ? -30.248 0.296   -2.490  1.00 0.00 ? 63 ILE P CG2  4  
ATOM 4670  C CD1  . ILE A 1 65 ? -29.507 2.722   -0.688  1.00 0.00 ? 63 ILE P CD1  4  
ATOM 4671  H H    . ILE A 1 65 ? -27.120 2.453   -4.397  1.00 0.00 ? 63 ILE P H    4  
ATOM 4672  H HA   . ILE A 1 65 ? -27.607 0.919   -1.871  1.00 0.00 ? 63 ILE P HA   4  
ATOM 4673  H HB   . ILE A 1 65 ? -29.620 1.640   -4.024  1.00 0.00 ? 63 ILE P HB   4  
ATOM 4674  H HG12 . ILE A 1 65 ? -29.169 3.593   -2.619  1.00 0.00 ? 63 ILE P HG12 4  
ATOM 4675  H HG13 . ILE A 1 65 ? -30.787 2.971   -2.384  1.00 0.00 ? 63 ILE P HG13 4  
ATOM 4676  H HG21 . ILE A 1 65 ? -29.943 -0.026  -1.493  1.00 0.00 ? 63 ILE P HG21 4  
ATOM 4677  H HG22 . ILE A 1 65 ? -31.292 0.608   -2.460  1.00 0.00 ? 63 ILE P HG22 4  
ATOM 4678  H HG23 . ILE A 1 65 ? -30.174 -0.548  -3.174  1.00 0.00 ? 63 ILE P HG23 4  
ATOM 4679  H HD11 . ILE A 1 65 ? -29.780 3.690   -0.267  1.00 0.00 ? 63 ILE P HD11 4  
ATOM 4680  H HD12 . ILE A 1 65 ? -28.462 2.523   -0.458  1.00 0.00 ? 63 ILE P HD12 4  
ATOM 4681  H HD13 . ILE A 1 65 ? -30.132 1.957   -0.227  1.00 0.00 ? 63 ILE P HD13 4  
ATOM 4682  N N    . VAL A 1 66 ? -27.350 -1.285  -2.957  1.00 0.00 ? 64 VAL P N    4  
ATOM 4683  C CA   . VAL A 1 66 ? -27.202 -2.654  -3.487  1.00 0.00 ? 64 VAL P CA   4  
ATOM 4684  C C    . VAL A 1 66 ? -28.485 -3.446  -3.215  1.00 0.00 ? 64 VAL P C    4  
ATOM 4685  O O    . VAL A 1 66 ? -28.991 -3.438  -2.090  1.00 0.00 ? 64 VAL P O    4  
ATOM 4686  C CB   . VAL A 1 66 ? -25.978 -3.361  -2.869  1.00 0.00 ? 64 VAL P CB   4  
ATOM 4687  C CG1  . VAL A 1 66 ? -25.801 -4.788  -3.403  1.00 0.00 ? 64 VAL P CG1  4  
ATOM 4688  C CG2  . VAL A 1 66 ? -24.678 -2.599  -3.166  1.00 0.00 ? 64 VAL P CG2  4  
ATOM 4689  H H    . VAL A 1 66 ? -27.391 -1.189  -1.952  1.00 0.00 ? 64 VAL P H    4  
ATOM 4690  H HA   . VAL A 1 66 ? -27.048 -2.612  -4.566  1.00 0.00 ? 64 VAL P HA   4  
ATOM 4691  H HB   . VAL A 1 66 ? -26.115 -3.413  -1.788  1.00 0.00 ? 64 VAL P HB   4  
ATOM 4692  H HG11 . VAL A 1 66 ? -26.644 -5.412  -3.109  1.00 0.00 ? 64 VAL P HG11 4  
ATOM 4693  H HG12 . VAL A 1 66 ? -25.717 -4.777  -4.490  1.00 0.00 ? 64 VAL P HG12 4  
ATOM 4694  H HG13 . VAL A 1 66 ? -24.898 -5.230  -2.982  1.00 0.00 ? 64 VAL P HG13 4  
ATOM 4695  H HG21 . VAL A 1 66 ? -23.836 -3.107  -2.697  1.00 0.00 ? 64 VAL P HG21 4  
ATOM 4696  H HG22 . VAL A 1 66 ? -24.512 -2.556  -4.242  1.00 0.00 ? 64 VAL P HG22 4  
ATOM 4697  H HG23 . VAL A 1 66 ? -24.728 -1.586  -2.770  1.00 0.00 ? 64 VAL P HG23 4  
ATOM 4698  N N    . THR A 1 67 ? -29.010 -4.132  -4.234  1.00 0.00 ? 65 THR P N    4  
ATOM 4699  C CA   . THR A 1 67 ? -30.313 -4.830  -4.184  1.00 0.00 ? 65 THR P CA   4  
ATOM 4700  C C    . THR A 1 67 ? -30.224 -6.360  -4.281  1.00 0.00 ? 65 THR P C    4  
ATOM 4701  O O    . THR A 1 67 ? -31.194 -7.049  -3.952  1.00 0.00 ? 65 THR P O    4  
ATOM 4702  C CB   . THR A 1 67 ? -31.245 -4.305  -5.289  1.00 0.00 ? 65 THR P CB   4  
ATOM 4703  O OG1  . THR A 1 67 ? -30.626 -4.432  -6.556  1.00 0.00 ? 65 THR P OG1  4  
ATOM 4704  C CG2  . THR A 1 67 ? -31.583 -2.827  -5.087  1.00 0.00 ? 65 THR P CG2  4  
ATOM 4705  H H    . THR A 1 67 ? -28.573 -4.052  -5.142  1.00 0.00 ? 65 THR P H    4  
ATOM 4706  H HA   . THR A 1 67 ? -30.791 -4.618  -3.229  1.00 0.00 ? 65 THR P HA   4  
ATOM 4707  H HB   . THR A 1 67 ? -32.173 -4.879  -5.278  1.00 0.00 ? 65 THR P HB   4  
ATOM 4708  H HG1  . THR A 1 67 ? -31.285 -4.184  -7.229  1.00 0.00 ? 65 THR P HG1  4  
ATOM 4709  H HG21 . THR A 1 67 ? -32.314 -2.514  -5.832  1.00 0.00 ? 65 THR P HG21 4  
ATOM 4710  H HG22 . THR A 1 67 ? -30.684 -2.217  -5.188  1.00 0.00 ? 65 THR P HG22 4  
ATOM 4711  H HG23 . THR A 1 67 ? -32.007 -2.682  -4.094  1.00 0.00 ? 65 THR P HG23 4  
ATOM 4712  N N    . ASP A 1 68 ? -29.074 -6.904  -4.699  1.00 0.00 ? 66 ASP P N    4  
ATOM 4713  C CA   . ASP A 1 68 ? -28.796 -8.347  -4.851  1.00 0.00 ? 66 ASP P CA   4  
ATOM 4714  C C    . ASP A 1 68 ? -27.322 -8.707  -4.568  1.00 0.00 ? 66 ASP P C    4  
ATOM 4715  O O    . ASP A 1 68 ? -26.416 -8.055  -5.138  1.00 0.00 ? 66 ASP P O    4  
ATOM 4716  C CB   . ASP A 1 68 ? -29.208 -8.804  -6.266  1.00 0.00 ? 66 ASP P CB   4  
ATOM 4717  C CG   . ASP A 1 68 ? -28.990 -10.316 -6.501  1.00 0.00 ? 66 ASP P CG   4  
ATOM 4718  O OD1  . ASP A 1 68 ? -29.761 -11.137 -5.943  1.00 0.00 ? 66 ASP P OD1  4  
ATOM 4719  O OD2  . ASP A 1 68 ? -28.071 -10.692 -7.271  1.00 0.00 ? 66 ASP P OD2  4  
ATOM 4720  O OXT  . ASP A 1 68 ? -27.083 -9.631  -3.757  1.00 0.00 ? 66 ASP P OXT  4  
ATOM 4721  H H    . ASP A 1 68 ? -28.331 -6.264  -4.941  1.00 0.00 ? 66 ASP P H    4  
ATOM 4722  H HA   . ASP A 1 68 ? -29.404 -8.902  -4.136  1.00 0.00 ? 66 ASP P HA   4  
ATOM 4723  H HB2  . ASP A 1 68 ? -30.265 -8.574  -6.418  1.00 0.00 ? 66 ASP P HB2  4  
ATOM 4724  H HB3  . ASP A 1 68 ? -28.643 -8.232  -7.005  1.00 0.00 ? 66 ASP P HB3  4  
ATOM 4725  N N    . GLY A 1 1  ? -1.251  16.737  23.124  1.00 0.00 ? -1 GLY P N    5  
ATOM 4726  C CA   . GLY A 1 1  ? -1.261  16.713  24.605  1.00 0.00 ? -1 GLY P CA   5  
ATOM 4727  C C    . GLY A 1 1  ? -1.508  15.309  25.132  1.00 0.00 ? -1 GLY P C    5  
ATOM 4728  O O    . GLY A 1 1  ? -2.425  14.628  24.671  1.00 0.00 ? -1 GLY P O    5  
ATOM 4729  H H1   . GLY A 1 1  ? -0.507  16.156  22.769  1.00 0.00 ? -1 GLY P H1   5  
ATOM 4730  H H2   . GLY A 1 1  ? -1.113  17.678  22.793  1.00 0.00 ? -1 GLY P H2   5  
ATOM 4731  H H3   . GLY A 1 1  ? -2.129  16.393  22.766  1.00 0.00 ? -1 GLY P H3   5  
ATOM 4732  H HA2  . GLY A 1 1  ? -0.305  17.074  24.983  1.00 0.00 ? -1 GLY P HA2  5  
ATOM 4733  H HA3  . GLY A 1 1  ? -2.055  17.363  24.975  1.00 0.00 ? -1 GLY P HA3  5  
ATOM 4734  N N    . SER A 1 2  ? -0.716  14.867  26.114  1.00 0.00 ? 0  SER P N    5  
ATOM 4735  C CA   . SER A 1 2  ? -0.662  13.472  26.606  1.00 0.00 ? 0  SER P CA   5  
ATOM 4736  C C    . SER A 1 2  ? -1.953  12.944  27.260  1.00 0.00 ? 0  SER P C    5  
ATOM 4737  O O    . SER A 1 2  ? -2.094  11.735  27.451  1.00 0.00 ? 0  SER P O    5  
ATOM 4738  C CB   . SER A 1 2  ? 0.496   13.325  27.604  1.00 0.00 ? 0  SER P CB   5  
ATOM 4739  O OG   . SER A 1 2  ? 1.710   13.803  27.039  1.00 0.00 ? 0  SER P OG   5  
ATOM 4740  H H    . SER A 1 2  ? 0.018   15.480  26.447  1.00 0.00 ? 0  SER P H    5  
ATOM 4741  H HA   . SER A 1 2  ? -0.448  12.821  25.758  1.00 0.00 ? 0  SER P HA   5  
ATOM 4742  H HB2  . SER A 1 2  ? 0.268   13.897  28.508  1.00 0.00 ? 0  SER P HB2  5  
ATOM 4743  H HB3  . SER A 1 2  ? 0.610   12.274  27.874  1.00 0.00 ? 0  SER P HB3  5  
ATOM 4744  H HG   . SER A 1 2  ? 2.426   13.669  27.692  1.00 0.00 ? 0  SER P HG   5  
ATOM 4745  N N    . GLN A 1 3  ? -2.912  13.821  27.581  1.00 0.00 ? 1  GLN P N    5  
ATOM 4746  C CA   . GLN A 1 3  ? -4.247  13.449  28.071  1.00 0.00 ? 1  GLN P CA   5  
ATOM 4747  C C    . GLN A 1 3  ? -5.128  12.796  26.981  1.00 0.00 ? 1  GLN P C    5  
ATOM 4748  O O    . GLN A 1 3  ? -6.069  12.068  27.310  1.00 0.00 ? 1  GLN P O    5  
ATOM 4749  C CB   . GLN A 1 3  ? -4.898  14.714  28.669  1.00 0.00 ? 1  GLN P CB   5  
ATOM 4750  C CG   . GLN A 1 3  ? -6.288  14.530  29.306  1.00 0.00 ? 1  GLN P CG   5  
ATOM 4751  C CD   . GLN A 1 3  ? -6.309  13.525  30.459  1.00 0.00 ? 1  GLN P CD   5  
ATOM 4752  O OE1  . GLN A 1 3  ? -6.153  13.867  31.625  1.00 0.00 ? 1  GLN P OE1  5  
ATOM 4753  N NE2  . GLN A 1 3  ? -6.495  12.251  30.184  1.00 0.00 ? 1  GLN P NE2  5  
ATOM 4754  H H    . GLN A 1 3  ? -2.715  14.802  27.443  1.00 0.00 ? 1  GLN P H    5  
ATOM 4755  H HA   . GLN A 1 3  ? -4.122  12.717  28.870  1.00 0.00 ? 1  GLN P HA   5  
ATOM 4756  H HB2  . GLN A 1 3  ? -4.230  15.117  29.433  1.00 0.00 ? 1  GLN P HB2  5  
ATOM 4757  H HB3  . GLN A 1 3  ? -4.988  15.464  27.881  1.00 0.00 ? 1  GLN P HB3  5  
ATOM 4758  H HG2  . GLN A 1 3  ? -6.620  15.496  29.687  1.00 0.00 ? 1  GLN P HG2  5  
ATOM 4759  H HG3  . GLN A 1 3  ? -7.005  14.225  28.544  1.00 0.00 ? 1  GLN P HG3  5  
ATOM 4760  H HE21 . GLN A 1 3  ? -6.592  11.956  29.216  1.00 0.00 ? 1  GLN P HE21 5  
ATOM 4761  H HE22 . GLN A 1 3  ? -6.513  11.587  30.943  1.00 0.00 ? 1  GLN P HE22 5  
ATOM 4762  N N    . ARG A 1 4  ? -4.833  13.028  25.692  1.00 0.00 ? 2  ARG P N    5  
ATOM 4763  C CA   . ARG A 1 4  ? -5.553  12.449  24.540  1.00 0.00 ? 2  ARG P CA   5  
ATOM 4764  C C    . ARG A 1 4  ? -4.918  11.131  24.075  1.00 0.00 ? 2  ARG P C    5  
ATOM 4765  O O    . ARG A 1 4  ? -3.699  10.955  24.156  1.00 0.00 ? 2  ARG P O    5  
ATOM 4766  C CB   . ARG A 1 4  ? -5.617  13.471  23.386  1.00 0.00 ? 2  ARG P CB   5  
ATOM 4767  C CG   . ARG A 1 4  ? -6.252  14.827  23.748  1.00 0.00 ? 2  ARG P CG   5  
ATOM 4768  C CD   . ARG A 1 4  ? -7.681  14.742  24.307  1.00 0.00 ? 2  ARG P CD   5  
ATOM 4769  N NE   . ARG A 1 4  ? -8.631  14.178  23.327  1.00 0.00 ? 2  ARG P NE   5  
ATOM 4770  C CZ   . ARG A 1 4  ? -9.905  13.894  23.536  1.00 0.00 ? 2  ARG P CZ   5  
ATOM 4771  N NH1  . ARG A 1 4  ? -10.477 14.076  24.692  1.00 0.00 ? 2  ARG P NH1  5  
ATOM 4772  N NH2  . ARG A 1 4  ? -10.640 13.414  22.573  1.00 0.00 ? 2  ARG P NH2  5  
ATOM 4773  H H    . ARG A 1 4  ? -4.018  13.600  25.493  1.00 0.00 ? 2  ARG P H    5  
ATOM 4774  H HA   . ARG A 1 4  ? -6.574  12.213  24.845  1.00 0.00 ? 2  ARG P HA   5  
ATOM 4775  H HB2  . ARG A 1 4  ? -4.603  13.657  23.026  1.00 0.00 ? 2  ARG P HB2  5  
ATOM 4776  H HB3  . ARG A 1 4  ? -6.177  13.030  22.559  1.00 0.00 ? 2  ARG P HB3  5  
ATOM 4777  H HG2  . ARG A 1 4  ? -5.624  15.328  24.486  1.00 0.00 ? 2  ARG P HG2  5  
ATOM 4778  H HG3  . ARG A 1 4  ? -6.264  15.455  22.855  1.00 0.00 ? 2  ARG P HG3  5  
ATOM 4779  H HD2  . ARG A 1 4  ? -7.673  14.137  25.216  1.00 0.00 ? 2  ARG P HD2  5  
ATOM 4780  H HD3  . ARG A 1 4  ? -8.002  15.751  24.575  1.00 0.00 ? 2  ARG P HD3  5  
ATOM 4781  H HE   . ARG A 1 4  ? -8.291  14.028  22.390  1.00 0.00 ? 2  ARG P HE   5  
ATOM 4782  H HH11 . ARG A 1 4  ? -9.939  14.457  25.452  1.00 0.00 ? 2  ARG P HH11 5  
ATOM 4783  H HH12 . ARG A 1 4  ? -11.450 13.857  24.825  1.00 0.00 ? 2  ARG P HH12 5  
ATOM 4784  H HH21 . ARG A 1 4  ? -10.244 13.262  21.660  1.00 0.00 ? 2  ARG P HH21 5  
ATOM 4785  H HH22 . ARG A 1 4  ? -11.610 13.202  22.733  1.00 0.00 ? 2  ARG P HH22 5  
ATOM 4786  N N    . ARG A 1 5  ? -5.744  10.214  23.554  1.00 0.00 ? 3  ARG P N    5  
ATOM 4787  C CA   . ARG A 1 5  ? -5.320  8.918   22.983  1.00 0.00 ? 3  ARG P CA   5  
ATOM 4788  C C    . ARG A 1 5  ? -4.966  9.053   21.498  1.00 0.00 ? 3  ARG P C    5  
ATOM 4789  O O    . ARG A 1 5  ? -5.636  9.781   20.764  1.00 0.00 ? 3  ARG P O    5  
ATOM 4790  C CB   . ARG A 1 5  ? -6.412  7.853   23.196  1.00 0.00 ? 3  ARG P CB   5  
ATOM 4791  C CG   . ARG A 1 5  ? -6.666  7.561   24.685  1.00 0.00 ? 3  ARG P CG   5  
ATOM 4792  C CD   . ARG A 1 5  ? -7.738  6.479   24.864  1.00 0.00 ? 3  ARG P CD   5  
ATOM 4793  N NE   . ARG A 1 5  ? -8.001  6.212   26.293  1.00 0.00 ? 3  ARG P NE   5  
ATOM 4794  C CZ   . ARG A 1 5  ? -8.901  5.380   26.788  1.00 0.00 ? 3  ARG P CZ   5  
ATOM 4795  N NH1  . ARG A 1 5  ? -9.683  4.667   26.026  1.00 0.00 ? 3  ARG P NH1  5  
ATOM 4796  N NH2  . ARG A 1 5  ? -9.035  5.244   28.078  1.00 0.00 ? 3  ARG P NH2  5  
ATOM 4797  H H    . ARG A 1 5  ? -6.722  10.459  23.493  1.00 0.00 ? 3  ARG P H    5  
ATOM 4798  H HA   . ARG A 1 5  ? -4.417  8.582   23.498  1.00 0.00 ? 3  ARG P HA   5  
ATOM 4799  H HB2  . ARG A 1 5  ? -7.340  8.190   22.727  1.00 0.00 ? 3  ARG P HB2  5  
ATOM 4800  H HB3  . ARG A 1 5  ? -6.102  6.929   22.707  1.00 0.00 ? 3  ARG P HB3  5  
ATOM 4801  H HG2  . ARG A 1 5  ? -5.737  7.224   25.148  1.00 0.00 ? 3  ARG P HG2  5  
ATOM 4802  H HG3  . ARG A 1 5  ? -6.999  8.470   25.187  1.00 0.00 ? 3  ARG P HG3  5  
ATOM 4803  H HD2  . ARG A 1 5  ? -8.658  6.816   24.381  1.00 0.00 ? 3  ARG P HD2  5  
ATOM 4804  H HD3  . ARG A 1 5  ? -7.399  5.562   24.377  1.00 0.00 ? 3  ARG P HD3  5  
ATOM 4805  H HE   . ARG A 1 5  ? -7.441  6.714   26.964  1.00 0.00 ? 3  ARG P HE   5  
ATOM 4806  H HH11 . ARG A 1 5  ? -9.599  4.748   25.027  1.00 0.00 ? 3  ARG P HH11 5  
ATOM 4807  H HH12 . ARG A 1 5  ? -10.360 4.041   26.428  1.00 0.00 ? 3  ARG P HH12 5  
ATOM 4808  H HH21 . ARG A 1 5  ? -8.454  5.774   28.707  1.00 0.00 ? 3  ARG P HH21 5  
ATOM 4809  H HH22 . ARG A 1 5  ? -9.721  4.611   28.452  1.00 0.00 ? 3  ARG P HH22 5  
ATOM 4810  N N    . GLN A 1 6  ? -3.946  8.323   21.040  1.00 0.00 ? 4  GLN P N    5  
ATOM 4811  C CA   . GLN A 1 6  ? -3.536  8.304   19.631  1.00 0.00 ? 4  GLN P CA   5  
ATOM 4812  C C    . GLN A 1 6  ? -4.379  7.297   18.830  1.00 0.00 ? 4  GLN P C    5  
ATOM 4813  O O    . GLN A 1 6  ? -4.130  6.089   18.857  1.00 0.00 ? 4  GLN P O    5  
ATOM 4814  C CB   . GLN A 1 6  ? -2.023  8.033   19.528  1.00 0.00 ? 4  GLN P CB   5  
ATOM 4815  C CG   . GLN A 1 6  ? -1.480  8.106   18.087  1.00 0.00 ? 4  GLN P CG   5  
ATOM 4816  C CD   . GLN A 1 6  ? -1.625  9.497   17.464  1.00 0.00 ? 4  GLN P CD   5  
ATOM 4817  O OE1  . GLN A 1 6  ? -0.917  10.435  17.805  1.00 0.00 ? 4  GLN P OE1  5  
ATOM 4818  N NE2  . GLN A 1 6  ? -2.550  9.702   16.550  1.00 0.00 ? 4  GLN P NE2  5  
ATOM 4819  H H    . GLN A 1 6  ? -3.451  7.731   21.690  1.00 0.00 ? 4  GLN P H    5  
ATOM 4820  H HA   . GLN A 1 6  ? -3.711  9.295   19.211  1.00 0.00 ? 4  GLN P HA   5  
ATOM 4821  H HB2  . GLN A 1 6  ? -1.490  8.766   20.137  1.00 0.00 ? 4  GLN P HB2  5  
ATOM 4822  H HB3  . GLN A 1 6  ? -1.805  7.043   19.932  1.00 0.00 ? 4  GLN P HB3  5  
ATOM 4823  H HG2  . GLN A 1 6  ? -0.420  7.850   18.102  1.00 0.00 ? 4  GLN P HG2  5  
ATOM 4824  H HG3  . GLN A 1 6  ? -1.982  7.368   17.461  1.00 0.00 ? 4  GLN P HG3  5  
ATOM 4825  H HE21 . GLN A 1 6  ? -3.143  8.946   16.211  1.00 0.00 ? 4  GLN P HE21 5  
ATOM 4826  H HE22 . GLN A 1 6  ? -2.623  10.624  16.147  1.00 0.00 ? 4  GLN P HE22 5  
ATOM 4827  N N    . ARG A 1 7  ? -5.372  7.809   18.095  1.00 0.00 ? 5  ARG P N    5  
ATOM 4828  C CA   . ARG A 1 7  ? -6.152  7.058   17.091  1.00 0.00 ? 5  ARG P CA   5  
ATOM 4829  C C    . ARG A 1 7  ? -5.448  7.070   15.723  1.00 0.00 ? 5  ARG P C    5  
ATOM 4830  O O    . ARG A 1 7  ? -4.556  7.891   15.502  1.00 0.00 ? 5  ARG P O    5  
ATOM 4831  C CB   . ARG A 1 7  ? -7.583  7.629   17.000  1.00 0.00 ? 5  ARG P CB   5  
ATOM 4832  C CG   . ARG A 1 7  ? -8.349  7.697   18.337  1.00 0.00 ? 5  ARG P CG   5  
ATOM 4833  C CD   . ARG A 1 7  ? -8.466  6.360   19.088  1.00 0.00 ? 5  ARG P CD   5  
ATOM 4834  N NE   . ARG A 1 7  ? -9.187  5.328   18.310  1.00 0.00 ? 5  ARG P NE   5  
ATOM 4835  C CZ   . ARG A 1 7  ? -10.497 5.183   18.189  1.00 0.00 ? 5  ARG P CZ   5  
ATOM 4836  N NH1  . ARG A 1 7  ? -11.347 5.989   18.761  1.00 0.00 ? 5  ARG P NH1  5  
ATOM 4837  N NH2  . ARG A 1 7  ? -10.985 4.206   17.480  1.00 0.00 ? 5  ARG P NH2  5  
ATOM 4838  H H    . ARG A 1 7  ? -5.540  8.803   18.176  1.00 0.00 ? 5  ARG P H    5  
ATOM 4839  H HA   . ARG A 1 7  ? -6.215  6.011   17.396  1.00 0.00 ? 5  ARG P HA   5  
ATOM 4840  H HB2  . ARG A 1 7  ? -7.531  8.640   16.589  1.00 0.00 ? 5  ARG P HB2  5  
ATOM 4841  H HB3  . ARG A 1 7  ? -8.162  7.025   16.301  1.00 0.00 ? 5  ARG P HB3  5  
ATOM 4842  H HG2  . ARG A 1 7  ? -7.856  8.416   18.993  1.00 0.00 ? 5  ARG P HG2  5  
ATOM 4843  H HG3  . ARG A 1 7  ? -9.350  8.079   18.138  1.00 0.00 ? 5  ARG P HG3  5  
ATOM 4844  H HD2  . ARG A 1 7  ? -7.464  5.997   19.326  1.00 0.00 ? 5  ARG P HD2  5  
ATOM 4845  H HD3  . ARG A 1 7  ? -8.975  6.532   20.038  1.00 0.00 ? 5  ARG P HD3  5  
ATOM 4846  H HE   . ARG A 1 7  ? -8.623  4.632   17.850  1.00 0.00 ? 5  ARG P HE   5  
ATOM 4847  H HH11 . ARG A 1 7  ? -11.005 6.749   19.320  1.00 0.00 ? 5  ARG P HH11 5  
ATOM 4848  H HH12 . ARG A 1 7  ? -12.338 5.849   18.652  1.00 0.00 ? 5  ARG P HH12 5  
ATOM 4849  H HH21 . ARG A 1 7  ? -10.370 3.552   17.023  1.00 0.00 ? 5  ARG P HH21 5  
ATOM 4850  H HH22 . ARG A 1 7  ? -11.981 4.095   17.387  1.00 0.00 ? 5  ARG P HH22 5  
ATOM 4851  N N    . THR A 1 8  ? -5.881  6.186   14.820  1.00 0.00 ? 6  THR P N    5  
ATOM 4852  C CA   . THR A 1 8  ? -5.456  6.064   13.405  1.00 0.00 ? 6  THR P CA   5  
ATOM 4853  C C    . THR A 1 8  ? -3.947  5.844   13.197  1.00 0.00 ? 6  THR P C    5  
ATOM 4854  O O    . THR A 1 8  ? -3.140  6.772   13.264  1.00 0.00 ? 6  THR P O    5  
ATOM 4855  C CB   . THR A 1 8  ? -5.977  7.248   12.565  1.00 0.00 ? 6  THR P CB   5  
ATOM 4856  O OG1  . THR A 1 8  ? -7.370  7.397   12.768  1.00 0.00 ? 6  THR P OG1  5  
ATOM 4857  C CG2  . THR A 1 8  ? -5.774  7.043   11.061  1.00 0.00 ? 6  THR P CG2  5  
ATOM 4858  H H    . THR A 1 8  ? -6.639  5.590   15.111  1.00 0.00 ? 6  THR P H    5  
ATOM 4859  H HA   . THR A 1 8  ? -5.957  5.180   13.008  1.00 0.00 ? 6  THR P HA   5  
ATOM 4860  H HB   . THR A 1 8  ? -5.474  8.166   12.873  1.00 0.00 ? 6  THR P HB   5  
ATOM 4861  H HG1  . THR A 1 8  ? -7.647  8.216   12.321  1.00 0.00 ? 6  THR P HG1  5  
ATOM 4862  H HG21 . THR A 1 8  ? -4.711  7.010   10.830  1.00 0.00 ? 6  THR P HG21 5  
ATOM 4863  H HG22 . THR A 1 8  ? -6.212  7.878   10.513  1.00 0.00 ? 6  THR P HG22 5  
ATOM 4864  H HG23 . THR A 1 8  ? -6.248  6.116   10.739  1.00 0.00 ? 6  THR P HG23 5  
ATOM 4865  N N    . HIS A 1 9  ? -3.558  4.606   12.869  1.00 0.00 ? 7  HIS P N    5  
ATOM 4866  C CA   . HIS A 1 9  ? -2.163  4.239   12.560  1.00 0.00 ? 7  HIS P CA   5  
ATOM 4867  C C    . HIS A 1 9  ? -1.683  4.718   11.177  1.00 0.00 ? 7  HIS P C    5  
ATOM 4868  O O    . HIS A 1 9  ? -0.478  4.858   10.961  1.00 0.00 ? 7  HIS P O    5  
ATOM 4869  C CB   . HIS A 1 9  ? -2.004  2.715   12.664  1.00 0.00 ? 7  HIS P CB   5  
ATOM 4870  C CG   . HIS A 1 9  ? -2.315  2.139   14.025  1.00 0.00 ? 7  HIS P CG   5  
ATOM 4871  N ND1  . HIS A 1 9  ? -3.159  1.050   14.267  1.00 0.00 ? 7  HIS P ND1  5  
ATOM 4872  C CD2  . HIS A 1 9  ? -1.807  2.573   15.215  1.00 0.00 ? 7  HIS P CD2  5  
ATOM 4873  C CE1  . HIS A 1 9  ? -3.152  0.865   15.600  1.00 0.00 ? 7  HIS P CE1  5  
ATOM 4874  N NE2  . HIS A 1 9  ? -2.347  1.763   16.192  1.00 0.00 ? 7  HIS P NE2  5  
ATOM 4875  H H    . HIS A 1 9  ? -4.250  3.869   12.869  1.00 0.00 ? 7  HIS P H    5  
ATOM 4876  H HA   . HIS A 1 9  ? -1.501  4.703   13.294  1.00 0.00 ? 7  HIS P HA   5  
ATOM 4877  H HB2  . HIS A 1 9  ? -2.655  2.247   11.925  1.00 0.00 ? 7  HIS P HB2  5  
ATOM 4878  H HB3  . HIS A 1 9  ? -0.978  2.449   12.412  1.00 0.00 ? 7  HIS P HB3  5  
ATOM 4879  H HD2  . HIS A 1 9  ? -1.114  3.393   15.359  1.00 0.00 ? 7  HIS P HD2  5  
ATOM 4880  H HE1  . HIS A 1 9  ? -3.714  0.099   16.124  1.00 0.00 ? 7  HIS P HE1  5  
ATOM 4881  H HE2  . HIS A 1 9  ? -2.174  1.824   17.190  1.00 0.00 ? 7  HIS P HE2  5  
ATOM 4882  N N    . PHE A 1 10 ? -2.607  4.971   10.245  1.00 0.00 ? 8  PHE P N    5  
ATOM 4883  C CA   . PHE A 1 10 ? -2.307  5.467   8.896   1.00 0.00 ? 8  PHE P CA   5  
ATOM 4884  C C    . PHE A 1 10 ? -1.835  6.930   8.896   1.00 0.00 ? 8  PHE P C    5  
ATOM 4885  O O    . PHE A 1 10 ? -2.167  7.708   9.795   1.00 0.00 ? 8  PHE P O    5  
ATOM 4886  C CB   . PHE A 1 10 ? -3.532  5.318   7.985   1.00 0.00 ? 8  PHE P CB   5  
ATOM 4887  C CG   . PHE A 1 10 ? -4.056  3.902   7.825   1.00 0.00 ? 8  PHE P CG   5  
ATOM 4888  C CD1  . PHE A 1 10 ? -5.027  3.397   8.714   1.00 0.00 ? 8  PHE P CD1  5  
ATOM 4889  C CD2  . PHE A 1 10 ? -3.586  3.091   6.775   1.00 0.00 ? 8  PHE P CD2  5  
ATOM 4890  C CE1  . PHE A 1 10 ? -5.516  2.088   8.559   1.00 0.00 ? 8  PHE P CE1  5  
ATOM 4891  C CE2  . PHE A 1 10 ? -4.085  1.786   6.613   1.00 0.00 ? 8  PHE P CE2  5  
ATOM 4892  C CZ   . PHE A 1 10 ? -5.044  1.282   7.510   1.00 0.00 ? 8  PHE P CZ   5  
ATOM 4893  H H    . PHE A 1 10 ? -3.573  4.832   10.491  1.00 0.00 ? 8  PHE P H    5  
ATOM 4894  H HA   . PHE A 1 10 ? -1.508  4.858   8.475   1.00 0.00 ? 8  PHE P HA   5  
ATOM 4895  H HB2  . PHE A 1 10 ? -4.333  5.952   8.366   1.00 0.00 ? 8  PHE P HB2  5  
ATOM 4896  H HB3  . PHE A 1 10 ? -3.255  5.696   6.999   1.00 0.00 ? 8  PHE P HB3  5  
ATOM 4897  H HD1  . PHE A 1 10 ? -5.402  4.014   9.518   1.00 0.00 ? 8  PHE P HD1  5  
ATOM 4898  H HD2  . PHE A 1 10 ? -2.845  3.472   6.086   1.00 0.00 ? 8  PHE P HD2  5  
ATOM 4899  H HE1  . PHE A 1 10 ? -6.261  1.703   9.243   1.00 0.00 ? 8  PHE P HE1  5  
ATOM 4900  H HE2  . PHE A 1 10 ? -3.733  1.173   5.796   1.00 0.00 ? 8  PHE P HE2  5  
ATOM 4901  H HZ   . PHE A 1 10 ? -5.427  0.278   7.387   1.00 0.00 ? 8  PHE P HZ   5  
ATOM 4902  N N    . THR A 1 11 ? -1.103  7.324   7.853   1.00 0.00 ? 9  THR P N    5  
ATOM 4903  C CA   . THR A 1 11 ? -0.648  8.711   7.638   1.00 0.00 ? 9  THR P CA   5  
ATOM 4904  C C    . THR A 1 11 ? -1.578  9.460   6.691   1.00 0.00 ? 9  THR P C    5  
ATOM 4905  O O    . THR A 1 11 ? -2.239  8.860   5.839   1.00 0.00 ? 9  THR P O    5  
ATOM 4906  C CB   . THR A 1 11 ? 0.797   8.810   7.115   1.00 0.00 ? 9  THR P CB   5  
ATOM 4907  O OG1  . THR A 1 11 ? 0.854   8.585   5.721   1.00 0.00 ? 9  THR P OG1  5  
ATOM 4908  C CG2  . THR A 1 11 ? 1.753   7.833   7.792   1.00 0.00 ? 9  THR P CG2  5  
ATOM 4909  H H    . THR A 1 11 ? -0.897  6.643   7.133   1.00 0.00 ? 9  THR P H    5  
ATOM 4910  H HA   . THR A 1 11 ? -0.664  9.235   8.593   1.00 0.00 ? 9  THR P HA   5  
ATOM 4911  H HB   . THR A 1 11 ? 1.154   9.822   7.304   1.00 0.00 ? 9  THR P HB   5  
ATOM 4912  H HG1  . THR A 1 11 ? 1.790   8.653   5.463   1.00 0.00 ? 9  THR P HG1  5  
ATOM 4913  H HG21 . THR A 1 11 ? 1.484   6.811   7.532   1.00 0.00 ? 9  THR P HG21 5  
ATOM 4914  H HG22 . THR A 1 11 ? 1.694   7.956   8.873   1.00 0.00 ? 9  THR P HG22 5  
ATOM 4915  H HG23 . THR A 1 11 ? 2.772   8.031   7.463   1.00 0.00 ? 9  THR P HG23 5  
ATOM 4916  N N    . SER A 1 12 ? -1.560  10.792  6.759   1.00 0.00 ? 10 SER P N    5  
ATOM 4917  C CA   . SER A 1 12 ? -2.310  11.663  5.846   1.00 0.00 ? 10 SER P CA   5  
ATOM 4918  C C    . SER A 1 12 ? -1.899  11.532  4.370   1.00 0.00 ? 10 SER P C    5  
ATOM 4919  O O    . SER A 1 12 ? -2.597  12.075  3.514   1.00 0.00 ? 10 SER P O    5  
ATOM 4920  C CB   . SER A 1 12 ? -2.194  13.127  6.284   1.00 0.00 ? 10 SER P CB   5  
ATOM 4921  O OG   . SER A 1 12 ? -2.404  13.278  7.682   1.00 0.00 ? 10 SER P OG   5  
ATOM 4922  H H    . SER A 1 12 ? -1.030  11.241  7.495   1.00 0.00 ? 10 SER P H    5  
ATOM 4923  H HA   . SER A 1 12 ? -3.362  11.394  5.903   1.00 0.00 ? 10 SER P HA   5  
ATOM 4924  H HB2  . SER A 1 12 ? -1.198  13.495  6.032   1.00 0.00 ? 10 SER P HB2  5  
ATOM 4925  H HB3  . SER A 1 12 ? -2.938  13.710  5.739   1.00 0.00 ? 10 SER P HB3  5  
ATOM 4926  H HG   . SER A 1 12 ? -3.346  13.102  7.876   1.00 0.00 ? 10 SER P HG   5  
ATOM 4927  N N    . GLN A 1 13 ? -0.816  10.806  4.054   1.00 0.00 ? 11 GLN P N    5  
ATOM 4928  C CA   . GLN A 1 13 ? -0.390  10.465  2.691   1.00 0.00 ? 11 GLN P CA   5  
ATOM 4929  C C    . GLN A 1 13 ? -0.840  9.050   2.271   1.00 0.00 ? 11 GLN P C    5  
ATOM 4930  O O    . GLN A 1 13 ? -1.332  8.877   1.156   1.00 0.00 ? 11 GLN P O    5  
ATOM 4931  C CB   . GLN A 1 13 ? 1.134   10.645  2.593   1.00 0.00 ? 11 GLN P CB   5  
ATOM 4932  C CG   . GLN A 1 13 ? 1.638   10.555  1.145   1.00 0.00 ? 11 GLN P CG   5  
ATOM 4933  C CD   . GLN A 1 13 ? 3.136   10.842  1.046   1.00 0.00 ? 11 GLN P CD   5  
ATOM 4934  O OE1  . GLN A 1 13 ? 3.569   11.939  0.716   1.00 0.00 ? 11 GLN P OE1  5  
ATOM 4935  N NE2  . GLN A 1 13 ? 3.989   9.880   1.337   1.00 0.00 ? 11 GLN P NE2  5  
ATOM 4936  H H    . GLN A 1 13 ? -0.294  10.389  4.815   1.00 0.00 ? 11 GLN P H    5  
ATOM 4937  H HA   . GLN A 1 13 ? -0.845  11.169  1.994   1.00 0.00 ? 11 GLN P HA   5  
ATOM 4938  H HB2  . GLN A 1 13 ? 1.396   11.629  2.986   1.00 0.00 ? 11 GLN P HB2  5  
ATOM 4939  H HB3  . GLN A 1 13 ? 1.633   9.888   3.201   1.00 0.00 ? 11 GLN P HB3  5  
ATOM 4940  H HG2  . GLN A 1 13 ? 1.441   9.559   0.747   1.00 0.00 ? 11 GLN P HG2  5  
ATOM 4941  H HG3  . GLN A 1 13 ? 1.100   11.281  0.534   1.00 0.00 ? 11 GLN P HG3  5  
ATOM 4942  H HE21 . GLN A 1 13 ? 3.658   8.967   1.611   1.00 0.00 ? 11 GLN P HE21 5  
ATOM 4943  H HE22 . GLN A 1 13 ? 4.976   10.080  1.270   1.00 0.00 ? 11 GLN P HE22 5  
ATOM 4944  N N    . GLN A 1 14 ? -0.748  8.046   3.155   1.00 0.00 ? 12 GLN P N    5  
ATOM 4945  C CA   . GLN A 1 14 ? -1.182  6.663   2.871   1.00 0.00 ? 12 GLN P CA   5  
ATOM 4946  C C    . GLN A 1 14 ? -2.674  6.602   2.522   1.00 0.00 ? 12 GLN P C    5  
ATOM 4947  O O    . GLN A 1 14 ? -3.076  5.946   1.559   1.00 0.00 ? 12 GLN P O    5  
ATOM 4948  C CB   . GLN A 1 14 ? -0.932  5.777   4.098   1.00 0.00 ? 12 GLN P CB   5  
ATOM 4949  C CG   . GLN A 1 14 ? 0.555   5.508   4.336   1.00 0.00 ? 12 GLN P CG   5  
ATOM 4950  C CD   . GLN A 1 14 ? 0.797   4.733   5.627   1.00 0.00 ? 12 GLN P CD   5  
ATOM 4951  O OE1  . GLN A 1 14 ? 0.071   4.839   6.606   1.00 0.00 ? 12 GLN P OE1  5  
ATOM 4952  N NE2  . GLN A 1 14 ? 1.828   3.925   5.672   1.00 0.00 ? 12 GLN P NE2  5  
ATOM 4953  H H    . GLN A 1 14 ? -0.384  8.249   4.080   1.00 0.00 ? 12 GLN P H    5  
ATOM 4954  H HA   . GLN A 1 14 ? -0.616  6.264   2.028   1.00 0.00 ? 12 GLN P HA   5  
ATOM 4955  H HB2  . GLN A 1 14 ? -1.373  6.252   4.976   1.00 0.00 ? 12 GLN P HB2  5  
ATOM 4956  H HB3  . GLN A 1 14 ? -1.412  4.809   3.945   1.00 0.00 ? 12 GLN P HB3  5  
ATOM 4957  H HG2  . GLN A 1 14 ? 0.938   4.938   3.491   1.00 0.00 ? 12 GLN P HG2  5  
ATOM 4958  H HG3  . GLN A 1 14 ? 1.105   6.444   4.386   1.00 0.00 ? 12 GLN P HG3  5  
ATOM 4959  H HE21 . GLN A 1 14 ? 2.337   3.750   4.810   1.00 0.00 ? 12 GLN P HE21 5  
ATOM 4960  H HE22 . GLN A 1 14 ? 1.982   3.363   6.489   1.00 0.00 ? 12 GLN P HE22 5  
ATOM 4961  N N    . LEU A 1 15 ? -3.483  7.348   3.278   1.00 0.00 ? 13 LEU P N    5  
ATOM 4962  C CA   . LEU A 1 15 ? -4.933  7.476   3.088   1.00 0.00 ? 13 LEU P CA   5  
ATOM 4963  C C    . LEU A 1 15 ? -5.319  7.974   1.685   1.00 0.00 ? 13 LEU P C    5  
ATOM 4964  O O    . LEU A 1 15 ? -6.363  7.583   1.161   1.00 0.00 ? 13 LEU P O    5  
ATOM 4965  C CB   . LEU A 1 15 ? -5.460  8.445   4.157   1.00 0.00 ? 13 LEU P CB   5  
ATOM 4966  C CG   . LEU A 1 15 ? -5.301  7.925   5.601   1.00 0.00 ? 13 LEU P CG   5  
ATOM 4967  C CD1  . LEU A 1 15 ? -5.495  9.061   6.601   1.00 0.00 ? 13 LEU P CD1  5  
ATOM 4968  C CD2  . LEU A 1 15 ? -6.276  6.797   5.912   1.00 0.00 ? 13 LEU P CD2  5  
ATOM 4969  H H    . LEU A 1 15 ? -3.061  7.822   4.072   1.00 0.00 ? 13 LEU P H    5  
ATOM 4970  H HA   . LEU A 1 15 ? -5.405  6.504   3.223   1.00 0.00 ? 13 LEU P HA   5  
ATOM 4971  H HB2  . LEU A 1 15 ? -4.924  9.391   4.056   1.00 0.00 ? 13 LEU P HB2  5  
ATOM 4972  H HB3  . LEU A 1 15 ? -6.515  8.641   3.952   1.00 0.00 ? 13 LEU P HB3  5  
ATOM 4973  H HG   . LEU A 1 15 ? -4.302  7.526   5.746   1.00 0.00 ? 13 LEU P HG   5  
ATOM 4974  H HD11 . LEU A 1 15 ? -6.508  9.456   6.533   1.00 0.00 ? 13 LEU P HD11 5  
ATOM 4975  H HD12 . LEU A 1 15 ? -5.298  8.695   7.608   1.00 0.00 ? 13 LEU P HD12 5  
ATOM 4976  H HD13 . LEU A 1 15 ? -4.780  9.855   6.382   1.00 0.00 ? 13 LEU P HD13 5  
ATOM 4977  H HD21 . LEU A 1 15 ? -6.188  6.519   6.962   1.00 0.00 ? 13 LEU P HD21 5  
ATOM 4978  H HD22 . LEU A 1 15 ? -7.296  7.121   5.706   1.00 0.00 ? 13 LEU P HD22 5  
ATOM 4979  H HD23 . LEU A 1 15 ? -6.014  5.930   5.309   1.00 0.00 ? 13 LEU P HD23 5  
ATOM 4980  N N    . GLN A 1 16 ? -4.466  8.791   1.058   1.00 0.00 ? 14 GLN P N    5  
ATOM 4981  C CA   . GLN A 1 16 ? -4.692  9.309   -0.298  1.00 0.00 ? 14 GLN P CA   5  
ATOM 4982  C C    . GLN A 1 16 ? -4.533  8.205   -1.350  1.00 0.00 ? 14 GLN P C    5  
ATOM 4983  O O    . GLN A 1 16 ? -5.342  8.108   -2.269  1.00 0.00 ? 14 GLN P O    5  
ATOM 4984  C CB   . GLN A 1 16 ? -3.735  10.470  -0.627  1.00 0.00 ? 14 GLN P CB   5  
ATOM 4985  C CG   . GLN A 1 16 ? -3.625  11.547  0.458   1.00 0.00 ? 14 GLN P CG   5  
ATOM 4986  C CD   . GLN A 1 16 ? -4.955  12.176  0.871   1.00 0.00 ? 14 GLN P CD   5  
ATOM 4987  O OE1  . GLN A 1 16 ? -5.873  12.374  0.085   1.00 0.00 ? 14 GLN P OE1  5  
ATOM 4988  N NE2  . GLN A 1 16 ? -5.095  12.527  2.131   1.00 0.00 ? 14 GLN P NE2  5  
ATOM 4989  H H    . GLN A 1 16 ? -3.597  9.009   1.522   1.00 0.00 ? 14 GLN P H    5  
ATOM 4990  H HA   . GLN A 1 16 ? -5.714  9.682   -0.363  1.00 0.00 ? 14 GLN P HA   5  
ATOM 4991  H HB2  . GLN A 1 16 ? -2.735  10.073  -0.794  1.00 0.00 ? 14 GLN P HB2  5  
ATOM 4992  H HB3  . GLN A 1 16 ? -4.064  10.936  -1.556  1.00 0.00 ? 14 GLN P HB3  5  
ATOM 4993  H HG2  . GLN A 1 16 ? -3.162  11.091  1.328   1.00 0.00 ? 14 GLN P HG2  5  
ATOM 4994  H HG3  . GLN A 1 16 ? -2.961  12.339  0.111   1.00 0.00 ? 14 GLN P HG3  5  
ATOM 4995  H HE21 . GLN A 1 16 ? -4.313  12.386  2.764   1.00 0.00 ? 14 GLN P HE21 5  
ATOM 4996  H HE22 . GLN A 1 16 ? -5.956  12.961  2.426   1.00 0.00 ? 14 GLN P HE22 5  
ATOM 4997  N N    . GLU A 1 17 ? -3.526  7.340   -1.200  1.00 0.00 ? 15 GLU P N    5  
ATOM 4998  C CA   . GLU A 1 17 ? -3.286  6.219   -2.119  1.00 0.00 ? 15 GLU P CA   5  
ATOM 4999  C C    . GLU A 1 17 ? -4.345  5.120   -1.968  1.00 0.00 ? 15 GLU P C    5  
ATOM 5000  O O    . GLU A 1 17 ? -4.756  4.509   -2.957  1.00 0.00 ? 15 GLU P O    5  
ATOM 5001  C CB   . GLU A 1 17 ? -1.871  5.649   -1.920  1.00 0.00 ? 15 GLU P CB   5  
ATOM 5002  C CG   . GLU A 1 17 ? -0.748  6.699   -1.984  1.00 0.00 ? 15 GLU P CG   5  
ATOM 5003  C CD   . GLU A 1 17 ? -0.801  7.613   -3.230  1.00 0.00 ? 15 GLU P CD   5  
ATOM 5004  O OE1  . GLU A 1 17 ? -1.131  7.137   -4.343  1.00 0.00 ? 15 GLU P OE1  5  
ATOM 5005  O OE2  . GLU A 1 17 ? -0.486  8.820   -3.106  1.00 0.00 ? 15 GLU P OE2  5  
ATOM 5006  H H    . GLU A 1 17 ? -2.915  7.446   -0.399  1.00 0.00 ? 15 GLU P H    5  
ATOM 5007  H HA   . GLU A 1 17 ? -3.364  6.576   -3.144  1.00 0.00 ? 15 GLU P HA   5  
ATOM 5008  H HB2  . GLU A 1 17 ? -1.822  5.156   -0.947  1.00 0.00 ? 15 GLU P HB2  5  
ATOM 5009  H HB3  . GLU A 1 17 ? -1.692  4.892   -2.683  1.00 0.00 ? 15 GLU P HB3  5  
ATOM 5010  H HG2  . GLU A 1 17 ? -0.795  7.307   -1.080  1.00 0.00 ? 15 GLU P HG2  5  
ATOM 5011  H HG3  . GLU A 1 17 ? 0.210   6.176   -1.961  1.00 0.00 ? 15 GLU P HG3  5  
ATOM 5012  N N    . LEU A 1 18 ? -4.847  4.927   -0.745  1.00 0.00 ? 16 LEU P N    5  
ATOM 5013  C CA   . LEU A 1 18 ? -5.957  4.027   -0.443  1.00 0.00 ? 16 LEU P CA   5  
ATOM 5014  C C    . LEU A 1 18 ? -7.266  4.511   -1.087  1.00 0.00 ? 16 LEU P C    5  
ATOM 5015  O O    . LEU A 1 18 ? -7.904  3.750   -1.815  1.00 0.00 ? 16 LEU P O    5  
ATOM 5016  C CB   . LEU A 1 18 ? -6.077  3.900   1.082   1.00 0.00 ? 16 LEU P CB   5  
ATOM 5017  C CG   . LEU A 1 18 ? -4.950  3.059   1.707   1.00 0.00 ? 16 LEU P CG   5  
ATOM 5018  C CD1  . LEU A 1 18 ? -4.785  3.393   3.184   1.00 0.00 ? 16 LEU P CD1  5  
ATOM 5019  C CD2  . LEU A 1 18 ? -5.251  1.566   1.573   1.00 0.00 ? 16 LEU P CD2  5  
ATOM 5020  H H    . LEU A 1 18 ? -4.445  5.456   0.021   1.00 0.00 ? 16 LEU P H    5  
ATOM 5021  H HA   . LEU A 1 18 ? -5.742  3.045   -0.864  1.00 0.00 ? 16 LEU P HA   5  
ATOM 5022  H HB2  . LEU A 1 18 ? -6.080  4.899   1.519   1.00 0.00 ? 16 LEU P HB2  5  
ATOM 5023  H HB3  . LEU A 1 18 ? -7.032  3.437   1.317   1.00 0.00 ? 16 LEU P HB3  5  
ATOM 5024  H HG   . LEU A 1 18 ? -4.003  3.268   1.211   1.00 0.00 ? 16 LEU P HG   5  
ATOM 5025  H HD11 . LEU A 1 18 ? -3.992  2.785   3.613   1.00 0.00 ? 16 LEU P HD11 5  
ATOM 5026  H HD12 . LEU A 1 18 ? -4.520  4.443   3.287   1.00 0.00 ? 16 LEU P HD12 5  
ATOM 5027  H HD13 . LEU A 1 18 ? -5.714  3.200   3.711   1.00 0.00 ? 16 LEU P HD13 5  
ATOM 5028  H HD21 . LEU A 1 18 ? -5.309  1.301   0.519   1.00 0.00 ? 16 LEU P HD21 5  
ATOM 5029  H HD22 . LEU A 1 18 ? -4.455  0.990   2.041   1.00 0.00 ? 16 LEU P HD22 5  
ATOM 5030  H HD23 . LEU A 1 18 ? -6.200  1.330   2.056   1.00 0.00 ? 16 LEU P HD23 5  
ATOM 5031  N N    . GLU A 1 19 ? -7.647  5.782   -0.914  1.00 0.00 ? 17 GLU P N    5  
ATOM 5032  C CA   . GLU A 1 19 ? -8.871  6.291   -1.557  1.00 0.00 ? 17 GLU P CA   5  
ATOM 5033  C C    . GLU A 1 19 ? -8.750  6.546   -3.068  1.00 0.00 ? 17 GLU P C    5  
ATOM 5034  O O    . GLU A 1 19 ? -9.769  6.570   -3.761  1.00 0.00 ? 17 GLU P O    5  
ATOM 5035  C CB   . GLU A 1 19 ? -9.499  7.455   -0.786  1.00 0.00 ? 17 GLU P CB   5  
ATOM 5036  C CG   . GLU A 1 19 ? -8.921  8.858   -1.004  1.00 0.00 ? 17 GLU P CG   5  
ATOM 5037  C CD   . GLU A 1 19 ? -9.775  9.940   -0.300  1.00 0.00 ? 17 GLU P CD   5  
ATOM 5038  O OE1  . GLU A 1 19 ? -10.672 9.604   0.517   1.00 0.00 ? 17 GLU P OE1  5  
ATOM 5039  O OE2  . GLU A 1 19 ? -9.575  11.144  -0.587  1.00 0.00 ? 17 GLU P OE2  5  
ATOM 5040  H H    . GLU A 1 19 ? -7.140  6.366   -0.254  1.00 0.00 ? 17 GLU P H    5  
ATOM 5041  H HA   . GLU A 1 19 ? -9.606  5.491   -1.482  1.00 0.00 ? 17 GLU P HA   5  
ATOM 5042  H HB2  . GLU A 1 19 ? -10.547 7.483   -1.079  1.00 0.00 ? 17 GLU P HB2  5  
ATOM 5043  H HB3  . GLU A 1 19 ? -9.444  7.224   0.276   1.00 0.00 ? 17 GLU P HB3  5  
ATOM 5044  H HG2  . GLU A 1 19 ? -7.898  8.888   -0.628  1.00 0.00 ? 17 GLU P HG2  5  
ATOM 5045  H HG3  . GLU A 1 19 ? -8.894  9.068   -2.076  1.00 0.00 ? 17 GLU P HG3  5  
ATOM 5046  N N    . ALA A 1 20 ? -7.530  6.662   -3.601  1.00 0.00 ? 18 ALA P N    5  
ATOM 5047  C CA   . ALA A 1 20 ? -7.269  6.687   -5.041  1.00 0.00 ? 18 ALA P CA   5  
ATOM 5048  C C    . ALA A 1 20 ? -7.381  5.286   -5.673  1.00 0.00 ? 18 ALA P C    5  
ATOM 5049  O O    . ALA A 1 20 ? -8.075  5.122   -6.678  1.00 0.00 ? 18 ALA P O    5  
ATOM 5050  C CB   . ALA A 1 20 ? -5.898  7.319   -5.301  1.00 0.00 ? 18 ALA P CB   5  
ATOM 5051  H H    . ALA A 1 20 ? -6.745  6.744   -2.965  1.00 0.00 ? 18 ALA P H    5  
ATOM 5052  H HA   . ALA A 1 20 ? -8.020  7.316   -5.522  1.00 0.00 ? 18 ALA P HA   5  
ATOM 5053  H HB1  . ALA A 1 20 ? -5.114  6.732   -4.821  1.00 0.00 ? 18 ALA P HB1  5  
ATOM 5054  H HB2  . ALA A 1 20 ? -5.709  7.353   -6.374  1.00 0.00 ? 18 ALA P HB2  5  
ATOM 5055  H HB3  . ALA A 1 20 ? -5.880  8.337   -4.911  1.00 0.00 ? 18 ALA P HB3  5  
ATOM 5056  N N    . THR A 1 21 ? -6.772  4.249   -5.080  1.00 0.00 ? 19 THR P N    5  
ATOM 5057  C CA   . THR A 1 21 ? -6.866  2.877   -5.619  1.00 0.00 ? 19 THR P CA   5  
ATOM 5058  C C    . THR A 1 21 ? -8.270  2.276   -5.454  1.00 0.00 ? 19 THR P C    5  
ATOM 5059  O O    . THR A 1 21 ? -8.698  1.474   -6.283  1.00 0.00 ? 19 THR P O    5  
ATOM 5060  C CB   . THR A 1 21 ? -5.759  1.969   -5.061  1.00 0.00 ? 19 THR P CB   5  
ATOM 5061  O OG1  . THR A 1 21 ? -5.567  0.888   -5.950  1.00 0.00 ? 19 THR P OG1  5  
ATOM 5062  C CG2  . THR A 1 21 ? -6.051  1.385   -3.682  1.00 0.00 ? 19 THR P CG2  5  
ATOM 5063  H H    . THR A 1 21 ? -6.193  4.418   -4.261  1.00 0.00 ? 19 THR P H    5  
ATOM 5064  H HA   . THR A 1 21 ? -6.682  2.949   -6.690  1.00 0.00 ? 19 THR P HA   5  
ATOM 5065  H HB   . THR A 1 21 ? -4.832  2.543   -5.017  1.00 0.00 ? 19 THR P HB   5  
ATOM 5066  H HG1  . THR A 1 21 ? -6.336  0.297   -5.858  1.00 0.00 ? 19 THR P HG1  5  
ATOM 5067  H HG21 . THR A 1 21 ? -6.682  0.500   -3.774  1.00 0.00 ? 19 THR P HG21 5  
ATOM 5068  H HG22 . THR A 1 21 ? -6.543  2.125   -3.063  1.00 0.00 ? 19 THR P HG22 5  
ATOM 5069  H HG23 . THR A 1 21 ? -5.118  1.122   -3.190  1.00 0.00 ? 19 THR P HG23 5  
ATOM 5070  N N    . PHE A 1 22 ? -9.035  2.749   -4.464  1.00 0.00 ? 20 PHE P N    5  
ATOM 5071  C CA   . PHE A 1 22 ? -10.464 2.460   -4.277  1.00 0.00 ? 20 PHE P CA   5  
ATOM 5072  C C    . PHE A 1 22 ? -11.311 2.845   -5.504  1.00 0.00 ? 20 PHE P C    5  
ATOM 5073  O O    . PHE A 1 22 ? -12.329 2.207   -5.766  1.00 0.00 ? 20 PHE P O    5  
ATOM 5074  C CB   . PHE A 1 22 ? -10.935 3.189   -3.005  1.00 0.00 ? 20 PHE P CB   5  
ATOM 5075  C CG   . PHE A 1 22 ? -12.423 3.166   -2.679  1.00 0.00 ? 20 PHE P CG   5  
ATOM 5076  C CD1  . PHE A 1 22 ? -13.133 1.952   -2.609  1.00 0.00 ? 20 PHE P CD1  5  
ATOM 5077  C CD2  . PHE A 1 22 ? -13.097 4.374   -2.402  1.00 0.00 ? 20 PHE P CD2  5  
ATOM 5078  C CE1  . PHE A 1 22 ? -14.502 1.943   -2.284  1.00 0.00 ? 20 PHE P CE1  5  
ATOM 5079  C CE2  . PHE A 1 22 ? -14.468 4.367   -2.083  1.00 0.00 ? 20 PHE P CE2  5  
ATOM 5080  C CZ   . PHE A 1 22 ? -15.171 3.151   -2.023  1.00 0.00 ? 20 PHE P CZ   5  
ATOM 5081  H H    . PHE A 1 22 ? -8.595  3.369   -3.799  1.00 0.00 ? 20 PHE P H    5  
ATOM 5082  H HA   . PHE A 1 22 ? -10.587 1.390   -4.123  1.00 0.00 ? 20 PHE P HA   5  
ATOM 5083  H HB2  . PHE A 1 22 ? -10.405 2.767   -2.152  1.00 0.00 ? 20 PHE P HB2  5  
ATOM 5084  H HB3  . PHE A 1 22 ? -10.629 4.229   -3.092  1.00 0.00 ? 20 PHE P HB3  5  
ATOM 5085  H HD1  . PHE A 1 22 ? -12.634 1.019   -2.811  1.00 0.00 ? 20 PHE P HD1  5  
ATOM 5086  H HD2  . PHE A 1 22 ? -12.560 5.311   -2.434  1.00 0.00 ? 20 PHE P HD2  5  
ATOM 5087  H HE1  . PHE A 1 22 ? -15.042 1.006   -2.241  1.00 0.00 ? 20 PHE P HE1  5  
ATOM 5088  H HE2  . PHE A 1 22 ? -14.985 5.297   -1.889  1.00 0.00 ? 20 PHE P HE2  5  
ATOM 5089  H HZ   . PHE A 1 22 ? -16.226 3.144   -1.781  1.00 0.00 ? 20 PHE P HZ   5  
ATOM 5090  N N    . GLN A 1 23 ? -10.877 3.830   -6.304  1.00 0.00 ? 21 GLN P N    5  
ATOM 5091  C CA   . GLN A 1 23 ? -11.590 4.239   -7.519  1.00 0.00 ? 21 GLN P CA   5  
ATOM 5092  C C    . GLN A 1 23 ? -11.460 3.219   -8.665  1.00 0.00 ? 21 GLN P C    5  
ATOM 5093  O O    . GLN A 1 23 ? -12.437 2.973   -9.376  1.00 0.00 ? 21 GLN P O    5  
ATOM 5094  C CB   . GLN A 1 23 ? -11.103 5.617   -8.002  1.00 0.00 ? 21 GLN P CB   5  
ATOM 5095  C CG   . GLN A 1 23 ? -11.132 6.743   -6.958  1.00 0.00 ? 21 GLN P CG   5  
ATOM 5096  C CD   . GLN A 1 23 ? -12.449 6.835   -6.194  1.00 0.00 ? 21 GLN P CD   5  
ATOM 5097  O OE1  . GLN A 1 23 ? -13.535 6.904   -6.757  1.00 0.00 ? 21 GLN P OE1  5  
ATOM 5098  N NE2  . GLN A 1 23 ? -12.401 6.830   -4.881  1.00 0.00 ? 21 GLN P NE2  5  
ATOM 5099  H H    . GLN A 1 23 ? -10.018 4.310   -6.066  1.00 0.00 ? 21 GLN P H    5  
ATOM 5100  H HA   . GLN A 1 23 ? -12.649 4.307   -7.273  1.00 0.00 ? 21 GLN P HA   5  
ATOM 5101  H HB2  . GLN A 1 23 ? -10.074 5.518   -8.343  1.00 0.00 ? 21 GLN P HB2  5  
ATOM 5102  H HB3  . GLN A 1 23 ? -11.714 5.920   -8.853  1.00 0.00 ? 21 GLN P HB3  5  
ATOM 5103  H HG2  . GLN A 1 23 ? -10.317 6.583   -6.257  1.00 0.00 ? 21 GLN P HG2  5  
ATOM 5104  H HG3  . GLN A 1 23 ? -10.947 7.695   -7.454  1.00 0.00 ? 21 GLN P HG3  5  
ATOM 5105  H HE21 . GLN A 1 23 ? -11.499 6.774   -4.414  1.00 0.00 ? 21 GLN P HE21 5  
ATOM 5106  H HE22 . GLN A 1 23 ? -13.266 6.861   -4.374  1.00 0.00 ? 21 GLN P HE22 5  
ATOM 5107  N N    . ARG A 1 24 ? -10.275 2.606   -8.838  1.00 0.00 ? 22 ARG P N    5  
ATOM 5108  C CA   . ARG A 1 24 ? -10.033 1.558   -9.856  1.00 0.00 ? 22 ARG P CA   5  
ATOM 5109  C C    . ARG A 1 24 ? -10.441 0.159   -9.384  1.00 0.00 ? 22 ARG P C    5  
ATOM 5110  O O    . ARG A 1 24 ? -10.772 -0.693  -10.211 1.00 0.00 ? 22 ARG P O    5  
ATOM 5111  C CB   . ARG A 1 24 ? -8.574  1.581   -10.365 1.00 0.00 ? 22 ARG P CB   5  
ATOM 5112  C CG   . ARG A 1 24 ? -7.522  1.242   -9.294  1.00 0.00 ? 22 ARG P CG   5  
ATOM 5113  C CD   . ARG A 1 24 ? -6.133  0.954   -9.878  1.00 0.00 ? 22 ARG P CD   5  
ATOM 5114  N NE   . ARG A 1 24 ? -5.222  0.539   -8.795  1.00 0.00 ? 22 ARG P NE   5  
ATOM 5115  C CZ   . ARG A 1 24 ? -4.323  -0.427  -8.789  1.00 0.00 ? 22 ARG P CZ   5  
ATOM 5116  N NH1  . ARG A 1 24 ? -3.971  -1.119  -9.831  1.00 0.00 ? 22 ARG P NH1  5  
ATOM 5117  N NH2  . ARG A 1 24 ? -3.735  -0.749  -7.682  1.00 0.00 ? 22 ARG P NH2  5  
ATOM 5118  H H    . ARG A 1 24 ? -9.529  2.846   -8.198  1.00 0.00 ? 22 ARG P H    5  
ATOM 5119  H HA   . ARG A 1 24 ? -10.667 1.768   -10.720 1.00 0.00 ? 22 ARG P HA   5  
ATOM 5120  H HB2  . ARG A 1 24 ? -8.492  0.852   -11.173 1.00 0.00 ? 22 ARG P HB2  5  
ATOM 5121  H HB3  . ARG A 1 24 ? -8.353  2.565   -10.780 1.00 0.00 ? 22 ARG P HB3  5  
ATOM 5122  H HG2  . ARG A 1 24 ? -7.447  2.077   -8.601  1.00 0.00 ? 22 ARG P HG2  5  
ATOM 5123  H HG3  . ARG A 1 24 ? -7.832  0.355   -8.743  1.00 0.00 ? 22 ARG P HG3  5  
ATOM 5124  H HD2  . ARG A 1 24 ? -6.224  0.161   -10.622 1.00 0.00 ? 22 ARG P HD2  5  
ATOM 5125  H HD3  . ARG A 1 24 ? -5.748  1.853   -10.362 1.00 0.00 ? 22 ARG P HD3  5  
ATOM 5126  H HE   . ARG A 1 24 ? -5.360  0.976   -7.892  1.00 0.00 ? 22 ARG P HE   5  
ATOM 5127  H HH11 . ARG A 1 24 ? -4.363  -0.921  -10.734 1.00 0.00 ? 22 ARG P HH11 5  
ATOM 5128  H HH12 . ARG A 1 24 ? -3.278  -1.851  -9.688  1.00 0.00 ? 22 ARG P HH12 5  
ATOM 5129  H HH21 . ARG A 1 24 ? -4.010  -0.295  -6.822  1.00 0.00 ? 22 ARG P HH21 5  
ATOM 5130  H HH22 . ARG A 1 24 ? -3.067  -1.518  -7.713  1.00 0.00 ? 22 ARG P HH22 5  
ATOM 5131  N N    . ASN A 1 25 ? -10.412 -0.079  -8.072  1.00 0.00 ? 23 ASN P N    5  
ATOM 5132  C CA   . ASN A 1 25 ? -10.641 -1.380  -7.452  1.00 0.00 ? 23 ASN P CA   5  
ATOM 5133  C C    . ASN A 1 25 ? -11.446 -1.213  -6.156  1.00 0.00 ? 23 ASN P C    5  
ATOM 5134  O O    . ASN A 1 25 ? -10.903 -0.819  -5.127  1.00 0.00 ? 23 ASN P O    5  
ATOM 5135  C CB   . ASN A 1 25 ? -9.269  -2.037  -7.205  1.00 0.00 ? 23 ASN P CB   5  
ATOM 5136  C CG   . ASN A 1 25 ? -9.387  -3.503  -6.823  1.00 0.00 ? 23 ASN P CG   5  
ATOM 5137  O OD1  . ASN A 1 25 ? -10.442 -4.011  -6.467  1.00 0.00 ? 23 ASN P OD1  5  
ATOM 5138  N ND2  . ASN A 1 25 ? -8.299  -4.232  -6.912  1.00 0.00 ? 23 ASN P ND2  5  
ATOM 5139  H H    . ASN A 1 25 ? -10.087 0.667   -7.467  1.00 0.00 ? 23 ASN P H    5  
ATOM 5140  H HA   . ASN A 1 25 ? -11.216 -2.018  -8.126  1.00 0.00 ? 23 ASN P HA   5  
ATOM 5141  H HB2  . ASN A 1 25 ? -8.667  -1.970  -8.110  1.00 0.00 ? 23 ASN P HB2  5  
ATOM 5142  H HB3  . ASN A 1 25 ? -8.736  -1.505  -6.414  1.00 0.00 ? 23 ASN P HB3  5  
ATOM 5143  H HD21 . ASN A 1 25 ? -7.438  -3.814  -7.224  1.00 0.00 ? 23 ASN P HD21 5  
ATOM 5144  H HD22 . ASN A 1 25 ? -8.355  -5.213  -6.691  1.00 0.00 ? 23 ASN P HD22 5  
ATOM 5145  N N    . HIS A 1 26 ? -12.743 -1.524  -6.195  1.00 0.00 ? 24 HIS P N    5  
ATOM 5146  C CA   . HIS A 1 26 ? -13.650 -1.356  -5.050  1.00 0.00 ? 24 HIS P CA   5  
ATOM 5147  C C    . HIS A 1 26 ? -13.551 -2.509  -4.030  1.00 0.00 ? 24 HIS P C    5  
ATOM 5148  O O    . HIS A 1 26 ? -14.089 -2.398  -2.928  1.00 0.00 ? 24 HIS P O    5  
ATOM 5149  C CB   . HIS A 1 26 ? -15.091 -1.177  -5.564  1.00 0.00 ? 24 HIS P CB   5  
ATOM 5150  C CG   . HIS A 1 26 ? -15.399 0.170   -6.190  1.00 0.00 ? 24 HIS P CG   5  
ATOM 5151  N ND1  . HIS A 1 26 ? -16.467 0.995   -5.820  1.00 0.00 ? 24 HIS P ND1  5  
ATOM 5152  C CD2  . HIS A 1 26 ? -14.727 0.768   -7.220  1.00 0.00 ? 24 HIS P CD2  5  
ATOM 5153  C CE1  . HIS A 1 26 ? -16.404 2.071   -6.624  1.00 0.00 ? 24 HIS P CE1  5  
ATOM 5154  N NE2  . HIS A 1 26 ? -15.369 1.960   -7.474  1.00 0.00 ? 24 HIS P NE2  5  
ATOM 5155  H H    . HIS A 1 26 ? -13.130 -1.881  -7.058  1.00 0.00 ? 24 HIS P H    5  
ATOM 5156  H HA   . HIS A 1 26 ? -13.380 -0.446  -4.511  1.00 0.00 ? 24 HIS P HA   5  
ATOM 5157  H HB2  . HIS A 1 26 ? -15.317 -1.958  -6.291  1.00 0.00 ? 24 HIS P HB2  5  
ATOM 5158  H HB3  . HIS A 1 26 ? -15.776 -1.308  -4.725  1.00 0.00 ? 24 HIS P HB3  5  
ATOM 5159  H HD2  . HIS A 1 26 ? -13.847 0.397   -7.725  1.00 0.00 ? 24 HIS P HD2  5  
ATOM 5160  H HE1  . HIS A 1 26 ? -17.090 2.911   -6.595  1.00 0.00 ? 24 HIS P HE1  5  
ATOM 5161  H HE2  . HIS A 1 26 ? -15.106 2.646   -8.174  1.00 0.00 ? 24 HIS P HE2  5  
ATOM 5162  N N    . TYR A 1 27 ? -12.882 -3.614  -4.386  1.00 0.00 ? 25 TYR P N    5  
ATOM 5163  C CA   . TYR A 1 27 ? -12.806 -4.852  -3.596  1.00 0.00 ? 25 TYR P CA   5  
ATOM 5164  C C    . TYR A 1 27 ? -11.482 -5.617  -3.851  1.00 0.00 ? 25 TYR P C    5  
ATOM 5165  O O    . TYR A 1 27 ? -11.488 -6.709  -4.429  1.00 0.00 ? 25 TYR P O    5  
ATOM 5166  C CB   . TYR A 1 27 ? -14.078 -5.701  -3.836  1.00 0.00 ? 25 TYR P CB   5  
ATOM 5167  C CG   . TYR A 1 27 ? -14.573 -5.809  -5.275  1.00 0.00 ? 25 TYR P CG   5  
ATOM 5168  C CD1  . TYR A 1 27 ? -14.128 -6.847  -6.119  1.00 0.00 ? 25 TYR P CD1  5  
ATOM 5169  C CD2  . TYR A 1 27 ? -15.506 -4.872  -5.763  1.00 0.00 ? 25 TYR P CD2  5  
ATOM 5170  C CE1  . TYR A 1 27 ? -14.583 -6.926  -7.449  1.00 0.00 ? 25 TYR P CE1  5  
ATOM 5171  C CE2  . TYR A 1 27 ? -15.963 -4.944  -7.093  1.00 0.00 ? 25 TYR P CE2  5  
ATOM 5172  C CZ   . TYR A 1 27 ? -15.498 -5.972  -7.943  1.00 0.00 ? 25 TYR P CZ   5  
ATOM 5173  O OH   . TYR A 1 27 ? -15.933 -6.055  -9.231  1.00 0.00 ? 25 TYR P OH   5  
ATOM 5174  H H    . TYR A 1 27 ? -12.411 -3.612  -5.282  1.00 0.00 ? 25 TYR P H    5  
ATOM 5175  H HA   . TYR A 1 27 ? -12.804 -4.586  -2.539  1.00 0.00 ? 25 TYR P HA   5  
ATOM 5176  H HB2  . TYR A 1 27 ? -13.925 -6.703  -3.431  1.00 0.00 ? 25 TYR P HB2  5  
ATOM 5177  H HB3  . TYR A 1 27 ? -14.882 -5.259  -3.246  1.00 0.00 ? 25 TYR P HB3  5  
ATOM 5178  H HD1  . TYR A 1 27 ? -13.432 -7.588  -5.748  1.00 0.00 ? 25 TYR P HD1  5  
ATOM 5179  H HD2  . TYR A 1 27 ? -15.874 -4.090  -5.111  1.00 0.00 ? 25 TYR P HD2  5  
ATOM 5180  H HE1  . TYR A 1 27 ? -14.237 -7.716  -8.099  1.00 0.00 ? 25 TYR P HE1  5  
ATOM 5181  H HE2  . TYR A 1 27 ? -16.671 -4.216  -7.463  1.00 0.00 ? 25 TYR P HE2  5  
ATOM 5182  H HH   . TYR A 1 27 ? -16.560 -5.346  -9.455  1.00 0.00 ? 25 TYR P HH   5  
ATOM 5183  N N    . PRO A 1 28 ? -10.321 -5.060  -3.446  1.00 0.00 ? 26 PRO P N    5  
ATOM 5184  C CA   . PRO A 1 28 ? -9.010  -5.644  -3.730  1.00 0.00 ? 26 PRO P CA   5  
ATOM 5185  C C    . PRO A 1 28 ? -8.772  -6.986  -3.019  1.00 0.00 ? 26 PRO P C    5  
ATOM 5186  O O    . PRO A 1 28 ? -9.295  -7.266  -1.936  1.00 0.00 ? 26 PRO P O    5  
ATOM 5187  C CB   . PRO A 1 28 ? -7.988  -4.569  -3.349  1.00 0.00 ? 26 PRO P CB   5  
ATOM 5188  C CG   . PRO A 1 28 ? -8.705  -3.804  -2.241  1.00 0.00 ? 26 PRO P CG   5  
ATOM 5189  C CD   . PRO A 1 28 ? -10.156 -3.811  -2.716  1.00 0.00 ? 26 PRO P CD   5  
ATOM 5190  H HA   . PRO A 1 28 ? -8.933  -5.825  -4.801  1.00 0.00 ? 26 PRO P HA   5  
ATOM 5191  H HB2  . PRO A 1 28 ? -7.039  -4.989  -3.019  1.00 0.00 ? 26 PRO P HB2  5  
ATOM 5192  H HB3  . PRO A 1 28 ? -7.820  -3.904  -4.195  1.00 0.00 ? 26 PRO P HB3  5  
ATOM 5193  H HG2  . PRO A 1 28 ? -8.630  -4.353  -1.304  1.00 0.00 ? 26 PRO P HG2  5  
ATOM 5194  H HG3  . PRO A 1 28 ? -8.311  -2.795  -2.135  1.00 0.00 ? 26 PRO P HG3  5  
ATOM 5195  H HD2  . PRO A 1 28 ? -10.829 -3.756  -1.860  1.00 0.00 ? 26 PRO P HD2  5  
ATOM 5196  H HD3  . PRO A 1 28 ? -10.327 -2.970  -3.389  1.00 0.00 ? 26 PRO P HD3  5  
ATOM 5197  N N    . ASP A 1 29 ? -7.936  -7.810  -3.644  1.00 0.00 ? 27 ASP P N    5  
ATOM 5198  C CA   . ASP A 1 29 ? -7.672  -9.218  -3.312  1.00 0.00 ? 27 ASP P CA   5  
ATOM 5199  C C    . ASP A 1 29 ? -6.251  -9.398  -2.753  1.00 0.00 ? 27 ASP P C    5  
ATOM 5200  O O    . ASP A 1 29 ? -5.479  -8.445  -2.719  1.00 0.00 ? 27 ASP P O    5  
ATOM 5201  C CB   . ASP A 1 29 ? -7.917  -10.066 -4.576  1.00 0.00 ? 27 ASP P CB   5  
ATOM 5202  C CG   . ASP A 1 29 ? -7.943  -11.586 -4.334  1.00 0.00 ? 27 ASP P CG   5  
ATOM 5203  O OD1  . ASP A 1 29 ? -8.184  -12.022 -3.183  1.00 0.00 ? 27 ASP P OD1  5  
ATOM 5204  O OD2  . ASP A 1 29 ? -7.698  -12.348 -5.299  1.00 0.00 ? 27 ASP P OD2  5  
ATOM 5205  H H    . ASP A 1 29 ? -7.405  -7.412  -4.416  1.00 0.00 ? 27 ASP P H    5  
ATOM 5206  H HA   . ASP A 1 29 ? -8.377  -9.543  -2.551  1.00 0.00 ? 27 ASP P HA   5  
ATOM 5207  H HB2  . ASP A 1 29 ? -8.876  -9.780  -5.005  1.00 0.00 ? 27 ASP P HB2  5  
ATOM 5208  H HB3  . ASP A 1 29 ? -7.136  -9.830  -5.301  1.00 0.00 ? 27 ASP P HB3  5  
ATOM 5209  N N    . MET A 1 30 ? -5.854  -10.607 -2.348  1.00 0.00 ? 28 MET P N    5  
ATOM 5210  C CA   . MET A 1 30 ? -4.519  -10.876 -1.782  1.00 0.00 ? 28 MET P CA   5  
ATOM 5211  C C    . MET A 1 30 ? -3.349  -10.392 -2.665  1.00 0.00 ? 28 MET P C    5  
ATOM 5212  O O    . MET A 1 30 ? -2.273  -10.097 -2.151  1.00 0.00 ? 28 MET P O    5  
ATOM 5213  C CB   . MET A 1 30 ? -4.358  -12.376 -1.486  1.00 0.00 ? 28 MET P CB   5  
ATOM 5214  C CG   . MET A 1 30 ? -4.363  -13.258 -2.748  1.00 0.00 ? 28 MET P CG   5  
ATOM 5215  S SD   . MET A 1 30 ? -3.747  -14.945 -2.502  1.00 0.00 ? 28 MET P SD   5  
ATOM 5216  C CE   . MET A 1 30 ? -1.965  -14.588 -2.474  1.00 0.00 ? 28 MET P CE   5  
ATOM 5217  H H    . MET A 1 30 ? -6.528  -11.366 -2.420  1.00 0.00 ? 28 MET P H    5  
ATOM 5218  H HA   . MET A 1 30 ? -4.440  -10.339 -0.835  1.00 0.00 ? 28 MET P HA   5  
ATOM 5219  H HB2  . MET A 1 30 ? -3.411  -12.515 -0.962  1.00 0.00 ? 28 MET P HB2  5  
ATOM 5220  H HB3  . MET A 1 30 ? -5.156  -12.705 -0.819  1.00 0.00 ? 28 MET P HB3  5  
ATOM 5221  H HG2  . MET A 1 30 ? -5.377  -13.299 -3.140  1.00 0.00 ? 28 MET P HG2  5  
ATOM 5222  H HG3  . MET A 1 30 ? -3.739  -12.811 -3.518  1.00 0.00 ? 28 MET P HG3  5  
ATOM 5223  H HE1  . MET A 1 30 ? -1.404  -15.522 -2.431  1.00 0.00 ? 28 MET P HE1  5  
ATOM 5224  H HE2  . MET A 1 30 ? -1.683  -14.038 -3.374  1.00 0.00 ? 28 MET P HE2  5  
ATOM 5225  H HE3  . MET A 1 30 ? -1.719  -13.984 -1.600  1.00 0.00 ? 28 MET P HE3  5  
ATOM 5226  N N    . SER A 1 31 ? -3.559  -10.294 -3.984  1.00 0.00 ? 29 SER P N    5  
ATOM 5227  C CA   . SER A 1 31 ? -2.565  -9.797  -4.940  1.00 0.00 ? 29 SER P CA   5  
ATOM 5228  C C    . SER A 1 31 ? -2.606  -8.266  -5.062  1.00 0.00 ? 29 SER P C    5  
ATOM 5229  O O    . SER A 1 31 ? -1.574  -7.599  -4.975  1.00 0.00 ? 29 SER P O    5  
ATOM 5230  C CB   . SER A 1 31 ? -2.785  -10.471 -6.300  1.00 0.00 ? 29 SER P CB   5  
ATOM 5231  O OG   . SER A 1 31 ? -1.752  -10.119 -7.206  1.00 0.00 ? 29 SER P OG   5  
ATOM 5232  H H    . SER A 1 31 ? -4.480  -10.528 -4.321  1.00 0.00 ? 29 SER P H    5  
ATOM 5233  H HA   . SER A 1 31 ? -1.579  -10.097 -4.584  1.00 0.00 ? 29 SER P HA   5  
ATOM 5234  H HB2  . SER A 1 31 ? -2.786  -11.555 -6.165  1.00 0.00 ? 29 SER P HB2  5  
ATOM 5235  H HB3  . SER A 1 31 ? -3.750  -10.167 -6.709  1.00 0.00 ? 29 SER P HB3  5  
ATOM 5236  H HG   . SER A 1 31 ? -1.903  -10.592 -8.048  1.00 0.00 ? 29 SER P HG   5  
ATOM 5237  N N    . THR A 1 32 ? -3.803  -7.679  -5.201  1.00 0.00 ? 30 THR P N    5  
ATOM 5238  C CA   . THR A 1 32 ? -3.986  -6.226  -5.381  1.00 0.00 ? 30 THR P CA   5  
ATOM 5239  C C    . THR A 1 32 ? -3.841  -5.427  -4.087  1.00 0.00 ? 30 THR P C    5  
ATOM 5240  O O    . THR A 1 32 ? -3.275  -4.339  -4.115  1.00 0.00 ? 30 THR P O    5  
ATOM 5241  C CB   . THR A 1 32 ? -5.308  -5.879  -6.083  1.00 0.00 ? 30 THR P CB   5  
ATOM 5242  O OG1  . THR A 1 32 ? -6.331  -6.810  -5.807  1.00 0.00 ? 30 THR P OG1  5  
ATOM 5243  C CG2  . THR A 1 32 ? -5.131  -5.858  -7.601  1.00 0.00 ? 30 THR P CG2  5  
ATOM 5244  H H    . THR A 1 32 ? -4.636  -8.251  -5.187  1.00 0.00 ? 30 THR P H    5  
ATOM 5245  H HA   . THR A 1 32 ? -3.190  -5.874  -6.030  1.00 0.00 ? 30 THR P HA   5  
ATOM 5246  H HB   . THR A 1 32 ? -5.641  -4.897  -5.750  1.00 0.00 ? 30 THR P HB   5  
ATOM 5247  H HG1  . THR A 1 32 ? -6.376  -7.423  -6.563  1.00 0.00 ? 30 THR P HG1  5  
ATOM 5248  H HG21 . THR A 1 32 ? -4.726  -6.811  -7.946  1.00 0.00 ? 30 THR P HG21 5  
ATOM 5249  H HG22 . THR A 1 32 ? -4.441  -5.060  -7.875  1.00 0.00 ? 30 THR P HG22 5  
ATOM 5250  H HG23 . THR A 1 32 ? -6.088  -5.674  -8.088  1.00 0.00 ? 30 THR P HG23 5  
ATOM 5251  N N    . ARG A 1 33 ? -4.253  -5.958  -2.933  1.00 0.00 ? 31 ARG P N    5  
ATOM 5252  C CA   . ARG A 1 33 ? -3.975  -5.365  -1.612  1.00 0.00 ? 31 ARG P CA   5  
ATOM 5253  C C    . ARG A 1 33 ? -2.472  -5.247  -1.348  1.00 0.00 ? 31 ARG P C    5  
ATOM 5254  O O    . ARG A 1 33 ? -2.004  -4.192  -0.933  1.00 0.00 ? 31 ARG P O    5  
ATOM 5255  C CB   . ARG A 1 33 ? -4.632  -6.204  -0.504  1.00 0.00 ? 31 ARG P CB   5  
ATOM 5256  C CG   . ARG A 1 33 ? -6.165  -6.102  -0.517  1.00 0.00 ? 31 ARG P CG   5  
ATOM 5257  C CD   . ARG A 1 33 ? -6.832  -6.744  0.704   1.00 0.00 ? 31 ARG P CD   5  
ATOM 5258  N NE   . ARG A 1 33 ? -6.493  -8.167  0.877   1.00 0.00 ? 31 ARG P NE   5  
ATOM 5259  C CZ   . ARG A 1 33 ? -7.232  -9.226  0.625   1.00 0.00 ? 31 ARG P CZ   5  
ATOM 5260  N NH1  . ARG A 1 33 ? -8.387  -9.178  0.025   1.00 0.00 ? 31 ARG P NH1  5  
ATOM 5261  N NH2  . ARG A 1 33 ? -6.783  -10.382 1.007   1.00 0.00 ? 31 ARG P NH2  5  
ATOM 5262  H H    . ARG A 1 33 ? -4.771  -6.829  -2.974  1.00 0.00 ? 31 ARG P H    5  
ATOM 5263  H HA   . ARG A 1 33 ? -4.373  -4.349  -1.604  1.00 0.00 ? 31 ARG P HA   5  
ATOM 5264  H HB2  . ARG A 1 33 ? -4.328  -7.246  -0.629  1.00 0.00 ? 31 ARG P HB2  5  
ATOM 5265  H HB3  . ARG A 1 33 ? -4.274  -5.849  0.462   1.00 0.00 ? 31 ARG P HB3  5  
ATOM 5266  H HG2  . ARG A 1 33 ? -6.443  -5.049  -0.535  1.00 0.00 ? 31 ARG P HG2  5  
ATOM 5267  H HG3  . ARG A 1 33 ? -6.552  -6.575  -1.413  1.00 0.00 ? 31 ARG P HG3  5  
ATOM 5268  H HD2  . ARG A 1 33 ? -6.503  -6.211  1.592   1.00 0.00 ? 31 ARG P HD2  5  
ATOM 5269  H HD3  . ARG A 1 33 ? -7.912  -6.615  0.621   1.00 0.00 ? 31 ARG P HD3  5  
ATOM 5270  H HE   . ARG A 1 33 ? -5.616  -8.386  1.346   1.00 0.00 ? 31 ARG P HE   5  
ATOM 5271  H HH11 . ARG A 1 33 ? -8.699  -8.309  -0.397  1.00 0.00 ? 31 ARG P HH11 5  
ATOM 5272  H HH12 . ARG A 1 33 ? -8.914  -10.019 -0.131  1.00 0.00 ? 31 ARG P HH12 5  
ATOM 5273  H HH21 . ARG A 1 33 ? -5.882  -10.381 1.492   1.00 0.00 ? 31 ARG P HH21 5  
ATOM 5274  H HH22 . ARG A 1 33 ? -7.289  -11.233 0.842   1.00 0.00 ? 31 ARG P HH22 5  
ATOM 5275  N N    . GLU A 1 34 ? -1.706  -6.298  -1.638  1.00 0.00 ? 32 GLU P N    5  
ATOM 5276  C CA   . GLU A 1 34 ? -0.238  -6.245  -1.588  1.00 0.00 ? 32 GLU P CA   5  
ATOM 5277  C C    . GLU A 1 34 ? 0.326   -5.215  -2.578  1.00 0.00 ? 32 GLU P C    5  
ATOM 5278  O O    . GLU A 1 34 ? 1.184   -4.421  -2.204  1.00 0.00 ? 32 GLU P O    5  
ATOM 5279  C CB   . GLU A 1 34 ? 0.378   -7.625  -1.880  1.00 0.00 ? 32 GLU P CB   5  
ATOM 5280  C CG   . GLU A 1 34 ? 0.240   -8.601  -0.705  1.00 0.00 ? 32 GLU P CG   5  
ATOM 5281  C CD   . GLU A 1 34 ? 0.903   -9.977  -0.950  1.00 0.00 ? 32 GLU P CD   5  
ATOM 5282  O OE1  . GLU A 1 34 ? 1.533   -10.209 -2.012  1.00 0.00 ? 32 GLU P OE1  5  
ATOM 5283  O OE2  . GLU A 1 34 ? 0.831   -10.843 -0.043  1.00 0.00 ? 32 GLU P OE2  5  
ATOM 5284  H H    . GLU A 1 34 ? -2.158  -7.143  -1.946  1.00 0.00 ? 32 GLU P H    5  
ATOM 5285  H HA   . GLU A 1 34 ? 0.066   -5.927  -0.589  1.00 0.00 ? 32 GLU P HA   5  
ATOM 5286  H HB2  . GLU A 1 34 ? -0.087  -8.051  -2.770  1.00 0.00 ? 32 GLU P HB2  5  
ATOM 5287  H HB3  . GLU A 1 34 ? 1.441   -7.484  -2.080  1.00 0.00 ? 32 GLU P HB3  5  
ATOM 5288  H HG2  . GLU A 1 34 ? 0.700   -8.138  0.170   1.00 0.00 ? 32 GLU P HG2  5  
ATOM 5289  H HG3  . GLU A 1 34 ? -0.819  -8.742  -0.488  1.00 0.00 ? 32 GLU P HG3  5  
ATOM 5290  N N    . GLU A 1 35 ? -0.188  -5.170  -3.812  1.00 0.00 ? 33 GLU P N    5  
ATOM 5291  C CA   . GLU A 1 35 ? 0.282   -4.255  -4.865  1.00 0.00 ? 33 GLU P CA   5  
ATOM 5292  C C    . GLU A 1 35 ? 0.279   -2.784  -4.423  1.00 0.00 ? 33 GLU P C    5  
ATOM 5293  O O    . GLU A 1 35 ? 1.219   -2.064  -4.753  1.00 0.00 ? 33 GLU P O    5  
ATOM 5294  C CB   . GLU A 1 35 ? -0.569  -4.431  -6.142  1.00 0.00 ? 33 GLU P CB   5  
ATOM 5295  C CG   . GLU A 1 35 ? -0.156  -3.527  -7.315  1.00 0.00 ? 33 GLU P CG   5  
ATOM 5296  C CD   . GLU A 1 35 ? -1.143  -3.654  -8.491  1.00 0.00 ? 33 GLU P CD   5  
ATOM 5297  O OE1  . GLU A 1 35 ? -0.947  -4.530  -9.368  1.00 0.00 ? 33 GLU P OE1  5  
ATOM 5298  O OE2  . GLU A 1 35 ? -2.113  -2.856  -8.550  1.00 0.00 ? 33 GLU P OE2  5  
ATOM 5299  H H    . GLU A 1 35 ? -0.878  -5.871  -4.055  1.00 0.00 ? 33 GLU P H    5  
ATOM 5300  H HA   . GLU A 1 35 ? 1.319   -4.509  -5.091  1.00 0.00 ? 33 GLU P HA   5  
ATOM 5301  H HB2  . GLU A 1 35 ? -0.513  -5.469  -6.467  1.00 0.00 ? 33 GLU P HB2  5  
ATOM 5302  H HB3  . GLU A 1 35 ? -1.604  -4.200  -5.911  1.00 0.00 ? 33 GLU P HB3  5  
ATOM 5303  H HG2  . GLU A 1 35 ? -0.142  -2.485  -6.994  1.00 0.00 ? 33 GLU P HG2  5  
ATOM 5304  H HG3  . GLU A 1 35 ? 0.854   -3.791  -7.632  1.00 0.00 ? 33 GLU P HG3  5  
ATOM 5305  N N    . ILE A 1 36 ? -0.725  -2.336  -3.658  1.00 0.00 ? 34 ILE P N    5  
ATOM 5306  C CA   . ILE A 1 36 ? -0.784  -0.952  -3.151  1.00 0.00 ? 34 ILE P CA   5  
ATOM 5307  C C    . ILE A 1 36 ? 0.039   -0.783  -1.864  1.00 0.00 ? 34 ILE P C    5  
ATOM 5308  O O    . ILE A 1 36 ? 0.627   0.275   -1.639  1.00 0.00 ? 34 ILE P O    5  
ATOM 5309  C CB   . ILE A 1 36 ? -2.239  -0.423  -3.035  1.00 0.00 ? 34 ILE P CB   5  
ATOM 5310  C CG1  . ILE A 1 36 ? -2.962  -0.735  -1.707  1.00 0.00 ? 34 ILE P CG1  5  
ATOM 5311  C CG2  . ILE A 1 36 ? -3.099  -0.957  -4.195  1.00 0.00 ? 34 ILE P CG2  5  
ATOM 5312  C CD1  . ILE A 1 36 ? -2.755  0.335   -0.628  1.00 0.00 ? 34 ILE P CD1  5  
ATOM 5313  H H    . ILE A 1 36 ? -1.490  -2.968  -3.452  1.00 0.00 ? 34 ILE P H    5  
ATOM 5314  H HA   . ILE A 1 36 ? -0.306  -0.314  -3.893  1.00 0.00 ? 34 ILE P HA   5  
ATOM 5315  H HB   . ILE A 1 36 ? -2.200  0.662   -3.140  1.00 0.00 ? 34 ILE P HB   5  
ATOM 5316  H HG12 . ILE A 1 36 ? -4.038  -0.799  -1.883  1.00 0.00 ? 34 ILE P HG12 5  
ATOM 5317  H HG13 . ILE A 1 36 ? -2.633  -1.704  -1.336  1.00 0.00 ? 34 ILE P HG13 5  
ATOM 5318  H HG21 . ILE A 1 36 ? -3.999  -0.361  -4.299  1.00 0.00 ? 34 ILE P HG21 5  
ATOM 5319  H HG22 . ILE A 1 36 ? -2.540  -0.921  -5.130  1.00 0.00 ? 34 ILE P HG22 5  
ATOM 5320  H HG23 . ILE A 1 36 ? -3.408  -1.980  -3.985  1.00 0.00 ? 34 ILE P HG23 5  
ATOM 5321  H HD11 . ILE A 1 36 ? -1.709  0.433   -0.350  1.00 0.00 ? 34 ILE P HD11 5  
ATOM 5322  H HD12 . ILE A 1 36 ? -3.309  0.047   0.261   1.00 0.00 ? 34 ILE P HD12 5  
ATOM 5323  H HD13 . ILE A 1 36 ? -3.127  1.300   -0.980  1.00 0.00 ? 34 ILE P HD13 5  
ATOM 5324  N N    . ALA A 1 37 ? 0.125   -1.826  -1.032  1.00 0.00 ? 35 ALA P N    5  
ATOM 5325  C CA   . ALA A 1 37 ? 0.834   -1.801  0.250   1.00 0.00 ? 35 ALA P CA   5  
ATOM 5326  C C    . ALA A 1 37 ? 2.364   -1.707  0.081   1.00 0.00 ? 35 ALA P C    5  
ATOM 5327  O O    . ALA A 1 37 ? 3.065   -1.126  0.915   1.00 0.00 ? 35 ALA P O    5  
ATOM 5328  C CB   . ALA A 1 37 ? 0.443   -3.067  1.022   1.00 0.00 ? 35 ALA P CB   5  
ATOM 5329  H H    . ALA A 1 37 ? -0.314  -2.694  -1.309  1.00 0.00 ? 35 ALA P H    5  
ATOM 5330  H HA   . ALA A 1 37 ? 0.499   -0.937  0.817   1.00 0.00 ? 35 ALA P HA   5  
ATOM 5331  H HB1  . ALA A 1 37 ? -0.634  -3.101  1.165   1.00 0.00 ? 35 ALA P HB1  5  
ATOM 5332  H HB2  . ALA A 1 37 ? 0.764   -3.954  0.479   1.00 0.00 ? 35 ALA P HB2  5  
ATOM 5333  H HB3  . ALA A 1 37 ? 0.923   -3.062  1.996   1.00 0.00 ? 35 ALA P HB3  5  
ATOM 5334  N N    . VAL A 1 38 ? 2.863   -2.259  -1.027  1.00 0.00 ? 36 VAL P N    5  
ATOM 5335  C CA   . VAL A 1 38 ? 4.282   -2.465  -1.357  1.00 0.00 ? 36 VAL P CA   5  
ATOM 5336  C C    . VAL A 1 38 ? 5.099   -1.172  -1.444  1.00 0.00 ? 36 VAL P C    5  
ATOM 5337  O O    . VAL A 1 38 ? 6.284   -1.178  -1.103  1.00 0.00 ? 36 VAL P O    5  
ATOM 5338  C CB   . VAL A 1 38 ? 4.326   -3.297  -2.664  1.00 0.00 ? 36 VAL P CB   5  
ATOM 5339  C CG1  . VAL A 1 38 ? 5.497   -3.030  -3.614  1.00 0.00 ? 36 VAL P CG1  5  
ATOM 5340  C CG2  . VAL A 1 38 ? 4.316   -4.793  -2.329  1.00 0.00 ? 36 VAL P CG2  5  
ATOM 5341  H H    . VAL A 1 38 ? 2.189   -2.704  -1.644  1.00 0.00 ? 36 VAL P H    5  
ATOM 5342  H HA   . VAL A 1 38 ? 4.731   -3.041  -0.547  1.00 0.00 ? 36 VAL P HA   5  
ATOM 5343  H HB   . VAL A 1 38 ? 3.426   -3.080  -3.240  1.00 0.00 ? 36 VAL P HB   5  
ATOM 5344  H HG11 . VAL A 1 38 ? 5.451   -2.003  -3.973  1.00 0.00 ? 36 VAL P HG11 5  
ATOM 5345  H HG12 . VAL A 1 38 ? 6.446   -3.209  -3.107  1.00 0.00 ? 36 VAL P HG12 5  
ATOM 5346  H HG13 . VAL A 1 38 ? 5.411   -3.689  -4.478  1.00 0.00 ? 36 VAL P HG13 5  
ATOM 5347  H HG21 . VAL A 1 38 ? 3.529   -5.008  -1.606  1.00 0.00 ? 36 VAL P HG21 5  
ATOM 5348  H HG22 . VAL A 1 38 ? 4.118   -5.369  -3.233  1.00 0.00 ? 36 VAL P HG22 5  
ATOM 5349  H HG23 . VAL A 1 38 ? 5.274   -5.092  -1.903  1.00 0.00 ? 36 VAL P HG23 5  
ATOM 5350  N N    . TRP A 1 39 ? 4.481   -0.058  -1.844  1.00 0.00 ? 37 TRP P N    5  
ATOM 5351  C CA   . TRP A 1 39 ? 5.122   1.260   -1.983  1.00 0.00 ? 37 TRP P CA   5  
ATOM 5352  C C    . TRP A 1 39 ? 4.547   2.324   -1.036  1.00 0.00 ? 37 TRP P C    5  
ATOM 5353  O O    . TRP A 1 39 ? 4.924   3.496   -1.112  1.00 0.00 ? 37 TRP P O    5  
ATOM 5354  C CB   . TRP A 1 39 ? 5.099   1.693   -3.455  1.00 0.00 ? 37 TRP P CB   5  
ATOM 5355  C CG   . TRP A 1 39 ? 3.781   1.542   -4.143  1.00 0.00 ? 37 TRP P CG   5  
ATOM 5356  C CD1  . TRP A 1 39 ? 3.330   0.399   -4.698  1.00 0.00 ? 37 TRP P CD1  5  
ATOM 5357  C CD2  . TRP A 1 39 ? 2.714   2.519   -4.318  1.00 0.00 ? 37 TRP P CD2  5  
ATOM 5358  N NE1  . TRP A 1 39 ? 2.044   0.580   -5.151  1.00 0.00 ? 37 TRP P NE1  5  
ATOM 5359  C CE2  . TRP A 1 39 ? 1.604   1.870   -4.940  1.00 0.00 ? 37 TRP P CE2  5  
ATOM 5360  C CE3  . TRP A 1 39 ? 2.570   3.883   -3.997  1.00 0.00 ? 37 TRP P CE3  5  
ATOM 5361  C CZ2  . TRP A 1 39 ? 0.398   2.535   -5.203  1.00 0.00 ? 37 TRP P CZ2  5  
ATOM 5362  C CZ3  . TRP A 1 39 ? 1.372   4.568   -4.277  1.00 0.00 ? 37 TRP P CZ3  5  
ATOM 5363  C CH2  . TRP A 1 39 ? 0.284   3.896   -4.867  1.00 0.00 ? 37 TRP P CH2  5  
ATOM 5364  H H    . TRP A 1 39 ? 3.509   -0.128  -2.120  1.00 0.00 ? 37 TRP P H    5  
ATOM 5365  H HA   . TRP A 1 39 ? 6.167   1.168   -1.699  1.00 0.00 ? 37 TRP P HA   5  
ATOM 5366  H HB2  . TRP A 1 39 ? 5.422   2.730   -3.528  1.00 0.00 ? 37 TRP P HB2  5  
ATOM 5367  H HB3  . TRP A 1 39 ? 5.826   1.097   -3.999  1.00 0.00 ? 37 TRP P HB3  5  
ATOM 5368  H HD1  . TRP A 1 39 ? 3.871   -0.540  -4.725  1.00 0.00 ? 37 TRP P HD1  5  
ATOM 5369  H HE1  . TRP A 1 39 ? 1.485   -0.210  -5.466  1.00 0.00 ? 37 TRP P HE1  5  
ATOM 5370  H HE3  . TRP A 1 39 ? 3.402   4.395   -3.531  1.00 0.00 ? 37 TRP P HE3  5  
ATOM 5371  H HZ2  . TRP A 1 39 ? -0.427  2.010   -5.666  1.00 0.00 ? 37 TRP P HZ2  5  
ATOM 5372  H HZ3  . TRP A 1 39 ? 1.284   5.617   -4.034  1.00 0.00 ? 37 TRP P HZ3  5  
ATOM 5373  H HH2  . TRP A 1 39 ? -0.634  4.432   -5.067  1.00 0.00 ? 37 TRP P HH2  5  
ATOM 5374  N N    . THR A 1 40 ? 3.665   1.922   -0.117  1.00 0.00 ? 38 THR P N    5  
ATOM 5375  C CA   . THR A 1 40 ? 3.012   2.812   0.866   1.00 0.00 ? 38 THR P CA   5  
ATOM 5376  C C    . THR A 1 40 ? 3.402   2.507   2.314   1.00 0.00 ? 38 THR P C    5  
ATOM 5377  O O    . THR A 1 40 ? 2.873   3.133   3.229   1.00 0.00 ? 38 THR P O    5  
ATOM 5378  C CB   . THR A 1 40 ? 1.486   2.822   0.689   1.00 0.00 ? 38 THR P CB   5  
ATOM 5379  O OG1  . THR A 1 40 ? 0.965   1.523   0.812   1.00 0.00 ? 38 THR P OG1  5  
ATOM 5380  C CG2  . THR A 1 40 ? 1.092   3.352   -0.691  1.00 0.00 ? 38 THR P CG2  5  
ATOM 5381  H H    . THR A 1 40 ? 3.401   0.942   -0.110  1.00 0.00 ? 38 THR P H    5  
ATOM 5382  H HA   . THR A 1 40 ? 3.343   3.835   0.694   1.00 0.00 ? 38 THR P HA   5  
ATOM 5383  H HB   . THR A 1 40 ? 1.032   3.456   1.455   1.00 0.00 ? 38 THR P HB   5  
ATOM 5384  H HG1  . THR A 1 40 ? 0.860   1.177   -0.094  1.00 0.00 ? 38 THR P HG1  5  
ATOM 5385  H HG21 . THR A 1 40 ? 1.553   2.749   -1.477  1.00 0.00 ? 38 THR P HG21 5  
ATOM 5386  H HG22 . THR A 1 40 ? 1.437   4.379   -0.795  1.00 0.00 ? 38 THR P HG22 5  
ATOM 5387  H HG23 . THR A 1 40 ? 0.009   3.323   -0.802  1.00 0.00 ? 38 THR P HG23 5  
ATOM 5388  N N    . ASN A 1 41 ? 4.351   1.590   2.541   1.00 0.00 ? 39 ASN P N    5  
ATOM 5389  C CA   . ASN A 1 41 ? 4.788   1.124   3.867   1.00 0.00 ? 39 ASN P CA   5  
ATOM 5390  C C    . ASN A 1 41 ? 3.647   0.516   4.718   1.00 0.00 ? 39 ASN P C    5  
ATOM 5391  O O    . ASN A 1 41 ? 3.537   0.761   5.922   1.00 0.00 ? 39 ASN P O    5  
ATOM 5392  C CB   . ASN A 1 41 ? 5.589   2.235   4.578   1.00 0.00 ? 39 ASN P CB   5  
ATOM 5393  C CG   . ASN A 1 41 ? 6.450   1.732   5.730   1.00 0.00 ? 39 ASN P CG   5  
ATOM 5394  O OD1  . ASN A 1 41 ? 6.742   0.553   5.878   1.00 0.00 ? 39 ASN P OD1  5  
ATOM 5395  N ND2  . ASN A 1 41 ? 6.921   2.625   6.573   1.00 0.00 ? 39 ASN P ND2  5  
ATOM 5396  H H    . ASN A 1 41 ? 4.760   1.145   1.731   1.00 0.00 ? 39 ASN P H    5  
ATOM 5397  H HA   . ASN A 1 41 ? 5.478   0.298   3.679   1.00 0.00 ? 39 ASN P HA   5  
ATOM 5398  H HB2  . ASN A 1 41 ? 6.244   2.732   3.864   1.00 0.00 ? 39 ASN P HB2  5  
ATOM 5399  H HB3  . ASN A 1 41 ? 4.889   2.976   4.961   1.00 0.00 ? 39 ASN P HB3  5  
ATOM 5400  H HD21 . ASN A 1 41 ? 6.700   3.601   6.456   1.00 0.00 ? 39 ASN P HD21 5  
ATOM 5401  H HD22 . ASN A 1 41 ? 7.501   2.306   7.335   1.00 0.00 ? 39 ASN P HD22 5  
ATOM 5402  N N    . LEU A 1 42 ? 2.778   -0.264  4.069   1.00 0.00 ? 40 LEU P N    5  
ATOM 5403  C CA   . LEU A 1 42 ? 1.673   -1.019  4.678   1.00 0.00 ? 40 LEU P CA   5  
ATOM 5404  C C    . LEU A 1 42 ? 1.857   -2.537  4.482   1.00 0.00 ? 40 LEU P C    5  
ATOM 5405  O O    . LEU A 1 42 ? 2.820   -2.995  3.860   1.00 0.00 ? 40 LEU P O    5  
ATOM 5406  C CB   . LEU A 1 42 ? 0.344   -0.526  4.060   1.00 0.00 ? 40 LEU P CB   5  
ATOM 5407  C CG   . LEU A 1 42 ? -0.033  0.937   4.350   1.00 0.00 ? 40 LEU P CG   5  
ATOM 5408  C CD1  . LEU A 1 42 ? -1.332  1.282   3.623   1.00 0.00 ? 40 LEU P CD1  5  
ATOM 5409  C CD2  . LEU A 1 42 ? -0.251  1.172   5.843   1.00 0.00 ? 40 LEU P CD2  5  
ATOM 5410  H H    . LEU A 1 42 ? 2.931   -0.397  3.077   1.00 0.00 ? 40 LEU P H    5  
ATOM 5411  H HA   . LEU A 1 42 ? 1.648   -0.847  5.754   1.00 0.00 ? 40 LEU P HA   5  
ATOM 5412  H HB2  . LEU A 1 42 ? 0.403   -0.648  2.982   1.00 0.00 ? 40 LEU P HB2  5  
ATOM 5413  H HB3  . LEU A 1 42 ? -0.474  -1.154  4.410   1.00 0.00 ? 40 LEU P HB3  5  
ATOM 5414  H HG   . LEU A 1 42 ? 0.751   1.603   3.992   1.00 0.00 ? 40 LEU P HG   5  
ATOM 5415  H HD11 . LEU A 1 42 ? -1.588  2.324   3.807   1.00 0.00 ? 40 LEU P HD11 5  
ATOM 5416  H HD12 . LEU A 1 42 ? -1.193  1.143   2.551   1.00 0.00 ? 40 LEU P HD12 5  
ATOM 5417  H HD13 . LEU A 1 42 ? -2.141  0.639   3.970   1.00 0.00 ? 40 LEU P HD13 5  
ATOM 5418  H HD21 . LEU A 1 42 ? -0.607  2.188   6.007   1.00 0.00 ? 40 LEU P HD21 5  
ATOM 5419  H HD22 . LEU A 1 42 ? -0.987  0.470   6.229   1.00 0.00 ? 40 LEU P HD22 5  
ATOM 5420  H HD23 . LEU A 1 42 ? 0.691   1.048   6.374   1.00 0.00 ? 40 LEU P HD23 5  
ATOM 5421  N N    . THR A 1 43 ? 0.911   -3.325  5.000   1.00 0.00 ? 41 THR P N    5  
ATOM 5422  C CA   . THR A 1 43 ? 0.759   -4.764  4.707   1.00 0.00 ? 41 THR P CA   5  
ATOM 5423  C C    . THR A 1 43 ? -0.664  -5.031  4.210   1.00 0.00 ? 41 THR P C    5  
ATOM 5424  O O    . THR A 1 43 ? -1.561  -4.216  4.436   1.00 0.00 ? 41 THR P O    5  
ATOM 5425  C CB   . THR A 1 43 ? 1.150   -5.634  5.913   1.00 0.00 ? 41 THR P CB   5  
ATOM 5426  O OG1  . THR A 1 43 ? 1.105   -6.996  5.548   1.00 0.00 ? 41 THR P OG1  5  
ATOM 5427  C CG2  . THR A 1 43 ? 0.240   -5.447  7.128   1.00 0.00 ? 41 THR P CG2  5  
ATOM 5428  H H    . THR A 1 43 ? 0.150   -2.887  5.508   1.00 0.00 ? 41 THR P H    5  
ATOM 5429  H HA   . THR A 1 43 ? 1.430   -5.037  3.893   1.00 0.00 ? 41 THR P HA   5  
ATOM 5430  H HB   . THR A 1 43 ? 2.172   -5.386  6.201   1.00 0.00 ? 41 THR P HB   5  
ATOM 5431  H HG1  . THR A 1 43 ? 1.525   -7.508  6.263   1.00 0.00 ? 41 THR P HG1  5  
ATOM 5432  H HG21 . THR A 1 43 ? 0.315   -4.420  7.483   1.00 0.00 ? 41 THR P HG21 5  
ATOM 5433  H HG22 . THR A 1 43 ? 0.556   -6.114  7.930   1.00 0.00 ? 41 THR P HG22 5  
ATOM 5434  H HG23 . THR A 1 43 ? -0.794  -5.669  6.864   1.00 0.00 ? 41 THR P HG23 5  
ATOM 5435  N N    . GLU A 1 44 ? -0.914  -6.153  3.534   1.00 0.00 ? 42 GLU P N    5  
ATOM 5436  C CA   . GLU A 1 44 ? -2.209  -6.421  2.889   1.00 0.00 ? 42 GLU P CA   5  
ATOM 5437  C C    . GLU A 1 44 ? -3.390  -6.434  3.873   1.00 0.00 ? 42 GLU P C    5  
ATOM 5438  O O    . GLU A 1 44 ? -4.497  -6.042  3.511   1.00 0.00 ? 42 GLU P O    5  
ATOM 5439  C CB   . GLU A 1 44 ? -2.122  -7.700  2.047   1.00 0.00 ? 42 GLU P CB   5  
ATOM 5440  C CG   . GLU A 1 44 ? -2.152  -9.035  2.809   1.00 0.00 ? 42 GLU P CG   5  
ATOM 5441  C CD   . GLU A 1 44 ? -3.579  -9.543  3.110   1.00 0.00 ? 42 GLU P CD   5  
ATOM 5442  O OE1  . GLU A 1 44 ? -4.424  -9.581  2.182   1.00 0.00 ? 42 GLU P OE1  5  
ATOM 5443  O OE2  . GLU A 1 44 ? -3.855  -9.935  4.267   1.00 0.00 ? 42 GLU P OE2  5  
ATOM 5444  H H    . GLU A 1 44 ? -0.166  -6.829  3.439   1.00 0.00 ? 42 GLU P H    5  
ATOM 5445  H HA   . GLU A 1 44 ? -2.396  -5.606  2.190   1.00 0.00 ? 42 GLU P HA   5  
ATOM 5446  H HB2  . GLU A 1 44 ? -2.920  -7.690  1.310   1.00 0.00 ? 42 GLU P HB2  5  
ATOM 5447  H HB3  . GLU A 1 44 ? -1.184  -7.648  1.500   1.00 0.00 ? 42 GLU P HB3  5  
ATOM 5448  H HG2  . GLU A 1 44 ? -1.653  -9.778  2.187   1.00 0.00 ? 42 GLU P HG2  5  
ATOM 5449  H HG3  . GLU A 1 44 ? -1.572  -8.939  3.730   1.00 0.00 ? 42 GLU P HG3  5  
ATOM 5450  N N    . ALA A 1 45 ? -3.136  -6.791  5.136   1.00 0.00 ? 43 ALA P N    5  
ATOM 5451  C CA   . ALA A 1 45 ? -4.118  -6.750  6.217   1.00 0.00 ? 43 ALA P CA   5  
ATOM 5452  C C    . ALA A 1 45 ? -4.565  -5.315  6.562   1.00 0.00 ? 43 ALA P C    5  
ATOM 5453  O O    . ALA A 1 45 ? -5.754  -5.083  6.768   1.00 0.00 ? 43 ALA P O    5  
ATOM 5454  C CB   . ALA A 1 45 ? -3.533  -7.472  7.436   1.00 0.00 ? 43 ALA P CB   5  
ATOM 5455  H H    . ALA A 1 45 ? -2.205  -7.121  5.343   1.00 0.00 ? 43 ALA P H    5  
ATOM 5456  H HA   . ALA A 1 45 ? -5.004  -7.300  5.893   1.00 0.00 ? 43 ALA P HA   5  
ATOM 5457  H HB1  . ALA A 1 45 ? -3.266  -8.496  7.168   1.00 0.00 ? 43 ALA P HB1  5  
ATOM 5458  H HB2  . ALA A 1 45 ? -2.647  -6.951  7.799   1.00 0.00 ? 43 ALA P HB2  5  
ATOM 5459  H HB3  . ALA A 1 45 ? -4.277  -7.503  8.234   1.00 0.00 ? 43 ALA P HB3  5  
ATOM 5460  N N    . ARG A 1 46 ? -3.652  -4.328  6.552   1.00 0.00 ? 44 ARG P N    5  
ATOM 5461  C CA   . ARG A 1 46 ? -3.985  -2.895  6.706   1.00 0.00 ? 44 ARG P CA   5  
ATOM 5462  C C    . ARG A 1 46 ? -4.907  -2.425  5.591   1.00 0.00 ? 44 ARG P C    5  
ATOM 5463  O O    . ARG A 1 46 ? -5.904  -1.763  5.860   1.00 0.00 ? 44 ARG P O    5  
ATOM 5464  C CB   . ARG A 1 46 ? -2.715  -2.018  6.706   1.00 0.00 ? 44 ARG P CB   5  
ATOM 5465  C CG   . ARG A 1 46 ? -1.835  -2.145  7.957   1.00 0.00 ? 44 ARG P CG   5  
ATOM 5466  C CD   . ARG A 1 46 ? -2.565  -1.553  9.166   1.00 0.00 ? 44 ARG P CD   5  
ATOM 5467  N NE   . ARG A 1 46 ? -1.712  -1.474  10.367  1.00 0.00 ? 44 ARG P NE   5  
ATOM 5468  C CZ   . ARG A 1 46 ? -2.073  -0.956  11.529  1.00 0.00 ? 44 ARG P CZ   5  
ATOM 5469  N NH1  . ARG A 1 46 ? -3.270  -0.490  11.739  1.00 0.00 ? 44 ARG P NH1  5  
ATOM 5470  N NH2  . ARG A 1 46 ? -1.237  -0.883  12.523  1.00 0.00 ? 44 ARG P NH2  5  
ATOM 5471  H H    . ARG A 1 46 ? -2.703  -4.578  6.316   1.00 0.00 ? 44 ARG P H    5  
ATOM 5472  H HA   . ARG A 1 46 ? -4.538  -2.750  7.634   1.00 0.00 ? 44 ARG P HA   5  
ATOM 5473  H HB2  . ARG A 1 46 ? -2.125  -2.239  5.820   1.00 0.00 ? 44 ARG P HB2  5  
ATOM 5474  H HB3  . ARG A 1 46 ? -3.017  -0.974  6.616   1.00 0.00 ? 44 ARG P HB3  5  
ATOM 5475  H HG2  . ARG A 1 46 ? -1.598  -3.191  8.147   1.00 0.00 ? 44 ARG P HG2  5  
ATOM 5476  H HG3  . ARG A 1 46 ? -0.909  -1.593  7.793   1.00 0.00 ? 44 ARG P HG3  5  
ATOM 5477  H HD2  . ARG A 1 46 ? -2.911  -0.549  8.904   1.00 0.00 ? 44 ARG P HD2  5  
ATOM 5478  H HD3  . ARG A 1 46 ? -3.424  -2.186  9.380   1.00 0.00 ? 44 ARG P HD3  5  
ATOM 5479  H HE   . ARG A 1 46 ? -0.768  -1.821  10.296  1.00 0.00 ? 44 ARG P HE   5  
ATOM 5480  H HH11 . ARG A 1 46 ? -3.954  -0.523  11.005  1.00 0.00 ? 44 ARG P HH11 5  
ATOM 5481  H HH12 . ARG A 1 46 ? -3.484  -0.056  12.628  1.00 0.00 ? 44 ARG P HH12 5  
ATOM 5482  H HH21 . ARG A 1 46 ? -0.298  -1.232  12.430  1.00 0.00 ? 44 ARG P HH21 5  
ATOM 5483  H HH22 . ARG A 1 46 ? -1.541  -0.467  13.389  1.00 0.00 ? 44 ARG P HH22 5  
ATOM 5484  N N    . VAL A 1 47 ? -4.609  -2.819  4.352   1.00 0.00 ? 45 VAL P N    5  
ATOM 5485  C CA   . VAL A 1 47 ? -5.449  -2.502  3.187   1.00 0.00 ? 45 VAL P CA   5  
ATOM 5486  C C    . VAL A 1 47 ? -6.822  -3.161  3.337   1.00 0.00 ? 45 VAL P C    5  
ATOM 5487  O O    . VAL A 1 47 ? -7.842  -2.495  3.180   1.00 0.00 ? 45 VAL P O    5  
ATOM 5488  C CB   . VAL A 1 47 ? -4.766  -2.916  1.869   1.00 0.00 ? 45 VAL P CB   5  
ATOM 5489  C CG1  . VAL A 1 47 ? -5.524  -2.357  0.660   1.00 0.00 ? 45 VAL P CG1  5  
ATOM 5490  C CG2  . VAL A 1 47 ? -3.321  -2.407  1.809   1.00 0.00 ? 45 VAL P CG2  5  
ATOM 5491  H H    . VAL A 1 47 ? -3.764  -3.362  4.222   1.00 0.00 ? 45 VAL P H    5  
ATOM 5492  H HA   . VAL A 1 47 ? -5.605  -1.423  3.161   1.00 0.00 ? 45 VAL P HA   5  
ATOM 5493  H HB   . VAL A 1 47 ? -4.750  -4.001  1.794   1.00 0.00 ? 45 VAL P HB   5  
ATOM 5494  H HG11 . VAL A 1 47 ? -6.534  -2.765  0.625   1.00 0.00 ? 45 VAL P HG11 5  
ATOM 5495  H HG12 . VAL A 1 47 ? -5.576  -1.271  0.721   1.00 0.00 ? 45 VAL P HG12 5  
ATOM 5496  H HG13 . VAL A 1 47 ? -5.011  -2.635  -0.260  1.00 0.00 ? 45 VAL P HG13 5  
ATOM 5497  H HG21 . VAL A 1 47 ? -3.281  -1.348  2.059   1.00 0.00 ? 45 VAL P HG21 5  
ATOM 5498  H HG22 . VAL A 1 47 ? -2.697  -2.962  2.508   1.00 0.00 ? 45 VAL P HG22 5  
ATOM 5499  H HG23 . VAL A 1 47 ? -2.914  -2.562  0.814   1.00 0.00 ? 45 VAL P HG23 5  
ATOM 5500  N N    . ARG A 1 48 ? -6.873  -4.437  3.738   1.00 0.00 ? 46 ARG P N    5  
ATOM 5501  C CA   . ARG A 1 48 ? -8.122  -5.181  3.964   1.00 0.00 ? 46 ARG P CA   5  
ATOM 5502  C C    . ARG A 1 48 ? -8.998  -4.531  5.042   1.00 0.00 ? 46 ARG P C    5  
ATOM 5503  O O    . ARG A 1 48 ? -10.192 -4.345  4.824   1.00 0.00 ? 46 ARG P O    5  
ATOM 5504  C CB   . ARG A 1 48 ? -7.779  -6.644  4.296   1.00 0.00 ? 46 ARG P CB   5  
ATOM 5505  C CG   . ARG A 1 48 ? -8.904  -7.599  3.886   1.00 0.00 ? 46 ARG P CG   5  
ATOM 5506  C CD   . ARG A 1 48 ? -8.471  -9.052  4.099   1.00 0.00 ? 46 ARG P CD   5  
ATOM 5507  N NE   . ARG A 1 48 ? -9.412  -9.980  3.446   1.00 0.00 ? 46 ARG P NE   5  
ATOM 5508  C CZ   . ARG A 1 48 ? -9.406  -11.299 3.530   1.00 0.00 ? 46 ARG P CZ   5  
ATOM 5509  N NH1  . ARG A 1 48 ? -8.504  -11.947 4.211   1.00 0.00 ? 46 ARG P NH1  5  
ATOM 5510  N NH2  . ARG A 1 48 ? -10.314 -12.002 2.915   1.00 0.00 ? 46 ARG P NH2  5  
ATOM 5511  H H    . ARG A 1 48 ? -5.991  -4.934  3.845   1.00 0.00 ? 46 ARG P H    5  
ATOM 5512  H HA   . ARG A 1 48 ? -8.700  -5.151  3.038   1.00 0.00 ? 46 ARG P HA   5  
ATOM 5513  H HB2  . ARG A 1 48 ? -6.887  -6.939  3.745   1.00 0.00 ? 46 ARG P HB2  5  
ATOM 5514  H HB3  . ARG A 1 48 ? -7.568  -6.751  5.362   1.00 0.00 ? 46 ARG P HB3  5  
ATOM 5515  H HG2  . ARG A 1 48 ? -9.802  -7.393  4.471   1.00 0.00 ? 46 ARG P HG2  5  
ATOM 5516  H HG3  . ARG A 1 48 ? -9.126  -7.447  2.828   1.00 0.00 ? 46 ARG P HG3  5  
ATOM 5517  H HD2  . ARG A 1 48 ? -7.476  -9.197  3.672   1.00 0.00 ? 46 ARG P HD2  5  
ATOM 5518  H HD3  . ARG A 1 48 ? -8.425  -9.253  5.172   1.00 0.00 ? 46 ARG P HD3  5  
ATOM 5519  H HE   . ARG A 1 48 ? -10.117 -9.563  2.860   1.00 0.00 ? 46 ARG P HE   5  
ATOM 5520  H HH11 . ARG A 1 48 ? -7.784  -11.430 4.685   1.00 0.00 ? 46 ARG P HH11 5  
ATOM 5521  H HH12 . ARG A 1 48 ? -8.524  -12.951 4.265   1.00 0.00 ? 46 ARG P HH12 5  
ATOM 5522  H HH21 . ARG A 1 48 ? -11.050 -11.547 2.401   1.00 0.00 ? 46 ARG P HH21 5  
ATOM 5523  H HH22 . ARG A 1 48 ? -10.312 -13.005 2.987   1.00 0.00 ? 46 ARG P HH22 5  
ATOM 5524  N N    . VAL A 1 49 ? -8.403  -4.109  6.160   1.00 0.00 ? 47 VAL P N    5  
ATOM 5525  C CA   . VAL A 1 49 ? -9.075  -3.363  7.242   1.00 0.00 ? 47 VAL P CA   5  
ATOM 5526  C C    . VAL A 1 49 ? -9.578  -2.003  6.759   1.00 0.00 ? 47 VAL P C    5  
ATOM 5527  O O    . VAL A 1 49 ? -10.726 -1.645  7.030   1.00 0.00 ? 47 VAL P O    5  
ATOM 5528  C CB   . VAL A 1 49 ? -8.129  -3.193  8.450   1.00 0.00 ? 47 VAL P CB   5  
ATOM 5529  C CG1  . VAL A 1 49 ? -8.648  -2.199  9.497   1.00 0.00 ? 47 VAL P CG1  5  
ATOM 5530  C CG2  . VAL A 1 49 ? -7.946  -4.538  9.158   1.00 0.00 ? 47 VAL P CG2  5  
ATOM 5531  H H    . VAL A 1 49 ? -7.417  -4.330  6.271   1.00 0.00 ? 47 VAL P H    5  
ATOM 5532  H HA   . VAL A 1 49 ? -9.948  -3.925  7.570   1.00 0.00 ? 47 VAL P HA   5  
ATOM 5533  H HB   . VAL A 1 49 ? -7.157  -2.843  8.102   1.00 0.00 ? 47 VAL P HB   5  
ATOM 5534  H HG11 . VAL A 1 49 ? -8.660  -1.188  9.088   1.00 0.00 ? 47 VAL P HG11 5  
ATOM 5535  H HG12 . VAL A 1 49 ? -9.656  -2.475  9.811   1.00 0.00 ? 47 VAL P HG12 5  
ATOM 5536  H HG13 . VAL A 1 49 ? -7.987  -2.199  10.365  1.00 0.00 ? 47 VAL P HG13 5  
ATOM 5537  H HG21 . VAL A 1 49 ? -7.196  -4.436  9.944   1.00 0.00 ? 47 VAL P HG21 5  
ATOM 5538  H HG22 . VAL A 1 49 ? -8.894  -4.857  9.590   1.00 0.00 ? 47 VAL P HG22 5  
ATOM 5539  H HG23 . VAL A 1 49 ? -7.598  -5.292  8.456   1.00 0.00 ? 47 VAL P HG23 5  
ATOM 5540  N N    . TRP A 1 50 ? -8.759  -1.252  6.021   1.00 0.00 ? 48 TRP P N    5  
ATOM 5541  C CA   . TRP A 1 50 ? -9.142  0.066   5.518   1.00 0.00 ? 48 TRP P CA   5  
ATOM 5542  C C    . TRP A 1 50 ? -10.317 -0.024  4.542   1.00 0.00 ? 48 TRP P C    5  
ATOM 5543  O O    . TRP A 1 50 ? -11.307 0.680   4.714   1.00 0.00 ? 48 TRP P O    5  
ATOM 5544  C CB   . TRP A 1 50 ? -7.939  0.747   4.867   1.00 0.00 ? 48 TRP P CB   5  
ATOM 5545  C CG   . TRP A 1 50 ? -8.183  2.185   4.535   1.00 0.00 ? 48 TRP P CG   5  
ATOM 5546  C CD1  . TRP A 1 50 ? -7.866  3.235   5.324   1.00 0.00 ? 48 TRP P CD1  5  
ATOM 5547  C CD2  . TRP A 1 50 ? -8.822  2.754   3.350   1.00 0.00 ? 48 TRP P CD2  5  
ATOM 5548  N NE1  . TRP A 1 50 ? -8.241  4.410   4.703   1.00 0.00 ? 48 TRP P NE1  5  
ATOM 5549  C CE2  . TRP A 1 50 ? -8.826  4.175   3.478   1.00 0.00 ? 48 TRP P CE2  5  
ATOM 5550  C CE3  . TRP A 1 50 ? -9.388  2.217   2.174   1.00 0.00 ? 48 TRP P CE3  5  
ATOM 5551  C CZ2  . TRP A 1 50 ? -9.347  5.017   2.487   1.00 0.00 ? 48 TRP P CZ2  5  
ATOM 5552  C CZ3  . TRP A 1 50 ? -9.938  3.048   1.183   1.00 0.00 ? 48 TRP P CZ3  5  
ATOM 5553  C CH2  . TRP A 1 50 ? -9.925  4.443   1.341   1.00 0.00 ? 48 TRP P CH2  5  
ATOM 5554  H H    . TRP A 1 50 ? -7.815  -1.580  5.842   1.00 0.00 ? 48 TRP P H    5  
ATOM 5555  H HA   . TRP A 1 50 ? -9.462  0.682   6.360   1.00 0.00 ? 48 TRP P HA   5  
ATOM 5556  H HB2  . TRP A 1 50 ? -7.088  0.694   5.546   1.00 0.00 ? 48 TRP P HB2  5  
ATOM 5557  H HB3  . TRP A 1 50 ? -7.677  0.207   3.956   1.00 0.00 ? 48 TRP P HB3  5  
ATOM 5558  H HD1  . TRP A 1 50 ? -7.376  3.161   6.290   1.00 0.00 ? 48 TRP P HD1  5  
ATOM 5559  H HE1  . TRP A 1 50 ? -8.096  5.323   5.115   1.00 0.00 ? 48 TRP P HE1  5  
ATOM 5560  H HE3  . TRP A 1 50 ? -9.394  1.150   2.035   1.00 0.00 ? 48 TRP P HE3  5  
ATOM 5561  H HZ2  . TRP A 1 50 ? -9.291  6.090   2.601   1.00 0.00 ? 48 TRP P HZ2  5  
ATOM 5562  H HZ3  . TRP A 1 50 ? -10.366 2.609   0.291   1.00 0.00 ? 48 TRP P HZ3  5  
ATOM 5563  H HH2  . TRP A 1 50 ? -10.362 5.071   0.579   1.00 0.00 ? 48 TRP P HH2  5  
ATOM 5564  N N    . PHE A 1 51 ? -10.266 -0.948  3.576   1.00 0.00 ? 49 PHE P N    5  
ATOM 5565  C CA   . PHE A 1 51 ? -11.359 -1.187  2.627   1.00 0.00 ? 49 PHE P CA   5  
ATOM 5566  C C    . PHE A 1 51 ? -12.623 -1.739  3.308   1.00 0.00 ? 49 PHE P C    5  
ATOM 5567  O O    . PHE A 1 51 ? -13.734 -1.388  2.906   1.00 0.00 ? 49 PHE P O    5  
ATOM 5568  C CB   . PHE A 1 51 ? -10.871 -2.106  1.498   1.00 0.00 ? 49 PHE P CB   5  
ATOM 5569  C CG   . PHE A 1 51 ? -10.204 -1.360  0.355   1.00 0.00 ? 49 PHE P CG   5  
ATOM 5570  C CD1  . PHE A 1 51 ? -8.879  -0.889  0.461   1.00 0.00 ? 49 PHE P CD1  5  
ATOM 5571  C CD2  . PHE A 1 51 ? -10.930 -1.107  -0.823  1.00 0.00 ? 49 PHE P CD2  5  
ATOM 5572  C CE1  . PHE A 1 51 ? -8.286  -0.169  -0.590  1.00 0.00 ? 49 PHE P CE1  5  
ATOM 5573  C CE2  . PHE A 1 51 ? -10.330 -0.407  -1.877  1.00 0.00 ? 49 PHE P CE2  5  
ATOM 5574  C CZ   . PHE A 1 51 ? -9.017  0.075   -1.762  1.00 0.00 ? 49 PHE P CZ   5  
ATOM 5575  H H    . PHE A 1 51 ? -9.420  -1.502  3.486   1.00 0.00 ? 49 PHE P H    5  
ATOM 5576  H HA   . PHE A 1 51 ? -11.645 -0.234  2.178   1.00 0.00 ? 49 PHE P HA   5  
ATOM 5577  H HB2  . PHE A 1 51 ? -10.190 -2.862  1.894   1.00 0.00 ? 49 PHE P HB2  5  
ATOM 5578  H HB3  . PHE A 1 51 ? -11.730 -2.642  1.091   1.00 0.00 ? 49 PHE P HB3  5  
ATOM 5579  H HD1  . PHE A 1 51 ? -8.314  -1.051  1.362   1.00 0.00 ? 49 PHE P HD1  5  
ATOM 5580  H HD2  . PHE A 1 51 ? -11.948 -1.449  -0.931  1.00 0.00 ? 49 PHE P HD2  5  
ATOM 5581  H HE1  . PHE A 1 51 ? -7.273  0.201   -0.498  1.00 0.00 ? 49 PHE P HE1  5  
ATOM 5582  H HE2  . PHE A 1 51 ? -10.884 -0.245  -2.782  1.00 0.00 ? 49 PHE P HE2  5  
ATOM 5583  H HZ   . PHE A 1 51 ? -8.577  0.633   -2.573  1.00 0.00 ? 49 PHE P HZ   5  
ATOM 5584  N N    . LYS A 1 52 ? -12.478 -2.527  4.382   1.00 0.00 ? 50 LYS P N    5  
ATOM 5585  C CA   . LYS A 1 52 ? -13.605 -3.028  5.197   1.00 0.00 ? 50 LYS P CA   5  
ATOM 5586  C C    . LYS A 1 52 ? -14.317 -1.893  5.942   1.00 0.00 ? 50 LYS P C    5  
ATOM 5587  O O    . LYS A 1 52 ? -15.546 -1.878  6.005   1.00 0.00 ? 50 LYS P O    5  
ATOM 5588  C CB   . LYS A 1 52 ? -13.112 -4.141  6.141   1.00 0.00 ? 50 LYS P CB   5  
ATOM 5589  C CG   . LYS A 1 52 ? -14.254 -4.764  6.963   1.00 0.00 ? 50 LYS P CG   5  
ATOM 5590  C CD   . LYS A 1 52 ? -13.825 -6.012  7.750   1.00 0.00 ? 50 LYS P CD   5  
ATOM 5591  C CE   . LYS A 1 52 ? -12.783 -5.694  8.834   1.00 0.00 ? 50 LYS P CE   5  
ATOM 5592  N NZ   . LYS A 1 52 ? -12.458 -6.897  9.646   1.00 0.00 ? 50 LYS P NZ   5  
ATOM 5593  H H    . LYS A 1 52 ? -11.530 -2.775  4.647   1.00 0.00 ? 50 LYS P H    5  
ATOM 5594  H HA   . LYS A 1 52 ? -14.342 -3.465  4.522   1.00 0.00 ? 50 LYS P HA   5  
ATOM 5595  H HB2  . LYS A 1 52 ? -12.658 -4.927  5.536   1.00 0.00 ? 50 LYS P HB2  5  
ATOM 5596  H HB3  . LYS A 1 52 ? -12.357 -3.739  6.815   1.00 0.00 ? 50 LYS P HB3  5  
ATOM 5597  H HG2  . LYS A 1 52 ? -14.646 -4.025  7.664   1.00 0.00 ? 50 LYS P HG2  5  
ATOM 5598  H HG3  . LYS A 1 52 ? -15.057 -5.050  6.285   1.00 0.00 ? 50 LYS P HG3  5  
ATOM 5599  H HD2  . LYS A 1 52 ? -14.712 -6.435  8.225   1.00 0.00 ? 50 LYS P HD2  5  
ATOM 5600  H HD3  . LYS A 1 52 ? -13.421 -6.753  7.058   1.00 0.00 ? 50 LYS P HD3  5  
ATOM 5601  H HE2  . LYS A 1 52 ? -11.878 -5.311  8.355   1.00 0.00 ? 50 LYS P HE2  5  
ATOM 5602  H HE3  . LYS A 1 52 ? -13.182 -4.906  9.481   1.00 0.00 ? 50 LYS P HE3  5  
ATOM 5603  H HZ1  . LYS A 1 52 ? -11.780 -6.681  10.365  1.00 0.00 ? 50 LYS P HZ1  5  
ATOM 5604  H HZ2  . LYS A 1 52 ? -12.072 -7.636  9.074   1.00 0.00 ? 50 LYS P HZ2  5  
ATOM 5605  H HZ3  . LYS A 1 52 ? -13.281 -7.262  10.108  1.00 0.00 ? 50 LYS P HZ3  5  
ATOM 5606  N N    . ASN A 1 53 ? -13.570 -0.904  6.436   1.00 0.00 ? 51 ASN P N    5  
ATOM 5607  C CA   . ASN A 1 53 ? -14.153 0.336   6.969   1.00 0.00 ? 51 ASN P CA   5  
ATOM 5608  C C    . ASN A 1 53 ? -14.733 1.234   5.855   1.00 0.00 ? 51 ASN P C    5  
ATOM 5609  O O    . ASN A 1 53 ? -15.849 1.740   5.989   1.00 0.00 ? 51 ASN P O    5  
ATOM 5610  C CB   . ASN A 1 53 ? -13.105 1.073   7.822   1.00 0.00 ? 51 ASN P CB   5  
ATOM 5611  C CG   . ASN A 1 53 ? -12.913 0.441   9.189   1.00 0.00 ? 51 ASN P CG   5  
ATOM 5612  O OD1  . ASN A 1 53 ? -13.538 0.824   10.168  1.00 0.00 ? 51 ASN P OD1  5  
ATOM 5613  N ND2  . ASN A 1 53 ? -12.057 -0.548  9.307   1.00 0.00 ? 51 ASN P ND2  5  
ATOM 5614  H H    . ASN A 1 53 ? -12.561 -1.018  6.424   1.00 0.00 ? 51 ASN P H    5  
ATOM 5615  H HA   . ASN A 1 53 ? -14.996 0.080   7.614   1.00 0.00 ? 51 ASN P HA   5  
ATOM 5616  H HB2  . ASN A 1 53 ? -12.147 1.108   7.304   1.00 0.00 ? 51 ASN P HB2  5  
ATOM 5617  H HB3  . ASN A 1 53 ? -13.439 2.098   7.983   1.00 0.00 ? 51 ASN P HB3  5  
ATOM 5618  H HD21 . ASN A 1 53 ? -11.548 -0.883  8.497   1.00 0.00 ? 51 ASN P HD21 5  
ATOM 5619  H HD22 . ASN A 1 53 ? -11.920 -0.953  10.215  1.00 0.00 ? 51 ASN P HD22 5  
ATOM 5620  N N    . ARG A 1 54 ? -14.025 1.403   4.730   1.00 0.00 ? 52 ARG P N    5  
ATOM 5621  C CA   . ARG A 1 54 ? -14.435 2.283   3.620   1.00 0.00 ? 52 ARG P CA   5  
ATOM 5622  C C    . ARG A 1 54 ? -15.740 1.833   2.966   1.00 0.00 ? 52 ARG P C    5  
ATOM 5623  O O    . ARG A 1 54 ? -16.595 2.675   2.697   1.00 0.00 ? 52 ARG P O    5  
ATOM 5624  C CB   . ARG A 1 54 ? -13.304 2.380   2.577   1.00 0.00 ? 52 ARG P CB   5  
ATOM 5625  C CG   . ARG A 1 54 ? -13.485 3.532   1.569   1.00 0.00 ? 52 ARG P CG   5  
ATOM 5626  C CD   . ARG A 1 54 ? -13.331 4.921   2.208   1.00 0.00 ? 52 ARG P CD   5  
ATOM 5627  N NE   . ARG A 1 54 ? -13.464 5.997   1.203   1.00 0.00 ? 52 ARG P NE   5  
ATOM 5628  C CZ   . ARG A 1 54 ? -12.743 7.101   1.104   1.00 0.00 ? 52 ARG P CZ   5  
ATOM 5629  N NH1  . ARG A 1 54 ? -11.777 7.409   1.915   1.00 0.00 ? 52 ARG P NH1  5  
ATOM 5630  N NH2  . ARG A 1 54 ? -12.951 7.968   0.160   1.00 0.00 ? 52 ARG P NH2  5  
ATOM 5631  H H    . ARG A 1 54 ? -13.096 0.991   4.694   1.00 0.00 ? 52 ARG P H    5  
ATOM 5632  H HA   . ARG A 1 54 ? -14.625 3.271   4.040   1.00 0.00 ? 52 ARG P HA   5  
ATOM 5633  H HB2  . ARG A 1 54 ? -12.346 2.499   3.086   1.00 0.00 ? 52 ARG P HB2  5  
ATOM 5634  H HB3  . ARG A 1 54 ? -13.265 1.443   2.020   1.00 0.00 ? 52 ARG P HB3  5  
ATOM 5635  H HG2  . ARG A 1 54 ? -12.733 3.425   0.786   1.00 0.00 ? 52 ARG P HG2  5  
ATOM 5636  H HG3  . ARG A 1 54 ? -14.464 3.457   1.095   1.00 0.00 ? 52 ARG P HG3  5  
ATOM 5637  H HD2  . ARG A 1 54 ? -14.101 5.060   2.966   1.00 0.00 ? 52 ARG P HD2  5  
ATOM 5638  H HD3  . ARG A 1 54 ? -12.357 4.966   2.697   1.00 0.00 ? 52 ARG P HD3  5  
ATOM 5639  H HE   . ARG A 1 54 ? -14.189 5.879   0.512   1.00 0.00 ? 52 ARG P HE   5  
ATOM 5640  H HH11 . ARG A 1 54 ? -11.558 6.812   2.691   1.00 0.00 ? 52 ARG P HH11 5  
ATOM 5641  H HH12 . ARG A 1 54 ? -11.243 8.252   1.709   1.00 0.00 ? 52 ARG P HH12 5  
ATOM 5642  H HH21 . ARG A 1 54 ? -13.694 7.856   -0.506  1.00 0.00 ? 52 ARG P HH21 5  
ATOM 5643  H HH22 . ARG A 1 54 ? -12.320 8.767   0.124   1.00 0.00 ? 52 ARG P HH22 5  
ATOM 5644  N N    . ARG A 1 55 ? -15.943 0.524   2.770   1.00 0.00 ? 53 ARG P N    5  
ATOM 5645  C CA   . ARG A 1 55 ? -17.184 -0.013  2.179   1.00 0.00 ? 53 ARG P CA   5  
ATOM 5646  C C    . ARG A 1 55 ? -18.400 0.191   3.088   1.00 0.00 ? 53 ARG P C    5  
ATOM 5647  O O    . ARG A 1 55 ? -19.485 0.482   2.593   1.00 0.00 ? 53 ARG P O    5  
ATOM 5648  C CB   . ARG A 1 55 ? -16.990 -1.471  1.717   1.00 0.00 ? 53 ARG P CB   5  
ATOM 5649  C CG   . ARG A 1 55 ? -16.937 -2.497  2.859   1.00 0.00 ? 53 ARG P CG   5  
ATOM 5650  C CD   . ARG A 1 55 ? -16.522 -3.880  2.349   1.00 0.00 ? 53 ARG P CD   5  
ATOM 5651  N NE   . ARG A 1 55 ? -16.587 -4.887  3.428   1.00 0.00 ? 53 ARG P NE   5  
ATOM 5652  C CZ   . ARG A 1 55 ? -16.159 -6.136  3.371   1.00 0.00 ? 53 ARG P CZ   5  
ATOM 5653  N NH1  . ARG A 1 55 ? -15.559 -6.618  2.320   1.00 0.00 ? 53 ARG P NH1  5  
ATOM 5654  N NH2  . ARG A 1 55 ? -16.330 -6.937  4.384   1.00 0.00 ? 53 ARG P NH2  5  
ATOM 5655  H H    . ARG A 1 55 ? -15.181 -0.111  2.993   1.00 0.00 ? 53 ARG P H    5  
ATOM 5656  H HA   . ARG A 1 55 ? -17.386 0.570   1.281   1.00 0.00 ? 53 ARG P HA   5  
ATOM 5657  H HB2  . ARG A 1 55 ? -17.815 -1.741  1.055   1.00 0.00 ? 53 ARG P HB2  5  
ATOM 5658  H HB3  . ARG A 1 55 ? -16.067 -1.531  1.135   1.00 0.00 ? 53 ARG P HB3  5  
ATOM 5659  H HG2  . ARG A 1 55 ? -16.214 -2.168  3.599   1.00 0.00 ? 53 ARG P HG2  5  
ATOM 5660  H HG3  . ARG A 1 55 ? -17.920 -2.568  3.327   1.00 0.00 ? 53 ARG P HG3  5  
ATOM 5661  H HD2  . ARG A 1 55 ? -17.191 -4.176  1.539   1.00 0.00 ? 53 ARG P HD2  5  
ATOM 5662  H HD3  . ARG A 1 55 ? -15.502 -3.815  1.961   1.00 0.00 ? 53 ARG P HD3  5  
ATOM 5663  H HE   . ARG A 1 55 ? -17.046 -4.612  4.283   1.00 0.00 ? 53 ARG P HE   5  
ATOM 5664  H HH11 . ARG A 1 55 ? -15.426 -6.028  1.518   1.00 0.00 ? 53 ARG P HH11 5  
ATOM 5665  H HH12 . ARG A 1 55 ? -15.250 -7.575  2.299   1.00 0.00 ? 53 ARG P HH12 5  
ATOM 5666  H HH21 . ARG A 1 55 ? -16.826 -6.625  5.201   1.00 0.00 ? 53 ARG P HH21 5  
ATOM 5667  H HH22 . ARG A 1 55 ? -16.015 -7.891  4.333   1.00 0.00 ? 53 ARG P HH22 5  
ATOM 5668  N N    . ALA A 1 56 ? -18.218 0.149   4.410   1.00 0.00 ? 54 ALA P N    5  
ATOM 5669  C CA   . ALA A 1 56 ? -19.273 0.498   5.361   1.00 0.00 ? 54 ALA P CA   5  
ATOM 5670  C C    . ALA A 1 56 ? -19.618 1.998   5.287   1.00 0.00 ? 54 ALA P C    5  
ATOM 5671  O O    . ALA A 1 56 ? -20.792 2.359   5.179   1.00 0.00 ? 54 ALA P O    5  
ATOM 5672  C CB   . ALA A 1 56 ? -18.841 0.061   6.767   1.00 0.00 ? 54 ALA P CB   5  
ATOM 5673  H H    . ALA A 1 56 ? -17.299 -0.071  4.768   1.00 0.00 ? 54 ALA P H    5  
ATOM 5674  H HA   . ALA A 1 56 ? -20.177 -0.057  5.102   1.00 0.00 ? 54 ALA P HA   5  
ATOM 5675  H HB1  . ALA A 1 56 ? -18.624 -1.008  6.772   1.00 0.00 ? 54 ALA P HB1  5  
ATOM 5676  H HB2  . ALA A 1 56 ? -17.951 0.607   7.083   1.00 0.00 ? 54 ALA P HB2  5  
ATOM 5677  H HB3  . ALA A 1 56 ? -19.646 0.260   7.475   1.00 0.00 ? 54 ALA P HB3  5  
ATOM 5678  N N    . LYS A 1 57 ? -18.605 2.877   5.248   1.00 0.00 ? 55 LYS P N    5  
ATOM 5679  C CA   . LYS A 1 57 ? -18.784 4.338   5.139   1.00 0.00 ? 55 LYS P CA   5  
ATOM 5680  C C    . LYS A 1 57 ? -19.413 4.750   3.802   1.00 0.00 ? 55 LYS P C    5  
ATOM 5681  O O    . LYS A 1 57 ? -20.218 5.681   3.770   1.00 0.00 ? 55 LYS P O    5  
ATOM 5682  C CB   . LYS A 1 57 ? -17.436 5.048   5.361   1.00 0.00 ? 55 LYS P CB   5  
ATOM 5683  C CG   . LYS A 1 57 ? -16.975 4.949   6.824   1.00 0.00 ? 55 LYS P CG   5  
ATOM 5684  C CD   . LYS A 1 57 ? -15.617 5.632   7.026   1.00 0.00 ? 55 LYS P CD   5  
ATOM 5685  C CE   . LYS A 1 57 ? -15.200 5.540   8.500   1.00 0.00 ? 55 LYS P CE   5  
ATOM 5686  N NZ   . LYS A 1 57 ? -13.914 6.242   8.753   1.00 0.00 ? 55 LYS P NZ   5  
ATOM 5687  H H    . LYS A 1 57 ? -17.660 2.511   5.300   1.00 0.00 ? 55 LYS P H    5  
ATOM 5688  H HA   . LYS A 1 57 ? -19.479 4.664   5.916   1.00 0.00 ? 55 LYS P HA   5  
ATOM 5689  H HB2  . LYS A 1 57 ? -16.680 4.614   4.704   1.00 0.00 ? 55 LYS P HB2  5  
ATOM 5690  H HB3  . LYS A 1 57 ? -17.546 6.104   5.107   1.00 0.00 ? 55 LYS P HB3  5  
ATOM 5691  H HG2  . LYS A 1 57 ? -17.718 5.432   7.462   1.00 0.00 ? 55 LYS P HG2  5  
ATOM 5692  H HG3  . LYS A 1 57 ? -16.894 3.903   7.120   1.00 0.00 ? 55 LYS P HG3  5  
ATOM 5693  H HD2  . LYS A 1 57 ? -14.867 5.142   6.402   1.00 0.00 ? 55 LYS P HD2  5  
ATOM 5694  H HD3  . LYS A 1 57 ? -15.695 6.682   6.734   1.00 0.00 ? 55 LYS P HD3  5  
ATOM 5695  H HE2  . LYS A 1 57 ? -15.990 5.980   9.116   1.00 0.00 ? 55 LYS P HE2  5  
ATOM 5696  H HE3  . LYS A 1 57 ? -15.113 4.484   8.775   1.00 0.00 ? 55 LYS P HE3  5  
ATOM 5697  H HZ1  . LYS A 1 57 ? -13.650 6.174   9.728   1.00 0.00 ? 55 LYS P HZ1  5  
ATOM 5698  H HZ2  . LYS A 1 57 ? -13.982 7.225   8.527   1.00 0.00 ? 55 LYS P HZ2  5  
ATOM 5699  H HZ3  . LYS A 1 57 ? -13.163 5.847   8.205   1.00 0.00 ? 55 LYS P HZ3  5  
ATOM 5700  N N    . TRP A 1 58 ? -19.126 4.019   2.722   1.00 0.00 ? 56 TRP P N    5  
ATOM 5701  C CA   . TRP A 1 58 ? -19.817 4.152   1.438   1.00 0.00 ? 56 TRP P CA   5  
ATOM 5702  C C    . TRP A 1 58 ? -21.298 3.766   1.566   1.00 0.00 ? 56 TRP P C    5  
ATOM 5703  O O    . TRP A 1 58 ? -22.166 4.567   1.224   1.00 0.00 ? 56 TRP P O    5  
ATOM 5704  C CB   . TRP A 1 58 ? -19.095 3.311   0.372   1.00 0.00 ? 56 TRP P CB   5  
ATOM 5705  C CG   . TRP A 1 58 ? -19.945 2.880   -0.787  1.00 0.00 ? 56 TRP P CG   5  
ATOM 5706  C CD1  . TRP A 1 58 ? -20.626 3.699   -1.620  1.00 0.00 ? 56 TRP P CD1  5  
ATOM 5707  C CD2  . TRP A 1 58 ? -20.295 1.520   -1.196  1.00 0.00 ? 56 TRP P CD2  5  
ATOM 5708  N NE1  . TRP A 1 58 ? -21.381 2.940   -2.496  1.00 0.00 ? 56 TRP P NE1  5  
ATOM 5709  C CE2  . TRP A 1 58 ? -21.216 1.593   -2.281  1.00 0.00 ? 56 TRP P CE2  5  
ATOM 5710  C CE3  . TRP A 1 58 ? -19.958 0.232   -0.735  1.00 0.00 ? 56 TRP P CE3  5  
ATOM 5711  C CZ2  . TRP A 1 58 ? -21.774 0.454   -2.880  1.00 0.00 ? 56 TRP P CZ2  5  
ATOM 5712  C CZ3  . TRP A 1 58 ? -20.522 -0.922  -1.314  1.00 0.00 ? 56 TRP P CZ3  5  
ATOM 5713  C CH2  . TRP A 1 58 ? -21.422 -0.815  -2.390  1.00 0.00 ? 56 TRP P CH2  5  
ATOM 5714  H H    . TRP A 1 58 ? -18.403 3.311   2.802   1.00 0.00 ? 56 TRP P H    5  
ATOM 5715  H HA   . TRP A 1 58 ? -19.786 5.195   1.123   1.00 0.00 ? 56 TRP P HA   5  
ATOM 5716  H HB2  . TRP A 1 58 ? -18.240 3.875   -0.004  1.00 0.00 ? 56 TRP P HB2  5  
ATOM 5717  H HB3  . TRP A 1 58 ? -18.707 2.412   0.850   1.00 0.00 ? 56 TRP P HB3  5  
ATOM 5718  H HD1  . TRP A 1 58 ? -20.614 4.781   -1.562  1.00 0.00 ? 56 TRP P HD1  5  
ATOM 5719  H HE1  . TRP A 1 58 ? -22.022 3.321   -3.187  1.00 0.00 ? 56 TRP P HE1  5  
ATOM 5720  H HE3  . TRP A 1 58 ? -19.285 0.144   0.104   1.00 0.00 ? 56 TRP P HE3  5  
ATOM 5721  H HZ2  . TRP A 1 58 ? -22.473 0.558   -3.698  1.00 0.00 ? 56 TRP P HZ2  5  
ATOM 5722  H HZ3  . TRP A 1 58 ? -20.272 -1.896  -0.917  1.00 0.00 ? 56 TRP P HZ3  5  
ATOM 5723  H HH2  . TRP A 1 58 ? -21.850 -1.707  -2.832  1.00 0.00 ? 56 TRP P HH2  5  
ATOM 5724  N N    . ARG A 1 59 ? -21.606 2.587   2.120   1.00 0.00 ? 57 ARG P N    5  
ATOM 5725  C CA   . ARG A 1 59 ? -22.985 2.082   2.288   1.00 0.00 ? 57 ARG P CA   5  
ATOM 5726  C C    . ARG A 1 59 ? -23.873 2.964   3.181   1.00 0.00 ? 57 ARG P C    5  
ATOM 5727  O O    . ARG A 1 59 ? -25.088 2.985   2.985   1.00 0.00 ? 57 ARG P O    5  
ATOM 5728  C CB   . ARG A 1 59 ? -22.941 0.644   2.832   1.00 0.00 ? 57 ARG P CB   5  
ATOM 5729  C CG   . ARG A 1 59 ? -22.553 -0.361  1.739   1.00 0.00 ? 57 ARG P CG   5  
ATOM 5730  C CD   . ARG A 1 59 ? -22.291 -1.764  2.302   1.00 0.00 ? 57 ARG P CD   5  
ATOM 5731  N NE   . ARG A 1 59 ? -23.505 -2.379  2.881   1.00 0.00 ? 57 ARG P NE   5  
ATOM 5732  C CZ   . ARG A 1 59 ? -24.475 -2.999  2.233   1.00 0.00 ? 57 ARG P CZ   5  
ATOM 5733  N NH1  . ARG A 1 59 ? -24.474 -3.136  0.936   1.00 0.00 ? 57 ARG P NH1  5  
ATOM 5734  N NH2  . ARG A 1 59 ? -25.483 -3.503  2.886   1.00 0.00 ? 57 ARG P NH2  5  
ATOM 5735  H H    . ARG A 1 59 ? -20.837 1.966   2.358   1.00 0.00 ? 57 ARG P H    5  
ATOM 5736  H HA   . ARG A 1 59 ? -23.462 2.070   1.304   1.00 0.00 ? 57 ARG P HA   5  
ATOM 5737  H HB2  . ARG A 1 59 ? -22.223 0.590   3.652   1.00 0.00 ? 57 ARG P HB2  5  
ATOM 5738  H HB3  . ARG A 1 59 ? -23.926 0.370   3.215   1.00 0.00 ? 57 ARG P HB3  5  
ATOM 5739  H HG2  . ARG A 1 59 ? -23.341 -0.404  0.986   1.00 0.00 ? 57 ARG P HG2  5  
ATOM 5740  H HG3  . ARG A 1 59 ? -21.644 -0.019  1.255   1.00 0.00 ? 57 ARG P HG3  5  
ATOM 5741  H HD2  . ARG A 1 59 ? -21.893 -2.398  1.507   1.00 0.00 ? 57 ARG P HD2  5  
ATOM 5742  H HD3  . ARG A 1 59 ? -21.521 -1.688  3.073   1.00 0.00 ? 57 ARG P HD3  5  
ATOM 5743  H HE   . ARG A 1 59 ? -23.597 -2.337  3.884   1.00 0.00 ? 57 ARG P HE   5  
ATOM 5744  H HH11 . ARG A 1 59 ? -23.710 -2.759  0.404   1.00 0.00 ? 57 ARG P HH11 5  
ATOM 5745  H HH12 . ARG A 1 59 ? -25.227 -3.614  0.470   1.00 0.00 ? 57 ARG P HH12 5  
ATOM 5746  H HH21 . ARG A 1 59 ? -25.529 -3.425  3.888   1.00 0.00 ? 57 ARG P HH21 5  
ATOM 5747  H HH22 . ARG A 1 59 ? -26.222 -3.976  2.393   1.00 0.00 ? 57 ARG P HH22 5  
ATOM 5748  N N    . LYS A 1 60 ? -23.289 3.736   4.108   1.00 0.00 ? 58 LYS P N    5  
ATOM 5749  C CA   . LYS A 1 60 ? -23.994 4.769   4.902   1.00 0.00 ? 58 LYS P CA   5  
ATOM 5750  C C    . LYS A 1 60 ? -24.543 5.930   4.054   1.00 0.00 ? 58 LYS P C    5  
ATOM 5751  O O    . LYS A 1 60 ? -25.522 6.559   4.463   1.00 0.00 ? 58 LYS P O    5  
ATOM 5752  C CB   . LYS A 1 60 ? -23.073 5.327   6.013   1.00 0.00 ? 58 LYS P CB   5  
ATOM 5753  C CG   . LYS A 1 60 ? -23.303 4.696   7.396   1.00 0.00 ? 58 LYS P CG   5  
ATOM 5754  C CD   . LYS A 1 60 ? -22.753 3.269   7.513   1.00 0.00 ? 58 LYS P CD   5  
ATOM 5755  C CE   . LYS A 1 60 ? -22.909 2.684   8.922   1.00 0.00 ? 58 LYS P CE   5  
ATOM 5756  N NZ   . LYS A 1 60 ? -24.329 2.419   9.281   1.00 0.00 ? 58 LYS P NZ   5  
ATOM 5757  H H    . LYS A 1 60 ? -22.298 3.590   4.258   1.00 0.00 ? 58 LYS P H    5  
ATOM 5758  H HA   . LYS A 1 60 ? -24.870 4.313   5.369   1.00 0.00 ? 58 LYS P HA   5  
ATOM 5759  H HB2  . LYS A 1 60 ? -22.026 5.227   5.729   1.00 0.00 ? 58 LYS P HB2  5  
ATOM 5760  H HB3  . LYS A 1 60 ? -23.268 6.395   6.126   1.00 0.00 ? 58 LYS P HB3  5  
ATOM 5761  H HG2  . LYS A 1 60 ? -22.799 5.317   8.138   1.00 0.00 ? 58 LYS P HG2  5  
ATOM 5762  H HG3  . LYS A 1 60 ? -24.370 4.706   7.617   1.00 0.00 ? 58 LYS P HG3  5  
ATOM 5763  H HD2  . LYS A 1 60 ? -23.234 2.615   6.783   1.00 0.00 ? 58 LYS P HD2  5  
ATOM 5764  H HD3  . LYS A 1 60 ? -21.685 3.305   7.299   1.00 0.00 ? 58 LYS P HD3  5  
ATOM 5765  H HE2  . LYS A 1 60 ? -22.340 1.751   8.966   1.00 0.00 ? 58 LYS P HE2  5  
ATOM 5766  H HE3  . LYS A 1 60 ? -22.459 3.377   9.639   1.00 0.00 ? 58 LYS P HE3  5  
ATOM 5767  H HZ1  . LYS A 1 60 ? -24.875 3.270   9.291   1.00 0.00 ? 58 LYS P HZ1  5  
ATOM 5768  H HZ2  . LYS A 1 60 ? -24.397 2.008   10.203  1.00 0.00 ? 58 LYS P HZ2  5  
ATOM 5769  H HZ3  . LYS A 1 60 ? -24.761 1.777   8.631   1.00 0.00 ? 58 LYS P HZ3  5  
ATOM 5770  N N    . ARG A 1 61 ? -23.927 6.229   2.901   1.00 0.00 ? 59 ARG P N    5  
ATOM 5771  C CA   . ARG A 1 61 ? -24.246 7.387   2.034   1.00 0.00 ? 59 ARG P CA   5  
ATOM 5772  C C    . ARG A 1 61 ? -24.763 7.010   0.638   1.00 0.00 ? 59 ARG P C    5  
ATOM 5773  O O    . ARG A 1 61 ? -25.458 7.811   0.014   1.00 0.00 ? 59 ARG P O    5  
ATOM 5774  C CB   . ARG A 1 61 ? -23.004 8.293   1.927   1.00 0.00 ? 59 ARG P CB   5  
ATOM 5775  C CG   . ARG A 1 61 ? -22.466 8.838   3.263   1.00 0.00 ? 59 ARG P CG   5  
ATOM 5776  C CD   . ARG A 1 61 ? -23.493 9.698   4.016   1.00 0.00 ? 59 ARG P CD   5  
ATOM 5777  N NE   . ARG A 1 61 ? -22.914 10.296  5.236   1.00 0.00 ? 59 ARG P NE   5  
ATOM 5778  C CZ   . ARG A 1 61 ? -22.266 11.445  5.338   1.00 0.00 ? 59 ARG P CZ   5  
ATOM 5779  N NH1  . ARG A 1 61 ? -22.039 12.214  4.309   1.00 0.00 ? 59 ARG P NH1  5  
ATOM 5780  N NH2  . ARG A 1 61 ? -21.826 11.850  6.494   1.00 0.00 ? 59 ARG P NH2  5  
ATOM 5781  H H    . ARG A 1 61 ? -23.124 5.662   2.653   1.00 0.00 ? 59 ARG P H    5  
ATOM 5782  H HA   . ARG A 1 61 ? -25.055 7.967   2.482   1.00 0.00 ? 59 ARG P HA   5  
ATOM 5783  H HB2  . ARG A 1 61 ? -22.203 7.734   1.440   1.00 0.00 ? 59 ARG P HB2  5  
ATOM 5784  H HB3  . ARG A 1 61 ? -23.249 9.146   1.291   1.00 0.00 ? 59 ARG P HB3  5  
ATOM 5785  H HG2  . ARG A 1 61 ? -22.152 8.012   3.901   1.00 0.00 ? 59 ARG P HG2  5  
ATOM 5786  H HG3  . ARG A 1 61 ? -21.586 9.447   3.050   1.00 0.00 ? 59 ARG P HG3  5  
ATOM 5787  H HD2  . ARG A 1 61 ? -23.873 10.478  3.354   1.00 0.00 ? 59 ARG P HD2  5  
ATOM 5788  H HD3  . ARG A 1 61 ? -24.338 9.070   4.306   1.00 0.00 ? 59 ARG P HD3  5  
ATOM 5789  H HE   . ARG A 1 61 ? -23.039 9.781   6.094   1.00 0.00 ? 59 ARG P HE   5  
ATOM 5790  H HH11 . ARG A 1 61 ? -22.368 11.931  3.402   1.00 0.00 ? 59 ARG P HH11 5  
ATOM 5791  H HH12 . ARG A 1 61 ? -21.546 13.083  4.417   1.00 0.00 ? 59 ARG P HH12 5  
ATOM 5792  H HH21 . ARG A 1 61 ? -21.979 11.293  7.319   1.00 0.00 ? 59 ARG P HH21 5  
ATOM 5793  H HH22 . ARG A 1 61 ? -21.334 12.726  6.572   1.00 0.00 ? 59 ARG P HH22 5  
ATOM 5794  N N    . GLU A 1 62 ? -24.451 5.804   0.160   1.00 0.00 ? 60 GLU P N    5  
ATOM 5795  C CA   . GLU A 1 62 ? -24.827 5.258   -1.158  1.00 0.00 ? 60 GLU P CA   5  
ATOM 5796  C C    . GLU A 1 62 ? -24.392 6.154   -2.342  1.00 0.00 ? 60 GLU P C    5  
ATOM 5797  O O    . GLU A 1 62 ? -25.115 6.332   -3.324  1.00 0.00 ? 60 GLU P O    5  
ATOM 5798  C CB   . GLU A 1 62 ? -26.312 4.841   -1.189  1.00 0.00 ? 60 GLU P CB   5  
ATOM 5799  C CG   . GLU A 1 62 ? -26.664 3.835   -0.083  1.00 0.00 ? 60 GLU P CG   5  
ATOM 5800  C CD   . GLU A 1 62 ? -28.122 3.355   -0.219  1.00 0.00 ? 60 GLU P CD   5  
ATOM 5801  O OE1  . GLU A 1 62 ? -29.042 4.028   0.310   1.00 0.00 ? 60 GLU P OE1  5  
ATOM 5802  O OE2  . GLU A 1 62 ? -28.363 2.297   -0.851  1.00 0.00 ? 60 GLU P OE2  5  
ATOM 5803  H H    . GLU A 1 62 ? -23.840 5.236   0.733   1.00 0.00 ? 60 GLU P H    5  
ATOM 5804  H HA   . GLU A 1 62 ? -24.254 4.339   -1.285  1.00 0.00 ? 60 GLU P HA   5  
ATOM 5805  H HB2  . GLU A 1 62 ? -26.944 5.723   -1.087  1.00 0.00 ? 60 GLU P HB2  5  
ATOM 5806  H HB3  . GLU A 1 62 ? -26.524 4.374   -2.152  1.00 0.00 ? 60 GLU P HB3  5  
ATOM 5807  H HG2  . GLU A 1 62 ? -25.981 2.982   -0.145  1.00 0.00 ? 60 GLU P HG2  5  
ATOM 5808  H HG3  . GLU A 1 62 ? -26.524 4.301   0.895   1.00 0.00 ? 60 GLU P HG3  5  
ATOM 5809  N N    . GLU A 1 63 ? -23.187 6.729   -2.245  1.00 0.00 ? 61 GLU P N    5  
ATOM 5810  C CA   . GLU A 1 63 ? -22.613 7.656   -3.246  1.00 0.00 ? 61 GLU P CA   5  
ATOM 5811  C C    . GLU A 1 63 ? -22.346 7.000   -4.616  1.00 0.00 ? 61 GLU P C    5  
ATOM 5812  O O    . GLU A 1 63 ? -22.393 7.663   -5.655  1.00 0.00 ? 61 GLU P O    5  
ATOM 5813  C CB   . GLU A 1 63 ? -21.293 8.222   -2.697  1.00 0.00 ? 61 GLU P CB   5  
ATOM 5814  C CG   . GLU A 1 63 ? -21.486 9.242   -1.566  1.00 0.00 ? 61 GLU P CG   5  
ATOM 5815  C CD   . GLU A 1 63 ? -22.000 10.597  -2.092  1.00 0.00 ? 61 GLU P CD   5  
ATOM 5816  O OE1  . GLU A 1 63 ? -21.170 11.445  -2.505  1.00 0.00 ? 61 GLU P OE1  5  
ATOM 5817  O OE2  . GLU A 1 63 ? -23.233 10.831  -2.092  1.00 0.00 ? 61 GLU P OE2  5  
ATOM 5818  H H    . GLU A 1 63 ? -22.663 6.561   -1.396  1.00 0.00 ? 61 GLU P H    5  
ATOM 5819  H HA   . GLU A 1 63 ? -23.311 8.477   -3.418  1.00 0.00 ? 61 GLU P HA   5  
ATOM 5820  H HB2  . GLU A 1 63 ? -20.684 7.395   -2.325  1.00 0.00 ? 61 GLU P HB2  5  
ATOM 5821  H HB3  . GLU A 1 63 ? -20.739 8.697   -3.505  1.00 0.00 ? 61 GLU P HB3  5  
ATOM 5822  H HG2  . GLU A 1 63 ? -22.173 8.835   -0.822  1.00 0.00 ? 61 GLU P HG2  5  
ATOM 5823  H HG3  . GLU A 1 63 ? -20.524 9.384   -1.068  1.00 0.00 ? 61 GLU P HG3  5  
ATOM 5824  N N    . PHE A 1 64 ? -22.094 5.690   -4.612  1.00 0.00 ? 62 PHE P N    5  
ATOM 5825  C CA   . PHE A 1 64 ? -21.979 4.808   -5.776  1.00 0.00 ? 62 PHE P CA   5  
ATOM 5826  C C    . PHE A 1 64 ? -22.995 3.659   -5.668  1.00 0.00 ? 62 PHE P C    5  
ATOM 5827  O O    . PHE A 1 64 ? -23.315 3.225   -4.558  1.00 0.00 ? 62 PHE P O    5  
ATOM 5828  C CB   . PHE A 1 64 ? -20.532 4.303   -5.863  1.00 0.00 ? 62 PHE P CB   5  
ATOM 5829  C CG   . PHE A 1 64 ? -20.285 3.287   -6.963  1.00 0.00 ? 62 PHE P CG   5  
ATOM 5830  C CD1  . PHE A 1 64 ? -20.255 3.696   -8.310  1.00 0.00 ? 62 PHE P CD1  5  
ATOM 5831  C CD2  . PHE A 1 64 ? -20.107 1.928   -6.641  1.00 0.00 ? 62 PHE P CD2  5  
ATOM 5832  C CE1  . PHE A 1 64 ? -20.051 2.749   -9.330  1.00 0.00 ? 62 PHE P CE1  5  
ATOM 5833  C CE2  . PHE A 1 64 ? -19.897 0.983   -7.661  1.00 0.00 ? 62 PHE P CE2  5  
ATOM 5834  C CZ   . PHE A 1 64 ? -19.871 1.392   -9.006  1.00 0.00 ? 62 PHE P CZ   5  
ATOM 5835  H H    . PHE A 1 64 ? -22.072 5.247   -3.708  1.00 0.00 ? 62 PHE P H    5  
ATOM 5836  H HA   . PHE A 1 64 ? -22.204 5.368   -6.685  1.00 0.00 ? 62 PHE P HA   5  
ATOM 5837  H HB2  . PHE A 1 64 ? -19.877 5.160   -6.019  1.00 0.00 ? 62 PHE P HB2  5  
ATOM 5838  H HB3  . PHE A 1 64 ? -20.253 3.856   -4.908  1.00 0.00 ? 62 PHE P HB3  5  
ATOM 5839  H HD1  . PHE A 1 64 ? -20.391 4.739   -8.564  1.00 0.00 ? 62 PHE P HD1  5  
ATOM 5840  H HD2  . PHE A 1 64 ? -20.128 1.604   -5.609  1.00 0.00 ? 62 PHE P HD2  5  
ATOM 5841  H HE1  . PHE A 1 64 ? -20.030 3.064   -10.365 1.00 0.00 ? 62 PHE P HE1  5  
ATOM 5842  H HE2  . PHE A 1 64 ? -19.748 -0.058  -7.409  1.00 0.00 ? 62 PHE P HE2  5  
ATOM 5843  H HZ   . PHE A 1 64 ? -19.711 0.664   -9.790  1.00 0.00 ? 62 PHE P HZ   5  
ATOM 5844  N N    . ILE A 1 65 ? -23.501 3.163   -6.802  1.00 0.00 ? 63 ILE P N    5  
ATOM 5845  C CA   . ILE A 1 65 ? -24.504 2.086   -6.876  1.00 0.00 ? 63 ILE P CA   5  
ATOM 5846  C C    . ILE A 1 65 ? -24.101 1.074   -7.962  1.00 0.00 ? 63 ILE P C    5  
ATOM 5847  O O    . ILE A 1 65 ? -23.789 1.457   -9.092  1.00 0.00 ? 63 ILE P O    5  
ATOM 5848  C CB   . ILE A 1 65 ? -25.925 2.661   -7.117  1.00 0.00 ? 63 ILE P CB   5  
ATOM 5849  C CG1  . ILE A 1 65 ? -26.317 3.634   -5.976  1.00 0.00 ? 63 ILE P CG1  5  
ATOM 5850  C CG2  . ILE A 1 65 ? -26.963 1.527   -7.241  1.00 0.00 ? 63 ILE P CG2  5  
ATOM 5851  C CD1  . ILE A 1 65 ? -27.718 4.241   -6.091  1.00 0.00 ? 63 ILE P CD1  5  
ATOM 5852  H H    . ILE A 1 65 ? -23.160 3.535   -7.678  1.00 0.00 ? 63 ILE P H    5  
ATOM 5853  H HA   . ILE A 1 65 ? -24.534 1.558   -5.922  1.00 0.00 ? 63 ILE P HA   5  
ATOM 5854  H HB   . ILE A 1 65 ? -25.919 3.218   -8.057  1.00 0.00 ? 63 ILE P HB   5  
ATOM 5855  H HG12 . ILE A 1 65 ? -26.242 3.118   -5.018  1.00 0.00 ? 63 ILE P HG12 5  
ATOM 5856  H HG13 . ILE A 1 65 ? -25.618 4.470   -5.966  1.00 0.00 ? 63 ILE P HG13 5  
ATOM 5857  H HG21 . ILE A 1 65 ? -27.016 0.959   -6.312  1.00 0.00 ? 63 ILE P HG21 5  
ATOM 5858  H HG22 . ILE A 1 65 ? -27.948 1.934   -7.470  1.00 0.00 ? 63 ILE P HG22 5  
ATOM 5859  H HG23 . ILE A 1 65 ? -26.710 0.855   -8.061  1.00 0.00 ? 63 ILE P HG23 5  
ATOM 5860  H HD11 . ILE A 1 65 ? -28.475 3.479   -5.907  1.00 0.00 ? 63 ILE P HD11 5  
ATOM 5861  H HD12 . ILE A 1 65 ? -27.856 4.671   -7.084  1.00 0.00 ? 63 ILE P HD12 5  
ATOM 5862  H HD13 . ILE A 1 65 ? -27.830 5.025   -5.342  1.00 0.00 ? 63 ILE P HD13 5  
ATOM 5863  N N    . VAL A 1 66 ? -24.148 -0.220  -7.630  1.00 0.00 ? 64 VAL P N    5  
ATOM 5864  C CA   . VAL A 1 66 ? -23.949 -1.336  -8.574  1.00 0.00 ? 64 VAL P CA   5  
ATOM 5865  C C    . VAL A 1 66 ? -25.286 -1.690  -9.234  1.00 0.00 ? 64 VAL P C    5  
ATOM 5866  O O    . VAL A 1 66 ? -26.271 -1.952  -8.539  1.00 0.00 ? 64 VAL P O    5  
ATOM 5867  C CB   . VAL A 1 66 ? -23.342 -2.564  -7.864  1.00 0.00 ? 64 VAL P CB   5  
ATOM 5868  C CG1  . VAL A 1 66 ? -23.095 -3.724  -8.838  1.00 0.00 ? 64 VAL P CG1  5  
ATOM 5869  C CG2  . VAL A 1 66 ? -21.997 -2.225  -7.205  1.00 0.00 ? 64 VAL P CG2  5  
ATOM 5870  H H    . VAL A 1 66 ? -24.430 -0.454  -6.688  1.00 0.00 ? 64 VAL P H    5  
ATOM 5871  H HA   . VAL A 1 66 ? -23.251 -1.025  -9.352  1.00 0.00 ? 64 VAL P HA   5  
ATOM 5872  H HB   . VAL A 1 66 ? -24.031 -2.904  -7.091  1.00 0.00 ? 64 VAL P HB   5  
ATOM 5873  H HG11 . VAL A 1 66 ? -24.035 -4.070  -9.265  1.00 0.00 ? 64 VAL P HG11 5  
ATOM 5874  H HG12 . VAL A 1 66 ? -22.429 -3.404  -9.641  1.00 0.00 ? 64 VAL P HG12 5  
ATOM 5875  H HG13 . VAL A 1 66 ? -22.638 -4.559  -8.309  1.00 0.00 ? 64 VAL P HG13 5  
ATOM 5876  H HG21 . VAL A 1 66 ? -21.589 -3.112  -6.718  1.00 0.00 ? 64 VAL P HG21 5  
ATOM 5877  H HG22 . VAL A 1 66 ? -21.292 -1.874  -7.958  1.00 0.00 ? 64 VAL P HG22 5  
ATOM 5878  H HG23 . VAL A 1 66 ? -22.127 -1.454  -6.446  1.00 0.00 ? 64 VAL P HG23 5  
ATOM 5879  N N    . THR A 1 67 ? -25.331 -1.697  -10.570 1.00 0.00 ? 65 THR P N    5  
ATOM 5880  C CA   . THR A 1 67 ? -26.575 -1.839  -11.360 1.00 0.00 ? 65 THR P CA   5  
ATOM 5881  C C    . THR A 1 67 ? -26.600 -3.047  -12.308 1.00 0.00 ? 65 THR P C    5  
ATOM 5882  O O    . THR A 1 67 ? -27.671 -3.425  -12.792 1.00 0.00 ? 65 THR P O    5  
ATOM 5883  C CB   . THR A 1 67 ? -26.848 -0.561  -12.171 1.00 0.00 ? 65 THR P CB   5  
ATOM 5884  O OG1  . THR A 1 67 ? -25.745 -0.262  -13.006 1.00 0.00 ? 65 THR P OG1  5  
ATOM 5885  C CG2  . THR A 1 67 ? -27.082 0.649   -11.264 1.00 0.00 ? 65 THR P CG2  5  
ATOM 5886  H H    . THR A 1 67 ? -24.502 -1.419  -11.076 1.00 0.00 ? 65 THR P H    5  
ATOM 5887  H HA   . THR A 1 67 ? -27.417 -1.975  -10.682 1.00 0.00 ? 65 THR P HA   5  
ATOM 5888  H HB   . THR A 1 67 ? -27.737 -0.708  -12.785 1.00 0.00 ? 65 THR P HB   5  
ATOM 5889  H HG1  . THR A 1 67 ? -25.998 0.495   -13.566 1.00 0.00 ? 65 THR P HG1  5  
ATOM 5890  H HG21 . THR A 1 67 ? -27.887 0.429   -10.563 1.00 0.00 ? 65 THR P HG21 5  
ATOM 5891  H HG22 . THR A 1 67 ? -27.368 1.511   -11.868 1.00 0.00 ? 65 THR P HG22 5  
ATOM 5892  H HG23 . THR A 1 67 ? -26.174 0.886   -10.708 1.00 0.00 ? 65 THR P HG23 5  
ATOM 5893  N N    . ASP A 1 68 ? -25.446 -3.675  -12.563 1.00 0.00 ? 66 ASP P N    5  
ATOM 5894  C CA   . ASP A 1 68 ? -25.281 -4.866  -13.420 1.00 0.00 ? 66 ASP P CA   5  
ATOM 5895  C C    . ASP A 1 68 ? -25.474 -6.211  -12.684 1.00 0.00 ? 66 ASP P C    5  
ATOM 5896  O O    . ASP A 1 68 ? -25.107 -6.322  -11.491 1.00 0.00 ? 66 ASP P O    5  
ATOM 5897  C CB   . ASP A 1 68 ? -23.923 -4.800  -14.149 1.00 0.00 ? 66 ASP P CB   5  
ATOM 5898  C CG   . ASP A 1 68 ? -22.693 -4.977  -13.231 1.00 0.00 ? 66 ASP P CG   5  
ATOM 5899  O OD1  . ASP A 1 68 ? -22.316 -4.005  -12.529 1.00 0.00 ? 66 ASP P OD1  5  
ATOM 5900  O OD2  . ASP A 1 68 ? -22.065 -6.067  -13.254 1.00 0.00 ? 66 ASP P OD2  5  
ATOM 5901  O OXT  . ASP A 1 68 ? -26.009 -7.156  -13.311 1.00 0.00 ? 66 ASP P OXT  5  
ATOM 5902  H H    . ASP A 1 68 ? -24.621 -3.310  -12.111 1.00 0.00 ? 66 ASP P H    5  
ATOM 5903  H HA   . ASP A 1 68 ? -26.048 -4.829  -14.195 1.00 0.00 ? 66 ASP P HA   5  
ATOM 5904  H HB2  . ASP A 1 68 ? -23.915 -5.578  -14.915 1.00 0.00 ? 66 ASP P HB2  5  
ATOM 5905  H HB3  . ASP A 1 68 ? -23.850 -3.844  -14.673 1.00 0.00 ? 66 ASP P HB3  5  
ATOM 5906  N N    . GLY A 1 1  ? -12.614 -0.186  24.415  1.00 0.00 ? -1 GLY P N    6  
ATOM 5907  C CA   . GLY A 1 1  ? -11.853 0.012   23.161  1.00 0.00 ? -1 GLY P CA   6  
ATOM 5908  C C    . GLY A 1 1  ? -10.726 -0.999  23.033  1.00 0.00 ? -1 GLY P C    6  
ATOM 5909  O O    . GLY A 1 1  ? -9.721  -0.895  23.740  1.00 0.00 ? -1 GLY P O    6  
ATOM 5910  H H1   . GLY A 1 1  ? -13.343 0.507   24.490  1.00 0.00 ? -1 GLY P H1   6  
ATOM 5911  H H2   . GLY A 1 1  ? -12.004 -0.097  25.212  1.00 0.00 ? -1 GLY P H2   6  
ATOM 5912  H H3   . GLY A 1 1  ? -13.038 -1.100  24.430  1.00 0.00 ? -1 GLY P H3   6  
ATOM 5913  H HA2  . GLY A 1 1  ? -12.519 -0.082  22.304  1.00 0.00 ? -1 GLY P HA2  6  
ATOM 5914  H HA3  . GLY A 1 1  ? -11.415 1.011   23.153  1.00 0.00 ? -1 GLY P HA3  6  
ATOM 5915  N N    . SER A 1 2  ? -10.877 -1.983  22.140  1.00 0.00 ? 0  SER P N    6  
ATOM 5916  C CA   . SER A 1 2  ? -9.917  -3.092  21.959  1.00 0.00 ? 0  SER P CA   6  
ATOM 5917  C C    . SER A 1 2  ? -8.591  -2.658  21.316  1.00 0.00 ? 0  SER P C    6  
ATOM 5918  O O    . SER A 1 2  ? -7.542  -3.226  21.627  1.00 0.00 ? 0  SER P O    6  
ATOM 5919  C CB   . SER A 1 2  ? -10.552 -4.201  21.107  1.00 0.00 ? 0  SER P CB   6  
ATOM 5920  O OG   . SER A 1 2  ? -11.802 -4.610  21.647  1.00 0.00 ? 0  SER P OG   6  
ATOM 5921  H H    . SER A 1 2  ? -11.740 -2.039  21.616  1.00 0.00 ? 0  SER P H    6  
ATOM 5922  H HA   . SER A 1 2  ? -9.680  -3.515  22.938  1.00 0.00 ? 0  SER P HA   6  
ATOM 5923  H HB2  . SER A 1 2  ? -10.709 -3.827  20.093  1.00 0.00 ? 0  SER P HB2  6  
ATOM 5924  H HB3  . SER A 1 2  ? -9.876  -5.056  21.059  1.00 0.00 ? 0  SER P HB3  6  
ATOM 5925  H HG   . SER A 1 2  ? -11.637 -5.092  22.481  1.00 0.00 ? 0  SER P HG   6  
ATOM 5926  N N    . GLN A 1 3  ? -8.612  -1.632  20.456  1.00 0.00 ? 1  GLN P N    6  
ATOM 5927  C CA   . GLN A 1 3  ? -7.403  -0.984  19.930  1.00 0.00 ? 1  GLN P CA   6  
ATOM 5928  C C    . GLN A 1 3  ? -6.831  -0.018  20.980  1.00 0.00 ? 1  GLN P C    6  
ATOM 5929  O O    . GLN A 1 3  ? -7.551  0.839   21.502  1.00 0.00 ? 1  GLN P O    6  
ATOM 5930  C CB   . GLN A 1 3  ? -7.699  -0.268  18.599  1.00 0.00 ? 1  GLN P CB   6  
ATOM 5931  C CG   . GLN A 1 3  ? -8.126  -1.243  17.485  1.00 0.00 ? 1  GLN P CG   6  
ATOM 5932  C CD   . GLN A 1 3  ? -8.333  -0.576  16.123  1.00 0.00 ? 1  GLN P CD   6  
ATOM 5933  O OE1  . GLN A 1 3  ? -8.075  0.602   15.906  1.00 0.00 ? 1  GLN P OE1  6  
ATOM 5934  N NE2  . GLN A 1 3  ? -8.802  -1.309  15.137  1.00 0.00 ? 1  GLN P NE2  6  
ATOM 5935  H H    . GLN A 1 3  ? -9.504  -1.202  20.254  1.00 0.00 ? 1  GLN P H    6  
ATOM 5936  H HA   . GLN A 1 3  ? -6.652  -1.751  19.730  1.00 0.00 ? 1  GLN P HA   6  
ATOM 5937  H HB2  . GLN A 1 3  ? -8.484  0.476   18.749  1.00 0.00 ? 1  GLN P HB2  6  
ATOM 5938  H HB3  . GLN A 1 3  ? -6.792  0.248   18.279  1.00 0.00 ? 1  GLN P HB3  6  
ATOM 5939  H HG2  . GLN A 1 3  ? -7.362  -2.014  17.374  1.00 0.00 ? 1  GLN P HG2  6  
ATOM 5940  H HG3  . GLN A 1 3  ? -9.058  -1.732  17.771  1.00 0.00 ? 1  GLN P HG3  6  
ATOM 5941  H HE21 . GLN A 1 3  ? -9.020  -2.283  15.282  1.00 0.00 ? 1  GLN P HE21 6  
ATOM 5942  H HE22 . GLN A 1 3  ? -8.935  -0.871  14.239  1.00 0.00 ? 1  GLN P HE22 6  
ATOM 5943  N N    . ARG A 1 4  ? -5.537  -0.158  21.303  1.00 0.00 ? 2  ARG P N    6  
ATOM 5944  C CA   . ARG A 1 4  ? -4.870  0.543   22.426  1.00 0.00 ? 2  ARG P CA   6  
ATOM 5945  C C    . ARG A 1 4  ? -4.014  1.752   22.006  1.00 0.00 ? 2  ARG P C    6  
ATOM 5946  O O    . ARG A 1 4  ? -3.378  2.386   22.851  1.00 0.00 ? 2  ARG P O    6  
ATOM 5947  C CB   . ARG A 1 4  ? -4.080  -0.475  23.276  1.00 0.00 ? 2  ARG P CB   6  
ATOM 5948  C CG   . ARG A 1 4  ? -4.889  -1.701  23.753  1.00 0.00 ? 2  ARG P CG   6  
ATOM 5949  C CD   . ARG A 1 4  ? -6.220  -1.372  24.450  1.00 0.00 ? 2  ARG P CD   6  
ATOM 5950  N NE   . ARG A 1 4  ? -6.023  -0.522  25.642  1.00 0.00 ? 2  ARG P NE   6  
ATOM 5951  C CZ   . ARG A 1 4  ? -6.899  0.308   26.181  1.00 0.00 ? 2  ARG P CZ   6  
ATOM 5952  N NH1  . ARG A 1 4  ? -8.109  0.451   25.720  1.00 0.00 ? 2  ARG P NH1  6  
ATOM 5953  N NH2  . ARG A 1 4  ? -6.565  1.026   27.215  1.00 0.00 ? 2  ARG P NH2  6  
ATOM 5954  H H    . ARG A 1 4  ? -5.017  -0.887  20.832  1.00 0.00 ? 2  ARG P H    6  
ATOM 5955  H HA   . ARG A 1 4  ? -5.637  0.974   23.073  1.00 0.00 ? 2  ARG P HA   6  
ATOM 5956  H HB2  . ARG A 1 4  ? -3.227  -0.835  22.697  1.00 0.00 ? 2  ARG P HB2  6  
ATOM 5957  H HB3  . ARG A 1 4  ? -3.684  0.035   24.155  1.00 0.00 ? 2  ARG P HB3  6  
ATOM 5958  H HG2  . ARG A 1 4  ? -5.102  -2.341  22.896  1.00 0.00 ? 2  ARG P HG2  6  
ATOM 5959  H HG3  . ARG A 1 4  ? -4.268  -2.279  24.440  1.00 0.00 ? 2  ARG P HG3  6  
ATOM 5960  H HD2  . ARG A 1 4  ? -6.880  -0.879  23.737  1.00 0.00 ? 2  ARG P HD2  6  
ATOM 5961  H HD3  . ARG A 1 4  ? -6.694  -2.308  24.752  1.00 0.00 ? 2  ARG P HD3  6  
ATOM 5962  H HE   . ARG A 1 4  ? -5.126  -0.580  26.097  1.00 0.00 ? 2  ARG P HE   6  
ATOM 5963  H HH11 . ARG A 1 4  ? -8.423  -0.117  24.941  1.00 0.00 ? 2  ARG P HH11 6  
ATOM 5964  H HH12 . ARG A 1 4  ? -8.743  1.098   26.153  1.00 0.00 ? 2  ARG P HH12 6  
ATOM 5965  H HH21 . ARG A 1 4  ? -5.641  0.952   27.607  1.00 0.00 ? 2  ARG P HH21 6  
ATOM 5966  H HH22 . ARG A 1 4  ? -7.228  1.658   27.630  1.00 0.00 ? 2  ARG P HH22 6  
ATOM 5967  N N    . ARG A 1 5  ? -4.004  2.080   20.708  1.00 0.00 ? 3  ARG P N    6  
ATOM 5968  C CA   . ARG A 1 5  ? -3.313  3.237   20.104  1.00 0.00 ? 3  ARG P CA   6  
ATOM 5969  C C    . ARG A 1 5  ? -3.881  4.586   20.576  1.00 0.00 ? 3  ARG P C    6  
ATOM 5970  O O    . ARG A 1 5  ? -5.073  4.700   20.870  1.00 0.00 ? 3  ARG P O    6  
ATOM 5971  C CB   . ARG A 1 5  ? -3.335  3.109   18.565  1.00 0.00 ? 3  ARG P CB   6  
ATOM 5972  C CG   . ARG A 1 5  ? -4.756  3.135   17.974  1.00 0.00 ? 3  ARG P CG   6  
ATOM 5973  C CD   . ARG A 1 5  ? -4.754  2.876   16.465  1.00 0.00 ? 3  ARG P CD   6  
ATOM 5974  N NE   . ARG A 1 5  ? -6.132  2.753   15.958  1.00 0.00 ? 3  ARG P NE   6  
ATOM 5975  C CZ   . ARG A 1 5  ? -6.980  3.721   15.673  1.00 0.00 ? 3  ARG P CZ   6  
ATOM 5976  N NH1  . ARG A 1 5  ? -6.657  4.982   15.727  1.00 0.00 ? 3  ARG P NH1  6  
ATOM 5977  N NH2  . ARG A 1 5  ? -8.194  3.409   15.335  1.00 0.00 ? 3  ARG P NH2  6  
ATOM 5978  H H    . ARG A 1 5  ? -4.562  1.495   20.105  1.00 0.00 ? 3  ARG P H    6  
ATOM 5979  H HA   . ARG A 1 5  ? -2.269  3.206   20.424  1.00 0.00 ? 3  ARG P HA   6  
ATOM 5980  H HB2  . ARG A 1 5  ? -2.754  3.922   18.127  1.00 0.00 ? 3  ARG P HB2  6  
ATOM 5981  H HB3  . ARG A 1 5  ? -2.854  2.169   18.289  1.00 0.00 ? 3  ARG P HB3  6  
ATOM 5982  H HG2  . ARG A 1 5  ? -5.365  2.367   18.450  1.00 0.00 ? 3  ARG P HG2  6  
ATOM 5983  H HG3  . ARG A 1 5  ? -5.213  4.107   18.165  1.00 0.00 ? 3  ARG P HG3  6  
ATOM 5984  H HD2  . ARG A 1 5  ? -4.228  3.681   15.951  1.00 0.00 ? 3  ARG P HD2  6  
ATOM 5985  H HD3  . ARG A 1 5  ? -4.223  1.942   16.267  1.00 0.00 ? 3  ARG P HD3  6  
ATOM 5986  H HE   . ARG A 1 5  ? -6.519  1.818   15.887  1.00 0.00 ? 3  ARG P HE   6  
ATOM 5987  H HH11 . ARG A 1 5  ? -5.723  5.243   16.018  1.00 0.00 ? 3  ARG P HH11 6  
ATOM 5988  H HH12 . ARG A 1 5  ? -7.352  5.689   15.556  1.00 0.00 ? 3  ARG P HH12 6  
ATOM 5989  H HH21 . ARG A 1 5  ? -8.455  2.428   15.360  1.00 0.00 ? 3  ARG P HH21 6  
ATOM 5990  H HH22 . ARG A 1 5  ? -8.875  4.115   15.116  1.00 0.00 ? 3  ARG P HH22 6  
ATOM 5991  N N    . GLN A 1 6  ? -3.032  5.617   20.601  1.00 0.00 ? 4  GLN P N    6  
ATOM 5992  C CA   . GLN A 1 6  ? -3.393  6.986   21.008  1.00 0.00 ? 4  GLN P CA   6  
ATOM 5993  C C    . GLN A 1 6  ? -3.847  7.876   19.830  1.00 0.00 ? 4  GLN P C    6  
ATOM 5994  O O    . GLN A 1 6  ? -4.556  8.864   20.046  1.00 0.00 ? 4  GLN P O    6  
ATOM 5995  C CB   . GLN A 1 6  ? -2.185  7.581   21.762  1.00 0.00 ? 4  GLN P CB   6  
ATOM 5996  C CG   . GLN A 1 6  ? -2.365  9.000   22.337  1.00 0.00 ? 4  GLN P CG   6  
ATOM 5997  C CD   . GLN A 1 6  ? -3.508  9.116   23.346  1.00 0.00 ? 4  GLN P CD   6  
ATOM 5998  O OE1  . GLN A 1 6  ? -3.332  8.977   24.551  1.00 0.00 ? 4  GLN P OE1  6  
ATOM 5999  N NE2  . GLN A 1 6  ? -4.721  9.371   22.902  1.00 0.00 ? 4  GLN P NE2  6  
ATOM 6000  H H    . GLN A 1 6  ? -2.065  5.429   20.376  1.00 0.00 ? 4  GLN P H    6  
ATOM 6001  H HA   . GLN A 1 6  ? -4.229  6.931   21.707  1.00 0.00 ? 4  GLN P HA   6  
ATOM 6002  H HB2  . GLN A 1 6  ? -1.934  6.915   22.589  1.00 0.00 ? 4  GLN P HB2  6  
ATOM 6003  H HB3  . GLN A 1 6  ? -1.329  7.602   21.085  1.00 0.00 ? 4  GLN P HB3  6  
ATOM 6004  H HG2  . GLN A 1 6  ? -1.438  9.286   22.834  1.00 0.00 ? 4  GLN P HG2  6  
ATOM 6005  H HG3  . GLN A 1 6  ? -2.523  9.710   21.526  1.00 0.00 ? 4  GLN P HG3  6  
ATOM 6006  H HE21 . GLN A 1 6  ? -4.880  9.457   21.902  1.00 0.00 ? 4  GLN P HE21 6  
ATOM 6007  H HE22 . GLN A 1 6  ? -5.475  9.455   23.567  1.00 0.00 ? 4  GLN P HE22 6  
ATOM 6008  N N    . ARG A 1 7  ? -3.442  7.548   18.593  1.00 0.00 ? 5  ARG P N    6  
ATOM 6009  C CA   . ARG A 1 7  ? -3.653  8.349   17.367  1.00 0.00 ? 5  ARG P CA   6  
ATOM 6010  C C    . ARG A 1 7  ? -4.074  7.477   16.174  1.00 0.00 ? 5  ARG P C    6  
ATOM 6011  O O    . ARG A 1 7  ? -4.130  6.248   16.275  1.00 0.00 ? 5  ARG P O    6  
ATOM 6012  C CB   . ARG A 1 7  ? -2.367  9.149   17.052  1.00 0.00 ? 5  ARG P CB   6  
ATOM 6013  C CG   . ARG A 1 7  ? -2.021  10.183  18.140  1.00 0.00 ? 5  ARG P CG   6  
ATOM 6014  C CD   . ARG A 1 7  ? -0.859  11.101  17.734  1.00 0.00 ? 5  ARG P CD   6  
ATOM 6015  N NE   . ARG A 1 7  ? 0.427   10.376  17.645  1.00 0.00 ? 5  ARG P NE   6  
ATOM 6016  C CZ   . ARG A 1 7  ? 1.596   10.892  17.307  1.00 0.00 ? 5  ARG P CZ   6  
ATOM 6017  N NH1  . ARG A 1 7  ? 1.736   12.149  16.992  1.00 0.00 ? 5  ARG P NH1  6  
ATOM 6018  N NH2  . ARG A 1 7  ? 2.663   10.145  17.279  1.00 0.00 ? 5  ARG P NH2  6  
ATOM 6019  H H    . ARG A 1 7  ? -2.910  6.694   18.496  1.00 0.00 ? 5  ARG P H    6  
ATOM 6020  H HA   . ARG A 1 7  ? -4.469  9.057   17.529  1.00 0.00 ? 5  ARG P HA   6  
ATOM 6021  H HB2  . ARG A 1 7  ? -1.533  8.456   16.926  1.00 0.00 ? 5  ARG P HB2  6  
ATOM 6022  H HB3  . ARG A 1 7  ? -2.502  9.688   16.113  1.00 0.00 ? 5  ARG P HB3  6  
ATOM 6023  H HG2  . ARG A 1 7  ? -2.897  10.806  18.323  1.00 0.00 ? 5  ARG P HG2  6  
ATOM 6024  H HG3  . ARG A 1 7  ? -1.759  9.675   19.069  1.00 0.00 ? 5  ARG P HG3  6  
ATOM 6025  H HD2  . ARG A 1 7  ? -1.094  11.564  16.774  1.00 0.00 ? 5  ARG P HD2  6  
ATOM 6026  H HD3  . ARG A 1 7  ? -0.772  11.889  18.485  1.00 0.00 ? 5  ARG P HD3  6  
ATOM 6027  H HE   . ARG A 1 7  ? 0.423   9.396   17.882  1.00 0.00 ? 5  ARG P HE   6  
ATOM 6028  H HH11 . ARG A 1 7  ? 0.930   12.751  17.007  1.00 0.00 ? 5  ARG P HH11 6  
ATOM 6029  H HH12 . ARG A 1 7  ? 2.637   12.519  16.740  1.00 0.00 ? 5  ARG P HH12 6  
ATOM 6030  H HH21 . ARG A 1 7  ? 2.605   9.168   17.516  1.00 0.00 ? 5  ARG P HH21 6  
ATOM 6031  H HH22 . ARG A 1 7  ? 3.552   10.541  17.024  1.00 0.00 ? 5  ARG P HH22 6  
ATOM 6032  N N    . THR A 1 8  ? -4.378  8.107   15.040  1.00 0.00 ? 6  THR P N    6  
ATOM 6033  C CA   . THR A 1 8  ? -4.667  7.444   13.752  1.00 0.00 ? 6  THR P CA   6  
ATOM 6034  C C    . THR A 1 8  ? -3.470  6.602   13.287  1.00 0.00 ? 6  THR P C    6  
ATOM 6035  O O    . THR A 1 8  ? -2.328  7.062   13.329  1.00 0.00 ? 6  THR P O    6  
ATOM 6036  C CB   . THR A 1 8  ? -5.035  8.486   12.676  1.00 0.00 ? 6  THR P CB   6  
ATOM 6037  O OG1  . THR A 1 8  ? -6.027  9.356   13.184  1.00 0.00 ? 6  THR P OG1  6  
ATOM 6038  C CG2  . THR A 1 8  ? -5.606  7.856   11.404  1.00 0.00 ? 6  THR P CG2  6  
ATOM 6039  H H    . THR A 1 8  ? -4.373  9.117   15.045  1.00 0.00 ? 6  THR P H    6  
ATOM 6040  H HA   . THR A 1 8  ? -5.526  6.788   13.885  1.00 0.00 ? 6  THR P HA   6  
ATOM 6041  H HB   . THR A 1 8  ? -4.149  9.072   12.424  1.00 0.00 ? 6  THR P HB   6  
ATOM 6042  H HG1  . THR A 1 8  ? -6.173  10.057  12.524  1.00 0.00 ? 6  THR P HG1  6  
ATOM 6043  H HG21 . THR A 1 8  ? -6.469  7.236   11.646  1.00 0.00 ? 6  THR P HG21 6  
ATOM 6044  H HG22 . THR A 1 8  ? -4.849  7.250   10.912  1.00 0.00 ? 6  THR P HG22 6  
ATOM 6045  H HG23 . THR A 1 8  ? -5.911  8.641   10.711  1.00 0.00 ? 6  THR P HG23 6  
ATOM 6046  N N    . HIS A 1 9  ? -3.719  5.363   12.843  1.00 0.00 ? 7  HIS P N    6  
ATOM 6047  C CA   . HIS A 1 9  ? -2.668  4.382   12.500  1.00 0.00 ? 7  HIS P CA   6  
ATOM 6048  C C    . HIS A 1 9  ? -2.183  4.442   11.039  1.00 0.00 ? 7  HIS P C    6  
ATOM 6049  O O    . HIS A 1 9  ? -1.262  3.716   10.663  1.00 0.00 ? 7  HIS P O    6  
ATOM 6050  C CB   . HIS A 1 9  ? -3.125  2.968   12.924  1.00 0.00 ? 7  HIS P CB   6  
ATOM 6051  C CG   . HIS A 1 9  ? -2.209  2.289   13.919  1.00 0.00 ? 7  HIS P CG   6  
ATOM 6052  N ND1  . HIS A 1 9  ? -1.829  0.944   13.885  1.00 0.00 ? 7  HIS P ND1  6  
ATOM 6053  C CD2  . HIS A 1 9  ? -1.660  2.869   15.028  1.00 0.00 ? 7  HIS P CD2  6  
ATOM 6054  C CE1  . HIS A 1 9  ? -1.054  0.747   14.966  1.00 0.00 ? 7  HIS P CE1  6  
ATOM 6055  N NE2  . HIS A 1 9  ? -0.935  1.887   15.668  1.00 0.00 ? 7  HIS P NE2  6  
ATOM 6056  H H    . HIS A 1 9  ? -4.679  5.045   12.828  1.00 0.00 ? 7  HIS P H    6  
ATOM 6057  H HA   . HIS A 1 9  ? -1.779  4.630   13.084  1.00 0.00 ? 7  HIS P HA   6  
ATOM 6058  H HB2  . HIS A 1 9  ? -4.116  3.015   13.377  1.00 0.00 ? 7  HIS P HB2  6  
ATOM 6059  H HB3  . HIS A 1 9  ? -3.215  2.333   12.042  1.00 0.00 ? 7  HIS P HB3  6  
ATOM 6060  H HD2  . HIS A 1 9  ? -1.782  3.897   15.346  1.00 0.00 ? 7  HIS P HD2  6  
ATOM 6061  H HE1  . HIS A 1 9  ? -0.592  -0.196  15.236  1.00 0.00 ? 7  HIS P HE1  6  
ATOM 6062  H HE2  . HIS A 1 9  ? -0.394  1.992   16.521  1.00 0.00 ? 7  HIS P HE2  6  
ATOM 6063  N N    . PHE A 1 10 ? -2.779  5.310   10.219  1.00 0.00 ? 8  PHE P N    6  
ATOM 6064  C CA   . PHE A 1 10 ? -2.373  5.621   8.842   1.00 0.00 ? 8  PHE P CA   6  
ATOM 6065  C C    . PHE A 1 10 ? -1.952  7.093   8.715   1.00 0.00 ? 8  PHE P C    6  
ATOM 6066  O O    . PHE A 1 10 ? -2.387  7.942   9.500   1.00 0.00 ? 8  PHE P O    6  
ATOM 6067  C CB   . PHE A 1 10 ? -3.519  5.322   7.867   1.00 0.00 ? 8  PHE P CB   6  
ATOM 6068  C CG   . PHE A 1 10 ? -3.964  3.873   7.771   1.00 0.00 ? 8  PHE P CG   6  
ATOM 6069  C CD1  . PHE A 1 10 ? -4.847  3.334   8.727   1.00 0.00 ? 8  PHE P CD1  6  
ATOM 6070  C CD2  . PHE A 1 10 ? -3.547  3.079   6.686   1.00 0.00 ? 8  PHE P CD2  6  
ATOM 6071  C CE1  . PHE A 1 10 ? -5.305  2.011   8.603   1.00 0.00 ? 8  PHE P CE1  6  
ATOM 6072  C CE2  . PHE A 1 10 ? -4.019  1.760   6.553   1.00 0.00 ? 8  PHE P CE2  6  
ATOM 6073  C CZ   . PHE A 1 10 ? -4.897  1.226   7.511   1.00 0.00 ? 8  PHE P CZ   6  
ATOM 6074  H H    . PHE A 1 10 ? -3.503  5.888   10.615  1.00 0.00 ? 8  PHE P H    6  
ATOM 6075  H HA   . PHE A 1 10 ? -1.519  5.007   8.556   1.00 0.00 ? 8  PHE P HA   6  
ATOM 6076  H HB2  . PHE A 1 10 ? -4.378  5.930   8.153   1.00 0.00 ? 8  PHE P HB2  6  
ATOM 6077  H HB3  . PHE A 1 10 ? -3.204  5.649   6.875   1.00 0.00 ? 8  PHE P HB3  6  
ATOM 6078  H HD1  . PHE A 1 10 ? -5.189  3.943   9.553   1.00 0.00 ? 8  PHE P HD1  6  
ATOM 6079  H HD2  . PHE A 1 10 ? -2.882  3.489   5.938   1.00 0.00 ? 8  PHE P HD2  6  
ATOM 6080  H HE1  . PHE A 1 10 ? -5.989  1.603   9.336   1.00 0.00 ? 8  PHE P HE1  6  
ATOM 6081  H HE2  . PHE A 1 10 ? -3.725  1.168   5.697   1.00 0.00 ? 8  PHE P HE2  6  
ATOM 6082  H HZ   . PHE A 1 10 ? -5.275  0.218   7.403   1.00 0.00 ? 8  PHE P HZ   6  
ATOM 6083  N N    . THR A 1 11 ? -1.138  7.410   7.706   1.00 0.00 ? 9  THR P N    6  
ATOM 6084  C CA   . THR A 1 11 ? -0.675  8.783   7.424   1.00 0.00 ? 9  THR P CA   6  
ATOM 6085  C C    . THR A 1 11 ? -1.561  9.476   6.394   1.00 0.00 ? 9  THR P C    6  
ATOM 6086  O O    . THR A 1 11 ? -2.182  8.827   5.548   1.00 0.00 ? 9  THR P O    6  
ATOM 6087  C CB   . THR A 1 11 ? 0.791   8.841   6.956   1.00 0.00 ? 9  THR P CB   6  
ATOM 6088  O OG1  . THR A 1 11 ? 0.900   8.502   5.591   1.00 0.00 ? 9  THR P OG1  6  
ATOM 6089  C CG2  . THR A 1 11 ? 1.720   7.920   7.741   1.00 0.00 ? 9  THR P CG2  6  
ATOM 6090  H H    . THR A 1 11 ? -0.847  6.673   7.075   1.00 0.00 ? 9  THR P H    6  
ATOM 6091  H HA   . THR A 1 11 ? -0.728  9.364   8.345   1.00 0.00 ? 9  THR P HA   6  
ATOM 6092  H HB   . THR A 1 11 ? 1.143   9.866   7.078   1.00 0.00 ? 9  THR P HB   6  
ATOM 6093  H HG1  . THR A 1 11 ? 1.848   8.522   5.369   1.00 0.00 ? 9  THR P HG1  6  
ATOM 6094  H HG21 . THR A 1 11 ? 1.473   6.879   7.537   1.00 0.00 ? 9  THR P HG21 6  
ATOM 6095  H HG22 . THR A 1 11 ? 1.614   8.114   8.807   1.00 0.00 ? 9  THR P HG22 6  
ATOM 6096  H HG23 . THR A 1 11 ? 2.753   8.104   7.446   1.00 0.00 ? 9  THR P HG23 6  
ATOM 6097  N N    . SER A 1 12 ? -1.548  10.811  6.379   1.00 0.00 ? 10 SER P N    6  
ATOM 6098  C CA   . SER A 1 12 ? -2.238  11.615  5.359   1.00 0.00 ? 10 SER P CA   6  
ATOM 6099  C C    . SER A 1 12 ? -1.697  11.417  3.932   1.00 0.00 ? 10 SER P C    6  
ATOM 6100  O O    . SER A 1 12 ? -2.297  11.922  2.985   1.00 0.00 ? 10 SER P O    6  
ATOM 6101  C CB   . SER A 1 12 ? -2.194  13.102  5.717   1.00 0.00 ? 10 SER P CB   6  
ATOM 6102  O OG   . SER A 1 12 ? -2.542  13.317  7.080   1.00 0.00 ? 10 SER P OG   6  
ATOM 6103  H H    . SER A 1 12 ? -1.068  11.310  7.117   1.00 0.00 ? 10 SER P H    6  
ATOM 6104  H HA   . SER A 1 12 ? -3.285  11.319  5.342   1.00 0.00 ? 10 SER P HA   6  
ATOM 6105  H HB2  . SER A 1 12 ? -1.187  13.483  5.532   1.00 0.00 ? 10 SER P HB2  6  
ATOM 6106  H HB3  . SER A 1 12 ? -2.903  13.627  5.076   1.00 0.00 ? 10 SER P HB3  6  
ATOM 6107  H HG   . SER A 1 12 ? -2.528  14.280  7.253   1.00 0.00 ? 10 SER P HG   6  
ATOM 6108  N N    . GLN A 1 13 ? -0.593  10.679  3.754   1.00 0.00 ? 11 GLN P N    6  
ATOM 6109  C CA   . GLN A 1 13 ? -0.105  10.228  2.448   1.00 0.00 ? 11 GLN P CA   6  
ATOM 6110  C C    . GLN A 1 13 ? -0.677  8.844   2.088   1.00 0.00 ? 11 GLN P C    6  
ATOM 6111  O O    . GLN A 1 13 ? -1.168  8.655   0.975   1.00 0.00 ? 11 GLN P O    6  
ATOM 6112  C CB   . GLN A 1 13 ? 1.431   10.247  2.456   1.00 0.00 ? 11 GLN P CB   6  
ATOM 6113  C CG   . GLN A 1 13 ? 2.009   10.095  1.043   1.00 0.00 ? 11 GLN P CG   6  
ATOM 6114  C CD   . GLN A 1 13 ? 3.537   10.112  1.048   1.00 0.00 ? 11 GLN P CD   6  
ATOM 6115  O OE1  . GLN A 1 13 ? 4.199   9.081   1.024   1.00 0.00 ? 11 GLN P OE1  6  
ATOM 6116  N NE2  . GLN A 1 13 ? 4.162   11.271  1.093   1.00 0.00 ? 11 GLN P NE2  6  
ATOM 6117  H H    . GLN A 1 13 ? -0.132  10.309  4.574   1.00 0.00 ? 11 GLN P H    6  
ATOM 6118  H HA   . GLN A 1 13 ? -0.440  10.929  1.682   1.00 0.00 ? 11 GLN P HA   6  
ATOM 6119  H HB2  . GLN A 1 13 ? 1.772   11.198  2.868   1.00 0.00 ? 11 GLN P HB2  6  
ATOM 6120  H HB3  . GLN A 1 13 ? 1.807   9.441   3.089   1.00 0.00 ? 11 GLN P HB3  6  
ATOM 6121  H HG2  . GLN A 1 13 ? 1.671   9.156   0.606   1.00 0.00 ? 11 GLN P HG2  6  
ATOM 6122  H HG3  . GLN A 1 13 ? 1.643   10.915  0.422   1.00 0.00 ? 11 GLN P HG3  6  
ATOM 6123  H HE21 . GLN A 1 13 ? 3.639   12.134  1.115   1.00 0.00 ? 11 GLN P HE21 6  
ATOM 6124  H HE22 . GLN A 1 13 ? 5.171   11.272  1.100   1.00 0.00 ? 11 GLN P HE22 6  
ATOM 6125  N N    . GLN A 1 14 ? -0.690  7.891   3.030   1.00 0.00 ? 12 GLN P N    6  
ATOM 6126  C CA   . GLN A 1 14 ? -1.205  6.529   2.812   1.00 0.00 ? 12 GLN P CA   6  
ATOM 6127  C C    . GLN A 1 14 ? -2.701  6.540   2.483   1.00 0.00 ? 12 GLN P C    6  
ATOM 6128  O O    . GLN A 1 14 ? -3.143  5.904   1.526   1.00 0.00 ? 12 GLN P O    6  
ATOM 6129  C CB   . GLN A 1 14 ? -0.974  5.681   4.070   1.00 0.00 ? 12 GLN P CB   6  
ATOM 6130  C CG   . GLN A 1 14 ? 0.508   5.389   4.309   1.00 0.00 ? 12 GLN P CG   6  
ATOM 6131  C CD   . GLN A 1 14 ? 0.748   4.676   5.635   1.00 0.00 ? 12 GLN P CD   6  
ATOM 6132  O OE1  . GLN A 1 14 ? 0.041   4.851   6.619   1.00 0.00 ? 12 GLN P OE1  6  
ATOM 6133  N NE2  . GLN A 1 14 ? 1.757   3.843   5.699   1.00 0.00 ? 12 GLN P NE2  6  
ATOM 6134  H H    . GLN A 1 14 ? -0.354  8.123   3.960   1.00 0.00 ? 12 GLN P H    6  
ATOM 6135  H HA   . GLN A 1 14 ? -0.675  6.066   1.978   1.00 0.00 ? 12 GLN P HA   6  
ATOM 6136  H HB2  . GLN A 1 14 ? -1.398  6.198   4.931   1.00 0.00 ? 12 GLN P HB2  6  
ATOM 6137  H HB3  . GLN A 1 14 ? -1.476  4.721   3.952   1.00 0.00 ? 12 GLN P HB3  6  
ATOM 6138  H HG2  . GLN A 1 14 ? 0.865   4.766   3.491   1.00 0.00 ? 12 GLN P HG2  6  
ATOM 6139  H HG3  . GLN A 1 14 ? 1.088   6.308   4.304   1.00 0.00 ? 12 GLN P HG3  6  
ATOM 6140  H HE21 . GLN A 1 14 ? 2.263   3.637   4.843   1.00 0.00 ? 12 GLN P HE21 6  
ATOM 6141  H HE22 . GLN A 1 14 ? 1.905   3.309   6.535   1.00 0.00 ? 12 GLN P HE22 6  
ATOM 6142  N N    . LEU A 1 15 ? -3.472  7.320   3.249   1.00 0.00 ? 13 LEU P N    6  
ATOM 6143  C CA   . LEU A 1 15 ? -4.923  7.479   3.095   1.00 0.00 ? 13 LEU P CA   6  
ATOM 6144  C C    . LEU A 1 15 ? -5.325  7.967   1.695   1.00 0.00 ? 13 LEU P C    6  
ATOM 6145  O O    . LEU A 1 15 ? -6.377  7.578   1.187   1.00 0.00 ? 13 LEU P O    6  
ATOM 6146  C CB   . LEU A 1 15 ? -5.406  8.473   4.165   1.00 0.00 ? 13 LEU P CB   6  
ATOM 6147  C CG   . LEU A 1 15 ? -5.248  7.961   5.611   1.00 0.00 ? 13 LEU P CG   6  
ATOM 6148  C CD1  . LEU A 1 15 ? -5.389  9.112   6.604   1.00 0.00 ? 13 LEU P CD1  6  
ATOM 6149  C CD2  . LEU A 1 15 ? -6.265  6.871   5.931   1.00 0.00 ? 13 LEU P CD2  6  
ATOM 6150  H H    . LEU A 1 15 ? -3.021  7.800   4.024   1.00 0.00 ? 13 LEU P H    6  
ATOM 6151  H HA   . LEU A 1 15 ? -5.412  6.519   3.252   1.00 0.00 ? 13 LEU P HA   6  
ATOM 6152  H HB2  . LEU A 1 15 ? -4.843  9.402   4.051   1.00 0.00 ? 13 LEU P HB2  6  
ATOM 6153  H HB3  . LEU A 1 15 ? -6.458  8.697   3.976   1.00 0.00 ? 13 LEU P HB3  6  
ATOM 6154  H HG   . LEU A 1 15 ? -4.263  7.526   5.750   1.00 0.00 ? 13 LEU P HG   6  
ATOM 6155  H HD11 . LEU A 1 15 ? -6.384  9.552   6.535   1.00 0.00 ? 13 LEU P HD11 6  
ATOM 6156  H HD12 . LEU A 1 15 ? -5.211  8.744   7.614   1.00 0.00 ? 13 LEU P HD12 6  
ATOM 6157  H HD13 . LEU A 1 15 ? -4.639  9.874   6.384   1.00 0.00 ? 13 LEU P HD13 6  
ATOM 6158  H HD21 . LEU A 1 15 ? -7.270  7.213   5.681   1.00 0.00 ? 13 LEU P HD21 6  
ATOM 6159  H HD22 . LEU A 1 15 ? -6.007  5.978   5.363   1.00 0.00 ? 13 LEU P HD22 6  
ATOM 6160  H HD23 . LEU A 1 15 ? -6.223  6.626   6.991   1.00 0.00 ? 13 LEU P HD23 6  
ATOM 6161  N N    . GLN A 1 16 ? -4.480  8.780   1.054   1.00 0.00 ? 14 GLN P N    6  
ATOM 6162  C CA   . GLN A 1 16 ? -4.730  9.292   -0.298  1.00 0.00 ? 14 GLN P CA   6  
ATOM 6163  C C    . GLN A 1 16 ? -4.500  8.236   -1.380  1.00 0.00 ? 14 GLN P C    6  
ATOM 6164  O O    . GLN A 1 16 ? -5.281  8.156   -2.325  1.00 0.00 ? 14 GLN P O    6  
ATOM 6165  C CB   . GLN A 1 16 ? -3.899  10.556  -0.561  1.00 0.00 ? 14 GLN P CB   6  
ATOM 6166  C CG   . GLN A 1 16 ? -4.317  11.719  0.348   1.00 0.00 ? 14 GLN P CG   6  
ATOM 6167  C CD   . GLN A 1 16 ? -5.801  12.059  0.212   1.00 0.00 ? 14 GLN P CD   6  
ATOM 6168  O OE1  . GLN A 1 16 ? -6.267  12.558  -0.805  1.00 0.00 ? 14 GLN P OE1  6  
ATOM 6169  N NE2  . GLN A 1 16 ? -6.604  11.730  1.201   1.00 0.00 ? 14 GLN P NE2  6  
ATOM 6170  H H    . GLN A 1 16 ? -3.611  9.018   1.511   1.00 0.00 ? 14 GLN P H    6  
ATOM 6171  H HA   . GLN A 1 16 ? -5.778  9.565   -0.370  1.00 0.00 ? 14 GLN P HA   6  
ATOM 6172  H HB2  . GLN A 1 16 ? -2.841  10.340  -0.412  1.00 0.00 ? 14 GLN P HB2  6  
ATOM 6173  H HB3  . GLN A 1 16 ? -4.040  10.860  -1.600  1.00 0.00 ? 14 GLN P HB3  6  
ATOM 6174  H HG2  . GLN A 1 16 ? -4.111  11.444  1.378   1.00 0.00 ? 14 GLN P HG2  6  
ATOM 6175  H HG3  . GLN A 1 16 ? -3.716  12.593  0.104   1.00 0.00 ? 14 GLN P HG3  6  
ATOM 6176  H HE21 . GLN A 1 16 ? -6.232  11.312  2.035   1.00 0.00 ? 14 GLN P HE21 6  
ATOM 6177  H HE22 . GLN A 1 16 ? -7.605  11.665  1.002   1.00 0.00 ? 14 GLN P HE22 6  
ATOM 6178  N N    . GLU A 1 17 ? -3.492  7.375   -1.226  1.00 0.00 ? 15 GLU P N    6  
ATOM 6179  C CA   . GLU A 1 17 ? -3.281  6.246   -2.145  1.00 0.00 ? 15 GLU P CA   6  
ATOM 6180  C C    . GLU A 1 17 ? -4.370  5.174   -1.991  1.00 0.00 ? 15 GLU P C    6  
ATOM 6181  O O    . GLU A 1 17 ? -4.804  4.584   -2.983  1.00 0.00 ? 15 GLU P O    6  
ATOM 6182  C CB   . GLU A 1 17 ? -1.878  5.647   -1.963  1.00 0.00 ? 15 GLU P CB   6  
ATOM 6183  C CG   . GLU A 1 17 ? -0.739  6.675   -2.080  1.00 0.00 ? 15 GLU P CG   6  
ATOM 6184  C CD   . GLU A 1 17 ? -0.794  7.546   -3.357  1.00 0.00 ? 15 GLU P CD   6  
ATOM 6185  O OE1  . GLU A 1 17 ? -1.156  7.041   -4.447  1.00 0.00 ? 15 GLU P OE1  6  
ATOM 6186  O OE2  . GLU A 1 17 ? -0.448  8.750   -3.282  1.00 0.00 ? 15 GLU P OE2  6  
ATOM 6187  H H    . GLU A 1 17 ? -2.889  7.475   -0.418  1.00 0.00 ? 15 GLU P H    6  
ATOM 6188  H HA   . GLU A 1 17 ? -3.359  6.603   -3.170  1.00 0.00 ? 15 GLU P HA   6  
ATOM 6189  H HB2  . GLU A 1 17 ? -1.816  5.175   -0.982  1.00 0.00 ? 15 GLU P HB2  6  
ATOM 6190  H HB3  . GLU A 1 17 ? -1.732  4.870   -2.714  1.00 0.00 ? 15 GLU P HB3  6  
ATOM 6191  H HG2  . GLU A 1 17 ? -0.765  7.317   -1.201  1.00 0.00 ? 15 GLU P HG2  6  
ATOM 6192  H HG3  . GLU A 1 17 ? 0.209   6.140   -2.045  1.00 0.00 ? 15 GLU P HG3  6  
ATOM 6193  N N    . LEU A 1 18 ? -4.875  4.983   -0.767  1.00 0.00 ? 16 LEU P N    6  
ATOM 6194  C CA   . LEU A 1 18 ? -5.996  4.094   -0.465  1.00 0.00 ? 16 LEU P CA   6  
ATOM 6195  C C    . LEU A 1 18 ? -7.308  4.605   -1.081  1.00 0.00 ? 16 LEU P C    6  
ATOM 6196  O O    . LEU A 1 18 ? -7.953  3.867   -1.825  1.00 0.00 ? 16 LEU P O    6  
ATOM 6197  C CB   . LEU A 1 18 ? -6.093  3.938   1.059   1.00 0.00 ? 16 LEU P CB   6  
ATOM 6198  C CG   . LEU A 1 18 ? -4.962  3.080   1.655   1.00 0.00 ? 16 LEU P CG   6  
ATOM 6199  C CD1  . LEU A 1 18 ? -4.787  3.384   3.138   1.00 0.00 ? 16 LEU P CD1  6  
ATOM 6200  C CD2  . LEU A 1 18 ? -5.260  1.590   1.492   1.00 0.00 ? 16 LEU P CD2  6  
ATOM 6201  H H    . LEU A 1 18 ? -4.461  5.494   0.004   1.00 0.00 ? 16 LEU P H    6  
ATOM 6202  H HA   . LEU A 1 18 ? -5.801  3.116   -0.904  1.00 0.00 ? 16 LEU P HA   6  
ATOM 6203  H HB2  . LEU A 1 18 ? -6.083  4.928   1.516   1.00 0.00 ? 16 LEU P HB2  6  
ATOM 6204  H HB3  . LEU A 1 18 ? -7.046  3.475   1.303   1.00 0.00 ? 16 LEU P HB3  6  
ATOM 6205  H HG   . LEU A 1 18 ? -4.020  3.298   1.157   1.00 0.00 ? 16 LEU P HG   6  
ATOM 6206  H HD11 . LEU A 1 18 ? -5.707  3.166   3.671   1.00 0.00 ? 16 LEU P HD11 6  
ATOM 6207  H HD12 . LEU A 1 18 ? -3.979  2.780   3.544   1.00 0.00 ? 16 LEU P HD12 6  
ATOM 6208  H HD13 . LEU A 1 18 ? -4.538  4.437   3.259   1.00 0.00 ? 16 LEU P HD13 6  
ATOM 6209  H HD21 . LEU A 1 18 ? -4.462  1.007   1.948   1.00 0.00 ? 16 LEU P HD21 6  
ATOM 6210  H HD22 . LEU A 1 18 ? -6.208  1.341   1.970   1.00 0.00 ? 16 LEU P HD22 6  
ATOM 6211  H HD23 . LEU A 1 18 ? -5.313  1.345   0.432   1.00 0.00 ? 16 LEU P HD23 6  
ATOM 6212  N N    . GLU A 1 19 ? -7.686  5.872   -0.864  1.00 0.00 ? 17 GLU P N    6  
ATOM 6213  C CA   . GLU A 1 19 ? -8.919  6.410   -1.466  1.00 0.00 ? 17 GLU P CA   6  
ATOM 6214  C C    . GLU A 1 19 ? -8.834  6.602   -2.989  1.00 0.00 ? 17 GLU P C    6  
ATOM 6215  O O    . GLU A 1 19 ? -9.869  6.557   -3.656  1.00 0.00 ? 17 GLU P O    6  
ATOM 6216  C CB   . GLU A 1 19 ? -9.448  7.662   -0.738  1.00 0.00 ? 17 GLU P CB   6  
ATOM 6217  C CG   . GLU A 1 19 ? -8.774  8.991   -1.104  1.00 0.00 ? 17 GLU P CG   6  
ATOM 6218  C CD   . GLU A 1 19 ? -9.547  10.186  -0.508  1.00 0.00 ? 17 GLU P CD   6  
ATOM 6219  O OE1  . GLU A 1 19 ? -10.564 10.609  -1.110  1.00 0.00 ? 17 GLU P OE1  6  
ATOM 6220  O OE2  . GLU A 1 19 ? -9.148  10.718  0.556   1.00 0.00 ? 17 GLU P OE2  6  
ATOM 6221  H H    . GLU A 1 19 ? -7.157  6.436   -0.206  1.00 0.00 ? 17 GLU P H    6  
ATOM 6222  H HA   . GLU A 1 19 ? -9.686  5.649   -1.327  1.00 0.00 ? 17 GLU P HA   6  
ATOM 6223  H HB2  . GLU A 1 19 ? -10.508 7.749   -0.979  1.00 0.00 ? 17 GLU P HB2  6  
ATOM 6224  H HB3  . GLU A 1 19 ? -9.370  7.509   0.339   1.00 0.00 ? 17 GLU P HB3  6  
ATOM 6225  H HG2  . GLU A 1 19 ? -7.750  8.977   -0.737  1.00 0.00 ? 17 GLU P HG2  6  
ATOM 6226  H HG3  . GLU A 1 19 ? -8.737  9.102   -2.189  1.00 0.00 ? 17 GLU P HG3  6  
ATOM 6227  N N    . ALA A 1 20 ? -7.631  6.754   -3.557  1.00 0.00 ? 18 ALA P N    6  
ATOM 6228  C CA   . ALA A 1 20 ? -7.424  6.804   -5.005  1.00 0.00 ? 18 ALA P CA   6  
ATOM 6229  C C    . ALA A 1 20 ? -7.531  5.413   -5.656  1.00 0.00 ? 18 ALA P C    6  
ATOM 6230  O O    . ALA A 1 20 ? -8.264  5.246   -6.633  1.00 0.00 ? 18 ALA P O    6  
ATOM 6231  C CB   . ALA A 1 20 ? -6.074  7.466   -5.305  1.00 0.00 ? 18 ALA P CB   6  
ATOM 6232  H H    . ALA A 1 20 ? -6.823  6.850   -2.953  1.00 0.00 ? 18 ALA P H    6  
ATOM 6233  H HA   . ALA A 1 20 ? -8.202  7.427   -5.446  1.00 0.00 ? 18 ALA P HA   6  
ATOM 6234  H HB1  . ALA A 1 20 ? -5.262  6.889   -4.862  1.00 0.00 ? 18 ALA P HB1  6  
ATOM 6235  H HB2  . ALA A 1 20 ? -5.925  7.519   -6.384  1.00 0.00 ? 18 ALA P HB2  6  
ATOM 6236  H HB3  . ALA A 1 20 ? -6.062  8.479   -4.901  1.00 0.00 ? 18 ALA P HB3  6  
ATOM 6237  N N    . THR A 1 21 ? -6.867  4.389   -5.104  1.00 0.00 ? 19 THR P N    6  
ATOM 6238  C CA   . THR A 1 21 ? -6.930  3.023   -5.660  1.00 0.00 ? 19 THR P CA   6  
ATOM 6239  C C    . THR A 1 21 ? -8.317  2.386   -5.473  1.00 0.00 ? 19 THR P C    6  
ATOM 6240  O O    . THR A 1 21 ? -8.779  1.632   -6.329  1.00 0.00 ? 19 THR P O    6  
ATOM 6241  C CB   . THR A 1 21 ? -5.783  2.152   -5.118  1.00 0.00 ? 19 THR P CB   6  
ATOM 6242  O OG1  . THR A 1 21 ? -5.505  1.119   -6.040  1.00 0.00 ? 19 THR P OG1  6  
ATOM 6243  C CG2  . THR A 1 21 ? -6.065  1.499   -3.766  1.00 0.00 ? 19 THR P CG2  6  
ATOM 6244  H H    . THR A 1 21 ? -6.268  4.563   -4.301  1.00 0.00 ? 19 THR P H    6  
ATOM 6245  H HA   . THR A 1 21 ? -6.772  3.110   -6.734  1.00 0.00 ? 19 THR P HA   6  
ATOM 6246  H HB   . THR A 1 21 ? -4.890  2.773   -5.025  1.00 0.00 ? 19 THR P HB   6  
ATOM 6247  H HG1  . THR A 1 21 ? -4.933  1.484   -6.738  1.00 0.00 ? 19 THR P HG1  6  
ATOM 6248  H HG21 . THR A 1 21 ? -6.557  2.204   -3.106  1.00 0.00 ? 19 THR P HG21 6  
ATOM 6249  H HG22 . THR A 1 21 ? -5.127  1.208   -3.300  1.00 0.00 ? 19 THR P HG22 6  
ATOM 6250  H HG23 . THR A 1 21 ? -6.692  0.616   -3.907  1.00 0.00 ? 19 THR P HG23 6  
ATOM 6251  N N    . PHE A 1 22 ? -9.051  2.798   -4.432  1.00 0.00 ? 20 PHE P N    6  
ATOM 6252  C CA   . PHE A 1 22 ? -10.463 2.464   -4.192  1.00 0.00 ? 20 PHE P CA   6  
ATOM 6253  C C    . PHE A 1 22 ? -11.381 2.874   -5.357  1.00 0.00 ? 20 PHE P C    6  
ATOM 6254  O O    . PHE A 1 22 ? -12.382 2.202   -5.605  1.00 0.00 ? 20 PHE P O    6  
ATOM 6255  C CB   . PHE A 1 22 ? -10.897 3.123   -2.869  1.00 0.00 ? 20 PHE P CB   6  
ATOM 6256  C CG   . PHE A 1 22 ? -12.374 3.074   -2.500  1.00 0.00 ? 20 PHE P CG   6  
ATOM 6257  C CD1  . PHE A 1 22 ? -13.077 1.852   -2.474  1.00 0.00 ? 20 PHE P CD1  6  
ATOM 6258  C CD2  . PHE A 1 22 ? -13.047 4.260   -2.141  1.00 0.00 ? 20 PHE P CD2  6  
ATOM 6259  C CE1  . PHE A 1 22 ? -14.435 1.818   -2.110  1.00 0.00 ? 20 PHE P CE1  6  
ATOM 6260  C CE2  . PHE A 1 22 ? -14.408 4.227   -1.784  1.00 0.00 ? 20 PHE P CE2  6  
ATOM 6261  C CZ   . PHE A 1 22 ? -15.103 3.007   -1.767  1.00 0.00 ? 20 PHE P CZ   6  
ATOM 6262  H H    . PHE A 1 22 ? -8.595  3.407   -3.764  1.00 0.00 ? 20 PHE P H    6  
ATOM 6263  H HA   . PHE A 1 22 ? -10.550 1.386   -4.081  1.00 0.00 ? 20 PHE P HA   6  
ATOM 6264  H HB2  . PHE A 1 22 ? -10.340 2.658   -2.056  1.00 0.00 ? 20 PHE P HB2  6  
ATOM 6265  H HB3  . PHE A 1 22 ? -10.598 4.168   -2.906  1.00 0.00 ? 20 PHE P HB3  6  
ATOM 6266  H HD1  . PHE A 1 22 ? -12.579 0.935   -2.740  1.00 0.00 ? 20 PHE P HD1  6  
ATOM 6267  H HD2  . PHE A 1 22 ? -12.517 5.201   -2.137  1.00 0.00 ? 20 PHE P HD2  6  
ATOM 6268  H HE1  . PHE A 1 22 ? -14.968 0.876   -2.100  1.00 0.00 ? 20 PHE P HE1  6  
ATOM 6269  H HE2  . PHE A 1 22 ? -14.922 5.143   -1.523  1.00 0.00 ? 20 PHE P HE2  6  
ATOM 6270  H HZ   . PHE A 1 22 ? -16.149 2.981   -1.494  1.00 0.00 ? 20 PHE P HZ   6  
ATOM 6271  N N    . GLN A 1 23 ? -11.032 3.918   -6.124  1.00 0.00 ? 21 GLN P N    6  
ATOM 6272  C CA   . GLN A 1 23 ? -11.836 4.349   -7.275  1.00 0.00 ? 21 GLN P CA   6  
ATOM 6273  C C    . GLN A 1 23 ? -11.755 3.377   -8.463  1.00 0.00 ? 21 GLN P C    6  
ATOM 6274  O O    . GLN A 1 23 ? -12.765 3.132   -9.129  1.00 0.00 ? 21 GLN P O    6  
ATOM 6275  C CB   . GLN A 1 23 ? -11.422 5.754   -7.747  1.00 0.00 ? 21 GLN P CB   6  
ATOM 6276  C CG   . GLN A 1 23 ? -11.443 6.857   -6.681  1.00 0.00 ? 21 GLN P CG   6  
ATOM 6277  C CD   . GLN A 1 23 ? -12.713 6.869   -5.834  1.00 0.00 ? 21 GLN P CD   6  
ATOM 6278  O OE1  . GLN A 1 23 ? -13.831 6.939   -6.326  1.00 0.00 ? 21 GLN P OE1  6  
ATOM 6279  N NE2  . GLN A 1 23 ? -12.584 6.785   -4.530  1.00 0.00 ? 21 GLN P NE2  6  
ATOM 6280  H H    . GLN A 1 23 ? -10.185 4.427   -5.907  1.00 0.00 ? 21 GLN P H    6  
ATOM 6281  H HA   . GLN A 1 23 ? -12.876 4.370   -6.956  1.00 0.00 ? 21 GLN P HA   6  
ATOM 6282  H HB2  . GLN A 1 23 ? -10.408 5.700   -8.139  1.00 0.00 ? 21 GLN P HB2  6  
ATOM 6283  H HB3  . GLN A 1 23 ? -12.085 6.053   -8.560  1.00 0.00 ? 21 GLN P HB3  6  
ATOM 6284  H HG2  . GLN A 1 23 ? -10.576 6.729   -6.041  1.00 0.00 ? 21 GLN P HG2  6  
ATOM 6285  H HG3  . GLN A 1 23 ? -11.340 7.827   -7.169  1.00 0.00 ? 21 GLN P HG3  6  
ATOM 6286  H HE21 . GLN A 1 23 ? -11.651 6.728   -4.126  1.00 0.00 ? 21 GLN P HE21 6  
ATOM 6287  H HE22 . GLN A 1 23 ? -13.415 6.759   -3.966  1.00 0.00 ? 21 GLN P HE22 6  
ATOM 6288  N N    . ARG A 1 24 ? -10.564 2.817   -8.724  1.00 0.00 ? 22 ARG P N    6  
ATOM 6289  C CA   . ARG A 1 24 ? -10.316 1.856   -9.819  1.00 0.00 ? 22 ARG P CA   6  
ATOM 6290  C C    . ARG A 1 24 ? -10.529 0.394   -9.416  1.00 0.00 ? 22 ARG P C    6  
ATOM 6291  O O    . ARG A 1 24 ? -10.800 -0.443  -10.278 1.00 0.00 ? 22 ARG P O    6  
ATOM 6292  C CB   . ARG A 1 24 ? -8.925  2.081   -10.437 1.00 0.00 ? 22 ARG P CB   6  
ATOM 6293  C CG   . ARG A 1 24 ? -7.750  1.883   -9.463  1.00 0.00 ? 22 ARG P CG   6  
ATOM 6294  C CD   . ARG A 1 24 ? -6.384  2.101   -10.127 1.00 0.00 ? 22 ARG P CD   6  
ATOM 6295  N NE   . ARG A 1 24 ? -6.084  1.072   -11.147 1.00 0.00 ? 22 ARG P NE   6  
ATOM 6296  C CZ   . ARG A 1 24 ? -6.066  1.213   -12.462 1.00 0.00 ? 22 ARG P CZ   6  
ATOM 6297  N NH1  . ARG A 1 24 ? -6.338  2.344   -13.051 1.00 0.00 ? 22 ARG P NH1  6  
ATOM 6298  N NH2  . ARG A 1 24 ? -5.773  0.200   -13.226 1.00 0.00 ? 22 ARG P NH2  6  
ATOM 6299  H H    . ARG A 1 24 ? -9.793  3.070   -8.117  1.00 0.00 ? 22 ARG P H    6  
ATOM 6300  H HA   . ARG A 1 24 ? -11.044 2.041   -10.611 1.00 0.00 ? 22 ARG P HA   6  
ATOM 6301  H HB2  . ARG A 1 24 ? -8.818  1.382   -11.268 1.00 0.00 ? 22 ARG P HB2  6  
ATOM 6302  H HB3  . ARG A 1 24 ? -8.880  3.096   -10.835 1.00 0.00 ? 22 ARG P HB3  6  
ATOM 6303  H HG2  . ARG A 1 24 ? -7.844  2.605   -8.655  1.00 0.00 ? 22 ARG P HG2  6  
ATOM 6304  H HG3  . ARG A 1 24 ? -7.781  0.878   -9.040  1.00 0.00 ? 22 ARG P HG3  6  
ATOM 6305  H HD2  . ARG A 1 24 ? -6.347  3.105   -10.551 1.00 0.00 ? 22 ARG P HD2  6  
ATOM 6306  H HD3  . ARG A 1 24 ? -5.620  2.049   -9.350  1.00 0.00 ? 22 ARG P HD3  6  
ATOM 6307  H HE   . ARG A 1 24 ? -5.847  0.155   -10.800 1.00 0.00 ? 22 ARG P HE   6  
ATOM 6308  H HH11 . ARG A 1 24 ? -6.558  3.150   -12.492 1.00 0.00 ? 22 ARG P HH11 6  
ATOM 6309  H HH12 . ARG A 1 24 ? -6.312  2.418   -14.054 1.00 0.00 ? 22 ARG P HH12 6  
ATOM 6310  H HH21 . ARG A 1 24 ? -5.554  -0.695  -12.820 1.00 0.00 ? 22 ARG P HH21 6  
ATOM 6311  H HH22 . ARG A 1 24 ? -5.758  0.306   -14.227 1.00 0.00 ? 22 ARG P HH22 6  
ATOM 6312  N N    . ASN A 1 25 ? -10.428 0.092   -8.122  1.00 0.00 ? 23 ASN P N    6  
ATOM 6313  C CA   . ASN A 1 25 ? -10.618 -1.239  -7.554  1.00 0.00 ? 23 ASN P CA   6  
ATOM 6314  C C    . ASN A 1 25 ? -11.414 -1.131  -6.246  1.00 0.00 ? 23 ASN P C    6  
ATOM 6315  O O    . ASN A 1 25 ? -10.864 -0.775  -5.206  1.00 0.00 ? 23 ASN P O    6  
ATOM 6316  C CB   . ASN A 1 25 ? -9.238  -1.892  -7.346  1.00 0.00 ? 23 ASN P CB   6  
ATOM 6317  C CG   . ASN A 1 25 ? -9.342  -3.364  -6.972  1.00 0.00 ? 23 ASN P CG   6  
ATOM 6318  O OD1  . ASN A 1 25 ? -10.400 -3.893  -6.658  1.00 0.00 ? 23 ASN P OD1  6  
ATOM 6319  N ND2  . ASN A 1 25 ? -8.241  -4.077  -7.017  1.00 0.00 ? 23 ASN P ND2  6  
ATOM 6320  H H    . ASN A 1 25 ? -10.157 0.833   -7.485  1.00 0.00 ? 23 ASN P H    6  
ATOM 6321  H HA   . ASN A 1 25 ? -11.190 -1.857  -8.248  1.00 0.00 ? 23 ASN P HA   6  
ATOM 6322  H HB2  . ASN A 1 25 ? -8.657  -1.812  -8.263  1.00 0.00 ? 23 ASN P HB2  6  
ATOM 6323  H HB3  . ASN A 1 25 ? -8.692  -1.364  -6.562  1.00 0.00 ? 23 ASN P HB3  6  
ATOM 6324  H HD21 . ASN A 1 25 ? -7.372  -3.647  -7.285  1.00 0.00 ? 23 ASN P HD21 6  
ATOM 6325  H HD22 . ASN A 1 25 ? -8.299  -5.061  -6.807  1.00 0.00 ? 23 ASN P HD22 6  
ATOM 6326  N N    . HIS A 1 26 ? -12.711 -1.440  -6.291  1.00 0.00 ? 24 HIS P N    6  
ATOM 6327  C CA   . HIS A 1 26 ? -13.613 -1.310  -5.137  1.00 0.00 ? 24 HIS P CA   6  
ATOM 6328  C C    . HIS A 1 26 ? -13.493 -2.486  -4.148  1.00 0.00 ? 24 HIS P C    6  
ATOM 6329  O O    . HIS A 1 26 ? -14.022 -2.407  -3.037  1.00 0.00 ? 24 HIS P O    6  
ATOM 6330  C CB   . HIS A 1 26 ? -15.060 -1.141  -5.639  1.00 0.00 ? 24 HIS P CB   6  
ATOM 6331  C CG   . HIS A 1 26 ? -15.387 0.208   -6.246  1.00 0.00 ? 24 HIS P CG   6  
ATOM 6332  N ND1  . HIS A 1 26 ? -16.462 1.018   -5.863  1.00 0.00 ? 24 HIS P ND1  6  
ATOM 6333  C CD2  . HIS A 1 26 ? -14.728 0.824   -7.275  1.00 0.00 ? 24 HIS P CD2  6  
ATOM 6334  C CE1  . HIS A 1 26 ? -16.417 2.100   -6.658  1.00 0.00 ? 24 HIS P CE1  6  
ATOM 6335  N NE2  . HIS A 1 26 ? -15.384 2.010   -7.513  1.00 0.00 ? 24 HIS P NE2  6  
ATOM 6336  H H    . HIS A 1 26 ? -13.101 -1.767  -7.162  1.00 0.00 ? 24 HIS P H    6  
ATOM 6337  H HA   . HIS A 1 26 ? -13.352 -0.409  -4.579  1.00 0.00 ? 24 HIS P HA   6  
ATOM 6338  H HB2  . HIS A 1 26 ? -15.281 -1.916  -6.374  1.00 0.00 ? 24 HIS P HB2  6  
ATOM 6339  H HB3  . HIS A 1 26 ? -15.737 -1.291  -4.797  1.00 0.00 ? 24 HIS P HB3  6  
ATOM 6340  H HD2  . HIS A 1 26 ? -13.851 0.463   -7.793  1.00 0.00 ? 24 HIS P HD2  6  
ATOM 6341  H HE1  . HIS A 1 26 ? -17.115 2.931   -6.617  1.00 0.00 ? 24 HIS P HE1  6  
ATOM 6342  H HE2  . HIS A 1 26 ? -15.128 2.706   -8.208  1.00 0.00 ? 24 HIS P HE2  6  
ATOM 6343  N N    . TYR A 1 27 ? -12.818 -3.575  -4.539  1.00 0.00 ? 25 TYR P N    6  
ATOM 6344  C CA   . TYR A 1 27 ? -12.728 -4.831  -3.782  1.00 0.00 ? 25 TYR P CA   6  
ATOM 6345  C C    . TYR A 1 27 ? -11.394 -5.577  -4.047  1.00 0.00 ? 25 TYR P C    6  
ATOM 6346  O O    . TYR A 1 27 ? -11.391 -6.669  -4.626  1.00 0.00 ? 25 TYR P O    6  
ATOM 6347  C CB   . TYR A 1 27 ? -13.990 -5.687  -4.043  1.00 0.00 ? 25 TYR P CB   6  
ATOM 6348  C CG   . TYR A 1 27 ? -14.491 -5.752  -5.483  1.00 0.00 ? 25 TYR P CG   6  
ATOM 6349  C CD1  . TYR A 1 27 ? -14.018 -6.740  -6.371  1.00 0.00 ? 25 TYR P CD1  6  
ATOM 6350  C CD2  . TYR A 1 27 ? -15.457 -4.826  -5.926  1.00 0.00 ? 25 TYR P CD2  6  
ATOM 6351  C CE1  . TYR A 1 27 ? -14.482 -6.780  -7.701  1.00 0.00 ? 25 TYR P CE1  6  
ATOM 6352  C CE2  . TYR A 1 27 ? -15.924 -4.861  -7.255  1.00 0.00 ? 25 TYR P CE2  6  
ATOM 6353  C CZ   . TYR A 1 27 ? -15.433 -5.838  -8.148  1.00 0.00 ? 25 TYR P CZ   6  
ATOM 6354  O OH   . TYR A 1 27 ? -15.876 -5.885  -9.436  1.00 0.00 ? 25 TYR P OH   6  
ATOM 6355  H H    . TYR A 1 27 ? -12.359 -3.545  -5.441  1.00 0.00 ? 25 TYR P H    6  
ATOM 6356  H HA   . TYR A 1 27 ? -12.730 -4.591  -2.719  1.00 0.00 ? 25 TYR P HA   6  
ATOM 6357  H HB2  . TYR A 1 27 ? -13.827 -6.700  -3.672  1.00 0.00 ? 25 TYR P HB2  6  
ATOM 6358  H HB3  . TYR A 1 27 ? -14.796 -5.274  -3.436  1.00 0.00 ? 25 TYR P HB3  6  
ATOM 6359  H HD1  . TYR A 1 27 ? -13.296 -7.472  -6.035  1.00 0.00 ? 25 TYR P HD1  6  
ATOM 6360  H HD2  . TYR A 1 27 ? -15.844 -4.083  -5.241  1.00 0.00 ? 25 TYR P HD2  6  
ATOM 6361  H HE1  . TYR A 1 27 ? -14.115 -7.532  -8.385  1.00 0.00 ? 25 TYR P HE1  6  
ATOM 6362  H HE2  . TYR A 1 27 ? -16.658 -4.142  -7.590  1.00 0.00 ? 25 TYR P HE2  6  
ATOM 6363  H HH   . TYR A 1 27 ? -16.532 -5.192  -9.626  1.00 0.00 ? 25 TYR P HH   6  
ATOM 6364  N N    . PRO A 1 28 ? -10.238 -5.011  -3.641  1.00 0.00 ? 26 PRO P N    6  
ATOM 6365  C CA   . PRO A 1 28 ? -8.929  -5.626  -3.858  1.00 0.00 ? 26 PRO P CA   6  
ATOM 6366  C C    . PRO A 1 28 ? -8.754  -6.940  -3.077  1.00 0.00 ? 26 PRO P C    6  
ATOM 6367  O O    . PRO A 1 28 ? -9.330  -7.154  -2.007  1.00 0.00 ? 26 PRO P O    6  
ATOM 6368  C CB   . PRO A 1 28 ? -7.901  -4.564  -3.466  1.00 0.00 ? 26 PRO P CB   6  
ATOM 6369  C CG   . PRO A 1 28 ? -8.641  -3.763  -2.399  1.00 0.00 ? 26 PRO P CG   6  
ATOM 6370  C CD   . PRO A 1 28 ? -10.078 -3.757  -2.920  1.00 0.00 ? 26 PRO P CD   6  
ATOM 6371  H HA   . PRO A 1 28 ? -8.809  -5.847  -4.919  1.00 0.00 ? 26 PRO P HA   6  
ATOM 6372  H HB2  . PRO A 1 28 ? -6.973  -4.993  -3.095  1.00 0.00 ? 26 PRO P HB2  6  
ATOM 6373  H HB3  . PRO A 1 28 ? -7.692  -3.923  -4.321  1.00 0.00 ? 26 PRO P HB3  6  
ATOM 6374  H HG2  . PRO A 1 28 ? -8.603  -4.292  -1.448  1.00 0.00 ? 26 PRO P HG2  6  
ATOM 6375  H HG3  . PRO A 1 28 ? -8.236  -2.757  -2.301  1.00 0.00 ? 26 PRO P HG3  6  
ATOM 6376  H HD2  . PRO A 1 28 ? -10.777 -3.681  -2.088  1.00 0.00 ? 26 PRO P HD2  6  
ATOM 6377  H HD3  . PRO A 1 28 ? -10.214 -2.923  -3.609  1.00 0.00 ? 26 PRO P HD3  6  
ATOM 6378  N N    . ASP A 1 29 ? -7.910  -7.810  -3.624  1.00 0.00 ? 27 ASP P N    6  
ATOM 6379  C CA   . ASP A 1 29 ? -7.671  -9.200  -3.203  1.00 0.00 ? 27 ASP P CA   6  
ATOM 6380  C C    . ASP A 1 29 ? -6.245  -9.366  -2.652  1.00 0.00 ? 27 ASP P C    6  
ATOM 6381  O O    . ASP A 1 29 ? -5.462  -8.422  -2.682  1.00 0.00 ? 27 ASP P O    6  
ATOM 6382  C CB   . ASP A 1 29 ? -7.940  -10.120 -4.409  1.00 0.00 ? 27 ASP P CB   6  
ATOM 6383  C CG   . ASP A 1 29 ? -7.998  -11.622 -4.072  1.00 0.00 ? 27 ASP P CG   6  
ATOM 6384  O OD1  . ASP A 1 29 ? -8.220  -11.981 -2.892  1.00 0.00 ? 27 ASP P OD1  6  
ATOM 6385  O OD2  . ASP A 1 29 ? -7.802  -12.448 -4.996  1.00 0.00 ? 27 ASP P OD2  6  
ATOM 6386  H H    . ASP A 1 29 ? -7.348  -7.460  -4.396  1.00 0.00 ? 27 ASP P H    6  
ATOM 6387  H HA   . ASP A 1 29 ? -8.371  -9.461  -2.413  1.00 0.00 ? 27 ASP P HA   6  
ATOM 6388  H HB2  . ASP A 1 29 ? -8.896  -9.842  -4.850  1.00 0.00 ? 27 ASP P HB2  6  
ATOM 6389  H HB3  . ASP A 1 29 ? -7.162  -9.947  -5.154  1.00 0.00 ? 27 ASP P HB3  6  
ATOM 6390  N N    . MET A 1 30 ? -5.857  -10.555 -2.186  1.00 0.00 ? 28 MET P N    6  
ATOM 6391  C CA   . MET A 1 30 ? -4.520  -10.810 -1.620  1.00 0.00 ? 28 MET P CA   6  
ATOM 6392  C C    . MET A 1 30 ? -3.352  -10.371 -2.527  1.00 0.00 ? 28 MET P C    6  
ATOM 6393  O O    . MET A 1 30 ? -2.274  -10.054 -2.028  1.00 0.00 ? 28 MET P O    6  
ATOM 6394  C CB   . MET A 1 30 ? -4.367  -12.298 -1.263  1.00 0.00 ? 28 MET P CB   6  
ATOM 6395  C CG   . MET A 1 30 ? -4.384  -13.229 -2.488  1.00 0.00 ? 28 MET P CG   6  
ATOM 6396  S SD   . MET A 1 30 ? -3.789  -14.912 -2.177  1.00 0.00 ? 28 MET P SD   6  
ATOM 6397  C CE   . MET A 1 30 ? -2.002  -14.575 -2.162  1.00 0.00 ? 28 MET P CE   6  
ATOM 6398  H H    . MET A 1 30 ? -6.542  -11.308 -2.200  1.00 0.00 ? 28 MET P H    6  
ATOM 6399  H HA   . MET A 1 30 ? -4.433  -10.237 -0.696  1.00 0.00 ? 28 MET P HA   6  
ATOM 6400  H HB2  . MET A 1 30 ? -3.420  -12.422 -0.737  1.00 0.00 ? 28 MET P HB2  6  
ATOM 6401  H HB3  . MET A 1 30 ? -5.166  -12.592 -0.581  1.00 0.00 ? 28 MET P HB3  6  
ATOM 6402  H HG2  . MET A 1 30 ? -5.399  -13.272 -2.880  1.00 0.00 ? 28 MET P HG2  6  
ATOM 6403  H HG3  . MET A 1 30 ? -3.755  -12.821 -3.276  1.00 0.00 ? 28 MET P HG3  6  
ATOM 6404  H HE1  . MET A 1 30 ? -1.715  -14.058 -3.080  1.00 0.00 ? 28 MET P HE1  6  
ATOM 6405  H HE2  . MET A 1 30 ? -1.749  -13.946 -1.310  1.00 0.00 ? 28 MET P HE2  6  
ATOM 6406  H HE3  . MET A 1 30 ? -1.453  -15.514 -2.089  1.00 0.00 ? 28 MET P HE3  6  
ATOM 6407  N N    . SER A 1 31 ? -3.559  -10.332 -3.850  1.00 0.00 ? 29 SER P N    6  
ATOM 6408  C CA   . SER A 1 31 ? -2.556  -9.877  -4.821  1.00 0.00 ? 29 SER P CA   6  
ATOM 6409  C C    . SER A 1 31 ? -2.581  -8.350  -4.995  1.00 0.00 ? 29 SER P C    6  
ATOM 6410  O O    . SER A 1 31 ? -1.543  -7.689  -4.912  1.00 0.00 ? 29 SER P O    6  
ATOM 6411  C CB   . SER A 1 31 ? -2.774  -10.595 -6.158  1.00 0.00 ? 29 SER P CB   6  
ATOM 6412  O OG   . SER A 1 31 ? -1.739  -10.279 -7.071  1.00 0.00 ? 29 SER P OG   6  
ATOM 6413  H H    . SER A 1 31 ? -4.477  -10.585 -4.185  1.00 0.00 ? 29 SER P H    6  
ATOM 6414  H HA   . SER A 1 31 ? -1.573  -10.169 -4.450  1.00 0.00 ? 29 SER P HA   6  
ATOM 6415  H HB2  . SER A 1 31 ? -2.781  -11.673 -5.985  1.00 0.00 ? 29 SER P HB2  6  
ATOM 6416  H HB3  . SER A 1 31 ? -3.738  -10.301 -6.579  1.00 0.00 ? 29 SER P HB3  6  
ATOM 6417  H HG   . SER A 1 31 ? -1.889  -10.781 -7.897  1.00 0.00 ? 29 SER P HG   6  
ATOM 6418  N N    . THR A 1 32 ? -3.768  -7.757  -5.173  1.00 0.00 ? 30 THR P N    6  
ATOM 6419  C CA   . THR A 1 32 ? -3.934  -6.309  -5.399  1.00 0.00 ? 30 THR P CA   6  
ATOM 6420  C C    . THR A 1 32 ? -3.772  -5.473  -4.129  1.00 0.00 ? 30 THR P C    6  
ATOM 6421  O O    . THR A 1 32 ? -3.184  -4.398  -4.188  1.00 0.00 ? 30 THR P O    6  
ATOM 6422  C CB   . THR A 1 32 ? -5.259  -5.970  -6.102  1.00 0.00 ? 30 THR P CB   6  
ATOM 6423  O OG1  . THR A 1 32 ? -6.284  -6.886  -5.790  1.00 0.00 ? 30 THR P OG1  6  
ATOM 6424  C CG2  . THR A 1 32 ? -5.101  -5.998  -7.620  1.00 0.00 ? 30 THR P CG2  6  
ATOM 6425  H H    . THR A 1 32 ? -4.606  -8.321  -5.154  1.00 0.00 ? 30 THR P H    6  
ATOM 6426  H HA   . THR A 1 32 ? -3.139  -5.987  -6.065  1.00 0.00 ? 30 THR P HA   6  
ATOM 6427  H HB   . THR A 1 32 ? -5.584  -4.976  -5.797  1.00 0.00 ? 30 THR P HB   6  
ATOM 6428  H HG1  . THR A 1 32 ? -6.391  -7.473  -6.559  1.00 0.00 ? 30 THR P HG1  6  
ATOM 6429  H HG21 . THR A 1 32 ? -6.061  -5.801  -8.099  1.00 0.00 ? 30 THR P HG21 6  
ATOM 6430  H HG22 . THR A 1 32 ? -4.726  -6.969  -7.943  1.00 0.00 ? 30 THR P HG22 6  
ATOM 6431  H HG23 . THR A 1 32 ? -4.396  -5.225  -7.926  1.00 0.00 ? 30 THR P HG23 6  
ATOM 6432  N N    . ARG A 1 33 ? -4.195  -5.967  -2.960  1.00 0.00 ? 31 ARG P N    6  
ATOM 6433  C CA   . ARG A 1 33 ? -3.923  -5.344  -1.652  1.00 0.00 ? 31 ARG P CA   6  
ATOM 6434  C C    . ARG A 1 33 ? -2.425  -5.229  -1.373  1.00 0.00 ? 31 ARG P C    6  
ATOM 6435  O O    . ARG A 1 33 ? -1.958  -4.164  -0.981  1.00 0.00 ? 31 ARG P O    6  
ATOM 6436  C CB   . ARG A 1 33 ? -4.598  -6.147  -0.529  1.00 0.00 ? 31 ARG P CB   6  
ATOM 6437  C CG   . ARG A 1 33 ? -6.128  -6.013  -0.543  1.00 0.00 ? 31 ARG P CG   6  
ATOM 6438  C CD   . ARG A 1 33 ? -6.784  -6.591  0.712   1.00 0.00 ? 31 ARG P CD   6  
ATOM 6439  N NE   . ARG A 1 33 ? -6.551  -8.037  0.874   1.00 0.00 ? 31 ARG P NE   6  
ATOM 6440  C CZ   . ARG A 1 33 ? -7.393  -9.033  0.680   1.00 0.00 ? 31 ARG P CZ   6  
ATOM 6441  N NH1  . ARG A 1 33 ? -8.571  -8.893  0.146   1.00 0.00 ? 31 ARG P NH1  6  
ATOM 6442  N NH2  . ARG A 1 33 ? -7.021  -10.222 1.040   1.00 0.00 ? 31 ARG P NH2  6  
ATOM 6443  H H    . ARG A 1 33 ? -4.724  -6.834  -2.979  1.00 0.00 ? 31 ARG P H    6  
ATOM 6444  H HA   . ARG A 1 33 ? -4.318  -4.328  -1.665  1.00 0.00 ? 31 ARG P HA   6  
ATOM 6445  H HB2  . ARG A 1 33 ? -4.313  -7.197  -0.623  1.00 0.00 ? 31 ARG P HB2  6  
ATOM 6446  H HB3  . ARG A 1 33 ? -4.230  -5.779  0.429   1.00 0.00 ? 31 ARG P HB3  6  
ATOM 6447  H HG2  . ARG A 1 33 ? -6.386  -4.957  -0.601  1.00 0.00 ? 31 ARG P HG2  6  
ATOM 6448  H HG3  . ARG A 1 33 ? -6.535  -6.515  -1.416  1.00 0.00 ? 31 ARG P HG3  6  
ATOM 6449  H HD2  . ARG A 1 33 ? -6.367  -6.075  1.576   1.00 0.00 ? 31 ARG P HD2  6  
ATOM 6450  H HD3  . ARG A 1 33 ? -7.854  -6.378  0.679   1.00 0.00 ? 31 ARG P HD3  6  
ATOM 6451  H HE   . ARG A 1 33 ? -5.664  -8.328  1.281   1.00 0.00 ? 31 ARG P HE   6  
ATOM 6452  H HH11 . ARG A 1 33 ? -8.822  -8.020  -0.303  1.00 0.00 ? 31 ARG P HH11 6  
ATOM 6453  H HH12 . ARG A 1 33 ? -9.183  -9.684  0.055   1.00 0.00 ? 31 ARG P HH12 6  
ATOM 6454  H HH21 . ARG A 1 33 ? -6.090  -10.302 1.452   1.00 0.00 ? 31 ARG P HH21 6  
ATOM 6455  H HH22 . ARG A 1 33 ? -7.611  -11.024 0.909   1.00 0.00 ? 31 ARG P HH22 6  
ATOM 6456  N N    . GLU A 1 34 ? -1.657  -6.289  -1.622  1.00 0.00 ? 32 GLU P N    6  
ATOM 6457  C CA   . GLU A 1 34 ? -0.190  -6.234  -1.553  1.00 0.00 ? 32 GLU P CA   6  
ATOM 6458  C C    . GLU A 1 34 ? 0.375   -5.221  -2.558  1.00 0.00 ? 32 GLU P C    6  
ATOM 6459  O O    . GLU A 1 34 ? 1.221   -4.407  -2.199  1.00 0.00 ? 32 GLU P O    6  
ATOM 6460  C CB   . GLU A 1 34 ? 0.435   -7.615  -1.819  1.00 0.00 ? 32 GLU P CB   6  
ATOM 6461  C CG   . GLU A 1 34 ? 0.290   -8.571  -0.629  1.00 0.00 ? 32 GLU P CG   6  
ATOM 6462  C CD   . GLU A 1 34 ? 0.971   -9.944  -0.841  1.00 0.00 ? 32 GLU P CD   6  
ATOM 6463  O OE1  . GLU A 1 34 ? 1.575   -10.207 -1.911  1.00 0.00 ? 32 GLU P OE1  6  
ATOM 6464  O OE2  . GLU A 1 34 ? 0.938   -10.777 0.099   1.00 0.00 ? 32 GLU P OE2  6  
ATOM 6465  H H    . GLU A 1 34 ? -2.104  -7.138  -1.929  1.00 0.00 ? 32 GLU P H    6  
ATOM 6466  H HA   . GLU A 1 34 ? 0.104   -5.898  -0.557  1.00 0.00 ? 32 GLU P HA   6  
ATOM 6467  H HB2  . GLU A 1 34 ? -0.019  -8.057  -2.706  1.00 0.00 ? 32 GLU P HB2  6  
ATOM 6468  H HB3  . GLU A 1 34 ? 1.499   -7.473  -2.009  1.00 0.00 ? 32 GLU P HB3  6  
ATOM 6469  H HG2  . GLU A 1 34 ? 0.730   -8.087  0.245   1.00 0.00 ? 32 GLU P HG2  6  
ATOM 6470  H HG3  . GLU A 1 34 ? -0.770  -8.721  -0.427  1.00 0.00 ? 32 GLU P HG3  6  
ATOM 6471  N N    . GLU A 1 35 ? -0.131  -5.213  -3.795  1.00 0.00 ? 33 GLU P N    6  
ATOM 6472  C CA   . GLU A 1 35 ? 0.349   -4.323  -4.863  1.00 0.00 ? 33 GLU P CA   6  
ATOM 6473  C C    . GLU A 1 35 ? 0.259   -2.826  -4.510  1.00 0.00 ? 33 GLU P C    6  
ATOM 6474  O O    . GLU A 1 35 ? 1.128   -2.072  -4.944  1.00 0.00 ? 33 GLU P O    6  
ATOM 6475  C CB   . GLU A 1 35 ? -0.393  -4.639  -6.174  1.00 0.00 ? 33 GLU P CB   6  
ATOM 6476  C CG   . GLU A 1 35 ? 0.068   -3.774  -7.354  1.00 0.00 ? 33 GLU P CG   6  
ATOM 6477  C CD   . GLU A 1 35 ? -0.470  -4.321  -8.690  1.00 0.00 ? 33 GLU P CD   6  
ATOM 6478  O OE1  . GLU A 1 35 ? -1.621  -3.991  -9.069  1.00 0.00 ? 33 GLU P OE1  6  
ATOM 6479  O OE2  . GLU A 1 35 ? 0.259   -5.076  -9.380  1.00 0.00 ? 33 GLU P OE2  6  
ATOM 6480  H H    . GLU A 1 35 ? -0.810  -5.928  -4.029  1.00 0.00 ? 33 GLU P H    6  
ATOM 6481  H HA   . GLU A 1 35 ? 1.408   -4.536  -5.021  1.00 0.00 ? 33 GLU P HA   6  
ATOM 6482  H HB2  . GLU A 1 35 ? -0.221  -5.687  -6.421  1.00 0.00 ? 33 GLU P HB2  6  
ATOM 6483  H HB3  . GLU A 1 35 ? -1.460  -4.485  -6.041  1.00 0.00 ? 33 GLU P HB3  6  
ATOM 6484  H HG2  . GLU A 1 35 ? -0.282  -2.749  -7.208  1.00 0.00 ? 33 GLU P HG2  6  
ATOM 6485  H HG3  . GLU A 1 35 ? 1.158   -3.746  -7.370  1.00 0.00 ? 33 GLU P HG3  6  
ATOM 6486  N N    . ILE A 1 36 ? -0.716  -2.386  -3.701  1.00 0.00 ? 34 ILE P N    6  
ATOM 6487  C CA   . ILE A 1 36 ? -0.776  -0.995  -3.198  1.00 0.00 ? 34 ILE P CA   6  
ATOM 6488  C C    . ILE A 1 36 ? 0.042   -0.811  -1.908  1.00 0.00 ? 34 ILE P C    6  
ATOM 6489  O O    . ILE A 1 36 ? 0.622   0.253   -1.688  1.00 0.00 ? 34 ILE P O    6  
ATOM 6490  C CB   . ILE A 1 36 ? -2.233  -0.462  -3.093  1.00 0.00 ? 34 ILE P CB   6  
ATOM 6491  C CG1  . ILE A 1 36 ? -2.958  -0.759  -1.764  1.00 0.00 ? 34 ILE P CG1  6  
ATOM 6492  C CG2  . ILE A 1 36 ? -3.101  -0.976  -4.257  1.00 0.00 ? 34 ILE P CG2  6  
ATOM 6493  C CD1  . ILE A 1 36 ? -2.760  0.329   -0.698  1.00 0.00 ? 34 ILE P CD1  6  
ATOM 6494  H H    . ILE A 1 36 ? -1.442  -3.036  -3.427  1.00 0.00 ? 34 ILE P H    6  
ATOM 6495  H HA   . ILE A 1 36 ? -0.296  -0.356  -3.938  1.00 0.00 ? 34 ILE P HA   6  
ATOM 6496  H HB   . ILE A 1 36 ? -2.181  0.622   -3.198  1.00 0.00 ? 34 ILE P HB   6  
ATOM 6497  H HG12 . ILE A 1 36 ? -4.032  -0.833  -1.942  1.00 0.00 ? 34 ILE P HG12 6  
ATOM 6498  H HG13 . ILE A 1 36 ? -2.622  -1.718  -1.376  1.00 0.00 ? 34 ILE P HG13 6  
ATOM 6499  H HG21 . ILE A 1 36 ? -4.016  -0.389  -4.331  1.00 0.00 ? 34 ILE P HG21 6  
ATOM 6500  H HG22 . ILE A 1 36 ? -2.558  -0.904  -5.201  1.00 0.00 ? 34 ILE P HG22 6  
ATOM 6501  H HG23 . ILE A 1 36 ? -3.385  -2.011  -4.078  1.00 0.00 ? 34 ILE P HG23 6  
ATOM 6502  H HD11 . ILE A 1 36 ? -1.712  0.446   -0.432  1.00 0.00 ? 34 ILE P HD11 6  
ATOM 6503  H HD12 . ILE A 1 36 ? -3.301  0.042   0.199   1.00 0.00 ? 34 ILE P HD12 6  
ATOM 6504  H HD13 . ILE A 1 36 ? -3.148  1.284   -1.060  1.00 0.00 ? 34 ILE P HD13 6  
ATOM 6505  N N    . ALA A 1 37 ? 0.132   -1.842  -1.061  1.00 0.00 ? 35 ALA P N    6  
ATOM 6506  C CA   . ALA A 1 37 ? 0.822   -1.796  0.232   1.00 0.00 ? 35 ALA P CA   6  
ATOM 6507  C C    . ALA A 1 37 ? 2.355   -1.693  0.092   1.00 0.00 ? 35 ALA P C    6  
ATOM 6508  O O    . ALA A 1 37 ? 3.040   -1.094  0.927   1.00 0.00 ? 35 ALA P O    6  
ATOM 6509  C CB   . ALA A 1 37 ? 0.428   -3.054  1.016   1.00 0.00 ? 35 ALA P CB   6  
ATOM 6510  H H    . ALA A 1 37 ? -0.304  -2.716  -1.326  1.00 0.00 ? 35 ALA P H    6  
ATOM 6511  H HA   . ALA A 1 37 ? 0.469   -0.929  0.783   1.00 0.00 ? 35 ALA P HA   6  
ATOM 6512  H HB1  . ALA A 1 37 ? 0.770   -3.946  0.491   1.00 0.00 ? 35 ALA P HB1  6  
ATOM 6513  H HB2  . ALA A 1 37 ? 0.889   -3.031  1.998   1.00 0.00 ? 35 ALA P HB2  6  
ATOM 6514  H HB3  . ALA A 1 37 ? -0.652  -3.097  1.139   1.00 0.00 ? 35 ALA P HB3  6  
ATOM 6515  N N    . VAL A 1 38 ? 2.876   -2.261  -0.998  1.00 0.00 ? 36 VAL P N    6  
ATOM 6516  C CA   . VAL A 1 38 ? 4.298   -2.460  -1.318  1.00 0.00 ? 36 VAL P CA   6  
ATOM 6517  C C    . VAL A 1 38 ? 5.106   -1.160  -1.394  1.00 0.00 ? 36 VAL P C    6  
ATOM 6518  O O    . VAL A 1 38 ? 6.283   -1.151  -1.028  1.00 0.00 ? 36 VAL P O    6  
ATOM 6519  C CB   . VAL A 1 38 ? 4.361   -3.281  -2.631  1.00 0.00 ? 36 VAL P CB   6  
ATOM 6520  C CG1  . VAL A 1 38 ? 5.545   -3.005  -3.560  1.00 0.00 ? 36 VAL P CG1  6  
ATOM 6521  C CG2  . VAL A 1 38 ? 4.355   -4.779  -2.303  1.00 0.00 ? 36 VAL P CG2  6  
ATOM 6522  H H    . VAL A 1 38 ? 2.208   -2.720  -1.610  1.00 0.00 ? 36 VAL P H    6  
ATOM 6523  H HA   . VAL A 1 38 ? 4.749   -3.040  -0.513  1.00 0.00 ? 36 VAL P HA   6  
ATOM 6524  H HB   . VAL A 1 38 ? 3.467   -3.063  -3.218  1.00 0.00 ? 36 VAL P HB   6  
ATOM 6525  H HG11 . VAL A 1 38 ? 5.502   -1.976  -3.915  1.00 0.00 ? 36 VAL P HG11 6  
ATOM 6526  H HG12 . VAL A 1 38 ? 6.486   -3.183  -3.039  1.00 0.00 ? 36 VAL P HG12 6  
ATOM 6527  H HG13 . VAL A 1 38 ? 5.478   -3.659  -4.429  1.00 0.00 ? 36 VAL P HG13 6  
ATOM 6528  H HG21 . VAL A 1 38 ? 5.308   -5.073  -1.864  1.00 0.00 ? 36 VAL P HG21 6  
ATOM 6529  H HG22 . VAL A 1 38 ? 3.558   -5.004  -1.595  1.00 0.00 ? 36 VAL P HG22 6  
ATOM 6530  H HG23 . VAL A 1 38 ? 4.177   -5.352  -3.213  1.00 0.00 ? 36 VAL P HG23 6  
ATOM 6531  N N    . TRP A 1 39 ? 4.485   -0.058  -1.822  1.00 0.00 ? 37 TRP P N    6  
ATOM 6532  C CA   . TRP A 1 39 ? 5.118   1.263   -1.970  1.00 0.00 ? 37 TRP P CA   6  
ATOM 6533  C C    . TRP A 1 39 ? 4.535   2.330   -1.029  1.00 0.00 ? 37 TRP P C    6  
ATOM 6534  O O    . TRP A 1 39 ? 4.896   3.505   -1.116  1.00 0.00 ? 37 TRP P O    6  
ATOM 6535  C CB   . TRP A 1 39 ? 5.096   1.684   -3.446  1.00 0.00 ? 37 TRP P CB   6  
ATOM 6536  C CG   . TRP A 1 39 ? 3.782   1.514   -4.137  1.00 0.00 ? 37 TRP P CG   6  
ATOM 6537  C CD1  . TRP A 1 39 ? 3.340   0.363   -4.683  1.00 0.00 ? 37 TRP P CD1  6  
ATOM 6538  C CD2  . TRP A 1 39 ? 2.710   2.483   -4.329  1.00 0.00 ? 37 TRP P CD2  6  
ATOM 6539  N NE1  . TRP A 1 39 ? 2.057   0.533   -5.146  1.00 0.00 ? 37 TRP P NE1  6  
ATOM 6540  C CE2  . TRP A 1 39 ? 1.608   1.822   -4.951  1.00 0.00 ? 37 TRP P CE2  6  
ATOM 6541  C CE3  . TRP A 1 39 ? 2.558   3.850   -4.027  1.00 0.00 ? 37 TRP P CE3  6  
ATOM 6542  C CZ2  . TRP A 1 39 ? 0.398   2.476   -5.229  1.00 0.00 ? 37 TRP P CZ2  6  
ATOM 6543  C CZ3  . TRP A 1 39 ? 1.358   4.524   -4.324  1.00 0.00 ? 37 TRP P CZ3  6  
ATOM 6544  C CH2  . TRP A 1 39 ? 0.277   3.839   -4.911  1.00 0.00 ? 37 TRP P CH2  6  
ATOM 6545  H H    . TRP A 1 39 ? 3.517   -0.138  -2.111  1.00 0.00 ? 37 TRP P H    6  
ATOM 6546  H HA   . TRP A 1 39 ? 6.163   1.179   -1.685  1.00 0.00 ? 37 TRP P HA   6  
ATOM 6547  H HB2  . TRP A 1 39 ? 5.412   2.722   -3.529  1.00 0.00 ? 37 TRP P HB2  6  
ATOM 6548  H HB3  . TRP A 1 39 ? 5.829   1.088   -3.982  1.00 0.00 ? 37 TRP P HB3  6  
ATOM 6549  H HD1  . TRP A 1 39 ? 3.885   -0.574  -4.701  1.00 0.00 ? 37 TRP P HD1  6  
ATOM 6550  H HE1  . TRP A 1 39 ? 1.506   -0.263  -5.464  1.00 0.00 ? 37 TRP P HE1  6  
ATOM 6551  H HE3  . TRP A 1 39 ? 3.383   4.373   -3.562  1.00 0.00 ? 37 TRP P HE3  6  
ATOM 6552  H HZ2  . TRP A 1 39 ? -0.420  1.939   -5.690  1.00 0.00 ? 37 TRP P HZ2  6  
ATOM 6553  H HZ3  . TRP A 1 39 ? 1.265   5.577   -4.098  1.00 0.00 ? 37 TRP P HZ3  6  
ATOM 6554  H HH2  . TRP A 1 39 ? -0.645  4.367   -5.123  1.00 0.00 ? 37 TRP P HH2  6  
ATOM 6555  N N    . THR A 1 40 ? 3.661   1.921   -0.104  1.00 0.00 ? 38 THR P N    6  
ATOM 6556  C CA   . THR A 1 40 ? 3.003   2.805   0.880   1.00 0.00 ? 38 THR P CA   6  
ATOM 6557  C C    . THR A 1 40 ? 3.392   2.493   2.327   1.00 0.00 ? 38 THR P C    6  
ATOM 6558  O O    . THR A 1 40 ? 2.854   3.102   3.249   1.00 0.00 ? 38 THR P O    6  
ATOM 6559  C CB   . THR A 1 40 ? 1.476   2.807   0.697   1.00 0.00 ? 38 THR P CB   6  
ATOM 6560  O OG1  . THR A 1 40 ? 0.963   1.504   0.809   1.00 0.00 ? 38 THR P OG1  6  
ATOM 6561  C CG2  . THR A 1 40 ? 1.083   3.333   -0.684  1.00 0.00 ? 38 THR P CG2  6  
ATOM 6562  H H    . THR A 1 40 ? 3.407   0.940   -0.092  1.00 0.00 ? 38 THR P H    6  
ATOM 6563  H HA   . THR A 1 40 ? 3.331   3.830   0.713   1.00 0.00 ? 38 THR P HA   6  
ATOM 6564  H HB   . THR A 1 40 ? 1.017   3.433   1.466   1.00 0.00 ? 38 THR P HB   6  
ATOM 6565  H HG1  . THR A 1 40 ? 0.859   1.169   -0.101  1.00 0.00 ? 38 THR P HG1  6  
ATOM 6566  H HG21 . THR A 1 40 ? 1.537   2.724   -1.470  1.00 0.00 ? 38 THR P HG21 6  
ATOM 6567  H HG22 . THR A 1 40 ? 1.430   4.359   -0.795  1.00 0.00 ? 38 THR P HG22 6  
ATOM 6568  H HG23 . THR A 1 40 ? -0.001  3.308   -0.793  1.00 0.00 ? 38 THR P HG23 6  
ATOM 6569  N N    . ASN A 1 41 ? 4.353   1.587   2.550   1.00 0.00 ? 39 ASN P N    6  
ATOM 6570  C CA   . ASN A 1 41 ? 4.796   1.125   3.876   1.00 0.00 ? 39 ASN P CA   6  
ATOM 6571  C C    . ASN A 1 41 ? 3.651   0.504   4.717   1.00 0.00 ? 39 ASN P C    6  
ATOM 6572  O O    . ASN A 1 41 ? 3.543   0.726   5.927   1.00 0.00 ? 39 ASN P O    6  
ATOM 6573  C CB   . ASN A 1 41 ? 5.591   2.249   4.576   1.00 0.00 ? 39 ASN P CB   6  
ATOM 6574  C CG   . ASN A 1 41 ? 6.624   1.733   5.570   1.00 0.00 ? 39 ASN P CG   6  
ATOM 6575  O OD1  . ASN A 1 41 ? 7.824   1.786   5.339   1.00 0.00 ? 39 ASN P OD1  6  
ATOM 6576  N ND2  . ASN A 1 41 ? 6.203   1.214   6.700   1.00 0.00 ? 39 ASN P ND2  6  
ATOM 6577  H H    . ASN A 1 41 ? 4.774   1.156   1.738   1.00 0.00 ? 39 ASN P H    6  
ATOM 6578  H HA   . ASN A 1 41 ? 5.494   0.306   3.692   1.00 0.00 ? 39 ASN P HA   6  
ATOM 6579  H HB2  . ASN A 1 41 ? 6.119   2.840   3.829   1.00 0.00 ? 39 ASN P HB2  6  
ATOM 6580  H HB3  . ASN A 1 41 ? 4.897   2.911   5.090   1.00 0.00 ? 39 ASN P HB3  6  
ATOM 6581  H HD21 . ASN A 1 41 ? 5.204   1.113   6.848   1.00 0.00 ? 39 ASN P HD21 6  
ATOM 6582  H HD22 . ASN A 1 41 ? 6.880   0.868   7.361   1.00 0.00 ? 39 ASN P HD22 6  
ATOM 6583  N N    . LEU A 1 42 ? 2.780   -0.263  4.059   1.00 0.00 ? 40 LEU P N    6  
ATOM 6584  C CA   . LEU A 1 42 ? 1.678   -1.029  4.655   1.00 0.00 ? 40 LEU P CA   6  
ATOM 6585  C C    . LEU A 1 42 ? 1.874   -2.547  4.451   1.00 0.00 ? 40 LEU P C    6  
ATOM 6586  O O    . LEU A 1 42 ? 2.846   -2.996  3.838   1.00 0.00 ? 40 LEU P O    6  
ATOM 6587  C CB   . LEU A 1 42 ? 0.348   -0.539  4.033   1.00 0.00 ? 40 LEU P CB   6  
ATOM 6588  C CG   . LEU A 1 42 ? -0.045  0.916   4.335   1.00 0.00 ? 40 LEU P CG   6  
ATOM 6589  C CD1  . LEU A 1 42 ? -1.347  1.249   3.607   1.00 0.00 ? 40 LEU P CD1  6  
ATOM 6590  C CD2  . LEU A 1 42 ? -0.277  1.136   5.829   1.00 0.00 ? 40 LEU P CD2  6  
ATOM 6591  H H    . LEU A 1 42 ? 2.929   -0.375  3.064   1.00 0.00 ? 40 LEU P H    6  
ATOM 6592  H HA   . LEU A 1 42 ? 1.645   -0.865  5.732   1.00 0.00 ? 40 LEU P HA   6  
ATOM 6593  H HB2  . LEU A 1 42 ? 0.418   -0.648  2.955   1.00 0.00 ? 40 LEU P HB2  6  
ATOM 6594  H HB3  . LEU A 1 42 ? -0.467  -1.180  4.369   1.00 0.00 ? 40 LEU P HB3  6  
ATOM 6595  H HG   . LEU A 1 42 ? 0.731   1.594   3.987   1.00 0.00 ? 40 LEU P HG   6  
ATOM 6596  H HD11 . LEU A 1 42 ? -1.621  2.283   3.804   1.00 0.00 ? 40 LEU P HD11 6  
ATOM 6597  H HD12 . LEU A 1 42 ? -1.202  1.127   2.533   1.00 0.00 ? 40 LEU P HD12 6  
ATOM 6598  H HD13 . LEU A 1 42 ? -2.147  0.588   3.941   1.00 0.00 ? 40 LEU P HD13 6  
ATOM 6599  H HD21 . LEU A 1 42 ? -0.634  2.151   6.002   1.00 0.00 ? 40 LEU P HD21 6  
ATOM 6600  H HD22 . LEU A 1 42 ? -1.015  0.432   6.199   1.00 0.00 ? 40 LEU P HD22 6  
ATOM 6601  H HD23 . LEU A 1 42 ? 0.660   1.006   6.369   1.00 0.00 ? 40 LEU P HD23 6  
ATOM 6602  N N    . THR A 1 43 ? 0.923   -3.340  4.951   1.00 0.00 ? 41 THR P N    6  
ATOM 6603  C CA   . THR A 1 43 ? 0.774   -4.779  4.660   1.00 0.00 ? 41 THR P CA   6  
ATOM 6604  C C    . THR A 1 43 ? -0.657  -5.054  4.184   1.00 0.00 ? 41 THR P C    6  
ATOM 6605  O O    . THR A 1 43 ? -1.549  -4.234  4.405   1.00 0.00 ? 41 THR P O    6  
ATOM 6606  C CB   . THR A 1 43 ? 1.183   -5.643  5.865   1.00 0.00 ? 41 THR P CB   6  
ATOM 6607  O OG1  . THR A 1 43 ? 1.139   -7.007  5.506   1.00 0.00 ? 41 THR P OG1  6  
ATOM 6608  C CG2  . THR A 1 43 ? 0.290   -5.452  7.092   1.00 0.00 ? 41 THR P CG2  6  
ATOM 6609  H H    . THR A 1 43 ? 0.157   -2.901  5.447   1.00 0.00 ? 41 THR P H    6  
ATOM 6610  H HA   . THR A 1 43 ? 1.435   -5.049  3.837   1.00 0.00 ? 41 THR P HA   6  
ATOM 6611  H HB   . THR A 1 43 ? 2.208   -5.391  6.136   1.00 0.00 ? 41 THR P HB   6  
ATOM 6612  H HG1  . THR A 1 43 ? 1.568   -7.514  6.220   1.00 0.00 ? 41 THR P HG1  6  
ATOM 6613  H HG21 . THR A 1 43 ? 0.367   -4.424  7.443   1.00 0.00 ? 41 THR P HG21 6  
ATOM 6614  H HG22 . THR A 1 43 ? 0.622   -6.114  7.892   1.00 0.00 ? 41 THR P HG22 6  
ATOM 6615  H HG23 . THR A 1 43 ? -0.745  -5.680  6.848   1.00 0.00 ? 41 THR P HG23 6  
ATOM 6616  N N    . GLU A 1 44 ? -0.922  -6.187  3.531   1.00 0.00 ? 42 GLU P N    6  
ATOM 6617  C CA   . GLU A 1 44 ? -2.230  -6.452  2.907   1.00 0.00 ? 42 GLU P CA   6  
ATOM 6618  C C    . GLU A 1 44 ? -3.396  -6.452  3.908   1.00 0.00 ? 42 GLU P C    6  
ATOM 6619  O O    . GLU A 1 44 ? -4.511  -6.070  3.557   1.00 0.00 ? 42 GLU P O    6  
ATOM 6620  C CB   . GLU A 1 44 ? -2.165  -7.736  2.071   1.00 0.00 ? 42 GLU P CB   6  
ATOM 6621  C CG   . GLU A 1 44 ? -2.314  -9.067  2.826   1.00 0.00 ? 42 GLU P CG   6  
ATOM 6622  C CD   . GLU A 1 44 ? -3.784  -9.474  3.031   1.00 0.00 ? 42 GLU P CD   6  
ATOM 6623  O OE1  . GLU A 1 44 ? -4.529  -9.626  2.035   1.00 0.00 ? 42 GLU P OE1  6  
ATOM 6624  O OE2  . GLU A 1 44 ? -4.224  -9.674  4.186   1.00 0.00 ? 42 GLU P OE2  6  
ATOM 6625  H H    . GLU A 1 44 ? -0.181  -6.870  3.435   1.00 0.00 ? 42 GLU P H    6  
ATOM 6626  H HA   . GLU A 1 44 ? -2.422  -5.640  2.207   1.00 0.00 ? 42 GLU P HA   6  
ATOM 6627  H HB2  . GLU A 1 44 ? -2.932  -7.685  1.302   1.00 0.00 ? 42 GLU P HB2  6  
ATOM 6628  H HB3  . GLU A 1 44 ? -1.203  -7.739  1.567   1.00 0.00 ? 42 GLU P HB3  6  
ATOM 6629  H HG2  . GLU A 1 44 ? -1.827  -9.839  2.229   1.00 0.00 ? 42 GLU P HG2  6  
ATOM 6630  H HG3  . GLU A 1 44 ? -1.785  -9.009  3.780   1.00 0.00 ? 42 GLU P HG3  6  
ATOM 6631  N N    . ALA A 1 45 ? -3.122  -6.797  5.169   1.00 0.00 ? 43 ALA P N    6  
ATOM 6632  C CA   . ALA A 1 45 ? -4.088  -6.749  6.265   1.00 0.00 ? 43 ALA P CA   6  
ATOM 6633  C C    . ALA A 1 45 ? -4.529  -5.311  6.601   1.00 0.00 ? 43 ALA P C    6  
ATOM 6634  O O    . ALA A 1 45 ? -5.715  -5.078  6.826   1.00 0.00 ? 43 ALA P O    6  
ATOM 6635  C CB   . ALA A 1 45 ? -3.482  -7.461  7.482   1.00 0.00 ? 43 ALA P CB   6  
ATOM 6636  H H    . ALA A 1 45 ? -2.190  -7.133  5.360   1.00 0.00 ? 43 ALA P H    6  
ATOM 6637  H HA   . ALA A 1 45 ? -4.978  -7.302  5.962   1.00 0.00 ? 43 ALA P HA   6  
ATOM 6638  H HB1  . ALA A 1 45 ? -3.220  -8.486  7.216   1.00 0.00 ? 43 ALA P HB1  6  
ATOM 6639  H HB2  . ALA A 1 45 ? -2.590  -6.937  7.826   1.00 0.00 ? 43 ALA P HB2  6  
ATOM 6640  H HB3  . ALA A 1 45 ? -4.214  -7.485  8.291   1.00 0.00 ? 43 ALA P HB3  6  
ATOM 6641  N N    . ARG A 1 46 ? -3.620  -4.323  6.554   1.00 0.00 ? 44 ARG P N    6  
ATOM 6642  C CA   . ARG A 1 46 ? -3.963  -2.890  6.680   1.00 0.00 ? 44 ARG P CA   6  
ATOM 6643  C C    . ARG A 1 46 ? -4.912  -2.456  5.573   1.00 0.00 ? 44 ARG P C    6  
ATOM 6644  O O    . ARG A 1 46 ? -5.906  -1.793  5.848   1.00 0.00 ? 44 ARG P O    6  
ATOM 6645  C CB   . ARG A 1 46 ? -2.706  -2.003  6.615   1.00 0.00 ? 44 ARG P CB   6  
ATOM 6646  C CG   . ARG A 1 46 ? -1.811  -2.050  7.858   1.00 0.00 ? 44 ARG P CG   6  
ATOM 6647  C CD   . ARG A 1 46 ? -2.558  -1.489  9.073   1.00 0.00 ? 44 ARG P CD   6  
ATOM 6648  N NE   . ARG A 1 46 ? -1.650  -0.822  10.024  1.00 0.00 ? 44 ARG P NE   6  
ATOM 6649  C CZ   . ARG A 1 46 ? -1.368  0.469   10.067  1.00 0.00 ? 44 ARG P CZ   6  
ATOM 6650  N NH1  . ARG A 1 46 ? -1.863  1.337   9.233   1.00 0.00 ? 44 ARG P NH1  6  
ATOM 6651  N NH2  . ARG A 1 46 ? -0.571  0.949   10.972  1.00 0.00 ? 44 ARG P NH2  6  
ATOM 6652  H H    . ARG A 1 46 ? -2.675  -4.571  6.301   1.00 0.00 ? 44 ARG P H    6  
ATOM 6653  H HA   . ARG A 1 46 ? -4.493  -2.723  7.620   1.00 0.00 ? 44 ARG P HA   6  
ATOM 6654  H HB2  . ARG A 1 46 ? -2.124  -2.259  5.736   1.00 0.00 ? 44 ARG P HB2  6  
ATOM 6655  H HB3  . ARG A 1 46 ? -3.021  -0.969  6.476   1.00 0.00 ? 44 ARG P HB3  6  
ATOM 6656  H HG2  . ARG A 1 46 ? -1.494  -3.072  8.063   1.00 0.00 ? 44 ARG P HG2  6  
ATOM 6657  H HG3  . ARG A 1 46 ? -0.924  -1.444  7.664   1.00 0.00 ? 44 ARG P HG3  6  
ATOM 6658  H HD2  . ARG A 1 46 ? -3.314  -0.780  8.734   1.00 0.00 ? 44 ARG P HD2  6  
ATOM 6659  H HD3  . ARG A 1 46 ? -3.074  -2.314  9.565   1.00 0.00 ? 44 ARG P HD3  6  
ATOM 6660  H HE   . ARG A 1 46 ? -1.212  -1.402  10.724  1.00 0.00 ? 44 ARG P HE   6  
ATOM 6661  H HH11 . ARG A 1 46 ? -2.535  1.060   8.540   1.00 0.00 ? 44 ARG P HH11 6  
ATOM 6662  H HH12 . ARG A 1 46 ? -1.639  2.312   9.368   1.00 0.00 ? 44 ARG P HH12 6  
ATOM 6663  H HH21 . ARG A 1 46 ? -0.246  0.368   11.725  1.00 0.00 ? 44 ARG P HH21 6  
ATOM 6664  H HH22 . ARG A 1 46 ? -0.460  1.952   11.026  1.00 0.00 ? 44 ARG P HH22 6  
ATOM 6665  N N    . VAL A 1 47 ? -4.630  -2.864  4.336   1.00 0.00 ? 45 VAL P N    6  
ATOM 6666  C CA   . VAL A 1 47 ? -5.474  -2.546  3.173   1.00 0.00 ? 45 VAL P CA   6  
ATOM 6667  C C    . VAL A 1 47 ? -6.843  -3.216  3.312   1.00 0.00 ? 45 VAL P C    6  
ATOM 6668  O O    . VAL A 1 47 ? -7.864  -2.555  3.140   1.00 0.00 ? 45 VAL P O    6  
ATOM 6669  C CB   . VAL A 1 47 ? -4.785  -2.937  1.852   1.00 0.00 ? 45 VAL P CB   6  
ATOM 6670  C CG1  . VAL A 1 47 ? -5.546  -2.369  0.649   1.00 0.00 ? 45 VAL P CG1  6  
ATOM 6671  C CG2  . VAL A 1 47 ? -3.345  -2.417  1.793   1.00 0.00 ? 45 VAL P CG2  6  
ATOM 6672  H H    . VAL A 1 47 ? -3.781  -3.401  4.203   1.00 0.00 ? 45 VAL P H    6  
ATOM 6673  H HA   . VAL A 1 47 ? -5.638  -1.467  3.157   1.00 0.00 ? 45 VAL P HA   6  
ATOM 6674  H HB   . VAL A 1 47 ? -4.761  -4.021  1.767   1.00 0.00 ? 45 VAL P HB   6  
ATOM 6675  H HG11 . VAL A 1 47 ? -6.557  -2.773  0.612   1.00 0.00 ? 45 VAL P HG11 6  
ATOM 6676  H HG12 . VAL A 1 47 ? -5.595  -1.282  0.719   1.00 0.00 ? 45 VAL P HG12 6  
ATOM 6677  H HG13 . VAL A 1 47 ? -5.034  -2.639  -0.274  1.00 0.00 ? 45 VAL P HG13 6  
ATOM 6678  H HG21 . VAL A 1 47 ? -2.716  -2.959  2.497   1.00 0.00 ? 45 VAL P HG21 6  
ATOM 6679  H HG22 . VAL A 1 47 ? -2.934  -2.575  0.799   1.00 0.00 ? 45 VAL P HG22 6  
ATOM 6680  H HG23 . VAL A 1 47 ? -3.315  -1.355  2.034   1.00 0.00 ? 45 VAL P HG23 6  
ATOM 6681  N N    . ARG A 1 48 ? -6.889  -4.490  3.723   1.00 0.00 ? 46 ARG P N    6  
ATOM 6682  C CA   . ARG A 1 48 ? -8.128  -5.236  3.994   1.00 0.00 ? 46 ARG P CA   6  
ATOM 6683  C C    . ARG A 1 48 ? -8.988  -4.534  5.054   1.00 0.00 ? 46 ARG P C    6  
ATOM 6684  O O    . ARG A 1 48 ? -10.173 -4.302  4.827   1.00 0.00 ? 46 ARG P O    6  
ATOM 6685  C CB   . ARG A 1 48 ? -7.749  -6.667  4.417   1.00 0.00 ? 46 ARG P CB   6  
ATOM 6686  C CG   . ARG A 1 48 ? -8.940  -7.632  4.378   1.00 0.00 ? 46 ARG P CG   6  
ATOM 6687  C CD   . ARG A 1 48 ? -8.650  -8.921  5.161   1.00 0.00 ? 46 ARG P CD   6  
ATOM 6688  N NE   . ARG A 1 48 ? -7.494  -9.683  4.635   1.00 0.00 ? 46 ARG P NE   6  
ATOM 6689  C CZ   . ARG A 1 48 ? -7.420  -10.985 4.428   1.00 0.00 ? 46 ARG P CZ   6  
ATOM 6690  N NH1  . ARG A 1 48 ? -8.443  -11.785 4.544   1.00 0.00 ? 46 ARG P NH1  6  
ATOM 6691  N NH2  . ARG A 1 48 ? -6.281  -11.513 4.098   1.00 0.00 ? 46 ARG P NH2  6  
ATOM 6692  H H    . ARG A 1 48 ? -6.007  -4.982  3.845   1.00 0.00 ? 46 ARG P H    6  
ATOM 6693  H HA   . ARG A 1 48 ? -8.721  -5.277  3.078   1.00 0.00 ? 46 ARG P HA   6  
ATOM 6694  H HB2  . ARG A 1 48 ? -6.983  -7.053  3.745   1.00 0.00 ? 46 ARG P HB2  6  
ATOM 6695  H HB3  . ARG A 1 48 ? -7.335  -6.644  5.426   1.00 0.00 ? 46 ARG P HB3  6  
ATOM 6696  H HG2  . ARG A 1 48 ? -9.810  -7.154  4.829   1.00 0.00 ? 46 ARG P HG2  6  
ATOM 6697  H HG3  . ARG A 1 48 ? -9.179  -7.873  3.342   1.00 0.00 ? 46 ARG P HG3  6  
ATOM 6698  H HD2  . ARG A 1 48 ? -8.448  -8.652  6.199   1.00 0.00 ? 46 ARG P HD2  6  
ATOM 6699  H HD3  . ARG A 1 48 ? -9.555  -9.529  5.146   1.00 0.00 ? 46 ARG P HD3  6  
ATOM 6700  H HE   . ARG A 1 48 ? -6.624  -9.185  4.511   1.00 0.00 ? 46 ARG P HE   6  
ATOM 6701  H HH11 . ARG A 1 48 ? -9.337  -11.406 4.804   1.00 0.00 ? 46 ARG P HH11 6  
ATOM 6702  H HH12 . ARG A 1 48 ? -8.341  -12.773 4.388   1.00 0.00 ? 46 ARG P HH12 6  
ATOM 6703  H HH21 . ARG A 1 48 ? -5.460  -10.904 4.067   1.00 0.00 ? 46 ARG P HH21 6  
ATOM 6704  H HH22 . ARG A 1 48 ? -6.184  -12.504 3.968   1.00 0.00 ? 46 ARG P HH22 6  
ATOM 6705  N N    . VAL A 1 49 ? -8.383  -4.133  6.176   1.00 0.00 ? 47 VAL P N    6  
ATOM 6706  C CA   . VAL A 1 49 ? -9.037  -3.385  7.267   1.00 0.00 ? 47 VAL P CA   6  
ATOM 6707  C C    . VAL A 1 49 ? -9.531  -2.018  6.795   1.00 0.00 ? 47 VAL P C    6  
ATOM 6708  O O    . VAL A 1 49 ? -10.671 -1.648  7.088   1.00 0.00 ? 47 VAL P O    6  
ATOM 6709  C CB   . VAL A 1 49 ? -8.073  -3.240  8.465   1.00 0.00 ? 47 VAL P CB   6  
ATOM 6710  C CG1  . VAL A 1 49 ? -8.560  -2.246  9.529   1.00 0.00 ? 47 VAL P CG1  6  
ATOM 6711  C CG2  . VAL A 1 49 ? -7.896  -4.593  9.162   1.00 0.00 ? 47 VAL P CG2  6  
ATOM 6712  H H    . VAL A 1 49 ? -7.405  -4.381  6.288   1.00 0.00 ? 47 VAL P H    6  
ATOM 6713  H HA   . VAL A 1 49 ? -9.912  -3.942  7.601   1.00 0.00 ? 47 VAL P HA   6  
ATOM 6714  H HB   . VAL A 1 49 ? -7.101  -2.900  8.106   1.00 0.00 ? 47 VAL P HB   6  
ATOM 6715  H HG11 . VAL A 1 49 ? -7.880  -2.259  10.381  1.00 0.00 ? 47 VAL P HG11 6  
ATOM 6716  H HG12 . VAL A 1 49 ? -8.567  -1.233  9.126   1.00 0.00 ? 47 VAL P HG12 6  
ATOM 6717  H HG13 . VAL A 1 49 ? -9.563  -2.513  9.861   1.00 0.00 ? 47 VAL P HG13 6  
ATOM 6718  H HG21 . VAL A 1 49 ? -7.118  -4.511  9.922   1.00 0.00 ? 47 VAL P HG21 6  
ATOM 6719  H HG22 . VAL A 1 49 ? -8.835  -4.899  9.625   1.00 0.00 ? 47 VAL P HG22 6  
ATOM 6720  H HG23 . VAL A 1 49 ? -7.591  -5.353  8.446   1.00 0.00 ? 47 VAL P HG23 6  
ATOM 6721  N N    . TRP A 1 50 ? -8.718  -1.275  6.042   1.00 0.00 ? 48 TRP P N    6  
ATOM 6722  C CA   . TRP A 1 50 ? -9.089  0.048   5.543   1.00 0.00 ? 48 TRP P CA   6  
ATOM 6723  C C    . TRP A 1 50 ? -10.268 -0.027  4.570   1.00 0.00 ? 48 TRP P C    6  
ATOM 6724  O O    . TRP A 1 50 ? -11.246 0.693   4.749   1.00 0.00 ? 48 TRP P O    6  
ATOM 6725  C CB   . TRP A 1 50 ? -7.886  0.725   4.885   1.00 0.00 ? 48 TRP P CB   6  
ATOM 6726  C CG   . TRP A 1 50 ? -8.120  2.172   4.586   1.00 0.00 ? 48 TRP P CG   6  
ATOM 6727  C CD1  . TRP A 1 50 ? -7.785  3.199   5.400   1.00 0.00 ? 48 TRP P CD1  6  
ATOM 6728  C CD2  . TRP A 1 50 ? -8.765  2.779   3.422   1.00 0.00 ? 48 TRP P CD2  6  
ATOM 6729  N NE1  . TRP A 1 50 ? -8.160  4.392   4.816   1.00 0.00 ? 48 TRP P NE1  6  
ATOM 6730  C CE2  . TRP A 1 50 ? -8.757  4.196   3.590   1.00 0.00 ? 48 TRP P CE2  6  
ATOM 6731  C CE3  . TRP A 1 50 ? -9.347  2.279   2.237   1.00 0.00 ? 48 TRP P CE3  6  
ATOM 6732  C CZ2  . TRP A 1 50 ? -9.281  5.072   2.628   1.00 0.00 ? 48 TRP P CZ2  6  
ATOM 6733  C CZ3  . TRP A 1 50 ? -9.898  3.146   1.274   1.00 0.00 ? 48 TRP P CZ3  6  
ATOM 6734  C CH2  . TRP A 1 50 ? -9.873  4.537   1.472   1.00 0.00 ? 48 TRP P CH2  6  
ATOM 6735  H H    . TRP A 1 50 ? -7.780  -1.613  5.853   1.00 0.00 ? 48 TRP P H    6  
ATOM 6736  H HA   . TRP A 1 50 ? -9.397  0.669   6.386   1.00 0.00 ? 48 TRP P HA   6  
ATOM 6737  H HB2  . TRP A 1 50 ? -7.027  0.651   5.551   1.00 0.00 ? 48 TRP P HB2  6  
ATOM 6738  H HB3  . TRP A 1 50 ? -7.644  0.201   3.959   1.00 0.00 ? 48 TRP P HB3  6  
ATOM 6739  H HD1  . TRP A 1 50 ? -7.286  3.095   6.359   1.00 0.00 ? 48 TRP P HD1  6  
ATOM 6740  H HE1  . TRP A 1 50 ? -8.005  5.294   5.252   1.00 0.00 ? 48 TRP P HE1  6  
ATOM 6741  H HE3  . TRP A 1 50 ? -9.365  1.216   2.066   1.00 0.00 ? 48 TRP P HE3  6  
ATOM 6742  H HZ2  . TRP A 1 50 ? -9.224  6.141   2.775   1.00 0.00 ? 48 TRP P HZ2  6  
ATOM 6743  H HZ3  . TRP A 1 50 ? -10.338 2.737   0.373   1.00 0.00 ? 48 TRP P HZ3  6  
ATOM 6744  H HH2  . TRP A 1 50 ? -10.309 5.194   0.735   1.00 0.00 ? 48 TRP P HH2  6  
ATOM 6745  N N    . PHE A 1 51 ? -10.238 -0.946  3.600   1.00 0.00 ? 49 PHE P N    6  
ATOM 6746  C CA   . PHE A 1 51 ? -11.337 -1.148  2.649   1.00 0.00 ? 49 PHE P CA   6  
ATOM 6747  C C    . PHE A 1 51 ? -12.611 -1.670  3.332   1.00 0.00 ? 49 PHE P C    6  
ATOM 6748  O O    . PHE A 1 51 ? -13.716 -1.281  2.947   1.00 0.00 ? 49 PHE P O    6  
ATOM 6749  C CB   . PHE A 1 51 ? -10.877 -2.076  1.514   1.00 0.00 ? 49 PHE P CB   6  
ATOM 6750  C CG   . PHE A 1 51 ? -10.202 -1.351  0.361   1.00 0.00 ? 49 PHE P CG   6  
ATOM 6751  C CD1  . PHE A 1 51 ? -8.884  -0.862  0.471   1.00 0.00 ? 49 PHE P CD1  6  
ATOM 6752  C CD2  . PHE A 1 51 ? -10.910 -1.154  -0.839  1.00 0.00 ? 49 PHE P CD2  6  
ATOM 6753  C CE1  . PHE A 1 51 ? -8.280  -0.184  -0.604  1.00 0.00 ? 49 PHE P CE1  6  
ATOM 6754  C CE2  . PHE A 1 51 ? -10.299 -0.493  -1.913  1.00 0.00 ? 49 PHE P CE2  6  
ATOM 6755  C CZ   . PHE A 1 51 ? -8.992  0.001   -1.798  1.00 0.00 ? 49 PHE P CZ   6  
ATOM 6756  H H    . PHE A 1 51 ? -9.411  -1.533  3.512   1.00 0.00 ? 49 PHE P H    6  
ATOM 6757  H HA   . PHE A 1 51 ? -11.597 -0.185  2.206   1.00 0.00 ? 49 PHE P HA   6  
ATOM 6758  H HB2  . PHE A 1 51 ? -10.212 -2.847  1.905   1.00 0.00 ? 49 PHE P HB2  6  
ATOM 6759  H HB3  . PHE A 1 51 ? -11.752 -2.593  1.116   1.00 0.00 ? 49 PHE P HB3  6  
ATOM 6760  H HD1  . PHE A 1 51 ? -8.331  -0.982  1.387   1.00 0.00 ? 49 PHE P HD1  6  
ATOM 6761  H HD2  . PHE A 1 51 ? -11.923 -1.512  -0.950  1.00 0.00 ? 49 PHE P HD2  6  
ATOM 6762  H HE1  . PHE A 1 51 ? -7.269  0.193   -0.515  1.00 0.00 ? 49 PHE P HE1  6  
ATOM 6763  H HE2  . PHE A 1 51 ? -10.840 -0.375  -2.834  1.00 0.00 ? 49 PHE P HE2  6  
ATOM 6764  H HZ   . PHE A 1 51 ? -8.539  0.520   -2.628  1.00 0.00 ? 49 PHE P HZ   6  
ATOM 6765  N N    . LYS A 1 52 ? -12.476 -2.476  4.395   1.00 0.00 ? 50 LYS P N    6  
ATOM 6766  C CA   . LYS A 1 52 ? -13.606 -2.955  5.218   1.00 0.00 ? 50 LYS P CA   6  
ATOM 6767  C C    . LYS A 1 52 ? -14.280 -1.805  5.971   1.00 0.00 ? 50 LYS P C    6  
ATOM 6768  O O    . LYS A 1 52 ? -15.507 -1.721  5.991   1.00 0.00 ? 50 LYS P O    6  
ATOM 6769  C CB   . LYS A 1 52 ? -13.123 -4.093  6.140   1.00 0.00 ? 50 LYS P CB   6  
ATOM 6770  C CG   . LYS A 1 52 ? -14.233 -4.754  6.982   1.00 0.00 ? 50 LYS P CG   6  
ATOM 6771  C CD   . LYS A 1 52 ? -14.501 -4.132  8.366   1.00 0.00 ? 50 LYS P CD   6  
ATOM 6772  C CE   . LYS A 1 52 ? -13.326 -4.264  9.345   1.00 0.00 ? 50 LYS P CE   6  
ATOM 6773  N NZ   . LYS A 1 52 ? -13.140 -5.661  9.826   1.00 0.00 ? 50 LYS P NZ   6  
ATOM 6774  H H    . LYS A 1 52 ? -11.531 -2.753  4.647   1.00 0.00 ? 50 LYS P H    6  
ATOM 6775  H HA   . LYS A 1 52 ? -14.362 -3.367  4.549   1.00 0.00 ? 50 LYS P HA   6  
ATOM 6776  H HB2  . LYS A 1 52 ? -12.705 -4.871  5.499   1.00 0.00 ? 50 LYS P HB2  6  
ATOM 6777  H HB3  . LYS A 1 52 ? -12.321 -3.738  6.784   1.00 0.00 ? 50 LYS P HB3  6  
ATOM 6778  H HG2  . LYS A 1 52 ? -15.161 -4.731  6.418   1.00 0.00 ? 50 LYS P HG2  6  
ATOM 6779  H HG3  . LYS A 1 52 ? -13.972 -5.803  7.125   1.00 0.00 ? 50 LYS P HG3  6  
ATOM 6780  H HD2  . LYS A 1 52 ? -14.736 -3.075  8.254   1.00 0.00 ? 50 LYS P HD2  6  
ATOM 6781  H HD3  . LYS A 1 52 ? -15.381 -4.608  8.802   1.00 0.00 ? 50 LYS P HD3  6  
ATOM 6782  H HE2  . LYS A 1 52 ? -12.419 -3.903  8.854   1.00 0.00 ? 50 LYS P HE2  6  
ATOM 6783  H HE3  . LYS A 1 52 ? -13.525 -3.610  10.198  1.00 0.00 ? 50 LYS P HE3  6  
ATOM 6784  H HZ1  . LYS A 1 52 ? -13.973 -6.004  10.286  1.00 0.00 ? 50 LYS P HZ1  6  
ATOM 6785  H HZ2  . LYS A 1 52 ? -12.384 -5.718  10.497  1.00 0.00 ? 50 LYS P HZ2  6  
ATOM 6786  H HZ3  . LYS A 1 52 ? -12.922 -6.295  9.069   1.00 0.00 ? 50 LYS P HZ3  6  
ATOM 6787  N N    . ASN A 1 53 ? -13.497 -0.878  6.523   1.00 0.00 ? 51 ASN P N    6  
ATOM 6788  C CA   . ASN A 1 53 ? -14.029 0.367   7.090   1.00 0.00 ? 51 ASN P CA   6  
ATOM 6789  C C    . ASN A 1 53 ? -14.608 1.294   6.003   1.00 0.00 ? 51 ASN P C    6  
ATOM 6790  O O    . ASN A 1 53 ? -15.684 1.864   6.187   1.00 0.00 ? 51 ASN P O    6  
ATOM 6791  C CB   . ASN A 1 53 ? -12.939 1.064   7.924   1.00 0.00 ? 51 ASN P CB   6  
ATOM 6792  C CG   . ASN A 1 53 ? -12.760 0.433   9.292   1.00 0.00 ? 51 ASN P CG   6  
ATOM 6793  O OD1  . ASN A 1 53 ? -13.376 0.832   10.270  1.00 0.00 ? 51 ASN P OD1  6  
ATOM 6794  N ND2  . ASN A 1 53 ? -11.927 -0.574  9.412   1.00 0.00 ? 51 ASN P ND2  6  
ATOM 6795  H H    . ASN A 1 53 ? -12.493 -1.034  6.514   1.00 0.00 ? 51 ASN P H    6  
ATOM 6796  H HA   . ASN A 1 53 ? -14.864 0.125   7.751   1.00 0.00 ? 51 ASN P HA   6  
ATOM 6797  H HB2  . ASN A 1 53 ? -11.986 1.056   7.393   1.00 0.00 ? 51 ASN P HB2  6  
ATOM 6798  H HB3  . ASN A 1 53 ? -13.222 2.104   8.084   1.00 0.00 ? 51 ASN P HB3  6  
ATOM 6799  H HD21 . ASN A 1 53 ? -11.416 -0.912  8.604   1.00 0.00 ? 51 ASN P HD21 6  
ATOM 6800  H HD22 . ASN A 1 53 ? -11.779 -0.961  10.328  1.00 0.00 ? 51 ASN P HD22 6  
ATOM 6801  N N    . ARG A 1 54 ? -13.950 1.419   4.844   1.00 0.00 ? 52 ARG P N    6  
ATOM 6802  C CA   . ARG A 1 54 ? -14.355 2.346   3.774   1.00 0.00 ? 52 ARG P CA   6  
ATOM 6803  C C    . ARG A 1 54 ? -15.689 1.975   3.133   1.00 0.00 ? 52 ARG P C    6  
ATOM 6804  O O    . ARG A 1 54 ? -16.487 2.876   2.873   1.00 0.00 ? 52 ARG P O    6  
ATOM 6805  C CB   . ARG A 1 54 ? -13.241 2.441   2.713   1.00 0.00 ? 52 ARG P CB   6  
ATOM 6806  C CG   . ARG A 1 54 ? -13.435 3.601   1.720   1.00 0.00 ? 52 ARG P CG   6  
ATOM 6807  C CD   . ARG A 1 54 ? -13.348 4.973   2.407   1.00 0.00 ? 52 ARG P CD   6  
ATOM 6808  N NE   . ARG A 1 54 ? -13.595 6.085   1.470   1.00 0.00 ? 52 ARG P NE   6  
ATOM 6809  C CZ   . ARG A 1 54 ? -14.774 6.541   1.082   1.00 0.00 ? 52 ARG P CZ   6  
ATOM 6810  N NH1  . ARG A 1 54 ? -15.898 5.958   1.383   1.00 0.00 ? 52 ARG P NH1  6  
ATOM 6811  N NH2  . ARG A 1 54 ? -14.851 7.623   0.368   1.00 0.00 ? 52 ARG P NH2  6  
ATOM 6812  H H    . ARG A 1 54 ? -13.044 0.963   4.764   1.00 0.00 ? 52 ARG P H    6  
ATOM 6813  H HA   . ARG A 1 54 ? -14.505 3.316   4.244   1.00 0.00 ? 52 ARG P HA   6  
ATOM 6814  H HB2  . ARG A 1 54 ? -12.275 2.555   3.207   1.00 0.00 ? 52 ARG P HB2  6  
ATOM 6815  H HB3  . ARG A 1 54 ? -13.220 1.509   2.147   1.00 0.00 ? 52 ARG P HB3  6  
ATOM 6816  H HG2  . ARG A 1 54 ? -12.663 3.542   0.954   1.00 0.00 ? 52 ARG P HG2  6  
ATOM 6817  H HG3  . ARG A 1 54 ? -14.398 3.497   1.221   1.00 0.00 ? 52 ARG P HG3  6  
ATOM 6818  H HD2  . ARG A 1 54 ? -14.068 5.039   3.220   1.00 0.00 ? 52 ARG P HD2  6  
ATOM 6819  H HD3  . ARG A 1 54 ? -12.351 5.083   2.839   1.00 0.00 ? 52 ARG P HD3  6  
ATOM 6820  H HE   . ARG A 1 54 ? -12.790 6.605   1.163   1.00 0.00 ? 52 ARG P HE   6  
ATOM 6821  H HH11 . ARG A 1 54 ? -15.903 5.090   1.889   1.00 0.00 ? 52 ARG P HH11 6  
ATOM 6822  H HH12 . ARG A 1 54 ? -16.756 6.326   0.966   1.00 0.00 ? 52 ARG P HH12 6  
ATOM 6823  H HH21 . ARG A 1 54 ? -14.024 8.128   0.100   1.00 0.00 ? 52 ARG P HH21 6  
ATOM 6824  H HH22 . ARG A 1 54 ? -15.769 8.023   0.174   1.00 0.00 ? 52 ARG P HH22 6  
ATOM 6825  N N    . ARG A 1 55 ? -15.966 0.681   2.938   1.00 0.00 ? 53 ARG P N    6  
ATOM 6826  C CA   . ARG A 1 55 ? -17.266 0.198   2.429   1.00 0.00 ? 53 ARG P CA   6  
ATOM 6827  C C    . ARG A 1 55 ? -18.389 0.347   3.462   1.00 0.00 ? 53 ARG P C    6  
ATOM 6828  O O    . ARG A 1 55 ? -19.515 0.682   3.100   1.00 0.00 ? 53 ARG P O    6  
ATOM 6829  C CB   . ARG A 1 55 ? -17.132 -1.223  1.848   1.00 0.00 ? 53 ARG P CB   6  
ATOM 6830  C CG   . ARG A 1 55 ? -16.950 -2.329  2.899   1.00 0.00 ? 53 ARG P CG   6  
ATOM 6831  C CD   . ARG A 1 55 ? -16.563 -3.658  2.243   1.00 0.00 ? 53 ARG P CD   6  
ATOM 6832  N NE   . ARG A 1 55 ? -16.461 -4.738  3.247   1.00 0.00 ? 53 ARG P NE   6  
ATOM 6833  C CZ   . ARG A 1 55 ? -15.675 -5.799  3.203   1.00 0.00 ? 53 ARG P CZ   6  
ATOM 6834  N NH1  . ARG A 1 55 ? -14.831 -6.002  2.232   1.00 0.00 ? 53 ARG P NH1  6  
ATOM 6835  N NH2  . ARG A 1 55 ? -15.720 -6.689  4.151   1.00 0.00 ? 53 ARG P NH2  6  
ATOM 6836  H H    . ARG A 1 55 ? -15.230 0.010   3.137   1.00 0.00 ? 53 ARG P H    6  
ATOM 6837  H HA   . ARG A 1 55 ? -17.545 0.839   1.592   1.00 0.00 ? 53 ARG P HA   6  
ATOM 6838  H HB2  . ARG A 1 55 ? -18.024 -1.449  1.264   1.00 0.00 ? 53 ARG P HB2  6  
ATOM 6839  H HB3  . ARG A 1 55 ? -16.279 -1.235  1.166   1.00 0.00 ? 53 ARG P HB3  6  
ATOM 6840  H HG2  . ARG A 1 55 ? -16.160 -2.043  3.586   1.00 0.00 ? 53 ARG P HG2  6  
ATOM 6841  H HG3  . ARG A 1 55 ? -17.878 -2.456  3.457   1.00 0.00 ? 53 ARG P HG3  6  
ATOM 6842  H HD2  . ARG A 1 55 ? -17.320 -3.925  1.503   1.00 0.00 ? 53 ARG P HD2  6  
ATOM 6843  H HD3  . ARG A 1 55 ? -15.609 -3.519  1.733   1.00 0.00 ? 53 ARG P HD3  6  
ATOM 6844  H HE   . ARG A 1 55 ? -17.090 -4.684  4.034   1.00 0.00 ? 53 ARG P HE   6  
ATOM 6845  H HH11 . ARG A 1 55 ? -14.792 -5.346  1.472   1.00 0.00 ? 53 ARG P HH11 6  
ATOM 6846  H HH12 . ARG A 1 55 ? -14.249 -6.822  2.220   1.00 0.00 ? 53 ARG P HH12 6  
ATOM 6847  H HH21 . ARG A 1 55 ? -16.382 -6.598  4.904   1.00 0.00 ? 53 ARG P HH21 6  
ATOM 6848  H HH22 . ARG A 1 55 ? -15.133 -7.505  4.109   1.00 0.00 ? 53 ARG P HH22 6  
ATOM 6849  N N    . ALA A 1 56 ? -18.075 0.210   4.753   1.00 0.00 ? 54 ALA P N    6  
ATOM 6850  C CA   . ALA A 1 56 ? -19.021 0.485   5.835   1.00 0.00 ? 54 ALA P CA   6  
ATOM 6851  C C    . ALA A 1 56 ? -19.371 1.979   5.946   1.00 0.00 ? 54 ALA P C    6  
ATOM 6852  O O    . ALA A 1 56 ? -20.508 2.309   6.288   1.00 0.00 ? 54 ALA P O    6  
ATOM 6853  C CB   . ALA A 1 56 ? -18.440 -0.048  7.150   1.00 0.00 ? 54 ALA P CB   6  
ATOM 6854  H H    . ALA A 1 56 ? -17.133 -0.066  4.995   1.00 0.00 ? 54 ALA P H    6  
ATOM 6855  H HA   . ALA A 1 56 ? -19.950 -0.049  5.627   1.00 0.00 ? 54 ALA P HA   6  
ATOM 6856  H HB1  . ALA A 1 56 ? -19.172 0.082   7.948   1.00 0.00 ? 54 ALA P HB1  6  
ATOM 6857  H HB2  . ALA A 1 56 ? -18.203 -1.108  7.053   1.00 0.00 ? 54 ALA P HB2  6  
ATOM 6858  H HB3  . ALA A 1 56 ? -17.539 0.506   7.414   1.00 0.00 ? 54 ALA P HB3  6  
ATOM 6859  N N    . LYS A 1 57 ? -18.429 2.878   5.622   1.00 0.00 ? 55 LYS P N    6  
ATOM 6860  C CA   . LYS A 1 57 ? -18.638 4.337   5.572   1.00 0.00 ? 55 LYS P CA   6  
ATOM 6861  C C    . LYS A 1 57 ? -19.334 4.804   4.287   1.00 0.00 ? 55 LYS P C    6  
ATOM 6862  O O    . LYS A 1 57 ? -20.198 5.678   4.348   1.00 0.00 ? 55 LYS P O    6  
ATOM 6863  C CB   . LYS A 1 57 ? -17.291 5.058   5.762   1.00 0.00 ? 55 LYS P CB   6  
ATOM 6864  C CG   . LYS A 1 57 ? -16.769 4.929   7.201   1.00 0.00 ? 55 LYS P CG   6  
ATOM 6865  C CD   . LYS A 1 57 ? -15.392 5.587   7.358   1.00 0.00 ? 55 LYS P CD   6  
ATOM 6866  C CE   . LYS A 1 57 ? -14.917 5.458   8.811   1.00 0.00 ? 55 LYS P CE   6  
ATOM 6867  N NZ   . LYS A 1 57 ? -13.607 6.131   9.024   1.00 0.00 ? 55 LYS P NZ   6  
ATOM 6868  H H    . LYS A 1 57 ? -17.490 2.523   5.468   1.00 0.00 ? 55 LYS P H    6  
ATOM 6869  H HA   . LYS A 1 57 ? -19.295 4.617   6.398   1.00 0.00 ? 55 LYS P HA   6  
ATOM 6870  H HB2  . LYS A 1 57 ? -16.556 4.653   5.064   1.00 0.00 ? 55 LYS P HB2  6  
ATOM 6871  H HB3  . LYS A 1 57 ? -17.422 6.120   5.541   1.00 0.00 ? 55 LYS P HB3  6  
ATOM 6872  H HG2  . LYS A 1 57 ? -17.475 5.412   7.877   1.00 0.00 ? 55 LYS P HG2  6  
ATOM 6873  H HG3  . LYS A 1 57 ? -16.694 3.878   7.479   1.00 0.00 ? 55 LYS P HG3  6  
ATOM 6874  H HD2  . LYS A 1 57 ? -14.678 5.095   6.694   1.00 0.00 ? 55 LYS P HD2  6  
ATOM 6875  H HD3  . LYS A 1 57 ? -15.464 6.642   7.089   1.00 0.00 ? 55 LYS P HD3  6  
ATOM 6876  H HE2  . LYS A 1 57 ? -15.672 5.901   9.467   1.00 0.00 ? 55 LYS P HE2  6  
ATOM 6877  H HE3  . LYS A 1 57 ? -14.838 4.395   9.063   1.00 0.00 ? 55 LYS P HE3  6  
ATOM 6878  H HZ1  . LYS A 1 57 ? -13.305 6.036   9.985   1.00 0.00 ? 55 LYS P HZ1  6  
ATOM 6879  H HZ2  . LYS A 1 57 ? -13.666 7.120   8.823   1.00 0.00 ? 55 LYS P HZ2  6  
ATOM 6880  H HZ3  . LYS A 1 57 ? -12.887 5.735   8.436   1.00 0.00 ? 55 LYS P HZ3  6  
ATOM 6881  N N    . TRP A 1 58 ? -19.018 4.195   3.139   1.00 0.00 ? 56 TRP P N    6  
ATOM 6882  C CA   . TRP A 1 58 ? -19.615 4.507   1.828   1.00 0.00 ? 56 TRP P CA   6  
ATOM 6883  C C    . TRP A 1 58 ? -21.143 4.424   1.860   1.00 0.00 ? 56 TRP P C    6  
ATOM 6884  O O    . TRP A 1 58 ? -21.826 5.326   1.375   1.00 0.00 ? 56 TRP P O    6  
ATOM 6885  C CB   . TRP A 1 58 ? -19.038 3.554   0.761   1.00 0.00 ? 56 TRP P CB   6  
ATOM 6886  C CG   . TRP A 1 58 ? -19.949 3.205   -0.382  1.00 0.00 ? 56 TRP P CG   6  
ATOM 6887  C CD1  . TRP A 1 58 ? -20.479 4.082   -1.265  1.00 0.00 ? 56 TRP P CD1  6  
ATOM 6888  C CD2  . TRP A 1 58 ? -20.513 1.903   -0.734  1.00 0.00 ? 56 TRP P CD2  6  
ATOM 6889  N NE1  . TRP A 1 58 ? -21.344 3.418   -2.117  1.00 0.00 ? 56 TRP P NE1  6  
ATOM 6890  C CE2  . TRP A 1 58 ? -21.402 2.073   -1.837  1.00 0.00 ? 56 TRP P CE2  6  
ATOM 6891  C CE3  . TRP A 1 58 ? -20.395 0.596   -0.214  1.00 0.00 ? 56 TRP P CE3  6  
ATOM 6892  C CZ2  . TRP A 1 58 ? -22.130 1.014   -2.397  1.00 0.00 ? 56 TRP P CZ2  6  
ATOM 6893  C CZ3  . TRP A 1 58 ? -21.111 -0.482  -0.773  1.00 0.00 ? 56 TRP P CZ3  6  
ATOM 6894  C CH2  . TRP A 1 58 ? -21.977 -0.276  -1.863  1.00 0.00 ? 56 TRP P CH2  6  
ATOM 6895  H H    . TRP A 1 58 ? -18.289 3.491   3.168   1.00 0.00 ? 56 TRP P H    6  
ATOM 6896  H HA   . TRP A 1 58 ? -19.361 5.528   1.546   1.00 0.00 ? 56 TRP P HA   6  
ATOM 6897  H HB2  . TRP A 1 58 ? -18.117 3.983   0.365   1.00 0.00 ? 56 TRP P HB2  6  
ATOM 6898  H HB3  . TRP A 1 58 ? -18.774 2.616   1.244   1.00 0.00 ? 56 TRP P HB3  6  
ATOM 6899  H HD1  . TRP A 1 58 ? -20.282 5.145   -1.251  1.00 0.00 ? 56 TRP P HD1  6  
ATOM 6900  H HE1  . TRP A 1 58 ? -21.902 3.861   -2.843  1.00 0.00 ? 56 TRP P HE1  6  
ATOM 6901  H HE3  . TRP A 1 58 ? -19.765 0.438   0.647   1.00 0.00 ? 56 TRP P HE3  6  
ATOM 6902  H HZ2  . TRP A 1 58 ? -22.803 1.199   -3.222  1.00 0.00 ? 56 TRP P HZ2  6  
ATOM 6903  H HZ3  . TRP A 1 58 ? -21.005 -1.475  -0.354  1.00 0.00 ? 56 TRP P HZ3  6  
ATOM 6904  H HH2  . TRP A 1 58 ? -22.529 -1.108  -2.282  1.00 0.00 ? 56 TRP P HH2  6  
ATOM 6905  N N    . ARG A 1 59 ? -21.686 3.378   2.489   1.00 0.00 ? 57 ARG P N    6  
ATOM 6906  C CA   . ARG A 1 59 ? -23.130 3.089   2.544   1.00 0.00 ? 57 ARG P CA   6  
ATOM 6907  C C    . ARG A 1 59 ? -23.981 4.170   3.230   1.00 0.00 ? 57 ARG P C    6  
ATOM 6908  O O    . ARG A 1 59 ? -25.168 4.284   2.922   1.00 0.00 ? 57 ARG P O    6  
ATOM 6909  C CB   . ARG A 1 59 ? -23.302 1.729   3.239   1.00 0.00 ? 57 ARG P CB   6  
ATOM 6910  C CG   . ARG A 1 59 ? -22.937 0.565   2.309   1.00 0.00 ? 57 ARG P CG   6  
ATOM 6911  C CD   . ARG A 1 59 ? -22.936 -0.776  3.050   1.00 0.00 ? 57 ARG P CD   6  
ATOM 6912  N NE   . ARG A 1 59 ? -24.296 -1.194  3.450   1.00 0.00 ? 57 ARG P NE   6  
ATOM 6913  C CZ   . ARG A 1 59 ? -24.618 -2.267  4.151   1.00 0.00 ? 57 ARG P CZ   6  
ATOM 6914  N NH1  . ARG A 1 59 ? -23.720 -3.108  4.585   1.00 0.00 ? 57 ARG P NH1  6  
ATOM 6915  N NH2  . ARG A 1 59 ? -25.863 -2.520  4.435   1.00 0.00 ? 57 ARG P NH2  6  
ATOM 6916  H H    . ARG A 1 59 ? -21.043 2.676   2.839   1.00 0.00 ? 57 ARG P H    6  
ATOM 6917  H HA   . ARG A 1 59 ? -23.505 3.030   1.518   1.00 0.00 ? 57 ARG P HA   6  
ATOM 6918  H HB2  . ARG A 1 59 ? -22.643 1.698   4.110   1.00 0.00 ? 57 ARG P HB2  6  
ATOM 6919  H HB3  . ARG A 1 59 ? -24.337 1.612   3.566   1.00 0.00 ? 57 ARG P HB3  6  
ATOM 6920  H HG2  . ARG A 1 59 ? -23.631 0.526   1.467   1.00 0.00 ? 57 ARG P HG2  6  
ATOM 6921  H HG3  . ARG A 1 59 ? -21.935 0.730   1.922   1.00 0.00 ? 57 ARG P HG3  6  
ATOM 6922  H HD2  . ARG A 1 59 ? -22.507 -1.530  2.388   1.00 0.00 ? 57 ARG P HD2  6  
ATOM 6923  H HD3  . ARG A 1 59 ? -22.297 -0.679  3.931   1.00 0.00 ? 57 ARG P HD3  6  
ATOM 6924  H HE   . ARG A 1 59 ? -25.063 -0.618  3.142   1.00 0.00 ? 57 ARG P HE   6  
ATOM 6925  H HH11 . ARG A 1 59 ? -22.753 -2.946  4.371   1.00 0.00 ? 57 ARG P HH11 6  
ATOM 6926  H HH12 . ARG A 1 59 ? -23.991 -3.919  5.114   1.00 0.00 ? 57 ARG P HH12 6  
ATOM 6927  H HH21 . ARG A 1 59 ? -26.592 -1.900  4.120   1.00 0.00 ? 57 ARG P HH21 6  
ATOM 6928  H HH22 . ARG A 1 59 ? -26.106 -3.338  4.967   1.00 0.00 ? 57 ARG P HH22 6  
ATOM 6929  N N    . LYS A 1 60 ? -23.390 4.983   4.116   1.00 0.00 ? 58 LYS P N    6  
ATOM 6930  C CA   . LYS A 1 60 ? -24.050 6.147   4.755   1.00 0.00 ? 58 LYS P CA   6  
ATOM 6931  C C    . LYS A 1 60 ? -24.082 7.380   3.840   1.00 0.00 ? 58 LYS P C    6  
ATOM 6932  O O    . LYS A 1 60 ? -24.989 8.208   3.953   1.00 0.00 ? 58 LYS P O    6  
ATOM 6933  C CB   . LYS A 1 60 ? -23.357 6.513   6.085   1.00 0.00 ? 58 LYS P CB   6  
ATOM 6934  C CG   . LYS A 1 60 ? -23.662 5.587   7.274   1.00 0.00 ? 58 LYS P CG   6  
ATOM 6935  C CD   . LYS A 1 60 ? -23.116 4.165   7.101   1.00 0.00 ? 58 LYS P CD   6  
ATOM 6936  C CE   . LYS A 1 60 ? -23.120 3.405   8.429   1.00 0.00 ? 58 LYS P CE   6  
ATOM 6937  N NZ   . LYS A 1 60 ? -22.608 2.024   8.246   1.00 0.00 ? 58 LYS P NZ   6  
ATOM 6938  H H    . LYS A 1 60 ? -22.415 4.803   4.316   1.00 0.00 ? 58 LYS P H    6  
ATOM 6939  H HA   . LYS A 1 60 ? -25.092 5.902   4.971   1.00 0.00 ? 58 LYS P HA   6  
ATOM 6940  H HB2  . LYS A 1 60 ? -22.278 6.571   5.934   1.00 0.00 ? 58 LYS P HB2  6  
ATOM 6941  H HB3  . LYS A 1 60 ? -23.692 7.510   6.378   1.00 0.00 ? 58 LYS P HB3  6  
ATOM 6942  H HG2  . LYS A 1 60 ? -23.204 6.028   8.161   1.00 0.00 ? 58 LYS P HG2  6  
ATOM 6943  H HG3  . LYS A 1 60 ? -24.740 5.543   7.436   1.00 0.00 ? 58 LYS P HG3  6  
ATOM 6944  H HD2  . LYS A 1 60 ? -23.728 3.626   6.377   1.00 0.00 ? 58 LYS P HD2  6  
ATOM 6945  H HD3  . LYS A 1 60 ? -22.091 4.233   6.734   1.00 0.00 ? 58 LYS P HD3  6  
ATOM 6946  H HE2  . LYS A 1 60 ? -22.488 3.946   9.141   1.00 0.00 ? 58 LYS P HE2  6  
ATOM 6947  H HE3  . LYS A 1 60 ? -24.138 3.382   8.831   1.00 0.00 ? 58 LYS P HE3  6  
ATOM 6948  H HZ1  . LYS A 1 60 ? -21.724 2.038   7.742   1.00 0.00 ? 58 LYS P HZ1  6  
ATOM 6949  H HZ2  . LYS A 1 60 ? -23.254 1.463   7.709   1.00 0.00 ? 58 LYS P HZ2  6  
ATOM 6950  H HZ3  . LYS A 1 60 ? -22.463 1.564   9.135   1.00 0.00 ? 58 LYS P HZ3  6  
ATOM 6951  N N    . ARG A 1 61 ? -23.096 7.503   2.944   1.00 0.00 ? 59 ARG P N    6  
ATOM 6952  C CA   . ARG A 1 61 ? -22.892 8.644   2.031   1.00 0.00 ? 59 ARG P CA   6  
ATOM 6953  C C    . ARG A 1 61 ? -23.513 8.438   0.641   1.00 0.00 ? 59 ARG P C    6  
ATOM 6954  O O    . ARG A 1 61 ? -23.903 9.410   -0.004  1.00 0.00 ? 59 ARG P O    6  
ATOM 6955  C CB   . ARG A 1 61 ? -21.383 8.875   1.869   1.00 0.00 ? 59 ARG P CB   6  
ATOM 6956  C CG   . ARG A 1 61 ? -20.605 9.222   3.146   1.00 0.00 ? 59 ARG P CG   6  
ATOM 6957  C CD   . ARG A 1 61 ? -19.123 9.315   2.764   1.00 0.00 ? 59 ARG P CD   6  
ATOM 6958  N NE   . ARG A 1 61 ? -18.262 9.724   3.884   1.00 0.00 ? 59 ARG P NE   6  
ATOM 6959  C CZ   . ARG A 1 61 ? -16.974 10.008  3.791   1.00 0.00 ? 59 ARG P CZ   6  
ATOM 6960  N NH1  . ARG A 1 61 ? -16.322 9.943   2.662   1.00 0.00 ? 59 ARG P NH1  6  
ATOM 6961  N NH2  . ARG A 1 61 ? -16.306 10.372  4.848   1.00 0.00 ? 59 ARG P NH2  6  
ATOM 6962  H H    . ARG A 1 61 ? -22.412 6.759   2.921   1.00 0.00 ? 59 ARG P H    6  
ATOM 6963  H HA   . ARG A 1 61 ? -23.342 9.545   2.451   1.00 0.00 ? 59 ARG P HA   6  
ATOM 6964  H HB2  . ARG A 1 61 ? -20.948 7.971   1.440   1.00 0.00 ? 59 ARG P HB2  6  
ATOM 6965  H HB3  . ARG A 1 61 ? -21.245 9.697   1.164   1.00 0.00 ? 59 ARG P HB3  6  
ATOM 6966  H HG2  . ARG A 1 61 ? -20.953 10.178  3.540   1.00 0.00 ? 59 ARG P HG2  6  
ATOM 6967  H HG3  . ARG A 1 61 ? -20.738 8.445   3.900   1.00 0.00 ? 59 ARG P HG3  6  
ATOM 6968  H HD2  . ARG A 1 61 ? -18.795 8.337   2.408   1.00 0.00 ? 59 ARG P HD2  6  
ATOM 6969  H HD3  . ARG A 1 61 ? -19.019 10.040  1.954   1.00 0.00 ? 59 ARG P HD3  6  
ATOM 6970  H HE   . ARG A 1 61 ? -18.684 9.801   4.797   1.00 0.00 ? 59 ARG P HE   6  
ATOM 6971  H HH11 . ARG A 1 61 ? -16.803 9.668   1.806   1.00 0.00 ? 59 ARG P HH11 6  
ATOM 6972  H HH12 . ARG A 1 61 ? -15.350 10.191  2.621   1.00 0.00 ? 59 ARG P HH12 6  
ATOM 6973  H HH21 . ARG A 1 61 ? -16.769 10.451  5.738   1.00 0.00 ? 59 ARG P HH21 6  
ATOM 6974  H HH22 . ARG A 1 61 ? -15.328 10.598  4.778   1.00 0.00 ? 59 ARG P HH22 6  
ATOM 6975  N N    . GLU A 1 62 ? -23.578 7.186   0.181   1.00 0.00 ? 60 GLU P N    6  
ATOM 6976  C CA   . GLU A 1 62 ? -23.981 6.767   -1.172  1.00 0.00 ? 60 GLU P CA   6  
ATOM 6977  C C    . GLU A 1 62 ? -23.150 7.441   -2.291  1.00 0.00 ? 60 GLU P C    6  
ATOM 6978  O O    . GLU A 1 62 ? -23.675 7.913   -3.300  1.00 0.00 ? 60 GLU P O    6  
ATOM 6979  C CB   . GLU A 1 62 ? -25.509 6.853   -1.356  1.00 0.00 ? 60 GLU P CB   6  
ATOM 6980  C CG   . GLU A 1 62 ? -26.258 5.955   -0.360  1.00 0.00 ? 60 GLU P CG   6  
ATOM 6981  C CD   . GLU A 1 62 ? -27.779 6.010   -0.604  1.00 0.00 ? 60 GLU P CD   6  
ATOM 6982  O OE1  . GLU A 1 62 ? -28.447 6.949   -0.103  1.00 0.00 ? 60 GLU P OE1  6  
ATOM 6983  O OE2  . GLU A 1 62 ? -28.325 5.110   -1.289  1.00 0.00 ? 60 GLU P OE2  6  
ATOM 6984  H H    . GLU A 1 62 ? -23.191 6.469   0.783   1.00 0.00 ? 60 GLU P H    6  
ATOM 6985  H HA   . GLU A 1 62 ? -23.731 5.707   -1.253  1.00 0.00 ? 60 GLU P HA   6  
ATOM 6986  H HB2  . GLU A 1 62 ? -25.841 7.885   -1.237  1.00 0.00 ? 60 GLU P HB2  6  
ATOM 6987  H HB3  . GLU A 1 62 ? -25.762 6.523   -2.364  1.00 0.00 ? 60 GLU P HB3  6  
ATOM 6988  H HG2  . GLU A 1 62 ? -25.897 4.927   -0.471  1.00 0.00 ? 60 GLU P HG2  6  
ATOM 6989  H HG3  . GLU A 1 62 ? -26.041 6.273   0.663   1.00 0.00 ? 60 GLU P HG3  6  
ATOM 6990  N N    . GLU A 1 63 ? -21.824 7.480   -2.102  1.00 0.00 ? 61 GLU P N    6  
ATOM 6991  C CA   . GLU A 1 63 ? -20.842 8.074   -3.041  1.00 0.00 ? 61 GLU P CA   6  
ATOM 6992  C C    . GLU A 1 63 ? -20.817 7.378   -4.418  1.00 0.00 ? 61 GLU P C    6  
ATOM 6993  O O    . GLU A 1 63 ? -20.500 7.993   -5.439  1.00 0.00 ? 61 GLU P O    6  
ATOM 6994  C CB   . GLU A 1 63 ? -19.430 7.967   -2.432  1.00 0.00 ? 61 GLU P CB   6  
ATOM 6995  C CG   . GLU A 1 63 ? -19.269 8.772   -1.135  1.00 0.00 ? 61 GLU P CG   6  
ATOM 6996  C CD   . GLU A 1 63 ? -18.085 8.288   -0.284  1.00 0.00 ? 61 GLU P CD   6  
ATOM 6997  O OE1  . GLU A 1 63 ? -18.029 7.089   0.068   1.00 0.00 ? 61 GLU P OE1  6  
ATOM 6998  O OE2  . GLU A 1 63 ? -17.216 9.099   0.111   1.00 0.00 ? 61 GLU P OE2  6  
ATOM 6999  H H    . GLU A 1 63 ? -21.478 7.115   -1.224  1.00 0.00 ? 61 GLU P H    6  
ATOM 7000  H HA   . GLU A 1 63 ? -21.080 9.127   -3.201  1.00 0.00 ? 61 GLU P HA   6  
ATOM 7001  H HB2  . GLU A 1 63 ? -19.221 6.914   -2.241  1.00 0.00 ? 61 GLU P HB2  6  
ATOM 7002  H HB3  . GLU A 1 63 ? -18.695 8.326   -3.152  1.00 0.00 ? 61 GLU P HB3  6  
ATOM 7003  H HG2  . GLU A 1 63 ? -19.161 9.828   -1.387  1.00 0.00 ? 61 GLU P HG2  6  
ATOM 7004  H HG3  . GLU A 1 63 ? -20.172 8.673   -0.542  1.00 0.00 ? 61 GLU P HG3  6  
ATOM 7005  N N    . PHE A 1 64 ? -21.161 6.089   -4.429  1.00 0.00 ? 62 PHE P N    6  
ATOM 7006  C CA   . PHE A 1 64 ? -21.259 5.196   -5.583  1.00 0.00 ? 62 PHE P CA   6  
ATOM 7007  C C    . PHE A 1 64 ? -22.531 4.339   -5.475  1.00 0.00 ? 62 PHE P C    6  
ATOM 7008  O O    . PHE A 1 64 ? -22.994 4.064   -4.364  1.00 0.00 ? 62 PHE P O    6  
ATOM 7009  C CB   . PHE A 1 64 ? -19.992 4.329   -5.613  1.00 0.00 ? 62 PHE P CB   6  
ATOM 7010  C CG   . PHE A 1 64 ? -19.933 3.341   -6.761  1.00 0.00 ? 62 PHE P CG   6  
ATOM 7011  C CD1  . PHE A 1 64 ? -19.595 3.781   -8.054  1.00 0.00 ? 62 PHE P CD1  6  
ATOM 7012  C CD2  . PHE A 1 64 ? -20.229 1.981   -6.539  1.00 0.00 ? 62 PHE P CD2  6  
ATOM 7013  C CE1  . PHE A 1 64 ? -19.550 2.865   -9.122  1.00 0.00 ? 62 PHE P CE1  6  
ATOM 7014  C CE2  . PHE A 1 64 ? -20.184 1.066   -7.606  1.00 0.00 ? 62 PHE P CE2  6  
ATOM 7015  C CZ   . PHE A 1 64 ? -19.844 1.508   -8.896  1.00 0.00 ? 62 PHE P CZ   6  
ATOM 7016  H H    . PHE A 1 64 ? -21.404 5.687   -3.540  1.00 0.00 ? 62 PHE P H    6  
ATOM 7017  H HA   . PHE A 1 64 ? -21.312 5.782   -6.502  1.00 0.00 ? 62 PHE P HA   6  
ATOM 7018  H HB2  . PHE A 1 64 ? -19.126 4.988   -5.672  1.00 0.00 ? 62 PHE P HB2  6  
ATOM 7019  H HB3  . PHE A 1 64 ? -19.913 3.781   -4.673  1.00 0.00 ? 62 PHE P HB3  6  
ATOM 7020  H HD1  . PHE A 1 64 ? -19.370 4.825   -8.230  1.00 0.00 ? 62 PHE P HD1  6  
ATOM 7021  H HD2  . PHE A 1 64 ? -20.493 1.639   -5.547  1.00 0.00 ? 62 PHE P HD2  6  
ATOM 7022  H HE1  . PHE A 1 64 ? -19.290 3.205   -10.116 1.00 0.00 ? 62 PHE P HE1  6  
ATOM 7023  H HE2  . PHE A 1 64 ? -20.409 0.023   -7.434  1.00 0.00 ? 62 PHE P HE2  6  
ATOM 7024  H HZ   . PHE A 1 64 ? -19.810 0.805   -9.718  1.00 0.00 ? 62 PHE P HZ   6  
ATOM 7025  N N    . ILE A 1 65 ? -23.085 3.901   -6.610  1.00 0.00 ? 63 ILE P N    6  
ATOM 7026  C CA   . ILE A 1 65 ? -24.308 3.083   -6.694  1.00 0.00 ? 63 ILE P CA   6  
ATOM 7027  C C    . ILE A 1 65 ? -24.021 1.788   -7.466  1.00 0.00 ? 63 ILE P C    6  
ATOM 7028  O O    . ILE A 1 65 ? -23.503 1.822   -8.585  1.00 0.00 ? 63 ILE P O    6  
ATOM 7029  C CB   . ILE A 1 65 ? -25.461 3.886   -7.344  1.00 0.00 ? 63 ILE P CB   6  
ATOM 7030  C CG1  . ILE A 1 65 ? -25.791 5.209   -6.610  1.00 0.00 ? 63 ILE P CG1  6  
ATOM 7031  C CG2  . ILE A 1 65 ? -26.736 3.032   -7.485  1.00 0.00 ? 63 ILE P CG2  6  
ATOM 7032  C CD1  . ILE A 1 65 ? -26.326 5.070   -5.176  1.00 0.00 ? 63 ILE P CD1  6  
ATOM 7033  H H    . ILE A 1 65 ? -22.616 4.114   -7.479  1.00 0.00 ? 63 ILE P H    6  
ATOM 7034  H HA   . ILE A 1 65 ? -24.625 2.803   -5.689  1.00 0.00 ? 63 ILE P HA   6  
ATOM 7035  H HB   . ILE A 1 65 ? -25.145 4.157   -8.353  1.00 0.00 ? 63 ILE P HB   6  
ATOM 7036  H HG12 . ILE A 1 65 ? -24.901 5.838   -6.585  1.00 0.00 ? 63 ILE P HG12 6  
ATOM 7037  H HG13 . ILE A 1 65 ? -26.538 5.747   -7.194  1.00 0.00 ? 63 ILE P HG13 6  
ATOM 7038  H HG21 . ILE A 1 65 ? -27.023 2.608   -6.522  1.00 0.00 ? 63 ILE P HG21 6  
ATOM 7039  H HG22 . ILE A 1 65 ? -27.555 3.646   -7.862  1.00 0.00 ? 63 ILE P HG22 6  
ATOM 7040  H HG23 . ILE A 1 65 ? -26.574 2.220   -8.195  1.00 0.00 ? 63 ILE P HG23 6  
ATOM 7041  H HD11 . ILE A 1 65 ? -27.276 4.536   -5.175  1.00 0.00 ? 63 ILE P HD11 6  
ATOM 7042  H HD12 . ILE A 1 65 ? -26.489 6.064   -4.760  1.00 0.00 ? 63 ILE P HD12 6  
ATOM 7043  H HD13 . ILE A 1 65 ? -25.612 4.541   -4.548  1.00 0.00 ? 63 ILE P HD13 6  
ATOM 7044  N N    . VAL A 1 66 ? -24.398 0.645   -6.883  1.00 0.00 ? 64 VAL P N    6  
ATOM 7045  C CA   . VAL A 1 66 ? -24.318 -0.682  -7.521  1.00 0.00 ? 64 VAL P CA   6  
ATOM 7046  C C    . VAL A 1 66 ? -25.590 -0.936  -8.336  1.00 0.00 ? 64 VAL P C    6  
ATOM 7047  O O    . VAL A 1 66 ? -26.701 -0.810  -7.811  1.00 0.00 ? 64 VAL P O    6  
ATOM 7048  C CB   . VAL A 1 66 ? -24.101 -1.794  -6.472  1.00 0.00 ? 64 VAL P CB   6  
ATOM 7049  C CG1  . VAL A 1 66 ? -23.956 -3.173  -7.129  1.00 0.00 ? 64 VAL P CG1  6  
ATOM 7050  C CG2  . VAL A 1 66 ? -22.836 -1.546  -5.638  1.00 0.00 ? 64 VAL P CG2  6  
ATOM 7051  H H    . VAL A 1 66 ? -24.842 0.704   -5.979  1.00 0.00 ? 64 VAL P H    6  
ATOM 7052  H HA   . VAL A 1 66 ? -23.464 -0.698  -8.198  1.00 0.00 ? 64 VAL P HA   6  
ATOM 7053  H HB   . VAL A 1 66 ? -24.960 -1.820  -5.801  1.00 0.00 ? 64 VAL P HB   6  
ATOM 7054  H HG11 . VAL A 1 66 ? -23.127 -3.168  -7.838  1.00 0.00 ? 64 VAL P HG11 6  
ATOM 7055  H HG12 . VAL A 1 66 ? -23.766 -3.927  -6.365  1.00 0.00 ? 64 VAL P HG12 6  
ATOM 7056  H HG13 . VAL A 1 66 ? -24.875 -3.446  -7.648  1.00 0.00 ? 64 VAL P HG13 6  
ATOM 7057  H HG21 . VAL A 1 66 ? -22.917 -0.607  -5.091  1.00 0.00 ? 64 VAL P HG21 6  
ATOM 7058  H HG22 . VAL A 1 66 ? -22.708 -2.350  -4.912  1.00 0.00 ? 64 VAL P HG22 6  
ATOM 7059  H HG23 . VAL A 1 66 ? -21.961 -1.508  -6.287  1.00 0.00 ? 64 VAL P HG23 6  
ATOM 7060  N N    . THR A 1 67 ? -25.438 -1.295  -9.613  1.00 0.00 ? 65 THR P N    6  
ATOM 7061  C CA   . THR A 1 67 ? -26.546 -1.419  -10.585 1.00 0.00 ? 65 THR P CA   6  
ATOM 7062  C C    . THR A 1 67 ? -26.772 -2.838  -11.124 1.00 0.00 ? 65 THR P C    6  
ATOM 7063  O O    . THR A 1 67 ? -27.814 -3.107  -11.726 1.00 0.00 ? 65 THR P O    6  
ATOM 7064  C CB   . THR A 1 67 ? -26.335 -0.455  -11.765 1.00 0.00 ? 65 THR P CB   6  
ATOM 7065  O OG1  . THR A 1 67 ? -25.080 -0.692  -12.375 1.00 0.00 ? 65 THR P OG1  6  
ATOM 7066  C CG2  . THR A 1 67 ? -26.360 1.005   -11.311 1.00 0.00 ? 65 THR P CG2  6  
ATOM 7067  H H    . THR A 1 67 ? -24.501 -1.321  -9.992  1.00 0.00 ? 65 THR P H    6  
ATOM 7068  H HA   . THR A 1 67 ? -27.479 -1.133  -10.099 1.00 0.00 ? 65 THR P HA   6  
ATOM 7069  H HB   . THR A 1 67 ? -27.129 -0.605  -12.498 1.00 0.00 ? 65 THR P HB   6  
ATOM 7070  H HG1  . THR A 1 67 ? -25.029 -0.130  -13.168 1.00 0.00 ? 65 THR P HG1  6  
ATOM 7071  H HG21 . THR A 1 67 ? -25.520 1.208   -10.647 1.00 0.00 ? 65 THR P HG21 6  
ATOM 7072  H HG22 . THR A 1 67 ? -27.292 1.207   -10.784 1.00 0.00 ? 65 THR P HG22 6  
ATOM 7073  H HG23 . THR A 1 67 ? -26.298 1.660   -12.180 1.00 0.00 ? 65 THR P HG23 6  
ATOM 7074  N N    . ASP A 1 68 ? -25.826 -3.758  -10.892 1.00 0.00 ? 66 ASP P N    6  
ATOM 7075  C CA   . ASP A 1 68 ? -25.859 -5.171  -11.323 1.00 0.00 ? 66 ASP P CA   6  
ATOM 7076  C C    . ASP A 1 68 ? -25.170 -6.120  -10.318 1.00 0.00 ? 66 ASP P C    6  
ATOM 7077  O O    . ASP A 1 68 ? -24.025 -5.832  -9.898  1.00 0.00 ? 66 ASP P O    6  
ATOM 7078  C CB   . ASP A 1 68 ? -25.224 -5.298  -12.723 1.00 0.00 ? 66 ASP P CB   6  
ATOM 7079  C CG   . ASP A 1 68 ? -25.260 -6.741  -13.274 1.00 0.00 ? 66 ASP P CG   6  
ATOM 7080  O OD1  . ASP A 1 68 ? -26.355 -7.216  -13.668 1.00 0.00 ? 66 ASP P OD1  6  
ATOM 7081  O OD2  . ASP A 1 68 ? -24.191 -7.397  -13.352 1.00 0.00 ? 66 ASP P OD2  6  
ATOM 7082  O OXT  . ASP A 1 68 ? -25.793 -7.139  -9.942  1.00 0.00 ? 66 ASP P OXT  6  
ATOM 7083  H H    . ASP A 1 68 ? -25.011 -3.451  -10.383 1.00 0.00 ? 66 ASP P H    6  
ATOM 7084  H HA   . ASP A 1 68 ? -26.899 -5.492  -11.402 1.00 0.00 ? 66 ASP P HA   6  
ATOM 7085  H HB2  . ASP A 1 68 ? -25.759 -4.643  -13.414 1.00 0.00 ? 66 ASP P HB2  6  
ATOM 7086  H HB3  . ASP A 1 68 ? -24.190 -4.947  -12.677 1.00 0.00 ? 66 ASP P HB3  6  
ATOM 7087  N N    . GLY A 1 1  ? -0.030  6.530   30.682  1.00 0.00 ? -1 GLY P N    7  
ATOM 7088  C CA   . GLY A 1 1  ? -1.204  6.523   29.780  1.00 0.00 ? -1 GLY P CA   7  
ATOM 7089  C C    . GLY A 1 1  ? -1.784  5.124   29.624  1.00 0.00 ? -1 GLY P C    7  
ATOM 7090  O O    . GLY A 1 1  ? -1.055  4.134   29.709  1.00 0.00 ? -1 GLY P O    7  
ATOM 7091  H H1   . GLY A 1 1  ? 0.685   5.915   30.325  1.00 0.00 ? -1 GLY P H1   7  
ATOM 7092  H H2   . GLY A 1 1  ? -0.294  6.214   31.603  1.00 0.00 ? -1 GLY P H2   7  
ATOM 7093  H H3   . GLY A 1 1  ? 0.349   7.460   30.755  1.00 0.00 ? -1 GLY P H3   7  
ATOM 7094  H HA2  . GLY A 1 1  ? -1.974  7.182   30.181  1.00 0.00 ? -1 GLY P HA2  7  
ATOM 7095  H HA3  . GLY A 1 1  ? -0.909  6.883   28.794  1.00 0.00 ? -1 GLY P HA3  7  
ATOM 7096  N N    . SER A 1 2  ? -3.098  5.023   29.400  1.00 0.00 ? 0  SER P N    7  
ATOM 7097  C CA   . SER A 1 2  ? -3.830  3.746   29.319  1.00 0.00 ? 0  SER P CA   7  
ATOM 7098  C C    . SER A 1 2  ? -3.405  2.893   28.114  1.00 0.00 ? 0  SER P C    7  
ATOM 7099  O O    . SER A 1 2  ? -3.345  3.382   26.984  1.00 0.00 ? 0  SER P O    7  
ATOM 7100  C CB   . SER A 1 2  ? -5.344  3.998   29.264  1.00 0.00 ? 0  SER P CB   7  
ATOM 7101  O OG   . SER A 1 2  ? -5.746  4.865   30.314  1.00 0.00 ? 0  SER P OG   7  
ATOM 7102  H H    . SER A 1 2  ? -3.655  5.866   29.374  1.00 0.00 ? 0  SER P H    7  
ATOM 7103  H HA   . SER A 1 2  ? -3.627  3.178   30.228  1.00 0.00 ? 0  SER P HA   7  
ATOM 7104  H HB2  . SER A 1 2  ? -5.603  4.454   28.307  1.00 0.00 ? 0  SER P HB2  7  
ATOM 7105  H HB3  . SER A 1 2  ? -5.871  3.047   29.354  1.00 0.00 ? 0  SER P HB3  7  
ATOM 7106  H HG   . SER A 1 2  ? -6.719  4.949   30.296  1.00 0.00 ? 0  SER P HG   7  
ATOM 7107  N N    . GLN A 1 3  ? -3.160  1.595   28.330  1.00 0.00 ? 1  GLN P N    7  
ATOM 7108  C CA   . GLN A 1 3  ? -2.619  0.677   27.312  1.00 0.00 ? 1  GLN P CA   7  
ATOM 7109  C C    . GLN A 1 3  ? -3.582  0.416   26.132  1.00 0.00 ? 1  GLN P C    7  
ATOM 7110  O O    . GLN A 1 3  ? -3.134  0.070   25.036  1.00 0.00 ? 1  GLN P O    7  
ATOM 7111  C CB   . GLN A 1 3  ? -2.199  -0.626  28.024  1.00 0.00 ? 1  GLN P CB   7  
ATOM 7112  C CG   . GLN A 1 3  ? -1.522  -1.693  27.143  1.00 0.00 ? 1  GLN P CG   7  
ATOM 7113  C CD   . GLN A 1 3  ? -0.235  -1.212  26.471  1.00 0.00 ? 1  GLN P CD   7  
ATOM 7114  O OE1  . GLN A 1 3  ? 0.866   -1.365  26.985  1.00 0.00 ? 1  GLN P OE1  7  
ATOM 7115  N NE2  . GLN A 1 3  ? -0.318  -0.608  25.303  1.00 0.00 ? 1  GLN P NE2  7  
ATOM 7116  H H    . GLN A 1 3  ? -3.231  1.251   29.279  1.00 0.00 ? 1  GLN P H    7  
ATOM 7117  H HA   . GLN A 1 3  ? -1.723  1.141   26.896  1.00 0.00 ? 1  GLN P HA   7  
ATOM 7118  H HB2  . GLN A 1 3  ? -1.508  -0.372  28.830  1.00 0.00 ? 1  GLN P HB2  7  
ATOM 7119  H HB3  . GLN A 1 3  ? -3.084  -1.076  28.477  1.00 0.00 ? 1  GLN P HB3  7  
ATOM 7120  H HG2  . GLN A 1 3  ? -1.280  -2.552  27.772  1.00 0.00 ? 1  GLN P HG2  7  
ATOM 7121  H HG3  . GLN A 1 3  ? -2.221  -2.043  26.383  1.00 0.00 ? 1  GLN P HG3  7  
ATOM 7122  H HE21 . GLN A 1 3  ? -1.230  -0.448  24.886  1.00 0.00 ? 1  GLN P HE21 7  
ATOM 7123  H HE22 . GLN A 1 3  ? 0.530   -0.294  24.856  1.00 0.00 ? 1  GLN P HE22 7  
ATOM 7124  N N    . ARG A 1 4  ? -4.894  0.622   26.327  1.00 0.00 ? 2  ARG P N    7  
ATOM 7125  C CA   . ARG A 1 4  ? -5.941  0.455   25.297  1.00 0.00 ? 2  ARG P CA   7  
ATOM 7126  C C    . ARG A 1 4  ? -5.995  1.567   24.233  1.00 0.00 ? 2  ARG P C    7  
ATOM 7127  O O    . ARG A 1 4  ? -6.731  1.429   23.253  1.00 0.00 ? 2  ARG P O    7  
ATOM 7128  C CB   . ARG A 1 4  ? -7.308  0.235   25.977  1.00 0.00 ? 2  ARG P CB   7  
ATOM 7129  C CG   . ARG A 1 4  ? -7.825  1.458   26.757  1.00 0.00 ? 2  ARG P CG   7  
ATOM 7130  C CD   . ARG A 1 4  ? -9.199  1.167   27.374  1.00 0.00 ? 2  ARG P CD   7  
ATOM 7131  N NE   . ARG A 1 4  ? -9.701  2.326   28.142  1.00 0.00 ? 2  ARG P NE   7  
ATOM 7132  C CZ   . ARG A 1 4  ? -9.514  2.585   29.425  1.00 0.00 ? 2  ARG P CZ   7  
ATOM 7133  N NH1  . ARG A 1 4  ? -8.817  1.803   30.202  1.00 0.00 ? 2  ARG P NH1  7  
ATOM 7134  N NH2  . ARG A 1 4  ? -10.028 3.654   29.961  1.00 0.00 ? 2  ARG P NH2  7  
ATOM 7135  H H    . ARG A 1 4  ? -5.179  0.873   27.263  1.00 0.00 ? 2  ARG P H    7  
ATOM 7136  H HA   . ARG A 1 4  ? -5.715  -0.456  24.739  1.00 0.00 ? 2  ARG P HA   7  
ATOM 7137  H HB2  . ARG A 1 4  ? -8.041  -0.027  25.212  1.00 0.00 ? 2  ARG P HB2  7  
ATOM 7138  H HB3  . ARG A 1 4  ? -7.228  -0.613  26.660  1.00 0.00 ? 2  ARG P HB3  7  
ATOM 7139  H HG2  . ARG A 1 4  ? -7.123  1.709   27.553  1.00 0.00 ? 2  ARG P HG2  7  
ATOM 7140  H HG3  . ARG A 1 4  ? -7.915  2.312   26.085  1.00 0.00 ? 2  ARG P HG3  7  
ATOM 7141  H HD2  . ARG A 1 4  ? -9.903  0.945   26.570  1.00 0.00 ? 2  ARG P HD2  7  
ATOM 7142  H HD3  . ARG A 1 4  ? -9.136  0.284   28.011  1.00 0.00 ? 2  ARG P HD3  7  
ATOM 7143  H HE   . ARG A 1 4  ? -10.264 2.992   27.634  1.00 0.00 ? 2  ARG P HE   7  
ATOM 7144  H HH11 . ARG A 1 4  ? -8.432  0.953   29.828  1.00 0.00 ? 2  ARG P HH11 7  
ATOM 7145  H HH12 . ARG A 1 4  ? -8.704  2.020   31.178  1.00 0.00 ? 2  ARG P HH12 7  
ATOM 7146  H HH21 . ARG A 1 4  ? -10.581 4.284   29.402  1.00 0.00 ? 2  ARG P HH21 7  
ATOM 7147  H HH22 . ARG A 1 4  ? -9.896  3.847   30.939  1.00 0.00 ? 2  ARG P HH22 7  
ATOM 7148  N N    . ARG A 1 5  ? -5.243  2.663   24.407  1.00 0.00 ? 3  ARG P N    7  
ATOM 7149  C CA   . ARG A 1 5  ? -5.177  3.797   23.459  1.00 0.00 ? 3  ARG P CA   7  
ATOM 7150  C C    . ARG A 1 5  ? -4.523  3.397   22.131  1.00 0.00 ? 3  ARG P C    7  
ATOM 7151  O O    . ARG A 1 5  ? -3.662  2.516   22.091  1.00 0.00 ? 3  ARG P O    7  
ATOM 7152  C CB   . ARG A 1 5  ? -4.428  4.981   24.096  1.00 0.00 ? 3  ARG P CB   7  
ATOM 7153  C CG   . ARG A 1 5  ? -5.213  5.601   25.265  1.00 0.00 ? 3  ARG P CG   7  
ATOM 7154  C CD   . ARG A 1 5  ? -4.398  6.702   25.950  1.00 0.00 ? 3  ARG P CD   7  
ATOM 7155  N NE   . ARG A 1 5  ? -5.132  7.283   27.093  1.00 0.00 ? 3  ARG P NE   7  
ATOM 7156  C CZ   . ARG A 1 5  ? -4.739  8.291   27.853  1.00 0.00 ? 3  ARG P CZ   7  
ATOM 7157  N NH1  . ARG A 1 5  ? -3.608  8.907   27.660  1.00 0.00 ? 3  ARG P NH1  7  
ATOM 7158  N NH2  . ARG A 1 5  ? -5.481  8.695   28.844  1.00 0.00 ? 3  ARG P NH2  7  
ATOM 7159  H H    . ARG A 1 5  ? -4.646  2.690   25.222  1.00 0.00 ? 3  ARG P H    7  
ATOM 7160  H HA   . ARG A 1 5  ? -6.196  4.116   23.227  1.00 0.00 ? 3  ARG P HA   7  
ATOM 7161  H HB2  . ARG A 1 5  ? -3.451  4.641   24.445  1.00 0.00 ? 3  ARG P HB2  7  
ATOM 7162  H HB3  . ARG A 1 5  ? -4.265  5.751   23.338  1.00 0.00 ? 3  ARG P HB3  7  
ATOM 7163  H HG2  . ARG A 1 5  ? -6.144  6.024   24.886  1.00 0.00 ? 3  ARG P HG2  7  
ATOM 7164  H HG3  . ARG A 1 5  ? -5.451  4.832   25.997  1.00 0.00 ? 3  ARG P HG3  7  
ATOM 7165  H HD2  . ARG A 1 5  ? -3.456  6.274   26.302  1.00 0.00 ? 3  ARG P HD2  7  
ATOM 7166  H HD3  . ARG A 1 5  ? -4.179  7.483   25.218  1.00 0.00 ? 3  ARG P HD3  7  
ATOM 7167  H HE   . ARG A 1 5  ? -6.035  6.892   27.305  1.00 0.00 ? 3  ARG P HE   7  
ATOM 7168  H HH11 . ARG A 1 5  ? -3.035  8.645   26.875  1.00 0.00 ? 3  ARG P HH11 7  
ATOM 7169  H HH12 . ARG A 1 5  ? -3.352  9.698   28.227  1.00 0.00 ? 3  ARG P HH12 7  
ATOM 7170  H HH21 . ARG A 1 5  ? -6.361  8.245   29.037  1.00 0.00 ? 3  ARG P HH21 7  
ATOM 7171  H HH22 . ARG A 1 5  ? -5.186  9.467   29.418  1.00 0.00 ? 3  ARG P HH22 7  
ATOM 7172  N N    . GLN A 1 6  ? -4.916  4.064   21.045  1.00 0.00 ? 4  GLN P N    7  
ATOM 7173  C CA   . GLN A 1 6  ? -4.383  3.871   19.688  1.00 0.00 ? 4  GLN P CA   7  
ATOM 7174  C C    . GLN A 1 6  ? -4.129  5.240   19.033  1.00 0.00 ? 4  GLN P C    7  
ATOM 7175  O O    . GLN A 1 6  ? -5.069  5.948   18.662  1.00 0.00 ? 4  GLN P O    7  
ATOM 7176  C CB   . GLN A 1 6  ? -5.370  3.026   18.853  1.00 0.00 ? 4  GLN P CB   7  
ATOM 7177  C CG   . GLN A 1 6  ? -5.581  1.580   19.339  1.00 0.00 ? 4  GLN P CG   7  
ATOM 7178  C CD   . GLN A 1 6  ? -4.378  0.673   19.086  1.00 0.00 ? 4  GLN P CD   7  
ATOM 7179  O OE1  . GLN A 1 6  ? -4.278  0.009   18.062  1.00 0.00 ? 4  GLN P OE1  7  
ATOM 7180  N NE2  . GLN A 1 6  ? -3.413  0.610   19.978  1.00 0.00 ? 4  GLN P NE2  7  
ATOM 7181  H H    . GLN A 1 6  ? -5.627  4.771   21.164  1.00 0.00 ? 4  GLN P H    7  
ATOM 7182  H HA   . GLN A 1 6  ? -3.429  3.344   19.731  1.00 0.00 ? 4  GLN P HA   7  
ATOM 7183  H HB2  . GLN A 1 6  ? -6.341  3.525   18.854  1.00 0.00 ? 4  GLN P HB2  7  
ATOM 7184  H HB3  . GLN A 1 6  ? -5.019  2.992   17.819  1.00 0.00 ? 4  GLN P HB3  7  
ATOM 7185  H HG2  . GLN A 1 6  ? -5.836  1.568   20.397  1.00 0.00 ? 4  GLN P HG2  7  
ATOM 7186  H HG3  . GLN A 1 6  ? -6.433  1.162   18.800  1.00 0.00 ? 4  GLN P HG3  7  
ATOM 7187  H HE21 . GLN A 1 6  ? -3.465  1.167   20.828  1.00 0.00 ? 4  GLN P HE21 7  
ATOM 7188  H HE22 . GLN A 1 6  ? -2.630  0.002   19.798  1.00 0.00 ? 4  GLN P HE22 7  
ATOM 7189  N N    . ARG A 1 7  ? -2.853  5.623   18.883  1.00 0.00 ? 5  ARG P N    7  
ATOM 7190  C CA   . ARG A 1 7  ? -2.402  6.942   18.379  1.00 0.00 ? 5  ARG P CA   7  
ATOM 7191  C C    . ARG A 1 7  ? -2.399  7.043   16.836  1.00 0.00 ? 5  ARG P C    7  
ATOM 7192  O O    . ARG A 1 7  ? -1.442  7.535   16.237  1.00 0.00 ? 5  ARG P O    7  
ATOM 7193  C CB   . ARG A 1 7  ? -1.061  7.300   19.058  1.00 0.00 ? 5  ARG P CB   7  
ATOM 7194  C CG   . ARG A 1 7  ? -0.767  8.811   19.064  1.00 0.00 ? 5  ARG P CG   7  
ATOM 7195  C CD   . ARG A 1 7  ? 0.560   9.102   19.775  1.00 0.00 ? 5  ARG P CD   7  
ATOM 7196  N NE   . ARG A 1 7  ? 0.856   10.550  19.791  1.00 0.00 ? 5  ARG P NE   7  
ATOM 7197  C CZ   . ARG A 1 7  ? 1.917   11.132  20.323  1.00 0.00 ? 5  ARG P CZ   7  
ATOM 7198  N NH1  . ARG A 1 7  ? 2.855   10.453  20.922  1.00 0.00 ? 5  ARG P NH1  7  
ATOM 7199  N NH2  . ARG A 1 7  ? 2.057   12.426  20.264  1.00 0.00 ? 5  ARG P NH2  7  
ATOM 7200  H H    . ARG A 1 7  ? -2.143  4.992   19.232  1.00 0.00 ? 5  ARG P H    7  
ATOM 7201  H HA   . ARG A 1 7  ? -3.135  7.682   18.710  1.00 0.00 ? 5  ARG P HA   7  
ATOM 7202  H HB2  . ARG A 1 7  ? -1.097  6.971   20.099  1.00 0.00 ? 5  ARG P HB2  7  
ATOM 7203  H HB3  . ARG A 1 7  ? -0.247  6.765   18.565  1.00 0.00 ? 5  ARG P HB3  7  
ATOM 7204  H HG2  . ARG A 1 7  ? -0.709  9.188   18.044  1.00 0.00 ? 5  ARG P HG2  7  
ATOM 7205  H HG3  . ARG A 1 7  ? -1.572  9.330   19.586  1.00 0.00 ? 5  ARG P HG3  7  
ATOM 7206  H HD2  . ARG A 1 7  ? 0.499   8.731   20.799  1.00 0.00 ? 5  ARG P HD2  7  
ATOM 7207  H HD3  . ARG A 1 7  ? 1.361   8.572   19.254  1.00 0.00 ? 5  ARG P HD3  7  
ATOM 7208  H HE   . ARG A 1 7  ? 0.186   11.159  19.348  1.00 0.00 ? 5  ARG P HE   7  
ATOM 7209  H HH11 . ARG A 1 7  ? 2.774   9.452   20.982  1.00 0.00 ? 5  ARG P HH11 7  
ATOM 7210  H HH12 . ARG A 1 7  ? 3.652   10.919  21.320  1.00 0.00 ? 5  ARG P HH12 7  
ATOM 7211  H HH21 . ARG A 1 7  ? 1.358   12.991  19.811  1.00 0.00 ? 5  ARG P HH21 7  
ATOM 7212  H HH22 . ARG A 1 7  ? 2.865   12.867  20.671  1.00 0.00 ? 5  ARG P HH22 7  
ATOM 7213  N N    . THR A 1 8  ? -3.483  6.571   16.213  1.00 0.00 ? 6  THR P N    7  
ATOM 7214  C CA   . THR A 1 8  ? -3.735  6.484   14.754  1.00 0.00 ? 6  THR P CA   7  
ATOM 7215  C C    . THR A 1 8  ? -2.799  5.523   13.992  1.00 0.00 ? 6  THR P C    7  
ATOM 7216  O O    . THR A 1 8  ? -1.587  5.488   14.208  1.00 0.00 ? 6  THR P O    7  
ATOM 7217  C CB   . THR A 1 8  ? -3.793  7.883   14.104  1.00 0.00 ? 6  THR P CB   7  
ATOM 7218  O OG1  . THR A 1 8  ? -4.654  8.727   14.847  1.00 0.00 ? 6  THR P OG1  7  
ATOM 7219  C CG2  . THR A 1 8  ? -4.343  7.860   12.676  1.00 0.00 ? 6  THR P CG2  7  
ATOM 7220  H H    . THR A 1 8  ? -4.230  6.267   16.821  1.00 0.00 ? 6  THR P H    7  
ATOM 7221  H HA   . THR A 1 8  ? -4.739  6.072   14.653  1.00 0.00 ? 6  THR P HA   7  
ATOM 7222  H HB   . THR A 1 8  ? -2.794  8.320   14.090  1.00 0.00 ? 6  THR P HB   7  
ATOM 7223  H HG1  . THR A 1 8  ? -4.579  9.625   14.477  1.00 0.00 ? 6  THR P HG1  7  
ATOM 7224  H HG21 . THR A 1 8  ? -3.660  7.317   12.026  1.00 0.00 ? 6  THR P HG21 7  
ATOM 7225  H HG22 . THR A 1 8  ? -4.428  8.878   12.296  1.00 0.00 ? 6  THR P HG22 7  
ATOM 7226  H HG23 . THR A 1 8  ? -5.325  7.386   12.656  1.00 0.00 ? 6  THR P HG23 7  
ATOM 7227  N N    . HIS A 1 9  ? -3.364  4.723   13.076  1.00 0.00 ? 7  HIS P N    7  
ATOM 7228  C CA   . HIS A 1 9  ? -2.638  3.681   12.324  1.00 0.00 ? 7  HIS P CA   7  
ATOM 7229  C C    . HIS A 1 9  ? -2.082  4.131   10.962  1.00 0.00 ? 7  HIS P C    7  
ATOM 7230  O O    . HIS A 1 9  ? -1.074  3.581   10.513  1.00 0.00 ? 7  HIS P O    7  
ATOM 7231  C CB   . HIS A 1 9  ? -3.546  2.449   12.166  1.00 0.00 ? 7  HIS P CB   7  
ATOM 7232  C CG   . HIS A 1 9  ? -3.462  1.507   13.343  1.00 0.00 ? 7  HIS P CG   7  
ATOM 7233  N ND1  . HIS A 1 9  ? -2.588  0.420   13.439  1.00 0.00 ? 7  HIS P ND1  7  
ATOM 7234  C CD2  . HIS A 1 9  ? -4.186  1.597   14.497  1.00 0.00 ? 7  HIS P CD2  7  
ATOM 7235  C CE1  . HIS A 1 9  ? -2.809  -0.124  14.648  1.00 0.00 ? 7  HIS P CE1  7  
ATOM 7236  N NE2  . HIS A 1 9  ? -3.760  0.562   15.301  1.00 0.00 ? 7  HIS P NE2  7  
ATOM 7237  H H    . HIS A 1 9  ? -4.366  4.783   12.948  1.00 0.00 ? 7  HIS P H    7  
ATOM 7238  H HA   . HIS A 1 9  ? -1.765  3.364   12.899  1.00 0.00 ? 7  HIS P HA   7  
ATOM 7239  H HB2  . HIS A 1 9  ? -4.582  2.757   12.015  1.00 0.00 ? 7  HIS P HB2  7  
ATOM 7240  H HB3  . HIS A 1 9  ? -3.250  1.889   11.280  1.00 0.00 ? 7  HIS P HB3  7  
ATOM 7241  H HD2  . HIS A 1 9  ? -4.935  2.343   14.730  1.00 0.00 ? 7  HIS P HD2  7  
ATOM 7242  H HE1  . HIS A 1 9  ? -2.289  -0.989  15.046  1.00 0.00 ? 7  HIS P HE1  7  
ATOM 7243  H HE2  . HIS A 1 9  ? -4.082  0.349   16.247  1.00 0.00 ? 7  HIS P HE2  7  
ATOM 7244  N N    . PHE A 1 10 ? -2.711  5.104   10.300  1.00 0.00 ? 8  PHE P N    7  
ATOM 7245  C CA   . PHE A 1 10 ? -2.360  5.558   8.945   1.00 0.00 ? 8  PHE P CA   7  
ATOM 7246  C C    . PHE A 1 10 ? -1.885  7.018   8.920   1.00 0.00 ? 8  PHE P C    7  
ATOM 7247  O O    . PHE A 1 10 ? -2.214  7.807   9.810   1.00 0.00 ? 8  PHE P O    7  
ATOM 7248  C CB   . PHE A 1 10 ? -3.549  5.358   7.996   1.00 0.00 ? 8  PHE P CB   7  
ATOM 7249  C CG   . PHE A 1 10 ? -4.004  3.918   7.829   1.00 0.00 ? 8  PHE P CG   7  
ATOM 7250  C CD1  . PHE A 1 10 ? -4.936  3.358   8.723   1.00 0.00 ? 8  PHE P CD1  7  
ATOM 7251  C CD2  . PHE A 1 10 ? -3.512  3.141   6.761   1.00 0.00 ? 8  PHE P CD2  7  
ATOM 7252  C CE1  . PHE A 1 10 ? -5.367  2.030   8.559   1.00 0.00 ? 8  PHE P CE1  7  
ATOM 7253  C CE2  . PHE A 1 10 ? -3.957  1.818   6.587   1.00 0.00 ? 8  PHE P CE2  7  
ATOM 7254  C CZ   . PHE A 1 10 ? -4.883  1.262   7.487   1.00 0.00 ? 8  PHE P CZ   7  
ATOM 7255  H H    . PHE A 1 10 ? -3.502  5.545   10.746  1.00 0.00 ? 8  PHE P H    7  
ATOM 7256  H HA   . PHE A 1 10 ? -1.540  4.956   8.557   1.00 0.00 ? 8  PHE P HA   7  
ATOM 7257  H HB2  . PHE A 1 10 ? -4.388  5.955   8.353   1.00 0.00 ? 8  PHE P HB2  7  
ATOM 7258  H HB3  . PHE A 1 10 ? -3.264  5.744   7.016   1.00 0.00 ? 8  PHE P HB3  7  
ATOM 7259  H HD1  . PHE A 1 10 ? -5.327  3.951   9.539   1.00 0.00 ? 8  PHE P HD1  7  
ATOM 7260  H HD2  . PHE A 1 10 ? -2.804  3.567   6.063   1.00 0.00 ? 8  PHE P HD2  7  
ATOM 7261  H HE1  . PHE A 1 10 ? -6.086  1.604   9.247   1.00 0.00 ? 8  PHE P HE1  7  
ATOM 7262  H HE2  . PHE A 1 10 ? -3.601  1.236   5.749   1.00 0.00 ? 8  PHE P HE2  7  
ATOM 7263  H HZ   . PHE A 1 10 ? -5.236  0.250   7.347   1.00 0.00 ? 8  PHE P HZ   7  
ATOM 7264  N N    . THR A 1 11 ? -1.137  7.389   7.878   1.00 0.00 ? 9  THR P N    7  
ATOM 7265  C CA   . THR A 1 11 ? -0.664  8.768   7.654   1.00 0.00 ? 9  THR P CA   7  
ATOM 7266  C C    . THR A 1 11 ? -1.571  9.515   6.683   1.00 0.00 ? 9  THR P C    7  
ATOM 7267  O O    . THR A 1 11 ? -2.221  8.910   5.825   1.00 0.00 ? 9  THR P O    7  
ATOM 7268  C CB   . THR A 1 11 ? 0.791   8.843   7.152   1.00 0.00 ? 9  THR P CB   7  
ATOM 7269  O OG1  . THR A 1 11 ? 0.864   8.599   5.763   1.00 0.00 ? 9  THR P OG1  7  
ATOM 7270  C CG2  . THR A 1 11 ? 1.728   7.865   7.854   1.00 0.00 ? 9  THR P CG2  7  
ATOM 7271  H H    . THR A 1 11 ? -0.933  6.700   7.166   1.00 0.00 ? 9  THR P H    7  
ATOM 7272  H HA   . THR A 1 11 ? -0.689  9.305   8.602   1.00 0.00 ? 9  THR P HA   7  
ATOM 7273  H HB   . THR A 1 11 ? 1.156   9.855   7.332   1.00 0.00 ? 9  THR P HB   7  
ATOM 7274  H HG1  . THR A 1 11 ? 1.806   8.648   5.517   1.00 0.00 ? 9  THR P HG1  7  
ATOM 7275  H HG21 . THR A 1 11 ? 1.652   7.998   8.933   1.00 0.00 ? 9  THR P HG21 7  
ATOM 7276  H HG22 . THR A 1 11 ? 2.754   8.053   7.542   1.00 0.00 ? 9  THR P HG22 7  
ATOM 7277  H HG23 . THR A 1 11 ? 1.458   6.841   7.599   1.00 0.00 ? 9  THR P HG23 7  
ATOM 7278  N N    . SER A 1 12 ? -1.543  10.846  6.737   1.00 0.00 ? 10 SER P N    7  
ATOM 7279  C CA   . SER A 1 12 ? -2.272  11.714  5.802   1.00 0.00 ? 10 SER P CA   7  
ATOM 7280  C C    . SER A 1 12 ? -1.836  11.566  4.333   1.00 0.00 ? 10 SER P C    7  
ATOM 7281  O O    . SER A 1 12 ? -2.508  12.115  3.462   1.00 0.00 ? 10 SER P O    7  
ATOM 7282  C CB   . SER A 1 12 ? -2.161  13.181  6.228   1.00 0.00 ? 10 SER P CB   7  
ATOM 7283  O OG   . SER A 1 12 ? -2.427  13.335  7.615   1.00 0.00 ? 10 SER P OG   7  
ATOM 7284  H H    . SER A 1 12 ? -1.033  11.300  7.483   1.00 0.00 ? 10 SER P H    7  
ATOM 7285  H HA   . SER A 1 12 ? -3.326  11.449  5.844   1.00 0.00 ? 10 SER P HA   7  
ATOM 7286  H HB2  . SER A 1 12 ? -1.157  13.544  6.005   1.00 0.00 ? 10 SER P HB2  7  
ATOM 7287  H HB3  . SER A 1 12 ? -2.889  13.757  5.655   1.00 0.00 ? 10 SER P HB3  7  
ATOM 7288  H HG   . SER A 1 12 ? -2.375  14.287  7.835   1.00 0.00 ? 10 SER P HG   7  
ATOM 7289  N N    . GLN A 1 13 ? -0.757  10.822  4.045   1.00 0.00 ? 11 GLN P N    7  
ATOM 7290  C CA   . GLN A 1 13 ? -0.308  10.462  2.695   1.00 0.00 ? 11 GLN P CA   7  
ATOM 7291  C C    . GLN A 1 13 ? -0.762  9.049   2.280   1.00 0.00 ? 11 GLN P C    7  
ATOM 7292  O O    . GLN A 1 13 ? -1.229  8.868   1.156   1.00 0.00 ? 11 GLN P O    7  
ATOM 7293  C CB   . GLN A 1 13 ? 1.220   10.627  2.628   1.00 0.00 ? 11 GLN P CB   7  
ATOM 7294  C CG   . GLN A 1 13 ? 1.754   10.525  1.191   1.00 0.00 ? 11 GLN P CG   7  
ATOM 7295  C CD   . GLN A 1 13 ? 3.266   10.741  1.133   1.00 0.00 ? 11 GLN P CD   7  
ATOM 7296  O OE1  . GLN A 1 13 ? 4.057   9.807   1.102   1.00 0.00 ? 11 GLN P OE1  7  
ATOM 7297  N NE2  . GLN A 1 13 ? 3.733   11.974  1.127   1.00 0.00 ? 11 GLN P NE2  7  
ATOM 7298  H H    . GLN A 1 13 ? -0.258  10.402  4.820   1.00 0.00 ? 11 GLN P H    7  
ATOM 7299  H HA   . GLN A 1 13 ? -0.742  11.166  1.981   1.00 0.00 ? 11 GLN P HA   7  
ATOM 7300  H HB2  . GLN A 1 13 ? 1.484   11.608  3.026   1.00 0.00 ? 11 GLN P HB2  7  
ATOM 7301  H HB3  . GLN A 1 13 ? 1.697   9.865   3.246   1.00 0.00 ? 11 GLN P HB3  7  
ATOM 7302  H HG2  . GLN A 1 13 ? 1.527   9.540   0.783   1.00 0.00 ? 11 GLN P HG2  7  
ATOM 7303  H HG3  . GLN A 1 13 ? 1.262   11.276  0.573   1.00 0.00 ? 11 GLN P HG3  7  
ATOM 7304  H HE21 . GLN A 1 13 ? 3.101   12.761  1.153   1.00 0.00 ? 11 GLN P HE21 7  
ATOM 7305  H HE22 . GLN A 1 13 ? 4.733   12.108  1.092   1.00 0.00 ? 11 GLN P HE22 7  
ATOM 7306  N N    . GLN A 1 14 ? -0.702  8.053   3.177   1.00 0.00 ? 12 GLN P N    7  
ATOM 7307  C CA   . GLN A 1 14 ? -1.146  6.673   2.897   1.00 0.00 ? 12 GLN P CA   7  
ATOM 7308  C C    . GLN A 1 14 ? -2.633  6.625   2.528   1.00 0.00 ? 12 GLN P C    7  
ATOM 7309  O O    . GLN A 1 14 ? -3.030  5.972   1.562   1.00 0.00 ? 12 GLN P O    7  
ATOM 7310  C CB   . GLN A 1 14 ? -0.924  5.788   4.130   1.00 0.00 ? 12 GLN P CB   7  
ATOM 7311  C CG   . GLN A 1 14 ? 0.557   5.505   4.391   1.00 0.00 ? 12 GLN P CG   7  
ATOM 7312  C CD   . GLN A 1 14 ? 0.773   4.713   5.676   1.00 0.00 ? 12 GLN P CD   7  
ATOM 7313  O OE1  . GLN A 1 14 ? 0.047   4.832   6.655   1.00 0.00 ? 12 GLN P OE1  7  
ATOM 7314  N NE2  . GLN A 1 14 ? 1.781   3.873   5.717   1.00 0.00 ? 12 GLN P NE2  7  
ATOM 7315  H H    . GLN A 1 14 ? -0.356  8.262   4.107   1.00 0.00 ? 12 GLN P H    7  
ATOM 7316  H HA   . GLN A 1 14 ? -0.575  6.265   2.062   1.00 0.00 ? 12 GLN P HA   7  
ATOM 7317  H HB2  . GLN A 1 14 ? -1.372  6.269   5.002   1.00 0.00 ? 12 GLN P HB2  7  
ATOM 7318  H HB3  . GLN A 1 14 ? -1.416  4.827   3.970   1.00 0.00 ? 12 GLN P HB3  7  
ATOM 7319  H HG2  . GLN A 1 14 ? 0.950   4.942   3.546   1.00 0.00 ? 12 GLN P HG2  7  
ATOM 7320  H HG3  . GLN A 1 14 ? 1.111   6.437   4.461   1.00 0.00 ? 12 GLN P HG3  7  
ATOM 7321  H HE21 . GLN A 1 14 ? 2.299   3.696   4.861   1.00 0.00 ? 12 GLN P HE21 7  
ATOM 7322  H HE22 . GLN A 1 14 ? 1.914   3.302   6.532   1.00 0.00 ? 12 GLN P HE22 7  
ATOM 7323  N N    . LEU A 1 15 ? -3.444  7.380   3.275   1.00 0.00 ? 13 LEU P N    7  
ATOM 7324  C CA   . LEU A 1 15 ? -4.889  7.523   3.067   1.00 0.00 ? 13 LEU P CA   7  
ATOM 7325  C C    . LEU A 1 15 ? -5.253  8.001   1.651   1.00 0.00 ? 13 LEU P C    7  
ATOM 7326  O O    . LEU A 1 15 ? -6.275  7.583   1.110   1.00 0.00 ? 13 LEU P O    7  
ATOM 7327  C CB   . LEU A 1 15 ? -5.417  8.513   4.117   1.00 0.00 ? 13 LEU P CB   7  
ATOM 7328  C CG   . LEU A 1 15 ? -5.291  8.000   5.567   1.00 0.00 ? 13 LEU P CG   7  
ATOM 7329  C CD1  . LEU A 1 15 ? -5.494  9.146   6.553   1.00 0.00 ? 13 LEU P CD1  7  
ATOM 7330  C CD2  . LEU A 1 15 ? -6.283  6.880   5.868   1.00 0.00 ? 13 LEU P CD2  7  
ATOM 7331  H H    . LEU A 1 15 ? -3.028  7.850   4.074   1.00 0.00 ? 13 LEU P H    7  
ATOM 7332  H HA   . LEU A 1 15 ? -5.376  6.560   3.210   1.00 0.00 ? 13 LEU P HA   7  
ATOM 7333  H HB2  . LEU A 1 15 ? -4.861  9.447   4.019   1.00 0.00 ? 13 LEU P HB2  7  
ATOM 7334  H HB3  . LEU A 1 15 ? -6.464  8.729   3.896   1.00 0.00 ? 13 LEU P HB3  7  
ATOM 7335  H HG   . LEU A 1 15 ? -4.298  7.594   5.733   1.00 0.00 ? 13 LEU P HG   7  
ATOM 7336  H HD11 . LEU A 1 15 ? -5.328  8.785   7.568   1.00 0.00 ? 13 LEU P HD11 7  
ATOM 7337  H HD12 . LEU A 1 15 ? -4.766  9.930   6.346   1.00 0.00 ? 13 LEU P HD12 7  
ATOM 7338  H HD13 . LEU A 1 15 ? -6.500  9.553   6.459   1.00 0.00 ? 13 LEU P HD13 7  
ATOM 7339  H HD21 . LEU A 1 15 ? -6.015  6.005   5.278   1.00 0.00 ? 13 LEU P HD21 7  
ATOM 7340  H HD22 . LEU A 1 15 ? -6.219  6.610   6.921   1.00 0.00 ? 13 LEU P HD22 7  
ATOM 7341  H HD23 . LEU A 1 15 ? -7.295  7.209   5.636   1.00 0.00 ? 13 LEU P HD23 7  
ATOM 7342  N N    . GLN A 1 16 ? -4.396  8.822   1.032   1.00 0.00 ? 14 GLN P N    7  
ATOM 7343  C CA   . GLN A 1 16 ? -4.610  9.343   -0.326  1.00 0.00 ? 14 GLN P CA   7  
ATOM 7344  C C    . GLN A 1 16 ? -4.492  8.236   -1.379  1.00 0.00 ? 14 GLN P C    7  
ATOM 7345  O O    . GLN A 1 16 ? -5.298  8.165   -2.303  1.00 0.00 ? 14 GLN P O    7  
ATOM 7346  C CB   . GLN A 1 16 ? -3.616  10.470  -0.662  1.00 0.00 ? 14 GLN P CB   7  
ATOM 7347  C CG   . GLN A 1 16 ? -3.499  11.562  0.406   1.00 0.00 ? 14 GLN P CG   7  
ATOM 7348  C CD   . GLN A 1 16 ? -4.820  12.234  0.777   1.00 0.00 ? 14 GLN P CD   7  
ATOM 7349  O OE1  . GLN A 1 16 ? -5.710  12.449  -0.037  1.00 0.00 ? 14 GLN P OE1  7  
ATOM 7350  N NE2  . GLN A 1 16 ? -4.981  12.603  2.028   1.00 0.00 ? 14 GLN P NE2  7  
ATOM 7351  H H    . GLN A 1 16 ? -3.534  9.045   1.510   1.00 0.00 ? 14 GLN P H    7  
ATOM 7352  H HA   . GLN A 1 16 ? -5.617  9.753   -0.385  1.00 0.00 ? 14 GLN P HA   7  
ATOM 7353  H HB2  . GLN A 1 16 ? -2.625  10.043  -0.806  1.00 0.00 ? 14 GLN P HB2  7  
ATOM 7354  H HB3  . GLN A 1 16 ? -3.918  10.928  -1.604  1.00 0.00 ? 14 GLN P HB3  7  
ATOM 7355  H HG2  . GLN A 1 16 ? -3.069  11.107  1.295   1.00 0.00 ? 14 GLN P HG2  7  
ATOM 7356  H HG3  . GLN A 1 16 ? -2.805  12.328  0.061   1.00 0.00 ? 14 GLN P HG3  7  
ATOM 7357  H HE21 . GLN A 1 16 ? -4.221  12.446  2.684   1.00 0.00 ? 14 GLN P HE21 7  
ATOM 7358  H HE22 . GLN A 1 16 ? -5.840  13.058  2.298   1.00 0.00 ? 14 GLN P HE22 7  
ATOM 7359  N N    . GLU A 1 17 ? -3.514  7.339   -1.225  1.00 0.00 ? 15 GLU P N    7  
ATOM 7360  C CA   . GLU A 1 17 ? -3.303  6.215   -2.145  1.00 0.00 ? 15 GLU P CA   7  
ATOM 7361  C C    . GLU A 1 17 ? -4.373  5.128   -1.972  1.00 0.00 ? 15 GLU P C    7  
ATOM 7362  O O    . GLU A 1 17 ? -4.778  4.496   -2.950  1.00 0.00 ? 15 GLU P O    7  
ATOM 7363  C CB   . GLU A 1 17 ? -1.890  5.636   -1.969  1.00 0.00 ? 15 GLU P CB   7  
ATOM 7364  C CG   . GLU A 1 17 ? -0.763  6.681   -2.057  1.00 0.00 ? 15 GLU P CG   7  
ATOM 7365  C CD   . GLU A 1 17 ? -0.831  7.583   -3.310  1.00 0.00 ? 15 GLU P CD   7  
ATOM 7366  O OE1  . GLU A 1 17 ? -1.173  7.099   -4.415  1.00 0.00 ? 15 GLU P OE1  7  
ATOM 7367  O OE2  . GLU A 1 17 ? -0.513  8.793   -3.201  1.00 0.00 ? 15 GLU P OE2  7  
ATOM 7368  H H    . GLU A 1 17 ? -2.897  7.432   -0.428  1.00 0.00 ? 15 GLU P H    7  
ATOM 7369  H HA   . GLU A 1 17 ? -3.396  6.575   -3.169  1.00 0.00 ? 15 GLU P HA   7  
ATOM 7370  H HB2  . GLU A 1 17 ? -1.826  5.145   -0.997  1.00 0.00 ? 15 GLU P HB2  7  
ATOM 7371  H HB3  . GLU A 1 17 ? -1.729  4.876   -2.735  1.00 0.00 ? 15 GLU P HB3  7  
ATOM 7372  H HG2  . GLU A 1 17 ? -0.798  7.300   -1.157  1.00 0.00 ? 15 GLU P HG2  7  
ATOM 7373  H HG3  . GLU A 1 17 ? 0.194   6.157   -2.040  1.00 0.00 ? 15 GLU P HG3  7  
ATOM 7374  N N    . LEU A 1 18 ? -4.892  4.960   -0.750  1.00 0.00 ? 16 LEU P N    7  
ATOM 7375  C CA   . LEU A 1 18 ? -6.000  4.058   -0.441  1.00 0.00 ? 16 LEU P CA   7  
ATOM 7376  C C    . LEU A 1 18 ? -7.313  4.543   -1.077  1.00 0.00 ? 16 LEU P C    7  
ATOM 7377  O O    . LEU A 1 18 ? -7.955  3.786   -1.805  1.00 0.00 ? 16 LEU P O    7  
ATOM 7378  C CB   . LEU A 1 18 ? -6.110  3.923   1.085   1.00 0.00 ? 16 LEU P CB   7  
ATOM 7379  C CG   . LEU A 1 18 ? -4.962  3.108   1.708   1.00 0.00 ? 16 LEU P CG   7  
ATOM 7380  C CD1  . LEU A 1 18 ? -4.799  3.441   3.186   1.00 0.00 ? 16 LEU P CD1  7  
ATOM 7381  C CD2  . LEU A 1 18 ? -5.222  1.608   1.575   1.00 0.00 ? 16 LEU P CD2  7  
ATOM 7382  H H    . LEU A 1 18 ? -4.509  5.512   0.009   1.00 0.00 ? 16 LEU P H    7  
ATOM 7383  H HA   . LEU A 1 18 ? -5.787  3.076   -0.865  1.00 0.00 ? 16 LEU P HA   7  
ATOM 7384  H HB2  . LEU A 1 18 ? -6.132  4.921   1.524   1.00 0.00 ? 16 LEU P HB2  7  
ATOM 7385  H HB3  . LEU A 1 18 ? -7.055  3.441   1.326   1.00 0.00 ? 16 LEU P HB3  7  
ATOM 7386  H HG   . LEU A 1 18 ? -4.021  3.341   1.210   1.00 0.00 ? 16 LEU P HG   7  
ATOM 7387  H HD11 . LEU A 1 18 ? -3.985  2.857   3.608   1.00 0.00 ? 16 LEU P HD11 7  
ATOM 7388  H HD12 . LEU A 1 18 ? -4.564  4.499   3.292   1.00 0.00 ? 16 LEU P HD12 7  
ATOM 7389  H HD13 . LEU A 1 18 ? -5.719  3.217   3.718   1.00 0.00 ? 16 LEU P HD13 7  
ATOM 7390  H HD21 . LEU A 1 18 ? -6.165  1.346   2.056   1.00 0.00 ? 16 LEU P HD21 7  
ATOM 7391  H HD22 . LEU A 1 18 ? -5.267  1.340   0.520   1.00 0.00 ? 16 LEU P HD22 7  
ATOM 7392  H HD23 . LEU A 1 18 ? -4.411  1.052   2.045   1.00 0.00 ? 16 LEU P HD23 7  
ATOM 7393  N N    . GLU A 1 19 ? -7.685  5.816   -0.899  1.00 0.00 ? 17 GLU P N    7  
ATOM 7394  C CA   . GLU A 1 19 ? -8.893  6.363   -1.539  1.00 0.00 ? 17 GLU P CA   7  
ATOM 7395  C C    . GLU A 1 19 ? -8.769  6.522   -3.066  1.00 0.00 ? 17 GLU P C    7  
ATOM 7396  O O    . GLU A 1 19 ? -9.783  6.464   -3.762  1.00 0.00 ? 17 GLU P O    7  
ATOM 7397  C CB   . GLU A 1 19 ? -9.380  7.651   -0.851  1.00 0.00 ? 17 GLU P CB   7  
ATOM 7398  C CG   . GLU A 1 19 ? -8.568  8.914   -1.165  1.00 0.00 ? 17 GLU P CG   7  
ATOM 7399  C CD   . GLU A 1 19 ? -9.197  10.150  -0.491  1.00 0.00 ? 17 GLU P CD   7  
ATOM 7400  O OE1  . GLU A 1 19 ? -9.042  10.332  0.740   1.00 0.00 ? 17 GLU P OE1  7  
ATOM 7401  O OE2  . GLU A 1 19 ? -9.866  10.949  -1.193  1.00 0.00 ? 17 GLU P OE2  7  
ATOM 7402  H H    . GLU A 1 19 ? -7.157  6.394   -0.252  1.00 0.00 ? 17 GLU P H    7  
ATOM 7403  H HA   . GLU A 1 19 ? -9.687  5.630   -1.395  1.00 0.00 ? 17 GLU P HA   7  
ATOM 7404  H HB2  . GLU A 1 19 ? -10.409 7.827   -1.166  1.00 0.00 ? 17 GLU P HB2  7  
ATOM 7405  H HB3  . GLU A 1 19 ? -9.388  7.491   0.227   1.00 0.00 ? 17 GLU P HB3  7  
ATOM 7406  H HG2  . GLU A 1 19 ? -7.547  8.777   -0.820  1.00 0.00 ? 17 GLU P HG2  7  
ATOM 7407  H HG3  . GLU A 1 19 ? -8.535  9.064   -2.246  1.00 0.00 ? 17 GLU P HG3  7  
ATOM 7408  N N    . ALA A 1 20 ? -7.550  6.661   -3.604  1.00 0.00 ? 18 ALA P N    7  
ATOM 7409  C CA   . ALA A 1 20 ? -7.300  6.683   -5.046  1.00 0.00 ? 18 ALA P CA   7  
ATOM 7410  C C    . ALA A 1 20 ? -7.395  5.283   -5.677  1.00 0.00 ? 18 ALA P C    7  
ATOM 7411  O O    . ALA A 1 20 ? -8.089  5.107   -6.680  1.00 0.00 ? 18 ALA P O    7  
ATOM 7412  C CB   . ALA A 1 20 ? -5.939  7.335   -5.316  1.00 0.00 ? 18 ALA P CB   7  
ATOM 7413  H H    . ALA A 1 20 ? -6.760  6.777   -2.980  1.00 0.00 ? 18 ALA P H    7  
ATOM 7414  H HA   . ALA A 1 20 ? -8.062  7.304   -5.523  1.00 0.00 ? 18 ALA P HA   7  
ATOM 7415  H HB1  . ALA A 1 20 ? -5.143  6.761   -4.841  1.00 0.00 ? 18 ALA P HB1  7  
ATOM 7416  H HB2  . ALA A 1 20 ? -5.757  7.371   -6.392  1.00 0.00 ? 18 ALA P HB2  7  
ATOM 7417  H HB3  . ALA A 1 20 ? -5.934  8.355   -4.928  1.00 0.00 ? 18 ALA P HB3  7  
ATOM 7418  N N    . THR A 1 21 ? -6.767  4.260   -5.084  1.00 0.00 ? 19 THR P N    7  
ATOM 7419  C CA   . THR A 1 21 ? -6.833  2.887   -5.624  1.00 0.00 ? 19 THR P CA   7  
ATOM 7420  C C    . THR A 1 21 ? -8.223  2.256   -5.450  1.00 0.00 ? 19 THR P C    7  
ATOM 7421  O O    . THR A 1 21 ? -8.634  1.437   -6.272  1.00 0.00 ? 19 THR P O    7  
ATOM 7422  C CB   . THR A 1 21 ? -5.704  2.008   -5.067  1.00 0.00 ? 19 THR P CB   7  
ATOM 7423  O OG1  . THR A 1 21 ? -5.483  0.933   -5.958  1.00 0.00 ? 19 THR P OG1  7  
ATOM 7424  C CG2  . THR A 1 21 ? -5.991  1.415   -3.690  1.00 0.00 ? 19 THR P CG2  7  
ATOM 7425  H H    . THR A 1 21 ? -6.192  4.439   -4.265  1.00 0.00 ? 19 THR P H    7  
ATOM 7426  H HA   . THR A 1 21 ? -6.654  2.962   -6.694  1.00 0.00 ? 19 THR P HA   7  
ATOM 7427  H HB   . THR A 1 21 ? -4.793  2.603   -5.017  1.00 0.00 ? 19 THR P HB   7  
ATOM 7428  H HG1  . THR A 1 21 ? -6.246  0.333   -5.884  1.00 0.00 ? 19 THR P HG1  7  
ATOM 7429  H HG21 . THR A 1 21 ? -5.054  1.184   -3.190  1.00 0.00 ? 19 THR P HG21 7  
ATOM 7430  H HG22 . THR A 1 21 ? -6.589  0.507   -3.794  1.00 0.00 ? 19 THR P HG22 7  
ATOM 7431  H HG23 . THR A 1 21 ? -6.518  2.138   -3.075  1.00 0.00 ? 19 THR P HG23 7  
ATOM 7432  N N    . PHE A 1 22 ? -8.997  2.717   -4.461  1.00 0.00 ? 20 PHE P N    7  
ATOM 7433  C CA   . PHE A 1 22 ? -10.415 2.387   -4.276  1.00 0.00 ? 20 PHE P CA   7  
ATOM 7434  C C    . PHE A 1 22 ? -11.281 2.783   -5.488  1.00 0.00 ? 20 PHE P C    7  
ATOM 7435  O O    . PHE A 1 22 ? -12.308 2.153   -5.736  1.00 0.00 ? 20 PHE P O    7  
ATOM 7436  C CB   . PHE A 1 22 ? -10.902 3.052   -2.975  1.00 0.00 ? 20 PHE P CB   7  
ATOM 7437  C CG   . PHE A 1 22 ? -12.383 2.924   -2.645  1.00 0.00 ? 20 PHE P CG   7  
ATOM 7438  C CD1  . PHE A 1 22 ? -12.996 1.658   -2.558  1.00 0.00 ? 20 PHE P CD1  7  
ATOM 7439  C CD2  . PHE A 1 22 ? -13.148 4.079   -2.391  1.00 0.00 ? 20 PHE P CD2  7  
ATOM 7440  C CE1  . PHE A 1 22 ? -14.360 1.548   -2.233  1.00 0.00 ? 20 PHE P CE1  7  
ATOM 7441  C CE2  . PHE A 1 22 ? -14.515 3.970   -2.072  1.00 0.00 ? 20 PHE P CE2  7  
ATOM 7442  C CZ   . PHE A 1 22 ? -15.121 2.705   -1.991  1.00 0.00 ? 20 PHE P CZ   7  
ATOM 7443  H H    . PHE A 1 22 ? -8.578  3.358   -3.799  1.00 0.00 ? 20 PHE P H    7  
ATOM 7444  H HA   . PHE A 1 22 ? -10.506 1.309   -4.155  1.00 0.00 ? 20 PHE P HA   7  
ATOM 7445  H HB2  . PHE A 1 22 ? -10.345 2.624   -2.143  1.00 0.00 ? 20 PHE P HB2  7  
ATOM 7446  H HB3  . PHE A 1 22 ? -10.649 4.110   -3.018  1.00 0.00 ? 20 PHE P HB3  7  
ATOM 7447  H HD1  . PHE A 1 22 ? -12.424 0.765   -2.749  1.00 0.00 ? 20 PHE P HD1  7  
ATOM 7448  H HD2  . PHE A 1 22 ? -12.689 5.055   -2.441  1.00 0.00 ? 20 PHE P HD2  7  
ATOM 7449  H HE1  . PHE A 1 22 ? -14.826 0.573   -2.177  1.00 0.00 ? 20 PHE P HE1  7  
ATOM 7450  H HE2  . PHE A 1 22 ? -15.102 4.860   -1.891  1.00 0.00 ? 20 PHE P HE2  7  
ATOM 7451  H HZ   . PHE A 1 22 ? -16.172 2.621   -1.747  1.00 0.00 ? 20 PHE P HZ   7  
ATOM 7452  N N    . GLN A 1 23 ? -10.857 3.768   -6.294  1.00 0.00 ? 21 GLN P N    7  
ATOM 7453  C CA   . GLN A 1 23 ? -11.580 4.169   -7.508  1.00 0.00 ? 21 GLN P CA   7  
ATOM 7454  C C    . GLN A 1 23 ? -11.428 3.160   -8.659  1.00 0.00 ? 21 GLN P C    7  
ATOM 7455  O O    . GLN A 1 23 ? -12.404 2.891   -9.364  1.00 0.00 ? 21 GLN P O    7  
ATOM 7456  C CB   . GLN A 1 23 ? -11.127 5.561   -7.984  1.00 0.00 ? 21 GLN P CB   7  
ATOM 7457  C CG   . GLN A 1 23 ? -11.179 6.680   -6.934  1.00 0.00 ? 21 GLN P CG   7  
ATOM 7458  C CD   . GLN A 1 23 ? -12.490 6.728   -6.155  1.00 0.00 ? 21 GLN P CD   7  
ATOM 7459  O OE1  . GLN A 1 23 ? -13.581 6.800   -6.706  1.00 0.00 ? 21 GLN P OE1  7  
ATOM 7460  N NE2  . GLN A 1 23 ? -12.430 6.676   -4.844  1.00 0.00 ? 21 GLN P NE2  7  
ATOM 7461  H H    . GLN A 1 23 ? -9.995  4.250   -6.067  1.00 0.00 ? 21 GLN P H    7  
ATOM 7462  H HA   . GLN A 1 23 ? -12.640 4.214   -7.263  1.00 0.00 ? 21 GLN P HA   7  
ATOM 7463  H HB2  . GLN A 1 23 ? -10.099 5.487   -8.335  1.00 0.00 ? 21 GLN P HB2  7  
ATOM 7464  H HB3  . GLN A 1 23 ? -11.751 5.854   -8.830  1.00 0.00 ? 21 GLN P HB3  7  
ATOM 7465  H HG2  . GLN A 1 23 ? -10.351 6.542   -6.243  1.00 0.00 ? 21 GLN P HG2  7  
ATOM 7466  H HG3  . GLN A 1 23 ? -11.029 7.641   -7.427  1.00 0.00 ? 21 GLN P HG3  7  
ATOM 7467  H HE21 . GLN A 1 23 ? -11.523 6.622   -4.386  1.00 0.00 ? 21 GLN P HE21 7  
ATOM 7468  H HE22 . GLN A 1 23 ? -13.291 6.683   -4.326  1.00 0.00 ? 21 GLN P HE22 7  
ATOM 7469  N N    . ARG A 1 24 ? -10.229 2.579   -8.842  1.00 0.00 ? 22 ARG P N    7  
ATOM 7470  C CA   . ARG A 1 24 ? -9.964  1.550   -9.873  1.00 0.00 ? 22 ARG P CA   7  
ATOM 7471  C C    . ARG A 1 24 ? -10.355 0.139   -9.421  1.00 0.00 ? 22 ARG P C    7  
ATOM 7472  O O    . ARG A 1 24 ? -10.673 -0.704  -10.259 1.00 0.00 ? 22 ARG P O    7  
ATOM 7473  C CB   . ARG A 1 24 ? -8.504  1.603   -10.373 1.00 0.00 ? 22 ARG P CB   7  
ATOM 7474  C CG   . ARG A 1 24 ? -7.454  1.256   -9.305  1.00 0.00 ? 22 ARG P CG   7  
ATOM 7475  C CD   . ARG A 1 24 ? -6.055  1.017   -9.886  1.00 0.00 ? 22 ARG P CD   7  
ATOM 7476  N NE   . ARG A 1 24 ? -5.140  0.598   -8.807  1.00 0.00 ? 22 ARG P NE   7  
ATOM 7477  C CZ   . ARG A 1 24 ? -4.258  -0.384  -8.800  1.00 0.00 ? 22 ARG P CZ   7  
ATOM 7478  N NH1  . ARG A 1 24 ? -3.926  -1.092  -9.838  1.00 0.00 ? 22 ARG P NH1  7  
ATOM 7479  N NH2  . ARG A 1 24 ? -3.670  -0.710  -7.694  1.00 0.00 ? 22 ARG P NH2  7  
ATOM 7480  H H    . ARG A 1 24 ? -9.485  2.833   -8.203  1.00 0.00 ? 22 ARG P H    7  
ATOM 7481  H HA   . ARG A 1 24 ? -10.598 1.763   -10.737 1.00 0.00 ? 22 ARG P HA   7  
ATOM 7482  H HB2  . ARG A 1 24 ? -8.408  0.894   -11.197 1.00 0.00 ? 22 ARG P HB2  7  
ATOM 7483  H HB3  . ARG A 1 24 ? -8.294  2.599   -10.767 1.00 0.00 ? 22 ARG P HB3  7  
ATOM 7484  H HG2  . ARG A 1 24 ? -7.403  2.071   -8.588  1.00 0.00 ? 22 ARG P HG2  7  
ATOM 7485  H HG3  . ARG A 1 24 ? -7.748  0.347   -8.783  1.00 0.00 ? 22 ARG P HG3  7  
ATOM 7486  H HD2  . ARG A 1 24 ? -6.119  0.244   -10.653 1.00 0.00 ? 22 ARG P HD2  7  
ATOM 7487  H HD3  . ARG A 1 24 ? -5.689  1.938   -10.343 1.00 0.00 ? 22 ARG P HD3  7  
ATOM 7488  H HE   . ARG A 1 24 ? -5.265  1.044   -7.907  1.00 0.00 ? 22 ARG P HE   7  
ATOM 7489  H HH11 . ARG A 1 24 ? -4.318  -0.893  -10.741 1.00 0.00 ? 22 ARG P HH11 7  
ATOM 7490  H HH12 . ARG A 1 24 ? -3.247  -1.836  -9.693  1.00 0.00 ? 22 ARG P HH12 7  
ATOM 7491  H HH21 . ARG A 1 24 ? -3.936  -0.247  -6.835  1.00 0.00 ? 22 ARG P HH21 7  
ATOM 7492  H HH22 . ARG A 1 24 ? -3.020  -1.493  -7.723  1.00 0.00 ? 22 ARG P HH22 7  
ATOM 7493  N N    . ASN A 1 25 ? -10.329 -0.114  -8.111  1.00 0.00 ? 23 ASN P N    7  
ATOM 7494  C CA   . ASN A 1 25 ? -10.565 -1.423  -7.510  1.00 0.00 ? 23 ASN P CA   7  
ATOM 7495  C C    . ASN A 1 25 ? -11.425 -1.286  -6.246  1.00 0.00 ? 23 ASN P C    7  
ATOM 7496  O O    . ASN A 1 25 ? -10.939 -0.858  -5.204  1.00 0.00 ? 23 ASN P O    7  
ATOM 7497  C CB   . ASN A 1 25 ? -9.193  -2.063  -7.217  1.00 0.00 ? 23 ASN P CB   7  
ATOM 7498  C CG   . ASN A 1 25 ? -9.306  -3.535  -6.854  1.00 0.00 ? 23 ASN P CG   7  
ATOM 7499  O OD1  . ASN A 1 25 ? -10.364 -4.054  -6.525  1.00 0.00 ? 23 ASN P OD1  7  
ATOM 7500  N ND2  . ASN A 1 25 ? -8.212  -4.255  -6.930  1.00 0.00 ? 23 ASN P ND2  7  
ATOM 7501  H H    . ASN A 1 25 ? -10.009 0.626   -7.495  1.00 0.00 ? 23 ASN P H    7  
ATOM 7502  H HA   . ASN A 1 25 ? -11.101 -2.064  -8.211  1.00 0.00 ? 23 ASN P HA   7  
ATOM 7503  H HB2  . ASN A 1 25 ? -8.563  -1.982  -8.102  1.00 0.00 ? 23 ASN P HB2  7  
ATOM 7504  H HB3  . ASN A 1 25 ? -8.695  -1.528  -6.403  1.00 0.00 ? 23 ASN P HB3  7  
ATOM 7505  H HD21 . ASN A 1 25 ? -7.349  -3.828  -7.222  1.00 0.00 ? 23 ASN P HD21 7  
ATOM 7506  H HD22 . ASN A 1 25 ? -8.268  -5.239  -6.723  1.00 0.00 ? 23 ASN P HD22 7  
ATOM 7507  N N    . HIS A 1 26 ? -12.702 -1.666  -6.327  1.00 0.00 ? 24 HIS P N    7  
ATOM 7508  C CA   . HIS A 1 26 ? -13.654 -1.551  -5.210  1.00 0.00 ? 24 HIS P CA   7  
ATOM 7509  C C    . HIS A 1 26 ? -13.597 -2.750  -4.242  1.00 0.00 ? 24 HIS P C    7  
ATOM 7510  O O    . HIS A 1 26 ? -14.228 -2.711  -3.183  1.00 0.00 ? 24 HIS P O    7  
ATOM 7511  C CB   . HIS A 1 26 ? -15.070 -1.330  -5.773  1.00 0.00 ? 24 HIS P CB   7  
ATOM 7512  C CG   . HIS A 1 26 ? -15.328 0.053   -6.339  1.00 0.00 ? 24 HIS P CG   7  
ATOM 7513  N ND1  . HIS A 1 26 ? -16.364 0.902   -5.932  1.00 0.00 ? 24 HIS P ND1  7  
ATOM 7514  C CD2  . HIS A 1 26 ? -14.627 0.674   -7.336  1.00 0.00 ? 24 HIS P CD2  7  
ATOM 7515  C CE1  . HIS A 1 26 ? -16.252 2.014   -6.679  1.00 0.00 ? 24 HIS P CE1  7  
ATOM 7516  N NE2  . HIS A 1 26 ? -15.219 1.901   -7.533  1.00 0.00 ? 24 HIS P NE2  7  
ATOM 7517  H H    . HIS A 1 26 ? -13.041 -2.034  -7.205  1.00 0.00 ? 24 HIS P H    7  
ATOM 7518  H HA   . HIS A 1 26 ? -13.401 -0.671  -4.615  1.00 0.00 ? 24 HIS P HA   7  
ATOM 7519  H HB2  . HIS A 1 26 ? -15.275 -2.069  -6.548  1.00 0.00 ? 24 HIS P HB2  7  
ATOM 7520  H HB3  . HIS A 1 26 ? -15.791 -1.493  -4.971  1.00 0.00 ? 24 HIS P HB3  7  
ATOM 7521  H HD2  . HIS A 1 26 ? -13.760 0.292   -7.856  1.00 0.00 ? 24 HIS P HD2  7  
ATOM 7522  H HE1  . HIS A 1 26 ? -16.902 2.879   -6.608  1.00 0.00 ? 24 HIS P HE1  7  
ATOM 7523  H HE2  . HIS A 1 26 ? -14.923 2.610   -8.195  1.00 0.00 ? 24 HIS P HE2  7  
ATOM 7524  N N    . TYR A 1 27 ? -12.865 -3.815  -4.584  1.00 0.00 ? 25 TYR P N    7  
ATOM 7525  C CA   . TYR A 1 27 ? -12.801 -5.075  -3.826  1.00 0.00 ? 25 TYR P CA   7  
ATOM 7526  C C    . TYR A 1 27 ? -11.447 -5.804  -4.030  1.00 0.00 ? 25 TYR P C    7  
ATOM 7527  O O    . TYR A 1 27 ? -11.401 -6.888  -4.622  1.00 0.00 ? 25 TYR P O    7  
ATOM 7528  C CB   . TYR A 1 27 ? -14.037 -5.945  -4.164  1.00 0.00 ? 25 TYR P CB   7  
ATOM 7529  C CG   . TYR A 1 27 ? -14.422 -6.054  -5.635  1.00 0.00 ? 25 TYR P CG   7  
ATOM 7530  C CD1  . TYR A 1 27 ? -15.305 -5.109  -6.198  1.00 0.00 ? 25 TYR P CD1  7  
ATOM 7531  C CD2  . TYR A 1 27 ? -13.928 -7.103  -6.437  1.00 0.00 ? 25 TYR P CD2  7  
ATOM 7532  C CE1  . TYR A 1 27 ? -15.661 -5.185  -7.558  1.00 0.00 ? 25 TYR P CE1  7  
ATOM 7533  C CE2  . TYR A 1 27 ? -14.284 -7.187  -7.797  1.00 0.00 ? 25 TYR P CE2  7  
ATOM 7534  C CZ   . TYR A 1 27 ? -15.147 -6.226  -8.365  1.00 0.00 ? 25 TYR P CZ   7  
ATOM 7535  O OH   . TYR A 1 27 ? -15.485 -6.313  -9.681  1.00 0.00 ? 25 TYR P OH   7  
ATOM 7536  H H    . TYR A 1 27 ? -12.335 -3.768  -5.447  1.00 0.00 ? 25 TYR P H    7  
ATOM 7537  H HA   . TYR A 1 27 ? -12.861 -4.845  -2.763  1.00 0.00 ? 25 TYR P HA   7  
ATOM 7538  H HB2  . TYR A 1 27 ? -13.895 -6.947  -3.753  1.00 0.00 ? 25 TYR P HB2  7  
ATOM 7539  H HB3  . TYR A 1 27 ? -14.890 -5.522  -3.632  1.00 0.00 ? 25 TYR P HB3  7  
ATOM 7540  H HD1  . TYR A 1 27 ? -15.713 -4.320  -5.580  1.00 0.00 ? 25 TYR P HD1  7  
ATOM 7541  H HD2  . TYR A 1 27 ? -13.271 -7.849  -6.009  1.00 0.00 ? 25 TYR P HD2  7  
ATOM 7542  H HE1  . TYR A 1 27 ? -16.330 -4.452  -7.985  1.00 0.00 ? 25 TYR P HE1  7  
ATOM 7543  H HE2  . TYR A 1 27 ? -13.899 -7.987  -8.414  1.00 0.00 ? 25 TYR P HE2  7  
ATOM 7544  H HH   . TYR A 1 27 ? -16.088 -5.601  -9.956  1.00 0.00 ? 25 TYR P HH   7  
ATOM 7545  N N    . PRO A 1 28 ? -10.319 -5.228  -3.565  1.00 0.00 ? 26 PRO P N    7  
ATOM 7546  C CA   . PRO A 1 28 ? -8.986  -5.786  -3.799  1.00 0.00 ? 26 PRO P CA   7  
ATOM 7547  C C    . PRO A 1 28 ? -8.754  -7.120  -3.073  1.00 0.00 ? 26 PRO P C    7  
ATOM 7548  O O    . PRO A 1 28 ? -9.303  -7.401  -2.003  1.00 0.00 ? 26 PRO P O    7  
ATOM 7549  C CB   . PRO A 1 28 ? -8.001  -4.695  -3.375  1.00 0.00 ? 26 PRO P CB   7  
ATOM 7550  C CG   . PRO A 1 28 ? -8.769  -3.960  -2.282  1.00 0.00 ? 26 PRO P CG   7  
ATOM 7551  C CD   . PRO A 1 28 ? -10.206 -3.992  -2.804  1.00 0.00 ? 26 PRO P CD   7  
ATOM 7552  H HA   . PRO A 1 28 ? -8.862  -5.965  -4.865  1.00 0.00 ? 26 PRO P HA   7  
ATOM 7553  H HB2  . PRO A 1 28 ? -7.053  -5.097  -3.024  1.00 0.00 ? 26 PRO P HB2  7  
ATOM 7554  H HB3  . PRO A 1 28 ? -7.823  -4.017  -4.209  1.00 0.00 ? 26 PRO P HB3  7  
ATOM 7555  H HG2  . PRO A 1 28 ? -8.707  -4.522  -1.350  1.00 0.00 ? 26 PRO P HG2  7  
ATOM 7556  H HG3  . PRO A 1 28 ? -8.400  -2.946  -2.148  1.00 0.00 ? 26 PRO P HG3  7  
ATOM 7557  H HD2  . PRO A 1 28 ? -10.909 -3.970  -1.971  1.00 0.00 ? 26 PRO P HD2  7  
ATOM 7558  H HD3  . PRO A 1 28 ? -10.373 -3.140  -3.466  1.00 0.00 ? 26 PRO P HD3  7  
ATOM 7559  N N    . ASP A 1 29 ? -7.890  -7.934  -3.671  1.00 0.00 ? 27 ASP P N    7  
ATOM 7560  C CA   . ASP A 1 29 ? -7.612  -9.336  -3.323  1.00 0.00 ? 27 ASP P CA   7  
ATOM 7561  C C    . ASP A 1 29 ? -6.191  -9.488  -2.752  1.00 0.00 ? 27 ASP P C    7  
ATOM 7562  O O    . ASP A 1 29 ? -5.435  -8.522  -2.722  1.00 0.00 ? 27 ASP P O    7  
ATOM 7563  C CB   . ASP A 1 29 ? -7.836  -10.198 -4.579  1.00 0.00 ? 27 ASP P CB   7  
ATOM 7564  C CG   . ASP A 1 29 ? -7.840  -11.717 -4.325  1.00 0.00 ? 27 ASP P CG   7  
ATOM 7565  O OD1  . ASP A 1 29 ? -8.081  -12.146 -3.171  1.00 0.00 ? 27 ASP P OD1  7  
ATOM 7566  O OD2  . ASP A 1 29 ? -7.578  -12.484 -5.280  1.00 0.00 ? 27 ASP P OD2  7  
ATOM 7567  H H    . ASP A 1 29 ? -7.349  -7.531  -4.432  1.00 0.00 ? 27 ASP P H    7  
ATOM 7568  H HA   . ASP A 1 29 ? -8.316  -9.663  -2.563  1.00 0.00 ? 27 ASP P HA   7  
ATOM 7569  H HB2  . ASP A 1 29 ? -8.799  -9.932  -5.016  1.00 0.00 ? 27 ASP P HB2  7  
ATOM 7570  H HB3  . ASP A 1 29 ? -7.056  -9.958  -5.304  1.00 0.00 ? 27 ASP P HB3  7  
ATOM 7571  N N    . MET A 1 30 ? -5.778  -10.687 -2.336  1.00 0.00 ? 28 MET P N    7  
ATOM 7572  C CA   . MET A 1 30 ? -4.441  -10.930 -1.760  1.00 0.00 ? 28 MET P CA   7  
ATOM 7573  C C    . MET A 1 30 ? -3.275  -10.435 -2.641  1.00 0.00 ? 28 MET P C    7  
ATOM 7574  O O    . MET A 1 30 ? -2.205  -10.122 -2.124  1.00 0.00 ? 28 MET P O    7  
ATOM 7575  C CB   . MET A 1 30 ? -4.259  -12.425 -1.450  1.00 0.00 ? 28 MET P CB   7  
ATOM 7576  C CG   . MET A 1 30 ? -4.239  -13.317 -2.704  1.00 0.00 ? 28 MET P CG   7  
ATOM 7577  S SD   . MET A 1 30 ? -3.598  -14.991 -2.441  1.00 0.00 ? 28 MET P SD   7  
ATOM 7578  C CE   . MET A 1 30 ? -1.822  -14.604 -2.398  1.00 0.00 ? 28 MET P CE   7  
ATOM 7579  H H    . MET A 1 30 ? -6.439  -11.457 -2.406  1.00 0.00 ? 28 MET P H    7  
ATOM 7580  H HA   . MET A 1 30 ? -4.378  -10.384 -0.818  1.00 0.00 ? 28 MET P HA   7  
ATOM 7581  H HB2  . MET A 1 30 ? -3.315  -12.544 -0.917  1.00 0.00 ? 28 MET P HB2  7  
ATOM 7582  H HB3  . MET A 1 30 ? -5.058  -12.760 -0.787  1.00 0.00 ? 28 MET P HB3  7  
ATOM 7583  H HG2  . MET A 1 30 ? -5.249  -13.377 -3.104  1.00 0.00 ? 28 MET P HG2  7  
ATOM 7584  H HG3  . MET A 1 30 ? -3.617  -12.865 -3.473  1.00 0.00 ? 28 MET P HG3  7  
ATOM 7585  H HE1  . MET A 1 30 ? -1.595  -13.992 -1.525  1.00 0.00 ? 28 MET P HE1  7  
ATOM 7586  H HE2  . MET A 1 30 ? -1.247  -15.529 -2.344  1.00 0.00 ? 28 MET P HE2  7  
ATOM 7587  H HE3  . MET A 1 30 ? -1.541  -14.055 -3.298  1.00 0.00 ? 28 MET P HE3  7  
ATOM 7588  N N    . SER A 1 31 ? -3.480  -10.348 -3.960  1.00 0.00 ? 29 SER P N    7  
ATOM 7589  C CA   . SER A 1 31 ? -2.488  -9.844  -4.916  1.00 0.00 ? 29 SER P CA   7  
ATOM 7590  C C    . SER A 1 31 ? -2.549  -8.313  -5.049  1.00 0.00 ? 29 SER P C    7  
ATOM 7591  O O    . SER A 1 31 ? -1.524  -7.632  -4.967  1.00 0.00 ? 29 SER P O    7  
ATOM 7592  C CB   . SER A 1 31 ? -2.694  -10.528 -6.273  1.00 0.00 ? 29 SER P CB   7  
ATOM 7593  O OG   . SER A 1 31 ? -1.661  -10.171 -7.176  1.00 0.00 ? 29 SER P OG   7  
ATOM 7594  H H    . SER A 1 31 ? -4.396  -10.598 -4.302  1.00 0.00 ? 29 SER P H    7  
ATOM 7595  H HA   . SER A 1 31 ? -1.500  -10.126 -4.554  1.00 0.00 ? 29 SER P HA   7  
ATOM 7596  H HB2  . SER A 1 31 ? -2.682  -11.611 -6.129  1.00 0.00 ? 29 SER P HB2  7  
ATOM 7597  H HB3  . SER A 1 31 ? -3.661  -10.240 -6.688  1.00 0.00 ? 29 SER P HB3  7  
ATOM 7598  H HG   . SER A 1 31 ? -1.803  -10.652 -8.015  1.00 0.00 ? 29 SER P HG   7  
ATOM 7599  N N    . THR A 1 32 ? -3.753  -7.741  -5.191  1.00 0.00 ? 30 THR P N    7  
ATOM 7600  C CA   . THR A 1 32 ? -3.953  -6.292  -5.380  1.00 0.00 ? 30 THR P CA   7  
ATOM 7601  C C    . THR A 1 32 ? -3.830  -5.484  -4.088  1.00 0.00 ? 30 THR P C    7  
ATOM 7602  O O    . THR A 1 32 ? -3.281  -4.388  -4.118  1.00 0.00 ? 30 THR P O    7  
ATOM 7603  C CB   . THR A 1 32 ? -5.274  -5.965  -6.093  1.00 0.00 ? 30 THR P CB   7  
ATOM 7604  O OG1  . THR A 1 32 ? -6.286  -6.907  -5.818  1.00 0.00 ? 30 THR P OG1  7  
ATOM 7605  C CG2  . THR A 1 32 ? -5.089  -5.952  -7.609  1.00 0.00 ? 30 THR P CG2  7  
ATOM 7606  H H    . THR A 1 32 ? -4.577  -8.324  -5.174  1.00 0.00 ? 30 THR P H    7  
ATOM 7607  H HA   . THR A 1 32 ? -3.156  -5.931  -6.025  1.00 0.00 ? 30 THR P HA   7  
ATOM 7608  H HB   . THR A 1 32 ? -5.622  -4.987  -5.769  1.00 0.00 ? 30 THR P HB   7  
ATOM 7609  H HG1  . THR A 1 32 ? -6.337  -7.510  -6.580  1.00 0.00 ? 30 THR P HG1  7  
ATOM 7610  H HG21 . THR A 1 32 ? -6.045  -5.780  -8.103  1.00 0.00 ? 30 THR P HG21 7  
ATOM 7611  H HG22 . THR A 1 32 ? -4.673  -6.901  -7.947  1.00 0.00 ? 30 THR P HG22 7  
ATOM 7612  H HG23 . THR A 1 32 ? -4.405  -5.147  -7.885  1.00 0.00 ? 30 THR P HG23 7  
ATOM 7613  N N    . ARG A 1 33 ? -4.243  -6.016  -2.935  1.00 0.00 ? 31 ARG P N    7  
ATOM 7614  C CA   . ARG A 1 33 ? -3.976  -5.419  -1.615  1.00 0.00 ? 31 ARG P CA   7  
ATOM 7615  C C    . ARG A 1 33 ? -2.476  -5.286  -1.346  1.00 0.00 ? 31 ARG P C    7  
ATOM 7616  O O    . ARG A 1 33 ? -2.018  -4.223  -0.935  1.00 0.00 ? 31 ARG P O    7  
ATOM 7617  C CB   . ARG A 1 33 ? -4.633  -6.259  -0.508  1.00 0.00 ? 31 ARG P CB   7  
ATOM 7618  C CG   . ARG A 1 33 ? -6.166  -6.174  -0.530  1.00 0.00 ? 31 ARG P CG   7  
ATOM 7619  C CD   . ARG A 1 33 ? -6.833  -6.810  0.693   1.00 0.00 ? 31 ARG P CD   7  
ATOM 7620  N NE   . ARG A 1 33 ? -6.490  -8.232  0.873   1.00 0.00 ? 31 ARG P NE   7  
ATOM 7621  C CZ   . ARG A 1 33 ? -7.223  -9.296  0.619   1.00 0.00 ? 31 ARG P CZ   7  
ATOM 7622  N NH1  . ARG A 1 33 ? -8.371  -9.255  0.007   1.00 0.00 ? 31 ARG P NH1  7  
ATOM 7623  N NH2  . ARG A 1 33 ? -6.773  -10.446 1.012   1.00 0.00 ? 31 ARG P NH2  7  
ATOM 7624  H H    . ARG A 1 33 ? -4.755  -6.891  -2.975  1.00 0.00 ? 31 ARG P H    7  
ATOM 7625  H HA   . ARG A 1 33 ? -4.387  -4.408  -1.606  1.00 0.00 ? 31 ARG P HA   7  
ATOM 7626  H HB2  . ARG A 1 33 ? -4.316  -7.298  -0.626  1.00 0.00 ? 31 ARG P HB2  7  
ATOM 7627  H HB3  . ARG A 1 33 ? -4.285  -5.896  0.460   1.00 0.00 ? 31 ARG P HB3  7  
ATOM 7628  H HG2  . ARG A 1 33 ? -6.456  -5.124  -0.560  1.00 0.00 ? 31 ARG P HG2  7  
ATOM 7629  H HG3  . ARG A 1 33 ? -6.544  -6.660  -1.424  1.00 0.00 ? 31 ARG P HG3  7  
ATOM 7630  H HD2  . ARG A 1 33 ? -6.507  -6.270  1.578   1.00 0.00 ? 31 ARG P HD2  7  
ATOM 7631  H HD3  . ARG A 1 33 ? -7.913  -6.686  0.607   1.00 0.00 ? 31 ARG P HD3  7  
ATOM 7632  H HE   . ARG A 1 33 ? -5.616  -8.445  1.351   1.00 0.00 ? 31 ARG P HE   7  
ATOM 7633  H HH11 . ARG A 1 33 ? -8.685  -8.392  -0.425  1.00 0.00 ? 31 ARG P HH11 7  
ATOM 7634  H HH12 . ARG A 1 33 ? -8.893  -10.099 -0.146  1.00 0.00 ? 31 ARG P HH12 7  
ATOM 7635  H HH21 . ARG A 1 33 ? -5.875  -10.440 1.504   1.00 0.00 ? 31 ARG P HH21 7  
ATOM 7636  H HH22 . ARG A 1 33 ? -7.273  -11.301 0.846   1.00 0.00 ? 31 ARG P HH22 7  
ATOM 7637  N N    . GLU A 1 34 ? -1.697  -6.329  -1.632  1.00 0.00 ? 32 GLU P N    7  
ATOM 7638  C CA   . GLU A 1 34 ? -0.229  -6.259  -1.579  1.00 0.00 ? 32 GLU P CA   7  
ATOM 7639  C C    . GLU A 1 34 ? 0.327   -5.224  -2.568  1.00 0.00 ? 32 GLU P C    7  
ATOM 7640  O O    . GLU A 1 34 ? 1.181   -4.425  -2.194  1.00 0.00 ? 32 GLU P O    7  
ATOM 7641  C CB   . GLU A 1 34 ? 0.406   -7.631  -1.869  1.00 0.00 ? 32 GLU P CB   7  
ATOM 7642  C CG   . GLU A 1 34 ? 0.286   -8.602  -0.688  1.00 0.00 ? 32 GLU P CG   7  
ATOM 7643  C CD   . GLU A 1 34 ? 0.973   -9.968  -0.926  1.00 0.00 ? 32 GLU P CD   7  
ATOM 7644  O OE1  . GLU A 1 34 ? 1.619   -10.189 -1.982  1.00 0.00 ? 32 GLU P OE1  7  
ATOM 7645  O OE2  . GLU A 1 34 ? 0.909   -10.834 -0.019  1.00 0.00 ? 32 GLU P OE2  7  
ATOM 7646  H H    . GLU A 1 34 ? -2.138  -7.181  -1.938  1.00 0.00 ? 32 GLU P H    7  
ATOM 7647  H HA   . GLU A 1 34 ? 0.070   -5.937  -0.580  1.00 0.00 ? 32 GLU P HA   7  
ATOM 7648  H HB2  . GLU A 1 34 ? -0.055  -8.068  -2.754  1.00 0.00 ? 32 GLU P HB2  7  
ATOM 7649  H HB3  . GLU A 1 34 ? 1.466   -7.475  -2.071  1.00 0.00 ? 32 GLU P HB3  7  
ATOM 7650  H HG2  . GLU A 1 34 ? 0.737   -8.126  0.186   1.00 0.00 ? 32 GLU P HG2  7  
ATOM 7651  H HG3  . GLU A 1 34 ? -0.770  -8.763  -0.471  1.00 0.00 ? 32 GLU P HG3  7  
ATOM 7652  N N    . GLU A 1 35 ? -0.187  -5.181  -3.802  1.00 0.00 ? 33 GLU P N    7  
ATOM 7653  C CA   . GLU A 1 35 ? 0.285   -4.266  -4.857  1.00 0.00 ? 33 GLU P CA   7  
ATOM 7654  C C    . GLU A 1 35 ? 0.281   -2.796  -4.416  1.00 0.00 ? 33 GLU P C    7  
ATOM 7655  O O    . GLU A 1 35 ? 1.223   -2.076  -4.743  1.00 0.00 ? 33 GLU P O    7  
ATOM 7656  C CB   . GLU A 1 35 ? -0.565  -4.443  -6.134  1.00 0.00 ? 33 GLU P CB   7  
ATOM 7657  C CG   . GLU A 1 35 ? -0.157  -3.532  -7.302  1.00 0.00 ? 33 GLU P CG   7  
ATOM 7658  C CD   . GLU A 1 35 ? -1.137  -3.663  -8.483  1.00 0.00 ? 33 GLU P CD   7  
ATOM 7659  O OE1  . GLU A 1 35 ? -0.944  -4.553  -9.347  1.00 0.00 ? 33 GLU P OE1  7  
ATOM 7660  O OE2  . GLU A 1 35 ? -2.098  -2.857  -8.559  1.00 0.00 ? 33 GLU P OE2  7  
ATOM 7661  H H    . GLU A 1 35 ? -0.872  -5.886  -4.046  1.00 0.00 ? 33 GLU P H    7  
ATOM 7662  H HA   . GLU A 1 35 ? 1.321   -4.521  -5.082  1.00 0.00 ? 33 GLU P HA   7  
ATOM 7663  H HB2  . GLU A 1 35 ? -0.500  -5.481  -6.462  1.00 0.00 ? 33 GLU P HB2  7  
ATOM 7664  H HB3  . GLU A 1 35 ? -1.601  -4.221  -5.902  1.00 0.00 ? 33 GLU P HB3  7  
ATOM 7665  H HG2  . GLU A 1 35 ? -0.157  -2.490  -6.976  1.00 0.00 ? 33 GLU P HG2  7  
ATOM 7666  H HG3  . GLU A 1 35 ? 0.858   -3.782  -7.614  1.00 0.00 ? 33 GLU P HG3  7  
ATOM 7667  N N    . ILE A 1 36 ? -0.727  -2.345  -3.658  1.00 0.00 ? 34 ILE P N    7  
ATOM 7668  C CA   . ILE A 1 36 ? -0.788  -0.960  -3.153  1.00 0.00 ? 34 ILE P CA   7  
ATOM 7669  C C    . ILE A 1 36 ? 0.041   -0.789  -1.872  1.00 0.00 ? 34 ILE P C    7  
ATOM 7670  O O    . ILE A 1 36 ? 0.637   0.266   -1.652  1.00 0.00 ? 34 ILE P O    7  
ATOM 7671  C CB   . ILE A 1 36 ? -2.247  -0.438  -3.032  1.00 0.00 ? 34 ILE P CB   7  
ATOM 7672  C CG1  . ILE A 1 36 ? -2.953  -0.726  -1.690  1.00 0.00 ? 34 ILE P CG1  7  
ATOM 7673  C CG2  . ILE A 1 36 ? -3.122  -0.997  -4.168  1.00 0.00 ? 34 ILE P CG2  7  
ATOM 7674  C CD1  . ILE A 1 36 ? -2.727  0.364   -0.633  1.00 0.00 ? 34 ILE P CD1  7  
ATOM 7675  H H    . ILE A 1 36 ? -1.492  -2.978  -3.453  1.00 0.00 ? 34 ILE P H    7  
ATOM 7676  H HA   . ILE A 1 36 ? -0.317  -0.321  -3.899  1.00 0.00 ? 34 ILE P HA   7  
ATOM 7677  H HB   . ILE A 1 36 ? -2.214  0.645   -3.158  1.00 0.00 ? 34 ILE P HB   7  
ATOM 7678  H HG12 . ILE A 1 36 ? -4.031  -0.788  -1.849  1.00 0.00 ? 34 ILE P HG12 7  
ATOM 7679  H HG13 . ILE A 1 36 ? -2.621  -1.689  -1.307  1.00 0.00 ? 34 ILE P HG13 7  
ATOM 7680  H HG21 . ILE A 1 36 ? -2.585  -0.956  -5.115  1.00 0.00 ? 34 ILE P HG21 7  
ATOM 7681  H HG22 . ILE A 1 36 ? -3.406  -2.023  -3.946  1.00 0.00 ? 34 ILE P HG22 7  
ATOM 7682  H HG23 . ILE A 1 36 ? -4.039  -0.423  -4.252  1.00 0.00 ? 34 ILE P HG23 7  
ATOM 7683  H HD11 . ILE A 1 36 ? -3.110  1.319   -0.994  1.00 0.00 ? 34 ILE P HD11 7  
ATOM 7684  H HD12 . ILE A 1 36 ? -1.675  0.471   -0.382  1.00 0.00 ? 34 ILE P HD12 7  
ATOM 7685  H HD13 . ILE A 1 36 ? -3.260  0.087   0.271   1.00 0.00 ? 34 ILE P HD13 7  
ATOM 7686  N N    . ALA A 1 37 ? 0.125   -1.829  -1.036  1.00 0.00 ? 35 ALA P N    7  
ATOM 7687  C CA   . ALA A 1 37 ? 0.830   -1.805  0.248   1.00 0.00 ? 35 ALA P CA   7  
ATOM 7688  C C    . ALA A 1 37 ? 2.360   -1.708  0.083   1.00 0.00 ? 35 ALA P C    7  
ATOM 7689  O O    . ALA A 1 37 ? 3.059   -1.124  0.918   1.00 0.00 ? 35 ALA P O    7  
ATOM 7690  C CB   . ALA A 1 37 ? 0.437   -3.071  1.016   1.00 0.00 ? 35 ALA P CB   7  
ATOM 7691  H H    . ALA A 1 37 ? -0.319  -2.696  -1.311  1.00 0.00 ? 35 ALA P H    7  
ATOM 7692  H HA   . ALA A 1 37 ? 0.491   -0.941  0.812   1.00 0.00 ? 35 ALA P HA   7  
ATOM 7693  H HB1  . ALA A 1 37 ? 0.910   -3.066  1.992   1.00 0.00 ? 35 ALA P HB1  7  
ATOM 7694  H HB2  . ALA A 1 37 ? -0.642  -3.106  1.152   1.00 0.00 ? 35 ALA P HB2  7  
ATOM 7695  H HB3  . ALA A 1 37 ? 0.762   -3.958  0.474   1.00 0.00 ? 35 ALA P HB3  7  
ATOM 7696  N N    . VAL A 1 38 ? 2.864   -2.259  -1.024  1.00 0.00 ? 36 VAL P N    7  
ATOM 7697  C CA   . VAL A 1 38 ? 4.282   -2.459  -1.356  1.00 0.00 ? 36 VAL P CA   7  
ATOM 7698  C C    . VAL A 1 38 ? 5.095   -1.161  -1.444  1.00 0.00 ? 36 VAL P C    7  
ATOM 7699  O O    . VAL A 1 38 ? 6.282   -1.164  -1.114  1.00 0.00 ? 36 VAL P O    7  
ATOM 7700  C CB   . VAL A 1 38 ? 4.327   -3.289  -2.664  1.00 0.00 ? 36 VAL P CB   7  
ATOM 7701  C CG1  . VAL A 1 38 ? 5.497   -3.023  -3.612  1.00 0.00 ? 36 VAL P CG1  7  
ATOM 7702  C CG2  . VAL A 1 38 ? 4.316   -4.785  -2.327  1.00 0.00 ? 36 VAL P CG2  7  
ATOM 7703  H H    . VAL A 1 38 ? 2.191   -2.704  -1.642  1.00 0.00 ? 36 VAL P H    7  
ATOM 7704  H HA   . VAL A 1 38 ? 4.737   -3.033  -0.550  1.00 0.00 ? 36 VAL P HA   7  
ATOM 7705  H HB   . VAL A 1 38 ? 3.426   -3.072  -3.240  1.00 0.00 ? 36 VAL P HB   7  
ATOM 7706  H HG11 . VAL A 1 38 ? 5.406   -3.676  -4.481  1.00 0.00 ? 36 VAL P HG11 7  
ATOM 7707  H HG12 . VAL A 1 38 ? 5.457   -1.993  -3.966  1.00 0.00 ? 36 VAL P HG12 7  
ATOM 7708  H HG13 . VAL A 1 38 ? 6.446   -3.210  -3.109  1.00 0.00 ? 36 VAL P HG13 7  
ATOM 7709  H HG21 . VAL A 1 38 ? 3.529   -5.000  -1.605  1.00 0.00 ? 36 VAL P HG21 7  
ATOM 7710  H HG22 . VAL A 1 38 ? 4.119   -5.362  -3.231  1.00 0.00 ? 36 VAL P HG22 7  
ATOM 7711  H HG23 . VAL A 1 38 ? 5.275   -5.083  -1.901  1.00 0.00 ? 36 VAL P HG23 7  
ATOM 7712  N N    . TRP A 1 39 ? 4.468   -0.048  -1.835  1.00 0.00 ? 37 TRP P N    7  
ATOM 7713  C CA   . TRP A 1 39 ? 5.104   1.273   -1.974  1.00 0.00 ? 37 TRP P CA   7  
ATOM 7714  C C    . TRP A 1 39 ? 4.524   2.334   -1.025  1.00 0.00 ? 37 TRP P C    7  
ATOM 7715  O O    . TRP A 1 39 ? 4.889   3.510   -1.105  1.00 0.00 ? 37 TRP P O    7  
ATOM 7716  C CB   . TRP A 1 39 ? 5.077   1.705   -3.446  1.00 0.00 ? 37 TRP P CB   7  
ATOM 7717  C CG   . TRP A 1 39 ? 3.763   1.543   -4.138  1.00 0.00 ? 37 TRP P CG   7  
ATOM 7718  C CD1  . TRP A 1 39 ? 3.317   0.395   -4.688  1.00 0.00 ? 37 TRP P CD1  7  
ATOM 7719  C CD2  . TRP A 1 39 ? 2.695   2.517   -4.330  1.00 0.00 ? 37 TRP P CD2  7  
ATOM 7720  N NE1  . TRP A 1 39 ? 2.036   0.571   -5.154  1.00 0.00 ? 37 TRP P NE1  7  
ATOM 7721  C CE2  . TRP A 1 39 ? 1.593   1.861   -4.959  1.00 0.00 ? 37 TRP P CE2  7  
ATOM 7722  C CE3  . TRP A 1 39 ? 2.548   3.884   -4.026  1.00 0.00 ? 37 TRP P CE3  7  
ATOM 7723  C CZ2  . TRP A 1 39 ? 0.389   2.523   -5.243  1.00 0.00 ? 37 TRP P CZ2  7  
ATOM 7724  C CZ3  . TRP A 1 39 ? 1.352   4.565   -4.329  1.00 0.00 ? 37 TRP P CZ3  7  
ATOM 7725  C CH2  . TRP A 1 39 ? 0.272   3.887   -4.924  1.00 0.00 ? 37 TRP P CH2  7  
ATOM 7726  H H    . TRP A 1 39 ? 3.494   -0.119  -2.104  1.00 0.00 ? 37 TRP P H    7  
ATOM 7727  H HA   . TRP A 1 39 ? 6.149   1.187   -1.690  1.00 0.00 ? 37 TRP P HA   7  
ATOM 7728  H HB2  . TRP A 1 39 ? 5.395   2.743   -3.521  1.00 0.00 ? 37 TRP P HB2  7  
ATOM 7729  H HB3  . TRP A 1 39 ? 5.809   1.113   -3.989  1.00 0.00 ? 37 TRP P HB3  7  
ATOM 7730  H HD1  . TRP A 1 39 ? 3.861   -0.542  -4.704  1.00 0.00 ? 37 TRP P HD1  7  
ATOM 7731  H HE1  . TRP A 1 39 ? 1.482   -0.222  -5.471  1.00 0.00 ? 37 TRP P HE1  7  
ATOM 7732  H HE3  . TRP A 1 39 ? 3.373   4.402   -3.556  1.00 0.00 ? 37 TRP P HE3  7  
ATOM 7733  H HZ2  . TRP A 1 39 ? -0.430  1.992   -5.710  1.00 0.00 ? 37 TRP P HZ2  7  
ATOM 7734  H HZ3  . TRP A 1 39 ? 1.263   5.619   -4.101  1.00 0.00 ? 37 TRP P HZ3  7  
ATOM 7735  H HH2  . TRP A 1 39 ? -0.645  4.421   -5.141  1.00 0.00 ? 37 TRP P HH2  7  
ATOM 7736  N N    . THR A 1 40 ? 3.651   1.925   -0.099  1.00 0.00 ? 38 THR P N    7  
ATOM 7737  C CA   . THR A 1 40 ? 2.998   2.808   0.888   1.00 0.00 ? 38 THR P CA   7  
ATOM 7738  C C    . THR A 1 40 ? 3.391   2.497   2.335   1.00 0.00 ? 38 THR P C    7  
ATOM 7739  O O    . THR A 1 40 ? 2.860   3.111   3.258   1.00 0.00 ? 38 THR P O    7  
ATOM 7740  C CB   . THR A 1 40 ? 1.471   2.815   0.711   1.00 0.00 ? 38 THR P CB   7  
ATOM 7741  O OG1  . THR A 1 40 ? 0.955   1.514   0.822   1.00 0.00 ? 38 THR P OG1  7  
ATOM 7742  C CG2  . THR A 1 40 ? 1.076   3.353   -0.666  1.00 0.00 ? 38 THR P CG2  7  
ATOM 7743  H H    . THR A 1 40 ? 3.395   0.943   -0.094  1.00 0.00 ? 38 THR P H    7  
ATOM 7744  H HA   . THR A 1 40 ? 3.328   3.832   0.722   1.00 0.00 ? 38 THR P HA   7  
ATOM 7745  H HB   . THR A 1 40 ? 1.016   3.443   1.482   1.00 0.00 ? 38 THR P HB   7  
ATOM 7746  H HG1  . THR A 1 40 ? 0.860   1.174   -0.087  1.00 0.00 ? 38 THR P HG1  7  
ATOM 7747  H HG21 . THR A 1 40 ? -0.008  3.324   -0.775  1.00 0.00 ? 38 THR P HG21 7  
ATOM 7748  H HG22 . THR A 1 40 ? 1.534   2.754   -1.457  1.00 0.00 ? 38 THR P HG22 7  
ATOM 7749  H HG23 . THR A 1 40 ? 1.419   4.382   -0.766  1.00 0.00 ? 38 THR P HG23 7  
ATOM 7750  N N    . ASN A 1 41 ? 4.348   1.585   2.553   1.00 0.00 ? 39 ASN P N    7  
ATOM 7751  C CA   . ASN A 1 41 ? 4.797   1.122   3.876   1.00 0.00 ? 39 ASN P CA   7  
ATOM 7752  C C    . ASN A 1 41 ? 3.655   0.502   4.721   1.00 0.00 ? 39 ASN P C    7  
ATOM 7753  O O    . ASN A 1 41 ? 3.543   0.733   5.929   1.00 0.00 ? 39 ASN P O    7  
ATOM 7754  C CB   . ASN A 1 41 ? 5.596   2.244   4.573   1.00 0.00 ? 39 ASN P CB   7  
ATOM 7755  C CG   . ASN A 1 41 ? 6.626   1.729   5.569   1.00 0.00 ? 39 ASN P CG   7  
ATOM 7756  O OD1  . ASN A 1 41 ? 7.827   1.777   5.337   1.00 0.00 ? 39 ASN P OD1  7  
ATOM 7757  N ND2  . ASN A 1 41 ? 6.205   1.216   6.701   1.00 0.00 ? 39 ASN P ND2  7  
ATOM 7758  H H    . ASN A 1 41 ? 4.759   1.149   1.740   1.00 0.00 ? 39 ASN P H    7  
ATOM 7759  H HA   . ASN A 1 41 ? 5.495   0.304   3.689   1.00 0.00 ? 39 ASN P HA   7  
ATOM 7760  H HB2  . ASN A 1 41 ? 6.126   2.833   3.825   1.00 0.00 ? 39 ASN P HB2  7  
ATOM 7761  H HB3  . ASN A 1 41 ? 4.902   2.909   5.087   1.00 0.00 ? 39 ASN P HB3  7  
ATOM 7762  H HD21 . ASN A 1 41 ? 5.205   1.119   6.850   1.00 0.00 ? 39 ASN P HD21 7  
ATOM 7763  H HD22 . ASN A 1 41 ? 6.880   0.869   7.364   1.00 0.00 ? 39 ASN P HD22 7  
ATOM 7764  N N    . LEU A 1 42 ? 2.791   -0.277  4.066   1.00 0.00 ? 40 LEU P N    7  
ATOM 7765  C CA   . LEU A 1 42 ? 1.692   -1.044  4.665   1.00 0.00 ? 40 LEU P CA   7  
ATOM 7766  C C    . LEU A 1 42 ? 1.885   -2.561  4.454   1.00 0.00 ? 40 LEU P C    7  
ATOM 7767  O O    . LEU A 1 42 ? 2.855   -3.008  3.837   1.00 0.00 ? 40 LEU P O    7  
ATOM 7768  C CB   . LEU A 1 42 ? 0.360   -0.551  4.051   1.00 0.00 ? 40 LEU P CB   7  
ATOM 7769  C CG   . LEU A 1 42 ? -0.027  0.906   4.355   1.00 0.00 ? 40 LEU P CG   7  
ATOM 7770  C CD1  . LEU A 1 42 ? -1.333  1.242   3.636   1.00 0.00 ? 40 LEU P CD1  7  
ATOM 7771  C CD2  . LEU A 1 42 ? -0.246  1.127   5.850   1.00 0.00 ? 40 LEU P CD2  7  
ATOM 7772  H H    . LEU A 1 42 ? 2.944   -0.394  3.072   1.00 0.00 ? 40 LEU P H    7  
ATOM 7773  H HA   . LEU A 1 42 ? 1.665   -0.884  5.743   1.00 0.00 ? 40 LEU P HA   7  
ATOM 7774  H HB2  . LEU A 1 42 ? 0.423   -0.660  2.972   1.00 0.00 ? 40 LEU P HB2  7  
ATOM 7775  H HB3  . LEU A 1 42 ? -0.455  -1.188  4.393   1.00 0.00 ? 40 LEU P HB3  7  
ATOM 7776  H HG   . LEU A 1 42 ? 0.749   1.582   4.000   1.00 0.00 ? 40 LEU P HG   7  
ATOM 7777  H HD11 . LEU A 1 42 ? -1.193  1.123   2.561   1.00 0.00 ? 40 LEU P HD11 7  
ATOM 7778  H HD12 . LEU A 1 42 ? -2.131  0.581   3.973   1.00 0.00 ? 40 LEU P HD12 7  
ATOM 7779  H HD13 . LEU A 1 42 ? -1.604  2.279   3.836   1.00 0.00 ? 40 LEU P HD13 7  
ATOM 7780  H HD21 . LEU A 1 42 ? -0.976  0.416   6.226   1.00 0.00 ? 40 LEU P HD21 7  
ATOM 7781  H HD22 . LEU A 1 42 ? 0.696   1.002   6.381   1.00 0.00 ? 40 LEU P HD22 7  
ATOM 7782  H HD23 . LEU A 1 42 ? -0.607  2.139   6.025   1.00 0.00 ? 40 LEU P HD23 7  
ATOM 7783  N N    . THR A 1 43 ? 0.935   -3.355  4.954   1.00 0.00 ? 41 THR P N    7  
ATOM 7784  C CA   . THR A 1 43 ? 0.784   -4.792  4.655   1.00 0.00 ? 41 THR P CA   7  
ATOM 7785  C C    . THR A 1 43 ? -0.645  -5.062  4.174   1.00 0.00 ? 41 THR P C    7  
ATOM 7786  O O    . THR A 1 43 ? -1.538  -4.244  4.400   1.00 0.00 ? 41 THR P O    7  
ATOM 7787  C CB   . THR A 1 43 ? 1.188   -5.666  5.855   1.00 0.00 ? 41 THR P CB   7  
ATOM 7788  O OG1  . THR A 1 43 ? 1.148   -7.027  5.485   1.00 0.00 ? 41 THR P OG1  7  
ATOM 7789  C CG2  . THR A 1 43 ? 0.289   -5.486  7.080   1.00 0.00 ? 41 THR P CG2  7  
ATOM 7790  H H    . THR A 1 43 ? 0.172   -2.919  5.456   1.00 0.00 ? 41 THR P H    7  
ATOM 7791  H HA   . THR A 1 43 ? 1.447   -5.059  3.832   1.00 0.00 ? 41 THR P HA   7  
ATOM 7792  H HB   . THR A 1 43 ? 2.213   -5.414  6.135   1.00 0.00 ? 41 THR P HB   7  
ATOM 7793  H HG1  . THR A 1 43 ? 1.571   -7.539  6.198   1.00 0.00 ? 41 THR P HG1  7  
ATOM 7794  H HG21 . THR A 1 43 ? -0.746  -5.714  6.827   1.00 0.00 ? 41 THR P HG21 7  
ATOM 7795  H HG22 . THR A 1 43 ? 0.363   -4.460  7.437   1.00 0.00 ? 41 THR P HG22 7  
ATOM 7796  H HG23 . THR A 1 43 ? 0.618   -6.153  7.876   1.00 0.00 ? 41 THR P HG23 7  
ATOM 7797  N N    . GLU A 1 44 ? -0.907  -6.188  3.509   1.00 0.00 ? 42 GLU P N    7  
ATOM 7798  C CA   . GLU A 1 44 ? -2.210  -6.452  2.874   1.00 0.00 ? 42 GLU P CA   7  
ATOM 7799  C C    . GLU A 1 44 ? -3.386  -6.458  3.863   1.00 0.00 ? 42 GLU P C    7  
ATOM 7800  O O    . GLU A 1 44 ? -4.495  -6.062  3.505   1.00 0.00 ? 42 GLU P O    7  
ATOM 7801  C CB   . GLU A 1 44 ? -2.132  -7.734  2.036   1.00 0.00 ? 42 GLU P CB   7  
ATOM 7802  C CG   . GLU A 1 44 ? -2.152  -9.066  2.804   1.00 0.00 ? 42 GLU P CG   7  
ATOM 7803  C CD   . GLU A 1 44 ? -3.574  -9.578  3.118   1.00 0.00 ? 42 GLU P CD   7  
ATOM 7804  O OE1  . GLU A 1 44 ? -4.423  -9.628  2.197   1.00 0.00 ? 42 GLU P OE1  7  
ATOM 7805  O OE2  . GLU A 1 44 ? -3.840  -9.963  4.281   1.00 0.00 ? 42 GLU P OE2  7  
ATOM 7806  H H    . GLU A 1 44 ? -0.163  -6.869  3.411   1.00 0.00 ? 42 GLU P H    7  
ATOM 7807  H HA   . GLU A 1 44 ? -2.398  -5.637  2.176   1.00 0.00 ? 42 GLU P HA   7  
ATOM 7808  H HB2  . GLU A 1 44 ? -2.940  -7.728  1.309   1.00 0.00 ? 42 GLU P HB2  7  
ATOM 7809  H HB3  . GLU A 1 44 ? -1.201  -7.684  1.478   1.00 0.00 ? 42 GLU P HB3  7  
ATOM 7810  H HG2  . GLU A 1 44 ? -1.655  -9.809  2.181   1.00 0.00 ? 42 GLU P HG2  7  
ATOM 7811  H HG3  . GLU A 1 44 ? -1.565  -8.963  3.721   1.00 0.00 ? 42 GLU P HG3  7  
ATOM 7812  N N    . ALA A 1 45 ? -3.126  -6.812  5.125   1.00 0.00 ? 43 ALA P N    7  
ATOM 7813  C CA   . ALA A 1 45 ? -4.104  -6.765  6.208   1.00 0.00 ? 43 ALA P CA   7  
ATOM 7814  C C    . ALA A 1 45 ? -4.550  -5.328  6.541   1.00 0.00 ? 43 ALA P C    7  
ATOM 7815  O O    . ALA A 1 45 ? -5.740  -5.094  6.741   1.00 0.00 ? 43 ALA P O    7  
ATOM 7816  C CB   . ALA A 1 45 ? -3.514  -7.475  7.433   1.00 0.00 ? 43 ALA P CB   7  
ATOM 7817  H H    . ALA A 1 45 ? -2.194  -7.143  5.330   1.00 0.00 ? 43 ALA P H    7  
ATOM 7818  H HA   . ALA A 1 45 ? -4.990  -7.319  5.893   1.00 0.00 ? 43 ALA P HA   7  
ATOM 7819  H HB1  . ALA A 1 45 ? -4.254  -7.498  8.234   1.00 0.00 ? 43 ALA P HB1  7  
ATOM 7820  H HB2  . ALA A 1 45 ? -3.246  -8.501  7.173   1.00 0.00 ? 43 ALA P HB2  7  
ATOM 7821  H HB3  . ALA A 1 45 ? -2.626  -6.951  7.787   1.00 0.00 ? 43 ALA P HB3  7  
ATOM 7822  N N    . ARG A 1 46 ? -3.636  -4.342  6.524   1.00 0.00 ? 44 ARG P N    7  
ATOM 7823  C CA   . ARG A 1 46 ? -3.968  -2.909  6.673   1.00 0.00 ? 44 ARG P CA   7  
ATOM 7824  C C    . ARG A 1 46 ? -4.908  -2.444  5.569   1.00 0.00 ? 44 ARG P C    7  
ATOM 7825  O O    . ARG A 1 46 ? -5.899  -1.774  5.846   1.00 0.00 ? 44 ARG P O    7  
ATOM 7826  C CB   . ARG A 1 46 ? -2.702  -2.035  6.627   1.00 0.00 ? 44 ARG P CB   7  
ATOM 7827  C CG   . ARG A 1 46 ? -1.808  -2.118  7.869   1.00 0.00 ? 44 ARG P CG   7  
ATOM 7828  C CD   . ARG A 1 46 ? -2.538  -1.555  9.093   1.00 0.00 ? 44 ARG P CD   7  
ATOM 7829  N NE   . ARG A 1 46 ? -1.606  -0.936  10.052  1.00 0.00 ? 44 ARG P NE   7  
ATOM 7830  C CZ   . ARG A 1 46 ? -1.199  0.322   10.041  1.00 0.00 ? 44 ARG P CZ   7  
ATOM 7831  N NH1  . ARG A 1 46 ? -1.576  1.178   9.135   1.00 0.00 ? 44 ARG P NH1  7  
ATOM 7832  N NH2  . ARG A 1 46 ? -0.399  0.776   10.958  1.00 0.00 ? 44 ARG P NH2  7  
ATOM 7833  H H    . ARG A 1 46 ? -2.687  -4.593  6.284   1.00 0.00 ? 44 ARG P H    7  
ATOM 7834  H HA   . ARG A 1 46 ? -4.498  -2.752  7.615   1.00 0.00 ? 44 ARG P HA   7  
ATOM 7835  H HB2  . ARG A 1 46 ? -2.115  -2.287  5.749   1.00 0.00 ? 44 ARG P HB2  7  
ATOM 7836  H HB3  . ARG A 1 46 ? -3.001  -0.994  6.504   1.00 0.00 ? 44 ARG P HB3  7  
ATOM 7837  H HG2  . ARG A 1 46 ? -1.516  -3.151  8.061   1.00 0.00 ? 44 ARG P HG2  7  
ATOM 7838  H HG3  . ARG A 1 46 ? -0.907  -1.533  7.679   1.00 0.00 ? 44 ARG P HG3  7  
ATOM 7839  H HD2  . ARG A 1 46 ? -3.270  -0.814  8.769   1.00 0.00 ? 44 ARG P HD2  7  
ATOM 7840  H HD3  . ARG A 1 46 ? -3.081  -2.371  9.571   1.00 0.00 ? 44 ARG P HD3  7  
ATOM 7841  H HE   . ARG A 1 46 ? -1.271  -1.511  10.809  1.00 0.00 ? 44 ARG P HE   7  
ATOM 7842  H HH11 . ARG A 1 46 ? -2.248  0.918   8.437   1.00 0.00 ? 44 ARG P HH11 7  
ATOM 7843  H HH12 . ARG A 1 46 ? -1.288  2.142   9.234   1.00 0.00 ? 44 ARG P HH12 7  
ATOM 7844  H HH21 . ARG A 1 46 ? -0.135  0.194   11.735  1.00 0.00 ? 44 ARG P HH21 7  
ATOM 7845  H HH22 . ARG A 1 46 ? -0.177  1.762   10.960  1.00 0.00 ? 44 ARG P HH22 7  
ATOM 7846  N N    . VAL A 1 47 ? -4.620  -2.843  4.331   1.00 0.00 ? 45 VAL P N    7  
ATOM 7847  C CA   . VAL A 1 47 ? -5.456  -2.518  3.165   1.00 0.00 ? 45 VAL P CA   7  
ATOM 7848  C C    . VAL A 1 47 ? -6.831  -3.168  3.313   1.00 0.00 ? 45 VAL P C    7  
ATOM 7849  O O    . VAL A 1 47 ? -7.846  -2.492  3.162   1.00 0.00 ? 45 VAL P O    7  
ATOM 7850  C CB   . VAL A 1 47 ? -4.776  -2.936  1.847   1.00 0.00 ? 45 VAL P CB   7  
ATOM 7851  C CG1  . VAL A 1 47 ? -5.532  -2.385  0.635   1.00 0.00 ? 45 VAL P CG1  7  
ATOM 7852  C CG2  . VAL A 1 47 ? -3.332  -2.423  1.789   1.00 0.00 ? 45 VAL P CG2  7  
ATOM 7853  H H    . VAL A 1 47 ? -3.779  -3.393  4.200   1.00 0.00 ? 45 VAL P H    7  
ATOM 7854  H HA   . VAL A 1 47 ? -5.604  -1.437  3.138   1.00 0.00 ? 45 VAL P HA   7  
ATOM 7855  H HB   . VAL A 1 47 ? -4.755  -4.021  1.777   1.00 0.00 ? 45 VAL P HB   7  
ATOM 7856  H HG11 . VAL A 1 47 ? -5.576  -1.297  0.685   1.00 0.00 ? 45 VAL P HG11 7  
ATOM 7857  H HG12 . VAL A 1 47 ? -5.023  -2.676  -0.283  1.00 0.00 ? 45 VAL P HG12 7  
ATOM 7858  H HG13 . VAL A 1 47 ? -6.545  -2.785  0.605   1.00 0.00 ? 45 VAL P HG13 7  
ATOM 7859  H HG21 . VAL A 1 47 ? -2.708  -2.968  2.493   1.00 0.00 ? 45 VAL P HG21 7  
ATOM 7860  H HG22 . VAL A 1 47 ? -2.922  -2.584  0.794   1.00 0.00 ? 45 VAL P HG22 7  
ATOM 7861  H HG23 . VAL A 1 47 ? -3.298  -1.361  2.027   1.00 0.00 ? 45 VAL P HG23 7  
ATOM 7862  N N    . ARG A 1 48 ? -6.889  -4.444  3.713   1.00 0.00 ? 46 ARG P N    7  
ATOM 7863  C CA   . ARG A 1 48 ? -8.145  -5.175  3.952   1.00 0.00 ? 46 ARG P CA   7  
ATOM 7864  C C    . ARG A 1 48 ? -9.003  -4.517  5.039   1.00 0.00 ? 46 ARG P C    7  
ATOM 7865  O O    . ARG A 1 48 ? -10.201 -4.331  4.840   1.00 0.00 ? 46 ARG P O    7  
ATOM 7866  C CB   . ARG A 1 48 ? -7.808  -6.641  4.283   1.00 0.00 ? 46 ARG P CB   7  
ATOM 7867  C CG   . ARG A 1 48 ? -8.937  -7.589  3.865   1.00 0.00 ? 46 ARG P CG   7  
ATOM 7868  C CD   . ARG A 1 48 ? -8.512  -9.046  4.072   1.00 0.00 ? 46 ARG P CD   7  
ATOM 7869  N NE   . ARG A 1 48 ? -9.464  -9.964  3.423   1.00 0.00 ? 46 ARG P NE   7  
ATOM 7870  C CZ   . ARG A 1 48 ? -9.454  -11.284 3.485   1.00 0.00 ? 46 ARG P CZ   7  
ATOM 7871  N NH1  . ARG A 1 48 ? -8.537  -11.941 4.136   1.00 0.00 ? 46 ARG P NH1  7  
ATOM 7872  N NH2  . ARG A 1 48 ? -10.372 -11.979 2.875   1.00 0.00 ? 46 ARG P NH2  7  
ATOM 7873  H H    . ARG A 1 48 ? -6.011  -4.946  3.819   1.00 0.00 ? 46 ARG P H    7  
ATOM 7874  H HA   . ARG A 1 48 ? -8.731  -5.140  3.032   1.00 0.00 ? 46 ARG P HA   7  
ATOM 7875  H HB2  . ARG A 1 48 ? -6.914  -6.939  3.735   1.00 0.00 ? 46 ARG P HB2  7  
ATOM 7876  H HB3  . ARG A 1 48 ? -7.602  -6.752  5.348   1.00 0.00 ? 46 ARG P HB3  7  
ATOM 7877  H HG2  . ARG A 1 48 ? -9.835  -7.381  4.449   1.00 0.00 ? 46 ARG P HG2  7  
ATOM 7878  H HG3  . ARG A 1 48 ? -9.156  -7.431  2.808   1.00 0.00 ? 46 ARG P HG3  7  
ATOM 7879  H HD2  . ARG A 1 48 ? -7.520  -9.194  3.638   1.00 0.00 ? 46 ARG P HD2  7  
ATOM 7880  H HD3  . ARG A 1 48 ? -8.460  -9.250  5.143   1.00 0.00 ? 46 ARG P HD3  7  
ATOM 7881  H HE   . ARG A 1 48 ? -10.184 -9.541  2.859   1.00 0.00 ? 46 ARG P HE   7  
ATOM 7882  H HH11 . ARG A 1 48 ? -7.809  -11.431 4.606   1.00 0.00 ? 46 ARG P HH11 7  
ATOM 7883  H HH12 . ARG A 1 48 ? -8.554  -12.946 4.175   1.00 0.00 ? 46 ARG P HH12 7  
ATOM 7884  H HH21 . ARG A 1 48 ? -11.118 -11.516 2.384   1.00 0.00 ? 46 ARG P HH21 7  
ATOM 7885  H HH22 . ARG A 1 48 ? -10.367 -12.984 2.932   1.00 0.00 ? 46 ARG P HH22 7  
ATOM 7886  N N    . VAL A 1 49 ? -8.389  -4.093  6.146   1.00 0.00 ? 47 VAL P N    7  
ATOM 7887  C CA   . VAL A 1 49 ? -9.044  -3.348  7.241   1.00 0.00 ? 47 VAL P CA   7  
ATOM 7888  C C    . VAL A 1 49 ? -9.549  -1.983  6.770   1.00 0.00 ? 47 VAL P C    7  
ATOM 7889  O O    . VAL A 1 49 ? -10.694 -1.629  7.058   1.00 0.00 ? 47 VAL P O    7  
ATOM 7890  C CB   . VAL A 1 49 ? -8.083  -3.208  8.443   1.00 0.00 ? 47 VAL P CB   7  
ATOM 7891  C CG1  . VAL A 1 49 ? -8.580  -2.225  9.513   1.00 0.00 ? 47 VAL P CG1  7  
ATOM 7892  C CG2  . VAL A 1 49 ? -7.897  -4.563  9.135   1.00 0.00 ? 47 VAL P CG2  7  
ATOM 7893  H H    . VAL A 1 49 ? -7.404  -4.316  6.242   1.00 0.00 ? 47 VAL P H    7  
ATOM 7894  H HA   . VAL A 1 49 ? -9.918  -3.909  7.573   1.00 0.00 ? 47 VAL P HA   7  
ATOM 7895  H HB   . VAL A 1 49 ? -7.113  -2.860  8.088   1.00 0.00 ? 47 VAL P HB   7  
ATOM 7896  H HG11 . VAL A 1 49 ? -9.578  -2.507  9.846   1.00 0.00 ? 47 VAL P HG11 7  
ATOM 7897  H HG12 . VAL A 1 49 ? -7.899  -2.236  10.364  1.00 0.00 ? 47 VAL P HG12 7  
ATOM 7898  H HG13 . VAL A 1 49 ? -8.600  -1.210  9.116   1.00 0.00 ? 47 VAL P HG13 7  
ATOM 7899  H HG21 . VAL A 1 49 ? -8.834  -4.883  9.592   1.00 0.00 ? 47 VAL P HG21 7  
ATOM 7900  H HG22 . VAL A 1 49 ? -7.580  -5.319  8.419   1.00 0.00 ? 47 VAL P HG22 7  
ATOM 7901  H HG23 . VAL A 1 49 ? -7.126  -4.479  9.902   1.00 0.00 ? 47 VAL P HG23 7  
ATOM 7902  N N    . TRP A 1 50 ? -8.750  -1.225  6.014   1.00 0.00 ? 48 TRP P N    7  
ATOM 7903  C CA   . TRP A 1 50 ? -9.155  0.089   5.504   1.00 0.00 ? 48 TRP P CA   7  
ATOM 7904  C C    . TRP A 1 50 ? -10.331 -0.017  4.528   1.00 0.00 ? 48 TRP P C    7  
ATOM 7905  O O    . TRP A 1 50 ? -11.331 0.678   4.686   1.00 0.00 ? 48 TRP P O    7  
ATOM 7906  C CB   . TRP A 1 50 ? -7.964  0.784   4.840   1.00 0.00 ? 48 TRP P CB   7  
ATOM 7907  C CG   . TRP A 1 50 ? -8.209  2.230   4.537   1.00 0.00 ? 48 TRP P CG   7  
ATOM 7908  C CD1  . TRP A 1 50 ? -7.857  3.260   5.340   1.00 0.00 ? 48 TRP P CD1  7  
ATOM 7909  C CD2  . TRP A 1 50 ? -8.874  2.835   3.380   1.00 0.00 ? 48 TRP P CD2  7  
ATOM 7910  N NE1  . TRP A 1 50 ? -8.231  4.452   4.754   1.00 0.00 ? 48 TRP P NE1  7  
ATOM 7911  C CE2  . TRP A 1 50 ? -8.848  4.254   3.538   1.00 0.00 ? 48 TRP P CE2  7  
ATOM 7912  C CE3  . TRP A 1 50 ? -9.484  2.338   2.207   1.00 0.00 ? 48 TRP P CE3  7  
ATOM 7913  C CZ2  . TRP A 1 50 ? -9.377  5.131   2.579   1.00 0.00 ? 48 TRP P CZ2  7  
ATOM 7914  C CZ3  . TRP A 1 50 ? -10.044 3.204   1.250   1.00 0.00 ? 48 TRP P CZ3  7  
ATOM 7915  C CH2  . TRP A 1 50 ? -9.995  4.597   1.436   1.00 0.00 ? 48 TRP P CH2  7  
ATOM 7916  H H    . TRP A 1 50 ? -7.807  -1.547  5.820   1.00 0.00 ? 48 TRP P H    7  
ATOM 7917  H HA   . TRP A 1 50 ? -9.476  0.710   6.343   1.00 0.00 ? 48 TRP P HA   7  
ATOM 7918  H HB2  . TRP A 1 50 ? -7.102  0.718   5.503   1.00 0.00 ? 48 TRP P HB2  7  
ATOM 7919  H HB3  . TRP A 1 50 ? -7.717  0.261   3.916   1.00 0.00 ? 48 TRP P HB3  7  
ATOM 7920  H HD1  . TRP A 1 50 ? -7.343  3.158   6.290   1.00 0.00 ? 48 TRP P HD1  7  
ATOM 7921  H HE1  . TRP A 1 50 ? -8.059  5.355   5.180   1.00 0.00 ? 48 TRP P HE1  7  
ATOM 7922  H HE3  . TRP A 1 50 ? -9.519  1.275   2.044   1.00 0.00 ? 48 TRP P HE3  7  
ATOM 7923  H HZ2  . TRP A 1 50 ? -9.305  6.199   2.717   1.00 0.00 ? 48 TRP P HZ2  7  
ATOM 7924  H HZ3  . TRP A 1 50 ? -10.505 2.796   0.360   1.00 0.00 ? 48 TRP P HZ3  7  
ATOM 7925  H HH2  . TRP A 1 50 ? -10.433 5.255   0.700   1.00 0.00 ? 48 TRP P HH2  7  
ATOM 7926  N N    . PHE A 1 51 ? -10.263 -0.944  3.568   1.00 0.00 ? 49 PHE P N    7  
ATOM 7927  C CA   . PHE A 1 51 ? -11.329 -1.194  2.593   1.00 0.00 ? 49 PHE P CA   7  
ATOM 7928  C C    . PHE A 1 51 ? -12.609 -1.750  3.237   1.00 0.00 ? 49 PHE P C    7  
ATOM 7929  O O    . PHE A 1 51 ? -13.704 -1.480  2.734   1.00 0.00 ? 49 PHE P O    7  
ATOM 7930  C CB   . PHE A 1 51 ? -10.797 -2.117  1.482   1.00 0.00 ? 49 PHE P CB   7  
ATOM 7931  C CG   . PHE A 1 51 ? -10.096 -1.376  0.355   1.00 0.00 ? 49 PHE P CG   7  
ATOM 7932  C CD1  . PHE A 1 51 ? -8.826  -0.790  0.537   1.00 0.00 ? 49 PHE P CD1  7  
ATOM 7933  C CD2  . PHE A 1 51 ? -10.735 -1.248  -0.892  1.00 0.00 ? 49 PHE P CD2  7  
ATOM 7934  C CE1  . PHE A 1 51 ? -8.208  -0.078  -0.507  1.00 0.00 ? 49 PHE P CE1  7  
ATOM 7935  C CE2  . PHE A 1 51 ? -10.111 -0.549  -1.933  1.00 0.00 ? 49 PHE P CE2  7  
ATOM 7936  C CZ   . PHE A 1 51 ? -8.860  0.050   -1.741  1.00 0.00 ? 49 PHE P CZ   7  
ATOM 7937  H H    . PHE A 1 51 ? -9.407  -1.482  3.487   1.00 0.00 ? 49 PHE P H    7  
ATOM 7938  H HA   . PHE A 1 51 ? -11.609 -0.245  2.132   1.00 0.00 ? 49 PHE P HA   7  
ATOM 7939  H HB2  . PHE A 1 51 ? -10.124 -2.864  1.904   1.00 0.00 ? 49 PHE P HB2  7  
ATOM 7940  H HB3  . PHE A 1 51 ? -11.635 -2.667  1.054   1.00 0.00 ? 49 PHE P HB3  7  
ATOM 7941  H HD1  . PHE A 1 51 ? -8.324  -0.859  1.487   1.00 0.00 ? 49 PHE P HD1  7  
ATOM 7942  H HD2  . PHE A 1 51 ? -11.704 -1.686  -1.065  1.00 0.00 ? 49 PHE P HD2  7  
ATOM 7943  H HE1  . PHE A 1 51 ? -7.238  0.376   -0.362  1.00 0.00 ? 49 PHE P HE1  7  
ATOM 7944  H HE2  . PHE A 1 51 ? -10.598 -0.472  -2.887  1.00 0.00 ? 49 PHE P HE2  7  
ATOM 7945  H HZ   . PHE A 1 51 ? -8.406  0.610   -2.541  1.00 0.00 ? 49 PHE P HZ   7  
ATOM 7946  N N    . LYS A 1 52 ? -12.507 -2.465  4.366   1.00 0.00 ? 50 LYS P N    7  
ATOM 7947  C CA   . LYS A 1 52 ? -13.659 -2.888  5.190   1.00 0.00 ? 50 LYS P CA   7  
ATOM 7948  C C    . LYS A 1 52 ? -14.305 -1.700  5.910   1.00 0.00 ? 50 LYS P C    7  
ATOM 7949  O O    . LYS A 1 52 ? -15.525 -1.540  5.879   1.00 0.00 ? 50 LYS P O    7  
ATOM 7950  C CB   . LYS A 1 52 ? -13.206 -3.968  6.180   1.00 0.00 ? 50 LYS P CB   7  
ATOM 7951  C CG   . LYS A 1 52 ? -14.403 -4.672  6.839   1.00 0.00 ? 50 LYS P CG   7  
ATOM 7952  C CD   . LYS A 1 52 ? -13.988 -5.538  8.033   1.00 0.00 ? 50 LYS P CD   7  
ATOM 7953  C CE   . LYS A 1 52 ? -12.885 -6.543  7.678   1.00 0.00 ? 50 LYS P CE   7  
ATOM 7954  N NZ   . LYS A 1 52 ? -12.575 -7.440  8.824   1.00 0.00 ? 50 LYS P NZ   7  
ATOM 7955  H H    . LYS A 1 52 ? -11.570 -2.704  4.680   1.00 0.00 ? 50 LYS P H    7  
ATOM 7956  H HA   . LYS A 1 52 ? -14.422 -3.333  4.551   1.00 0.00 ? 50 LYS P HA   7  
ATOM 7957  H HB2  . LYS A 1 52 ? -12.629 -4.717  5.639   1.00 0.00 ? 50 LYS P HB2  7  
ATOM 7958  H HB3  . LYS A 1 52 ? -12.573 -3.521  6.948   1.00 0.00 ? 50 LYS P HB3  7  
ATOM 7959  H HG2  . LYS A 1 52 ? -15.120 -3.935  7.199   1.00 0.00 ? 50 LYS P HG2  7  
ATOM 7960  H HG3  . LYS A 1 52 ? -14.901 -5.296  6.095   1.00 0.00 ? 50 LYS P HG3  7  
ATOM 7961  H HD2  . LYS A 1 52 ? -13.636 -4.879  8.827   1.00 0.00 ? 50 LYS P HD2  7  
ATOM 7962  H HD3  . LYS A 1 52 ? -14.872 -6.070  8.385   1.00 0.00 ? 50 LYS P HD3  7  
ATOM 7963  H HE2  . LYS A 1 52 ? -13.211 -7.133  6.817   1.00 0.00 ? 50 LYS P HE2  7  
ATOM 7964  H HE3  . LYS A 1 52 ? -11.990 -5.983  7.385   1.00 0.00 ? 50 LYS P HE3  7  
ATOM 7965  H HZ1  . LYS A 1 52 ? -12.266 -6.917  9.632   1.00 0.00 ? 50 LYS P HZ1  7  
ATOM 7966  H HZ2  . LYS A 1 52 ? -11.844 -8.098  8.586   1.00 0.00 ? 50 LYS P HZ2  7  
ATOM 7967  H HZ3  . LYS A 1 52 ? -13.387 -7.979  9.097   1.00 0.00 ? 50 LYS P HZ3  7  
ATOM 7968  N N    . ASN A 1 53 ? -13.492 -0.821  6.494   1.00 0.00 ? 51 ASN P N    7  
ATOM 7969  C CA   . ASN A 1 53 ? -13.975 0.424   7.102   1.00 0.00 ? 51 ASN P CA   7  
ATOM 7970  C C    . ASN A 1 53 ? -14.586 1.376   6.056   1.00 0.00 ? 51 ASN P C    7  
ATOM 7971  O O    . ASN A 1 53 ? -15.587 2.030   6.337   1.00 0.00 ? 51 ASN P O    7  
ATOM 7972  C CB   . ASN A 1 53 ? -12.841 1.094   7.899   1.00 0.00 ? 51 ASN P CB   7  
ATOM 7973  C CG   . ASN A 1 53 ? -12.674 0.489   9.282   1.00 0.00 ? 51 ASN P CG   7  
ATOM 7974  O OD1  . ASN A 1 53 ? -13.247 0.947   10.260  1.00 0.00 ? 51 ASN P OD1  7  
ATOM 7975  N ND2  . ASN A 1 53 ? -11.904 -0.564  9.410   1.00 0.00 ? 51 ASN P ND2  7  
ATOM 7976  H H    . ASN A 1 53 ? -12.498 -1.026  6.494   1.00 0.00 ? 51 ASN P H    7  
ATOM 7977  H HA   . ASN A 1 53 ? -14.783 0.185   7.797   1.00 0.00 ? 51 ASN P HA   7  
ATOM 7978  H HB2  . ASN A 1 53 ? -11.898 1.030   7.360   1.00 0.00 ? 51 ASN P HB2  7  
ATOM 7979  H HB3  . ASN A 1 53 ? -13.076 2.150   8.039   1.00 0.00 ? 51 ASN P HB3  7  
ATOM 7980  H HD21 . ASN A 1 53 ? -11.436 -0.954  8.600   1.00 0.00 ? 51 ASN P HD21 7  
ATOM 7981  H HD22 . ASN A 1 53 ? -11.786 -0.958  10.328  1.00 0.00 ? 51 ASN P HD22 7  
ATOM 7982  N N    . ARG A 1 54 ? -14.051 1.426   4.829   1.00 0.00 ? 52 ARG P N    7  
ATOM 7983  C CA   . ARG A 1 54 ? -14.515 2.351   3.781   1.00 0.00 ? 52 ARG P CA   7  
ATOM 7984  C C    . ARG A 1 54 ? -15.925 2.056   3.280   1.00 0.00 ? 52 ARG P C    7  
ATOM 7985  O O    . ARG A 1 54 ? -16.695 2.998   3.079   1.00 0.00 ? 52 ARG P O    7  
ATOM 7986  C CB   . ARG A 1 54 ? -13.511 2.343   2.616   1.00 0.00 ? 52 ARG P CB   7  
ATOM 7987  C CG   . ARG A 1 54 ? -13.775 3.414   1.541   1.00 0.00 ? 52 ARG P CG   7  
ATOM 7988  C CD   . ARG A 1 54 ? -13.749 4.850   2.084   1.00 0.00 ? 52 ARG P CD   7  
ATOM 7989  N NE   . ARG A 1 54 ? -14.258 5.821   1.097   1.00 0.00 ? 52 ARG P NE   7  
ATOM 7990  C CZ   . ARG A 1 54 ? -15.525 6.115   0.854   1.00 0.00 ? 52 ARG P CZ   7  
ATOM 7991  N NH1  . ARG A 1 54 ? -16.522 5.488   1.417   1.00 0.00 ? 52 ARG P NH1  7  
ATOM 7992  N NH2  . ARG A 1 54 ? -15.820 7.069   0.017   1.00 0.00 ? 52 ARG P NH2  7  
ATOM 7993  H H    . ARG A 1 54 ? -13.177 0.928   4.681   1.00 0.00 ? 52 ARG P H    7  
ATOM 7994  H HA   . ARG A 1 54 ? -14.559 3.335   4.239   1.00 0.00 ? 52 ARG P HA   7  
ATOM 7995  H HB2  . ARG A 1 54 ? -12.497 2.456   3.006   1.00 0.00 ? 52 ARG P HB2  7  
ATOM 7996  H HB3  . ARG A 1 54 ? -13.588 1.371   2.131   1.00 0.00 ? 52 ARG P HB3  7  
ATOM 7997  H HG2  . ARG A 1 54 ? -13.019 3.321   0.760   1.00 0.00 ? 52 ARG P HG2  7  
ATOM 7998  H HG3  . ARG A 1 54 ? -14.743 3.218   1.078   1.00 0.00 ? 52 ARG P HG3  7  
ATOM 7999  H HD2  . ARG A 1 54 ? -14.351 4.933   2.987   1.00 0.00 ? 52 ARG P HD2  7  
ATOM 8000  H HD3  . ARG A 1 54 ? -12.721 5.105   2.351   1.00 0.00 ? 52 ARG P HD3  7  
ATOM 8001  H HE   . ARG A 1 54 ? -13.569 6.357   0.593   1.00 0.00 ? 52 ARG P HE   7  
ATOM 8002  H HH11 . ARG A 1 54 ? -16.353 4.704   2.032   1.00 0.00 ? 52 ARG P HH11 7  
ATOM 8003  H HH12 . ARG A 1 54 ? -17.465 5.758   1.205   1.00 0.00 ? 52 ARG P HH12 7  
ATOM 8004  H HH21 . ARG A 1 54 ? -15.089 7.600   -0.424  1.00 0.00 ? 52 ARG P HH21 7  
ATOM 8005  H HH22 . ARG A 1 54 ? -16.779 7.307   -0.165  1.00 0.00 ? 52 ARG P HH22 7  
ATOM 8006  N N    . ARG A 1 55 ? -16.279 0.777   3.114   1.00 0.00 ? 53 ARG P N    7  
ATOM 8007  C CA   . ARG A 1 55 ? -17.647 0.358   2.750   1.00 0.00 ? 53 ARG P CA   7  
ATOM 8008  C C    . ARG A 1 55 ? -18.620 0.474   3.924   1.00 0.00 ? 53 ARG P C    7  
ATOM 8009  O O    . ARG A 1 55 ? -19.770 0.854   3.722   1.00 0.00 ? 53 ARG P O    7  
ATOM 8010  C CB   . ARG A 1 55 ? -17.640 -1.021  2.072   1.00 0.00 ? 53 ARG P CB   7  
ATOM 8011  C CG   . ARG A 1 55 ? -17.222 -2.190  2.980   1.00 0.00 ? 53 ARG P CG   7  
ATOM 8012  C CD   . ARG A 1 55 ? -16.835 -3.418  2.151   1.00 0.00 ? 53 ARG P CD   7  
ATOM 8013  N NE   . ARG A 1 55 ? -15.591 -3.141  1.409   1.00 0.00 ? 53 ARG P NE   7  
ATOM 8014  C CZ   . ARG A 1 55 ? -15.385 -3.169  0.107   1.00 0.00 ? 53 ARG P CZ   7  
ATOM 8015  N NH1  . ARG A 1 55 ? -16.197 -3.731  -0.740  1.00 0.00 ? 53 ARG P NH1  7  
ATOM 8016  N NH2  . ARG A 1 55 ? -14.333 -2.585  -0.378  1.00 0.00 ? 53 ARG P NH2  7  
ATOM 8017  H H    . ARG A 1 55 ? -15.563 0.075   3.257   1.00 0.00 ? 53 ARG P H    7  
ATOM 8018  H HA   . ARG A 1 55 ? -18.012 1.057   1.997   1.00 0.00 ? 53 ARG P HA   7  
ATOM 8019  H HB2  . ARG A 1 55 ? -18.635 -1.233  1.678   1.00 0.00 ? 53 ARG P HB2  7  
ATOM 8020  H HB3  . ARG A 1 55 ? -16.966 -0.950  1.217   1.00 0.00 ? 53 ARG P HB3  7  
ATOM 8021  H HG2  . ARG A 1 55 ? -16.361 -1.902  3.575   1.00 0.00 ? 53 ARG P HG2  7  
ATOM 8022  H HG3  . ARG A 1 55 ? -18.044 -2.444  3.650   1.00 0.00 ? 53 ARG P HG3  7  
ATOM 8023  H HD2  . ARG A 1 55 ? -16.674 -4.265  2.821   1.00 0.00 ? 53 ARG P HD2  7  
ATOM 8024  H HD3  . ARG A 1 55 ? -17.663 -3.653  1.484   1.00 0.00 ? 53 ARG P HD3  7  
ATOM 8025  H HE   . ARG A 1 55 ? -14.857 -2.693  1.943   1.00 0.00 ? 53 ARG P HE   7  
ATOM 8026  H HH11 . ARG A 1 55 ? -17.009 -4.215  -0.401  1.00 0.00 ? 53 ARG P HH11 7  
ATOM 8027  H HH12 . ARG A 1 55 ? -15.991 -3.694  -1.725  1.00 0.00 ? 53 ARG P HH12 7  
ATOM 8028  H HH21 . ARG A 1 55 ? -13.742 -2.049  0.232   1.00 0.00 ? 53 ARG P HH21 7  
ATOM 8029  H HH22 . ARG A 1 55 ? -14.204 -2.568  -1.385  1.00 0.00 ? 53 ARG P HH22 7  
ATOM 8030  N N    . ALA A 1 56 ? -18.145 0.277   5.153   1.00 0.00 ? 54 ALA P N    7  
ATOM 8031  C CA   . ALA A 1 56 ? -18.934 0.585   6.349   1.00 0.00 ? 54 ALA P CA   7  
ATOM 8032  C C    . ALA A 1 56 ? -19.252 2.094   6.438   1.00 0.00 ? 54 ALA P C    7  
ATOM 8033  O O    . ALA A 1 56 ? -20.389 2.470   6.721   1.00 0.00 ? 54 ALA P O    7  
ATOM 8034  C CB   . ALA A 1 56 ? -18.194 0.072   7.590   1.00 0.00 ? 54 ALA P CB   7  
ATOM 8035  H H    . ALA A 1 56 ? -17.191 -0.047  5.255   1.00 0.00 ? 54 ALA P H    7  
ATOM 8036  H HA   . ALA A 1 56 ? -19.886 0.054   6.284   1.00 0.00 ? 54 ALA P HA   7  
ATOM 8037  H HB1  . ALA A 1 56 ? -17.991 -0.995  7.485   1.00 0.00 ? 54 ALA P HB1  7  
ATOM 8038  H HB2  . ALA A 1 56 ? -17.254 0.606   7.723   1.00 0.00 ? 54 ALA P HB2  7  
ATOM 8039  H HB3  . ALA A 1 56 ? -18.814 0.227   8.474   1.00 0.00 ? 54 ALA P HB3  7  
ATOM 8040  N N    . LYS A 1 57 ? -18.288 2.964   6.105   1.00 0.00 ? 55 LYS P N    7  
ATOM 8041  C CA   . LYS A 1 57 ? -18.461 4.428   6.063   1.00 0.00 ? 55 LYS P CA   7  
ATOM 8042  C C    . LYS A 1 57 ? -19.370 4.870   4.914   1.00 0.00 ? 55 LYS P C    7  
ATOM 8043  O O    . LYS A 1 57 ? -20.172 5.783   5.105   1.00 0.00 ? 55 LYS P O    7  
ATOM 8044  C CB   . LYS A 1 57 ? -17.091 5.124   6.013   1.00 0.00 ? 55 LYS P CB   7  
ATOM 8045  C CG   . LYS A 1 57 ? -16.410 5.079   7.391   1.00 0.00 ? 55 LYS P CG   7  
ATOM 8046  C CD   . LYS A 1 57 ? -14.965 5.591   7.366   1.00 0.00 ? 55 LYS P CD   7  
ATOM 8047  C CE   . LYS A 1 57 ? -14.883 7.085   7.018   1.00 0.00 ? 55 LYS P CE   7  
ATOM 8048  N NZ   . LYS A 1 57 ? -13.488 7.593   7.106   1.00 0.00 ? 55 LYS P NZ   7  
ATOM 8049  H H    . LYS A 1 57 ? -17.370 2.588   5.891   1.00 0.00 ? 55 LYS P H    7  
ATOM 8050  H HA   . LYS A 1 57 ? -18.958 4.741   6.984   1.00 0.00 ? 55 LYS P HA   7  
ATOM 8051  H HB2  . LYS A 1 57 ? -16.460 4.645   5.264   1.00 0.00 ? 55 LYS P HB2  7  
ATOM 8052  H HB3  . LYS A 1 57 ? -17.235 6.168   5.728   1.00 0.00 ? 55 LYS P HB3  7  
ATOM 8053  H HG2  . LYS A 1 57 ? -16.989 5.677   8.096   1.00 0.00 ? 55 LYS P HG2  7  
ATOM 8054  H HG3  . LYS A 1 57 ? -16.397 4.054   7.759   1.00 0.00 ? 55 LYS P HG3  7  
ATOM 8055  H HD2  . LYS A 1 57 ? -14.536 5.431   8.356   1.00 0.00 ? 55 LYS P HD2  7  
ATOM 8056  H HD3  . LYS A 1 57 ? -14.396 5.008   6.642   1.00 0.00 ? 55 LYS P HD3  7  
ATOM 8057  H HE2  . LYS A 1 57 ? -15.271 7.238   6.006   1.00 0.00 ? 55 LYS P HE2  7  
ATOM 8058  H HE3  . LYS A 1 57 ? -15.522 7.641   7.710   1.00 0.00 ? 55 LYS P HE3  7  
ATOM 8059  H HZ1  . LYS A 1 57 ? -12.874 7.104   6.466   1.00 0.00 ? 55 LYS P HZ1  7  
ATOM 8060  H HZ2  . LYS A 1 57 ? -13.114 7.482   8.040   1.00 0.00 ? 55 LYS P HZ2  7  
ATOM 8061  H HZ3  . LYS A 1 57 ? -13.444 8.578   6.878   1.00 0.00 ? 55 LYS P HZ3  7  
ATOM 8062  N N    . TRP A 1 58 ? -19.323 4.192   3.760   1.00 0.00 ? 56 TRP P N    7  
ATOM 8063  C CA   . TRP A 1 58 ? -20.322 4.389   2.696   1.00 0.00 ? 56 TRP P CA   7  
ATOM 8064  C C    . TRP A 1 58 ? -21.739 4.060   3.196   1.00 0.00 ? 56 TRP P C    7  
ATOM 8065  O O    . TRP A 1 58 ? -22.649 4.872   3.033   1.00 0.00 ? 56 TRP P O    7  
ATOM 8066  C CB   . TRP A 1 58 ? -19.962 3.550   1.459   1.00 0.00 ? 56 TRP P CB   7  
ATOM 8067  C CG   . TRP A 1 58 ? -21.125 3.120   0.609   1.00 0.00 ? 56 TRP P CG   7  
ATOM 8068  C CD1  . TRP A 1 58 ? -22.012 3.942   -0.001  1.00 0.00 ? 56 TRP P CD1  7  
ATOM 8069  C CD2  . TRP A 1 58 ? -21.601 1.764   0.345   1.00 0.00 ? 56 TRP P CD2  7  
ATOM 8070  N NE1  . TRP A 1 58 ? -23.004 3.188   -0.601  1.00 0.00 ? 56 TRP P NE1  7  
ATOM 8071  C CE2  . TRP A 1 58 ? -22.801 1.841   -0.421  1.00 0.00 ? 56 TRP P CE2  7  
ATOM 8072  C CE3  . TRP A 1 58 ? -21.160 0.475   0.705   1.00 0.00 ? 56 TRP P CE3  7  
ATOM 8073  C CZ2  . TRP A 1 58 ? -23.522 0.703   -0.815  1.00 0.00 ? 56 TRP P CZ2  7  
ATOM 8074  C CZ3  . TRP A 1 58 ? -21.875 -0.676  0.323   1.00 0.00 ? 56 TRP P CZ3  7  
ATOM 8075  C CH2  . TRP A 1 58 ? -23.053 -0.567  -0.436  1.00 0.00 ? 56 TRP P CH2  7  
ATOM 8076  H H    . TRP A 1 58 ? -18.586 3.502   3.628   1.00 0.00 ? 56 TRP P H    7  
ATOM 8077  H HA   . TRP A 1 58 ? -20.330 5.439   2.402   1.00 0.00 ? 56 TRP P HA   7  
ATOM 8078  H HB2  . TRP A 1 58 ? -19.259 4.108   0.841   1.00 0.00 ? 56 TRP P HB2  7  
ATOM 8079  H HB3  . TRP A 1 58 ? -19.451 2.652   1.799   1.00 0.00 ? 56 TRP P HB3  7  
ATOM 8080  H HD1  . TRP A 1 58 ? -21.967 5.024   0.035   1.00 0.00 ? 56 TRP P HD1  7  
ATOM 8081  H HE1  . TRP A 1 58 ? -23.808 3.570   -1.098  1.00 0.00 ? 56 TRP P HE1  7  
ATOM 8082  H HE3  . TRP A 1 58 ? -20.277 0.386   1.316   1.00 0.00 ? 56 TRP P HE3  7  
ATOM 8083  H HZ2  . TRP A 1 58 ? -24.431 0.808   -1.390  1.00 0.00 ? 56 TRP P HZ2  7  
ATOM 8084  H HZ3  . TRP A 1 58 ? -21.523 -1.652  0.629   1.00 0.00 ? 56 TRP P HZ3  7  
ATOM 8085  H HH2  . TRP A 1 58 ? -23.601 -1.457  -0.718  1.00 0.00 ? 56 TRP P HH2  7  
ATOM 8086  N N    . ARG A 1 59 ? -21.931 2.912   3.859   1.00 0.00 ? 57 ARG P N    7  
ATOM 8087  C CA   . ARG A 1 59 ? -23.242 2.449   4.357   1.00 0.00 ? 57 ARG P CA   7  
ATOM 8088  C C    . ARG A 1 59 ? -23.898 3.372   5.396   1.00 0.00 ? 57 ARG P C    7  
ATOM 8089  O O    . ARG A 1 59 ? -25.124 3.359   5.509   1.00 0.00 ? 57 ARG P O    7  
ATOM 8090  C CB   . ARG A 1 59 ? -23.083 1.028   4.921   1.00 0.00 ? 57 ARG P CB   7  
ATOM 8091  C CG   . ARG A 1 59 ? -23.008 -0.026  3.810   1.00 0.00 ? 57 ARG P CG   7  
ATOM 8092  C CD   . ARG A 1 59 ? -22.719 -1.409  4.404   1.00 0.00 ? 57 ARG P CD   7  
ATOM 8093  N NE   . ARG A 1 59 ? -22.636 -2.452  3.363   1.00 0.00 ? 57 ARG P NE   7  
ATOM 8094  C CZ   . ARG A 1 59 ? -23.639 -3.076  2.767   1.00 0.00 ? 57 ARG P CZ   7  
ATOM 8095  N NH1  . ARG A 1 59 ? -24.886 -2.812  3.037   1.00 0.00 ? 57 ARG P NH1  7  
ATOM 8096  N NH2  . ARG A 1 59 ? -23.404 -3.996  1.874   1.00 0.00 ? 57 ARG P NH2  7  
ATOM 8097  H H    . ARG A 1 59 ? -21.145 2.270   3.917   1.00 0.00 ? 57 ARG P H    7  
ATOM 8098  H HA   . ARG A 1 59 ? -23.932 2.418   3.509   1.00 0.00 ? 57 ARG P HA   7  
ATOM 8099  H HB2  . ARG A 1 59 ? -22.174 0.987   5.521   1.00 0.00 ? 57 ARG P HB2  7  
ATOM 8100  H HB3  . ARG A 1 59 ? -23.935 0.790   5.560   1.00 0.00 ? 57 ARG P HB3  7  
ATOM 8101  H HG2  . ARG A 1 59 ? -23.952 -0.044  3.263   1.00 0.00 ? 57 ARG P HG2  7  
ATOM 8102  H HG3  . ARG A 1 59 ? -22.210 0.233   3.120   1.00 0.00 ? 57 ARG P HG3  7  
ATOM 8103  H HD2  . ARG A 1 59 ? -21.764 -1.359  4.931   1.00 0.00 ? 57 ARG P HD2  7  
ATOM 8104  H HD3  . ARG A 1 59 ? -23.491 -1.664  5.133   1.00 0.00 ? 57 ARG P HD3  7  
ATOM 8105  H HE   . ARG A 1 59 ? -21.710 -2.738  3.087   1.00 0.00 ? 57 ARG P HE   7  
ATOM 8106  H HH11 . ARG A 1 59 ? -25.102 -2.113  3.726   1.00 0.00 ? 57 ARG P HH11 7  
ATOM 8107  H HH12 . ARG A 1 59 ? -25.628 -3.305  2.570   1.00 0.00 ? 57 ARG P HH12 7  
ATOM 8108  H HH21 . ARG A 1 59 ? -22.459 -4.253  1.645   1.00 0.00 ? 57 ARG P HH21 7  
ATOM 8109  H HH22 . ARG A 1 59 ? -24.169 -4.475  1.430   1.00 0.00 ? 57 ARG P HH22 7  
ATOM 8110  N N    . LYS A 1 60 ? -23.131 4.215   6.104   1.00 0.00 ? 58 LYS P N    7  
ATOM 8111  C CA   . LYS A 1 60 ? -23.676 5.295   6.964   1.00 0.00 ? 58 LYS P CA   7  
ATOM 8112  C C    . LYS A 1 60 ? -24.387 6.406   6.169   1.00 0.00 ? 58 LYS P C    7  
ATOM 8113  O O    . LYS A 1 60 ? -25.243 7.092   6.731   1.00 0.00 ? 58 LYS P O    7  
ATOM 8114  C CB   . LYS A 1 60 ? -22.573 5.919   7.850   1.00 0.00 ? 58 LYS P CB   7  
ATOM 8115  C CG   . LYS A 1 60 ? -22.394 5.247   9.221   1.00 0.00 ? 58 LYS P CG   7  
ATOM 8116  C CD   . LYS A 1 60 ? -21.660 3.903   9.150   1.00 0.00 ? 58 LYS P CD   7  
ATOM 8117  C CE   . LYS A 1 60 ? -21.520 3.206   10.510  1.00 0.00 ? 58 LYS P CE   7  
ATOM 8118  N NZ   . LYS A 1 60 ? -20.664 3.963   11.463  1.00 0.00 ? 58 LYS P NZ   7  
ATOM 8119  H H    . LYS A 1 60 ? -22.129 4.109   6.012   1.00 0.00 ? 58 LYS P H    7  
ATOM 8120  H HA   . LYS A 1 60 ? -24.443 4.872   7.616   1.00 0.00 ? 58 LYS P HA   7  
ATOM 8121  H HB2  . LYS A 1 60 ? -21.622 5.942   7.318   1.00 0.00 ? 58 LYS P HB2  7  
ATOM 8122  H HB3  . LYS A 1 60 ? -22.844 6.957   8.055   1.00 0.00 ? 58 LYS P HB3  7  
ATOM 8123  H HG2  . LYS A 1 60 ? -21.814 5.926   9.848   1.00 0.00 ? 58 LYS P HG2  7  
ATOM 8124  H HG3  . LYS A 1 60 ? -23.371 5.107   9.686   1.00 0.00 ? 58 LYS P HG3  7  
ATOM 8125  H HD2  . LYS A 1 60 ? -22.217 3.234   8.493   1.00 0.00 ? 58 LYS P HD2  7  
ATOM 8126  H HD3  . LYS A 1 60 ? -20.667 4.062   8.727   1.00 0.00 ? 58 LYS P HD3  7  
ATOM 8127  H HE2  . LYS A 1 60 ? -22.517 3.057   10.933  1.00 0.00 ? 58 LYS P HE2  7  
ATOM 8128  H HE3  . LYS A 1 60 ? -21.082 2.219   10.334  1.00 0.00 ? 58 LYS P HE3  7  
ATOM 8129  H HZ1  . LYS A 1 60 ? -19.736 4.110   11.091  1.00 0.00 ? 58 LYS P HZ1  7  
ATOM 8130  H HZ2  . LYS A 1 60 ? -20.562 3.457   12.335  1.00 0.00 ? 58 LYS P HZ2  7  
ATOM 8131  H HZ3  . LYS A 1 60 ? -21.063 4.865   11.686  1.00 0.00 ? 58 LYS P HZ3  7  
ATOM 8132  N N    . ARG A 1 61 ? -24.035 6.601   4.890   1.00 0.00 ? 59 ARG P N    7  
ATOM 8133  C CA   . ARG A 1 61 ? -24.512 7.702   4.023   1.00 0.00 ? 59 ARG P CA   7  
ATOM 8134  C C    . ARG A 1 61 ? -25.355 7.238   2.825   1.00 0.00 ? 59 ARG P C    7  
ATOM 8135  O O    . ARG A 1 61 ? -26.179 8.005   2.332   1.00 0.00 ? 59 ARG P O    7  
ATOM 8136  C CB   . ARG A 1 61 ? -23.304 8.535   3.548   1.00 0.00 ? 59 ARG P CB   7  
ATOM 8137  C CG   . ARG A 1 61 ? -22.374 9.055   4.661   1.00 0.00 ? 59 ARG P CG   7  
ATOM 8138  C CD   . ARG A 1 61 ? -23.097 9.917   5.705   1.00 0.00 ? 59 ARG P CD   7  
ATOM 8139  N NE   . ARG A 1 61 ? -22.163 10.395  6.744   1.00 0.00 ? 59 ARG P NE   7  
ATOM 8140  C CZ   . ARG A 1 61 ? -22.465 10.753  7.980   1.00 0.00 ? 59 ARG P CZ   7  
ATOM 8141  N NH1  . ARG A 1 61 ? -23.685 10.715  8.439   1.00 0.00 ? 59 ARG P NH1  7  
ATOM 8142  N NH2  . ARG A 1 61 ? -21.533 11.162  8.792   1.00 0.00 ? 59 ARG P NH2  7  
ATOM 8143  H H    . ARG A 1 61 ? -23.316 5.992   4.517   1.00 0.00 ? 59 ARG P H    7  
ATOM 8144  H HA   . ARG A 1 61 ? -25.174 8.356   4.594   1.00 0.00 ? 59 ARG P HA   7  
ATOM 8145  H HB2  . ARG A 1 61 ? -22.705 7.928   2.868   1.00 0.00 ? 59 ARG P HB2  7  
ATOM 8146  H HB3  . ARG A 1 61 ? -23.676 9.395   2.987   1.00 0.00 ? 59 ARG P HB3  7  
ATOM 8147  H HG2  . ARG A 1 61 ? -21.900 8.210   5.162   1.00 0.00 ? 59 ARG P HG2  7  
ATOM 8148  H HG3  . ARG A 1 61 ? -21.588 9.651   4.197   1.00 0.00 ? 59 ARG P HG3  7  
ATOM 8149  H HD2  . ARG A 1 61 ? -23.555 10.773  5.205   1.00 0.00 ? 59 ARG P HD2  7  
ATOM 8150  H HD3  . ARG A 1 61 ? -23.883 9.321   6.168   1.00 0.00 ? 59 ARG P HD3  7  
ATOM 8151  H HE   . ARG A 1 61 ? -21.193 10.474  6.482   1.00 0.00 ? 59 ARG P HE   7  
ATOM 8152  H HH11 . ARG A 1 61 ? -24.428 10.410  7.834   1.00 0.00 ? 59 ARG P HH11 7  
ATOM 8153  H HH12 . ARG A 1 61 ? -23.887 10.995  9.384   1.00 0.00 ? 59 ARG P HH12 7  
ATOM 8154  H HH21 . ARG A 1 61 ? -20.576 11.213  8.482   1.00 0.00 ? 59 ARG P HH21 7  
ATOM 8155  H HH22 . ARG A 1 61 ? -21.763 11.437  9.732   1.00 0.00 ? 59 ARG P HH22 7  
ATOM 8156  N N    . GLU A 1 62 ? -25.172 5.992   2.379   1.00 0.00 ? 60 GLU P N    7  
ATOM 8157  C CA   . GLU A 1 62 ? -25.896 5.341   1.270   1.00 0.00 ? 60 GLU P CA   7  
ATOM 8158  C C    . GLU A 1 62 ? -25.841 6.131   -0.059  1.00 0.00 ? 60 GLU P C    7  
ATOM 8159  O O    . GLU A 1 62 ? -26.822 6.217   -0.800  1.00 0.00 ? 60 GLU P O    7  
ATOM 8160  C CB   . GLU A 1 62 ? -27.324 4.937   1.695   1.00 0.00 ? 60 GLU P CB   7  
ATOM 8161  C CG   . GLU A 1 62 ? -27.351 4.045   2.943   1.00 0.00 ? 60 GLU P CG   7  
ATOM 8162  C CD   . GLU A 1 62 ? -28.781 3.558   3.244   1.00 0.00 ? 60 GLU P CD   7  
ATOM 8163  O OE1  . GLU A 1 62 ? -29.556 4.296   3.902   1.00 0.00 ? 60 GLU P OE1  7  
ATOM 8164  O OE2  . GLU A 1 62 ? -29.146 2.431   2.828   1.00 0.00 ? 60 GLU P OE2  7  
ATOM 8165  H H    . GLU A 1 62 ? -24.429 5.462   2.815   1.00 0.00 ? 60 GLU P H    7  
ATOM 8166  H HA   . GLU A 1 62 ? -25.368 4.410   1.059   1.00 0.00 ? 60 GLU P HA   7  
ATOM 8167  H HB2  . GLU A 1 62 ? -27.917 5.833   1.883   1.00 0.00 ? 60 GLU P HB2  7  
ATOM 8168  H HB3  . GLU A 1 62 ? -27.788 4.384   0.876   1.00 0.00 ? 60 GLU P HB3  7  
ATOM 8169  H HG2  . GLU A 1 62 ? -26.689 3.190   2.783   1.00 0.00 ? 60 GLU P HG2  7  
ATOM 8170  H HG3  . GLU A 1 62 ? -26.971 4.609   3.799   1.00 0.00 ? 60 GLU P HG3  7  
ATOM 8171  N N    . GLU A 1 63 ? -24.685 6.738   -0.356  1.00 0.00 ? 61 GLU P N    7  
ATOM 8172  C CA   . GLU A 1 63 ? -24.494 7.591   -1.549  1.00 0.00 ? 61 GLU P CA   7  
ATOM 8173  C C    . GLU A 1 63 ? -24.551 6.784   -2.861  1.00 0.00 ? 61 GLU P C    7  
ATOM 8174  O O    . GLU A 1 63 ? -25.207 7.190   -3.823  1.00 0.00 ? 61 GLU P O    7  
ATOM 8175  C CB   . GLU A 1 63 ? -23.162 8.350   -1.454  1.00 0.00 ? 61 GLU P CB   7  
ATOM 8176  C CG   . GLU A 1 63 ? -23.154 9.379   -0.317  1.00 0.00 ? 61 GLU P CG   7  
ATOM 8177  C CD   . GLU A 1 63 ? -21.846 10.195  -0.320  1.00 0.00 ? 61 GLU P CD   7  
ATOM 8178  O OE1  . GLU A 1 63 ? -20.836 9.731   0.261   1.00 0.00 ? 61 GLU P OE1  7  
ATOM 8179  O OE2  . GLU A 1 63 ? -21.821 11.307  -0.903  1.00 0.00 ? 61 GLU P OE2  7  
ATOM 8180  H H    . GLU A 1 63 ? -23.930 6.654   0.311   1.00 0.00 ? 61 GLU P H    7  
ATOM 8181  H HA   . GLU A 1 63 ? -25.302 8.324   -1.592  1.00 0.00 ? 61 GLU P HA   7  
ATOM 8182  H HB2  . GLU A 1 63 ? -22.347 7.640   -1.307  1.00 0.00 ? 61 GLU P HB2  7  
ATOM 8183  H HB3  . GLU A 1 63 ? -22.995 8.872   -2.396  1.00 0.00 ? 61 GLU P HB3  7  
ATOM 8184  H HG2  . GLU A 1 63 ? -24.011 10.047  -0.435  1.00 0.00 ? 61 GLU P HG2  7  
ATOM 8185  H HG3  . GLU A 1 63 ? -23.264 8.861   0.637   1.00 0.00 ? 61 GLU P HG3  7  
ATOM 8186  N N    . PHE A 1 64 ? -23.887 5.623   -2.882  1.00 0.00 ? 62 PHE P N    7  
ATOM 8187  C CA   . PHE A 1 64 ? -24.002 4.601   -3.928  1.00 0.00 ? 62 PHE P CA   7  
ATOM 8188  C C    . PHE A 1 64 ? -25.054 3.547   -3.534  1.00 0.00 ? 62 PHE P C    7  
ATOM 8189  O O    . PHE A 1 64 ? -25.269 3.305   -2.342  1.00 0.00 ? 62 PHE P O    7  
ATOM 8190  C CB   . PHE A 1 64 ? -22.617 3.985   -4.184  1.00 0.00 ? 62 PHE P CB   7  
ATOM 8191  C CG   . PHE A 1 64 ? -22.610 2.872   -5.216  1.00 0.00 ? 62 PHE P CG   7  
ATOM 8192  C CD1  . PHE A 1 64 ? -22.730 3.180   -6.584  1.00 0.00 ? 62 PHE P CD1  7  
ATOM 8193  C CD2  . PHE A 1 64 ? -22.510 1.527   -4.808  1.00 0.00 ? 62 PHE P CD2  7  
ATOM 8194  C CE1  . PHE A 1 64 ? -22.752 2.149   -7.541  1.00 0.00 ? 62 PHE P CE1  7  
ATOM 8195  C CE2  . PHE A 1 64 ? -22.527 0.497   -5.765  1.00 0.00 ? 62 PHE P CE2  7  
ATOM 8196  C CZ   . PHE A 1 64 ? -22.650 0.807   -7.132  1.00 0.00 ? 62 PHE P CZ   7  
ATOM 8197  H H    . PHE A 1 64 ? -23.348 5.389   -2.064  1.00 0.00 ? 62 PHE P H    7  
ATOM 8198  H HA   . PHE A 1 64 ? -24.335 5.070   -4.856  1.00 0.00 ? 62 PHE P HA   7  
ATOM 8199  H HB2  . PHE A 1 64 ? -21.942 4.773   -4.522  1.00 0.00 ? 62 PHE P HB2  7  
ATOM 8200  H HB3  . PHE A 1 64 ? -22.218 3.596   -3.247  1.00 0.00 ? 62 PHE P HB3  7  
ATOM 8201  H HD1  . PHE A 1 64 ? -22.809 4.211   -6.904  1.00 0.00 ? 62 PHE P HD1  7  
ATOM 8202  H HD2  . PHE A 1 64 ? -22.422 1.281   -3.758  1.00 0.00 ? 62 PHE P HD2  7  
ATOM 8203  H HE1  . PHE A 1 64 ? -22.846 2.386   -8.592  1.00 0.00 ? 62 PHE P HE1  7  
ATOM 8204  H HE2  . PHE A 1 64 ? -22.444 -0.534  -5.452  1.00 0.00 ? 62 PHE P HE2  7  
ATOM 8205  H HZ   . PHE A 1 64 ? -22.667 0.014   -7.868  1.00 0.00 ? 62 PHE P HZ   7  
ATOM 8206  N N    . ILE A 1 65 ? -25.691 2.905   -4.519  1.00 0.00 ? 63 ILE P N    7  
ATOM 8207  C CA   . ILE A 1 65 ? -26.710 1.858   -4.336  1.00 0.00 ? 63 ILE P CA   7  
ATOM 8208  C C    . ILE A 1 65 ? -26.364 0.644   -5.211  1.00 0.00 ? 63 ILE P C    7  
ATOM 8209  O O    . ILE A 1 65 ? -26.112 0.780   -6.411  1.00 0.00 ? 63 ILE P O    7  
ATOM 8210  C CB   . ILE A 1 65 ? -28.124 2.408   -4.659  1.00 0.00 ? 63 ILE P CB   7  
ATOM 8211  C CG1  . ILE A 1 65 ? -28.545 3.600   -3.765  1.00 0.00 ? 63 ILE P CG1  7  
ATOM 8212  C CG2  . ILE A 1 65 ? -29.195 1.303   -4.596  1.00 0.00 ? 63 ILE P CG2  7  
ATOM 8213  C CD1  . ILE A 1 65 ? -28.747 3.287   -2.274  1.00 0.00 ? 63 ILE P CD1  7  
ATOM 8214  H H    . ILE A 1 65 ? -25.416 3.111   -5.469  1.00 0.00 ? 63 ILE P H    7  
ATOM 8215  H HA   . ILE A 1 65 ? -26.707 1.527   -3.299  1.00 0.00 ? 63 ILE P HA   7  
ATOM 8216  H HB   . ILE A 1 65 ? -28.104 2.775   -5.687  1.00 0.00 ? 63 ILE P HB   7  
ATOM 8217  H HG12 . ILE A 1 65 ? -27.805 4.396   -3.853  1.00 0.00 ? 63 ILE P HG12 7  
ATOM 8218  H HG13 . ILE A 1 65 ? -29.482 4.002   -4.151  1.00 0.00 ? 63 ILE P HG13 7  
ATOM 8219  H HG21 . ILE A 1 65 ? -29.161 0.788   -3.636  1.00 0.00 ? 63 ILE P HG21 7  
ATOM 8220  H HG22 . ILE A 1 65 ? -30.186 1.739   -4.732  1.00 0.00 ? 63 ILE P HG22 7  
ATOM 8221  H HG23 . ILE A 1 65 ? -29.040 0.576   -5.394  1.00 0.00 ? 63 ILE P HG23 7  
ATOM 8222  H HD11 . ILE A 1 65 ? -27.843 2.861   -1.842  1.00 0.00 ? 63 ILE P HD11 7  
ATOM 8223  H HD12 . ILE A 1 65 ? -29.574 2.589   -2.141  1.00 0.00 ? 63 ILE P HD12 7  
ATOM 8224  H HD13 . ILE A 1 65 ? -28.985 4.210   -1.744  1.00 0.00 ? 63 ILE P HD13 7  
ATOM 8225  N N    . VAL A 1 66 ? -26.382 -0.552  -4.613  1.00 0.00 ? 64 VAL P N    7  
ATOM 8226  C CA   . VAL A 1 66 ? -26.116 -1.833  -5.294  1.00 0.00 ? 64 VAL P CA   7  
ATOM 8227  C C    . VAL A 1 66 ? -27.374 -2.319  -6.023  1.00 0.00 ? 64 VAL P C    7  
ATOM 8228  O O    . VAL A 1 66 ? -28.461 -2.346  -5.440  1.00 0.00 ? 64 VAL P O    7  
ATOM 8229  C CB   . VAL A 1 66 ? -25.619 -2.897  -4.293  1.00 0.00 ? 64 VAL P CB   7  
ATOM 8230  C CG1  . VAL A 1 66 ? -25.297 -4.231  -4.978  1.00 0.00 ? 64 VAL P CG1  7  
ATOM 8231  C CG2  . VAL A 1 66 ? -24.345 -2.436  -3.568  1.00 0.00 ? 64 VAL P CG2  7  
ATOM 8232  H H    . VAL A 1 66 ? -26.635 -0.584  -3.636  1.00 0.00 ? 64 VAL P H    7  
ATOM 8233  H HA   . VAL A 1 66 ? -25.328 -1.678  -6.032  1.00 0.00 ? 64 VAL P HA   7  
ATOM 8234  H HB   . VAL A 1 66 ? -26.399 -3.071  -3.551  1.00 0.00 ? 64 VAL P HB   7  
ATOM 8235  H HG11 . VAL A 1 66 ? -24.896 -4.933  -4.246  1.00 0.00 ? 64 VAL P HG11 7  
ATOM 8236  H HG12 . VAL A 1 66 ? -26.200 -4.670  -5.400  1.00 0.00 ? 64 VAL P HG12 7  
ATOM 8237  H HG13 . VAL A 1 66 ? -24.560 -4.082  -5.767  1.00 0.00 ? 64 VAL P HG13 7  
ATOM 8238  H HG21 . VAL A 1 66 ? -23.543 -2.280  -4.287  1.00 0.00 ? 64 VAL P HG21 7  
ATOM 8239  H HG22 . VAL A 1 66 ? -24.527 -1.508  -3.028  1.00 0.00 ? 64 VAL P HG22 7  
ATOM 8240  H HG23 . VAL A 1 66 ? -24.036 -3.194  -2.848  1.00 0.00 ? 64 VAL P HG23 7  
ATOM 8241  N N    . THR A 1 67 ? -27.230 -2.722  -7.288  1.00 0.00 ? 65 THR P N    7  
ATOM 8242  C CA   . THR A 1 67 ? -28.344 -3.132  -8.169  1.00 0.00 ? 65 THR P CA   7  
ATOM 8243  C C    . THR A 1 67 ? -28.374 -4.629  -8.512  1.00 0.00 ? 65 THR P C    7  
ATOM 8244  O O    . THR A 1 67 ? -29.409 -5.134  -8.953  1.00 0.00 ? 65 THR P O    7  
ATOM 8245  C CB   . THR A 1 67 ? -28.327 -2.315  -9.472  1.00 0.00 ? 65 THR P CB   7  
ATOM 8246  O OG1  . THR A 1 67 ? -27.069 -2.432  -10.110 1.00 0.00 ? 65 THR P OG1  7  
ATOM 8247  C CG2  . THR A 1 67 ? -28.579 -0.830  -9.210  1.00 0.00 ? 65 THR P CG2  7  
ATOM 8248  H H    . THR A 1 67 ? -26.323 -2.621  -7.723  1.00 0.00 ? 65 THR P H    7  
ATOM 8249  H HA   . THR A 1 67 ? -29.289 -2.921  -7.668  1.00 0.00 ? 65 THR P HA   7  
ATOM 8250  H HB   . THR A 1 67 ? -29.108 -2.687  -10.139 1.00 0.00 ? 65 THR P HB   7  
ATOM 8251  H HG1  . THR A 1 67 ? -27.136 -1.986  -10.973 1.00 0.00 ? 65 THR P HG1  7  
ATOM 8252  H HG21 . THR A 1 67 ? -27.770 -0.410  -8.612  1.00 0.00 ? 65 THR P HG21 7  
ATOM 8253  H HG22 . THR A 1 67 ? -29.521 -0.709  -8.676  1.00 0.00 ? 65 THR P HG22 7  
ATOM 8254  H HG23 . THR A 1 67 ? -28.641 -0.296  -10.158 1.00 0.00 ? 65 THR P HG23 7  
ATOM 8255  N N    . ASP A 1 68 ? -27.267 -5.351  -8.292  1.00 0.00 ? 66 ASP P N    7  
ATOM 8256  C CA   . ASP A 1 68 ? -27.104 -6.797  -8.553  1.00 0.00 ? 66 ASP P CA   7  
ATOM 8257  C C    . ASP A 1 68 ? -26.149 -7.483  -7.553  1.00 0.00 ? 66 ASP P C    7  
ATOM 8258  O O    . ASP A 1 68 ? -25.011 -6.995  -7.368  1.00 0.00 ? 66 ASP P O    7  
ATOM 8259  C CB   . ASP A 1 68 ? -26.624 -7.008  -10.004 1.00 0.00 ? 66 ASP P CB   7  
ATOM 8260  C CG   . ASP A 1 68 ? -26.462 -8.499  -10.376 1.00 0.00 ? 66 ASP P CG   7  
ATOM 8261  O OD1  . ASP A 1 68 ? -27.491 -9.201  -10.540 1.00 0.00 ? 66 ASP P OD1  7  
ATOM 8262  O OD2  . ASP A 1 68 ? -25.308 -8.971  -10.542 1.00 0.00 ? 66 ASP P OD2  7  
ATOM 8263  O OXT  . ASP A 1 68 ? -26.555 -8.501  -6.949  1.00 0.00 ? 66 ASP P OXT  7  
ATOM 8264  H H    . ASP A 1 68 ? -26.466 -4.858  -7.926  1.00 0.00 ? 66 ASP P H    7  
ATOM 8265  H HA   . ASP A 1 68 ? -28.074 -7.286  -8.453  1.00 0.00 ? 66 ASP P HA   7  
ATOM 8266  H HB2  . ASP A 1 68 ? -27.345 -6.551  -10.686 1.00 0.00 ? 66 ASP P HB2  7  
ATOM 8267  H HB3  . ASP A 1 68 ? -25.672 -6.488  -10.144 1.00 0.00 ? 66 ASP P HB3  7  
ATOM 8268  N N    . GLY A 1 1  ? -3.572  -8.511  19.018  1.00 0.00 ? -1 GLY P N    8  
ATOM 8269  C CA   . GLY A 1 1  ? -4.082  -7.643  20.103  1.00 0.00 ? -1 GLY P CA   8  
ATOM 8270  C C    . GLY A 1 1  ? -5.370  -6.939  19.700  1.00 0.00 ? -1 GLY P C    8  
ATOM 8271  O O    . GLY A 1 1  ? -5.576  -6.635  18.523  1.00 0.00 ? -1 GLY P O    8  
ATOM 8272  H H1   . GLY A 1 1  ? -3.404  -7.964  18.187  1.00 0.00 ? -1 GLY P H1   8  
ATOM 8273  H H2   . GLY A 1 1  ? -4.244  -9.230  18.799  1.00 0.00 ? -1 GLY P H2   8  
ATOM 8274  H H3   . GLY A 1 1  ? -2.709  -8.949  19.299  1.00 0.00 ? -1 GLY P H3   8  
ATOM 8275  H HA2  . GLY A 1 1  ? -4.271  -8.246  20.991  1.00 0.00 ? -1 GLY P HA2  8  
ATOM 8276  H HA3  . GLY A 1 1  ? -3.337  -6.884  20.344  1.00 0.00 ? -1 GLY P HA3  8  
ATOM 8277  N N    . SER A 1 2  ? -6.250  -6.668  20.670  1.00 0.00 ? 0  SER P N    8  
ATOM 8278  C CA   . SER A 1 2  ? -7.579  -6.068  20.444  1.00 0.00 ? 0  SER P CA   8  
ATOM 8279  C C    . SER A 1 2  ? -7.507  -4.643  19.875  1.00 0.00 ? 0  SER P C    8  
ATOM 8280  O O    . SER A 1 2  ? -6.713  -3.815  20.327  1.00 0.00 ? 0  SER P O    8  
ATOM 8281  C CB   . SER A 1 2  ? -8.396  -6.065  21.743  1.00 0.00 ? 0  SER P CB   8  
ATOM 8282  O OG   . SER A 1 2  ? -8.472  -7.378  22.282  1.00 0.00 ? 0  SER P OG   8  
ATOM 8283  H H    . SER A 1 2  ? -6.046  -6.977  21.611  1.00 0.00 ? 0  SER P H    8  
ATOM 8284  H HA   . SER A 1 2  ? -8.114  -6.690  19.724  1.00 0.00 ? 0  SER P HA   8  
ATOM 8285  H HB2  . SER A 1 2  ? -7.921  -5.404  22.471  1.00 0.00 ? 0  SER P HB2  8  
ATOM 8286  H HB3  . SER A 1 2  ? -9.403  -5.697  21.537  1.00 0.00 ? 0  SER P HB3  8  
ATOM 8287  H HG   . SER A 1 2  ? -9.027  -7.352  23.085  1.00 0.00 ? 0  SER P HG   8  
ATOM 8288  N N    . GLN A 1 3  ? -8.380  -4.333  18.915  1.00 0.00 ? 1  GLN P N    8  
ATOM 8289  C CA   . GLN A 1 3  ? -8.353  -3.107  18.100  1.00 0.00 ? 1  GLN P CA   8  
ATOM 8290  C C    . GLN A 1 3  ? -8.899  -1.847  18.814  1.00 0.00 ? 1  GLN P C    8  
ATOM 8291  O O    . GLN A 1 3  ? -9.019  -0.786  18.199  1.00 0.00 ? 1  GLN P O    8  
ATOM 8292  C CB   . GLN A 1 3  ? -9.081  -3.360  16.761  1.00 0.00 ? 1  GLN P CB   8  
ATOM 8293  C CG   . GLN A 1 3  ? -8.472  -4.475  15.884  1.00 0.00 ? 1  GLN P CG   8  
ATOM 8294  C CD   . GLN A 1 3  ? -8.867  -5.910  16.254  1.00 0.00 ? 1  GLN P CD   8  
ATOM 8295  O OE1  . GLN A 1 3  ? -9.638  -6.182  17.168  1.00 0.00 ? 1  GLN P OE1  8  
ATOM 8296  N NE2  . GLN A 1 3  ? -8.353  -6.898  15.552  1.00 0.00 ? 1  GLN P NE2  8  
ATOM 8297  H H    . GLN A 1 3  ? -9.020  -5.061  18.613  1.00 0.00 ? 1  GLN P H    8  
ATOM 8298  H HA   . GLN A 1 3  ? -7.309  -2.888  17.867  1.00 0.00 ? 1  GLN P HA   8  
ATOM 8299  H HB2  . GLN A 1 3  ? -10.136 -3.568  16.945  1.00 0.00 ? 1  GLN P HB2  8  
ATOM 8300  H HB3  . GLN A 1 3  ? -9.031  -2.440  16.176  1.00 0.00 ? 1  GLN P HB3  8  
ATOM 8301  H HG2  . GLN A 1 3  ? -8.796  -4.308  14.857  1.00 0.00 ? 1  GLN P HG2  8  
ATOM 8302  H HG3  . GLN A 1 3  ? -7.384  -4.391  15.898  1.00 0.00 ? 1  GLN P HG3  8  
ATOM 8303  H HE21 . GLN A 1 3  ? -7.714  -6.708  14.794  1.00 0.00 ? 1  GLN P HE21 8  
ATOM 8304  H HE22 . GLN A 1 3  ? -8.616  -7.842  15.792  1.00 0.00 ? 1  GLN P HE22 8  
ATOM 8305  N N    . ARG A 1 4  ? -9.212  -1.932  20.116  1.00 0.00 ? 2  ARG P N    8  
ATOM 8306  C CA   . ARG A 1 4  ? -9.845  -0.884  20.951  1.00 0.00 ? 2  ARG P CA   8  
ATOM 8307  C C    . ARG A 1 4  ? -8.938  0.303   21.341  1.00 0.00 ? 2  ARG P C    8  
ATOM 8308  O O    . ARG A 1 4  ? -9.152  0.934   22.378  1.00 0.00 ? 2  ARG P O    8  
ATOM 8309  C CB   . ARG A 1 4  ? -10.552 -1.548  22.153  1.00 0.00 ? 2  ARG P CB   8  
ATOM 8310  C CG   . ARG A 1 4  ? -9.597  -2.210  23.163  1.00 0.00 ? 2  ARG P CG   8  
ATOM 8311  C CD   . ARG A 1 4  ? -10.388 -2.853  24.308  1.00 0.00 ? 2  ARG P CD   8  
ATOM 8312  N NE   . ARG A 1 4  ? -9.493  -3.471  25.308  1.00 0.00 ? 2  ARG P NE   8  
ATOM 8313  C CZ   . ARG A 1 4  ? -9.863  -4.135  26.390  1.00 0.00 ? 2  ARG P CZ   8  
ATOM 8314  N NH1  . ARG A 1 4  ? -11.117 -4.331  26.691  1.00 0.00 ? 2  ARG P NH1  8  
ATOM 8315  N NH2  . ARG A 1 4  ? -8.970  -4.622  27.204  1.00 0.00 ? 2  ARG P NH2  8  
ATOM 8316  H H    . ARG A 1 4  ? -9.051  -2.830  20.548  1.00 0.00 ? 2  ARG P H    8  
ATOM 8317  H HA   . ARG A 1 4  ? -10.632 -0.429  20.345  1.00 0.00 ? 2  ARG P HA   8  
ATOM 8318  H HB2  . ARG A 1 4  ? -11.148 -0.795  22.673  1.00 0.00 ? 2  ARG P HB2  8  
ATOM 8319  H HB3  . ARG A 1 4  ? -11.244 -2.304  21.775  1.00 0.00 ? 2  ARG P HB3  8  
ATOM 8320  H HG2  . ARG A 1 4  ? -9.007  -2.980  22.665  1.00 0.00 ? 2  ARG P HG2  8  
ATOM 8321  H HG3  . ARG A 1 4  ? -8.920  -1.462  23.577  1.00 0.00 ? 2  ARG P HG3  8  
ATOM 8322  H HD2  . ARG A 1 4  ? -10.994 -2.083  24.791  1.00 0.00 ? 2  ARG P HD2  8  
ATOM 8323  H HD3  . ARG A 1 4  ? -11.053 -3.613  23.892  1.00 0.00 ? 2  ARG P HD3  8  
ATOM 8324  H HE   . ARG A 1 4  ? -8.501  -3.359  25.170  1.00 0.00 ? 2  ARG P HE   8  
ATOM 8325  H HH11 . ARG A 1 4  ? -11.830 -3.962  26.085  1.00 0.00 ? 2  ARG P HH11 8  
ATOM 8326  H HH12 . ARG A 1 4  ? -11.373 -4.838  27.520  1.00 0.00 ? 2  ARG P HH12 8  
ATOM 8327  H HH21 . ARG A 1 4  ? -7.989  -4.493  27.016  1.00 0.00 ? 2  ARG P HH21 8  
ATOM 8328  H HH22 . ARG A 1 4  ? -9.254  -5.125  28.027  1.00 0.00 ? 2  ARG P HH22 8  
ATOM 8329  N N    . ARG A 1 5  ? -7.917  0.603   20.530  1.00 0.00 ? 3  ARG P N    8  
ATOM 8330  C CA   . ARG A 1 5  ? -6.975  1.730   20.696  1.00 0.00 ? 3  ARG P CA   8  
ATOM 8331  C C    . ARG A 1 5  ? -7.527  3.031   20.091  1.00 0.00 ? 3  ARG P C    8  
ATOM 8332  O O    . ARG A 1 5  ? -8.340  3.006   19.165  1.00 0.00 ? 3  ARG P O    8  
ATOM 8333  C CB   . ARG A 1 5  ? -5.597  1.362   20.102  1.00 0.00 ? 3  ARG P CB   8  
ATOM 8334  C CG   . ARG A 1 5  ? -4.669  0.628   21.085  1.00 0.00 ? 3  ARG P CG   8  
ATOM 8335  C CD   . ARG A 1 5  ? -5.111  -0.789  21.482  1.00 0.00 ? 3  ARG P CD   8  
ATOM 8336  N NE   . ARG A 1 5  ? -4.183  -1.350  22.483  1.00 0.00 ? 3  ARG P NE   8  
ATOM 8337  C CZ   . ARG A 1 5  ? -4.149  -2.585  22.952  1.00 0.00 ? 3  ARG P CZ   8  
ATOM 8338  N NH1  . ARG A 1 5  ? -4.930  -3.529  22.511  1.00 0.00 ? 3  ARG P NH1  8  
ATOM 8339  N NH2  . ARG A 1 5  ? -3.310  -2.900  23.896  1.00 0.00 ? 3  ARG P NH2  8  
ATOM 8340  H H    . ARG A 1 5  ? -7.889  0.092   19.657  1.00 0.00 ? 3  ARG P H    8  
ATOM 8341  H HA   . ARG A 1 5  ? -6.848  1.927   21.764  1.00 0.00 ? 3  ARG P HA   8  
ATOM 8342  H HB2  . ARG A 1 5  ? -5.724  0.766   19.196  1.00 0.00 ? 3  ARG P HB2  8  
ATOM 8343  H HB3  . ARG A 1 5  ? -5.085  2.281   19.815  1.00 0.00 ? 3  ARG P HB3  8  
ATOM 8344  H HG2  . ARG A 1 5  ? -3.682  0.558   20.627  1.00 0.00 ? 3  ARG P HG2  8  
ATOM 8345  H HG3  . ARG A 1 5  ? -4.573  1.235   21.988  1.00 0.00 ? 3  ARG P HG3  8  
ATOM 8346  H HD2  . ARG A 1 5  ? -6.113  -0.752  21.913  1.00 0.00 ? 3  ARG P HD2  8  
ATOM 8347  H HD3  . ARG A 1 5  ? -5.130  -1.417  20.589  1.00 0.00 ? 3  ARG P HD3  8  
ATOM 8348  H HE   . ARG A 1 5  ? -3.517  -0.712  22.889  1.00 0.00 ? 3  ARG P HE   8  
ATOM 8349  H HH11 . ARG A 1 5  ? -5.551  -3.349  21.729  1.00 0.00 ? 3  ARG P HH11 8  
ATOM 8350  H HH12 . ARG A 1 5  ? -4.876  -4.452  22.903  1.00 0.00 ? 3  ARG P HH12 8  
ATOM 8351  H HH21 . ARG A 1 5  ? -2.686  -2.204  24.273  1.00 0.00 ? 3  ARG P HH21 8  
ATOM 8352  H HH22 . ARG A 1 5  ? -3.278  -3.837  24.259  1.00 0.00 ? 3  ARG P HH22 8  
ATOM 8353  N N    . GLN A 1 6  ? -7.073  4.171   20.620  1.00 0.00 ? 4  GLN P N    8  
ATOM 8354  C CA   . GLN A 1 6  ? -7.602  5.513   20.309  1.00 0.00 ? 4  GLN P CA   8  
ATOM 8355  C C    . GLN A 1 6  ? -6.805  6.263   19.221  1.00 0.00 ? 4  GLN P C    8  
ATOM 8356  O O    . GLN A 1 6  ? -7.305  7.244   18.664  1.00 0.00 ? 4  GLN P O    8  
ATOM 8357  C CB   . GLN A 1 6  ? -7.669  6.345   21.609  1.00 0.00 ? 4  GLN P CB   8  
ATOM 8358  C CG   . GLN A 1 6  ? -8.817  5.954   22.560  1.00 0.00 ? 4  GLN P CG   8  
ATOM 8359  C CD   . GLN A 1 6  ? -8.737  4.515   23.072  1.00 0.00 ? 4  GLN P CD   8  
ATOM 8360  O OE1  . GLN A 1 6  ? -7.747  4.080   23.647  1.00 0.00 ? 4  GLN P OE1  8  
ATOM 8361  N NE2  . GLN A 1 6  ? -9.746  3.704   22.835  1.00 0.00 ? 4  GLN P NE2  8  
ATOM 8362  H H    . GLN A 1 6  ? -6.419  4.094   21.386  1.00 0.00 ? 4  GLN P H    8  
ATOM 8363  H HA   . GLN A 1 6  ? -8.619  5.416   19.927  1.00 0.00 ? 4  GLN P HA   8  
ATOM 8364  H HB2  . GLN A 1 6  ? -6.716  6.277   22.138  1.00 0.00 ? 4  GLN P HB2  8  
ATOM 8365  H HB3  . GLN A 1 6  ? -7.820  7.393   21.345  1.00 0.00 ? 4  GLN P HB3  8  
ATOM 8366  H HG2  . GLN A 1 6  ? -8.805  6.623   23.422  1.00 0.00 ? 4  GLN P HG2  8  
ATOM 8367  H HG3  . GLN A 1 6  ? -9.765  6.106   22.042  1.00 0.00 ? 4  GLN P HG3  8  
ATOM 8368  H HE21 . GLN A 1 6  ? -10.569 4.036   22.357  1.00 0.00 ? 4  GLN P HE21 8  
ATOM 8369  H HE22 . GLN A 1 6  ? -9.620  2.716   23.033  1.00 0.00 ? 4  GLN P HE22 8  
ATOM 8370  N N    . ARG A 1 7  ? -5.578  5.820   18.901  1.00 0.00 ? 5  ARG P N    8  
ATOM 8371  C CA   . ARG A 1 7  ? -4.686  6.447   17.905  1.00 0.00 ? 5  ARG P CA   8  
ATOM 8372  C C    . ARG A 1 7  ? -4.850  5.831   16.510  1.00 0.00 ? 5  ARG P C    8  
ATOM 8373  O O    . ARG A 1 7  ? -5.043  4.621   16.374  1.00 0.00 ? 5  ARG P O    8  
ATOM 8374  C CB   . ARG A 1 7  ? -3.220  6.376   18.373  1.00 0.00 ? 5  ARG P CB   8  
ATOM 8375  C CG   . ARG A 1 7  ? -2.970  7.194   19.653  1.00 0.00 ? 5  ARG P CG   8  
ATOM 8376  C CD   . ARG A 1 7  ? -1.503  7.136   20.108  1.00 0.00 ? 5  ARG P CD   8  
ATOM 8377  N NE   . ARG A 1 7  ? -0.580  7.766   19.138  1.00 0.00 ? 5  ARG P NE   8  
ATOM 8378  C CZ   . ARG A 1 7  ? -0.291  9.051   19.021  1.00 0.00 ? 5  ARG P CZ   8  
ATOM 8379  N NH1  . ARG A 1 7  ? -0.824  9.960   19.788  1.00 0.00 ? 5  ARG P NH1  8  
ATOM 8380  N NH2  . ARG A 1 7  ? 0.553   9.453   18.114  1.00 0.00 ? 5  ARG P NH2  8  
ATOM 8381  H H    . ARG A 1 7  ? -5.251  4.987   19.369  1.00 0.00 ? 5  ARG P H    8  
ATOM 8382  H HA   . ARG A 1 7  ? -4.950  7.503   17.812  1.00 0.00 ? 5  ARG P HA   8  
ATOM 8383  H HB2  . ARG A 1 7  ? -2.944  5.334   18.548  1.00 0.00 ? 5  ARG P HB2  8  
ATOM 8384  H HB3  . ARG A 1 7  ? -2.584  6.769   17.578  1.00 0.00 ? 5  ARG P HB3  8  
ATOM 8385  H HG2  . ARG A 1 7  ? -3.255  8.232   19.482  1.00 0.00 ? 5  ARG P HG2  8  
ATOM 8386  H HG3  . ARG A 1 7  ? -3.589  6.798   20.460  1.00 0.00 ? 5  ARG P HG3  8  
ATOM 8387  H HD2  . ARG A 1 7  ? -1.412  7.625   21.080  1.00 0.00 ? 5  ARG P HD2  8  
ATOM 8388  H HD3  . ARG A 1 7  ? -1.220  6.090   20.245  1.00 0.00 ? 5  ARG P HD3  8  
ATOM 8389  H HE   . ARG A 1 7  ? -0.102  7.145   18.504  1.00 0.00 ? 5  ARG P HE   8  
ATOM 8390  H HH11 . ARG A 1 7  ? -1.474  9.682   20.502  1.00 0.00 ? 5  ARG P HH11 8  
ATOM 8391  H HH12 . ARG A 1 7  ? -0.583  10.931  19.676  1.00 0.00 ? 5  ARG P HH12 8  
ATOM 8392  H HH21 . ARG A 1 7  ? 0.990   8.788   17.498  1.00 0.00 ? 5  ARG P HH21 8  
ATOM 8393  H HH22 . ARG A 1 7  ? 0.774   10.431  18.025  1.00 0.00 ? 5  ARG P HH22 8  
ATOM 8394  N N    . THR A 1 8  ? -4.730  6.661   15.473  1.00 0.00 ? 6  THR P N    8  
ATOM 8395  C CA   . THR A 1 8  ? -4.815  6.255   14.056  1.00 0.00 ? 6  THR P CA   8  
ATOM 8396  C C    . THR A 1 8  ? -3.470  5.716   13.556  1.00 0.00 ? 6  THR P C    8  
ATOM 8397  O O    . THR A 1 8  ? -2.426  6.333   13.785  1.00 0.00 ? 6  THR P O    8  
ATOM 8398  C CB   . THR A 1 8  ? -5.283  7.433   13.180  1.00 0.00 ? 6  THR P CB   8  
ATOM 8399  O OG1  . THR A 1 8  ? -6.496  7.950   13.692  1.00 0.00 ? 6  THR P OG1  8  
ATOM 8400  C CG2  . THR A 1 8  ? -5.547  7.039   11.725  1.00 0.00 ? 6  THR P CG2  8  
ATOM 8401  H H    . THR A 1 8  ? -4.585  7.640   15.669  1.00 0.00 ? 6  THR P H    8  
ATOM 8402  H HA   . THR A 1 8  ? -5.560  5.464   13.963  1.00 0.00 ? 6  THR P HA   8  
ATOM 8403  H HB   . THR A 1 8  ? -4.528  8.221   13.204  1.00 0.00 ? 6  THR P HB   8  
ATOM 8404  H HG1  . THR A 1 8  ? -6.706  8.761   13.194  1.00 0.00 ? 6  THR P HG1  8  
ATOM 8405  H HG21 . THR A 1 8  ? -6.238  6.196   11.682  1.00 0.00 ? 6  THR P HG21 8  
ATOM 8406  H HG22 . THR A 1 8  ? -4.611  6.771   11.239  1.00 0.00 ? 6  THR P HG22 8  
ATOM 8407  H HG23 . THR A 1 8  ? -5.975  7.883   11.185  1.00 0.00 ? 6  THR P HG23 8  
ATOM 8408  N N    . HIS A 1 9  ? -3.481  4.581   12.846  1.00 0.00 ? 7  HIS P N    8  
ATOM 8409  C CA   . HIS A 1 9  ? -2.276  3.979   12.248  1.00 0.00 ? 7  HIS P CA   8  
ATOM 8410  C C    . HIS A 1 9  ? -1.785  4.738   11.004  1.00 0.00 ? 7  HIS P C    8  
ATOM 8411  O O    . HIS A 1 9  ? -0.591  5.012   10.868  1.00 0.00 ? 7  HIS P O    8  
ATOM 8412  C CB   . HIS A 1 9  ? -2.560  2.507   11.908  1.00 0.00 ? 7  HIS P CB   8  
ATOM 8413  C CG   . HIS A 1 9  ? -1.427  1.849   11.158  1.00 0.00 ? 7  HIS P CG   8  
ATOM 8414  N ND1  . HIS A 1 9  ? -0.242  1.370   11.725  1.00 0.00 ? 7  HIS P ND1  8  
ATOM 8415  C CD2  . HIS A 1 9  ? -1.353  1.718   9.802   1.00 0.00 ? 7  HIS P CD2  8  
ATOM 8416  C CE1  . HIS A 1 9  ? 0.517   0.960   10.693  1.00 0.00 ? 7  HIS P CE1  8  
ATOM 8417  N NE2  . HIS A 1 9  ? -0.126  1.155   9.529   1.00 0.00 ? 7  HIS P NE2  8  
ATOM 8418  H H    . HIS A 1 9  ? -4.361  4.099   12.729  1.00 0.00 ? 7  HIS P H    8  
ATOM 8419  H HA   . HIS A 1 9  ? -1.458  3.999   12.971  1.00 0.00 ? 7  HIS P HA   8  
ATOM 8420  H HB2  . HIS A 1 9  ? -2.738  1.954   12.833  1.00 0.00 ? 7  HIS P HB2  8  
ATOM 8421  H HB3  . HIS A 1 9  ? -3.461  2.442   11.296  1.00 0.00 ? 7  HIS P HB3  8  
ATOM 8422  H HD2  . HIS A 1 9  ? -2.101  2.040   9.088   1.00 0.00 ? 7  HIS P HD2  8  
ATOM 8423  H HE1  . HIS A 1 9  ? 1.514   0.543   10.785  1.00 0.00 ? 7  HIS P HE1  8  
ATOM 8424  H HE2  . HIS A 1 9  ? 0.254   0.957   8.611   1.00 0.00 ? 7  HIS P HE2  8  
ATOM 8425  N N    . PHE A 1 10 ? -2.707  5.066   10.095  1.00 0.00 ? 8  PHE P N    8  
ATOM 8426  C CA   . PHE A 1 10 ? -2.390  5.594   8.767   1.00 0.00 ? 8  PHE P CA   8  
ATOM 8427  C C    . PHE A 1 10 ? -1.949  7.066   8.769   1.00 0.00 ? 8  PHE P C    8  
ATOM 8428  O O    . PHE A 1 10 ? -2.315  7.844   9.655   1.00 0.00 ? 8  PHE P O    8  
ATOM 8429  C CB   . PHE A 1 10 ? -3.586  5.411   7.826   1.00 0.00 ? 8  PHE P CB   8  
ATOM 8430  C CG   . PHE A 1 10 ? -4.094  3.988   7.698   1.00 0.00 ? 8  PHE P CG   8  
ATOM 8431  C CD1  . PHE A 1 10 ? -3.529  3.124   6.741   1.00 0.00 ? 8  PHE P CD1  8  
ATOM 8432  C CD2  . PHE A 1 10 ? -5.132  3.526   8.531   1.00 0.00 ? 8  PHE P CD2  8  
ATOM 8433  C CE1  . PHE A 1 10 ? -3.993  1.802   6.625   1.00 0.00 ? 8  PHE P CE1  8  
ATOM 8434  C CE2  . PHE A 1 10 ? -5.585  2.198   8.425   1.00 0.00 ? 8  PHE P CE2  8  
ATOM 8435  C CZ   . PHE A 1 10 ? -5.013  1.336   7.474   1.00 0.00 ? 8  PHE P CZ   8  
ATOM 8436  H H    . PHE A 1 10 ? -3.666  4.828   10.290  1.00 0.00 ? 8  PHE P H    8  
ATOM 8437  H HA   . PHE A 1 10 ? -1.567  5.002   8.370   1.00 0.00 ? 8  PHE P HA   8  
ATOM 8438  H HB2  . PHE A 1 10 ? -4.400  6.050   8.172   1.00 0.00 ? 8  PHE P HB2  8  
ATOM 8439  H HB3  . PHE A 1 10 ? -3.285  5.761   6.837   1.00 0.00 ? 8  PHE P HB3  8  
ATOM 8440  H HD1  . PHE A 1 10 ? -2.740  3.478   6.091   1.00 0.00 ? 8  PHE P HD1  8  
ATOM 8441  H HD2  . PHE A 1 10 ? -5.587  4.188   9.255   1.00 0.00 ? 8  PHE P HD2  8  
ATOM 8442  H HE1  . PHE A 1 10 ? -3.570  1.147   5.879   1.00 0.00 ? 8  PHE P HE1  8  
ATOM 8443  H HE2  . PHE A 1 10 ? -6.378  1.842   9.069   1.00 0.00 ? 8  PHE P HE2  8  
ATOM 8444  H HZ   . PHE A 1 10 ? -5.367  0.318   7.388   1.00 0.00 ? 8  PHE P HZ   8  
ATOM 8445  N N    . THR A 1 11 ? -1.212  7.460   7.728   1.00 0.00 ? 9  THR P N    8  
ATOM 8446  C CA   . THR A 1 11 ? -0.789  8.848   7.471   1.00 0.00 ? 9  THR P CA   8  
ATOM 8447  C C    . THR A 1 11 ? -1.675  9.524   6.424   1.00 0.00 ? 9  THR P C    8  
ATOM 8448  O O    . THR A 1 11 ? -2.262  8.861   5.566   1.00 0.00 ? 9  THR P O    8  
ATOM 8449  C CB   . THR A 1 11 ? 0.682   8.944   7.022   1.00 0.00 ? 9  THR P CB   8  
ATOM 8450  O OG1  . THR A 1 11 ? 0.816   8.611   5.656   1.00 0.00 ? 9  THR P OG1  8  
ATOM 8451  C CG2  . THR A 1 11 ? 1.619   8.034   7.811   1.00 0.00 ? 9  THR P CG2  8  
ATOM 8452  H H    . THR A 1 11 ? -0.948  6.759   7.047   1.00 0.00 ? 9  THR P H    8  
ATOM 8453  H HA   . THR A 1 11 ? -0.875  9.421   8.394   1.00 0.00 ? 9  THR P HA   8  
ATOM 8454  H HB   . THR A 1 11 ? 1.011   9.975   7.154   1.00 0.00 ? 9  THR P HB   8  
ATOM 8455  H HG1  . THR A 1 11 ? 1.766   8.644   5.448   1.00 0.00 ? 9  THR P HG1  8  
ATOM 8456  H HG21 . THR A 1 11 ? 2.651   8.245   7.536   1.00 0.00 ? 9  THR P HG21 8  
ATOM 8457  H HG22 . THR A 1 11 ? 1.395   6.989   7.591   1.00 0.00 ? 9  THR P HG22 8  
ATOM 8458  H HG23 . THR A 1 11 ? 1.489   8.212   8.879   1.00 0.00 ? 9  THR P HG23 8  
ATOM 8459  N N    . SER A 1 12 ? -1.695  10.858  6.409   1.00 0.00 ? 10 SER P N    8  
ATOM 8460  C CA   . SER A 1 12 ? -2.375  11.654  5.372   1.00 0.00 ? 10 SER P CA   8  
ATOM 8461  C C    . SER A 1 12 ? -1.801  11.469  3.957   1.00 0.00 ? 10 SER P C    8  
ATOM 8462  O O    . SER A 1 12 ? -2.383  11.977  3.001   1.00 0.00 ? 10 SER P O    8  
ATOM 8463  C CB   . SER A 1 12 ? -2.357  13.141  5.735   1.00 0.00 ? 10 SER P CB   8  
ATOM 8464  O OG   . SER A 1 12 ? -2.761  13.348  7.083   1.00 0.00 ? 10 SER P OG   8  
ATOM 8465  H H    . SER A 1 12 ? -1.241  11.367  7.156   1.00 0.00 ? 10 SER P H    8  
ATOM 8466  H HA   . SER A 1 12 ? -3.419  11.344  5.324   1.00 0.00 ? 10 SER P HA   8  
ATOM 8467  H HB2  . SER A 1 12 ? -1.347  13.530  5.592   1.00 0.00 ? 10 SER P HB2  8  
ATOM 8468  H HB3  . SER A 1 12 ? -3.042  13.666  5.068   1.00 0.00 ? 10 SER P HB3  8  
ATOM 8469  H HG   . SER A 1 12 ? -2.759  14.309  7.261   1.00 0.00 ? 10 SER P HG   8  
ATOM 8470  N N    . GLN A 1 13 ? -0.689  10.739  3.797   1.00 0.00 ? 11 GLN P N    8  
ATOM 8471  C CA   . GLN A 1 13 ? -0.172  10.300  2.498   1.00 0.00 ? 11 GLN P CA   8  
ATOM 8472  C C    . GLN A 1 13 ? -0.712  8.907   2.124   1.00 0.00 ? 11 GLN P C    8  
ATOM 8473  O O    . GLN A 1 13 ? -1.177  8.710   1.001   1.00 0.00 ? 11 GLN P O    8  
ATOM 8474  C CB   . GLN A 1 13 ? 1.364   10.350  2.527   1.00 0.00 ? 11 GLN P CB   8  
ATOM 8475  C CG   . GLN A 1 13 ? 1.963   10.219  1.121   1.00 0.00 ? 11 GLN P CG   8  
ATOM 8476  C CD   . GLN A 1 13 ? 3.490   10.287  1.145   1.00 0.00 ? 11 GLN P CD   8  
ATOM 8477  O OE1  . GLN A 1 13 ? 4.187   9.281   1.127   1.00 0.00 ? 11 GLN P OE1  8  
ATOM 8478  N NE2  . GLN A 1 13 ? 4.074   11.468  1.200   1.00 0.00 ? 11 GLN P NE2  8  
ATOM 8479  H H    . GLN A 1 13 ? -0.241  10.368  4.625   1.00 0.00 ? 11 GLN P H    8  
ATOM 8480  H HA   . GLN A 1 13 ? -0.509  10.997  1.729   1.00 0.00 ? 11 GLN P HA   8  
ATOM 8481  H HB2  . GLN A 1 13 ? 1.679   11.307  2.948   1.00 0.00 ? 11 GLN P HB2  8  
ATOM 8482  H HB3  . GLN A 1 13 ? 1.747   9.550   3.161   1.00 0.00 ? 11 GLN P HB3  8  
ATOM 8483  H HG2  . GLN A 1 13 ? 1.662   9.269   0.679   1.00 0.00 ? 11 GLN P HG2  8  
ATOM 8484  H HG3  . GLN A 1 13 ? 1.579   11.027  0.496   1.00 0.00 ? 11 GLN P HG3  8  
ATOM 8485  H HE21 . GLN A 1 13 ? 3.521   12.312  1.217   1.00 0.00 ? 11 GLN P HE21 8  
ATOM 8486  H HE22 . GLN A 1 13 ? 5.082   11.503  1.219   1.00 0.00 ? 11 GLN P HE22 8  
ATOM 8487  N N    . GLN A 1 14 ? -0.733  7.952   3.065   1.00 0.00 ? 12 GLN P N    8  
ATOM 8488  C CA   . GLN A 1 14 ? -1.232  6.586   2.832   1.00 0.00 ? 12 GLN P CA   8  
ATOM 8489  C C    . GLN A 1 14 ? -2.728  6.581   2.499   1.00 0.00 ? 12 GLN P C    8  
ATOM 8490  O O    . GLN A 1 14 ? -3.159  5.928   1.549   1.00 0.00 ? 12 GLN P O    8  
ATOM 8491  C CB   . GLN A 1 14 ? -0.988  5.726   4.080   1.00 0.00 ? 12 GLN P CB   8  
ATOM 8492  C CG   . GLN A 1 14 ? 0.501   5.460   4.321   1.00 0.00 ? 12 GLN P CG   8  
ATOM 8493  C CD   . GLN A 1 14 ? 0.756   4.718   5.629   1.00 0.00 ? 12 GLN P CD   8  
ATOM 8494  O OE1  . GLN A 1 14 ? 0.066   4.883   6.624   1.00 0.00 ? 12 GLN P OE1  8  
ATOM 8495  N NE2  . GLN A 1 14 ? 1.762   3.875   5.671   1.00 0.00 ? 12 GLN P NE2  8  
ATOM 8496  H H    . GLN A 1 14 ? -0.414  8.188   4.000   1.00 0.00 ? 12 GLN P H    8  
ATOM 8497  H HA   . GLN A 1 14 ? -0.697  6.140   1.992   1.00 0.00 ? 12 GLN P HA   8  
ATOM 8498  H HB2  . GLN A 1 14 ? -1.423  6.224   4.948   1.00 0.00 ? 12 GLN P HB2  8  
ATOM 8499  H HB3  . GLN A 1 14 ? -1.477  4.760   3.950   1.00 0.00 ? 12 GLN P HB3  8  
ATOM 8500  H HG2  . GLN A 1 14 ? 0.879   4.871   3.487   1.00 0.00 ? 12 GLN P HG2  8  
ATOM 8501  H HG3  . GLN A 1 14 ? 1.052   6.396   4.350   1.00 0.00 ? 12 GLN P HG3  8  
ATOM 8502  H HE21 . GLN A 1 14 ? 2.254   3.670   4.808   1.00 0.00 ? 12 GLN P HE21 8  
ATOM 8503  H HE22 . GLN A 1 14 ? 1.919   3.326   6.496   1.00 0.00 ? 12 GLN P HE22 8  
ATOM 8504  N N    . LEU A 1 15 ? -3.511  7.364   3.248   1.00 0.00 ? 13 LEU P N    8  
ATOM 8505  C CA   . LEU A 1 15 ? -4.963  7.504   3.087   1.00 0.00 ? 13 LEU P CA   8  
ATOM 8506  C C    . LEU A 1 15 ? -5.364  7.987   1.684   1.00 0.00 ? 13 LEU P C    8  
ATOM 8507  O O    . LEU A 1 15 ? -6.412  7.593   1.173   1.00 0.00 ? 13 LEU P O    8  
ATOM 8508  C CB   . LEU A 1 15 ? -5.470  8.493   4.149   1.00 0.00 ? 13 LEU P CB   8  
ATOM 8509  C CG   . LEU A 1 15 ? -5.323  7.986   5.598   1.00 0.00 ? 13 LEU P CG   8  
ATOM 8510  C CD1  . LEU A 1 15 ? -5.499  9.136   6.585   1.00 0.00 ? 13 LEU P CD1  8  
ATOM 8511  C CD2  . LEU A 1 15 ? -6.327  6.881   5.908   1.00 0.00 ? 13 LEU P CD2  8  
ATOM 8512  H H    . LEU A 1 15 ? -3.068  7.867   4.013   1.00 0.00 ? 13 LEU P H    8  
ATOM 8513  H HA   . LEU A 1 15 ? -5.441  6.537   3.240   1.00 0.00 ? 13 LEU P HA   8  
ATOM 8514  H HB2  . LEU A 1 15 ? -4.915  9.427   4.041   1.00 0.00 ? 13 LEU P HB2  8  
ATOM 8515  H HB3  . LEU A 1 15 ? -6.522  8.706   3.950   1.00 0.00 ? 13 LEU P HB3  8  
ATOM 8516  H HG   . LEU A 1 15 ? -4.334  7.568   5.750   1.00 0.00 ? 13 LEU P HG   8  
ATOM 8517  H HD11 . LEU A 1 15 ? -6.495  9.567   6.490   1.00 0.00 ? 13 LEU P HD11 8  
ATOM 8518  H HD12 . LEU A 1 15 ? -5.345  8.772   7.600   1.00 0.00 ? 13 LEU P HD12 8  
ATOM 8519  H HD13 . LEU A 1 15 ? -4.749  9.903   6.381   1.00 0.00 ? 13 LEU P HD13 8  
ATOM 8520  H HD21 . LEU A 1 15 ? -6.290  6.635   6.967   1.00 0.00 ? 13 LEU P HD21 8  
ATOM 8521  H HD22 . LEU A 1 15 ? -7.333  7.209   5.650   1.00 0.00 ? 13 LEU P HD22 8  
ATOM 8522  H HD23 . LEU A 1 15 ? -6.049  5.993   5.340   1.00 0.00 ? 13 LEU P HD23 8  
ATOM 8523  N N    . GLN A 1 16 ? -4.518  8.803   1.048   1.00 0.00 ? 14 GLN P N    8  
ATOM 8524  C CA   . GLN A 1 16 ? -4.751  9.306   -0.309  1.00 0.00 ? 14 GLN P CA   8  
ATOM 8525  C C    . GLN A 1 16 ? -4.509  8.234   -1.374  1.00 0.00 ? 14 GLN P C    8  
ATOM 8526  O O    . GLN A 1 16 ? -5.286  8.136   -2.320  1.00 0.00 ? 14 GLN P O    8  
ATOM 8527  C CB   . GLN A 1 16 ? -3.897  10.555  -0.579  1.00 0.00 ? 14 GLN P CB   8  
ATOM 8528  C CG   . GLN A 1 16 ? -4.297  11.742  0.307   1.00 0.00 ? 14 GLN P CG   8  
ATOM 8529  C CD   . GLN A 1 16 ? -5.758  12.141  0.111   1.00 0.00 ? 14 GLN P CD   8  
ATOM 8530  O OE1  . GLN A 1 16 ? -6.154  12.675  -0.918  1.00 0.00 ? 14 GLN P OE1  8  
ATOM 8531  N NE2  . GLN A 1 16 ? -6.619  11.838  1.060   1.00 0.00 ? 14 GLN P NE2  8  
ATOM 8532  H H    . GLN A 1 16 ? -3.652  9.036   1.513   1.00 0.00 ? 14 GLN P H    8  
ATOM 8533  H HA   . GLN A 1 16 ? -5.800  9.585   -0.400  1.00 0.00 ? 14 GLN P HA   8  
ATOM 8534  H HB2  . GLN A 1 16 ? -2.845  10.322  -0.414  1.00 0.00 ? 14 GLN P HB2  8  
ATOM 8535  H HB3  . GLN A 1 16 ? -4.018  10.846  -1.623  1.00 0.00 ? 14 GLN P HB3  8  
ATOM 8536  H HG2  . GLN A 1 16 ? -4.142  11.468  1.347   1.00 0.00 ? 14 GLN P HG2  8  
ATOM 8537  H HG3  . GLN A 1 16 ? -3.657  12.593  0.080   1.00 0.00 ? 14 GLN P HG3  8  
ATOM 8538  H HE21 . GLN A 1 16 ? -6.301  11.410  1.914   1.00 0.00 ? 14 GLN P HE21 8  
ATOM 8539  H HE22 . GLN A 1 16 ? -7.611  11.841  0.813   1.00 0.00 ? 14 GLN P HE22 8  
ATOM 8540  N N    . GLU A 1 17 ? -3.494  7.381   -1.209  1.00 0.00 ? 15 GLU P N    8  
ATOM 8541  C CA   . GLU A 1 17 ? -3.265  6.254   -2.127  1.00 0.00 ? 15 GLU P CA   8  
ATOM 8542  C C    . GLU A 1 17 ? -4.344  5.174   -1.981  1.00 0.00 ? 15 GLU P C    8  
ATOM 8543  O O    . GLU A 1 17 ? -4.780  4.595   -2.977  1.00 0.00 ? 15 GLU P O    8  
ATOM 8544  C CB   . GLU A 1 17 ? -1.860  5.664   -1.932  1.00 0.00 ? 15 GLU P CB   8  
ATOM 8545  C CG   . GLU A 1 17 ? -0.727  6.699   -2.040  1.00 0.00 ? 15 GLU P CG   8  
ATOM 8546  C CD   . GLU A 1 17 ? -0.779  7.577   -3.311  1.00 0.00 ? 15 GLU P CD   8  
ATOM 8547  O OE1  . GLU A 1 17 ? -1.138  7.080   -4.406  1.00 0.00 ? 15 GLU P OE1  8  
ATOM 8548  O OE2  . GLU A 1 17 ? -0.433  8.781   -3.227  1.00 0.00 ? 15 GLU P OE2  8  
ATOM 8549  H H    . GLU A 1 17 ? -2.893  7.486   -0.400  1.00 0.00 ? 15 GLU P H    8  
ATOM 8550  H HA   . GLU A 1 17 ? -3.338  6.609   -3.152  1.00 0.00 ? 15 GLU P HA   8  
ATOM 8551  H HB2  . GLU A 1 17 ? -1.803  5.193   -0.951  1.00 0.00 ? 15 GLU P HB2  8  
ATOM 8552  H HB3  . GLU A 1 17 ? -1.703  4.889   -2.683  1.00 0.00 ? 15 GLU P HB3  8  
ATOM 8553  H HG2  . GLU A 1 17 ? -0.759  7.333   -1.156  1.00 0.00 ? 15 GLU P HG2  8  
ATOM 8554  H HG3  . GLU A 1 17 ? 0.224   6.166   -2.004  1.00 0.00 ? 15 GLU P HG3  8  
ATOM 8555  N N    . LEU A 1 18 ? -4.840  4.963   -0.756  1.00 0.00 ? 16 LEU P N    8  
ATOM 8556  C CA   . LEU A 1 18 ? -5.953  4.064   -0.461  1.00 0.00 ? 16 LEU P CA   8  
ATOM 8557  C C    . LEU A 1 18 ? -7.261  4.563   -1.093  1.00 0.00 ? 16 LEU P C    8  
ATOM 8558  O O    . LEU A 1 18 ? -7.890  3.824   -1.849  1.00 0.00 ? 16 LEU P O    8  
ATOM 8559  C CB   . LEU A 1 18 ? -6.069  3.915   1.064   1.00 0.00 ? 16 LEU P CB   8  
ATOM 8560  C CG   . LEU A 1 18 ? -4.929  3.078   1.676   1.00 0.00 ? 16 LEU P CG   8  
ATOM 8561  C CD1  . LEU A 1 18 ? -4.769  3.393   3.159   1.00 0.00 ? 16 LEU P CD1  8  
ATOM 8562  C CD2  . LEU A 1 18 ? -5.202  1.584   1.517   1.00 0.00 ? 16 LEU P CD2  8  
ATOM 8563  H H    . LEU A 1 18 ? -4.429  5.474   0.018   1.00 0.00 ? 16 LEU P H    8  
ATOM 8564  H HA   . LEU A 1 18 ? -5.745  3.085   -0.894  1.00 0.00 ? 16 LEU P HA   8  
ATOM 8565  H HB2  . LEU A 1 18 ? -6.079  4.907   1.513   1.00 0.00 ? 16 LEU P HB2  8  
ATOM 8566  H HB3  . LEU A 1 18 ? -7.018  3.439   1.299   1.00 0.00 ? 16 LEU P HB3  8  
ATOM 8567  H HG   . LEU A 1 18 ? -3.986  3.310   1.184   1.00 0.00 ? 16 LEU P HG   8  
ATOM 8568  H HD11 . LEU A 1 18 ? -3.946  2.812   3.570   1.00 0.00 ? 16 LEU P HD11 8  
ATOM 8569  H HD12 . LEU A 1 18 ? -4.549  4.451   3.280   1.00 0.00 ? 16 LEU P HD12 8  
ATOM 8570  H HD13 . LEU A 1 18 ? -5.684  3.147   3.688   1.00 0.00 ? 16 LEU P HD13 8  
ATOM 8571  H HD21 . LEU A 1 18 ? -5.251  1.334   0.459   1.00 0.00 ? 16 LEU P HD21 8  
ATOM 8572  H HD22 . LEU A 1 18 ? -4.393  1.015   1.976   1.00 0.00 ? 16 LEU P HD22 8  
ATOM 8573  H HD23 . LEU A 1 18 ? -6.145  1.321   1.996   1.00 0.00 ? 16 LEU P HD23 8  
ATOM 8574  N N    . GLU A 1 19 ? -7.650  5.824   -0.874  1.00 0.00 ? 17 GLU P N    8  
ATOM 8575  C CA   . GLU A 1 19 ? -8.903  6.341   -1.449  1.00 0.00 ? 17 GLU P CA   8  
ATOM 8576  C C    . GLU A 1 19 ? -8.845  6.648   -2.952  1.00 0.00 ? 17 GLU P C    8  
ATOM 8577  O O    . GLU A 1 19 ? -9.893  6.687   -3.598  1.00 0.00 ? 17 GLU P O    8  
ATOM 8578  C CB   . GLU A 1 19 ? -9.506  7.475   -0.612  1.00 0.00 ? 17 GLU P CB   8  
ATOM 8579  C CG   . GLU A 1 19 ? -8.987  8.900   -0.850  1.00 0.00 ? 17 GLU P CG   8  
ATOM 8580  C CD   . GLU A 1 19 ? -9.693  9.921   0.075   1.00 0.00 ? 17 GLU P CD   8  
ATOM 8581  O OE1  . GLU A 1 19 ? -10.759 9.600   0.660   1.00 0.00 ? 17 GLU P OE1  8  
ATOM 8582  O OE2  . GLU A 1 19 ? -9.192  11.063  0.211   1.00 0.00 ? 17 GLU P OE2  8  
ATOM 8583  H H    . GLU A 1 19 ? -7.135  6.394   -0.210  1.00 0.00 ? 17 GLU P H    8  
ATOM 8584  H HA   . GLU A 1 19 ? -9.625  5.529   -1.372  1.00 0.00 ? 17 GLU P HA   8  
ATOM 8585  H HB2  . GLU A 1 19 ? -10.572 7.474   -0.829  1.00 0.00 ? 17 GLU P HB2  8  
ATOM 8586  H HB3  . GLU A 1 19 ? -9.370  7.234   0.440   1.00 0.00 ? 17 GLU P HB3  8  
ATOM 8587  H HG2  . GLU A 1 19 ? -7.912  8.918   -0.674  1.00 0.00 ? 17 GLU P HG2  8  
ATOM 8588  H HG3  . GLU A 1 19 ? -9.166  9.177   -1.890  1.00 0.00 ? 17 GLU P HG3  8  
ATOM 8589  N N    . ALA A 1 20 ? -7.649  6.793   -3.527  1.00 0.00 ? 18 ALA P N    8  
ATOM 8590  C CA   . ALA A 1 20 ? -7.451  6.869   -4.977  1.00 0.00 ? 18 ALA P CA   8  
ATOM 8591  C C    . ALA A 1 20 ? -7.530  5.484   -5.644  1.00 0.00 ? 18 ALA P C    8  
ATOM 8592  O O    . ALA A 1 20 ? -8.257  5.316   -6.625  1.00 0.00 ? 18 ALA P O    8  
ATOM 8593  C CB   . ALA A 1 20 ? -6.121  7.568   -5.280  1.00 0.00 ? 18 ALA P CB   8  
ATOM 8594  H H    . ALA A 1 20 ? -6.836  6.836   -2.923  1.00 0.00 ? 18 ALA P H    8  
ATOM 8595  H HA   . ALA A 1 20 ? -8.249  7.478   -5.406  1.00 0.00 ? 18 ALA P HA   8  
ATOM 8596  H HB1  . ALA A 1 20 ? -5.291  7.002   -4.856  1.00 0.00 ? 18 ALA P HB1  8  
ATOM 8597  H HB2  . ALA A 1 20 ? -5.986  7.644   -6.359  1.00 0.00 ? 18 ALA P HB2  8  
ATOM 8598  H HB3  . ALA A 1 20 ? -6.129  8.574   -4.857  1.00 0.00 ? 18 ALA P HB3  8  
ATOM 8599  N N    . THR A 1 21 ? -6.848  4.464   -5.108  1.00 0.00 ? 19 THR P N    8  
ATOM 8600  C CA   . THR A 1 21 ? -6.884  3.106   -5.690  1.00 0.00 ? 19 THR P CA   8  
ATOM 8601  C C    . THR A 1 21 ? -8.252  2.430   -5.509  1.00 0.00 ? 19 THR P C    8  
ATOM 8602  O O    . THR A 1 21 ? -8.697  1.670   -6.369  1.00 0.00 ? 19 THR P O    8  
ATOM 8603  C CB   . THR A 1 21 ? -5.712  2.250   -5.185  1.00 0.00 ? 19 THR P CB   8  
ATOM 8604  O OG1  . THR A 1 21 ? -5.442  1.252   -6.145  1.00 0.00 ? 19 THR P OG1  8  
ATOM 8605  C CG2  . THR A 1 21 ? -5.958  1.570   -3.839  1.00 0.00 ? 19 THR P CG2  8  
ATOM 8606  H H    . THR A 1 21 ? -6.252  4.634   -4.300  1.00 0.00 ? 19 THR P H    8  
ATOM 8607  H HA   . THR A 1 21 ? -6.730  3.220   -6.761  1.00 0.00 ? 19 THR P HA   8  
ATOM 8608  H HB   . THR A 1 21 ? -4.831  2.889   -5.105  1.00 0.00 ? 19 THR P HB   8  
ATOM 8609  H HG1  . THR A 1 21 ? -4.569  0.876   -5.946  1.00 0.00 ? 19 THR P HG1  8  
ATOM 8610  H HG21 . THR A 1 21 ? -6.452  2.257   -3.160  1.00 0.00 ? 19 THR P HG21 8  
ATOM 8611  H HG22 . THR A 1 21 ? -5.006  1.297   -3.388  1.00 0.00 ? 19 THR P HG22 8  
ATOM 8612  H HG23 . THR A 1 21 ? -6.573  0.679   -3.974  1.00 0.00 ? 19 THR P HG23 8  
ATOM 8613  N N    . PHE A 1 22 ? -8.993  2.816   -4.465  1.00 0.00 ? 20 PHE P N    8  
ATOM 8614  C CA   . PHE A 1 22 ? -10.399 2.461   -4.227  1.00 0.00 ? 20 PHE P CA   8  
ATOM 8615  C C    . PHE A 1 22 ? -11.316 2.835   -5.403  1.00 0.00 ? 20 PHE P C    8  
ATOM 8616  O O    . PHE A 1 22 ? -12.296 2.136   -5.657  1.00 0.00 ? 20 PHE P O    8  
ATOM 8617  C CB   . PHE A 1 22 ? -10.845 3.150   -2.923  1.00 0.00 ? 20 PHE P CB   8  
ATOM 8618  C CG   . PHE A 1 22 ? -12.321 3.095   -2.552  1.00 0.00 ? 20 PHE P CG   8  
ATOM 8619  C CD1  . PHE A 1 22 ? -13.032 1.879   -2.565  1.00 0.00 ? 20 PHE P CD1  8  
ATOM 8620  C CD2  . PHE A 1 22 ? -12.981 4.273   -2.147  1.00 0.00 ? 20 PHE P CD2  8  
ATOM 8621  C CE1  . PHE A 1 22 ? -14.391 1.843   -2.199  1.00 0.00 ? 20 PHE P CE1  8  
ATOM 8622  C CE2  . PHE A 1 22 ? -14.340 4.239   -1.785  1.00 0.00 ? 20 PHE P CE2  8  
ATOM 8623  C CZ   . PHE A 1 22 ? -15.046 3.023   -1.811  1.00 0.00 ? 20 PHE P CZ   8  
ATOM 8624  H H    . PHE A 1 22 ? -8.547  3.421   -3.790  1.00 0.00 ? 20 PHE P H    8  
ATOM 8625  H HA   . PHE A 1 22 ? -10.468 1.385   -4.094  1.00 0.00 ? 20 PHE P HA   8  
ATOM 8626  H HB2  . PHE A 1 22 ? -10.284 2.715   -2.097  1.00 0.00 ? 20 PHE P HB2  8  
ATOM 8627  H HB3  . PHE A 1 22 ? -10.560 4.198   -2.993  1.00 0.00 ? 20 PHE P HB3  8  
ATOM 8628  H HD1  . PHE A 1 22 ? -12.542 0.969   -2.864  1.00 0.00 ? 20 PHE P HD1  8  
ATOM 8629  H HD2  . PHE A 1 22 ? -12.445 5.211   -2.108  1.00 0.00 ? 20 PHE P HD2  8  
ATOM 8630  H HE1  . PHE A 1 22 ? -14.931 0.906   -2.221  1.00 0.00 ? 20 PHE P HE1  8  
ATOM 8631  H HE2  . PHE A 1 22 ? -14.843 5.147   -1.481  1.00 0.00 ? 20 PHE P HE2  8  
ATOM 8632  H HZ   . PHE A 1 22 ? -16.091 2.999   -1.533  1.00 0.00 ? 20 PHE P HZ   8  
ATOM 8633  N N    . GLN A 1 23 ? -10.985 3.882   -6.172  1.00 0.00 ? 21 GLN P N    8  
ATOM 8634  C CA   . GLN A 1 23 ? -11.791 4.299   -7.325  1.00 0.00 ? 21 GLN P CA   8  
ATOM 8635  C C    . GLN A 1 23 ? -11.668 3.346   -8.526  1.00 0.00 ? 21 GLN P C    8  
ATOM 8636  O O    . GLN A 1 23 ? -12.656 3.105   -9.224  1.00 0.00 ? 21 GLN P O    8  
ATOM 8637  C CB   . GLN A 1 23 ? -11.411 5.724   -7.765  1.00 0.00 ? 21 GLN P CB   8  
ATOM 8638  C CG   . GLN A 1 23 ? -11.447 6.797   -6.669  1.00 0.00 ? 21 GLN P CG   8  
ATOM 8639  C CD   . GLN A 1 23 ? -12.725 6.786   -5.835  1.00 0.00 ? 21 GLN P CD   8  
ATOM 8640  O OE1  . GLN A 1 23 ? -13.841 6.762   -6.337  1.00 0.00 ? 21 GLN P OE1  8  
ATOM 8641  N NE2  . GLN A 1 23 ? -12.603 6.798   -4.529  1.00 0.00 ? 21 GLN P NE2  8  
ATOM 8642  H H    . GLN A 1 23 ? -10.150 4.408   -5.951  1.00 0.00 ? 21 GLN P H    8  
ATOM 8643  H HA   . GLN A 1 23 ? -12.835 4.287   -7.015  1.00 0.00 ? 21 GLN P HA   8  
ATOM 8644  H HB2  . GLN A 1 23 ? -10.395 5.695   -8.152  1.00 0.00 ? 21 GLN P HB2  8  
ATOM 8645  H HB3  . GLN A 1 23 ? -12.079 6.028   -8.571  1.00 0.00 ? 21 GLN P HB3  8  
ATOM 8646  H HG2  . GLN A 1 23 ? -10.588 6.650   -6.020  1.00 0.00 ? 21 GLN P HG2  8  
ATOM 8647  H HG3  . GLN A 1 23 ? -11.338 7.780   -7.129  1.00 0.00 ? 21 GLN P HG3  8  
ATOM 8648  H HE21 . GLN A 1 23 ? -11.674 6.811   -4.114  1.00 0.00 ? 21 GLN P HE21 8  
ATOM 8649  H HE22 . GLN A 1 23 ? -13.437 6.774   -3.970  1.00 0.00 ? 21 GLN P HE22 8  
ATOM 8650  N N    . ARG A 1 24 ? -10.468 2.792   -8.762  1.00 0.00 ? 22 ARG P N    8  
ATOM 8651  C CA   . ARG A 1 24 ? -10.188 1.820   -9.840  1.00 0.00 ? 22 ARG P CA   8  
ATOM 8652  C C    . ARG A 1 24 ? -10.401 0.361   -9.424  1.00 0.00 ? 22 ARG P C    8  
ATOM 8653  O O    . ARG A 1 24 ? -10.659 -0.484  -10.281 1.00 0.00 ? 22 ARG P O    8  
ATOM 8654  C CB   . ARG A 1 24 ? -8.782  2.050   -10.426 1.00 0.00 ? 22 ARG P CB   8  
ATOM 8655  C CG   . ARG A 1 24 ? -7.633  1.912   -9.410  1.00 0.00 ? 22 ARG P CG   8  
ATOM 8656  C CD   . ARG A 1 24 ? -6.248  2.031   -10.056 1.00 0.00 ? 22 ARG P CD   8  
ATOM 8657  N NE   . ARG A 1 24 ? -5.994  3.384   -10.595 1.00 0.00 ? 22 ARG P NE   8  
ATOM 8658  C CZ   . ARG A 1 24 ? -4.926  3.773   -11.271 1.00 0.00 ? 22 ARG P CZ   8  
ATOM 8659  N NH1  . ARG A 1 24 ? -3.938  2.963   -11.534 1.00 0.00 ? 22 ARG P NH1  8  
ATOM 8660  N NH2  . ARG A 1 24 ? -4.828  4.998   -11.700 1.00 0.00 ? 22 ARG P NH2  8  
ATOM 8661  H H    . ARG A 1 24 ? -9.711  3.049   -8.140  1.00 0.00 ? 22 ARG P H    8  
ATOM 8662  H HA   . ARG A 1 24 ? -10.898 1.991   -10.651 1.00 0.00 ? 22 ARG P HA   8  
ATOM 8663  H HB2  . ARG A 1 24 ? -8.628  1.323   -11.226 1.00 0.00 ? 22 ARG P HB2  8  
ATOM 8664  H HB3  . ARG A 1 24 ? -8.754  3.049   -10.861 1.00 0.00 ? 22 ARG P HB3  8  
ATOM 8665  H HG2  . ARG A 1 24 ? -7.730  2.689   -8.654  1.00 0.00 ? 22 ARG P HG2  8  
ATOM 8666  H HG3  . ARG A 1 24 ? -7.694  0.938   -8.924  1.00 0.00 ? 22 ARG P HG3  8  
ATOM 8667  H HD2  . ARG A 1 24 ? -5.497  1.802   -9.296  1.00 0.00 ? 22 ARG P HD2  8  
ATOM 8668  H HD3  . ARG A 1 24 ? -6.168  1.290   -10.855 1.00 0.00 ? 22 ARG P HD3  8  
ATOM 8669  H HE   . ARG A 1 24 ? -6.697  4.086   -10.430 1.00 0.00 ? 22 ARG P HE   8  
ATOM 8670  H HH11 . ARG A 1 24 ? -3.985  2.012   -11.211 1.00 0.00 ? 22 ARG P HH11 8  
ATOM 8671  H HH12 . ARG A 1 24 ? -3.137  3.283   -12.051 1.00 0.00 ? 22 ARG P HH12 8  
ATOM 8672  H HH21 . ARG A 1 24 ? -5.568  5.659   -11.525 1.00 0.00 ? 22 ARG P HH21 8  
ATOM 8673  H HH22 . ARG A 1 24 ? -4.015  5.292   -12.215 1.00 0.00 ? 22 ARG P HH22 8  
ATOM 8674  N N    . ASN A 1 25 ? -10.320 0.069   -8.126  1.00 0.00 ? 23 ASN P N    8  
ATOM 8675  C CA   . ASN A 1 25 ? -10.536 -1.254  -7.547  1.00 0.00 ? 23 ASN P CA   8  
ATOM 8676  C C    . ASN A 1 25 ? -11.346 -1.125  -6.249  1.00 0.00 ? 23 ASN P C    8  
ATOM 8677  O O    . ASN A 1 25 ? -10.804 -0.773  -5.204  1.00 0.00 ? 23 ASN P O    8  
ATOM 8678  C CB   . ASN A 1 25 ? -9.170  -1.928  -7.313  1.00 0.00 ? 23 ASN P CB   8  
ATOM 8679  C CG   . ASN A 1 25 ? -9.308  -3.389  -6.906  1.00 0.00 ? 23 ASN P CG   8  
ATOM 8680  O OD1  . ASN A 1 25 ? -10.381 -3.893  -6.606  1.00 0.00 ? 23 ASN P OD1  8  
ATOM 8681  N ND2  . ASN A 1 25 ? -8.220  -4.123  -6.905  1.00 0.00 ? 23 ASN P ND2  8  
ATOM 8682  H H    . ASN A 1 25 ? -10.058 0.816   -7.491  1.00 0.00 ? 23 ASN P H    8  
ATOM 8683  H HA   . ASN A 1 25 ? -11.107 -1.870  -8.243  1.00 0.00 ? 23 ASN P HA   8  
ATOM 8684  H HB2  . ASN A 1 25 ? -8.580  -1.879  -8.227  1.00 0.00 ? 23 ASN P HB2  8  
ATOM 8685  H HB3  . ASN A 1 25 ? -8.622  -1.392  -6.535  1.00 0.00 ? 23 ASN P HB3  8  
ATOM 8686  H HD21 . ASN A 1 25 ? -7.335  -3.717  -7.157  1.00 0.00 ? 23 ASN P HD21 8  
ATOM 8687  H HD22 . ASN A 1 25 ? -8.305  -5.099  -6.674  1.00 0.00 ? 23 ASN P HD22 8  
ATOM 8688  N N    . HIS A 1 26 ? -12.645 -1.425  -6.307  1.00 0.00 ? 24 HIS P N    8  
ATOM 8689  C CA   . HIS A 1 26 ? -13.559 -1.282  -5.165  1.00 0.00 ? 24 HIS P CA   8  
ATOM 8690  C C    . HIS A 1 26 ? -13.482 -2.466  -4.179  1.00 0.00 ? 24 HIS P C    8  
ATOM 8691  O O    . HIS A 1 26 ? -14.052 -2.392  -3.090  1.00 0.00 ? 24 HIS P O    8  
ATOM 8692  C CB   . HIS A 1 26 ? -14.992 -1.059  -5.686  1.00 0.00 ? 24 HIS P CB   8  
ATOM 8693  C CG   . HIS A 1 26 ? -15.247 0.308   -6.289  1.00 0.00 ? 24 HIS P CG   8  
ATOM 8694  N ND1  . HIS A 1 26 ? -16.196 1.226   -5.824  1.00 0.00 ? 24 HIS P ND1  8  
ATOM 8695  C CD2  . HIS A 1 26 ? -14.622 0.847   -7.378  1.00 0.00 ? 24 HIS P CD2  8  
ATOM 8696  C CE1  . HIS A 1 26 ? -16.103 2.299   -6.629  1.00 0.00 ? 24 HIS P CE1  8  
ATOM 8697  N NE2  . HIS A 1 26 ? -15.167 2.096   -7.571  1.00 0.00 ? 24 HIS P NE2  8  
ATOM 8698  H H    . HIS A 1 26 ? -13.027 -1.754  -7.182  1.00 0.00 ? 24 HIS P H    8  
ATOM 8699  H HA   . HIS A 1 26 ? -13.279 -0.393  -4.597  1.00 0.00 ? 24 HIS P HA   8  
ATOM 8700  H HB2  . HIS A 1 26 ? -15.231 -1.820  -6.429  1.00 0.00 ? 24 HIS P HB2  8  
ATOM 8701  H HB3  . HIS A 1 26 ? -15.687 -1.185  -4.855  1.00 0.00 ? 24 HIS P HB3  8  
ATOM 8702  H HD2  . HIS A 1 26 ? -13.830 0.398   -7.959  1.00 0.00 ? 24 HIS P HD2  8  
ATOM 8703  H HE1  . HIS A 1 26 ? -16.696 3.202   -6.533  1.00 0.00 ? 24 HIS P HE1  8  
ATOM 8704  H HE2  . HIS A 1 26 ? -14.891 2.762   -8.287  1.00 0.00 ? 24 HIS P HE2  8  
ATOM 8705  N N    . TYR A 1 27 ? -12.797 -3.556  -4.550  1.00 0.00 ? 25 TYR P N    8  
ATOM 8706  C CA   . TYR A 1 27 ? -12.746 -4.818  -3.798  1.00 0.00 ? 25 TYR P CA   8  
ATOM 8707  C C    . TYR A 1 27 ? -11.414 -5.580  -4.023  1.00 0.00 ? 25 TYR P C    8  
ATOM 8708  O O    . TYR A 1 27 ? -11.406 -6.670  -4.607  1.00 0.00 ? 25 TYR P O    8  
ATOM 8709  C CB   . TYR A 1 27 ? -14.009 -5.659  -4.108  1.00 0.00 ? 25 TYR P CB   8  
ATOM 8710  C CG   . TYR A 1 27 ? -14.440 -5.741  -5.568  1.00 0.00 ? 25 TYR P CG   8  
ATOM 8711  C CD1  . TYR A 1 27 ? -15.343 -4.787  -6.083  1.00 0.00 ? 25 TYR P CD1  8  
ATOM 8712  C CD2  . TYR A 1 27 ? -13.969 -6.771  -6.407  1.00 0.00 ? 25 TYR P CD2  8  
ATOM 8713  C CE1  . TYR A 1 27 ? -15.742 -4.838  -7.432  1.00 0.00 ? 25 TYR P CE1  8  
ATOM 8714  C CE2  . TYR A 1 27 ? -14.367 -6.828  -7.757  1.00 0.00 ? 25 TYR P CE2  8  
ATOM 8715  C CZ   . TYR A 1 27 ? -15.251 -5.858  -8.276  1.00 0.00 ? 25 TYR P CZ   8  
ATOM 8716  O OH   . TYR A 1 27 ? -15.642 -5.903  -9.580  1.00 0.00 ? 25 TYR P OH   8  
ATOM 8717  H H    . TYR A 1 27 ? -12.300 -3.525  -5.432  1.00 0.00 ? 25 TYR P H    8  
ATOM 8718  H HA   . TYR A 1 27 ? -12.779 -4.584  -2.735  1.00 0.00 ? 25 TYR P HA   8  
ATOM 8719  H HB2  . TYR A 1 27 ? -13.878 -6.667  -3.713  1.00 0.00 ? 25 TYR P HB2  8  
ATOM 8720  H HB3  . TYR A 1 27 ? -14.837 -5.224  -3.545  1.00 0.00 ? 25 TYR P HB3  8  
ATOM 8721  H HD1  . TYR A 1 27 ? -15.734 -4.013  -5.436  1.00 0.00 ? 25 TYR P HD1  8  
ATOM 8722  H HD2  . TYR A 1 27 ? -13.297 -7.524  -6.016  1.00 0.00 ? 25 TYR P HD2  8  
ATOM 8723  H HE1  . TYR A 1 27 ? -16.426 -4.102  -7.829  1.00 0.00 ? 25 TYR P HE1  8  
ATOM 8724  H HE2  . TYR A 1 27 ? -13.994 -7.617  -8.397  1.00 0.00 ? 25 TYR P HE2  8  
ATOM 8725  H HH   . TYR A 1 27 ? -15.242 -6.650  -10.058 1.00 0.00 ? 25 TYR P HH   8  
ATOM 8726  N N    . PRO A 1 28 ? -10.263 -5.033  -3.577  1.00 0.00 ? 26 PRO P N    8  
ATOM 8727  C CA   . PRO A 1 28 ? -8.960  -5.672  -3.749  1.00 0.00 ? 26 PRO P CA   8  
ATOM 8728  C C    . PRO A 1 28 ? -8.826  -6.971  -2.934  1.00 0.00 ? 26 PRO P C    8  
ATOM 8729  O O    . PRO A 1 28 ? -9.481  -7.173  -1.905  1.00 0.00 ? 26 PRO P O    8  
ATOM 8730  C CB   . PRO A 1 28 ? -7.929  -4.611  -3.351  1.00 0.00 ? 26 PRO P CB   8  
ATOM 8731  C CG   . PRO A 1 28 ? -8.677  -3.801  -2.297  1.00 0.00 ? 26 PRO P CG   8  
ATOM 8732  C CD   . PRO A 1 28 ? -10.107 -3.786  -2.841  1.00 0.00 ? 26 PRO P CD   8  
ATOM 8733  H HA   . PRO A 1 28 ? -8.812  -5.915  -4.802  1.00 0.00 ? 26 PRO P HA   8  
ATOM 8734  H HB2  . PRO A 1 28 ? -7.007  -5.041  -2.968  1.00 0.00 ? 26 PRO P HB2  8  
ATOM 8735  H HB3  . PRO A 1 28 ? -7.709  -3.976  -4.208  1.00 0.00 ? 26 PRO P HB3  8  
ATOM 8736  H HG2  . PRO A 1 28 ? -8.648  -4.333  -1.347  1.00 0.00 ? 26 PRO P HG2  8  
ATOM 8737  H HG3  . PRO A 1 28 ? -8.267  -2.797  -2.193  1.00 0.00 ? 26 PRO P HG3  8  
ATOM 8738  H HD2  . PRO A 1 28 ? -10.818 -3.713  -2.018  1.00 0.00 ? 26 PRO P HD2  8  
ATOM 8739  H HD3  . PRO A 1 28 ? -10.230 -2.945  -3.525  1.00 0.00 ? 26 PRO P HD3  8  
ATOM 8740  N N    . ASP A 1 29 ? -7.933  -7.842  -3.395  1.00 0.00 ? 27 ASP P N    8  
ATOM 8741  C CA   . ASP A 1 29 ? -7.667  -9.196  -2.885  1.00 0.00 ? 27 ASP P CA   8  
ATOM 8742  C C    . ASP A 1 29 ? -6.227  -9.302  -2.369  1.00 0.00 ? 27 ASP P C    8  
ATOM 8743  O O    . ASP A 1 29 ? -5.458  -8.358  -2.515  1.00 0.00 ? 27 ASP P O    8  
ATOM 8744  C CB   . ASP A 1 29 ? -7.937  -10.208 -4.015  1.00 0.00 ? 27 ASP P CB   8  
ATOM 8745  C CG   . ASP A 1 29 ? -7.995  -11.682 -3.566  1.00 0.00 ? 27 ASP P CG   8  
ATOM 8746  O OD1  . ASP A 1 29 ? -8.157  -11.952 -2.352  1.00 0.00 ? 27 ASP P OD1  8  
ATOM 8747  O OD2  . ASP A 1 29 ? -7.866  -12.574 -4.435  1.00 0.00 ? 27 ASP P OD2  8  
ATOM 8748  H H    . ASP A 1 29 ? -7.333  -7.511  -4.149  1.00 0.00 ? 27 ASP P H    8  
ATOM 8749  H HA   . ASP A 1 29 ? -8.336  -9.410  -2.057  1.00 0.00 ? 27 ASP P HA   8  
ATOM 8750  H HB2  . ASP A 1 29 ? -8.892  -9.966  -4.474  1.00 0.00 ? 27 ASP P HB2  8  
ATOM 8751  H HB3  . ASP A 1 29 ? -7.163  -10.092 -4.775  1.00 0.00 ? 27 ASP P HB3  8  
ATOM 8752  N N    . MET A 1 30 ? -5.811  -10.439 -1.808  1.00 0.00 ? 28 MET P N    8  
ATOM 8753  C CA   . MET A 1 30 ? -4.453  -10.622 -1.265  1.00 0.00 ? 28 MET P CA   8  
ATOM 8754  C C    . MET A 1 30 ? -3.327  -10.205 -2.235  1.00 0.00 ? 28 MET P C    8  
ATOM 8755  O O    . MET A 1 30 ? -2.279  -9.745  -1.786  1.00 0.00 ? 28 MET P O    8  
ATOM 8756  C CB   . MET A 1 30 ? -4.247  -12.076 -0.809  1.00 0.00 ? 28 MET P CB   8  
ATOM 8757  C CG   . MET A 1 30 ? -4.291  -13.100 -1.956  1.00 0.00 ? 28 MET P CG   8  
ATOM 8758  S SD   . MET A 1 30 ? -3.673  -14.748 -1.527  1.00 0.00 ? 28 MET P SD   8  
ATOM 8759  C CE   . MET A 1 30 ? -1.889  -14.403 -1.594  1.00 0.00 ? 28 MET P CE   8  
ATOM 8760  H H    . MET A 1 30 ? -6.486  -11.197 -1.735  1.00 0.00 ? 28 MET P H    8  
ATOM 8761  H HA   . MET A 1 30 ? -4.360  -9.987  -0.384  1.00 0.00 ? 28 MET P HA   8  
ATOM 8762  H HB2  . MET A 1 30 ? -3.277  -12.137 -0.317  1.00 0.00 ? 28 MET P HB2  8  
ATOM 8763  H HB3  . MET A 1 30 ? -5.009  -12.334 -0.072  1.00 0.00 ? 28 MET P HB3  8  
ATOM 8764  H HG2  . MET A 1 30 ? -5.317  -13.183 -2.309  1.00 0.00 ? 28 MET P HG2  8  
ATOM 8765  H HG3  . MET A 1 30 ? -3.689  -12.749 -2.791  1.00 0.00 ? 28 MET P HG3  8  
ATOM 8766  H HE1  . MET A 1 30 ? -1.633  -13.970 -2.562  1.00 0.00 ? 28 MET P HE1  8  
ATOM 8767  H HE2  . MET A 1 30 ? -1.615  -13.699 -0.809  1.00 0.00 ? 28 MET P HE2  8  
ATOM 8768  H HE3  . MET A 1 30 ? -1.331  -15.329 -1.453  1.00 0.00 ? 28 MET P HE3  8  
ATOM 8769  N N    . SER A 1 31 ? -3.542  -10.314 -3.552  1.00 0.00 ? 29 SER P N    8  
ATOM 8770  C CA   . SER A 1 31 ? -2.554  -9.926  -4.568  1.00 0.00 ? 29 SER P CA   8  
ATOM 8771  C C    . SER A 1 31 ? -2.579  -8.420  -4.867  1.00 0.00 ? 29 SER P C    8  
ATOM 8772  O O    . SER A 1 31 ? -1.527  -7.782  -4.949  1.00 0.00 ? 29 SER P O    8  
ATOM 8773  C CB   . SER A 1 31 ? -2.771  -10.719 -5.862  1.00 0.00 ? 29 SER P CB   8  
ATOM 8774  O OG   . SER A 1 31 ? -2.719  -12.116 -5.606  1.00 0.00 ? 29 SER P OG   8  
ATOM 8775  H H    . SER A 1 31 ? -4.425  -10.697 -3.861  1.00 0.00 ? 29 SER P H    8  
ATOM 8776  H HA   . SER A 1 31 ? -1.563  -10.181 -4.190  1.00 0.00 ? 29 SER P HA   8  
ATOM 8777  H HB2  . SER A 1 31 ? -3.744  -10.464 -6.288  1.00 0.00 ? 29 SER P HB2  8  
ATOM 8778  H HB3  . SER A 1 31 ? -1.993  -10.453 -6.579  1.00 0.00 ? 29 SER P HB3  8  
ATOM 8779  H HG   . SER A 1 31 ? -2.834  -12.589 -6.454  1.00 0.00 ? 29 SER P HG   8  
ATOM 8780  N N    . THR A 1 32 ? -3.771  -7.823  -4.994  1.00 0.00 ? 30 THR P N    8  
ATOM 8781  C CA   . THR A 1 32 ? -3.946  -6.388  -5.294  1.00 0.00 ? 30 THR P CA   8  
ATOM 8782  C C    . THR A 1 32 ? -3.754  -5.497  -4.067  1.00 0.00 ? 30 THR P C    8  
ATOM 8783  O O    . THR A 1 32 ? -3.164  -4.427  -4.187  1.00 0.00 ? 30 THR P O    8  
ATOM 8784  C CB   . THR A 1 32 ? -5.291  -6.090  -5.976  1.00 0.00 ? 30 THR P CB   8  
ATOM 8785  O OG1  . THR A 1 32 ? -6.302  -6.991  -5.588  1.00 0.00 ? 30 THR P OG1  8  
ATOM 8786  C CG2  . THR A 1 32 ? -5.176  -6.197  -7.496  1.00 0.00 ? 30 THR P CG2  8  
ATOM 8787  H H    . THR A 1 32 ? -4.608  -8.369  -4.844  1.00 0.00 ? 30 THR P H    8  
ATOM 8788  H HA   . THR A 1 32 ? -3.169  -6.095  -5.995  1.00 0.00 ? 30 THR P HA   8  
ATOM 8789  H HB   . THR A 1 32 ? -5.614  -5.083  -5.717  1.00 0.00 ? 30 THR P HB   8  
ATOM 8790  H HG1  . THR A 1 32 ? -6.402  -7.640  -6.307  1.00 0.00 ? 30 THR P HG1  8  
ATOM 8791  H HG21 . THR A 1 32 ? -4.807  -7.184  -7.777  1.00 0.00 ? 30 THR P HG21 8  
ATOM 8792  H HG22 . THR A 1 32 ? -4.483  -5.440  -7.862  1.00 0.00 ? 30 THR P HG22 8  
ATOM 8793  H HG23 . THR A 1 32 ? -6.150  -6.029  -7.956  1.00 0.00 ? 30 THR P HG23 8  
ATOM 8794  N N    . ARG A 1 33 ? -4.153  -5.944  -2.871  1.00 0.00 ? 31 ARG P N    8  
ATOM 8795  C CA   . ARG A 1 33 ? -3.834  -5.290  -1.590  1.00 0.00 ? 31 ARG P CA   8  
ATOM 8796  C C    . ARG A 1 33 ? -2.324  -5.157  -1.393  1.00 0.00 ? 31 ARG P C    8  
ATOM 8797  O O    . ARG A 1 33 ? -1.847  -4.077  -1.063  1.00 0.00 ? 31 ARG P O    8  
ATOM 8798  C CB   . ARG A 1 33 ? -4.403  -6.110  -0.422  1.00 0.00 ? 31 ARG P CB   8  
ATOM 8799  C CG   . ARG A 1 33 ? -5.934  -6.136  -0.335  1.00 0.00 ? 31 ARG P CG   8  
ATOM 8800  C CD   . ARG A 1 33 ? -6.358  -7.227  0.649   1.00 0.00 ? 31 ARG P CD   8  
ATOM 8801  N NE   . ARG A 1 33 ? -7.756  -7.633  0.441   1.00 0.00 ? 31 ARG P NE   8  
ATOM 8802  C CZ   . ARG A 1 33 ? -8.281  -8.795  0.770   1.00 0.00 ? 31 ARG P CZ   8  
ATOM 8803  N NH1  . ARG A 1 33 ? -7.630  -9.703  1.439   1.00 0.00 ? 31 ARG P NH1  8  
ATOM 8804  N NH2  . ARG A 1 33 ? -9.494  -9.067  0.386   1.00 0.00 ? 31 ARG P NH2  8  
ATOM 8805  H H    . ARG A 1 33 ? -4.692  -6.806  -2.850  1.00 0.00 ? 31 ARG P H    8  
ATOM 8806  H HA   . ARG A 1 33 ? -4.255  -4.285  -1.588  1.00 0.00 ? 31 ARG P HA   8  
ATOM 8807  H HB2  . ARG A 1 33 ? -4.034  -7.132  -0.525  1.00 0.00 ? 31 ARG P HB2  8  
ATOM 8808  H HB3  . ARG A 1 33 ? -4.016  -5.712  0.515   1.00 0.00 ? 31 ARG P HB3  8  
ATOM 8809  H HG2  . ARG A 1 33 ? -6.316  -5.168  -0.010  1.00 0.00 ? 31 ARG P HG2  8  
ATOM 8810  H HG3  . ARG A 1 33 ? -6.352  -6.364  -1.311  1.00 0.00 ? 31 ARG P HG3  8  
ATOM 8811  H HD2  . ARG A 1 33 ? -5.724  -8.097  0.475   1.00 0.00 ? 31 ARG P HD2  8  
ATOM 8812  H HD3  . ARG A 1 33 ? -6.206  -6.880  1.672   1.00 0.00 ? 31 ARG P HD3  8  
ATOM 8813  H HE   . ARG A 1 33 ? -8.341  -7.032  -0.122  1.00 0.00 ? 31 ARG P HE   8  
ATOM 8814  H HH11 . ARG A 1 33 ? -6.655  -9.536  1.708   1.00 0.00 ? 31 ARG P HH11 8  
ATOM 8815  H HH12 . ARG A 1 33 ? -8.044  -10.597 1.625   1.00 0.00 ? 31 ARG P HH12 8  
ATOM 8816  H HH21 . ARG A 1 33 ? -9.958  -8.423  -0.241  1.00 0.00 ? 31 ARG P HH21 8  
ATOM 8817  H HH22 . ARG A 1 33 ? -9.919  -9.951  0.608   1.00 0.00 ? 31 ARG P HH22 8  
ATOM 8818  N N    . GLU A 1 34 ? -1.560  -6.224  -1.634  1.00 0.00 ? 32 GLU P N    8  
ATOM 8819  C CA   . GLU A 1 34 ? -0.096  -6.164  -1.574  1.00 0.00 ? 32 GLU P CA   8  
ATOM 8820  C C    . GLU A 1 34 ? 0.461   -5.189  -2.619  1.00 0.00 ? 32 GLU P C    8  
ATOM 8821  O O    . GLU A 1 34 ? 1.309   -4.366  -2.289  1.00 0.00 ? 32 GLU P O    8  
ATOM 8822  C CB   . GLU A 1 34 ? 0.527   -7.557  -1.757  1.00 0.00 ? 32 GLU P CB   8  
ATOM 8823  C CG   . GLU A 1 34 ? 0.382   -8.408  -0.488  1.00 0.00 ? 32 GLU P CG   8  
ATOM 8824  C CD   . GLU A 1 34 ? 1.011   -9.815  -0.602  1.00 0.00 ? 32 GLU P CD   8  
ATOM 8825  O OE1  . GLU A 1 34 ? 1.700   -10.132 -1.603  1.00 0.00 ? 32 GLU P OE1  8  
ATOM 8826  O OE2  . GLU A 1 34 ? 0.853   -10.619 0.351   1.00 0.00 ? 32 GLU P OE2  8  
ATOM 8827  H H    . GLU A 1 34 ? -2.001  -7.092  -1.895  1.00 0.00 ? 32 GLU P H    8  
ATOM 8828  H HA   . GLU A 1 34 ? 0.198   -5.782  -0.596  1.00 0.00 ? 32 GLU P HA   8  
ATOM 8829  H HB2  . GLU A 1 34 ? 0.058   -8.061  -2.604  1.00 0.00 ? 32 GLU P HB2  8  
ATOM 8830  H HB3  . GLU A 1 34 ? 1.589   -7.432  -1.967  1.00 0.00 ? 32 GLU P HB3  8  
ATOM 8831  H HG2  . GLU A 1 34 ? 0.851   -7.869  0.337   1.00 0.00 ? 32 GLU P HG2  8  
ATOM 8832  H HG3  . GLU A 1 34 ? -0.677  -8.502  -0.250  1.00 0.00 ? 32 GLU P HG3  8  
ATOM 8833  N N    . GLU A 1 35 ? -0.065  -5.204  -3.847  1.00 0.00 ? 33 GLU P N    8  
ATOM 8834  C CA   . GLU A 1 35 ? 0.374   -4.301  -4.920  1.00 0.00 ? 33 GLU P CA   8  
ATOM 8835  C C    . GLU A 1 35 ? 0.264   -2.806  -4.565  1.00 0.00 ? 33 GLU P C    8  
ATOM 8836  O O    . GLU A 1 35 ? 1.103   -2.034  -5.025  1.00 0.00 ? 33 GLU P O    8  
ATOM 8837  C CB   . GLU A 1 35 ? -0.390  -4.632  -6.215  1.00 0.00 ? 33 GLU P CB   8  
ATOM 8838  C CG   . GLU A 1 35 ? 0.035   -3.761  -7.404  1.00 0.00 ? 33 GLU P CG   8  
ATOM 8839  C CD   . GLU A 1 35 ? -0.550  -4.298  -8.724  1.00 0.00 ? 33 GLU P CD   8  
ATOM 8840  O OE1  . GLU A 1 35 ? -1.709  -3.954  -9.064  1.00 0.00 ? 33 GLU P OE1  8  
ATOM 8841  O OE2  . GLU A 1 35 ? 0.147   -5.060  -9.437  1.00 0.00 ? 33 GLU P OE2  8  
ATOM 8842  H H    . GLU A 1 35 ? -0.741  -5.924  -4.068  1.00 0.00 ? 33 GLU P H    8  
ATOM 8843  H HA   . GLU A 1 35 ? 1.434   -4.492  -5.094  1.00 0.00 ? 33 GLU P HA   8  
ATOM 8844  H HB2  . GLU A 1 35 ? -0.209  -5.677  -6.461  1.00 0.00 ? 33 GLU P HB2  8  
ATOM 8845  H HB3  . GLU A 1 35 ? -1.457  -4.495  -6.059  1.00 0.00 ? 33 GLU P HB3  8  
ATOM 8846  H HG2  . GLU A 1 35 ? -0.300  -2.734  -7.242  1.00 0.00 ? 33 GLU P HG2  8  
ATOM 8847  H HG3  . GLU A 1 35 ? 1.124   -3.740  -7.456  1.00 0.00 ? 33 GLU P HG3  8  
ATOM 8848  N N    . ILE A 1 36 ? -0.693  -2.383  -3.726  1.00 0.00 ? 34 ILE P N    8  
ATOM 8849  C CA   . ILE A 1 36 ? -0.759  -0.998  -3.213  1.00 0.00 ? 34 ILE P CA   8  
ATOM 8850  C C    . ILE A 1 36 ? 0.065   -0.817  -1.927  1.00 0.00 ? 34 ILE P C    8  
ATOM 8851  O O    . ILE A 1 36 ? 0.652   0.243   -1.711  1.00 0.00 ? 34 ILE P O    8  
ATOM 8852  C CB   . ILE A 1 36 ? -2.218  -0.468  -3.099  1.00 0.00 ? 34 ILE P CB   8  
ATOM 8853  C CG1  . ILE A 1 36 ? -2.936  -0.760  -1.763  1.00 0.00 ? 34 ILE P CG1  8  
ATOM 8854  C CG2  . ILE A 1 36 ? -3.090  -0.986  -4.258  1.00 0.00 ? 34 ILE P CG2  8  
ATOM 8855  C CD1  . ILE A 1 36 ? -2.728  0.328   -0.699  1.00 0.00 ? 34 ILE P CD1  8  
ATOM 8856  H H    . ILE A 1 36 ? -1.398  -3.047  -3.428  1.00 0.00 ? 34 ILE P H    8  
ATOM 8857  H HA   . ILE A 1 36 ? -0.287  -0.352  -3.952  1.00 0.00 ? 34 ILE P HA   8  
ATOM 8858  H HB   . ILE A 1 36 ? -2.169  0.615   -3.207  1.00 0.00 ? 34 ILE P HB   8  
ATOM 8859  H HG12 . ILE A 1 36 ? -4.011  -0.833  -1.934  1.00 0.00 ? 34 ILE P HG12 8  
ATOM 8860  H HG13 . ILE A 1 36 ? -2.599  -1.716  -1.373  1.00 0.00 ? 34 ILE P HG13 8  
ATOM 8861  H HG21 . ILE A 1 36 ? -4.023  -0.429  -4.307  1.00 0.00 ? 34 ILE P HG21 8  
ATOM 8862  H HG22 . ILE A 1 36 ? -2.560  -0.890  -5.207  1.00 0.00 ? 34 ILE P HG22 8  
ATOM 8863  H HG23 . ILE A 1 36 ? -3.344  -2.031  -4.088  1.00 0.00 ? 34 ILE P HG23 8  
ATOM 8864  H HD11 . ILE A 1 36 ? -1.678  0.455   -0.453  1.00 0.00 ? 34 ILE P HD11 8  
ATOM 8865  H HD12 . ILE A 1 36 ? -3.251  0.033   0.207   1.00 0.00 ? 34 ILE P HD12 8  
ATOM 8866  H HD13 . ILE A 1 36 ? -3.130  1.280   -1.053  1.00 0.00 ? 34 ILE P HD13 8  
ATOM 8867  N N    . ALA A 1 37 ? 0.155   -1.848  -1.080  1.00 0.00 ? 35 ALA P N    8  
ATOM 8868  C CA   . ALA A 1 37 ? 0.836   -1.800  0.217   1.00 0.00 ? 35 ALA P CA   8  
ATOM 8869  C C    . ALA A 1 37 ? 2.371   -1.707  0.081   1.00 0.00 ? 35 ALA P C    8  
ATOM 8870  O O    . ALA A 1 37 ? 3.055   -1.118  0.925   1.00 0.00 ? 35 ALA P O    8  
ATOM 8871  C CB   . ALA A 1 37 ? 0.424   -3.044  1.011   1.00 0.00 ? 35 ALA P CB   8  
ATOM 8872  H H    . ALA A 1 37 ? -0.284  -2.723  -1.343  1.00 0.00 ? 35 ALA P H    8  
ATOM 8873  H HA   . ALA A 1 37 ? 0.488   -0.927  0.762   1.00 0.00 ? 35 ALA P HA   8  
ATOM 8874  H HB1  . ALA A 1 37 ? 0.755   -3.944  0.496   1.00 0.00 ? 35 ALA P HB1  8  
ATOM 8875  H HB2  . ALA A 1 37 ? 0.882   -3.017  1.993   1.00 0.00 ? 35 ALA P HB2  8  
ATOM 8876  H HB3  . ALA A 1 37 ? -0.658  -3.071  1.136   1.00 0.00 ? 35 ALA P HB3  8  
ATOM 8877  N N    . VAL A 1 38 ? 2.895   -2.265  -1.013  1.00 0.00 ? 36 VAL P N    8  
ATOM 8878  C CA   . VAL A 1 38 ? 4.319   -2.446  -1.338  1.00 0.00 ? 36 VAL P CA   8  
ATOM 8879  C C    . VAL A 1 38 ? 5.114   -1.137  -1.405  1.00 0.00 ? 36 VAL P C    8  
ATOM 8880  O O    . VAL A 1 38 ? 6.290   -1.119  -1.035  1.00 0.00 ? 36 VAL P O    8  
ATOM 8881  C CB   . VAL A 1 38 ? 4.389   -3.254  -2.658  1.00 0.00 ? 36 VAL P CB   8  
ATOM 8882  C CG1  . VAL A 1 38 ? 5.563   -2.953  -3.592  1.00 0.00 ? 36 VAL P CG1  8  
ATOM 8883  C CG2  . VAL A 1 38 ? 4.407   -4.754  -2.337  1.00 0.00 ? 36 VAL P CG2  8  
ATOM 8884  H H    . VAL A 1 38 ? 2.232   -2.723  -1.633  1.00 0.00 ? 36 VAL P H    8  
ATOM 8885  H HA   . VAL A 1 38 ? 4.777   -3.030  -0.540  1.00 0.00 ? 36 VAL P HA   8  
ATOM 8886  H HB   . VAL A 1 38 ? 3.490   -3.045  -3.239  1.00 0.00 ? 36 VAL P HB   8  
ATOM 8887  H HG11 . VAL A 1 38 ? 5.499   -3.601  -4.466  1.00 0.00 ? 36 VAL P HG11 8  
ATOM 8888  H HG12 . VAL A 1 38 ? 5.500   -1.922  -3.941  1.00 0.00 ? 36 VAL P HG12 8  
ATOM 8889  H HG13 . VAL A 1 38 ? 6.510   -3.118  -3.079  1.00 0.00 ? 36 VAL P HG13 8  
ATOM 8890  H HG21 . VAL A 1 38 ? 4.234   -5.324  -3.249  1.00 0.00 ? 36 VAL P HG21 8  
ATOM 8891  H HG22 . VAL A 1 38 ? 5.367   -5.035  -1.903  1.00 0.00 ? 36 VAL P HG22 8  
ATOM 8892  H HG23 . VAL A 1 38 ? 3.615   -4.992  -1.626  1.00 0.00 ? 36 VAL P HG23 8  
ATOM 8893  N N    . TRP A 1 39 ? 4.483   -0.040  -1.830  1.00 0.00 ? 37 TRP P N    8  
ATOM 8894  C CA   . TRP A 1 39 ? 5.104   1.286   -1.970  1.00 0.00 ? 37 TRP P CA   8  
ATOM 8895  C C    . TRP A 1 39 ? 4.505   2.342   -1.026  1.00 0.00 ? 37 TRP P C    8  
ATOM 8896  O O    . TRP A 1 39 ? 4.854   3.522   -1.103  1.00 0.00 ? 37 TRP P O    8  
ATOM 8897  C CB   . TRP A 1 39 ? 5.081   1.713   -3.444  1.00 0.00 ? 37 TRP P CB   8  
ATOM 8898  C CG   . TRP A 1 39 ? 3.767   1.545   -4.134  1.00 0.00 ? 37 TRP P CG   8  
ATOM 8899  C CD1  . TRP A 1 39 ? 3.322   0.395   -4.683  1.00 0.00 ? 37 TRP P CD1  8  
ATOM 8900  C CD2  . TRP A 1 39 ? 2.695   2.515   -4.321  1.00 0.00 ? 37 TRP P CD2  8  
ATOM 8901  N NE1  . TRP A 1 39 ? 2.040   0.571   -5.146  1.00 0.00 ? 37 TRP P NE1  8  
ATOM 8902  C CE2  . TRP A 1 39 ? 1.592   1.857   -4.945  1.00 0.00 ? 37 TRP P CE2  8  
ATOM 8903  C CE3  . TRP A 1 39 ? 2.546   3.882   -4.013  1.00 0.00 ? 37 TRP P CE3  8  
ATOM 8904  C CZ2  . TRP A 1 39 ? 0.383   2.515   -5.219  1.00 0.00 ? 37 TRP P CZ2  8  
ATOM 8905  C CZ3  . TRP A 1 39 ? 1.346   4.558   -4.306  1.00 0.00 ? 37 TRP P CZ3  8  
ATOM 8906  C CH2  . TRP A 1 39 ? 0.263   3.877   -4.895  1.00 0.00 ? 37 TRP P CH2  8  
ATOM 8907  H H    . TRP A 1 39 ? 3.516   -0.126  -2.119  1.00 0.00 ? 37 TRP P H    8  
ATOM 8908  H HA   . TRP A 1 39 ? 6.149   1.211   -1.683  1.00 0.00 ? 37 TRP P HA   8  
ATOM 8909  H HB2  . TRP A 1 39 ? 5.396   2.752   -3.520  1.00 0.00 ? 37 TRP P HB2  8  
ATOM 8910  H HB3  . TRP A 1 39 ? 5.814   1.120   -3.983  1.00 0.00 ? 37 TRP P HB3  8  
ATOM 8911  H HD1  . TRP A 1 39 ? 3.864   -0.542  -4.706  1.00 0.00 ? 37 TRP P HD1  8  
ATOM 8912  H HE1  . TRP A 1 39 ? 1.491   -0.224  -5.472  1.00 0.00 ? 37 TRP P HE1  8  
ATOM 8913  H HE3  . TRP A 1 39 ? 3.372   4.402   -3.548  1.00 0.00 ? 37 TRP P HE3  8  
ATOM 8914  H HZ2  . TRP A 1 39 ? -0.436  1.982   -5.680  1.00 0.00 ? 37 TRP P HZ2  8  
ATOM 8915  H HZ3  . TRP A 1 39 ? 1.255   5.611   -4.075  1.00 0.00 ? 37 TRP P HZ3  8  
ATOM 8916  H HH2  . TRP A 1 39 ? -0.658  4.408   -5.102  1.00 0.00 ? 37 TRP P HH2  8  
ATOM 8917  N N    . THR A 1 40 ? 3.631   1.918   -0.107  1.00 0.00 ? 38 THR P N    8  
ATOM 8918  C CA   . THR A 1 40 ? 2.961   2.783   0.883   1.00 0.00 ? 38 THR P CA   8  
ATOM 8919  C C    . THR A 1 40 ? 3.343   2.452   2.328   1.00 0.00 ? 38 THR P C    8  
ATOM 8920  O O    . THR A 1 40 ? 2.796   3.047   3.250   1.00 0.00 ? 38 THR P O    8  
ATOM 8921  C CB   . THR A 1 40 ? 1.437   2.786   0.691   1.00 0.00 ? 38 THR P CB   8  
ATOM 8922  O OG1  . THR A 1 40 ? 0.923   1.483   0.787   1.00 0.00 ? 38 THR P OG1  8  
ATOM 8923  C CG2  . THR A 1 40 ? 1.052   3.327   -0.686  1.00 0.00 ? 38 THR P CG2  8  
ATOM 8924  H H    . THR A 1 40 ? 3.391   0.933   -0.103  1.00 0.00 ? 38 THR P H    8  
ATOM 8925  H HA   . THR A 1 40 ? 3.286   3.812   0.736   1.00 0.00 ? 38 THR P HA   8  
ATOM 8926  H HB   . THR A 1 40 ? 0.971   3.403   1.464   1.00 0.00 ? 38 THR P HB   8  
ATOM 8927  H HG1  . THR A 1 40 ? 0.844   1.149   -0.125  1.00 0.00 ? 38 THR P HG1  8  
ATOM 8928  H HG21 . THR A 1 40 ? -0.030  3.302   -0.804  1.00 0.00 ? 38 THR P HG21 8  
ATOM 8929  H HG22 . THR A 1 40 ? 1.514   2.728   -1.475  1.00 0.00 ? 38 THR P HG22 8  
ATOM 8930  H HG23 . THR A 1 40 ? 1.398   4.355   -0.782  1.00 0.00 ? 38 THR P HG23 8  
ATOM 8931  N N    . ASN A 1 41 ? 4.309   1.549   2.547   1.00 0.00 ? 39 ASN P N    8  
ATOM 8932  C CA   . ASN A 1 41 ? 4.754   1.073   3.868   1.00 0.00 ? 39 ASN P CA   8  
ATOM 8933  C C    . ASN A 1 41 ? 3.628   0.428   4.715   1.00 0.00 ? 39 ASN P C    8  
ATOM 8934  O O    . ASN A 1 41 ? 3.523   0.649   5.926   1.00 0.00 ? 39 ASN P O    8  
ATOM 8935  C CB   . ASN A 1 41 ? 5.535   2.191   4.590   1.00 0.00 ? 39 ASN P CB   8  
ATOM 8936  C CG   . ASN A 1 41 ? 6.403   1.692   5.740   1.00 0.00 ? 39 ASN P CG   8  
ATOM 8937  O OD1  . ASN A 1 41 ? 6.725   0.519   5.870   1.00 0.00 ? 39 ASN P OD1  8  
ATOM 8938  N ND2  . ASN A 1 41 ? 6.847   2.584   6.598   1.00 0.00 ? 39 ASN P ND2  8  
ATOM 8939  H H    . ASN A 1 41 ? 4.736   1.130   1.732   1.00 0.00 ? 39 ASN P H    8  
ATOM 8940  H HA   . ASN A 1 41 ? 5.459   0.264   3.669   1.00 0.00 ? 39 ASN P HA   8  
ATOM 8941  H HB2  . ASN A 1 41 ? 6.183   2.705   3.882   1.00 0.00 ? 39 ASN P HB2  8  
ATOM 8942  H HB3  . ASN A 1 41 ? 4.823   2.918   4.979   1.00 0.00 ? 39 ASN P HB3  8  
ATOM 8943  H HD21 . ASN A 1 41 ? 6.602   3.556   6.496   1.00 0.00 ? 39 ASN P HD21 8  
ATOM 8944  H HD22 . ASN A 1 41 ? 7.432   2.269   7.358   1.00 0.00 ? 39 ASN P HD22 8  
ATOM 8945  N N    . LEU A 1 42 ? 2.767   -0.355  4.059   1.00 0.00 ? 40 LEU P N    8  
ATOM 8946  C CA   . LEU A 1 42 ? 1.669   -1.128  4.657   1.00 0.00 ? 40 LEU P CA   8  
ATOM 8947  C C    . LEU A 1 42 ? 1.847   -2.648  4.434   1.00 0.00 ? 40 LEU P C    8  
ATOM 8948  O O    . LEU A 1 42 ? 2.832   -3.101  3.844   1.00 0.00 ? 40 LEU P O    8  
ATOM 8949  C CB   . LEU A 1 42 ? 0.335   -0.610  4.069   1.00 0.00 ? 40 LEU P CB   8  
ATOM 8950  C CG   . LEU A 1 42 ? -0.021  0.853   4.391   1.00 0.00 ? 40 LEU P CG   8  
ATOM 8951  C CD1  . LEU A 1 42 ? -1.342  1.208   3.712   1.00 0.00 ? 40 LEU P CD1  8  
ATOM 8952  C CD2  . LEU A 1 42 ? -0.192  1.082   5.891   1.00 0.00 ? 40 LEU P CD2  8  
ATOM 8953  H H    . LEU A 1 42 ? 2.908   -0.451  3.062   1.00 0.00 ? 40 LEU P H    8  
ATOM 8954  H HA   . LEU A 1 42 ? 1.654   -0.980  5.738   1.00 0.00 ? 40 LEU P HA   8  
ATOM 8955  H HB2  . LEU A 1 42 ? 0.377   -0.711  2.988   1.00 0.00 ? 40 LEU P HB2  8  
ATOM 8956  H HB3  . LEU A 1 42 ? -0.483  -1.235  4.422   1.00 0.00 ? 40 LEU P HB3  8  
ATOM 8957  H HG   . LEU A 1 42 ? 0.752   1.517   4.011   1.00 0.00 ? 40 LEU P HG   8  
ATOM 8958  H HD11 . LEU A 1 42 ? -1.235  1.088   2.633   1.00 0.00 ? 40 LEU P HD11 8  
ATOM 8959  H HD12 . LEU A 1 42 ? -2.138  0.560   4.078   1.00 0.00 ? 40 LEU P HD12 8  
ATOM 8960  H HD13 . LEU A 1 42 ? -1.591  2.247   3.923   1.00 0.00 ? 40 LEU P HD13 8  
ATOM 8961  H HD21 . LEU A 1 42 ? -0.538  2.100   6.066   1.00 0.00 ? 40 LEU P HD21 8  
ATOM 8962  H HD22 . LEU A 1 42 ? -0.918  0.381   6.296   1.00 0.00 ? 40 LEU P HD22 8  
ATOM 8963  H HD23 . LEU A 1 42 ? 0.769   0.955   6.387   1.00 0.00 ? 40 LEU P HD23 8  
ATOM 8964  N N    . THR A 1 43 ? 0.871   -3.439  4.890   1.00 0.00 ? 41 THR P N    8  
ATOM 8965  C CA   . THR A 1 43 ? 0.712   -4.876  4.588   1.00 0.00 ? 41 THR P CA   8  
ATOM 8966  C C    . THR A 1 43 ? -0.744  -5.165  4.199   1.00 0.00 ? 41 THR P C    8  
ATOM 8967  O O    . THR A 1 43 ? -1.617  -4.327  4.429   1.00 0.00 ? 41 THR P O    8  
ATOM 8968  C CB   . THR A 1 43 ? 1.207   -5.749  5.753   1.00 0.00 ? 41 THR P CB   8  
ATOM 8969  O OG1  . THR A 1 43 ? 1.183   -7.108  5.374   1.00 0.00 ? 41 THR P OG1  8  
ATOM 8970  C CG2  . THR A 1 43 ? 0.376   -5.604  7.030   1.00 0.00 ? 41 THR P CG2  8  
ATOM 8971  H H    . THR A 1 43 ? 0.091   -2.996  5.359   1.00 0.00 ? 41 THR P H    8  
ATOM 8972  H HA   . THR A 1 43 ? 1.322   -5.128  3.721   1.00 0.00 ? 41 THR P HA   8  
ATOM 8973  H HB   . THR A 1 43 ? 2.238   -5.474  5.976   1.00 0.00 ? 41 THR P HB   8  
ATOM 8974  H HG1  . THR A 1 43 ? 1.658   -7.615  6.058   1.00 0.00 ? 41 THR P HG1  8  
ATOM 8975  H HG21 . THR A 1 43 ? 0.771   -6.265  7.801   1.00 0.00 ? 41 THR P HG21 8  
ATOM 8976  H HG22 . THR A 1 43 ? -0.665  -5.858  6.840   1.00 0.00 ? 41 THR P HG22 8  
ATOM 8977  H HG23 . THR A 1 43 ? 0.443   -4.578  7.393   1.00 0.00 ? 41 THR P HG23 8  
ATOM 8978  N N    . GLU A 1 44 ? -1.043  -6.328  3.611   1.00 0.00 ? 42 GLU P N    8  
ATOM 8979  C CA   . GLU A 1 44 ? -2.370  -6.613  3.033   1.00 0.00 ? 42 GLU P CA   8  
ATOM 8980  C C    . GLU A 1 44 ? -3.511  -6.506  4.053   1.00 0.00 ? 42 GLU P C    8  
ATOM 8981  O O    . GLU A 1 44 ? -4.610  -6.084  3.702   1.00 0.00 ? 42 GLU P O    8  
ATOM 8982  C CB   . GLU A 1 44 ? -2.373  -7.965  2.297   1.00 0.00 ? 42 GLU P CB   8  
ATOM 8983  C CG   . GLU A 1 44 ? -2.722  -9.222  3.113   1.00 0.00 ? 42 GLU P CG   8  
ATOM 8984  C CD   . GLU A 1 44 ? -4.241  -9.454  3.275   1.00 0.00 ? 42 GLU P CD   8  
ATOM 8985  O OE1  . GLU A 1 44 ? -4.965  -9.597  2.265   1.00 0.00 ? 42 GLU P OE1  8  
ATOM 8986  O OE2  . GLU A 1 44 ? -4.737  -9.563  4.420   1.00 0.00 ? 42 GLU P OE2  8  
ATOM 8987  H H    . GLU A 1 44 ? -0.306  -7.017  3.518   1.00 0.00 ? 42 GLU P H    8  
ATOM 8988  H HA   . GLU A 1 44 ? -2.553  -5.848  2.283   1.00 0.00 ? 42 GLU P HA   8  
ATOM 8989  H HB2  . GLU A 1 44 ? -3.075  -7.895  1.473   1.00 0.00 ? 42 GLU P HB2  8  
ATOM 8990  H HB3  . GLU A 1 44 ? -1.384  -8.109  1.864   1.00 0.00 ? 42 GLU P HB3  8  
ATOM 8991  H HG2  . GLU A 1 44 ? -2.306  -10.077 2.582   1.00 0.00 ? 42 GLU P HG2  8  
ATOM 8992  H HG3  . GLU A 1 44 ? -2.227  -9.173  4.086   1.00 0.00 ? 42 GLU P HG3  8  
ATOM 8993  N N    . ALA A 1 45 ? -3.227  -6.815  5.319   1.00 0.00 ? 43 ALA P N    8  
ATOM 8994  C CA   . ALA A 1 45 ? -4.181  -6.723  6.422   1.00 0.00 ? 43 ALA P CA   8  
ATOM 8995  C C    . ALA A 1 45 ? -4.599  -5.270  6.707   1.00 0.00 ? 43 ALA P C    8  
ATOM 8996  O O    . ALA A 1 45 ? -5.773  -5.008  6.953   1.00 0.00 ? 43 ALA P O    8  
ATOM 8997  C CB   . ALA A 1 45 ? -3.565  -7.394  7.656   1.00 0.00 ? 43 ALA P CB   8  
ATOM 8998  H H    . ALA A 1 45 ? -2.297  -7.156  5.509   1.00 0.00 ? 43 ALA P H    8  
ATOM 8999  H HA   . ALA A 1 45 ? -5.080  -7.278  6.148   1.00 0.00 ? 43 ALA P HA   8  
ATOM 9000  H HB1  . ALA A 1 45 ? -3.316  -8.432  7.427   1.00 0.00 ? 43 ALA P HB1  8  
ATOM 9001  H HB2  . ALA A 1 45 ? -2.663  -6.866  7.966   1.00 0.00 ? 43 ALA P HB2  8  
ATOM 9002  H HB3  . ALA A 1 45 ? -4.284  -7.378  8.476   1.00 0.00 ? 43 ALA P HB3  8  
ATOM 9003  N N    . ARG A 1 46 ? -3.676  -4.303  6.600   1.00 0.00 ? 44 ARG P N    8  
ATOM 9004  C CA   . ARG A 1 46 ? -3.978  -2.863  6.714   1.00 0.00 ? 44 ARG P CA   8  
ATOM 9005  C C    . ARG A 1 46 ? -4.905  -2.410  5.594   1.00 0.00 ? 44 ARG P C    8  
ATOM 9006  O O    . ARG A 1 46 ? -5.889  -1.726  5.857   1.00 0.00 ? 44 ARG P O    8  
ATOM 9007  C CB   . ARG A 1 46 ? -2.685  -2.027  6.692   1.00 0.00 ? 44 ARG P CB   8  
ATOM 9008  C CG   . ARG A 1 46 ? -1.729  -2.291  7.866   1.00 0.00 ? 44 ARG P CG   8  
ATOM 9009  C CD   . ARG A 1 46 ? -2.322  -1.786  9.183   1.00 0.00 ? 44 ARG P CD   8  
ATOM 9010  N NE   . ARG A 1 46 ? -1.405  -2.014  10.316  1.00 0.00 ? 44 ARG P NE   8  
ATOM 9011  C CZ   . ARG A 1 46 ? -1.663  -1.785  11.593  1.00 0.00 ? 44 ARG P CZ   8  
ATOM 9012  N NH1  . ARG A 1 46 ? -2.805  -1.300  11.995  1.00 0.00 ? 44 ARG P NH1  8  
ATOM 9013  N NH2  . ARG A 1 46 ? -0.773  -2.057  12.503  1.00 0.00 ? 44 ARG P NH2  8  
ATOM 9014  H H    . ARG A 1 46 ? -2.746  -4.581  6.323   1.00 0.00 ? 44 ARG P H    8  
ATOM 9015  H HA   . ARG A 1 46 ? -4.516  -2.681  7.644   1.00 0.00 ? 44 ARG P HA   8  
ATOM 9016  H HB2  . ARG A 1 46 ? -2.163  -2.213  5.756   1.00 0.00 ? 44 ARG P HB2  8  
ATOM 9017  H HB3  . ARG A 1 46 ? -2.953  -0.971  6.703   1.00 0.00 ? 44 ARG P HB3  8  
ATOM 9018  H HG2  . ARG A 1 46 ? -1.522  -3.359  7.945   1.00 0.00 ? 44 ARG P HG2  8  
ATOM 9019  H HG3  . ARG A 1 46 ? -0.791  -1.769  7.678   1.00 0.00 ? 44 ARG P HG3  8  
ATOM 9020  H HD2  . ARG A 1 46 ? -2.529  -0.718  9.076   1.00 0.00 ? 44 ARG P HD2  8  
ATOM 9021  H HD3  . ARG A 1 46 ? -3.255  -2.316  9.368   1.00 0.00 ? 44 ARG P HD3  8  
ATOM 9022  H HE   . ARG A 1 46 ? -0.495  -2.390  10.105  1.00 0.00 ? 44 ARG P HE   8  
ATOM 9023  H HH11 . ARG A 1 46 ? -3.509  -1.078  11.315  1.00 0.00 ? 44 ARG P HH11 8  
ATOM 9024  H HH12 . ARG A 1 46 ? -2.976  -1.143  12.973  1.00 0.00 ? 44 ARG P HH12 8  
ATOM 9025  H HH21 . ARG A 1 46 ? 0.124   -2.431  12.242  1.00 0.00 ? 44 ARG P HH21 8  
ATOM 9026  H HH22 . ARG A 1 46 ? -0.962  -1.859  13.470  1.00 0.00 ? 44 ARG P HH22 8  
ATOM 9027  N N    . VAL A 1 47 ? -4.636  -2.846  4.361   1.00 0.00 ? 45 VAL P N    8  
ATOM 9028  C CA   . VAL A 1 47 ? -5.491  -2.537  3.202   1.00 0.00 ? 45 VAL P CA   8  
ATOM 9029  C C    . VAL A 1 47 ? -6.869  -3.191  3.357   1.00 0.00 ? 45 VAL P C    8  
ATOM 9030  O O    . VAL A 1 47 ? -7.883  -2.516  3.196   1.00 0.00 ? 45 VAL P O    8  
ATOM 9031  C CB   . VAL A 1 47 ? -4.819  -2.949  1.879   1.00 0.00 ? 45 VAL P CB   8  
ATOM 9032  C CG1  . VAL A 1 47 ? -5.577  -2.373  0.679   1.00 0.00 ? 45 VAL P CG1  8  
ATOM 9033  C CG2  . VAL A 1 47 ? -3.368  -2.459  1.799   1.00 0.00 ? 45 VAL P CG2  8  
ATOM 9034  H H    . VAL A 1 47 ? -3.798  -3.400  4.224   1.00 0.00 ? 45 VAL P H    8  
ATOM 9035  H HA   . VAL A 1 47 ? -5.644  -1.457  3.173   1.00 0.00 ? 45 VAL P HA   8  
ATOM 9036  H HB   . VAL A 1 47 ? -4.814  -4.035  1.804   1.00 0.00 ? 45 VAL P HB   8  
ATOM 9037  H HG11 . VAL A 1 47 ? -5.078  -2.651  -0.248  1.00 0.00 ? 45 VAL P HG11 8  
ATOM 9038  H HG12 . VAL A 1 47 ? -6.594  -2.761  0.650   1.00 0.00 ? 45 VAL P HG12 8  
ATOM 9039  H HG13 . VAL A 1 47 ? -5.610  -1.286  0.747   1.00 0.00 ? 45 VAL P HG13 8  
ATOM 9040  H HG21 . VAL A 1 47 ? -3.316  -1.394  2.024   1.00 0.00 ? 45 VAL P HG21 8  
ATOM 9041  H HG22 . VAL A 1 47 ? -2.744  -3.003  2.504   1.00 0.00 ? 45 VAL P HG22 8  
ATOM 9042  H HG23 . VAL A 1 47 ? -2.970  -2.639  0.802   1.00 0.00 ? 45 VAL P HG23 8  
ATOM 9043  N N    . ARG A 1 48 ? -6.929  -4.464  3.771   1.00 0.00 ? 46 ARG P N    8  
ATOM 9044  C CA   . ARG A 1 48 ? -8.173  -5.198  4.068   1.00 0.00 ? 46 ARG P CA   8  
ATOM 9045  C C    . ARG A 1 48 ? -9.020  -4.461  5.111   1.00 0.00 ? 46 ARG P C    8  
ATOM 9046  O O    . ARG A 1 48 ? -10.200 -4.213  4.877   1.00 0.00 ? 46 ARG P O    8  
ATOM 9047  C CB   . ARG A 1 48 ? -7.806  -6.621  4.534   1.00 0.00 ? 46 ARG P CB   8  
ATOM 9048  C CG   . ARG A 1 48 ? -9.024  -7.544  4.685   1.00 0.00 ? 46 ARG P CG   8  
ATOM 9049  C CD   . ARG A 1 48 ? -8.703  -8.783  5.537   1.00 0.00 ? 46 ARG P CD   8  
ATOM 9050  N NE   . ARG A 1 48 ? -7.659  -9.645  4.942   1.00 0.00 ? 46 ARG P NE   8  
ATOM 9051  C CZ   . ARG A 1 48 ? -7.743  -10.927 4.645   1.00 0.00 ? 46 ARG P CZ   8  
ATOM 9052  N NH1  . ARG A 1 48 ? -8.841  -11.621 4.752   1.00 0.00 ? 46 ARG P NH1  8  
ATOM 9053  N NH2  . ARG A 1 48 ? -6.681  -11.535 4.215   1.00 0.00 ? 46 ARG P NH2  8  
ATOM 9054  H H    . ARG A 1 48 ? -6.050  -4.962  3.887   1.00 0.00 ? 46 ARG P H    8  
ATOM 9055  H HA   . ARG A 1 48 ? -8.770  -5.265  3.157   1.00 0.00 ? 46 ARG P HA   8  
ATOM 9056  H HB2  . ARG A 1 48 ? -7.124  -7.074  3.815   1.00 0.00 ? 46 ARG P HB2  8  
ATOM 9057  H HB3  . ARG A 1 48 ? -7.291  -6.556  5.492   1.00 0.00 ? 46 ARG P HB3  8  
ATOM 9058  H HG2  . ARG A 1 48 ? -9.833  -7.006  5.178   1.00 0.00 ? 46 ARG P HG2  8  
ATOM 9059  H HG3  . ARG A 1 48 ? -9.371  -7.852  3.697   1.00 0.00 ? 46 ARG P HG3  8  
ATOM 9060  H HD2  . ARG A 1 48 ? -8.368  -8.452  6.521   1.00 0.00 ? 46 ARG P HD2  8  
ATOM 9061  H HD3  . ARG A 1 48 ? -9.629  -9.340  5.682   1.00 0.00 ? 46 ARG P HD3  8  
ATOM 9062  H HE   . ARG A 1 48 ? -6.729  -9.251  4.819   1.00 0.00 ? 46 ARG P HE   8  
ATOM 9063  H HH11 . ARG A 1 48 ? -9.676  -11.174 5.087   1.00 0.00 ? 46 ARG P HH11 8  
ATOM 9064  H HH12 . ARG A 1 48 ? -8.851  -12.602 4.530   1.00 0.00 ? 46 ARG P HH12 8  
ATOM 9065  H HH21 . ARG A 1 48 ? -5.828  -10.976 4.158   1.00 0.00 ? 46 ARG P HH21 8  
ATOM 9066  H HH22 . ARG A 1 48 ? -6.679  -12.516 4.003   1.00 0.00 ? 46 ARG P HH22 8  
ATOM 9067  N N    . VAL A 1 49 ? -8.413  -4.058  6.231   1.00 0.00 ? 47 VAL P N    8  
ATOM 9068  C CA   . VAL A 1 49 ? -9.065  -3.291  7.311   1.00 0.00 ? 47 VAL P CA   8  
ATOM 9069  C C    . VAL A 1 49 ? -9.555  -1.931  6.816   1.00 0.00 ? 47 VAL P C    8  
ATOM 9070  O O    . VAL A 1 49 ? -10.692 -1.552  7.106   1.00 0.00 ? 47 VAL P O    8  
ATOM 9071  C CB   . VAL A 1 49 ? -8.102  -3.134  8.506   1.00 0.00 ? 47 VAL P CB   8  
ATOM 9072  C CG1  . VAL A 1 49 ? -8.580  -2.116  9.551   1.00 0.00 ? 47 VAL P CG1  8  
ATOM 9073  C CG2  . VAL A 1 49 ? -7.940  -4.477  9.227   1.00 0.00 ? 47 VAL P CG2  8  
ATOM 9074  H H    . VAL A 1 49 ? -7.441  -4.321  6.354   1.00 0.00 ? 47 VAL P H    8  
ATOM 9075  H HA   . VAL A 1 49 ? -9.943  -3.838  7.652   1.00 0.00 ? 47 VAL P HA   8  
ATOM 9076  H HB   . VAL A 1 49 ? -7.127  -2.809  8.142   1.00 0.00 ? 47 VAL P HB   8  
ATOM 9077  H HG11 . VAL A 1 49 ? -8.577  -1.110  9.129   1.00 0.00 ? 47 VAL P HG11 8  
ATOM 9078  H HG12 . VAL A 1 49 ? -9.588  -2.366  9.885   1.00 0.00 ? 47 VAL P HG12 8  
ATOM 9079  H HG13 . VAL A 1 49 ? -7.903  -2.123  10.405  1.00 0.00 ? 47 VAL P HG13 8  
ATOM 9080  H HG21 . VAL A 1 49 ? -8.876  -4.756  9.712   1.00 0.00 ? 47 VAL P HG21 8  
ATOM 9081  H HG22 . VAL A 1 49 ? -7.664  -5.258  8.522   1.00 0.00 ? 47 VAL P HG22 8  
ATOM 9082  H HG23 . VAL A 1 49 ? -7.147  -4.396  9.971   1.00 0.00 ? 47 VAL P HG23 8  
ATOM 9083  N N    . TRP A 1 50 ? -8.747  -1.207  6.038   1.00 0.00 ? 48 TRP P N    8  
ATOM 9084  C CA   . TRP A 1 50 ? -9.127  0.105   5.515   1.00 0.00 ? 48 TRP P CA   8  
ATOM 9085  C C    . TRP A 1 50 ? -10.312 0.013   4.549   1.00 0.00 ? 48 TRP P C    8  
ATOM 9086  O O    . TRP A 1 50 ? -11.292 0.731   4.721   1.00 0.00 ? 48 TRP P O    8  
ATOM 9087  C CB   . TRP A 1 50 ? -7.921  0.779   4.859   1.00 0.00 ? 48 TRP P CB   8  
ATOM 9088  C CG   . TRP A 1 50 ? -8.159  2.217   4.529   1.00 0.00 ? 48 TRP P CG   8  
ATOM 9089  C CD1  . TRP A 1 50 ? -7.816  3.266   5.310   1.00 0.00 ? 48 TRP P CD1  8  
ATOM 9090  C CD2  . TRP A 1 50 ? -8.819  2.791   3.357   1.00 0.00 ? 48 TRP P CD2  8  
ATOM 9091  N NE1  . TRP A 1 50 ? -8.195  4.442   4.696   1.00 0.00 ? 48 TRP P NE1  8  
ATOM 9092  C CE2  . TRP A 1 50 ? -8.810  4.211   3.486   1.00 0.00 ? 48 TRP P CE2  8  
ATOM 9093  C CE3  . TRP A 1 50 ? -9.416  2.257   2.195   1.00 0.00 ? 48 TRP P CE3  8  
ATOM 9094  C CZ2  . TRP A 1 50 ? -9.353  5.058   2.510   1.00 0.00 ? 48 TRP P CZ2  8  
ATOM 9095  C CZ3  . TRP A 1 50 ? -9.993  3.093   1.223   1.00 0.00 ? 48 TRP P CZ3  8  
ATOM 9096  C CH2  . TRP A 1 50 ? -9.973  4.487   1.385   1.00 0.00 ? 48 TRP P CH2  8  
ATOM 9097  H H    . TRP A 1 50 ? -7.810  -1.548  5.847   1.00 0.00 ? 48 TRP P H    8  
ATOM 9098  H HA   . TRP A 1 50 ? -9.440  0.732   6.352   1.00 0.00 ? 48 TRP P HA   8  
ATOM 9099  H HB2  . TRP A 1 50 ? -7.070  0.723   5.538   1.00 0.00 ? 48 TRP P HB2  8  
ATOM 9100  H HB3  . TRP A 1 50 ? -7.657  0.243   3.946   1.00 0.00 ? 48 TRP P HB3  8  
ATOM 9101  H HD1  . TRP A 1 50 ? -7.306  3.188   6.266   1.00 0.00 ? 48 TRP P HD1  8  
ATOM 9102  H HE1  . TRP A 1 50 ? -8.033  5.355   5.104   1.00 0.00 ? 48 TRP P HE1  8  
ATOM 9103  H HE3  . TRP A 1 50 ? -9.433  1.191   2.055   1.00 0.00 ? 48 TRP P HE3  8  
ATOM 9104  H HZ2  . TRP A 1 50 ? -9.281  6.129   2.624   1.00 0.00 ? 48 TRP P HZ2  8  
ATOM 9105  H HZ3  . TRP A 1 50 ? -10.454 2.657   0.345   1.00 0.00 ? 48 TRP P HZ3  8  
ATOM 9106  H HH2  . TRP A 1 50 ? -10.435 5.116   0.639   1.00 0.00 ? 48 TRP P HH2  8  
ATOM 9107  N N    . PHE A 1 51 ? -10.288 -0.922  3.595   1.00 0.00 ? 49 PHE P N    8  
ATOM 9108  C CA   . PHE A 1 51 ? -11.387 -1.159  2.648   1.00 0.00 ? 49 PHE P CA   8  
ATOM 9109  C C    . PHE A 1 51 ? -12.649 -1.741  3.318   1.00 0.00 ? 49 PHE P C    8  
ATOM 9110  O O    . PHE A 1 51 ? -13.760 -1.543  2.814   1.00 0.00 ? 49 PHE P O    8  
ATOM 9111  C CB   . PHE A 1 51 ? -10.883 -2.061  1.508   1.00 0.00 ? 49 PHE P CB   8  
ATOM 9112  C CG   . PHE A 1 51 ? -10.193 -1.321  0.372   1.00 0.00 ? 49 PHE P CG   8  
ATOM 9113  C CD1  . PHE A 1 51 ? -8.871  -0.845  0.494   1.00 0.00 ? 49 PHE P CD1  8  
ATOM 9114  C CD2  . PHE A 1 51 ? -10.885 -1.112  -0.836  1.00 0.00 ? 49 PHE P CD2  8  
ATOM 9115  C CE1  . PHE A 1 51 ? -8.248  -0.172  -0.572  1.00 0.00 ? 49 PHE P CE1  8  
ATOM 9116  C CE2  . PHE A 1 51 ? -10.255 -0.457  -1.903  1.00 0.00 ? 49 PHE P CE2  8  
ATOM 9117  C CZ   . PHE A 1 51 ? -8.943  0.021   -1.776  1.00 0.00 ? 49 PHE P CZ   8  
ATOM 9118  H H    . PHE A 1 51 ? -9.451  -1.488  3.507   1.00 0.00 ? 49 PHE P H    8  
ATOM 9119  H HA   . PHE A 1 51 ? -11.685 -0.205  2.211   1.00 0.00 ? 49 PHE P HA   8  
ATOM 9120  H HB2  . PHE A 1 51 ? -10.213 -2.825  1.905   1.00 0.00 ? 49 PHE P HB2  8  
ATOM 9121  H HB3  . PHE A 1 51 ? -11.736 -2.591  1.085   1.00 0.00 ? 49 PHE P HB3  8  
ATOM 9122  H HD1  . PHE A 1 51 ? -8.328  -0.975  1.414   1.00 0.00 ? 49 PHE P HD1  8  
ATOM 9123  H HD2  . PHE A 1 51 ? -11.900 -1.461  -0.959  1.00 0.00 ? 49 PHE P HD2  8  
ATOM 9124  H HE1  . PHE A 1 51 ? -7.234  0.193   -0.473  1.00 0.00 ? 49 PHE P HE1  8  
ATOM 9125  H HE2  . PHE A 1 51 ? -10.785 -0.333  -2.830  1.00 0.00 ? 49 PHE P HE2  8  
ATOM 9126  H HZ   . PHE A 1 51 ? -8.471  0.533   -2.601  1.00 0.00 ? 49 PHE P HZ   8  
ATOM 9127  N N    . LYS A 1 52 ? -12.511 -2.413  4.469   1.00 0.00 ? 50 LYS P N    8  
ATOM 9128  C CA   . LYS A 1 52 ? -13.634 -2.886  5.306   1.00 0.00 ? 50 LYS P CA   8  
ATOM 9129  C C    . LYS A 1 52 ? -14.281 -1.741  6.095   1.00 0.00 ? 50 LYS P C    8  
ATOM 9130  O O    . LYS A 1 52 ? -15.503 -1.699  6.222   1.00 0.00 ? 50 LYS P O    8  
ATOM 9131  C CB   . LYS A 1 52 ? -13.153 -4.035  6.212   1.00 0.00 ? 50 LYS P CB   8  
ATOM 9132  C CG   . LYS A 1 52 ? -14.313 -4.691  6.981   1.00 0.00 ? 50 LYS P CG   8  
ATOM 9133  C CD   . LYS A 1 52 ? -13.892 -5.948  7.760   1.00 0.00 ? 50 LYS P CD   8  
ATOM 9134  C CE   . LYS A 1 52 ? -12.915 -5.631  8.901   1.00 0.00 ? 50 LYS P CE   8  
ATOM 9135  N NZ   . LYS A 1 52 ? -12.615 -6.841  9.712   1.00 0.00 ? 50 LYS P NZ   8  
ATOM 9136  H H    . LYS A 1 52 ? -11.562 -2.589  4.785   1.00 0.00 ? 50 LYS P H    8  
ATOM 9137  H HA   . LYS A 1 52 ? -14.409 -3.286  4.650   1.00 0.00 ? 50 LYS P HA   8  
ATOM 9138  H HB2  . LYS A 1 52 ? -12.685 -4.797  5.587   1.00 0.00 ? 50 LYS P HB2  8  
ATOM 9139  H HB3  . LYS A 1 52 ? -12.411 -3.657  6.916   1.00 0.00 ? 50 LYS P HB3  8  
ATOM 9140  H HG2  . LYS A 1 52 ? -14.744 -3.974  7.681   1.00 0.00 ? 50 LYS P HG2  8  
ATOM 9141  H HG3  . LYS A 1 52 ? -15.086 -4.980  6.267   1.00 0.00 ? 50 LYS P HG3  8  
ATOM 9142  H HD2  . LYS A 1 52 ? -14.792 -6.402  8.178   1.00 0.00 ? 50 LYS P HD2  8  
ATOM 9143  H HD3  . LYS A 1 52 ? -13.437 -6.663  7.071   1.00 0.00 ? 50 LYS P HD3  8  
ATOM 9144  H HE2  . LYS A 1 52 ? -11.991 -5.227  8.477   1.00 0.00 ? 50 LYS P HE2  8  
ATOM 9145  H HE3  . LYS A 1 52 ? -13.359 -4.859  9.538   1.00 0.00 ? 50 LYS P HE3  8  
ATOM 9146  H HZ1  . LYS A 1 52 ? -12.196 -7.569  9.149   1.00 0.00 ? 50 LYS P HZ1  8  
ATOM 9147  H HZ2  . LYS A 1 52 ? -13.455 -7.220  10.129  1.00 0.00 ? 50 LYS P HZ2  8  
ATOM 9148  H HZ3  . LYS A 1 52 ? -11.974 -6.627  10.465  1.00 0.00 ? 50 LYS P HZ3  8  
ATOM 9149  N N    . ASN A 1 53 ? -13.490 -0.772  6.560   1.00 0.00 ? 51 ASN P N    8  
ATOM 9150  C CA   . ASN A 1 53 ? -14.012 0.476   7.129   1.00 0.00 ? 51 ASN P CA   8  
ATOM 9151  C C    . ASN A 1 53 ? -14.608 1.399   6.046   1.00 0.00 ? 51 ASN P C    8  
ATOM 9152  O O    . ASN A 1 53 ? -15.674 1.981   6.252   1.00 0.00 ? 51 ASN P O    8  
ATOM 9153  C CB   . ASN A 1 53 ? -12.906 1.182   7.934   1.00 0.00 ? 51 ASN P CB   8  
ATOM 9154  C CG   . ASN A 1 53 ? -12.723 0.583   9.316   1.00 0.00 ? 51 ASN P CG   8  
ATOM 9155  O OD1  . ASN A 1 53 ? -13.298 1.037   10.295  1.00 0.00 ? 51 ASN P OD1  8  
ATOM 9156  N ND2  . ASN A 1 53 ? -11.932 -0.456  9.444   1.00 0.00 ? 51 ASN P ND2  8  
ATOM 9157  H H    . ASN A 1 53 ? -12.485 -0.905  6.493   1.00 0.00 ? 51 ASN P H    8  
ATOM 9158  H HA   . ASN A 1 53 ? -14.833 0.243   7.810   1.00 0.00 ? 51 ASN P HA   8  
ATOM 9159  H HB2  . ASN A 1 53 ? -11.958 1.149   7.397   1.00 0.00 ? 51 ASN P HB2  8  
ATOM 9160  H HB3  . ASN A 1 53 ? -13.177 2.229   8.071   1.00 0.00 ? 51 ASN P HB3  8  
ATOM 9161  H HD21 . ASN A 1 53 ? -11.462 -0.842  8.633   1.00 0.00 ? 51 ASN P HD21 8  
ATOM 9162  H HD22 . ASN A 1 53 ? -11.803 -0.841  10.363  1.00 0.00 ? 51 ASN P HD22 8  
ATOM 9163  N N    . ARG A 1 54 ? -13.965 1.513   4.873   1.00 0.00 ? 52 ARG P N    8  
ATOM 9164  C CA   . ARG A 1 54 ? -14.367 2.461   3.822   1.00 0.00 ? 52 ARG P CA   8  
ATOM 9165  C C    . ARG A 1 54 ? -15.746 2.159   3.250   1.00 0.00 ? 52 ARG P C    8  
ATOM 9166  O O    . ARG A 1 54 ? -16.503 3.098   3.041   1.00 0.00 ? 52 ARG P O    8  
ATOM 9167  C CB   . ARG A 1 54 ? -13.303 2.541   2.707   1.00 0.00 ? 52 ARG P CB   8  
ATOM 9168  C CG   . ARG A 1 54 ? -13.556 3.688   1.697   1.00 0.00 ? 52 ARG P CG   8  
ATOM 9169  C CD   . ARG A 1 54 ? -13.693 5.076   2.349   1.00 0.00 ? 52 ARG P CD   8  
ATOM 9170  N NE   . ARG A 1 54 ? -13.779 6.171   1.357   1.00 0.00 ? 52 ARG P NE   8  
ATOM 9171  C CZ   . ARG A 1 54 ? -12.931 7.172   1.198   1.00 0.00 ? 52 ARG P CZ   8  
ATOM 9172  N NH1  . ARG A 1 54 ? -11.857 7.334   1.911   1.00 0.00 ? 52 ARG P NH1  8  
ATOM 9173  N NH2  . ARG A 1 54 ? -13.116 8.088   0.303   1.00 0.00 ? 52 ARG P NH2  8  
ATOM 9174  H H    . ARG A 1 54 ? -13.064 1.052   4.783   1.00 0.00 ? 52 ARG P H    8  
ATOM 9175  H HA   . ARG A 1 54 ? -14.444 3.438   4.299   1.00 0.00 ? 52 ARG P HA   8  
ATOM 9176  H HB2  . ARG A 1 54 ? -12.316 2.663   3.161   1.00 0.00 ? 52 ARG P HB2  8  
ATOM 9177  H HB3  . ARG A 1 54 ? -13.288 1.599   2.159   1.00 0.00 ? 52 ARG P HB3  8  
ATOM 9178  H HG2  . ARG A 1 54 ? -12.731 3.710   0.987   1.00 0.00 ? 52 ARG P HG2  8  
ATOM 9179  H HG3  . ARG A 1 54 ? -14.465 3.477   1.134   1.00 0.00 ? 52 ARG P HG3  8  
ATOM 9180  H HD2  . ARG A 1 54 ? -14.606 5.100   2.946   1.00 0.00 ? 52 ARG P HD2  8  
ATOM 9181  H HD3  . ARG A 1 54 ? -12.849 5.228   3.021   1.00 0.00 ? 52 ARG P HD3  8  
ATOM 9182  H HE   . ARG A 1 54 ? -14.632 6.239   0.802   1.00 0.00 ? 52 ARG P HE   8  
ATOM 9183  H HH11 . ARG A 1 54 ? -11.625 6.684   2.637   1.00 0.00 ? 52 ARG P HH11 8  
ATOM 9184  H HH12 . ARG A 1 54 ? -11.281 8.147   1.700   1.00 0.00 ? 52 ARG P HH12 8  
ATOM 9185  H HH21 . ARG A 1 54 ? -13.931 8.061   -0.312  1.00 0.00 ? 52 ARG P HH21 8  
ATOM 9186  H HH22 . ARG A 1 54 ? -12.421 8.824   0.233   1.00 0.00 ? 52 ARG P HH22 8  
ATOM 9187  N N    . ARG A 1 55 ? -16.127 0.889   3.072   1.00 0.00 ? 53 ARG P N    8  
ATOM 9188  C CA   . ARG A 1 55 ? -17.483 0.519   2.603   1.00 0.00 ? 53 ARG P CA   8  
ATOM 9189  C C    . ARG A 1 55 ? -18.592 0.883   3.603   1.00 0.00 ? 53 ARG P C    8  
ATOM 9190  O O    . ARG A 1 55 ? -19.681 1.280   3.195   1.00 0.00 ? 53 ARG P O    8  
ATOM 9191  C CB   . ARG A 1 55 ? -17.522 -0.957  2.171   1.00 0.00 ? 53 ARG P CB   8  
ATOM 9192  C CG   . ARG A 1 55 ? -17.313 -1.951  3.327   1.00 0.00 ? 53 ARG P CG   8  
ATOM 9193  C CD   . ARG A 1 55 ? -17.106 -3.387  2.835   1.00 0.00 ? 53 ARG P CD   8  
ATOM 9194  N NE   . ARG A 1 55 ? -15.800 -3.542  2.164   1.00 0.00 ? 53 ARG P NE   8  
ATOM 9195  C CZ   . ARG A 1 55 ? -15.355 -4.617  1.541   1.00 0.00 ? 53 ARG P CZ   8  
ATOM 9196  N NH1  . ARG A 1 55 ? -16.045 -5.720  1.476   1.00 0.00 ? 53 ARG P NH1  8  
ATOM 9197  N NH2  . ARG A 1 55 ? -14.187 -4.599  0.967   1.00 0.00 ? 53 ARG P NH2  8  
ATOM 9198  H H    . ARG A 1 55 ? -15.438 0.165   3.238   1.00 0.00 ? 53 ARG P H    8  
ATOM 9199  H HA   . ARG A 1 55 ? -17.693 1.108   1.709   1.00 0.00 ? 53 ARG P HA   8  
ATOM 9200  H HB2  . ARG A 1 55 ? -18.488 -1.157  1.705   1.00 0.00 ? 53 ARG P HB2  8  
ATOM 9201  H HB3  . ARG A 1 55 ? -16.751 -1.107  1.415   1.00 0.00 ? 53 ARG P HB3  8  
ATOM 9202  H HG2  . ARG A 1 55 ? -16.440 -1.658  3.903   1.00 0.00 ? 53 ARG P HG2  8  
ATOM 9203  H HG3  . ARG A 1 55 ? -18.186 -1.929  3.981   1.00 0.00 ? 53 ARG P HG3  8  
ATOM 9204  H HD2  . ARG A 1 55 ? -17.145 -4.054  3.698   1.00 0.00 ? 53 ARG P HD2  8  
ATOM 9205  H HD3  . ARG A 1 55 ? -17.918 -3.648  2.153   1.00 0.00 ? 53 ARG P HD3  8  
ATOM 9206  H HE   . ARG A 1 55 ? -15.167 -2.751  2.203   1.00 0.00 ? 53 ARG P HE   8  
ATOM 9207  H HH11 . ARG A 1 55 ? -16.949 -5.759  1.915   1.00 0.00 ? 53 ARG P HH11 8  
ATOM 9208  H HH12 . ARG A 1 55 ? -15.685 -6.526  0.994   1.00 0.00 ? 53 ARG P HH12 8  
ATOM 9209  H HH21 . ARG A 1 55 ? -13.652 -3.750  0.960   1.00 0.00 ? 53 ARG P HH21 8  
ATOM 9210  H HH22 . ARG A 1 55 ? -13.841 -5.418  0.498   1.00 0.00 ? 53 ARG P HH22 8  
ATOM 9211  N N    . ALA A 1 56 ? -18.309 0.840   4.904   1.00 0.00 ? 54 ALA P N    8  
ATOM 9212  C CA   . ALA A 1 56 ? -19.243 1.298   5.934   1.00 0.00 ? 54 ALA P CA   8  
ATOM 9213  C C    . ALA A 1 56 ? -19.361 2.832   5.982   1.00 0.00 ? 54 ALA P C    8  
ATOM 9214  O O    . ALA A 1 56 ? -20.451 3.344   6.240   1.00 0.00 ? 54 ALA P O    8  
ATOM 9215  C CB   . ALA A 1 56 ? -18.804 0.720   7.285   1.00 0.00 ? 54 ALA P CB   8  
ATOM 9216  H H    . ALA A 1 56 ? -17.402 0.507   5.191   1.00 0.00 ? 54 ALA P H    8  
ATOM 9217  H HA   . ALA A 1 56 ? -20.239 0.917   5.697   1.00 0.00 ? 54 ALA P HA   8  
ATOM 9218  H HB1  . ALA A 1 56 ? -18.747 -0.367  7.224   1.00 0.00 ? 54 ALA P HB1  8  
ATOM 9219  H HB2  . ALA A 1 56 ? -17.829 1.119   7.567   1.00 0.00 ? 54 ALA P HB2  8  
ATOM 9220  H HB3  . ALA A 1 56 ? -19.530 0.995   8.052   1.00 0.00 ? 54 ALA P HB3  8  
ATOM 9221  N N    . LYS A 1 57 ? -18.274 3.565   5.707   1.00 0.00 ? 55 LYS P N    8  
ATOM 9222  C CA   . LYS A 1 57 ? -18.260 5.041   5.653   1.00 0.00 ? 55 LYS P CA   8  
ATOM 9223  C C    . LYS A 1 57 ? -18.821 5.601   4.338   1.00 0.00 ? 55 LYS P C    8  
ATOM 9224  O O    . LYS A 1 57 ? -19.546 6.594   4.361   1.00 0.00 ? 55 LYS P O    8  
ATOM 9225  C CB   . LYS A 1 57 ? -16.830 5.553   5.904   1.00 0.00 ? 55 LYS P CB   8  
ATOM 9226  C CG   . LYS A 1 57 ? -16.366 5.284   7.346   1.00 0.00 ? 55 LYS P CG   8  
ATOM 9227  C CD   . LYS A 1 57 ? -14.942 5.806   7.578   1.00 0.00 ? 55 LYS P CD   8  
ATOM 9228  C CE   . LYS A 1 57 ? -14.522 5.548   9.031   1.00 0.00 ? 55 LYS P CE   8  
ATOM 9229  N NZ   . LYS A 1 57 ? -13.170 6.096   9.318   1.00 0.00 ? 55 LYS P NZ   8  
ATOM 9230  H H    . LYS A 1 57 ? -17.397 3.070   5.580   1.00 0.00 ? 55 LYS P H    8  
ATOM 9231  H HA   . LYS A 1 57 ? -18.904 5.424   6.447   1.00 0.00 ? 55 LYS P HA   8  
ATOM 9232  H HB2  . LYS A 1 57 ? -16.142 5.079   5.202   1.00 0.00 ? 55 LYS P HB2  8  
ATOM 9233  H HB3  . LYS A 1 57 ? -16.807 6.631   5.732   1.00 0.00 ? 55 LYS P HB3  8  
ATOM 9234  H HG2  . LYS A 1 57 ? -17.048 5.785   8.035   1.00 0.00 ? 55 LYS P HG2  8  
ATOM 9235  H HG3  . LYS A 1 57 ? -16.389 4.214   7.549   1.00 0.00 ? 55 LYS P HG3  8  
ATOM 9236  H HD2  . LYS A 1 57 ? -14.254 5.296   6.900   1.00 0.00 ? 55 LYS P HD2  8  
ATOM 9237  H HD3  . LYS A 1 57 ? -14.916 6.879   7.376   1.00 0.00 ? 55 LYS P HD3  8  
ATOM 9238  H HE2  . LYS A 1 57 ? -15.258 6.011   9.695   1.00 0.00 ? 55 LYS P HE2  8  
ATOM 9239  H HE3  . LYS A 1 57 ? -14.537 4.469   9.216   1.00 0.00 ? 55 LYS P HE3  8  
ATOM 9240  H HZ1  . LYS A 1 57 ? -13.143 7.097   9.178   1.00 0.00 ? 55 LYS P HZ1  8  
ATOM 9241  H HZ2  . LYS A 1 57 ? -12.466 5.680   8.721   1.00 0.00 ? 55 LYS P HZ2  8  
ATOM 9242  H HZ3  . LYS A 1 57 ? -12.903 5.918   10.276  1.00 0.00 ? 55 LYS P HZ3  8  
ATOM 9243  N N    . TRP A 1 58 ? -18.561 4.932   3.212   1.00 0.00 ? 56 TRP P N    8  
ATOM 9244  C CA   . TRP A 1 58 ? -19.031 5.277   1.862   1.00 0.00 ? 56 TRP P CA   8  
ATOM 9245  C C    . TRP A 1 58 ? -20.546 5.483   1.833   1.00 0.00 ? 56 TRP P C    8  
ATOM 9246  O O    . TRP A 1 58 ? -21.032 6.466   1.277   1.00 0.00 ? 56 TRP P O    8  
ATOM 9247  C CB   . TRP A 1 58 ? -18.620 4.150   0.894   1.00 0.00 ? 56 TRP P CB   8  
ATOM 9248  C CG   . TRP A 1 58 ? -19.506 3.956   -0.300  1.00 0.00 ? 56 TRP P CG   8  
ATOM 9249  C CD1  . TRP A 1 58 ? -19.766 4.885   -1.242  1.00 0.00 ? 56 TRP P CD1  8  
ATOM 9250  C CD2  . TRP A 1 58 ? -20.330 2.802   -0.648  1.00 0.00 ? 56 TRP P CD2  8  
ATOM 9251  N NE1  . TRP A 1 58 ? -20.708 4.401   -2.131  1.00 0.00 ? 56 TRP P NE1  8  
ATOM 9252  C CE2  . TRP A 1 58 ? -21.100 3.123   -1.805  1.00 0.00 ? 56 TRP P CE2  8  
ATOM 9253  C CE3  . TRP A 1 58 ? -20.529 1.529   -0.081  1.00 0.00 ? 56 TRP P CE3  8  
ATOM 9254  C CZ2  . TRP A 1 58 ? -22.030 2.233   -2.362  1.00 0.00 ? 56 TRP P CZ2  8  
ATOM 9255  C CZ3  . TRP A 1 58 ? -21.441 0.613   -0.643  1.00 0.00 ? 56 TRP P CZ3  8  
ATOM 9256  C CH2  . TRP A 1 58 ? -22.195 0.964   -1.779  1.00 0.00 ? 56 TRP P CH2  8  
ATOM 9257  H H    . TRP A 1 58 ? -17.955 4.123   3.282   1.00 0.00 ? 56 TRP P H    8  
ATOM 9258  H HA   . TRP A 1 58 ? -18.566 6.206   1.532   1.00 0.00 ? 56 TRP P HA   8  
ATOM 9259  H HB2  . TRP A 1 58 ? -17.598 4.326   0.558   1.00 0.00 ? 56 TRP P HB2  8  
ATOM 9260  H HB3  . TRP A 1 58 ? -18.625 3.207   1.437   1.00 0.00 ? 56 TRP P HB3  8  
ATOM 9261  H HD1  . TRP A 1 58 ? -19.330 5.872   -1.242  1.00 0.00 ? 56 TRP P HD1  8  
ATOM 9262  H HE1  . TRP A 1 58 ? -21.080 4.933   -2.905  1.00 0.00 ? 56 TRP P HE1  8  
ATOM 9263  H HE3  . TRP A 1 58 ? -19.981 1.276   0.813   1.00 0.00 ? 56 TRP P HE3  8  
ATOM 9264  H HZ2  . TRP A 1 58 ? -22.610 2.526   -3.226  1.00 0.00 ? 56 TRP P HZ2  8  
ATOM 9265  H HZ3  . TRP A 1 58 ? -21.566 -0.362  -0.194  1.00 0.00 ? 56 TRP P HZ3  8  
ATOM 9266  H HH2  . TRP A 1 58 ? -22.902 0.261   -2.202  1.00 0.00 ? 56 TRP P HH2  8  
ATOM 9267  N N    . ARG A 1 59 ? -21.292 4.604   2.505   1.00 0.00 ? 57 ARG P N    8  
ATOM 9268  C CA   . ARG A 1 59 ? -22.762 4.635   2.600   1.00 0.00 ? 57 ARG P CA   8  
ATOM 9269  C C    . ARG A 1 59 ? -23.345 5.905   3.248   1.00 0.00 ? 57 ARG P C    8  
ATOM 9270  O O    . ARG A 1 59 ? -24.507 6.226   2.994   1.00 0.00 ? 57 ARG P O    8  
ATOM 9271  C CB   . ARG A 1 59 ? -23.190 3.367   3.353   1.00 0.00 ? 57 ARG P CB   8  
ATOM 9272  C CG   . ARG A 1 59 ? -23.105 2.144   2.430   1.00 0.00 ? 57 ARG P CG   8  
ATOM 9273  C CD   . ARG A 1 59 ? -23.261 0.840   3.219   1.00 0.00 ? 57 ARG P CD   8  
ATOM 9274  N NE   . ARG A 1 59 ? -23.339 -0.324  2.315   1.00 0.00 ? 57 ARG P NE   8  
ATOM 9275  C CZ   . ARG A 1 59 ? -23.360 -1.597  2.664   1.00 0.00 ? 57 ARG P CZ   8  
ATOM 9276  N NH1  . ARG A 1 59 ? -23.301 -1.976  3.911   1.00 0.00 ? 57 ARG P NH1  8  
ATOM 9277  N NH2  . ARG A 1 59 ? -23.448 -2.529  1.759   1.00 0.00 ? 57 ARG P NH2  8  
ATOM 9278  H H    . ARG A 1 59 ? -20.803 3.805   2.894   1.00 0.00 ? 57 ARG P H    8  
ATOM 9279  H HA   . ARG A 1 59 ? -23.172 4.607   1.587   1.00 0.00 ? 57 ARG P HA   8  
ATOM 9280  H HB2  . ARG A 1 59 ? -22.526 3.229   4.211   1.00 0.00 ? 57 ARG P HB2  8  
ATOM 9281  H HB3  . ARG A 1 59 ? -24.217 3.468   3.708   1.00 0.00 ? 57 ARG P HB3  8  
ATOM 9282  H HG2  . ARG A 1 59 ? -23.886 2.220   1.670   1.00 0.00 ? 57 ARG P HG2  8  
ATOM 9283  H HG3  . ARG A 1 59 ? -22.141 2.133   1.927   1.00 0.00 ? 57 ARG P HG3  8  
ATOM 9284  H HD2  . ARG A 1 59 ? -22.399 0.734   3.884   1.00 0.00 ? 57 ARG P HD2  8  
ATOM 9285  H HD3  . ARG A 1 59 ? -24.172 0.894   3.818   1.00 0.00 ? 57 ARG P HD3  8  
ATOM 9286  H HE   . ARG A 1 59 ? -23.397 -0.128  1.328   1.00 0.00 ? 57 ARG P HE   8  
ATOM 9287  H HH11 . ARG A 1 59 ? -23.250 -1.279  4.633   1.00 0.00 ? 57 ARG P HH11 8  
ATOM 9288  H HH12 . ARG A 1 59 ? -23.328 -2.952  4.152   1.00 0.00 ? 57 ARG P HH12 8  
ATOM 9289  H HH21 . ARG A 1 59 ? -23.518 -2.287  0.785   1.00 0.00 ? 57 ARG P HH21 8  
ATOM 9290  H HH22 . ARG A 1 59 ? -23.471 -3.497  2.029   1.00 0.00 ? 57 ARG P HH22 8  
ATOM 9291  N N    . LYS A 1 60 ? -22.550 6.654   4.025   1.00 0.00 ? 58 LYS P N    8  
ATOM 9292  C CA   . LYS A 1 60 ? -22.904 7.982   4.582   1.00 0.00 ? 58 LYS P CA   8  
ATOM 9293  C C    . LYS A 1 60 ? -22.484 9.166   3.693   1.00 0.00 ? 58 LYS P C    8  
ATOM 9294  O O    . LYS A 1 60 ? -22.878 10.303  3.969   1.00 0.00 ? 58 LYS P O    8  
ATOM 9295  C CB   . LYS A 1 60 ? -22.335 8.158   6.006   1.00 0.00 ? 58 LYS P CB   8  
ATOM 9296  C CG   . LYS A 1 60 ? -22.939 7.211   7.057   1.00 0.00 ? 58 LYS P CG   8  
ATOM 9297  C CD   . LYS A 1 60 ? -22.130 5.921   7.237   1.00 0.00 ? 58 LYS P CD   8  
ATOM 9298  C CE   . LYS A 1 60 ? -22.790 5.032   8.296   1.00 0.00 ? 58 LYS P CE   8  
ATOM 9299  N NZ   . LYS A 1 60 ? -21.955 3.843   8.598   1.00 0.00 ? 58 LYS P NZ   8  
ATOM 9300  H H    . LYS A 1 60 ? -21.618 6.294   4.195   1.00 0.00 ? 58 LYS P H    8  
ATOM 9301  H HA   . LYS A 1 60 ? -23.991 8.055   4.655   1.00 0.00 ? 58 LYS P HA   8  
ATOM 9302  H HB2  . LYS A 1 60 ? -21.248 8.064   5.993   1.00 0.00 ? 58 LYS P HB2  8  
ATOM 9303  H HB3  . LYS A 1 60 ? -22.565 9.173   6.334   1.00 0.00 ? 58 LYS P HB3  8  
ATOM 9304  H HG2  . LYS A 1 60 ? -22.953 7.733   8.015   1.00 0.00 ? 58 LYS P HG2  8  
ATOM 9305  H HG3  . LYS A 1 60 ? -23.969 6.971   6.789   1.00 0.00 ? 58 LYS P HG3  8  
ATOM 9306  H HD2  . LYS A 1 60 ? -22.086 5.378   6.295   1.00 0.00 ? 58 LYS P HD2  8  
ATOM 9307  H HD3  . LYS A 1 60 ? -21.116 6.175   7.553   1.00 0.00 ? 58 LYS P HD3  8  
ATOM 9308  H HE2  . LYS A 1 60 ? -22.949 5.617   9.207   1.00 0.00 ? 58 LYS P HE2  8  
ATOM 9309  H HE3  . LYS A 1 60 ? -23.769 4.717   7.920   1.00 0.00 ? 58 LYS P HE3  8  
ATOM 9310  H HZ1  . LYS A 1 60 ? -21.655 3.393   7.738   1.00 0.00 ? 58 LYS P HZ1  8  
ATOM 9311  H HZ2  . LYS A 1 60 ? -22.459 3.170   9.159   1.00 0.00 ? 58 LYS P HZ2  8  
ATOM 9312  H HZ3  . LYS A 1 60 ? -21.120 4.107   9.104   1.00 0.00 ? 58 LYS P HZ3  8  
ATOM 9313  N N    . ARG A 1 61 ? -21.675 8.935   2.651   1.00 0.00 ? 59 ARG P N    8  
ATOM 9314  C CA   . ARG A 1 61 ? -21.165 9.965   1.717   1.00 0.00 ? 59 ARG P CA   8  
ATOM 9315  C C    . ARG A 1 61 ? -21.689 9.823   0.282   1.00 0.00 ? 59 ARG P C    8  
ATOM 9316  O O    . ARG A 1 61 ? -21.697 10.805  -0.457  1.00 0.00 ? 59 ARG P O    8  
ATOM 9317  C CB   . ARG A 1 61 ? -19.624 9.978   1.734   1.00 0.00 ? 59 ARG P CB   8  
ATOM 9318  C CG   . ARG A 1 61 ? -18.957 10.111  3.119   1.00 0.00 ? 59 ARG P CG   8  
ATOM 9319  C CD   . ARG A 1 61 ? -19.503 11.212  4.041   1.00 0.00 ? 59 ARG P CD   8  
ATOM 9320  N NE   . ARG A 1 61 ? -19.535 12.543  3.400   1.00 0.00 ? 59 ARG P NE   8  
ATOM 9321  C CZ   . ARG A 1 61 ? -20.571 13.361  3.291   1.00 0.00 ? 59 ARG P CZ   8  
ATOM 9322  N NH1  . ARG A 1 61 ? -21.779 13.038  3.666   1.00 0.00 ? 59 ARG P NH1  8  
ATOM 9323  N NH2  . ARG A 1 61 ? -20.408 14.548  2.784   1.00 0.00 ? 59 ARG P NH2  8  
ATOM 9324  H H    . ARG A 1 61 ? -21.372 7.980   2.510   1.00 0.00 ? 59 ARG P H    8  
ATOM 9325  H HA   . ARG A 1 61 ? -21.505 10.947  2.037   1.00 0.00 ? 59 ARG P HA   8  
ATOM 9326  H HB2  . ARG A 1 61 ? -19.261 9.055   1.279   1.00 0.00 ? 59 ARG P HB2  8  
ATOM 9327  H HB3  . ARG A 1 61 ? -19.281 10.806  1.112   1.00 0.00 ? 59 ARG P HB3  8  
ATOM 9328  H HG2  . ARG A 1 61 ? -19.056 9.160   3.642   1.00 0.00 ? 59 ARG P HG2  8  
ATOM 9329  H HG3  . ARG A 1 61 ? -17.893 10.286  2.963   1.00 0.00 ? 59 ARG P HG3  8  
ATOM 9330  H HD2  . ARG A 1 61 ? -20.490 10.925  4.395   1.00 0.00 ? 59 ARG P HD2  8  
ATOM 9331  H HD3  . ARG A 1 61 ? -18.859 11.265  4.922   1.00 0.00 ? 59 ARG P HD3  8  
ATOM 9332  H HE   . ARG A 1 61 ? -18.654 12.899  3.063   1.00 0.00 ? 59 ARG P HE   8  
ATOM 9333  H HH11 . ARG A 1 61 ? -21.977 12.104  4.002   1.00 0.00 ? 59 ARG P HH11 8  
ATOM 9334  H HH12 . ARG A 1 61 ? -22.533 13.696  3.571   1.00 0.00 ? 59 ARG P HH12 8  
ATOM 9335  H HH21 . ARG A 1 61 ? -19.496 14.850  2.480   1.00 0.00 ? 59 ARG P HH21 8  
ATOM 9336  H HH22 . ARG A 1 61 ? -21.189 15.177  2.697   1.00 0.00 ? 59 ARG P HH22 8  
ATOM 9337  N N    . GLU A 1 62 ? -22.139 8.625   -0.095  1.00 0.00 ? 60 GLU P N    8  
ATOM 9338  C CA   . GLU A 1 62 ? -22.648 8.252   -1.425  1.00 0.00 ? 60 GLU P CA   8  
ATOM 9339  C C    . GLU A 1 62 ? -21.677 8.651   -2.556  1.00 0.00 ? 60 GLU P C    8  
ATOM 9340  O O    . GLU A 1 62 ? -22.011 9.389   -3.484  1.00 0.00 ? 60 GLU P O    8  
ATOM 9341  C CB   . GLU A 1 62 ? -24.099 8.728   -1.617  1.00 0.00 ? 60 GLU P CB   8  
ATOM 9342  C CG   . GLU A 1 62 ? -25.054 8.039   -0.630  1.00 0.00 ? 60 GLU P CG   8  
ATOM 9343  C CD   . GLU A 1 62 ? -26.507 8.495   -0.860  1.00 0.00 ? 60 GLU P CD   8  
ATOM 9344  O OE1  . GLU A 1 62 ? -26.929 9.519   -0.270  1.00 0.00 ? 60 GLU P OE1  8  
ATOM 9345  O OE2  . GLU A 1 62 ? -27.245 7.829   -1.629  1.00 0.00 ? 60 GLU P OE2  8  
ATOM 9346  H H    . GLU A 1 62 ? -22.036 7.875   0.576   1.00 0.00 ? 60 GLU P H    8  
ATOM 9347  H HA   . GLU A 1 62 ? -22.681 7.159   -1.452  1.00 0.00 ? 60 GLU P HA   8  
ATOM 9348  H HB2  . GLU A 1 62 ? -24.156 9.810   -1.487  1.00 0.00 ? 60 GLU P HB2  8  
ATOM 9349  H HB3  . GLU A 1 62 ? -24.422 8.484   -2.630  1.00 0.00 ? 60 GLU P HB3  8  
ATOM 9350  H HG2  . GLU A 1 62 ? -24.975 6.955   -0.763  1.00 0.00 ? 60 GLU P HG2  8  
ATOM 9351  H HG3  . GLU A 1 62 ? -24.753 8.268   0.396   1.00 0.00 ? 60 GLU P HG3  8  
ATOM 9352  N N    . GLU A 1 63 ? -20.435 8.163   -2.450  1.00 0.00 ? 61 GLU P N    8  
ATOM 9353  C CA   . GLU A 1 63 ? -19.308 8.516   -3.341  1.00 0.00 ? 61 GLU P CA   8  
ATOM 9354  C C    . GLU A 1 63 ? -19.485 8.060   -4.808  1.00 0.00 ? 61 GLU P C    8  
ATOM 9355  O O    . GLU A 1 63 ? -18.782 8.549   -5.697  1.00 0.00 ? 61 GLU P O    8  
ATOM 9356  C CB   . GLU A 1 63 ? -17.992 7.927   -2.793  1.00 0.00 ? 61 GLU P CB   8  
ATOM 9357  C CG   . GLU A 1 63 ? -17.657 8.343   -1.352  1.00 0.00 ? 61 GLU P CG   8  
ATOM 9358  C CD   . GLU A 1 63 ? -16.283 7.797   -0.916  1.00 0.00 ? 61 GLU P CD   8  
ATOM 9359  O OE1  . GLU A 1 63 ? -15.246 8.241   -1.461  1.00 0.00 ? 61 GLU P OE1  8  
ATOM 9360  O OE2  . GLU A 1 63 ? -16.211 6.941   -0.004  1.00 0.00 ? 61 GLU P OE2  8  
ATOM 9361  H H    . GLU A 1 63 ? -20.234 7.611   -1.628  1.00 0.00 ? 61 GLU P H    8  
ATOM 9362  H HA   . GLU A 1 63 ? -19.211 9.603   -3.355  1.00 0.00 ? 61 GLU P HA   8  
ATOM 9363  H HB2  . GLU A 1 63 ? -18.037 6.839   -2.846  1.00 0.00 ? 61 GLU P HB2  8  
ATOM 9364  H HB3  . GLU A 1 63 ? -17.179 8.256   -3.440  1.00 0.00 ? 61 GLU P HB3  8  
ATOM 9365  H HG2  . GLU A 1 63 ? -17.654 9.434   -1.287  1.00 0.00 ? 61 GLU P HG2  8  
ATOM 9366  H HG3  . GLU A 1 63 ? -18.430 7.969   -0.678  1.00 0.00 ? 61 GLU P HG3  8  
ATOM 9367  N N    . PHE A 1 64 ? -20.411 7.132   -5.073  1.00 0.00 ? 62 PHE P N    8  
ATOM 9368  C CA   . PHE A 1 64 ? -20.717 6.587   -6.402  1.00 0.00 ? 62 PHE P CA   8  
ATOM 9369  C C    . PHE A 1 64 ? -21.945 7.267   -7.036  1.00 0.00 ? 62 PHE P C    8  
ATOM 9370  O O    . PHE A 1 64 ? -22.948 7.515   -6.360  1.00 0.00 ? 62 PHE P O    8  
ATOM 9371  C CB   . PHE A 1 64 ? -20.900 5.065   -6.296  1.00 0.00 ? 62 PHE P CB   8  
ATOM 9372  C CG   . PHE A 1 64 ? -21.285 4.402   -7.607  1.00 0.00 ? 62 PHE P CG   8  
ATOM 9373  C CD1  . PHE A 1 64 ? -20.326 4.238   -8.625  1.00 0.00 ? 62 PHE P CD1  8  
ATOM 9374  C CD2  . PHE A 1 64 ? -22.612 3.982   -7.823  1.00 0.00 ? 62 PHE P CD2  8  
ATOM 9375  C CE1  . PHE A 1 64 ? -20.693 3.659   -9.854  1.00 0.00 ? 62 PHE P CE1  8  
ATOM 9376  C CE2  . PHE A 1 64 ? -22.976 3.397   -9.049  1.00 0.00 ? 62 PHE P CE2  8  
ATOM 9377  C CZ   . PHE A 1 64 ? -22.018 3.240   -10.067 1.00 0.00 ? 62 PHE P CZ   8  
ATOM 9378  H H    . PHE A 1 64 ? -21.002 6.846   -4.309  1.00 0.00 ? 62 PHE P H    8  
ATOM 9379  H HA   . PHE A 1 64 ? -19.867 6.766   -7.062  1.00 0.00 ? 62 PHE P HA   8  
ATOM 9380  H HB2  . PHE A 1 64 ? -19.968 4.622   -5.942  1.00 0.00 ? 62 PHE P HB2  8  
ATOM 9381  H HB3  . PHE A 1 64 ? -21.669 4.852   -5.553  1.00 0.00 ? 62 PHE P HB3  8  
ATOM 9382  H HD1  . PHE A 1 64 ? -19.306 4.562   -8.467  1.00 0.00 ? 62 PHE P HD1  8  
ATOM 9383  H HD2  . PHE A 1 64 ? -23.357 4.109   -7.049  1.00 0.00 ? 62 PHE P HD2  8  
ATOM 9384  H HE1  . PHE A 1 64 ? -19.956 3.538   -10.637 1.00 0.00 ? 62 PHE P HE1  8  
ATOM 9385  H HE2  . PHE A 1 64 ? -23.995 3.068   -9.209  1.00 0.00 ? 62 PHE P HE2  8  
ATOM 9386  H HZ   . PHE A 1 64 ? -22.300 2.793   -11.012 1.00 0.00 ? 62 PHE P HZ   8  
ATOM 9387  N N    . ILE A 1 65 ? -21.876 7.529   -8.346  1.00 0.00 ? 63 ILE P N    8  
ATOM 9388  C CA   . ILE A 1 65 ? -22.916 8.182   -9.161  1.00 0.00 ? 63 ILE P CA   8  
ATOM 9389  C C    . ILE A 1 65 ? -23.124 7.380   -10.455 1.00 0.00 ? 63 ILE P C    8  
ATOM 9390  O O    . ILE A 1 65 ? -22.158 7.005   -11.125 1.00 0.00 ? 63 ILE P O    8  
ATOM 9391  C CB   . ILE A 1 65 ? -22.521 9.652   -9.464  1.00 0.00 ? 63 ILE P CB   8  
ATOM 9392  C CG1  . ILE A 1 65 ? -22.348 10.524  -8.196  1.00 0.00 ? 63 ILE P CG1  8  
ATOM 9393  C CG2  . ILE A 1 65 ? -23.514 10.329  -10.428 1.00 0.00 ? 63 ILE P CG2  8  
ATOM 9394  C CD1  . ILE A 1 65 ? -23.623 10.785  -7.380  1.00 0.00 ? 63 ILE P CD1  8  
ATOM 9395  H H    . ILE A 1 65 ? -21.050 7.221   -8.841  1.00 0.00 ? 63 ILE P H    8  
ATOM 9396  H HA   . ILE A 1 65 ? -23.858 8.185   -8.614  1.00 0.00 ? 63 ILE P HA   8  
ATOM 9397  H HB   . ILE A 1 65 ? -21.552 9.634   -9.967  1.00 0.00 ? 63 ILE P HB   8  
ATOM 9398  H HG12 . ILE A 1 65 ? -21.607 10.067  -7.541  1.00 0.00 ? 63 ILE P HG12 8  
ATOM 9399  H HG13 . ILE A 1 65 ? -21.942 11.489  -8.499  1.00 0.00 ? 63 ILE P HG13 8  
ATOM 9400  H HG21 . ILE A 1 65 ? -23.457 9.871   -11.416 1.00 0.00 ? 63 ILE P HG21 8  
ATOM 9401  H HG22 . ILE A 1 65 ? -24.535 10.242  -10.053 1.00 0.00 ? 63 ILE P HG22 8  
ATOM 9402  H HG23 . ILE A 1 65 ? -23.263 11.385  -10.539 1.00 0.00 ? 63 ILE P HG23 8  
ATOM 9403  H HD11 . ILE A 1 65 ? -24.087 9.849   -7.076  1.00 0.00 ? 63 ILE P HD11 8  
ATOM 9404  H HD12 . ILE A 1 65 ? -24.335 11.368  -7.965  1.00 0.00 ? 63 ILE P HD12 8  
ATOM 9405  H HD13 . ILE A 1 65 ? -23.364 11.353  -6.485  1.00 0.00 ? 63 ILE P HD13 8  
ATOM 9406  N N    . VAL A 1 66 ? -24.385 7.143   -10.827 1.00 0.00 ? 64 VAL P N    8  
ATOM 9407  C CA   . VAL A 1 66 ? -24.770 6.448   -12.071 1.00 0.00 ? 64 VAL P CA   8  
ATOM 9408  C C    . VAL A 1 66 ? -24.777 7.431   -13.247 1.00 0.00 ? 64 VAL P C    8  
ATOM 9409  O O    . VAL A 1 66 ? -25.364 8.512   -13.155 1.00 0.00 ? 64 VAL P O    8  
ATOM 9410  C CB   . VAL A 1 66 ? -26.142 5.761   -11.923 1.00 0.00 ? 64 VAL P CB   8  
ATOM 9411  C CG1  . VAL A 1 66 ? -26.547 4.996   -13.190 1.00 0.00 ? 64 VAL P CG1  8  
ATOM 9412  C CG2  . VAL A 1 66 ? -26.137 4.755   -10.763 1.00 0.00 ? 64 VAL P CG2  8  
ATOM 9413  H H    . VAL A 1 66 ? -25.126 7.503   -10.243 1.00 0.00 ? 64 VAL P H    8  
ATOM 9414  H HA   . VAL A 1 66 ? -24.034 5.671   -12.278 1.00 0.00 ? 64 VAL P HA   8  
ATOM 9415  H HB   . VAL A 1 66 ? -26.896 6.525   -11.728 1.00 0.00 ? 64 VAL P HB   8  
ATOM 9416  H HG11 . VAL A 1 66 ? -26.713 5.691   -14.013 1.00 0.00 ? 64 VAL P HG11 8  
ATOM 9417  H HG12 . VAL A 1 66 ? -25.772 4.278   -13.464 1.00 0.00 ? 64 VAL P HG12 8  
ATOM 9418  H HG13 . VAL A 1 66 ? -27.481 4.461   -13.016 1.00 0.00 ? 64 VAL P HG13 8  
ATOM 9419  H HG21 . VAL A 1 66 ? -27.118 4.289   -10.672 1.00 0.00 ? 64 VAL P HG21 8  
ATOM 9420  H HG22 . VAL A 1 66 ? -25.389 3.984   -10.947 1.00 0.00 ? 64 VAL P HG22 8  
ATOM 9421  H HG23 . VAL A 1 66 ? -25.911 5.256   -9.821  1.00 0.00 ? 64 VAL P HG23 8  
ATOM 9422  N N    . THR A 1 67 ? -24.146 7.049   -14.360 1.00 0.00 ? 65 THR P N    8  
ATOM 9423  C CA   . THR A 1 67 ? -23.980 7.895   -15.562 1.00 0.00 ? 65 THR P CA   8  
ATOM 9424  C C    . THR A 1 67 ? -24.888 7.507   -16.739 1.00 0.00 ? 65 THR P C    8  
ATOM 9425  O O    . THR A 1 67 ? -24.946 8.226   -17.740 1.00 0.00 ? 65 THR P O    8  
ATOM 9426  C CB   . THR A 1 67 ? -22.509 7.905   -16.013 1.00 0.00 ? 65 THR P CB   8  
ATOM 9427  O OG1  . THR A 1 67 ? -22.033 6.588   -16.233 1.00 0.00 ? 65 THR P OG1  8  
ATOM 9428  C CG2  . THR A 1 67 ? -21.611 8.531   -14.947 1.00 0.00 ? 65 THR P CG2  8  
ATOM 9429  H H    . THR A 1 67 ? -23.640 6.174   -14.348 1.00 0.00 ? 65 THR P H    8  
ATOM 9430  H HA   . THR A 1 67 ? -24.249 8.918   -15.304 1.00 0.00 ? 65 THR P HA   8  
ATOM 9431  H HB   . THR A 1 67 ? -22.410 8.488   -16.930 1.00 0.00 ? 65 THR P HB   8  
ATOM 9432  H HG1  . THR A 1 67 ? -22.365 6.290   -17.099 1.00 0.00 ? 65 THR P HG1  8  
ATOM 9433  H HG21 . THR A 1 67 ? -21.960 9.538   -14.720 1.00 0.00 ? 65 THR P HG21 8  
ATOM 9434  H HG22 . THR A 1 67 ? -20.588 8.586   -15.320 1.00 0.00 ? 65 THR P HG22 8  
ATOM 9435  H HG23 . THR A 1 67 ? -21.630 7.930   -14.038 1.00 0.00 ? 65 THR P HG23 8  
ATOM 9436  N N    . ASP A 1 68 ? -25.601 6.382   -16.629 1.00 0.00 ? 66 ASP P N    8  
ATOM 9437  C CA   . ASP A 1 68 ? -26.558 5.861   -17.625 1.00 0.00 ? 66 ASP P CA   8  
ATOM 9438  C C    . ASP A 1 68 ? -27.844 6.708   -17.761 1.00 0.00 ? 66 ASP P C    8  
ATOM 9439  O O    . ASP A 1 68 ? -28.451 7.074   -16.726 1.00 0.00 ? 66 ASP P O    8  
ATOM 9440  C CB   . ASP A 1 68 ? -26.887 4.393   -17.289 1.00 0.00 ? 66 ASP P CB   8  
ATOM 9441  C CG   . ASP A 1 68 ? -27.828 3.732   -18.323 1.00 0.00 ? 66 ASP P CG   8  
ATOM 9442  O OD1  . ASP A 1 68 ? -27.365 3.407   -19.445 1.00 0.00 ? 66 ASP P OD1  8  
ATOM 9443  O OD2  . ASP A 1 68 ? -29.022 3.498   -18.006 1.00 0.00 ? 66 ASP P OD2  8  
ATOM 9444  O OXT  . ASP A 1 68 ? -28.239 7.006   -18.910 1.00 0.00 ? 66 ASP P OXT  8  
ATOM 9445  H H    . ASP A 1 68 ? -25.490 5.869   -15.767 1.00 0.00 ? 66 ASP P H    8  
ATOM 9446  H HA   . ASP A 1 68 ? -26.069 5.866   -18.601 1.00 0.00 ? 66 ASP P HA   8  
ATOM 9447  H HB2  . ASP A 1 68 ? -25.956 3.825   -17.243 1.00 0.00 ? 66 ASP P HB2  8  
ATOM 9448  H HB3  . ASP A 1 68 ? -27.343 4.351   -16.297 1.00 0.00 ? 66 ASP P HB3  8  
ATOM 9449  N N    . GLY A 1 1  ? 15.647  4.740   23.406  1.00 0.00 ? -1 GLY P N    9  
ATOM 9450  C CA   . GLY A 1 1  ? 15.301  6.034   22.781  1.00 0.00 ? -1 GLY P CA   9  
ATOM 9451  C C    . GLY A 1 1  ? 14.265  5.849   21.684  1.00 0.00 ? -1 GLY P C    9  
ATOM 9452  O O    . GLY A 1 1  ? 14.430  4.989   20.817  1.00 0.00 ? -1 GLY P O    9  
ATOM 9453  H H1   . GLY A 1 1  ? 16.335  4.874   24.130  1.00 0.00 ? -1 GLY P H1   9  
ATOM 9454  H H2   . GLY A 1 1  ? 16.020  4.109   22.714  1.00 0.00 ? -1 GLY P H2   9  
ATOM 9455  H H3   . GLY A 1 1  ? 14.821  4.326   23.812  1.00 0.00 ? -1 GLY P H3   9  
ATOM 9456  H HA2  . GLY A 1 1  ? 14.904  6.710   23.538  1.00 0.00 ? -1 GLY P HA2  9  
ATOM 9457  H HA3  . GLY A 1 1  ? 16.193  6.480   22.341  1.00 0.00 ? -1 GLY P HA3  9  
ATOM 9458  N N    . SER A 1 2  ? 13.196  6.654   21.708  1.00 0.00 ? 0  SER P N    9  
ATOM 9459  C CA   . SER A 1 2  ? 12.105  6.669   20.709  1.00 0.00 ? 0  SER P CA   9  
ATOM 9460  C C    . SER A 1 2  ? 11.405  5.314   20.479  1.00 0.00 ? 0  SER P C    9  
ATOM 9461  O O    . SER A 1 2  ? 10.948  5.022   19.371  1.00 0.00 ? 0  SER P O    9  
ATOM 9462  C CB   . SER A 1 2  ? 12.565  7.332   19.398  1.00 0.00 ? 0  SER P CB   9  
ATOM 9463  O OG   . SER A 1 2  ? 13.096  8.627   19.650  1.00 0.00 ? 0  SER P OG   9  
ATOM 9464  H H    . SER A 1 2  ? 13.154  7.358   22.431  1.00 0.00 ? 0  SER P H    9  
ATOM 9465  H HA   . SER A 1 2  ? 11.327  7.317   21.115  1.00 0.00 ? 0  SER P HA   9  
ATOM 9466  H HB2  . SER A 1 2  ? 13.324  6.709   18.921  1.00 0.00 ? 0  SER P HB2  9  
ATOM 9467  H HB3  . SER A 1 2  ? 11.713  7.425   18.721  1.00 0.00 ? 0  SER P HB3  9  
ATOM 9468  H HG   . SER A 1 2  ? 13.380  9.015   18.799  1.00 0.00 ? 0  SER P HG   9  
ATOM 9469  N N    . GLN A 1 3  ? 11.307  4.478   21.521  1.00 0.00 ? 1  GLN P N    9  
ATOM 9470  C CA   . GLN A 1 3  ? 10.708  3.133   21.471  1.00 0.00 ? 1  GLN P CA   9  
ATOM 9471  C C    . GLN A 1 3  ? 9.212   3.075   21.852  1.00 0.00 ? 1  GLN P C    9  
ATOM 9472  O O    . GLN A 1 3  ? 8.560   2.052   21.632  1.00 0.00 ? 1  GLN P O    9  
ATOM 9473  C CB   . GLN A 1 3  ? 11.564  2.145   22.295  1.00 0.00 ? 1  GLN P CB   9  
ATOM 9474  C CG   . GLN A 1 3  ? 11.430  2.210   23.833  1.00 0.00 ? 1  GLN P CG   9  
ATOM 9475  C CD   . GLN A 1 3  ? 12.090  3.409   24.519  1.00 0.00 ? 1  GLN P CD   9  
ATOM 9476  O OE1  . GLN A 1 3  ? 12.814  4.202   23.931  1.00 0.00 ? 1  GLN P OE1  9  
ATOM 9477  N NE2  . GLN A 1 3  ? 11.878  3.587   25.803  1.00 0.00 ? 1  GLN P NE2  9  
ATOM 9478  H H    . GLN A 1 3  ? 11.774  4.750   22.379  1.00 0.00 ? 1  GLN P H    9  
ATOM 9479  H HA   . GLN A 1 3  ? 10.763  2.787   20.438  1.00 0.00 ? 1  GLN P HA   9  
ATOM 9480  H HB2  . GLN A 1 3  ? 11.271  1.138   21.993  1.00 0.00 ? 1  GLN P HB2  9  
ATOM 9481  H HB3  . GLN A 1 3  ? 12.614  2.259   22.018  1.00 0.00 ? 1  GLN P HB3  9  
ATOM 9482  H HG2  . GLN A 1 3  ? 10.377  2.179   24.111  1.00 0.00 ? 1  GLN P HG2  9  
ATOM 9483  H HG3  . GLN A 1 3  ? 11.892  1.312   24.244  1.00 0.00 ? 1  GLN P HG3  9  
ATOM 9484  H HE21 . GLN A 1 3  ? 11.324  2.930   26.330  1.00 0.00 ? 1  GLN P HE21 9  
ATOM 9485  H HE22 . GLN A 1 3  ? 12.320  4.375   26.254  1.00 0.00 ? 1  GLN P HE22 9  
ATOM 9486  N N    . ARG A 1 4  ? 8.656   4.153   22.429  1.00 0.00 ? 2  ARG P N    9  
ATOM 9487  C CA   . ARG A 1 4  ? 7.269   4.211   22.950  1.00 0.00 ? 2  ARG P CA   9  
ATOM 9488  C C    . ARG A 1 4  ? 6.201   4.475   21.878  1.00 0.00 ? 2  ARG P C    9  
ATOM 9489  O O    . ARG A 1 4  ? 5.031   4.142   22.084  1.00 0.00 ? 2  ARG P O    9  
ATOM 9490  C CB   . ARG A 1 4  ? 7.180   5.267   24.070  1.00 0.00 ? 2  ARG P CB   9  
ATOM 9491  C CG   . ARG A 1 4  ? 8.067   4.987   25.300  1.00 0.00 ? 2  ARG P CG   9  
ATOM 9492  C CD   . ARG A 1 4  ? 7.797   3.644   25.995  1.00 0.00 ? 2  ARG P CD   9  
ATOM 9493  N NE   . ARG A 1 4  ? 6.408   3.538   26.488  1.00 0.00 ? 2  ARG P NE   9  
ATOM 9494  C CZ   . ARG A 1 4  ? 5.832   2.470   27.011  1.00 0.00 ? 2  ARG P CZ   9  
ATOM 9495  N NH1  . ARG A 1 4  ? 6.466   1.340   27.161  1.00 0.00 ? 2  ARG P NH1  9  
ATOM 9496  N NH2  . ARG A 1 4  ? 4.590   2.515   27.399  1.00 0.00 ? 2  ARG P NH2  9  
ATOM 9497  H H    . ARG A 1 4  ? 9.254   4.956   22.577  1.00 0.00 ? 2  ARG P H    9  
ATOM 9498  H HA   . ARG A 1 4  ? 7.006   3.238   23.370  1.00 0.00 ? 2  ARG P HA   9  
ATOM 9499  H HB2  . ARG A 1 4  ? 7.457   6.241   23.661  1.00 0.00 ? 2  ARG P HB2  9  
ATOM 9500  H HB3  . ARG A 1 4  ? 6.144   5.341   24.403  1.00 0.00 ? 2  ARG P HB3  9  
ATOM 9501  H HG2  . ARG A 1 4  ? 9.116   5.016   24.999  1.00 0.00 ? 2  ARG P HG2  9  
ATOM 9502  H HG3  . ARG A 1 4  ? 7.915   5.790   26.025  1.00 0.00 ? 2  ARG P HG3  9  
ATOM 9503  H HD2  . ARG A 1 4  ? 8.010   2.833   25.298  1.00 0.00 ? 2  ARG P HD2  9  
ATOM 9504  H HD3  . ARG A 1 4  ? 8.482   3.553   26.840  1.00 0.00 ? 2  ARG P HD3  9  
ATOM 9505  H HE   . ARG A 1 4  ? 5.840   4.368   26.440  1.00 0.00 ? 2  ARG P HE   9  
ATOM 9506  H HH11 . ARG A 1 4  ? 7.430   1.275   26.884  1.00 0.00 ? 2  ARG P HH11 9  
ATOM 9507  H HH12 . ARG A 1 4  ? 6.003   0.543   27.565  1.00 0.00 ? 2  ARG P HH12 9  
ATOM 9508  H HH21 . ARG A 1 4  ? 4.059   3.366   27.303  1.00 0.00 ? 2  ARG P HH21 9  
ATOM 9509  H HH22 . ARG A 1 4  ? 4.152   1.701   27.799  1.00 0.00 ? 2  ARG P HH22 9  
ATOM 9510  N N    . ARG A 1 5  ? 6.589   5.048   20.733  1.00 0.00 ? 3  ARG P N    9  
ATOM 9511  C CA   . ARG A 1 5  ? 5.710   5.339   19.581  1.00 0.00 ? 3  ARG P CA   9  
ATOM 9512  C C    . ARG A 1 5  ? 5.073   4.072   19.000  1.00 0.00 ? 3  ARG P C    9  
ATOM 9513  O O    . ARG A 1 5  ? 5.719   3.028   18.905  1.00 0.00 ? 3  ARG P O    9  
ATOM 9514  C CB   . ARG A 1 5  ? 6.473   6.158   18.516  1.00 0.00 ? 3  ARG P CB   9  
ATOM 9515  C CG   . ARG A 1 5  ? 7.748   5.470   18.000  1.00 0.00 ? 3  ARG P CG   9  
ATOM 9516  C CD   . ARG A 1 5  ? 8.526   6.359   17.024  1.00 0.00 ? 3  ARG P CD   9  
ATOM 9517  N NE   . ARG A 1 5  ? 9.889   5.831   16.826  1.00 0.00 ? 3  ARG P NE   9  
ATOM 9518  C CZ   . ARG A 1 5  ? 10.697  6.030   15.802  1.00 0.00 ? 3  ARG P CZ   9  
ATOM 9519  N NH1  . ARG A 1 5  ? 10.358  6.756   14.774  1.00 0.00 ? 3  ARG P NH1  9  
ATOM 9520  N NH2  . ARG A 1 5  ? 11.883  5.496   15.801  1.00 0.00 ? 3  ARG P NH2  9  
ATOM 9521  H H    . ARG A 1 5  ? 7.568   5.281   20.659  1.00 0.00 ? 3  ARG P H    9  
ATOM 9522  H HA   . ARG A 1 5  ? 4.891   5.965   19.944  1.00 0.00 ? 3  ARG P HA   9  
ATOM 9523  H HB2  . ARG A 1 5  ? 5.810   6.359   17.672  1.00 0.00 ? 3  ARG P HB2  9  
ATOM 9524  H HB3  . ARG A 1 5  ? 6.749   7.117   18.957  1.00 0.00 ? 3  ARG P HB3  9  
ATOM 9525  H HG2  . ARG A 1 5  ? 8.394   5.243   18.848  1.00 0.00 ? 3  ARG P HG2  9  
ATOM 9526  H HG3  . ARG A 1 5  ? 7.495   4.535   17.499  1.00 0.00 ? 3  ARG P HG3  9  
ATOM 9527  H HD2  . ARG A 1 5  ? 7.982   6.399   16.078  1.00 0.00 ? 3  ARG P HD2  9  
ATOM 9528  H HD3  . ARG A 1 5  ? 8.597   7.369   17.434  1.00 0.00 ? 3  ARG P HD3  9  
ATOM 9529  H HE   . ARG A 1 5  ? 10.279  5.304   17.601  1.00 0.00 ? 3  ARG P HE   9  
ATOM 9530  H HH11 . ARG A 1 5  ? 9.454   7.195   14.760  1.00 0.00 ? 3  ARG P HH11 9  
ATOM 9531  H HH12 . ARG A 1 5  ? 10.997  6.894   14.009  1.00 0.00 ? 3  ARG P HH12 9  
ATOM 9532  H HH21 . ARG A 1 5  ? 12.173  4.914   16.570  1.00 0.00 ? 3  ARG P HH21 9  
ATOM 9533  H HH22 . ARG A 1 5  ? 12.506  5.638   15.023  1.00 0.00 ? 3  ARG P HH22 9  
ATOM 9534  N N    . GLN A 1 6  ? 3.808   4.172   18.588  1.00 0.00 ? 4  GLN P N    9  
ATOM 9535  C CA   . GLN A 1 6  ? 2.973   3.038   18.145  1.00 0.00 ? 4  GLN P CA   9  
ATOM 9536  C C    . GLN A 1 6  ? 2.885   2.883   16.609  1.00 0.00 ? 4  GLN P C    9  
ATOM 9537  O O    . GLN A 1 6  ? 2.205   1.981   16.118  1.00 0.00 ? 4  GLN P O    9  
ATOM 9538  C CB   . GLN A 1 6  ? 1.581   3.155   18.797  1.00 0.00 ? 4  GLN P CB   9  
ATOM 9539  C CG   . GLN A 1 6  ? 1.607   3.142   20.338  1.00 0.00 ? 4  GLN P CG   9  
ATOM 9540  C CD   . GLN A 1 6  ? 2.169   1.842   20.916  1.00 0.00 ? 4  GLN P CD   9  
ATOM 9541  O OE1  . GLN A 1 6  ? 1.617   0.762   20.746  1.00 0.00 ? 4  GLN P OE1  9  
ATOM 9542  N NE2  . GLN A 1 6  ? 3.288   1.878   21.611  1.00 0.00 ? 4  GLN P NE2  9  
ATOM 9543  H H    . GLN A 1 6  ? 3.355   5.070   18.695  1.00 0.00 ? 4  GLN P H    9  
ATOM 9544  H HA   . GLN A 1 6  ? 3.422   2.112   18.504  1.00 0.00 ? 4  GLN P HA   9  
ATOM 9545  H HB2  . GLN A 1 6  ? 1.111   4.082   18.465  1.00 0.00 ? 4  GLN P HB2  9  
ATOM 9546  H HB3  . GLN A 1 6  ? 0.956   2.326   18.460  1.00 0.00 ? 4  GLN P HB3  9  
ATOM 9547  H HG2  . GLN A 1 6  ? 2.184   3.990   20.707  1.00 0.00 ? 4  GLN P HG2  9  
ATOM 9548  H HG3  . GLN A 1 6  ? 0.587   3.263   20.705  1.00 0.00 ? 4  GLN P HG3  9  
ATOM 9549  H HE21 . GLN A 1 6  ? 3.773   2.757   21.774  1.00 0.00 ? 4  GLN P HE21 9  
ATOM 9550  H HE22 . GLN A 1 6  ? 3.640   1.015   21.994  1.00 0.00 ? 4  GLN P HE22 9  
ATOM 9551  N N    . ARG A 1 7  ? 3.576   3.751   15.847  1.00 0.00 ? 5  ARG P N    9  
ATOM 9552  C CA   . ARG A 1 7  ? 3.670   3.764   14.366  1.00 0.00 ? 5  ARG P CA   9  
ATOM 9553  C C    . ARG A 1 7  ? 2.331   3.936   13.612  1.00 0.00 ? 5  ARG P C    9  
ATOM 9554  O O    . ARG A 1 7  ? 2.288   3.731   12.399  1.00 0.00 ? 5  ARG P O    9  
ATOM 9555  C CB   . ARG A 1 7  ? 4.521   2.577   13.846  1.00 0.00 ? 5  ARG P CB   9  
ATOM 9556  C CG   . ARG A 1 7  ? 5.988   2.536   14.327  1.00 0.00 ? 5  ARG P CG   9  
ATOM 9557  C CD   . ARG A 1 7  ? 6.227   1.943   15.726  1.00 0.00 ? 5  ARG P CD   9  
ATOM 9558  N NE   . ARG A 1 7  ? 5.805   0.531   15.816  1.00 0.00 ? 5  ARG P NE   9  
ATOM 9559  C CZ   . ARG A 1 7  ? 5.633   -0.186  16.913  1.00 0.00 ? 5  ARG P CZ   9  
ATOM 9560  N NH1  . ARG A 1 7  ? 5.768   0.310   18.111  1.00 0.00 ? 5  ARG P NH1  9  
ATOM 9561  N NH2  . ARG A 1 7  ? 5.316   -1.446  16.827  1.00 0.00 ? 5  ARG P NH2  9  
ATOM 9562  H H    . ARG A 1 7  ? 4.090   4.466   16.343  1.00 0.00 ? 5  ARG P H    9  
ATOM 9563  H HA   . ARG A 1 7  ? 4.220   4.667   14.098  1.00 0.00 ? 5  ARG P HA   9  
ATOM 9564  H HB2  . ARG A 1 7  ? 4.024   1.636   14.081  1.00 0.00 ? 5  ARG P HB2  9  
ATOM 9565  H HB3  . ARG A 1 7  ? 4.563   2.647   12.759  1.00 0.00 ? 5  ARG P HB3  9  
ATOM 9566  H HG2  . ARG A 1 7  ? 6.558   1.937   13.616  1.00 0.00 ? 5  ARG P HG2  9  
ATOM 9567  H HG3  . ARG A 1 7  ? 6.397   3.547   14.299  1.00 0.00 ? 5  ARG P HG3  9  
ATOM 9568  H HD2  . ARG A 1 7  ? 7.294   2.006   15.946  1.00 0.00 ? 5  ARG P HD2  9  
ATOM 9569  H HD3  . ARG A 1 7  ? 5.703   2.542   16.464  1.00 0.00 ? 5  ARG P HD3  9  
ATOM 9570  H HE   . ARG A 1 7  ? 5.674   0.041   14.945  1.00 0.00 ? 5  ARG P HE   9  
ATOM 9571  H HH11 . ARG A 1 7  ? 5.973   1.297   18.235  1.00 0.00 ? 5  ARG P HH11 9  
ATOM 9572  H HH12 . ARG A 1 7  ? 5.652   -0.273  18.920  1.00 0.00 ? 5  ARG P HH12 9  
ATOM 9573  H HH21 . ARG A 1 7  ? 5.202   -1.880  15.926  1.00 0.00 ? 5  ARG P HH21 9  
ATOM 9574  H HH22 . ARG A 1 7  ? 5.186   -1.996  17.659  1.00 0.00 ? 5  ARG P HH22 9  
ATOM 9575  N N    . THR A 1 8  ? 1.280   4.372   14.318  1.00 0.00 ? 6  THR P N    9  
ATOM 9576  C CA   . THR A 1 8  ? -0.094  4.689   13.857  1.00 0.00 ? 6  THR P CA   9  
ATOM 9577  C C    . THR A 1 8  ? -0.832  3.589   13.060  1.00 0.00 ? 6  THR P C    9  
ATOM 9578  O O    . THR A 1 8  ? -0.281  2.538   12.718  1.00 0.00 ? 6  THR P O    9  
ATOM 9579  C CB   . THR A 1 8  ? -0.157  6.086   13.196  1.00 0.00 ? 6  THR P CB   9  
ATOM 9580  O OG1  . THR A 1 8  ? -1.488  6.556   13.213  1.00 0.00 ? 6  THR P OG1  9  
ATOM 9581  C CG2  . THR A 1 8  ? 0.347   6.174   11.754  1.00 0.00 ? 6  THR P CG2  9  
ATOM 9582  H H    . THR A 1 8  ? 1.456   4.510   15.300  1.00 0.00 ? 6  THR P H    9  
ATOM 9583  H HA   . THR A 1 8  ? -0.682  4.792   14.769  1.00 0.00 ? 6  THR P HA   9  
ATOM 9584  H HB   . THR A 1 8  ? 0.437   6.772   13.803  1.00 0.00 ? 6  THR P HB   9  
ATOM 9585  H HG1  . THR A 1 8  ? -1.479  7.478   12.902  1.00 0.00 ? 6  THR P HG1  9  
ATOM 9586  H HG21 . THR A 1 8  ? 0.129   7.162   11.347  1.00 0.00 ? 6  THR P HG21 9  
ATOM 9587  H HG22 . THR A 1 8  ? -0.128  5.417   11.131  1.00 0.00 ? 6  THR P HG22 9  
ATOM 9588  H HG23 . THR A 1 8  ? 1.426   6.039   11.730  1.00 0.00 ? 6  THR P HG23 9  
ATOM 9589  N N    . HIS A 1 9  ? -2.120  3.815   12.784  1.00 0.00 ? 7  HIS P N    9  
ATOM 9590  C CA   . HIS A 1 9  ? -2.955  2.982   11.907  1.00 0.00 ? 7  HIS P CA   9  
ATOM 9591  C C    . HIS A 1 9  ? -2.706  3.320   10.431  1.00 0.00 ? 7  HIS P C    9  
ATOM 9592  O O    . HIS A 1 9  ? -2.366  2.429   9.651   1.00 0.00 ? 7  HIS P O    9  
ATOM 9593  C CB   . HIS A 1 9  ? -4.436  3.143   12.282  1.00 0.00 ? 7  HIS P CB   9  
ATOM 9594  C CG   . HIS A 1 9  ? -4.749  2.706   13.693  1.00 0.00 ? 7  HIS P CG   9  
ATOM 9595  N ND1  . HIS A 1 9  ? -4.896  3.556   14.795  1.00 0.00 ? 7  HIS P ND1  9  
ATOM 9596  C CD2  . HIS A 1 9  ? -4.920  1.416   14.106  1.00 0.00 ? 7  HIS P CD2  9  
ATOM 9597  C CE1  . HIS A 1 9  ? -5.152  2.756   15.845  1.00 0.00 ? 7  HIS P CE1  9  
ATOM 9598  N NE2  . HIS A 1 9  ? -5.172  1.468   15.460  1.00 0.00 ? 7  HIS P NE2  9  
ATOM 9599  H H    . HIS A 1 9  ? -2.504  4.695   13.111  1.00 0.00 ? 7  HIS P H    9  
ATOM 9600  H HA   . HIS A 1 9  ? -2.694  1.933   12.050  1.00 0.00 ? 7  HIS P HA   9  
ATOM 9601  H HB2  . HIS A 1 9  ? -4.733  4.187   12.162  1.00 0.00 ? 7  HIS P HB2  9  
ATOM 9602  H HB3  . HIS A 1 9  ? -5.038  2.545   11.596  1.00 0.00 ? 7  HIS P HB3  9  
ATOM 9603  H HD2  . HIS A 1 9  ? -4.863  0.531   13.484  1.00 0.00 ? 7  HIS P HD2  9  
ATOM 9604  H HE1  . HIS A 1 9  ? -5.320  3.099   16.861  1.00 0.00 ? 7  HIS P HE1  9  
ATOM 9605  H HE2  . HIS A 1 9  ? -5.346  0.678   16.073  1.00 0.00 ? 7  HIS P HE2  9  
ATOM 9606  N N    . PHE A 1 10 ? -2.811  4.607   10.075  1.00 0.00 ? 8  PHE P N    9  
ATOM 9607  C CA   . PHE A 1 10 ? -2.475  5.163   8.762   1.00 0.00 ? 8  PHE P CA   9  
ATOM 9608  C C    . PHE A 1 10 ? -1.964  6.606   8.884   1.00 0.00 ? 8  PHE P C    9  
ATOM 9609  O O    . PHE A 1 10 ? -2.278  7.306   9.850   1.00 0.00 ? 8  PHE P O    9  
ATOM 9610  C CB   . PHE A 1 10 ? -3.700  5.167   7.839   1.00 0.00 ? 8  PHE P CB   9  
ATOM 9611  C CG   . PHE A 1 10 ? -4.359  3.819   7.644   1.00 0.00 ? 8  PHE P CG   9  
ATOM 9612  C CD1  . PHE A 1 10 ? -3.869  2.934   6.668   1.00 0.00 ? 8  PHE P CD1  9  
ATOM 9613  C CD2  . PHE A 1 10 ? -5.429  3.432   8.475   1.00 0.00 ? 8  PHE P CD2  9  
ATOM 9614  C CE1  . PHE A 1 10 ? -4.436  1.652   6.537   1.00 0.00 ? 8  PHE P CE1  9  
ATOM 9615  C CE2  . PHE A 1 10 ? -5.982  2.146   8.357   1.00 0.00 ? 8  PHE P CE2  9  
ATOM 9616  C CZ   . PHE A 1 10 ? -5.476  1.255   7.397   1.00 0.00 ? 8  PHE P CZ   9  
ATOM 9617  H H    . PHE A 1 10 ? -3.085  5.278   10.777  1.00 0.00 ? 8  PHE P H    9  
ATOM 9618  H HA   . PHE A 1 10 ? -1.696  4.552   8.308   1.00 0.00 ? 8  PHE P HA   9  
ATOM 9619  H HB2  . PHE A 1 10 ? -4.436  5.866   8.239   1.00 0.00 ? 8  PHE P HB2  9  
ATOM 9620  H HB3  . PHE A 1 10 ? -3.378  5.541   6.867   1.00 0.00 ? 8  PHE P HB3  9  
ATOM 9621  H HD1  . PHE A 1 10 ? -3.046  3.235   6.032   1.00 0.00 ? 8  PHE P HD1  9  
ATOM 9622  H HD2  . PHE A 1 10 ? -5.805  4.114   9.226   1.00 0.00 ? 8  PHE P HD2  9  
ATOM 9623  H HE1  . PHE A 1 10 ? -4.063  0.973   5.784   1.00 0.00 ? 8  PHE P HE1  9  
ATOM 9624  H HE2  . PHE A 1 10 ? -6.788  1.840   9.010   1.00 0.00 ? 8  PHE P HE2  9  
ATOM 9625  H HZ   . PHE A 1 10 ? -5.898  0.264   7.319   1.00 0.00 ? 8  PHE P HZ   9  
ATOM 9626  N N    . THR A 1 11 ? -1.234  7.076   7.873   1.00 0.00 ? 9  THR P N    9  
ATOM 9627  C CA   . THR A 1 11 ? -0.788  8.475   7.748   1.00 0.00 ? 9  THR P CA   9  
ATOM 9628  C C    . THR A 1 11 ? -1.694  9.262   6.808   1.00 0.00 ? 9  THR P C    9  
ATOM 9629  O O    . THR A 1 11 ? -2.336  8.696   5.919   1.00 0.00 ? 9  THR P O    9  
ATOM 9630  C CB   . THR A 1 11 ? 0.671   8.606   7.275   1.00 0.00 ? 9  THR P CB   9  
ATOM 9631  O OG1  . THR A 1 11 ? 0.769   8.445   5.875   1.00 0.00 ? 9  THR P OG1  9  
ATOM 9632  C CG2  . THR A 1 11 ? 1.608   7.598   7.934   1.00 0.00 ? 9  THR P CG2  9  
ATOM 9633  H H    . THR A 1 11 ? -1.030  6.447   7.106   1.00 0.00 ? 9  THR P H    9  
ATOM 9634  H HA   . THR A 1 11 ? -0.840  8.950   8.728   1.00 0.00 ? 9  THR P HA   9  
ATOM 9635  H HB   . THR A 1 11 ? 1.019   9.609   7.522   1.00 0.00 ? 9  THR P HB   9  
ATOM 9636  H HG1  . THR A 1 11 ? 1.711   8.530   5.644   1.00 0.00 ? 9  THR P HG1  9  
ATOM 9637  H HG21 . THR A 1 11 ? 1.517   7.671   9.018   1.00 0.00 ? 9  THR P HG21 9  
ATOM 9638  H HG22 . THR A 1 11 ? 2.637   7.808   7.645   1.00 0.00 ? 9  THR P HG22 9  
ATOM 9639  H HG23 . THR A 1 11 ? 1.346   6.589   7.622   1.00 0.00 ? 9  THR P HG23 9  
ATOM 9640  N N    . SER A 1 12 ? -1.677  10.591  6.927   1.00 0.00 ? 10 SER P N    9  
ATOM 9641  C CA   . SER A 1 12 ? -2.414  11.497  6.035   1.00 0.00 ? 10 SER P CA   9  
ATOM 9642  C C    . SER A 1 12 ? -1.992  11.412  4.558   1.00 0.00 ? 10 SER P C    9  
ATOM 9643  O O    . SER A 1 12 ? -2.693  11.961  3.711   1.00 0.00 ? 10 SER P O    9  
ATOM 9644  C CB   . SER A 1 12 ? -2.294  12.944  6.520   1.00 0.00 ? 10 SER P CB   9  
ATOM 9645  O OG   . SER A 1 12 ? -2.555  13.042  7.915   1.00 0.00 ? 10 SER P OG   9  
ATOM 9646  H H    . SER A 1 12 ? -1.173  11.011  7.696   1.00 0.00 ? 10 SER P H    9  
ATOM 9647  H HA   . SER A 1 12 ? -3.468  11.235  6.076   1.00 0.00 ? 10 SER P HA   9  
ATOM 9648  H HB2  . SER A 1 12 ? -1.289  13.313  6.310   1.00 0.00 ? 10 SER P HB2  9  
ATOM 9649  H HB3  . SER A 1 12 ? -3.021  13.548  5.974   1.00 0.00 ? 10 SER P HB3  9  
ATOM 9650  H HG   . SER A 1 12 ? -2.496  13.984  8.174   1.00 0.00 ? 10 SER P HG   9  
ATOM 9651  N N    . GLN A 1 13 ? -0.893  10.713  4.235   1.00 0.00 ? 11 GLN P N    9  
ATOM 9652  C CA   . GLN A 1 13 ? -0.453  10.409  2.867   1.00 0.00 ? 11 GLN P CA   9  
ATOM 9653  C C    . GLN A 1 13 ? -0.898  9.007   2.402   1.00 0.00 ? 11 GLN P C    9  
ATOM 9654  O O    . GLN A 1 13 ? -1.377  8.865   1.277   1.00 0.00 ? 11 GLN P O    9  
ATOM 9655  C CB   . GLN A 1 13 ? 1.072   10.590  2.791   1.00 0.00 ? 11 GLN P CB   9  
ATOM 9656  C CG   . GLN A 1 13 ? 1.594   10.537  1.348   1.00 0.00 ? 11 GLN P CG   9  
ATOM 9657  C CD   . GLN A 1 13 ? 3.101   10.785  1.280   1.00 0.00 ? 11 GLN P CD   9  
ATOM 9658  O OE1  . GLN A 1 13 ? 3.909   9.866   1.217   1.00 0.00 ? 11 GLN P OE1  9  
ATOM 9659  N NE2  . GLN A 1 13 ? 3.543   12.026  1.303   1.00 0.00 ? 11 GLN P NE2  9  
ATOM 9660  H H    . GLN A 1 13 ? -0.367  10.292  4.990   1.00 0.00 ? 11 GLN P H    9  
ATOM 9661  H HA   . GLN A 1 13 ? -0.901  11.133  2.185   1.00 0.00 ? 11 GLN P HA   9  
ATOM 9662  H HB2  . GLN A 1 13 ? 1.331   11.561  3.217   1.00 0.00 ? 11 GLN P HB2  9  
ATOM 9663  H HB3  . GLN A 1 13 ? 1.562   9.814   3.381   1.00 0.00 ? 11 GLN P HB3  9  
ATOM 9664  H HG2  . GLN A 1 13 ? 1.382   9.560   0.914   1.00 0.00 ? 11 GLN P HG2  9  
ATOM 9665  H HG3  . GLN A 1 13 ? 1.082   11.294  0.753   1.00 0.00 ? 11 GLN P HG3  9  
ATOM 9666  H HE21 . GLN A 1 13 ? 2.896   12.799  1.357   1.00 0.00 ? 11 GLN P HE21 9  
ATOM 9667  H HE22 . GLN A 1 13 ? 4.539   12.181  1.262   1.00 0.00 ? 11 GLN P HE22 9  
ATOM 9668  N N    . GLN A 1 14 ? -0.817  7.979   3.258   1.00 0.00 ? 12 GLN P N    9  
ATOM 9669  C CA   . GLN A 1 14 ? -1.239  6.603   2.925   1.00 0.00 ? 12 GLN P CA   9  
ATOM 9670  C C    . GLN A 1 14 ? -2.727  6.539   2.565   1.00 0.00 ? 12 GLN P C    9  
ATOM 9671  O O    . GLN A 1 14 ? -3.119  5.901   1.587   1.00 0.00 ? 12 GLN P O    9  
ATOM 9672  C CB   . GLN A 1 14 ? -0.986  5.681   4.126   1.00 0.00 ? 12 GLN P CB   9  
ATOM 9673  C CG   . GLN A 1 14 ? 0.502   5.430   4.361   1.00 0.00 ? 12 GLN P CG   9  
ATOM 9674  C CD   . GLN A 1 14 ? 0.756   4.624   5.631   1.00 0.00 ? 12 GLN P CD   9  
ATOM 9675  O OE1  . GLN A 1 14 ? 0.016   4.674   6.603   1.00 0.00 ? 12 GLN P OE1  9  
ATOM 9676  N NE2  . GLN A 1 14 ? 1.814   3.852   5.663   1.00 0.00 ? 12 GLN P NE2  9  
ATOM 9677  H H    . GLN A 1 14 ? -0.467  8.156   4.194   1.00 0.00 ? 12 GLN P H    9  
ATOM 9678  H HA   . GLN A 1 14 ? -0.665  6.236   2.073   1.00 0.00 ? 12 GLN P HA   9  
ATOM 9679  H HB2  . GLN A 1 14 ? -1.440  6.121   5.016   1.00 0.00 ? 12 GLN P HB2  9  
ATOM 9680  H HB3  . GLN A 1 14 ? -1.447  4.710   3.941   1.00 0.00 ? 12 GLN P HB3  9  
ATOM 9681  H HG2  . GLN A 1 14 ? 0.896   4.890   3.502   1.00 0.00 ? 12 GLN P HG2  9  
ATOM 9682  H HG3  . GLN A 1 14 ? 1.036   6.373   4.440   1.00 0.00 ? 12 GLN P HG3  9  
ATOM 9683  H HE21 . GLN A 1 14 ? 2.331   3.716   4.802   1.00 0.00 ? 12 GLN P HE21 9  
ATOM 9684  H HE22 . GLN A 1 14 ? 1.972   3.266   6.464   1.00 0.00 ? 12 GLN P HE22 9  
ATOM 9685  N N    . LEU A 1 15 ? -3.547  7.267   3.328   1.00 0.00 ? 13 LEU P N    9  
ATOM 9686  C CA   . LEU A 1 15 ? -4.994  7.397   3.126   1.00 0.00 ? 13 LEU P CA   9  
ATOM 9687  C C    . LEU A 1 15 ? -5.366  7.927   1.730   1.00 0.00 ? 13 LEU P C    9  
ATOM 9688  O O    . LEU A 1 15 ? -6.401  7.544   1.185   1.00 0.00 ? 13 LEU P O    9  
ATOM 9689  C CB   . LEU A 1 15 ? -5.533  8.339   4.213   1.00 0.00 ? 13 LEU P CB   9  
ATOM 9690  C CG   . LEU A 1 15 ? -5.401  7.779   5.645   1.00 0.00 ? 13 LEU P CG   9  
ATOM 9691  C CD1  . LEU A 1 15 ? -5.611  8.890   6.667   1.00 0.00 ? 13 LEU P CD1  9  
ATOM 9692  C CD2  . LEU A 1 15 ? -6.392  6.649   5.900   1.00 0.00 ? 13 LEU P CD2  9  
ATOM 9693  H H    . LEU A 1 15 ? -3.134  7.735   4.130   1.00 0.00 ? 13 LEU P H    9  
ATOM 9694  H HA   . LEU A 1 15 ? -5.466  6.423   3.232   1.00 0.00 ? 13 LEU P HA   9  
ATOM 9695  H HB2  . LEU A 1 15 ? -4.991  9.285   4.147   1.00 0.00 ? 13 LEU P HB2  9  
ATOM 9696  H HB3  . LEU A 1 15 ? -6.583  8.543   3.994   1.00 0.00 ? 13 LEU P HB3  9  
ATOM 9697  H HG   . LEU A 1 15 ? -4.408  7.369   5.807   1.00 0.00 ? 13 LEU P HG   9  
ATOM 9698  H HD11 . LEU A 1 15 ? -6.617  9.299   6.583   1.00 0.00 ? 13 LEU P HD11 9  
ATOM 9699  H HD12 . LEU A 1 15 ? -5.446  8.496   7.669   1.00 0.00 ? 13 LEU P HD12 9  
ATOM 9700  H HD13 . LEU A 1 15 ? -4.880  9.680   6.489   1.00 0.00 ? 13 LEU P HD13 9  
ATOM 9701  H HD21 . LEU A 1 15 ? -6.111  5.794   5.287   1.00 0.00 ? 13 LEU P HD21 9  
ATOM 9702  H HD22 . LEU A 1 15 ? -6.341  6.347   6.945   1.00 0.00 ? 13 LEU P HD22 9  
ATOM 9703  H HD23 . LEU A 1 15 ? -7.402  6.983   5.666   1.00 0.00 ? 13 LEU P HD23 9  
ATOM 9704  N N    . GLN A 1 16 ? -4.508  8.760   1.133   1.00 0.00 ? 14 GLN P N    9  
ATOM 9705  C CA   . GLN A 1 16 ? -4.717  9.306   -0.215  1.00 0.00 ? 14 GLN P CA   9  
ATOM 9706  C C    . GLN A 1 16 ? -4.539  8.226   -1.288  1.00 0.00 ? 14 GLN P C    9  
ATOM 9707  O O    . GLN A 1 16 ? -5.329  8.152   -2.226  1.00 0.00 ? 14 GLN P O    9  
ATOM 9708  C CB   . GLN A 1 16 ? -3.764  10.481  -0.503  1.00 0.00 ? 14 GLN P CB   9  
ATOM 9709  C CG   . GLN A 1 16 ? -3.672  11.530  0.612   1.00 0.00 ? 14 GLN P CG   9  
ATOM 9710  C CD   . GLN A 1 16 ? -5.009  12.138  1.030   1.00 0.00 ? 14 GLN P CD   9  
ATOM 9711  O OE1  . GLN A 1 16 ? -5.926  12.339  0.245   1.00 0.00 ? 14 GLN P OE1  9  
ATOM 9712  N NE2  . GLN A 1 16 ? -5.157  12.467  2.295   1.00 0.00 ? 14 GLN P NE2  9  
ATOM 9713  H H    . GLN A 1 16 ? -3.646  8.974   1.613   1.00 0.00 ? 14 GLN P H    9  
ATOM 9714  H HA   . GLN A 1 16 ? -5.740  9.675   -0.285  1.00 0.00 ? 14 GLN P HA   9  
ATOM 9715  H HB2  . GLN A 1 16 ? -2.759  10.092  -0.669  1.00 0.00 ? 14 GLN P HB2  9  
ATOM 9716  H HB3  . GLN A 1 16 ? -4.086  10.968  -1.423  1.00 0.00 ? 14 GLN P HB3  9  
ATOM 9717  H HG2  . GLN A 1 16 ? -3.212  11.055  1.474   1.00 0.00 ? 14 GLN P HG2  9  
ATOM 9718  H HG3  . GLN A 1 16 ? -3.010  12.335  0.291   1.00 0.00 ? 14 GLN P HG3  9  
ATOM 9719  H HE21 . GLN A 1 16 ? -4.378  12.318  2.929   1.00 0.00 ? 14 GLN P HE21 9  
ATOM 9720  H HE22 . GLN A 1 16 ? -6.023  12.885  2.595   1.00 0.00 ? 14 GLN P HE22 9  
ATOM 9721  N N    . GLU A 1 17 ? -3.536  7.355   -1.140  1.00 0.00 ? 15 GLU P N    9  
ATOM 9722  C CA   . GLU A 1 17 ? -3.284  6.250   -2.075  1.00 0.00 ? 15 GLU P CA   9  
ATOM 9723  C C    . GLU A 1 17 ? -4.339  5.143   -1.952  1.00 0.00 ? 15 GLU P C    9  
ATOM 9724  O O    . GLU A 1 17 ? -4.723  4.534   -2.952  1.00 0.00 ? 15 GLU P O    9  
ATOM 9725  C CB   . GLU A 1 17 ? -1.869  5.683   -1.873  1.00 0.00 ? 15 GLU P CB   9  
ATOM 9726  C CG   . GLU A 1 17 ? -0.751  6.738   -1.929  1.00 0.00 ? 15 GLU P CG   9  
ATOM 9727  C CD   . GLU A 1 17 ? -0.803  7.652   -3.176  1.00 0.00 ? 15 GLU P CD   9  
ATOM 9728  O OE1  . GLU A 1 17 ? -1.096  7.167   -4.295  1.00 0.00 ? 15 GLU P OE1  9  
ATOM 9729  O OE2  . GLU A 1 17 ? -0.526  8.868   -3.045  1.00 0.00 ? 15 GLU P OE2  9  
ATOM 9730  H H    . GLU A 1 17 ? -2.939  7.442   -0.326  1.00 0.00 ? 15 GLU P H    9  
ATOM 9731  H HA   . GLU A 1 17 ? -3.354  6.625   -3.093  1.00 0.00 ? 15 GLU P HA   9  
ATOM 9732  H HB2  . GLU A 1 17 ? -1.821  5.185   -0.904  1.00 0.00 ? 15 GLU P HB2  9  
ATOM 9733  H HB3  . GLU A 1 17 ? -1.684  4.931   -2.640  1.00 0.00 ? 15 GLU P HB3  9  
ATOM 9734  H HG2  . GLU A 1 17 ? -0.808  7.346   -1.025  1.00 0.00 ? 15 GLU P HG2  9  
ATOM 9735  H HG3  . GLU A 1 17 ? 0.209   6.221   -1.900  1.00 0.00 ? 15 GLU P HG3  9  
ATOM 9736  N N    . LEU A 1 18 ? -4.865  4.936   -0.740  1.00 0.00 ? 16 LEU P N    9  
ATOM 9737  C CA   . LEU A 1 18 ? -5.977  4.029   -0.467  1.00 0.00 ? 16 LEU P CA   9  
ATOM 9738  C C    . LEU A 1 18 ? -7.275  4.512   -1.133  1.00 0.00 ? 16 LEU P C    9  
ATOM 9739  O O    . LEU A 1 18 ? -7.887  3.758   -1.889  1.00 0.00 ? 16 LEU P O    9  
ATOM 9740  C CB   . LEU A 1 18 ? -6.121  3.882   1.055   1.00 0.00 ? 16 LEU P CB   9  
ATOM 9741  C CG   . LEU A 1 18 ? -4.996  3.036   1.681   1.00 0.00 ? 16 LEU P CG   9  
ATOM 9742  C CD1  . LEU A 1 18 ? -4.856  3.338   3.168   1.00 0.00 ? 16 LEU P CD1  9  
ATOM 9743  C CD2  . LEU A 1 18 ? -5.285  1.545   1.515   1.00 0.00 ? 16 LEU P CD2  9  
ATOM 9744  H H    . LEU A 1 18 ? -4.477  5.458   0.037   1.00 0.00 ? 16 LEU P H    9  
ATOM 9745  H HA   . LEU A 1 18 ? -5.751  3.050   -0.894  1.00 0.00 ? 16 LEU P HA   9  
ATOM 9746  H HB2  . LEU A 1 18 ? -6.132  4.873   1.504   1.00 0.00 ? 16 LEU P HB2  9  
ATOM 9747  H HB3  . LEU A 1 18 ? -7.076  3.411   1.272   1.00 0.00 ? 16 LEU P HB3  9  
ATOM 9748  H HG   . LEU A 1 18 ? -4.042  3.262   1.204   1.00 0.00 ? 16 LEU P HG   9  
ATOM 9749  H HD11 . LEU A 1 18 ? -4.064  2.726   3.595   1.00 0.00 ? 16 LEU P HD11 9  
ATOM 9750  H HD12 . LEU A 1 18 ? -4.598  4.387   3.298   1.00 0.00 ? 16 LEU P HD12 9  
ATOM 9751  H HD13 . LEU A 1 18 ? -5.792  3.129   3.677   1.00 0.00 ? 16 LEU P HD13 9  
ATOM 9752  H HD21 . LEU A 1 18 ? -6.241  1.295   1.973   1.00 0.00 ? 16 LEU P HD21 9  
ATOM 9753  H HD22 . LEU A 1 18 ? -5.316  1.298   0.454   1.00 0.00 ? 16 LEU P HD22 9  
ATOM 9754  H HD23 . LEU A 1 18 ? -4.495  0.965   1.990   1.00 0.00 ? 16 LEU P HD23 9  
ATOM 9755  N N    . GLU A 1 19 ? -7.671  5.778   -0.956  1.00 0.00 ? 17 GLU P N    9  
ATOM 9756  C CA   . GLU A 1 19 ? -8.865  6.297   -1.645  1.00 0.00 ? 17 GLU P CA   9  
ATOM 9757  C C    . GLU A 1 19 ? -8.680  6.571   -3.147  1.00 0.00 ? 17 GLU P C    9  
ATOM 9758  O O    . GLU A 1 19 ? -9.670  6.629   -3.876  1.00 0.00 ? 17 GLU P O    9  
ATOM 9759  C CB   . GLU A 1 19 ? -9.513  7.460   -0.888  1.00 0.00 ? 17 GLU P CB   9  
ATOM 9760  C CG   . GLU A 1 19 ? -8.883  8.851   -1.043  1.00 0.00 ? 17 GLU P CG   9  
ATOM 9761  C CD   . GLU A 1 19 ? -9.753  9.941   -0.372  1.00 0.00 ? 17 GLU P CD   9  
ATOM 9762  O OE1  . GLU A 1 19 ? -10.605 9.620   0.497   1.00 0.00 ? 17 GLU P OE1  9  
ATOM 9763  O OE2  . GLU A 1 19 ? -9.612  11.133  -0.737  1.00 0.00 ? 17 GLU P OE2  9  
ATOM 9764  H H    . GLU A 1 19 ? -7.195  6.353   -0.265  1.00 0.00 ? 17 GLU P H    9  
ATOM 9765  H HA   . GLU A 1 19 ? -9.608  5.501   -1.609  1.00 0.00 ? 17 GLU P HA   9  
ATOM 9766  H HB2  . GLU A 1 19 ? -10.542 7.524   -1.239  1.00 0.00 ? 17 GLU P HB2  9  
ATOM 9767  H HB3  . GLU A 1 19 ? -9.523  7.204   0.168   1.00 0.00 ? 17 GLU P HB3  9  
ATOM 9768  H HG2  . GLU A 1 19 ? -7.887  8.847   -0.600  1.00 0.00 ? 17 GLU P HG2  9  
ATOM 9769  H HG3  . GLU A 1 19 ? -8.782  9.077   -2.107  1.00 0.00 ? 17 GLU P HG3  9  
ATOM 9770  N N    . ALA A 1 20 ? -7.440  6.667   -3.634  1.00 0.00 ? 18 ALA P N    9  
ATOM 9771  C CA   . ALA A 1 20 ? -7.133  6.705   -5.067  1.00 0.00 ? 18 ALA P CA   9  
ATOM 9772  C C    . ALA A 1 20 ? -7.244  5.314   -5.719  1.00 0.00 ? 18 ALA P C    9  
ATOM 9773  O O    . ALA A 1 20 ? -7.910  5.173   -6.746  1.00 0.00 ? 18 ALA P O    9  
ATOM 9774  C CB   . ALA A 1 20 ? -5.747  7.324   -5.281  1.00 0.00 ? 18 ALA P CB   9  
ATOM 9775  H H    . ALA A 1 20 ? -6.678  6.729   -2.969  1.00 0.00 ? 18 ALA P H    9  
ATOM 9776  H HA   . ALA A 1 20 ? -7.861  7.349   -5.565  1.00 0.00 ? 18 ALA P HA   9  
ATOM 9777  H HB1  . ALA A 1 20 ? -5.728  8.338   -4.878  1.00 0.00 ? 18 ALA P HB1  9  
ATOM 9778  H HB2  . ALA A 1 20 ? -4.984  6.722   -4.788  1.00 0.00 ? 18 ALA P HB2  9  
ATOM 9779  H HB3  . ALA A 1 20 ? -5.528  7.369   -6.348  1.00 0.00 ? 18 ALA P HB3  9  
ATOM 9780  N N    . THR A 1 21 ? -6.669  4.263   -5.119  1.00 0.00 ? 19 THR P N    9  
ATOM 9781  C CA   . THR A 1 21 ? -6.784  2.893   -5.663  1.00 0.00 ? 19 THR P CA   9  
ATOM 9782  C C    . THR A 1 21 ? -8.202  2.325   -5.519  1.00 0.00 ? 19 THR P C    9  
ATOM 9783  O O    . THR A 1 21 ? -8.633  1.525   -6.350  1.00 0.00 ? 19 THR P O    9  
ATOM 9784  C CB   . THR A 1 21 ? -5.710  1.957   -5.089  1.00 0.00 ? 19 THR P CB   9  
ATOM 9785  O OG1  . THR A 1 21 ? -5.542  0.865   -5.972  1.00 0.00 ? 19 THR P OG1  9  
ATOM 9786  C CG2  . THR A 1 21 ? -6.039  1.387   -3.711  1.00 0.00 ? 19 THR P CG2  9  
ATOM 9787  H H    . THR A 1 21 ? -6.111  4.415   -4.283  1.00 0.00 ? 19 THR P H    9  
ATOM 9788  H HA   . THR A 1 21 ? -6.583  2.960   -6.731  1.00 0.00 ? 19 THR P HA   9  
ATOM 9789  H HB   . THR A 1 21 ? -4.768  2.503   -5.035  1.00 0.00 ? 19 THR P HB   9  
ATOM 9790  H HG1  . THR A 1 21 ? -6.329  0.297   -5.882  1.00 0.00 ? 19 THR P HG1  9  
ATOM 9791  H HG21 . THR A 1 21 ? -6.479  2.158   -3.090  1.00 0.00 ? 19 THR P HG21 9  
ATOM 9792  H HG22 . THR A 1 21 ? -5.127  1.061   -3.219  1.00 0.00 ? 19 THR P HG22 9  
ATOM 9793  H HG23 . THR A 1 21 ? -6.727  0.546   -3.804  1.00 0.00 ? 19 THR P HG23 9  
ATOM 9794  N N    . PHE A 1 22 ? -8.975  2.815   -4.542  1.00 0.00 ? 20 PHE P N    9  
ATOM 9795  C CA   . PHE A 1 22 ? -10.410 2.548   -4.386  1.00 0.00 ? 20 PHE P CA   9  
ATOM 9796  C C    . PHE A 1 22 ? -11.200 2.904   -5.655  1.00 0.00 ? 20 PHE P C    9  
ATOM 9797  O O    . PHE A 1 22 ? -12.156 2.211   -5.995  1.00 0.00 ? 20 PHE P O    9  
ATOM 9798  C CB   . PHE A 1 22 ? -10.933 3.314   -3.156  1.00 0.00 ? 20 PHE P CB   9  
ATOM 9799  C CG   . PHE A 1 22 ? -12.411 3.134   -2.840  1.00 0.00 ? 20 PHE P CG   9  
ATOM 9800  C CD1  . PHE A 1 22 ? -13.382 3.897   -3.519  1.00 0.00 ? 20 PHE P CD1  9  
ATOM 9801  C CD2  . PHE A 1 22 ? -12.825 2.225   -1.846  1.00 0.00 ? 20 PHE P CD2  9  
ATOM 9802  C CE1  . PHE A 1 22 ? -14.749 3.736   -3.226  1.00 0.00 ? 20 PHE P CE1  9  
ATOM 9803  C CE2  . PHE A 1 22 ? -14.191 2.058   -1.555  1.00 0.00 ? 20 PHE P CE2  9  
ATOM 9804  C CZ   . PHE A 1 22 ? -15.154 2.812   -2.246  1.00 0.00 ? 20 PHE P CZ   9  
ATOM 9805  H H    . PHE A 1 22 ? -8.534  3.421   -3.866  1.00 0.00 ? 20 PHE P H    9  
ATOM 9806  H HA   . PHE A 1 22 ? -10.549 1.485   -4.201  1.00 0.00 ? 20 PHE P HA   9  
ATOM 9807  H HB2  . PHE A 1 22 ? -10.363 2.991   -2.286  1.00 0.00 ? 20 PHE P HB2  9  
ATOM 9808  H HB3  . PHE A 1 22 ? -10.734 4.376   -3.285  1.00 0.00 ? 20 PHE P HB3  9  
ATOM 9809  H HD1  . PHE A 1 22 ? -13.080 4.603   -4.277  1.00 0.00 ? 20 PHE P HD1  9  
ATOM 9810  H HD2  . PHE A 1 22 ? -12.094 1.656   -1.295  1.00 0.00 ? 20 PHE P HD2  9  
ATOM 9811  H HE1  . PHE A 1 22 ? -15.489 4.316   -3.759  1.00 0.00 ? 20 PHE P HE1  9  
ATOM 9812  H HE2  . PHE A 1 22 ? -14.502 1.350   -0.798  1.00 0.00 ? 20 PHE P HE2  9  
ATOM 9813  H HZ   . PHE A 1 22 ? -16.206 2.684   -2.026  1.00 0.00 ? 20 PHE P HZ   9  
ATOM 9814  N N    . GLN A 1 23 ? -10.780 3.934   -6.405  1.00 0.00 ? 21 GLN P N    9  
ATOM 9815  C CA   . GLN A 1 23 ? -11.472 4.363   -7.627  1.00 0.00 ? 21 GLN P CA   9  
ATOM 9816  C C    . GLN A 1 23 ? -11.365 3.339   -8.771  1.00 0.00 ? 21 GLN P C    9  
ATOM 9817  O O    . GLN A 1 23 ? -12.335 3.147   -9.509  1.00 0.00 ? 21 GLN P O    9  
ATOM 9818  C CB   . GLN A 1 23 ? -10.933 5.723   -8.110  1.00 0.00 ? 21 GLN P CB   9  
ATOM 9819  C CG   . GLN A 1 23 ? -10.938 6.859   -7.079  1.00 0.00 ? 21 GLN P CG   9  
ATOM 9820  C CD   . GLN A 1 23 ? -12.265 7.023   -6.345  1.00 0.00 ? 21 GLN P CD   9  
ATOM 9821  O OE1  . GLN A 1 23 ? -13.338 7.106   -6.931  1.00 0.00 ? 21 GLN P OE1  9  
ATOM 9822  N NE2  . GLN A 1 23 ? -12.242 7.064   -5.033  1.00 0.00 ? 21 GLN P NE2  9  
ATOM 9823  H H    . GLN A 1 23 ? -9.959  4.449   -6.111  1.00 0.00 ? 21 GLN P H    9  
ATOM 9824  H HA   . GLN A 1 23 ? -12.529 4.467   -7.384  1.00 0.00 ? 21 GLN P HA   9  
ATOM 9825  H HB2  . GLN A 1 23 ? -9.903  5.587   -8.430  1.00 0.00 ? 21 GLN P HB2  9  
ATOM 9826  H HB3  . GLN A 1 23 ? -11.520 6.038   -8.974  1.00 0.00 ? 21 GLN P HB3  9  
ATOM 9827  H HG2  . GLN A 1 23 ? -10.147 6.673   -6.358  1.00 0.00 ? 21 GLN P HG2  9  
ATOM 9828  H HG3  . GLN A 1 23 ? -10.700 7.797   -7.580  1.00 0.00 ? 21 GLN P HG3  9  
ATOM 9829  H HE21 . GLN A 1 23 ? -11.352 6.982   -4.545  1.00 0.00 ? 21 GLN P HE21 9  
ATOM 9830  H HE22 . GLN A 1 23 ? -13.111 7.159   -4.541  1.00 0.00 ? 21 GLN P HE22 9  
ATOM 9831  N N    . ARG A 1 24 ? -10.211 2.663   -8.912  1.00 0.00 ? 22 ARG P N    9  
ATOM 9832  C CA   . ARG A 1 24 ? -9.997  1.591   -9.909  1.00 0.00 ? 22 ARG P CA   9  
ATOM 9833  C C    . ARG A 1 24 ? -10.441 0.210   -9.412  1.00 0.00 ? 22 ARG P C    9  
ATOM 9834  O O    . ARG A 1 24 ? -10.787 -0.648  -10.224 1.00 0.00 ? 22 ARG P O    9  
ATOM 9835  C CB   . ARG A 1 24 ? -8.536  1.569   -10.414 1.00 0.00 ? 22 ARG P CB   9  
ATOM 9836  C CG   . ARG A 1 24 ? -7.495  1.226   -9.336  1.00 0.00 ? 22 ARG P CG   9  
ATOM 9837  C CD   . ARG A 1 24 ? -6.112  0.893   -9.910  1.00 0.00 ? 22 ARG P CD   9  
ATOM 9838  N NE   . ARG A 1 24 ? -5.214  0.472   -8.819  1.00 0.00 ? 22 ARG P NE   9  
ATOM 9839  C CZ   . ARG A 1 24 ? -4.324  -0.503  -8.805  1.00 0.00 ? 22 ARG P CZ   9  
ATOM 9840  N NH1  . ARG A 1 24 ? -3.975  -1.201  -9.843  1.00 0.00 ? 22 ARG P NH1  9  
ATOM 9841  N NH2  . ARG A 1 24 ? -3.745  -0.829  -7.694  1.00 0.00 ? 22 ARG P NH2  9  
ATOM 9842  H H    . ARG A 1 24 ? -9.470  2.870   -8.254  1.00 0.00 ? 22 ARG P H    9  
ATOM 9843  H HA   . ARG A 1 24 ? -10.625 1.800   -10.778 1.00 0.00 ? 22 ARG P HA   9  
ATOM 9844  H HB2  . ARG A 1 24 ? -8.470  0.824   -11.209 1.00 0.00 ? 22 ARG P HB2  9  
ATOM 9845  H HB3  . ARG A 1 24 ? -8.293  2.541   -10.846 1.00 0.00 ? 22 ARG P HB3  9  
ATOM 9846  H HG2  . ARG A 1 24 ? -7.399  2.075   -8.660  1.00 0.00 ? 22 ARG P HG2  9  
ATOM 9847  H HG3  . ARG A 1 24 ? -7.827  0.360   -8.768  1.00 0.00 ? 22 ARG P HG3  9  
ATOM 9848  H HD2  . ARG A 1 24 ? -6.221  0.091   -10.642 1.00 0.00 ? 22 ARG P HD2  9  
ATOM 9849  H HD3  . ARG A 1 24 ? -5.703  1.774   -10.409 1.00 0.00 ? 22 ARG P HD3  9  
ATOM 9850  H HE   . ARG A 1 24 ? -5.351  0.916   -7.919  1.00 0.00 ? 22 ARG P HE   9  
ATOM 9851  H HH11 . ARG A 1 24 ? -4.357  -1.001  -10.749 1.00 0.00 ? 22 ARG P HH11 9  
ATOM 9852  H HH12 . ARG A 1 24 ? -3.286  -1.938  -9.694  1.00 0.00 ? 22 ARG P HH12 9  
ATOM 9853  H HH21 . ARG A 1 24 ? -4.018  -0.366  -6.837  1.00 0.00 ? 22 ARG P HH21 9  
ATOM 9854  H HH22 . ARG A 1 24 ? -3.083  -1.602  -7.721  1.00 0.00 ? 22 ARG P HH22 9  
ATOM 9855  N N    . ASN A 1 25 ? -10.424 -0.005  -8.095  1.00 0.00 ? 23 ASN P N    9  
ATOM 9856  C CA   . ASN A 1 25 ? -10.679 -1.293  -7.457  1.00 0.00 ? 23 ASN P CA   9  
ATOM 9857  C C    . ASN A 1 25 ? -11.458 -1.109  -6.143  1.00 0.00 ? 23 ASN P C    9  
ATOM 9858  O O    . ASN A 1 25 ? -10.884 -0.754  -5.116  1.00 0.00 ? 23 ASN P O    9  
ATOM 9859  C CB   . ASN A 1 25 ? -9.321  -1.987  -7.228  1.00 0.00 ? 23 ASN P CB   9  
ATOM 9860  C CG   . ASN A 1 25 ? -9.472  -3.450  -6.851  1.00 0.00 ? 23 ASN P CG   9  
ATOM 9861  O OD1  . ASN A 1 25 ? -10.538 -3.932  -6.491  1.00 0.00 ? 23 ASN P OD1  9  
ATOM 9862  N ND2  . ASN A 1 25 ? -8.405  -4.208  -6.952  1.00 0.00 ? 23 ASN P ND2  9  
ATOM 9863  H H    . ASN A 1 25 ? -10.088 0.745   -7.504  1.00 0.00 ? 23 ASN P H    9  
ATOM 9864  H HA   . ASN A 1 25 ? -11.278 -1.919  -8.122  1.00 0.00 ? 23 ASN P HA   9  
ATOM 9865  H HB2  . ASN A 1 25 ? -8.724  -1.929  -8.137  1.00 0.00 ? 23 ASN P HB2  9  
ATOM 9866  H HB3  . ASN A 1 25 ? -8.766  -1.470  -6.441  1.00 0.00 ? 23 ASN P HB3  9  
ATOM 9867  H HD21 . ASN A 1 25 ? -7.535  -3.815  -7.271  1.00 0.00 ? 23 ASN P HD21 9  
ATOM 9868  H HD22 . ASN A 1 25 ? -8.491  -5.189  -6.736  1.00 0.00 ? 23 ASN P HD22 9  
ATOM 9869  N N    . HIS A 1 26 ? -12.767 -1.376  -6.164  1.00 0.00 ? 24 HIS P N    9  
ATOM 9870  C CA   . HIS A 1 26 ? -13.652 -1.213  -5.000  1.00 0.00 ? 24 HIS P CA   9  
ATOM 9871  C C    . HIS A 1 26 ? -13.580 -2.398  -4.016  1.00 0.00 ? 24 HIS P C    9  
ATOM 9872  O O    . HIS A 1 26 ? -14.160 -2.330  -2.929  1.00 0.00 ? 24 HIS P O    9  
ATOM 9873  C CB   . HIS A 1 26 ? -15.095 -0.975  -5.490  1.00 0.00 ? 24 HIS P CB   9  
ATOM 9874  C CG   . HIS A 1 26 ? -15.371 0.399   -6.069  1.00 0.00 ? 24 HIS P CG   9  
ATOM 9875  N ND1  . HIS A 1 26 ? -16.379 1.262   -5.626  1.00 0.00 ? 24 HIS P ND1  9  
ATOM 9876  C CD2  . HIS A 1 26 ? -14.726 0.991   -7.120  1.00 0.00 ? 24 HIS P CD2  9  
ATOM 9877  C CE1  . HIS A 1 26 ? -16.303 2.356   -6.404  1.00 0.00 ? 24 HIS P CE1  9  
ATOM 9878  N NE2  . HIS A 1 26 ? -15.321 2.218   -7.311  1.00 0.00 ? 24 HIS P NE2  9  
ATOM 9879  H H    . HIS A 1 26 ? -13.176 -1.707  -7.025  1.00 0.00 ? 24 HIS P H    9  
ATOM 9880  H HA   . HIS A 1 26 ? -13.345 -0.329  -4.436  1.00 0.00 ? 24 HIS P HA   9  
ATOM 9881  H HB2  . HIS A 1 26 ? -15.353 -1.727  -6.235  1.00 0.00 ? 24 HIS P HB2  9  
ATOM 9882  H HB3  . HIS A 1 26 ? -15.773 -1.109  -4.646  1.00 0.00 ? 24 HIS P HB3  9  
ATOM 9883  H HD2  . HIS A 1 26 ? -13.886 0.594   -7.675  1.00 0.00 ? 24 HIS P HD2  9  
ATOM 9884  H HE1  . HIS A 1 26 ? -16.940 3.228   -6.316  1.00 0.00 ? 24 HIS P HE1  9  
ATOM 9885  H HE2  . HIS A 1 26 ? -15.062 2.910   -8.005  1.00 0.00 ? 24 HIS P HE2  9  
ATOM 9886  N N    . TYR A 1 27 ? -12.902 -3.491  -4.380  1.00 0.00 ? 25 TYR P N    9  
ATOM 9887  C CA   . TYR A 1 27 ? -12.833 -4.742  -3.609  1.00 0.00 ? 25 TYR P CA   9  
ATOM 9888  C C    . TYR A 1 27 ? -11.511 -5.512  -3.869  1.00 0.00 ? 25 TYR P C    9  
ATOM 9889  O O    . TYR A 1 27 ? -11.527 -6.610  -4.437  1.00 0.00 ? 25 TYR P O    9  
ATOM 9890  C CB   . TYR A 1 27 ? -14.110 -5.579  -3.868  1.00 0.00 ? 25 TYR P CB   9  
ATOM 9891  C CG   . TYR A 1 27 ? -14.601 -5.654  -5.310  1.00 0.00 ? 25 TYR P CG   9  
ATOM 9892  C CD1  . TYR A 1 27 ? -14.154 -6.672  -6.176  1.00 0.00 ? 25 TYR P CD1  9  
ATOM 9893  C CD2  . TYR A 1 27 ? -15.530 -4.702  -5.780  1.00 0.00 ? 25 TYR P CD2  9  
ATOM 9894  C CE1  . TYR A 1 27 ? -14.604 -6.721  -7.510  1.00 0.00 ? 25 TYR P CE1  9  
ATOM 9895  C CE2  . TYR A 1 27 ? -15.980 -4.745  -7.114  1.00 0.00 ? 25 TYR P CE2  9  
ATOM 9896  C CZ   . TYR A 1 27 ? -15.516 -5.753  -7.985  1.00 0.00 ? 25 TYR P CZ   9  
ATOM 9897  O OH   . TYR A 1 27 ? -15.957 -5.790  -9.273  1.00 0.00 ? 25 TYR P OH   9  
ATOM 9898  H H    . TYR A 1 27 ? -12.423 -3.476  -5.272  1.00 0.00 ? 25 TYR P H    9  
ATOM 9899  H HA   . TYR A 1 27 ? -12.832 -4.492  -2.549  1.00 0.00 ? 25 TYR P HA   9  
ATOM 9900  H HB2  . TYR A 1 27 ? -13.966 -6.589  -3.482  1.00 0.00 ? 25 TYR P HB2  9  
ATOM 9901  H HB3  . TYR A 1 27 ? -14.913 -5.144  -3.271  1.00 0.00 ? 25 TYR P HB3  9  
ATOM 9902  H HD1  . TYR A 1 27 ? -13.460 -7.421  -5.819  1.00 0.00 ? 25 TYR P HD1  9  
ATOM 9903  H HD2  . TYR A 1 27 ? -15.898 -3.933  -5.114  1.00 0.00 ? 25 TYR P HD2  9  
ATOM 9904  H HE1  . TYR A 1 27 ? -14.251 -7.500  -8.171  1.00 0.00 ? 25 TYR P HE1  9  
ATOM 9905  H HE2  . TYR A 1 27 ? -16.685 -4.010  -7.477  1.00 0.00 ? 25 TYR P HE2  9  
ATOM 9906  H HH   . TYR A 1 27 ? -15.573 -6.530  -9.773  1.00 0.00 ? 25 TYR P HH   9  
ATOM 9907  N N    . PRO A 1 28 ? -10.344 -4.958  -3.478  1.00 0.00 ? 26 PRO P N    9  
ATOM 9908  C CA   . PRO A 1 28 ? -9.043  -5.575  -3.731  1.00 0.00 ? 26 PRO P CA   9  
ATOM 9909  C C    . PRO A 1 28 ? -8.841  -6.889  -2.960  1.00 0.00 ? 26 PRO P C    9  
ATOM 9910  O O    . PRO A 1 28 ? -9.395  -7.108  -1.878  1.00 0.00 ? 26 PRO P O    9  
ATOM 9911  C CB   . PRO A 1 28 ? -8.001  -4.510  -3.373  1.00 0.00 ? 26 PRO P CB   9  
ATOM 9912  C CG   . PRO A 1 28 ? -8.708  -3.703  -2.288  1.00 0.00 ? 26 PRO P CG   9  
ATOM 9913  C CD   . PRO A 1 28 ? -10.163 -3.705  -2.758  1.00 0.00 ? 26 PRO P CD   9  
ATOM 9914  H HA   . PRO A 1 28 ? -8.956  -5.800  -4.793  1.00 0.00 ? 26 PRO P HA   9  
ATOM 9915  H HB2  . PRO A 1 28 ? -7.063  -4.938  -3.029  1.00 0.00 ? 26 PRO P HB2  9  
ATOM 9916  H HB3  . PRO A 1 28 ? -7.821  -3.872  -4.238  1.00 0.00 ? 26 PRO P HB3  9  
ATOM 9917  H HG2  . PRO A 1 28 ? -8.631  -4.225  -1.333  1.00 0.00 ? 26 PRO P HG2  9  
ATOM 9918  H HG3  . PRO A 1 28 ? -8.303  -2.696  -2.213  1.00 0.00 ? 26 PRO P HG3  9  
ATOM 9919  H HD2  . PRO A 1 28 ? -10.832 -3.639  -1.899  1.00 0.00 ? 26 PRO P HD2  9  
ATOM 9920  H HD3  . PRO A 1 28 ? -10.329 -2.868  -3.435  1.00 0.00 ? 26 PRO P HD3  9  
ATOM 9921  N N    . ASP A 1 29 ? -8.006  -7.754  -3.527  1.00 0.00 ? 27 ASP P N    9  
ATOM 9922  C CA   . ASP A 1 29 ? -7.755  -9.142  -3.110  1.00 0.00 ? 27 ASP P CA   9  
ATOM 9923  C C    . ASP A 1 29 ? -6.323  -9.300  -2.577  1.00 0.00 ? 27 ASP P C    9  
ATOM 9924  O O    . ASP A 1 29 ? -5.545  -8.353  -2.631  1.00 0.00 ? 27 ASP P O    9  
ATOM 9925  C CB   . ASP A 1 29 ? -8.027  -10.069 -4.310  1.00 0.00 ? 27 ASP P CB   9  
ATOM 9926  C CG   . ASP A 1 29 ? -8.104  -11.569 -3.963  1.00 0.00 ? 27 ASP P CG   9  
ATOM 9927  O OD1  . ASP A 1 29 ? -8.277  -11.920 -2.772  1.00 0.00 ? 27 ASP P OD1  9  
ATOM 9928  O OD2  . ASP A 1 29 ? -7.982  -12.402 -4.891  1.00 0.00 ? 27 ASP P OD2  9  
ATOM 9929  H H    . ASP A 1 29 ? -7.449  -7.398  -4.302  1.00 0.00 ? 27 ASP P H    9  
ATOM 9930  H HA   . ASP A 1 29 ? -8.442  -9.407  -2.311  1.00 0.00 ? 27 ASP P HA   9  
ATOM 9931  H HB2  . ASP A 1 29 ? -8.976  -9.785  -4.756  1.00 0.00 ? 27 ASP P HB2  9  
ATOM 9932  H HB3  . ASP A 1 29 ? -7.245  -9.910  -5.055  1.00 0.00 ? 27 ASP P HB3  9  
ATOM 9933  N N    . MET A 1 30 ? -5.926  -10.480 -2.099  1.00 0.00 ? 28 MET P N    9  
ATOM 9934  C CA   . MET A 1 30 ? -4.581  -10.716 -1.545  1.00 0.00 ? 28 MET P CA   9  
ATOM 9935  C C    . MET A 1 30 ? -3.431  -10.269 -2.470  1.00 0.00 ? 28 MET P C    9  
ATOM 9936  O O    . MET A 1 30 ? -2.364  -9.894  -1.987  1.00 0.00 ? 28 MET P O    9  
ATOM 9937  C CB   . MET A 1 30 ? -4.408  -12.195 -1.168  1.00 0.00 ? 28 MET P CB   9  
ATOM 9938  C CG   . MET A 1 30 ? -4.440  -13.149 -2.374  1.00 0.00 ? 28 MET P CG   9  
ATOM 9939  S SD   . MET A 1 30 ? -3.838  -14.824 -2.039  1.00 0.00 ? 28 MET P SD   9  
ATOM 9940  C CE   . MET A 1 30 ? -2.052  -14.484 -2.050  1.00 0.00 ? 28 MET P CE   9  
ATOM 9941  H H    . MET A 1 30 ? -6.607  -11.236 -2.097  1.00 0.00 ? 28 MET P H    9  
ATOM 9942  H HA   . MET A 1 30 ? -4.491  -10.129 -0.630  1.00 0.00 ? 28 MET P HA   9  
ATOM 9943  H HB2  . MET A 1 30 ? -3.449  -12.302 -0.659  1.00 0.00 ? 28 MET P HB2  9  
ATOM 9944  H HB3  . MET A 1 30 ? -5.189  -12.485 -0.465  1.00 0.00 ? 28 MET P HB3  9  
ATOM 9945  H HG2  . MET A 1 30 ? -5.461  -13.203 -2.748  1.00 0.00 ? 28 MET P HG2  9  
ATOM 9946  H HG3  . MET A 1 30 ? -3.825  -12.753 -3.179  1.00 0.00 ? 28 MET P HG3  9  
ATOM 9947  H HE1  . MET A 1 30 ? -1.776  -13.987 -2.983  1.00 0.00 ? 28 MET P HE1  9  
ATOM 9948  H HE2  . MET A 1 30 ? -1.790  -13.836 -1.214  1.00 0.00 ? 28 MET P HE2  9  
ATOM 9949  H HE3  . MET A 1 30 ? -1.499  -15.420 -1.963  1.00 0.00 ? 28 MET P HE3  9  
ATOM 9950  N N    . SER A 1 31 ? -3.647  -10.270 -3.792  1.00 0.00 ? 29 SER P N    9  
ATOM 9951  C CA   . SER A 1 31 ? -2.653  -9.835  -4.782  1.00 0.00 ? 29 SER P CA   9  
ATOM 9952  C C    . SER A 1 31 ? -2.668  -8.313  -4.988  1.00 0.00 ? 29 SER P C    9  
ATOM 9953  O O    . SER A 1 31 ? -1.613  -7.677  -5.019  1.00 0.00 ? 29 SER P O    9  
ATOM 9954  C CB   . SER A 1 31 ? -2.889  -10.542 -6.124  1.00 0.00 ? 29 SER P CB   9  
ATOM 9955  O OG   . SER A 1 31 ? -2.875  -11.955 -5.970  1.00 0.00 ? 29 SER P OG   9  
ATOM 9956  H H    . SER A 1 31 ? -4.547  -10.586 -4.120  1.00 0.00 ? 29 SER P H    9  
ATOM 9957  H HA   . SER A 1 31 ? -1.665  -10.124 -4.422  1.00 0.00 ? 29 SER P HA   9  
ATOM 9958  H HB2  . SER A 1 31 ? -3.857  -10.239 -6.527  1.00 0.00 ? 29 SER P HB2  9  
ATOM 9959  H HB3  . SER A 1 31 ? -2.111  -10.245 -6.831  1.00 0.00 ? 29 SER P HB3  9  
ATOM 9960  H HG   . SER A 1 31 ? -1.958  -12.240 -5.797  1.00 0.00 ? 29 SER P HG   9  
ATOM 9961  N N    . THR A 1 32 ? -3.855  -7.705  -5.097  1.00 0.00 ? 30 THR P N    9  
ATOM 9962  C CA   . THR A 1 32 ? -4.023  -6.259  -5.333  1.00 0.00 ? 30 THR P CA   9  
ATOM 9963  C C    . THR A 1 32 ? -3.854  -5.420  -4.067  1.00 0.00 ? 30 THR P C    9  
ATOM 9964  O O    . THR A 1 32 ? -3.278  -4.339  -4.130  1.00 0.00 ? 30 THR P O    9  
ATOM 9965  C CB   . THR A 1 32 ? -5.354  -5.924  -6.028  1.00 0.00 ? 30 THR P CB   9  
ATOM 9966  O OG1  . THR A 1 32 ? -6.375  -6.842  -5.709  1.00 0.00 ? 30 THR P OG1  9  
ATOM 9967  C CG2  . THR A 1 32 ? -5.201  -5.948  -7.547  1.00 0.00 ? 30 THR P CG2  9  
ATOM 9968  H H    . THR A 1 32 ? -4.697  -8.256  -4.990  1.00 0.00 ? 30 THR P H    9  
ATOM 9969  H HA   . THR A 1 32 ? -3.232  -5.936  -6.005  1.00 0.00 ? 30 THR P HA   9  
ATOM 9970  H HB   . THR A 1 32 ? -5.680  -4.930  -5.721  1.00 0.00 ? 30 THR P HB   9  
ATOM 9971  H HG1  . THR A 1 32 ? -6.434  -7.475  -6.445  1.00 0.00 ? 30 THR P HG1  9  
ATOM 9972  H HG21 . THR A 1 32 ? -6.164  -5.768  -8.023  1.00 0.00 ? 30 THR P HG21 9  
ATOM 9973  H HG22 . THR A 1 32 ? -4.812  -6.915  -7.871  1.00 0.00 ? 30 THR P HG22 9  
ATOM 9974  H HG23 . THR A 1 32 ? -4.507  -5.166  -7.856  1.00 0.00 ? 30 THR P HG23 9  
ATOM 9975  N N    . ARG A 1 33 ? -4.257  -5.919  -2.896  1.00 0.00 ? 31 ARG P N    9  
ATOM 9976  C CA   . ARG A 1 33 ? -3.963  -5.303  -1.592  1.00 0.00 ? 31 ARG P CA   9  
ATOM 9977  C C    . ARG A 1 33 ? -2.459  -5.196  -1.336  1.00 0.00 ? 31 ARG P C    9  
ATOM 9978  O O    . ARG A 1 33 ? -1.980  -4.138  -0.943  1.00 0.00 ? 31 ARG P O    9  
ATOM 9979  C CB   . ARG A 1 33 ? -4.626  -6.113  -0.467  1.00 0.00 ? 31 ARG P CB   9  
ATOM 9980  C CG   . ARG A 1 33 ? -6.157  -5.971  -0.466  1.00 0.00 ? 31 ARG P CG   9  
ATOM 9981  C CD   . ARG A 1 33 ? -6.806  -6.558  0.790   1.00 0.00 ? 31 ARG P CD   9  
ATOM 9982  N NE   . ARG A 1 33 ? -6.581  -8.008  0.933   1.00 0.00 ? 31 ARG P NE   9  
ATOM 9983  C CZ   . ARG A 1 33 ? -7.437  -8.995  0.759   1.00 0.00 ? 31 ARG P CZ   9  
ATOM 9984  N NH1  . ARG A 1 33 ? -8.628  -8.843  0.258   1.00 0.00 ? 31 ARG P NH1  9  
ATOM 9985  N NH2  . ARG A 1 33 ? -7.067  -10.189 1.103   1.00 0.00 ? 31 ARG P NH2  9  
ATOM 9986  H H    . ARG A 1 33 ? -4.788  -6.784  -2.913  1.00 0.00 ? 31 ARG P H    9  
ATOM 9987  H HA   . ARG A 1 33 ? -4.352  -4.285  -1.601  1.00 0.00 ? 31 ARG P HA   9  
ATOM 9988  H HB2  . ARG A 1 33 ? -4.346  -7.164  -0.577  1.00 0.00 ? 31 ARG P HB2  9  
ATOM 9989  H HB3  . ARG A 1 33 ? -4.246  -5.758  0.490   1.00 0.00 ? 31 ARG P HB3  9  
ATOM 9990  H HG2  . ARG A 1 33 ? -6.410  -4.913  -0.511  1.00 0.00 ? 31 ARG P HG2  9  
ATOM 9991  H HG3  . ARG A 1 33 ? -6.576  -6.458  -1.340  1.00 0.00 ? 31 ARG P HG3  9  
ATOM 9992  H HD2  . ARG A 1 33 ? -6.377  -6.056  1.654   1.00 0.00 ? 31 ARG P HD2  9  
ATOM 9993  H HD3  . ARG A 1 33 ? -7.875  -6.338  0.769   1.00 0.00 ? 31 ARG P HD3  9  
ATOM 9994  H HE   . ARG A 1 33 ? -5.687  -8.309  1.316   1.00 0.00 ? 31 ARG P HE   9  
ATOM 9995  H HH11 . ARG A 1 33 ? -8.880  -7.969  -0.188  1.00 0.00 ? 31 ARG P HH11 9  
ATOM 9996  H HH12 . ARG A 1 33 ? -9.249  -9.629  0.178   1.00 0.00 ? 31 ARG P HH12 9  
ATOM 9997  H HH21 . ARG A 1 33 ? -6.126  -10.279 1.492   1.00 0.00 ? 31 ARG P HH21 9  
ATOM 9998  H HH22 . ARG A 1 33 ? -7.667  -10.985 0.982   1.00 0.00 ? 31 ARG P HH22 9  
ATOM 9999  N N    . GLU A 1 34 ? -1.700  -6.259  -1.608  1.00 0.00 ? 32 GLU P N    9  
ATOM 10000 C CA   . GLU A 1 34 ? -0.233  -6.215  -1.557  1.00 0.00 ? 32 GLU P CA   9  
ATOM 10001 C C    . GLU A 1 34 ? 0.337   -5.212  -2.570  1.00 0.00 ? 32 GLU P C    9  
ATOM 10002 O O    . GLU A 1 34 ? 1.202   -4.416  -2.214  1.00 0.00 ? 32 GLU P O    9  
ATOM 10003 C CB   . GLU A 1 34 ? 0.373   -7.604  -1.818  1.00 0.00 ? 32 GLU P CB   9  
ATOM 10004 C CG   . GLU A 1 34 ? 0.240   -8.535  -0.606  1.00 0.00 ? 32 GLU P CG   9  
ATOM 10005 C CD   . GLU A 1 34 ? 0.877   -9.930  -0.813  1.00 0.00 ? 32 GLU P CD   9  
ATOM 10006 O OE1  . GLU A 1 34 ? 1.510   -10.199 -1.865  1.00 0.00 ? 32 GLU P OE1  9  
ATOM 10007 O OE2  . GLU A 1 34 ? 0.782   -10.773 0.113   1.00 0.00 ? 32 GLU P OE2  9  
ATOM 10008 H H    . GLU A 1 34 ? -2.154  -7.110  -1.896  1.00 0.00 ? 32 GLU P H    9  
ATOM 10009 H HA   . GLU A 1 34 ? 0.073   -5.876  -0.565  1.00 0.00 ? 32 GLU P HA   9  
ATOM 10010 H HB2  . GLU A 1 34 ? -0.106  -8.054  -2.688  1.00 0.00 ? 32 GLU P HB2  9  
ATOM 10011 H HB3  . GLU A 1 34 ? 1.435   -7.477  -2.032  1.00 0.00 ? 32 GLU P HB3  9  
ATOM 10012 H HG2  . GLU A 1 34 ? 0.717   -8.048  0.245   1.00 0.00 ? 32 GLU P HG2  9  
ATOM 10013 H HG3  . GLU A 1 34 ? -0.817  -8.652  -0.368  1.00 0.00 ? 32 GLU P HG3  9  
ATOM 10014 N N    . GLU A 1 35 ? -0.181  -5.190  -3.802  1.00 0.00 ? 33 GLU P N    9  
ATOM 10015 C CA   . GLU A 1 35 ? 0.286   -4.286  -4.869  1.00 0.00 ? 33 GLU P CA   9  
ATOM 10016 C C    . GLU A 1 35 ? 0.280   -2.809  -4.448  1.00 0.00 ? 33 GLU P C    9  
ATOM 10017 O O    . GLU A 1 35 ? 1.208   -2.086  -4.809  1.00 0.00 ? 33 GLU P O    9  
ATOM 10018 C CB   . GLU A 1 35 ? -0.562  -4.490  -6.142  1.00 0.00 ? 33 GLU P CB   9  
ATOM 10019 C CG   . GLU A 1 35 ? -0.164  -3.600  -7.331  1.00 0.00 ? 33 GLU P CG   9  
ATOM 10020 C CD   . GLU A 1 35 ? -1.162  -3.747  -8.494  1.00 0.00 ? 33 GLU P CD   9  
ATOM 10021 O OE1  . GLU A 1 35 ? -0.982  -4.646  -9.350  1.00 0.00 ? 33 GLU P OE1  9  
ATOM 10022 O OE2  . GLU A 1 35 ? -2.126  -2.943  -8.564  1.00 0.00 ? 33 GLU P OE2  9  
ATOM 10023 H H    . GLU A 1 35 ? -0.877  -5.890  -4.030  1.00 0.00 ? 33 GLU P H    9  
ATOM 10024 H HA   . GLU A 1 35 ? 1.325   -4.540  -5.089  1.00 0.00 ? 33 GLU P HA   9  
ATOM 10025 H HB2  . GLU A 1 35 ? -0.493  -5.533  -6.452  1.00 0.00 ? 33 GLU P HB2  9  
ATOM 10026 H HB3  . GLU A 1 35 ? -1.600  -4.270  -5.914  1.00 0.00 ? 33 GLU P HB3  9  
ATOM 10027 H HG2  . GLU A 1 35 ? -0.152  -2.553  -7.023  1.00 0.00 ? 33 GLU P HG2  9  
ATOM 10028 H HG3  . GLU A 1 35 ? 0.845   -3.864  -7.653  1.00 0.00 ? 33 GLU P HG3  9  
ATOM 10029 N N    . ILE A 1 36 ? -0.709  -2.356  -3.666  1.00 0.00 ? 34 ILE P N    9  
ATOM 10030 C CA   . ILE A 1 36 ? -0.758  -0.969  -3.163  1.00 0.00 ? 34 ILE P CA   9  
ATOM 10031 C C    . ILE A 1 36 ? 0.059   -0.797  -1.875  1.00 0.00 ? 34 ILE P C    9  
ATOM 10032 O O    . ILE A 1 36 ? 0.655   0.257   -1.655  1.00 0.00 ? 34 ILE P O    9  
ATOM 10033 C CB   . ILE A 1 36 ? -2.210  -0.429  -3.060  1.00 0.00 ? 34 ILE P CB   9  
ATOM 10034 C CG1  . ILE A 1 36 ? -2.946  -0.730  -1.736  1.00 0.00 ? 34 ILE P CG1  9  
ATOM 10035 C CG2  . ILE A 1 36 ? -3.063  -0.951  -4.230  1.00 0.00 ? 34 ILE P CG2  9  
ATOM 10036 C CD1  . ILE A 1 36 ? -2.744  0.354   -0.668  1.00 0.00 ? 34 ILE P CD1  9  
ATOM 10037 H H    . ILE A 1 36 ? -1.467  -2.987  -3.436  1.00 0.00 ? 34 ILE P H    9  
ATOM 10038 H HA   . ILE A 1 36 ? -0.275  -0.337  -3.907  1.00 0.00 ? 34 ILE P HA   9  
ATOM 10039 H HB   . ILE A 1 36 ? -2.159  0.656   -3.163  1.00 0.00 ? 34 ILE P HB   9  
ATOM 10040 H HG12 . ILE A 1 36 ? -4.019  -0.796  -1.920  1.00 0.00 ? 34 ILE P HG12 9  
ATOM 10041 H HG13 . ILE A 1 36 ? -2.618  -1.692  -1.350  1.00 0.00 ? 34 ILE P HG13 9  
ATOM 10042 H HG21 . ILE A 1 36 ? -3.380  -1.973  -4.027  1.00 0.00 ? 34 ILE P HG21 9  
ATOM 10043 H HG22 . ILE A 1 36 ? -3.956  -0.347  -4.341  1.00 0.00 ? 34 ILE P HG22 9  
ATOM 10044 H HG23 . ILE A 1 36 ? -2.493  -0.915  -5.159  1.00 0.00 ? 34 ILE P HG23 9  
ATOM 10045 H HD11 . ILE A 1 36 ? -3.284  0.063   0.229   1.00 0.00 ? 34 ILE P HD11 9  
ATOM 10046 H HD12 . ILE A 1 36 ? -3.136  1.308   -1.026  1.00 0.00 ? 34 ILE P HD12 9  
ATOM 10047 H HD13 . ILE A 1 36 ? -1.697  0.472   -0.407  1.00 0.00 ? 34 ILE P HD13 9  
ATOM 10048 N N    . ALA A 1 37 ? 0.135   -1.834  -1.035  1.00 0.00 ? 35 ALA P N    9  
ATOM 10049 C CA   . ALA A 1 37 ? 0.842   -1.803  0.248   1.00 0.00 ? 35 ALA P CA   9  
ATOM 10050 C C    . ALA A 1 37 ? 2.372   -1.713  0.080   1.00 0.00 ? 35 ALA P C    9  
ATOM 10051 O O    . ALA A 1 37 ? 3.075   -1.132  0.913   1.00 0.00 ? 35 ALA P O    9  
ATOM 10052 C CB   . ALA A 1 37 ? 0.446   -3.059  1.033   1.00 0.00 ? 35 ALA P CB   9  
ATOM 10053 H H    . ALA A 1 37 ? -0.309  -2.702  -1.305  1.00 0.00 ? 35 ALA P H    9  
ATOM 10054 H HA   . ALA A 1 37 ? 0.508   -0.933  0.806   1.00 0.00 ? 35 ALA P HA   9  
ATOM 10055 H HB1  . ALA A 1 37 ? -0.631  -3.086  1.182   1.00 0.00 ? 35 ALA P HB1  9  
ATOM 10056 H HB2  . ALA A 1 37 ? 0.760   -3.952  0.495   1.00 0.00 ? 35 ALA P HB2  9  
ATOM 10057 H HB3  . ALA A 1 37 ? 0.930   -3.051  2.004   1.00 0.00 ? 35 ALA P HB3  9  
ATOM 10058 N N    . VAL A 1 38 ? 2.872   -2.264  -1.029  1.00 0.00 ? 36 VAL P N    9  
ATOM 10059 C CA   . VAL A 1 38 ? 4.289   -2.467  -1.362  1.00 0.00 ? 36 VAL P CA   9  
ATOM 10060 C C    . VAL A 1 38 ? 5.104   -1.172  -1.455  1.00 0.00 ? 36 VAL P C    9  
ATOM 10061 O O    . VAL A 1 38 ? 6.290   -1.175  -1.119  1.00 0.00 ? 36 VAL P O    9  
ATOM 10062 C CB   . VAL A 1 38 ? 4.332   -3.302  -2.668  1.00 0.00 ? 36 VAL P CB   9  
ATOM 10063 C CG1  . VAL A 1 38 ? 5.498   -3.035  -3.622  1.00 0.00 ? 36 VAL P CG1  9  
ATOM 10064 C CG2  . VAL A 1 38 ? 4.323   -4.796  -2.329  1.00 0.00 ? 36 VAL P CG2  9  
ATOM 10065 H H    . VAL A 1 38 ? 2.198   -2.711  -1.646  1.00 0.00 ? 36 VAL P H    9  
ATOM 10066 H HA   . VAL A 1 38 ? 4.741   -3.039  -0.553  1.00 0.00 ? 36 VAL P HA   9  
ATOM 10067 H HB   . VAL A 1 38 ? 3.430   -3.086  -3.243  1.00 0.00 ? 36 VAL P HB   9  
ATOM 10068 H HG11 . VAL A 1 38 ? 6.449   -3.214  -3.121  1.00 0.00 ? 36 VAL P HG11 9  
ATOM 10069 H HG12 . VAL A 1 38 ? 5.408   -3.692  -4.487  1.00 0.00 ? 36 VAL P HG12 9  
ATOM 10070 H HG13 . VAL A 1 38 ? 5.451   -2.006  -3.981  1.00 0.00 ? 36 VAL P HG13 9  
ATOM 10071 H HG21 . VAL A 1 38 ? 4.122   -5.375  -3.231  1.00 0.00 ? 36 VAL P HG21 9  
ATOM 10072 H HG22 . VAL A 1 38 ? 5.283   -5.093  -1.906  1.00 0.00 ? 36 VAL P HG22 9  
ATOM 10073 H HG23 . VAL A 1 38 ? 3.539   -5.011  -1.604  1.00 0.00 ? 36 VAL P HG23 9  
ATOM 10074 N N    . TRP A 1 39 ? 4.482   -0.061  -1.857  1.00 0.00 ? 37 TRP P N    9  
ATOM 10075 C CA   . TRP A 1 39 ? 5.122   1.258   -1.999  1.00 0.00 ? 37 TRP P CA   9  
ATOM 10076 C C    . TRP A 1 39 ? 4.548   2.324   -1.053  1.00 0.00 ? 37 TRP P C    9  
ATOM 10077 O O    . TRP A 1 39 ? 4.928   3.495   -1.128  1.00 0.00 ? 37 TRP P O    9  
ATOM 10078 C CB   . TRP A 1 39 ? 5.094   1.689   -3.472  1.00 0.00 ? 37 TRP P CB   9  
ATOM 10079 C CG   . TRP A 1 39 ? 3.773   1.535   -4.152  1.00 0.00 ? 37 TRP P CG   9  
ATOM 10080 C CD1  . TRP A 1 39 ? 3.321   0.393   -4.708  1.00 0.00 ? 37 TRP P CD1  9  
ATOM 10081 C CD2  . TRP A 1 39 ? 2.698   2.506   -4.306  1.00 0.00 ? 37 TRP P CD2  9  
ATOM 10082 N NE1  . TRP A 1 39 ? 2.030   0.570   -5.144  1.00 0.00 ? 37 TRP P NE1  9  
ATOM 10083 C CE2  . TRP A 1 39 ? 1.583   1.854   -4.916  1.00 0.00 ? 37 TRP P CE2  9  
ATOM 10084 C CE3  . TRP A 1 39 ? 2.553   3.867   -3.973  1.00 0.00 ? 37 TRP P CE3  9  
ATOM 10085 C CZ2  . TRP A 1 39 ? 0.367   2.514   -5.152  1.00 0.00 ? 37 TRP P CZ2  9  
ATOM 10086 C CZ3  . TRP A 1 39 ? 1.344   4.545   -4.225  1.00 0.00 ? 37 TRP P CZ3  9  
ATOM 10087 C CH2  . TRP A 1 39 ? 0.251   3.872   -4.801  1.00 0.00 ? 37 TRP P CH2  9  
ATOM 10088 H H    . TRP A 1 39 ? 3.510   -0.132  -2.129  1.00 0.00 ? 37 TRP P H    9  
ATOM 10089 H HA   . TRP A 1 39 ? 6.166   1.168   -1.718  1.00 0.00 ? 37 TRP P HA   9  
ATOM 10090 H HB2  . TRP A 1 39 ? 5.417   2.725   -3.549  1.00 0.00 ? 37 TRP P HB2  9  
ATOM 10091 H HB3  . TRP A 1 39 ? 5.818   1.091   -4.018  1.00 0.00 ? 37 TRP P HB3  9  
ATOM 10092 H HD1  . TRP A 1 39 ? 3.868   -0.542  -4.745  1.00 0.00 ? 37 TRP P HD1  9  
ATOM 10093 H HE1  . TRP A 1 39 ? 1.473   -0.222  -5.459  1.00 0.00 ? 37 TRP P HE1  9  
ATOM 10094 H HE3  . TRP A 1 39 ? 3.388   4.380   -3.517  1.00 0.00 ? 37 TRP P HE3  9  
ATOM 10095 H HZ2  . TRP A 1 39 ? -0.462  1.988   -5.604  1.00 0.00 ? 37 TRP P HZ2  9  
ATOM 10096 H HZ3  . TRP A 1 39 ? 1.254   5.593   -3.971  1.00 0.00 ? 37 TRP P HZ3  9  
ATOM 10097 H HH2  . TRP A 1 39 ? -0.676  4.404   -4.976  1.00 0.00 ? 37 TRP P HH2  9  
ATOM 10098 N N    . THR A 1 40 ? 3.662   1.924   -0.136  1.00 0.00 ? 38 THR P N    9  
ATOM 10099 C CA   . THR A 1 40 ? 3.007   2.815   0.842   1.00 0.00 ? 38 THR P CA   9  
ATOM 10100 C C    . THR A 1 40 ? 3.400   2.519   2.291   1.00 0.00 ? 38 THR P C    9  
ATOM 10101 O O    . THR A 1 40 ? 2.874   3.149   3.203   1.00 0.00 ? 38 THR P O    9  
ATOM 10102 C CB   . THR A 1 40 ? 1.480   2.815   0.670   1.00 0.00 ? 38 THR P CB   9  
ATOM 10103 O OG1  . THR A 1 40 ? 0.969   1.513   0.794   1.00 0.00 ? 38 THR P OG1  9  
ATOM 10104 C CG2  . THR A 1 40 ? 1.082   3.340   -0.709  1.00 0.00 ? 38 THR P CG2  9  
ATOM 10105 H H    . THR A 1 40 ? 3.397   0.945   -0.129  1.00 0.00 ? 38 THR P H    9  
ATOM 10106 H HA   . THR A 1 40 ? 3.332   3.839   0.666   1.00 0.00 ? 38 THR P HA   9  
ATOM 10107 H HB   . THR A 1 40 ? 1.024   3.446   1.436   1.00 0.00 ? 38 THR P HB   9  
ATOM 10108 H HG1  . THR A 1 40 ? 0.872   1.165   -0.112  1.00 0.00 ? 38 THR P HG1  9  
ATOM 10109 H HG21 . THR A 1 40 ? 1.542   2.736   -1.494  1.00 0.00 ? 38 THR P HG21 9  
ATOM 10110 H HG22 . THR A 1 40 ? 1.424   4.369   -0.818  1.00 0.00 ? 38 THR P HG22 9  
ATOM 10111 H HG23 . THR A 1 40 ? -0.002  3.309   -0.818  1.00 0.00 ? 38 THR P HG23 9  
ATOM 10112 N N    . ASN A 1 41 ? 4.351   1.605   2.522   1.00 0.00 ? 39 ASN P N    9  
ATOM 10113 C CA   . ASN A 1 41 ? 4.784   1.141   3.850   1.00 0.00 ? 39 ASN P CA   9  
ATOM 10114 C C    . ASN A 1 41 ? 3.637   0.540   4.699   1.00 0.00 ? 39 ASN P C    9  
ATOM 10115 O O    . ASN A 1 41 ? 3.518   0.797   5.901   1.00 0.00 ? 39 ASN P O    9  
ATOM 10116 C CB   . ASN A 1 41 ? 5.587   2.253   4.558   1.00 0.00 ? 39 ASN P CB   9  
ATOM 10117 C CG   . ASN A 1 41 ? 6.438   1.753   5.719   1.00 0.00 ? 39 ASN P CG   9  
ATOM 10118 O OD1  . ASN A 1 41 ? 6.721   0.572   5.878   1.00 0.00 ? 39 ASN P OD1  9  
ATOM 10119 N ND2  . ASN A 1 41 ? 6.913   2.649   6.556   1.00 0.00 ? 39 ASN P ND2  9  
ATOM 10120 H H    . ASN A 1 41 ? 4.759   1.154   1.714   1.00 0.00 ? 39 ASN P H    9  
ATOM 10121 H HA   . ASN A 1 41 ? 5.471   0.313   3.668   1.00 0.00 ? 39 ASN P HA   9  
ATOM 10122 H HB2  . ASN A 1 41 ? 6.249   2.740   3.845   1.00 0.00 ? 39 ASN P HB2  9  
ATOM 10123 H HB3  . ASN A 1 41 ? 4.889   3.000   4.932   1.00 0.00 ? 39 ASN P HB3  9  
ATOM 10124 H HD21 . ASN A 1 41 ? 6.699   3.627   6.430   1.00 0.00 ? 39 ASN P HD21 9  
ATOM 10125 H HD22 . ASN A 1 41 ? 7.487   2.333   7.322   1.00 0.00 ? 39 ASN P HD22 9  
ATOM 10126 N N    . LEU A 1 42 ? 2.773   -0.245  4.051   1.00 0.00 ? 40 LEU P N    9  
ATOM 10127 C CA   . LEU A 1 42 ? 1.673   -1.004  4.658   1.00 0.00 ? 40 LEU P CA   9  
ATOM 10128 C C    . LEU A 1 42 ? 1.875   -2.523  4.479   1.00 0.00 ? 40 LEU P C    9  
ATOM 10129 O O    . LEU A 1 42 ? 2.848   -2.979  3.872   1.00 0.00 ? 40 LEU P O    9  
ATOM 10130 C CB   . LEU A 1 42 ? 0.341   -0.530  4.029   1.00 0.00 ? 40 LEU P CB   9  
ATOM 10131 C CG   . LEU A 1 42 ? -0.057  0.927   4.316   1.00 0.00 ? 40 LEU P CG   9  
ATOM 10132 C CD1  . LEU A 1 42 ? -1.351  1.257   3.573   1.00 0.00 ? 40 LEU P CD1  9  
ATOM 10133 C CD2  . LEU A 1 42 ? -0.295  1.152   5.807   1.00 0.00 ? 40 LEU P CD2  9  
ATOM 10134 H H    . LEU A 1 42 ? 2.933   -0.383  3.061   1.00 0.00 ? 40 LEU P H    9  
ATOM 10135 H HA   . LEU A 1 42 ? 1.640   -0.824  5.733   1.00 0.00 ? 40 LEU P HA   9  
ATOM 10136 H HB2  . LEU A 1 42 ? 0.409   -0.652  2.954   1.00 0.00 ? 40 LEU P HB2  9  
ATOM 10137 H HB3  . LEU A 1 42 ? -0.472  -1.169  4.374   1.00 0.00 ? 40 LEU P HB3  9  
ATOM 10138 H HG   . LEU A 1 42 ? 0.723   1.603   3.968   1.00 0.00 ? 40 LEU P HG   9  
ATOM 10139 H HD11 . LEU A 1 42 ? -2.160  0.610   3.913   1.00 0.00 ? 40 LEU P HD11 9  
ATOM 10140 H HD12 . LEU A 1 42 ? -1.618  2.297   3.748   1.00 0.00 ? 40 LEU P HD12 9  
ATOM 10141 H HD13 . LEU A 1 42 ? -1.199  1.116   2.502   1.00 0.00 ? 40 LEU P HD13 9  
ATOM 10142 H HD21 . LEU A 1 42 ? -0.686  2.154   5.970   1.00 0.00 ? 40 LEU P HD21 9  
ATOM 10143 H HD22 . LEU A 1 42 ? -1.010  0.426   6.187   1.00 0.00 ? 40 LEU P HD22 9  
ATOM 10144 H HD23 . LEU A 1 42 ? 0.648   1.058   6.343   1.00 0.00 ? 40 LEU P HD23 9  
ATOM 10145 N N    . THR A 1 43 ? 0.928   -3.310  4.993   1.00 0.00 ? 41 THR P N    9  
ATOM 10146 C CA   . THR A 1 43 ? 0.782   -4.752  4.720   1.00 0.00 ? 41 THR P CA   9  
ATOM 10147 C C    . THR A 1 43 ? -0.653  -5.031  4.264   1.00 0.00 ? 41 THR P C    9  
ATOM 10148 O O    . THR A 1 43 ? -1.543  -4.210  4.496   1.00 0.00 ? 41 THR P O    9  
ATOM 10149 C CB   . THR A 1 43 ? 1.205   -5.606  5.926   1.00 0.00 ? 41 THR P CB   9  
ATOM 10150 O OG1  . THR A 1 43 ? 1.170   -6.972  5.576   1.00 0.00 ? 41 THR P OG1  9  
ATOM 10151 C CG2  . THR A 1 43 ? 0.317   -5.416  7.157   1.00 0.00 ? 41 THR P CG2  9  
ATOM 10152 H H    . THR A 1 43 ? 0.156   -2.868  5.475   1.00 0.00 ? 41 THR P H    9  
ATOM 10153 H HA   . THR A 1 43 ? 1.435   -5.028  3.892   1.00 0.00 ? 41 THR P HA   9  
ATOM 10154 H HB   . THR A 1 43 ? 2.230   -5.344  6.192   1.00 0.00 ? 41 THR P HB   9  
ATOM 10155 H HG1  . THR A 1 43 ? 1.607   -7.472  6.289   1.00 0.00 ? 41 THR P HG1  9  
ATOM 10156 H HG21 . THR A 1 43 ? -0.720  -5.650  6.917   1.00 0.00 ? 41 THR P HG21 9  
ATOM 10157 H HG22 . THR A 1 43 ? 0.390   -4.387  7.504   1.00 0.00 ? 41 THR P HG22 9  
ATOM 10158 H HG23 . THR A 1 43 ? 0.655   -6.073  7.958   1.00 0.00 ? 41 THR P HG23 9  
ATOM 10159 N N    . GLU A 1 44 ? -0.916  -6.166  3.614   1.00 0.00 ? 42 GLU P N    9  
ATOM 10160 C CA   . GLU A 1 44 ? -2.220  -6.436  2.986   1.00 0.00 ? 42 GLU P CA   9  
ATOM 10161 C C    . GLU A 1 44 ? -3.390  -6.413  3.981   1.00 0.00 ? 42 GLU P C    9  
ATOM 10162 O O    . GLU A 1 44 ? -4.498  -6.030  3.615   1.00 0.00 ? 42 GLU P O    9  
ATOM 10163 C CB   . GLU A 1 44 ? -2.158  -7.738  2.175   1.00 0.00 ? 42 GLU P CB   9  
ATOM 10164 C CG   . GLU A 1 44 ? -2.378  -9.050  2.945   1.00 0.00 ? 42 GLU P CG   9  
ATOM 10165 C CD   . GLU A 1 44 ? -3.868  -9.417  3.076   1.00 0.00 ? 42 GLU P CD   9  
ATOM 10166 O OE1  . GLU A 1 44 ? -4.547  -9.616  2.044   1.00 0.00 ? 42 GLU P OE1  9  
ATOM 10167 O OE2  . GLU A 1 44 ? -4.387  -9.544  4.209   1.00 0.00 ? 42 GLU P OE2  9  
ATOM 10168 H H    . GLU A 1 44 ? -0.170  -6.843  3.515   1.00 0.00 ? 42 GLU P H    9  
ATOM 10169 H HA   . GLU A 1 44 ? -2.401  -5.637  2.269   1.00 0.00 ? 42 GLU P HA   9  
ATOM 10170 H HB2  . GLU A 1 44 ? -2.892  -7.676  1.378   1.00 0.00 ? 42 GLU P HB2  9  
ATOM 10171 H HB3  . GLU A 1 44 ? -1.176  -7.781  1.708   1.00 0.00 ? 42 GLU P HB3  9  
ATOM 10172 H HG2  . GLU A 1 44 ? -1.881  -9.844  2.390   1.00 0.00 ? 42 GLU P HG2  9  
ATOM 10173 H HG3  . GLU A 1 44 ? -1.900  -8.987  3.925   1.00 0.00 ? 42 GLU P HG3  9  
ATOM 10174 N N    . ALA A 1 45 ? -3.128  -6.742  5.249   1.00 0.00 ? 43 ALA P N    9  
ATOM 10175 C CA   . ALA A 1 45 ? -4.102  -6.690  6.337   1.00 0.00 ? 43 ALA P CA   9  
ATOM 10176 C C    . ALA A 1 45 ? -4.544  -5.251  6.671   1.00 0.00 ? 43 ALA P C    9  
ATOM 10177 O O    . ALA A 1 45 ? -5.731  -5.017  6.891   1.00 0.00 ? 43 ALA P O    9  
ATOM 10178 C CB   . ALA A 1 45 ? -3.508  -7.402  7.557   1.00 0.00 ? 43 ALA P CB   9  
ATOM 10179 H H    . ALA A 1 45 ? -2.197  -7.076  5.450   1.00 0.00 ? 43 ALA P H    9  
ATOM 10180 H HA   . ALA A 1 45 ? -4.991  -7.242  6.027   1.00 0.00 ? 43 ALA P HA   9  
ATOM 10181 H HB1  . ALA A 1 45 ? -3.247  -8.428  7.296   1.00 0.00 ? 43 ALA P HB1  9  
ATOM 10182 H HB2  . ALA A 1 45 ? -2.616  -6.880  7.907   1.00 0.00 ? 43 ALA P HB2  9  
ATOM 10183 H HB3  . ALA A 1 45 ? -4.244  -7.422  8.362   1.00 0.00 ? 43 ALA P HB3  9  
ATOM 10184 N N    . ARG A 1 46 ? -3.635  -4.264  6.630   1.00 0.00 ? 44 ARG P N    9  
ATOM 10185 C CA   . ARG A 1 46 ? -3.969  -2.829  6.762   1.00 0.00 ? 44 ARG P CA   9  
ATOM 10186 C C    . ARG A 1 46 ? -4.915  -2.402  5.641   1.00 0.00 ? 44 ARG P C    9  
ATOM 10187 O O    . ARG A 1 46 ? -5.939  -1.776  5.898   1.00 0.00 ? 44 ARG P O    9  
ATOM 10188 C CB   . ARG A 1 46 ? -2.701  -1.952  6.724   1.00 0.00 ? 44 ARG P CB   9  
ATOM 10189 C CG   . ARG A 1 46 ? -1.727  -2.149  7.895   1.00 0.00 ? 44 ARG P CG   9  
ATOM 10190 C CD   . ARG A 1 46 ? -2.218  -1.456  9.170   1.00 0.00 ? 44 ARG P CD   9  
ATOM 10191 N NE   . ARG A 1 46 ? -1.297  -1.698  10.301  1.00 0.00 ? 44 ARG P NE   9  
ATOM 10192 C CZ   . ARG A 1 46 ? -0.652  -0.806  11.035  1.00 0.00 ? 44 ARG P CZ   9  
ATOM 10193 N NH1  . ARG A 1 46 ? -0.716  0.474   10.820  1.00 0.00 ? 44 ARG P NH1  9  
ATOM 10194 N NH2  . ARG A 1 46 ? 0.085   -1.187  12.038  1.00 0.00 ? 44 ARG P NH2  9  
ATOM 10195 H H    . ARG A 1 46 ? -2.690  -4.516  6.380   1.00 0.00 ? 44 ARG P H    9  
ATOM 10196 H HA   . ARG A 1 46 ? -4.498  -2.661  7.701   1.00 0.00 ? 44 ARG P HA   9  
ATOM 10197 H HB2  . ARG A 1 46 ? -2.173  -2.143  5.792   1.00 0.00 ? 44 ARG P HB2  9  
ATOM 10198 H HB3  . ARG A 1 46 ? -3.001  -0.904  6.704   1.00 0.00 ? 44 ARG P HB3  9  
ATOM 10199 H HG2  . ARG A 1 46 ? -1.591  -3.213  8.089   1.00 0.00 ? 44 ARG P HG2  9  
ATOM 10200 H HG3  . ARG A 1 46 ? -0.761  -1.722  7.623   1.00 0.00 ? 44 ARG P HG3  9  
ATOM 10201 H HD2  . ARG A 1 46 ? -2.328  -0.388  8.970   1.00 0.00 ? 44 ARG P HD2  9  
ATOM 10202 H HD3  . ARG A 1 46 ? -3.199  -1.856  9.423   1.00 0.00 ? 44 ARG P HD3  9  
ATOM 10203 H HE   . ARG A 1 46 ? -1.169  -2.660  10.573  1.00 0.00 ? 44 ARG P HE   9  
ATOM 10204 H HH11 . ARG A 1 46 ? -1.303  0.843   10.084  1.00 0.00 ? 44 ARG P HH11 9  
ATOM 10205 H HH12 . ARG A 1 46 ? -0.286  1.125   11.467  1.00 0.00 ? 44 ARG P HH12 9  
ATOM 10206 H HH21 . ARG A 1 46 ? 0.176   -2.164  12.263  1.00 0.00 ? 44 ARG P HH21 9  
ATOM 10207 H HH22 . ARG A 1 46 ? 0.567   -0.501  12.592  1.00 0.00 ? 44 ARG P HH22 9  
ATOM 10208 N N    . VAL A 1 47 ? -4.610  -2.805  4.405   1.00 0.00 ? 45 VAL P N    9  
ATOM 10209 C CA   . VAL A 1 47 ? -5.447  -2.510  3.231   1.00 0.00 ? 45 VAL P CA   9  
ATOM 10210 C C    . VAL A 1 47 ? -6.812  -3.199  3.350   1.00 0.00 ? 45 VAL P C    9  
ATOM 10211 O O    . VAL A 1 47 ? -7.839  -2.558  3.139   1.00 0.00 ? 45 VAL P O    9  
ATOM 10212 C CB   . VAL A 1 47 ? -4.733  -2.898  1.921   1.00 0.00 ? 45 VAL P CB   9  
ATOM 10213 C CG1  . VAL A 1 47 ? -5.486  -2.354  0.704   1.00 0.00 ? 45 VAL P CG1  9  
ATOM 10214 C CG2  . VAL A 1 47 ? -3.300  -2.355  1.874   1.00 0.00 ? 45 VAL P CG2  9  
ATOM 10215 H H    . VAL A 1 47 ? -3.748  -3.323  4.278   1.00 0.00 ? 45 VAL P H    9  
ATOM 10216 H HA   . VAL A 1 47 ? -5.627  -1.434  3.206   1.00 0.00 ? 45 VAL P HA   9  
ATOM 10217 H HB   . VAL A 1 47 ? -4.688  -3.981  1.846   1.00 0.00 ? 45 VAL P HB   9  
ATOM 10218 H HG11 . VAL A 1 47 ? -4.948  -2.605  -0.209  1.00 0.00 ? 45 VAL P HG11 9  
ATOM 10219 H HG12 . VAL A 1 47 ? -6.482  -2.792  0.647   1.00 0.00 ? 45 VAL P HG12 9  
ATOM 10220 H HG13 . VAL A 1 47 ? -5.573  -1.270  0.772   1.00 0.00 ? 45 VAL P HG13 9  
ATOM 10221 H HG21 . VAL A 1 47 ? -2.875  -2.517  0.885   1.00 0.00 ? 45 VAL P HG21 9  
ATOM 10222 H HG22 . VAL A 1 47 ? -3.290  -1.290  2.102   1.00 0.00 ? 45 VAL P HG22 9  
ATOM 10223 H HG23 . VAL A 1 47 ? -2.671  -2.879  2.591   1.00 0.00 ? 45 VAL P HG23 9  
ATOM 10224 N N    . ARG A 1 48 ? -6.851  -4.468  3.778   1.00 0.00 ? 46 ARG P N    9  
ATOM 10225 C CA   . ARG A 1 48 ? -8.081  -5.239  4.027   1.00 0.00 ? 46 ARG P CA   9  
ATOM 10226 C C    . ARG A 1 48 ? -8.978  -4.552  5.062   1.00 0.00 ? 46 ARG P C    9  
ATOM 10227 O O    . ARG A 1 48 ? -10.169 -4.371  4.818   1.00 0.00 ? 46 ARG P O    9  
ATOM 10228 C CB   . ARG A 1 48 ? -7.687  -6.662  4.470   1.00 0.00 ? 46 ARG P CB   9  
ATOM 10229 C CG   . ARG A 1 48 ? -8.864  -7.647  4.460   1.00 0.00 ? 46 ARG P CG   9  
ATOM 10230 C CD   . ARG A 1 48 ? -8.548  -8.922  5.257   1.00 0.00 ? 46 ARG P CD   9  
ATOM 10231 N NE   . ARG A 1 48 ? -7.423  -9.705  4.698   1.00 0.00 ? 46 ARG P NE   9  
ATOM 10232 C CZ   . ARG A 1 48 ? -7.400  -10.998 4.431   1.00 0.00 ? 46 ARG P CZ   9  
ATOM 10233 N NH1  . ARG A 1 48 ? -8.452  -11.765 4.510   1.00 0.00 ? 46 ARG P NH1  9  
ATOM 10234 N NH2  . ARG A 1 48 ? -6.280  -11.545 4.076   1.00 0.00 ? 46 ARG P NH2  9  
ATOM 10235 H H    . ARG A 1 48 ? -5.962  -4.942  3.918   1.00 0.00 ? 46 ARG P H    9  
ATOM 10236 H HA   . ARG A 1 48 ? -8.654  -5.300  3.099   1.00 0.00 ? 46 ARG P HA   9  
ATOM 10237 H HB2  . ARG A 1 48 ? -6.919  -7.053  3.802   1.00 0.00 ? 46 ARG P HB2  9  
ATOM 10238 H HB3  . ARG A 1 48 ? -7.268  -6.616  5.476   1.00 0.00 ? 46 ARG P HB3  9  
ATOM 10239 H HG2  . ARG A 1 48 ? -9.734  -7.176  4.917   1.00 0.00 ? 46 ARG P HG2  9  
ATOM 10240 H HG3  . ARG A 1 48 ? -9.114  -7.906  3.430   1.00 0.00 ? 46 ARG P HG3  9  
ATOM 10241 H HD2  . ARG A 1 48 ? -8.301  -8.636  6.282   1.00 0.00 ? 46 ARG P HD2  9  
ATOM 10242 H HD3  . ARG A 1 48 ? -9.457  -9.523  5.297   1.00 0.00 ? 46 ARG P HD3  9  
ATOM 10243 H HE   . ARG A 1 48 ? -6.526  -9.242  4.598   1.00 0.00 ? 46 ARG P HE   9  
ATOM 10244 H HH11 . ARG A 1 48 ? -9.333  -11.367 4.786   1.00 0.00 ? 46 ARG P HH11 9  
ATOM 10245 H HH12 . ARG A 1 48 ? -8.384  -12.748 4.310   1.00 0.00 ? 46 ARG P HH12 9  
ATOM 10246 H HH21 . ARG A 1 48 ? -5.455  -10.943 4.056   1.00 0.00 ? 46 ARG P HH21 9  
ATOM 10247 H HH22 . ARG A 1 48 ? -6.208  -12.532 3.901   1.00 0.00 ? 46 ARG P HH22 9  
ATOM 10248 N N    . VAL A 1 49 ? -8.403  -4.105  6.182   1.00 0.00 ? 47 VAL P N    9  
ATOM 10249 C CA   . VAL A 1 49 ? -9.098  -3.346  7.238   1.00 0.00 ? 47 VAL P CA   9  
ATOM 10250 C C    . VAL A 1 49 ? -9.632  -2.015  6.708   1.00 0.00 ? 47 VAL P C    9  
ATOM 10251 O O    . VAL A 1 49 ? -10.791 -1.681  6.963   1.00 0.00 ? 47 VAL P O    9  
ATOM 10252 C CB   . VAL A 1 49 ? -8.162  -3.127  8.446   1.00 0.00 ? 47 VAL P CB   9  
ATOM 10253 C CG1  . VAL A 1 49 ? -8.706  -2.117  9.466   1.00 0.00 ? 47 VAL P CG1  9  
ATOM 10254 C CG2  . VAL A 1 49 ? -7.949  -4.449  9.190   1.00 0.00 ? 47 VAL P CG2  9  
ATOM 10255 H H    . VAL A 1 49 ? -7.418  -4.317  6.315   1.00 0.00 ? 47 VAL P H    9  
ATOM 10256 H HA   . VAL A 1 49 ? -9.961  -3.921  7.577   1.00 0.00 ? 47 VAL P HA   9  
ATOM 10257 H HB   . VAL A 1 49 ? -7.197  -2.764  8.093   1.00 0.00 ? 47 VAL P HB   9  
ATOM 10258 H HG11 . VAL A 1 49 ? -9.702  -2.414  9.794   1.00 0.00 ? 47 VAL P HG11 9  
ATOM 10259 H HG12 . VAL A 1 49 ? -8.040  -2.073  10.328  1.00 0.00 ? 47 VAL P HG12 9  
ATOM 10260 H HG13 . VAL A 1 49 ? -8.749  -1.120  9.027   1.00 0.00 ? 47 VAL P HG13 9  
ATOM 10261 H HG21 . VAL A 1 49 ? -8.885  -4.776  9.643   1.00 0.00 ? 47 VAL P HG21 9  
ATOM 10262 H HG22 . VAL A 1 49 ? -7.601  -5.220  8.506   1.00 0.00 ? 47 VAL P HG22 9  
ATOM 10263 H HG23 . VAL A 1 49 ? -7.191  -4.314  9.963   1.00 0.00 ? 47 VAL P HG23 9  
ATOM 10264 N N    . TRP A 1 50 ? -8.833  -1.272  5.940   1.00 0.00 ? 48 TRP P N    9  
ATOM 10265 C CA   . TRP A 1 50 ? -9.250  0.015   5.383   1.00 0.00 ? 48 TRP P CA   9  
ATOM 10266 C C    . TRP A 1 50 ? -10.412 -0.140  4.396   1.00 0.00 ? 48 TRP P C    9  
ATOM 10267 O O    . TRP A 1 50 ? -11.433 0.527   4.541   1.00 0.00 ? 48 TRP P O    9  
ATOM 10268 C CB   . TRP A 1 50 ? -8.060  0.711   4.722   1.00 0.00 ? 48 TRP P CB   9  
ATOM 10269 C CG   . TRP A 1 50 ? -8.321  2.145   4.390   1.00 0.00 ? 48 TRP P CG   9  
ATOM 10270 C CD1  . TRP A 1 50 ? -8.024  3.198   5.184   1.00 0.00 ? 48 TRP P CD1  9  
ATOM 10271 C CD2  . TRP A 1 50 ? -8.948  2.707   3.197   1.00 0.00 ? 48 TRP P CD2  9  
ATOM 10272 N NE1  . TRP A 1 50 ? -8.399  4.370   4.556   1.00 0.00 ? 48 TRP P NE1  9  
ATOM 10273 C CE2  . TRP A 1 50 ? -8.962  4.128   3.323   1.00 0.00 ? 48 TRP P CE2  9  
ATOM 10274 C CE3  . TRP A 1 50 ? -9.490  2.165   2.013   1.00 0.00 ? 48 TRP P CE3  9  
ATOM 10275 C CZ2  . TRP A 1 50 ? -9.467  4.968   2.321   1.00 0.00 ? 48 TRP P CZ2  9  
ATOM 10276 C CZ3  . TRP A 1 50 ? -10.023 2.992   1.010   1.00 0.00 ? 48 TRP P CZ3  9  
ATOM 10277 C CH2  . TRP A 1 50 ? -10.022 4.389   1.165   1.00 0.00 ? 48 TRP P CH2  9  
ATOM 10278 H H    . TRP A 1 50 ? -7.879  -1.581  5.780   1.00 0.00 ? 48 TRP P H    9  
ATOM 10279 H HA   . TRP A 1 50 ? -9.598  0.650   6.199   1.00 0.00 ? 48 TRP P HA   9  
ATOM 10280 H HB2  . TRP A 1 50 ? -7.206  0.669   5.393   1.00 0.00 ? 48 TRP P HB2  9  
ATOM 10281 H HB3  . TRP A 1 50 ? -7.788  0.178   3.810   1.00 0.00 ? 48 TRP P HB3  9  
ATOM 10282 H HD1  . TRP A 1 50 ? -7.543  3.129   6.154   1.00 0.00 ? 48 TRP P HD1  9  
ATOM 10283 H HE1  . TRP A 1 50 ? -8.259  5.285   4.966   1.00 0.00 ? 48 TRP P HE1  9  
ATOM 10284 H HE3  . TRP A 1 50 ? -9.489  1.096   1.875   1.00 0.00 ? 48 TRP P HE3  9  
ATOM 10285 H HZ2  . TRP A 1 50 ? -9.418  6.040   2.435   1.00 0.00 ? 48 TRP P HZ2  9  
ATOM 10286 H HZ3  . TRP A 1 50 ? -10.427 2.551   0.110   1.00 0.00 ? 48 TRP P HZ3  9  
ATOM 10287 H HH2  . TRP A 1 50 ? -10.446 5.013   0.394   1.00 0.00 ? 48 TRP P HH2  9  
ATOM 10288 N N    . PHE A 1 51 ? -10.312 -1.077  3.448   1.00 0.00 ? 49 PHE P N    9  
ATOM 10289 C CA   . PHE A 1 51 ? -11.367 -1.357  2.469   1.00 0.00 ? 49 PHE P CA   9  
ATOM 10290 C C    . PHE A 1 51 ? -12.623 -1.991  3.090   1.00 0.00 ? 49 PHE P C    9  
ATOM 10291 O O    . PHE A 1 51 ? -13.706 -1.856  2.516   1.00 0.00 ? 49 PHE P O    9  
ATOM 10292 C CB   . PHE A 1 51 ? -10.799 -2.213  1.326   1.00 0.00 ? 49 PHE P CB   9  
ATOM 10293 C CG   . PHE A 1 51 ? -10.164 -1.386  0.223   1.00 0.00 ? 49 PHE P CG   9  
ATOM 10294 C CD1  . PHE A 1 51 ? -8.830  -0.943  0.319   1.00 0.00 ? 49 PHE P CD1  9  
ATOM 10295 C CD2  . PHE A 1 51 ? -10.931 -1.023  -0.899  1.00 0.00 ? 49 PHE P CD2  9  
ATOM 10296 C CE1  . PHE A 1 51 ? -8.270  -0.139  -0.689  1.00 0.00 ? 49 PHE P CE1  9  
ATOM 10297 C CE2  . PHE A 1 51 ? -10.367 -0.237  -1.911  1.00 0.00 ? 49 PHE P CE2  9  
ATOM 10298 C CZ   . PHE A 1 51 ? -9.043  0.217   -1.805  1.00 0.00 ? 49 PHE P CZ   9  
ATOM 10299 H H    . PHE A 1 51 ? -9.447  -1.604  3.386   1.00 0.00 ? 49 PHE P H    9  
ATOM 10300 H HA   . PHE A 1 51 ? -11.697 -0.410  2.040   1.00 0.00 ? 49 PHE P HA   9  
ATOM 10301 H HB2  . PHE A 1 51 ? -10.078 -2.932  1.716   1.00 0.00 ? 49 PHE P HB2  9  
ATOM 10302 H HB3  . PHE A 1 51 ? -11.611 -2.792  0.883   1.00 0.00 ? 49 PHE P HB3  9  
ATOM 10303 H HD1  . PHE A 1 51 ? -8.236  -1.191  1.182   1.00 0.00 ? 49 PHE P HD1  9  
ATOM 10304 H HD2  . PHE A 1 51 ? -11.958 -1.338  -0.998  1.00 0.00 ? 49 PHE P HD2  9  
ATOM 10305 H HE1  . PHE A 1 51 ? -7.250  0.211   -0.604  1.00 0.00 ? 49 PHE P HE1  9  
ATOM 10306 H HE2  . PHE A 1 51 ? -10.970 0.028   -2.764  1.00 0.00 ? 49 PHE P HE2  9  
ATOM 10307 H HZ   . PHE A 1 51 ? -8.627  0.846   -2.575  1.00 0.00 ? 49 PHE P HZ   9  
ATOM 10308 N N    . LYS A 1 52 ? -12.521 -2.626  4.265   1.00 0.00 ? 50 LYS P N    9  
ATOM 10309 C CA   . LYS A 1 52 ? -13.679 -3.080  5.058   1.00 0.00 ? 50 LYS P CA   9  
ATOM 10310 C C    . LYS A 1 52 ? -14.385 -1.904  5.744   1.00 0.00 ? 50 LYS P C    9  
ATOM 10311 O O    . LYS A 1 52 ? -15.610 -1.817  5.703   1.00 0.00 ? 50 LYS P O    9  
ATOM 10312 C CB   . LYS A 1 52 ? -13.224 -4.163  6.055   1.00 0.00 ? 50 LYS P CB   9  
ATOM 10313 C CG   . LYS A 1 52 ? -14.408 -4.785  6.816   1.00 0.00 ? 50 LYS P CG   9  
ATOM 10314 C CD   . LYS A 1 52 ? -14.003 -5.974  7.700   1.00 0.00 ? 50 LYS P CD   9  
ATOM 10315 C CE   . LYS A 1 52 ? -13.081 -5.559  8.856   1.00 0.00 ? 50 LYS P CE   9  
ATOM 10316 N NZ   . LYS A 1 52 ? -12.792 -6.704  9.760   1.00 0.00 ? 50 LYS P NZ   9  
ATOM 10317 H H    . LYS A 1 52 ? -11.588 -2.772  4.638   1.00 0.00 ? 50 LYS P H    9  
ATOM 10318 H HA   . LYS A 1 52 ? -14.408 -3.534  4.384   1.00 0.00 ? 50 LYS P HA   9  
ATOM 10319 H HB2  . LYS A 1 52 ? -12.719 -4.955  5.500   1.00 0.00 ? 50 LYS P HB2  9  
ATOM 10320 H HB3  . LYS A 1 52 ? -12.518 -3.732  6.764   1.00 0.00 ? 50 LYS P HB3  9  
ATOM 10321 H HG2  . LYS A 1 52 ? -14.883 -4.028  7.442   1.00 0.00 ? 50 LYS P HG2  9  
ATOM 10322 H HG3  . LYS A 1 52 ? -15.143 -5.137  6.090   1.00 0.00 ? 50 LYS P HG3  9  
ATOM 10323 H HD2  . LYS A 1 52 ? -14.913 -6.415  8.113   1.00 0.00 ? 50 LYS P HD2  9  
ATOM 10324 H HD3  . LYS A 1 52 ? -13.508 -6.728  7.087   1.00 0.00 ? 50 LYS P HD3  9  
ATOM 10325 H HE2  . LYS A 1 52 ? -12.148 -5.165  8.445   1.00 0.00 ? 50 LYS P HE2  9  
ATOM 10326 H HE3  . LYS A 1 52 ? -13.566 -4.756  9.420   1.00 0.00 ? 50 LYS P HE3  9  
ATOM 10327 H HZ1  . LYS A 1 52 ? -12.334 -7.459  9.267   1.00 0.00 ? 50 LYS P HZ1  9  
ATOM 10328 H HZ2  . LYS A 1 52 ? -13.640 -7.073  10.169  1.00 0.00 ? 50 LYS P HZ2  9  
ATOM 10329 H HZ3  . LYS A 1 52 ? -12.189 -6.427  10.523  1.00 0.00 ? 50 LYS P HZ3  9  
ATOM 10330 N N    . ASN A 1 53 ? -13.624 -0.963  6.312   1.00 0.00 ? 51 ASN P N    9  
ATOM 10331 C CA   . ASN A 1 53 ? -14.172 0.254   6.924   1.00 0.00 ? 51 ASN P CA   9  
ATOM 10332 C C    . ASN A 1 53 ? -14.735 1.255   5.896   1.00 0.00 ? 51 ASN P C    9  
ATOM 10333 O O    . ASN A 1 53 ? -15.762 1.883   6.156   1.00 0.00 ? 51 ASN P O    9  
ATOM 10334 C CB   . ASN A 1 53 ? -13.097 0.909   7.812   1.00 0.00 ? 51 ASN P CB   9  
ATOM 10335 C CG   . ASN A 1 53 ? -12.986 0.244   9.171   1.00 0.00 ? 51 ASN P CG   9  
ATOM 10336 O OD1  . ASN A 1 53 ? -13.625 0.639   10.136  1.00 0.00 ? 51 ASN P OD1  9  
ATOM 10337 N ND2  . ASN A 1 53 ? -12.185 -0.788  9.295   1.00 0.00 ? 51 ASN P ND2  9  
ATOM 10338 H H    . ASN A 1 53 ? -12.619 -1.118  6.340   1.00 0.00 ? 51 ASN P H    9  
ATOM 10339 H HA   . ASN A 1 53 ? -15.016 -0.023  7.561   1.00 0.00 ? 51 ASN P HA   9  
ATOM 10340 H HB2  . ASN A 1 53 ? -12.126 0.892   7.316   1.00 0.00 ? 51 ASN P HB2  9  
ATOM 10341 H HB3  . ASN A 1 53 ? -13.364 1.951   7.987   1.00 0.00 ? 51 ASN P HB3  9  
ATOM 10342 H HD21 . ASN A 1 53 ? -11.652 -1.117  8.498   1.00 0.00 ? 51 ASN P HD21 9  
ATOM 10343 H HD22 . ASN A 1 53 ? -12.099 -1.214  10.203  1.00 0.00 ? 51 ASN P HD22 9  
ATOM 10344 N N    . ARG A 1 54 ? -14.108 1.410   4.721   1.00 0.00 ? 52 ARG P N    9  
ATOM 10345 C CA   . ARG A 1 54 ? -14.443 2.476   3.756   1.00 0.00 ? 52 ARG P CA   9  
ATOM 10346 C C    . ARG A 1 54 ? -15.878 2.395   3.242   1.00 0.00 ? 52 ARG P C    9  
ATOM 10347 O O    . ARG A 1 54 ? -16.545 3.423   3.168   1.00 0.00 ? 52 ARG P O    9  
ATOM 10348 C CB   . ARG A 1 54 ? -13.434 2.451   2.592   1.00 0.00 ? 52 ARG P CB   9  
ATOM 10349 C CG   . ARG A 1 54 ? -13.574 3.624   1.601   1.00 0.00 ? 52 ARG P CG   9  
ATOM 10350 C CD   . ARG A 1 54 ? -13.347 5.008   2.226   1.00 0.00 ? 52 ARG P CD   9  
ATOM 10351 N NE   . ARG A 1 54 ? -13.453 6.072   1.203   1.00 0.00 ? 52 ARG P NE   9  
ATOM 10352 C CZ   . ARG A 1 54 ? -12.721 7.167   1.100   1.00 0.00 ? 52 ARG P CZ   9  
ATOM 10353 N NH1  . ARG A 1 54 ? -11.784 7.493   1.938   1.00 0.00 ? 52 ARG P NH1  9  
ATOM 10354 N NH2  . ARG A 1 54 ? -12.887 8.005   0.123   1.00 0.00 ? 52 ARG P NH2  9  
ATOM 10355 H H    . ARG A 1 54 ? -13.239 0.897   4.583   1.00 0.00 ? 52 ARG P H    9  
ATOM 10356 H HA   . ARG A 1 54 ? -14.366 3.427   4.284   1.00 0.00 ? 52 ARG P HA   9  
ATOM 10357 H HB2  . ARG A 1 54 ? -12.418 2.441   2.991   1.00 0.00 ? 52 ARG P HB2  9  
ATOM 10358 H HB3  . ARG A 1 54 ? -13.581 1.526   2.035   1.00 0.00 ? 52 ARG P HB3  9  
ATOM 10359 H HG2  . ARG A 1 54 ? -12.844 3.483   0.805   1.00 0.00 ? 52 ARG P HG2  9  
ATOM 10360 H HG3  . ARG A 1 54 ? -14.564 3.597   1.144   1.00 0.00 ? 52 ARG P HG3  9  
ATOM 10361 H HD2  . ARG A 1 54 ? -14.099 5.188   2.995   1.00 0.00 ? 52 ARG P HD2  9  
ATOM 10362 H HD3  . ARG A 1 54 ? -12.361 5.017   2.693   1.00 0.00 ? 52 ARG P HD3  9  
ATOM 10363 H HE   . ARG A 1 54 ? -14.154 5.943   0.492   1.00 0.00 ? 52 ARG P HE   9  
ATOM 10364 H HH11 . ARG A 1 54 ? -11.605 6.924   2.744   1.00 0.00 ? 52 ARG P HH11 9  
ATOM 10365 H HH12 . ARG A 1 54 ? -11.231 8.321   1.722   1.00 0.00 ? 52 ARG P HH12 9  
ATOM 10366 H HH21 . ARG A 1 54 ? -13.594 7.863   -0.578  1.00 0.00 ? 52 ARG P HH21 9  
ATOM 10367 H HH22 . ARG A 1 54 ? -12.248 8.796   0.083   1.00 0.00 ? 52 ARG P HH22 9  
ATOM 10368 N N    . ARG A 1 55 ? -16.387 1.193   2.952   1.00 0.00 ? 53 ARG P N    9  
ATOM 10369 C CA   . ARG A 1 55 ? -17.783 0.991   2.507   1.00 0.00 ? 53 ARG P CA   9  
ATOM 10370 C C    . ARG A 1 55 ? -18.809 1.247   3.615   1.00 0.00 ? 53 ARG P C    9  
ATOM 10371 O O    . ARG A 1 55 ? -19.878 1.790   3.349   1.00 0.00 ? 53 ARG P O    9  
ATOM 10372 C CB   . ARG A 1 55 ? -17.937 -0.382  1.836   1.00 0.00 ? 53 ARG P CB   9  
ATOM 10373 C CG   . ARG A 1 55 ? -17.785 -1.581  2.791   1.00 0.00 ? 53 ARG P CG   9  
ATOM 10374 C CD   . ARG A 1 55 ? -17.507 -2.878  2.022   1.00 0.00 ? 53 ARG P CD   9  
ATOM 10375 N NE   . ARG A 1 55 ? -16.159 -2.838  1.424   1.00 0.00 ? 53 ARG P NE   9  
ATOM 10376 C CZ   . ARG A 1 55 ? -15.819 -2.811  0.150   1.00 0.00 ? 53 ARG P CZ   9  
ATOM 10377 N NH1  . ARG A 1 55 ? -16.652 -3.016  -0.828  1.00 0.00 ? 53 ARG P NH1  9  
ATOM 10378 N NH2  . ARG A 1 55 ? -14.591 -2.541  -0.162  1.00 0.00 ? 53 ARG P NH2  9  
ATOM 10379 H H    . ARG A 1 55 ? -15.769 0.397   3.034   1.00 0.00 ? 53 ARG P H    9  
ATOM 10380 H HA   . ARG A 1 55 ? -17.990 1.734   1.735   1.00 0.00 ? 53 ARG P HA   9  
ATOM 10381 H HB2  . ARG A 1 55 ? -18.918 -0.440  1.363   1.00 0.00 ? 53 ARG P HB2  9  
ATOM 10382 H HB3  . ARG A 1 55 ? -17.192 -0.439  1.042   1.00 0.00 ? 53 ARG P HB3  9  
ATOM 10383 H HG2  . ARG A 1 55 ? -16.961 -1.409  3.482   1.00 0.00 ? 53 ARG P HG2  9  
ATOM 10384 H HG3  . ARG A 1 55 ? -18.702 -1.697  3.371   1.00 0.00 ? 53 ARG P HG3  9  
ATOM 10385 H HD2  . ARG A 1 55 ? -17.560 -3.716  2.719   1.00 0.00 ? 53 ARG P HD2  9  
ATOM 10386 H HD3  . ARG A 1 55 ? -18.282 -3.011  1.268   1.00 0.00 ? 53 ARG P HD3  9  
ATOM 10387 H HE   . ARG A 1 55 ? -15.390 -2.669  2.062   1.00 0.00 ? 53 ARG P HE   9  
ATOM 10388 H HH11 . ARG A 1 55 ? -17.609 -3.245  -0.626  1.00 0.00 ? 53 ARG P HH11 9  
ATOM 10389 H HH12 . ARG A 1 55 ? -16.326 -2.955  -1.779  1.00 0.00 ? 53 ARG P HH12 9  
ATOM 10390 H HH21 . ARG A 1 55 ? -13.953 -2.298  0.581   1.00 0.00 ? 53 ARG P HH21 9  
ATOM 10391 H HH22 . ARG A 1 55 ? -14.330 -2.460  -1.138  1.00 0.00 ? 53 ARG P HH22 9  
ATOM 10392 N N    . ALA A 1 56 ? -18.455 0.954   4.867   1.00 0.00 ? 54 ALA P N    9  
ATOM 10393 C CA   . ALA A 1 56 ? -19.283 1.297   6.026   1.00 0.00 ? 54 ALA P CA   9  
ATOM 10394 C C    . ALA A 1 56 ? -19.330 2.812   6.288   1.00 0.00 ? 54 ALA P C    9  
ATOM 10395 O O    . ALA A 1 56 ? -20.356 3.315   6.753   1.00 0.00 ? 54 ALA P O    9  
ATOM 10396 C CB   . ALA A 1 56 ? -18.761 0.538   7.250   1.00 0.00 ? 54 ALA P CB   9  
ATOM 10397 H H    . ALA A 1 56 ? -17.551 0.531   5.021   1.00 0.00 ? 54 ALA P H    9  
ATOM 10398 H HA   . ALA A 1 56 ? -20.307 0.975   5.828   1.00 0.00 ? 54 ALA P HA   9  
ATOM 10399 H HB1  . ALA A 1 56 ? -18.732 -0.533  7.045   1.00 0.00 ? 54 ALA P HB1  9  
ATOM 10400 H HB2  . ALA A 1 56 ? -17.761 0.887   7.511   1.00 0.00 ? 54 ALA P HB2  9  
ATOM 10401 H HB3  . ALA A 1 56 ? -19.422 0.719   8.098   1.00 0.00 ? 54 ALA P HB3  9  
ATOM 10402 N N    . LYS A 1 57 ? -18.257 3.544   5.958   1.00 0.00 ? 55 LYS P N    9  
ATOM 10403 C CA   . LYS A 1 57 ? -18.187 5.014   6.048   1.00 0.00 ? 55 LYS P CA   9  
ATOM 10404 C C    . LYS A 1 57 ? -18.862 5.721   4.864   1.00 0.00 ? 55 LYS P C    9  
ATOM 10405 O O    . LYS A 1 57 ? -19.559 6.714   5.066   1.00 0.00 ? 55 LYS P O    9  
ATOM 10406 C CB   . LYS A 1 57 ? -16.718 5.454   6.196   1.00 0.00 ? 55 LYS P CB   9  
ATOM 10407 C CG   . LYS A 1 57 ? -16.131 5.051   7.557   1.00 0.00 ? 55 LYS P CG   9  
ATOM 10408 C CD   . LYS A 1 57 ? -14.664 5.483   7.685   1.00 0.00 ? 55 LYS P CD   9  
ATOM 10409 C CE   . LYS A 1 57 ? -14.131 5.111   9.075   1.00 0.00 ? 55 LYS P CE   9  
ATOM 10410 N NZ   . LYS A 1 57 ? -12.729 5.567   9.265   1.00 0.00 ? 55 LYS P NZ   9  
ATOM 10411 H H    . LYS A 1 57 ? -17.420 3.041   5.679   1.00 0.00 ? 55 LYS P H    9  
ATOM 10412 H HA   . LYS A 1 57 ? -18.726 5.327   6.944   1.00 0.00 ? 55 LYS P HA   9  
ATOM 10413 H HB2  . LYS A 1 57 ? -16.121 5.019   5.393   1.00 0.00 ? 55 LYS P HB2  9  
ATOM 10414 H HB3  . LYS A 1 57 ? -16.667 6.541   6.108   1.00 0.00 ? 55 LYS P HB3  9  
ATOM 10415 H HG2  . LYS A 1 57 ? -16.713 5.528   8.346   1.00 0.00 ? 55 LYS P HG2  9  
ATOM 10416 H HG3  . LYS A 1 57 ? -16.195 3.972   7.687   1.00 0.00 ? 55 LYS P HG3  9  
ATOM 10417 H HD2  . LYS A 1 57 ? -14.071 4.984   6.916   1.00 0.00 ? 55 LYS P HD2  9  
ATOM 10418 H HD3  . LYS A 1 57 ? -14.595 6.564   7.545   1.00 0.00 ? 55 LYS P HD3  9  
ATOM 10419 H HE2  . LYS A 1 57 ? -14.775 5.570   9.831   1.00 0.00 ? 55 LYS P HE2  9  
ATOM 10420 H HE3  . LYS A 1 57 ? -14.195 4.026   9.198   1.00 0.00 ? 55 LYS P HE3  9  
ATOM 10421 H HZ1  . LYS A 1 57 ? -12.107 5.153   8.583   1.00 0.00 ? 55 LYS P HZ1  9  
ATOM 10422 H HZ2  . LYS A 1 57 ? -12.387 5.314   10.184  1.00 0.00 ? 55 LYS P HZ2  9  
ATOM 10423 H HZ3  . LYS A 1 57 ? -12.656 6.572   9.183   1.00 0.00 ? 55 LYS P HZ3  9  
ATOM 10424 N N    . TRP A 1 58 ? -18.718 5.188   3.646   1.00 0.00 ? 56 TRP P N    9  
ATOM 10425 C CA   . TRP A 1 58 ? -19.299 5.726   2.401   1.00 0.00 ? 56 TRP P CA   9  
ATOM 10426 C C    . TRP A 1 58 ? -20.819 5.906   2.493   1.00 0.00 ? 56 TRP P C    9  
ATOM 10427 O O    . TRP A 1 58 ? -21.354 6.956   2.131   1.00 0.00 ? 56 TRP P O    9  
ATOM 10428 C CB   . TRP A 1 58 ? -18.925 4.782   1.241   1.00 0.00 ? 56 TRP P CB   9  
ATOM 10429 C CG   . TRP A 1 58 ? -19.893 4.694   0.096   1.00 0.00 ? 56 TRP P CG   9  
ATOM 10430 C CD1  . TRP A 1 58 ? -20.270 5.716   -0.704  1.00 0.00 ? 56 TRP P CD1  9  
ATOM 10431 C CD2  . TRP A 1 58 ? -20.654 3.531   -0.362  1.00 0.00 ? 56 TRP P CD2  9  
ATOM 10432 N NE1  . TRP A 1 58 ? -21.214 5.268   -1.610  1.00 0.00 ? 56 TRP P NE1  9  
ATOM 10433 C CE2  . TRP A 1 58 ? -21.478 3.928   -1.455  1.00 0.00 ? 56 TRP P CE2  9  
ATOM 10434 C CE3  . TRP A 1 58 ? -20.748 2.183   0.044   1.00 0.00 ? 56 TRP P CE3  9  
ATOM 10435 C CZ2  . TRP A 1 58 ? -22.335 3.041   -2.121  1.00 0.00 ? 56 TRP P CZ2  9  
ATOM 10436 C CZ3  . TRP A 1 58 ? -21.606 1.278   -0.611  1.00 0.00 ? 56 TRP P CZ3  9  
ATOM 10437 C CH2  . TRP A 1 58 ? -22.397 1.702   -1.696  1.00 0.00 ? 56 TRP P CH2  9  
ATOM 10438 H H    . TRP A 1 58 ? -18.103 4.384   3.562   1.00 0.00 ? 56 TRP P H    9  
ATOM 10439 H HA   . TRP A 1 58 ? -18.874 6.708   2.194   1.00 0.00 ? 56 TRP P HA   9  
ATOM 10440 H HB2  . TRP A 1 58 ? -17.946 5.068   0.857   1.00 0.00 ? 56 TRP P HB2  9  
ATOM 10441 H HB3  . TRP A 1 58 ? -18.830 3.774   1.637   1.00 0.00 ? 56 TRP P HB3  9  
ATOM 10442 H HD1  . TRP A 1 58 ? -19.900 6.730   -0.612  1.00 0.00 ? 56 TRP P HD1  9  
ATOM 10443 H HE1  . TRP A 1 58 ? -21.666 5.843   -2.317  1.00 0.00 ? 56 TRP P HE1  9  
ATOM 10444 H HE3  . TRP A 1 58 ? -20.167 1.857   0.891   1.00 0.00 ? 56 TRP P HE3  9  
ATOM 10445 H HZ2  . TRP A 1 58 ? -22.942 3.388   -2.945  1.00 0.00 ? 56 TRP P HZ2  9  
ATOM 10446 H HZ3  . TRP A 1 58 ? -21.666 0.252   -0.275  1.00 0.00 ? 56 TRP P HZ3  9  
ATOM 10447 H HH2  . TRP A 1 58 ? -23.056 1.002   -2.194  1.00 0.00 ? 56 TRP P HH2  9  
ATOM 10448 N N    . ARG A 1 59 ? -21.515 4.900   3.032   1.00 0.00 ? 57 ARG P N    9  
ATOM 10449 C CA   . ARG A 1 59 ? -22.985 4.834   3.117   1.00 0.00 ? 57 ARG P CA   9  
ATOM 10450 C C    . ARG A 1 59 ? -23.641 5.970   3.918   1.00 0.00 ? 57 ARG P C    9  
ATOM 10451 O O    . ARG A 1 59 ? -24.818 6.259   3.701   1.00 0.00 ? 57 ARG P O    9  
ATOM 10452 C CB   . ARG A 1 59 ? -23.346 3.469   3.721   1.00 0.00 ? 57 ARG P CB   9  
ATOM 10453 C CG   . ARG A 1 59 ? -23.202 2.339   2.691   1.00 0.00 ? 57 ARG P CG   9  
ATOM 10454 C CD   . ARG A 1 59 ? -23.331 0.960   3.344   1.00 0.00 ? 57 ARG P CD   9  
ATOM 10455 N NE   . ARG A 1 59 ? -24.705 0.693   3.821   1.00 0.00 ? 57 ARG P NE   9  
ATOM 10456 C CZ   . ARG A 1 59 ? -25.115 -0.370  4.490   1.00 0.00 ? 57 ARG P CZ   9  
ATOM 10457 N NH1  . ARG A 1 59 ? -24.307 -1.340  4.816   1.00 0.00 ? 57 ARG P NH1  9  
ATOM 10458 N NH2  . ARG A 1 59 ? -26.362 -0.481  4.850   1.00 0.00 ? 57 ARG P NH2  9  
ATOM 10459 H H    . ARG A 1 59 ? -20.987 4.073   3.287   1.00 0.00 ? 57 ARG P H    9  
ATOM 10460 H HA   . ARG A 1 59 ? -23.395 4.910   2.105   1.00 0.00 ? 57 ARG P HA   9  
ATOM 10461 H HB2  . ARG A 1 59 ? -22.672 3.276   4.559   1.00 0.00 ? 57 ARG P HB2  9  
ATOM 10462 H HB3  . ARG A 1 59 ? -24.375 3.485   4.086   1.00 0.00 ? 57 ARG P HB3  9  
ATOM 10463 H HG2  . ARG A 1 59 ? -23.949 2.452   1.904   1.00 0.00 ? 57 ARG P HG2  9  
ATOM 10464 H HG3  . ARG A 1 59 ? -22.217 2.402   2.237   1.00 0.00 ? 57 ARG P HG3  9  
ATOM 10465 H HD2  . ARG A 1 59 ? -23.052 0.206   2.607   1.00 0.00 ? 57 ARG P HD2  9  
ATOM 10466 H HD3  . ARG A 1 59 ? -22.628 0.912   4.179   1.00 0.00 ? 57 ARG P HD3  9  
ATOM 10467 H HE   . ARG A 1 59 ? -25.410 1.378   3.598   1.00 0.00 ? 57 ARG P HE   9  
ATOM 10468 H HH11 . ARG A 1 59 ? -23.342 -1.288  4.541   1.00 0.00 ? 57 ARG P HH11 9  
ATOM 10469 H HH12 . ARG A 1 59 ? -24.645 -2.140  5.324   1.00 0.00 ? 57 ARG P HH12 9  
ATOM 10470 H HH21 . ARG A 1 59 ? -27.024 0.242   4.619   1.00 0.00 ? 57 ARG P HH21 9  
ATOM 10471 H HH22 . ARG A 1 59 ? -26.673 -1.292  5.358   1.00 0.00 ? 57 ARG P HH22 9  
ATOM 10472 N N    . LYS A 1 60 ? -22.890 6.645   4.797   1.00 0.00 ? 58 LYS P N    9  
ATOM 10473 C CA   . LYS A 1 60 ? -23.347 7.831   5.561   1.00 0.00 ? 58 LYS P CA   9  
ATOM 10474 C C    . LYS A 1 60 ? -23.462 9.104   4.705   1.00 0.00 ? 58 LYS P C    9  
ATOM 10475 O O    . LYS A 1 60 ? -24.102 10.063  5.142   1.00 0.00 ? 58 LYS P O    9  
ATOM 10476 C CB   . LYS A 1 60 ? -22.422 8.085   6.772   1.00 0.00 ? 58 LYS P CB   9  
ATOM 10477 C CG   . LYS A 1 60 ? -22.688 7.196   7.998   1.00 0.00 ? 58 LYS P CG   9  
ATOM 10478 C CD   . LYS A 1 60 ? -22.463 5.701   7.749   1.00 0.00 ? 58 LYS P CD   9  
ATOM 10479 C CE   . LYS A 1 60 ? -22.476 4.925   9.071   1.00 0.00 ? 58 LYS P CE   9  
ATOM 10480 N NZ   . LYS A 1 60 ? -22.310 3.469   8.834   1.00 0.00 ? 58 LYS P NZ   9  
ATOM 10481 H H    . LYS A 1 60 ? -21.941 6.318   4.920   1.00 0.00 ? 58 LYS P H    9  
ATOM 10482 H HA   . LYS A 1 60 ? -24.355 7.644   5.937   1.00 0.00 ? 58 LYS P HA   9  
ATOM 10483 H HB2  . LYS A 1 60 ? -21.380 7.991   6.468   1.00 0.00 ? 58 LYS P HB2  9  
ATOM 10484 H HB3  . LYS A 1 60 ? -22.560 9.114   7.106   1.00 0.00 ? 58 LYS P HB3  9  
ATOM 10485 H HG2  . LYS A 1 60 ? -22.015 7.521   8.793   1.00 0.00 ? 58 LYS P HG2  9  
ATOM 10486 H HG3  . LYS A 1 60 ? -23.713 7.351   8.339   1.00 0.00 ? 58 LYS P HG3  9  
ATOM 10487 H HD2  . LYS A 1 60 ? -23.253 5.317   7.101   1.00 0.00 ? 58 LYS P HD2  9  
ATOM 10488 H HD3  . LYS A 1 60 ? -21.497 5.567   7.263   1.00 0.00 ? 58 LYS P HD3  9  
ATOM 10489 H HE2  . LYS A 1 60 ? -21.661 5.297   9.698   1.00 0.00 ? 58 LYS P HE2  9  
ATOM 10490 H HE3  . LYS A 1 60 ? -23.419 5.117   9.592   1.00 0.00 ? 58 LYS P HE3  9  
ATOM 10491 H HZ1  . LYS A 1 60 ? -21.500 3.297   8.242   1.00 0.00 ? 58 LYS P HZ1  9  
ATOM 10492 H HZ2  . LYS A 1 60 ? -23.116 3.080   8.366   1.00 0.00 ? 58 LYS P HZ2  9  
ATOM 10493 H HZ3  . LYS A 1 60 ? -22.183 2.968   9.703   1.00 0.00 ? 58 LYS P HZ3  9  
ATOM 10494 N N    . ARG A 1 61 ? -22.837 9.145   3.519   1.00 0.00 ? 59 ARG P N    9  
ATOM 10495 C CA   . ARG A 1 61 ? -22.808 10.310  2.605   1.00 0.00 ? 59 ARG P CA   9  
ATOM 10496 C C    . ARG A 1 61 ? -23.178 9.990   1.149   1.00 0.00 ? 59 ARG P C    9  
ATOM 10497 O O    . ARG A 1 61 ? -23.540 10.905  0.411   1.00 0.00 ? 59 ARG P O    9  
ATOM 10498 C CB   . ARG A 1 61 ? -21.421 10.980  2.687   1.00 0.00 ? 59 ARG P CB   9  
ATOM 10499 C CG   . ARG A 1 61 ? -21.051 11.532  4.076   1.00 0.00 ? 59 ARG P CG   9  
ATOM 10500 C CD   . ARG A 1 61 ? -21.999 12.648  4.537   1.00 0.00 ? 59 ARG P CD   9  
ATOM 10501 N NE   . ARG A 1 61 ? -21.655 13.131  5.889   1.00 0.00 ? 59 ARG P NE   9  
ATOM 10502 C CZ   . ARG A 1 61 ? -22.252 12.826  7.029   1.00 0.00 ? 59 ARG P CZ   9  
ATOM 10503 N NH1  . ARG A 1 61 ? -23.238 11.976  7.109   1.00 0.00 ? 59 ARG P NH1  9  
ATOM 10504 N NH2  . ARG A 1 61 ? -21.859 13.383  8.139   1.00 0.00 ? 59 ARG P NH2  9  
ATOM 10505 H H    . ARG A 1 61 ? -22.273 8.341   3.276   1.00 0.00 ? 59 ARG P H    9  
ATOM 10506 H HA   . ARG A 1 61 ? -23.565 11.031  2.915   1.00 0.00 ? 59 ARG P HA   9  
ATOM 10507 H HB2  . ARG A 1 61 ? -20.662 10.252  2.394   1.00 0.00 ? 59 ARG P HB2  9  
ATOM 10508 H HB3  . ARG A 1 61 ? -21.382 11.804  1.973   1.00 0.00 ? 59 ARG P HB3  9  
ATOM 10509 H HG2  . ARG A 1 61 ? -21.053 10.724  4.808   1.00 0.00 ? 59 ARG P HG2  9  
ATOM 10510 H HG3  . ARG A 1 61 ? -20.039 11.935  4.028   1.00 0.00 ? 59 ARG P HG3  9  
ATOM 10511 H HD2  . ARG A 1 61 ? -21.930 13.478  3.833   1.00 0.00 ? 59 ARG P HD2  9  
ATOM 10512 H HD3  . ARG A 1 61 ? -23.027 12.289  4.520   1.00 0.00 ? 59 ARG P HD3  9  
ATOM 10513 H HE   . ARG A 1 61 ? -20.898 13.795  5.949   1.00 0.00 ? 59 ARG P HE   9  
ATOM 10514 H HH11 . ARG A 1 61 ? -23.558 11.493  6.277   1.00 0.00 ? 59 ARG P HH11 9  
ATOM 10515 H HH12 . ARG A 1 61 ? -23.678 11.788  7.992   1.00 0.00 ? 59 ARG P HH12 9  
ATOM 10516 H HH21 . ARG A 1 61 ? -21.104 14.049  8.133   1.00 0.00 ? 59 ARG P HH21 9  
ATOM 10517 H HH22 . ARG A 1 61 ? -22.311 13.157  9.010   1.00 0.00 ? 59 ARG P HH22 9  
ATOM 10518 N N    . GLU A 1 62 ? -23.129 8.719   0.746   1.00 0.00 ? 60 GLU P N    9  
ATOM 10519 C CA   . GLU A 1 62 ? -23.473 8.229   -0.603  1.00 0.00 ? 60 GLU P CA   9  
ATOM 10520 C C    . GLU A 1 62 ? -22.670 8.930   -1.724  1.00 0.00 ? 60 GLU P C    9  
ATOM 10521 O O    . GLU A 1 62 ? -23.197 9.296   -2.776  1.00 0.00 ? 60 GLU P O    9  
ATOM 10522 C CB   . GLU A 1 62 ? -24.999 8.218   -0.825  1.00 0.00 ? 60 GLU P CB   9  
ATOM 10523 C CG   . GLU A 1 62 ? -25.744 7.378   0.223   1.00 0.00 ? 60 GLU P CG   9  
ATOM 10524 C CD   . GLU A 1 62 ? -27.251 7.314   -0.092  1.00 0.00 ? 60 GLU P CD   9  
ATOM 10525 O OE1  . GLU A 1 62 ? -28.003 8.233   0.315   1.00 0.00 ? 60 GLU P OE1  9  
ATOM 10526 O OE2  . GLU A 1 62 ? -27.700 6.340   -0.745  1.00 0.00 ? 60 GLU P OE2  9  
ATOM 10527 H H    . GLU A 1 62 ? -22.769 8.039   1.404   1.00 0.00 ? 60 GLU P H    9  
ATOM 10528 H HA   . GLU A 1 62 ? -23.156 7.186   -0.645  1.00 0.00 ? 60 GLU P HA   9  
ATOM 10529 H HB2  . GLU A 1 62 ? -25.382 9.239   -0.806  1.00 0.00 ? 60 GLU P HB2  9  
ATOM 10530 H HB3  . GLU A 1 62 ? -25.205 7.793   -1.808  1.00 0.00 ? 60 GLU P HB3  9  
ATOM 10531 H HG2  . GLU A 1 62 ? -25.320 6.370   0.239   1.00 0.00 ? 60 GLU P HG2  9  
ATOM 10532 H HG3  . GLU A 1 62 ? -25.598 7.816   1.214   1.00 0.00 ? 60 GLU P HG3  9  
ATOM 10533 N N    . GLU A 1 63 ? -21.369 9.126   -1.482  1.00 0.00 ? 61 GLU P N    9  
ATOM 10534 C CA   . GLU A 1 63 ? -20.434 9.821   -2.395  1.00 0.00 ? 61 GLU P CA   9  
ATOM 10535 C C    . GLU A 1 63 ? -20.232 9.101   -3.746  1.00 0.00 ? 61 GLU P C    9  
ATOM 10536 O O    . GLU A 1 63 ? -19.910 9.730   -4.756  1.00 0.00 ? 61 GLU P O    9  
ATOM 10537 C CB   . GLU A 1 63 ? -19.073 9.966   -1.692  1.00 0.00 ? 61 GLU P CB   9  
ATOM 10538 C CG   . GLU A 1 63 ? -19.074 10.991  -0.549  1.00 0.00 ? 61 GLU P CG   9  
ATOM 10539 C CD   . GLU A 1 63 ? -19.130 12.441  -1.073  1.00 0.00 ? 61 GLU P CD   9  
ATOM 10540 O OE1  . GLU A 1 63 ? -18.060 13.017  -1.387  1.00 0.00 ? 61 GLU P OE1  9  
ATOM 10541 O OE2  . GLU A 1 63 ? -20.239 13.019  -1.169  1.00 0.00 ? 61 GLU P OE2  9  
ATOM 10542 H H    . GLU A 1 63 ? -21.024 8.840   -0.574  1.00 0.00 ? 61 GLU P H    9  
ATOM 10543 H HA   . GLU A 1 63 ? -20.827 10.813  -2.621  1.00 0.00 ? 61 GLU P HA   9  
ATOM 10544 H HB2  . GLU A 1 63 ? -18.779 8.995   -1.293  1.00 0.00 ? 61 GLU P HB2  9  
ATOM 10545 H HB3  . GLU A 1 63 ? -18.321 10.259  -2.423  1.00 0.00 ? 61 GLU P HB3  9  
ATOM 10546 H HG2  . GLU A 1 63 ? -19.915 10.792  0.120   1.00 0.00 ? 61 GLU P HG2  9  
ATOM 10547 H HG3  . GLU A 1 63 ? -18.162 10.851  0.036   1.00 0.00 ? 61 GLU P HG3  9  
ATOM 10548 N N    . PHE A 1 64 ? -20.453 7.786   -3.759  1.00 0.00 ? 62 PHE P N    9  
ATOM 10549 C CA   . PHE A 1 64 ? -20.536 6.912   -4.933  1.00 0.00 ? 62 PHE P CA   9  
ATOM 10550 C C    . PHE A 1 64 ? -21.926 6.251   -4.987  1.00 0.00 ? 62 PHE P C    9  
ATOM 10551 O O    . PHE A 1 64 ? -22.571 6.088   -3.947  1.00 0.00 ? 62 PHE P O    9  
ATOM 10552 C CB   . PHE A 1 64 ? -19.398 5.883   -4.867  1.00 0.00 ? 62 PHE P CB   9  
ATOM 10553 C CG   . PHE A 1 64 ? -19.365 4.912   -6.032  1.00 0.00 ? 62 PHE P CG   9  
ATOM 10554 C CD1  . PHE A 1 64 ? -18.844 5.321   -7.274  1.00 0.00 ? 62 PHE P CD1  9  
ATOM 10555 C CD2  . PHE A 1 64 ? -19.875 3.608   -5.883  1.00 0.00 ? 62 PHE P CD2  9  
ATOM 10556 C CE1  . PHE A 1 64 ? -18.832 4.431   -8.363  1.00 0.00 ? 62 PHE P CE1  9  
ATOM 10557 C CE2  . PHE A 1 64 ? -19.862 2.717   -6.972  1.00 0.00 ? 62 PHE P CE2  9  
ATOM 10558 C CZ   . PHE A 1 64 ? -19.342 3.129   -8.211  1.00 0.00 ? 62 PHE P CZ   9  
ATOM 10559 H H    . PHE A 1 64 ? -20.726 7.381   -2.880  1.00 0.00 ? 62 PHE P H    9  
ATOM 10560 H HA   . PHE A 1 64 ? -20.413 7.504   -5.841  1.00 0.00 ? 62 PHE P HA   9  
ATOM 10561 H HB2  . PHE A 1 64 ? -18.447 6.416   -4.836  1.00 0.00 ? 62 PHE P HB2  9  
ATOM 10562 H HB3  . PHE A 1 64 ? -19.481 5.317   -3.938  1.00 0.00 ? 62 PHE P HB3  9  
ATOM 10563 H HD1  . PHE A 1 64 ? -18.453 6.323   -7.394  1.00 0.00 ? 62 PHE P HD1  9  
ATOM 10564 H HD2  . PHE A 1 64 ? -20.280 3.286   -4.932  1.00 0.00 ? 62 PHE P HD2  9  
ATOM 10565 H HE1  . PHE A 1 64 ? -18.432 4.747   -9.317  1.00 0.00 ? 62 PHE P HE1  9  
ATOM 10566 H HE2  . PHE A 1 64 ? -20.250 1.714   -6.856  1.00 0.00 ? 62 PHE P HE2  9  
ATOM 10567 H HZ   . PHE A 1 64 ? -19.333 2.444   -9.049  1.00 0.00 ? 62 PHE P HZ   9  
ATOM 10568 N N    . ILE A 1 65 ? -22.397 5.870   -6.179  1.00 0.00 ? 63 ILE P N    9  
ATOM 10569 C CA   . ILE A 1 65 ? -23.731 5.282   -6.396  1.00 0.00 ? 63 ILE P CA   9  
ATOM 10570 C C    . ILE A 1 65 ? -23.613 4.017   -7.259  1.00 0.00 ? 63 ILE P C    9  
ATOM 10571 O O    . ILE A 1 65 ? -23.020 4.037   -8.341  1.00 0.00 ? 63 ILE P O    9  
ATOM 10572 C CB   . ILE A 1 65 ? -24.710 6.323   -6.997  1.00 0.00 ? 63 ILE P CB   9  
ATOM 10573 C CG1  . ILE A 1 65 ? -24.819 7.553   -6.062  1.00 0.00 ? 63 ILE P CG1  9  
ATOM 10574 C CG2  . ILE A 1 65 ? -26.097 5.691   -7.233  1.00 0.00 ? 63 ILE P CG2  9  
ATOM 10575 C CD1  . ILE A 1 65 ? -25.773 8.652   -6.540  1.00 0.00 ? 63 ILE P CD1  9  
ATOM 10576 H H    . ILE A 1 65 ? -21.801 5.983   -6.988  1.00 0.00 ? 63 ILE P H    9  
ATOM 10577 H HA   . ILE A 1 65 ? -24.149 4.984   -5.435  1.00 0.00 ? 63 ILE P HA   9  
ATOM 10578 H HB   . ILE A 1 65 ? -24.317 6.651   -7.961  1.00 0.00 ? 63 ILE P HB   9  
ATOM 10579 H HG12 . ILE A 1 65 ? -25.137 7.229   -5.071  1.00 0.00 ? 63 ILE P HG12 9  
ATOM 10580 H HG13 . ILE A 1 65 ? -23.839 8.019   -5.966  1.00 0.00 ? 63 ILE P HG13 9  
ATOM 10581 H HG21 . ILE A 1 65 ? -26.532 5.371   -6.285  1.00 0.00 ? 63 ILE P HG21 9  
ATOM 10582 H HG22 . ILE A 1 65 ? -26.765 6.409   -7.708  1.00 0.00 ? 63 ILE P HG22 9  
ATOM 10583 H HG23 . ILE A 1 65 ? -26.026 4.836   -7.905  1.00 0.00 ? 63 ILE P HG23 9  
ATOM 10584 H HD11 . ILE A 1 65 ? -25.532 8.929   -7.566  1.00 0.00 ? 63 ILE P HD11 9  
ATOM 10585 H HD12 . ILE A 1 65 ? -25.656 9.525   -5.896  1.00 0.00 ? 63 ILE P HD12 9  
ATOM 10586 H HD13 . ILE A 1 65 ? -26.805 8.310   -6.476  1.00 0.00 ? 63 ILE P HD13 9  
ATOM 10587 N N    . VAL A 1 66 ? -24.206 2.918   -6.784  1.00 0.00 ? 64 VAL P N    9  
ATOM 10588 C CA   . VAL A 1 66 ? -24.243 1.610   -7.466  1.00 0.00 ? 64 VAL P CA   9  
ATOM 10589 C C    . VAL A 1 66 ? -25.450 1.540   -8.410  1.00 0.00 ? 64 VAL P C    9  
ATOM 10590 O O    . VAL A 1 66 ? -26.566 1.885   -8.017  1.00 0.00 ? 64 VAL P O    9  
ATOM 10591 C CB   . VAL A 1 66 ? -24.284 0.457   -6.440  1.00 0.00 ? 64 VAL P CB   9  
ATOM 10592 C CG1  . VAL A 1 66 ? -24.254 -0.918  -7.117  1.00 0.00 ? 64 VAL P CG1  9  
ATOM 10593 C CG2  . VAL A 1 66 ? -23.095 0.516   -5.469  1.00 0.00 ? 64 VAL P CG2  9  
ATOM 10594 H H    . VAL A 1 66 ? -24.705 2.999   -5.910  1.00 0.00 ? 64 VAL P H    9  
ATOM 10595 H HA   . VAL A 1 66 ? -23.334 1.496   -8.056  1.00 0.00 ? 64 VAL P HA   9  
ATOM 10596 H HB   . VAL A 1 66 ? -25.208 0.535   -5.866  1.00 0.00 ? 64 VAL P HB   9  
ATOM 10597 H HG11 . VAL A 1 66 ? -23.371 -1.008  -7.752  1.00 0.00 ? 64 VAL P HG11 9  
ATOM 10598 H HG12 . VAL A 1 66 ? -24.227 -1.702  -6.360  1.00 0.00 ? 64 VAL P HG12 9  
ATOM 10599 H HG13 . VAL A 1 66 ? -25.152 -1.065  -7.716  1.00 0.00 ? 64 VAL P HG13 9  
ATOM 10600 H HG21 . VAL A 1 66 ? -22.158 0.446   -6.021  1.00 0.00 ? 64 VAL P HG21 9  
ATOM 10601 H HG22 . VAL A 1 66 ? -23.108 1.445   -4.901  1.00 0.00 ? 64 VAL P HG22 9  
ATOM 10602 H HG23 . VAL A 1 66 ? -23.154 -0.312  -4.762  1.00 0.00 ? 64 VAL P HG23 9  
ATOM 10603 N N    . THR A 1 67 ? -25.239 1.080   -9.649  1.00 0.00 ? 65 THR P N    9  
ATOM 10604 C CA   . THR A 1 67 ? -26.292 0.999   -10.684 1.00 0.00 ? 65 THR P CA   9  
ATOM 10605 C C    . THR A 1 67 ? -26.953 -0.388  -10.799 1.00 0.00 ? 65 THR P C    9  
ATOM 10606 O O    . THR A 1 67 ? -28.133 -0.482  -11.149 1.00 0.00 ? 65 THR P O    9  
ATOM 10607 C CB   . THR A 1 67 ? -25.747 1.506   -12.034 1.00 0.00 ? 65 THR P CB   9  
ATOM 10608 O OG1  . THR A 1 67 ? -26.784 1.703   -12.973 1.00 0.00 ? 65 THR P OG1  9  
ATOM 10609 C CG2  . THR A 1 67 ? -24.721 0.572   -12.677 1.00 0.00 ? 65 THR P CG2  9  
ATOM 10610 H H    . THR A 1 67 ? -24.293 0.834   -9.909  1.00 0.00 ? 65 THR P H    9  
ATOM 10611 H HA   . THR A 1 67 ? -27.086 1.685   -10.400 1.00 0.00 ? 65 THR P HA   9  
ATOM 10612 H HB   . THR A 1 67 ? -25.263 2.469   -11.862 1.00 0.00 ? 65 THR P HB   9  
ATOM 10613 H HG1  . THR A 1 67 ? -27.326 2.455   -12.669 1.00 0.00 ? 65 THR P HG1  9  
ATOM 10614 H HG21 . THR A 1 67 ? -24.336 1.032   -13.588 1.00 0.00 ? 65 THR P HG21 9  
ATOM 10615 H HG22 . THR A 1 67 ? -25.182 -0.383  -12.928 1.00 0.00 ? 65 THR P HG22 9  
ATOM 10616 H HG23 . THR A 1 67 ? -23.888 0.404   -11.994 1.00 0.00 ? 65 THR P HG23 9  
ATOM 10617 N N    . ASP A 1 68 ? -26.230 -1.467  -10.463 1.00 0.00 ? 66 ASP P N    9  
ATOM 10618 C CA   . ASP A 1 68 ? -26.689 -2.870  -10.515 1.00 0.00 ? 66 ASP P CA   9  
ATOM 10619 C C    . ASP A 1 68 ? -26.014 -3.761  -9.449  1.00 0.00 ? 66 ASP P C    9  
ATOM 10620 O O    . ASP A 1 68 ? -24.765 -3.756  -9.357  1.00 0.00 ? 66 ASP P O    9  
ATOM 10621 C CB   . ASP A 1 68 ? -26.449 -3.438  -11.930 1.00 0.00 ? 66 ASP P CB   9  
ATOM 10622 C CG   . ASP A 1 68 ? -26.934 -4.897  -12.085 1.00 0.00 ? 66 ASP P CG   9  
ATOM 10623 O OD1  . ASP A 1 68 ? -28.169 -5.129  -12.122 1.00 0.00 ? 66 ASP P OD1  9  
ATOM 10624 O OD2  . ASP A 1 68 ? -26.085 -5.817  -12.207 1.00 0.00 ? 66 ASP P OD2  9  
ATOM 10625 O OXT  . ASP A 1 68 ? -26.746 -4.447  -8.701  1.00 0.00 ? 66 ASP P OXT  9  
ATOM 10626 H H    . ASP A 1 68 ? -25.281 -1.314  -10.151 1.00 0.00 ? 66 ASP P H    9  
ATOM 10627 H HA   . ASP A 1 68 ? -27.762 -2.899  -10.323 1.00 0.00 ? 66 ASP P HA   9  
ATOM 10628 H HB2  . ASP A 1 68 ? -26.976 -2.813  -12.655 1.00 0.00 ? 66 ASP P HB2  9  
ATOM 10629 H HB3  . ASP A 1 68 ? -25.384 -3.376  -12.162 1.00 0.00 ? 66 ASP P HB3  9  
ATOM 10630 N N    . GLY A 1 1  ? -7.700  -0.026  32.948  1.00 0.00 ? -1 GLY P N    10 
ATOM 10631 C CA   . GLY A 1 1  ? -7.391  -0.646  31.640  1.00 0.00 ? -1 GLY P CA   10 
ATOM 10632 C C    . GLY A 1 1  ? -6.821  0.368   30.658  1.00 0.00 ? -1 GLY P C    10 
ATOM 10633 O O    . GLY A 1 1  ? -7.161  1.552   30.712  1.00 0.00 ? -1 GLY P O    10 
ATOM 10634 H H1   . GLY A 1 1  ? -8.094  -0.710  33.574  1.00 0.00 ? -1 GLY P H1   10 
ATOM 10635 H H2   . GLY A 1 1  ? -8.363  0.724   32.828  1.00 0.00 ? -1 GLY P H2   10 
ATOM 10636 H H3   . GLY A 1 1  ? -6.862  0.350   33.364  1.00 0.00 ? -1 GLY P H3   10 
ATOM 10637 H HA2  . GLY A 1 1  ? -6.666  -1.448  31.782  1.00 0.00 ? -1 GLY P HA2  10 
ATOM 10638 H HA3  . GLY A 1 1  ? -8.302  -1.065  31.211  1.00 0.00 ? -1 GLY P HA3  10 
ATOM 10639 N N    . SER A 1 2  ? -5.951  -0.083  29.750  1.00 0.00 ? 0  SER P N    10 
ATOM 10640 C CA   . SER A 1 2  ? -5.275  0.764   28.748  1.00 0.00 ? 0  SER P CA   10 
ATOM 10641 C C    . SER A 1 2  ? -6.234  1.324   27.686  1.00 0.00 ? 0  SER P C    10 
ATOM 10642 O O    . SER A 1 2  ? -7.247  0.697   27.353  1.00 0.00 ? 0  SER P O    10 
ATOM 10643 C CB   . SER A 1 2  ? -4.150  -0.020  28.058  1.00 0.00 ? 0  SER P CB   10 
ATOM 10644 O OG   . SER A 1 2  ? -3.235  -0.527  29.020  1.00 0.00 ? 0  SER P OG   10 
ATOM 10645 H H    . SER A 1 2  ? -5.691  -1.060  29.773  1.00 0.00 ? 0  SER P H    10 
ATOM 10646 H HA   . SER A 1 2  ? -4.818  1.609   29.264  1.00 0.00 ? 0  SER P HA   10 
ATOM 10647 H HB2  . SER A 1 2  ? -4.580  -0.849  27.492  1.00 0.00 ? 0  SER P HB2  10 
ATOM 10648 H HB3  . SER A 1 2  ? -3.621  0.638   27.366  1.00 0.00 ? 0  SER P HB3  10 
ATOM 10649 H HG   . SER A 1 2  ? -2.524  -1.004  28.547  1.00 0.00 ? 0  SER P HG   10 
ATOM 10650 N N    . GLN A 1 3  ? -5.899  2.486   27.116  1.00 0.00 ? 1  GLN P N    10 
ATOM 10651 C CA   . GLN A 1 3  ? -6.707  3.174   26.098  1.00 0.00 ? 1  GLN P CA   10 
ATOM 10652 C C    . GLN A 1 3  ? -6.941  2.326   24.828  1.00 0.00 ? 1  GLN P C    10 
ATOM 10653 O O    . GLN A 1 3  ? -6.114  1.493   24.448  1.00 0.00 ? 1  GLN P O    10 
ATOM 10654 C CB   . GLN A 1 3  ? -6.135  4.581   25.823  1.00 0.00 ? 1  GLN P CB   10 
ATOM 10655 C CG   . GLN A 1 3  ? -4.685  4.642   25.295  1.00 0.00 ? 1  GLN P CG   10 
ATOM 10656 C CD   . GLN A 1 3  ? -4.524  4.375   23.799  1.00 0.00 ? 1  GLN P CD   10 
ATOM 10657 O OE1  . GLN A 1 3  ? -5.465  4.383   23.018  1.00 0.00 ? 1  GLN P OE1  10 
ATOM 10658 N NE2  . GLN A 1 3  ? -3.314  4.154   23.333  1.00 0.00 ? 1  GLN P NE2  10 
ATOM 10659 H H    . GLN A 1 3  ? -5.055  2.943   27.432  1.00 0.00 ? 1  GLN P H    10 
ATOM 10660 H HA   . GLN A 1 3  ? -7.691  3.333   26.541  1.00 0.00 ? 1  GLN P HA   10 
ATOM 10661 H HB2  . GLN A 1 3  ? -6.797  5.116   25.140  1.00 0.00 ? 1  GLN P HB2  10 
ATOM 10662 H HB3  . GLN A 1 3  ? -6.157  5.126   26.769  1.00 0.00 ? 1  GLN P HB3  10 
ATOM 10663 H HG2  . GLN A 1 3  ? -4.301  5.645   25.484  1.00 0.00 ? 1  GLN P HG2  10 
ATOM 10664 H HG3  . GLN A 1 3  ? -4.058  3.947   25.852  1.00 0.00 ? 1  GLN P HG3  10 
ATOM 10665 H HE21 . GLN A 1 3  ? -2.519  4.155   23.955  1.00 0.00 ? 1  GLN P HE21 10 
ATOM 10666 H HE22 . GLN A 1 3  ? -3.200  4.002   22.344  1.00 0.00 ? 1  GLN P HE22 10 
ATOM 10667 N N    . ARG A 1 4  ? -8.094  2.527   24.176  1.00 0.00 ? 2  ARG P N    10 
ATOM 10668 C CA   . ARG A 1 4  ? -8.639  1.684   23.088  1.00 0.00 ? 2  ARG P CA   10 
ATOM 10669 C C    . ARG A 1 4  ? -8.034  1.974   21.701  1.00 0.00 ? 2  ARG P C    10 
ATOM 10670 O O    . ARG A 1 4  ? -8.760  2.148   20.719  1.00 0.00 ? 2  ARG P O    10 
ATOM 10671 C CB   . ARG A 1 4  ? -10.183 1.759   23.107  1.00 0.00 ? 2  ARG P CB   10 
ATOM 10672 C CG   . ARG A 1 4  ? -10.867 1.327   24.420  1.00 0.00 ? 2  ARG P CG   10 
ATOM 10673 C CD   . ARG A 1 4  ? -10.716 -0.165  24.756  1.00 0.00 ? 2  ARG P CD   10 
ATOM 10674 N NE   . ARG A 1 4  ? -9.418  -0.484  25.389  1.00 0.00 ? 2  ARG P NE   10 
ATOM 10675 C CZ   . ARG A 1 4  ? -8.764  -1.630  25.333  1.00 0.00 ? 2  ARG P CZ   10 
ATOM 10676 N NH1  . ARG A 1 4  ? -9.190  -2.654  24.649  1.00 0.00 ? 2  ARG P NH1  10 
ATOM 10677 N NH2  . ARG A 1 4  ? -7.647  -1.759  25.982  1.00 0.00 ? 2  ARG P NH2  10 
ATOM 10678 H H    . ARG A 1 4  ? -8.684  3.276   24.515  1.00 0.00 ? 2  ARG P H    10 
ATOM 10679 H HA   . ARG A 1 4  ? -8.361  0.648   23.289  1.00 0.00 ? 2  ARG P HA   10 
ATOM 10680 H HB2  . ARG A 1 4  ? -10.482 2.787   22.894  1.00 0.00 ? 2  ARG P HB2  10 
ATOM 10681 H HB3  . ARG A 1 4  ? -10.578 1.131   22.307  1.00 0.00 ? 2  ARG P HB3  10 
ATOM 10682 H HG2  . ARG A 1 4  ? -10.512 1.932   25.255  1.00 0.00 ? 2  ARG P HG2  10 
ATOM 10683 H HG3  . ARG A 1 4  ? -11.933 1.528   24.308  1.00 0.00 ? 2  ARG P HG3  10 
ATOM 10684 H HD2  . ARG A 1 4  ? -11.509 -0.437  25.456  1.00 0.00 ? 2  ARG P HD2  10 
ATOM 10685 H HD3  . ARG A 1 4  ? -10.860 -0.744  23.843  1.00 0.00 ? 2  ARG P HD3  10 
ATOM 10686 H HE   . ARG A 1 4  ? -9.004  0.224   25.980  1.00 0.00 ? 2  ARG P HE   10 
ATOM 10687 H HH11 . ARG A 1 4  ? -10.066 -2.587  24.159  1.00 0.00 ? 2  ARG P HH11 10 
ATOM 10688 H HH12 . ARG A 1 4  ? -8.672  -3.515  24.637  1.00 0.00 ? 2  ARG P HH12 10 
ATOM 10689 H HH21 . ARG A 1 4  ? -7.321  -0.974  26.536  1.00 0.00 ? 2  ARG P HH21 10 
ATOM 10690 H HH22 . ARG A 1 4  ? -7.134  -2.623  25.964  1.00 0.00 ? 2  ARG P HH22 10 
ATOM 10691 N N    . ARG A 1 5  ? -6.698  2.028   21.624  1.00 0.00 ? 3  ARG P N    10 
ATOM 10692 C CA   . ARG A 1 5  ? -5.884  2.279   20.411  1.00 0.00 ? 3  ARG P CA   10 
ATOM 10693 C C    . ARG A 1 5  ? -6.348  3.528   19.638  1.00 0.00 ? 3  ARG P C    10 
ATOM 10694 O O    . ARG A 1 5  ? -6.529  3.508   18.420  1.00 0.00 ? 3  ARG P O    10 
ATOM 10695 C CB   . ARG A 1 5  ? -5.768  1.006   19.541  1.00 0.00 ? 3  ARG P CB   10 
ATOM 10696 C CG   . ARG A 1 5  ? -4.960  -0.143  20.171  1.00 0.00 ? 3  ARG P CG   10 
ATOM 10697 C CD   . ARG A 1 5  ? -5.703  -0.938  21.256  1.00 0.00 ? 3  ARG P CD   10 
ATOM 10698 N NE   . ARG A 1 5  ? -4.949  -2.145  21.654  1.00 0.00 ? 3  ARG P NE   10 
ATOM 10699 C CZ   . ARG A 1 5  ? -5.005  -3.346  21.103  1.00 0.00 ? 3  ARG P CZ   10 
ATOM 10700 N NH1  . ARG A 1 5  ? -5.771  -3.613  20.082  1.00 0.00 ? 3  ARG P NH1  10 
ATOM 10701 N NH2  . ARG A 1 5  ? -4.277  -4.318  21.574  1.00 0.00 ? 3  ARG P NH2  10 
ATOM 10702 H H    . ARG A 1 5  ? -6.207  1.912   22.505  1.00 0.00 ? 3  ARG P H    10 
ATOM 10703 H HA   . ARG A 1 5  ? -4.876  2.529   20.743  1.00 0.00 ? 3  ARG P HA   10 
ATOM 10704 H HB2  . ARG A 1 5  ? -6.762  0.649   19.264  1.00 0.00 ? 3  ARG P HB2  10 
ATOM 10705 H HB3  . ARG A 1 5  ? -5.250  1.276   18.619  1.00 0.00 ? 3  ARG P HB3  10 
ATOM 10706 H HG2  . ARG A 1 5  ? -4.695  -0.833  19.369  1.00 0.00 ? 3  ARG P HG2  10 
ATOM 10707 H HG3  . ARG A 1 5  ? -4.035  0.257   20.586  1.00 0.00 ? 3  ARG P HG3  10 
ATOM 10708 H HD2  . ARG A 1 5  ? -5.827  -0.311  22.139  1.00 0.00 ? 3  ARG P HD2  10 
ATOM 10709 H HD3  . ARG A 1 5  ? -6.696  -1.212  20.897  1.00 0.00 ? 3  ARG P HD3  10 
ATOM 10710 H HE   . ARG A 1 5  ? -4.321  -2.046  22.437  1.00 0.00 ? 3  ARG P HE   10 
ATOM 10711 H HH11 . ARG A 1 5  ? -6.341  -2.884  19.691  1.00 0.00 ? 3  ARG P HH11 10 
ATOM 10712 H HH12 . ARG A 1 5  ? -5.790  -4.536  19.683  1.00 0.00 ? 3  ARG P HH12 10 
ATOM 10713 H HH21 . ARG A 1 5  ? -3.666  -4.161  22.358  1.00 0.00 ? 3  ARG P HH21 10 
ATOM 10714 H HH22 . ARG A 1 5  ? -4.318  -5.232  21.153  1.00 0.00 ? 3  ARG P HH22 10 
ATOM 10715 N N    . GLN A 1 6  ? -6.559  4.623   20.369  1.00 0.00 ? 4  GLN P N    10 
ATOM 10716 C CA   . GLN A 1 6  ? -7.132  5.886   19.885  1.00 0.00 ? 4  GLN P CA   10 
ATOM 10717 C C    . GLN A 1 6  ? -6.084  6.751   19.150  1.00 0.00 ? 4  GLN P C    10 
ATOM 10718 O O    . GLN A 1 6  ? -5.707  7.836   19.601  1.00 0.00 ? 4  GLN P O    10 
ATOM 10719 C CB   . GLN A 1 6  ? -7.831  6.586   21.071  1.00 0.00 ? 4  GLN P CB   10 
ATOM 10720 C CG   . GLN A 1 6  ? -8.718  7.780   20.678  1.00 0.00 ? 4  GLN P CG   10 
ATOM 10721 C CD   . GLN A 1 6  ? -9.837  7.399   19.709  1.00 0.00 ? 4  GLN P CD   10 
ATOM 10722 O OE1  . GLN A 1 6  ? -9.746  7.596   18.505  1.00 0.00 ? 4  GLN P OE1  10 
ATOM 10723 N NE2  . GLN A 1 6  ? -10.918 6.815   20.183  1.00 0.00 ? 4  GLN P NE2  10 
ATOM 10724 H H    . GLN A 1 6  ? -6.333  4.554   21.356  1.00 0.00 ? 4  GLN P H    10 
ATOM 10725 H HA   . GLN A 1 6  ? -7.900  5.634   19.152  1.00 0.00 ? 4  GLN P HA   10 
ATOM 10726 H HB2  . GLN A 1 6  ? -8.459  5.856   21.584  1.00 0.00 ? 4  GLN P HB2  10 
ATOM 10727 H HB3  . GLN A 1 6  ? -7.076  6.926   21.782  1.00 0.00 ? 4  GLN P HB3  10 
ATOM 10728 H HG2  . GLN A 1 6  ? -9.163  8.194   21.583  1.00 0.00 ? 4  GLN P HG2  10 
ATOM 10729 H HG3  . GLN A 1 6  ? -8.111  8.565   20.227  1.00 0.00 ? 4  GLN P HG3  10 
ATOM 10730 H HE21 . GLN A 1 6  ? -11.012 6.638   21.172  1.00 0.00 ? 4  GLN P HE21 10 
ATOM 10731 H HE22 . GLN A 1 6  ? -11.647 6.558   19.535  1.00 0.00 ? 4  GLN P HE22 10 
ATOM 10732 N N    . ARG A 1 7  ? -5.567  6.233   18.029  1.00 0.00 ? 5  ARG P N    10 
ATOM 10733 C CA   . ARG A 1 7  ? -4.555  6.842   17.138  1.00 0.00 ? 5  ARG P CA   10 
ATOM 10734 C C    . ARG A 1 7  ? -5.044  6.870   15.684  1.00 0.00 ? 5  ARG P C    10 
ATOM 10735 O O    . ARG A 1 7  ? -5.940  6.110   15.307  1.00 0.00 ? 5  ARG P O    10 
ATOM 10736 C CB   . ARG A 1 7  ? -3.226  6.056   17.236  1.00 0.00 ? 5  ARG P CB   10 
ATOM 10737 C CG   . ARG A 1 7  ? -2.530  6.011   18.612  1.00 0.00 ? 5  ARG P CG   10 
ATOM 10738 C CD   . ARG A 1 7  ? -1.910  7.342   19.065  1.00 0.00 ? 5  ARG P CD   10 
ATOM 10739 N NE   . ARG A 1 7  ? -2.932  8.287   19.544  1.00 0.00 ? 5  ARG P NE   10 
ATOM 10740 C CZ   . ARG A 1 7  ? -2.779  9.542   19.911  1.00 0.00 ? 5  ARG P CZ   10 
ATOM 10741 N NH1  . ARG A 1 7  ? -1.618  10.135  19.922  1.00 0.00 ? 5  ARG P NH1  10 
ATOM 10742 N NH2  . ARG A 1 7  ? -3.827  10.222  20.276  1.00 0.00 ? 5  ARG P NH2  10 
ATOM 10743 H H    . ARG A 1 7  ? -5.940  5.330   17.746  1.00 0.00 ? 5  ARG P H    10 
ATOM 10744 H HA   . ARG A 1 7  ? -4.383  7.881   17.421  1.00 0.00 ? 5  ARG P HA   10 
ATOM 10745 H HB2  . ARG A 1 7  ? -3.424  5.025   16.934  1.00 0.00 ? 5  ARG P HB2  10 
ATOM 10746 H HB3  . ARG A 1 7  ? -2.516  6.468   16.519  1.00 0.00 ? 5  ARG P HB3  10 
ATOM 10747 H HG2  . ARG A 1 7  ? -3.222  5.646   19.373  1.00 0.00 ? 5  ARG P HG2  10 
ATOM 10748 H HG3  . ARG A 1 7  ? -1.719  5.285   18.539  1.00 0.00 ? 5  ARG P HG3  10 
ATOM 10749 H HD2  . ARG A 1 7  ? -1.215  7.135   19.880  1.00 0.00 ? 5  ARG P HD2  10 
ATOM 10750 H HD3  . ARG A 1 7  ? -1.350  7.778   18.235  1.00 0.00 ? 5  ARG P HD3  10 
ATOM 10751 H HE   . ARG A 1 7  ? -3.881  7.942   19.604  1.00 0.00 ? 5  ARG P HE   10 
ATOM 10752 H HH11 . ARG A 1 7  ? -0.801  9.615   19.650  1.00 0.00 ? 5  ARG P HH11 10 
ATOM 10753 H HH12 . ARG A 1 7  ? -1.535  11.096  20.208  1.00 0.00 ? 5  ARG P HH12 10 
ATOM 10754 H HH21 . ARG A 1 7  ? -4.731  9.771   20.252  1.00 0.00 ? 5  ARG P HH21 10 
ATOM 10755 H HH22 . ARG A 1 7  ? -3.744  11.183  20.560  1.00 0.00 ? 5  ARG P HH22 10 
ATOM 10756 N N    . THR A 1 8  ? -4.425  7.708   14.848  1.00 0.00 ? 6  THR P N    10 
ATOM 10757 C CA   . THR A 1 8  ? -4.763  7.863   13.415  1.00 0.00 ? 6  THR P CA   10 
ATOM 10758 C C    . THR A 1 8  ? -4.466  6.597   12.593  1.00 0.00 ? 6  THR P C    10 
ATOM 10759 O O    . THR A 1 8  ? -5.151  6.334   11.604  1.00 0.00 ? 6  THR P O    10 
ATOM 10760 C CB   . THR A 1 8  ? -4.005  9.058   12.802  1.00 0.00 ? 6  THR P CB   10 
ATOM 10761 O OG1  . THR A 1 8  ? -3.981  10.143  13.712  1.00 0.00 ? 6  THR P OG1  10 
ATOM 10762 C CG2  . THR A 1 8  ? -4.656  9.575   11.516  1.00 0.00 ? 6  THR P CG2  10 
ATOM 10763 H H    . THR A 1 8  ? -3.743  8.348   15.231  1.00 0.00 ? 6  THR P H    10 
ATOM 10764 H HA   . THR A 1 8  ? -5.831  8.063   13.334  1.00 0.00 ? 6  THR P HA   10 
ATOM 10765 H HB   . THR A 1 8  ? -2.977  8.761   12.591  1.00 0.00 ? 6  THR P HB   10 
ATOM 10766 H HG1  . THR A 1 8  ? -3.436  10.848  13.316  1.00 0.00 ? 6  THR P HG1  10 
ATOM 10767 H HG21 . THR A 1 8  ? -5.682  9.888   11.716  1.00 0.00 ? 6  THR P HG21 10 
ATOM 10768 H HG22 . THR A 1 8  ? -4.661  8.794   10.757  1.00 0.00 ? 6  THR P HG22 10 
ATOM 10769 H HG23 . THR A 1 8  ? -4.089  10.422  11.130  1.00 0.00 ? 6  THR P HG23 10 
ATOM 10770 N N    . HIS A 1 9  ? -3.483  5.789   13.026  1.00 0.00 ? 7  HIS P N    10 
ATOM 10771 C CA   . HIS A 1 9  ? -3.053  4.479   12.485  1.00 0.00 ? 7  HIS P CA   10 
ATOM 10772 C C    . HIS A 1 9  ? -2.461  4.486   11.059  1.00 0.00 ? 7  HIS P C    10 
ATOM 10773 O O    . HIS A 1 9  ? -1.544  3.715   10.773  1.00 0.00 ? 7  HIS P O    10 
ATOM 10774 C CB   . HIS A 1 9  ? -4.207  3.472   12.660  1.00 0.00 ? 7  HIS P CB   10 
ATOM 10775 C CG   . HIS A 1 9  ? -3.818  2.014   12.608  1.00 0.00 ? 7  HIS P CG   10 
ATOM 10776 N ND1  . HIS A 1 9  ? -4.416  1.046   11.796  1.00 0.00 ? 7  HIS P ND1  10 
ATOM 10777 C CD2  . HIS A 1 9  ? -2.936  1.398   13.449  1.00 0.00 ? 7  HIS P CD2  10 
ATOM 10778 C CE1  . HIS A 1 9  ? -3.878  -0.129  12.164  1.00 0.00 ? 7  HIS P CE1  10 
ATOM 10779 N NE2  . HIS A 1 9  ? -2.981  0.053   13.148  1.00 0.00 ? 7  HIS P NE2  10 
ATOM 10780 H H    . HIS A 1 9  ? -2.983  6.113   13.842  1.00 0.00 ? 7  HIS P H    10 
ATOM 10781 H HA   . HIS A 1 9  ? -2.239  4.134   13.124  1.00 0.00 ? 7  HIS P HA   10 
ATOM 10782 H HB2  . HIS A 1 9  ? -4.675  3.641   13.632  1.00 0.00 ? 7  HIS P HB2  10 
ATOM 10783 H HB3  . HIS A 1 9  ? -4.964  3.658   11.898  1.00 0.00 ? 7  HIS P HB3  10 
ATOM 10784 H HD2  . HIS A 1 9  ? -2.358  1.870   14.233  1.00 0.00 ? 7  HIS P HD2  10 
ATOM 10785 H HE1  . HIS A 1 9  ? -4.138  -1.091  11.736  1.00 0.00 ? 7  HIS P HE1  10 
ATOM 10786 H HE2  . HIS A 1 9  ? -2.466  -0.686  13.616  1.00 0.00 ? 7  HIS P HE2  10 
ATOM 10787 N N    . PHE A 1 10 ? -2.923  5.379   10.187  1.00 0.00 ? 8  PHE P N    10 
ATOM 10788 C CA   . PHE A 1 10 ? -2.414  5.659   8.838   1.00 0.00 ? 8  PHE P CA   10 
ATOM 10789 C C    . PHE A 1 10 ? -1.958  7.125   8.727   1.00 0.00 ? 8  PHE P C    10 
ATOM 10790 O O    . PHE A 1 10 ? -2.345  7.968   9.542   1.00 0.00 ? 8  PHE P O    10 
ATOM 10791 C CB   . PHE A 1 10 ? -3.516  5.370   7.809   1.00 0.00 ? 8  PHE P CB   10 
ATOM 10792 C CG   . PHE A 1 10 ? -3.975  3.926   7.706   1.00 0.00 ? 8  PHE P CG   10 
ATOM 10793 C CD1  . PHE A 1 10 ? -4.908  3.407   8.626   1.00 0.00 ? 8  PHE P CD1  10 
ATOM 10794 C CD2  . PHE A 1 10 ? -3.508  3.109   6.658   1.00 0.00 ? 8  PHE P CD2  10 
ATOM 10795 C CE1  . PHE A 1 10 ? -5.358  2.080   8.508   1.00 0.00 ? 8  PHE P CE1  10 
ATOM 10796 C CE2  . PHE A 1 10 ? -3.974  1.789   6.530   1.00 0.00 ? 8  PHE P CE2  10 
ATOM 10797 C CZ   . PHE A 1 10 ? -4.896  1.272   7.457   1.00 0.00 ? 8  PHE P CZ   10 
ATOM 10798 H H    . PHE A 1 10 ? -3.692  5.956   10.502  1.00 0.00 ? 8  PHE P H    10 
ATOM 10799 H HA   . PHE A 1 10 ? -1.558  5.024   8.608   1.00 0.00 ? 8  PHE P HA   10 
ATOM 10800 H HB2  . PHE A 1 10 ? -4.378  5.989   8.055   1.00 0.00 ? 8  PHE P HB2  10 
ATOM 10801 H HB3  . PHE A 1 10 ? -3.159  5.687   6.828   1.00 0.00 ? 8  PHE P HB3  10 
ATOM 10802 H HD1  . PHE A 1 10 ? -5.287  4.032   9.423   1.00 0.00 ? 8  PHE P HD1  10 
ATOM 10803 H HD2  . PHE A 1 10 ? -2.803  3.502   5.940   1.00 0.00 ? 8  PHE P HD2  10 
ATOM 10804 H HE1  . PHE A 1 10 ? -6.068  1.684   9.223   1.00 0.00 ? 8  PHE P HE1  10 
ATOM 10805 H HE2  . PHE A 1 10 ? -3.635  1.176   5.706   1.00 0.00 ? 8  PHE P HE2  10 
ATOM 10806 H HZ   . PHE A 1 10 ? -5.263  0.260   7.355   1.00 0.00 ? 8  PHE P HZ   10 
ATOM 10807 N N    . THR A 1 11 ? -1.164  7.449   7.705   1.00 0.00 ? 9  THR P N    10 
ATOM 10808 C CA   . THR A 1 11 ? -0.724  8.828   7.412   1.00 0.00 ? 9  THR P CA   10 
ATOM 10809 C C    . THR A 1 11 ? -1.631  9.504   6.386   1.00 0.00 ? 9  THR P C    10 
ATOM 10810 O O    . THR A 1 11 ? -2.241  8.841   5.543   1.00 0.00 ? 9  THR P O    10 
ATOM 10811 C CB   . THR A 1 11 ? 0.738   8.910   6.932   1.00 0.00 ? 9  THR P CB   10 
ATOM 10812 O OG1  . THR A 1 11 ? 0.842   8.560   5.569   1.00 0.00 ? 9  THR P OG1  10 
ATOM 10813 C CG2  . THR A 1 11 ? 1.696   8.020   7.718   1.00 0.00 ? 9  THR P CG2  10 
ATOM 10814 H H    . THR A 1 11 ? -0.891  6.716   7.060   1.00 0.00 ? 9  THR P H    10 
ATOM 10815 H HA   . THR A 1 11 ? -0.778  9.414   8.330   1.00 0.00 ? 9  THR P HA   10 
ATOM 10816 H HB   . THR A 1 11 ? 1.068   9.943   7.038   1.00 0.00 ? 9  THR P HB   10 
ATOM 10817 H HG1  . THR A 1 11 ? 1.788   8.593   5.340   1.00 0.00 ? 9  THR P HG1  10 
ATOM 10818 H HG21 . THR A 1 11 ? 1.477   6.970   7.523   1.00 0.00 ? 9  THR P HG21 10 
ATOM 10819 H HG22 . THR A 1 11 ? 1.591   8.220   8.784   1.00 0.00 ? 9  THR P HG22 10 
ATOM 10820 H HG23 . THR A 1 11 ? 2.721   8.231   7.415   1.00 0.00 ? 9  THR P HG23 10 
ATOM 10821 N N    . SER A 1 12 ? -1.647  10.839  6.369   1.00 0.00 ? 10 SER P N    10 
ATOM 10822 C CA   . SER A 1 12 ? -2.346  11.633  5.343   1.00 0.00 ? 10 SER P CA   10 
ATOM 10823 C C    . SER A 1 12 ? -1.796  11.440  3.919   1.00 0.00 ? 10 SER P C    10 
ATOM 10824 O O    . SER A 1 12 ? -2.396  11.942  2.971   1.00 0.00 ? 10 SER P O    10 
ATOM 10825 C CB   . SER A 1 12 ? -2.317  13.122  5.701   1.00 0.00 ? 10 SER P CB   10 
ATOM 10826 O OG   . SER A 1 12 ? -2.694  13.333  7.055   1.00 0.00 ? 10 SER P OG   10 
ATOM 10827 H H    . SER A 1 12 ? -1.176  11.347  7.105   1.00 0.00 ? 10 SER P H    10 
ATOM 10828 H HA   . SER A 1 12 ? -3.390  11.325  5.314   1.00 0.00 ? 10 SER P HA   10 
ATOM 10829 H HB2  . SER A 1 12 ? -1.310  13.509  5.537   1.00 0.00 ? 10 SER P HB2  10 
ATOM 10830 H HB3  . SER A 1 12 ? -3.015  13.644  5.045   1.00 0.00 ? 10 SER P HB3  10 
ATOM 10831 H HG   . SER A 1 12 ? -2.686  14.294  7.231   1.00 0.00 ? 10 SER P HG   10 
ATOM 10832 N N    . GLN A 1 13 ? -0.685  10.712  3.744   1.00 0.00 ? 11 GLN P N    10 
ATOM 10833 C CA   . GLN A 1 13 ? -0.197  10.265  2.437   1.00 0.00 ? 11 GLN P CA   10 
ATOM 10834 C C    . GLN A 1 13 ? -0.755  8.873   2.086   1.00 0.00 ? 11 GLN P C    10 
ATOM 10835 O O    . GLN A 1 13 ? -1.251  8.677   0.978   1.00 0.00 ? 11 GLN P O    10 
ATOM 10836 C CB   . GLN A 1 13 ? 1.340   10.305  2.432   1.00 0.00 ? 11 GLN P CB   10 
ATOM 10837 C CG   . GLN A 1 13 ? 1.902   10.162  1.008   1.00 0.00 ? 11 GLN P CG   10 
ATOM 10838 C CD   . GLN A 1 13 ? 3.431   10.234  0.936   1.00 0.00 ? 11 GLN P CD   10 
ATOM 10839 O OE1  . GLN A 1 13 ? 4.147   10.365  1.922   1.00 0.00 ? 11 GLN P OE1  10 
ATOM 10840 N NE2  . GLN A 1 13 ? 4.000   10.150  -0.249  1.00 0.00 ? 11 GLN P NE2  10 
ATOM 10841 H H    . GLN A 1 13 ? -0.220  10.347  4.565   1.00 0.00 ? 11 GLN P H    10 
ATOM 10842 H HA   . GLN A 1 13 ? -0.547  10.959  1.672   1.00 0.00 ? 11 GLN P HA   10 
ATOM 10843 H HB2  . GLN A 1 13 ? 1.668   11.264  2.837   1.00 0.00 ? 11 GLN P HB2  10 
ATOM 10844 H HB3  . GLN A 1 13 ? 1.732   9.507   3.063   1.00 0.00 ? 11 GLN P HB3  10 
ATOM 10845 H HG2  . GLN A 1 13 ? 1.584   9.209   0.587   1.00 0.00 ? 11 GLN P HG2  10 
ATOM 10846 H HG3  . GLN A 1 13 ? 1.492   10.962  0.391   1.00 0.00 ? 11 GLN P HG3  10 
ATOM 10847 H HE21 . GLN A 1 13 ? 3.436   10.044  -1.080  1.00 0.00 ? 11 GLN P HE21 10 
ATOM 10848 H HE22 . GLN A 1 13 ? 5.006   10.198  -0.303  1.00 0.00 ? 11 GLN P HE22 10 
ATOM 10849 N N    . GLN A 1 14 ? -0.755  7.922   3.031   1.00 0.00 ? 12 GLN P N    10 
ATOM 10850 C CA   . GLN A 1 14 ? -1.266  6.559   2.815   1.00 0.00 ? 12 GLN P CA   10 
ATOM 10851 C C    . GLN A 1 14 ? -2.766  6.570   2.503   1.00 0.00 ? 12 GLN P C    10 
ATOM 10852 O O    . GLN A 1 14 ? -3.211  5.943   1.543   1.00 0.00 ? 12 GLN P O    10 
ATOM 10853 C CB   . GLN A 1 14 ? -1.021  5.703   4.064   1.00 0.00 ? 12 GLN P CB   10 
ATOM 10854 C CG   . GLN A 1 14 ? 0.464   5.428   4.304   1.00 0.00 ? 12 GLN P CG   10 
ATOM 10855 C CD   . GLN A 1 14 ? 0.713   4.713   5.627   1.00 0.00 ? 12 GLN P CD   10 
ATOM 10856 O OE1  . GLN A 1 14 ? 0.019   4.893   6.619   1.00 0.00 ? 12 GLN P OE1  10 
ATOM 10857 N NE2  . GLN A 1 14 ? 1.717   3.872   5.679   1.00 0.00 ? 12 GLN P NE2  10 
ATOM 10858 H H    . GLN A 1 14 ? -0.418  8.159   3.961   1.00 0.00 ? 12 GLN P H    10 
ATOM 10859 H HA   . GLN A 1 14 ? -0.745  6.101   1.973   1.00 0.00 ? 12 GLN P HA   10 
ATOM 10860 H HB2  . GLN A 1 14 ? -1.454  6.205   4.931   1.00 0.00 ? 12 GLN P HB2  10 
ATOM 10861 H HB3  . GLN A 1 14 ? -1.512  4.738   3.933   1.00 0.00 ? 12 GLN P HB3  10 
ATOM 10862 H HG2  . GLN A 1 14 ? 0.831   4.815   3.483   1.00 0.00 ? 12 GLN P HG2  10 
ATOM 10863 H HG3  . GLN A 1 14 ? 1.030   6.356   4.306   1.00 0.00 ? 12 GLN P HG3  10 
ATOM 10864 H HE21 . GLN A 1 14 ? 2.218   3.666   4.820   1.00 0.00 ? 12 GLN P HE21 10 
ATOM 10865 H HE22 . GLN A 1 14 ? 1.870   3.333   6.510   1.00 0.00 ? 12 GLN P HE22 10 
ATOM 10866 N N    . LEU A 1 15 ? -3.535  7.338   3.283   1.00 0.00 ? 13 LEU P N    10 
ATOM 10867 C CA   . LEU A 1 15 ? -4.987  7.493   3.140   1.00 0.00 ? 13 LEU P CA   10 
ATOM 10868 C C    . LEU A 1 15 ? -5.402  7.986   1.745   1.00 0.00 ? 13 LEU P C    10 
ATOM 10869 O O    . LEU A 1 15 ? -6.451  7.587   1.238   1.00 0.00 ? 13 LEU P O    10 
ATOM 10870 C CB   . LEU A 1 15 ? -5.468  8.488   4.210   1.00 0.00 ? 13 LEU P CB   10 
ATOM 10871 C CG   . LEU A 1 15 ? -5.302  7.982   5.658   1.00 0.00 ? 13 LEU P CG   10 
ATOM 10872 C CD1  . LEU A 1 15 ? -5.444  9.133   6.650   1.00 0.00 ? 13 LEU P CD1  10 
ATOM 10873 C CD2  . LEU A 1 15 ? -6.315  6.890   5.982   1.00 0.00 ? 13 LEU P CD2  10 
ATOM 10874 H H    . LEU A 1 15 ? -3.081  7.807   4.063   1.00 0.00 ? 13 LEU P H    10 
ATOM 10875 H HA   . LEU A 1 15 ? -5.473  6.532   3.299   1.00 0.00 ? 13 LEU P HA   10 
ATOM 10876 H HB2  . LEU A 1 15 ? -4.908  9.418   4.092   1.00 0.00 ? 13 LEU P HB2  10 
ATOM 10877 H HB3  . LEU A 1 15 ? -6.520  8.705   4.022   1.00 0.00 ? 13 LEU P HB3  10 
ATOM 10878 H HG   . LEU A 1 15 ? -4.315  7.550   5.794   1.00 0.00 ? 13 LEU P HG   10 
ATOM 10879 H HD11 . LEU A 1 15 ? -4.690  9.891   6.433   1.00 0.00 ? 13 LEU P HD11 10 
ATOM 10880 H HD12 . LEU A 1 15 ? -6.437  9.575   6.579   1.00 0.00 ? 13 LEU P HD12 10 
ATOM 10881 H HD13 . LEU A 1 15 ? -5.270  8.764   7.661   1.00 0.00 ? 13 LEU P HD13 10 
ATOM 10882 H HD21 . LEU A 1 15 ? -7.318  7.221   5.715   1.00 0.00 ? 13 LEU P HD21 10 
ATOM 10883 H HD22 . LEU A 1 15 ? -6.039  5.991   5.433   1.00 0.00 ? 13 LEU P HD22 10 
ATOM 10884 H HD23 . LEU A 1 15 ? -6.286  6.663   7.047   1.00 0.00 ? 13 LEU P HD23 10 
ATOM 10885 N N    . GLN A 1 16 ? -4.571  8.818   1.108   1.00 0.00 ? 14 GLN P N    10 
ATOM 10886 C CA   . GLN A 1 16 ? -4.824  9.329   -0.241  1.00 0.00 ? 14 GLN P CA   10 
ATOM 10887 C C    . GLN A 1 16 ? -4.563  8.273   -1.317  1.00 0.00 ? 14 GLN P C    10 
ATOM 10888 O O    . GLN A 1 16 ? -5.344  8.167   -2.258  1.00 0.00 ? 14 GLN P O    10 
ATOM 10889 C CB   . GLN A 1 16 ? -3.999  10.599  -0.502  1.00 0.00 ? 14 GLN P CB   10 
ATOM 10890 C CG   . GLN A 1 16 ? -4.429  11.768  0.396   1.00 0.00 ? 14 GLN P CG   10 
ATOM 10891 C CD   . GLN A 1 16 ? -5.899  12.133  0.205   1.00 0.00 ? 14 GLN P CD   10 
ATOM 10892 O OE1  . GLN A 1 16 ? -6.315  12.645  -0.826  1.00 0.00 ? 14 GLN P OE1  10 
ATOM 10893 N NE2  . GLN A 1 16 ? -6.744  11.822  1.165   1.00 0.00 ? 14 GLN P NE2  10 
ATOM 10894 H H    . GLN A 1 16 ? -3.704  9.061   1.564   1.00 0.00 ? 14 GLN P H    10 
ATOM 10895 H HA   . GLN A 1 16 ? -5.879  9.585   -0.324  1.00 0.00 ? 14 GLN P HA   10 
ATOM 10896 H HB2  . GLN A 1 16 ? -2.942  10.391  -0.339  1.00 0.00 ? 14 GLN P HB2  10 
ATOM 10897 H HB3  . GLN A 1 16 ? -4.128  10.897  -1.543  1.00 0.00 ? 14 GLN P HB3  10 
ATOM 10898 H HG2  . GLN A 1 16 ? -4.266  11.488  1.433   1.00 0.00 ? 14 GLN P HG2  10 
ATOM 10899 H HG3  . GLN A 1 16 ? -3.808  12.635  0.176   1.00 0.00 ? 14 GLN P HG3  10 
ATOM 10900 H HE21 . GLN A 1 16 ? -6.410  11.412  2.022   1.00 0.00 ? 14 GLN P HE21 10 
ATOM 10901 H HE22 . GLN A 1 16 ? -7.738  11.801  0.927   1.00 0.00 ? 14 GLN P HE22 10 
ATOM 10902 N N    . GLU A 1 17 ? -3.528  7.442   -1.165  1.00 0.00 ? 15 GLU P N    10 
ATOM 10903 C CA   . GLU A 1 17 ? -3.293  6.318   -2.083  1.00 0.00 ? 15 GLU P CA   10 
ATOM 10904 C C    . GLU A 1 17 ? -4.365  5.231   -1.937  1.00 0.00 ? 15 GLU P C    10 
ATOM 10905 O O    . GLU A 1 17 ? -4.793  4.652   -2.935  1.00 0.00 ? 15 GLU P O    10 
ATOM 10906 C CB   . GLU A 1 17 ? -1.889  5.727   -1.888  1.00 0.00 ? 15 GLU P CB   10 
ATOM 10907 C CG   . GLU A 1 17 ? -0.752  6.747   -2.054  1.00 0.00 ? 15 GLU P CG   10 
ATOM 10908 C CD   . GLU A 1 17 ? -0.782  7.538   -3.382  1.00 0.00 ? 15 GLU P CD   10 
ATOM 10909 O OE1  . GLU A 1 17 ? -1.203  6.995   -4.431  1.00 0.00 ? 15 GLU P OE1  10 
ATOM 10910 O OE2  . GLU A 1 17 ? -0.356  8.720   -3.387  1.00 0.00 ? 15 GLU P OE2  10 
ATOM 10911 H H    . GLU A 1 17 ? -2.929  7.549   -0.357  1.00 0.00 ? 15 GLU P H    10 
ATOM 10912 H HA   . GLU A 1 17 ? -3.369  6.673   -3.109  1.00 0.00 ? 15 GLU P HA   10 
ATOM 10913 H HB2  . GLU A 1 17 ? -1.820  5.293   -0.890  1.00 0.00 ? 15 GLU P HB2  10 
ATOM 10914 H HB3  . GLU A 1 17 ? -1.746  4.921   -2.609  1.00 0.00 ? 15 GLU P HB3  10 
ATOM 10915 H HG2  . GLU A 1 17 ? -0.790  7.442   -1.217  1.00 0.00 ? 15 GLU P HG2  10 
ATOM 10916 H HG3  . GLU A 1 17 ? 0.194   6.212   -1.969  1.00 0.00 ? 15 GLU P HG3  10 
ATOM 10917 N N    . LEU A 1 18 ? -4.862  5.008   -0.717  1.00 0.00 ? 16 LEU P N    10 
ATOM 10918 C CA   . LEU A 1 18 ? -5.957  4.085   -0.431  1.00 0.00 ? 16 LEU P CA   10 
ATOM 10919 C C    . LEU A 1 18 ? -7.273  4.565   -1.060  1.00 0.00 ? 16 LEU P C    10 
ATOM 10920 O O    . LEU A 1 18 ? -7.883  3.822   -1.831  1.00 0.00 ? 16 LEU P O    10 
ATOM 10921 C CB   . LEU A 1 18 ? -6.070  3.918   1.091   1.00 0.00 ? 16 LEU P CB   10 
ATOM 10922 C CG   . LEU A 1 18 ? -4.915  3.089   1.684   1.00 0.00 ? 16 LEU P CG   10 
ATOM 10923 C CD1  . LEU A 1 18 ? -4.732  3.397   3.166   1.00 0.00 ? 16 LEU P CD1  10 
ATOM 10924 C CD2  . LEU A 1 18 ? -5.185  1.594   1.525   1.00 0.00 ? 16 LEU P CD2  10 
ATOM 10925 H H    . LEU A 1 18 ? -4.455  5.510   0.065   1.00 0.00 ? 16 LEU P H    10 
ATOM 10926 H HA   . LEU A 1 18 ? -5.728  3.116   -0.876  1.00 0.00 ? 16 LEU P HA   10 
ATOM 10927 H HB2  . LEU A 1 18 ? -6.092  4.905   1.552   1.00 0.00 ? 16 LEU P HB2  10 
ATOM 10928 H HB3  . LEU A 1 18 ? -7.013  3.427   1.323   1.00 0.00 ? 16 LEU P HB3  10 
ATOM 10929 H HG   . LEU A 1 18 ? -3.980  3.328   1.178   1.00 0.00 ? 16 LEU P HG   10 
ATOM 10930 H HD11 . LEU A 1 18 ? -4.528  4.458   3.292   1.00 0.00 ? 16 LEU P HD11 10 
ATOM 10931 H HD12 . LEU A 1 18 ? -5.633  3.136   3.711   1.00 0.00 ? 16 LEU P HD12 10 
ATOM 10932 H HD13 . LEU A 1 18 ? -3.895  2.827   3.557   1.00 0.00 ? 16 LEU P HD13 10 
ATOM 10933 H HD21 . LEU A 1 18 ? -5.245  1.347   0.465   1.00 0.00 ? 16 LEU P HD21 10 
ATOM 10934 H HD22 . LEU A 1 18 ? -4.372  1.027   1.975   1.00 0.00 ? 16 LEU P HD22 10 
ATOM 10935 H HD23 . LEU A 1 18 ? -6.123  1.328   2.013   1.00 0.00 ? 16 LEU P HD23 10 
ATOM 10936 N N    . GLU A 1 19 ? -7.690  5.814   -0.821  1.00 0.00 ? 17 GLU P N    10 
ATOM 10937 C CA   . GLU A 1 19 ? -8.950  6.312   -1.393  1.00 0.00 ? 17 GLU P CA   10 
ATOM 10938 C C    . GLU A 1 19 ? -8.892  6.618   -2.895  1.00 0.00 ? 17 GLU P C    10 
ATOM 10939 O O    . GLU A 1 19 ? -9.935  6.603   -3.551  1.00 0.00 ? 17 GLU P O    10 
ATOM 10940 C CB   . GLU A 1 19 ? -9.572  7.440   -0.559  1.00 0.00 ? 17 GLU P CB   10 
ATOM 10941 C CG   . GLU A 1 19 ? -9.088  8.877   -0.797  1.00 0.00 ? 17 GLU P CG   10 
ATOM 10942 C CD   . GLU A 1 19 ? -9.828  9.882   0.118   1.00 0.00 ? 17 GLU P CD   10 
ATOM 10943 O OE1  . GLU A 1 19 ? -10.939 9.570   0.620   1.00 0.00 ? 17 GLU P OE1  10 
ATOM 10944 O OE2  . GLU A 1 19 ? -9.309  11.005  0.334   1.00 0.00 ? 17 GLU P OE2  10 
ATOM 10945 H H    . GLU A 1 19 ? -7.182  6.386   -0.153  1.00 0.00 ? 17 GLU P H    10 
ATOM 10946 H HA   . GLU A 1 19 ? -9.659  5.488   -1.316  1.00 0.00 ? 17 GLU P HA   10 
ATOM 10947 H HB2  . GLU A 1 19 ? -10.638 7.415   -0.775  1.00 0.00 ? 17 GLU P HB2  10 
ATOM 10948 H HB3  . GLU A 1 19 ? -9.435  7.208   0.496   1.00 0.00 ? 17 GLU P HB3  10 
ATOM 10949 H HG2  . GLU A 1 19 ? -8.014  8.920   -0.612  1.00 0.00 ? 17 GLU P HG2  10 
ATOM 10950 H HG3  . GLU A 1 19 ? -9.264  9.146   -1.841  1.00 0.00 ? 17 GLU P HG3  10 
ATOM 10951 N N    . ALA A 1 20 ? -7.697  6.815   -3.462  1.00 0.00 ? 18 ALA P N    10 
ATOM 10952 C CA   . ALA A 1 20 ? -7.495  6.897   -4.910  1.00 0.00 ? 18 ALA P CA   10 
ATOM 10953 C C    . ALA A 1 20 ? -7.499  5.510   -5.576  1.00 0.00 ? 18 ALA P C    10 
ATOM 10954 O O    . ALA A 1 20 ? -8.163  5.322   -6.596  1.00 0.00 ? 18 ALA P O    10 
ATOM 10955 C CB   . ALA A 1 20 ? -6.199  7.659   -5.208  1.00 0.00 ? 18 ALA P CB   10 
ATOM 10956 H H    . ALA A 1 20 ? -6.889  6.889   -2.855  1.00 0.00 ? 18 ALA P H    10 
ATOM 10957 H HA   . ALA A 1 20 ? -8.318  7.465   -5.345  1.00 0.00 ? 18 ALA P HA   10 
ATOM 10958 H HB1  . ALA A 1 20 ? -6.069  7.752   -6.286  1.00 0.00 ? 18 ALA P HB1  10 
ATOM 10959 H HB2  . ALA A 1 20 ? -6.250  8.659   -4.775  1.00 0.00 ? 18 ALA P HB2  10 
ATOM 10960 H HB3  . ALA A 1 20 ? -5.343  7.126   -4.792  1.00 0.00 ? 18 ALA P HB3  10 
ATOM 10961 N N    . THR A 1 21 ? -6.821  4.508   -5.002  1.00 0.00 ? 19 THR P N    10 
ATOM 10962 C CA   . THR A 1 21 ? -6.779  3.158   -5.593  1.00 0.00 ? 19 THR P CA   10 
ATOM 10963 C C    . THR A 1 21 ? -8.121  2.420   -5.465  1.00 0.00 ? 19 THR P C    10 
ATOM 10964 O O    . THR A 1 21 ? -8.496  1.634   -6.334  1.00 0.00 ? 19 THR P O    10 
ATOM 10965 C CB   . THR A 1 21 ? -5.579  2.354   -5.075  1.00 0.00 ? 19 THR P CB   10 
ATOM 10966 O OG1  . THR A 1 21 ? -5.161  1.483   -6.106  1.00 0.00 ? 19 THR P OG1  10 
ATOM 10967 C CG2  . THR A 1 21 ? -5.851  1.553   -3.802  1.00 0.00 ? 19 THR P CG2  10 
ATOM 10968 H H    . THR A 1 21 ? -6.270  4.694   -4.168  1.00 0.00 ? 19 THR P H    10 
ATOM 10969 H HA   . THR A 1 21 ? -6.611  3.298   -6.655  1.00 0.00 ? 19 THR P HA   10 
ATOM 10970 H HB   . THR A 1 21 ? -4.758  3.045   -4.886  1.00 0.00 ? 19 THR P HB   10 
ATOM 10971 H HG1  . THR A 1 21 ? -4.422  0.952   -5.764  1.00 0.00 ? 19 THR P HG1  10 
ATOM 10972 H HG21 . THR A 1 21 ? -6.410  0.646   -4.036  1.00 0.00 ? 19 THR P HG21 10 
ATOM 10973 H HG22 . THR A 1 21 ? -6.416  2.156   -3.095  1.00 0.00 ? 19 THR P HG22 10 
ATOM 10974 H HG23 . THR A 1 21 ? -4.907  1.296   -3.325  1.00 0.00 ? 19 THR P HG23 10 
ATOM 10975 N N    . PHE A 1 22 ? -8.917  2.776   -4.453  1.00 0.00 ? 20 PHE P N    10 
ATOM 10976 C CA   . PHE A 1 22 ? -10.318 2.372   -4.288  1.00 0.00 ? 20 PHE P CA   10 
ATOM 10977 C C    . PHE A 1 22 ? -11.192 2.779   -5.492  1.00 0.00 ? 20 PHE P C    10 
ATOM 10978 O O    . PHE A 1 22 ? -12.168 2.095   -5.793  1.00 0.00 ? 20 PHE P O    10 
ATOM 10979 C CB   . PHE A 1 22 ? -10.828 2.994   -2.972  1.00 0.00 ? 20 PHE P CB   10 
ATOM 10980 C CG   . PHE A 1 22 ? -12.313 2.857   -2.667  1.00 0.00 ? 20 PHE P CG   10 
ATOM 10981 C CD1  . PHE A 1 22 ? -12.956 1.604   -2.737  1.00 0.00 ? 20 PHE P CD1  10 
ATOM 10982 C CD2  . PHE A 1 22 ? -13.056 3.992   -2.286  1.00 0.00 ? 20 PHE P CD2  10 
ATOM 10983 C CE1  . PHE A 1 22 ? -14.328 1.492   -2.453  1.00 0.00 ? 20 PHE P CE1  10 
ATOM 10984 C CE2  . PHE A 1 22 ? -14.430 3.881   -2.003  1.00 0.00 ? 20 PHE P CE2  10 
ATOM 10985 C CZ   . PHE A 1 22 ? -15.066 2.630   -2.086  1.00 0.00 ? 20 PHE P CZ   10 
ATOM 10986 H H    . PHE A 1 22 ? -8.521  3.383   -3.750  1.00 0.00 ? 20 PHE P H    10 
ATOM 10987 H HA   . PHE A 1 22 ? -10.363 1.288   -4.202  1.00 0.00 ? 20 PHE P HA   10 
ATOM 10988 H HB2  . PHE A 1 22 ? -10.277 2.548   -2.144  1.00 0.00 ? 20 PHE P HB2  10 
ATOM 10989 H HB3  . PHE A 1 22 ? -10.582 4.055   -2.987  1.00 0.00 ? 20 PHE P HB3  10 
ATOM 10990 H HD1  . PHE A 1 22 ? -12.400 0.728   -3.025  1.00 0.00 ? 20 PHE P HD1  10 
ATOM 10991 H HD2  . PHE A 1 22 ? -12.572 4.956   -2.212  1.00 0.00 ? 20 PHE P HD2  10 
ATOM 10992 H HE1  . PHE A 1 22 ? -14.820 0.531   -2.526  1.00 0.00 ? 20 PHE P HE1  10 
ATOM 10993 H HE2  . PHE A 1 22 ? -15.000 4.757   -1.726  1.00 0.00 ? 20 PHE P HE2  10 
ATOM 10994 H HZ   . PHE A 1 22 ? -16.124 2.544   -1.872  1.00 0.00 ? 20 PHE P HZ   10 
ATOM 10995 N N    . GLN A 1 23 ? -10.827 3.837   -6.233  1.00 0.00 ? 21 GLN P N    10 
ATOM 10996 C CA   . GLN A 1 23 ? -11.567 4.269   -7.426  1.00 0.00 ? 21 GLN P CA   10 
ATOM 10997 C C    . GLN A 1 23 ? -11.334 3.360   -8.646  1.00 0.00 ? 21 GLN P C    10 
ATOM 10998 O O    . GLN A 1 23 ? -12.274 3.102   -9.403  1.00 0.00 ? 21 GLN P O    10 
ATOM 10999 C CB   . GLN A 1 23 ? -11.209 5.715   -7.809  1.00 0.00 ? 21 GLN P CB   10 
ATOM 11000 C CG   . GLN A 1 23 ? -11.338 6.757   -6.691  1.00 0.00 ? 21 GLN P CG   10 
ATOM 11001 C CD   . GLN A 1 23 ? -12.655 6.677   -5.926  1.00 0.00 ? 21 GLN P CD   10 
ATOM 11002 O OE1  . GLN A 1 23 ? -13.743 6.655   -6.486  1.00 0.00 ? 21 GLN P OE1  10 
ATOM 11003 N NE2  . GLN A 1 23 ? -12.602 6.621   -4.615  1.00 0.00 ? 21 GLN P NE2  10 
ATOM 11004 H H    . GLN A 1 23 ? -9.999  4.355   -5.971  1.00 0.00 ? 21 GLN P H    10 
ATOM 11005 H HA   . GLN A 1 23 ? -12.629 4.226   -7.190  1.00 0.00 ? 21 GLN P HA   10 
ATOM 11006 H HB2  . GLN A 1 23 ? -10.177 5.730   -8.153  1.00 0.00 ? 21 GLN P HB2  10 
ATOM 11007 H HB3  . GLN A 1 23 ? -11.847 6.021   -8.639  1.00 0.00 ? 21 GLN P HB3  10 
ATOM 11008 H HG2  . GLN A 1 23 ? -10.509 6.620   -6.001  1.00 0.00 ? 21 GLN P HG2  10 
ATOM 11009 H HG3  . GLN A 1 23 ? -11.240 7.755   -7.118  1.00 0.00 ? 21 GLN P HG3  10 
ATOM 11010 H HE21 . GLN A 1 23 ? -11.696 6.641   -4.151  1.00 0.00 ? 21 GLN P HE21 10 
ATOM 11011 H HE22 . GLN A 1 23 ? -13.463 6.532   -4.108  1.00 0.00 ? 21 GLN P HE22 10 
ATOM 11012 N N    . ARG A 1 24 ? -10.101 2.860   -8.838  1.00 0.00 ? 22 ARG P N    10 
ATOM 11013 C CA   . ARG A 1 24 ? -9.752  1.919   -9.925  1.00 0.00 ? 22 ARG P CA   10 
ATOM 11014 C C    . ARG A 1 24 ? -10.061 0.462   -9.573  1.00 0.00 ? 22 ARG P C    10 
ATOM 11015 O O    . ARG A 1 24 ? -10.324 -0.341  -10.469 1.00 0.00 ? 22 ARG P O    10 
ATOM 11016 C CB   . ARG A 1 24 ? -8.285  2.097   -10.367 1.00 0.00 ? 22 ARG P CB   10 
ATOM 11017 C CG   . ARG A 1 24 ? -7.257  1.779   -9.270  1.00 0.00 ? 22 ARG P CG   10 
ATOM 11018 C CD   . ARG A 1 24 ? -5.807  1.824   -9.759  1.00 0.00 ? 22 ARG P CD   10 
ATOM 11019 N NE   . ARG A 1 24 ? -5.345  3.204   -10.011 1.00 0.00 ? 22 ARG P NE   10 
ATOM 11020 C CZ   . ARG A 1 24 ? -4.619  3.963   -9.208  1.00 0.00 ? 22 ARG P CZ   10 
ATOM 11021 N NH1  . ARG A 1 24 ? -4.253  3.582   -8.016  1.00 0.00 ? 22 ARG P NH1  10 
ATOM 11022 N NH2  . ARG A 1 24 ? -4.239  5.148   -9.595  1.00 0.00 ? 22 ARG P NH2  10 
ATOM 11023 H H    . ARG A 1 24 ? -9.381  3.117   -8.175  1.00 0.00 ? 22 ARG P H    10 
ATOM 11024 H HA   . ARG A 1 24 ? -10.375 2.148   -10.793 1.00 0.00 ? 22 ARG P HA   10 
ATOM 11025 H HB2  . ARG A 1 24 ? -8.108  1.430   -11.212 1.00 0.00 ? 22 ARG P HB2  10 
ATOM 11026 H HB3  . ARG A 1 24 ? -8.141  3.124   -10.709 1.00 0.00 ? 22 ARG P HB3  10 
ATOM 11027 H HG2  . ARG A 1 24 ? -7.373  2.497   -8.465  1.00 0.00 ? 22 ARG P HG2  10 
ATOM 11028 H HG3  . ARG A 1 24 ? -7.437  0.778   -8.880  1.00 0.00 ? 22 ARG P HG3  10 
ATOM 11029 H HD2  . ARG A 1 24 ? -5.177  1.347   -9.008  1.00 0.00 ? 22 ARG P HD2  10 
ATOM 11030 H HD3  . ARG A 1 24 ? -5.725  1.237   -10.675 1.00 0.00 ? 22 ARG P HD3  10 
ATOM 11031 H HE   . ARG A 1 24 ? -5.568  3.598   -10.912 1.00 0.00 ? 22 ARG P HE   10 
ATOM 11032 H HH11 . ARG A 1 24 ? -4.548  2.680   -7.662  1.00 0.00 ? 22 ARG P HH11 10 
ATOM 11033 H HH12 . ARG A 1 24 ? -3.671  4.174   -7.450  1.00 0.00 ? 22 ARG P HH12 10 
ATOM 11034 H HH21 . ARG A 1 24 ? -4.492  5.487   -10.509 1.00 0.00 ? 22 ARG P HH21 10 
ATOM 11035 H HH22 . ARG A 1 24 ? -3.683  5.727   -8.991  1.00 0.00 ? 22 ARG P HH22 10 
ATOM 11036 N N    . ASN A 1 25 ? -10.038 0.126   -8.283  1.00 0.00 ? 23 ASN P N    10 
ATOM 11037 C CA   . ASN A 1 25 ? -10.283 -1.213  -7.761  1.00 0.00 ? 23 ASN P CA   10 
ATOM 11038 C C    . ASN A 1 25 ? -11.159 -1.127  -6.506  1.00 0.00 ? 23 ASN P C    10 
ATOM 11039 O O    . ASN A 1 25 ? -10.677 -0.826  -5.416  1.00 0.00 ? 23 ASN P O    10 
ATOM 11040 C CB   . ASN A 1 25 ? -8.928  -1.887  -7.479  1.00 0.00 ? 23 ASN P CB   10 
ATOM 11041 C CG   . ASN A 1 25 ? -9.080  -3.359  -7.123  1.00 0.00 ? 23 ASN P CG   10 
ATOM 11042 O OD1  . ASN A 1 25 ? -10.165 -3.879  -6.901  1.00 0.00 ? 23 ASN P OD1  10 
ATOM 11043 N ND2  . ASN A 1 25 ? -7.988  -4.085  -7.082  1.00 0.00 ? 23 ASN P ND2  10 
ATOM 11044 H H    . ASN A 1 25 ? -9.773  0.839   -7.611  1.00 0.00 ? 23 ASN P H    10 
ATOM 11045 H HA   . ASN A 1 25 ? -10.813 -1.809  -8.507  1.00 0.00 ? 23 ASN P HA   10 
ATOM 11046 H HB2  . ASN A 1 25 ? -8.299  -1.815  -8.366  1.00 0.00 ? 23 ASN P HB2  10 
ATOM 11047 H HB3  . ASN A 1 25 ? -8.422  -1.366  -6.663  1.00 0.00 ? 23 ASN P HB3  10 
ATOM 11048 H HD21 . ASN A 1 25 ? -7.095  -3.664  -7.272  1.00 0.00 ? 23 ASN P HD21 10 
ATOM 11049 H HD22 . ASN A 1 25 ? -8.073  -5.068  -6.877  1.00 0.00 ? 23 ASN P HD22 10 
ATOM 11050 N N    . HIS A 1 26 ? -12.455 -1.407  -6.657  1.00 0.00 ? 24 HIS P N    10 
ATOM 11051 C CA   . HIS A 1 26 ? -13.429 -1.300  -5.564  1.00 0.00 ? 24 HIS P CA   10 
ATOM 11052 C C    . HIS A 1 26 ? -13.401 -2.515  -4.624  1.00 0.00 ? 24 HIS P C    10 
ATOM 11053 O O    . HIS A 1 26 ? -14.010 -2.464  -3.555  1.00 0.00 ? 24 HIS P O    10 
ATOM 11054 C CB   . HIS A 1 26 ? -14.831 -1.057  -6.154  1.00 0.00 ? 24 HIS P CB   10 
ATOM 11055 C CG   . HIS A 1 26 ? -15.040 0.325   -6.736  1.00 0.00 ? 24 HIS P CG   10 
ATOM 11056 N ND1  . HIS A 1 26 ? -15.974 1.260   -6.275  1.00 0.00 ? 24 HIS P ND1  10 
ATOM 11057 C CD2  . HIS A 1 26 ? -14.371 0.869   -7.797  1.00 0.00 ? 24 HIS P CD2  10 
ATOM 11058 C CE1  . HIS A 1 26 ? -15.829 2.347   -7.054  1.00 0.00 ? 24 HIS P CE1  10 
ATOM 11059 N NE2  . HIS A 1 26 ? -14.876 2.136   -7.977  1.00 0.00 ? 24 HIS P NE2  10 
ATOM 11060 H H    . HIS A 1 26 ? -12.787 -1.695  -7.565  1.00 0.00 ? 24 HIS P H    10 
ATOM 11061 H HA   . HIS A 1 26 ? -13.181 -0.431  -4.952  1.00 0.00 ? 24 HIS P HA   10 
ATOM 11062 H HB2  . HIS A 1 26 ? -15.035 -1.798  -6.928  1.00 0.00 ? 24 HIS P HB2  10 
ATOM 11063 H HB3  . HIS A 1 26 ? -15.570 -1.197  -5.364  1.00 0.00 ? 24 HIS P HB3  10 
ATOM 11064 H HD2  . HIS A 1 26 ? -13.576 0.409   -8.367  1.00 0.00 ? 24 HIS P HD2  10 
ATOM 11065 H HE1  . HIS A 1 26 ? -16.399 3.265   -6.953  1.00 0.00 ? 24 HIS P HE1  10 
ATOM 11066 H HE2  . HIS A 1 26 ? -14.561 2.811   -8.669  1.00 0.00 ? 24 HIS P HE2  10 
ATOM 11067 N N    . TYR A 1 27 ? -12.722 -3.605  -4.994  1.00 0.00 ? 25 TYR P N    10 
ATOM 11068 C CA   . TYR A 1 27 ? -12.715 -4.883  -4.269  1.00 0.00 ? 25 TYR P CA   10 
ATOM 11069 C C    . TYR A 1 27 ? -11.379 -5.647  -4.456  1.00 0.00 ? 25 TYR P C    10 
ATOM 11070 O O    . TYR A 1 27 ? -11.348 -6.711  -5.084  1.00 0.00 ? 25 TYR P O    10 
ATOM 11071 C CB   . TYR A 1 27 ? -13.969 -5.706  -4.650  1.00 0.00 ? 25 TYR P CB   10 
ATOM 11072 C CG   . TYR A 1 27 ? -14.334 -5.762  -6.129  1.00 0.00 ? 25 TYR P CG   10 
ATOM 11073 C CD1  . TYR A 1 27 ? -15.193 -4.785  -6.674  1.00 0.00 ? 25 TYR P CD1  10 
ATOM 11074 C CD2  . TYR A 1 27 ? -13.848 -6.795  -6.955  1.00 0.00 ? 25 TYR P CD2  10 
ATOM 11075 C CE1  . TYR A 1 27 ? -15.529 -4.814  -8.041  1.00 0.00 ? 25 TYR P CE1  10 
ATOM 11076 C CE2  . TYR A 1 27 ? -14.184 -6.831  -8.323  1.00 0.00 ? 25 TYR P CE2  10 
ATOM 11077 C CZ   . TYR A 1 27 ? -15.023 -5.836  -8.871  1.00 0.00 ? 25 TYR P CZ   10 
ATOM 11078 O OH   . TYR A 1 27 ? -15.354 -5.861  -10.193 1.00 0.00 ? 25 TYR P OH   10 
ATOM 11079 H H    . TYR A 1 27 ? -12.186 -3.561  -5.853  1.00 0.00 ? 25 TYR P H    10 
ATOM 11080 H HA   . TYR A 1 27 ? -12.793 -4.672  -3.203  1.00 0.00 ? 25 TYR P HA   10 
ATOM 11081 H HB2  . TYR A 1 27 ? -13.864 -6.722  -4.265  1.00 0.00 ? 25 TYR P HB2  10 
ATOM 11082 H HB3  . TYR A 1 27 ? -14.818 -5.272  -4.118  1.00 0.00 ? 25 TYR P HB3  10 
ATOM 11083 H HD1  . TYR A 1 27 ? -15.597 -4.009  -6.038  1.00 0.00 ? 25 TYR P HD1  10 
ATOM 11084 H HD2  . TYR A 1 27 ? -13.211 -7.566  -6.542  1.00 0.00 ? 25 TYR P HD2  10 
ATOM 11085 H HE1  . TYR A 1 27 ? -16.179 -4.058  -8.461  1.00 0.00 ? 25 TYR P HE1  10 
ATOM 11086 H HE2  . TYR A 1 27 ? -13.801 -7.621  -8.953  1.00 0.00 ? 25 TYR P HE2  10 
ATOM 11087 H HH   . TYR A 1 27 ? -14.951 -6.613  -10.660 1.00 0.00 ? 25 TYR P HH   10 
ATOM 11088 N N    . PRO A 1 28 ? -10.250 -5.123  -3.934  1.00 0.00 ? 26 PRO P N    10 
ATOM 11089 C CA   . PRO A 1 28 ? -8.939  -5.756  -4.072  1.00 0.00 ? 26 PRO P CA   10 
ATOM 11090 C C    . PRO A 1 28 ? -8.841  -7.091  -3.309  1.00 0.00 ? 26 PRO P C    10 
ATOM 11091 O O    . PRO A 1 28 ? -9.575  -7.360  -2.354  1.00 0.00 ? 26 PRO P O    10 
ATOM 11092 C CB   . PRO A 1 28 ? -7.932  -4.712  -3.583  1.00 0.00 ? 26 PRO P CB   10 
ATOM 11093 C CG   . PRO A 1 28 ? -8.729  -3.950  -2.529  1.00 0.00 ? 26 PRO P CG   10 
ATOM 11094 C CD   . PRO A 1 28 ? -10.128 -3.903  -3.146  1.00 0.00 ? 26 PRO P CD   10 
ATOM 11095 H HA   . PRO A 1 28 ? -8.743  -5.955  -5.126  1.00 0.00 ? 26 PRO P HA   10 
ATOM 11096 H HB2  . PRO A 1 28 ? -7.024  -5.157  -3.182  1.00 0.00 ? 26 PRO P HB2  10 
ATOM 11097 H HB3  . PRO A 1 28 ? -7.677  -4.036  -4.398  1.00 0.00 ? 26 PRO P HB3  10 
ATOM 11098 H HG2  . PRO A 1 28 ? -8.754  -4.528  -1.607  1.00 0.00 ? 26 PRO P HG2  10 
ATOM 11099 H HG3  . PRO A 1 28 ? -8.323  -2.954  -2.355  1.00 0.00 ? 26 PRO P HG3  10 
ATOM 11100 H HD2  . PRO A 1 28 ? -10.881 -3.854  -2.359  1.00 0.00 ? 26 PRO P HD2  10 
ATOM 11101 H HD3  . PRO A 1 28 ? -10.210 -3.037  -3.803  1.00 0.00 ? 26 PRO P HD3  10 
ATOM 11102 N N    . ASP A 1 29 ? -7.899  -7.927  -3.735  1.00 0.00 ? 27 ASP P N    10 
ATOM 11103 C CA   . ASP A 1 29 ? -7.660  -9.305  -3.273  1.00 0.00 ? 27 ASP P CA   10 
ATOM 11104 C C    . ASP A 1 29 ? -6.239  -9.440  -2.700  1.00 0.00 ? 27 ASP P C    10 
ATOM 11105 O O    . ASP A 1 29 ? -5.495  -8.467  -2.688  1.00 0.00 ? 27 ASP P O    10 
ATOM 11106 C CB   . ASP A 1 29 ? -7.909  -10.263 -4.457  1.00 0.00 ? 27 ASP P CB   10 
ATOM 11107 C CG   . ASP A 1 29 ? -8.051  -11.750 -4.076  1.00 0.00 ? 27 ASP P CG   10 
ATOM 11108 O OD1  . ASP A 1 29 ? -8.136  -12.075 -2.867  1.00 0.00 ? 27 ASP P OD1  10 
ATOM 11109 O OD2  . ASP A 1 29 ? -8.076  -12.601 -4.995  1.00 0.00 ? 27 ASP P OD2  10 
ATOM 11110 H H    . ASP A 1 29 ? -7.257  -7.560  -4.434  1.00 0.00 ? 27 ASP P H    10 
ATOM 11111 H HA   . ASP A 1 29 ? -8.363  -9.546  -2.477  1.00 0.00 ? 27 ASP P HA   10 
ATOM 11112 H HB2  . ASP A 1 29 ? -8.830  -9.963  -4.950  1.00 0.00 ? 27 ASP P HB2  10 
ATOM 11113 H HB3  . ASP A 1 29 ? -7.096  -10.147 -5.176  1.00 0.00 ? 27 ASP P HB3  10 
ATOM 11114 N N    . MET A 1 30 ? -5.819  -10.620 -2.236  1.00 0.00 ? 28 MET P N    10 
ATOM 11115 C CA   . MET A 1 30 ? -4.473  -10.832 -1.668  1.00 0.00 ? 28 MET P CA   10 
ATOM 11116 C C    . MET A 1 30 ? -3.336  -10.326 -2.573  1.00 0.00 ? 28 MET P C    10 
ATOM 11117 O O    . MET A 1 30 ? -2.318  -9.850  -2.076  1.00 0.00 ? 28 MET P O    10 
ATOM 11118 C CB   . MET A 1 30 ? -4.262  -12.318 -1.329  1.00 0.00 ? 28 MET P CB   10 
ATOM 11119 C CG   . MET A 1 30 ? -4.314  -13.251 -2.551  1.00 0.00 ? 28 MET P CG   10 
ATOM 11120 S SD   . MET A 1 30 ? -3.716  -14.936 -2.253  1.00 0.00 ? 28 MET P SD   10 
ATOM 11121 C CE   . MET A 1 30 ? -1.929  -14.608 -2.259  1.00 0.00 ? 28 MET P CE   10 
ATOM 11122 H H    . MET A 1 30 ? -6.473  -11.399 -2.276  1.00 0.00 ? 28 MET P H    10 
ATOM 11123 H HA   . MET A 1 30 ? -4.398  -10.266 -0.738  1.00 0.00 ? 28 MET P HA   10 
ATOM 11124 H HB2  . MET A 1 30 ? -3.289  -12.417 -0.849  1.00 0.00 ? 28 MET P HB2  10 
ATOM 11125 H HB3  . MET A 1 30 ? -5.021  -12.635 -0.612  1.00 0.00 ? 28 MET P HB3  10 
ATOM 11126 H HG2  . MET A 1 30 ? -5.341  -13.297 -2.910  1.00 0.00 ? 28 MET P HG2  10 
ATOM 11127 H HG3  . MET A 1 30 ? -3.707  -12.842 -3.356  1.00 0.00 ? 28 MET P HG3  10 
ATOM 11128 H HE1  . MET A 1 30 ? -1.662  -13.979 -1.410  1.00 0.00 ? 28 MET P HE1  10 
ATOM 11129 H HE2  . MET A 1 30 ? -1.383  -15.550 -2.191  1.00 0.00 ? 28 MET P HE2  10 
ATOM 11130 H HE3  . MET A 1 30 ? -1.649  -14.094 -3.181  1.00 0.00 ? 28 MET P HE3  10 
ATOM 11131 N N    . SER A 1 31 ? -3.520  -10.372 -3.893  1.00 0.00 ? 29 SER P N    10 
ATOM 11132 C CA   . SER A 1 31 ? -2.556  -9.904  -4.889  1.00 0.00 ? 29 SER P CA   10 
ATOM 11133 C C    . SER A 1 31 ? -2.547  -8.377  -5.014  1.00 0.00 ? 29 SER P C    10 
ATOM 11134 O O    . SER A 1 31 ? -1.493  -7.744  -4.939  1.00 0.00 ? 29 SER P O    10 
ATOM 11135 C CB   . SER A 1 31 ? -2.891  -10.553 -6.235  1.00 0.00 ? 29 SER P CB   10 
ATOM 11136 O OG   . SER A 1 31 ? -4.263  -10.365 -6.565  1.00 0.00 ? 29 SER P OG   10 
ATOM 11137 H H    . SER A 1 31 ? -4.407  -10.707 -4.244  1.00 0.00 ? 29 SER P H    10 
ATOM 11138 H HA   . SER A 1 31 ? -1.560  -10.228 -4.587  1.00 0.00 ? 29 SER P HA   10 
ATOM 11139 H HB2  . SER A 1 31 ? -2.260  -10.122 -7.013  1.00 0.00 ? 29 SER P HB2  10 
ATOM 11140 H HB3  . SER A 1 31 ? -2.695  -11.623 -6.158  1.00 0.00 ? 29 SER P HB3  10 
ATOM 11141 H HG   . SER A 1 31 ? -4.436  -10.804 -7.420  1.00 0.00 ? 29 SER P HG   10 
ATOM 11142 N N    . THR A 1 32 ? -3.725  -7.769  -5.160  1.00 0.00 ? 30 THR P N    10 
ATOM 11143 C CA   . THR A 1 32 ? -3.887  -6.321  -5.356  1.00 0.00 ? 30 THR P CA   10 
ATOM 11144 C C    . THR A 1 32 ? -3.741  -5.521  -4.062  1.00 0.00 ? 30 THR P C    10 
ATOM 11145 O O    . THR A 1 32 ? -3.151  -4.445  -4.088  1.00 0.00 ? 30 THR P O    10 
ATOM 11146 C CB   . THR A 1 32 ? -5.197  -5.967  -6.075  1.00 0.00 ? 30 THR P CB   10 
ATOM 11147 O OG1  . THR A 1 32 ? -6.229  -6.893  -5.825  1.00 0.00 ? 30 THR P OG1  10 
ATOM 11148 C CG2  . THR A 1 32 ? -4.998  -5.942  -7.589  1.00 0.00 ? 30 THR P CG2  10 
ATOM 11149 H H    . THR A 1 32 ? -4.549  -8.354  -5.205  1.00 0.00 ? 30 THR P H    10 
ATOM 11150 H HA   . THR A 1 32 ? -3.078  -5.986  -6.000  1.00 0.00 ? 30 THR P HA   10 
ATOM 11151 H HB   . THR A 1 32 ? -5.533  -4.987  -5.740  1.00 0.00 ? 30 THR P HB   10 
ATOM 11152 H HG1  . THR A 1 32 ? -6.193  -7.561  -6.531  1.00 0.00 ? 30 THR P HG1  10 
ATOM 11153 H HG21 . THR A 1 32 ? -4.584  -6.893  -7.929  1.00 0.00 ? 30 THR P HG21 10 
ATOM 11154 H HG22 . THR A 1 32 ? -4.308  -5.139  -7.853  1.00 0.00 ? 30 THR P HG22 10 
ATOM 11155 H HG23 . THR A 1 32 ? -5.948  -5.766  -8.092  1.00 0.00 ? 30 THR P HG23 10 
ATOM 11156 N N    . ARG A 1 33 ? -4.175  -6.044  -2.911  1.00 0.00 ? 31 ARG P N    10 
ATOM 11157 C CA   . ARG A 1 33 ? -3.928  -5.447  -1.590  1.00 0.00 ? 31 ARG P CA   10 
ATOM 11158 C C    . ARG A 1 33 ? -2.434  -5.343  -1.281  1.00 0.00 ? 31 ARG P C    10 
ATOM 11159 O O    . ARG A 1 33 ? -1.979  -4.291  -0.841  1.00 0.00 ? 31 ARG P O    10 
ATOM 11160 C CB   . ARG A 1 33 ? -4.649  -6.262  -0.501  1.00 0.00 ? 31 ARG P CB   10 
ATOM 11161 C CG   . ARG A 1 33 ? -6.173  -6.056  -0.553  1.00 0.00 ? 31 ARG P CG   10 
ATOM 11162 C CD   . ARG A 1 33 ? -6.927  -6.651  0.642   1.00 0.00 ? 31 ARG P CD   10 
ATOM 11163 N NE   . ARG A 1 33 ? -7.063  -8.117  0.557   1.00 0.00 ? 31 ARG P NE   10 
ATOM 11164 C CZ   . ARG A 1 33 ? -6.359  -9.024  1.210   1.00 0.00 ? 31 ARG P CZ   10 
ATOM 11165 N NH1  . ARG A 1 33 ? -5.465  -8.718  2.098   1.00 0.00 ? 31 ARG P NH1  10 
ATOM 11166 N NH2  . ARG A 1 33 ? -6.531  -10.293 0.997   1.00 0.00 ? 31 ARG P NH2  10 
ATOM 11167 H H    . ARG A 1 33 ? -4.691  -6.918  -2.949  1.00 0.00 ? 31 ARG P H    10 
ATOM 11168 H HA   . ARG A 1 33 ? -4.312  -4.426  -1.601  1.00 0.00 ? 31 ARG P HA   10 
ATOM 11169 H HB2  . ARG A 1 33 ? -4.398  -7.318  -0.632  1.00 0.00 ? 31 ARG P HB2  10 
ATOM 11170 H HB3  . ARG A 1 33 ? -4.289  -5.939  0.476   1.00 0.00 ? 31 ARG P HB3  10 
ATOM 11171 H HG2  . ARG A 1 33 ? -6.374  -4.985  -0.571  1.00 0.00 ? 31 ARG P HG2  10 
ATOM 11172 H HG3  . ARG A 1 33 ? -6.572  -6.490  -1.467  1.00 0.00 ? 31 ARG P HG3  10 
ATOM 11173 H HD2  . ARG A 1 33 ? -6.426  -6.357  1.561   1.00 0.00 ? 31 ARG P HD2  10 
ATOM 11174 H HD3  . ARG A 1 33 ? -7.928  -6.216  0.653   1.00 0.00 ? 31 ARG P HD3  10 
ATOM 11175 H HE   . ARG A 1 33 ? -7.757  -8.465  -0.087  1.00 0.00 ? 31 ARG P HE   10 
ATOM 11176 H HH11 . ARG A 1 33 ? -5.300  -7.757  2.361   1.00 0.00 ? 31 ARG P HH11 10 
ATOM 11177 H HH12 . ARG A 1 33 ? -4.826  -9.455  2.399   1.00 0.00 ? 31 ARG P HH12 10 
ATOM 11178 H HH21 . ARG A 1 33 ? -7.218  -10.625 0.341   1.00 0.00 ? 31 ARG P HH21 10 
ATOM 11179 H HH22 . ARG A 1 33 ? -5.946  -10.950 1.491   1.00 0.00 ? 31 ARG P HH22 10 
ATOM 11180 N N    . GLU A 1 34 ? -1.654  -6.384  -1.572  1.00 0.00 ? 32 GLU P N    10 
ATOM 11181 C CA   . GLU A 1 34 ? -0.187  -6.297  -1.511  1.00 0.00 ? 32 GLU P CA   10 
ATOM 11182 C C    . GLU A 1 34 ? 0.356   -5.266  -2.511  1.00 0.00 ? 32 GLU P C    10 
ATOM 11183 O O    . GLU A 1 34 ? 1.194   -4.444  -2.150  1.00 0.00 ? 32 GLU P O    10 
ATOM 11184 C CB   . GLU A 1 34 ? 0.478   -7.656  -1.793  1.00 0.00 ? 32 GLU P CB   10 
ATOM 11185 C CG   . GLU A 1 34 ? 0.397   -8.628  -0.615  1.00 0.00 ? 32 GLU P CG   10 
ATOM 11186 C CD   . GLU A 1 34 ? 1.306   -9.857  -0.839  1.00 0.00 ? 32 GLU P CD   10 
ATOM 11187 O OE1  . GLU A 1 34 ? 1.080   -10.645 -1.790  1.00 0.00 ? 32 GLU P OE1  10 
ATOM 11188 O OE2  . GLU A 1 34 ? 2.283   -10.034 -0.069  1.00 0.00 ? 32 GLU P OE2  10 
ATOM 11189 H H    . GLU A 1 34 ? -2.090  -7.225  -1.919  1.00 0.00 ? 32 GLU P H    10 
ATOM 11190 H HA   . GLU A 1 34 ? 0.104   -5.959  -0.515  1.00 0.00 ? 32 GLU P HA   10 
ATOM 11191 H HB2  . GLU A 1 34 ? 0.034   -8.108  -2.679  1.00 0.00 ? 32 GLU P HB2  10 
ATOM 11192 H HB3  . GLU A 1 34 ? 1.533   -7.477  -1.998  1.00 0.00 ? 32 GLU P HB3  10 
ATOM 11193 H HG2  . GLU A 1 34 ? 0.715   -8.099  0.286   1.00 0.00 ? 32 GLU P HG2  10 
ATOM 11194 H HG3  . GLU A 1 34 ? -0.640  -8.938  -0.471  1.00 0.00 ? 32 GLU P HG3  10 
ATOM 11195 N N    . GLU A 1 35 ? -0.146  -5.263  -3.748  1.00 0.00 ? 33 GLU P N    10 
ATOM 11196 C CA   . GLU A 1 35 ? 0.342   -4.380  -4.821  1.00 0.00 ? 33 GLU P CA   10 
ATOM 11197 C C    . GLU A 1 35 ? 0.265   -2.881  -4.474  1.00 0.00 ? 33 GLU P C    10 
ATOM 11198 O O    . GLU A 1 35 ? 1.150   -2.135  -4.894  1.00 0.00 ? 33 GLU P O    10 
ATOM 11199 C CB   . GLU A 1 35 ? -0.400  -4.689  -6.133  1.00 0.00 ? 33 GLU P CB   10 
ATOM 11200 C CG   . GLU A 1 35 ? 0.069   -3.834  -7.315  1.00 0.00 ? 33 GLU P CG   10 
ATOM 11201 C CD   . GLU A 1 35 ? -0.467  -4.386  -8.649  1.00 0.00 ? 33 GLU P CD   10 
ATOM 11202 O OE1  . GLU A 1 35 ? -1.598  -4.023  -9.052  1.00 0.00 ? 33 GLU P OE1  10 
ATOM 11203 O OE2  . GLU A 1 35 ? 0.247   -5.179  -9.313  1.00 0.00 ? 33 GLU P OE2  10 
ATOM 11204 H H    . GLU A 1 35 ? -0.821  -5.986  -3.980  1.00 0.00 ? 33 GLU P H    10 
ATOM 11205 H HA   . GLU A 1 35 ? 1.400   -4.603  -4.979  1.00 0.00 ? 33 GLU P HA   10 
ATOM 11206 H HB2  . GLU A 1 35 ? -0.243  -5.740  -6.378  1.00 0.00 ? 33 GLU P HB2  10 
ATOM 11207 H HB3  . GLU A 1 35 ? -1.465  -4.516  -5.999  1.00 0.00 ? 33 GLU P HB3  10 
ATOM 11208 H HG2  . GLU A 1 35 ? -0.276  -2.806  -7.177  1.00 0.00 ? 33 GLU P HG2  10 
ATOM 11209 H HG3  . GLU A 1 35 ? 1.159   -3.812  -7.328  1.00 0.00 ? 33 GLU P HG3  10 
ATOM 11210 N N    . ILE A 1 36 ? -0.720  -2.428  -3.686  1.00 0.00 ? 34 ILE P N    10 
ATOM 11211 C CA   . ILE A 1 36 ? -0.782  -1.032  -3.199  1.00 0.00 ? 34 ILE P CA   10 
ATOM 11212 C C    . ILE A 1 36 ? 0.042   -0.837  -1.914  1.00 0.00 ? 34 ILE P C    10 
ATOM 11213 O O    . ILE A 1 36 ? 0.625   0.227   -1.706  1.00 0.00 ? 34 ILE P O    10 
ATOM 11214 C CB   . ILE A 1 36 ? -2.239  -0.501  -3.097  1.00 0.00 ? 34 ILE P CB   10 
ATOM 11215 C CG1  . ILE A 1 36 ? -2.947  -0.763  -1.750  1.00 0.00 ? 34 ILE P CG1  10 
ATOM 11216 C CG2  . ILE A 1 36 ? -3.119  -1.056  -4.232  1.00 0.00 ? 34 ILE P CG2  10 
ATOM 11217 C CD1  . ILE A 1 36 ? -2.743  0.368   -0.730  1.00 0.00 ? 34 ILE P CD1  10 
ATOM 11218 H H    . ILE A 1 36 ? -1.459  -3.070  -3.426  1.00 0.00 ? 34 ILE P H    10 
ATOM 11219 H HA   . ILE A 1 36 ? -0.304  -0.401  -3.947  1.00 0.00 ? 34 ILE P HA   10 
ATOM 11220 H HB   . ILE A 1 36 ? -2.196  0.580   -3.230  1.00 0.00 ? 34 ILE P HB   10 
ATOM 11221 H HG12 . ILE A 1 36 ? -4.023  -0.850  -1.911  1.00 0.00 ? 34 ILE P HG12 10 
ATOM 11222 H HG13 . ILE A 1 36 ? -2.598  -1.707  -1.336  1.00 0.00 ? 34 ILE P HG13 10 
ATOM 11223 H HG21 . ILE A 1 36 ? -4.049  -0.497  -4.300  1.00 0.00 ? 34 ILE P HG21 10 
ATOM 11224 H HG22 . ILE A 1 36 ? -2.591  -1.002  -5.187  1.00 0.00 ? 34 ILE P HG22 10 
ATOM 11225 H HG23 . ILE A 1 36 ? -3.382  -2.089  -4.018  1.00 0.00 ? 34 ILE P HG23 10 
ATOM 11226 H HD11 . ILE A 1 36 ? -3.243  0.097   0.194   1.00 0.00 ? 34 ILE P HD11 10 
ATOM 11227 H HD12 . ILE A 1 36 ? -3.172  1.299   -1.109  1.00 0.00 ? 34 ILE P HD12 10 
ATOM 11228 H HD13 . ILE A 1 36 ? -1.692  0.529   -0.509  1.00 0.00 ? 34 ILE P HD13 10 
ATOM 11229 N N    . ALA A 1 37 ? 0.135   -1.862  -1.061  1.00 0.00 ? 35 ALA P N    10 
ATOM 11230 C CA   . ALA A 1 37 ? 0.826   -1.804  0.231   1.00 0.00 ? 35 ALA P CA   10 
ATOM 11231 C C    . ALA A 1 37 ? 2.359   -1.699  0.090   1.00 0.00 ? 35 ALA P C    10 
ATOM 11232 O O    . ALA A 1 37 ? 3.042   -1.094  0.922   1.00 0.00 ? 35 ALA P O    10 
ATOM 11233 C CB   . ALA A 1 37 ? 0.435   -3.056  1.022   1.00 0.00 ? 35 ALA P CB   10 
ATOM 11234 H H    . ALA A 1 37 ? -0.295  -2.739  -1.322  1.00 0.00 ? 35 ALA P H    10 
ATOM 11235 H HA   . ALA A 1 37 ? 0.472   -0.933  0.775   1.00 0.00 ? 35 ALA P HA   10 
ATOM 11236 H HB1  . ALA A 1 37 ? 0.914   -3.036  1.995   1.00 0.00 ? 35 ALA P HB1  10 
ATOM 11237 H HB2  . ALA A 1 37 ? -0.643  -3.087  1.164   1.00 0.00 ? 35 ALA P HB2  10 
ATOM 11238 H HB3  . ALA A 1 37 ? 0.757   -3.953  0.494   1.00 0.00 ? 35 ALA P HB3  10 
ATOM 11239 N N    . VAL A 1 38 ? 2.881   -2.273  -0.996  1.00 0.00 ? 36 VAL P N    10 
ATOM 11240 C CA   . VAL A 1 38 ? 4.303   -2.470  -1.318  1.00 0.00 ? 36 VAL P CA   10 
ATOM 11241 C C    . VAL A 1 38 ? 5.109   -1.169  -1.405  1.00 0.00 ? 36 VAL P C    10 
ATOM 11242 O O    . VAL A 1 38 ? 6.290   -1.160  -1.052  1.00 0.00 ? 36 VAL P O    10 
ATOM 11243 C CB   . VAL A 1 38 ? 4.362   -3.302  -2.625  1.00 0.00 ? 36 VAL P CB   10 
ATOM 11244 C CG1  . VAL A 1 38 ? 5.544   -3.036  -3.560  1.00 0.00 ? 36 VAL P CG1  10 
ATOM 11245 C CG2  . VAL A 1 38 ? 4.353   -4.798  -2.289  1.00 0.00 ? 36 VAL P CG2  10 
ATOM 11246 H H    . VAL A 1 38 ? 2.215   -2.737  -1.604  1.00 0.00 ? 36 VAL P H    10 
ATOM 11247 H HA   . VAL A 1 38 ? 4.756   -3.043  -0.509  1.00 0.00 ? 36 VAL P HA   10 
ATOM 11248 H HB   . VAL A 1 38 ? 3.467   -3.086  -3.211  1.00 0.00 ? 36 VAL P HB   10 
ATOM 11249 H HG11 . VAL A 1 38 ? 5.505   -2.008  -3.921  1.00 0.00 ? 36 VAL P HG11 10 
ATOM 11250 H HG12 . VAL A 1 38 ? 6.487   -3.215  -3.041  1.00 0.00 ? 36 VAL P HG12 10 
ATOM 11251 H HG13 . VAL A 1 38 ? 5.471   -3.694  -4.426  1.00 0.00 ? 36 VAL P HG13 10 
ATOM 11252 H HG21 . VAL A 1 38 ? 4.175   -5.376  -3.197  1.00 0.00 ? 36 VAL P HG21 10 
ATOM 11253 H HG22 . VAL A 1 38 ? 5.306   -5.092  -1.849  1.00 0.00 ? 36 VAL P HG22 10 
ATOM 11254 H HG23 . VAL A 1 38 ? 3.556   -5.019  -1.580  1.00 0.00 ? 36 VAL P HG23 10 
ATOM 11255 N N    . TRP A 1 39 ? 4.482   -0.068  -1.824  1.00 0.00 ? 37 TRP P N    10 
ATOM 11256 C CA   . TRP A 1 39 ? 5.110   1.254   -1.976  1.00 0.00 ? 37 TRP P CA   10 
ATOM 11257 C C    . TRP A 1 39 ? 4.523   2.323   -1.041  1.00 0.00 ? 37 TRP P C    10 
ATOM 11258 O O    . TRP A 1 39 ? 4.884   3.499   -1.131  1.00 0.00 ? 37 TRP P O    10 
ATOM 11259 C CB   . TRP A 1 39 ? 5.084   1.667   -3.454  1.00 0.00 ? 37 TRP P CB   10 
ATOM 11260 C CG   . TRP A 1 39 ? 3.767   1.490   -4.136  1.00 0.00 ? 37 TRP P CG   10 
ATOM 11261 C CD1  . TRP A 1 39 ? 3.329   0.337   -4.682  1.00 0.00 ? 37 TRP P CD1  10 
ATOM 11262 C CD2  . TRP A 1 39 ? 2.683   2.449   -4.306  1.00 0.00 ? 37 TRP P CD2  10 
ATOM 11263 N NE1  . TRP A 1 39 ? 2.037   0.497   -5.124  1.00 0.00 ? 37 TRP P NE1  10 
ATOM 11264 C CE2  . TRP A 1 39 ? 1.576   1.778   -4.910  1.00 0.00 ? 37 TRP P CE2  10 
ATOM 11265 C CE3  . TRP A 1 39 ? 2.523   3.812   -3.991  1.00 0.00 ? 37 TRP P CE3  10 
ATOM 11266 C CZ2  . TRP A 1 39 ? 0.354   2.422   -5.157  1.00 0.00 ? 37 TRP P CZ2  10 
ATOM 11267 C CZ3  . TRP A 1 39 ? 1.310   4.474   -4.255  1.00 0.00 ? 37 TRP P CZ3  10 
ATOM 11268 C CH2  . TRP A 1 39 ? 0.223   3.781   -4.822  1.00 0.00 ? 37 TRP P CH2  10 
ATOM 11269 H H    . TRP A 1 39 ? 3.513   -0.150  -2.105  1.00 0.00 ? 37 TRP P H    10 
ATOM 11270 H HA   . TRP A 1 39 ? 6.155   1.175   -1.691  1.00 0.00 ? 37 TRP P HA   10 
ATOM 11271 H HB2  . TRP A 1 39 ? 5.396   2.706   -3.543  1.00 0.00 ? 37 TRP P HB2  10 
ATOM 11272 H HB3  . TRP A 1 39 ? 5.816   1.071   -3.989  1.00 0.00 ? 37 TRP P HB3  10 
ATOM 11273 H HD1  . TRP A 1 39 ? 3.884   -0.593  -4.707  1.00 0.00 ? 37 TRP P HD1  10 
ATOM 11274 H HE1  . TRP A 1 39 ? 1.489   -0.304  -5.436  1.00 0.00 ? 37 TRP P HE1  10 
ATOM 11275 H HE3  . TRP A 1 39 ? 3.353   4.339   -3.539  1.00 0.00 ? 37 TRP P HE3  10 
ATOM 11276 H HZ2  . TRP A 1 39 ? -0.469  1.881   -5.604  1.00 0.00 ? 37 TRP P HZ2  10 
ATOM 11277 H HZ3  . TRP A 1 39 ? 1.209   5.524   -4.016  1.00 0.00 ? 37 TRP P HZ3  10 
ATOM 11278 H HH2  . TRP A 1 39 ? -0.710  4.301   -5.004  1.00 0.00 ? 37 TRP P HH2  10 
ATOM 11279 N N    . THR A 1 40 ? 3.646   1.919   -0.116  1.00 0.00 ? 38 THR P N    10 
ATOM 11280 C CA   . THR A 1 40 ? 2.984   2.809   0.860   1.00 0.00 ? 38 THR P CA   10 
ATOM 11281 C C    . THR A 1 40 ? 3.373   2.513   2.311   1.00 0.00 ? 38 THR P C    10 
ATOM 11282 O O    . THR A 1 40 ? 2.832   3.126   3.228   1.00 0.00 ? 38 THR P O    10 
ATOM 11283 C CB   . THR A 1 40 ? 1.456   2.802   0.678   1.00 0.00 ? 38 THR P CB   10 
ATOM 11284 O OG1  . THR A 1 40 ? 0.953   1.495   0.793   1.00 0.00 ? 38 THR P OG1  10 
ATOM 11285 C CG2  . THR A 1 40 ? 1.060   3.317   -0.707  1.00 0.00 ? 38 THR P CG2  10 
ATOM 11286 H H    . THR A 1 40 ? 3.394   0.937   -0.099  1.00 0.00 ? 38 THR P H    10 
ATOM 11287 H HA   . THR A 1 40 ? 3.308   3.834   0.684   1.00 0.00 ? 38 THR P HA   10 
ATOM 11288 H HB   . THR A 1 40 ? 0.991   3.430   1.444   1.00 0.00 ? 38 THR P HB   10 
ATOM 11289 H HG1  . THR A 1 40 ? 0.852   1.157   -0.115  1.00 0.00 ? 38 THR P HG1  10 
ATOM 11290 H HG21 . THR A 1 40 ? 1.515   2.700   -1.487  1.00 0.00 ? 38 THR P HG21 10 
ATOM 11291 H HG22 . THR A 1 40 ? 1.406   4.341   -0.827  1.00 0.00 ? 38 THR P HG22 10 
ATOM 11292 H HG23 . THR A 1 40 ? -0.024  3.288   -0.816  1.00 0.00 ? 38 THR P HG23 10 
ATOM 11293 N N    . ASN A 1 41 ? 4.339   1.612   2.540   1.00 0.00 ? 39 ASN P N    10 
ATOM 11294 C CA   . ASN A 1 41 ? 4.782   1.161   3.871   1.00 0.00 ? 39 ASN P CA   10 
ATOM 11295 C C    . ASN A 1 41 ? 3.641   0.531   4.709   1.00 0.00 ? 39 ASN P C    10 
ATOM 11296 O O    . ASN A 1 41 ? 3.522   0.758   5.917   1.00 0.00 ? 39 ASN P O    10 
ATOM 11297 C CB   . ASN A 1 41 ? 5.566   2.295   4.567   1.00 0.00 ? 39 ASN P CB   10 
ATOM 11298 C CG   . ASN A 1 41 ? 6.597   1.794   5.569   1.00 0.00 ? 39 ASN P CG   10 
ATOM 11299 O OD1  . ASN A 1 41 ? 7.799   1.857   5.345   1.00 0.00 ? 39 ASN P OD1  10 
ATOM 11300 N ND2  . ASN A 1 41 ? 6.175   1.277   6.700   1.00 0.00 ? 39 ASN P ND2  10 
ATOM 11301 H H    . ASN A 1 41 ? 4.757   1.171   1.732   1.00 0.00 ? 39 ASN P H    10 
ATOM 11302 H HA   . ASN A 1 41 ? 5.490   0.349   3.693   1.00 0.00 ? 39 ASN P HA   10 
ATOM 11303 H HB2  . ASN A 1 41 ? 6.093   2.886   3.820   1.00 0.00 ? 39 ASN P HB2  10 
ATOM 11304 H HB3  . ASN A 1 41 ? 4.864   2.955   5.075   1.00 0.00 ? 39 ASN P HB3  10 
ATOM 11305 H HD21 . ASN A 1 41 ? 5.176   1.167   6.844   1.00 0.00 ? 39 ASN P HD21 10 
ATOM 11306 H HD22 . ASN A 1 41 ? 6.852   0.939   7.367   1.00 0.00 ? 39 ASN P HD22 10 
ATOM 11307 N N    . LEU A 1 42 ? 2.785   -0.250  4.048   1.00 0.00 ? 40 LEU P N    10 
ATOM 11308 C CA   . LEU A 1 42 ? 1.685   -1.025  4.635   1.00 0.00 ? 40 LEU P CA   10 
ATOM 11309 C C    . LEU A 1 42 ? 1.895   -2.541  4.425   1.00 0.00 ? 40 LEU P C    10 
ATOM 11310 O O    . LEU A 1 42 ? 2.895   -2.983  3.855   1.00 0.00 ? 40 LEU P O    10 
ATOM 11311 C CB   . LEU A 1 42 ? 0.357   -0.536  4.009   1.00 0.00 ? 40 LEU P CB   10 
ATOM 11312 C CG   . LEU A 1 42 ? -0.037  0.921   4.307   1.00 0.00 ? 40 LEU P CG   10 
ATOM 11313 C CD1  . LEU A 1 42 ? -1.332  1.257   3.568   1.00 0.00 ? 40 LEU P CD1  10 
ATOM 11314 C CD2  . LEU A 1 42 ? -0.276  1.145   5.800   1.00 0.00 ? 40 LEU P CD2  10 
ATOM 11315 H H    . LEU A 1 42 ? 2.945   -0.362  3.054   1.00 0.00 ? 40 LEU P H    10 
ATOM 11316 H HA   . LEU A 1 42 ? 1.646   -0.866  5.713   1.00 0.00 ? 40 LEU P HA   10 
ATOM 11317 H HB2  . LEU A 1 42 ? 0.430   -0.646  2.932   1.00 0.00 ? 40 LEU P HB2  10 
ATOM 11318 H HB3  . LEU A 1 42 ? -0.460  -1.174  4.344   1.00 0.00 ? 40 LEU P HB3  10 
ATOM 11319 H HG   . LEU A 1 42 ? 0.743   1.596   3.962   1.00 0.00 ? 40 LEU P HG   10 
ATOM 11320 H HD11 . LEU A 1 42 ? -1.600  2.295   3.759   1.00 0.00 ? 40 LEU P HD11 10 
ATOM 11321 H HD12 . LEU A 1 42 ? -1.183  1.131   2.496   1.00 0.00 ? 40 LEU P HD12 10 
ATOM 11322 H HD13 . LEU A 1 42 ? -2.138  0.603   3.896   1.00 0.00 ? 40 LEU P HD13 10 
ATOM 11323 H HD21 . LEU A 1 42 ? -0.627  2.161   5.968   1.00 0.00 ? 40 LEU P HD21 10 
ATOM 11324 H HD22 . LEU A 1 42 ? -1.021  0.447   6.167   1.00 0.00 ? 40 LEU P HD22 10 
ATOM 11325 H HD23 . LEU A 1 42 ? 0.657   1.009   6.345   1.00 0.00 ? 40 LEU P HD23 10 
ATOM 11326 N N    . THR A 1 43 ? 0.923   -3.342  4.870   1.00 0.00 ? 41 THR P N    10 
ATOM 11327 C CA   . THR A 1 43 ? 0.792   -4.780  4.569   1.00 0.00 ? 41 THR P CA   10 
ATOM 11328 C C    . THR A 1 43 ? -0.638  -5.081  4.106   1.00 0.00 ? 41 THR P C    10 
ATOM 11329 O O    . THR A 1 43 ? -1.542  -4.272  4.318   1.00 0.00 ? 41 THR P O    10 
ATOM 11330 C CB   . THR A 1 43 ? 1.229   -5.645  5.763   1.00 0.00 ? 41 THR P CB   10 
ATOM 11331 O OG1  . THR A 1 43 ? 1.226   -7.006  5.391   1.00 0.00 ? 41 THR P OG1  10 
ATOM 11332 C CG2  . THR A 1 43 ? 0.333   -5.495  6.994   1.00 0.00 ? 41 THR P CG2  10 
ATOM 11333 H H    . THR A 1 43 ? 0.133   -2.908  5.325   1.00 0.00 ? 41 THR P H    10 
ATOM 11334 H HA   . THR A 1 43 ? 1.449   -5.032  3.736   1.00 0.00 ? 41 THR P HA   10 
ATOM 11335 H HB   . THR A 1 43 ? 2.247   -5.365  6.037   1.00 0.00 ? 41 THR P HB   10 
ATOM 11336 H HG1  . THR A 1 43 ? 1.671   -7.507  6.098   1.00 0.00 ? 41 THR P HG1  10 
ATOM 11337 H HG21 . THR A 1 43 ? 0.693   -6.148  7.790   1.00 0.00 ? 41 THR P HG21 10 
ATOM 11338 H HG22 . THR A 1 43 ? -0.695  -5.762  6.752   1.00 0.00 ? 41 THR P HG22 10 
ATOM 11339 H HG23 . THR A 1 43 ? 0.371   -4.467  7.350   1.00 0.00 ? 41 THR P HG23 10 
ATOM 11340 N N    . GLU A 1 44 ? -0.885  -6.232  3.477   1.00 0.00 ? 42 GLU P N    10 
ATOM 11341 C CA   . GLU A 1 44 ? -2.182  -6.548  2.854   1.00 0.00 ? 42 GLU P CA   10 
ATOM 11342 C C    . GLU A 1 44 ? -3.376  -6.538  3.827   1.00 0.00 ? 42 GLU P C    10 
ATOM 11343 O O    . GLU A 1 44 ? -4.511  -6.285  3.411   1.00 0.00 ? 42 GLU P O    10 
ATOM 11344 C CB   . GLU A 1 44 ? -2.092  -7.892  2.114   1.00 0.00 ? 42 GLU P CB   10 
ATOM 11345 C CG   . GLU A 1 44 ? -1.857  -9.122  3.010   1.00 0.00 ? 42 GLU P CG   10 
ATOM 11346 C CD   . GLU A 1 44 ? -2.312  -10.424 2.325   1.00 0.00 ? 42 GLU P CD   10 
ATOM 11347 O OE1  . GLU A 1 44 ? -3.543  -10.671 2.295   1.00 0.00 ? 42 GLU P OE1  10 
ATOM 11348 O OE2  . GLU A 1 44 ? -1.455  -11.208 1.853   1.00 0.00 ? 42 GLU P OE2  10 
ATOM 11349 H H    . GLU A 1 44 ? -0.128  -6.901  3.400   1.00 0.00 ? 42 GLU P H    10 
ATOM 11350 H HA   . GLU A 1 44 ? -2.385  -5.774  2.113   1.00 0.00 ? 42 GLU P HA   10 
ATOM 11351 H HB2  . GLU A 1 44 ? -3.010  -8.025  1.548   1.00 0.00 ? 42 GLU P HB2  10 
ATOM 11352 H HB3  . GLU A 1 44 ? -1.281  -7.823  1.399   1.00 0.00 ? 42 GLU P HB3  10 
ATOM 11353 H HG2  . GLU A 1 44 ? -0.798  -9.172  3.276   1.00 0.00 ? 42 GLU P HG2  10 
ATOM 11354 H HG3  . GLU A 1 44 ? -2.419  -9.024  3.939   1.00 0.00 ? 42 GLU P HG3  10 
ATOM 11355 N N    . ALA A 1 45 ? -3.121  -6.781  5.115   1.00 0.00 ? 43 ALA P N    10 
ATOM 11356 C CA   . ALA A 1 45 ? -4.116  -6.727  6.184   1.00 0.00 ? 43 ALA P CA   10 
ATOM 11357 C C    . ALA A 1 45 ? -4.547  -5.287  6.511   1.00 0.00 ? 43 ALA P C    10 
ATOM 11358 O O    . ALA A 1 45 ? -5.735  -5.044  6.710   1.00 0.00 ? 43 ALA P O    10 
ATOM 11359 C CB   . ALA A 1 45 ? -3.547  -7.449  7.412   1.00 0.00 ? 43 ALA P CB   10 
ATOM 11360 H H    . ALA A 1 45 ? -2.172  -7.032  5.354   1.00 0.00 ? 43 ALA P H    10 
ATOM 11361 H HA   . ALA A 1 45 ? -5.006  -7.269  5.858   1.00 0.00 ? 43 ALA P HA   10 
ATOM 11362 H HB1  . ALA A 1 45 ? -4.295  -7.467  8.204   1.00 0.00 ? 43 ALA P HB1  10 
ATOM 11363 H HB2  . ALA A 1 45 ? -3.288  -8.477  7.151   1.00 0.00 ? 43 ALA P HB2  10 
ATOM 11364 H HB3  . ALA A 1 45 ? -2.656  -6.935  7.777   1.00 0.00 ? 43 ALA P HB3  10 
ATOM 11365 N N    . ARG A 1 46 ? -3.625  -4.310  6.482   1.00 0.00 ? 44 ARG P N    10 
ATOM 11366 C CA   . ARG A 1 46 ? -3.947  -2.873  6.620   1.00 0.00 ? 44 ARG P CA   10 
ATOM 11367 C C    . ARG A 1 46 ? -4.902  -2.420  5.524   1.00 0.00 ? 44 ARG P C    10 
ATOM 11368 O O    . ARG A 1 46 ? -5.885  -1.744  5.806   1.00 0.00 ? 44 ARG P O    10 
ATOM 11369 C CB   . ARG A 1 46 ? -2.676  -2.008  6.537   1.00 0.00 ? 44 ARG P CB   10 
ATOM 11370 C CG   . ARG A 1 46 ? -1.764  -2.074  7.765   1.00 0.00 ? 44 ARG P CG   10 
ATOM 11371 C CD   . ARG A 1 46 ? -2.468  -1.490  8.995   1.00 0.00 ? 44 ARG P CD   10 
ATOM 11372 N NE   . ARG A 1 46 ? -1.515  -0.805  9.888   1.00 0.00 ? 44 ARG P NE   10 
ATOM 11373 C CZ   . ARG A 1 46 ? -1.350  0.503   10.003  1.00 0.00 ? 44 ARG P CZ   10 
ATOM 11374 N NH1  . ARG A 1 46 ? -2.021  1.371   9.305   1.00 0.00 ? 44 ARG P NH1  10 
ATOM 11375 N NH2  . ARG A 1 46 ? -0.490  0.999   10.843  1.00 0.00 ? 44 ARG P NH2  10 
ATOM 11376 H H    . ARG A 1 46 ? -2.677  -4.570  6.245   1.00 0.00 ? 44 ARG P H    10 
ATOM 11377 H HA   . ARG A 1 46 ? -4.459  -2.701  7.568   1.00 0.00 ? 44 ARG P HA   10 
ATOM 11378 H HB2  . ARG A 1 46 ? -2.106  -2.279  5.652   1.00 0.00 ? 44 ARG P HB2  10 
ATOM 11379 H HB3  . ARG A 1 46 ? -2.974  -0.968  6.402   1.00 0.00 ? 44 ARG P HB3  10 
ATOM 11380 H HG2  . ARG A 1 46 ? -1.471  -3.103  7.966   1.00 0.00 ? 44 ARG P HG2  10 
ATOM 11381 H HG3  . ARG A 1 46 ? -0.865  -1.494  7.552   1.00 0.00 ? 44 ARG P HG3  10 
ATOM 11382 H HD2  . ARG A 1 46 ? -3.245  -0.794  8.678   1.00 0.00 ? 44 ARG P HD2  10 
ATOM 11383 H HD3  . ARG A 1 46 ? -2.963  -2.306  9.523   1.00 0.00 ? 44 ARG P HD3  10 
ATOM 11384 H HE   . ARG A 1 46 ? -0.935  -1.386  10.474  1.00 0.00 ? 44 ARG P HE   10 
ATOM 11385 H HH11 . ARG A 1 46 ? -2.756  1.077   8.688   1.00 0.00 ? 44 ARG P HH11 10 
ATOM 11386 H HH12 . ARG A 1 46 ? -1.904  2.350   9.524   1.00 0.00 ? 44 ARG P HH12 10 
ATOM 11387 H HH21 . ARG A 1 46 ? 0.068   0.401   11.428  1.00 0.00 ? 44 ARG P HH21 10 
ATOM 11388 H HH22 . ARG A 1 46 ? -0.462  2.003   10.957  1.00 0.00 ? 44 ARG P HH22 10 
ATOM 11389 N N    . VAL A 1 47 ? -4.634  -2.836  4.288   1.00 0.00 ? 45 VAL P N    10 
ATOM 11390 C CA   . VAL A 1 47 ? -5.478  -2.515  3.127   1.00 0.00 ? 45 VAL P CA   10 
ATOM 11391 C C    . VAL A 1 47 ? -6.859  -3.159  3.278   1.00 0.00 ? 45 VAL P C    10 
ATOM 11392 O O    . VAL A 1 47 ? -7.870  -2.484  3.104   1.00 0.00 ? 45 VAL P O    10 
ATOM 11393 C CB   . VAL A 1 47 ? -4.801  -2.933  1.808   1.00 0.00 ? 45 VAL P CB   10 
ATOM 11394 C CG1  . VAL A 1 47 ? -5.553  -2.370  0.598   1.00 0.00 ? 45 VAL P CG1  10 
ATOM 11395 C CG2  . VAL A 1 47 ? -3.356  -2.428  1.746   1.00 0.00 ? 45 VAL P CG2  10 
ATOM 11396 H H    . VAL A 1 47 ? -3.782  -3.367  4.154   1.00 0.00 ? 45 VAL P H    10 
ATOM 11397 H HA   . VAL A 1 47 ? -5.624  -1.434  3.099   1.00 0.00 ? 45 VAL P HA   10 
ATOM 11398 H HB   . VAL A 1 47 ? -4.789  -4.020  1.737   1.00 0.00 ? 45 VAL P HB   10 
ATOM 11399 H HG11 . VAL A 1 47 ? -5.575  -1.282  0.648   1.00 0.00 ? 45 VAL P HG11 10 
ATOM 11400 H HG12 . VAL A 1 47 ? -5.055  -2.671  -0.322  1.00 0.00 ? 45 VAL P HG12 10 
ATOM 11401 H HG13 . VAL A 1 47 ? -6.576  -2.748  0.574   1.00 0.00 ? 45 VAL P HG13 10 
ATOM 11402 H HG21 . VAL A 1 47 ? -2.948  -2.591  0.751   1.00 0.00 ? 45 VAL P HG21 10 
ATOM 11403 H HG22 . VAL A 1 47 ? -3.314  -1.366  1.983   1.00 0.00 ? 45 VAL P HG22 10 
ATOM 11404 H HG23 . VAL A 1 47 ? -2.731  -2.977  2.447   1.00 0.00 ? 45 VAL P HG23 10 
ATOM 11405 N N    . ARG A 1 48 ? -6.924  -4.430  3.703   1.00 0.00 ? 46 ARG P N    10 
ATOM 11406 C CA   . ARG A 1 48 ? -8.195  -5.132  3.966   1.00 0.00 ? 46 ARG P CA   10 
ATOM 11407 C C    . ARG A 1 48 ? -9.024  -4.440  5.056   1.00 0.00 ? 46 ARG P C    10 
ATOM 11408 O O    . ARG A 1 48 ? -10.214 -4.202  4.866   1.00 0.00 ? 46 ARG P O    10 
ATOM 11409 C CB   . ARG A 1 48 ? -7.896  -6.600  4.317   1.00 0.00 ? 46 ARG P CB   10 
ATOM 11410 C CG   . ARG A 1 48 ? -9.102  -7.505  4.042   1.00 0.00 ? 46 ARG P CG   10 
ATOM 11411 C CD   . ARG A 1 48 ? -8.739  -8.972  4.289   1.00 0.00 ? 46 ARG P CD   10 
ATOM 11412 N NE   . ARG A 1 48 ? -9.769  -9.870  3.733   1.00 0.00 ? 46 ARG P NE   10 
ATOM 11413 C CZ   . ARG A 1 48 ? -10.770 -10.452 4.374   1.00 0.00 ? 46 ARG P CZ   10 
ATOM 11414 N NH1  . ARG A 1 48 ? -10.975 -10.282 5.650   1.00 0.00 ? 46 ARG P NH1  10 
ATOM 11415 N NH2  . ARG A 1 48 ? -11.600 -11.224 3.735   1.00 0.00 ? 46 ARG P NH2  10 
ATOM 11416 H H    . ARG A 1 48 ? -6.052  -4.934  3.835   1.00 0.00 ? 46 ARG P H    10 
ATOM 11417 H HA   . ARG A 1 48 ? -8.793  -5.099  3.053   1.00 0.00 ? 46 ARG P HA   10 
ATOM 11418 H HB2  . ARG A 1 48 ? -7.070  -6.952  3.703   1.00 0.00 ? 46 ARG P HB2  10 
ATOM 11419 H HB3  . ARG A 1 48 ? -7.599  -6.685  5.364   1.00 0.00 ? 46 ARG P HB3  10 
ATOM 11420 H HG2  . ARG A 1 48 ? -9.939  -7.222  4.682   1.00 0.00 ? 46 ARG P HG2  10 
ATOM 11421 H HG3  . ARG A 1 48 ? -9.399  -7.386  2.998   1.00 0.00 ? 46 ARG P HG3  10 
ATOM 11422 H HD2  . ARG A 1 48 ? -7.791  -9.194  3.796   1.00 0.00 ? 46 ARG P HD2  10 
ATOM 11423 H HD3  . ARG A 1 48 ? -8.599  -9.141  5.359   1.00 0.00 ? 46 ARG P HD3  10 
ATOM 11424 H HE   . ARG A 1 48 ? -9.706  -10.050 2.743   1.00 0.00 ? 46 ARG P HE   10 
ATOM 11425 H HH11 . ARG A 1 48 ? -10.352 -9.695  6.176   1.00 0.00 ? 46 ARG P HH11 10 
ATOM 11426 H HH12 . ARG A 1 48 ? -11.741 -10.743 6.111   1.00 0.00 ? 46 ARG P HH12 10 
ATOM 11427 H HH21 . ARG A 1 48 ? -11.483 -11.390 2.748   1.00 0.00 ? 46 ARG P HH21 10 
ATOM 11428 H HH22 . ARG A 1 48 ? -12.360 -11.666 4.223   1.00 0.00 ? 46 ARG P HH22 10 
ATOM 11429 N N    . VAL A 1 49 ? -8.381  -4.050  6.159   1.00 0.00 ? 47 VAL P N    10 
ATOM 11430 C CA   . VAL A 1 49 ? -8.991  -3.293  7.268   1.00 0.00 ? 47 VAL P CA   10 
ATOM 11431 C C    . VAL A 1 49 ? -9.468  -1.915  6.810   1.00 0.00 ? 47 VAL P C    10 
ATOM 11432 O O    . VAL A 1 49 ? -10.580 -1.516  7.155   1.00 0.00 ? 47 VAL P O    10 
ATOM 11433 C CB   . VAL A 1 49 ? -7.999  -3.186  8.449   1.00 0.00 ? 47 VAL P CB   10 
ATOM 11434 C CG1  . VAL A 1 49 ? -8.423  -2.183  9.529   1.00 0.00 ? 47 VAL P CG1  10 
ATOM 11435 C CG2  . VAL A 1 49 ? -7.858  -4.549  9.136   1.00 0.00 ? 47 VAL P CG2  10 
ATOM 11436 H H    . VAL A 1 49 ? -7.404  -4.310  6.241   1.00 0.00 ? 47 VAL P H    10 
ATOM 11437 H HA   . VAL A 1 49 ? -9.872  -3.830  7.617   1.00 0.00 ? 47 VAL P HA   10 
ATOM 11438 H HB   . VAL A 1 49 ? -7.023  -2.880  8.070   1.00 0.00 ? 47 VAL P HB   10 
ATOM 11439 H HG11 . VAL A 1 49 ? -9.420  -2.425  9.897   1.00 0.00 ? 47 VAL P HG11 10 
ATOM 11440 H HG12 . VAL A 1 49 ? -7.718  -2.219  10.360  1.00 0.00 ? 47 VAL P HG12 10 
ATOM 11441 H HG13 . VAL A 1 49 ? -8.415  -1.168  9.131   1.00 0.00 ? 47 VAL P HG13 10 
ATOM 11442 H HG21 . VAL A 1 49 ? -7.583  -5.315  8.414   1.00 0.00 ? 47 VAL P HG21 10 
ATOM 11443 H HG22 . VAL A 1 49 ? -7.076  -4.497  9.894   1.00 0.00 ? 47 VAL P HG22 10 
ATOM 11444 H HG23 . VAL A 1 49 ? -8.802  -4.830  9.605   1.00 0.00 ? 47 VAL P HG23 10 
ATOM 11445 N N    . TRP A 1 50 ? -8.689  -1.194  6.000   1.00 0.00 ? 48 TRP P N    10 
ATOM 11446 C CA   . TRP A 1 50 ? -9.069  0.132   5.508   1.00 0.00 ? 48 TRP P CA   10 
ATOM 11447 C C    . TRP A 1 50 ? -10.270 0.073   4.558   1.00 0.00 ? 48 TRP P C    10 
ATOM 11448 O O    . TRP A 1 50 ? -11.234 0.811   4.747   1.00 0.00 ? 48 TRP P O    10 
ATOM 11449 C CB   . TRP A 1 50 ? -7.881  0.803   4.824   1.00 0.00 ? 48 TRP P CB   10 
ATOM 11450 C CG   . TRP A 1 50 ? -8.126  2.243   4.500   1.00 0.00 ? 48 TRP P CG   10 
ATOM 11451 C CD1  . TRP A 1 50 ? -7.760  3.289   5.274   1.00 0.00 ? 48 TRP P CD1  10 
ATOM 11452 C CD2  . TRP A 1 50 ? -8.830  2.823   3.355   1.00 0.00 ? 48 TRP P CD2  10 
ATOM 11453 N NE1  . TRP A 1 50 ? -8.157  4.469   4.676   1.00 0.00 ? 48 TRP P NE1  10 
ATOM 11454 C CE2  . TRP A 1 50 ? -8.817  4.243   3.490   1.00 0.00 ? 48 TRP P CE2  10 
ATOM 11455 C CE3  . TRP A 1 50 ? -9.475  2.299   2.213   1.00 0.00 ? 48 TRP P CE3  10 
ATOM 11456 C CZ2  . TRP A 1 50 ? -9.396  5.094   2.539   1.00 0.00 ? 48 TRP P CZ2  10 
ATOM 11457 C CZ3  . TRP A 1 50 ? -10.097 3.138   1.271   1.00 0.00 ? 48 TRP P CZ3  10 
ATOM 11458 C CH2  . TRP A 1 50 ? -10.063 4.530   1.437   1.00 0.00 ? 48 TRP P CH2  10 
ATOM 11459 H H    . TRP A 1 50 ? -7.764  -1.546  5.769   1.00 0.00 ? 48 TRP P H    10 
ATOM 11460 H HA   . TRP A 1 50 ? -9.354  0.750   6.359   1.00 0.00 ? 48 TRP P HA   10 
ATOM 11461 H HB2  . TRP A 1 50 ? -7.010  0.743   5.478   1.00 0.00 ? 48 TRP P HB2  10 
ATOM 11462 H HB3  . TRP A 1 50 ? -7.651  0.261   3.906   1.00 0.00 ? 48 TRP P HB3  10 
ATOM 11463 H HD1  . TRP A 1 50 ? -7.221  3.208   6.214   1.00 0.00 ? 48 TRP P HD1  10 
ATOM 11464 H HE1  . TRP A 1 50 ? -7.983  5.380   5.084   1.00 0.00 ? 48 TRP P HE1  10 
ATOM 11465 H HE3  . TRP A 1 50 ? -9.497  1.235   2.067   1.00 0.00 ? 48 TRP P HE3  10 
ATOM 11466 H HZ2  . TRP A 1 50 ? -9.322  6.166   2.656   1.00 0.00 ? 48 TRP P HZ2  10 
ATOM 11467 H HZ3  . TRP A 1 50 ? -10.595 2.707   0.412   1.00 0.00 ? 48 TRP P HZ3  10 
ATOM 11468 H HH2  . TRP A 1 50 ? -10.554 5.162   0.712   1.00 0.00 ? 48 TRP P HH2  10 
ATOM 11469 N N    . PHE A 1 51 ? -10.268 -0.844  3.585   1.00 0.00 ? 49 PHE P N    10 
ATOM 11470 C CA   . PHE A 1 51 ? -11.392 -1.027  2.658   1.00 0.00 ? 49 PHE P CA   10 
ATOM 11471 C C    . PHE A 1 51 ? -12.658 -1.513  3.397   1.00 0.00 ? 49 PHE P C    10 
ATOM 11472 O O    . PHE A 1 51 ? -13.767 -1.117  3.030   1.00 0.00 ? 49 PHE P O    10 
ATOM 11473 C CB   . PHE A 1 51 ? -10.973 -1.964  1.506   1.00 0.00 ? 49 PHE P CB   10 
ATOM 11474 C CG   . PHE A 1 51 ? -10.225 -1.297  0.351   1.00 0.00 ? 49 PHE P CG   10 
ATOM 11475 C CD1  . PHE A 1 51 ? -8.923  -0.776  0.515   1.00 0.00 ? 49 PHE P CD1  10 
ATOM 11476 C CD2  . PHE A 1 51 ? -10.828 -1.213  -0.921  1.00 0.00 ? 49 PHE P CD2  10 
ATOM 11477 C CE1  . PHE A 1 51 ? -8.245  -0.173  -0.561  1.00 0.00 ? 49 PHE P CE1  10 
ATOM 11478 C CE2  . PHE A 1 51 ? -10.142 -0.628  -1.998  1.00 0.00 ? 49 PHE P CE2  10 
ATOM 11479 C CZ   . PHE A 1 51 ? -8.856  -0.100  -1.821  1.00 0.00 ? 49 PHE P CZ   10 
ATOM 11480 H H    . PHE A 1 51 ? -9.446  -1.430  3.472   1.00 0.00 ? 49 PHE P H    10 
ATOM 11481 H HA   . PHE A 1 51 ? -11.646 -0.060  2.221   1.00 0.00 ? 49 PHE P HA   10 
ATOM 11482 H HB2  . PHE A 1 51 ? -10.366 -2.780  1.901   1.00 0.00 ? 49 PHE P HB2  10 
ATOM 11483 H HB3  . PHE A 1 51 ? -11.877 -2.419  1.099   1.00 0.00 ? 49 PHE P HB3  10 
ATOM 11484 H HD1  . PHE A 1 51 ? -8.435  -0.817  1.473   1.00 0.00 ? 49 PHE P HD1  10 
ATOM 11485 H HD2  . PHE A 1 51 ? -11.820 -1.604  -1.087  1.00 0.00 ? 49 PHE P HD2  10 
ATOM 11486 H HE1  . PHE A 1 51 ? -7.251  0.233   -0.423  1.00 0.00 ? 49 PHE P HE1  10 
ATOM 11487 H HE2  . PHE A 1 51 ? -10.603 -0.593  -2.970  1.00 0.00 ? 49 PHE P HE2  10 
ATOM 11488 H HZ   . PHE A 1 51 ? -8.338  0.356   -2.652  1.00 0.00 ? 49 PHE P HZ   10 
ATOM 11489 N N    . LYS A 1 52 ? -12.512 -2.271  4.496   1.00 0.00 ? 50 LYS P N    10 
ATOM 11490 C CA   . LYS A 1 52 ? -13.626 -2.643  5.395   1.00 0.00 ? 50 LYS P CA   10 
ATOM 11491 C C    . LYS A 1 52 ? -14.154 -1.447  6.203   1.00 0.00 ? 50 LYS P C    10 
ATOM 11492 O O    . LYS A 1 52 ? -15.365 -1.275  6.329   1.00 0.00 ? 50 LYS P O    10 
ATOM 11493 C CB   . LYS A 1 52 ? -13.186 -3.812  6.294   1.00 0.00 ? 50 LYS P CB   10 
ATOM 11494 C CG   . LYS A 1 52 ? -14.358 -4.403  7.098   1.00 0.00 ? 50 LYS P CG   10 
ATOM 11495 C CD   . LYS A 1 52 ? -13.978 -5.678  7.867   1.00 0.00 ? 50 LYS P CD   10 
ATOM 11496 C CE   . LYS A 1 52 ? -12.957 -5.447  8.990   1.00 0.00 ? 50 LYS P CE   10 
ATOM 11497 N NZ   . LYS A 1 52 ? -13.549 -4.746  10.162  1.00 0.00 ? 50 LYS P NZ   10 
ATOM 11498 H H    . LYS A 1 52 ? -11.575 -2.595  4.723   1.00 0.00 ? 50 LYS P H    10 
ATOM 11499 H HA   . LYS A 1 52 ? -14.458 -2.990  4.778   1.00 0.00 ? 50 LYS P HA   10 
ATOM 11500 H HB2  . LYS A 1 52 ? -12.776 -4.601  5.661   1.00 0.00 ? 50 LYS P HB2  10 
ATOM 11501 H HB3  . LYS A 1 52 ? -12.404 -3.475  6.975   1.00 0.00 ? 50 LYS P HB3  10 
ATOM 11502 H HG2  . LYS A 1 52 ? -14.747 -3.659  7.793   1.00 0.00 ? 50 LYS P HG2  10 
ATOM 11503 H HG3  . LYS A 1 52 ? -15.154 -4.666  6.403   1.00 0.00 ? 50 LYS P HG3  10 
ATOM 11504 H HD2  . LYS A 1 52 ? -14.882 -6.124  8.288   1.00 0.00 ? 50 LYS P HD2  10 
ATOM 11505 H HD3  . LYS A 1 52 ? -13.559 -6.396  7.160   1.00 0.00 ? 50 LYS P HD3  10 
ATOM 11506 H HE2  . LYS A 1 52 ? -12.577 -6.423  9.306   1.00 0.00 ? 50 LYS P HE2  10 
ATOM 11507 H HE3  . LYS A 1 52 ? -12.116 -4.878  8.586   1.00 0.00 ? 50 LYS P HE3  10 
ATOM 11508 H HZ1  . LYS A 1 52 ? -13.893 -3.827  9.920   1.00 0.00 ? 50 LYS P HZ1  10 
ATOM 11509 H HZ2  . LYS A 1 52 ? -12.866 -4.633  10.900  1.00 0.00 ? 50 LYS P HZ2  10 
ATOM 11510 H HZ3  . LYS A 1 52 ? -14.321 -5.273  10.550  1.00 0.00 ? 50 LYS P HZ3  10 
ATOM 11511 N N    . ASN A 1 53 ? -13.271 -0.567  6.679   1.00 0.00 ? 51 ASN P N    10 
ATOM 11512 C CA   . ASN A 1 53 ? -13.664 0.709   7.293   1.00 0.00 ? 51 ASN P CA   10 
ATOM 11513 C C    . ASN A 1 53 ? -14.328 1.655   6.274   1.00 0.00 ? 51 ASN P C    10 
ATOM 11514 O O    . ASN A 1 53 ? -15.263 2.370   6.631   1.00 0.00 ? 51 ASN P O    10 
ATOM 11515 C CB   . ASN A 1 53 ? -12.452 1.361   7.986   1.00 0.00 ? 51 ASN P CB   10 
ATOM 11516 C CG   . ASN A 1 53 ? -12.228 0.825   9.387   1.00 0.00 ? 51 ASN P CG   10 
ATOM 11517 O OD1  . ASN A 1 53 ? -12.681 1.387   10.373  1.00 0.00 ? 51 ASN P OD1  10 
ATOM 11518 N ND2  . ASN A 1 53 ? -11.540 -0.284  9.524   1.00 0.00 ? 51 ASN P ND2  10 
ATOM 11519 H H    . ASN A 1 53 ? -12.286 -0.775  6.566   1.00 0.00 ? 51 ASN P H    10 
ATOM 11520 H HA   . ASN A 1 53 ? -14.419 0.511   8.057   1.00 0.00 ? 51 ASN P HA   10 
ATOM 11521 H HB2  . ASN A 1 53 ? -11.547 1.222   7.396   1.00 0.00 ? 51 ASN P HB2  10 
ATOM 11522 H HB3  . ASN A 1 53 ? -12.627 2.433   8.078   1.00 0.00 ? 51 ASN P HB3  10 
ATOM 11523 H HD21 . ASN A 1 53 ? -11.171 -0.753  8.704   1.00 0.00 ? 51 ASN P HD21 10 
ATOM 11524 H HD22 . ASN A 1 53 ? -11.363 -0.624  10.453  1.00 0.00 ? 51 ASN P HD22 10 
ATOM 11525 N N    . ARG A 1 54 ? -13.934 1.617   4.993   1.00 0.00 ? 52 ARG P N    10 
ATOM 11526 C CA   . ARG A 1 54 ? -14.599 2.373   3.919   1.00 0.00 ? 52 ARG P CA   10 
ATOM 11527 C C    . ARG A 1 54 ? -16.030 1.879   3.679   1.00 0.00 ? 52 ARG P C    10 
ATOM 11528 O O    . ARG A 1 54 ? -16.931 2.705   3.544   1.00 0.00 ? 52 ARG P O    10 
ATOM 11529 C CB   . ARG A 1 54 ? -13.735 2.348   2.643   1.00 0.00 ? 52 ARG P CB   10 
ATOM 11530 C CG   . ARG A 1 54 ? -14.007 3.515   1.677   1.00 0.00 ? 52 ARG P CG   10 
ATOM 11531 C CD   . ARG A 1 54 ? -13.582 4.877   2.249   1.00 0.00 ? 52 ARG P CD   10 
ATOM 11532 N NE   . ARG A 1 54 ? -13.725 5.957   1.250   1.00 0.00 ? 52 ARG P NE   10 
ATOM 11533 C CZ   . ARG A 1 54 ? -12.993 7.055   1.153   1.00 0.00 ? 52 ARG P CZ   10 
ATOM 11534 N NH1  . ARG A 1 54 ? -12.023 7.346   1.964   1.00 0.00 ? 52 ARG P NH1  10 
ATOM 11535 N NH2  . ARG A 1 54 ? -13.194 7.928   0.214   1.00 0.00 ? 52 ARG P NH2  10 
ATOM 11536 H H    . ARG A 1 54 ? -13.095 1.087   4.774   1.00 0.00 ? 52 ARG P H    10 
ATOM 11537 H HA   . ARG A 1 54 ? -14.697 3.399   4.268   1.00 0.00 ? 52 ARG P HA   10 
ATOM 11538 H HB2  . ARG A 1 54 ? -12.678 2.372   2.915   1.00 0.00 ? 52 ARG P HB2  10 
ATOM 11539 H HB3  . ARG A 1 54 ? -13.920 1.413   2.113   1.00 0.00 ? 52 ARG P HB3  10 
ATOM 11540 H HG2  . ARG A 1 54 ? -13.438 3.333   0.764   1.00 0.00 ? 52 ARG P HG2  10 
ATOM 11541 H HG3  . ARG A 1 54 ? -15.066 3.540   1.419   1.00 0.00 ? 52 ARG P HG3  10 
ATOM 11542 H HD2  . ARG A 1 54 ? -14.200 5.120   3.115   1.00 0.00 ? 52 ARG P HD2  10 
ATOM 11543 H HD3  . ARG A 1 54 ? -12.544 4.800   2.576   1.00 0.00 ? 52 ARG P HD3  10 
ATOM 11544 H HE   . ARG A 1 54 ? -14.464 5.855   0.574   1.00 0.00 ? 52 ARG P HE   10 
ATOM 11545 H HH11 . ARG A 1 54 ? -11.800 6.739   2.730   1.00 0.00 ? 52 ARG P HH11 10 
ATOM 11546 H HH12 . ARG A 1 54 ? -11.494 8.195   1.770   1.00 0.00 ? 52 ARG P HH12 10 
ATOM 11547 H HH21 . ARG A 1 54 ? -13.935 7.823   -0.457  1.00 0.00 ? 52 ARG P HH21 10 
ATOM 11548 H HH22 . ARG A 1 54 ? -12.554 8.721   0.178   1.00 0.00 ? 52 ARG P HH22 10 
ATOM 11549 N N    . ARG A 1 55 ? -16.277 0.560   3.740   1.00 0.00 ? 53 ARG P N    10 
ATOM 11550 C CA   . ARG A 1 55 ? -17.634 -0.021  3.765   1.00 0.00 ? 53 ARG P CA   10 
ATOM 11551 C C    . ARG A 1 55 ? -18.443 0.459   4.970   1.00 0.00 ? 53 ARG P C    10 
ATOM 11552 O O    . ARG A 1 55 ? -19.603 0.827   4.811   1.00 0.00 ? 53 ARG P O    10 
ATOM 11553 C CB   . ARG A 1 55 ? -17.564 -1.562  3.758   1.00 0.00 ? 53 ARG P CB   10 
ATOM 11554 C CG   . ARG A 1 55 ? -17.723 -2.163  2.361   1.00 0.00 ? 53 ARG P CG   10 
ATOM 11555 C CD   . ARG A 1 55 ? -16.571 -1.843  1.409   1.00 0.00 ? 53 ARG P CD   10 
ATOM 11556 N NE   . ARG A 1 55 ? -16.825 -2.435  0.084   1.00 0.00 ? 53 ARG P NE   10 
ATOM 11557 C CZ   . ARG A 1 55 ? -16.000 -2.443  -0.942  1.00 0.00 ? 53 ARG P CZ   10 
ATOM 11558 N NH1  . ARG A 1 55 ? -14.819 -1.901  -0.898  1.00 0.00 ? 53 ARG P NH1  10 
ATOM 11559 N NH2  . ARG A 1 55 ? -16.339 -3.004  -2.063  1.00 0.00 ? 53 ARG P NH2  10 
ATOM 11560 H H    . ARG A 1 55 ? -15.486 -0.073  3.780   1.00 0.00 ? 53 ARG P H    10 
ATOM 11561 H HA   . ARG A 1 55 ? -18.178 0.320   2.883   1.00 0.00 ? 53 ARG P HA   10 
ATOM 11562 H HB2  . ARG A 1 55 ? -16.631 -1.911  4.196   1.00 0.00 ? 53 ARG P HB2  10 
ATOM 11563 H HB3  . ARG A 1 55 ? -18.379 -1.958  4.365   1.00 0.00 ? 53 ARG P HB3  10 
ATOM 11564 H HG2  . ARG A 1 55 ? -17.789 -3.244  2.467   1.00 0.00 ? 53 ARG P HG2  10 
ATOM 11565 H HG3  . ARG A 1 55 ? -18.652 -1.794  1.929   1.00 0.00 ? 53 ARG P HG3  10 
ATOM 11566 H HD2  . ARG A 1 55 ? -16.467 -0.761  1.310   1.00 0.00 ? 53 ARG P HD2  10 
ATOM 11567 H HD3  . ARG A 1 55 ? -15.652 -2.257  1.827   1.00 0.00 ? 53 ARG P HD3  10 
ATOM 11568 H HE   . ARG A 1 55 ? -17.718 -2.881  -0.057  1.00 0.00 ? 53 ARG P HE   10 
ATOM 11569 H HH11 . ARG A 1 55 ? -14.511 -1.446  -0.056  1.00 0.00 ? 53 ARG P HH11 10 
ATOM 11570 H HH12 . ARG A 1 55 ? -14.243 -1.946  -1.728  1.00 0.00 ? 53 ARG P HH12 10 
ATOM 11571 H HH21 . ARG A 1 55 ? -17.238 -3.444  -2.173  1.00 0.00 ? 53 ARG P HH21 10 
ATOM 11572 H HH22 . ARG A 1 55 ? -15.675 -2.981  -2.825  1.00 0.00 ? 53 ARG P HH22 10 
ATOM 11573 N N    . ALA A 1 56 ? -17.839 0.522   6.156   1.00 0.00 ? 54 ALA P N    10 
ATOM 11574 C CA   . ALA A 1 56 ? -18.514 1.030   7.354   1.00 0.00 ? 54 ALA P CA   10 
ATOM 11575 C C    . ALA A 1 56 ? -18.898 2.517   7.207   1.00 0.00 ? 54 ALA P C    10 
ATOM 11576 O O    . ALA A 1 56 ? -20.035 2.894   7.495   1.00 0.00 ? 54 ALA P O    10 
ATOM 11577 C CB   . ALA A 1 56 ? -17.627 0.766   8.576   1.00 0.00 ? 54 ALA P CB   10 
ATOM 11578 H H    . ALA A 1 56 ? -16.890 0.175   6.230   1.00 0.00 ? 54 ALA P H    10 
ATOM 11579 H HA   . ALA A 1 56 ? -19.440 0.469   7.489   1.00 0.00 ? 54 ALA P HA   10 
ATOM 11580 H HB1  . ALA A 1 56 ? -17.377 -0.294  8.632   1.00 0.00 ? 54 ALA P HB1  10 
ATOM 11581 H HB2  . ALA A 1 56 ? -16.708 1.348   8.515   1.00 0.00 ? 54 ALA P HB2  10 
ATOM 11582 H HB3  . ALA A 1 56 ? -18.164 1.051   9.482   1.00 0.00 ? 54 ALA P HB3  10 
ATOM 11583 N N    . LYS A 1 57 ? -17.996 3.353   6.672   1.00 0.00 ? 55 LYS P N    10 
ATOM 11584 C CA   . LYS A 1 57 ? -18.239 4.785   6.419   1.00 0.00 ? 55 LYS P CA   10 
ATOM 11585 C C    . LYS A 1 57 ? -19.286 5.013   5.325   1.00 0.00 ? 55 LYS P C    10 
ATOM 11586 O O    . LYS A 1 57 ? -20.093 5.934   5.443   1.00 0.00 ? 55 LYS P O    10 
ATOM 11587 C CB   . LYS A 1 57 ? -16.911 5.487   6.086   1.00 0.00 ? 55 LYS P CB   10 
ATOM 11588 C CG   . LYS A 1 57 ? -16.022 5.626   7.334   1.00 0.00 ? 55 LYS P CG   10 
ATOM 11589 C CD   . LYS A 1 57 ? -14.663 6.248   6.990   1.00 0.00 ? 55 LYS P CD   10 
ATOM 11590 C CE   . LYS A 1 57 ? -13.824 6.390   8.267   1.00 0.00 ? 55 LYS P CE   10 
ATOM 11591 N NZ   . LYS A 1 57 ? -12.509 7.029   7.995   1.00 0.00 ? 55 LYS P NZ   10 
ATOM 11592 H H    . LYS A 1 57 ? -17.084 2.972   6.439   1.00 0.00 ? 55 LYS P H    10 
ATOM 11593 H HA   . LYS A 1 57 ? -18.649 5.236   7.327   1.00 0.00 ? 55 LYS P HA   10 
ATOM 11594 H HB2  . LYS A 1 57 ? -16.384 4.926   5.312   1.00 0.00 ? 55 LYS P HB2  10 
ATOM 11595 H HB3  . LYS A 1 57 ? -17.121 6.487   5.702   1.00 0.00 ? 55 LYS P HB3  10 
ATOM 11596 H HG2  . LYS A 1 57 ? -16.533 6.258   8.061   1.00 0.00 ? 55 LYS P HG2  10 
ATOM 11597 H HG3  . LYS A 1 57 ? -15.859 4.647   7.785   1.00 0.00 ? 55 LYS P HG3  10 
ATOM 11598 H HD2  . LYS A 1 57 ? -14.142 5.608   6.277   1.00 0.00 ? 55 LYS P HD2  10 
ATOM 11599 H HD3  . LYS A 1 57 ? -14.820 7.231   6.543   1.00 0.00 ? 55 LYS P HD3  10 
ATOM 11600 H HE2  . LYS A 1 57 ? -14.385 6.990   8.989   1.00 0.00 ? 55 LYS P HE2  10 
ATOM 11601 H HE3  . LYS A 1 57 ? -13.676 5.397   8.702   1.00 0.00 ? 55 LYS P HE3  10 
ATOM 11602 H HZ1  . LYS A 1 57 ? -11.962 6.485   7.343   1.00 0.00 ? 55 LYS P HZ1  10 
ATOM 11603 H HZ2  . LYS A 1 57 ? -11.970 7.119   8.846   1.00 0.00 ? 55 LYS P HZ2  10 
ATOM 11604 H HZ3  . LYS A 1 57 ? -12.625 7.957   7.611   1.00 0.00 ? 55 LYS P HZ3  10 
ATOM 11605 N N    . TRP A 1 58 ? -19.349 4.141   4.314   1.00 0.00 ? 56 TRP P N    10 
ATOM 11606 C CA   . TRP A 1 58 ? -20.441 4.118   3.336   1.00 0.00 ? 56 TRP P CA   10 
ATOM 11607 C C    . TRP A 1 58 ? -21.787 3.793   4.005   1.00 0.00 ? 56 TRP P C    10 
ATOM 11608 O O    . TRP A 1 58 ? -22.757 4.529   3.831   1.00 0.00 ? 56 TRP P O    10 
ATOM 11609 C CB   . TRP A 1 58 ? -20.103 3.118   2.218   1.00 0.00 ? 56 TRP P CB   10 
ATOM 11610 C CG   . TRP A 1 58 ? -21.289 2.560   1.491   1.00 0.00 ? 56 TRP P CG   10 
ATOM 11611 C CD1  . TRP A 1 58 ? -22.210 3.285   0.818   1.00 0.00 ? 56 TRP P CD1  10 
ATOM 11612 C CD2  . TRP A 1 58 ? -21.759 1.178   1.439   1.00 0.00 ? 56 TRP P CD2  10 
ATOM 11613 N NE1  . TRP A 1 58 ? -23.210 2.452   0.357   1.00 0.00 ? 56 TRP P NE1  10 
ATOM 11614 C CE2  . TRP A 1 58 ? -22.993 1.143   0.723   1.00 0.00 ? 56 TRP P CE2  10 
ATOM 11615 C CE3  . TRP A 1 58 ? -21.289 -0.045  1.961   1.00 0.00 ? 56 TRP P CE3  10 
ATOM 11616 C CZ2  . TRP A 1 58 ? -23.720 -0.043  0.534   1.00 0.00 ? 56 TRP P CZ2  10 
ATOM 11617 C CZ3  . TRP A 1 58 ? -22.010 -1.241  1.782   1.00 0.00 ? 56 TRP P CZ3  10 
ATOM 11618 C CH2  . TRP A 1 58 ? -23.222 -1.243  1.069   1.00 0.00 ? 56 TRP P CH2  10 
ATOM 11619 H H    . TRP A 1 58 ? -18.618 3.441   4.231   1.00 0.00 ? 56 TRP P H    10 
ATOM 11620 H HA   . TRP A 1 58 ? -20.540 5.107   2.887   1.00 0.00 ? 56 TRP P HA   10 
ATOM 11621 H HB2  . TRP A 1 58 ? -19.440 3.602   1.501   1.00 0.00 ? 56 TRP P HB2  10 
ATOM 11622 H HB3  . TRP A 1 58 ? -19.555 2.282   2.652   1.00 0.00 ? 56 TRP P HB3  10 
ATOM 11623 H HD1  . TRP A 1 58 ? -22.180 4.362   0.708   1.00 0.00 ? 56 TRP P HD1  10 
ATOM 11624 H HE1  . TRP A 1 58 ? -24.013 2.781   -0.162  1.00 0.00 ? 56 TRP P HE1  10 
ATOM 11625 H HE3  . TRP A 1 58 ? -20.377 -0.042  2.538   1.00 0.00 ? 56 TRP P HE3  10 
ATOM 11626 H HZ2  . TRP A 1 58 ? -24.658 -0.029  -0.003  1.00 0.00 ? 56 TRP P HZ2  10 
ATOM 11627 H HZ3  . TRP A 1 58 ? -21.640 -2.162  2.212   1.00 0.00 ? 56 TRP P HZ3  10 
ATOM 11628 H HH2  . TRP A 1 58 ? -23.774 -2.167  0.940   1.00 0.00 ? 56 TRP P HH2  10 
ATOM 11629 N N    . ARG A 1 59 ? -21.844 2.744   4.835   1.00 0.00 ? 57 ARG P N    10 
ATOM 11630 C CA   . ARG A 1 59 ? -23.053 2.314   5.573   1.00 0.00 ? 57 ARG P CA   10 
ATOM 11631 C C    . ARG A 1 59 ? -23.584 3.352   6.575   1.00 0.00 ? 57 ARG P C    10 
ATOM 11632 O O    . ARG A 1 59 ? -24.772 3.325   6.890   1.00 0.00 ? 57 ARG P O    10 
ATOM 11633 C CB   . ARG A 1 59 ? -22.773 0.977   6.277   1.00 0.00 ? 57 ARG P CB   10 
ATOM 11634 C CG   . ARG A 1 59 ? -22.734 -0.191  5.281   1.00 0.00 ? 57 ARG P CG   10 
ATOM 11635 C CD   . ARG A 1 59 ? -22.195 -1.475  5.919   1.00 0.00 ? 57 ARG P CD   10 
ATOM 11636 N NE   . ARG A 1 59 ? -23.108 -2.016  6.949   1.00 0.00 ? 57 ARG P NE   10 
ATOM 11637 C CZ   . ARG A 1 59 ? -22.892 -3.067  7.720   1.00 0.00 ? 57 ARG P CZ   10 
ATOM 11638 N NH1  . ARG A 1 59 ? -21.797 -3.769  7.647   1.00 0.00 ? 57 ARG P NH1  10 
ATOM 11639 N NH2  . ARG A 1 59 ? -23.785 -3.438  8.592   1.00 0.00 ? 57 ARG P NH2  10 
ATOM 11640 H H    . ARG A 1 59 ? -21.015 2.159   4.886   1.00 0.00 ? 57 ARG P H    10 
ATOM 11641 H HA   . ARG A 1 59 ? -23.858 2.161   4.848   1.00 0.00 ? 57 ARG P HA   10 
ATOM 11642 H HB2  . ARG A 1 59 ? -21.819 1.041   6.803   1.00 0.00 ? 57 ARG P HB2  10 
ATOM 11643 H HB3  . ARG A 1 59 ? -23.557 0.780   7.010   1.00 0.00 ? 57 ARG P HB3  10 
ATOM 11644 H HG2  . ARG A 1 59 ? -23.731 -0.367  4.876   1.00 0.00 ? 57 ARG P HG2  10 
ATOM 11645 H HG3  . ARG A 1 59 ? -22.079 0.072   4.456   1.00 0.00 ? 57 ARG P HG3  10 
ATOM 11646 H HD2  . ARG A 1 59 ? -22.060 -2.218  5.131   1.00 0.00 ? 57 ARG P HD2  10 
ATOM 11647 H HD3  . ARG A 1 59 ? -21.221 -1.255  6.362   1.00 0.00 ? 57 ARG P HD3  10 
ATOM 11648 H HE   . ARG A 1 59 ? -23.994 -1.551  7.066   1.00 0.00 ? 57 ARG P HE   10 
ATOM 11649 H HH11 . ARG A 1 59 ? -21.094 -3.515  6.975   1.00 0.00 ? 57 ARG P HH11 10 
ATOM 11650 H HH12 . ARG A 1 59 ? -21.659 -4.567  8.244   1.00 0.00 ? 57 ARG P HH12 10 
ATOM 11651 H HH21 . ARG A 1 59 ? -24.649 -2.927  8.684   1.00 0.00 ? 57 ARG P HH21 10 
ATOM 11652 H HH22 . ARG A 1 59 ? -23.621 -4.239  9.177   1.00 0.00 ? 57 ARG P HH22 10 
ATOM 11653 N N    . LYS A 1 60 ? -22.750 4.297   7.030   1.00 0.00 ? 58 LYS P N    10 
ATOM 11654 C CA   . LYS A 1 60 ? -23.182 5.480   7.812   1.00 0.00 ? 58 LYS P CA   10 
ATOM 11655 C C    . LYS A 1 60 ? -23.971 6.511   6.983   1.00 0.00 ? 58 LYS P C    10 
ATOM 11656 O O    . LYS A 1 60 ? -24.666 7.347   7.568   1.00 0.00 ? 58 LYS P O    10 
ATOM 11657 C CB   . LYS A 1 60 ? -21.972 6.159   8.497   1.00 0.00 ? 58 LYS P CB   10 
ATOM 11658 C CG   . LYS A 1 60 ? -21.752 5.725   9.956   1.00 0.00 ? 58 LYS P CG   10 
ATOM 11659 C CD   . LYS A 1 60 ? -21.171 4.311   10.092  1.00 0.00 ? 58 LYS P CD   10 
ATOM 11660 C CE   . LYS A 1 60 ? -20.881 3.924   11.548  1.00 0.00 ? 58 LYS P CE   10 
ATOM 11661 N NZ   . LYS A 1 60 ? -22.119 3.743   12.353  1.00 0.00 ? 58 LYS P NZ   10 
ATOM 11662 H H    . LYS A 1 60 ? -21.769 4.179   6.806   1.00 0.00 ? 58 LYS P H    10 
ATOM 11663 H HA   . LYS A 1 60 ? -23.877 5.153   8.587   1.00 0.00 ? 58 LYS P HA   10 
ATOM 11664 H HB2  . LYS A 1 60 ? -21.060 5.992   7.921   1.00 0.00 ? 58 LYS P HB2  10 
ATOM 11665 H HB3  . LYS A 1 60 ? -22.138 7.238   8.519   1.00 0.00 ? 58 LYS P HB3  10 
ATOM 11666 H HG2  . LYS A 1 60 ? -21.052 6.426   10.415  1.00 0.00 ? 58 LYS P HG2  10 
ATOM 11667 H HG3  . LYS A 1 60 ? -22.699 5.795   10.493  1.00 0.00 ? 58 LYS P HG3  10 
ATOM 11668 H HD2  . LYS A 1 60 ? -21.845 3.580   9.642   1.00 0.00 ? 58 LYS P HD2  10 
ATOM 11669 H HD3  . LYS A 1 60 ? -20.224 4.290   9.557   1.00 0.00 ? 58 LYS P HD3  10 
ATOM 11670 H HE2  . LYS A 1 60 ? -20.308 2.992   11.541  1.00 0.00 ? 58 LYS P HE2  10 
ATOM 11671 H HE3  . LYS A 1 60 ? -20.246 4.696   11.993  1.00 0.00 ? 58 LYS P HE3  10 
ATOM 11672 H HZ1  . LYS A 1 60 ? -22.716 3.031   11.956  1.00 0.00 ? 58 LYS P HZ1  10 
ATOM 11673 H HZ2  . LYS A 1 60 ? -22.650 4.600   12.416  1.00 0.00 ? 58 LYS P HZ2  10 
ATOM 11674 H HZ3  . LYS A 1 60 ? -21.895 3.458   13.297  1.00 0.00 ? 58 LYS P HZ3  10 
ATOM 11675 N N    . ARG A 1 61 ? -23.866 6.489   5.646   1.00 0.00 ? 59 ARG P N    10 
ATOM 11676 C CA   . ARG A 1 61 ? -24.517 7.446   4.720   1.00 0.00 ? 59 ARG P CA   10 
ATOM 11677 C C    . ARG A 1 61 ? -25.535 6.812   3.759   1.00 0.00 ? 59 ARG P C    10 
ATOM 11678 O O    . ARG A 1 61 ? -26.462 7.497   3.329   1.00 0.00 ? 59 ARG P O    10 
ATOM 11679 C CB   . ARG A 1 61 ? -23.448 8.233   3.939   1.00 0.00 ? 59 ARG P CB   10 
ATOM 11680 C CG   . ARG A 1 61 ? -22.352 8.927   4.772   1.00 0.00 ? 59 ARG P CG   10 
ATOM 11681 C CD   . ARG A 1 61 ? -22.825 9.786   5.956   1.00 0.00 ? 59 ARG P CD   10 
ATOM 11682 N NE   . ARG A 1 61 ? -23.864 10.768  5.584   1.00 0.00 ? 59 ARG P NE   10 
ATOM 11683 C CZ   . ARG A 1 61 ? -25.061 10.919  6.129   1.00 0.00 ? 59 ARG P CZ   10 
ATOM 11684 N NH1  . ARG A 1 61 ? -25.536 10.118  7.043   1.00 0.00 ? 59 ARG P NH1  10 
ATOM 11685 N NH2  . ARG A 1 61 ? -25.827 11.902  5.748   1.00 0.00 ? 59 ARG P NH2  10 
ATOM 11686 H H    . ARG A 1 61 ? -23.244 5.797   5.245   1.00 0.00 ? 59 ARG P H    10 
ATOM 11687 H HA   . ARG A 1 61 ? -25.097 8.165   5.294   1.00 0.00 ? 59 ARG P HA   10 
ATOM 11688 H HB2  . ARG A 1 61 ? -22.954 7.554   3.242   1.00 0.00 ? 59 ARG P HB2  10 
ATOM 11689 H HB3  . ARG A 1 61 ? -23.955 8.997   3.347   1.00 0.00 ? 59 ARG P HB3  10 
ATOM 11690 H HG2  . ARG A 1 61 ? -21.677 8.165   5.161   1.00 0.00 ? 59 ARG P HG2  10 
ATOM 11691 H HG3  . ARG A 1 61 ? -21.772 9.560   4.099   1.00 0.00 ? 59 ARG P HG3  10 
ATOM 11692 H HD2  . ARG A 1 61 ? -23.171 9.133   6.752   1.00 0.00 ? 59 ARG P HD2  10 
ATOM 11693 H HD3  . ARG A 1 61 ? -21.960 10.323  6.349   1.00 0.00 ? 59 ARG P HD3  10 
ATOM 11694 H HE   . ARG A 1 61 ? -23.611 11.442  4.879   1.00 0.00 ? 59 ARG P HE   10 
ATOM 11695 H HH11 . ARG A 1 61 ? -25.013 9.298   7.325   1.00 0.00 ? 59 ARG P HH11 10 
ATOM 11696 H HH12 . ARG A 1 61 ? -26.450 10.277  7.433   1.00 0.00 ? 59 ARG P HH12 10 
ATOM 11697 H HH21 . ARG A 1 61 ? -25.508 12.552  5.048   1.00 0.00 ? 59 ARG P HH21 10 
ATOM 11698 H HH22 . ARG A 1 61 ? -26.738 12.024  6.157   1.00 0.00 ? 59 ARG P HH22 10 
ATOM 11699 N N    . GLU A 1 62 ? -25.391 5.520   3.454   1.00 0.00 ? 60 GLU P N    10 
ATOM 11700 C CA   . GLU A 1 62 ? -26.293 4.714   2.605   1.00 0.00 ? 60 GLU P CA   10 
ATOM 11701 C C    . GLU A 1 62 ? -26.555 5.326   1.209   1.00 0.00 ? 60 GLU P C    10 
ATOM 11702 O O    . GLU A 1 62 ? -27.689 5.402   0.733   1.00 0.00 ? 60 GLU P O    10 
ATOM 11703 C CB   . GLU A 1 62 ? -27.582 4.331   3.361   1.00 0.00 ? 60 GLU P CB   10 
ATOM 11704 C CG   . GLU A 1 62 ? -27.298 3.552   4.651   1.00 0.00 ? 60 GLU P CG   10 
ATOM 11705 C CD   . GLU A 1 62 ? -28.606 3.051   5.293   1.00 0.00 ? 60 GLU P CD   10 
ATOM 11706 O OE1  . GLU A 1 62 ? -29.254 3.819   6.047   1.00 0.00 ? 60 GLU P OE1  10 
ATOM 11707 O OE2  . GLU A 1 62 ? -29.001 1.885   5.049   1.00 0.00 ? 60 GLU P OE2  10 
ATOM 11708 H H    . GLU A 1 62 ? -24.562 5.063   3.812   1.00 0.00 ? 60 GLU P H    10 
ATOM 11709 H HA   . GLU A 1 62 ? -25.772 3.777   2.403   1.00 0.00 ? 60 GLU P HA   10 
ATOM 11710 H HB2  . GLU A 1 62 ? -28.151 5.230   3.602   1.00 0.00 ? 60 GLU P HB2  10 
ATOM 11711 H HB3  . GLU A 1 62 ? -28.192 3.699   2.715   1.00 0.00 ? 60 GLU P HB3  10 
ATOM 11712 H HG2  . GLU A 1 62 ? -26.645 2.707   4.416   1.00 0.00 ? 60 GLU P HG2  10 
ATOM 11713 H HG3  . GLU A 1 62 ? -26.772 4.204   5.352   1.00 0.00 ? 60 GLU P HG3  10 
ATOM 11714 N N    . GLU A 1 63 ? -25.488 5.774   0.539   1.00 0.00 ? 61 GLU P N    10 
ATOM 11715 C CA   . GLU A 1 63 ? -25.558 6.492   -0.752  1.00 0.00 ? 61 GLU P CA   10 
ATOM 11716 C C    . GLU A 1 63 ? -25.771 5.583   -1.987  1.00 0.00 ? 61 GLU P C    10 
ATOM 11717 O O    . GLU A 1 63 ? -25.853 6.076   -3.115  1.00 0.00 ? 61 GLU P O    10 
ATOM 11718 C CB   . GLU A 1 63 ? -24.305 7.372   -0.927  1.00 0.00 ? 61 GLU P CB   10 
ATOM 11719 C CG   . GLU A 1 63 ? -24.188 8.454   0.154   1.00 0.00 ? 61 GLU P CG   10 
ATOM 11720 C CD   . GLU A 1 63 ? -23.010 9.402   -0.138  1.00 0.00 ? 61 GLU P CD   10 
ATOM 11721 O OE1  . GLU A 1 63 ? -21.856 9.078   0.236   1.00 0.00 ? 61 GLU P OE1  10 
ATOM 11722 O OE2  . GLU A 1 63 ? -23.227 10.482  -0.741  1.00 0.00 ? 61 GLU P OE2  10 
ATOM 11723 H H    . GLU A 1 63 ? -24.588 5.699   0.995   1.00 0.00 ? 61 GLU P H    10 
ATOM 11724 H HA   . GLU A 1 63 ? -26.420 7.159   -0.722  1.00 0.00 ? 61 GLU P HA   10 
ATOM 11725 H HB2  . GLU A 1 63 ? -23.415 6.741   -0.908  1.00 0.00 ? 61 GLU P HB2  10 
ATOM 11726 H HB3  . GLU A 1 63 ? -24.353 7.870   -1.896  1.00 0.00 ? 61 GLU P HB3  10 
ATOM 11727 H HG2  . GLU A 1 63 ? -25.122 9.022   0.193   1.00 0.00 ? 61 GLU P HG2  10 
ATOM 11728 H HG3  . GLU A 1 63 ? -24.047 7.978   1.125   1.00 0.00 ? 61 GLU P HG3  10 
ATOM 11729 N N    . PHE A 1 64 ? -25.866 4.262   -1.794  1.00 0.00 ? 62 PHE P N    10 
ATOM 11730 C CA   . PHE A 1 64 ? -26.070 3.265   -2.855  1.00 0.00 ? 62 PHE P CA   10 
ATOM 11731 C C    . PHE A 1 64 ? -27.551 2.867   -3.006  1.00 0.00 ? 62 PHE P C    10 
ATOM 11732 O O    . PHE A 1 64 ? -28.268 2.719   -2.014  1.00 0.00 ? 62 PHE P O    10 
ATOM 11733 C CB   . PHE A 1 64 ? -25.178 2.045   -2.584  1.00 0.00 ? 62 PHE P CB   10 
ATOM 11734 C CG   . PHE A 1 64 ? -25.336 0.923   -3.595  1.00 0.00 ? 62 PHE P CG   10 
ATOM 11735 C CD1  . PHE A 1 64 ? -24.852 1.081   -4.908  1.00 0.00 ? 62 PHE P CD1  10 
ATOM 11736 C CD2  . PHE A 1 64 ? -25.992 -0.269  -3.232  1.00 0.00 ? 62 PHE P CD2  10 
ATOM 11737 C CE1  . PHE A 1 64 ? -25.028 0.055   -5.853  1.00 0.00 ? 62 PHE P CE1  10 
ATOM 11738 C CE2  . PHE A 1 64 ? -26.159 -1.299  -4.175  1.00 0.00 ? 62 PHE P CE2  10 
ATOM 11739 C CZ   . PHE A 1 64 ? -25.682 -1.136  -5.487  1.00 0.00 ? 62 PHE P CZ   10 
ATOM 11740 H H    . PHE A 1 64 ? -25.890 3.942   -0.839  1.00 0.00 ? 62 PHE P H    10 
ATOM 11741 H HA   . PHE A 1 64 ? -25.749 3.693   -3.806  1.00 0.00 ? 62 PHE P HA   10 
ATOM 11742 H HB2  . PHE A 1 64 ? -24.135 2.365   -2.583  1.00 0.00 ? 62 PHE P HB2  10 
ATOM 11743 H HB3  . PHE A 1 64 ? -25.411 1.659   -1.592  1.00 0.00 ? 62 PHE P HB3  10 
ATOM 11744 H HD1  . PHE A 1 64 ? -24.346 1.994   -5.194  1.00 0.00 ? 62 PHE P HD1  10 
ATOM 11745 H HD2  . PHE A 1 64 ? -26.371 -0.399  -2.227  1.00 0.00 ? 62 PHE P HD2  10 
ATOM 11746 H HE1  . PHE A 1 64 ? -24.660 0.180   -6.863  1.00 0.00 ? 62 PHE P HE1  10 
ATOM 11747 H HE2  . PHE A 1 64 ? -26.655 -2.217  -3.888  1.00 0.00 ? 62 PHE P HE2  10 
ATOM 11748 H HZ   . PHE A 1 64 ? -25.815 -1.925  -6.215  1.00 0.00 ? 62 PHE P HZ   10 
ATOM 11749 N N    . ILE A 1 65 ? -27.990 2.653   -4.253  1.00 0.00 ? 63 ILE P N    10 
ATOM 11750 C CA   . ILE A 1 65 ? -29.349 2.238   -4.641  1.00 0.00 ? 63 ILE P CA   10 
ATOM 11751 C C    . ILE A 1 65 ? -29.255 1.105   -5.676  1.00 0.00 ? 63 ILE P C    10 
ATOM 11752 O O    . ILE A 1 65 ? -28.501 1.205   -6.648  1.00 0.00 ? 63 ILE P O    10 
ATOM 11753 C CB   . ILE A 1 65 ? -30.146 3.446   -5.201  1.00 0.00 ? 63 ILE P CB   10 
ATOM 11754 C CG1  . ILE A 1 65 ? -30.331 4.595   -4.181  1.00 0.00 ? 63 ILE P CG1  10 
ATOM 11755 C CG2  . ILE A 1 65 ? -31.517 3.024   -5.763  1.00 0.00 ? 63 ILE P CG2  10 
ATOM 11756 C CD1  . ILE A 1 65 ? -31.217 4.280   -2.966  1.00 0.00 ? 63 ILE P CD1  10 
ATOM 11757 H H    . ILE A 1 65 ? -27.317 2.736   -5.003  1.00 0.00 ? 63 ILE P H    10 
ATOM 11758 H HA   . ILE A 1 65 ? -29.874 1.851   -3.769  1.00 0.00 ? 63 ILE P HA   10 
ATOM 11759 H HB   . ILE A 1 65 ? -29.573 3.857   -6.035  1.00 0.00 ? 63 ILE P HB   10 
ATOM 11760 H HG12 . ILE A 1 65 ? -29.355 4.922   -3.823  1.00 0.00 ? 63 ILE P HG12 10 
ATOM 11761 H HG13 . ILE A 1 65 ? -30.772 5.445   -4.702  1.00 0.00 ? 63 ILE P HG13 10 
ATOM 11762 H HG21 . ILE A 1 65 ? -32.081 2.461   -5.019  1.00 0.00 ? 63 ILE P HG21 10 
ATOM 11763 H HG22 . ILE A 1 65 ? -32.088 3.907   -6.051  1.00 0.00 ? 63 ILE P HG22 10 
ATOM 11764 H HG23 . ILE A 1 65 ? -31.389 2.409   -6.654  1.00 0.00 ? 63 ILE P HG23 10 
ATOM 11765 H HD11 . ILE A 1 65 ? -30.838 3.414   -2.426  1.00 0.00 ? 63 ILE P HD11 10 
ATOM 11766 H HD12 . ILE A 1 65 ? -32.241 4.088   -3.282  1.00 0.00 ? 63 ILE P HD12 10 
ATOM 11767 H HD13 . ILE A 1 65 ? -31.219 5.138   -2.293  1.00 0.00 ? 63 ILE P HD13 10 
ATOM 11768 N N    . VAL A 1 66 ? -30.048 0.044   -5.494  1.00 0.00 ? 64 VAL P N    10 
ATOM 11769 C CA   . VAL A 1 66 ? -30.167 -1.076  -6.448  1.00 0.00 ? 64 VAL P CA   10 
ATOM 11770 C C    . VAL A 1 66 ? -31.162 -0.720  -7.557  1.00 0.00 ? 64 VAL P C    10 
ATOM 11771 O O    . VAL A 1 66 ? -32.289 -0.302  -7.275  1.00 0.00 ? 64 VAL P O    10 
ATOM 11772 C CB   . VAL A 1 66 ? -30.586 -2.378  -5.735  1.00 0.00 ? 64 VAL P CB   10 
ATOM 11773 C CG1  . VAL A 1 66 ? -30.696 -3.561  -6.708  1.00 0.00 ? 64 VAL P CG1  10 
ATOM 11774 C CG2  . VAL A 1 66 ? -29.570 -2.772  -4.653  1.00 0.00 ? 64 VAL P CG2  10 
ATOM 11775 H H    . VAL A 1 66 ? -30.656 0.039   -4.687  1.00 0.00 ? 64 VAL P H    10 
ATOM 11776 H HA   . VAL A 1 66 ? -29.192 -1.252  -6.905  1.00 0.00 ? 64 VAL P HA   10 
ATOM 11777 H HB   . VAL A 1 66 ? -31.558 -2.228  -5.265  1.00 0.00 ? 64 VAL P HB   10 
ATOM 11778 H HG11 . VAL A 1 66 ? -31.504 -3.393  -7.419  1.00 0.00 ? 64 VAL P HG11 10 
ATOM 11779 H HG12 . VAL A 1 66 ? -29.757 -3.698  -7.246  1.00 0.00 ? 64 VAL P HG12 10 
ATOM 11780 H HG13 . VAL A 1 66 ? -30.924 -4.473  -6.156  1.00 0.00 ? 64 VAL P HG13 10 
ATOM 11781 H HG21 . VAL A 1 66 ? -29.894 -3.685  -4.155  1.00 0.00 ? 64 VAL P HG21 10 
ATOM 11782 H HG22 . VAL A 1 66 ? -28.593 -2.938  -5.107  1.00 0.00 ? 64 VAL P HG22 10 
ATOM 11783 H HG23 . VAL A 1 66 ? -29.488 -1.986  -3.902  1.00 0.00 ? 64 VAL P HG23 10 
ATOM 11784 N N    . THR A 1 67 ? -30.758 -0.902  -8.817  1.00 0.00 ? 65 THR P N    10 
ATOM 11785 C CA   . THR A 1 67 ? -31.557 -0.561  -10.016 1.00 0.00 ? 65 THR P CA   10 
ATOM 11786 C C    . THR A 1 67 ? -32.067 -1.780  -10.798 1.00 0.00 ? 65 THR P C    10 
ATOM 11787 O O    . THR A 1 67 ? -32.837 -1.631  -11.750 1.00 0.00 ? 65 THR P O    10 
ATOM 11788 C CB   . THR A 1 67 ? -30.762 0.374   -10.946 1.00 0.00 ? 65 THR P CB   10 
ATOM 11789 O OG1  . THR A 1 67 ? -29.521 -0.202  -11.314 1.00 0.00 ? 65 THR P OG1  10 
ATOM 11790 C CG2  . THR A 1 67 ? -30.452 1.702   -10.255 1.00 0.00 ? 65 THR P CG2  10 
ATOM 11791 H H    . THR A 1 67 ? -29.802 -1.188  -8.975  1.00 0.00 ? 65 THR P H    10 
ATOM 11792 H HA   . THR A 1 67 ? -32.447 -0.019  -9.701  1.00 0.00 ? 65 THR P HA   10 
ATOM 11793 H HB   . THR A 1 67 ? -31.348 0.582   -11.842 1.00 0.00 ? 65 THR P HB   10 
ATOM 11794 H HG1  . THR A 1 67 ? -29.689 -0.857  -12.015 1.00 0.00 ? 65 THR P HG1  10 
ATOM 11795 H HG21 . THR A 1 67 ? -31.380 2.164   -9.920  1.00 0.00 ? 65 THR P HG21 10 
ATOM 11796 H HG22 . THR A 1 67 ? -29.955 2.370   -10.959 1.00 0.00 ? 65 THR P HG22 10 
ATOM 11797 H HG23 . THR A 1 67 ? -29.802 1.536   -9.396  1.00 0.00 ? 65 THR P HG23 10 
ATOM 11798 N N    . ASP A 1 68 ? -31.651 -2.988  -10.403 1.00 0.00 ? 66 ASP P N    10 
ATOM 11799 C CA   . ASP A 1 68 ? -32.064 -4.282  -10.981 1.00 0.00 ? 66 ASP P CA   10 
ATOM 11800 C C    . ASP A 1 68 ? -33.523 -4.669  -10.653 1.00 0.00 ? 66 ASP P C    10 
ATOM 11801 O O    . ASP A 1 68 ? -33.943 -4.548  -9.477  1.00 0.00 ? 66 ASP P O    10 
ATOM 11802 C CB   . ASP A 1 68 ? -31.087 -5.386  -10.531 1.00 0.00 ? 66 ASP P CB   10 
ATOM 11803 C CG   . ASP A 1 68 ? -29.661 -5.217  -11.094 1.00 0.00 ? 66 ASP P CG   10 
ATOM 11804 O OD1  . ASP A 1 68 ? -29.424 -5.584  -12.274 1.00 0.00 ? 66 ASP P OD1  10 
ATOM 11805 O OD2  . ASP A 1 68 ? -28.766 -4.735  -10.357 1.00 0.00 ? 66 ASP P OD2  10 
ATOM 11806 O OXT  . ASP A 1 68 ? -34.244 -5.104  -11.580 1.00 0.00 ? 66 ASP P OXT  10 
ATOM 11807 H H    . ASP A 1 68 ? -31.028 -3.003  -9.608  1.00 0.00 ? 66 ASP P H    10 
ATOM 11808 H HA   . ASP A 1 68 ? -31.995 -4.210  -12.068 1.00 0.00 ? 66 ASP P HA   10 
ATOM 11809 H HB2  . ASP A 1 68 ? -31.055 -5.412  -9.438  1.00 0.00 ? 66 ASP P HB2  10 
ATOM 11810 H HB3  . ASP A 1 68 ? -31.481 -6.349  -10.863 1.00 0.00 ? 66 ASP P HB3  10 
ATOM 11811 N N    . GLY A 1 1  ? 9.324   -7.178  20.507  1.00 0.00 ? -1 GLY P N    11 
ATOM 11812 C CA   . GLY A 1 1  ? 9.212   -6.084  19.516  1.00 0.00 ? -1 GLY P CA   11 
ATOM 11813 C C    . GLY A 1 1  ? 9.506   -4.726  20.139  1.00 0.00 ? -1 GLY P C    11 
ATOM 11814 O O    . GLY A 1 1  ? 9.287   -4.524  21.335  1.00 0.00 ? -1 GLY P O    11 
ATOM 11815 H H1   . GLY A 1 1  ? 9.106   -8.062  20.076  1.00 0.00 ? -1 GLY P H1   11 
ATOM 11816 H H2   . GLY A 1 1  ? 8.682   -7.021  21.268  1.00 0.00 ? -1 GLY P H2   11 
ATOM 11817 H H3   . GLY A 1 1  ? 10.260  -7.219  20.879  1.00 0.00 ? -1 GLY P H3   11 
ATOM 11818 H HA2  . GLY A 1 1  ? 9.918   -6.258  18.703  1.00 0.00 ? -1 GLY P HA2  11 
ATOM 11819 H HA3  . GLY A 1 1  ? 8.202   -6.063  19.107  1.00 0.00 ? -1 GLY P HA3  11 
ATOM 11820 N N    . SER A 1 2  ? 9.998   -3.779  19.337  1.00 0.00 ? 0  SER P N    11 
ATOM 11821 C CA   . SER A 1 2  ? 10.327  -2.406  19.758  1.00 0.00 ? 0  SER P CA   11 
ATOM 11822 C C    . SER A 1 2  ? 9.087   -1.514  19.928  1.00 0.00 ? 0  SER P C    11 
ATOM 11823 O O    . SER A 1 2  ? 8.022   -1.777  19.360  1.00 0.00 ? 0  SER P O    11 
ATOM 11824 C CB   . SER A 1 2  ? 11.331  -1.789  18.774  1.00 0.00 ? 0  SER P CB   11 
ATOM 11825 O OG   . SER A 1 2  ? 10.848  -1.863  17.442  1.00 0.00 ? 0  SER P OG   11 
ATOM 11826 H H    . SER A 1 2  ? 10.122  -3.986  18.353  1.00 0.00 ? 0  SER P H    11 
ATOM 11827 H HA   . SER A 1 2  ? 10.823  -2.455  20.728  1.00 0.00 ? 0  SER P HA   11 
ATOM 11828 H HB2  . SER A 1 2  ? 11.523  -0.748  19.042  1.00 0.00 ? 0  SER P HB2  11 
ATOM 11829 H HB3  . SER A 1 2  ? 12.270  -2.341  18.842  1.00 0.00 ? 0  SER P HB3  11 
ATOM 11830 H HG   . SER A 1 2  ? 11.577  -1.627  16.837  1.00 0.00 ? 0  SER P HG   11 
ATOM 11831 N N    . GLN A 1 3  ? 9.208   -0.451  20.731  1.00 0.00 ? 1  GLN P N    11 
ATOM 11832 C CA   . GLN A 1 3  ? 8.123   0.498   21.031  1.00 0.00 ? 1  GLN P CA   11 
ATOM 11833 C C    . GLN A 1 3  ? 7.937   1.543   19.915  1.00 0.00 ? 1  GLN P C    11 
ATOM 11834 O O    . GLN A 1 3  ? 8.888   1.877   19.207  1.00 0.00 ? 1  GLN P O    11 
ATOM 11835 C CB   . GLN A 1 3  ? 8.382   1.184   22.385  1.00 0.00 ? 1  GLN P CB   11 
ATOM 11836 C CG   . GLN A 1 3  ? 8.360   0.197   23.568  1.00 0.00 ? 1  GLN P CG   11 
ATOM 11837 C CD   . GLN A 1 3  ? 8.562   0.867   24.931  1.00 0.00 ? 1  GLN P CD   11 
ATOM 11838 O OE1  . GLN A 1 3  ? 8.735   2.073   25.069  1.00 0.00 ? 1  GLN P OE1  11 
ATOM 11839 N NE2  . GLN A 1 3  ? 8.547   0.106   26.006  1.00 0.00 ? 1  GLN P NE2  11 
ATOM 11840 H H    . GLN A 1 3  ? 10.107  -0.280  21.159  1.00 0.00 ? 1  GLN P H    11 
ATOM 11841 H HA   . GLN A 1 3  ? 7.188   -0.058  21.117  1.00 0.00 ? 1  GLN P HA   11 
ATOM 11842 H HB2  . GLN A 1 3  ? 9.348   1.690   22.353  1.00 0.00 ? 1  GLN P HB2  11 
ATOM 11843 H HB3  . GLN A 1 3  ? 7.607   1.934   22.551  1.00 0.00 ? 1  GLN P HB3  11 
ATOM 11844 H HG2  . GLN A 1 3  ? 7.401   -0.322  23.579  1.00 0.00 ? 1  GLN P HG2  11 
ATOM 11845 H HG3  . GLN A 1 3  ? 9.145   -0.548  23.437  1.00 0.00 ? 1  GLN P HG3  11 
ATOM 11846 H HE21 . GLN A 1 3  ? 8.406   -0.891  25.926  1.00 0.00 ? 1  GLN P HE21 11 
ATOM 11847 H HE22 . GLN A 1 3  ? 8.679   0.544   26.906  1.00 0.00 ? 1  GLN P HE22 11 
ATOM 11848 N N    . ARG A 1 4  ? 6.716   2.086   19.780  1.00 0.00 ? 2  ARG P N    11 
ATOM 11849 C CA   . ARG A 1 4  ? 6.281   3.146   18.831  1.00 0.00 ? 2  ARG P CA   11 
ATOM 11850 C C    .