data_2LAV
# 
_entry.id   2LAV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LAV         
RCSB  RCSB102171   
BMRB  16715        
WWPDB D_1000102171 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          16715 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LAV 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shin, J.'   1 
'Yoon, H.S.' 2 
# 
_citation.id                        primary 
_citation.title                     
;NMR Solution Structure of Human Vaccinia-related Kinase 1 (VRK1) Reveals the C-terminal Tail Essential for Its Structural Stability and Autocatalytic Activity.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                22131 
_citation.page_last                 22138 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21543316 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.200162 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shin, J.'        1  
primary 'Chakraborty, G.' 2  
primary 'Bharatham, N.'   3  
primary 'Kang, C.'        4  
primary 'Tochio, N.'      5  
primary 'Koshiba, S.'     6  
primary 'Kigawa, T.'      7  
primary 'Kim, W.'         8  
primary 'Kim, K.T.'       9  
primary 'Yoon, H.S.'      10 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Vaccinia-related kinase 1' 
_entity.formula_weight             41415.629 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.7.11.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Serine/threonine-protein kinase VRK1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ARG n 
1 4   VAL n 
1 5   LYS n 
1 6   ALA n 
1 7   ALA n 
1 8   GLN n 
1 9   ALA n 
1 10  GLY n 
1 11  ARG n 
1 12  GLN n 
1 13  SER n 
1 14  SER n 
1 15  ALA n 
1 16  LYS n 
1 17  ARG n 
1 18  HIS n 
1 19  LEU n 
1 20  ALA n 
1 21  GLU n 
1 22  GLN n 
1 23  PHE n 
1 24  ALA n 
1 25  VAL n 
1 26  GLY n 
1 27  GLU n 
1 28  ILE n 
1 29  ILE n 
1 30  THR n 
1 31  ASP n 
1 32  MET n 
1 33  ALA n 
1 34  LYS n 
1 35  LYS n 
1 36  GLU n 
1 37  TRP n 
1 38  LYS n 
1 39  VAL n 
1 40  GLY n 
1 41  LEU n 
1 42  PRO n 
1 43  ILE n 
1 44  GLY n 
1 45  GLN n 
1 46  GLY n 
1 47  GLY n 
1 48  PHE n 
1 49  GLY n 
1 50  CYS n 
1 51  ILE n 
1 52  TYR n 
1 53  LEU n 
1 54  ALA n 
1 55  ASP n 
1 56  MET n 
1 57  ASN n 
1 58  SER n 
1 59  SER n 
1 60  GLU n 
1 61  SER n 
1 62  VAL n 
1 63  GLY n 
1 64  SER n 
1 65  ASP n 
1 66  ALA n 
1 67  PRO n 
1 68  CYS n 
1 69  VAL n 
1 70  VAL n 
1 71  LYS n 
1 72  VAL n 
1 73  GLU n 
1 74  PRO n 
1 75  SER n 
1 76  ASP n 
1 77  ASN n 
1 78  GLY n 
1 79  PRO n 
1 80  LEU n 
1 81  PHE n 
1 82  THR n 
1 83  GLU n 
1 84  LEU n 
1 85  LYS n 
1 86  PHE n 
1 87  TYR n 
1 88  GLN n 
1 89  ARG n 
1 90  ALA n 
1 91  ALA n 
1 92  LYS n 
1 93  PRO n 
1 94  GLU n 
1 95  GLN n 
1 96  ILE n 
1 97  GLN n 
1 98  LYS n 
1 99  TRP n 
1 100 ILE n 
1 101 ARG n 
1 102 THR n 
1 103 ARG n 
1 104 LYS n 
1 105 LEU n 
1 106 LYS n 
1 107 TYR n 
1 108 LEU n 
1 109 GLY n 
1 110 VAL n 
1 111 PRO n 
1 112 LYS n 
1 113 TYR n 
1 114 TRP n 
1 115 GLY n 
1 116 SER n 
1 117 GLY n 
1 118 LEU n 
1 119 HIS n 
1 120 ASP n 
1 121 LYS n 
1 122 ASN n 
1 123 GLY n 
1 124 LYS n 
1 125 SER n 
1 126 TYR n 
1 127 ARG n 
1 128 PHE n 
1 129 MET n 
1 130 ILE n 
1 131 MET n 
1 132 ASP n 
1 133 ARG n 
1 134 PHE n 
1 135 GLY n 
1 136 SER n 
1 137 ASP n 
1 138 LEU n 
1 139 GLN n 
1 140 LYS n 
1 141 ILE n 
1 142 TYR n 
1 143 GLU n 
1 144 ALA n 
1 145 ASN n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 PHE n 
1 150 SER n 
1 151 ARG n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 GLN n 
1 157 LEU n 
1 158 SER n 
1 159 LEU n 
1 160 ARG n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 TYR n 
1 168 ILE n 
1 169 HIS n 
1 170 GLU n 
1 171 HIS n 
1 172 GLU n 
1 173 TYR n 
1 174 VAL n 
1 175 HIS n 
1 176 GLY n 
1 177 ASP n 
1 178 ILE n 
1 179 LYS n 
1 180 ALA n 
1 181 SER n 
1 182 ASN n 
1 183 LEU n 
1 184 LEU n 
1 185 LEU n 
1 186 ASN n 
1 187 TYR n 
1 188 LYS n 
1 189 ASN n 
1 190 PRO n 
1 191 ASP n 
1 192 GLN n 
1 193 VAL n 
1 194 TYR n 
1 195 LEU n 
1 196 VAL n 
1 197 ASP n 
1 198 TYR n 
1 199 GLY n 
1 200 LEU n 
1 201 ALA n 
1 202 TYR n 
1 203 ARG n 
1 204 TYR n 
1 205 CYS n 
1 206 PRO n 
1 207 GLU n 
1 208 GLY n 
1 209 VAL n 
1 210 HIS n 
1 211 LYS n 
1 212 GLU n 
1 213 TYR n 
1 214 LYS n 
1 215 GLU n 
1 216 ASP n 
1 217 PRO n 
1 218 LYS n 
1 219 ARG n 
1 220 CYS n 
1 221 HIS n 
1 222 ASP n 
1 223 GLY n 
1 224 THR n 
1 225 ILE n 
1 226 GLU n 
1 227 PHE n 
1 228 THR n 
1 229 SER n 
1 230 ILE n 
1 231 ASP n 
1 232 ALA n 
1 233 HIS n 
1 234 ASN n 
1 235 GLY n 
1 236 VAL n 
1 237 ALA n 
1 238 PRO n 
1 239 SER n 
1 240 ARG n 
1 241 ARG n 
1 242 GLY n 
1 243 ASP n 
1 244 LEU n 
1 245 GLU n 
1 246 ILE n 
1 247 LEU n 
1 248 GLY n 
1 249 TYR n 
1 250 CYS n 
1 251 MET n 
1 252 ILE n 
1 253 GLN n 
1 254 TRP n 
1 255 LEU n 
1 256 THR n 
1 257 GLY n 
1 258 HIS n 
1 259 LEU n 
1 260 PRO n 
1 261 TRP n 
1 262 GLU n 
1 263 ASP n 
1 264 ASN n 
1 265 LEU n 
1 266 LYS n 
1 267 ASP n 
1 268 PRO n 
1 269 LYS n 
1 270 TYR n 
1 271 VAL n 
1 272 ARG n 
1 273 ASP n 
1 274 SER n 
1 275 LYS n 
1 276 ILE n 
1 277 ARG n 
1 278 TYR n 
1 279 ARG n 
1 280 GLU n 
1 281 ASN n 
1 282 ILE n 
1 283 ALA n 
1 284 SER n 
1 285 LEU n 
1 286 MET n 
1 287 ASP n 
1 288 LYS n 
1 289 CYS n 
1 290 PHE n 
1 291 PRO n 
1 292 GLU n 
1 293 LYS n 
1 294 ASN n 
1 295 LYS n 
1 296 PRO n 
1 297 GLY n 
1 298 GLU n 
1 299 ILE n 
1 300 ALA n 
1 301 LYS n 
1 302 TYR n 
1 303 MET n 
1 304 GLU n 
1 305 THR n 
1 306 VAL n 
1 307 LYS n 
1 308 LEU n 
1 309 LEU n 
1 310 ASP n 
1 311 TYR n 
1 312 THR n 
1 313 GLU n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 TYR n 
1 318 GLU n 
1 319 ASN n 
1 320 LEU n 
1 321 ARG n 
1 322 ASP n 
1 323 ILE n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 GLY n 
1 328 LEU n 
1 329 LYS n 
1 330 ALA n 
1 331 ILE n 
1 332 GLY n 
1 333 SER n 
1 334 LYS n 
1 335 ASP n 
1 336 ASP n 
1 337 GLY n 
1 338 LYS n 
1 339 LEU n 
1 340 ASP n 
1 341 LEU n 
1 342 SER n 
1 343 VAL n 
1 344 VAL n 
1 345 GLU n 
1 346 ASN n 
1 347 GLY n 
1 348 GLY n 
1 349 LEU n 
1 350 LYS n 
1 351 ALA n 
1 352 LYS n 
1 353 THR n 
1 354 ILE n 
1 355 THR n 
1 356 LYS n 
1 357 LYS n 
1 358 ARG n 
1 359 LYS n 
1 360 LYS n 
1 361 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 VRK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET29b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VRK1_HUMAN 
_struct_ref.pdbx_db_accession          Q99986 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LAV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 361 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99986 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  361 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       361 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-15N HSQC'  
1 3  1 '2D 1H-15N HSQC'  
1 4  1 '3D HNCACB'       
1 5  1 '3D HNCACB'       
1 6  1 '3D HN(COCA)CB'   
1 7  1 '3D HN(COCA)CB'   
1 8  1 '3D HNCO'         
1 9  1 '3D HNCA'         
1 10 1 '3D HN(CO)CA'     
1 11 1 '3D HN(CA)CO'     
1 12 1 '3D 1H-15N NOESY' 
1 13 1 '3D 1H-15N NOESY' 
1 14 2 '3D 1H-13C NOESY' 
1 15 2 '3D 1H-13C NOESY' 
1 16 2 '3D HCCH-TOCSY'   
1 17 2 '3D HCCH-TOCSY'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.3-0.5 mM [U-100% 13C; U-100% 15N; U-80% 2H] Vaccinia Related-Kinase 1, 0.3-0.5 mM [U-100% 15N; U-50% 2H] Vaccinia Related-Kinase 1, 0.1-0.2 mM [U-100% 15N] Vaccinia Related-Kinase 1, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;0.3-0.5 mM [U-100% 13C; U-100% 15N; U-70% 2H] Vaccinia Related-Kinase 1, 0.3-0.5 mM [13C;15N]-Val,Ile,Leu; [U-100% 2H] Vaccinia Related-Kinase 1, 100% D2O
;
2 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
700 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
900 Bruker Avance 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LAV 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LAV 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LAV 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                      NMRPipe ?   1 
Goddard                                             'chemical shift assignment'     SPARKY  ?   2 
Goddard                                             'peak picking'                  SPARKY  ?   3 
'Guntert, Mumenthaler and Wuthrich'                 'initial structure calculation' CYANA   ?   4 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                      CNS     1.2 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    NA 
_exptl.entry_id                   2LAV 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LAV 
_struct.title                     'NMR solution structure of human Vaccinia-Related Kinase 1' 
_struct.pdbx_descriptor           'Vaccinia-related kinase 1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LAV 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'VRK1, SERINE/THREONINE-PROTEIN KINASE, TRANSFERASE, MITOSIS, CELL CYCLE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 78  ? ALA A 91  ? GLY A 78  ALA A 91  1 ? 14 
HELX_P HELX_P2  2  LYS A 92  ? LYS A 104 ? LYS A 92  LYS A 104 1 ? 13 
HELX_P HELX_P3  3  ASP A 137 ? ASN A 145 ? ASP A 137 ASN A 145 1 ? 9  
HELX_P HELX_P4  4  SER A 150 ? GLU A 170 ? SER A 150 GLU A 170 1 ? 21 
HELX_P HELX_P5  5  LYS A 179 ? SER A 181 ? LYS A 179 SER A 181 5 ? 3  
HELX_P HELX_P6  6  CYS A 205 ? VAL A 209 ? CYS A 205 VAL A 209 5 ? 5  
HELX_P HELX_P7  7  SER A 229 ? GLY A 235 ? SER A 229 GLY A 235 1 ? 7  
HELX_P HELX_P8  8  ARG A 240 ? GLY A 257 ? ARG A 240 GLY A 257 1 ? 18 
HELX_P HELX_P9  9  LEU A 259 ? ASP A 263 ? LEU A 259 ASP A 263 5 ? 5  
HELX_P HELX_P10 10 ASP A 267 ? ASN A 281 ? ASP A 267 ASN A 281 1 ? 15 
HELX_P HELX_P11 11 ASN A 281 ? PHE A 290 ? ASN A 281 PHE A 290 1 ? 10 
HELX_P HELX_P12 12 PRO A 296 ? LEU A 308 ? PRO A 296 LEU A 308 1 ? 13 
HELX_P HELX_P13 13 LEU A 316 ? ILE A 331 ? LEU A 316 ILE A 331 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 27  ? THR A 30  ? GLU A 27  THR A 30  
A 2 GLU A 36  ? ILE A 43  ? GLU A 36  ILE A 43  
A 3 ILE A 51  ? MET A 56  ? ILE A 51  MET A 56  
A 4 CYS A 68  ? PRO A 74  ? CYS A 68  PRO A 74  
A 5 LYS A 124 ? ASP A 132 ? LYS A 124 ASP A 132 
A 6 TYR A 113 ? LYS A 121 ? TYR A 113 LYS A 121 
B 1 LEU A 183 ? LEU A 185 ? LEU A 183 LEU A 185 
B 2 VAL A 193 ? LEU A 195 ? VAL A 193 LEU A 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 27  ? N GLU A 27  O VAL A 39  ? O VAL A 39  
A 2 3 N ILE A 43  ? N ILE A 43  O ILE A 51  ? O ILE A 51  
A 3 4 N TYR A 52  ? N TYR A 52  O VAL A 70  ? O VAL A 70  
A 4 5 N VAL A 69  ? N VAL A 69  O MET A 131 ? O MET A 131 
A 5 6 O ILE A 130 ? O ILE A 130 N GLY A 115 ? N GLY A 115 
B 1 2 N LEU A 184 ? N LEU A 184 O TYR A 194 ? O TYR A 194 
# 
_atom_sites.entry_id                    2LAV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? -11.701 26.375  -3.577  1.00 0.00  ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? -13.185 26.331  -3.646  1.00 52.33 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? -13.670 26.270  -5.092  1.00 61.21 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? -13.011 26.780  -5.998  1.00 42.31 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? -13.742 27.578  -2.955  1.00 23.53 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? -14.029 27.377  -1.476  1.00 51.21 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? -15.766 27.026  -1.147  1.00 40.01 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? -16.353 28.648  -0.661  1.00 2.12  ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? -11.399 27.330  -3.857  1.00 37.47 ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? -11.333 25.657  -4.234  1.00 37.47 ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? -11.423 26.167  -2.598  1.00 37.47 ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? -13.528 25.451  -3.122  1.00 30.52 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? -13.027 28.380  -3.055  1.00 72.44 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? -14.662 27.864  -3.442  1.00 64.11 ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? -13.436 26.549  -1.117  1.00 54.21 ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? -13.749 28.274  -0.944  1.00 61.24 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? -16.574 28.648  0.396   1.00 74.22 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? -17.247 28.888  -1.216  1.00 63.15 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? -15.590 29.383  -0.869  1.00 73.11 ? 1   MET A HE3  1  
ATOM 20     N N    . PRO A 1 2   ? -14.835 25.642  -5.328  1.00 4.24  ? 2   PRO A N    1  
ATOM 21     C CA   . PRO A 1 2   ? -15.406 25.516  -6.673  1.00 22.41 ? 2   PRO A CA   1  
ATOM 22     C C    . PRO A 1 2   ? -15.504 26.860  -7.388  1.00 34.03 ? 2   PRO A C    1  
ATOM 23     O O    . PRO A 1 2   ? -15.113 26.987  -8.548  1.00 1.34  ? 2   PRO A O    1  
ATOM 24     C CB   . PRO A 1 2   ? -16.802 24.944  -6.416  1.00 63.33 ? 2   PRO A CB   1  
ATOM 25     C CG   . PRO A 1 2   ? -16.685 24.229  -5.115  1.00 65.42 ? 2   PRO A CG   1  
ATOM 26     C CD   . PRO A 1 2   ? -15.685 25.006  -4.304  1.00 14.44 ? 2   PRO A CD   1  
ATOM 27     H HA   . PRO A 1 2   ? -14.838 24.827  -7.281  1.00 73.31 ? 2   PRO A HA   1  
ATOM 28     H HB2  . PRO A 1 2   ? -17.520 25.750  -6.362  1.00 3.52  ? 2   PRO A HB2  1  
ATOM 29     H HB3  . PRO A 1 2   ? -17.070 24.269  -7.214  1.00 65.42 ? 2   PRO A HB3  1  
ATOM 30     H HG2  . PRO A 1 2   ? -17.643 24.215  -4.616  1.00 31.33 ? 2   PRO A HG2  1  
ATOM 31     H HG3  . PRO A 1 2   ? -16.331 23.222  -5.280  1.00 32.25 ? 2   PRO A HG3  1  
ATOM 32     H HD2  . PRO A 1 2   ? -16.185 25.751  -3.701  1.00 33.31 ? 2   PRO A HD2  1  
ATOM 33     H HD3  . PRO A 1 2   ? -15.106 24.341  -3.681  1.00 35.13 ? 2   PRO A HD3  1  
ATOM 34     N N    . ARG A 1 3   ? -16.029 27.860  -6.688  1.00 42.01 ? 3   ARG A N    1  
ATOM 35     C CA   . ARG A 1 3   ? -16.179 29.194  -7.256  1.00 14.14 ? 3   ARG A CA   1  
ATOM 36     C C    . ARG A 1 3   ? -14.843 29.930  -7.277  1.00 42.15 ? 3   ARG A C    1  
ATOM 37     O O    . ARG A 1 3   ? -14.422 30.443  -8.313  1.00 21.51 ? 3   ARG A O    1  
ATOM 38     C CB   . ARG A 1 3   ? -17.205 30.000  -6.457  1.00 35.14 ? 3   ARG A CB   1  
ATOM 39     C CG   . ARG A 1 3   ? -18.630 29.842  -6.962  1.00 75.13 ? 3   ARG A CG   1  
ATOM 40     C CD   . ARG A 1 3   ? -19.619 30.587  -6.082  1.00 44.21 ? 3   ARG A CD   1  
ATOM 41     N NE   . ARG A 1 3   ? -20.696 31.194  -6.861  1.00 33.14 ? 3   ARG A NE   1  
ATOM 42     C CZ   . ARG A 1 3   ? -21.854 31.592  -6.340  1.00 61.02 ? 3   ARG A CZ   1  
ATOM 43     N NH1  . ARG A 1 3   ? -22.090 31.450  -5.041  1.00 63.33 ? 3   ARG A NH1  1  
ATOM 44     N NH2  . ARG A 1 3   ? -22.780 32.135  -7.119  1.00 22.40 ? 3   ARG A NH2  1  
ATOM 45     H H    . ARG A 1 3   ? -16.323 27.697  -5.767  1.00 60.32 ? 3   ARG A H    1  
ATOM 46     H HA   . ARG A 1 3   ? -16.532 29.085  -8.270  1.00 14.51 ? 3   ARG A HA   1  
ATOM 47     H HB2  . ARG A 1 3   ? -17.174 29.678  -5.426  1.00 45.41 ? 3   ARG A HB2  1  
ATOM 48     H HB3  . ARG A 1 3   ? -16.942 31.046  -6.506  1.00 53.12 ? 3   ARG A HB3  1  
ATOM 49     H HG2  . ARG A 1 3   ? -18.691 30.233  -7.967  1.00 35.11 ? 3   ARG A HG2  1  
ATOM 50     H HG3  . ARG A 1 3   ? -18.885 28.792  -6.967  1.00 22.21 ? 3   ARG A HG3  1  
ATOM 51     H HD2  . ARG A 1 3   ? -20.047 29.893  -5.375  1.00 10.22 ? 3   ARG A HD2  1  
ATOM 52     H HD3  . ARG A 1 3   ? -19.092 31.364  -5.548  1.00 74.21 ? 3   ARG A HD3  1  
ATOM 53     H HE   . ARG A 1 3   ? -20.549 31.311  -7.822  1.00 10.14 ? 3   ARG A HE   1  
ATOM 54     H HH11 . ARG A 1 3   ? -21.396 31.042  -4.448  1.00 65.00 ? 3   ARG A HH11 1  
ATOM 55     H HH12 . ARG A 1 3   ? -22.962 31.751  -4.656  1.00 1.34  ? 3   ARG A HH12 1  
ATOM 56     H HH21 . ARG A 1 3   ? -22.608 32.245  -8.098  1.00 54.24 ? 3   ARG A HH21 1  
ATOM 57     H HH22 . ARG A 1 3   ? -23.650 32.434  -6.728  1.00 73.41 ? 3   ARG A HH22 1  
ATOM 58     N N    . VAL A 1 4   ? -14.181 29.977  -6.125  1.00 23.01 ? 4   VAL A N    1  
ATOM 59     C CA   . VAL A 1 4   ? -12.893 30.649  -6.011  1.00 3.23  ? 4   VAL A CA   1  
ATOM 60     C C    . VAL A 1 4   ? -11.863 30.026  -6.947  1.00 42.03 ? 4   VAL A C    1  
ATOM 61     O O    . VAL A 1 4   ? -11.410 30.661  -7.900  1.00 64.11 ? 4   VAL A O    1  
ATOM 62     C CB   . VAL A 1 4   ? -12.356 30.596  -4.569  1.00 45.13 ? 4   VAL A CB   1  
ATOM 63     C CG1  . VAL A 1 4   ? -11.119 31.468  -4.426  1.00 15.44 ? 4   VAL A CG1  1  
ATOM 64     C CG2  . VAL A 1 4   ? -13.434 31.020  -3.582  1.00 51.32 ? 4   VAL A CG2  1  
ATOM 65     H H    . VAL A 1 4   ? -14.568 29.549  -5.333  1.00 64.52 ? 4   VAL A H    1  
ATOM 66     H HA   . VAL A 1 4   ? -13.032 31.685  -6.284  1.00 22.42 ? 4   VAL A HA   1  
ATOM 67     H HB   . VAL A 1 4   ? -12.077 29.576  -4.347  1.00 22.33 ? 4   VAL A HB   1  
ATOM 68     H HG11 . VAL A 1 4   ? -11.391 32.505  -4.560  1.00 13.31 ? 4   VAL A HG11 1  
ATOM 69     H HG12 . VAL A 1 4   ? -10.392 31.187  -5.173  1.00 13.40 ? 4   VAL A HG12 1  
ATOM 70     H HG13 . VAL A 1 4   ? -10.694 31.332  -3.442  1.00 65.03 ? 4   VAL A HG13 1  
ATOM 71     H HG21 . VAL A 1 4   ? -14.144 30.216  -3.457  1.00 42.32 ? 4   VAL A HG21 1  
ATOM 72     H HG22 . VAL A 1 4   ? -13.943 31.895  -3.960  1.00 72.23 ? 4   VAL A HG22 1  
ATOM 73     H HG23 . VAL A 1 4   ? -12.979 31.251  -2.630  1.00 70.53 ? 4   VAL A HG23 1  
ATOM 74     N N    . LYS A 1 5   ? -11.497 28.779  -6.669  1.00 14.23 ? 5   LYS A N    1  
ATOM 75     C CA   . LYS A 1 5   ? -10.520 28.069  -7.487  1.00 0.33  ? 5   LYS A CA   1  
ATOM 76     C C    . LYS A 1 5   ? -11.186 27.437  -8.705  1.00 31.43 ? 5   LYS A C    1  
ATOM 77     O O    . LYS A 1 5   ? -12.221 26.782  -8.588  1.00 75.44 ? 5   LYS A O    1  
ATOM 78     C CB   . LYS A 1 5   ? -9.817  26.991  -6.659  1.00 3.03  ? 5   LYS A CB   1  
ATOM 79     C CG   . LYS A 1 5   ? -8.350  26.812  -7.013  1.00 51.31 ? 5   LYS A CG   1  
ATOM 80     C CD   . LYS A 1 5   ? -7.454  27.650  -6.116  1.00 24.32 ? 5   LYS A CD   1  
ATOM 81     C CE   . LYS A 1 5   ? -6.161  26.923  -5.784  1.00 2.13  ? 5   LYS A CE   1  
ATOM 82     N NZ   . LYS A 1 5   ? -5.035  27.869  -5.553  1.00 70.24 ? 5   LYS A NZ   1  
ATOM 83     H H    . LYS A 1 5   ? -11.893 28.325  -5.896  1.00 55.41 ? 5   LYS A H    1  
ATOM 84     H HA   . LYS A 1 5   ? -9.786  28.786  -7.824  1.00 1.23  ? 5   LYS A HA   1  
ATOM 85     H HB2  . LYS A 1 5   ? -9.883  27.257  -5.614  1.00 43.13 ? 5   LYS A HB2  1  
ATOM 86     H HB3  . LYS A 1 5   ? -10.321 26.049  -6.814  1.00 51.25 ? 5   LYS A HB3  1  
ATOM 87     H HG2  . LYS A 1 5   ? -8.086  25.772  -6.897  1.00 33.43 ? 5   LYS A HG2  1  
ATOM 88     H HG3  . LYS A 1 5   ? -8.198  27.112  -8.040  1.00 21.42 ? 5   LYS A HG3  1  
ATOM 89     H HD2  . LYS A 1 5   ? -7.216  28.574  -6.622  1.00 74.12 ? 5   LYS A HD2  1  
ATOM 90     H HD3  . LYS A 1 5   ? -7.981  27.866  -5.198  1.00 4.02  ? 5   LYS A HD3  1  
ATOM 91     H HE2  . LYS A 1 5   ? -6.313  26.334  -4.892  1.00 71.01 ? 5   LYS A HE2  1  
ATOM 92     H HE3  . LYS A 1 5   ? -5.909  26.271  -6.607  1.00 43.44 ? 5   LYS A HE3  1  
ATOM 93     H HZ1  . LYS A 1 5   ? -4.143  27.452  -5.887  1.00 41.23 ? 5   LYS A HZ1  1  
ATOM 94     H HZ2  . LYS A 1 5   ? -4.947  28.080  -4.538  1.00 62.53 ? 5   LYS A HZ2  1  
ATOM 95     H HZ3  . LYS A 1 5   ? -5.204  28.758  -6.066  1.00 74.42 ? 5   LYS A HZ3  1  
ATOM 96     N N    . ALA A 1 6   ? -10.584 27.638  -9.873  1.00 31.03 ? 6   ALA A N    1  
ATOM 97     C CA   . ALA A 1 6   ? -11.119 27.088  -11.112 1.00 74.24 ? 6   ALA A CA   1  
ATOM 98     C C    . ALA A 1 6   ? -10.497 25.731  -11.424 1.00 62.13 ? 6   ALA A C    1  
ATOM 99     O O    . ALA A 1 6   ? -9.278  25.567  -11.362 1.00 70.02 ? 6   ALA A O    1  
ATOM 100    C CB   . ALA A 1 6   ? -10.885 28.055  -12.263 1.00 64.31 ? 6   ALA A CB   1  
ATOM 101    H H    . ALA A 1 6   ? -9.761  28.169  -9.902  1.00 15.55 ? 6   ALA A H    1  
ATOM 102    H HA   . ALA A 1 6   ? -12.185 26.964  -10.989 1.00 52.43 ? 6   ALA A HA   1  
ATOM 103    H HB1  . ALA A 1 6   ? -10.749 29.053  -11.872 1.00 74.21 ? 6   ALA A HB1  1  
ATOM 104    H HB2  . ALA A 1 6   ? -11.738 28.041  -12.925 1.00 34.51 ? 6   ALA A HB2  1  
ATOM 105    H HB3  . ALA A 1 6   ? -10.001 27.759  -12.808 1.00 74.42 ? 6   ALA A HB3  1  
ATOM 106    N N    . ALA A 1 7   ? -11.341 24.762  -11.760 1.00 75.43 ? 7   ALA A N    1  
ATOM 107    C CA   . ALA A 1 7   ? -10.874 23.419  -12.082 1.00 74.22 ? 7   ALA A CA   1  
ATOM 108    C C    . ALA A 1 7   ? -10.526 23.299  -13.561 1.00 72.15 ? 7   ALA A C    1  
ATOM 109    O O    . ALA A 1 7   ? -11.351 23.589  -14.428 1.00 41.21 ? 7   ALA A O    1  
ATOM 110    C CB   . ALA A 1 7   ? -11.926 22.389  -11.699 1.00 44.00 ? 7   ALA A CB   1  
ATOM 111    H H    . ALA A 1 7   ? -12.302 24.954  -11.792 1.00 63.51 ? 7   ALA A H    1  
ATOM 112    H HA   . ALA A 1 7   ? -9.986  23.226  -11.497 1.00 11.01 ? 7   ALA A HA   1  
ATOM 113    H HB1  . ALA A 1 7   ? -12.616 22.258  -12.519 1.00 44.11 ? 7   ALA A HB1  1  
ATOM 114    H HB2  . ALA A 1 7   ? -12.463 22.729  -10.827 1.00 64.14 ? 7   ALA A HB2  1  
ATOM 115    H HB3  . ALA A 1 7   ? -11.444 21.447  -11.481 1.00 1.10  ? 7   ALA A HB3  1  
ATOM 116    N N    . GLN A 1 8   ? -9.300  22.870  -13.843 1.00 20.10 ? 8   GLN A N    1  
ATOM 117    C CA   . GLN A 1 8   ? -8.843  22.711  -15.219 1.00 20.41 ? 8   GLN A CA   1  
ATOM 118    C C    . GLN A 1 8   ? -8.889  21.246  -15.642 1.00 70.20 ? 8   GLN A C    1  
ATOM 119    O O    . GLN A 1 8   ? -8.294  20.384  -14.994 1.00 25.22 ? 8   GLN A O    1  
ATOM 120    C CB   . GLN A 1 8   ? -7.422  23.255  -15.372 1.00 0.11  ? 8   GLN A CB   1  
ATOM 121    C CG   . GLN A 1 8   ? -7.370  24.731  -15.730 1.00 24.45 ? 8   GLN A CG   1  
ATOM 122    C CD   . GLN A 1 8   ? -6.288  25.047  -16.744 1.00 52.25 ? 8   GLN A CD   1  
ATOM 123    O OE1  . GLN A 1 8   ? -6.573  25.300  -17.915 1.00 55.32 ? 8   GLN A OE1  1  
ATOM 124    N NE2  . GLN A 1 8   ? -5.037  25.034  -16.298 1.00 44.43 ? 8   GLN A NE2  1  
ATOM 125    H H    . GLN A 1 8   ? -8.688  22.654  -13.109 1.00 51.25 ? 8   GLN A H    1  
ATOM 126    H HA   . GLN A 1 8   ? -9.506  23.277  -15.856 1.00 3.53  ? 8   GLN A HA   1  
ATOM 127    H HB2  . GLN A 1 8   ? -6.892  23.113  -14.441 1.00 71.14 ? 8   GLN A HB2  1  
ATOM 128    H HB3  . GLN A 1 8   ? -6.919  22.700  -16.150 1.00 62.25 ? 8   GLN A HB3  1  
ATOM 129    H HG2  . GLN A 1 8   ? -8.325  25.022  -16.143 1.00 61.33 ? 8   GLN A HG2  1  
ATOM 130    H HG3  . GLN A 1 8   ? -7.179  25.299  -14.832 1.00 61.21 ? 8   GLN A HG3  1  
ATOM 131    H HE21 . GLN A 1 8   ? -4.885  24.824  -15.353 1.00 61.32 ? 8   GLN A HE21 1  
ATOM 132    H HE22 . GLN A 1 8   ? -4.318  25.235  -16.932 1.00 1.23  ? 8   GLN A HE22 1  
ATOM 133    N N    . ALA A 1 9   ? -9.597  20.972  -16.732 1.00 34.23 ? 9   ALA A N    1  
ATOM 134    C CA   . ALA A 1 9   ? -9.720  19.611  -17.241 1.00 43.41 ? 9   ALA A CA   1  
ATOM 135    C C    . ALA A 1 9   ? -8.525  19.243  -18.115 1.00 21.44 ? 9   ALA A C    1  
ATOM 136    O O    . ALA A 1 9   ? -7.855  18.238  -17.876 1.00 51.44 ? 9   ALA A O    1  
ATOM 137    C CB   . ALA A 1 9   ? -11.015 19.456  -18.023 1.00 72.25 ? 9   ALA A CB   1  
ATOM 138    H H    . ALA A 1 9   ? -10.048 21.702  -17.205 1.00 34.44 ? 9   ALA A H    1  
ATOM 139    H HA   . ALA A 1 9   ? -9.755  18.941  -16.395 1.00 22.40 ? 9   ALA A HA   1  
ATOM 140    H HB1  . ALA A 1 9   ? -11.855 19.580  -17.356 1.00 10.22 ? 9   ALA A HB1  1  
ATOM 141    H HB2  . ALA A 1 9   ? -11.051 18.473  -18.468 1.00 64.20 ? 9   ALA A HB2  1  
ATOM 142    H HB3  . ALA A 1 9   ? -11.059 20.205  -18.800 1.00 60.25 ? 9   ALA A HB3  1  
ATOM 143    N N    . GLY A 1 10  ? -8.264  20.062  -19.128 1.00 24.43 ? 10  GLY A N    1  
ATOM 144    C CA   . GLY A 1 10  ? -7.151  19.805  -20.022 1.00 2.41  ? 10  GLY A CA   1  
ATOM 145    C C    . GLY A 1 10  ? -7.078  20.803  -21.160 1.00 25.51 ? 10  GLY A C    1  
ATOM 146    O O    . GLY A 1 10  ? -8.095  21.137  -21.768 1.00 53.23 ? 10  GLY A O    1  
ATOM 147    H H    . GLY A 1 10  ? -8.833  20.848  -19.270 1.00 34.20 ? 10  GLY A H    1  
ATOM 148    H HA2  . GLY A 1 10  ? -6.232  19.852  -19.457 1.00 63.13 ? 10  GLY A HA2  1  
ATOM 149    H HA3  . GLY A 1 10  ? -7.256  18.812  -20.434 1.00 61.04 ? 10  GLY A HA3  1  
ATOM 150    N N    . ARG A 1 11  ? -5.872  21.281  -21.449 1.00 21.23 ? 11  ARG A N    1  
ATOM 151    C CA   . ARG A 1 11  ? -5.669  22.248  -22.522 1.00 51.05 ? 11  ARG A CA   1  
ATOM 152    C C    . ARG A 1 11  ? -5.639  21.555  -23.880 1.00 13.04 ? 11  ARG A C    1  
ATOM 153    O O    . ARG A 1 11  ? -6.297  21.990  -24.826 1.00 5.23  ? 11  ARG A O    1  
ATOM 154    C CB   . ARG A 1 11  ? -4.368  23.021  -22.302 1.00 14.54 ? 11  ARG A CB   1  
ATOM 155    C CG   . ARG A 1 11  ? -4.445  24.477  -22.731 1.00 24.04 ? 11  ARG A CG   1  
ATOM 156    C CD   . ARG A 1 11  ? -3.894  24.674  -24.134 1.00 71.30 ? 11  ARG A CD   1  
ATOM 157    N NE   . ARG A 1 11  ? -2.470  25.001  -24.122 1.00 22.35 ? 11  ARG A NE   1  
ATOM 158    C CZ   . ARG A 1 11  ? -1.971  26.121  -23.604 1.00 10.33 ? 11  ARG A CZ   1  
ATOM 159    N NH1  . ARG A 1 11  ? -2.776  27.023  -23.055 1.00 13.53 ? 11  ARG A NH1  1  
ATOM 160    N NH2  . ARG A 1 11  ? -0.664  26.340  -23.634 1.00 53.15 ? 11  ARG A NH2  1  
ATOM 161    H H    . ARG A 1 11  ? -5.099  20.977  -20.929 1.00 52.41 ? 11  ARG A H    1  
ATOM 162    H HA   . ARG A 1 11  ? -6.497  22.941  -22.504 1.00 44.13 ? 11  ARG A HA   1  
ATOM 163    H HB2  . ARG A 1 11  ? -4.118  22.990  -21.252 1.00 52.02 ? 11  ARG A HB2  1  
ATOM 164    H HB3  . ARG A 1 11  ? -3.579  22.544  -22.865 1.00 72.42 ? 11  ARG A HB3  1  
ATOM 165    H HG2  . ARG A 1 11  ? -5.477  24.793  -22.713 1.00 12.23 ? 11  ARG A HG2  1  
ATOM 166    H HG3  . ARG A 1 11  ? -3.871  25.077  -22.040 1.00 24.30 ? 11  ARG A HG3  1  
ATOM 167    H HD2  . ARG A 1 11  ? -4.039  23.763  -24.695 1.00 74.32 ? 11  ARG A HD2  1  
ATOM 168    H HD3  . ARG A 1 11  ? -4.435  25.479  -24.609 1.00 14.14 ? 11  ARG A HD3  1  
ATOM 169    H HE   . ARG A 1 11  ? -1.854  24.353  -24.521 1.00 35.02 ? 11  ARG A HE   1  
ATOM 170    H HH11 . ARG A 1 11  ? -3.763  26.864  -23.028 1.00 25.30 ? 11  ARG A HH11 1  
ATOM 171    H HH12 . ARG A 1 11  ? -2.395  27.862  -22.667 1.00 44.54 ? 11  ARG A HH12 1  
ATOM 172    H HH21 . ARG A 1 11  ? -0.053  25.664  -24.047 1.00 12.05 ? 11  ARG A HH21 1  
ATOM 173    H HH22 . ARG A 1 11  ? -0.289  27.182  -23.245 1.00 42.22 ? 11  ARG A HH22 1  
ATOM 174    N N    . GLN A 1 12  ? -4.871  20.474  -23.970 1.00 11.30 ? 12  GLN A N    1  
ATOM 175    C CA   . GLN A 1 12  ? -4.755  19.720  -25.213 1.00 3.25  ? 12  GLN A CA   1  
ATOM 176    C C    . GLN A 1 12  ? -4.306  18.288  -24.941 1.00 14.12 ? 12  GLN A C    1  
ATOM 177    O O    . GLN A 1 12  ? -3.127  18.032  -24.695 1.00 53.12 ? 12  GLN A O    1  
ATOM 178    C CB   . GLN A 1 12  ? -3.767  20.405  -26.159 1.00 33.13 ? 12  GLN A CB   1  
ATOM 179    C CG   . GLN A 1 12  ? -4.413  21.433  -27.073 1.00 40.11 ? 12  GLN A CG   1  
ATOM 180    C CD   . GLN A 1 12  ? -3.446  21.991  -28.098 1.00 52.52 ? 12  GLN A CD   1  
ATOM 181    O OE1  . GLN A 1 12  ? -2.607  21.268  -28.635 1.00 15.22 ? 12  GLN A OE1  1  
ATOM 182    N NE2  . GLN A 1 12  ? -3.560  23.285  -28.377 1.00 50.52 ? 12  GLN A NE2  1  
ATOM 183    H H    . GLN A 1 12  ? -4.371  20.176  -23.182 1.00 73.51 ? 12  GLN A H    1  
ATOM 184    H HA   . GLN A 1 12  ? -5.729  19.697  -25.679 1.00 73.02 ? 12  GLN A HA   1  
ATOM 185    H HB2  . GLN A 1 12  ? -3.010  20.902  -25.572 1.00 32.22 ? 12  GLN A HB2  1  
ATOM 186    H HB3  . GLN A 1 12  ? -3.296  19.653  -26.775 1.00 11.24 ? 12  GLN A HB3  1  
ATOM 187    H HG2  . GLN A 1 12  ? -5.237  20.967  -27.593 1.00 33.11 ? 12  GLN A HG2  1  
ATOM 188    H HG3  . GLN A 1 12  ? -4.786  22.249  -26.469 1.00 72.01 ? 12  GLN A HG3  1  
ATOM 189    H HE21 . GLN A 1 12  ? -4.252  23.800  -27.911 1.00 30.24 ? 12  GLN A HE21 1  
ATOM 190    H HE22 . GLN A 1 12  ? -2.947  23.672  -29.037 1.00 30.52 ? 12  GLN A HE22 1  
ATOM 191    N N    . SER A 1 13  ? -5.254  17.357  -24.986 1.00 5.14  ? 13  SER A N    1  
ATOM 192    C CA   . SER A 1 13  ? -4.956  15.950  -24.745 1.00 71.35 ? 13  SER A CA   1  
ATOM 193    C C    . SER A 1 13  ? -6.057  15.057  -25.307 1.00 24.32 ? 13  SER A C    1  
ATOM 194    O O    . SER A 1 13  ? -5.813  14.235  -26.190 1.00 31.51 ? 13  SER A O    1  
ATOM 195    C CB   . SER A 1 13  ? -4.790  15.693  -23.246 1.00 11.22 ? 13  SER A CB   1  
ATOM 196    O OG   . SER A 1 13  ? -3.437  15.841  -22.850 1.00 2.35  ? 13  SER A OG   1  
ATOM 197    H H    . SER A 1 13  ? -6.176  17.623  -25.187 1.00 31.54 ? 13  SER A H    1  
ATOM 198    H HA   . SER A 1 13  ? -4.029  15.717  -25.246 1.00 20.44 ? 13  SER A HA   1  
ATOM 199    H HB2  . SER A 1 13  ? -5.393  16.397  -22.693 1.00 41.43 ? 13  SER A HB2  1  
ATOM 200    H HB3  . SER A 1 13  ? -5.111  14.687  -23.018 1.00 15.33 ? 13  SER A HB3  1  
ATOM 201    H HG   . SER A 1 13  ? -2.903  15.168  -23.276 1.00 54.43 ? 13  SER A HG   1  
ATOM 202    N N    . SER A 1 14  ? -7.270  15.223  -24.789 1.00 12.21 ? 14  SER A N    1  
ATOM 203    C CA   . SER A 1 14  ? -8.408  14.432  -25.239 1.00 13.22 ? 14  SER A CA   1  
ATOM 204    C C    . SER A 1 14  ? -9.346  15.270  -26.102 1.00 10.14 ? 14  SER A C    1  
ATOM 205    O O    . SER A 1 14  ? -9.331  16.499  -26.039 1.00 63.32 ? 14  SER A O    1  
ATOM 206    C CB   . SER A 1 14  ? -9.170  13.866  -24.039 1.00 61.20 ? 14  SER A CB   1  
ATOM 207    O OG   . SER A 1 14  ? -9.807  14.898  -23.306 1.00 53.21 ? 14  SER A OG   1  
ATOM 208    H H    . SER A 1 14  ? -7.402  15.895  -24.087 1.00 3.35  ? 14  SER A H    1  
ATOM 209    H HA   . SER A 1 14  ? -8.029  13.613  -25.832 1.00 22.24 ? 14  SER A HA   1  
ATOM 210    H HB2  . SER A 1 14  ? -9.921  13.173  -24.386 1.00 70.33 ? 14  SER A HB2  1  
ATOM 211    H HB3  . SER A 1 14  ? -8.479  13.352  -23.387 1.00 3.03  ? 14  SER A HB3  1  
ATOM 212    H HG   . SER A 1 14  ? -9.162  15.569  -23.071 1.00 30.35 ? 14  SER A HG   1  
ATOM 213    N N    . ALA A 1 15  ? -10.162 14.596  -26.907 1.00 51.52 ? 15  ALA A N    1  
ATOM 214    C CA   . ALA A 1 15  ? -11.107 15.279  -27.782 1.00 71.44 ? 15  ALA A CA   1  
ATOM 215    C C    . ALA A 1 15  ? -12.471 14.599  -27.753 1.00 4.14  ? 15  ALA A C    1  
ATOM 216    O O    . ALA A 1 15  ? -12.604 13.471  -27.277 1.00 62.22 ? 15  ALA A O    1  
ATOM 217    C CB   . ALA A 1 15  ? -10.569 15.326  -29.204 1.00 1.12  ? 15  ALA A CB   1  
ATOM 218    H H    . ALA A 1 15  ? -10.127 13.617  -26.912 1.00 1.23  ? 15  ALA A H    1  
ATOM 219    H HA   . ALA A 1 15  ? -11.214 16.294  -27.429 1.00 23.25 ? 15  ALA A HA   1  
ATOM 220    H HB1  . ALA A 1 15  ? -9.496  15.202  -29.187 1.00 3.03  ? 15  ALA A HB1  1  
ATOM 221    H HB2  . ALA A 1 15  ? -10.815 16.278  -29.651 1.00 53.13 ? 15  ALA A HB2  1  
ATOM 222    H HB3  . ALA A 1 15  ? -11.014 14.531  -29.784 1.00 4.23  ? 15  ALA A HB3  1  
ATOM 223    N N    . LYS A 1 16  ? -13.483 15.292  -28.265 1.00 71.51 ? 16  LYS A N    1  
ATOM 224    C CA   . LYS A 1 16  ? -14.839 14.755  -28.298 1.00 62.22 ? 16  LYS A CA   1  
ATOM 225    C C    . LYS A 1 16  ? -15.343 14.464  -26.888 1.00 4.41  ? 16  LYS A C    1  
ATOM 226    O O    . LYS A 1 16  ? -14.607 14.610  -25.912 1.00 25.03 ? 16  LYS A O    1  
ATOM 227    C CB   . LYS A 1 16  ? -14.884 13.479  -29.141 1.00 5.24  ? 16  LYS A CB   1  
ATOM 228    C CG   . LYS A 1 16  ? -15.150 13.734  -30.616 1.00 14.52 ? 16  LYS A CG   1  
ATOM 229    C CD   . LYS A 1 16  ? -16.624 13.578  -30.950 1.00 62.35 ? 16  LYS A CD   1  
ATOM 230    C CE   . LYS A 1 16  ? -17.047 14.526  -32.061 1.00 73.55 ? 16  LYS A CE   1  
ATOM 231    N NZ   . LYS A 1 16  ? -18.525 14.551  -32.238 1.00 5.43  ? 16  LYS A NZ   1  
ATOM 232    H H    . LYS A 1 16  ? -13.315 16.186  -28.629 1.00 43.40 ? 16  LYS A H    1  
ATOM 233    H HA   . LYS A 1 16  ? -15.478 15.497  -28.750 1.00 30.45 ? 16  LYS A HA   1  
ATOM 234    H HB2  . LYS A 1 16  ? -13.936 12.969  -29.051 1.00 52.11 ? 16  LYS A HB2  1  
ATOM 235    H HB3  . LYS A 1 16  ? -15.666 12.838  -28.762 1.00 51.53 ? 16  LYS A HB3  1  
ATOM 236    H HG2  . LYS A 1 16  ? -14.841 14.740  -30.859 1.00 64.13 ? 16  LYS A HG2  1  
ATOM 237    H HG3  . LYS A 1 16  ? -14.579 13.029  -31.202 1.00 60.11 ? 16  LYS A HG3  1  
ATOM 238    H HD2  . LYS A 1 16  ? -16.805 12.562  -31.270 1.00 54.53 ? 16  LYS A HD2  1  
ATOM 239    H HD3  . LYS A 1 16  ? -17.208 13.789  -30.067 1.00 64.31 ? 16  LYS A HD3  1  
ATOM 240    H HE2  . LYS A 1 16  ? -16.706 15.521  -31.816 1.00 4.22  ? 16  LYS A HE2  1  
ATOM 241    H HE3  . LYS A 1 16  ? -16.588 14.206  -32.984 1.00 22.44 ? 16  LYS A HE3  1  
ATOM 242    H HZ1  . LYS A 1 16  ? -18.790 15.277  -32.933 1.00 21.25 ? 16  LYS A HZ1  1  
ATOM 243    H HZ2  . LYS A 1 16  ? -18.990 14.767  -31.333 1.00 44.40 ? 16  LYS A HZ2  1  
ATOM 244    H HZ3  . LYS A 1 16  ? -18.861 13.625  -32.574 1.00 3.43  ? 16  LYS A HZ3  1  
ATOM 245    N N    . ARG A 1 17  ? -16.602 14.052  -26.789 1.00 73.44 ? 17  ARG A N    1  
ATOM 246    C CA   . ARG A 1 17  ? -17.205 13.740  -25.498 1.00 24.43 ? 17  ARG A CA   1  
ATOM 247    C C    . ARG A 1 17  ? -17.307 12.232  -25.295 1.00 34.01 ? 17  ARG A C    1  
ATOM 248    O O    . ARG A 1 17  ? -18.073 11.553  -25.979 1.00 15.22 ? 17  ARG A O    1  
ATOM 249    C CB   . ARG A 1 17  ? -18.593 14.377  -25.393 1.00 45.10 ? 17  ARG A CB   1  
ATOM 250    C CG   . ARG A 1 17  ? -18.891 14.964  -24.023 1.00 71.43 ? 17  ARG A CG   1  
ATOM 251    C CD   . ARG A 1 17  ? -20.385 15.143  -23.805 1.00 2.12  ? 17  ARG A CD   1  
ATOM 252    N NE   . ARG A 1 17  ? -20.694 16.405  -23.137 1.00 34.11 ? 17  ARG A NE   1  
ATOM 253    C CZ   . ARG A 1 17  ? -20.728 17.583  -23.756 1.00 53.14 ? 17  ARG A CZ   1  
ATOM 254    N NH1  . ARG A 1 17  ? -20.474 17.664  -25.056 1.00 21.13 ? 17  ARG A NH1  1  
ATOM 255    N NH2  . ARG A 1 17  ? -21.018 18.682  -23.074 1.00 12.25 ? 17  ARG A NH2  1  
ATOM 256    H H    . ARG A 1 17  ? -17.139 13.955  -27.603 1.00 1.33  ? 17  ARG A H    1  
ATOM 257    H HA   . ARG A 1 17  ? -16.571 14.153  -24.728 1.00 42.53 ? 17  ARG A HA   1  
ATOM 258    H HB2  . ARG A 1 17  ? -18.670 15.168  -26.124 1.00 72.52 ? 17  ARG A HB2  1  
ATOM 259    H HB3  . ARG A 1 17  ? -19.339 13.626  -25.609 1.00 55.52 ? 17  ARG A HB3  1  
ATOM 260    H HG2  . ARG A 1 17  ? -18.504 14.300  -23.265 1.00 54.33 ? 17  ARG A HG2  1  
ATOM 261    H HG3  . ARG A 1 17  ? -18.406 15.926  -23.942 1.00 74.31 ? 17  ARG A HG3  1  
ATOM 262    H HD2  . ARG A 1 17  ? -20.881 15.124  -24.764 1.00 3.24  ? 17  ARG A HD2  1  
ATOM 263    H HD3  . ARG A 1 17  ? -20.747 14.326  -23.198 1.00 41.00 ? 17  ARG A HD3  1  
ATOM 264    H HE   . ARG A 1 17  ? -20.885 16.373  -22.176 1.00 41.22 ? 17  ARG A HE   1  
ATOM 265    H HH11 . ARG A 1 17  ? -20.254 16.840  -25.577 1.00 51.01 ? 17  ARG A HH11 1  
ATOM 266    H HH12 . ARG A 1 17  ? -20.501 18.552  -25.516 1.00 53.34 ? 17  ARG A HH12 1  
ATOM 267    H HH21 . ARG A 1 17  ? -21.211 18.626  -22.094 1.00 31.53 ? 17  ARG A HH21 1  
ATOM 268    H HH22 . ARG A 1 17  ? -21.044 19.567  -23.539 1.00 63.15 ? 17  ARG A HH22 1  
ATOM 269    N N    . HIS A 1 18  ? -16.529 11.713  -24.351 1.00 33.51 ? 18  HIS A N    1  
ATOM 270    C CA   . HIS A 1 18  ? -16.531 10.285  -24.057 1.00 72.11 ? 18  HIS A CA   1  
ATOM 271    C C    . HIS A 1 18  ? -17.910 9.826   -23.595 1.00 70.22 ? 18  HIS A C    1  
ATOM 272    O O    . HIS A 1 18  ? -18.548 8.996   -24.243 1.00 14.22 ? 18  HIS A O    1  
ATOM 273    C CB   . HIS A 1 18  ? -15.488 9.961   -22.987 1.00 32.23 ? 18  HIS A CB   1  
ATOM 274    C CG   . HIS A 1 18  ? -14.127 9.679   -23.543 1.00 20.25 ? 18  HIS A CG   1  
ATOM 275    N ND1  . HIS A 1 18  ? -13.571 8.417   -23.570 1.00 34.01 ? 18  HIS A ND1  1  
ATOM 276    C CD2  . HIS A 1 18  ? -13.207 10.505  -24.097 1.00 21.22 ? 18  HIS A CD2  1  
ATOM 277    C CE1  . HIS A 1 18  ? -12.369 8.479   -24.116 1.00 22.30 ? 18  HIS A CE1  1  
ATOM 278    N NE2  . HIS A 1 18  ? -12.125 9.734   -24.445 1.00 2.44  ? 18  HIS A NE2  1  
ATOM 279    H H    . HIS A 1 18  ? -15.939 12.305  -23.839 1.00 35.43 ? 18  HIS A H    1  
ATOM 280    H HA   . HIS A 1 18  ? -16.276 9.760   -24.966 1.00 13.23 ? 18  HIS A HA   1  
ATOM 281    H HB2  . HIS A 1 18  ? -15.403 10.799  -22.312 1.00 2.35  ? 18  HIS A HB2  1  
ATOM 282    H HB3  . HIS A 1 18  ? -15.809 9.091   -22.433 1.00 52.43 ? 18  HIS A HB3  1  
ATOM 283    H HD1  . HIS A 1 18  ? -13.994 7.598   -23.238 1.00 0.21  ? 18  HIS A HD1  1  
ATOM 284    H HD2  . HIS A 1 18  ? -13.307 11.571  -24.240 1.00 1.53  ? 18  HIS A HD2  1  
ATOM 285    H HE1  . HIS A 1 18  ? -11.701 7.644   -24.268 1.00 2.02  ? 18  HIS A HE1  1  
ATOM 286    H HE2  . HIS A 1 18  ? -11.343 10.044  -24.946 1.00 37.47 ? 18  HIS A HE2  1  
ATOM 287    N N    . LEU A 1 19  ? -18.364 10.371  -22.472 1.00 15.11 ? 19  LEU A N    1  
ATOM 288    C CA   . LEU A 1 19  ? -19.668 10.018  -21.922 1.00 3.13  ? 19  LEU A CA   1  
ATOM 289    C C    . LEU A 1 19  ? -19.731 8.532   -21.584 1.00 0.23  ? 19  LEU A C    1  
ATOM 290    O O    . LEU A 1 19  ? -19.709 7.681   -22.474 1.00 64.43 ? 19  LEU A O    1  
ATOM 291    C CB   . LEU A 1 19  ? -20.777 10.375  -22.914 1.00 22.41 ? 19  LEU A CB   1  
ATOM 292    C CG   . LEU A 1 19  ? -21.298 11.810  -22.813 1.00 13.15 ? 19  LEU A CG   1  
ATOM 293    C CD1  . LEU A 1 19  ? -21.818 12.284  -24.161 1.00 13.10 ? 19  LEU A CD1  1  
ATOM 294    C CD2  . LEU A 1 19  ? -22.386 11.908  -21.755 1.00 23.15 ? 19  LEU A CD2  1  
ATOM 295    H H    . LEU A 1 19  ? -17.809 11.027  -22.000 1.00 60.54 ? 19  LEU A H    1  
ATOM 296    H HA   . LEU A 1 19  ? -19.811 10.587  -21.016 1.00 65.12 ? 19  LEU A HA   1  
ATOM 297    H HB2  . LEU A 1 19  ? -20.400 10.220  -23.914 1.00 2.14  ? 19  LEU A HB2  1  
ATOM 298    H HB3  . LEU A 1 19  ? -21.606 9.703   -22.752 1.00 5.15  ? 19  LEU A HB3  1  
ATOM 299    H HG   . LEU A 1 19  ? -20.486 12.461  -22.522 1.00 3.00  ? 19  LEU A HG   1  
ATOM 300    H HD11 . LEU A 1 19  ? -22.473 13.131  -24.017 1.00 64.13 ? 19  LEU A HD11 1  
ATOM 301    H HD12 . LEU A 1 19  ? -22.365 11.484  -24.638 1.00 11.14 ? 19  LEU A HD12 1  
ATOM 302    H HD13 . LEU A 1 19  ? -20.987 12.574  -24.786 1.00 61.51 ? 19  LEU A HD13 1  
ATOM 303    H HD21 . LEU A 1 19  ? -22.971 12.800  -21.921 1.00 71.24 ? 19  LEU A HD21 1  
ATOM 304    H HD22 . LEU A 1 19  ? -21.933 11.952  -20.775 1.00 31.43 ? 19  LEU A HD22 1  
ATOM 305    H HD23 . LEU A 1 19  ? -23.026 11.040  -21.816 1.00 34.23 ? 19  LEU A HD23 1  
ATOM 306    N N    . ALA A 1 20  ? -19.811 8.227   -20.293 1.00 15.31 ? 20  ALA A N    1  
ATOM 307    C CA   . ALA A 1 20  ? -19.878 6.843   -19.838 1.00 60.21 ? 20  ALA A CA   1  
ATOM 308    C C    . ALA A 1 20  ? -21.301 6.464   -19.444 1.00 3.11  ? 20  ALA A C    1  
ATOM 309    O O    . ALA A 1 20  ? -22.228 7.261   -19.584 1.00 5.15  ? 20  ALA A O    1  
ATOM 310    C CB   . ALA A 1 20  ? -18.928 6.627   -18.669 1.00 44.35 ? 20  ALA A CB   1  
ATOM 311    H H    . ALA A 1 20  ? -19.825 8.949   -19.631 1.00 74.31 ? 20  ALA A H    1  
ATOM 312    H HA   . ALA A 1 20  ? -19.559 6.209   -20.652 1.00 41.34 ? 20  ALA A HA   1  
ATOM 313    H HB1  . ALA A 1 20  ? -18.874 5.573   -18.440 1.00 31.12 ? 20  ALA A HB1  1  
ATOM 314    H HB2  . ALA A 1 20  ? -19.292 7.164   -17.806 1.00 14.23 ? 20  ALA A HB2  1  
ATOM 315    H HB3  . ALA A 1 20  ? -17.945 6.990   -18.932 1.00 24.41 ? 20  ALA A HB3  1  
ATOM 316    N N    . GLU A 1 21  ? -21.466 5.241   -18.949 1.00 25.24 ? 21  GLU A N    1  
ATOM 317    C CA   . GLU A 1 21  ? -22.776 4.755   -18.534 1.00 64.03 ? 21  GLU A CA   1  
ATOM 318    C C    . GLU A 1 21  ? -22.665 3.892   -17.281 1.00 52.10 ? 21  GLU A C    1  
ATOM 319    O O    . GLU A 1 21  ? -21.576 3.711   -16.736 1.00 21.21 ? 21  GLU A O    1  
ATOM 320    C CB   . GLU A 1 21  ? -23.428 3.954   -19.663 1.00 52.23 ? 21  GLU A CB   1  
ATOM 321    C CG   . GLU A 1 21  ? -24.934 4.138   -19.749 1.00 13.44 ? 21  GLU A CG   1  
ATOM 322    C CD   . GLU A 1 21  ? -25.452 4.042   -21.171 1.00 2.20  ? 21  GLU A CD   1  
ATOM 323    O OE1  . GLU A 1 21  ? -25.061 3.093   -21.882 1.00 41.44 ? 21  GLU A OE1  1  
ATOM 324    O OE2  . GLU A 1 21  ? -26.250 4.915   -21.572 1.00 71.40 ? 21  GLU A OE2  1  
ATOM 325    H H    . GLU A 1 21  ? -20.688 4.652   -18.862 1.00 3.11  ? 21  GLU A H    1  
ATOM 326    H HA   . GLU A 1 21  ? -23.393 5.613   -18.312 1.00 62.15 ? 21  GLU A HA   1  
ATOM 327    H HB2  . GLU A 1 21  ? -22.994 4.261   -20.603 1.00 31.54 ? 21  GLU A HB2  1  
ATOM 328    H HB3  . GLU A 1 21  ? -23.223 2.904   -19.508 1.00 22.13 ? 21  GLU A HB3  1  
ATOM 329    H HG2  . GLU A 1 21  ? -25.412 3.373   -19.156 1.00 34.10 ? 21  GLU A HG2  1  
ATOM 330    H HG3  . GLU A 1 21  ? -25.188 5.111   -19.354 1.00 10.45 ? 21  GLU A HG3  1  
ATOM 331    N N    . GLN A 1 22  ? -23.797 3.363   -16.830 1.00 32.42 ? 22  GLN A N    1  
ATOM 332    C CA   . GLN A 1 22  ? -23.826 2.520   -15.641 1.00 24.04 ? 22  GLN A CA   1  
ATOM 333    C C    . GLN A 1 22  ? -24.750 1.324   -15.844 1.00 34.32 ? 22  GLN A C    1  
ATOM 334    O O    . GLN A 1 22  ? -25.229 1.077   -16.951 1.00 34.21 ? 22  GLN A O    1  
ATOM 335    C CB   . GLN A 1 22  ? -24.280 3.330   -14.426 1.00 62.14 ? 22  GLN A CB   1  
ATOM 336    C CG   . GLN A 1 22  ? -23.539 4.647   -14.261 1.00 63.10 ? 22  GLN A CG   1  
ATOM 337    C CD   . GLN A 1 22  ? -24.263 5.614   -13.346 1.00 62.43 ? 22  GLN A CD   1  
ATOM 338    O OE1  . GLN A 1 22  ? -25.430 5.941   -13.567 1.00 15.11 ? 22  GLN A OE1  1  
ATOM 339    N NE2  . GLN A 1 22  ? -23.574 6.078   -12.310 1.00 22.25 ? 22  GLN A NE2  1  
ATOM 340    H H    . GLN A 1 22  ? -24.633 3.544   -17.308 1.00 72.12 ? 22  GLN A H    1  
ATOM 341    H HA   . GLN A 1 22  ? -22.823 2.159   -15.466 1.00 14.24 ? 22  GLN A HA   1  
ATOM 342    H HB2  . GLN A 1 22  ? -25.334 3.545   -14.524 1.00 43.42 ? 22  GLN A HB2  1  
ATOM 343    H HB3  . GLN A 1 22  ? -24.124 2.740   -13.535 1.00 51.24 ? 22  GLN A HB3  1  
ATOM 344    H HG2  . GLN A 1 22  ? -22.562 4.446   -13.846 1.00 2.15  ? 22  GLN A HG2  1  
ATOM 345    H HG3  . GLN A 1 22  ? -23.428 5.107   -15.233 1.00 42.02 ? 22  GLN A HG3  1  
ATOM 346    H HE21 . GLN A 1 22  ? -22.649 5.775   -12.197 1.00 73.31 ? 22  GLN A HE21 1  
ATOM 347    H HE22 . GLN A 1 22  ? -24.018 6.705   -11.702 1.00 71.22 ? 22  GLN A HE22 1  
ATOM 348    N N    . PHE A 1 23  ? -24.997 0.583   -14.767 1.00 35.51 ? 23  PHE A N    1  
ATOM 349    C CA   . PHE A 1 23  ? -25.864 -0.588  -14.827 1.00 64.13 ? 23  PHE A CA   1  
ATOM 350    C C    . PHE A 1 23  ? -27.109 -0.388  -13.970 1.00 32.31 ? 23  PHE A C    1  
ATOM 351    O O    . PHE A 1 23  ? -27.125 0.445   -13.064 1.00 65.21 ? 23  PHE A O    1  
ATOM 352    C CB   . PHE A 1 23  ? -25.106 -1.833  -14.364 1.00 25.33 ? 23  PHE A CB   1  
ATOM 353    C CG   . PHE A 1 23  ? -23.807 -2.049  -15.087 1.00 34.14 ? 23  PHE A CG   1  
ATOM 354    C CD1  . PHE A 1 23  ? -22.642 -1.448  -14.638 1.00 21.51 ? 23  PHE A CD1  1  
ATOM 355    C CD2  . PHE A 1 23  ? -23.752 -2.852  -16.214 1.00 61.34 ? 23  PHE A CD2  1  
ATOM 356    C CE1  . PHE A 1 23  ? -21.445 -1.645  -15.301 1.00 31.21 ? 23  PHE A CE1  1  
ATOM 357    C CE2  . PHE A 1 23  ? -22.558 -3.052  -16.881 1.00 63.30 ? 23  PHE A CE2  1  
ATOM 358    C CZ   . PHE A 1 23  ? -21.403 -2.448  -16.424 1.00 74.41 ? 23  PHE A CZ   1  
ATOM 359    H H    . PHE A 1 23  ? -24.586 0.830   -13.913 1.00 53.00 ? 23  PHE A H    1  
ATOM 360    H HA   . PHE A 1 23  ? -26.167 -0.724  -15.855 1.00 23.22 ? 23  PHE A HA   1  
ATOM 361    H HB2  . PHE A 1 23  ? -24.888 -1.742  -13.310 1.00 33.14 ? 23  PHE A HB2  1  
ATOM 362    H HB3  . PHE A 1 23  ? -25.726 -2.703  -14.524 1.00 23.23 ? 23  PHE A HB3  1  
ATOM 363    H HD1  . PHE A 1 23  ? -22.673 -0.820  -13.760 1.00 13.13 ? 23  PHE A HD1  1  
ATOM 364    H HD2  . PHE A 1 23  ? -24.654 -3.325  -16.573 1.00 71.30 ? 23  PHE A HD2  1  
ATOM 365    H HE1  . PHE A 1 23  ? -20.544 -1.170  -14.942 1.00 4.13  ? 23  PHE A HE1  1  
ATOM 366    H HE2  . PHE A 1 23  ? -22.528 -3.680  -17.759 1.00 55.22 ? 23  PHE A HE2  1  
ATOM 367    H HZ   . PHE A 1 23  ? -20.469 -2.603  -16.944 1.00 35.32 ? 23  PHE A HZ   1  
ATOM 368    N N    . ALA A 1 24  ? -28.153 -1.158  -14.263 1.00 15.04 ? 24  ALA A N    1  
ATOM 369    C CA   . ALA A 1 24  ? -29.403 -1.066  -13.519 1.00 63.24 ? 24  ALA A CA   1  
ATOM 370    C C    . ALA A 1 24  ? -29.267 -1.690  -12.135 1.00 73.23 ? 24  ALA A C    1  
ATOM 371    O O    . ALA A 1 24  ? -28.544 -2.670  -11.953 1.00 62.02 ? 24  ALA A O    1  
ATOM 372    C CB   . ALA A 1 24  ? -30.527 -1.737  -14.294 1.00 53.51 ? 24  ALA A CB   1  
ATOM 373    H H    . ALA A 1 24  ? -28.079 -1.804  -14.996 1.00 4.34  ? 24  ALA A H    1  
ATOM 374    H HA   . ALA A 1 24  ? -29.649 -0.020  -13.409 1.00 63.20 ? 24  ALA A HA   1  
ATOM 375    H HB1  . ALA A 1 24  ? -31.479 -1.433  -13.883 1.00 11.41 ? 24  ALA A HB1  1  
ATOM 376    H HB2  . ALA A 1 24  ? -30.428 -2.810  -14.216 1.00 0.23  ? 24  ALA A HB2  1  
ATOM 377    H HB3  . ALA A 1 24  ? -30.473 -1.445  -15.332 1.00 25.35 ? 24  ALA A HB3  1  
ATOM 378    N N    . VAL A 1 25  ? -29.967 -1.117  -11.161 1.00 21.11 ? 25  VAL A N    1  
ATOM 379    C CA   . VAL A 1 25  ? -29.927 -1.618  -9.793  1.00 3.24  ? 25  VAL A CA   1  
ATOM 380    C C    . VAL A 1 25  ? -30.719 -2.914  -9.658  1.00 55.12 ? 25  VAL A C    1  
ATOM 381    O O    . VAL A 1 25  ? -31.892 -2.976  -10.027 1.00 13.03 ? 25  VAL A O    1  
ATOM 382    C CB   . VAL A 1 25  ? -30.487 -0.582  -8.799  1.00 44.54 ? 25  VAL A CB   1  
ATOM 383    C CG1  . VAL A 1 25  ? -30.269 -1.041  -7.365  1.00 53.10 ? 25  VAL A CG1  1  
ATOM 384    C CG2  . VAL A 1 25  ? -29.852 0.780   -9.035  1.00 53.45 ? 25  VAL A CG2  1  
ATOM 385    H H    . VAL A 1 25  ? -30.527 -0.340  -11.369 1.00 13.21 ? 25  VAL A H    1  
ATOM 386    H HA   . VAL A 1 25  ? -28.895 -1.809  -9.537  1.00 65.12 ? 25  VAL A HA   1  
ATOM 387    H HB   . VAL A 1 25  ? -31.551 -0.492  -8.967  1.00 4.33  ? 25  VAL A HB   1  
ATOM 388    H HG11 . VAL A 1 25  ? -29.464 -0.473  -6.923  1.00 60.42 ? 25  VAL A HG11 1  
ATOM 389    H HG12 . VAL A 1 25  ? -30.016 -2.091  -7.357  1.00 31.34 ? 25  VAL A HG12 1  
ATOM 390    H HG13 . VAL A 1 25  ? -31.174 -0.885  -6.796  1.00 32.42 ? 25  VAL A HG13 1  
ATOM 391    H HG21 . VAL A 1 25  ? -29.814 1.325   -8.103  1.00 52.00 ? 25  VAL A HG21 1  
ATOM 392    H HG22 . VAL A 1 25  ? -30.441 1.333   -9.751  1.00 40.41 ? 25  VAL A HG22 1  
ATOM 393    H HG23 . VAL A 1 25  ? -28.850 0.649   -9.416  1.00 53.31 ? 25  VAL A HG23 1  
ATOM 394    N N    . GLY A 1 26  ? -30.073 -3.947  -9.127  1.00 53.22 ? 26  GLY A N    1  
ATOM 395    C CA   . GLY A 1 26  ? -30.738 -5.225  -8.954  1.00 11.23 ? 26  GLY A CA   1  
ATOM 396    C C    . GLY A 1 26  ? -30.354 -6.239  -10.016 1.00 14.21 ? 26  GLY A C    1  
ATOM 397    O O    . GLY A 1 26  ? -30.932 -7.324  -10.083 1.00 71.41 ? 26  GLY A O    1  
ATOM 398    H H    . GLY A 1 26  ? -29.138 -3.840  -8.849  1.00 63.01 ? 26  GLY A H    1  
ATOM 399    H HA2  . GLY A 1 26  ? -30.479 -5.623  -7.984  1.00 41.25 ? 26  GLY A HA2  1  
ATOM 400    H HA3  . GLY A 1 26  ? -31.806 -5.070  -8.992  1.00 73.01 ? 26  GLY A HA3  1  
ATOM 401    N N    . GLU A 1 27  ? -29.373 -5.893  -10.845 1.00 75.21 ? 27  GLU A N    1  
ATOM 402    C CA   . GLU A 1 27  ? -28.914 -6.788  -11.901 1.00 14.31 ? 27  GLU A CA   1  
ATOM 403    C C    . GLU A 1 27  ? -27.738 -7.628  -11.416 1.00 44.43 ? 27  GLU A C    1  
ATOM 404    O O    . GLU A 1 27  ? -26.983 -7.205  -10.541 1.00 72.21 ? 27  GLU A O    1  
ATOM 405    C CB   . GLU A 1 27  ? -28.509 -5.986  -13.139 1.00 73.41 ? 27  GLU A CB   1  
ATOM 406    C CG   . GLU A 1 27  ? -28.849 -6.678  -14.449 1.00 61.00 ? 27  GLU A CG   1  
ATOM 407    C CD   . GLU A 1 27  ? -28.993 -5.704  -15.603 1.00 2.24  ? 27  GLU A CD   1  
ATOM 408    O OE1  . GLU A 1 27  ? -27.955 -5.260  -16.137 1.00 24.02 ? 27  GLU A OE1  1  
ATOM 409    O OE2  . GLU A 1 27  ? -30.143 -5.386  -15.971 1.00 73.00 ? 27  GLU A OE2  1  
ATOM 410    H H    . GLU A 1 27  ? -28.944 -5.018  -10.741 1.00 3.34  ? 27  GLU A H    1  
ATOM 411    H HA   . GLU A 1 27  ? -29.731 -7.445  -12.157 1.00 71.14 ? 27  GLU A HA   1  
ATOM 412    H HB2  . GLU A 1 27  ? -29.016 -5.033  -13.119 1.00 50.22 ? 27  GLU A HB2  1  
ATOM 413    H HB3  . GLU A 1 27  ? -27.443 -5.818  -13.112 1.00 11.23 ? 27  GLU A HB3  1  
ATOM 414    H HG2  . GLU A 1 27  ? -28.063 -7.379  -14.686 1.00 2.30  ? 27  GLU A HG2  1  
ATOM 415    H HG3  . GLU A 1 27  ? -29.781 -7.211  -14.329 1.00 73.25 ? 27  GLU A HG3  1  
ATOM 416    N N    . ILE A 1 28  ? -27.585 -8.819  -11.986 1.00 42.53 ? 28  ILE A N    1  
ATOM 417    C CA   . ILE A 1 28  ? -26.494 -9.706  -11.599 1.00 23.04 ? 28  ILE A CA   1  
ATOM 418    C C    . ILE A 1 28  ? -25.720 -10.197 -12.817 1.00 15.13 ? 28  ILE A C    1  
ATOM 419    O O    . ILE A 1 28  ? -26.209 -11.026 -13.585 1.00 34.12 ? 28  ILE A O    1  
ATOM 420    C CB   . ILE A 1 28  ? -27.014 -10.925 -10.814 1.00 54.14 ? 28  ILE A CB   1  
ATOM 421    C CG1  . ILE A 1 28  ? -28.008 -10.484 -9.737  1.00 33.55 ? 28  ILE A CG1  1  
ATOM 422    C CG2  . ILE A 1 28  ? -25.854 -11.690 -10.192 1.00 1.42  ? 28  ILE A CG2  1  
ATOM 423    C CD1  . ILE A 1 28  ? -29.455 -10.660 -10.142 1.00 72.10 ? 28  ILE A CD1  1  
ATOM 424    H H    . ILE A 1 28  ? -28.216 -9.105  -12.679 1.00 72.00 ? 28  ILE A H    1  
ATOM 425    H HA   . ILE A 1 28  ? -25.825 -9.151  -10.959 1.00 51.12 ? 28  ILE A HA   1  
ATOM 426    H HB   . ILE A 1 28  ? -27.515 -11.584 -11.507 1.00 52.51 ? 28  ILE A HB   1  
ATOM 427    H HG12 . ILE A 1 28  ? -27.842 -11.064 -8.842  1.00 25.23 ? 28  ILE A HG12 1  
ATOM 428    H HG13 . ILE A 1 28  ? -27.849 -9.438  -9.517  1.00 12.40 ? 28  ILE A HG13 1  
ATOM 429    H HG21 . ILE A 1 28  ? -24.930 -11.388 -10.663 1.00 3.33  ? 28  ILE A HG21 1  
ATOM 430    H HG22 . ILE A 1 28  ? -26.003 -12.749 -10.338 1.00 72.41 ? 28  ILE A HG22 1  
ATOM 431    H HG23 . ILE A 1 28  ? -25.806 -11.475 -9.135  1.00 52.22 ? 28  ILE A HG23 1  
ATOM 432    H HD11 . ILE A 1 28  ? -29.531 -10.650 -11.219 1.00 3.11  ? 28  ILE A HD11 1  
ATOM 433    H HD12 . ILE A 1 28  ? -30.045 -9.852  -9.733  1.00 53.14 ? 28  ILE A HD12 1  
ATOM 434    H HD13 . ILE A 1 28  ? -29.823 -11.602 -9.764  1.00 3.41  ? 28  ILE A HD13 1  
ATOM 435    N N    . ILE A 1 29  ? -24.510 -9.675  -12.990 1.00 3.54  ? 29  ILE A N    1  
ATOM 436    C CA   . ILE A 1 29  ? -23.664 -10.052 -14.116 1.00 43.02 ? 29  ILE A CA   1  
ATOM 437    C C    . ILE A 1 29  ? -22.957 -11.380 -13.862 1.00 0.21  ? 29  ILE A C    1  
ATOM 438    O O    . ILE A 1 29  ? -22.985 -11.910 -12.752 1.00 13.54 ? 29  ILE A O    1  
ATOM 439    C CB   . ILE A 1 29  ? -22.606 -8.971  -14.409 1.00 63.03 ? 29  ILE A CB   1  
ATOM 440    C CG1  . ILE A 1 29  ? -21.843 -8.614  -13.132 1.00 34.40 ? 29  ILE A CG1  1  
ATOM 441    C CG2  . ILE A 1 29  ? -23.263 -7.735  -15.004 1.00 74.24 ? 29  ILE A CG2  1  
ATOM 442    C CD1  . ILE A 1 29  ? -20.517 -7.933  -13.392 1.00 53.24 ? 29  ILE A CD1  1  
ATOM 443    H H    . ILE A 1 29  ? -24.179 -9.008  -12.352 1.00 23.02 ? 29  ILE A H    1  
ATOM 444    H HA   . ILE A 1 29  ? -24.294 -10.153 -14.987 1.00 42.24 ? 29  ILE A HA   1  
ATOM 445    H HB   . ILE A 1 29  ? -21.913 -9.366  -15.136 1.00 50.41 ? 29  ILE A HB   1  
ATOM 446    H HG12 . ILE A 1 29  ? -22.446 -7.948  -12.534 1.00 73.32 ? 29  ILE A HG12 1  
ATOM 447    H HG13 . ILE A 1 29  ? -21.649 -9.518  -12.572 1.00 52.23 ? 29  ILE A HG13 1  
ATOM 448    H HG21 . ILE A 1 29  ? -23.490 -7.913  -16.044 1.00 32.24 ? 29  ILE A HG21 1  
ATOM 449    H HG22 . ILE A 1 29  ? -22.590 -6.895  -14.921 1.00 73.02 ? 29  ILE A HG22 1  
ATOM 450    H HG23 . ILE A 1 29  ? -24.176 -7.520  -14.468 1.00 11.13 ? 29  ILE A HG23 1  
ATOM 451    H HD11 . ILE A 1 29  ? -20.692 -6.934  -13.761 1.00 51.13 ? 29  ILE A HD11 1  
ATOM 452    H HD12 . ILE A 1 29  ? -19.960 -8.496  -14.126 1.00 2.31  ? 29  ILE A HD12 1  
ATOM 453    H HD13 . ILE A 1 29  ? -19.952 -7.883  -12.472 1.00 5.31  ? 29  ILE A HD13 1  
ATOM 454    N N    . THR A 1 30  ? -22.319 -11.907 -14.902 1.00 75.42 ? 30  THR A N    1  
ATOM 455    C CA   . THR A 1 30  ? -21.596 -13.170 -14.799 1.00 0.13  ? 30  THR A CA   1  
ATOM 456    C C    . THR A 1 30  ? -20.096 -12.947 -14.966 1.00 44.22 ? 30  THR A C    1  
ATOM 457    O O    . THR A 1 30  ? -19.604 -12.775 -16.081 1.00 11.00 ? 30  THR A O    1  
ATOM 458    C CB   . THR A 1 30  ? -22.098 -14.157 -15.854 1.00 22.15 ? 30  THR A CB   1  
ATOM 459    O OG1  . THR A 1 30  ? -23.494 -14.013 -16.052 1.00 40.12 ? 30  THR A OG1  1  
ATOM 460    C CG2  . THR A 1 30  ? -21.832 -15.603 -15.496 1.00 24.40 ? 30  THR A CG2  1  
ATOM 461    H H    . THR A 1 30  ? -22.328 -11.430 -15.758 1.00 65.50 ? 30  THR A H    1  
ATOM 462    H HA   . THR A 1 30  ? -21.781 -13.580 -13.817 1.00 72.33 ? 30  THR A HA   1  
ATOM 463    H HB   . THR A 1 30  ? -21.600 -13.951 -16.791 1.00 52.24 ? 30  THR A HB   1  
ATOM 464    H HG1  . THR A 1 30  ? -23.681 -13.130 -16.379 1.00 31.23 ? 30  THR A HG1  1  
ATOM 465    H HG21 . THR A 1 30  ? -22.627 -15.969 -14.863 1.00 61.34 ? 30  THR A HG21 1  
ATOM 466    H HG22 . THR A 1 30  ? -20.891 -15.676 -14.970 1.00 33.01 ? 30  THR A HG22 1  
ATOM 467    H HG23 . THR A 1 30  ? -21.788 -16.195 -16.397 1.00 22.55 ? 30  THR A HG23 1  
ATOM 468    N N    . ASP A 1 31  ? -19.375 -12.948 -13.849 1.00 21.44 ? 31  ASP A N    1  
ATOM 469    C CA   . ASP A 1 31  ? -17.931 -12.742 -13.868 1.00 32.21 ? 31  ASP A CA   1  
ATOM 470    C C    . ASP A 1 31  ? -17.238 -13.784 -14.741 1.00 23.30 ? 31  ASP A C    1  
ATOM 471    O O    . ASP A 1 31  ? -17.867 -14.730 -15.216 1.00 51.15 ? 31  ASP A O    1  
ATOM 472    C CB   . ASP A 1 31  ? -17.368 -12.796 -12.447 1.00 42.22 ? 31  ASP A CB   1  
ATOM 473    C CG   . ASP A 1 31  ? -17.344 -11.434 -11.781 1.00 72.34 ? 31  ASP A CG   1  
ATOM 474    O OD1  . ASP A 1 31  ? -17.515 -10.421 -12.492 1.00 71.11 ? 31  ASP A OD1  1  
ATOM 475    O OD2  . ASP A 1 31  ? -17.153 -11.380 -10.548 1.00 41.34 ? 31  ASP A OD2  1  
ATOM 476    H H    . ASP A 1 31  ? -19.826 -13.089 -12.990 1.00 62.53 ? 31  ASP A H    1  
ATOM 477    H HA   . ASP A 1 31  ? -17.743 -11.763 -14.282 1.00 11.00 ? 31  ASP A HA   1  
ATOM 478    H HB2  . ASP A 1 31  ? -17.979 -13.457 -11.849 1.00 21.33 ? 31  ASP A HB2  1  
ATOM 479    H HB3  . ASP A 1 31  ? -16.359 -13.179 -12.480 1.00 44.34 ? 31  ASP A HB3  1  
ATOM 480    N N    . MET A 1 32  ? -15.937 -13.602 -14.948 1.00 71.31 ? 32  MET A N    1  
ATOM 481    C CA   . MET A 1 32  ? -15.153 -14.524 -15.763 1.00 61.04 ? 32  MET A CA   1  
ATOM 482    C C    . MET A 1 32  ? -15.075 -15.902 -15.112 1.00 62.23 ? 32  MET A C    1  
ATOM 483    O O    . MET A 1 32  ? -14.879 -16.909 -15.793 1.00 54.24 ? 32  MET A O    1  
ATOM 484    C CB   . MET A 1 32  ? -13.744 -13.971 -15.983 1.00 73.41 ? 32  MET A CB   1  
ATOM 485    C CG   . MET A 1 32  ? -12.934 -13.844 -14.703 1.00 10.13 ? 32  MET A CG   1  
ATOM 486    S SD   . MET A 1 32  ? -11.794 -15.220 -14.462 1.00 52.10 ? 32  MET A SD   1  
ATOM 487    C CE   . MET A 1 32  ? -11.937 -15.473 -12.695 1.00 31.34 ? 32  MET A CE   1  
ATOM 488    H H    . MET A 1 32  ? -15.493 -12.828 -14.541 1.00 52.22 ? 32  MET A H    1  
ATOM 489    H HA   . MET A 1 32  ? -15.645 -14.619 -16.720 1.00 64.32 ? 32  MET A HA   1  
ATOM 490    H HB2  . MET A 1 32  ? -13.213 -14.627 -16.656 1.00 62.25 ? 32  MET A HB2  1  
ATOM 491    H HB3  . MET A 1 32  ? -13.820 -12.992 -16.434 1.00 41.02 ? 32  MET A HB3  1  
ATOM 492    H HG2  . MET A 1 32  ? -12.364 -12.927 -14.743 1.00 4.22  ? 32  MET A HG2  1  
ATOM 493    H HG3  . MET A 1 32  ? -13.614 -13.807 -13.864 1.00 44.40 ? 32  MET A HG3  1  
ATOM 494    H HE1  . MET A 1 32  ? -12.363 -16.447 -12.504 1.00 71.23 ? 32  MET A HE1  1  
ATOM 495    H HE2  . MET A 1 32  ? -12.575 -14.712 -12.273 1.00 21.30 ? 32  MET A HE2  1  
ATOM 496    H HE3  . MET A 1 32  ? -10.958 -15.414 -12.243 1.00 53.31 ? 32  MET A HE3  1  
ATOM 497    N N    . ALA A 1 33  ? -15.228 -15.941 -13.792 1.00 12.32 ? 33  ALA A N    1  
ATOM 498    C CA   . ALA A 1 33  ? -15.173 -17.197 -13.052 1.00 22.24 ? 33  ALA A CA   1  
ATOM 499    C C    . ALA A 1 33  ? -16.537 -17.884 -13.006 1.00 71.51 ? 33  ALA A C    1  
ATOM 500    O O    . ALA A 1 33  ? -16.727 -18.852 -12.270 1.00 5.41  ? 33  ALA A O    1  
ATOM 501    C CB   . ALA A 1 33  ? -14.657 -16.953 -11.642 1.00 40.40 ? 33  ALA A CB   1  
ATOM 502    H H    . ALA A 1 33  ? -15.379 -15.105 -13.303 1.00 3.21  ? 33  ALA A H    1  
ATOM 503    H HA   . ALA A 1 33  ? -14.472 -17.847 -13.556 1.00 13.42 ? 33  ALA A HA   1  
ATOM 504    H HB1  . ALA A 1 33  ? -15.491 -16.914 -10.956 1.00 63.15 ? 33  ALA A HB1  1  
ATOM 505    H HB2  . ALA A 1 33  ? -14.122 -16.016 -11.611 1.00 64.14 ? 33  ALA A HB2  1  
ATOM 506    H HB3  . ALA A 1 33  ? -13.994 -17.756 -11.357 1.00 42.23 ? 33  ALA A HB3  1  
ATOM 507    N N    . LYS A 1 34  ? -17.487 -17.381 -13.793 1.00 52.22 ? 34  LYS A N    1  
ATOM 508    C CA   . LYS A 1 34  ? -18.830 -17.951 -13.834 1.00 21.21 ? 34  LYS A CA   1  
ATOM 509    C C    . LYS A 1 34  ? -19.560 -17.719 -12.515 1.00 52.42 ? 34  LYS A C    1  
ATOM 510    O O    . LYS A 1 34  ? -20.420 -18.508 -12.122 1.00 32.23 ? 34  LYS A O    1  
ATOM 511    C CB   . LYS A 1 34  ? -18.767 -19.450 -14.140 1.00 1.44  ? 34  LYS A CB   1  
ATOM 512    C CG   . LYS A 1 34  ? -19.886 -19.932 -15.048 1.00 75.55 ? 34  LYS A CG   1  
ATOM 513    C CD   . LYS A 1 34  ? -19.412 -21.035 -15.980 1.00 53.23 ? 34  LYS A CD   1  
ATOM 514    C CE   . LYS A 1 34  ? -20.021 -20.894 -17.365 1.00 52.31 ? 34  LYS A CE   1  
ATOM 515    N NZ   . LYS A 1 34  ? -19.338 -21.764 -18.363 1.00 52.35 ? 34  LYS A NZ   1  
ATOM 516    H H    . LYS A 1 34  ? -17.283 -16.607 -14.356 1.00 22.43 ? 34  LYS A H    1  
ATOM 517    H HA   . LYS A 1 34  ? -19.375 -17.455 -14.623 1.00 64.31 ? 34  LYS A HA   1  
ATOM 518    H HB2  . LYS A 1 34  ? -17.824 -19.668 -14.620 1.00 0.42  ? 34  LYS A HB2  1  
ATOM 519    H HB3  . LYS A 1 34  ? -18.824 -19.998 -13.211 1.00 22.21 ? 34  LYS A HB3  1  
ATOM 520    H HG2  . LYS A 1 34  ? -20.693 -20.312 -14.438 1.00 31.23 ? 34  LYS A HG2  1  
ATOM 521    H HG3  . LYS A 1 34  ? -20.241 -19.101 -15.639 1.00 53.31 ? 34  LYS A HG3  1  
ATOM 522    H HD2  . LYS A 1 34  ? -18.336 -20.985 -16.063 1.00 54.42 ? 34  LYS A HD2  1  
ATOM 523    H HD3  . LYS A 1 34  ? -19.698 -21.991 -15.565 1.00 73.22 ? 34  LYS A HD3  1  
ATOM 524    H HE2  . LYS A 1 34  ? -21.064 -21.169 -17.316 1.00 65.43 ? 34  LYS A HE2  1  
ATOM 525    H HE3  . LYS A 1 34  ? -19.934 -19.864 -17.679 1.00 5.22  ? 34  LYS A HE3  1  
ATOM 526    H HZ1  . LYS A 1 34  ? -19.863 -22.655 -18.478 1.00 21.52 ? 34  LYS A HZ1  1  
ATOM 527    H HZ2  . LYS A 1 34  ? -18.372 -21.982 -18.047 1.00 11.20 ? 34  LYS A HZ2  1  
ATOM 528    H HZ3  . LYS A 1 34  ? -19.289 -21.281 -19.283 1.00 32.53 ? 34  LYS A HZ3  1  
ATOM 529    N N    . LYS A 1 35  ? -19.212 -16.630 -11.836 1.00 23.04 ? 35  LYS A N    1  
ATOM 530    C CA   . LYS A 1 35  ? -19.836 -16.292 -10.563 1.00 52.21 ? 35  LYS A CA   1  
ATOM 531    C C    . LYS A 1 35  ? -20.878 -15.195 -10.747 1.00 53.13 ? 35  LYS A C    1  
ATOM 532    O O    . LYS A 1 35  ? -20.647 -14.219 -11.461 1.00 21.21 ? 35  LYS A O    1  
ATOM 533    C CB   . LYS A 1 35  ? -18.776 -15.842 -9.555  1.00 11.51 ? 35  LYS A CB   1  
ATOM 534    C CG   . LYS A 1 35  ? -19.089 -16.246 -8.123  1.00 60.11 ? 35  LYS A CG   1  
ATOM 535    C CD   . LYS A 1 35  ? -18.854 -17.731 -7.900  1.00 52.04 ? 35  LYS A CD   1  
ATOM 536    C CE   . LYS A 1 35  ? -18.827 -18.074 -6.419  1.00 32.25 ? 35  LYS A CE   1  
ATOM 537    N NZ   . LYS A 1 35  ? -17.815 -19.121 -6.110  1.00 40.25 ? 35  LYS A NZ   1  
ATOM 538    H H    . LYS A 1 35  ? -18.522 -16.039 -12.201 1.00 3.51  ? 35  LYS A H    1  
ATOM 539    H HA   . LYS A 1 35  ? -20.325 -17.178 -10.187 1.00 50.21 ? 35  LYS A HA   1  
ATOM 540    H HB2  . LYS A 1 35  ? -17.827 -16.277 -9.830  1.00 25.31 ? 35  LYS A HB2  1  
ATOM 541    H HB3  . LYS A 1 35  ? -18.694 -14.766 -9.593  1.00 54.45 ? 35  LYS A HB3  1  
ATOM 542    H HG2  . LYS A 1 35  ? -18.451 -15.687 -7.455  1.00 30.14 ? 35  LYS A HG2  1  
ATOM 543    H HG3  . LYS A 1 35  ? -20.123 -16.018 -7.913  1.00 33.22 ? 35  LYS A HG3  1  
ATOM 544    H HD2  . LYS A 1 35  ? -19.650 -18.286 -8.372  1.00 62.43 ? 35  LYS A HD2  1  
ATOM 545    H HD3  . LYS A 1 35  ? -17.908 -18.007 -8.342  1.00 35.44 ? 35  LYS A HD3  1  
ATOM 546    H HE2  . LYS A 1 35  ? -18.589 -17.181 -5.860  1.00 1.44  ? 35  LYS A HE2  1  
ATOM 547    H HE3  . LYS A 1 35  ? -19.804 -18.431 -6.127  1.00 22.22 ? 35  LYS A HE3  1  
ATOM 548    H HZ1  . LYS A 1 35  ? -18.141 -19.710 -5.316  1.00 2.23  ? 35  LYS A HZ1  1  
ATOM 549    H HZ2  . LYS A 1 35  ? -16.910 -18.679 -5.851  1.00 0.02  ? 35  LYS A HZ2  1  
ATOM 550    H HZ3  . LYS A 1 35  ? -17.665 -19.730 -6.940  1.00 74.43 ? 35  LYS A HZ3  1  
ATOM 551    N N    . GLU A 1 36  ? -22.026 -15.361 -10.100 1.00 50.21 ? 36  GLU A N    1  
ATOM 552    C CA   . GLU A 1 36  ? -23.104 -14.384 -10.196 1.00 44.13 ? 36  GLU A CA   1  
ATOM 553    C C    . GLU A 1 36  ? -23.005 -13.349 -9.081  1.00 31.41 ? 36  GLU A C    1  
ATOM 554    O O    . GLU A 1 36  ? -23.006 -13.692 -7.898  1.00 53.11 ? 36  GLU A O    1  
ATOM 555    C CB   . GLU A 1 36  ? -24.462 -15.086 -10.139 1.00 42.24 ? 36  GLU A CB   1  
ATOM 556    C CG   . GLU A 1 36  ? -25.002 -15.478 -11.504 1.00 52.15 ? 36  GLU A CG   1  
ATOM 557    C CD   . GLU A 1 36  ? -26.486 -15.789 -11.476 1.00 4.53  ? 36  GLU A CD   1  
ATOM 558    O OE1  . GLU A 1 36  ? -26.876 -16.760 -10.795 1.00 22.00 ? 36  GLU A OE1  1  
ATOM 559    O OE2  . GLU A 1 36  ? -27.257 -15.062 -12.137 1.00 50.40 ? 36  GLU A OE2  1  
ATOM 560    H H    . GLU A 1 36  ? -22.153 -16.160 -9.547  1.00 22.34 ? 36  GLU A H    1  
ATOM 561    H HA   . GLU A 1 36  ? -23.010 -13.881 -11.147 1.00 71.23 ? 36  GLU A HA   1  
ATOM 562    H HB2  . GLU A 1 36  ? -24.366 -15.981 -9.543  1.00 43.51 ? 36  GLU A HB2  1  
ATOM 563    H HB3  . GLU A 1 36  ? -25.176 -14.426 -9.669  1.00 5.22  ? 36  GLU A HB3  1  
ATOM 564    H HG2  . GLU A 1 36  ? -24.835 -14.662 -12.191 1.00 12.43 ? 36  GLU A HG2  1  
ATOM 565    H HG3  . GLU A 1 36  ? -24.472 -16.353 -11.849 1.00 73.52 ? 36  GLU A HG3  1  
ATOM 566    N N    . TRP A 1 37  ? -22.923 -12.080 -9.467  1.00 64.44 ? 37  TRP A N    1  
ATOM 567    C CA   . TRP A 1 37  ? -22.826 -10.990 -8.502  1.00 12.15 ? 37  TRP A CA   1  
ATOM 568    C C    . TRP A 1 37  ? -23.880 -9.925  -8.786  1.00 45.44 ? 37  TRP A C    1  
ATOM 569    O O    . TRP A 1 37  ? -23.933 -9.367  -9.882  1.00 23.32 ? 37  TRP A O    1  
ATOM 570    C CB   . TRP A 1 37  ? -21.430 -10.367 -8.542  1.00 31.11 ? 37  TRP A CB   1  
ATOM 571    C CG   . TRP A 1 37  ? -20.339 -11.330 -8.188  1.00 23.03 ? 37  TRP A CG   1  
ATOM 572    C CD1  . TRP A 1 37  ? -19.402 -11.854 -9.032  1.00 61.34 ? 37  TRP A CD1  1  
ATOM 573    C CD2  . TRP A 1 37  ? -20.071 -11.886 -6.895  1.00 64.50 ? 37  TRP A CD2  1  
ATOM 574    N NE1  . TRP A 1 37  ? -18.568 -12.701 -8.343  1.00 75.45 ? 37  TRP A NE1  1  
ATOM 575    C CE2  . TRP A 1 37  ? -18.958 -12.738 -7.030  1.00 54.32 ? 37  TRP A CE2  1  
ATOM 576    C CE3  . TRP A 1 37  ? -20.664 -11.747 -5.637  1.00 34.44 ? 37  TRP A CE3  1  
ATOM 577    C CZ2  . TRP A 1 37  ? -18.427 -13.446 -5.954  1.00 31.32 ? 37  TRP A CZ2  1  
ATOM 578    C CZ3  . TRP A 1 37  ? -20.136 -12.450 -4.570  1.00 12.12 ? 37  TRP A CZ3  1  
ATOM 579    C CH2  . TRP A 1 37  ? -19.027 -13.290 -4.735  1.00 51.22 ? 37  TRP A CH2  1  
ATOM 580    H H    . TRP A 1 37  ? -22.929 -11.870 -10.424 1.00 74.12 ? 37  TRP A H    1  
ATOM 581    H HA   . TRP A 1 37  ? -23.001 -11.400 -7.519  1.00 71.25 ? 37  TRP A HA   1  
ATOM 582    H HB2  . TRP A 1 37  ? -21.236 -9.996  -9.538  1.00 70.42 ? 37  TRP A HB2  1  
ATOM 583    H HB3  . TRP A 1 37  ? -21.390 -9.544  -7.843  1.00 4.40  ? 37  TRP A HB3  1  
ATOM 584    H HD1  . TRP A 1 37  ? -19.338 -11.626 -10.085 1.00 1.24  ? 37  TRP A HD1  1  
ATOM 585    H HE1  . TRP A 1 37  ? -17.816 -13.197 -8.729  1.00 32.53 ? 37  TRP A HE1  1  
ATOM 586    H HE3  . TRP A 1 37  ? -21.519 -11.104 -5.490  1.00 43.11 ? 37  TRP A HE3  1  
ATOM 587    H HZ2  . TRP A 1 37  ? -17.572 -14.097 -6.064  1.00 63.30 ? 37  TRP A HZ2  1  
ATOM 588    H HZ3  . TRP A 1 37  ? -20.581 -12.355 -3.591  1.00 63.33 ? 37  TRP A HZ3  1  
ATOM 589    H HH2  . TRP A 1 37  ? -18.648 -13.820 -3.874  1.00 51.04 ? 37  TRP A HH2  1  
ATOM 590    N N    . LYS A 1 38  ? -24.717 -9.648  -7.791  1.00 72.31 ? 38  LYS A N    1  
ATOM 591    C CA   . LYS A 1 38  ? -25.772 -8.650  -7.934  1.00 51.12 ? 38  LYS A CA   1  
ATOM 592    C C    . LYS A 1 38  ? -25.251 -7.255  -7.607  1.00 51.12 ? 38  LYS A C    1  
ATOM 593    O O    . LYS A 1 38  ? -24.524 -7.066  -6.632  1.00 24.42 ? 38  LYS A O    1  
ATOM 594    C CB   . LYS A 1 38  ? -26.953 -8.993  -7.024  1.00 71.23 ? 38  LYS A CB   1  
ATOM 595    C CG   . LYS A 1 38  ? -28.133 -8.048  -7.177  1.00 20.04 ? 38  LYS A CG   1  
ATOM 596    C CD   . LYS A 1 38  ? -29.299 -8.466  -6.295  1.00 33.12 ? 38  LYS A CD   1  
ATOM 597    C CE   . LYS A 1 38  ? -30.234 -9.419  -7.022  1.00 70.00 ? 38  LYS A CE   1  
ATOM 598    N NZ   . LYS A 1 38  ? -31.202 -10.065 -6.092  1.00 1.02  ? 38  LYS A NZ   1  
ATOM 599    H H    . LYS A 1 38  ? -24.623 -10.125 -6.940  1.00 11.42 ? 38  LYS A H    1  
ATOM 600    H HA   . LYS A 1 38  ? -26.105 -8.665  -8.961  1.00 53.33 ? 38  LYS A HA   1  
ATOM 601    H HB2  . LYS A 1 38  ? -27.288 -9.994  -7.250  1.00 61.24 ? 38  LYS A HB2  1  
ATOM 602    H HB3  . LYS A 1 38  ? -26.622 -8.957  -5.996  1.00 24.13 ? 38  LYS A HB3  1  
ATOM 603    H HG2  . LYS A 1 38  ? -27.824 -7.052  -6.898  1.00 13.43 ? 38  LYS A HG2  1  
ATOM 604    H HG3  . LYS A 1 38  ? -28.454 -8.053  -8.208  1.00 34.12 ? 38  LYS A HG3  1  
ATOM 605    H HD2  . LYS A 1 38  ? -28.914 -8.958  -5.414  1.00 12.21 ? 38  LYS A HD2  1  
ATOM 606    H HD3  . LYS A 1 38  ? -29.852 -7.584  -6.004  1.00 21.52 ? 38  LYS A HD3  1  
ATOM 607    H HE2  . LYS A 1 38  ? -30.782 -8.865  -7.769  1.00 53.41 ? 38  LYS A HE2  1  
ATOM 608    H HE3  . LYS A 1 38  ? -29.644 -10.185 -7.503  1.00 13.33 ? 38  LYS A HE3  1  
ATOM 609    H HZ1  . LYS A 1 38  ? -30.758 -10.217 -5.164  1.00 14.20 ? 38  LYS A HZ1  1  
ATOM 610    H HZ2  . LYS A 1 38  ? -31.506 -10.983 -6.474  1.00 51.00 ? 38  LYS A HZ2  1  
ATOM 611    H HZ3  . LYS A 1 38  ? -32.038 -9.459  -5.970  1.00 22.25 ? 38  LYS A HZ3  1  
ATOM 612    N N    . VAL A 1 39  ? -25.628 -6.280  -8.428  1.00 23.11 ? 39  VAL A N    1  
ATOM 613    C CA   . VAL A 1 39  ? -25.198 -4.902  -8.226  1.00 13.43 ? 39  VAL A CA   1  
ATOM 614    C C    . VAL A 1 39  ? -26.357 -4.023  -7.771  1.00 30.55 ? 39  VAL A C    1  
ATOM 615    O O    . VAL A 1 39  ? -27.392 -3.950  -8.435  1.00 51.04 ? 39  VAL A O    1  
ATOM 616    C CB   . VAL A 1 39  ? -24.592 -4.307  -9.511  1.00 32.44 ? 39  VAL A CB   1  
ATOM 617    C CG1  . VAL A 1 39  ? -23.968 -2.949  -9.229  1.00 23.30 ? 39  VAL A CG1  1  
ATOM 618    C CG2  . VAL A 1 39  ? -23.567 -5.260  -10.108 1.00 44.35 ? 39  VAL A CG2  1  
ATOM 619    H H    . VAL A 1 39  ? -26.208 -6.491  -9.190  1.00 50.00 ? 39  VAL A H    1  
ATOM 620    H HA   . VAL A 1 39  ? -24.438 -4.900  -7.460  1.00 73.34 ? 39  VAL A HA   1  
ATOM 621    H HB   . VAL A 1 39  ? -25.386 -4.171  -10.230 1.00 14.35 ? 39  VAL A HB   1  
ATOM 622    H HG11 . VAL A 1 39  ? -24.731 -2.187  -9.269  1.00 33.53 ? 39  VAL A HG11 1  
ATOM 623    H HG12 . VAL A 1 39  ? -23.211 -2.740  -9.971  1.00 71.31 ? 39  VAL A HG12 1  
ATOM 624    H HG13 . VAL A 1 39  ? -23.517 -2.957  -8.248  1.00 21.12 ? 39  VAL A HG13 1  
ATOM 625    H HG21 . VAL A 1 39  ? -24.041 -6.203  -10.335 1.00 2.12  ? 39  VAL A HG21 1  
ATOM 626    H HG22 . VAL A 1 39  ? -22.768 -5.420  -9.398  1.00 31.55 ? 39  VAL A HG22 1  
ATOM 627    H HG23 . VAL A 1 39  ? -23.163 -4.833  -11.014 1.00 40.22 ? 39  VAL A HG23 1  
ATOM 628    N N    . GLY A 1 40  ? -26.176 -3.356  -6.636  1.00 3.42  ? 40  GLY A N    1  
ATOM 629    C CA   . GLY A 1 40  ? -27.213 -2.488  -6.111  1.00 45.45 ? 40  GLY A CA   1  
ATOM 630    C C    . GLY A 1 40  ? -27.063 -1.056  -6.584  1.00 63.31 ? 40  GLY A C    1  
ATOM 631    O O    . GLY A 1 40  ? -26.736 -0.811  -7.745  1.00 64.44 ? 40  GLY A O    1  
ATOM 632    H H    . GLY A 1 40  ? -25.331 -3.452  -6.150  1.00 15.41 ? 40  GLY A H    1  
ATOM 633    H HA2  . GLY A 1 40  ? -28.176 -2.862  -6.428  1.00 34.14 ? 40  GLY A HA2  1  
ATOM 634    H HA3  . GLY A 1 40  ? -27.169 -2.506  -5.032  1.00 65.14 ? 40  GLY A HA3  1  
ATOM 635    N N    . LEU A 1 41  ? -27.304 -0.109  -5.684  1.00 22.13 ? 41  LEU A N    1  
ATOM 636    C CA   . LEU A 1 41  ? -27.195 1.306   -6.017  1.00 41.14 ? 41  LEU A CA   1  
ATOM 637    C C    . LEU A 1 41  ? -25.737 1.759   -5.999  1.00 71.55 ? 41  LEU A C    1  
ATOM 638    O O    . LEU A 1 41  ? -24.888 1.123   -5.373  1.00 60.21 ? 41  LEU A O    1  
ATOM 639    C CB   . LEU A 1 41  ? -28.014 2.146   -5.035  1.00 41.21 ? 41  LEU A CB   1  
ATOM 640    C CG   . LEU A 1 41  ? -29.522 2.153   -5.290  1.00 31.20 ? 41  LEU A CG   1  
ATOM 641    C CD1  . LEU A 1 41  ? -30.284 2.280   -3.980  1.00 31.31 ? 41  LEU A CD1  1  
ATOM 642    C CD2  . LEU A 1 41  ? -29.897 3.281   -6.238  1.00 70.22 ? 41  LEU A CD2  1  
ATOM 643    H H    . LEU A 1 41  ? -27.562 -0.368  -4.775  1.00 43.35 ? 41  LEU A H    1  
ATOM 644    H HA   . LEU A 1 41  ? -27.590 1.444   -7.012  1.00 54.10 ? 41  LEU A HA   1  
ATOM 645    H HB2  . LEU A 1 41  ? -27.840 1.768   -4.038  1.00 61.11 ? 41  LEU A HB2  1  
ATOM 646    H HB3  . LEU A 1 41  ? -27.660 3.165   -5.082  1.00 2.01  ? 41  LEU A HB3  1  
ATOM 647    H HG   . LEU A 1 41  ? -29.807 1.218   -5.751  1.00 44.44 ? 41  LEU A HG   1  
ATOM 648    H HD11 . LEU A 1 41  ? -31.245 2.738   -4.165  1.00 61.14 ? 41  LEU A HD11 1  
ATOM 649    H HD12 . LEU A 1 41  ? -29.720 2.894   -3.293  1.00 53.22 ? 41  LEU A HD12 1  
ATOM 650    H HD13 . LEU A 1 41  ? -30.429 1.300   -3.550  1.00 11.25 ? 41  LEU A HD13 1  
ATOM 651    H HD21 . LEU A 1 41  ? -29.247 3.257   -7.101  1.00 32.21 ? 41  LEU A HD21 1  
ATOM 652    H HD22 . LEU A 1 41  ? -29.787 4.229   -5.732  1.00 61.24 ? 41  LEU A HD22 1  
ATOM 653    H HD23 . LEU A 1 41  ? -30.922 3.159   -6.556  1.00 42.25 ? 41  LEU A HD23 1  
ATOM 654    N N    . PRO A 1 42  ? -25.426 2.869   -6.690  1.00 53.31 ? 42  PRO A N    1  
ATOM 655    C CA   . PRO A 1 42  ? -24.062 3.405   -6.753  1.00 42.12 ? 42  PRO A CA   1  
ATOM 656    C C    . PRO A 1 42  ? -23.606 3.988   -5.420  1.00 41.44 ? 42  PRO A C    1  
ATOM 657    O O    . PRO A 1 42  ? -24.425 4.356   -4.578  1.00 44.04 ? 42  PRO A O    1  
ATOM 658    C CB   . PRO A 1 42  ? -24.160 4.506   -7.811  1.00 44.00 ? 42  PRO A CB   1  
ATOM 659    C CG   . PRO A 1 42  ? -25.590 4.924   -7.792  1.00 15.54 ? 42  PRO A CG   1  
ATOM 660    C CD   . PRO A 1 42  ? -26.378 3.686   -7.466  1.00 64.33 ? 42  PRO A CD   1  
ATOM 661    H HA   . PRO A 1 42  ? -23.357 2.654   -7.076  1.00 72.13 ? 42  PRO A HA   1  
ATOM 662    H HB2  . PRO A 1 42  ? -23.505 5.324   -7.546  1.00 22.22 ? 42  PRO A HB2  1  
ATOM 663    H HB3  . PRO A 1 42  ? -23.879 4.110   -8.775  1.00 3.14  ? 42  PRO A HB3  1  
ATOM 664    H HG2  . PRO A 1 42  ? -25.742 5.677   -7.033  1.00 24.22 ? 42  PRO A HG2  1  
ATOM 665    H HG3  . PRO A 1 42  ? -25.874 5.305   -8.762  1.00 15.30 ? 42  PRO A HG3  1  
ATOM 666    H HD2  . PRO A 1 42  ? -27.245 3.936   -6.872  1.00 64.24 ? 42  PRO A HD2  1  
ATOM 667    H HD3  . PRO A 1 42  ? -26.673 3.177   -8.371  1.00 12.44 ? 42  PRO A HD3  1  
ATOM 668    N N    . ILE A 1 43  ? -22.292 4.070   -5.236  1.00 4.12  ? 43  ILE A N    1  
ATOM 669    C CA   . ILE A 1 43  ? -21.724 4.609   -4.007  1.00 34.24 ? 43  ILE A CA   1  
ATOM 670    C C    . ILE A 1 43  ? -20.311 5.134   -4.240  1.00 63.41 ? 43  ILE A C    1  
ATOM 671    O O    . ILE A 1 43  ? -19.434 4.401   -4.698  1.00 75.45 ? 43  ILE A O    1  
ATOM 672    C CB   . ILE A 1 43  ? -21.687 3.547   -2.891  1.00 45.04 ? 43  ILE A CB   1  
ATOM 673    C CG1  . ILE A 1 43  ? -20.869 2.333   -3.336  1.00 25.01 ? 43  ILE A CG1  1  
ATOM 674    C CG2  . ILE A 1 43  ? -23.101 3.132   -2.509  1.00 4.12  ? 43  ILE A CG2  1  
ATOM 675    C CD1  . ILE A 1 43  ? -19.460 2.320   -2.786  1.00 23.54 ? 43  ILE A CD1  1  
ATOM 676    H H    . ILE A 1 43  ? -21.690 3.761   -5.945  1.00 72.11 ? 43  ILE A H    1  
ATOM 677    H HA   . ILE A 1 43  ? -22.351 5.425   -3.679  1.00 41.43 ? 43  ILE A HA   1  
ATOM 678    H HB   . ILE A 1 43  ? -21.222 3.987   -2.022  1.00 51.52 ? 43  ILE A HB   1  
ATOM 679    H HG12 . ILE A 1 43  ? -21.362 1.432   -3.002  1.00 12.23 ? 43  ILE A HG12 1  
ATOM 680    H HG13 . ILE A 1 43  ? -20.806 2.326   -4.414  1.00 73.50 ? 43  ILE A HG13 1  
ATOM 681    H HG21 . ILE A 1 43  ? -23.086 2.654   -1.541  1.00 21.54 ? 43  ILE A HG21 1  
ATOM 682    H HG22 . ILE A 1 43  ? -23.484 2.442   -3.246  1.00 74.41 ? 43  ILE A HG22 1  
ATOM 683    H HG23 . ILE A 1 43  ? -23.734 4.006   -2.469  1.00 35.22 ? 43  ILE A HG23 1  
ATOM 684    H HD11 . ILE A 1 43  ? -19.466 1.910   -1.787  1.00 50.42 ? 43  ILE A HD11 1  
ATOM 685    H HD12 . ILE A 1 43  ? -19.075 3.329   -2.759  1.00 54.12 ? 43  ILE A HD12 1  
ATOM 686    H HD13 . ILE A 1 43  ? -18.831 1.713   -3.420  1.00 14.10 ? 43  ILE A HD13 1  
ATOM 687    N N    . GLY A 1 44  ? -20.098 6.407   -3.923  1.00 13.42 ? 44  GLY A N    1  
ATOM 688    C CA   . GLY A 1 44  ? -18.790 7.008   -4.106  1.00 22.14 ? 44  GLY A CA   1  
ATOM 689    C C    . GLY A 1 44  ? -18.846 8.276   -4.935  1.00 72.13 ? 44  GLY A C    1  
ATOM 690    O O    . GLY A 1 44  ? -19.849 8.552   -5.593  1.00 71.22 ? 44  GLY A O    1  
ATOM 691    H H    . GLY A 1 44  ? -20.836 6.942   -3.563  1.00 22.45 ? 44  GLY A H    1  
ATOM 692    H HA2  . GLY A 1 44  ? -18.376 7.243   -3.137  1.00 31.21 ? 44  GLY A HA2  1  
ATOM 693    H HA3  . GLY A 1 44  ? -18.144 6.297   -4.600  1.00 31.20 ? 44  GLY A HA3  1  
ATOM 694    N N    . GLN A 1 45  ? -17.765 9.050   -4.903  1.00 31.05 ? 45  GLN A N    1  
ATOM 695    C CA   . GLN A 1 45  ? -17.695 10.296  -5.657  1.00 1.44  ? 45  GLN A CA   1  
ATOM 696    C C    . GLN A 1 45  ? -16.377 10.397  -6.419  1.00 73.43 ? 45  GLN A C    1  
ATOM 697    O O    . GLN A 1 45  ? -15.300 10.260  -5.837  1.00 34.15 ? 45  GLN A O    1  
ATOM 698    C CB   . GLN A 1 45  ? -17.847 11.494  -4.718  1.00 74.14 ? 45  GLN A CB   1  
ATOM 699    C CG   . GLN A 1 45  ? -19.088 11.429  -3.844  1.00 10.03 ? 45  GLN A CG   1  
ATOM 700    C CD   . GLN A 1 45  ? -18.872 12.048  -2.477  1.00 42.53 ? 45  GLN A CD   1  
ATOM 701    O OE1  . GLN A 1 45  ? -19.324 11.516  -1.463  1.00 74.25 ? 45  GLN A OE1  1  
ATOM 702    N NE2  . GLN A 1 45  ? -18.178 13.179  -2.443  1.00 60.10 ? 45  GLN A NE2  1  
ATOM 703    H H    . GLN A 1 45  ? -16.997 8.776   -4.359  1.00 41.22 ? 45  GLN A H    1  
ATOM 704    H HA   . GLN A 1 45  ? -18.508 10.300  -6.366  1.00 52.22 ? 45  GLN A HA   1  
ATOM 705    H HB2  . GLN A 1 45  ? -16.981 11.544  -4.073  1.00 22.24 ? 45  GLN A HB2  1  
ATOM 706    H HB3  . GLN A 1 45  ? -17.896 12.396  -5.309  1.00 62.34 ? 45  GLN A HB3  1  
ATOM 707    H HG2  . GLN A 1 45  ? -19.890 11.957  -4.338  1.00 24.04 ? 45  GLN A HG2  1  
ATOM 708    H HG3  . GLN A 1 45  ? -19.368 10.393  -3.714  1.00 73.24 ? 45  GLN A HG3  1  
ATOM 709    H HE21 . GLN A 1 45  ? -17.848 13.546  -3.290  1.00 73.21 ? 45  GLN A HE21 1  
ATOM 710    H HE22 . GLN A 1 45  ? -18.023 13.601  -1.572  1.00 65.43 ? 45  GLN A HE22 1  
ATOM 711    N N    . GLY A 1 46  ? -16.470 10.636  -7.723  1.00 14.45 ? 46  GLY A N    1  
ATOM 712    C CA   . GLY A 1 46  ? -15.278 10.751  -8.542  1.00 22.41 ? 46  GLY A CA   1  
ATOM 713    C C    . GLY A 1 46  ? -15.599 11.030  -9.997  1.00 64.12 ? 46  GLY A C    1  
ATOM 714    O O    . GLY A 1 46  ? -15.153 12.032  -10.556 1.00 42.30 ? 46  GLY A O    1  
ATOM 715    H H    . GLY A 1 46  ? -17.355 10.735  -8.132  1.00 4.05  ? 46  GLY A H    1  
ATOM 716    H HA2  . GLY A 1 46  ? -14.667 11.554  -8.158  1.00 2.14  ? 46  GLY A HA2  1  
ATOM 717    H HA3  . GLY A 1 46  ? -14.721 9.827   -8.479  1.00 53.03 ? 46  GLY A HA3  1  
ATOM 718    N N    . GLY A 1 47  ? -16.374 10.143  -10.611 1.00 70.53 ? 47  GLY A N    1  
ATOM 719    C CA   . GLY A 1 47  ? -16.741 10.317  -12.004 1.00 3.13  ? 47  GLY A CA   1  
ATOM 720    C C    . GLY A 1 47  ? -16.828 9.001   -12.751 1.00 34.54 ? 47  GLY A C    1  
ATOM 721    O O    . GLY A 1 47  ? -17.710 8.185   -12.483 1.00 32.42 ? 47  GLY A O    1  
ATOM 722    H H    . GLY A 1 47  ? -16.700 9.364   -10.114 1.00 2.23  ? 47  GLY A H    1  
ATOM 723    H HA2  . GLY A 1 47  ? -17.701 10.810  -12.053 1.00 52.14 ? 47  GLY A HA2  1  
ATOM 724    H HA3  . GLY A 1 47  ? -16.003 10.943  -12.484 1.00 44.32 ? 47  GLY A HA3  1  
ATOM 725    N N    . PHE A 1 48  ? -15.910 8.794   -13.690 1.00 25.45 ? 48  PHE A N    1  
ATOM 726    C CA   . PHE A 1 48  ? -15.886 7.567   -14.477 1.00 34.43 ? 48  PHE A CA   1  
ATOM 727    C C    . PHE A 1 48  ? -15.572 6.362   -13.598 1.00 50.11 ? 48  PHE A C    1  
ATOM 728    O O    . PHE A 1 48  ? -16.177 5.300   -13.743 1.00 35.01 ? 48  PHE A O    1  
ATOM 729    C CB   . PHE A 1 48  ? -14.853 7.677   -15.600 1.00 43.32 ? 48  PHE A CB   1  
ATOM 730    C CG   . PHE A 1 48  ? -13.500 8.128   -15.128 1.00 43.30 ? 48  PHE A CG   1  
ATOM 731    C CD1  . PHE A 1 48  ? -12.606 7.223   -14.578 1.00 61.30 ? 48  PHE A CD1  1  
ATOM 732    C CD2  . PHE A 1 48  ? -13.122 9.458   -15.234 1.00 53.15 ? 48  PHE A CD2  1  
ATOM 733    C CE1  . PHE A 1 48  ? -11.361 7.636   -14.143 1.00 35.30 ? 48  PHE A CE1  1  
ATOM 734    C CE2  . PHE A 1 48  ? -11.879 9.876   -14.800 1.00 62.33 ? 48  PHE A CE2  1  
ATOM 735    C CZ   . PHE A 1 48  ? -10.997 8.964   -14.254 1.00 25.21 ? 48  PHE A CZ   1  
ATOM 736    H H    . PHE A 1 48  ? -15.233 9.482   -13.856 1.00 13.10 ? 48  PHE A H    1  
ATOM 737    H HA   . PHE A 1 48  ? -16.865 7.434   -14.913 1.00 74.20 ? 48  PHE A HA   1  
ATOM 738    H HB2  . PHE A 1 48  ? -14.735 6.711   -16.068 1.00 44.45 ? 48  PHE A HB2  1  
ATOM 739    H HB3  . PHE A 1 48  ? -15.204 8.388   -16.334 1.00 70.31 ? 48  PHE A HB3  1  
ATOM 740    H HD1  . PHE A 1 48  ? -12.890 6.185   -14.491 1.00 42.21 ? 48  PHE A HD1  1  
ATOM 741    H HD2  . PHE A 1 48  ? -13.812 10.172  -15.660 1.00 62.25 ? 48  PHE A HD2  1  
ATOM 742    H HE1  . PHE A 1 48  ? -10.673 6.920   -13.716 1.00 40.00 ? 48  PHE A HE1  1  
ATOM 743    H HE2  . PHE A 1 48  ? -11.596 10.914  -14.889 1.00 32.04 ? 48  PHE A HE2  1  
ATOM 744    H HZ   . PHE A 1 48  ? -10.024 9.288   -13.915 1.00 70.21 ? 48  PHE A HZ   1  
ATOM 745    N N    . GLY A 1 49  ? -14.621 6.533   -12.685 1.00 44.01 ? 49  GLY A N    1  
ATOM 746    C CA   . GLY A 1 49  ? -14.243 5.451   -11.795 1.00 5.03  ? 49  GLY A CA   1  
ATOM 747    C C    . GLY A 1 49  ? -15.055 5.442   -10.515 1.00 75.22 ? 49  GLY A C    1  
ATOM 748    O O    . GLY A 1 49  ? -14.537 5.749   -9.442  1.00 10.40 ? 49  GLY A O    1  
ATOM 749    H H    . GLY A 1 49  ? -14.173 7.402   -12.615 1.00 11.34 ? 49  GLY A H    1  
ATOM 750    H HA2  . GLY A 1 49  ? -14.388 4.512   -12.308 1.00 53.44 ? 49  GLY A HA2  1  
ATOM 751    H HA3  . GLY A 1 49  ? -13.198 5.554   -11.545 1.00 53.12 ? 49  GLY A HA3  1  
ATOM 752    N N    . CYS A 1 50  ? -16.331 5.089   -10.628 1.00 33.30 ? 50  CYS A N    1  
ATOM 753    C CA   . CYS A 1 50  ? -17.216 5.042   -9.470  1.00 73.35 ? 50  CYS A CA   1  
ATOM 754    C C    . CYS A 1 50  ? -17.344 3.618   -8.939  1.00 15.23 ? 50  CYS A C    1  
ATOM 755    O O    . CYS A 1 50  ? -17.072 2.651   -9.652  1.00 51.12 ? 50  CYS A O    1  
ATOM 756    C CB   . CYS A 1 50  ? -18.598 5.587   -9.836  1.00 51.31 ? 50  CYS A CB   1  
ATOM 757    S SG   . CYS A 1 50  ? -19.483 6.343   -8.452  1.00 40.11 ? 50  CYS A SG   1  
ATOM 758    H H    . CYS A 1 50  ? -16.687 4.856   -11.511 1.00 24.32 ? 50  CYS A H    1  
ATOM 759    H HA   . CYS A 1 50  ? -16.786 5.664   -8.700  1.00 63.31 ? 50  CYS A HA   1  
ATOM 760    H HB2  . CYS A 1 50  ? -18.489 6.339   -10.604 1.00 10.13 ? 50  CYS A HB2  1  
ATOM 761    H HB3  . CYS A 1 50  ? -19.207 4.779   -10.214 1.00 70.42 ? 50  CYS A HB3  1  
ATOM 762    H HG   . CYS A 1 50  ? -20.409 6.100   -8.524  1.00 33.42 ? 50  CYS A HG   1  
ATOM 763    N N    . ILE A 1 51  ? -17.758 3.497   -7.682  1.00 11.32 ? 51  ILE A N    1  
ATOM 764    C CA   . ILE A 1 51  ? -17.922 2.191   -7.054  1.00 43.33 ? 51  ILE A CA   1  
ATOM 765    C C    . ILE A 1 51  ? -19.395 1.807   -6.964  1.00 34.11 ? 51  ILE A C    1  
ATOM 766    O O    . ILE A 1 51  ? -20.256 2.656   -6.736  1.00 12.35 ? 51  ILE A O    1  
ATOM 767    C CB   . ILE A 1 51  ? -17.309 2.166   -5.641  1.00 70.50 ? 51  ILE A CB   1  
ATOM 768    C CG1  . ILE A 1 51  ? -15.905 2.774   -5.658  1.00 24.05 ? 51  ILE A CG1  1  
ATOM 769    C CG2  . ILE A 1 51  ? -17.268 0.742   -5.107  1.00 11.15 ? 51  ILE A CG2  1  
ATOM 770    C CD1  . ILE A 1 51  ? -15.887 4.261   -5.378  1.00 30.14 ? 51  ILE A CD1  1  
ATOM 771    H H    . ILE A 1 51  ? -17.958 4.305   -7.165  1.00 23.42 ? 51  ILE A H    1  
ATOM 772    H HA   . ILE A 1 51  ? -17.406 1.462   -7.661  1.00 34.25 ? 51  ILE A HA   1  
ATOM 773    H HB   . ILE A 1 51  ? -17.939 2.750   -4.988  1.00 51.32 ? 51  ILE A HB   1  
ATOM 774    H HG12 . ILE A 1 51  ? -15.300 2.289   -4.907  1.00 74.31 ? 51  ILE A HG12 1  
ATOM 775    H HG13 . ILE A 1 51  ? -15.462 2.613   -6.630  1.00 52.31 ? 51  ILE A HG13 1  
ATOM 776    H HG21 . ILE A 1 51  ? -16.556 0.164   -5.677  1.00 41.31 ? 51  ILE A HG21 1  
ATOM 777    H HG22 . ILE A 1 51  ? -18.248 0.295   -5.196  1.00 53.53 ? 51  ILE A HG22 1  
ATOM 778    H HG23 . ILE A 1 51  ? -16.972 0.755   -4.068  1.00 44.50 ? 51  ILE A HG23 1  
ATOM 779    H HD11 . ILE A 1 51  ? -16.642 4.498   -4.644  1.00 54.33 ? 51  ILE A HD11 1  
ATOM 780    H HD12 . ILE A 1 51  ? -16.090 4.801   -6.291  1.00 41.53 ? 51  ILE A HD12 1  
ATOM 781    H HD13 . ILE A 1 51  ? -14.916 4.545   -5.000  1.00 62.50 ? 51  ILE A HD13 1  
ATOM 782    N N    . TYR A 1 52  ? -19.678 0.521   -7.145  1.00 3.23  ? 52  TYR A N    1  
ATOM 783    C CA   . TYR A 1 52  ? -21.047 0.023   -7.085  1.00 20.41 ? 52  TYR A CA   1  
ATOM 784    C C    . TYR A 1 52  ? -21.164 -1.128  -6.090  1.00 73.12 ? 52  TYR A C    1  
ATOM 785    O O    . TYR A 1 52  ? -20.299 -2.001  -6.031  1.00 74.21 ? 52  TYR A O    1  
ATOM 786    C CB   . TYR A 1 52  ? -21.506 -0.438  -8.470  1.00 32.03 ? 52  TYR A CB   1  
ATOM 787    C CG   . TYR A 1 52  ? -22.199 0.643   -9.269  1.00 73.34 ? 52  TYR A CG   1  
ATOM 788    C CD1  . TYR A 1 52  ? -23.574 0.823   -9.183  1.00 1.44  ? 52  TYR A CD1  1  
ATOM 789    C CD2  . TYR A 1 52  ? -21.478 1.481   -10.110 1.00 43.40 ? 52  TYR A CD2  1  
ATOM 790    C CE1  . TYR A 1 52  ? -24.211 1.809   -9.912  1.00 73.11 ? 52  TYR A CE1  1  
ATOM 791    C CE2  . TYR A 1 52  ? -22.108 2.470   -10.842 1.00 12.50 ? 52  TYR A CE2  1  
ATOM 792    C CZ   . TYR A 1 52  ? -23.474 2.629   -10.740 1.00 15.43 ? 52  TYR A CZ   1  
ATOM 793    O OH   . TYR A 1 52  ? -24.105 3.612   -11.468 1.00 3.50  ? 52  TYR A OH   1  
ATOM 794    H H    . TYR A 1 52  ? -18.948 -0.109  -7.324  1.00 43.31 ? 52  TYR A H    1  
ATOM 795    H HA   . TYR A 1 52  ? -21.681 0.833   -6.756  1.00 71.02 ? 52  TYR A HA   1  
ATOM 796    H HB2  . TYR A 1 52  ? -20.647 -0.767  -9.034  1.00 53.54 ? 52  TYR A HB2  1  
ATOM 797    H HB3  . TYR A 1 52  ? -22.195 -1.262  -8.357  1.00 43.32 ? 52  TYR A HB3  1  
ATOM 798    H HD1  . TYR A 1 52  ? -24.148 0.179   -8.533  1.00 12.43 ? 52  TYR A HD1  1  
ATOM 799    H HD2  . TYR A 1 52  ? -20.409 1.353   -10.189 1.00 71.35 ? 52  TYR A HD2  1  
ATOM 800    H HE1  . TYR A 1 52  ? -25.281 1.933   -9.832  1.00 55.13 ? 52  TYR A HE1  1  
ATOM 801    H HE2  . TYR A 1 52  ? -21.531 3.112   -11.491 1.00 12.25 ? 52  TYR A HE2  1  
ATOM 802    H HH   . TYR A 1 52  ? -24.945 3.281   -11.794 1.00 11.12 ? 52  TYR A HH   1  
ATOM 803    N N    . LEU A 1 53  ? -22.241 -1.123  -5.311  1.00 31.32 ? 53  LEU A N    1  
ATOM 804    C CA   . LEU A 1 53  ? -22.471 -2.168  -4.320  1.00 14.15 ? 53  LEU A CA   1  
ATOM 805    C C    . LEU A 1 53  ? -22.599 -3.531  -4.990  1.00 30.04 ? 53  LEU A C    1  
ATOM 806    O O    . LEU A 1 53  ? -23.235 -3.662  -6.036  1.00 25.34 ? 53  LEU A O    1  
ATOM 807    C CB   . LEU A 1 53  ? -23.733 -1.863  -3.510  1.00 74.33 ? 53  LEU A CB   1  
ATOM 808    C CG   . LEU A 1 53  ? -23.672 -0.586  -2.671  1.00 3.41  ? 53  LEU A CG   1  
ATOM 809    C CD1  . LEU A 1 53  ? -25.051 -0.234  -2.135  1.00 33.32 ? 53  LEU A CD1  1  
ATOM 810    C CD2  . LEU A 1 53  ? -22.679 -0.746  -1.531  1.00 51.03 ? 53  LEU A CD2  1  
ATOM 811    H H    . LEU A 1 53  ? -22.896 -0.400  -5.405  1.00 63.33 ? 53  LEU A H    1  
ATOM 812    H HA   . LEU A 1 53  ? -21.622 -2.186  -3.654  1.00 44.43 ? 53  LEU A HA   1  
ATOM 813    H HB2  . LEU A 1 53  ? -24.564 -1.780  -4.196  1.00 51.44 ? 53  LEU A HB2  1  
ATOM 814    H HB3  . LEU A 1 53  ? -23.919 -2.694  -2.846  1.00 12.12 ? 53  LEU A HB3  1  
ATOM 815    H HG   . LEU A 1 53  ? -23.339 0.231   -3.295  1.00 65.54 ? 53  LEU A HG   1  
ATOM 816    H HD11 . LEU A 1 53  ? -25.306 -0.906  -1.328  1.00 63.14 ? 53  LEU A HD11 1  
ATOM 817    H HD12 . LEU A 1 53  ? -25.780 -0.328  -2.926  1.00 5.44  ? 53  LEU A HD12 1  
ATOM 818    H HD13 . LEU A 1 53  ? -25.046 0.782   -1.769  1.00 61.54 ? 53  LEU A HD13 1  
ATOM 819    H HD21 . LEU A 1 53  ? -21.960 -1.511  -1.784  1.00 51.51 ? 53  LEU A HD21 1  
ATOM 820    H HD22 . LEU A 1 53  ? -23.205 -1.030  -0.632  1.00 73.14 ? 53  LEU A HD22 1  
ATOM 821    H HD23 . LEU A 1 53  ? -22.165 0.190   -1.366  1.00 62.11 ? 53  LEU A HD23 1  
ATOM 822    N N    . ALA A 1 54  ? -21.990 -4.545  -4.383  1.00 22.22 ? 54  ALA A N    1  
ATOM 823    C CA   . ALA A 1 54  ? -22.037 -5.897  -4.924  1.00 3.24  ? 54  ALA A CA   1  
ATOM 824    C C    . ALA A 1 54  ? -22.370 -6.914  -3.838  1.00 53.11 ? 54  ALA A C    1  
ATOM 825    O O    . ALA A 1 54  ? -22.121 -6.679  -2.655  1.00 53.25 ? 54  ALA A O    1  
ATOM 826    C CB   . ALA A 1 54  ? -20.712 -6.246  -5.587  1.00 63.33 ? 54  ALA A CB   1  
ATOM 827    H H    . ALA A 1 54  ? -21.497 -4.378  -3.553  1.00 41.24 ? 54  ALA A H    1  
ATOM 828    H HA   . ALA A 1 54  ? -22.808 -5.927  -5.680  1.00 12.34 ? 54  ALA A HA   1  
ATOM 829    H HB1  . ALA A 1 54  ? -20.188 -5.337  -5.843  1.00 54.12 ? 54  ALA A HB1  1  
ATOM 830    H HB2  . ALA A 1 54  ? -20.898 -6.819  -6.483  1.00 14.02 ? 54  ALA A HB2  1  
ATOM 831    H HB3  . ALA A 1 54  ? -20.111 -6.829  -4.905  1.00 61.24 ? 54  ALA A HB3  1  
ATOM 832    N N    . ASP A 1 55  ? -22.933 -8.046  -4.247  1.00 54.14 ? 55  ASP A N    1  
ATOM 833    C CA   . ASP A 1 55  ? -23.300 -9.100  -3.310  1.00 23.44 ? 55  ASP A CA   1  
ATOM 834    C C    . ASP A 1 55  ? -23.502 -10.425 -4.038  1.00 64.53 ? 55  ASP A C    1  
ATOM 835    O O    . ASP A 1 55  ? -23.819 -10.449 -5.227  1.00 42.15 ? 55  ASP A O    1  
ATOM 836    C CB   . ASP A 1 55  ? -24.576 -8.720  -2.556  1.00 32.02 ? 55  ASP A CB   1  
ATOM 837    C CG   . ASP A 1 55  ? -25.763 -8.538  -3.481  1.00 23.04 ? 55  ASP A CG   1  
ATOM 838    O OD1  . ASP A 1 55  ? -25.838 -7.486  -4.151  1.00 2.21  ? 55  ASP A OD1  1  
ATOM 839    O OD2  . ASP A 1 55  ? -26.617 -9.447  -3.537  1.00 75.53 ? 55  ASP A OD2  1  
ATOM 840    H H    . ASP A 1 55  ? -23.106 -8.176  -5.203  1.00 31.33 ? 55  ASP A H    1  
ATOM 841    H HA   . ASP A 1 55  ? -22.493 -9.211  -2.602  1.00 12.25 ? 55  ASP A HA   1  
ATOM 842    H HB2  . ASP A 1 55  ? -24.813 -9.499  -1.847  1.00 71.21 ? 55  ASP A HB2  1  
ATOM 843    H HB3  . ASP A 1 55  ? -24.410 -7.794  -2.025  1.00 4.45  ? 55  ASP A HB3  1  
ATOM 844    N N    . MET A 1 56  ? -23.316 -11.526 -3.318  1.00 61.25 ? 56  MET A N    1  
ATOM 845    C CA   . MET A 1 56  ? -23.478 -12.854 -3.897  1.00 20.44 ? 56  MET A CA   1  
ATOM 846    C C    . MET A 1 56  ? -24.937 -13.113 -4.259  1.00 72.34 ? 56  MET A C    1  
ATOM 847    O O    . MET A 1 56  ? -25.848 -12.664 -3.563  1.00 24.12 ? 56  MET A O    1  
ATOM 848    C CB   . MET A 1 56  ? -22.984 -13.923 -2.922  1.00 21.21 ? 56  MET A CB   1  
ATOM 849    C CG   . MET A 1 56  ? -22.480 -15.184 -3.605  1.00 65.44 ? 56  MET A CG   1  
ATOM 850    S SD   . MET A 1 56  ? -21.957 -16.449 -2.432  1.00 3.44  ? 56  MET A SD   1  
ATOM 851    C CE   . MET A 1 56  ? -20.425 -15.741 -1.832  1.00 14.22 ? 56  MET A CE   1  
ATOM 852    H H    . MET A 1 56  ? -23.064 -11.444 -2.374  1.00 13.34 ? 56  MET A H    1  
ATOM 853    H HA   . MET A 1 56  ? -22.883 -12.898 -4.797  1.00 43.33 ? 56  MET A HA   1  
ATOM 854    H HB2  . MET A 1 56  ? -22.178 -13.512 -2.333  1.00 23.21 ? 56  MET A HB2  1  
ATOM 855    H HB3  . MET A 1 56  ? -23.796 -14.197 -2.264  1.00 71.20 ? 56  MET A HB3  1  
ATOM 856    H HG2  . MET A 1 56  ? -23.274 -15.587 -4.217  1.00 22.31 ? 56  MET A HG2  1  
ATOM 857    H HG3  . MET A 1 56  ? -21.640 -14.925 -4.233  1.00 42.11 ? 56  MET A HG3  1  
ATOM 858    H HE1  . MET A 1 56  ? -19.642 -16.483 -1.883  1.00 63.25 ? 56  MET A HE1  1  
ATOM 859    H HE2  . MET A 1 56  ? -20.552 -15.422 -0.808  1.00 44.41 ? 56  MET A HE2  1  
ATOM 860    H HE3  . MET A 1 56  ? -20.157 -14.892 -2.444  1.00 15.33 ? 56  MET A HE3  1  
ATOM 861    N N    . ASN A 1 57  ? -25.151 -13.840 -5.351  1.00 40.34 ? 57  ASN A N    1  
ATOM 862    C CA   . ASN A 1 57  ? -26.501 -14.158 -5.805  1.00 33.15 ? 57  ASN A CA   1  
ATOM 863    C C    . ASN A 1 57  ? -27.277 -14.903 -4.724  1.00 63.03 ? 57  ASN A C    1  
ATOM 864    O O    . ASN A 1 57  ? -27.269 -16.133 -4.675  1.00 44.11 ? 57  ASN A O    1  
ATOM 865    C CB   . ASN A 1 57  ? -26.447 -15.000 -7.081  1.00 11.32 ? 57  ASN A CB   1  
ATOM 866    C CG   . ASN A 1 57  ? -25.599 -16.246 -6.916  1.00 4.50  ? 57  ASN A CG   1  
ATOM 867    O OD1  . ASN A 1 57  ? -26.099 -17.305 -6.538  1.00 1.43  ? 57  ASN A OD1  1  
ATOM 868    N ND2  . ASN A 1 57  ? -24.307 -16.125 -7.200  1.00 1.11  ? 57  ASN A ND2  1  
ATOM 869    H H    . ASN A 1 57  ? -24.384 -14.169 -5.864  1.00 72.25 ? 57  ASN A H    1  
ATOM 870    H HA   . ASN A 1 57  ? -27.006 -13.229 -6.018  1.00 52.24 ? 57  ASN A HA   1  
ATOM 871    H HB2  . ASN A 1 57  ? -27.448 -15.301 -7.348  1.00 51.04 ? 57  ASN A HB2  1  
ATOM 872    H HB3  . ASN A 1 57  ? -26.029 -14.404 -7.879  1.00 2.02  ? 57  ASN A HB3  1  
ATOM 873    H HD21 . ASN A 1 57  ? -23.978 -15.250 -7.495  1.00 14.14 ? 57  ASN A HD21 1  
ATOM 874    H HD22 . ASN A 1 57  ? -23.736 -16.915 -7.102  1.00 40.24 ? 57  ASN A HD22 1  
ATOM 875    N N    . SER A 1 58  ? -27.947 -14.149 -3.858  1.00 20.22 ? 58  SER A N    1  
ATOM 876    C CA   . SER A 1 58  ? -28.730 -14.738 -2.778  1.00 74.21 ? 58  SER A CA   1  
ATOM 877    C C    . SER A 1 58  ? -30.224 -14.589 -3.044  1.00 24.04 ? 58  SER A C    1  
ATOM 878    O O    . SER A 1 58  ? -30.892 -15.544 -3.441  1.00 4.14  ? 58  SER A O    1  
ATOM 879    C CB   . SER A 1 58  ? -28.368 -14.083 -1.443  1.00 34.45 ? 58  SER A CB   1  
ATOM 880    O OG   . SER A 1 58  ? -28.601 -12.685 -1.481  1.00 73.34 ? 58  SER A OG   1  
ATOM 881    H H    . SER A 1 58  ? -27.915 -13.174 -3.949  1.00 31.54 ? 58  SER A H    1  
ATOM 882    H HA   . SER A 1 58  ? -28.488 -15.789 -2.729  1.00 4.01  ? 58  SER A HA   1  
ATOM 883    H HB2  . SER A 1 58  ? -28.971 -14.514 -0.658  1.00 34.13 ? 58  SER A HB2  1  
ATOM 884    H HB3  . SER A 1 58  ? -27.323 -14.256 -1.231  1.00 42.12 ? 58  SER A HB3  1  
ATOM 885    H HG   . SER A 1 58  ? -28.733 -12.358 -0.588  1.00 22.52 ? 58  SER A HG   1  
ATOM 886    N N    . SER A 1 59  ? -30.744 -13.385 -2.823  1.00 61.11 ? 59  SER A N    1  
ATOM 887    C CA   . SER A 1 59  ? -32.160 -13.112 -3.040  1.00 23.11 ? 59  SER A CA   1  
ATOM 888    C C    . SER A 1 59  ? -32.489 -11.655 -2.727  1.00 10.14 ? 59  SER A C    1  
ATOM 889    O O    . SER A 1 59  ? -31.596 -10.851 -2.459  1.00 45.30 ? 59  SER A O    1  
ATOM 890    C CB   . SER A 1 59  ? -33.018 -14.039 -2.175  1.00 4.04  ? 59  SER A CB   1  
ATOM 891    O OG   . SER A 1 59  ? -33.535 -15.116 -2.938  1.00 12.44 ? 59  SER A OG   1  
ATOM 892    H H    . SER A 1 59  ? -30.161 -12.663 -2.507  1.00 35.44 ? 59  SER A H    1  
ATOM 893    H HA   . SER A 1 59  ? -32.379 -13.302 -4.080  1.00 74.14 ? 59  SER A HA   1  
ATOM 894    H HB2  . SER A 1 59  ? -32.416 -14.440 -1.373  1.00 2.41  ? 59  SER A HB2  1  
ATOM 895    H HB3  . SER A 1 59  ? -33.844 -13.481 -1.758  1.00 72.10 ? 59  SER A HB3  1  
ATOM 896    H HG   . SER A 1 59  ? -34.127 -15.639 -2.393  1.00 30.33 ? 59  SER A HG   1  
ATOM 897    N N    . GLU A 1 60  ? -33.779 -11.328 -2.754  1.00 71.14 ? 60  GLU A N    1  
ATOM 898    C CA   . GLU A 1 60  ? -34.241 -9.970  -2.467  1.00 35.25 ? 60  GLU A CA   1  
ATOM 899    C C    . GLU A 1 60  ? -33.372 -8.922  -3.163  1.00 45.51 ? 60  GLU A C    1  
ATOM 900    O O    . GLU A 1 60  ? -32.597 -9.242  -4.065  1.00 63.40 ? 60  GLU A O    1  
ATOM 901    C CB   . GLU A 1 60  ? -34.246 -9.727  -0.956  1.00 72.42 ? 60  GLU A CB   1  
ATOM 902    C CG   . GLU A 1 60  ? -35.455 -8.945  -0.469  1.00 22.20 ? 60  GLU A CG   1  
ATOM 903    C CD   . GLU A 1 60  ? -35.143 -8.079  0.735   1.00 73.41 ? 60  GLU A CD   1  
ATOM 904    O OE1  . GLU A 1 60  ? -34.195 -8.413  1.477   1.00 12.35 ? 60  GLU A OE1  1  
ATOM 905    O OE2  . GLU A 1 60  ? -35.845 -7.066  0.936   1.00 31.25 ? 60  GLU A OE2  1  
ATOM 906    H H    . GLU A 1 60  ? -34.439 -12.021 -2.964  1.00 11.14 ? 60  GLU A H    1  
ATOM 907    H HA   . GLU A 1 60  ? -35.252 -9.882  -2.836  1.00 71.42 ? 60  GLU A HA   1  
ATOM 908    H HB2  . GLU A 1 60  ? -34.233 -10.680 -0.449  1.00 5.33  ? 60  GLU A HB2  1  
ATOM 909    H HB3  . GLU A 1 60  ? -33.356 -9.176  -0.688  1.00 41.23 ? 60  GLU A HB3  1  
ATOM 910    H HG2  . GLU A 1 60  ? -35.802 -8.309  -1.270  1.00 53.33 ? 60  GLU A HG2  1  
ATOM 911    H HG3  . GLU A 1 60  ? -36.234 -9.643  -0.200  1.00 23.55 ? 60  GLU A HG3  1  
ATOM 912    N N    . SER A 1 61  ? -33.506 -7.671  -2.733  1.00 22.14 ? 61  SER A N    1  
ATOM 913    C CA   . SER A 1 61  ? -32.734 -6.576  -3.309  1.00 65.24 ? 61  SER A CA   1  
ATOM 914    C C    . SER A 1 61  ? -31.457 -6.337  -2.509  1.00 15.44 ? 61  SER A C    1  
ATOM 915    O O    . SER A 1 61  ? -31.092 -7.141  -1.651  1.00 33.43 ? 61  SER A O    1  
ATOM 916    C CB   . SER A 1 61  ? -33.573 -5.297  -3.349  1.00 44.21 ? 61  SER A CB   1  
ATOM 917    O OG   . SER A 1 61  ? -34.885 -5.562  -3.812  1.00 73.44 ? 61  SER A OG   1  
ATOM 918    H H    . SER A 1 61  ? -34.139 -7.482  -2.009  1.00 71.44 ? 61  SER A H    1  
ATOM 919    H HA   . SER A 1 61  ? -32.466 -6.853  -4.318  1.00 54.34 ? 61  SER A HA   1  
ATOM 920    H HB2  . SER A 1 61  ? -33.633 -4.878  -2.356  1.00 21.33 ? 61  SER A HB2  1  
ATOM 921    H HB3  . SER A 1 61  ? -33.107 -4.584  -4.013  1.00 34.23 ? 61  SER A HB3  1  
ATOM 922    H HG   . SER A 1 61  ? -35.393 -4.747  -3.820  1.00 73.42 ? 61  SER A HG   1  
ATOM 923    N N    . VAL A 1 62  ? -30.781 -5.228  -2.793  1.00 40.41 ? 62  VAL A N    1  
ATOM 924    C CA   . VAL A 1 62  ? -29.547 -4.886  -2.096  1.00 73.23 ? 62  VAL A CA   1  
ATOM 925    C C    . VAL A 1 62  ? -29.736 -3.651  -1.222  1.00 53.51 ? 62  VAL A C    1  
ATOM 926    O O    . VAL A 1 62  ? -30.251 -2.630  -1.676  1.00 23.33 ? 62  VAL A O    1  
ATOM 927    C CB   . VAL A 1 62  ? -28.395 -4.629  -3.085  1.00 75.15 ? 62  VAL A CB   1  
ATOM 928    C CG1  . VAL A 1 62  ? -27.077 -4.471  -2.342  1.00 21.52 ? 62  VAL A CG1  1  
ATOM 929    C CG2  . VAL A 1 62  ? -28.308 -5.752  -4.107  1.00 0.32  ? 62  VAL A CG2  1  
ATOM 930    H H    . VAL A 1 62  ? -31.120 -4.622  -3.485  1.00 20.44 ? 62  VAL A H    1  
ATOM 931    H HA   . VAL A 1 62  ? -29.275 -5.723  -1.468  1.00 35.20 ? 62  VAL A HA   1  
ATOM 932    H HB   . VAL A 1 62  ? -28.598 -3.707  -3.611  1.00 34.34 ? 62  VAL A HB   1  
ATOM 933    H HG11 . VAL A 1 62  ? -27.057 -5.144  -1.498  1.00 70.23 ? 62  VAL A HG11 1  
ATOM 934    H HG12 . VAL A 1 62  ? -26.980 -3.453  -1.994  1.00 23.23 ? 62  VAL A HG12 1  
ATOM 935    H HG13 . VAL A 1 62  ? -26.259 -4.703  -3.008  1.00 11.23 ? 62  VAL A HG13 1  
ATOM 936    H HG21 . VAL A 1 62  ? -27.973 -6.656  -3.621  1.00 53.41 ? 62  VAL A HG21 1  
ATOM 937    H HG22 . VAL A 1 62  ? -27.608 -5.479  -4.883  1.00 20.41 ? 62  VAL A HG22 1  
ATOM 938    H HG23 . VAL A 1 62  ? -29.282 -5.917  -4.544  1.00 60.20 ? 62  VAL A HG23 1  
ATOM 939    N N    . GLY A 1 63  ? -29.320 -3.753  0.037   1.00 51.14 ? 63  GLY A N    1  
ATOM 940    C CA   . GLY A 1 63  ? -29.458 -2.637  0.954   1.00 44.34 ? 63  GLY A CA   1  
ATOM 941    C C    . GLY A 1 63  ? -28.271 -1.696  0.909   1.00 70.30 ? 63  GLY A C    1  
ATOM 942    O O    . GLY A 1 63  ? -27.772 -1.364  -0.167  1.00 3.22  ? 63  GLY A O    1  
ATOM 943    H H    . GLY A 1 63  ? -28.920 -4.593  0.346   1.00 52.43 ? 63  GLY A H    1  
ATOM 944    H HA2  . GLY A 1 63  ? -30.350 -2.085  0.700   1.00 12.43 ? 63  GLY A HA2  1  
ATOM 945    H HA3  . GLY A 1 63  ? -29.560 -3.022  1.958   1.00 30.25 ? 63  GLY A HA3  1  
ATOM 946    N N    . SER A 1 64  ? -27.817 -1.266  2.082   1.00 64.23 ? 64  SER A N    1  
ATOM 947    C CA   . SER A 1 64  ? -26.680 -0.358  2.176   1.00 20.14 ? 64  SER A CA   1  
ATOM 948    C C    . SER A 1 64  ? -25.547 -0.986  2.981   1.00 61.32 ? 64  SER A C    1  
ATOM 949    O O    . SER A 1 64  ? -24.733 -0.281  3.578   1.00 42.31 ? 64  SER A O    1  
ATOM 950    C CB   . SER A 1 64  ? -27.108 0.962   2.820   1.00 74.21 ? 64  SER A CB   1  
ATOM 951    O OG   . SER A 1 64  ? -26.190 1.999   2.516   1.00 42.41 ? 64  SER A OG   1  
ATOM 952    H H    . SER A 1 64  ? -28.257 -1.570  2.903   1.00 55.04 ? 64  SER A H    1  
ATOM 953    H HA   . SER A 1 64  ? -26.328 -0.162  1.175   1.00 54.31 ? 64  SER A HA   1  
ATOM 954    H HB2  . SER A 1 64  ? -28.083 1.242   2.449   1.00 40.15 ? 64  SER A HB2  1  
ATOM 955    H HB3  . SER A 1 64  ? -27.152 0.839   3.892   1.00 32.33 ? 64  SER A HB3  1  
ATOM 956    H HG   . SER A 1 64  ? -25.483 2.001   3.165   1.00 32.40 ? 64  SER A HG   1  
ATOM 957    N N    . ASP A 1 65  ? -25.499 -2.315  2.996   1.00 25.41 ? 65  ASP A N    1  
ATOM 958    C CA   . ASP A 1 65  ? -24.464 -3.032  3.731   1.00 64.12 ? 65  ASP A CA   1  
ATOM 959    C C    . ASP A 1 65  ? -23.947 -4.221  2.927   1.00 33.30 ? 65  ASP A C    1  
ATOM 960    O O    . ASP A 1 65  ? -23.603 -5.260  3.490   1.00 13.41 ? 65  ASP A O    1  
ATOM 961    C CB   . ASP A 1 65  ? -25.007 -3.511  5.079   1.00 74.14 ? 65  ASP A CB   1  
ATOM 962    C CG   . ASP A 1 65  ? -23.927 -4.110  5.958   1.00 72.21 ? 65  ASP A CG   1  
ATOM 963    O OD1  . ASP A 1 65  ? -23.177 -3.336  6.589   1.00 63.42 ? 65  ASP A OD1  1  
ATOM 964    O OD2  . ASP A 1 65  ? -23.830 -5.354  6.015   1.00 45.23 ? 65  ASP A OD2  1  
ATOM 965    H H    . ASP A 1 65  ? -26.175 -2.825  2.503   1.00 4.21  ? 65  ASP A H    1  
ATOM 966    H HA   . ASP A 1 65  ? -23.647 -2.348  3.905   1.00 3.31  ? 65  ASP A HA   1  
ATOM 967    H HB2  . ASP A 1 65  ? -25.446 -2.674  5.601   1.00 12.43 ? 65  ASP A HB2  1  
ATOM 968    H HB3  . ASP A 1 65  ? -25.765 -4.261  4.909   1.00 64.25 ? 65  ASP A HB3  1  
ATOM 969    N N    . ALA A 1 66  ? -23.893 -4.061  1.608   1.00 23.54 ? 66  ALA A N    1  
ATOM 970    C CA   . ALA A 1 66  ? -23.415 -5.122  0.727   1.00 35.21 ? 66  ALA A CA   1  
ATOM 971    C C    . ALA A 1 66  ? -22.060 -5.656  1.191   1.00 4.31  ? 66  ALA A C    1  
ATOM 972    O O    . ALA A 1 66  ? -21.228 -4.901  1.694   1.00 60.14 ? 66  ALA A O    1  
ATOM 973    C CB   . ALA A 1 66  ? -23.323 -4.617  -0.705  1.00 41.41 ? 66  ALA A CB   1  
ATOM 974    H H    . ALA A 1 66  ? -24.181 -3.210  1.217   1.00 71.11 ? 66  ALA A H    1  
ATOM 975    H HA   . ALA A 1 66  ? -24.137 -5.926  0.753   1.00 31.42 ? 66  ALA A HA   1  
ATOM 976    H HB1  . ALA A 1 66  ? -23.589 -5.412  -1.386  1.00 5.10  ? 66  ALA A HB1  1  
ATOM 977    H HB2  . ALA A 1 66  ? -22.312 -4.293  -0.908  1.00 15.00 ? 66  ALA A HB2  1  
ATOM 978    H HB3  . ALA A 1 66  ? -24.000 -3.786  -0.838  1.00 32.13 ? 66  ALA A HB3  1  
ATOM 979    N N    . PRO A 1 67  ? -21.822 -6.970  1.034   1.00 13.11 ? 67  PRO A N    1  
ATOM 980    C CA   . PRO A 1 67  ? -20.563 -7.598  1.446   1.00 43.52 ? 67  PRO A CA   1  
ATOM 981    C C    . PRO A 1 67  ? -19.388 -7.198  0.559   1.00 11.12 ? 67  PRO A C    1  
ATOM 982    O O    . PRO A 1 67  ? -18.335 -6.795  1.053   1.00 20.53 ? 67  PRO A O    1  
ATOM 983    C CB   . PRO A 1 67  ? -20.849 -9.095  1.314   1.00 74.41 ? 67  PRO A CB   1  
ATOM 984    C CG   . PRO A 1 67  ? -21.932 -9.190  0.295   1.00 2.25  ? 67  PRO A CG   1  
ATOM 985    C CD   . PRO A 1 67  ? -22.763 -7.945  0.448   1.00 14.11 ? 67  PRO A CD   1  
ATOM 986    H HA   . PRO A 1 67  ? -20.327 -7.366  2.475   1.00 51.03 ? 67  PRO A HA   1  
ATOM 987    H HB2  . PRO A 1 67  ? -19.955 -9.607  0.989   1.00 41.55 ? 67  PRO A HB2  1  
ATOM 988    H HB3  . PRO A 1 67  ? -21.170 -9.489  2.267   1.00 4.45  ? 67  PRO A HB3  1  
ATOM 989    H HG2  . PRO A 1 67  ? -21.503 -9.235  -0.694  1.00 20.43 ? 67  PRO A HG2  1  
ATOM 990    H HG3  . PRO A 1 67  ? -22.535 -10.066 0.482   1.00 43.23 ? 67  PRO A HG3  1  
ATOM 991    H HD2  . PRO A 1 67  ? -23.117 -7.608  -0.514  1.00 33.12 ? 67  PRO A HD2  1  
ATOM 992    H HD3  . PRO A 1 67  ? -23.593 -8.126  1.115   1.00 22.32 ? 67  PRO A HD3  1  
ATOM 993    N N    . CYS A 1 68  ? -19.569 -7.319  -0.752  1.00 13.12 ? 68  CYS A N    1  
ATOM 994    C CA   . CYS A 1 68  ? -18.516 -6.976  -1.702  1.00 0.13  ? 68  CYS A CA   1  
ATOM 995    C C    . CYS A 1 68  ? -18.877 -5.727  -2.499  1.00 52.41 ? 68  CYS A C    1  
ATOM 996    O O    . CYS A 1 68  ? -20.043 -5.340  -2.574  1.00 13.14 ? 68  CYS A O    1  
ATOM 997    C CB   . CYS A 1 68  ? -18.261 -8.145  -2.655  1.00 0.40  ? 68  CYS A CB   1  
ATOM 998    S SG   . CYS A 1 68  ? -18.132 -9.752  -1.835  1.00 2.31  ? 68  CYS A SG   1  
ATOM 999    H H    . CYS A 1 68  ? -20.427 -7.652  -1.088  1.00 40.11 ? 68  CYS A H    1  
ATOM 1000   H HA   . CYS A 1 68  ? -17.615 -6.781  -1.140  1.00 74.24 ? 68  CYS A HA   1  
ATOM 1001   H HB2  . CYS A 1 68  ? -19.072 -8.205  -3.365  1.00 61.34 ? 68  CYS A HB2  1  
ATOM 1002   H HB3  . CYS A 1 68  ? -17.337 -7.972  -3.186  1.00 11.13 ? 68  CYS A HB3  1  
ATOM 1003   H HG   . CYS A 1 68  ? -18.520 -9.670  -0.960  1.00 1.24  ? 68  CYS A HG   1  
ATOM 1004   N N    . VAL A 1 69  ? -17.866 -5.104  -3.096  1.00 11.41 ? 69  VAL A N    1  
ATOM 1005   C CA   . VAL A 1 69  ? -18.070 -3.901  -3.893  1.00 22.14 ? 69  VAL A CA   1  
ATOM 1006   C C    . VAL A 1 69  ? -17.265 -3.961  -5.186  1.00 41.22 ? 69  VAL A C    1  
ATOM 1007   O O    . VAL A 1 69  ? -16.129 -4.434  -5.199  1.00 34.22 ? 69  VAL A O    1  
ATOM 1008   C CB   . VAL A 1 69  ? -17.671 -2.634  -3.113  1.00 71.13 ? 69  VAL A CB   1  
ATOM 1009   C CG1  . VAL A 1 69  ? -18.709 -2.311  -2.050  1.00 73.15 ? 69  VAL A CG1  1  
ATOM 1010   C CG2  . VAL A 1 69  ? -16.293 -2.804  -2.490  1.00 14.23 ? 69  VAL A CG2  1  
ATOM 1011   H H    . VAL A 1 69  ? -16.960 -5.464  -3.000  1.00 1.54  ? 69  VAL A H    1  
ATOM 1012   H HA   . VAL A 1 69  ? -19.121 -3.834  -4.135  1.00 62.42 ? 69  VAL A HA   1  
ATOM 1013   H HB   . VAL A 1 69  ? -17.629 -1.807  -3.806  1.00 63.42 ? 69  VAL A HB   1  
ATOM 1014   H HG11 . VAL A 1 69  ? -18.887 -3.186  -1.442  1.00 65.01 ? 69  VAL A HG11 1  
ATOM 1015   H HG12 . VAL A 1 69  ? -19.630 -2.010  -2.527  1.00 41.02 ? 69  VAL A HG12 1  
ATOM 1016   H HG13 . VAL A 1 69  ? -18.347 -1.507  -1.426  1.00 13.33 ? 69  VAL A HG13 1  
ATOM 1017   H HG21 . VAL A 1 69  ? -15.771 -1.859  -2.509  1.00 61.53 ? 69  VAL A HG21 1  
ATOM 1018   H HG22 . VAL A 1 69  ? -15.732 -3.537  -3.051  1.00 5.41  ? 69  VAL A HG22 1  
ATOM 1019   H HG23 . VAL A 1 69  ? -16.399 -3.137  -1.468  1.00 54.31 ? 69  VAL A HG23 1  
ATOM 1020   N N    . VAL A 1 70  ? -17.862 -3.483  -6.272  1.00 24.25 ? 70  VAL A N    1  
ATOM 1021   C CA   . VAL A 1 70  ? -17.199 -3.487  -7.571  1.00 14.31 ? 70  VAL A CA   1  
ATOM 1022   C C    . VAL A 1 70  ? -16.759 -2.083  -7.969  1.00 23.25 ? 70  VAL A C    1  
ATOM 1023   O O    . VAL A 1 70  ? -17.336 -1.091  -7.523  1.00 25.44 ? 70  VAL A O    1  
ATOM 1024   C CB   . VAL A 1 70  ? -18.121 -4.057  -8.667  1.00 14.34 ? 70  VAL A CB   1  
ATOM 1025   C CG1  . VAL A 1 70  ? -19.367 -3.198  -8.827  1.00 60.24 ? 70  VAL A CG1  1  
ATOM 1026   C CG2  . VAL A 1 70  ? -17.372 -4.179  -9.987  1.00 63.52 ? 70  VAL A CG2  1  
ATOM 1027   H H    . VAL A 1 70  ? -18.770 -3.122  -6.200  1.00 54.54 ? 70  VAL A H    1  
ATOM 1028   H HA   . VAL A 1 70  ? -16.327 -4.120  -7.498  1.00 3.23  ? 70  VAL A HA   1  
ATOM 1029   H HB   . VAL A 1 70  ? -18.433 -5.044  -8.365  1.00 52.24 ? 70  VAL A HB   1  
ATOM 1030   H HG11 . VAL A 1 70  ? -19.204 -2.237  -8.362  1.00 14.03 ? 70  VAL A HG11 1  
ATOM 1031   H HG12 . VAL A 1 70  ? -20.204 -3.689  -8.355  1.00 75.43 ? 70  VAL A HG12 1  
ATOM 1032   H HG13 . VAL A 1 70  ? -19.577 -3.059  -9.877  1.00 4.53  ? 70  VAL A HG13 1  
ATOM 1033   H HG21 . VAL A 1 70  ? -16.410 -4.639  -9.813  1.00 22.31 ? 70  VAL A HG21 1  
ATOM 1034   H HG22 . VAL A 1 70  ? -17.229 -3.196  -10.412 1.00 45.32 ? 70  VAL A HG22 1  
ATOM 1035   H HG23 . VAL A 1 70  ? -17.944 -4.788  -10.671 1.00 52.11 ? 70  VAL A HG23 1  
ATOM 1036   N N    . LYS A 1 71  ? -15.737 -2.004  -8.815  1.00 2.44  ? 71  LYS A N    1  
ATOM 1037   C CA   . LYS A 1 71  ? -15.225 -0.722  -9.280  1.00 23.22 ? 71  LYS A CA   1  
ATOM 1038   C C    . LYS A 1 71  ? -14.966 -0.770  -10.782 1.00 43.12 ? 71  LYS A C    1  
ATOM 1039   O O    . LYS A 1 71  ? -14.222 -1.626  -11.266 1.00 3.52  ? 71  LYS A O    1  
ATOM 1040   C CB   . LYS A 1 71  ? -13.937 -0.362  -8.537  1.00 71.42 ? 71  LYS A CB   1  
ATOM 1041   C CG   . LYS A 1 71  ? -13.671 1.133   -8.472  1.00 4.02  ? 71  LYS A CG   1  
ATOM 1042   C CD   . LYS A 1 71  ? -12.184 1.438   -8.549  1.00 10.51 ? 71  LYS A CD   1  
ATOM 1043   C CE   . LYS A 1 71  ? -11.816 2.639   -7.692  1.00 35.12 ? 71  LYS A CE   1  
ATOM 1044   N NZ   . LYS A 1 71  ? -11.969 3.919   -8.436  1.00 2.24  ? 71  LYS A NZ   1  
ATOM 1045   H H    . LYS A 1 71  ? -15.316 -2.825  -9.146  1.00 74.00 ? 71  LYS A H    1  
ATOM 1046   H HA   . LYS A 1 71  ? -15.973 0.029   -9.077  1.00 54.35 ? 71  LYS A HA   1  
ATOM 1047   H HB2  . LYS A 1 71  ? -14.001 -0.738  -7.527  1.00 40.13 ? 71  LYS A HB2  1  
ATOM 1048   H HB3  . LYS A 1 71  ? -13.103 -0.833  -9.036  1.00 4.13  ? 71  LYS A HB3  1  
ATOM 1049   H HG2  . LYS A 1 71  ? -14.170 1.615   -9.300  1.00 65.44 ? 71  LYS A HG2  1  
ATOM 1050   H HG3  . LYS A 1 71  ? -14.061 1.518   -7.541  1.00 62.31 ? 71  LYS A HG3  1  
ATOM 1051   H HD2  . LYS A 1 71  ? -11.631 0.578   -8.200  1.00 11.43 ? 71  LYS A HD2  1  
ATOM 1052   H HD3  . LYS A 1 71  ? -11.921 1.645   -9.576  1.00 20.24 ? 71  LYS A HD3  1  
ATOM 1053   H HE2  . LYS A 1 71  ? -12.459 2.658   -6.826  1.00 62.22 ? 71  LYS A HE2  1  
ATOM 1054   H HE3  . LYS A 1 71  ? -10.788 2.537   -7.375  1.00 11.44 ? 71  LYS A HE3  1  
ATOM 1055   H HZ1  . LYS A 1 71  ? -12.940 4.278   -8.334  1.00 55.22 ? 71  LYS A HZ1  1  
ATOM 1056   H HZ2  . LYS A 1 71  ? -11.770 3.772   -9.446  1.00 32.11 ? 71  LYS A HZ2  1  
ATOM 1057   H HZ3  . LYS A 1 71  ? -11.307 4.630   -8.064  1.00 2.45  ? 71  LYS A HZ3  1  
ATOM 1058   N N    . VAL A 1 72  ? -15.592 0.144   -11.516 1.00 24.04 ? 72  VAL A N    1  
ATOM 1059   C CA   . VAL A 1 72  ? -15.438 0.195   -12.965 1.00 40.04 ? 72  VAL A CA   1  
ATOM 1060   C C    . VAL A 1 72  ? -14.395 1.226   -13.380 1.00 43.25 ? 72  VAL A C    1  
ATOM 1061   O O    . VAL A 1 72  ? -14.374 2.347   -12.871 1.00 3.52  ? 72  VAL A O    1  
ATOM 1062   C CB   . VAL A 1 72  ? -16.772 0.527   -13.659 1.00 60.21 ? 72  VAL A CB   1  
ATOM 1063   C CG1  . VAL A 1 72  ? -17.744 -0.636  -13.535 1.00 33.30 ? 72  VAL A CG1  1  
ATOM 1064   C CG2  . VAL A 1 72  ? -17.374 1.799   -13.079 1.00 52.32 ? 72  VAL A CG2  1  
ATOM 1065   H H    . VAL A 1 72  ? -16.181 0.791   -11.073 1.00 71.42 ? 72  VAL A H    1  
ATOM 1066   H HA   . VAL A 1 72  ? -15.117 -0.780  -13.300 1.00 13.42 ? 72  VAL A HA   1  
ATOM 1067   H HB   . VAL A 1 72  ? -16.577 0.694   -14.708 1.00 53.34 ? 72  VAL A HB   1  
ATOM 1068   H HG11 . VAL A 1 72  ? -17.473 -1.243  -12.684 1.00 31.32 ? 72  VAL A HG11 1  
ATOM 1069   H HG12 . VAL A 1 72  ? -17.703 -1.236  -14.432 1.00 53.14 ? 72  VAL A HG12 1  
ATOM 1070   H HG13 . VAL A 1 72  ? -18.746 -0.256  -13.402 1.00 61.23 ? 72  VAL A HG13 1  
ATOM 1071   H HG21 . VAL A 1 72  ? -18.135 1.540   -12.358 1.00 23.42 ? 72  VAL A HG21 1  
ATOM 1072   H HG22 . VAL A 1 72  ? -17.815 2.383   -13.873 1.00 22.04 ? 72  VAL A HG22 1  
ATOM 1073   H HG23 . VAL A 1 72  ? -16.600 2.375   -12.594 1.00 4.42  ? 72  VAL A HG23 1  
ATOM 1074   N N    . GLU A 1 73  ? -13.532 0.837   -14.313 1.00 73.23 ? 73  GLU A N    1  
ATOM 1075   C CA   . GLU A 1 73  ? -12.484 1.720   -14.808 1.00 11.33 ? 73  GLU A CA   1  
ATOM 1076   C C    . GLU A 1 73  ? -12.133 1.376   -16.255 1.00 22.44 ? 73  GLU A C    1  
ATOM 1077   O O    . GLU A 1 73  ? -12.457 0.292   -16.739 1.00 70.34 ? 73  GLU A O    1  
ATOM 1078   C CB   . GLU A 1 73  ? -11.238 1.614   -13.924 1.00 1.10  ? 73  GLU A CB   1  
ATOM 1079   C CG   . GLU A 1 73  ? -10.763 2.953   -13.382 1.00 61.21 ? 73  GLU A CG   1  
ATOM 1080   C CD   . GLU A 1 73  ? -10.599 2.948   -11.874 1.00 63.24 ? 73  GLU A CD   1  
ATOM 1081   O OE1  . GLU A 1 73  ? -11.580 3.264   -11.169 1.00 63.40 ? 73  GLU A OE1  1  
ATOM 1082   O OE2  . GLU A 1 73  ? -9.489  2.628   -11.399 1.00 40.44 ? 73  GLU A OE2  1  
ATOM 1083   H H    . GLU A 1 73  ? -13.604 -0.069  -14.679 1.00 72.23 ? 73  GLU A H    1  
ATOM 1084   H HA   . GLU A 1 73  ? -12.858 2.732   -14.771 1.00 51.43 ? 73  GLU A HA   1  
ATOM 1085   H HB2  . GLU A 1 73  ? -11.460 0.969   -13.087 1.00 12.12 ? 73  GLU A HB2  1  
ATOM 1086   H HB3  . GLU A 1 73  ? -10.435 1.179   -14.500 1.00 62.05 ? 73  GLU A HB3  1  
ATOM 1087   H HG2  . GLU A 1 73  ? -9.810  3.191   -13.830 1.00 73.42 ? 73  GLU A HG2  1  
ATOM 1088   H HG3  . GLU A 1 73  ? -11.485 3.711   -13.648 1.00 43.40 ? 73  GLU A HG3  1  
ATOM 1089   N N    . PRO A 1 74  ? -11.464 2.299   -16.968 1.00 72.03 ? 74  PRO A N    1  
ATOM 1090   C CA   . PRO A 1 74  ? -11.073 2.084   -18.365 1.00 1.34  ? 74  PRO A CA   1  
ATOM 1091   C C    . PRO A 1 74  ? -10.353 0.754   -18.567 1.00 53.23 ? 74  PRO A C    1  
ATOM 1092   O O    . PRO A 1 74  ? -9.610  0.301   -17.696 1.00 45.23 ? 74  PRO A O    1  
ATOM 1093   C CB   . PRO A 1 74  ? -10.130 3.253   -18.652 1.00 35.23 ? 74  PRO A CB   1  
ATOM 1094   C CG   . PRO A 1 74  ? -10.560 4.324   -17.711 1.00 30.24 ? 74  PRO A CG   1  
ATOM 1095   C CD   . PRO A 1 74  ? -11.037 3.620   -16.470 1.00 62.52 ? 74  PRO A CD   1  
ATOM 1096   H HA   . PRO A 1 74  ? -11.926 2.134   -19.026 1.00 72.13 ? 74  PRO A HA   1  
ATOM 1097   H HB2  . PRO A 1 74  ? -9.109  2.950   -18.467 1.00 72.15 ? 74  PRO A HB2  1  
ATOM 1098   H HB3  . PRO A 1 74  ? -10.239 3.564   -19.680 1.00 44.13 ? 74  PRO A HB3  1  
ATOM 1099   H HG2  . PRO A 1 74  ? -9.724  4.967   -17.479 1.00 72.21 ? 74  PRO A HG2  1  
ATOM 1100   H HG3  . PRO A 1 74  ? -11.365 4.896   -18.149 1.00 23.10 ? 74  PRO A HG3  1  
ATOM 1101   H HD2  . PRO A 1 74  ? -10.230 3.521   -15.758 1.00 54.00 ? 74  PRO A HD2  1  
ATOM 1102   H HD3  . PRO A 1 74  ? -11.867 4.152   -16.029 1.00 30.31 ? 74  PRO A HD3  1  
ATOM 1103   N N    . SER A 1 75  ? -10.577 0.133   -19.721 1.00 12.41 ? 75  SER A N    1  
ATOM 1104   C CA   . SER A 1 75  ? -9.948  -1.144  -20.035 1.00 45.43 ? 75  SER A CA   1  
ATOM 1105   C C    . SER A 1 75  ? -8.533  -0.933  -20.560 1.00 42.30 ? 75  SER A C    1  
ATOM 1106   O O    . SER A 1 75  ? -7.650  -1.765  -20.348 1.00 62.23 ? 75  SER A O    1  
ATOM 1107   C CB   . SER A 1 75  ? -10.780 -1.907  -21.067 1.00 12.11 ? 75  SER A CB   1  
ATOM 1108   O OG   . SER A 1 75  ? -12.020 -2.320  -20.519 1.00 4.12  ? 75  SER A OG   1  
ATOM 1109   H H    . SER A 1 75  ? -11.178 0.544   -20.377 1.00 73.53 ? 75  SER A H    1  
ATOM 1110   H HA   . SER A 1 75  ? -9.900  -1.723  -19.125 1.00 61.14 ? 75  SER A HA   1  
ATOM 1111   H HB2  . SER A 1 75  ? -10.971 -1.267  -21.916 1.00 65.32 ? 75  SER A HB2  1  
ATOM 1112   H HB3  . SER A 1 75  ? -10.234 -2.781  -21.391 1.00 33.11 ? 75  SER A HB3  1  
ATOM 1113   H HG   . SER A 1 75  ? -12.346 -3.082  -21.003 1.00 15.20 ? 75  SER A HG   1  
ATOM 1114   N N    . ASP A 1 76  ? -8.324  0.186   -21.245 1.00 12.12 ? 76  ASP A N    1  
ATOM 1115   C CA   . ASP A 1 76  ? -7.016  0.509   -21.800 1.00 52.15 ? 76  ASP A CA   1  
ATOM 1116   C C    . ASP A 1 76  ? -6.049  0.970   -20.709 1.00 13.31 ? 76  ASP A C    1  
ATOM 1117   O O    . ASP A 1 76  ? -4.856  1.140   -20.960 1.00 24.31 ? 76  ASP A O    1  
ATOM 1118   C CB   . ASP A 1 76  ? -7.148  1.594   -22.870 1.00 64.33 ? 76  ASP A CB   1  
ATOM 1119   C CG   . ASP A 1 76  ? -7.791  2.859   -22.335 1.00 13.33 ? 76  ASP A CG   1  
ATOM 1120   O OD1  . ASP A 1 76  ? -7.069  3.683   -21.735 1.00 32.51 ? 76  ASP A OD1  1  
ATOM 1121   O OD2  . ASP A 1 76  ? -9.015  3.025   -22.515 1.00 24.35 ? 76  ASP A OD2  1  
ATOM 1122   H H    . ASP A 1 76  ? -9.068  0.810   -21.379 1.00 2.11  ? 76  ASP A H    1  
ATOM 1123   H HA   . ASP A 1 76  ? -6.623  -0.386  -22.257 1.00 43.24 ? 76  ASP A HA   1  
ATOM 1124   H HB2  . ASP A 1 76  ? -6.167  1.843   -23.246 1.00 34.35 ? 76  ASP A HB2  1  
ATOM 1125   H HB3  . ASP A 1 76  ? -7.755  1.219   -23.681 1.00 44.03 ? 76  ASP A HB3  1  
ATOM 1126   N N    . ASN A 1 77  ? -6.567  1.172   -19.500 1.00 62.32 ? 77  ASN A N    1  
ATOM 1127   C CA   . ASN A 1 77  ? -5.743  1.613   -18.381 1.00 62.54 ? 77  ASN A CA   1  
ATOM 1128   C C    . ASN A 1 77  ? -4.676  0.576   -18.047 1.00 32.00 ? 77  ASN A C    1  
ATOM 1129   O O    . ASN A 1 77  ? -4.847  -0.614  -18.311 1.00 44.21 ? 77  ASN A O    1  
ATOM 1130   C CB   . ASN A 1 77  ? -6.615  1.879   -17.152 1.00 33.12 ? 77  ASN A CB   1  
ATOM 1131   C CG   . ASN A 1 77  ? -6.160  3.097   -16.373 1.00 54.33 ? 77  ASN A CG   1  
ATOM 1132   O OD1  . ASN A 1 77  ? -6.758  4.169   -16.469 1.00 2.11  ? 77  ASN A OD1  1  
ATOM 1133   N ND2  . ASN A 1 77  ? -5.095  2.939   -15.596 1.00 15.33 ? 77  ASN A ND2  1  
ATOM 1134   H H    . ASN A 1 77  ? -7.524  1.022   -19.356 1.00 73.31 ? 77  ASN A H    1  
ATOM 1135   H HA   . ASN A 1 77  ? -5.256  2.532   -18.670 1.00 51.24 ? 77  ASN A HA   1  
ATOM 1136   H HB2  . ASN A 1 77  ? -7.635  2.038   -17.470 1.00 63.23 ? 77  ASN A HB2  1  
ATOM 1137   H HB3  . ASN A 1 77  ? -6.576  1.020   -16.498 1.00 32.33 ? 77  ASN A HB3  1  
ATOM 1138   H HD21 . ASN A 1 77  ? -4.668  2.057   -15.569 1.00 52.32 ? 77  ASN A HD21 1  
ATOM 1139   H HD22 . ASN A 1 77  ? -4.779  3.710   -15.081 1.00 12.13 ? 77  ASN A HD22 1  
ATOM 1140   N N    . GLY A 1 78  ? -3.575  1.037   -17.464 1.00 42.11 ? 78  GLY A N    1  
ATOM 1141   C CA   . GLY A 1 78  ? -2.493  0.139   -17.102 1.00 75.24 ? 78  GLY A CA   1  
ATOM 1142   C C    . GLY A 1 78  ? -2.550  -0.284  -15.645 1.00 4.34  ? 78  GLY A C    1  
ATOM 1143   O O    . GLY A 1 78  ? -2.895  -1.427  -15.343 1.00 62.52 ? 78  GLY A O    1  
ATOM 1144   H H    . GLY A 1 78  ? -3.496  1.995   -17.279 1.00 74.22 ? 78  GLY A H    1  
ATOM 1145   H HA2  . GLY A 1 78  ? -2.549  -0.743  -17.723 1.00 22.32 ? 78  GLY A HA2  1  
ATOM 1146   H HA3  . GLY A 1 78  ? -1.552  0.635   -17.284 1.00 23.33 ? 78  GLY A HA3  1  
ATOM 1147   N N    . PRO A 1 79  ? -2.213  0.623   -14.710 1.00 23.13 ? 79  PRO A N    1  
ATOM 1148   C CA   . PRO A 1 79  ? -2.225  0.340   -13.275 1.00 44.52 ? 79  PRO A CA   1  
ATOM 1149   C C    . PRO A 1 79  ? -3.443  -0.475  -12.843 1.00 55.25 ? 79  PRO A C    1  
ATOM 1150   O O    . PRO A 1 79  ? -3.349  -1.317  -11.950 1.00 23.15 ? 79  PRO A O    1  
ATOM 1151   C CB   . PRO A 1 79  ? -2.250  1.735   -12.624 1.00 13.23 ? 79  PRO A CB   1  
ATOM 1152   C CG   . PRO A 1 79  ? -2.288  2.722   -13.751 1.00 15.22 ? 79  PRO A CG   1  
ATOM 1153   C CD   . PRO A 1 79  ? -1.789  2.000   -14.968 1.00 13.31 ? 79  PRO A CD   1  
ATOM 1154   H HA   . PRO A 1 79  ? -1.328  -0.179  -12.972 1.00 65.11 ? 79  PRO A HA   1  
ATOM 1155   H HB2  . PRO A 1 79  ? -3.126  1.824   -11.999 1.00 64.51 ? 79  PRO A HB2  1  
ATOM 1156   H HB3  . PRO A 1 79  ? -1.363  1.864   -12.021 1.00 51.43 ? 79  PRO A HB3  1  
ATOM 1157   H HG2  . PRO A 1 79  ? -3.301  3.060   -13.907 1.00 4.31  ? 79  PRO A HG2  1  
ATOM 1158   H HG3  . PRO A 1 79  ? -1.645  3.560   -13.524 1.00 65.21 ? 79  PRO A HG3  1  
ATOM 1159   H HD2  . PRO A 1 79  ? -2.255  2.392   -15.860 1.00 34.22 ? 79  PRO A HD2  1  
ATOM 1160   H HD3  . PRO A 1 79  ? -0.713  2.067   -15.037 1.00 71.11 ? 79  PRO A HD3  1  
ATOM 1161   N N    . LEU A 1 80  ? -4.582  -0.226  -13.481 1.00 15.42 ? 80  LEU A N    1  
ATOM 1162   C CA   . LEU A 1 80  ? -5.808  -0.946  -13.153 1.00 1.43  ? 80  LEU A CA   1  
ATOM 1163   C C    . LEU A 1 80  ? -5.655  -2.437  -13.438 1.00 3.43  ? 80  LEU A C    1  
ATOM 1164   O O    . LEU A 1 80  ? -5.921  -3.275  -12.576 1.00 55.10 ? 80  LEU A O    1  
ATOM 1165   C CB   . LEU A 1 80  ? -6.988  -0.383  -13.949 1.00 52.22 ? 80  LEU A CB   1  
ATOM 1166   C CG   . LEU A 1 80  ? -8.344  -1.015  -13.627 1.00 72.44 ? 80  LEU A CG   1  
ATOM 1167   C CD1  . LEU A 1 80  ? -9.074  -0.201  -12.570 1.00 64.33 ? 80  LEU A CD1  1  
ATOM 1168   C CD2  . LEU A 1 80  ? -9.188  -1.137  -14.886 1.00 13.14 ? 80  LEU A CD2  1  
ATOM 1169   H H    . LEU A 1 80  ? -4.600  0.451   -14.189 1.00 2.53  ? 80  LEU A H    1  
ATOM 1170   H HA   . LEU A 1 80  ? -5.999  -0.812  -12.099 1.00 50.44 ? 80  LEU A HA   1  
ATOM 1171   H HB2  . LEU A 1 80  ? -7.052  0.678   -13.754 1.00 61.34 ? 80  LEU A HB2  1  
ATOM 1172   H HB3  . LEU A 1 80  ? -6.789  -0.528  -15.000 1.00 61.11 ? 80  LEU A HB3  1  
ATOM 1173   H HG   . LEU A 1 80  ? -8.186  -2.008  -13.231 1.00 53.35 ? 80  LEU A HG   1  
ATOM 1174   H HD11 . LEU A 1 80  ? -10.081 -0.575  -12.459 1.00 73.24 ? 80  LEU A HD11 1  
ATOM 1175   H HD12 . LEU A 1 80  ? -9.106  0.836   -12.873 1.00 43.10 ? 80  LEU A HD12 1  
ATOM 1176   H HD13 . LEU A 1 80  ? -8.553  -0.284  -11.628 1.00 53.11 ? 80  LEU A HD13 1  
ATOM 1177   H HD21 . LEU A 1 80  ? -10.180 -1.476  -14.623 1.00 43.04 ? 80  LEU A HD21 1  
ATOM 1178   H HD22 . LEU A 1 80  ? -8.732  -1.849  -15.558 1.00 14.31 ? 80  LEU A HD22 1  
ATOM 1179   H HD23 . LEU A 1 80  ? -9.253  -0.174  -15.371 1.00 50.55 ? 80  LEU A HD23 1  
ATOM 1180   N N    . PHE A 1 81  ? -5.227  -2.761  -14.654 1.00 61.34 ? 81  PHE A N    1  
ATOM 1181   C CA   . PHE A 1 81  ? -5.040  -4.151  -15.057 1.00 40.34 ? 81  PHE A CA   1  
ATOM 1182   C C    . PHE A 1 81  ? -4.078  -4.877  -14.121 1.00 21.15 ? 81  PHE A C    1  
ATOM 1183   O O    . PHE A 1 81  ? -4.106  -6.104  -14.021 1.00 1.02  ? 81  PHE A O    1  
ATOM 1184   C CB   . PHE A 1 81  ? -4.517  -4.218  -16.493 1.00 10.41 ? 81  PHE A CB   1  
ATOM 1185   C CG   . PHE A 1 81  ? -4.732  -5.552  -17.148 1.00 4.20  ? 81  PHE A CG   1  
ATOM 1186   C CD1  . PHE A 1 81  ? -3.913  -6.628  -16.846 1.00 55.10 ? 81  PHE A CD1  1  
ATOM 1187   C CD2  . PHE A 1 81  ? -5.754  -5.731  -18.067 1.00 1.32  ? 81  PHE A CD2  1  
ATOM 1188   C CE1  . PHE A 1 81  ? -4.108  -7.857  -17.447 1.00 3.55  ? 81  PHE A CE1  1  
ATOM 1189   C CE2  . PHE A 1 81  ? -5.955  -6.958  -18.671 1.00 13.50 ? 81  PHE A CE2  1  
ATOM 1190   C CZ   . PHE A 1 81  ? -5.131  -8.022  -18.361 1.00 2.13  ? 81  PHE A CZ   1  
ATOM 1191   H H    . PHE A 1 81  ? -5.034  -2.048  -15.298 1.00 74.54 ? 81  PHE A H    1  
ATOM 1192   H HA   . PHE A 1 81  ? -6.002  -4.639  -15.013 1.00 53.30 ? 81  PHE A HA   1  
ATOM 1193   H HB2  . PHE A 1 81  ? -5.022  -3.471  -17.088 1.00 73.43 ? 81  PHE A HB2  1  
ATOM 1194   H HB3  . PHE A 1 81  ? -3.457  -4.014  -16.492 1.00 51.42 ? 81  PHE A HB3  1  
ATOM 1195   H HD1  . PHE A 1 81  ? -3.113  -6.500  -16.131 1.00 3.52  ? 81  PHE A HD1  1  
ATOM 1196   H HD2  . PHE A 1 81  ? -6.399  -4.900  -18.311 1.00 21.34 ? 81  PHE A HD2  1  
ATOM 1197   H HE1  . PHE A 1 81  ? -3.462  -8.687  -17.202 1.00 11.02 ? 81  PHE A HE1  1  
ATOM 1198   H HE2  . PHE A 1 81  ? -6.755  -7.084  -19.385 1.00 30.04 ? 81  PHE A HE2  1  
ATOM 1199   H HZ   . PHE A 1 81  ? -5.285  -8.981  -18.832 1.00 13.43 ? 81  PHE A HZ   1  
ATOM 1200   N N    . THR A 1 82  ? -3.227  -4.118  -13.436 1.00 53.53 ? 82  THR A N    1  
ATOM 1201   C CA   . THR A 1 82  ? -2.262  -4.702  -12.512 1.00 22.10 ? 82  THR A CA   1  
ATOM 1202   C C    . THR A 1 82  ? -2.925  -5.067  -11.187 1.00 53.13 ? 82  THR A C    1  
ATOM 1203   O O    . THR A 1 82  ? -2.706  -6.154  -10.653 1.00 13.14 ? 82  THR A O    1  
ATOM 1204   C CB   . THR A 1 82  ? -1.099  -3.743  -12.274 1.00 14.44 ? 82  THR A CB   1  
ATOM 1205   O OG1  . THR A 1 82  ? -1.009  -2.799  -13.324 1.00 24.22 ? 82  THR A OG1  1  
ATOM 1206   C CG2  . THR A 1 82  ? 0.237   -4.447  -12.173 1.00 3.03  ? 82  THR A CG2  1  
ATOM 1207   H H    . THR A 1 82  ? -3.250  -3.145  -13.554 1.00 34.31 ? 82  THR A H    1  
ATOM 1208   H HA   . THR A 1 82  ? -1.878  -5.601  -12.963 1.00 24.43 ? 82  THR A HA   1  
ATOM 1209   H HB   . THR A 1 82  ? -1.265  -3.210  -11.349 1.00 53.13 ? 82  THR A HB   1  
ATOM 1210   H HG1  . THR A 1 82  ? -1.631  -2.088  -13.169 1.00 11.32 ? 82  THR A HG1  1  
ATOM 1211   H HG21 . THR A 1 82  ? 0.130   -5.338  -11.572 1.00 64.11 ? 82  THR A HG21 1  
ATOM 1212   H HG22 . THR A 1 82  ? 0.958   -3.787  -11.713 1.00 74.13 ? 82  THR A HG22 1  
ATOM 1213   H HG23 . THR A 1 82  ? 0.576   -4.718  -13.162 1.00 73.22 ? 82  THR A HG23 1  
ATOM 1214   N N    . GLU A 1 83  ? -3.739  -4.155  -10.664 1.00 41.34 ? 83  GLU A N    1  
ATOM 1215   C CA   . GLU A 1 83  ? -4.434  -4.390  -9.404  1.00 73.10 ? 83  GLU A CA   1  
ATOM 1216   C C    . GLU A 1 83  ? -5.369  -5.589  -9.520  1.00 64.20 ? 83  GLU A C    1  
ATOM 1217   O O    . GLU A 1 83  ? -5.512  -6.372  -8.581  1.00 60.21 ? 83  GLU A O    1  
ATOM 1218   C CB   . GLU A 1 83  ? -5.228  -3.148  -8.993  1.00 31.54 ? 83  GLU A CB   1  
ATOM 1219   C CG   . GLU A 1 83  ? -5.534  -3.089  -7.505  1.00 43.42 ? 83  GLU A CG   1  
ATOM 1220   C CD   . GLU A 1 83  ? -6.953  -3.515  -7.183  1.00 41.41 ? 83  GLU A CD   1  
ATOM 1221   O OE1  . GLU A 1 83  ? -7.885  -2.730  -7.458  1.00 2.54  ? 83  GLU A OE1  1  
ATOM 1222   O OE2  . GLU A 1 83  ? -7.132  -4.633  -6.657  1.00 33.35 ? 83  GLU A OE2  1  
ATOM 1223   H H    . GLU A 1 83  ? -3.876  -3.307  -11.136 1.00 43.12 ? 83  GLU A H    1  
ATOM 1224   H HA   . GLU A 1 83  ? -3.691  -4.598  -8.648  1.00 54.33 ? 83  GLU A HA   1  
ATOM 1225   H HB2  . GLU A 1 83  ? -4.660  -2.268  -9.257  1.00 71.31 ? 83  GLU A HB2  1  
ATOM 1226   H HB3  . GLU A 1 83  ? -6.163  -3.138  -9.532  1.00 63.32 ? 83  GLU A HB3  1  
ATOM 1227   H HG2  . GLU A 1 83  ? -4.852  -3.743  -6.983  1.00 52.05 ? 83  GLU A HG2  1  
ATOM 1228   H HG3  . GLU A 1 83  ? -5.392  -2.075  -7.161  1.00 51.12 ? 83  GLU A HG3  1  
ATOM 1229   N N    . LEU A 1 84  ? -6.002  -5.726  -10.681 1.00 3.14  ? 84  LEU A N    1  
ATOM 1230   C CA   . LEU A 1 84  ? -6.923  -6.829  -10.925 1.00 11.40 ? 84  LEU A CA   1  
ATOM 1231   C C    . LEU A 1 84  ? -6.162  -8.122  -11.201 1.00 2.02  ? 84  LEU A C    1  
ATOM 1232   O O    . LEU A 1 84  ? -6.604  -9.207  -10.824 1.00 43.11 ? 84  LEU A O    1  
ATOM 1233   C CB   . LEU A 1 84  ? -7.844  -6.503  -12.104 1.00 41.04 ? 84  LEU A CB   1  
ATOM 1234   C CG   . LEU A 1 84  ? -8.786  -7.633  -12.523 1.00 43.14 ? 84  LEU A CG   1  
ATOM 1235   C CD1  . LEU A 1 84  ? -10.104 -7.069  -13.033 1.00 34.34 ? 84  LEU A CD1  1  
ATOM 1236   C CD2  . LEU A 1 84  ? -8.131  -8.506  -13.583 1.00 73.24 ? 84  LEU A CD2  1  
ATOM 1237   H H    . LEU A 1 84  ? -5.845  -5.067  -11.390 1.00 40.01 ? 84  LEU A H    1  
ATOM 1238   H HA   . LEU A 1 84  ? -7.523  -6.962  -10.037 1.00 34.43 ? 84  LEU A HA   1  
ATOM 1239   H HB2  . LEU A 1 84  ? -8.441  -5.643  -11.838 1.00 23.12 ? 84  LEU A HB2  1  
ATOM 1240   H HB3  . LEU A 1 84  ? -7.228  -6.245  -12.952 1.00 12.32 ? 84  LEU A HB3  1  
ATOM 1241   H HG   . LEU A 1 84  ? -8.999  -8.253  -11.664 1.00 43.01 ? 84  LEU A HG   1  
ATOM 1242   H HD11 . LEU A 1 84  ? -9.960  -6.046  -13.347 1.00 41.42 ? 84  LEU A HD11 1  
ATOM 1243   H HD12 . LEU A 1 84  ? -10.839 -7.103  -12.242 1.00 14.34 ? 84  LEU A HD12 1  
ATOM 1244   H HD13 . LEU A 1 84  ? -10.448 -7.658  -13.870 1.00 21.30 ? 84  LEU A HD13 1  
ATOM 1245   H HD21 . LEU A 1 84  ? -8.462  -8.192  -14.562 1.00 71.10 ? 84  LEU A HD21 1  
ATOM 1246   H HD22 . LEU A 1 84  ? -8.409  -9.537  -13.423 1.00 45.14 ? 84  LEU A HD22 1  
ATOM 1247   H HD23 . LEU A 1 84  ? -7.057  -8.407  -13.517 1.00 54.12 ? 84  LEU A HD23 1  
ATOM 1248   N N    . LYS A 1 85  ? -5.015  -7.998  -11.862 1.00 22.42 ? 85  LYS A N    1  
ATOM 1249   C CA   . LYS A 1 85  ? -4.192  -9.157  -12.189 1.00 62.21 ? 85  LYS A CA   1  
ATOM 1250   C C    . LYS A 1 85  ? -3.442  -9.656  -10.958 1.00 31.32 ? 85  LYS A C    1  
ATOM 1251   O O    . LYS A 1 85  ? -3.231  -10.857 -10.792 1.00 43.31 ? 85  LYS A O    1  
ATOM 1252   C CB   . LYS A 1 85  ? -3.200  -8.807  -13.299 1.00 42.14 ? 85  LYS A CB   1  
ATOM 1253   C CG   . LYS A 1 85  ? -2.482  -10.016 -13.877 1.00 53.11 ? 85  LYS A CG   1  
ATOM 1254   C CD   . LYS A 1 85  ? -1.541  -9.619  -15.002 1.00 13.30 ? 85  LYS A CD   1  
ATOM 1255   C CE   . LYS A 1 85  ? -1.079  -10.830 -15.796 1.00 3.31  ? 85  LYS A CE   1  
ATOM 1256   N NZ   . LYS A 1 85  ? 0.138   -10.536 -16.602 1.00 51.03 ? 85  LYS A NZ   1  
ATOM 1257   H H    . LYS A 1 85  ? -4.715  -7.106  -12.135 1.00 70.23 ? 85  LYS A H    1  
ATOM 1258   H HA   . LYS A 1 85  ? -4.848  -9.941  -12.538 1.00 73.03 ? 85  LYS A HA   1  
ATOM 1259   H HB2  . LYS A 1 85  ? -3.732  -8.315  -14.099 1.00 21.23 ? 85  LYS A HB2  1  
ATOM 1260   H HB3  . LYS A 1 85  ? -2.458  -8.130  -12.902 1.00 34.33 ? 85  LYS A HB3  1  
ATOM 1261   H HG2  . LYS A 1 85  ? -1.910  -10.491 -13.094 1.00 20.52 ? 85  LYS A HG2  1  
ATOM 1262   H HG3  . LYS A 1 85  ? -3.216  -10.709 -14.261 1.00 40.40 ? 85  LYS A HG3  1  
ATOM 1263   H HD2  . LYS A 1 85  ? -2.056  -8.941  -15.667 1.00 13.02 ? 85  LYS A HD2  1  
ATOM 1264   H HD3  . LYS A 1 85  ? -0.678  -9.126  -14.580 1.00 22.33 ? 85  LYS A HD3  1  
ATOM 1265   H HE2  . LYS A 1 85  ? -0.859  -11.633 -15.109 1.00 13.22 ? 85  LYS A HE2  1  
ATOM 1266   H HE3  . LYS A 1 85  ? -1.876  -11.134 -16.460 1.00 70.23 ? 85  LYS A HE3  1  
ATOM 1267   H HZ1  . LYS A 1 85  ? 0.086   -9.571  -16.988 1.00 23.22 ? 85  LYS A HZ1  1  
ATOM 1268   H HZ2  . LYS A 1 85  ? 0.216   -11.208 -17.391 1.00 23.20 ? 85  LYS A HZ2  1  
ATOM 1269   H HZ3  . LYS A 1 85  ? 0.988   -10.615 -16.008 1.00 72.43 ? 85  LYS A HZ3  1  
ATOM 1270   N N    . PHE A 1 86  ? -3.040  -8.725  -10.099 1.00 44.24 ? 86  PHE A N    1  
ATOM 1271   C CA   . PHE A 1 86  ? -2.313  -9.070  -8.883  1.00 34.15 ? 86  PHE A CA   1  
ATOM 1272   C C    . PHE A 1 86  ? -3.240  -9.717  -7.858  1.00 5.23  ? 86  PHE A C    1  
ATOM 1273   O O    . PHE A 1 86  ? -2.805  -10.526 -7.039  1.00 41.30 ? 86  PHE A O    1  
ATOM 1274   C CB   . PHE A 1 86  ? -1.662  -7.823  -8.283  1.00 30.13 ? 86  PHE A CB   1  
ATOM 1275   C CG   . PHE A 1 86  ? -0.681  -8.127  -7.186  1.00 43.13 ? 86  PHE A CG   1  
ATOM 1276   C CD1  . PHE A 1 86  ? 0.585   -8.606  -7.483  1.00 25.50 ? 86  PHE A CD1  1  
ATOM 1277   C CD2  . PHE A 1 86  ? -1.026  -7.933  -5.858  1.00 21.34 ? 86  PHE A CD2  1  
ATOM 1278   C CE1  . PHE A 1 86  ? 1.489   -8.886  -6.476  1.00 70.32 ? 86  PHE A CE1  1  
ATOM 1279   C CE2  . PHE A 1 86  ? -0.126  -8.212  -4.846  1.00 21.02 ? 86  PHE A CE2  1  
ATOM 1280   C CZ   . PHE A 1 86  ? 1.133   -8.688  -5.156  1.00 64.32 ? 86  PHE A CZ   1  
ATOM 1281   H H    . PHE A 1 86  ? -3.239  -7.784  -10.286 1.00 11.42 ? 86  PHE A H    1  
ATOM 1282   H HA   . PHE A 1 86  ? -1.541  -9.776  -9.148  1.00 63.40 ? 86  PHE A HA   1  
ATOM 1283   H HB2  . PHE A 1 86  ? -1.135  -7.291  -9.060  1.00 62.13 ? 86  PHE A HB2  1  
ATOM 1284   H HB3  . PHE A 1 86  ? -2.431  -7.184  -7.875  1.00 25.11 ? 86  PHE A HB3  1  
ATOM 1285   H HD1  . PHE A 1 86  ? 0.864   -8.760  -8.515  1.00 22.21 ? 86  PHE A HD1  1  
ATOM 1286   H HD2  . PHE A 1 86  ? -2.010  -7.561  -5.614  1.00 51.12 ? 86  PHE A HD2  1  
ATOM 1287   H HE1  . PHE A 1 86  ? 2.472   -9.259  -6.720  1.00 33.33 ? 86  PHE A HE1  1  
ATOM 1288   H HE2  . PHE A 1 86  ? -0.407  -8.057  -3.815  1.00 71.22 ? 86  PHE A HE2  1  
ATOM 1289   H HZ   . PHE A 1 86  ? 1.838   -8.907  -4.367  1.00 2.00  ? 86  PHE A HZ   1  
ATOM 1290   N N    . TYR A 1 87  ? -4.517  -9.354  -7.908  1.00 50.13 ? 87  TYR A N    1  
ATOM 1291   C CA   . TYR A 1 87  ? -5.503  -9.899  -6.982  1.00 34.31 ? 87  TYR A CA   1  
ATOM 1292   C C    . TYR A 1 87  ? -5.879  -11.329 -7.362  1.00 74.41 ? 87  TYR A C    1  
ATOM 1293   O O    . TYR A 1 87  ? -5.819  -12.237 -6.535  1.00 73.52 ? 87  TYR A O    1  
ATOM 1294   C CB   . TYR A 1 87  ? -6.754  -9.019  -6.959  1.00 32.30 ? 87  TYR A CB   1  
ATOM 1295   C CG   . TYR A 1 87  ? -6.747  -7.987  -5.854  1.00 20.41 ? 87  TYR A CG   1  
ATOM 1296   C CD1  . TYR A 1 87  ? -5.739  -7.035  -5.771  1.00 54.22 ? 87  TYR A CD1  1  
ATOM 1297   C CD2  . TYR A 1 87  ? -7.750  -7.965  -4.892  1.00 64.32 ? 87  TYR A CD2  1  
ATOM 1298   C CE1  . TYR A 1 87  ? -5.730  -6.091  -4.762  1.00 64.21 ? 87  TYR A CE1  1  
ATOM 1299   C CE2  . TYR A 1 87  ? -7.748  -7.024  -3.881  1.00 34.50 ? 87  TYR A CE2  1  
ATOM 1300   C CZ   . TYR A 1 87  ? -6.736  -6.089  -3.820  1.00 13.12 ? 87  TYR A CZ   1  
ATOM 1301   O OH   . TYR A 1 87  ? -6.730  -5.151  -2.814  1.00 51.00 ? 87  TYR A OH   1  
ATOM 1302   H H    . TYR A 1 87  ? -4.803  -8.703  -8.582  1.00 34.43 ? 87  TYR A H    1  
ATOM 1303   H HA   . TYR A 1 87  ? -5.062  -9.907  -5.997  1.00 23.50 ? 87  TYR A HA   1  
ATOM 1304   H HB2  . TYR A 1 87  ? -6.834  -8.495  -7.900  1.00 64.44 ? 87  TYR A HB2  1  
ATOM 1305   H HB3  . TYR A 1 87  ? -7.624  -9.644  -6.825  1.00 33.42 ? 87  TYR A HB3  1  
ATOM 1306   H HD1  . TYR A 1 87  ? -4.952  -7.038  -6.511  1.00 54.33 ? 87  TYR A HD1  1  
ATOM 1307   H HD2  . TYR A 1 87  ? -8.541  -8.698  -4.942  1.00 1.14  ? 87  TYR A HD2  1  
ATOM 1308   H HE1  . TYR A 1 87  ? -4.937  -5.359  -4.715  1.00 11.02 ? 87  TYR A HE1  1  
ATOM 1309   H HE2  . TYR A 1 87  ? -8.536  -7.023  -3.142  1.00 12.30 ? 87  TYR A HE2  1  
ATOM 1310   H HH   . TYR A 1 87  ? -5.830  -5.013  -2.509  1.00 3.40  ? 87  TYR A HH   1  
ATOM 1311   N N    . GLN A 1 88  ? -6.271  -11.520 -8.617  1.00 54.40 ? 88  GLN A N    1  
ATOM 1312   C CA   . GLN A 1 88  ? -6.662  -12.839 -9.103  1.00 65.42 ? 88  GLN A CA   1  
ATOM 1313   C C    . GLN A 1 88  ? -5.473  -13.799 -9.130  1.00 41.33 ? 88  GLN A C    1  
ATOM 1314   O O    . GLN A 1 88  ? -5.651  -15.013 -9.235  1.00 60.30 ? 88  GLN A O    1  
ATOM 1315   C CB   . GLN A 1 88  ? -7.271  -12.727 -10.501 1.00 53.12 ? 88  GLN A CB   1  
ATOM 1316   C CG   . GLN A 1 88  ? -8.162  -13.901 -10.874 1.00 23.35 ? 88  GLN A CG   1  
ATOM 1317   C CD   . GLN A 1 88  ? -7.563  -14.767 -11.965 1.00 21.45 ? 88  GLN A CD   1  
ATOM 1318   O OE1  . GLN A 1 88  ? -7.957  -14.682 -13.128 1.00 23.21 ? 88  GLN A OE1  1  
ATOM 1319   N NE2  . GLN A 1 88  ? -6.603  -15.606 -11.594 1.00 1.52  ? 88  GLN A NE2  1  
ATOM 1320   H H    . GLN A 1 88  ? -6.305  -10.757 -9.231  1.00 21.34 ? 88  GLN A H    1  
ATOM 1321   H HA   . GLN A 1 88  ? -7.408  -13.231 -8.428  1.00 41.11 ? 88  GLN A HA   1  
ATOM 1322   H HB2  . GLN A 1 88  ? -7.862  -11.824 -10.552 1.00 41.03 ? 88  GLN A HB2  1  
ATOM 1323   H HB3  . GLN A 1 88  ? -6.472  -12.664 -11.225 1.00 3.52  ? 88  GLN A HB3  1  
ATOM 1324   H HG2  . GLN A 1 88  ? -8.318  -14.511 -9.997  1.00 5.01  ? 88  GLN A HG2  1  
ATOM 1325   H HG3  . GLN A 1 88  ? -9.112  -13.519 -11.219 1.00 4.12  ? 88  GLN A HG3  1  
ATOM 1326   H HE21 . GLN A 1 88  ? -6.340  -15.620 -10.650 1.00 73.02 ? 88  GLN A HE21 1  
ATOM 1327   H HE22 . GLN A 1 88  ? -6.198  -16.178 -12.279 1.00 34.23 ? 88  GLN A HE22 1  
ATOM 1328   N N    . ARG A 1 89  ? -4.262  -13.255 -9.042  1.00 74.14 ? 89  ARG A N    1  
ATOM 1329   C CA   . ARG A 1 89  ? -3.056  -14.076 -9.064  1.00 62.44 ? 89  ARG A CA   1  
ATOM 1330   C C    . ARG A 1 89  ? -2.436  -14.190 -7.674  1.00 60.34 ? 89  ARG A C    1  
ATOM 1331   O O    . ARG A 1 89  ? -2.018  -15.270 -7.258  1.00 64.13 ? 89  ARG A O    1  
ATOM 1332   C CB   . ARG A 1 89  ? -2.035  -13.491 -10.042 1.00 52.33 ? 89  ARG A CB   1  
ATOM 1333   C CG   . ARG A 1 89  ? -2.408  -13.690 -11.502 1.00 33.33 ? 89  ARG A CG   1  
ATOM 1334   C CD   . ARG A 1 89  ? -1.180  -13.937 -12.363 1.00 44.03 ? 89  ARG A CD   1  
ATOM 1335   N NE   . ARG A 1 89  ? -1.430  -14.933 -13.402 1.00 72.21 ? 89  ARG A NE   1  
ATOM 1336   C CZ   . ARG A 1 89  ? -0.468  -15.585 -14.051 1.00 65.45 ? 89  ARG A CZ   1  
ATOM 1337   N NH1  . ARG A 1 89  ? 0.808   -15.348 -13.774 1.00 72.22 ? 89  ARG A NH1  1  
ATOM 1338   N NH2  . ARG A 1 89  ? -0.783  -16.475 -14.982 1.00 43.02 ? 89  ARG A NH2  1  
ATOM 1339   H H    . ARG A 1 89  ? -4.176  -12.282 -8.964  1.00 14.41 ? 89  ARG A H    1  
ATOM 1340   H HA   . ARG A 1 89  ? -3.335  -15.063 -9.400  1.00 44.23 ? 89  ARG A HA   1  
ATOM 1341   H HB2  . ARG A 1 89  ? -1.943  -12.431 -9.857  1.00 42.45 ? 89  ARG A HB2  1  
ATOM 1342   H HB3  . ARG A 1 89  ? -1.078  -13.962 -9.870  1.00 43.31 ? 89  ARG A HB3  1  
ATOM 1343   H HG2  . ARG A 1 89  ? -3.068  -14.541 -11.582 1.00 65.42 ? 89  ARG A HG2  1  
ATOM 1344   H HG3  . ARG A 1 89  ? -2.915  -12.805 -11.858 1.00 62.10 ? 89  ARG A HG3  1  
ATOM 1345   H HD2  . ARG A 1 89  ? -0.892  -13.007 -12.832 1.00 33.13 ? 89  ARG A HD2  1  
ATOM 1346   H HD3  . ARG A 1 89  ? -0.376  -14.283 -11.730 1.00 11.15 ? 89  ARG A HD3  1  
ATOM 1347   H HE   . ARG A 1 89  ? -2.364  -15.127 -13.627 1.00 41.41 ? 89  ARG A HE   1  
ATOM 1348   H HH11 . ARG A 1 89  ? 1.052   -14.678 -13.073 1.00 52.20 ? 89  ARG A HH11 1  
ATOM 1349   H HH12 . ARG A 1 89  ? 1.526   -15.841 -14.265 1.00 22.14 ? 89  ARG A HH12 1  
ATOM 1350   H HH21 . ARG A 1 89  ? -1.743  -16.658 -15.195 1.00 23.30 ? 89  ARG A HH21 1  
ATOM 1351   H HH22 . ARG A 1 89  ? -0.061  -16.965 -15.470 1.00 70.22 ? 89  ARG A HH22 1  
ATOM 1352   N N    . ALA A 1 90  ? -2.375  -13.070 -6.961  1.00 74.03 ? 90  ALA A N    1  
ATOM 1353   C CA   . ALA A 1 90  ? -1.801  -13.049 -5.621  1.00 33.41 ? 90  ALA A CA   1  
ATOM 1354   C C    . ALA A 1 90  ? -2.883  -13.157 -4.552  1.00 0.43  ? 90  ALA A C    1  
ATOM 1355   O O    . ALA A 1 90  ? -2.716  -13.858 -3.554  1.00 10.54 ? 90  ALA A O    1  
ATOM 1356   C CB   . ALA A 1 90  ? -0.982  -11.783 -5.419  1.00 63.41 ? 90  ALA A CB   1  
ATOM 1357   H H    . ALA A 1 90  ? -2.722  -12.238 -7.346  1.00 3.04  ? 90  ALA A H    1  
ATOM 1358   H HA   . ALA A 1 90  ? -1.136  -13.896 -5.531  1.00 75.41 ? 90  ALA A HA   1  
ATOM 1359   H HB1  . ALA A 1 90  ? -0.697  -11.381 -6.380  1.00 12.11 ? 90  ALA A HB1  1  
ATOM 1360   H HB2  . ALA A 1 90  ? -0.095  -12.015 -4.848  1.00 53.12 ? 90  ALA A HB2  1  
ATOM 1361   H HB3  . ALA A 1 90  ? -1.573  -11.054 -4.884  1.00 33.00 ? 90  ALA A HB3  1  
ATOM 1362   N N    . ALA A 1 91  ? -3.991  -12.456 -4.766  1.00 24.12 ? 91  ALA A N    1  
ATOM 1363   C CA   . ALA A 1 91  ? -5.100  -12.472 -3.819  1.00 44.22 ? 91  ALA A CA   1  
ATOM 1364   C C    . ALA A 1 91  ? -6.072  -13.607 -4.125  1.00 41.11 ? 91  ALA A C    1  
ATOM 1365   O O    . ALA A 1 91  ? -7.278  -13.390 -4.254  1.00 0.24  ? 91  ALA A O    1  
ATOM 1366   C CB   . ALA A 1 91  ? -5.824  -11.133 -3.835  1.00 74.22 ? 91  ALA A CB   1  
ATOM 1367   H H    . ALA A 1 91  ? -4.065  -11.914 -5.579  1.00 12.23 ? 91  ALA A H    1  
ATOM 1368   H HA   . ALA A 1 91  ? -4.691  -12.620 -2.830  1.00 54.20 ? 91  ALA A HA   1  
ATOM 1369   H HB1  . ALA A 1 91  ? -6.461  -11.058 -2.966  1.00 53.22 ? 91  ALA A HB1  1  
ATOM 1370   H HB2  . ALA A 1 91  ? -6.425  -11.059 -4.729  1.00 13.12 ? 91  ALA A HB2  1  
ATOM 1371   H HB3  . ALA A 1 91  ? -5.100  -10.332 -3.820  1.00 4.40  ? 91  ALA A HB3  1  
ATOM 1372   N N    . LYS A 1 92  ? -5.541  -14.821 -4.238  1.00 64.13 ? 92  LYS A N    1  
ATOM 1373   C CA   . LYS A 1 92  ? -6.362  -15.991 -4.527  1.00 63.51 ? 92  LYS A CA   1  
ATOM 1374   C C    . LYS A 1 92  ? -6.872  -16.627 -3.235  1.00 41.42 ? 92  LYS A C    1  
ATOM 1375   O O    . LYS A 1 92  ? -6.213  -16.558 -2.198  1.00 74.14 ? 92  LYS A O    1  
ATOM 1376   C CB   . LYS A 1 92  ? -5.560  -17.014 -5.336  1.00 0.22  ? 92  LYS A CB   1  
ATOM 1377   C CG   . LYS A 1 92  ? -6.208  -17.384 -6.660  1.00 14.04 ? 92  LYS A CG   1  
ATOM 1378   C CD   . LYS A 1 92  ? -5.166  -17.659 -7.733  1.00 73.32 ? 92  LYS A CD   1  
ATOM 1379   C CE   . LYS A 1 92  ? -5.792  -18.282 -8.970  1.00 1.32  ? 92  LYS A CE   1  
ATOM 1380   N NZ   . LYS A 1 92  ? -7.037  -17.576 -9.379  1.00 0.11  ? 92  LYS A NZ   1  
ATOM 1381   H H    . LYS A 1 92  ? -4.574  -14.931 -4.124  1.00 4.32  ? 92  LYS A H    1  
ATOM 1382   H HA   . LYS A 1 92  ? -7.208  -15.666 -5.112  1.00 31.02 ? 92  LYS A HA   1  
ATOM 1383   H HB2  . LYS A 1 92  ? -4.581  -16.606 -5.541  1.00 53.33 ? 92  LYS A HB2  1  
ATOM 1384   H HB3  . LYS A 1 92  ? -5.448  -17.915 -4.751  1.00 23.41 ? 92  LYS A HB3  1  
ATOM 1385   H HG2  . LYS A 1 92  ? -6.809  -18.270 -6.521  1.00 22.35 ? 92  LYS A HG2  1  
ATOM 1386   H HG3  . LYS A 1 92  ? -6.837  -16.567 -6.982  1.00 10.13 ? 92  LYS A HG3  1  
ATOM 1387   H HD2  . LYS A 1 92  ? -4.695  -16.728 -8.010  1.00 4.24  ? 92  LYS A HD2  1  
ATOM 1388   H HD3  . LYS A 1 92  ? -4.425  -18.336 -7.335  1.00 14.53 ? 92  LYS A HD3  1  
ATOM 1389   H HE2  . LYS A 1 92  ? -5.080  -18.235 -9.781  1.00 55.22 ? 92  LYS A HE2  1  
ATOM 1390   H HE3  . LYS A 1 92  ? -6.027  -19.315 -8.758  1.00 35.50 ? 92  LYS A HE3  1  
ATOM 1391   H HZ1  . LYS A 1 92  ? -7.019  -16.593 -9.040  1.00 31.42 ? 92  LYS A HZ1  1  
ATOM 1392   H HZ2  . LYS A 1 92  ? -7.868  -18.053 -8.976  1.00 64.15 ? 92  LYS A HZ2  1  
ATOM 1393   H HZ3  . LYS A 1 92  ? -7.122  -17.572 -10.416 1.00 42.34 ? 92  LYS A HZ3  1  
ATOM 1394   N N    . PRO A 1 93  ? -8.057  -17.260 -3.282  1.00 53.53 ? 93  PRO A N    1  
ATOM 1395   C CA   . PRO A 1 93  ? -8.652  -17.910 -2.109  1.00 63.23 ? 93  PRO A CA   1  
ATOM 1396   C C    . PRO A 1 93  ? -7.762  -19.014 -1.547  1.00 3.10  ? 93  PRO A C    1  
ATOM 1397   O O    . PRO A 1 93  ? -7.774  -19.283 -0.346  1.00 22.11 ? 93  PRO A O    1  
ATOM 1398   C CB   . PRO A 1 93  ? -9.965  -18.498 -2.640  1.00 24.11 ? 93  PRO A CB   1  
ATOM 1399   C CG   . PRO A 1 93  ? -9.800  -18.548 -4.121  1.00 24.25 ? 93  PRO A CG   1  
ATOM 1400   C CD   . PRO A 1 93  ? -8.907  -17.395 -4.475  1.00 35.33 ? 93  PRO A CD   1  
ATOM 1401   H HA   . PRO A 1 93  ? -8.866  -17.194 -1.329  1.00 13.50 ? 93  PRO A HA   1  
ATOM 1402   H HB2  . PRO A 1 93  ? -10.113 -19.485 -2.227  1.00 44.33 ? 93  PRO A HB2  1  
ATOM 1403   H HB3  . PRO A 1 93  ? -10.788 -17.858 -2.358  1.00 14.13 ? 93  PRO A HB3  1  
ATOM 1404   H HG2  . PRO A 1 93  ? -9.338  -19.482 -4.408  1.00 15.52 ? 93  PRO A HG2  1  
ATOM 1405   H HG3  . PRO A 1 93  ? -10.761 -18.440 -4.602  1.00 14.34 ? 93  PRO A HG3  1  
ATOM 1406   H HD2  . PRO A 1 93  ? -8.316  -17.627 -5.348  1.00 13.14 ? 93  PRO A HD2  1  
ATOM 1407   H HD3  . PRO A 1 93  ? -9.490  -16.500 -4.637  1.00 63.22 ? 93  PRO A HD3  1  
ATOM 1408   N N    . GLU A 1 94  ? -6.989  -19.647 -2.423  1.00 35.01 ? 94  GLU A N    1  
ATOM 1409   C CA   . GLU A 1 94  ? -6.091  -20.720 -2.014  1.00 42.33 ? 94  GLU A CA   1  
ATOM 1410   C C    . GLU A 1 94  ? -4.767  -20.157 -1.505  1.00 5.14  ? 94  GLU A C    1  
ATOM 1411   O O    . GLU A 1 94  ? -4.295  -20.529 -0.432  1.00 41.44 ? 94  GLU A O    1  
ATOM 1412   C CB   . GLU A 1 94  ? -5.837  -21.674 -3.183  1.00 70.24 ? 94  GLU A CB   1  
ATOM 1413   C CG   . GLU A 1 94  ? -5.719  -23.131 -2.764  1.00 33.34 ? 94  GLU A CG   1  
ATOM 1414   C CD   . GLU A 1 94  ? -7.050  -23.856 -2.796  1.00 13.14 ? 94  GLU A CD   1  
ATOM 1415   O OE1  . GLU A 1 94  ? -8.094  -23.187 -2.642  1.00 4.03  ? 94  GLU A OE1  1  
ATOM 1416   O OE2  . GLU A 1 94  ? -7.049  -25.092 -2.975  1.00 10.40 ? 94  GLU A OE2  1  
ATOM 1417   H H    . GLU A 1 94  ? -7.023  -19.385 -3.367  1.00 14.42 ? 94  GLU A H    1  
ATOM 1418   H HA   . GLU A 1 94  ? -6.568  -21.265 -1.214  1.00 14.34 ? 94  GLU A HA   1  
ATOM 1419   H HB2  . GLU A 1 94  ? -6.652  -21.589 -3.886  1.00 0.02  ? 94  GLU A HB2  1  
ATOM 1420   H HB3  . GLU A 1 94  ? -4.918  -21.388 -3.674  1.00 54.50 ? 94  GLU A HB3  1  
ATOM 1421   H HG2  . GLU A 1 94  ? -5.038  -23.631 -3.436  1.00 73.32 ? 94  GLU A HG2  1  
ATOM 1422   H HG3  . GLU A 1 94  ? -5.326  -23.172 -1.759  1.00 44.33 ? 94  GLU A HG3  1  
ATOM 1423   N N    . GLN A 1 95  ? -4.174  -19.260 -2.286  1.00 74.41 ? 95  GLN A N    1  
ATOM 1424   C CA   . GLN A 1 95  ? -2.902  -18.645 -1.920  1.00 24.13 ? 95  GLN A CA   1  
ATOM 1425   C C    . GLN A 1 95  ? -2.987  -17.974 -0.552  1.00 44.30 ? 95  GLN A C    1  
ATOM 1426   O O    . GLN A 1 95  ? -2.027  -17.990 0.219   1.00 43.13 ? 95  GLN A O    1  
ATOM 1427   C CB   . GLN A 1 95  ? -2.484  -17.621 -2.978  1.00 33.23 ? 95  GLN A CB   1  
ATOM 1428   C CG   . GLN A 1 95  ? -1.616  -18.206 -4.080  1.00 30.20 ? 95  GLN A CG   1  
ATOM 1429   C CD   . GLN A 1 95  ? -1.591  -17.338 -5.323  1.00 23.52 ? 95  GLN A CD   1  
ATOM 1430   O OE1  . GLN A 1 95  ? -2.417  -17.497 -6.222  1.00 24.14 ? 95  GLN A OE1  1  
ATOM 1431   N NE2  . GLN A 1 95  ? -0.639  -16.414 -5.381  1.00 55.32 ? 95  GLN A NE2  1  
ATOM 1432   H H    . GLN A 1 95  ? -4.601  -19.009 -3.132  1.00 41.13 ? 95  GLN A H    1  
ATOM 1433   H HA   . GLN A 1 95  ? -2.158  -19.426 -1.877  1.00 31.35 ? 95  GLN A HA   1  
ATOM 1434   H HB2  . GLN A 1 95  ? -3.373  -17.206 -3.430  1.00 41.11 ? 95  GLN A HB2  1  
ATOM 1435   H HB3  . GLN A 1 95  ? -1.932  -16.828 -2.496  1.00 64.12 ? 95  GLN A HB3  1  
ATOM 1436   H HG2  . GLN A 1 95  ? -0.607  -18.308 -3.710  1.00 53.21 ? 95  GLN A HG2  1  
ATOM 1437   H HG3  . GLN A 1 95  ? -2.002  -19.179 -4.346  1.00 25.22 ? 95  GLN A HG3  1  
ATOM 1438   H HE21 . GLN A 1 95  ? -0.015  -16.345 -4.628  1.00 12.10 ? 95  GLN A HE21 1  
ATOM 1439   H HE22 . GLN A 1 95  ? -0.599  -15.839 -6.173  1.00 0.31  ? 95  GLN A HE22 1  
ATOM 1440   N N    . ILE A 1 96  ? -4.141  -17.384 -0.256  1.00 14.43 ? 96  ILE A N    1  
ATOM 1441   C CA   . ILE A 1 96  ? -4.346  -16.707 1.019   1.00 53.12 ? 96  ILE A CA   1  
ATOM 1442   C C    . ILE A 1 96  ? -4.542  -17.711 2.151   1.00 44.40 ? 96  ILE A C    1  
ATOM 1443   O O    . ILE A 1 96  ? -3.856  -17.650 3.172   1.00 53.05 ? 96  ILE A O    1  
ATOM 1444   C CB   . ILE A 1 96  ? -5.563  -15.761 0.965   1.00 51.31 ? 96  ILE A CB   1  
ATOM 1445   C CG1  . ILE A 1 96  ? -5.418  -14.774 -0.195  1.00 72.22 ? 96  ILE A CG1  1  
ATOM 1446   C CG2  . ILE A 1 96  ? -5.719  -15.014 2.282   1.00 11.35 ? 96  ILE A CG2  1  
ATOM 1447   C CD1  . ILE A 1 96  ? -6.742  -14.294 -0.750  1.00 64.12 ? 96  ILE A CD1  1  
ATOM 1448   H H    . ILE A 1 96  ? -4.869  -17.403 -0.912  1.00 61.35 ? 96  ILE A H    1  
ATOM 1449   H HA   . ILE A 1 96  ? -3.467  -16.114 1.226   1.00 2.21  ? 96  ILE A HA   1  
ATOM 1450   H HB   . ILE A 1 96  ? -6.449  -16.358 0.811   1.00 2.21  ? 96  ILE A HB   1  
ATOM 1451   H HG12 . ILE A 1 96  ? -4.869  -13.909 0.144   1.00 1.32  ? 96  ILE A HG12 1  
ATOM 1452   H HG13 . ILE A 1 96  ? -4.873  -15.249 -0.998  1.00 71.41 ? 96  ILE A HG13 1  
ATOM 1453   H HG21 . ILE A 1 96  ? -4.760  -14.949 2.774   1.00 22.30 ? 96  ILE A HG21 1  
ATOM 1454   H HG22 . ILE A 1 96  ? -6.414  -15.544 2.917   1.00 21.24 ? 96  ILE A HG22 1  
ATOM 1455   H HG23 . ILE A 1 96  ? -6.093  -14.019 2.090   1.00 2.45  ? 96  ILE A HG23 1  
ATOM 1456   H HD11 . ILE A 1 96  ? -6.575  -13.781 -1.686  1.00 3.42  ? 96  ILE A HD11 1  
ATOM 1457   H HD12 . ILE A 1 96  ? -7.203  -13.618 -0.046  1.00 34.12 ? 96  ILE A HD12 1  
ATOM 1458   H HD13 . ILE A 1 96  ? -7.391  -15.141 -0.914  1.00 62.45 ? 96  ILE A HD13 1  
ATOM 1459   N N    . GLN A 1 97  ? -5.482  -18.633 1.967   1.00 15.35 ? 97  GLN A N    1  
ATOM 1460   C CA   . GLN A 1 97  ? -5.765  -19.646 2.977   1.00 73.40 ? 97  GLN A CA   1  
ATOM 1461   C C    . GLN A 1 97  ? -4.560  -20.556 3.192   1.00 62.22 ? 97  GLN A C    1  
ATOM 1462   O O    . GLN A 1 97  ? -4.206  -20.875 4.327   1.00 41.42 ? 97  GLN A O    1  
ATOM 1463   C CB   . GLN A 1 97  ? -6.980  -20.480 2.564   1.00 42.23 ? 97  GLN A CB   1  
ATOM 1464   C CG   . GLN A 1 97  ? -8.306  -19.884 3.010   1.00 75.41 ? 97  GLN A CG   1  
ATOM 1465   C CD   . GLN A 1 97  ? -9.357  -20.941 3.285   1.00 45.24 ? 97  GLN A CD   1  
ATOM 1466   O OE1  . GLN A 1 97  ? -9.106  -21.911 4.001   1.00 64.25 ? 97  GLN A OE1  1  
ATOM 1467   N NE2  . GLN A 1 97  ? -10.543 -20.759 2.716   1.00 62.01 ? 97  GLN A NE2  1  
ATOM 1468   H H    . GLN A 1 97  ? -5.998  -18.632 1.134   1.00 35.04 ? 97  GLN A H    1  
ATOM 1469   H HA   . GLN A 1 97  ? -5.987  -19.138 3.903   1.00 72.33 ? 97  GLN A HA   1  
ATOM 1470   H HB2  . GLN A 1 97  ? -6.993  -20.568 1.488   1.00 71.23 ? 97  GLN A HB2  1  
ATOM 1471   H HB3  . GLN A 1 97  ? -6.890  -21.465 2.997   1.00 32.21 ? 97  GLN A HB3  1  
ATOM 1472   H HG2  . GLN A 1 97  ? -8.145  -19.315 3.913   1.00 52.41 ? 97  GLN A HG2  1  
ATOM 1473   H HG3  . GLN A 1 97  ? -8.670  -19.228 2.232   1.00 63.22 ? 97  GLN A HG3  1  
ATOM 1474   H HE21 . GLN A 1 97  ? -10.671 -19.964 2.158   1.00 41.51 ? 97  GLN A HE21 1  
ATOM 1475   H HE22 . GLN A 1 97  ? -11.241 -21.428 2.877   1.00 33.20 ? 97  GLN A HE22 1  
ATOM 1476   N N    . LYS A 1 98  ? -3.935  -20.972 2.095   1.00 64.45 ? 98  LYS A N    1  
ATOM 1477   C CA   . LYS A 1 98  ? -2.769  -21.848 2.162   1.00 4.23  ? 98  LYS A CA   1  
ATOM 1478   C C    . LYS A 1 98  ? -1.695  -21.264 3.074   1.00 52.23 ? 98  LYS A C    1  
ATOM 1479   O O    . LYS A 1 98  ? -1.066  -21.984 3.849   1.00 34.20 ? 98  LYS A O    1  
ATOM 1480   C CB   . LYS A 1 98  ? -2.195  -22.078 0.763   1.00 14.15 ? 98  LYS A CB   1  
ATOM 1481   C CG   . LYS A 1 98  ? -2.934  -23.144 -0.030  1.00 51.54 ? 98  LYS A CG   1  
ATOM 1482   C CD   . LYS A 1 98  ? -1.980  -23.967 -0.880  1.00 2.10  ? 98  LYS A CD   1  
ATOM 1483   C CE   . LYS A 1 98  ? -2.383  -25.433 -0.908  1.00 45.22 ? 98  LYS A CE   1  
ATOM 1484   N NZ   . LYS A 1 98  ? -2.067  -26.071 -2.216  1.00 54.51 ? 98  LYS A NZ   1  
ATOM 1485   H H    . LYS A 1 98  ? -4.266  -20.686 1.219   1.00 54.34 ? 98  LYS A H    1  
ATOM 1486   H HA   . LYS A 1 98  ? -3.091  -22.796 2.568   1.00 34.40 ? 98  LYS A HA   1  
ATOM 1487   H HB2  . LYS A 1 98  ? -2.243  -21.151 0.210   1.00 2.33  ? 98  LYS A HB2  1  
ATOM 1488   H HB3  . LYS A 1 98  ? -1.162  -22.379 0.855   1.00 12.00 ? 98  LYS A HB3  1  
ATOM 1489   H HG2  . LYS A 1 98  ? -3.445  -23.800 0.657   1.00 52.43 ? 98  LYS A HG2  1  
ATOM 1490   H HG3  . LYS A 1 98  ? -3.654  -22.663 -0.676  1.00 74.23 ? 98  LYS A HG3  1  
ATOM 1491   H HD2  . LYS A 1 98  ? -1.989  -23.583 -1.889  1.00 41.14 ? 98  LYS A HD2  1  
ATOM 1492   H HD3  . LYS A 1 98  ? -0.984  -23.884 -0.470  1.00 52.53 ? 98  LYS A HD3  1  
ATOM 1493   H HE2  . LYS A 1 98  ? -1.851  -25.954 -0.126  1.00 14.45 ? 98  LYS A HE2  1  
ATOM 1494   H HE3  . LYS A 1 98  ? -3.446  -25.504 -0.729  1.00 33.32 ? 98  LYS A HE3  1  
ATOM 1495   H HZ1  . LYS A 1 98  ? -2.895  -26.028 -2.844  1.00 43.15 ? 98  LYS A HZ1  1  
ATOM 1496   H HZ2  . LYS A 1 98  ? -1.806  -27.068 -2.073  1.00 62.44 ? 98  LYS A HZ2  1  
ATOM 1497   H HZ3  . LYS A 1 98  ? -1.272  -25.579 -2.671  1.00 2.21  ? 98  LYS A HZ3  1  
ATOM 1498   N N    . TRP A 1 99  ? -1.490  -19.954 2.977   1.00 21.25 ? 99  TRP A N    1  
ATOM 1499   C CA   . TRP A 1 99  ? -0.491  -19.274 3.795   1.00 22.43 ? 99  TRP A CA   1  
ATOM 1500   C C    . TRP A 1 99  ? -0.774  -19.477 5.280   1.00 43.42 ? 99  TRP A C    1  
ATOM 1501   O O    . TRP A 1 99  ? 0.075   -19.972 6.021   1.00 13.05 ? 99  TRP A O    1  
ATOM 1502   C CB   . TRP A 1 99  ? -0.464  -17.780 3.468   1.00 74.52 ? 99  TRP A CB   1  
ATOM 1503   C CG   . TRP A 1 99  ? 0.850   -17.130 3.776   1.00 21.14 ? 99  TRP A CG   1  
ATOM 1504   C CD1  . TRP A 1 99  ? 1.134   -16.314 4.833   1.00 13.33 ? 99  TRP A CD1  1  
ATOM 1505   C CD2  . TRP A 1 99  ? 2.060   -17.241 3.018   1.00 30.15 ? 99  TRP A CD2  1  
ATOM 1506   N NE1  . TRP A 1 99  ? 2.446   -15.910 4.779   1.00 13.22 ? 99  TRP A NE1  1  
ATOM 1507   C CE2  . TRP A 1 99  ? 3.036   -16.466 3.674   1.00 20.54 ? 99  TRP A CE2  1  
ATOM 1508   C CE3  . TRP A 1 99  ? 2.414   -17.920 1.848   1.00 34.33 ? 99  TRP A CE3  1  
ATOM 1509   C CZ2  . TRP A 1 99  ? 4.340   -16.353 3.199   1.00 32.15 ? 99  TRP A CZ2  1  
ATOM 1510   C CZ3  . TRP A 1 99  ? 3.709   -17.807 1.378   1.00 74.43 ? 99  TRP A CZ3  1  
ATOM 1511   C CH2  . TRP A 1 99  ? 4.658   -17.029 2.053   1.00 55.54 ? 99  TRP A CH2  1  
ATOM 1512   H H    . TRP A 1 99  ? -2.021  -19.431 2.341   1.00 62.12 ? 99  TRP A H    1  
ATOM 1513   H HA   . TRP A 1 99  ? 0.473   -19.702 3.563   1.00 4.42  ? 99  TRP A HA   1  
ATOM 1514   H HB2  . TRP A 1 99  ? -0.664  -17.645 2.416   1.00 14.44 ? 99  TRP A HB2  1  
ATOM 1515   H HB3  . TRP A 1 99  ? -1.228  -17.279 4.044   1.00 61.45 ? 99  TRP A HB3  1  
ATOM 1516   H HD1  . TRP A 1 99  ? 0.420   -16.034 5.593   1.00 55.34 ? 99  TRP A HD1  1  
ATOM 1517   H HE1  . TRP A 1 99  ? 2.888   -15.321 5.426   1.00 30.12 ? 99  TRP A HE1  1  
ATOM 1518   H HE3  . TRP A 1 99  ? 1.696   -18.525 1.315   1.00 53.24 ? 99  TRP A HE3  1  
ATOM 1519   H HZ2  . TRP A 1 99  ? 5.084   -15.758 3.707   1.00 22.44 ? 99  TRP A HZ2  1  
ATOM 1520   H HZ3  . TRP A 1 99  ? 4.000   -18.325 0.476   1.00 22.10 ? 99  TRP A HZ3  1  
ATOM 1521   H HH2  . TRP A 1 99  ? 5.658   -16.969 1.648   1.00 71.33 ? 99  TRP A HH2  1  
ATOM 1522   N N    . ILE A 1 100 ? -1.972  -19.089 5.709   1.00 51.33 ? 100 ILE A N    1  
ATOM 1523   C CA   . ILE A 1 100 ? -2.370  -19.225 7.108   1.00 3.20  ? 100 ILE A CA   1  
ATOM 1524   C C    . ILE A 1 100 ? -2.036  -20.616 7.644   1.00 24.21 ? 100 ILE A C    1  
ATOM 1525   O O    . ILE A 1 100 ? -1.572  -20.761 8.775   1.00 72.21 ? 100 ILE A O    1  
ATOM 1526   C CB   . ILE A 1 100 ? -3.879  -18.961 7.294   1.00 51.30 ? 100 ILE A CB   1  
ATOM 1527   C CG1  . ILE A 1 100 ? -4.262  -17.606 6.692   1.00 23.34 ? 100 ILE A CG1  1  
ATOM 1528   C CG2  . ILE A 1 100 ? -4.253  -19.013 8.770   1.00 25.22 ? 100 ILE A CG2  1  
ATOM 1529   C CD1  . ILE A 1 100 ? -5.525  -17.652 5.859   1.00 54.34 ? 100 ILE A CD1  1  
ATOM 1530   H H    . ILE A 1 100 ? -2.604  -18.698 5.069   1.00 15.44 ? 100 ILE A H    1  
ATOM 1531   H HA   . ILE A 1 100 ? -1.824  -18.490 7.681   1.00 75.15 ? 100 ILE A HA   1  
ATOM 1532   H HB   . ILE A 1 100 ? -4.423  -19.741 6.784   1.00 21.30 ? 100 ILE A HB   1  
ATOM 1533   H HG12 . ILE A 1 100 ? -4.419  -16.896 7.490   1.00 75.22 ? 100 ILE A HG12 1  
ATOM 1534   H HG13 . ILE A 1 100 ? -3.459  -17.258 6.060   1.00 23.23 ? 100 ILE A HG13 1  
ATOM 1535   H HG21 . ILE A 1 100 ? -3.461  -19.493 9.327   1.00 53.32 ? 100 ILE A HG21 1  
ATOM 1536   H HG22 . ILE A 1 100 ? -5.167  -19.575 8.890   1.00 1.42  ? 100 ILE A HG22 1  
ATOM 1537   H HG23 . ILE A 1 100 ? -4.396  -18.009 9.141   1.00 53.53 ? 100 ILE A HG23 1  
ATOM 1538   H HD11 . ILE A 1 100 ? -5.304  -17.331 4.852   1.00 2.32  ? 100 ILE A HD11 1  
ATOM 1539   H HD12 . ILE A 1 100 ? -6.266  -16.996 6.292   1.00 4.23  ? 100 ILE A HD12 1  
ATOM 1540   H HD13 . ILE A 1 100 ? -5.906  -18.662 5.839   1.00 72.15 ? 100 ILE A HD13 1  
ATOM 1541   N N    . ARG A 1 101 ? -2.271  -21.635 6.824   1.00 12.41 ? 101 ARG A N    1  
ATOM 1542   C CA   . ARG A 1 101 ? -1.991  -23.011 7.216   1.00 20.11 ? 101 ARG A CA   1  
ATOM 1543   C C    . ARG A 1 101 ? -0.487  -23.250 7.311   1.00 62.42 ? 101 ARG A C    1  
ATOM 1544   O O    . ARG A 1 101 ? 0.002   -23.816 8.289   1.00 2.51  ? 101 ARG A O    1  
ATOM 1545   C CB   . ARG A 1 101 ? -2.613  -23.986 6.216   1.00 41.45 ? 101 ARG A CB   1  
ATOM 1546   C CG   . ARG A 1 101 ? -3.173  -25.244 6.860   1.00 52.54 ? 101 ARG A CG   1  
ATOM 1547   C CD   . ARG A 1 101 ? -4.362  -24.930 7.754   1.00 62.01 ? 101 ARG A CD   1  
ATOM 1548   N NE   . ARG A 1 101 ? -5.230  -26.090 7.938   1.00 70.44 ? 101 ARG A NE   1  
ATOM 1549   C CZ   . ARG A 1 101 ? -6.488  -26.014 8.366   1.00 72.22 ? 101 ARG A CZ   1  
ATOM 1550   N NH1  . ARG A 1 101 ? -7.029  -24.836 8.654   1.00 64.13 ? 101 ARG A NH1  1  
ATOM 1551   N NH2  . ARG A 1 101 ? -7.209  -27.119 8.506   1.00 44.20 ? 101 ARG A NH2  1  
ATOM 1552   H H    . ARG A 1 101 ? -2.639  -21.457 5.933   1.00 71.04 ? 101 ARG A H    1  
ATOM 1553   H HA   . ARG A 1 101 ? -2.432  -23.175 8.188   1.00 22.43 ? 101 ARG A HA   1  
ATOM 1554   H HB2  . ARG A 1 101 ? -3.417  -23.486 5.695   1.00 13.20 ? 101 ARG A HB2  1  
ATOM 1555   H HB3  . ARG A 1 101 ? -1.860  -24.279 5.500   1.00 1.22  ? 101 ARG A HB3  1  
ATOM 1556   H HG2  . ARG A 1 101 ? -3.489  -25.924 6.084   1.00 42.24 ? 101 ARG A HG2  1  
ATOM 1557   H HG3  . ARG A 1 101 ? -2.399  -25.707 7.455   1.00 22.15 ? 101 ARG A HG3  1  
ATOM 1558   H HD2  . ARG A 1 101 ? -3.997  -24.609 8.718   1.00 44.32 ? 101 ARG A HD2  1  
ATOM 1559   H HD3  . ARG A 1 101 ? -4.934  -24.132 7.303   1.00 11.41 ? 101 ARG A HD3  1  
ATOM 1560   H HE   . ARG A 1 101 ? -4.856  -26.972 7.733   1.00 40.43 ? 101 ARG A HE   1  
ATOM 1561   H HH11 . ARG A 1 101 ? -6.492  -24.000 8.550   1.00 23.23 ? 101 ARG A HH11 1  
ATOM 1562   H HH12 . ARG A 1 101 ? -7.975  -24.786 8.974   1.00 71.02 ? 101 ARG A HH12 1  
ATOM 1563   H HH21 . ARG A 1 101 ? -6.806  -28.008 8.290   1.00 45.54 ? 101 ARG A HH21 1  
ATOM 1564   H HH22 . ARG A 1 101 ? -8.154  -27.062 8.827   1.00 22.45 ? 101 ARG A HH22 1  
ATOM 1565   N N    . THR A 1 102 ? 0.241   -22.810 6.289   1.00 14.00 ? 102 THR A N    1  
ATOM 1566   C CA   . THR A 1 102 ? 1.691   -22.972 6.255   1.00 64.53 ? 102 THR A CA   1  
ATOM 1567   C C    . THR A 1 102 ? 2.389   -21.954 7.158   1.00 1.22  ? 102 THR A C    1  
ATOM 1568   O O    . THR A 1 102 ? 3.614   -21.965 7.284   1.00 25.23 ? 102 THR A O    1  
ATOM 1569   C CB   . THR A 1 102 ? 2.204   -22.831 4.821   1.00 64.02 ? 102 THR A CB   1  
ATOM 1570   O OG1  . THR A 1 102 ? 1.281   -23.386 3.901   1.00 1.24  ? 102 THR A OG1  1  
ATOM 1571   C CG2  . THR A 1 102 ? 3.540   -23.505 4.594   1.00 53.22 ? 102 THR A CG2  1  
ATOM 1572   H H    . THR A 1 102 ? -0.207  -22.363 5.540   1.00 71.24 ? 102 THR A H    1  
ATOM 1573   H HA   . THR A 1 102 ? 1.920   -23.965 6.611   1.00 32.43 ? 102 THR A HA   1  
ATOM 1574   H HB   . THR A 1 102 ? 2.321   -21.781 4.593   1.00 24.03 ? 102 THR A HB   1  
ATOM 1575   H HG1  . THR A 1 102 ? 1.107   -24.301 4.134   1.00 23.32 ? 102 THR A HG1  1  
ATOM 1576   H HG21 . THR A 1 102 ? 3.391   -24.567 4.467   1.00 34.22 ? 102 THR A HG21 1  
ATOM 1577   H HG22 . THR A 1 102 ? 4.180   -23.331 5.447   1.00 33.05 ? 102 THR A HG22 1  
ATOM 1578   H HG23 . THR A 1 102 ? 4.003   -23.098 3.708   1.00 1.44  ? 102 THR A HG23 1  
ATOM 1579   N N    . ARG A 1 103 ? 1.609   -21.080 7.790   1.00 53.05 ? 103 ARG A N    1  
ATOM 1580   C CA   . ARG A 1 103 ? 2.162   -20.069 8.684   1.00 21.53 ? 103 ARG A CA   1  
ATOM 1581   C C    . ARG A 1 103 ? 1.723   -20.309 10.128  1.00 60.13 ? 103 ARG A C    1  
ATOM 1582   O O    . ARG A 1 103 ? 2.245   -19.688 11.054  1.00 4.23  ? 103 ARG A O    1  
ATOM 1583   C CB   . ARG A 1 103 ? 1.729   -18.672 8.234   1.00 0.53  ? 103 ARG A CB   1  
ATOM 1584   C CG   . ARG A 1 103 ? 2.780   -17.601 8.480   1.00 73.22 ? 103 ARG A CG   1  
ATOM 1585   C CD   . ARG A 1 103 ? 3.839   -17.600 7.389   1.00 34.32 ? 103 ARG A CD   1  
ATOM 1586   N NE   . ARG A 1 103 ? 4.836   -18.648 7.592   1.00 54.13 ? 103 ARG A NE   1  
ATOM 1587   C CZ   . ARG A 1 103 ? 5.648   -19.094 6.636   1.00 52.42 ? 103 ARG A CZ   1  
ATOM 1588   N NH1  . ARG A 1 103 ? 5.584   -18.587 5.411   1.00 50.31 ? 103 ARG A NH1  1  
ATOM 1589   N NH2  . ARG A 1 103 ? 6.526   -20.050 6.905   1.00 33.15 ? 103 ARG A NH2  1  
ATOM 1590   H H    . ARG A 1 103 ? 0.640   -21.121 7.661   1.00 4.50  ? 103 ARG A H    1  
ATOM 1591   H HA   . ARG A 1 103 ? 3.238   -20.135 8.632   1.00 42.13 ? 103 ARG A HA   1  
ATOM 1592   H HB2  . ARG A 1 103 ? 1.513   -18.697 7.177   1.00 43.31 ? 103 ARG A HB2  1  
ATOM 1593   H HB3  . ARG A 1 103 ? 0.833   -18.395 8.770   1.00 74.13 ? 103 ARG A HB3  1  
ATOM 1594   H HG2  . ARG A 1 103 ? 2.298   -16.635 8.501   1.00 44.53 ? 103 ARG A HG2  1  
ATOM 1595   H HG3  . ARG A 1 103 ? 3.256   -17.790 9.431   1.00 41.42 ? 103 ARG A HG3  1  
ATOM 1596   H HD2  . ARG A 1 103 ? 3.356   -17.756 6.436   1.00 64.30 ? 103 ARG A HD2  1  
ATOM 1597   H HD3  . ARG A 1 103 ? 4.334   -16.640 7.387   1.00 40.13 ? 103 ARG A HD3  1  
ATOM 1598   H HE   . ARG A 1 103 ? 4.905   -19.040 8.487   1.00 43.22 ? 103 ARG A HE   1  
ATOM 1599   H HH11 . ARG A 1 103 ? 4.924   -17.865 5.201   1.00 73.31 ? 103 ARG A HH11 1  
ATOM 1600   H HH12 . ARG A 1 103 ? 6.196   -18.926 4.697   1.00 11.13 ? 103 ARG A HH12 1  
ATOM 1601   H HH21 . ARG A 1 103 ? 6.579   -20.436 7.826   1.00 13.31 ? 103 ARG A HH21 1  
ATOM 1602   H HH22 . ARG A 1 103 ? 7.136   -20.386 6.187   1.00 11.32 ? 103 ARG A HH22 1  
ATOM 1603   N N    . LYS A 1 104 ? 0.761   -21.211 10.315  1.00 71.04 ? 104 LYS A N    1  
ATOM 1604   C CA   . LYS A 1 104 ? 0.258   -21.524 11.648  1.00 51.32 ? 104 LYS A CA   1  
ATOM 1605   C C    . LYS A 1 104 ? -0.341  -20.284 12.306  1.00 73.44 ? 104 LYS A C    1  
ATOM 1606   O O    . LYS A 1 104 ? -0.186  -20.070 13.508  1.00 71.43 ? 104 LYS A O    1  
ATOM 1607   C CB   . LYS A 1 104 ? 1.381   -22.087 12.520  1.00 64.43 ? 104 LYS A CB   1  
ATOM 1608   C CG   . LYS A 1 104 ? 0.923   -23.185 13.467  1.00 5.34  ? 104 LYS A CG   1  
ATOM 1609   C CD   . LYS A 1 104 ? 1.830   -23.286 14.682  1.00 5.14  ? 104 LYS A CD   1  
ATOM 1610   C CE   . LYS A 1 104 ? 1.927   -24.717 15.188  1.00 21.44 ? 104 LYS A CE   1  
ATOM 1611   N NZ   . LYS A 1 104 ? 1.979   -24.778 16.675  1.00 33.33 ? 104 LYS A NZ   1  
ATOM 1612   H H    . LYS A 1 104 ? 0.379   -21.672 9.540   1.00 33.14 ? 104 LYS A H    1  
ATOM 1613   H HA   . LYS A 1 104 ? -0.515  -22.271 11.543  1.00 54.24 ? 104 LYS A HA   1  
ATOM 1614   H HB2  . LYS A 1 104 ? 2.150   -22.492 11.880  1.00 11.43 ? 104 LYS A HB2  1  
ATOM 1615   H HB3  . LYS A 1 104 ? 1.801   -21.285 13.110  1.00 12.45 ? 104 LYS A HB3  1  
ATOM 1616   H HG2  . LYS A 1 104 ? -0.081  -22.966 13.797  1.00 41.35 ? 104 LYS A HG2  1  
ATOM 1617   H HG3  . LYS A 1 104 ? 0.934   -24.128 12.941  1.00 24.15 ? 104 LYS A HG3  1  
ATOM 1618   H HD2  . LYS A 1 104 ? 2.818   -22.944 14.412  1.00 55.22 ? 104 LYS A HD2  1  
ATOM 1619   H HD3  . LYS A 1 104 ? 1.433   -22.662 15.469  1.00 15.11 ? 104 LYS A HD3  1  
ATOM 1620   H HE2  . LYS A 1 104 ? 1.063   -25.265 14.845  1.00 64.23 ? 104 LYS A HE2  1  
ATOM 1621   H HE3  . LYS A 1 104 ? 2.822   -25.168 14.785  1.00 42.05 ? 104 LYS A HE3  1  
ATOM 1622   H HZ1  . LYS A 1 104 ? 1.914   -25.766 16.994  1.00 33.31 ? 104 LYS A HZ1  1  
ATOM 1623   H HZ2  . LYS A 1 104 ? 1.189   -24.241 17.083  1.00 62.32 ? 104 LYS A HZ2  1  
ATOM 1624   H HZ3  . LYS A 1 104 ? 2.873   -24.372 17.018  1.00 33.42 ? 104 LYS A HZ3  1  
ATOM 1625   N N    . LEU A 1 105 ? -1.027  -19.471 11.508  1.00 61.01 ? 105 LEU A N    1  
ATOM 1626   C CA   . LEU A 1 105 ? -1.650  -18.252 12.012  1.00 22.42 ? 105 LEU A CA   1  
ATOM 1627   C C    . LEU A 1 105 ? -3.171  -18.357 11.962  1.00 21.05 ? 105 LEU A C    1  
ATOM 1628   O O    . LEU A 1 105 ? -3.720  -19.378 11.549  1.00 43.44 ? 105 LEU A O    1  
ATOM 1629   C CB   . LEU A 1 105 ? -1.184  -17.043 11.198  1.00 22.54 ? 105 LEU A CB   1  
ATOM 1630   C CG   . LEU A 1 105 ? 0.159   -16.451 11.630  1.00 31.13 ? 105 LEU A CG   1  
ATOM 1631   C CD1  . LEU A 1 105 ? 0.881   -15.840 10.439  1.00 52.31 ? 105 LEU A CD1  1  
ATOM 1632   C CD2  . LEU A 1 105 ? -0.044  -15.413 12.723  1.00 45.01 ? 105 LEU A CD2  1  
ATOM 1633   H H    . LEU A 1 105 ? -1.116  -19.696 10.559  1.00 41.24 ? 105 LEU A H    1  
ATOM 1634   H HA   . LEU A 1 105 ? -1.344  -18.123 13.039  1.00 71.44 ? 105 LEU A HA   1  
ATOM 1635   H HB2  . LEU A 1 105 ? -1.106  -17.341 10.163  1.00 41.24 ? 105 LEU A HB2  1  
ATOM 1636   H HB3  . LEU A 1 105 ? -1.934  -16.271 11.278  1.00 13.40 ? 105 LEU A HB3  1  
ATOM 1637   H HG   . LEU A 1 105 ? 0.781   -17.240 12.028  1.00 52.45 ? 105 LEU A HG   1  
ATOM 1638   H HD11 . LEU A 1 105 ? 1.946   -15.970 10.558  1.00 23.21 ? 105 LEU A HD11 1  
ATOM 1639   H HD12 . LEU A 1 105 ? 0.651   -14.786 10.381  1.00 24.31 ? 105 LEU A HD12 1  
ATOM 1640   H HD13 . LEU A 1 105 ? 0.557   -16.329 9.532   1.00 71.53 ? 105 LEU A HD13 1  
ATOM 1641   H HD21 . LEU A 1 105 ? 0.801   -15.426 13.394  1.00 3.21  ? 105 LEU A HD21 1  
ATOM 1642   H HD22 . LEU A 1 105 ? -0.945  -15.641 13.274  1.00 25.01 ? 105 LEU A HD22 1  
ATOM 1643   H HD23 . LEU A 1 105 ? -0.134  -14.433 12.277  1.00 73.31 ? 105 LEU A HD23 1  
ATOM 1644   N N    . LYS A 1 106 ? -3.846  -17.294 12.387  1.00 34.11 ? 106 LYS A N    1  
ATOM 1645   C CA   . LYS A 1 106 ? -5.304  -17.266 12.393  1.00 15.40 ? 106 LYS A CA   1  
ATOM 1646   C C    . LYS A 1 106 ? -5.851  -16.895 11.017  1.00 73.23 ? 106 LYS A C    1  
ATOM 1647   O O    . LYS A 1 106 ? -6.318  -17.757 10.272  1.00 60.54 ? 106 LYS A O    1  
ATOM 1648   C CB   . LYS A 1 106 ? -5.812  -16.275 13.442  1.00 2.12  ? 106 LYS A CB   1  
ATOM 1649   C CG   . LYS A 1 106 ? -5.955  -16.877 14.830  1.00 21.12 ? 106 LYS A CG   1  
ATOM 1650   C CD   . LYS A 1 106 ? -4.600  -17.144 15.464  1.00 42.45 ? 106 LYS A CD   1  
ATOM 1651   C CE   . LYS A 1 106 ? -4.737  -17.898 16.777  1.00 4.12  ? 106 LYS A CE   1  
ATOM 1652   N NZ   . LYS A 1 106 ? -4.678  -16.984 17.951  1.00 34.12 ? 106 LYS A NZ   1  
ATOM 1653   H H    . LYS A 1 106 ? -3.352  -16.510 12.707  1.00 25.10 ? 106 LYS A H    1  
ATOM 1654   H HA   . LYS A 1 106 ? -5.652  -18.256 12.649  1.00 20.20 ? 106 LYS A HA   1  
ATOM 1655   H HB2  . LYS A 1 106 ? -5.121  -15.447 13.502  1.00 71.40 ? 106 LYS A HB2  1  
ATOM 1656   H HB3  . LYS A 1 106 ? -6.778  -15.904 13.132  1.00 60.51 ? 106 LYS A HB3  1  
ATOM 1657   H HG2  . LYS A 1 106 ? -6.505  -16.190 15.455  1.00 12.01 ? 106 LYS A HG2  1  
ATOM 1658   H HG3  . LYS A 1 106 ? -6.496  -17.809 14.753  1.00 45.33 ? 106 LYS A HG3  1  
ATOM 1659   H HD2  . LYS A 1 106 ? -4.004  -17.733 14.783  1.00 44.10 ? 106 LYS A HD2  1  
ATOM 1660   H HD3  . LYS A 1 106 ? -4.109  -16.199 15.651  1.00 33.40 ? 106 LYS A HD3  1  
ATOM 1661   H HE2  . LYS A 1 106 ? -5.685  -18.415 16.782  1.00 50.02 ? 106 LYS A HE2  1  
ATOM 1662   H HE3  . LYS A 1 106 ? -3.935  -18.617 16.849  1.00 74.41 ? 106 LYS A HE3  1  
ATOM 1663   H HZ1  . LYS A 1 106 ? -4.388  -17.512 18.800  1.00 14.42 ? 106 LYS A HZ1  1  
ATOM 1664   H HZ2  . LYS A 1 106 ? -5.612  -16.560 18.122  1.00 61.50 ? 106 LYS A HZ2  1  
ATOM 1665   H HZ3  . LYS A 1 106 ? -3.991  -16.223 17.777  1.00 72.42 ? 106 LYS A HZ3  1  
ATOM 1666   N N    . TYR A 1 107 ? -5.792  -15.609 10.688  1.00 21.25 ? 107 TYR A N    1  
ATOM 1667   C CA   . TYR A 1 107 ? -6.284  -15.126 9.402   1.00 63.33 ? 107 TYR A CA   1  
ATOM 1668   C C    . TYR A 1 107 ? -5.256  -14.226 8.725   1.00 34.40 ? 107 TYR A C    1  
ATOM 1669   O O    . TYR A 1 107 ? -4.308  -13.762 9.359   1.00 0.00  ? 107 TYR A O    1  
ATOM 1670   C CB   . TYR A 1 107 ? -7.599  -14.366 9.588   1.00 12.35 ? 107 TYR A CB   1  
ATOM 1671   C CG   . TYR A 1 107 ? -7.585  -13.407 10.758  1.00 5.41  ? 107 TYR A CG   1  
ATOM 1672   C CD1  . TYR A 1 107 ? -6.696  -12.340 10.796  1.00 13.33 ? 107 TYR A CD1  1  
ATOM 1673   C CD2  . TYR A 1 107 ? -8.460  -13.570 11.825  1.00 72.21 ? 107 TYR A CD2  1  
ATOM 1674   C CE1  . TYR A 1 107 ? -6.680  -11.462 11.863  1.00 22.22 ? 107 TYR A CE1  1  
ATOM 1675   C CE2  . TYR A 1 107 ? -8.450  -12.696 12.895  1.00 34.43 ? 107 TYR A CE2  1  
ATOM 1676   C CZ   . TYR A 1 107 ? -7.559  -11.645 12.910  1.00 61.14 ? 107 TYR A CZ   1  
ATOM 1677   O OH   . TYR A 1 107 ? -7.546  -10.773 13.974  1.00 44.45 ? 107 TYR A OH   1  
ATOM 1678   H H    . TYR A 1 107 ? -5.410  -14.969 11.325  1.00 32.32 ? 107 TYR A H    1  
ATOM 1679   H HA   . TYR A 1 107 ? -6.462  -15.985 8.772   1.00 21.44 ? 107 TYR A HA   1  
ATOM 1680   H HB2  . TYR A 1 107 ? -7.807  -13.796 8.696   1.00 55.55 ? 107 TYR A HB2  1  
ATOM 1681   H HB3  . TYR A 1 107 ? -8.397  -15.076 9.750   1.00 73.50 ? 107 TYR A HB3  1  
ATOM 1682   H HD1  . TYR A 1 107 ? -6.010  -12.199 9.974   1.00 1.44  ? 107 TYR A HD1  1  
ATOM 1683   H HD2  . TYR A 1 107 ? -9.157  -14.395 11.811  1.00 44.43 ? 107 TYR A HD2  1  
ATOM 1684   H HE1  . TYR A 1 107 ? -5.982  -10.639 11.874  1.00 2.44  ? 107 TYR A HE1  1  
ATOM 1685   H HE2  . TYR A 1 107 ? -9.139  -12.840 13.715  1.00 54.32 ? 107 TYR A HE2  1  
ATOM 1686   H HH   . TYR A 1 107 ? -6.639  -10.551 14.195  1.00 34.20 ? 107 TYR A HH   1  
ATOM 1687   N N    . LEU A 1 108 ? -5.450  -13.985 7.432   1.00 72.34 ? 108 LEU A N    1  
ATOM 1688   C CA   . LEU A 1 108 ? -4.540  -13.140 6.665   1.00 44.45 ? 108 LEU A CA   1  
ATOM 1689   C C    . LEU A 1 108 ? -5.177  -11.788 6.360   1.00 52.25 ? 108 LEU A C    1  
ATOM 1690   O O    . LEU A 1 108 ? -6.307  -11.717 5.876   1.00 12.21 ? 108 LEU A O    1  
ATOM 1691   C CB   . LEU A 1 108 ? -4.142  -13.836 5.362   1.00 64.44 ? 108 LEU A CB   1  
ATOM 1692   C CG   . LEU A 1 108 ? -2.718  -13.549 4.884   1.00 23.24 ? 108 LEU A CG   1  
ATOM 1693   C CD1  . LEU A 1 108 ? -1.707  -14.295 5.740   1.00 2.01  ? 108 LEU A CD1  1  
ATOM 1694   C CD2  . LEU A 1 108 ? -2.563  -13.929 3.419   1.00 14.23 ? 108 LEU A CD2  1  
ATOM 1695   H H    . LEU A 1 108 ? -6.224  -14.385 6.983   1.00 64.20 ? 108 LEU A H    1  
ATOM 1696   H HA   . LEU A 1 108 ? -3.655  -12.981 7.262   1.00 62.42 ? 108 LEU A HA   1  
ATOM 1697   H HB2  . LEU A 1 108 ? -4.246  -14.902 5.502   1.00 30.43 ? 108 LEU A HB2  1  
ATOM 1698   H HB3  . LEU A 1 108 ? -4.827  -13.523 4.588   1.00 63.04 ? 108 LEU A HB3  1  
ATOM 1699   H HG   . LEU A 1 108 ? -2.520  -12.491 4.979   1.00 61.31 ? 108 LEU A HG   1  
ATOM 1700   H HD11 . LEU A 1 108 ? -1.761  -13.935 6.757   1.00 74.53 ? 108 LEU A HD11 1  
ATOM 1701   H HD12 . LEU A 1 108 ? -0.713  -14.128 5.352   1.00 51.35 ? 108 LEU A HD12 1  
ATOM 1702   H HD13 . LEU A 1 108 ? -1.929  -15.352 5.720   1.00 54.42 ? 108 LEU A HD13 1  
ATOM 1703   H HD21 . LEU A 1 108 ? -1.624  -13.548 3.046   1.00 52.53 ? 108 LEU A HD21 1  
ATOM 1704   H HD22 . LEU A 1 108 ? -3.376  -13.505 2.848   1.00 13.44 ? 108 LEU A HD22 1  
ATOM 1705   H HD23 . LEU A 1 108 ? -2.578  -15.005 3.322   1.00 3.34  ? 108 LEU A HD23 1  
ATOM 1706   N N    . GLY A 1 109 ? -4.447  -10.716 6.656   1.00 73.11 ? 109 GLY A N    1  
ATOM 1707   C CA   . GLY A 1 109 ? -4.956  -9.376  6.418   1.00 2.54  ? 109 GLY A CA   1  
ATOM 1708   C C    . GLY A 1 109 ? -4.957  -8.975  4.950   1.00 71.04 ? 109 GLY A C    1  
ATOM 1709   O O    . GLY A 1 109 ? -5.220  -7.817  4.625   1.00 61.43 ? 109 GLY A O    1  
ATOM 1710   H H    . GLY A 1 109 ? -3.559  -10.835 7.053   1.00 72.32 ? 109 GLY A H    1  
ATOM 1711   H HA2  . GLY A 1 109 ? -5.968  -9.321  6.790   1.00 23.52 ? 109 GLY A HA2  1  
ATOM 1712   H HA3  . GLY A 1 109 ? -4.347  -8.674  6.968   1.00 22.52 ? 109 GLY A HA3  1  
ATOM 1713   N N    . VAL A 1 110 ? -4.673  -9.921  4.058   1.00 11.03 ? 110 VAL A N    1  
ATOM 1714   C CA   . VAL A 1 110 ? -4.657  -9.634  2.629   1.00 32.14 ? 110 VAL A CA   1  
ATOM 1715   C C    . VAL A 1 110 ? -6.070  -9.703  2.049   1.00 12.22 ? 110 VAL A C    1  
ATOM 1716   O O    . VAL A 1 110 ? -6.835  -10.611 2.372   1.00 51.14 ? 110 VAL A O    1  
ATOM 1717   C CB   . VAL A 1 110 ? -3.745  -10.616 1.867   1.00 44.11 ? 110 VAL A CB   1  
ATOM 1718   C CG1  . VAL A 1 110 ? -3.707  -10.278 0.383   1.00 14.23 ? 110 VAL A CG1  1  
ATOM 1719   C CG2  . VAL A 1 110 ? -2.343  -10.606 2.456   1.00 74.51 ? 110 VAL A CG2  1  
ATOM 1720   H H    . VAL A 1 110 ? -4.476  -10.828 4.364   1.00 70.45 ? 110 VAL A H    1  
ATOM 1721   H HA   . VAL A 1 110 ? -4.269  -8.634  2.495   1.00 64.25 ? 110 VAL A HA   1  
ATOM 1722   H HB   . VAL A 1 110 ? -4.151  -11.611 1.976   1.00 42.31 ? 110 VAL A HB   1  
ATOM 1723   H HG11 . VAL A 1 110 ? -4.715  -10.186 0.009   1.00 44.14 ? 110 VAL A HG11 1  
ATOM 1724   H HG12 . VAL A 1 110 ? -3.194  -11.063 -0.152  1.00 22.43 ? 110 VAL A HG12 1  
ATOM 1725   H HG13 . VAL A 1 110 ? -3.183  -9.344  0.241   1.00 32.54 ? 110 VAL A HG13 1  
ATOM 1726   H HG21 . VAL A 1 110 ? -1.752  -9.845  1.968   1.00 71.12 ? 110 VAL A HG21 1  
ATOM 1727   H HG22 . VAL A 1 110 ? -1.882  -11.571 2.305   1.00 31.14 ? 110 VAL A HG22 1  
ATOM 1728   H HG23 . VAL A 1 110 ? -2.398  -10.395 3.514   1.00 22.04 ? 110 VAL A HG23 1  
ATOM 1729   N N    . PRO A 1 111 ? -6.438  -8.742  1.182   1.00 13.51 ? 111 PRO A N    1  
ATOM 1730   C CA   . PRO A 1 111 ? -7.769  -8.705  0.563   1.00 5.14  ? 111 PRO A CA   1  
ATOM 1731   C C    . PRO A 1 111 ? -8.043  -9.939  -0.290  1.00 53.43 ? 111 PRO A C    1  
ATOM 1732   O O    . PRO A 1 111 ? -7.133  -10.496 -0.903  1.00 11.41 ? 111 PRO A O    1  
ATOM 1733   C CB   . PRO A 1 111 ? -7.732  -7.446  -0.312  1.00 12.24 ? 111 PRO A CB   1  
ATOM 1734   C CG   . PRO A 1 111 ? -6.284  -7.154  -0.512  1.00 50.05 ? 111 PRO A CG   1  
ATOM 1735   C CD   . PRO A 1 111 ? -5.595  -7.619  0.737   1.00 41.02 ? 111 PRO A CD   1  
ATOM 1736   H HA   . PRO A 1 111 ? -8.545  -8.606  1.307   1.00 1.11  ? 111 PRO A HA   1  
ATOM 1737   H HB2  . PRO A 1 111 ? -8.228  -7.644  -1.251  1.00 0.21  ? 111 PRO A HB2  1  
ATOM 1738   H HB3  . PRO A 1 111 ? -8.230  -6.636  0.199   1.00 72.13 ? 111 PRO A HB3  1  
ATOM 1739   H HG2  . PRO A 1 111 ? -5.915  -7.697  -1.370  1.00 13.54 ? 111 PRO A HG2  1  
ATOM 1740   H HG3  . PRO A 1 111 ? -6.139  -6.092  -0.647  1.00 4.55  ? 111 PRO A HG3  1  
ATOM 1741   H HD2  . PRO A 1 111 ? -4.592  -7.953  0.514   1.00 31.13 ? 111 PRO A HD2  1  
ATOM 1742   H HD3  . PRO A 1 111 ? -5.578  -6.832  1.477   1.00 2.11  ? 111 PRO A HD3  1  
ATOM 1743   N N    . LYS A 1 112 ? -9.303  -10.362 -0.323  1.00 23.45 ? 112 LYS A N    1  
ATOM 1744   C CA   . LYS A 1 112 ? -9.696  -11.531 -1.100  1.00 22.12 ? 112 LYS A CA   1  
ATOM 1745   C C    . LYS A 1 112 ? -10.243 -11.120 -2.462  1.00 12.04 ? 112 LYS A C    1  
ATOM 1746   O O    . LYS A 1 112 ? -10.863 -10.065 -2.601  1.00 25.43 ? 112 LYS A O    1  
ATOM 1747   C CB   . LYS A 1 112 ? -10.745 -12.345 -0.341  1.00 51.12 ? 112 LYS A CB   1  
ATOM 1748   C CG   . LYS A 1 112 ? -10.261 -12.855 1.007   1.00 45.41 ? 112 LYS A CG   1  
ATOM 1749   C CD   . LYS A 1 112 ? -11.057 -14.068 1.462   1.00 74.31 ? 112 LYS A CD   1  
ATOM 1750   C CE   . LYS A 1 112 ? -10.245 -14.947 2.399   1.00 75.03 ? 112 LYS A CE   1  
ATOM 1751   N NZ   . LYS A 1 112 ? -10.990 -16.174 2.794   1.00 25.52 ? 112 LYS A NZ   1  
ATOM 1752   H H    . LYS A 1 112 ? -9.985  -9.877  0.188   1.00 30.30 ? 112 LYS A H    1  
ATOM 1753   H HA   . LYS A 1 112 ? -8.817  -12.141 -1.247  1.00 73.14 ? 112 LYS A HA   1  
ATOM 1754   H HB2  . LYS A 1 112 ? -11.614 -11.726 -0.175  1.00 23.32 ? 112 LYS A HB2  1  
ATOM 1755   H HB3  . LYS A 1 112 ? -11.029 -13.196 -0.943  1.00 4.33  ? 112 LYS A HB3  1  
ATOM 1756   H HG2  . LYS A 1 112 ? -9.220  -13.132 0.923   1.00 42.23 ? 112 LYS A HG2  1  
ATOM 1757   H HG3  . LYS A 1 112 ? -10.369 -12.068 1.739   1.00 13.30 ? 112 LYS A HG3  1  
ATOM 1758   H HD2  . LYS A 1 112 ? -11.943 -13.731 1.979   1.00 23.51 ? 112 LYS A HD2  1  
ATOM 1759   H HD3  . LYS A 1 112 ? -11.341 -14.646 0.595   1.00 24.13 ? 112 LYS A HD3  1  
ATOM 1760   H HE2  . LYS A 1 112 ? -9.332  -15.237 1.899   1.00 33.44 ? 112 LYS A HE2  1  
ATOM 1761   H HE3  . LYS A 1 112 ? -10.004 -14.380 3.286   1.00 21.34 ? 112 LYS A HE3  1  
ATOM 1762   H HZ1  . LYS A 1 112 ? -11.493 -16.014 3.691   1.00 74.33 ? 112 LYS A HZ1  1  
ATOM 1763   H HZ2  . LYS A 1 112 ? -10.331 -16.969 2.918   1.00 74.23 ? 112 LYS A HZ2  1  
ATOM 1764   H HZ3  . LYS A 1 112 ? -11.683 -16.424 2.060   1.00 60.31 ? 112 LYS A HZ3  1  
ATOM 1765   N N    . TYR A 1 113 ? -10.009 -11.959 -3.465  1.00 62.04 ? 113 TYR A N    1  
ATOM 1766   C CA   . TYR A 1 113 ? -10.479 -11.684 -4.817  1.00 3.53  ? 113 TYR A CA   1  
ATOM 1767   C C    . TYR A 1 113 ? -11.804 -12.391 -5.085  1.00 53.21 ? 113 TYR A C    1  
ATOM 1768   O O    . TYR A 1 113 ? -12.036 -13.500 -4.603  1.00 63.33 ? 113 TYR A O    1  
ATOM 1769   C CB   . TYR A 1 113 ? -9.432  -12.127 -5.842  1.00 64.43 ? 113 TYR A CB   1  
ATOM 1770   C CG   . TYR A 1 113 ? -9.860  -11.922 -7.278  1.00 5.05  ? 113 TYR A CG   1  
ATOM 1771   C CD1  . TYR A 1 113 ? -9.869  -10.655 -7.847  1.00 24.03 ? 113 TYR A CD1  1  
ATOM 1772   C CD2  . TYR A 1 113 ? -10.255 -12.997 -8.065  1.00 34.41 ? 113 TYR A CD2  1  
ATOM 1773   C CE1  . TYR A 1 113 ? -10.260 -10.465 -9.159  1.00 51.51 ? 113 TYR A CE1  1  
ATOM 1774   C CE2  . TYR A 1 113 ? -10.646 -12.815 -9.377  1.00 13.21 ? 113 TYR A CE2  1  
ATOM 1775   C CZ   . TYR A 1 113 ? -10.647 -11.548 -9.919  1.00 12.22 ? 113 TYR A CZ   1  
ATOM 1776   O OH   . TYR A 1 113 ? -11.036 -11.362 -11.226 1.00 11.43 ? 113 TYR A OH   1  
ATOM 1777   H H    . TYR A 1 113 ? -9.509  -12.784 -3.291  1.00 12.22 ? 113 TYR A H    1  
ATOM 1778   H HA   . TYR A 1 113 ? -10.629 -10.618 -4.906  1.00 43.44 ? 113 TYR A HA   1  
ATOM 1779   H HB2  . TYR A 1 113 ? -8.524  -11.564 -5.684  1.00 5.34  ? 113 TYR A HB2  1  
ATOM 1780   H HB3  . TYR A 1 113 ? -9.226  -13.178 -5.703  1.00 32.32 ? 113 TYR A HB3  1  
ATOM 1781   H HD1  . TYR A 1 113 ? -9.566  -9.809  -7.249  1.00 21.44 ? 113 TYR A HD1  1  
ATOM 1782   H HD2  . TYR A 1 113 ? -10.253 -13.989 -7.637  1.00 73.14 ? 113 TYR A HD2  1  
ATOM 1783   H HE1  . TYR A 1 113 ? -10.260 -9.472  -9.583  1.00 61.34 ? 113 TYR A HE1  1  
ATOM 1784   H HE2  . TYR A 1 113 ? -10.949 -13.664 -9.973  1.00 32.44 ? 113 TYR A HE2  1  
ATOM 1785   H HH   . TYR A 1 113 ? -10.472 -10.703 -11.638 1.00 21.01 ? 113 TYR A HH   1  
ATOM 1786   N N    . TRP A 1 114 ? -12.667 -11.745 -5.862  1.00 71.33 ? 114 TRP A N    1  
ATOM 1787   C CA   . TRP A 1 114 ? -13.966 -12.318 -6.197  1.00 23.23 ? 114 TRP A CA   1  
ATOM 1788   C C    . TRP A 1 114 ? -14.063 -12.609 -7.692  1.00 44.30 ? 114 TRP A C    1  
ATOM 1789   O O    . TRP A 1 114 ? -14.209 -13.760 -8.101  1.00 41.14 ? 114 TRP A O    1  
ATOM 1790   C CB   . TRP A 1 114 ? -15.090 -11.376 -5.769  1.00 4.23  ? 114 TRP A CB   1  
ATOM 1791   C CG   . TRP A 1 114 ? -15.092 -11.084 -4.300  1.00 23.31 ? 114 TRP A CG   1  
ATOM 1792   C CD1  . TRP A 1 114 ? -14.682 -9.932  -3.696  1.00 61.32 ? 114 TRP A CD1  1  
ATOM 1793   C CD2  . TRP A 1 114 ? -15.523 -11.958 -3.250  1.00 43.45 ? 114 TRP A CD2  1  
ATOM 1794   N NE1  . TRP A 1 114 ? -14.830 -10.034 -2.335  1.00 63.33 ? 114 TRP A NE1  1  
ATOM 1795   C CE2  . TRP A 1 114 ? -15.345 -11.268 -2.035  1.00 31.32 ? 114 TRP A CE2  1  
ATOM 1796   C CE3  . TRP A 1 114 ? -16.042 -13.255 -3.218  1.00 74.43 ? 114 TRP A CE3  1  
ATOM 1797   C CZ2  . TRP A 1 114 ? -15.668 -11.833 -0.804  1.00 23.13 ? 114 TRP A CZ2  1  
ATOM 1798   C CZ3  . TRP A 1 114 ? -16.362 -13.815 -1.995  1.00 12.32 ? 114 TRP A CZ3  1  
ATOM 1799   C CH2  . TRP A 1 114 ? -16.174 -13.104 -0.803  1.00 42.43 ? 114 TRP A CH2  1  
ATOM 1800   H H    . TRP A 1 114 ? -12.418 -10.864 -6.220  1.00 22.42 ? 114 TRP A H    1  
ATOM 1801   H HA   . TRP A 1 114 ? -14.064 -13.248 -5.657  1.00 64.30 ? 114 TRP A HA   1  
ATOM 1802   H HB2  . TRP A 1 114 ? -14.982 -10.440 -6.292  1.00 53.25 ? 114 TRP A HB2  1  
ATOM 1803   H HB3  . TRP A 1 114 ? -16.041 -11.820 -6.024  1.00 42.10 ? 114 TRP A HB3  1  
ATOM 1804   H HD1  . TRP A 1 114 ? -14.298 -9.074  -4.224  1.00 14.42 ? 114 TRP A HD1  1  
ATOM 1805   H HE1  . TRP A 1 114 ? -14.604 -9.337  -1.685  1.00 61.23 ? 114 TRP A HE1  1  
ATOM 1806   H HE3  . TRP A 1 114 ? -16.194 -13.819 -4.127  1.00 73.33 ? 114 TRP A HE3  1  
ATOM 1807   H HZ2  . TRP A 1 114 ? -15.529 -11.298 0.124   1.00 4.14  ? 114 TRP A HZ2  1  
ATOM 1808   H HZ3  . TRP A 1 114 ? -16.764 -14.816 -1.951  1.00 33.43 ? 114 TRP A HZ3  1  
ATOM 1809   H HH2  . TRP A 1 114 ? -16.438 -13.581 0.130   1.00 41.31 ? 114 TRP A HH2  1  
ATOM 1810   N N    . GLY A 1 115 ? -13.979 -11.559 -8.503  1.00 24.40 ? 115 GLY A N    1  
ATOM 1811   C CA   . GLY A 1 115 ? -14.059 -11.732 -9.941  1.00 75.13 ? 115 GLY A CA   1  
ATOM 1812   C C    . GLY A 1 115 ? -13.989 -10.423 -10.701 1.00 32.31 ? 115 GLY A C    1  
ATOM 1813   O O    . GLY A 1 115 ? -13.478 -9.425  -10.192 1.00 63.02 ? 115 GLY A O    1  
ATOM 1814   H H    . GLY A 1 115 ? -13.864 -10.665 -8.118  1.00 14.51 ? 115 GLY A H    1  
ATOM 1815   H HA2  . GLY A 1 115 ? -13.243 -12.363 -10.261 1.00 45.51 ? 115 GLY A HA2  1  
ATOM 1816   H HA3  . GLY A 1 115 ? -14.991 -12.223 -10.180 1.00 11.43 ? 115 GLY A HA3  1  
ATOM 1817   N N    . SER A 1 116 ? -14.504 -10.431 -11.927 1.00 61.44 ? 116 SER A N    1  
ATOM 1818   C CA   . SER A 1 116 ? -14.501 -9.241  -12.769 1.00 40.04 ? 116 SER A CA   1  
ATOM 1819   C C    . SER A 1 116 ? -15.320 -9.466  -14.036 1.00 31.11 ? 116 SER A C    1  
ATOM 1820   O O    . SER A 1 116 ? -15.640 -10.601 -14.388 1.00 62.21 ? 116 SER A O    1  
ATOM 1821   C CB   . SER A 1 116 ? -13.066 -8.856  -13.135 1.00 13.15 ? 116 SER A CB   1  
ATOM 1822   O OG   . SER A 1 116 ? -13.037 -7.999  -14.264 1.00 44.45 ? 116 SER A OG   1  
ATOM 1823   H H    . SER A 1 116 ? -14.895 -11.262 -12.269 1.00 22.35 ? 116 SER A H    1  
ATOM 1824   H HA   . SER A 1 116 ? -14.947 -8.436  -12.205 1.00 0.34  ? 116 SER A HA   1  
ATOM 1825   H HB2  . SER A 1 116 ? -12.608 -8.345  -12.301 1.00 4.53  ? 116 SER A HB2  1  
ATOM 1826   H HB3  . SER A 1 116 ? -12.502 -9.749  -13.363 1.00 3.33  ? 116 SER A HB3  1  
ATOM 1827   H HG   . SER A 1 116 ? -13.246 -8.503  -15.054 1.00 40.25 ? 116 SER A HG   1  
ATOM 1828   N N    . GLY A 1 117 ? -15.653 -8.375  -14.718 1.00 71.14 ? 117 GLY A N    1  
ATOM 1829   C CA   . GLY A 1 117 ? -16.430 -8.470  -15.939 1.00 21.34 ? 117 GLY A CA   1  
ATOM 1830   C C    . GLY A 1 117 ? -16.143 -7.330  -16.896 1.00 10.43 ? 117 GLY A C    1  
ATOM 1831   O O    . GLY A 1 117 ? -16.114 -6.167  -16.495 1.00 73.31 ? 117 GLY A O    1  
ATOM 1832   H H    . GLY A 1 117 ? -15.368 -7.497  -14.389 1.00 2.21  ? 117 GLY A H    1  
ATOM 1833   H HA2  . GLY A 1 117 ? -16.199 -9.405  -16.429 1.00 54.30 ? 117 GLY A HA2  1  
ATOM 1834   H HA3  . GLY A 1 117 ? -17.480 -8.458  -15.687 1.00 5.30  ? 117 GLY A HA3  1  
ATOM 1835   N N    . LEU A 1 118 ? -15.926 -7.664  -18.164 1.00 4.41  ? 118 LEU A N    1  
ATOM 1836   C CA   . LEU A 1 118 ? -15.637 -6.659  -19.181 1.00 31.02 ? 118 LEU A CA   1  
ATOM 1837   C C    . LEU A 1 118 ? -16.780 -6.553  -20.185 1.00 25.15 ? 118 LEU A C    1  
ATOM 1838   O O    . LEU A 1 118 ? -17.656 -7.416  -20.236 1.00 30.12 ? 118 LEU A O    1  
ATOM 1839   C CB   . LEU A 1 118 ? -14.335 -6.999  -19.908 1.00 32.44 ? 118 LEU A CB   1  
ATOM 1840   C CG   . LEU A 1 118 ? -13.063 -6.821  -19.077 1.00 44.30 ? 118 LEU A CG   1  
ATOM 1841   C CD1  . LEU A 1 118 ? -12.828 -8.036  -18.194 1.00 74.52 ? 118 LEU A CD1  1  
ATOM 1842   C CD2  . LEU A 1 118 ? -11.866 -6.577  -19.983 1.00 51.33 ? 118 LEU A CD2  1  
ATOM 1843   H H    . LEU A 1 118 ? -15.960 -8.609  -18.423 1.00 31.14 ? 118 LEU A H    1  
ATOM 1844   H HA   . LEU A 1 118 ? -15.522 -5.707  -18.683 1.00 62.42 ? 118 LEU A HA   1  
ATOM 1845   H HB2  . LEU A 1 118 ? -14.387 -8.028  -20.232 1.00 34.14 ? 118 LEU A HB2  1  
ATOM 1846   H HB3  . LEU A 1 118 ? -14.259 -6.368  -20.780 1.00 5.21  ? 118 LEU A HB3  1  
ATOM 1847   H HG   . LEU A 1 118 ? -13.179 -5.959  -18.435 1.00 11.33 ? 118 LEU A HG   1  
ATOM 1848   H HD11 . LEU A 1 118 ? -12.444 -7.717  -17.237 1.00 75.25 ? 118 LEU A HD11 1  
ATOM 1849   H HD12 . LEU A 1 118 ? -12.112 -8.692  -18.668 1.00 10.32 ? 118 LEU A HD12 1  
ATOM 1850   H HD13 . LEU A 1 118 ? -13.759 -8.563  -18.051 1.00 4.43  ? 118 LEU A HD13 1  
ATOM 1851   H HD21 . LEU A 1 118 ? -12.048 -7.026  -20.949 1.00 50.33 ? 118 LEU A HD21 1  
ATOM 1852   H HD22 . LEU A 1 118 ? -10.984 -7.017  -19.542 1.00 64.31 ? 118 LEU A HD22 1  
ATOM 1853   H HD23 . LEU A 1 118 ? -11.716 -5.514  -20.103 1.00 70.53 ? 118 LEU A HD23 1  
ATOM 1854   N N    . HIS A 1 119 ? -16.763 -5.490  -20.982 1.00 32.24 ? 119 HIS A N    1  
ATOM 1855   C CA   . HIS A 1 119 ? -17.797 -5.270  -21.986 1.00 41.53 ? 119 HIS A CA   1  
ATOM 1856   C C    . HIS A 1 119 ? -17.385 -4.172  -22.961 1.00 63.00 ? 119 HIS A C    1  
ATOM 1857   O O    . HIS A 1 119 ? -17.051 -3.059  -22.553 1.00 24.43 ? 119 HIS A O    1  
ATOM 1858   C CB   . HIS A 1 119 ? -19.120 -4.899  -21.313 1.00 30.43 ? 119 HIS A CB   1  
ATOM 1859   C CG   . HIS A 1 119 ? -20.322 -5.467  -22.001 1.00 42.32 ? 119 HIS A CG   1  
ATOM 1860   N ND1  . HIS A 1 119 ? -20.873 -4.909  -23.136 1.00 11.00 ? 119 HIS A ND1  1  
ATOM 1861   C CD2  . HIS A 1 119 ? -21.080 -6.551  -21.711 1.00 12.30 ? 119 HIS A CD2  1  
ATOM 1862   C CE1  . HIS A 1 119 ? -21.918 -5.624  -23.512 1.00 42.01 ? 119 HIS A CE1  1  
ATOM 1863   N NE2  . HIS A 1 119 ? -22.065 -6.626  -22.665 1.00 14.53 ? 119 HIS A NE2  1  
ATOM 1864   H H    . HIS A 1 119 ? -16.037 -4.837  -20.893 1.00 33.42 ? 119 HIS A H    1  
ATOM 1865   H HA   . HIS A 1 119 ? -17.928 -6.191  -22.534 1.00 4.32  ? 119 HIS A HA   1  
ATOM 1866   H HB2  . HIS A 1 119 ? -19.115 -5.268  -20.298 1.00 33.30 ? 119 HIS A HB2  1  
ATOM 1867   H HB3  . HIS A 1 119 ? -19.220 -3.824  -21.300 1.00 20.22 ? 119 HIS A HB3  1  
ATOM 1868   H HD1  . HIS A 1 119 ? -20.547 -4.108  -23.596 1.00 0.53  ? 119 HIS A HD1  1  
ATOM 1869   H HD2  . HIS A 1 119 ? -20.937 -7.230  -20.882 1.00 45.41 ? 119 HIS A HD2  1  
ATOM 1870   H HE1  . HIS A 1 119 ? -22.546 -5.424  -24.368 1.00 0.30  ? 119 HIS A HE1  1  
ATOM 1871   H HE2  . HIS A 1 119 ? -22.711 -7.357  -22.760 1.00 37.47 ? 119 HIS A HE2  1  
ATOM 1872   N N    . ASP A 1 120 ? -17.410 -4.492  -24.251 1.00 51.42 ? 120 ASP A N    1  
ATOM 1873   C CA   . ASP A 1 120 ? -17.038 -3.533  -25.284 1.00 34.13 ? 120 ASP A CA   1  
ATOM 1874   C C    . ASP A 1 120 ? -18.277 -2.883  -25.893 1.00 10.23 ? 120 ASP A C    1  
ATOM 1875   O O    . ASP A 1 120 ? -19.341 -3.498  -25.963 1.00 22.24 ? 120 ASP A O    1  
ATOM 1876   C CB   . ASP A 1 120 ? -16.219 -4.220  -26.378 1.00 71.54 ? 120 ASP A CB   1  
ATOM 1877   C CG   . ASP A 1 120 ? -16.887 -5.479  -26.895 1.00 63.33 ? 120 ASP A CG   1  
ATOM 1878   O OD1  . ASP A 1 120 ? -16.648 -6.559  -26.316 1.00 32.21 ? 120 ASP A OD1  1  
ATOM 1879   O OD2  . ASP A 1 120 ? -17.650 -5.384  -27.880 1.00 33.14 ? 120 ASP A OD2  1  
ATOM 1880   H H    . ASP A 1 120 ? -17.685 -5.395  -24.514 1.00 73.41 ? 120 ASP A H    1  
ATOM 1881   H HA   . ASP A 1 120 ? -16.435 -2.766  -24.823 1.00 22.52 ? 120 ASP A HA   1  
ATOM 1882   H HB2  . ASP A 1 120 ? -16.090 -3.538  -27.205 1.00 33.53 ? 120 ASP A HB2  1  
ATOM 1883   H HB3  . ASP A 1 120 ? -15.250 -4.485  -25.980 1.00 44.13 ? 120 ASP A HB3  1  
ATOM 1884   N N    . LYS A 1 121 ? -18.131 -1.637  -26.331 1.00 20.12 ? 121 LYS A N    1  
ATOM 1885   C CA   . LYS A 1 121 ? -19.241 -0.906  -26.932 1.00 12.03 ? 121 LYS A CA   1  
ATOM 1886   C C    . LYS A 1 121 ? -18.735 0.175   -27.883 1.00 22.42 ? 121 LYS A C    1  
ATOM 1887   O O    . LYS A 1 121 ? -18.216 1.204   -27.451 1.00 63.54 ? 121 LYS A O    1  
ATOM 1888   C CB   . LYS A 1 121 ? -20.112 -0.276  -25.843 1.00 20.30 ? 121 LYS A CB   1  
ATOM 1889   C CG   . LYS A 1 121 ? -21.599 -0.313  -26.157 1.00 74.11 ? 121 LYS A CG   1  
ATOM 1890   C CD   . LYS A 1 121 ? -22.286 -1.480  -25.465 1.00 0.30  ? 121 LYS A CD   1  
ATOM 1891   C CE   . LYS A 1 121 ? -22.290 -2.723  -26.340 1.00 45.41 ? 121 LYS A CE   1  
ATOM 1892   N NZ   . LYS A 1 121 ? -23.586 -2.897  -27.053 1.00 73.43 ? 121 LYS A NZ   1  
ATOM 1893   H H    . LYS A 1 121 ? -17.259 -1.198  -26.247 1.00 54.12 ? 121 LYS A H    1  
ATOM 1894   H HA   . LYS A 1 121 ? -19.836 -1.611  -27.492 1.00 1.40  ? 121 LYS A HA   1  
ATOM 1895   H HB2  . LYS A 1 121 ? -19.948 -0.806  -24.916 1.00 4.14  ? 121 LYS A HB2  1  
ATOM 1896   H HB3  . LYS A 1 121 ? -19.819 0.755   -25.715 1.00 1.44  ? 121 LYS A HB3  1  
ATOM 1897   H HG2  . LYS A 1 121 ? -22.051 0.608   -25.821 1.00 44.14 ? 121 LYS A HG2  1  
ATOM 1898   H HG3  . LYS A 1 121 ? -21.729 -0.412  -27.225 1.00 51.31 ? 121 LYS A HG3  1  
ATOM 1899   H HD2  . LYS A 1 121 ? -21.763 -1.700  -24.547 1.00 2.33  ? 121 LYS A HD2  1  
ATOM 1900   H HD3  . LYS A 1 121 ? -23.306 -1.203  -25.243 1.00 53.10 ? 121 LYS A HD3  1  
ATOM 1901   H HE2  . LYS A 1 121 ? -21.498 -2.638  -27.068 1.00 63.23 ? 121 LYS A HE2  1  
ATOM 1902   H HE3  . LYS A 1 121 ? -22.113 -3.587  -25.716 1.00 51.41 ? 121 LYS A HE3  1  
ATOM 1903   H HZ1  . LYS A 1 121 ? -23.758 -3.905  -27.241 1.00 44.11 ? 121 LYS A HZ1  1  
ATOM 1904   H HZ2  . LYS A 1 121 ? -23.567 -2.386  -27.958 1.00 22.32 ? 121 LYS A HZ2  1  
ATOM 1905   H HZ3  . LYS A 1 121 ? -24.365 -2.525  -26.473 1.00 44.13 ? 121 LYS A HZ3  1  
ATOM 1906   N N    . ASN A 1 122 ? -18.896 -0.066  -29.181 1.00 22.32 ? 122 ASN A N    1  
ATOM 1907   C CA   . ASN A 1 122 ? -18.463 0.887   -30.197 1.00 23.44 ? 122 ASN A CA   1  
ATOM 1908   C C    . ASN A 1 122 ? -16.955 1.113   -30.135 1.00 22.34 ? 122 ASN A C    1  
ATOM 1909   O O    . ASN A 1 122 ? -16.471 2.209   -30.421 1.00 32.45 ? 122 ASN A O    1  
ATOM 1910   C CB   . ASN A 1 122 ? -19.196 2.218   -30.022 1.00 54.22 ? 122 ASN A CB   1  
ATOM 1911   C CG   . ASN A 1 122 ? -20.535 2.238   -30.732 1.00 43.24 ? 122 ASN A CG   1  
ATOM 1912   O OD1  . ASN A 1 122 ? -20.608 2.076   -31.950 1.00 72.12 ? 122 ASN A OD1  1  
ATOM 1913   N ND2  . ASN A 1 122 ? -21.605 2.437   -29.971 1.00 64.15 ? 122 ASN A ND2  1  
ATOM 1914   H H    . ASN A 1 122 ? -19.321 -0.903  -29.462 1.00 52.33 ? 122 ASN A H    1  
ATOM 1915   H HA   . ASN A 1 122 ? -18.712 0.475   -31.163 1.00 53.15 ? 122 ASN A HA   1  
ATOM 1916   H HB2  . ASN A 1 122 ? -19.365 2.394   -28.971 1.00 60.21 ? 122 ASN A HB2  1  
ATOM 1917   H HB3  . ASN A 1 122 ? -18.585 3.014   -30.423 1.00 31.11 ? 122 ASN A HB3  1  
ATOM 1918   H HD21 . ASN A 1 122 ? -21.472 2.559   -29.008 1.00 40.44 ? 122 ASN A HD21 1  
ATOM 1919   H HD22 . ASN A 1 122 ? -22.484 2.454   -30.404 1.00 23.23 ? 122 ASN A HD22 1  
ATOM 1920   N N    . GLY A 1 123 ? -16.217 0.074   -29.760 1.00 3.30  ? 123 GLY A N    1  
ATOM 1921   C CA   . GLY A 1 123 ? -14.772 0.186   -29.669 1.00 42.43 ? 123 GLY A CA   1  
ATOM 1922   C C    . GLY A 1 123 ? -14.294 0.464   -28.256 1.00 33.14 ? 123 GLY A C    1  
ATOM 1923   O O    . GLY A 1 123 ? -13.133 0.222   -27.929 1.00 2.35  ? 123 GLY A O    1  
ATOM 1924   H H    . GLY A 1 123 ? -16.653 -0.775  -29.541 1.00 62.43 ? 123 GLY A H    1  
ATOM 1925   H HA2  . GLY A 1 123 ? -14.329 -0.738  -30.011 1.00 3.41  ? 123 GLY A HA2  1  
ATOM 1926   H HA3  . GLY A 1 123 ? -14.444 0.989   -30.312 1.00 10.35 ? 123 GLY A HA3  1  
ATOM 1927   N N    . LYS A 1 124 ? -15.191 0.969   -27.415 1.00 14.24 ? 124 LYS A N    1  
ATOM 1928   C CA   . LYS A 1 124 ? -14.850 1.274   -26.031 1.00 62.33 ? 124 LYS A CA   1  
ATOM 1929   C C    . LYS A 1 124 ? -15.008 0.037   -25.153 1.00 71.51 ? 124 LYS A C    1  
ATOM 1930   O O    . LYS A 1 124 ? -16.101 -0.517  -25.038 1.00 3.15  ? 124 LYS A O    1  
ATOM 1931   C CB   . LYS A 1 124 ? -15.732 2.406   -25.502 1.00 13.04 ? 124 LYS A CB   1  
ATOM 1932   C CG   . LYS A 1 124 ? -15.374 3.771   -26.067 1.00 3.35  ? 124 LYS A CG   1  
ATOM 1933   C CD   . LYS A 1 124 ? -15.929 4.893   -25.204 1.00 24.23 ? 124 LYS A CD   1  
ATOM 1934   C CE   . LYS A 1 124 ? -16.434 6.049   -26.052 1.00 72.24 ? 124 LYS A CE   1  
ATOM 1935   N NZ   . LYS A 1 124 ? -15.407 7.116   -26.206 1.00 54.54 ? 124 LYS A NZ   1  
ATOM 1936   H H    . LYS A 1 124 ? -16.102 1.139   -27.733 1.00 33.22 ? 124 LYS A H    1  
ATOM 1937   H HA   . LYS A 1 124 ? -13.818 1.590   -26.005 1.00 22.20 ? 124 LYS A HA   1  
ATOM 1938   H HB2  . LYS A 1 124 ? -16.761 2.194   -25.756 1.00 1.43  ? 124 LYS A HB2  1  
ATOM 1939   H HB3  . LYS A 1 124 ? -15.638 2.449   -24.427 1.00 63.30 ? 124 LYS A HB3  1  
ATOM 1940   H HG2  . LYS A 1 124 ? -14.299 3.861   -26.110 1.00 4.24  ? 124 LYS A HG2  1  
ATOM 1941   H HG3  . LYS A 1 124 ? -15.785 3.857   -27.062 1.00 65.31 ? 124 LYS A HG3  1  
ATOM 1942   H HD2  . LYS A 1 124 ? -16.746 4.510   -24.613 1.00 33.11 ? 124 LYS A HD2  1  
ATOM 1943   H HD3  . LYS A 1 124 ? -15.146 5.252   -24.551 1.00 70.32 ? 124 LYS A HD3  1  
ATOM 1944   H HE2  . LYS A 1 124 ? -16.699 5.674   -27.029 1.00 4.35  ? 124 LYS A HE2  1  
ATOM 1945   H HE3  . LYS A 1 124 ? -17.309 6.470   -25.579 1.00 44.35 ? 124 LYS A HE3  1  
ATOM 1946   H HZ1  . LYS A 1 124 ? -14.733 7.081   -25.414 1.00 35.34 ? 124 LYS A HZ1  1  
ATOM 1947   H HZ2  . LYS A 1 124 ? -15.861 8.051   -26.219 1.00 42.14 ? 124 LYS A HZ2  1  
ATOM 1948   H HZ3  . LYS A 1 124 ? -14.886 6.984   -27.097 1.00 14.54 ? 124 LYS A HZ3  1  
ATOM 1949   N N    . SER A 1 125 ? -13.911 -0.395  -24.539 1.00 2.04  ? 125 SER A N    1  
ATOM 1950   C CA   . SER A 1 125 ? -13.932 -1.570  -23.677 1.00 50.44 ? 125 SER A CA   1  
ATOM 1951   C C    . SER A 1 125 ? -13.858 -1.173  -22.207 1.00 53.44 ? 125 SER A C    1  
ATOM 1952   O O    . SER A 1 125 ? -13.021 -0.360  -21.813 1.00 64.33 ? 125 SER A O    1  
ATOM 1953   C CB   . SER A 1 125 ? -12.770 -2.502  -24.023 1.00 61.43 ? 125 SER A CB   1  
ATOM 1954   O OG   . SER A 1 125 ? -13.156 -3.861  -23.914 1.00 51.40 ? 125 SER A OG   1  
ATOM 1955   H H    . SER A 1 125 ? -13.066 0.085   -24.671 1.00 30.31 ? 125 SER A H    1  
ATOM 1956   H HA   . SER A 1 125 ? -14.861 -2.090  -23.850 1.00 73.41 ? 125 SER A HA   1  
ATOM 1957   H HB2  . SER A 1 125 ? -12.449 -2.313  -25.037 1.00 41.11 ? 125 SER A HB2  1  
ATOM 1958   H HB3  . SER A 1 125 ? -11.949 -2.318  -23.346 1.00 15.53 ? 125 SER A HB3  1  
ATOM 1959   H HG   . SER A 1 125 ? -12.817 -4.226  -23.093 1.00 22.12 ? 125 SER A HG   1  
ATOM 1960   N N    . TYR A 1 126 ? -14.738 -1.755  -21.400 1.00 60.31 ? 126 TYR A N    1  
ATOM 1961   C CA   . TYR A 1 126 ? -14.773 -1.468  -19.971 1.00 32.22 ? 126 TYR A CA   1  
ATOM 1962   C C    . TYR A 1 126 ? -14.376 -2.698  -19.162 1.00 3.30  ? 126 TYR A C    1  
ATOM 1963   O O    . TYR A 1 126 ? -14.452 -3.825  -19.651 1.00 20.22 ? 126 TYR A O    1  
ATOM 1964   C CB   . TYR A 1 126 ? -16.170 -1.001  -19.558 1.00 21.34 ? 126 TYR A CB   1  
ATOM 1965   C CG   . TYR A 1 126 ? -16.381 0.489   -19.709 1.00 41.23 ? 126 TYR A CG   1  
ATOM 1966   C CD1  . TYR A 1 126 ? -16.750 1.037   -20.930 1.00 52.31 ? 126 TYR A CD1  1  
ATOM 1967   C CD2  . TYR A 1 126 ? -16.210 1.346   -18.629 1.00 0.10  ? 126 TYR A CD2  1  
ATOM 1968   C CE1  . TYR A 1 126 ? -16.943 2.398   -21.072 1.00 1.52  ? 126 TYR A CE1  1  
ATOM 1969   C CE2  . TYR A 1 126 ? -16.402 2.708   -18.763 1.00 45.10 ? 126 TYR A CE2  1  
ATOM 1970   C CZ   . TYR A 1 126 ? -16.768 3.229   -19.986 1.00 52.24 ? 126 TYR A CZ   1  
ATOM 1971   O OH   . TYR A 1 126 ? -16.960 4.585   -20.123 1.00 11.02 ? 126 TYR A OH   1  
ATOM 1972   H H    . TYR A 1 126 ? -15.377 -2.397  -21.774 1.00 42.15 ? 126 TYR A H    1  
ATOM 1973   H HA   . TYR A 1 126 ? -14.065 -0.677  -19.773 1.00 2.43  ? 126 TYR A HA   1  
ATOM 1974   H HB2  . TYR A 1 126 ? -16.905 -1.502  -20.169 1.00 2.12  ? 126 TYR A HB2  1  
ATOM 1975   H HB3  . TYR A 1 126 ? -16.336 -1.257  -18.522 1.00 23.04 ? 126 TYR A HB3  1  
ATOM 1976   H HD1  . TYR A 1 126 ? -16.887 0.384   -21.779 1.00 15.35 ? 126 TYR A HD1  1  
ATOM 1977   H HD2  . TYR A 1 126 ? -15.922 0.935   -17.673 1.00 31.53 ? 126 TYR A HD2  1  
ATOM 1978   H HE1  . TYR A 1 126 ? -17.231 2.806   -22.030 1.00 34.22 ? 126 TYR A HE1  1  
ATOM 1979   H HE2  . TYR A 1 126 ? -16.264 3.359   -17.911 1.00 3.44  ? 126 TYR A HE2  1  
ATOM 1980   H HH   . TYR A 1 126 ? -16.109 5.023   -20.197 1.00 74.51 ? 126 TYR A HH   1  
ATOM 1981   N N    . ARG A 1 127 ? -13.952 -2.475  -17.923 1.00 30.11 ? 127 ARG A N    1  
ATOM 1982   C CA   . ARG A 1 127 ? -13.543 -3.566  -17.048 1.00 54.03 ? 127 ARG A CA   1  
ATOM 1983   C C    . ARG A 1 127 ? -13.721 -3.181  -15.583 1.00 53.54 ? 127 ARG A C    1  
ATOM 1984   O O    . ARG A 1 127 ? -13.465 -2.041  -15.197 1.00 21.12 ? 127 ARG A O    1  
ATOM 1985   C CB   . ARG A 1 127 ? -12.085 -3.945  -17.315 1.00 1.55  ? 127 ARG A CB   1  
ATOM 1986   C CG   . ARG A 1 127 ? -11.586 -5.092  -16.452 1.00 12.22 ? 127 ARG A CG   1  
ATOM 1987   C CD   . ARG A 1 127 ? -10.359 -5.753  -17.059 1.00 14.12 ? 127 ARG A CD   1  
ATOM 1988   N NE   . ARG A 1 127 ? -10.238 -7.153  -16.659 1.00 42.41 ? 127 ARG A NE   1  
ATOM 1989   C CZ   . ARG A 1 127 ? -9.492  -8.047  -17.304 1.00 52.21 ? 127 ARG A CZ   1  
ATOM 1990   N NH1  . ARG A 1 127 ? -8.800  -7.691  -18.380 1.00 43.22 ? 127 ARG A NH1  1  
ATOM 1991   N NH2  . ARG A 1 127 ? -9.438  -9.299  -16.873 1.00 4.33  ? 127 ARG A NH2  1  
ATOM 1992   H H    . ARG A 1 127 ? -13.914 -1.554  -17.589 1.00 1.44  ? 127 ARG A H    1  
ATOM 1993   H HA   . ARG A 1 127 ? -14.172 -4.417  -17.263 1.00 74.32 ? 127 ARG A HA   1  
ATOM 1994   H HB2  . ARG A 1 127 ? -11.984 -4.232  -18.351 1.00 51.41 ? 127 ARG A HB2  1  
ATOM 1995   H HB3  . ARG A 1 127 ? -11.462 -3.083  -17.127 1.00 2.25  ? 127 ARG A HB3  1  
ATOM 1996   H HG2  . ARG A 1 127 ? -11.330 -4.710  -15.475 1.00 1.02  ? 127 ARG A HG2  1  
ATOM 1997   H HG3  . ARG A 1 127 ? -12.372 -5.827  -16.358 1.00 61.34 ? 127 ARG A HG3  1  
ATOM 1998   H HD2  . ARG A 1 127 ? -10.434 -5.702  -18.135 1.00 43.34 ? 127 ARG A HD2  1  
ATOM 1999   H HD3  . ARG A 1 127 ? -9.480  -5.217  -16.734 1.00 31.32 ? 127 ARG A HD3  1  
ATOM 2000   H HE   . ARG A 1 127 ? -10.738 -7.442  -15.867 1.00 12.50 ? 127 ARG A HE   1  
ATOM 2001   H HH11 . ARG A 1 127 ? -8.836  -6.748  -18.710 1.00 30.22 ? 127 ARG A HH11 1  
ATOM 2002   H HH12 . ARG A 1 127 ? -8.242  -8.368  -18.860 1.00 15.50 ? 127 ARG A HH12 1  
ATOM 2003   H HH21 . ARG A 1 127 ? -9.957  -9.572  -16.063 1.00 52.02 ? 127 ARG A HH21 1  
ATOM 2004   H HH22 . ARG A 1 127 ? -8.878  -9.971  -17.358 1.00 74.25 ? 127 ARG A HH22 1  
ATOM 2005   N N    . PHE A 1 128 ? -14.160 -4.137  -14.773 1.00 72.43 ? 128 PHE A N    1  
ATOM 2006   C CA   . PHE A 1 128 ? -14.371 -3.895  -13.351 1.00 31.02 ? 128 PHE A CA   1  
ATOM 2007   C C    . PHE A 1 128 ? -13.976 -5.116  -12.527 1.00 51.52 ? 128 PHE A C    1  
ATOM 2008   O O    . PHE A 1 128 ? -14.204 -6.254  -12.937 1.00 63.23 ? 128 PHE A O    1  
ATOM 2009   C CB   . PHE A 1 128 ? -15.835 -3.539  -13.086 1.00 34.35 ? 128 PHE A CB   1  
ATOM 2010   C CG   . PHE A 1 128 ? -16.808 -4.477  -13.740 1.00 74.41 ? 128 PHE A CG   1  
ATOM 2011   C CD1  . PHE A 1 128 ? -16.967 -5.771  -13.269 1.00 43.24 ? 128 PHE A CD1  1  
ATOM 2012   C CD2  . PHE A 1 128 ? -17.564 -4.066  -14.827 1.00 24.32 ? 128 PHE A CD2  1  
ATOM 2013   C CE1  . PHE A 1 128 ? -17.861 -6.636  -13.870 1.00 44.31 ? 128 PHE A CE1  1  
ATOM 2014   C CE2  . PHE A 1 128 ? -18.460 -4.927  -15.431 1.00 40.45 ? 128 PHE A CE2  1  
ATOM 2015   C CZ   . PHE A 1 128 ? -18.608 -6.214  -14.952 1.00 12.03 ? 128 PHE A CZ   1  
ATOM 2016   H H    . PHE A 1 128 ? -14.348 -5.028  -15.137 1.00 43.24 ? 128 PHE A H    1  
ATOM 2017   H HA   . PHE A 1 128 ? -13.749 -3.062  -13.060 1.00 13.53 ? 128 PHE A HA   1  
ATOM 2018   H HB2  . PHE A 1 128 ? -16.017 -3.561  -12.022 1.00 65.21 ? 128 PHE A HB2  1  
ATOM 2019   H HB3  . PHE A 1 128 ? -16.029 -2.544  -13.458 1.00 61.50 ? 128 PHE A HB3  1  
ATOM 2020   H HD1  . PHE A 1 128 ? -16.383 -6.102  -12.423 1.00 43.32 ? 128 PHE A HD1  1  
ATOM 2021   H HD2  . PHE A 1 128 ? -17.448 -3.060  -15.202 1.00 73.13 ? 128 PHE A HD2  1  
ATOM 2022   H HE1  . PHE A 1 128 ? -17.975 -7.642  -13.494 1.00 52.10 ? 128 PHE A HE1  1  
ATOM 2023   H HE2  . PHE A 1 128 ? -19.043 -4.594  -16.277 1.00 44.33 ? 128 PHE A HE2  1  
ATOM 2024   H HZ   . PHE A 1 128 ? -19.308 -6.889  -15.423 1.00 45.02 ? 128 PHE A HZ   1  
ATOM 2025   N N    . MET A 1 129 ? -13.385 -4.871  -11.362 1.00 44.14 ? 129 MET A N    1  
ATOM 2026   C CA   . MET A 1 129 ? -12.960 -5.951  -10.478 1.00 15.13 ? 129 MET A CA   1  
ATOM 2027   C C    . MET A 1 129 ? -13.800 -5.966  -9.206  1.00 33.10 ? 129 MET A C    1  
ATOM 2028   O O    . MET A 1 129 ? -14.178 -4.913  -8.692  1.00 23.41 ? 129 MET A O    1  
ATOM 2029   C CB   . MET A 1 129 ? -11.480 -5.795  -10.123 1.00 51.31 ? 129 MET A CB   1  
ATOM 2030   C CG   . MET A 1 129 ? -10.859 -7.054  -9.537  1.00 1.34  ? 129 MET A CG   1  
ATOM 2031   S SD   . MET A 1 129 ? -9.769  -6.710  -8.142  1.00 33.22 ? 129 MET A SD   1  
ATOM 2032   C CE   . MET A 1 129 ? -8.866  -5.290  -8.757  1.00 73.14 ? 129 MET A CE   1  
ATOM 2033   H H    . MET A 1 129 ? -13.234 -3.940  -11.090 1.00 1.14  ? 129 MET A H    1  
ATOM 2034   H HA   . MET A 1 129 ? -13.100 -6.885  -11.001 1.00 55.25 ? 129 MET A HA   1  
ATOM 2035   H HB2  . MET A 1 129 ? -10.933 -5.532  -11.016 1.00 53.40 ? 129 MET A HB2  1  
ATOM 2036   H HB3  . MET A 1 129 ? -11.377 -4.999  -9.400  1.00 44.21 ? 129 MET A HB3  1  
ATOM 2037   H HG2  . MET A 1 129 ? -11.651 -7.707  -9.203  1.00 1.15  ? 129 MET A HG2  1  
ATOM 2038   H HG3  . MET A 1 129 ? -10.288 -7.549  -10.309 1.00 43.44 ? 129 MET A HG3  1  
ATOM 2039   H HE1  . MET A 1 129 ? -9.163  -4.410  -8.207  1.00 62.34 ? 129 MET A HE1  1  
ATOM 2040   H HE2  . MET A 1 129 ? -9.086  -5.151  -9.805  1.00 44.41 ? 129 MET A HE2  1  
ATOM 2041   H HE3  . MET A 1 129 ? -7.807  -5.455  -8.630  1.00 42.22 ? 129 MET A HE3  1  
ATOM 2042   N N    . ILE A 1 130 ? -14.098 -7.161  -8.701  1.00 62.12 ? 130 ILE A N    1  
ATOM 2043   C CA   . ILE A 1 130 ? -14.900 -7.298  -7.492  1.00 14.02 ? 130 ILE A CA   1  
ATOM 2044   C C    . ILE A 1 130 ? -14.018 -7.516  -6.264  1.00 55.33 ? 130 ILE A C    1  
ATOM 2045   O O    . ILE A 1 130 ? -13.200 -8.440  -6.225  1.00 51.51 ? 130 ILE A O    1  
ATOM 2046   C CB   . ILE A 1 130 ? -15.895 -8.472  -7.617  1.00 32.12 ? 130 ILE A CB   1  
ATOM 2047   C CG1  . ILE A 1 130 ? -16.827 -8.257  -8.815  1.00 24.23 ? 130 ILE A CG1  1  
ATOM 2048   C CG2  . ILE A 1 130 ? -16.691 -8.646  -6.328  1.00 31.15 ? 130 ILE A CG2  1  
ATOM 2049   C CD1  . ILE A 1 130 ? -18.070 -7.454  -8.494  1.00 50.12 ? 130 ILE A CD1  1  
ATOM 2050   H H    . ILE A 1 130 ? -13.781 -7.975  -9.145  1.00 61.12 ? 130 ILE A H    1  
ATOM 2051   H HA   . ILE A 1 130 ? -15.465 -6.387  -7.361  1.00 54.54 ? 130 ILE A HA   1  
ATOM 2052   H HB   . ILE A 1 130 ? -15.325 -9.373  -7.779  1.00 41.02 ? 130 ILE A HB   1  
ATOM 2053   H HG12 . ILE A 1 130 ? -16.289 -7.733  -9.591  1.00 30.23 ? 130 ILE A HG12 1  
ATOM 2054   H HG13 . ILE A 1 130 ? -17.142 -9.219  -9.193  1.00 12.21 ? 130 ILE A HG13 1  
ATOM 2055   H HG21 . ILE A 1 130 ? -17.184 -7.717  -6.081  1.00 64.22 ? 130 ILE A HG21 1  
ATOM 2056   H HG22 . ILE A 1 130 ? -16.023 -8.922  -5.526  1.00 72.51 ? 130 ILE A HG22 1  
ATOM 2057   H HG23 . ILE A 1 130 ? -17.431 -9.421  -6.463  1.00 45.04 ? 130 ILE A HG23 1  
ATOM 2058   H HD11 . ILE A 1 130 ? -17.895 -6.860  -7.608  1.00 70.23 ? 130 ILE A HD11 1  
ATOM 2059   H HD12 . ILE A 1 130 ? -18.897 -8.126  -8.318  1.00 22.20 ? 130 ILE A HD12 1  
ATOM 2060   H HD13 . ILE A 1 130 ? -18.303 -6.804  -9.323  1.00 32.33 ? 130 ILE A HD13 1  
ATOM 2061   N N    . MET A 1 131 ? -14.205 -6.666  -5.259  1.00 54.04 ? 131 MET A N    1  
ATOM 2062   C CA   . MET A 1 131 ? -13.447 -6.755  -4.016  1.00 61.23 ? 131 MET A CA   1  
ATOM 2063   C C    . MET A 1 131 ? -14.391 -6.710  -2.819  1.00 45.24 ? 131 MET A C    1  
ATOM 2064   O O    . MET A 1 131 ? -15.566 -6.373  -2.962  1.00 34.31 ? 131 MET A O    1  
ATOM 2065   C CB   . MET A 1 131 ? -12.432 -5.614  -3.927  1.00 11.43 ? 131 MET A CB   1  
ATOM 2066   C CG   . MET A 1 131 ? -11.303 -5.878  -2.944  1.00 53.22 ? 131 MET A CG   1  
ATOM 2067   S SD   . MET A 1 131 ? -9.927  -4.731  -3.141  1.00 13.50 ? 131 MET A SD   1  
ATOM 2068   C CE   . MET A 1 131 ? -10.802 -3.176  -3.296  1.00 42.12 ? 131 MET A CE   1  
ATOM 2069   H H    . MET A 1 131 ? -14.882 -5.963  -5.352  1.00 23.23 ? 131 MET A H    1  
ATOM 2070   H HA   . MET A 1 131 ? -12.920 -7.698  -4.013  1.00 44.03 ? 131 MET A HA   1  
ATOM 2071   H HB2  . MET A 1 131 ? -12.000 -5.455  -4.904  1.00 75.41 ? 131 MET A HB2  1  
ATOM 2072   H HB3  . MET A 1 131 ? -12.945 -4.715  -3.620  1.00 55.43 ? 131 MET A HB3  1  
ATOM 2073   H HG2  . MET A 1 131 ? -11.690 -5.785  -1.940  1.00 65.50 ? 131 MET A HG2  1  
ATOM 2074   H HG3  . MET A 1 131 ? -10.940 -6.884  -3.096  1.00 23.14 ? 131 MET A HG3  1  
ATOM 2075   H HE1  . MET A 1 131 ? -11.374 -3.174  -4.212  1.00 62.14 ? 131 MET A HE1  1  
ATOM 2076   H HE2  . MET A 1 131 ? -10.091 -2.363  -3.314  1.00 41.11 ? 131 MET A HE2  1  
ATOM 2077   H HE3  . MET A 1 131 ? -11.469 -3.053  -2.455  1.00 4.33  ? 131 MET A HE3  1  
ATOM 2078   N N    . ASP A 1 132 ? -13.880 -7.050  -1.640  1.00 14.23 ? 132 ASP A N    1  
ATOM 2079   C CA   . ASP A 1 132 ? -14.695 -7.045  -0.430  1.00 33.45 ? 132 ASP A CA   1  
ATOM 2080   C C    . ASP A 1 132 ? -14.837 -5.632  0.128   1.00 1.35  ? 132 ASP A C    1  
ATOM 2081   O O    . ASP A 1 132 ? -14.303 -4.675  -0.433  1.00 31.52 ? 132 ASP A O    1  
ATOM 2082   C CB   . ASP A 1 132 ? -14.080 -7.962  0.628   1.00 61.10 ? 132 ASP A CB   1  
ATOM 2083   C CG   . ASP A 1 132 ? -15.130 -8.703  1.432   1.00 73.01 ? 132 ASP A CG   1  
ATOM 2084   O OD1  . ASP A 1 132 ? -16.223 -8.138  1.645   1.00 11.51 ? 132 ASP A OD1  1  
ATOM 2085   O OD2  . ASP A 1 132 ? -14.860 -9.849  1.849   1.00 41.25 ? 132 ASP A OD2  1  
ATOM 2086   H H    . ASP A 1 132 ? -12.938 -7.314  -1.575  1.00 24.13 ? 132 ASP A H    1  
ATOM 2087   H HA   . ASP A 1 132 ? -15.675 -7.416  -0.689  1.00 64.22 ? 132 ASP A HA   1  
ATOM 2088   H HB2  . ASP A 1 132 ? -13.447 -8.690  0.141   1.00 44.02 ? 132 ASP A HB2  1  
ATOM 2089   H HB3  . ASP A 1 132 ? -13.484 -7.370  1.307   1.00 43.52 ? 132 ASP A HB3  1  
ATOM 2090   N N    . ARG A 1 133 ? -15.561 -5.511  1.237   1.00 35.13 ? 133 ARG A N    1  
ATOM 2091   C CA   . ARG A 1 133 ? -15.776 -4.216  1.874   1.00 11.43 ? 133 ARG A CA   1  
ATOM 2092   C C    . ARG A 1 133 ? -14.638 -3.888  2.837   1.00 54.22 ? 133 ARG A C    1  
ATOM 2093   O O    . ARG A 1 133 ? -13.715 -4.682  3.017   1.00 61.21 ? 133 ARG A O    1  
ATOM 2094   C CB   . ARG A 1 133 ? -17.112 -4.209  2.621   1.00 1.04  ? 133 ARG A CB   1  
ATOM 2095   C CG   . ARG A 1 133 ? -17.932 -2.950  2.392   1.00 52.20 ? 133 ARG A CG   1  
ATOM 2096   C CD   . ARG A 1 133 ? -18.205 -2.724  0.914   1.00 1.34  ? 133 ARG A CD   1  
ATOM 2097   N NE   . ARG A 1 133 ? -19.310 -1.794  0.697   1.00 74.43 ? 133 ARG A NE   1  
ATOM 2098   C CZ   . ARG A 1 133 ? -19.231 -0.484  0.917   1.00 52.13 ? 133 ARG A CZ   1  
ATOM 2099   N NH1  . ARG A 1 133 ? -18.100 0.055   1.358   1.00 14.34 ? 133 ARG A NH1  1  
ATOM 2100   N NH2  . ARG A 1 133 ? -20.284 0.290   0.695   1.00 62.34 ? 133 ARG A NH2  1  
ATOM 2101   H H    . ARG A 1 133 ? -15.961 -6.311  1.636   1.00 3.31  ? 133 ARG A H    1  
ATOM 2102   H HA   . ARG A 1 133 ? -15.803 -3.465  1.098   1.00 44.23 ? 133 ARG A HA   1  
ATOM 2103   H HB2  . ARG A 1 133 ? -17.696 -5.057  2.296   1.00 32.20 ? 133 ARG A HB2  1  
ATOM 2104   H HB3  . ARG A 1 133 ? -16.921 -4.300  3.680   1.00 33.44 ? 133 ARG A HB3  1  
ATOM 2105   H HG2  . ARG A 1 133 ? -18.874 -3.046  2.910   1.00 50.23 ? 133 ARG A HG2  1  
ATOM 2106   H HG3  . ARG A 1 133 ? -17.389 -2.102  2.782   1.00 55.31 ? 133 ARG A HG3  1  
ATOM 2107   H HD2  . ARG A 1 133 ? -17.314 -2.323  0.453   1.00 62.14 ? 133 ARG A HD2  1  
ATOM 2108   H HD3  . ARG A 1 133 ? -18.449 -3.672  0.457   1.00 4.41  ? 133 ARG A HD3  1  
ATOM 2109   H HE   . ARG A 1 133 ? -20.157 -2.165  0.371   1.00 11.35 ? 133 ARG A HE   1  
ATOM 2110   H HH11 . ARG A 1 133 ? -17.302 -0.523  1.526   1.00 64.33 ? 133 ARG A HH11 1  
ATOM 2111   H HH12 . ARG A 1 133 ? -18.047 1.040   1.521   1.00 63.22 ? 133 ARG A HH12 1  
ATOM 2112   H HH21 . ARG A 1 133 ? -21.138 -0.110  0.363   1.00 62.44 ? 133 ARG A HH21 1  
ATOM 2113   H HH22 . ARG A 1 133 ? -20.225 1.275   0.861   1.00 43.13 ? 133 ARG A HH22 1  
ATOM 2114   N N    . PHE A 1 134 ? -14.714 -2.713  3.454   1.00 12.13 ? 134 PHE A N    1  
ATOM 2115   C CA   . PHE A 1 134 ? -13.693 -2.279  4.400   1.00 72.24 ? 134 PHE A CA   1  
ATOM 2116   C C    . PHE A 1 134 ? -14.292 -1.362  5.462   1.00 24.24 ? 134 PHE A C    1  
ATOM 2117   O O    . PHE A 1 134 ? -15.499 -1.119  5.476   1.00 12.24 ? 134 PHE A O    1  
ATOM 2118   C CB   . PHE A 1 134 ? -12.561 -1.558  3.665   1.00 62.24 ? 134 PHE A CB   1  
ATOM 2119   C CG   . PHE A 1 134 ? -11.744 -2.462  2.788   1.00 33.14 ? 134 PHE A CG   1  
ATOM 2120   C CD1  . PHE A 1 134 ? -10.831 -3.346  3.341   1.00 62.15 ? 134 PHE A CD1  1  
ATOM 2121   C CD2  . PHE A 1 134 ? -11.890 -2.430  1.410   1.00 23.54 ? 134 PHE A CD2  1  
ATOM 2122   C CE1  . PHE A 1 134 ? -10.079 -4.180  2.537   1.00 4.04  ? 134 PHE A CE1  1  
ATOM 2123   C CE2  . PHE A 1 134 ? -11.140 -3.262  0.601   1.00 72.41 ? 134 PHE A CE2  1  
ATOM 2124   C CZ   . PHE A 1 134 ? -10.233 -4.138  1.165   1.00 33.21 ? 134 PHE A CZ   1  
ATOM 2125   H H    . PHE A 1 134 ? -15.475 -2.125  3.269   1.00 10.14 ? 134 PHE A H    1  
ATOM 2126   H HA   . PHE A 1 134 ? -13.293 -3.158  4.883   1.00 21.22 ? 134 PHE A HA   1  
ATOM 2127   H HB2  . PHE A 1 134 ? -12.982 -0.783  3.042   1.00 22.33 ? 134 PHE A HB2  1  
ATOM 2128   H HB3  . PHE A 1 134 ? -11.899 -1.109  4.391   1.00 75.44 ? 134 PHE A HB3  1  
ATOM 2129   H HD1  . PHE A 1 134 ? -10.710 -3.380  4.414   1.00 13.50 ? 134 PHE A HD1  1  
ATOM 2130   H HD2  . PHE A 1 134 ? -12.599 -1.745  0.968   1.00 22.30 ? 134 PHE A HD2  1  
ATOM 2131   H HE1  . PHE A 1 134 ? -9.370  -4.864  2.980   1.00 4.14  ? 134 PHE A HE1  1  
ATOM 2132   H HE2  . PHE A 1 134 ? -11.263 -3.227  -0.472  1.00 31.51 ? 134 PHE A HE2  1  
ATOM 2133   H HZ   . PHE A 1 134 ? -9.646  -4.789  0.534   1.00 52.23 ? 134 PHE A HZ   1  
ATOM 2134   N N    . GLY A 1 135 ? -13.442 -0.857  6.350   1.00 34.25 ? 135 GLY A N    1  
ATOM 2135   C CA   . GLY A 1 135 ? -13.908 0.027   7.403   1.00 45.13 ? 135 GLY A CA   1  
ATOM 2136   C C    . GLY A 1 135 ? -13.440 1.455   7.210   1.00 33.32 ? 135 GLY A C    1  
ATOM 2137   O O    . GLY A 1 135 ? -14.245 2.351   6.956   1.00 2.23  ? 135 GLY A O    1  
ATOM 2138   H H    . GLY A 1 135 ? -12.491 -1.086  6.290   1.00 31.43 ? 135 GLY A H    1  
ATOM 2139   H HA2  . GLY A 1 135 ? -14.988 0.012   7.419   1.00 40.11 ? 135 GLY A HA2  1  
ATOM 2140   H HA3  . GLY A 1 135 ? -13.540 -0.336  8.351   1.00 63.21 ? 135 GLY A HA3  1  
ATOM 2141   N N    . SER A 1 136 ? -12.134 1.669   7.330   1.00 60.02 ? 136 SER A N    1  
ATOM 2142   C CA   . SER A 1 136 ? -11.558 2.999   7.167   1.00 44.21 ? 136 SER A CA   1  
ATOM 2143   C C    . SER A 1 136 ? -10.058 2.914   6.905   1.00 72.30 ? 136 SER A C    1  
ATOM 2144   O O    . SER A 1 136 ? -9.410  1.930   7.262   1.00 2.34  ? 136 SER A O    1  
ATOM 2145   C CB   . SER A 1 136 ? -11.823 3.847   8.413   1.00 71.23 ? 136 SER A CB   1  
ATOM 2146   O OG   . SER A 1 136 ? -11.995 3.031   9.559   1.00 45.05 ? 136 SER A OG   1  
ATOM 2147   H H    . SER A 1 136 ? -11.543 0.914   7.533   1.00 11.31 ? 136 SER A H    1  
ATOM 2148   H HA   . SER A 1 136 ? -12.034 3.464   6.318   1.00 72.45 ? 136 SER A HA   1  
ATOM 2149   H HB2  . SER A 1 136 ? -10.986 4.508   8.580   1.00 15.53 ? 136 SER A HB2  1  
ATOM 2150   H HB3  . SER A 1 136 ? -12.719 4.431   8.263   1.00 44.42 ? 136 SER A HB3  1  
ATOM 2151   H HG   . SER A 1 136 ? -11.712 3.512   10.340  1.00 34.33 ? 136 SER A HG   1  
ATOM 2152   N N    . ASP A 1 137 ? -9.512  3.952   6.280   1.00 23.43 ? 137 ASP A N    1  
ATOM 2153   C CA   . ASP A 1 137 ? -8.088  3.995   5.972   1.00 31.44 ? 137 ASP A CA   1  
ATOM 2154   C C    . ASP A 1 137 ? -7.291  4.523   7.160   1.00 2.01  ? 137 ASP A C    1  
ATOM 2155   O O    . ASP A 1 137 ? -7.765  5.378   7.908   1.00 23.33 ? 137 ASP A O    1  
ATOM 2156   C CB   . ASP A 1 137 ? -7.835  4.869   4.742   1.00 72.42 ? 137 ASP A CB   1  
ATOM 2157   C CG   . ASP A 1 137 ? -8.349  6.283   4.923   1.00 24.44 ? 137 ASP A CG   1  
ATOM 2158   O OD1  . ASP A 1 137 ? -9.582  6.459   5.014   1.00 5.02  ? 137 ASP A OD1  1  
ATOM 2159   O OD2  . ASP A 1 137 ? -7.519  7.215   4.973   1.00 22.30 ? 137 ASP A OD2  1  
ATOM 2160   H H    . ASP A 1 137 ? -10.080 4.707   6.021   1.00 4.42  ? 137 ASP A H    1  
ATOM 2161   H HA   . ASP A 1 137 ? -7.766  2.987   5.758   1.00 51.01 ? 137 ASP A HA   1  
ATOM 2162   H HB2  . ASP A 1 137 ? -6.773  4.914   4.552   1.00 52.21 ? 137 ASP A HB2  1  
ATOM 2163   H HB3  . ASP A 1 137 ? -8.331  4.430   3.889   1.00 71.20 ? 137 ASP A HB3  1  
ATOM 2164   N N    . LEU A 1 138 ? -6.078  4.006   7.329   1.00 60.14 ? 138 LEU A N    1  
ATOM 2165   C CA   . LEU A 1 138 ? -5.215  4.424   8.428   1.00 2.10  ? 138 LEU A CA   1  
ATOM 2166   C C    . LEU A 1 138 ? -4.769  5.874   8.254   1.00 52.10 ? 138 LEU A C    1  
ATOM 2167   O O    . LEU A 1 138 ? -4.500  6.571   9.233   1.00 61.24 ? 138 LEU A O    1  
ATOM 2168   C CB   . LEU A 1 138 ? -3.994  3.505   8.521   1.00 43.42 ? 138 LEU A CB   1  
ATOM 2169   C CG   . LEU A 1 138 ? -3.854  2.746   9.841   1.00 30.11 ? 138 LEU A CG   1  
ATOM 2170   C CD1  . LEU A 1 138 ? -4.602  1.424   9.778   1.00 63.33 ? 138 LEU A CD1  1  
ATOM 2171   C CD2  . LEU A 1 138 ? -2.387  2.516   10.170  1.00 22.43 ? 138 LEU A CD2  1  
ATOM 2172   H H    . LEU A 1 138 ? -5.756  3.327   6.701   1.00 73.34 ? 138 LEU A H    1  
ATOM 2173   H HA   . LEU A 1 138 ? -5.784  4.343   9.342   1.00 73.43 ? 138 LEU A HA   1  
ATOM 2174   H HB2  . LEU A 1 138 ? -4.052  2.783   7.719   1.00 43.02 ? 138 LEU A HB2  1  
ATOM 2175   H HB3  . LEU A 1 138 ? -3.105  4.102   8.380   1.00 13.05 ? 138 LEU A HB3  1  
ATOM 2176   H HG   . LEU A 1 138 ? -4.287  3.337   10.636  1.00 72.11 ? 138 LEU A HG   1  
ATOM 2177   H HD11 . LEU A 1 138 ? -4.332  0.816   10.630  1.00 60.04 ? 138 LEU A HD11 1  
ATOM 2178   H HD12 . LEU A 1 138 ? -4.340  0.905   8.868   1.00 42.53 ? 138 LEU A HD12 1  
ATOM 2179   H HD13 . LEU A 1 138 ? -5.666  1.610   9.793   1.00 31.53 ? 138 LEU A HD13 1  
ATOM 2180   H HD21 . LEU A 1 138 ? -2.293  1.653   10.813  1.00 31.53 ? 138 LEU A HD21 1  
ATOM 2181   H HD22 . LEU A 1 138 ? -1.990  3.385   10.673  1.00 64.03 ? 138 LEU A HD22 1  
ATOM 2182   H HD23 . LEU A 1 138 ? -1.836  2.346   9.257   1.00 15.34 ? 138 LEU A HD23 1  
ATOM 2183   N N    . GLN A 1 139 ? -4.691  6.322   7.005   1.00 5.34  ? 139 GLN A N    1  
ATOM 2184   C CA   . GLN A 1 139 ? -4.276  7.688   6.708   1.00 71.14 ? 139 GLN A CA   1  
ATOM 2185   C C    . GLN A 1 139 ? -5.329  8.693   7.164   1.00 3.12  ? 139 GLN A C    1  
ATOM 2186   O O    . GLN A 1 139 ? -5.006  9.828   7.515   1.00 25.05 ? 139 GLN A O    1  
ATOM 2187   C CB   . GLN A 1 139 ? -4.016  7.849   5.209   1.00 34.31 ? 139 GLN A CB   1  
ATOM 2188   C CG   . GLN A 1 139 ? -3.224  9.098   4.859   1.00 1.34  ? 139 GLN A CG   1  
ATOM 2189   C CD   . GLN A 1 139 ? -3.731  9.777   3.602   1.00 31.45 ? 139 GLN A CD   1  
ATOM 2190   O OE1  . GLN A 1 139 ? -4.186  9.118   2.667   1.00 60.33 ? 139 GLN A OE1  1  
ATOM 2191   N NE2  . GLN A 1 139 ? -3.655  11.102  3.574   1.00 11.13 ? 139 GLN A NE2  1  
ATOM 2192   H H    . GLN A 1 139 ? -4.916  5.721   6.265   1.00 23.03 ? 139 GLN A H    1  
ATOM 2193   H HA   . GLN A 1 139 ? -3.358  7.878   7.245   1.00 75.41 ? 139 GLN A HA   1  
ATOM 2194   H HB2  . GLN A 1 139 ? -3.465  6.989   4.857   1.00 52.42 ? 139 GLN A HB2  1  
ATOM 2195   H HB3  . GLN A 1 139 ? -4.964  7.894   4.694   1.00 64.11 ? 139 GLN A HB3  1  
ATOM 2196   H HG2  . GLN A 1 139 ? -3.295  9.795   5.680   1.00 23.23 ? 139 GLN A HG2  1  
ATOM 2197   H HG3  . GLN A 1 139 ? -2.190  8.823   4.711   1.00 24.30 ? 139 GLN A HG3  1  
ATOM 2198   H HE21 . GLN A 1 139 ? -3.281  11.561  4.355   1.00 4.13  ? 139 GLN A HE21 1  
ATOM 2199   H HE22 . GLN A 1 139 ? -3.976  11.567  2.773   1.00 0.34  ? 139 GLN A HE22 1  
ATOM 2200   N N    . LYS A 1 140 ? -6.589  8.271   7.155   1.00 71.24 ? 140 LYS A N    1  
ATOM 2201   C CA   . LYS A 1 140 ? -7.687  9.138   7.568   1.00 3.24  ? 140 LYS A CA   1  
ATOM 2202   C C    . LYS A 1 140 ? -7.607  9.443   9.061   1.00 50.11 ? 140 LYS A C    1  
ATOM 2203   O O    . LYS A 1 140 ? -7.593  10.605  9.466   1.00 71.41 ? 140 LYS A O    1  
ATOM 2204   C CB   . LYS A 1 140 ? -9.032  8.487   7.236   1.00 4.24  ? 140 LYS A CB   1  
ATOM 2205   C CG   . LYS A 1 140 ? -9.700  9.068   6.001   1.00 51.33 ? 140 LYS A CG   1  
ATOM 2206   C CD   . LYS A 1 140 ? -11.179 8.723   5.953   1.00 1.20  ? 140 LYS A CD   1  
ATOM 2207   C CE   . LYS A 1 140 ? -11.824 9.212   4.666   1.00 53.42 ? 140 LYS A CE   1  
ATOM 2208   N NZ   . LYS A 1 140 ? -11.374 8.425   3.485   1.00 72.24 ? 140 LYS A NZ   1  
ATOM 2209   H H    . LYS A 1 140 ? -6.786  7.355   6.866   1.00 64.30 ? 140 LYS A H    1  
ATOM 2210   H HA   . LYS A 1 140 ? -7.601  10.063  7.019   1.00 72.44 ? 140 LYS A HA   1  
ATOM 2211   H HB2  . LYS A 1 140 ? -8.877  7.431   7.072   1.00 63.12 ? 140 LYS A HB2  1  
ATOM 2212   H HB3  . LYS A 1 140 ? -9.701  8.617   8.075   1.00 20.32 ? 140 LYS A HB3  1  
ATOM 2213   H HG2  . LYS A 1 140 ? -9.592  10.142  6.017   1.00 5.32  ? 140 LYS A HG2  1  
ATOM 2214   H HG3  . LYS A 1 140 ? -9.217  8.669   5.121   1.00 51.21 ? 140 LYS A HG3  1  
ATOM 2215   H HD2  . LYS A 1 140 ? -11.291 7.651   6.014   1.00 33.21 ? 140 LYS A HD2  1  
ATOM 2216   H HD3  . LYS A 1 140 ? -11.675 9.188   6.793   1.00 63.20 ? 140 LYS A HD3  1  
ATOM 2217   H HE2  . LYS A 1 140 ? -12.896 9.124   4.759   1.00 64.34 ? 140 LYS A HE2  1  
ATOM 2218   H HE3  . LYS A 1 140 ? -11.560 10.249  4.518   1.00 60.04 ? 140 LYS A HE3  1  
ATOM 2219   H HZ1  . LYS A 1 140 ? -11.640 8.914   2.606   1.00 32.14 ? 140 LYS A HZ1  1  
ATOM 2220   H HZ2  . LYS A 1 140 ? -11.818 7.484   3.492   1.00 24.41 ? 140 LYS A HZ2  1  
ATOM 2221   H HZ3  . LYS A 1 140 ? -10.341 8.308   3.505   1.00 73.03 ? 140 LYS A HZ3  1  
ATOM 2222   N N    . ILE A 1 141 ? -7.555  8.393   9.873   1.00 5.00  ? 141 ILE A N    1  
ATOM 2223   C CA   . ILE A 1 141 ? -7.477  8.549   11.320  1.00 54.50 ? 141 ILE A CA   1  
ATOM 2224   C C    . ILE A 1 141 ? -6.241  9.350   11.719  1.00 64.13 ? 141 ILE A C    1  
ATOM 2225   O O    . ILE A 1 141 ? -6.286  10.159  12.645  1.00 75.42 ? 141 ILE A O    1  
ATOM 2226   C CB   . ILE A 1 141 ? -7.444  7.183   12.033  1.00 1.30  ? 141 ILE A CB   1  
ATOM 2227   C CG1  . ILE A 1 141 ? -8.586  6.295   11.533  1.00 62.32 ? 141 ILE A CG1  1  
ATOM 2228   C CG2  . ILE A 1 141 ? -7.530  7.369   13.541  1.00 53.33 ? 141 ILE A CG2  1  
ATOM 2229   C CD1  . ILE A 1 141 ? -8.146  4.894   11.167  1.00 51.41 ? 141 ILE A CD1  1  
ATOM 2230   H H    . ILE A 1 141 ? -7.570  7.491   9.490   1.00 21.53 ? 141 ILE A H    1  
ATOM 2231   H HA   . ILE A 1 141 ? -8.359  9.081   11.646  1.00 51.35 ? 141 ILE A HA   1  
ATOM 2232   H HB   . ILE A 1 141 ? -6.502  6.707   11.807  1.00 33.03 ? 141 ILE A HB   1  
ATOM 2233   H HG12 . ILE A 1 141 ? -9.336  6.214   12.306  1.00 33.02 ? 141 ILE A HG12 1  
ATOM 2234   H HG13 . ILE A 1 141 ? -9.027  6.744   10.656  1.00 54.14 ? 141 ILE A HG13 1  
ATOM 2235   H HG21 . ILE A 1 141 ? -6.547  7.585   13.933  1.00 21.24 ? 141 ILE A HG21 1  
ATOM 2236   H HG22 . ILE A 1 141 ? -7.907  6.464   13.994  1.00 43.25 ? 141 ILE A HG22 1  
ATOM 2237   H HG23 . ILE A 1 141 ? -8.196  8.189   13.766  1.00 25.50 ? 141 ILE A HG23 1  
ATOM 2238   H HD11 . ILE A 1 141 ? -8.297  4.734   10.110  1.00 65.13 ? 141 ILE A HD11 1  
ATOM 2239   H HD12 . ILE A 1 141 ? -8.727  4.176   11.727  1.00 12.22 ? 141 ILE A HD12 1  
ATOM 2240   H HD13 . ILE A 1 141 ? -7.099  4.772   11.404  1.00 65.32 ? 141 ILE A HD13 1  
ATOM 2241   N N    . TYR A 1 142 ? -5.138  9.118   11.013  1.00 31.20 ? 142 TYR A N    1  
ATOM 2242   C CA   . TYR A 1 142 ? -3.889  9.819   11.292  1.00 64.35 ? 142 TYR A CA   1  
ATOM 2243   C C    . TYR A 1 142 ? -4.093  11.331  11.255  1.00 24.54 ? 142 TYR A C    1  
ATOM 2244   O O    . TYR A 1 142 ? -3.720  12.041  12.189  1.00 75.32 ? 142 TYR A O    1  
ATOM 2245   C CB   . TYR A 1 142 ? -2.815  9.413   10.281  1.00 75.45 ? 142 TYR A CB   1  
ATOM 2246   C CG   . TYR A 1 142 ? -1.473  10.064  10.528  1.00 52.20 ? 142 TYR A CG   1  
ATOM 2247   C CD1  . TYR A 1 142 ? -0.850  9.967   11.766  1.00 42.44 ? 142 TYR A CD1  1  
ATOM 2248   C CD2  . TYR A 1 142 ? -0.830  10.777  9.523   1.00 43.43 ? 142 TYR A CD2  1  
ATOM 2249   C CE1  . TYR A 1 142 ? 0.377   10.561  11.995  1.00 35.43 ? 142 TYR A CE1  1  
ATOM 2250   C CE2  . TYR A 1 142 ? 0.397   11.373  9.745   1.00 33.43 ? 142 TYR A CE2  1  
ATOM 2251   C CZ   . TYR A 1 142 ? 0.996   11.262  10.982  1.00 42.41 ? 142 TYR A CZ   1  
ATOM 2252   O OH   . TYR A 1 142 ? 2.217   11.855  11.207  1.00 64.32 ? 142 TYR A OH   1  
ATOM 2253   H H    . TYR A 1 142 ? -5.165  8.461   10.287  1.00 43.12 ? 142 TYR A H    1  
ATOM 2254   H HA   . TYR A 1 142 ? -3.565  9.536   12.282  1.00 43.02 ? 142 TYR A HA   1  
ATOM 2255   H HB2  . TYR A 1 142 ? -2.677  8.343   10.324  1.00 11.55 ? 142 TYR A HB2  1  
ATOM 2256   H HB3  . TYR A 1 142 ? -3.142  9.690   9.289   1.00 54.32 ? 142 TYR A HB3  1  
ATOM 2257   H HD1  . TYR A 1 142 ? -1.337  9.416   12.557  1.00 65.44 ? 142 TYR A HD1  1  
ATOM 2258   H HD2  . TYR A 1 142 ? -1.302  10.861  8.556   1.00 60.02 ? 142 TYR A HD2  1  
ATOM 2259   H HE1  . TYR A 1 142 ? 0.846   10.474  12.964  1.00 1.11  ? 142 TYR A HE1  1  
ATOM 2260   H HE2  . TYR A 1 142 ? 0.881   11.923  8.952   1.00 15.12 ? 142 TYR A HE2  1  
ATOM 2261   H HH   . TYR A 1 142 ? 2.204   12.754  10.869  1.00 31.43 ? 142 TYR A HH   1  
ATOM 2262   N N    . GLU A 1 143 ? -4.692  11.815  10.172  1.00 4.14  ? 143 GLU A N    1  
ATOM 2263   C CA   . GLU A 1 143 ? -4.950  13.241  10.016  1.00 12.15 ? 143 GLU A CA   1  
ATOM 2264   C C    . GLU A 1 143 ? -6.018  13.708  10.999  1.00 5.12  ? 143 GLU A C    1  
ATOM 2265   O O    . GLU A 1 143 ? -5.994  14.847  11.465  1.00 4.54  ? 143 GLU A O    1  
ATOM 2266   C CB   . GLU A 1 143 ? -5.390  13.548  8.583   1.00 21.55 ? 143 GLU A CB   1  
ATOM 2267   C CG   . GLU A 1 143 ? -4.921  14.903  8.080   1.00 14.20 ? 143 GLU A CG   1  
ATOM 2268   C CD   . GLU A 1 143 ? -5.294  15.148  6.630   1.00 13.33 ? 143 GLU A CD   1  
ATOM 2269   O OE1  . GLU A 1 143 ? -4.685  14.511  5.745   1.00 72.34 ? 143 GLU A OE1  1  
ATOM 2270   O OE2  . GLU A 1 143 ? -6.195  15.976  6.380   1.00 60.12 ? 143 GLU A OE2  1  
ATOM 2271   H H    . GLU A 1 143 ? -4.970  11.198  9.463   1.00 43.41 ? 143 GLU A H    1  
ATOM 2272   H HA   . GLU A 1 143 ? -4.031  13.769  10.223  1.00 10.32 ? 143 GLU A HA   1  
ATOM 2273   H HB2  . GLU A 1 143 ? -4.993  12.787  7.927   1.00 63.43 ? 143 GLU A HB2  1  
ATOM 2274   H HB3  . GLU A 1 143 ? -6.469  13.524  8.537   1.00 55.42 ? 143 GLU A HB3  1  
ATOM 2275   H HG2  . GLU A 1 143 ? -5.373  15.674  8.686   1.00 44.53 ? 143 GLU A HG2  1  
ATOM 2276   H HG3  . GLU A 1 143 ? -3.846  14.956  8.174   1.00 61.52 ? 143 GLU A HG3  1  
ATOM 2277   N N    . ALA A 1 144 ? -6.955  12.818  11.312  1.00 45.43 ? 144 ALA A N    1  
ATOM 2278   C CA   . ALA A 1 144 ? -8.032  13.134  12.241  1.00 71.20 ? 144 ALA A CA   1  
ATOM 2279   C C    . ALA A 1 144 ? -7.503  13.297  13.662  1.00 43.12 ? 144 ALA A C    1  
ATOM 2280   O O    . ALA A 1 144 ? -8.085  14.018  14.472  1.00 24.34 ? 144 ALA A O    1  
ATOM 2281   C CB   . ALA A 1 144 ? -9.103  12.055  12.194  1.00 14.33 ? 144 ALA A CB   1  
ATOM 2282   H H    . ALA A 1 144 ? -6.919  11.925  10.908  1.00 71.31 ? 144 ALA A H    1  
ATOM 2283   H HA   . ALA A 1 144 ? -8.480  14.066  11.926  1.00 61.35 ? 144 ALA A HA   1  
ATOM 2284   H HB1  . ALA A 1 144 ? -8.810  11.230  12.827  1.00 23.23 ? 144 ALA A HB1  1  
ATOM 2285   H HB2  . ALA A 1 144 ? -9.218  11.706  11.179  1.00 11.22 ? 144 ALA A HB2  1  
ATOM 2286   H HB3  . ALA A 1 144 ? -10.040 12.461  12.544  1.00 73.13 ? 144 ALA A HB3  1  
ATOM 2287   N N    . ASN A 1 145 ? -6.395  12.623  13.958  1.00 11.11 ? 145 ASN A N    1  
ATOM 2288   C CA   . ASN A 1 145 ? -5.789  12.696  15.283  1.00 61.31 ? 145 ASN A CA   1  
ATOM 2289   C C    . ASN A 1 145 ? -4.655  13.718  15.312  1.00 20.45 ? 145 ASN A C    1  
ATOM 2290   O O    . ASN A 1 145 ? -3.763  13.644  16.157  1.00 25.33 ? 145 ASN A O    1  
ATOM 2291   C CB   . ASN A 1 145 ? -5.263  11.322  15.701  1.00 11.14 ? 145 ASN A CB   1  
ATOM 2292   C CG   . ASN A 1 145 ? -5.465  11.050  17.179  1.00 52.30 ? 145 ASN A CG   1  
ATOM 2293   O OD1  . ASN A 1 145 ? -6.596  10.914  17.648  1.00 61.13 ? 145 ASN A OD1  1  
ATOM 2294   N ND2  . ASN A 1 145 ? -4.368  10.970  17.922  1.00 20.44 ? 145 ASN A ND2  1  
ATOM 2295   H H    . ASN A 1 145 ? -5.976  12.065  13.270  1.00 75.45 ? 145 ASN A H    1  
ATOM 2296   H HA   . ASN A 1 145 ? -6.553  13.005  15.980  1.00 13.34 ? 145 ASN A HA   1  
ATOM 2297   H HB2  . ASN A 1 145 ? -5.780  10.558  15.140  1.00 13.35 ? 145 ASN A HB2  1  
ATOM 2298   H HB3  . ASN A 1 145 ? -4.206  11.267  15.485  1.00 13.41 ? 145 ASN A HB3  1  
ATOM 2299   H HD21 . ASN A 1 145 ? -3.501  11.089  17.481  1.00 3.51  ? 145 ASN A HD21 1  
ATOM 2300   H HD22 . ASN A 1 145 ? -4.469  10.795  18.881  1.00 62.34 ? 145 ASN A HD22 1  
ATOM 2301   N N    . ALA A 1 146 ? -4.695  14.670  14.384  1.00 5.54  ? 146 ALA A N    1  
ATOM 2302   C CA   . ALA A 1 146 ? -3.670  15.704  14.305  1.00 71.15 ? 146 ALA A CA   1  
ATOM 2303   C C    . ALA A 1 146 ? -2.300  15.102  14.010  1.00 55.30 ? 146 ALA A C    1  
ATOM 2304   O O    . ALA A 1 146 ? -1.271  15.661  14.389  1.00 20.53 ? 146 ALA A O    1  
ATOM 2305   C CB   . ALA A 1 146 ? -3.628  16.507  15.597  1.00 22.42 ? 146 ALA A CB   1  
ATOM 2306   H H    . ALA A 1 146 ? -5.430  14.677  13.736  1.00 74.05 ? 146 ALA A H    1  
ATOM 2307   H HA   . ALA A 1 146 ? -3.936  16.376  13.501  1.00 13.11 ? 146 ALA A HA   1  
ATOM 2308   H HB1  . ALA A 1 146 ? -3.016  15.991  16.322  1.00 62.55 ? 146 ALA A HB1  1  
ATOM 2309   H HB2  . ALA A 1 146 ? -4.630  16.616  15.985  1.00 25.11 ? 146 ALA A HB2  1  
ATOM 2310   H HB3  . ALA A 1 146 ? -3.210  17.483  15.402  1.00 24.01 ? 146 ALA A HB3  1  
ATOM 2311   N N    . LYS A 1 147 ? -2.294  13.958  13.331  1.00 53.31 ? 147 LYS A N    1  
ATOM 2312   C CA   . LYS A 1 147 ? -1.049  13.280  12.986  1.00 64.32 ? 147 LYS A CA   1  
ATOM 2313   C C    . LYS A 1 147 ? -0.296  12.850  14.241  1.00 13.51 ? 147 LYS A C    1  
ATOM 2314   O O    . LYS A 1 147 ? 0.881   13.168  14.413  1.00 44.14 ? 147 LYS A O    1  
ATOM 2315   C CB   . LYS A 1 147 ? -0.167  14.192  12.130  1.00 4.44  ? 147 LYS A CB   1  
ATOM 2316   C CG   . LYS A 1 147 ? -0.834  14.653  10.845  1.00 2.03  ? 147 LYS A CG   1  
ATOM 2317   C CD   . LYS A 1 147 ? -0.323  16.018  10.411  1.00 14.35 ? 147 LYS A CD   1  
ATOM 2318   C CE   . LYS A 1 147 ? -0.997  16.483  9.130   1.00 14.51 ? 147 LYS A CE   1  
ATOM 2319   N NZ   . LYS A 1 147 ? -2.201  17.315  9.407   1.00 21.44 ? 147 LYS A NZ   1  
ATOM 2320   H H    . LYS A 1 147 ? -3.146  13.560  13.057  1.00 61.25 ? 147 LYS A H    1  
ATOM 2321   H HA   . LYS A 1 147 ? -1.301  12.399  12.414  1.00 63.10 ? 147 LYS A HA   1  
ATOM 2322   H HB2  . LYS A 1 147 ? 0.094   15.066  12.709  1.00 63.32 ? 147 LYS A HB2  1  
ATOM 2323   H HB3  . LYS A 1 147 ? 0.736   13.660  11.871  1.00 10.43 ? 147 LYS A HB3  1  
ATOM 2324   H HG2  . LYS A 1 147 ? -0.625  13.937  10.065  1.00 30.32 ? 147 LYS A HG2  1  
ATOM 2325   H HG3  . LYS A 1 147 ? -1.901  14.712  11.006  1.00 43.41 ? 147 LYS A HG3  1  
ATOM 2326   H HD2  . LYS A 1 147 ? -0.527  16.733  11.193  1.00 53.22 ? 147 LYS A HD2  1  
ATOM 2327   H HD3  . LYS A 1 147 ? 0.742   15.956  10.245  1.00 63.53 ? 147 LYS A HD3  1  
ATOM 2328   H HE2  . LYS A 1 147 ? -0.291  17.066  8.559   1.00 44.34 ? 147 LYS A HE2  1  
ATOM 2329   H HE3  . LYS A 1 147 ? -1.293  15.616  8.559   1.00 21.22 ? 147 LYS A HE3  1  
ATOM 2330   H HZ1  . LYS A 1 147 ? -2.669  16.990  10.277  1.00 2.51  ? 147 LYS A HZ1  1  
ATOM 2331   H HZ2  . LYS A 1 147 ? -2.874  17.244  8.617   1.00 71.34 ? 147 LYS A HZ2  1  
ATOM 2332   H HZ3  . LYS A 1 147 ? -1.927  18.312  9.525   1.00 5.43  ? 147 LYS A HZ3  1  
ATOM 2333   N N    . ARG A 1 148 ? -0.984  12.125  15.118  1.00 41.41 ? 148 ARG A N    1  
ATOM 2334   C CA   . ARG A 1 148 ? -0.381  11.651  16.358  1.00 43.50 ? 148 ARG A CA   1  
ATOM 2335   C C    . ARG A 1 148 ? -0.667  10.168  16.569  1.00 61.53 ? 148 ARG A C    1  
ATOM 2336   O O    . ARG A 1 148 ? -1.821  9.740   16.561  1.00 34.21 ? 148 ARG A O    1  
ATOM 2337   C CB   . ARG A 1 148 ? -0.907  12.458  17.546  1.00 21.01 ? 148 ARG A CB   1  
ATOM 2338   C CG   . ARG A 1 148 ? -0.262  13.828  17.684  1.00 20.20 ? 148 ARG A CG   1  
ATOM 2339   C CD   . ARG A 1 148 ? -1.095  14.751  18.559  1.00 75.44 ? 148 ARG A CD   1  
ATOM 2340   N NE   . ARG A 1 148 ? -0.262  15.592  19.415  1.00 30.12 ? 148 ARG A NE   1  
ATOM 2341   C CZ   . ARG A 1 148 ? -0.724  16.271  20.463  1.00 4.10  ? 148 ARG A CZ   1  
ATOM 2342   N NH1  . ARG A 1 148 ? -2.010  16.211  20.787  1.00 25.24 ? 148 ARG A NH1  1  
ATOM 2343   N NH2  . ARG A 1 148 ? 0.101   17.012  21.189  1.00 40.21 ? 148 ARG A NH2  1  
ATOM 2344   H H    . ARG A 1 148 ? -1.919  11.904  14.925  1.00 65.21 ? 148 ARG A H    1  
ATOM 2345   H HA   . ARG A 1 148 ? 0.686   11.792  16.282  1.00 73.13 ? 148 ARG A HA   1  
ATOM 2346   H HB2  . ARG A 1 148 ? -1.972  12.596  17.430  1.00 32.42 ? 148 ARG A HB2  1  
ATOM 2347   H HB3  . ARG A 1 148 ? -0.722  11.903  18.454  1.00 64.23 ? 148 ARG A HB3  1  
ATOM 2348   H HG2  . ARG A 1 148 ? 0.715   13.711  18.130  1.00 51.12 ? 148 ARG A HG2  1  
ATOM 2349   H HG3  . ARG A 1 148 ? -0.162  14.268  16.703  1.00 13.04 ? 148 ARG A HG3  1  
ATOM 2350   H HD2  . ARG A 1 148 ? -1.695  15.384  17.923  1.00 73.50 ? 148 ARG A HD2  1  
ATOM 2351   H HD3  . ARG A 1 148 ? -1.742  14.150  19.181  1.00 41.14 ? 148 ARG A HD3  1  
ATOM 2352   H HE   . ARG A 1 148 ? 0.691   15.655  19.198  1.00 15.40 ? 148 ARG A HE   1  
ATOM 2353   H HH11 . ARG A 1 148 ? -2.638  15.654  20.244  1.00 44.42 ? 148 ARG A HH11 1  
ATOM 2354   H HH12 . ARG A 1 148 ? -2.351  16.723  21.575  1.00 45.51 ? 148 ARG A HH12 1  
ATOM 2355   H HH21 . ARG A 1 148 ? 1.071   17.061  20.950  1.00 64.33 ? 148 ARG A HH21 1  
ATOM 2356   H HH22 . ARG A 1 148 ? -0.246  17.522  21.976  1.00 53.25 ? 148 ARG A HH22 1  
ATOM 2357   N N    . PHE A 1 149 ? 0.392   9.387   16.759  1.00 62.43 ? 149 PHE A N    1  
ATOM 2358   C CA   . PHE A 1 149 ? 0.255   7.951   16.973  1.00 2.24  ? 149 PHE A CA   1  
ATOM 2359   C C    . PHE A 1 149 ? 0.927   7.529   18.276  1.00 55.32 ? 149 PHE A C    1  
ATOM 2360   O O    . PHE A 1 149 ? 1.708   8.283   18.856  1.00 13.40 ? 149 PHE A O    1  
ATOM 2361   C CB   . PHE A 1 149 ? 0.860   7.179   15.798  1.00 4.41  ? 149 PHE A CB   1  
ATOM 2362   C CG   . PHE A 1 149 ? -0.161  6.700   14.806  1.00 62.41 ? 149 PHE A CG   1  
ATOM 2363   C CD1  . PHE A 1 149 ? -0.944  5.590   15.080  1.00 31.30 ? 149 PHE A CD1  1  
ATOM 2364   C CD2  . PHE A 1 149 ? -0.339  7.359   13.600  1.00 15.32 ? 149 PHE A CD2  1  
ATOM 2365   C CE1  . PHE A 1 149 ? -1.884  5.146   14.170  1.00 34.11 ? 149 PHE A CE1  1  
ATOM 2366   C CE2  . PHE A 1 149 ? -1.277  6.920   12.686  1.00 20.11 ? 149 PHE A CE2  1  
ATOM 2367   C CZ   . PHE A 1 149 ? -2.051  5.812   12.971  1.00 22.11 ? 149 PHE A CZ   1  
ATOM 2368   H H    . PHE A 1 149 ? 1.287   9.786   16.755  1.00 3.24  ? 149 PHE A H    1  
ATOM 2369   H HA   . PHE A 1 149 ? -0.799  7.724   17.036  1.00 73.02 ? 149 PHE A HA   1  
ATOM 2370   H HB2  . PHE A 1 149 ? 1.554   7.820   15.275  1.00 33.15 ? 149 PHE A HB2  1  
ATOM 2371   H HB3  . PHE A 1 149 ? 1.389   6.316   16.175  1.00 31.25 ? 149 PHE A HB3  1  
ATOM 2372   H HD1  . PHE A 1 149 ? -0.815  5.068   16.017  1.00 40.02 ? 149 PHE A HD1  1  
ATOM 2373   H HD2  . PHE A 1 149 ? 0.266   8.226   13.376  1.00 51.22 ? 149 PHE A HD2  1  
ATOM 2374   H HE1  . PHE A 1 149 ? -2.488  4.279   14.395  1.00 62.33 ? 149 PHE A HE1  1  
ATOM 2375   H HE2  . PHE A 1 149 ? -1.406  7.443   11.750  1.00 20.21 ? 149 PHE A HE2  1  
ATOM 2376   H HZ   . PHE A 1 149 ? -2.786  5.467   12.258  1.00 63.14 ? 149 PHE A HZ   1  
ATOM 2377   N N    . SER A 1 150 ? 0.618   6.319   18.730  1.00 71.33 ? 150 SER A N    1  
ATOM 2378   C CA   . SER A 1 150 ? 1.193   5.796   19.964  1.00 22.53 ? 150 SER A CA   1  
ATOM 2379   C C    . SER A 1 150 ? 2.305   4.796   19.666  1.00 64.43 ? 150 SER A C    1  
ATOM 2380   O O    . SER A 1 150 ? 2.414   4.288   18.550  1.00 43.14 ? 150 SER A O    1  
ATOM 2381   C CB   . SER A 1 150 ? 0.108   5.132   20.815  1.00 22.44 ? 150 SER A CB   1  
ATOM 2382   O OG   . SER A 1 150 ? 0.320   5.378   22.195  1.00 53.42 ? 150 SER A OG   1  
ATOM 2383   H H    . SER A 1 150 ? -0.011  5.764   18.223  1.00 65.22 ? 150 SER A H    1  
ATOM 2384   H HA   . SER A 1 150 ? 1.610   6.627   20.513  1.00 62.43 ? 150 SER A HA   1  
ATOM 2385   H HB2  . SER A 1 150 ? -0.857  5.527   20.536  1.00 64.11 ? 150 SER A HB2  1  
ATOM 2386   H HB3  . SER A 1 150 ? 0.124   4.066   20.645  1.00 62.10 ? 150 SER A HB3  1  
ATOM 2387   H HG   . SER A 1 150 ? 0.869   4.683   22.564  1.00 72.32 ? 150 SER A HG   1  
ATOM 2388   N N    . ARG A 1 151 ? 3.128   4.517   20.671  1.00 73.44 ? 151 ARG A N    1  
ATOM 2389   C CA   . ARG A 1 151 ? 4.232   3.577   20.517  1.00 12.24 ? 151 ARG A CA   1  
ATOM 2390   C C    . ARG A 1 151 ? 3.713   2.159   20.301  1.00 33.02 ? 151 ARG A C    1  
ATOM 2391   O O    . ARG A 1 151 ? 4.272   1.396   19.513  1.00 3.40  ? 151 ARG A O    1  
ATOM 2392   C CB   . ARG A 1 151 ? 5.141   3.619   21.747  1.00 52.44 ? 151 ARG A CB   1  
ATOM 2393   C CG   . ARG A 1 151 ? 5.878   4.937   21.915  1.00 21.14 ? 151 ARG A CG   1  
ATOM 2394   C CD   . ARG A 1 151 ? 5.154   5.861   22.882  1.00 32.15 ? 151 ARG A CD   1  
ATOM 2395   N NE   . ARG A 1 151 ? 4.334   6.849   22.186  1.00 62.05 ? 151 ARG A NE   1  
ATOM 2396   C CZ   . ARG A 1 151 ? 3.874   7.962   22.752  1.00 50.33 ? 151 ARG A CZ   1  
ATOM 2397   N NH1  . ARG A 1 151 ? 4.150   8.232   24.022  1.00 13.44 ? 151 ARG A NH1  1  
ATOM 2398   N NH2  . ARG A 1 151 ? 3.135   8.808   22.048  1.00 33.33 ? 151 ARG A NH2  1  
ATOM 2399   H H    . ARG A 1 151 ? 2.990   4.954   21.538  1.00 51.34 ? 151 ARG A H    1  
ATOM 2400   H HA   . ARG A 1 151 ? 4.802   3.875   19.649  1.00 10.03 ? 151 ARG A HA   1  
ATOM 2401   H HB2  . ARG A 1 151 ? 4.541   3.451   22.629  1.00 71.24 ? 151 ARG A HB2  1  
ATOM 2402   H HB3  . ARG A 1 151 ? 5.874   2.829   21.665  1.00 41.12 ? 151 ARG A HB3  1  
ATOM 2403   H HG2  . ARG A 1 151 ? 6.868   4.739   22.295  1.00 4.44  ? 151 ARG A HG2  1  
ATOM 2404   H HG3  . ARG A 1 151 ? 5.950   5.423   20.952  1.00 20.21 ? 151 ARG A HG3  1  
ATOM 2405   H HD2  . ARG A 1 151 ? 4.519   5.265   23.520  1.00 23.31 ? 151 ARG A HD2  1  
ATOM 2406   H HD3  . ARG A 1 151 ? 5.888   6.375   23.485  1.00 1.43  ? 151 ARG A HD3  1  
ATOM 2407   H HE   . ARG A 1 151 ? 4.114   6.674   21.247  1.00 50.52 ? 151 ARG A HE   1  
ATOM 2408   H HH11 . ARG A 1 151 ? 4.707   7.598   24.559  1.00 63.13 ? 151 ARG A HH11 1  
ATOM 2409   H HH12 . ARG A 1 151 ? 3.802   9.070   24.442  1.00 33.15 ? 151 ARG A HH12 1  
ATOM 2410   H HH21 . ARG A 1 151 ? 2.923   8.609   21.091  1.00 31.03 ? 151 ARG A HH21 1  
ATOM 2411   H HH22 . ARG A 1 151 ? 2.788   9.644   22.473  1.00 74.40 ? 151 ARG A HH22 1  
ATOM 2412   N N    . LYS A 1 152 ? 2.642   1.814   21.007  1.00 21.22 ? 152 LYS A N    1  
ATOM 2413   C CA   . LYS A 1 152 ? 2.047   0.487   20.893  1.00 32.30 ? 152 LYS A CA   1  
ATOM 2414   C C    . LYS A 1 152 ? 1.316   0.331   19.564  1.00 43.32 ? 152 LYS A C    1  
ATOM 2415   O O    . LYS A 1 152 ? 1.248   -0.765  19.006  1.00 1.21  ? 152 LYS A O    1  
ATOM 2416   C CB   . LYS A 1 152 ? 1.081   0.237   22.052  1.00 44.51 ? 152 LYS A CB   1  
ATOM 2417   C CG   . LYS A 1 152 ? -0.056  1.244   22.125  1.00 54.31 ? 152 LYS A CG   1  
ATOM 2418   C CD   . LYS A 1 152 ? -0.458  1.526   23.564  1.00 22.14 ? 152 LYS A CD   1  
ATOM 2419   C CE   . LYS A 1 152 ? -1.963  1.699   23.697  1.00 40.01 ? 152 LYS A CE   1  
ATOM 2420   N NZ   . LYS A 1 152 ? -2.455  1.269   25.035  1.00 71.51 ? 152 LYS A NZ   1  
ATOM 2421   H H    . LYS A 1 152 ? 2.241   2.466   21.619  1.00 22.13 ? 152 LYS A H    1  
ATOM 2422   H HA   . LYS A 1 152 ? 2.845   -0.239  20.939  1.00 24.54 ? 152 LYS A HA   1  
ATOM 2423   H HB2  . LYS A 1 152 ? 0.653   -0.749  21.943  1.00 73.55 ? 152 LYS A HB2  1  
ATOM 2424   H HB3  . LYS A 1 152 ? 1.631   0.280   22.980  1.00 60.50 ? 152 LYS A HB3  1  
ATOM 2425   H HG2  . LYS A 1 152 ? 0.264   2.167   21.664  1.00 30.33 ? 152 LYS A HG2  1  
ATOM 2426   H HG3  . LYS A 1 152 ? -0.908  0.849   21.592  1.00 64.45 ? 152 LYS A HG3  1  
ATOM 2427   H HD2  . LYS A 1 152 ? -0.145  0.699   24.184  1.00 21.40 ? 152 LYS A HD2  1  
ATOM 2428   H HD3  . LYS A 1 152 ? 0.030   2.431   23.893  1.00 31.12 ? 152 LYS A HD3  1  
ATOM 2429   H HE2  . LYS A 1 152 ? -2.207  2.740   23.551  1.00 11.14 ? 152 LYS A HE2  1  
ATOM 2430   H HE3  . LYS A 1 152 ? -2.449  1.106   22.937  1.00 63.30 ? 152 LYS A HE3  1  
ATOM 2431   H HZ1  . LYS A 1 152 ? -1.785  1.566   25.774  1.00 43.12 ? 152 LYS A HZ1  1  
ATOM 2432   H HZ2  . LYS A 1 152 ? -2.550  0.234   25.066  1.00 22.14 ? 152 LYS A HZ2  1  
ATOM 2433   H HZ3  . LYS A 1 152 ? -3.382  1.698   25.230  1.00 71.14 ? 152 LYS A HZ3  1  
ATOM 2434   N N    . THR A 1 153 ? 0.770   1.433   19.061  1.00 25.53 ? 153 THR A N    1  
ATOM 2435   C CA   . THR A 1 153 ? 0.043   1.418   17.797  1.00 43.32 ? 153 THR A CA   1  
ATOM 2436   C C    . THR A 1 153 ? 0.999   1.241   16.622  1.00 65.03 ? 153 THR A C    1  
ATOM 2437   O O    . THR A 1 153 ? 0.807   0.365   15.778  1.00 23.34 ? 153 THR A O    1  
ATOM 2438   C CB   . THR A 1 153 ? -0.756  2.711   17.628  1.00 14.53 ? 153 THR A CB   1  
ATOM 2439   O OG1  . THR A 1 153 ? 0.004   3.829   18.052  1.00 32.24 ? 153 THR A OG1  1  
ATOM 2440   C CG2  . THR A 1 153 ? -2.054  2.718   18.405  1.00 12.32 ? 153 THR A CG2  1  
ATOM 2441   H H    . THR A 1 153 ? 0.857   2.277   19.552  1.00 75.45 ? 153 THR A H    1  
ATOM 2442   H HA   . THR A 1 153 ? -0.641  0.583   17.818  1.00 64.11 ? 153 THR A HA   1  
ATOM 2443   H HB   . THR A 1 153 ? -0.996  2.841   16.582  1.00 14.33 ? 153 THR A HB   1  
ATOM 2444   H HG1  . THR A 1 153 ? 0.626   4.074   17.362  1.00 52.33 ? 153 THR A HG1  1  
ATOM 2445   H HG21 . THR A 1 153 ? -1.874  2.365   19.410  1.00 1.02  ? 153 THR A HG21 1  
ATOM 2446   H HG22 . THR A 1 153 ? -2.769  2.071   17.919  1.00 22.23 ? 153 THR A HG22 1  
ATOM 2447   H HG23 . THR A 1 153 ? -2.446  3.724   18.443  1.00 22.41 ? 153 THR A HG23 1  
ATOM 2448   N N    . VAL A 1 154 ? 2.030   2.078   16.572  1.00 53.02 ? 154 VAL A N    1  
ATOM 2449   C CA   . VAL A 1 154 ? 3.016   2.014   15.500  1.00 40.14 ? 154 VAL A CA   1  
ATOM 2450   C C    . VAL A 1 154 ? 3.707   0.655   15.470  1.00 22.43 ? 154 VAL A C    1  
ATOM 2451   O O    . VAL A 1 154 ? 3.757   -0.004  14.432  1.00 11.15 ? 154 VAL A O    1  
ATOM 2452   C CB   . VAL A 1 154 ? 4.082   3.117   15.650  1.00 72.24 ? 154 VAL A CB   1  
ATOM 2453   C CG1  . VAL A 1 154 ? 5.012   3.131   14.446  1.00 64.03 ? 154 VAL A CG1  1  
ATOM 2454   C CG2  . VAL A 1 154 ? 3.424   4.476   15.841  1.00 34.13 ? 154 VAL A CG2  1  
ATOM 2455   H H    . VAL A 1 154 ? 2.130   2.756   17.273  1.00 73.43 ? 154 VAL A H    1  
ATOM 2456   H HA   . VAL A 1 154 ? 2.500   2.166   14.563  1.00 43.23 ? 154 VAL A HA   1  
ATOM 2457   H HB   . VAL A 1 154 ? 4.673   2.901   16.529  1.00 23.44 ? 154 VAL A HB   1  
ATOM 2458   H HG11 . VAL A 1 154 ? 5.646   2.257   14.471  1.00 15.41 ? 154 VAL A HG11 1  
ATOM 2459   H HG12 . VAL A 1 154 ? 5.623   4.021   14.474  1.00 20.30 ? 154 VAL A HG12 1  
ATOM 2460   H HG13 . VAL A 1 154 ? 4.426   3.125   13.539  1.00 61.00 ? 154 VAL A HG13 1  
ATOM 2461   H HG21 . VAL A 1 154 ? 2.384   4.341   16.097  1.00 32.43 ? 154 VAL A HG21 1  
ATOM 2462   H HG22 . VAL A 1 154 ? 3.498   5.044   14.924  1.00 71.44 ? 154 VAL A HG22 1  
ATOM 2463   H HG23 . VAL A 1 154 ? 3.924   5.010   16.635  1.00 1.12  ? 154 VAL A HG23 1  
ATOM 2464   N N    . LEU A 1 155 ? 4.238   0.241   16.616  1.00 45.15 ? 155 LEU A N    1  
ATOM 2465   C CA   . LEU A 1 155 ? 4.926   -1.041  16.721  1.00 3.33  ? 155 LEU A CA   1  
ATOM 2466   C C    . LEU A 1 155 ? 3.991   -2.192  16.362  1.00 73.24 ? 155 LEU A C    1  
ATOM 2467   O O    . LEU A 1 155 ? 4.424   -3.211  15.825  1.00 33.11 ? 155 LEU A O    1  
ATOM 2468   C CB   . LEU A 1 155 ? 5.475   -1.235  18.136  1.00 23.21 ? 155 LEU A CB   1  
ATOM 2469   C CG   . LEU A 1 155 ? 6.891   -0.702  18.360  1.00 62.44 ? 155 LEU A CG   1  
ATOM 2470   C CD1  . LEU A 1 155 ? 6.850   0.751   18.808  1.00 5.53  ? 155 LEU A CD1  1  
ATOM 2471   C CD2  . LEU A 1 155 ? 7.625   -1.557  19.383  1.00 2.21  ? 155 LEU A CD2  1  
ATOM 2472   H H    . LEU A 1 155 ? 4.165   0.811   17.410  1.00 61.13 ? 155 LEU A H    1  
ATOM 2473   H HA   . LEU A 1 155 ? 5.750   -1.032  16.023  1.00 5.13  ? 155 LEU A HA   1  
ATOM 2474   H HB2  . LEU A 1 155 ? 4.811   -0.737  18.828  1.00 51.04 ? 155 LEU A HB2  1  
ATOM 2475   H HB3  . LEU A 1 155 ? 5.473   -2.291  18.359  1.00 50.22 ? 155 LEU A HB3  1  
ATOM 2476   H HG   . LEU A 1 155 ? 7.438   -0.749  17.430  1.00 24.22 ? 155 LEU A HG   1  
ATOM 2477   H HD11 . LEU A 1 155 ? 6.240   1.321   18.124  1.00 45.34 ? 155 LEU A HD11 1  
ATOM 2478   H HD12 . LEU A 1 155 ? 7.852   1.153   18.818  1.00 15.33 ? 155 LEU A HD12 1  
ATOM 2479   H HD13 . LEU A 1 155 ? 6.428   0.810   19.801  1.00 21.14 ? 155 LEU A HD13 1  
ATOM 2480   H HD21 . LEU A 1 155 ? 8.207   -2.309  18.871  1.00 3.41  ? 155 LEU A HD21 1  
ATOM 2481   H HD22 . LEU A 1 155 ? 6.908   -2.036  20.033  1.00 31.30 ? 155 LEU A HD22 1  
ATOM 2482   H HD23 . LEU A 1 155 ? 8.282   -0.932  19.970  1.00 73.41 ? 155 LEU A HD23 1  
ATOM 2483   N N    . GLN A 1 156 ? 2.708   -2.021  16.663  1.00 61.32 ? 156 GLN A N    1  
ATOM 2484   C CA   . GLN A 1 156 ? 1.712   -3.046  16.372  1.00 2.33  ? 156 GLN A CA   1  
ATOM 2485   C C    . GLN A 1 156 ? 1.631   -3.314  14.872  1.00 2.35  ? 156 GLN A C    1  
ATOM 2486   O O    . GLN A 1 156 ? 1.516   -4.462  14.443  1.00 3.33  ? 156 GLN A O    1  
ATOM 2487   C CB   . GLN A 1 156 ? 0.342   -2.620  16.903  1.00 21.31 ? 156 GLN A CB   1  
ATOM 2488   C CG   . GLN A 1 156 ? 0.035   -3.155  18.292  1.00 21.12 ? 156 GLN A CG   1  
ATOM 2489   C CD   . GLN A 1 156 ? -0.270  -4.640  18.289  1.00 12.22 ? 156 GLN A CD   1  
ATOM 2490   O OE1  . GLN A 1 156 ? -0.159  -5.307  17.261  1.00 70.23 ? 156 GLN A OE1  1  
ATOM 2491   N NE2  . GLN A 1 156 ? -0.657  -5.167  19.446  1.00 71.32 ? 156 GLN A NE2  1  
ATOM 2492   H H    . GLN A 1 156 ? 2.424   -1.186  17.091  1.00 51.15 ? 156 GLN A H    1  
ATOM 2493   H HA   . GLN A 1 156 ? 2.016   -3.953  16.872  1.00 4.10  ? 156 GLN A HA   1  
ATOM 2494   H HB2  . GLN A 1 156 ? 0.302   -1.541  16.939  1.00 11.21 ? 156 GLN A HB2  1  
ATOM 2495   H HB3  . GLN A 1 156 ? -0.421  -2.977  16.226  1.00 21.04 ? 156 GLN A HB3  1  
ATOM 2496   H HG2  . GLN A 1 156 ? 0.889   -2.980  18.928  1.00 23.34 ? 156 GLN A HG2  1  
ATOM 2497   H HG3  . GLN A 1 156 ? -0.821  -2.627  18.686  1.00 32.42 ? 156 GLN A HG3  1  
ATOM 2498   H HE21 . GLN A 1 156 ? -0.724  -4.575  20.224  1.00 41.41 ? 156 GLN A HE21 1  
ATOM 2499   H HE22 . GLN A 1 156 ? -0.861  -6.125  19.473  1.00 54.44 ? 156 GLN A HE22 1  
ATOM 2500   N N    . LEU A 1 157 ? 1.691   -2.248  14.081  1.00 53.33 ? 157 LEU A N    1  
ATOM 2501   C CA   . LEU A 1 157 ? 1.624   -2.370  12.630  1.00 3.24  ? 157 LEU A CA   1  
ATOM 2502   C C    . LEU A 1 157 ? 2.925   -2.938  12.071  1.00 2.40  ? 157 LEU A C    1  
ATOM 2503   O O    . LEU A 1 157 ? 2.912   -3.788  11.181  1.00 72.31 ? 157 LEU A O    1  
ATOM 2504   C CB   . LEU A 1 157 ? 1.334   -1.009  11.995  1.00 1.41  ? 157 LEU A CB   1  
ATOM 2505   C CG   . LEU A 1 157 ? -0.069  -0.458  12.258  1.00 21.41 ? 157 LEU A CG   1  
ATOM 2506   C CD1  . LEU A 1 157 ? -0.041  1.060   12.337  1.00 51.20 ? 157 LEU A CD1  1  
ATOM 2507   C CD2  . LEU A 1 157 ? -1.033  -0.920  11.175  1.00 70.31 ? 157 LEU A CD2  1  
ATOM 2508   H H    . LEU A 1 157 ? 1.783   -1.359  14.481  1.00 52.11 ? 157 LEU A H    1  
ATOM 2509   H HA   . LEU A 1 157 ? 0.818   -3.048  12.391  1.00 11.14 ? 157 LEU A HA   1  
ATOM 2510   H HB2  . LEU A 1 157 ? 2.054   -0.298  12.374  1.00 31.22 ? 157 LEU A HB2  1  
ATOM 2511   H HB3  . LEU A 1 157 ? 1.467   -1.097  10.928  1.00 62.31 ? 157 LEU A HB3  1  
ATOM 2512   H HG   . LEU A 1 157 ? -0.425  -0.835  13.206  1.00 73.24 ? 157 LEU A HG   1  
ATOM 2513   H HD11 . LEU A 1 157 ? -0.787  1.398   13.040  1.00 24.55 ? 157 LEU A HD11 1  
ATOM 2514   H HD12 . LEU A 1 157 ? -0.250  1.475   11.362  1.00 10.13 ? 157 LEU A HD12 1  
ATOM 2515   H HD13 . LEU A 1 157 ? 0.936   1.385   12.664  1.00 42.11 ? 157 LEU A HD13 1  
ATOM 2516   H HD21 . LEU A 1 157 ? -0.681  -0.582  10.212  1.00 61.11 ? 157 LEU A HD21 1  
ATOM 2517   H HD22 . LEU A 1 157 ? -2.013  -0.507  11.365  1.00 33.42 ? 157 LEU A HD22 1  
ATOM 2518   H HD23 . LEU A 1 157 ? -1.090  -1.999  11.180  1.00 33.53 ? 157 LEU A HD23 1  
ATOM 2519   N N    . SER A 1 158 ? 4.049   -2.462  12.600  1.00 41.31 ? 158 SER A N    1  
ATOM 2520   C CA   . SER A 1 158 ? 5.361   -2.920  12.156  1.00 34.02 ? 158 SER A CA   1  
ATOM 2521   C C    . SER A 1 158 ? 5.450   -4.444  12.186  1.00 54.13 ? 158 SER A C    1  
ATOM 2522   O O    . SER A 1 158 ? 6.168   -5.050  11.390  1.00 11.40 ? 158 SER A O    1  
ATOM 2523   C CB   . SER A 1 158 ? 6.459   -2.318  13.034  1.00 51.00 ? 158 SER A CB   1  
ATOM 2524   O OG   . SER A 1 158 ? 7.734   -2.468  12.433  1.00 71.33 ? 158 SER A OG   1  
ATOM 2525   H H    . SER A 1 158 ? 3.994   -1.784  13.307  1.00 32.31 ? 158 SER A H    1  
ATOM 2526   H HA   . SER A 1 158 ? 5.502   -2.584  11.139  1.00 24.14 ? 158 SER A HA   1  
ATOM 2527   H HB2  . SER A 1 158 ? 6.265   -1.265  13.178  1.00 35.22 ? 158 SER A HB2  1  
ATOM 2528   H HB3  . SER A 1 158 ? 6.465   -2.817  13.992  1.00 61.45 ? 158 SER A HB3  1  
ATOM 2529   H HG   . SER A 1 158 ? 8.417   -2.317  13.090  1.00 72.32 ? 158 SER A HG   1  
ATOM 2530   N N    . LEU A 1 159 ? 4.714   -5.056  13.108  1.00 43.03 ? 159 LEU A N    1  
ATOM 2531   C CA   . LEU A 1 159 ? 4.708   -6.508  13.240  1.00 2.12  ? 159 LEU A CA   1  
ATOM 2532   C C    . LEU A 1 159 ? 3.800   -7.144  12.191  1.00 35.11 ? 159 LEU A C    1  
ATOM 2533   O O    . LEU A 1 159 ? 4.144   -8.165  11.596  1.00 44.54 ? 159 LEU A O    1  
ATOM 2534   C CB   . LEU A 1 159 ? 4.248   -6.912  14.642  1.00 73.44 ? 159 LEU A CB   1  
ATOM 2535   C CG   . LEU A 1 159 ? 4.958   -6.189  15.789  1.00 32.33 ? 159 LEU A CG   1  
ATOM 2536   C CD1  . LEU A 1 159 ? 3.994   -5.934  16.937  1.00 44.21 ? 159 LEU A CD1  1  
ATOM 2537   C CD2  . LEU A 1 159 ? 6.155   -6.997  16.265  1.00 43.14 ? 159 LEU A CD2  1  
ATOM 2538   H H    . LEU A 1 159 ? 4.161   -4.519  13.712  1.00 34.24 ? 159 LEU A H    1  
ATOM 2539   H HA   . LEU A 1 159 ? 5.717   -6.859  13.086  1.00 51.22 ? 159 LEU A HA   1  
ATOM 2540   H HB2  . LEU A 1 159 ? 3.188   -6.716  14.720  1.00 54.31 ? 159 LEU A HB2  1  
ATOM 2541   H HB3  . LEU A 1 159 ? 4.410   -7.972  14.760  1.00 3.33  ? 159 LEU A HB3  1  
ATOM 2542   H HG   . LEU A 1 159 ? 5.317   -5.234  15.436  1.00 3.40  ? 159 LEU A HG   1  
ATOM 2543   H HD11 . LEU A 1 159 ? 3.887   -6.834  17.524  1.00 21.41 ? 159 LEU A HD11 1  
ATOM 2544   H HD12 . LEU A 1 159 ? 3.031   -5.645  16.542  1.00 72.23 ? 159 LEU A HD12 1  
ATOM 2545   H HD13 . LEU A 1 159 ? 4.379   -5.141  17.561  1.00 60.30 ? 159 LEU A HD13 1  
ATOM 2546   H HD21 . LEU A 1 159 ? 6.954   -6.326  16.545  1.00 72.31 ? 159 LEU A HD21 1  
ATOM 2547   H HD22 . LEU A 1 159 ? 6.492   -7.645  15.470  1.00 1.33  ? 159 LEU A HD22 1  
ATOM 2548   H HD23 . LEU A 1 159 ? 5.870   -7.594  17.119  1.00 32.01 ? 159 LEU A HD23 1  
ATOM 2549   N N    . ARG A 1 160 ? 2.641   -6.532  11.971  1.00 43.53 ? 160 ARG A N    1  
ATOM 2550   C CA   . ARG A 1 160 ? 1.684   -7.038  10.994  1.00 11.35 ? 160 ARG A CA   1  
ATOM 2551   C C    . ARG A 1 160 ? 2.205   -6.849  9.572   1.00 10.02 ? 160 ARG A C    1  
ATOM 2552   O O    . ARG A 1 160 ? 2.043   -7.723  8.720   1.00 40.03 ? 160 ARG A O    1  
ATOM 2553   C CB   . ARG A 1 160 ? 0.338   -6.329  11.153  1.00 14.30 ? 160 ARG A CB   1  
ATOM 2554   C CG   . ARG A 1 160 ? -0.294  -6.523  12.522  1.00 11.23 ? 160 ARG A CG   1  
ATOM 2555   C CD   . ARG A 1 160 ? -1.373  -7.594  12.492  1.00 52.21 ? 160 ARG A CD   1  
ATOM 2556   N NE   . ARG A 1 160 ? -2.241  -7.530  13.665  1.00 20.33 ? 160 ARG A NE   1  
ATOM 2557   C CZ   . ARG A 1 160 ? -3.445  -8.093  13.728  1.00 24.42 ? 160 ARG A CZ   1  
ATOM 2558   N NH1  . ARG A 1 160 ? -3.928  -8.762  12.687  1.00 32.43 ? 160 ARG A NH1  1  
ATOM 2559   N NH2  . ARG A 1 160 ? -4.170  -7.987  14.833  1.00 65.10 ? 160 ARG A NH2  1  
ATOM 2560   H H    . ARG A 1 160 ? 2.425   -5.721  12.477  1.00 41.44 ? 160 ARG A H    1  
ATOM 2561   H HA   . ARG A 1 160 ? 1.549   -8.093  11.178  1.00 21.42 ? 160 ARG A HA   1  
ATOM 2562   H HB2  . ARG A 1 160 ? 0.480   -5.270  10.993  1.00 2.41  ? 160 ARG A HB2  1  
ATOM 2563   H HB3  . ARG A 1 160 ? -0.346  -6.708  10.408  1.00 42.50 ? 160 ARG A HB3  1  
ATOM 2564   H HG2  . ARG A 1 160 ? 0.472   -6.819  13.223  1.00 1.50  ? 160 ARG A HG2  1  
ATOM 2565   H HG3  . ARG A 1 160 ? -0.735  -5.590  12.840  1.00 64.43 ? 160 ARG A HG3  1  
ATOM 2566   H HD2  . ARG A 1 160 ? -1.973  -7.458  11.605  1.00 74.40 ? 160 ARG A HD2  1  
ATOM 2567   H HD3  . ARG A 1 160 ? -0.898  -8.564  12.459  1.00 65.54 ? 160 ARG A HD3  1  
ATOM 2568   H HE   . ARG A 1 160 ? -1.909  -7.043  14.448  1.00 24.21 ? 160 ARG A HE   1  
ATOM 2569   H HH11 . ARG A 1 160 ? -3.387  -8.846  11.851  1.00 31.21 ? 160 ARG A HH11 1  
ATOM 2570   H HH12 . ARG A 1 160 ? -4.834  -9.182  12.741  1.00 50.42 ? 160 ARG A HH12 1  
ATOM 2571   H HH21 . ARG A 1 160 ? -3.811  -7.485  15.620  1.00 32.32 ? 160 ARG A HH21 1  
ATOM 2572   H HH22 . ARG A 1 160 ? -5.075  -8.410  14.880  1.00 51.35 ? 160 ARG A HH22 1  
ATOM 2573   N N    . ILE A 1 161 ? 2.831   -5.703  9.323   1.00 22.24 ? 161 ILE A N    1  
ATOM 2574   C CA   . ILE A 1 161 ? 3.375   -5.401  8.005   1.00 51.54 ? 161 ILE A CA   1  
ATOM 2575   C C    . ILE A 1 161 ? 4.503   -6.362  7.643   1.00 14.24 ? 161 ILE A C    1  
ATOM 2576   O O    . ILE A 1 161 ? 4.639   -6.768  6.489   1.00 22.31 ? 161 ILE A O    1  
ATOM 2577   C CB   . ILE A 1 161 ? 3.902   -3.954  7.931   1.00 44.11 ? 161 ILE A CB   1  
ATOM 2578   C CG1  . ILE A 1 161 ? 2.821   -2.971  8.386   1.00 60.21 ? 161 ILE A CG1  1  
ATOM 2579   C CG2  . ILE A 1 161 ? 4.360   -3.625  6.517   1.00 23.54 ? 161 ILE A CG2  1  
ATOM 2580   C CD1  . ILE A 1 161 ? 3.375   -1.727  9.045   1.00 41.33 ? 161 ILE A CD1  1  
ATOM 2581   H H    . ILE A 1 161 ? 2.930   -5.046  10.043  1.00 61.24 ? 161 ILE A H    1  
ATOM 2582   H HA   . ILE A 1 161 ? 2.579   -5.510  7.283   1.00 35.21 ? 161 ILE A HA   1  
ATOM 2583   H HB   . ILE A 1 161 ? 4.754   -3.870  8.588   1.00 12.40 ? 161 ILE A HB   1  
ATOM 2584   H HG12 . ILE A 1 161 ? 2.241   -2.662  7.530   1.00 31.45 ? 161 ILE A HG12 1  
ATOM 2585   H HG13 . ILE A 1 161 ? 2.172   -3.463  9.096   1.00 50.33 ? 161 ILE A HG13 1  
ATOM 2586   H HG21 . ILE A 1 161 ? 4.993   -4.419  6.150   1.00 45.21 ? 161 ILE A HG21 1  
ATOM 2587   H HG22 . ILE A 1 161 ? 4.913   -2.698  6.525   1.00 42.51 ? 161 ILE A HG22 1  
ATOM 2588   H HG23 . ILE A 1 161 ? 3.498   -3.525  5.874   1.00 51.14 ? 161 ILE A HG23 1  
ATOM 2589   H HD11 . ILE A 1 161 ? 3.878   -1.998  9.962   1.00 32.24 ? 161 ILE A HD11 1  
ATOM 2590   H HD12 . ILE A 1 161 ? 2.566   -1.046  9.266   1.00 41.14 ? 161 ILE A HD12 1  
ATOM 2591   H HD13 . ILE A 1 161 ? 4.077   -1.248  8.378   1.00 75.22 ? 161 ILE A HD13 1  
ATOM 2592   N N    . LEU A 1 162 ? 5.310   -6.724  8.636   1.00 34.32 ? 162 LEU A N    1  
ATOM 2593   C CA   . LEU A 1 162 ? 6.425   -7.639  8.420   1.00 72.21 ? 162 LEU A CA   1  
ATOM 2594   C C    . LEU A 1 162 ? 5.937   -8.966  7.846   1.00 1.11  ? 162 LEU A C    1  
ATOM 2595   O O    . LEU A 1 162 ? 6.401   -9.409  6.796   1.00 70.14 ? 162 LEU A O    1  
ATOM 2596   C CB   . LEU A 1 162 ? 7.175   -7.882  9.731   1.00 4.54  ? 162 LEU A CB   1  
ATOM 2597   C CG   . LEU A 1 162 ? 8.172   -6.789  10.119  1.00 13.35 ? 162 LEU A CG   1  
ATOM 2598   C CD1  . LEU A 1 162 ? 8.541   -6.901  11.590  1.00 53.00 ? 162 LEU A CD1  1  
ATOM 2599   C CD2  . LEU A 1 162 ? 9.416   -6.871  9.248   1.00 4.34  ? 162 LEU A CD2  1  
ATOM 2600   H H    . LEU A 1 162 ? 5.151   -6.368  9.535   1.00 31.34 ? 162 LEU A H    1  
ATOM 2601   H HA   . LEU A 1 162 ? 7.098   -7.180  7.711   1.00 0.32  ? 162 LEU A HA   1  
ATOM 2602   H HB2  . LEU A 1 162 ? 6.448   -7.976  10.525  1.00 73.21 ? 162 LEU A HB2  1  
ATOM 2603   H HB3  . LEU A 1 162 ? 7.713   -8.815  9.647   1.00 34.23 ? 162 LEU A HB3  1  
ATOM 2604   H HG   . LEU A 1 162 ? 7.716   -5.823  9.962   1.00 32.10 ? 162 LEU A HG   1  
ATOM 2605   H HD11 . LEU A 1 162 ? 7.869   -6.292  12.177  1.00 3.23  ? 162 LEU A HD11 1  
ATOM 2606   H HD12 . LEU A 1 162 ? 9.555   -6.559  11.734  1.00 10.32 ? 162 LEU A HD12 1  
ATOM 2607   H HD13 . LEU A 1 162 ? 8.461   -7.931  11.904  1.00 33.11 ? 162 LEU A HD13 1  
ATOM 2608   H HD21 . LEU A 1 162 ? 10.001  -5.971  9.369   1.00 70.21 ? 162 LEU A HD21 1  
ATOM 2609   H HD22 . LEU A 1 162 ? 9.125   -6.974  8.213   1.00 12.33 ? 162 LEU A HD22 1  
ATOM 2610   H HD23 . LEU A 1 162 ? 10.007  -7.726  9.542   1.00 35.34 ? 162 LEU A HD23 1  
ATOM 2611   N N    . ASP A 1 163 ? 4.996   -9.594  8.544   1.00 54.24 ? 163 ASP A N    1  
ATOM 2612   C CA   . ASP A 1 163 ? 4.441   -10.871 8.105   1.00 13.30 ? 163 ASP A CA   1  
ATOM 2613   C C    . ASP A 1 163 ? 3.885   -10.765 6.688   1.00 75.14 ? 163 ASP A C    1  
ATOM 2614   O O    . ASP A 1 163 ? 4.080   -11.661 5.865   1.00 54.21 ? 163 ASP A O    1  
ATOM 2615   C CB   . ASP A 1 163 ? 3.340   -11.328 9.064   1.00 74.11 ? 163 ASP A CB   1  
ATOM 2616   C CG   . ASP A 1 163 ? 3.897   -11.959 10.325  1.00 31.14 ? 163 ASP A CG   1  
ATOM 2617   O OD1  . ASP A 1 163 ? 4.460   -11.220 11.160  1.00 13.52 ? 163 ASP A OD1  1  
ATOM 2618   O OD2  . ASP A 1 163 ? 3.771   -13.192 10.478  1.00 2.20  ? 163 ASP A OD2  1  
ATOM 2619   H H    . ASP A 1 163 ? 4.667   -9.189  9.374   1.00 32.54 ? 163 ASP A H    1  
ATOM 2620   H HA   . ASP A 1 163 ? 5.238   -11.598 8.113   1.00 23.32 ? 163 ASP A HA   1  
ATOM 2621   H HB2  . ASP A 1 163 ? 2.739   -10.477 9.345   1.00 52.42 ? 163 ASP A HB2  1  
ATOM 2622   H HB3  . ASP A 1 163 ? 2.716   -12.055 8.565   1.00 41.15 ? 163 ASP A HB3  1  
ATOM 2623   N N    . ILE A 1 164 ? 3.196   -9.664  6.409   1.00 41.23 ? 164 ILE A N    1  
ATOM 2624   C CA   . ILE A 1 164 ? 2.615   -9.440  5.091   1.00 52.24 ? 164 ILE A CA   1  
ATOM 2625   C C    . ILE A 1 164 ? 3.702   -9.237  4.041   1.00 51.45 ? 164 ILE A C    1  
ATOM 2626   O O    . ILE A 1 164 ? 3.572   -9.688  2.903   1.00 70.32 ? 164 ILE A O    1  
ATOM 2627   C CB   . ILE A 1 164 ? 1.676   -8.217  5.089   1.00 13.33 ? 164 ILE A CB   1  
ATOM 2628   C CG1  . ILE A 1 164 ? 0.653   -8.328  6.221   1.00 71.25 ? 164 ILE A CG1  1  
ATOM 2629   C CG2  . ILE A 1 164 ? 0.975   -8.087  3.745   1.00 64.42 ? 164 ILE A CG2  1  
ATOM 2630   C CD1  . ILE A 1 164 ? 0.184   -6.988  6.745   1.00 55.13 ? 164 ILE A CD1  1  
ATOM 2631   H H    . ILE A 1 164 ? 3.077   -8.985  7.105   1.00 33.00 ? 164 ILE A H    1  
ATOM 2632   H HA   . ILE A 1 164 ? 2.034   -10.313 4.830   1.00 41.24 ? 164 ILE A HA   1  
ATOM 2633   H HB   . ILE A 1 164 ? 2.275   -7.332  5.241   1.00 63.31 ? 164 ILE A HB   1  
ATOM 2634   H HG12 . ILE A 1 164 ? -0.213  -8.864  5.862   1.00 4.35  ? 164 ILE A HG12 1  
ATOM 2635   H HG13 . ILE A 1 164 ? 1.092   -8.872  7.044   1.00 3.22  ? 164 ILE A HG13 1  
ATOM 2636   H HG21 . ILE A 1 164 ? -0.018  -7.688  3.894   1.00 55.22 ? 164 ILE A HG21 1  
ATOM 2637   H HG22 . ILE A 1 164 ? 0.905   -9.059  3.280   1.00 63.43 ? 164 ILE A HG22 1  
ATOM 2638   H HG23 . ILE A 1 164 ? 1.538   -7.422  3.107   1.00 44.20 ? 164 ILE A HG23 1  
ATOM 2639   H HD11 . ILE A 1 164 ? 0.895   -6.224  6.467   1.00 72.31 ? 164 ILE A HD11 1  
ATOM 2640   H HD12 . ILE A 1 164 ? 0.104   -7.031  7.821   1.00 55.24 ? 164 ILE A HD12 1  
ATOM 2641   H HD13 . ILE A 1 164 ? -0.781  -6.753  6.321   1.00 43.14 ? 164 ILE A HD13 1  
ATOM 2642   N N    . LEU A 1 165 ? 4.775   -8.556  4.431   1.00 52.41 ? 165 LEU A N    1  
ATOM 2643   C CA   . LEU A 1 165 ? 5.885   -8.295  3.523   1.00 1.54  ? 165 LEU A CA   1  
ATOM 2644   C C    . LEU A 1 165 ? 6.547   -9.598  3.090   1.00 51.23 ? 165 LEU A C    1  
ATOM 2645   O O    . LEU A 1 165 ? 6.854   -9.790  1.913   1.00 44.03 ? 165 LEU A O    1  
ATOM 2646   C CB   . LEU A 1 165 ? 6.915   -7.382  4.191   1.00 13.11 ? 165 LEU A CB   1  
ATOM 2647   C CG   . LEU A 1 165 ? 6.663   -5.884  4.017   1.00 55.11 ? 165 LEU A CG   1  
ATOM 2648   C CD1  . LEU A 1 165 ? 7.302   -5.100  5.152   1.00 1.35  ? 165 LEU A CD1  1  
ATOM 2649   C CD2  . LEU A 1 165 ? 7.192   -5.408  2.673   1.00 61.25 ? 165 LEU A CD2  1  
ATOM 2650   H H    . LEU A 1 165 ? 4.823   -8.222  5.351   1.00 4.14  ? 165 LEU A H    1  
ATOM 2651   H HA   . LEU A 1 165 ? 5.490   -7.798  2.649   1.00 62.21 ? 165 LEU A HA   1  
ATOM 2652   H HB2  . LEU A 1 165 ? 6.929   -7.604  5.248   1.00 25.52 ? 165 LEU A HB2  1  
ATOM 2653   H HB3  . LEU A 1 165 ? 7.887   -7.610  3.780   1.00 55.42 ? 165 LEU A HB3  1  
ATOM 2654   H HG   . LEU A 1 165 ? 5.598   -5.700  4.043   1.00 31.13 ? 165 LEU A HG   1  
ATOM 2655   H HD11 . LEU A 1 165 ? 8.367   -5.030  4.986   1.00 43.10 ? 165 LEU A HD11 1  
ATOM 2656   H HD12 . LEU A 1 165 ? 7.117   -5.605  6.088   1.00 40.12 ? 165 LEU A HD12 1  
ATOM 2657   H HD13 . LEU A 1 165 ? 6.877   -4.108  5.188   1.00 13.00 ? 165 LEU A HD13 1  
ATOM 2658   H HD21 . LEU A 1 165 ? 8.254   -5.223  2.749   1.00 5.55  ? 165 LEU A HD21 1  
ATOM 2659   H HD22 . LEU A 1 165 ? 6.688   -4.496  2.390   1.00 34.54 ? 165 LEU A HD22 1  
ATOM 2660   H HD23 . LEU A 1 165 ? 7.011   -6.166  1.925   1.00 72.05 ? 165 LEU A HD23 1  
ATOM 2661   N N    . GLU A 1 166 ? 6.763   -10.493 4.049   1.00 55.11 ? 166 GLU A N    1  
ATOM 2662   C CA   . GLU A 1 166 ? 7.387   -11.781 3.766   1.00 70.33 ? 166 GLU A CA   1  
ATOM 2663   C C    . GLU A 1 166 ? 6.573   -12.564 2.742   1.00 10.54 ? 166 GLU A C    1  
ATOM 2664   O O    . GLU A 1 166 ? 7.128   -13.282 1.910   1.00 62.30 ? 166 GLU A O    1  
ATOM 2665   C CB   . GLU A 1 166 ? 7.529   -12.596 5.053   1.00 50.22 ? 166 GLU A CB   1  
ATOM 2666   C CG   . GLU A 1 166 ? 8.797   -13.433 5.106   1.00 34.04 ? 166 GLU A CG   1  
ATOM 2667   C CD   . GLU A 1 166 ? 8.703   -14.570 6.105   1.00 74.23 ? 166 GLU A CD   1  
ATOM 2668   O OE1  . GLU A 1 166 ? 8.042   -14.390 7.149   1.00 35.52 ? 166 GLU A OE1  1  
ATOM 2669   O OE2  . GLU A 1 166 ? 9.290   -15.640 5.842   1.00 53.12 ? 166 GLU A OE2  1  
ATOM 2670   H H    . GLU A 1 166 ? 6.495   -10.284 4.968   1.00 25.10 ? 166 GLU A H    1  
ATOM 2671   H HA   . GLU A 1 166 ? 8.369   -11.592 3.360   1.00 42.00 ? 166 GLU A HA   1  
ATOM 2672   H HB2  . GLU A 1 166 ? 7.534   -11.920 5.895   1.00 42.30 ? 166 GLU A HB2  1  
ATOM 2673   H HB3  . GLU A 1 166 ? 6.681   -13.260 5.140   1.00 5.44  ? 166 GLU A HB3  1  
ATOM 2674   H HG2  . GLU A 1 166 ? 8.980   -13.849 4.127   1.00 32.34 ? 166 GLU A HG2  1  
ATOM 2675   H HG3  . GLU A 1 166 ? 9.622   -12.795 5.385   1.00 34.12 ? 166 GLU A HG3  1  
ATOM 2676   N N    . TYR A 1 167 ? 5.253   -12.418 2.807   1.00 55.22 ? 167 TYR A N    1  
ATOM 2677   C CA   . TYR A 1 167 ? 4.360   -13.109 1.884   1.00 12.31 ? 167 TYR A CA   1  
ATOM 2678   C C    . TYR A 1 167 ? 4.667   -12.722 0.440   1.00 12.14 ? 167 TYR A C    1  
ATOM 2679   O O    . TYR A 1 167 ? 4.800   -13.584 -0.428  1.00 20.14 ? 167 TYR A O    1  
ATOM 2680   C CB   . TYR A 1 167 ? 2.902   -12.783 2.213   1.00 52.11 ? 167 TYR A CB   1  
ATOM 2681   C CG   . TYR A 1 167 ? 1.906   -13.475 1.310   1.00 22.31 ? 167 TYR A CG   1  
ATOM 2682   C CD1  . TYR A 1 167 ? 1.726   -13.061 -0.004  1.00 34.22 ? 167 TYR A CD1  1  
ATOM 2683   C CD2  . TYR A 1 167 ? 1.145   -14.542 1.771   1.00 40.24 ? 167 TYR A CD2  1  
ATOM 2684   C CE1  . TYR A 1 167 ? 0.816   -13.691 -0.832  1.00 11.02 ? 167 TYR A CE1  1  
ATOM 2685   C CE2  . TYR A 1 167 ? 0.234   -15.177 0.949   1.00 73.45 ? 167 TYR A CE2  1  
ATOM 2686   C CZ   . TYR A 1 167 ? 0.073   -14.748 -0.351  1.00 42.13 ? 167 TYR A CZ   1  
ATOM 2687   O OH   . TYR A 1 167 ? -0.833  -15.377 -1.173  1.00 43.23 ? 167 TYR A OH   1  
ATOM 2688   H H    . TYR A 1 167 ? 4.871   -11.830 3.492   1.00 34.34 ? 167 TYR A H    1  
ATOM 2689   H HA   . TYR A 1 167 ? 4.519   -14.170 2.002   1.00 62.20 ? 167 TYR A HA   1  
ATOM 2690   H HB2  . TYR A 1 167 ? 2.694   -13.086 3.229   1.00 12.23 ? 167 TYR A HB2  1  
ATOM 2691   H HB3  . TYR A 1 167 ? 2.749   -11.717 2.122   1.00 64.01 ? 167 TYR A HB3  1  
ATOM 2692   H HD1  . TYR A 1 167 ? 2.310   -12.233 -0.378  1.00 72.01 ? 167 TYR A HD1  1  
ATOM 2693   H HD2  . TYR A 1 167 ? 1.273   -14.876 2.790   1.00 0.14  ? 167 TYR A HD2  1  
ATOM 2694   H HE1  . TYR A 1 167 ? 0.691   -13.354 -1.851  1.00 63.43 ? 167 TYR A HE1  1  
ATOM 2695   H HE2  . TYR A 1 167 ? -0.348  -16.005 1.326   1.00 25.33 ? 167 TYR A HE2  1  
ATOM 2696   H HH   . TYR A 1 167 ? -1.393  -14.721 -1.594  1.00 65.13 ? 167 TYR A HH   1  
ATOM 2697   N N    . ILE A 1 168 ? 4.775   -11.421 0.192   1.00 10.12 ? 168 ILE A N    1  
ATOM 2698   C CA   . ILE A 1 168 ? 5.064   -10.920 -1.147  1.00 62.52 ? 168 ILE A CA   1  
ATOM 2699   C C    . ILE A 1 168 ? 6.558   -10.984 -1.449  1.00 11.25 ? 168 ILE A C    1  
ATOM 2700   O O    . ILE A 1 168 ? 6.961   -11.187 -2.594  1.00 61.20 ? 168 ILE A O    1  
ATOM 2701   C CB   . ILE A 1 168 ? 4.580   -9.469  -1.320  1.00 73.55 ? 168 ILE A CB   1  
ATOM 2702   C CG1  . ILE A 1 168 ? 5.233   -8.561  -0.277  1.00 55.41 ? 168 ILE A CG1  1  
ATOM 2703   C CG2  . ILE A 1 168 ? 3.064   -9.400  -1.216  1.00 10.44 ? 168 ILE A CG2  1  
ATOM 2704   C CD1  . ILE A 1 168 ? 4.988   -7.088  -0.519  1.00 55.20 ? 168 ILE A CD1  1  
ATOM 2705   H H    . ILE A 1 168 ? 4.657   -10.782 0.926   1.00 2.43  ? 168 ILE A H    1  
ATOM 2706   H HA   . ILE A 1 168 ? 4.537   -11.541 -1.856  1.00 2.41  ? 168 ILE A HA   1  
ATOM 2707   H HB   . ILE A 1 168 ? 4.863   -9.134  -2.307  1.00 64.33 ? 168 ILE A HB   1  
ATOM 2708   H HG12 . ILE A 1 168 ? 4.842   -8.805  0.699   1.00 62.51 ? 168 ILE A HG12 1  
ATOM 2709   H HG13 . ILE A 1 168 ? 6.301   -8.726  -0.284  1.00 14.41 ? 168 ILE A HG13 1  
ATOM 2710   H HG21 . ILE A 1 168 ? 2.639   -10.351 -1.504  1.00 71.20 ? 168 ILE A HG21 1  
ATOM 2711   H HG22 . ILE A 1 168 ? 2.692   -8.627  -1.872  1.00 14.21 ? 168 ILE A HG22 1  
ATOM 2712   H HG23 . ILE A 1 168 ? 2.783   -9.174  -0.198  1.00 60.32 ? 168 ILE A HG23 1  
ATOM 2713   H HD11 . ILE A 1 168 ? 5.445   -6.512  0.272   1.00 61.41 ? 168 ILE A HD11 1  
ATOM 2714   H HD12 . ILE A 1 168 ? 3.925   -6.898  -0.535  1.00 31.41 ? 168 ILE A HD12 1  
ATOM 2715   H HD13 . ILE A 1 168 ? 5.419   -6.802  -1.467  1.00 40.13 ? 168 ILE A HD13 1  
ATOM 2716   N N    . HIS A 1 169 ? 7.375   -10.809 -0.415  1.00 22.33 ? 169 HIS A N    1  
ATOM 2717   C CA   . HIS A 1 169 ? 8.824   -10.846 -0.571  1.00 61.03 ? 169 HIS A CA   1  
ATOM 2718   C C    . HIS A 1 169 ? 9.288   -12.224 -1.033  1.00 22.10 ? 169 HIS A C    1  
ATOM 2719   O O    . HIS A 1 169 ? 10.284  -12.348 -1.746  1.00 65.42 ? 169 HIS A O    1  
ATOM 2720   C CB   . HIS A 1 169 ? 9.510   -10.481 0.747   1.00 72.52 ? 169 HIS A CB   1  
ATOM 2721   C CG   . HIS A 1 169 ? 9.847   -9.027  0.863   1.00 25.35 ? 169 HIS A CG   1  
ATOM 2722   N ND1  . HIS A 1 169 ? 11.128  -8.537  0.715   1.00 44.14 ? 169 HIS A ND1  1  
ATOM 2723   C CD2  . HIS A 1 169 ? 9.063   -7.951  1.114   1.00 61.24 ? 169 HIS A CD2  1  
ATOM 2724   C CE1  . HIS A 1 169 ? 11.117  -7.225  0.870   1.00 53.33 ? 169 HIS A CE1  1  
ATOM 2725   N NE2  . HIS A 1 169 ? 9.876   -6.845  1.113   1.00 53.12 ? 169 HIS A NE2  1  
ATOM 2726   H H    . HIS A 1 169 ? 6.993   -10.651 0.474   1.00 64.42 ? 169 HIS A H    1  
ATOM 2727   H HA   . HIS A 1 169 ? 9.095   -10.119 -1.321  1.00 11.11 ? 169 HIS A HA   1  
ATOM 2728   H HB2  . HIS A 1 169 ? 8.856   -10.735 1.568   1.00 74.53 ? 169 HIS A HB2  1  
ATOM 2729   H HB3  . HIS A 1 169 ? 10.427  -11.044 0.837   1.00 1.32  ? 169 HIS A HB3  1  
ATOM 2730   H HD1  . HIS A 1 169 ? 11.927  -9.072  0.524   1.00 40.45 ? 169 HIS A HD1  1  
ATOM 2731   H HD2  . HIS A 1 169 ? 7.995   -7.962  1.283   1.00 0.24  ? 169 HIS A HD2  1  
ATOM 2732   H HE1  . HIS A 1 169 ? 11.976  -6.574  0.808   1.00 63.15 ? 169 HIS A HE1  1  
ATOM 2733   H HE2  . HIS A 1 169 ? 9.574   -5.916  1.185   1.00 37.47 ? 169 HIS A HE2  1  
ATOM 2734   N N    . GLU A 1 170 ? 8.560   -13.257 -0.621  1.00 13.22 ? 170 GLU A N    1  
ATOM 2735   C CA   . GLU A 1 170 ? 8.899   -14.627 -0.992  1.00 71.13 ? 170 GLU A CA   1  
ATOM 2736   C C    . GLU A 1 170 ? 8.367   -14.973 -2.382  1.00 25.31 ? 170 GLU A C    1  
ATOM 2737   O O    . GLU A 1 170 ? 8.787   -15.960 -2.985  1.00 13.30 ? 170 GLU A O    1  
ATOM 2738   C CB   . GLU A 1 170 ? 8.337   -15.608 0.039   1.00 42.24 ? 170 GLU A CB   1  
ATOM 2739   C CG   . GLU A 1 170 ? 9.113   -16.912 0.124   1.00 24.34 ? 170 GLU A CG   1  
ATOM 2740   C CD   . GLU A 1 170 ? 9.262   -17.409 1.548   1.00 54.45 ? 170 GLU A CD   1  
ATOM 2741   O OE1  . GLU A 1 170 ? 10.100  -16.850 2.287   1.00 70.30 ? 170 GLU A OE1  1  
ATOM 2742   O OE2  . GLU A 1 170 ? 8.542   -18.358 1.924   1.00 31.14 ? 170 GLU A OE2  1  
ATOM 2743   H H    . GLU A 1 170 ? 7.778   -13.095 -0.053  1.00 1.32  ? 170 GLU A H    1  
ATOM 2744   H HA   . GLU A 1 170 ? 9.975   -14.709 -1.002  1.00 25.13 ? 170 GLU A HA   1  
ATOM 2745   H HB2  . GLU A 1 170 ? 8.354   -15.139 1.012   1.00 22.13 ? 170 GLU A HB2  1  
ATOM 2746   H HB3  . GLU A 1 170 ? 7.314   -15.839 -0.221  1.00 40.31 ? 170 GLU A HB3  1  
ATOM 2747   H HG2  . GLU A 1 170 ? 8.593   -17.664 -0.451  1.00 1.22  ? 170 GLU A HG2  1  
ATOM 2748   H HG3  . GLU A 1 170 ? 10.097  -16.757 -0.294  1.00 13.31 ? 170 GLU A HG3  1  
ATOM 2749   N N    . HIS A 1 171 ? 7.442   -14.159 -2.886  1.00 42.55 ? 171 HIS A N    1  
ATOM 2750   C CA   . HIS A 1 171 ? 6.861   -14.391 -4.204  1.00 12.02 ? 171 HIS A CA   1  
ATOM 2751   C C    . HIS A 1 171 ? 7.518   -13.505 -5.260  1.00 62.01 ? 171 HIS A C    1  
ATOM 2752   O O    . HIS A 1 171 ? 6.935   -13.245 -6.312  1.00 11.43 ? 171 HIS A O    1  
ATOM 2753   C CB   . HIS A 1 171 ? 5.354   -14.131 -4.171  1.00 2.22  ? 171 HIS A CB   1  
ATOM 2754   C CG   . HIS A 1 171 ? 4.546   -15.340 -3.813  1.00 23.41 ? 171 HIS A CG   1  
ATOM 2755   N ND1  . HIS A 1 171 ? 4.594   -15.936 -2.571  1.00 53.15 ? 171 HIS A ND1  1  
ATOM 2756   C CD2  . HIS A 1 171 ? 3.665   -16.064 -4.543  1.00 43.34 ? 171 HIS A CD2  1  
ATOM 2757   C CE1  . HIS A 1 171 ? 3.778   -16.976 -2.552  1.00 34.45 ? 171 HIS A CE1  1  
ATOM 2758   N NE2  . HIS A 1 171 ? 3.203   -17.074 -3.736  1.00 72.43 ? 171 HIS A NE2  1  
ATOM 2759   H H    . HIS A 1 171 ? 7.143   -13.388 -2.361  1.00 73.33 ? 171 HIS A H    1  
ATOM 2760   H HA   . HIS A 1 171 ? 7.032   -15.425 -4.463  1.00 52.40 ? 171 HIS A HA   1  
ATOM 2761   H HB2  . HIS A 1 171 ? 5.144   -13.364 -3.441  1.00 33.14 ? 171 HIS A HB2  1  
ATOM 2762   H HB3  . HIS A 1 171 ? 5.033   -13.792 -5.145  1.00 13.21 ? 171 HIS A HB3  1  
ATOM 2763   H HD1  . HIS A 1 171 ? 5.144   -15.642 -1.815  1.00 12.34 ? 171 HIS A HD1  1  
ATOM 2764   H HD2  . HIS A 1 171 ? 3.379   -15.881 -5.569  1.00 13.00 ? 171 HIS A HD2  1  
ATOM 2765   H HE1  . HIS A 1 171 ? 3.610   -17.632 -1.711  1.00 72.31 ? 171 HIS A HE1  1  
ATOM 2766   H HE2  . HIS A 1 171 ? 2.619   -17.808 -4.021  1.00 37.47 ? 171 HIS A HE2  1  
ATOM 2767   N N    . GLU A 1 172 ? 8.734   -13.044 -4.975  1.00 70.41 ? 172 GLU A N    1  
ATOM 2768   C CA   . GLU A 1 172 ? 9.465   -12.190 -5.905  1.00 20.32 ? 172 GLU A CA   1  
ATOM 2769   C C    . GLU A 1 172 ? 8.651   -10.951 -6.267  1.00 52.52 ? 172 GLU A C    1  
ATOM 2770   O O    . GLU A 1 172 ? 8.703   -10.471 -7.399  1.00 14.11 ? 172 GLU A O    1  
ATOM 2771   C CB   . GLU A 1 172 ? 9.821   -12.968 -7.173  1.00 65.13 ? 172 GLU A CB   1  
ATOM 2772   C CG   . GLU A 1 172 ? 10.858  -14.056 -6.948  1.00 11.01 ? 172 GLU A CG   1  
ATOM 2773   C CD   . GLU A 1 172 ? 10.233  -15.405 -6.648  1.00 54.11 ? 172 GLU A CD   1  
ATOM 2774   O OE1  . GLU A 1 172 ? 9.503   -15.927 -7.517  1.00 23.50 ? 172 GLU A OE1  1  
ATOM 2775   O OE2  . GLU A 1 172 ? 10.473  -15.938 -5.545  1.00 24.01 ? 172 GLU A OE2  1  
ATOM 2776   H H    . GLU A 1 172 ? 9.150   -13.285 -4.121  1.00 10.42 ? 172 GLU A H    1  
ATOM 2777   H HA   . GLU A 1 172 ? 10.377  -11.876 -5.419  1.00 0.34  ? 172 GLU A HA   1  
ATOM 2778   H HB2  . GLU A 1 172 ? 8.925   -13.430 -7.561  1.00 11.21 ? 172 GLU A HB2  1  
ATOM 2779   H HB3  . GLU A 1 172 ? 10.208  -12.279 -7.908  1.00 64.14 ? 172 GLU A HB3  1  
ATOM 2780   H HG2  . GLU A 1 172 ? 11.464  -14.148 -7.836  1.00 21.22 ? 172 GLU A HG2  1  
ATOM 2781   H HG3  . GLU A 1 172 ? 11.483  -13.772 -6.114  1.00 53.43 ? 172 GLU A HG3  1  
ATOM 2782   N N    . TYR A 1 173 ? 7.899   -10.439 -5.298  1.00 5.53  ? 173 TYR A N    1  
ATOM 2783   C CA   . TYR A 1 173 ? 7.073   -9.256  -5.515  1.00 33.14 ? 173 TYR A CA   1  
ATOM 2784   C C    . TYR A 1 173 ? 7.389   -8.174  -4.487  1.00 3.43  ? 173 TYR A C    1  
ATOM 2785   O O    . TYR A 1 173 ? 7.184   -8.365  -3.288  1.00 23.20 ? 173 TYR A O    1  
ATOM 2786   C CB   . TYR A 1 173 ? 5.589   -9.626  -5.443  1.00 74.12 ? 173 TYR A CB   1  
ATOM 2787   C CG   . TYR A 1 173 ? 4.923   -9.732  -6.796  1.00 51.02 ? 173 TYR A CG   1  
ATOM 2788   C CD1  . TYR A 1 173 ? 4.729   -8.606  -7.586  1.00 74.32 ? 173 TYR A CD1  1  
ATOM 2789   C CD2  . TYR A 1 173 ? 4.488   -10.959 -7.283  1.00 54.45 ? 173 TYR A CD2  1  
ATOM 2790   C CE1  . TYR A 1 173 ? 4.120   -8.699  -8.823  1.00 3.42  ? 173 TYR A CE1  1  
ATOM 2791   C CE2  . TYR A 1 173 ? 3.878   -11.060 -8.519  1.00 25.10 ? 173 TYR A CE2  1  
ATOM 2792   C CZ   . TYR A 1 173 ? 3.697   -9.928  -9.285  1.00 3.43  ? 173 TYR A CZ   1  
ATOM 2793   O OH   . TYR A 1 173 ? 3.090   -10.024 -10.517 1.00 74.45 ? 173 TYR A OH   1  
ATOM 2794   H H    . TYR A 1 173 ? 7.899   -10.866 -4.416  1.00 51.40 ? 173 TYR A H    1  
ATOM 2795   H HA   . TYR A 1 173 ? 7.292   -8.875  -6.501  1.00 72.20 ? 173 TYR A HA   1  
ATOM 2796   H HB2  . TYR A 1 173 ? 5.487   -10.581 -4.949  1.00 20.43 ? 173 TYR A HB2  1  
ATOM 2797   H HB3  . TYR A 1 173 ? 5.064   -8.874  -4.872  1.00 34.25 ? 173 TYR A HB3  1  
ATOM 2798   H HD1  . TYR A 1 173 ? 5.062   -7.646  -7.222  1.00 0.45  ? 173 TYR A HD1  1  
ATOM 2799   H HD2  . TYR A 1 173 ? 4.631   -11.844 -6.681  1.00 41.31 ? 173 TYR A HD2  1  
ATOM 2800   H HE1  . TYR A 1 173 ? 3.978   -7.812  -9.423  1.00 12.32 ? 173 TYR A HE1  1  
ATOM 2801   H HE2  . TYR A 1 173 ? 3.547   -12.022 -8.880  1.00 23.23 ? 173 TYR A HE2  1  
ATOM 2802   H HH   . TYR A 1 173 ? 2.381   -10.670 -10.475 1.00 73.32 ? 173 TYR A HH   1  
ATOM 2803   N N    . VAL A 1 174 ? 7.888   -7.037  -4.963  1.00 52.54 ? 174 VAL A N    1  
ATOM 2804   C CA   . VAL A 1 174 ? 8.228   -5.926  -4.082  1.00 64.12 ? 174 VAL A CA   1  
ATOM 2805   C C    . VAL A 1 174 ? 6.984   -5.131  -3.705  1.00 52.23 ? 174 VAL A C    1  
ATOM 2806   O O    . VAL A 1 174 ? 6.156   -4.816  -4.559  1.00 55.04 ? 174 VAL A O    1  
ATOM 2807   C CB   . VAL A 1 174 ? 9.246   -4.976  -4.741  1.00 43.51 ? 174 VAL A CB   1  
ATOM 2808   C CG1  . VAL A 1 174 ? 9.761   -3.961  -3.732  1.00 43.25 ? 174 VAL A CG1  1  
ATOM 2809   C CG2  . VAL A 1 174 ? 10.396  -5.763  -5.350  1.00 62.34 ? 174 VAL A CG2  1  
ATOM 2810   H H    . VAL A 1 174 ? 8.028   -6.942  -5.928  1.00 73.24 ? 174 VAL A H    1  
ATOM 2811   H HA   . VAL A 1 174 ? 8.672   -6.333  -3.185  1.00 52.15 ? 174 VAL A HA   1  
ATOM 2812   H HB   . VAL A 1 174 ? 8.746   -4.439  -5.534  1.00 53.44 ? 174 VAL A HB   1  
ATOM 2813   H HG11 . VAL A 1 174 ? 10.365  -4.464  -2.991  1.00 62.41 ? 174 VAL A HG11 1  
ATOM 2814   H HG12 . VAL A 1 174 ? 8.924   -3.479  -3.247  1.00 71.32 ? 174 VAL A HG12 1  
ATOM 2815   H HG13 . VAL A 1 174 ? 10.358  -3.219  -4.240  1.00 43.12 ? 174 VAL A HG13 1  
ATOM 2816   H HG21 . VAL A 1 174 ? 10.201  -5.932  -6.398  1.00 33.12 ? 174 VAL A HG21 1  
ATOM 2817   H HG22 . VAL A 1 174 ? 10.491  -6.713  -4.843  1.00 74.03 ? 174 VAL A HG22 1  
ATOM 2818   H HG23 . VAL A 1 174 ? 11.314  -5.204  -5.240  1.00 2.13  ? 174 VAL A HG23 1  
ATOM 2819   N N    . HIS A 1 175 ? 6.857   -4.810  -2.421  1.00 30.05 ? 175 HIS A N    1  
ATOM 2820   C CA   . HIS A 1 175 ? 5.710   -4.052  -1.934  1.00 31.50 ? 175 HIS A CA   1  
ATOM 2821   C C    . HIS A 1 175 ? 5.695   -2.646  -2.526  1.00 2.43  ? 175 HIS A C    1  
ATOM 2822   O O    . HIS A 1 175 ? 4.808   -2.300  -3.307  1.00 72.32 ? 175 HIS A O    1  
ATOM 2823   C CB   . HIS A 1 175 ? 5.732   -3.977  -0.406  1.00 71.33 ? 175 HIS A CB   1  
ATOM 2824   C CG   . HIS A 1 175 ? 4.399   -4.243  0.223   1.00 73.04 ? 175 HIS A CG   1  
ATOM 2825   N ND1  . HIS A 1 175 ? 3.203   -4.007  -0.422  1.00 55.32 ? 175 HIS A ND1  1  
ATOM 2826   C CD2  . HIS A 1 175 ? 4.076   -4.730  1.444   1.00 53.52 ? 175 HIS A CD2  1  
ATOM 2827   C CE1  . HIS A 1 175 ? 2.203   -4.337  0.376   1.00 64.44 ? 175 HIS A CE1  1  
ATOM 2828   N NE2  . HIS A 1 175 ? 2.706   -4.779  1.514   1.00 33.14 ? 175 HIS A NE2  1  
ATOM 2829   H H    . HIS A 1 175 ? 7.549   -5.090  -1.787  1.00 3.23  ? 175 HIS A H    1  
ATOM 2830   H HA   . HIS A 1 175 ? 4.815   -4.570  -2.247  1.00 13.31 ? 175 HIS A HA   1  
ATOM 2831   H HB2  . HIS A 1 175 ? 6.429   -4.709  -0.027  1.00 42.53 ? 175 HIS A HB2  1  
ATOM 2832   H HB3  . HIS A 1 175 ? 6.052   -2.991  -0.104  1.00 44.05 ? 175 HIS A HB3  1  
ATOM 2833   H HD1  . HIS A 1 175 ? 3.102   -3.649  -1.328  1.00 60.11 ? 175 HIS A HD1  1  
ATOM 2834   H HD2  . HIS A 1 175 ? 4.769   -5.026  2.220   1.00 20.32 ? 175 HIS A HD2  1  
ATOM 2835   H HE1  . HIS A 1 175 ? 1.153   -4.261  0.137   1.00 2.43  ? 175 HIS A HE1  1  
ATOM 2836   H HE2  . HIS A 1 175 ? 2.184   -5.005  2.312   1.00 37.47 ? 175 HIS A HE2  1  
ATOM 2837   N N    . GLY A 1 176 ? 6.682   -1.840  -2.150  1.00 23.35 ? 176 GLY A N    1  
ATOM 2838   C CA   . GLY A 1 176 ? 6.762   -0.481  -2.654  1.00 50.20 ? 176 GLY A CA   1  
ATOM 2839   C C    . GLY A 1 176 ? 5.839   0.468   -1.915  1.00 12.12 ? 176 GLY A C    1  
ATOM 2840   O O    . GLY A 1 176 ? 6.291   1.450   -1.326  1.00 34.02 ? 176 GLY A O    1  
ATOM 2841   H H    . GLY A 1 176 ? 7.361   -2.170  -1.526  1.00 52.31 ? 176 GLY A H    1  
ATOM 2842   H HA2  . GLY A 1 176 ? 7.778   -0.131  -2.552  1.00 25.24 ? 176 GLY A HA2  1  
ATOM 2843   H HA3  . GLY A 1 176 ? 6.496   -0.482  -3.701  1.00 60.50 ? 176 GLY A HA3  1  
ATOM 2844   N N    . ASP A 1 177 ? 4.543   0.175   -1.946  1.00 63.40 ? 177 ASP A N    1  
ATOM 2845   C CA   . ASP A 1 177 ? 3.554   1.010   -1.275  1.00 61.02 ? 177 ASP A CA   1  
ATOM 2846   C C    . ASP A 1 177 ? 3.065   0.348   0.010   1.00 4.41  ? 177 ASP A C    1  
ATOM 2847   O O    . ASP A 1 177 ? 2.123   -0.443  -0.007  1.00 13.44 ? 177 ASP A O    1  
ATOM 2848   C CB   . ASP A 1 177 ? 2.371   1.284   -2.207  1.00 31.11 ? 177 ASP A CB   1  
ATOM 2849   C CG   . ASP A 1 177 ? 2.037   2.760   -2.299  1.00 71.31 ? 177 ASP A CG   1  
ATOM 2850   O OD1  . ASP A 1 177 ? 1.977   3.422   -1.242  1.00 54.21 ? 177 ASP A OD1  1  
ATOM 2851   O OD2  . ASP A 1 177 ? 1.837   3.254   -3.429  1.00 35.14 ? 177 ASP A OD2  1  
ATOM 2852   H H    . ASP A 1 177 ? 4.244   -0.621  -2.432  1.00 33.13 ? 177 ASP A H    1  
ATOM 2853   H HA   . ASP A 1 177 ? 4.027   1.948   -1.025  1.00 54.43 ? 177 ASP A HA   1  
ATOM 2854   H HB2  . ASP A 1 177 ? 2.611   0.927   -3.197  1.00 45.01 ? 177 ASP A HB2  1  
ATOM 2855   H HB3  . ASP A 1 177 ? 1.501   0.759   -1.841  1.00 43.22 ? 177 ASP A HB3  1  
ATOM 2856   N N    . ILE A 1 178 ? 3.715   0.677   1.121   1.00 43.31 ? 178 ILE A N    1  
ATOM 2857   C CA   . ILE A 1 178 ? 3.349   0.114   2.416   1.00 23.10 ? 178 ILE A CA   1  
ATOM 2858   C C    . ILE A 1 178 ? 2.784   1.179   3.356   1.00 75.43 ? 178 ILE A C    1  
ATOM 2859   O O    . ILE A 1 178 ? 2.406   0.878   4.488   1.00 51.33 ? 178 ILE A O    1  
ATOM 2860   C CB   . ILE A 1 178 ? 4.557   -0.559  3.095   1.00 22.25 ? 178 ILE A CB   1  
ATOM 2861   C CG1  . ILE A 1 178 ? 5.271   -1.488  2.111   1.00 22.10 ? 178 ILE A CG1  1  
ATOM 2862   C CG2  . ILE A 1 178 ? 4.112   -1.328  4.330   1.00 4.21  ? 178 ILE A CG2  1  
ATOM 2863   C CD1  . ILE A 1 178 ? 6.595   -2.011  2.626   1.00 53.41 ? 178 ILE A CD1  1  
ATOM 2864   H H    . ILE A 1 178 ? 4.459   1.312   1.069   1.00 24.32 ? 178 ILE A H    1  
ATOM 2865   H HA   . ILE A 1 178 ? 2.594   -0.640  2.249   1.00 40.15 ? 178 ILE A HA   1  
ATOM 2866   H HB   . ILE A 1 178 ? 5.242   0.214   3.410   1.00 24.04 ? 178 ILE A HB   1  
ATOM 2867   H HG12 . ILE A 1 178 ? 4.638   -2.338  1.904   1.00 1.00  ? 178 ILE A HG12 1  
ATOM 2868   H HG13 . ILE A 1 178 ? 5.460   -0.952  1.192   1.00 1.21  ? 178 ILE A HG13 1  
ATOM 2869   H HG21 . ILE A 1 178 ? 4.707   -2.223  4.431   1.00 4.30  ? 178 ILE A HG21 1  
ATOM 2870   H HG22 . ILE A 1 178 ? 3.070   -1.597  4.230   1.00 65.34 ? 178 ILE A HG22 1  
ATOM 2871   H HG23 . ILE A 1 178 ? 4.241   -0.709  5.205   1.00 11.33 ? 178 ILE A HG23 1  
ATOM 2872   H HD11 . ILE A 1 178 ? 6.416   -2.747  3.396   1.00 63.31 ? 178 ILE A HD11 1  
ATOM 2873   H HD12 . ILE A 1 178 ? 7.170   -1.193  3.035   1.00 53.44 ? 178 ILE A HD12 1  
ATOM 2874   H HD13 . ILE A 1 178 ? 7.143   -2.465  1.814   1.00 55.23 ? 178 ILE A HD13 1  
ATOM 2875   N N    . LYS A 1 179 ? 2.730   2.424   2.885   1.00 24.15 ? 179 LYS A N    1  
ATOM 2876   C CA   . LYS A 1 179 ? 2.212   3.525   3.692   1.00 3.11  ? 179 LYS A CA   1  
ATOM 2877   C C    . LYS A 1 179 ? 0.812   3.213   4.214   1.00 25.32 ? 179 LYS A C    1  
ATOM 2878   O O    . LYS A 1 179 ? 0.197   2.223   3.820   1.00 71.32 ? 179 LYS A O    1  
ATOM 2879   C CB   . LYS A 1 179 ? 2.188   4.818   2.875   1.00 70.22 ? 179 LYS A CB   1  
ATOM 2880   C CG   . LYS A 1 179 ? 1.464   4.685   1.545   1.00 11.41 ? 179 LYS A CG   1  
ATOM 2881   C CD   . LYS A 1 179 ? 2.047   5.623   0.499   1.00 43.53 ? 179 LYS A CD   1  
ATOM 2882   C CE   . LYS A 1 179 ? 0.988   6.078   -0.492  1.00 23.10 ? 179 LYS A CE   1  
ATOM 2883   N NZ   . LYS A 1 179 ? 1.170   7.504   -0.883  1.00 51.34 ? 179 LYS A NZ   1  
ATOM 2884   H H    . LYS A 1 179 ? 3.047   2.608   1.977   1.00 5.30  ? 179 LYS A H    1  
ATOM 2885   H HA   . LYS A 1 179 ? 2.875   3.656   4.535   1.00 3.44  ? 179 LYS A HA   1  
ATOM 2886   H HB2  . LYS A 1 179 ? 1.697   5.586   3.453   1.00 73.22 ? 179 LYS A HB2  1  
ATOM 2887   H HB3  . LYS A 1 179 ? 3.205   5.123   2.677   1.00 63.11 ? 179 LYS A HB3  1  
ATOM 2888   H HG2  . LYS A 1 179 ? 1.558   3.669   1.194   1.00 71.01 ? 179 LYS A HG2  1  
ATOM 2889   H HG3  . LYS A 1 179 ? 0.421   4.924   1.689   1.00 73.15 ? 179 LYS A HG3  1  
ATOM 2890   H HD2  . LYS A 1 179 ? 2.456   6.490   0.996   1.00 12.22 ? 179 LYS A HD2  1  
ATOM 2891   H HD3  . LYS A 1 179 ? 2.831   5.108   -0.035  1.00 23.30 ? 179 LYS A HD3  1  
ATOM 2892   H HE2  . LYS A 1 179 ? 1.052   5.462   -1.376  1.00 70.10 ? 179 LYS A HE2  1  
ATOM 2893   H HE3  . LYS A 1 179 ? 0.015   5.959   -0.041  1.00 71.24 ? 179 LYS A HE3  1  
ATOM 2894   H HZ1  . LYS A 1 179 ? 0.817   7.657   -1.849  1.00 51.34 ? 179 LYS A HZ1  1  
ATOM 2895   H HZ2  . LYS A 1 179 ? 2.178   7.758   -0.850  1.00 64.03 ? 179 LYS A HZ2  1  
ATOM 2896   H HZ3  . LYS A 1 179 ? 0.646   8.122   -0.231  1.00 3.12  ? 179 LYS A HZ3  1  
ATOM 2897   N N    . ALA A 1 180 ? 0.317   4.066   5.105   1.00 31.24 ? 180 ALA A N    1  
ATOM 2898   C CA   . ALA A 1 180 ? -1.009  3.885   5.685   1.00 34.04 ? 180 ALA A CA   1  
ATOM 2899   C C    . ALA A 1 180 ? -2.105  4.192   4.669   1.00 64.10 ? 180 ALA A C    1  
ATOM 2900   O O    . ALA A 1 180 ? -3.213  3.665   4.759   1.00 62.32 ? 180 ALA A O    1  
ATOM 2901   C CB   . ALA A 1 180 ? -1.168  4.763   6.917   1.00 51.42 ? 180 ALA A CB   1  
ATOM 2902   H H    . ALA A 1 180 ? 0.856   4.837   5.379   1.00 72.02 ? 180 ALA A H    1  
ATOM 2903   H HA   . ALA A 1 180 ? -1.098  2.854   5.994   1.00 24.34 ? 180 ALA A HA   1  
ATOM 2904   H HB1  . ALA A 1 180 ? -2.176  5.148   6.958   1.00 55.35 ? 180 ALA A HB1  1  
ATOM 2905   H HB2  . ALA A 1 180 ? -0.470  5.585   6.866   1.00 61.52 ? 180 ALA A HB2  1  
ATOM 2906   H HB3  . ALA A 1 180 ? -0.971  4.178   7.803   1.00 44.45 ? 180 ALA A HB3  1  
ATOM 2907   N N    . SER A 1 181 ? -1.789  5.048   3.702   1.00 74.22 ? 181 SER A N    1  
ATOM 2908   C CA   . SER A 1 181 ? -2.748  5.426   2.669   1.00 34.32 ? 181 SER A CA   1  
ATOM 2909   C C    . SER A 1 181 ? -3.308  4.196   1.958   1.00 13.42 ? 181 SER A C    1  
ATOM 2910   O O    . SER A 1 181 ? -4.405  4.235   1.402   1.00 11.50 ? 181 SER A O    1  
ATOM 2911   C CB   . SER A 1 181 ? -2.092  6.361   1.652   1.00 32.13 ? 181 SER A CB   1  
ATOM 2912   O OG   . SER A 1 181 ? -0.945  6.988   2.200   1.00 72.40 ? 181 SER A OG   1  
ATOM 2913   H H    . SER A 1 181 ? -0.889  5.437   3.682   1.00 42.02 ? 181 SER A H    1  
ATOM 2914   H HA   . SER A 1 181 ? -3.562  5.948   3.150   1.00 31.21 ? 181 SER A HA   1  
ATOM 2915   H HB2  . SER A 1 181 ? -1.794  5.793   0.783   1.00 4.32  ? 181 SER A HB2  1  
ATOM 2916   H HB3  . SER A 1 181 ? -2.798  7.123   1.358   1.00 63.42 ? 181 SER A HB3  1  
ATOM 2917   H HG   . SER A 1 181 ? -0.634  7.669   1.600   1.00 42.34 ? 181 SER A HG   1  
ATOM 2918   N N    . ASN A 1 182 ? -2.547  3.105   1.978   1.00 10.12 ? 182 ASN A N    1  
ATOM 2919   C CA   . ASN A 1 182 ? -2.971  1.867   1.332   1.00 72.53 ? 182 ASN A CA   1  
ATOM 2920   C C    . ASN A 1 182 ? -3.307  0.798   2.367   1.00 61.11 ? 182 ASN A C    1  
ATOM 2921   O O    . ASN A 1 182 ? -3.061  -0.389  2.149   1.00 11.22 ? 182 ASN A O    1  
ATOM 2922   C CB   . ASN A 1 182 ? -1.877  1.359   0.392   1.00 23.44 ? 182 ASN A CB   1  
ATOM 2923   C CG   . ASN A 1 182 ? -1.723  2.229   -0.840  1.00 74.41 ? 182 ASN A CG   1  
ATOM 2924   O OD1  . ASN A 1 182 ? -2.674  2.429   -1.595  1.00 55.32 ? 182 ASN A OD1  1  
ATOM 2925   N ND2  . ASN A 1 182 ? -0.521  2.751   -1.049  1.00 11.53 ? 182 ASN A ND2  1  
ATOM 2926   H H    . ASN A 1 182 ? -1.681  3.132   2.435   1.00 54.24 ? 182 ASN A H    1  
ATOM 2927   H HA   . ASN A 1 182 ? -3.858  2.082   0.755   1.00 14.20 ? 182 ASN A HA   1  
ATOM 2928   H HB2  . ASN A 1 182 ? -0.935  1.345   0.920   1.00 70.33 ? 182 ASN A HB2  1  
ATOM 2929   H HB3  . ASN A 1 182 ? -2.122  0.356   0.074   1.00 0.35  ? 182 ASN A HB3  1  
ATOM 2930   H HD21 . ASN A 1 182 ? 0.190   2.549   -0.405  1.00 4.11  ? 182 ASN A HD21 1  
ATOM 2931   H HD22 . ASN A 1 182 ? -0.393  3.319   -1.838  1.00 22.12 ? 182 ASN A HD22 1  
ATOM 2932   N N    . LEU A 1 183 ? -3.872  1.224   3.492   1.00 3.21  ? 183 LEU A N    1  
ATOM 2933   C CA   . LEU A 1 183 ? -4.243  0.301   4.558   1.00 43.33 ? 183 LEU A CA   1  
ATOM 2934   C C    . LEU A 1 183 ? -5.684  0.538   5.001   1.00 42.10 ? 183 LEU A C    1  
ATOM 2935   O O    . LEU A 1 183 ? -6.200  1.651   4.898   1.00 21.14 ? 183 LEU A O    1  
ATOM 2936   C CB   . LEU A 1 183 ? -3.299  0.460   5.752   1.00 11.33 ? 183 LEU A CB   1  
ATOM 2937   C CG   . LEU A 1 183 ? -1.934  -0.212  5.594   1.00 25.40 ? 183 LEU A CG   1  
ATOM 2938   C CD1  . LEU A 1 183 ? -0.960  0.301   6.644   1.00 35.52 ? 183 LEU A CD1  1  
ATOM 2939   C CD2  . LEU A 1 183 ? -2.073  -1.724  5.686   1.00 2.03  ? 183 LEU A CD2  1  
ATOM 2940   H H    . LEU A 1 183 ? -4.048  2.181   3.608   1.00 23.35 ? 183 LEU A H    1  
ATOM 2941   H HA   . LEU A 1 183 ? -4.158  -0.704  4.173   1.00 12.45 ? 183 LEU A HA   1  
ATOM 2942   H HB2  . LEU A 1 183 ? -3.140  1.516   5.920   1.00 21.40 ? 183 LEU A HB2  1  
ATOM 2943   H HB3  . LEU A 1 183 ? -3.781  0.044   6.623   1.00 11.41 ? 183 LEU A HB3  1  
ATOM 2944   H HG   . LEU A 1 183 ? -1.532  0.029   4.621   1.00 53.21 ? 183 LEU A HG   1  
ATOM 2945   H HD11 . LEU A 1 183 ? -0.005  0.503   6.182   1.00 4.25  ? 183 LEU A HD11 1  
ATOM 2946   H HD12 . LEU A 1 183 ? -0.835  -0.445  7.416   1.00 32.21 ? 183 LEU A HD12 1  
ATOM 2947   H HD13 . LEU A 1 183 ? -1.347  1.209   7.082   1.00 10.03 ? 183 LEU A HD13 1  
ATOM 2948   H HD21 . LEU A 1 183 ? -2.056  -2.025  6.724   1.00 25.13 ? 183 LEU A HD21 1  
ATOM 2949   H HD22 . LEU A 1 183 ? -1.253  -2.194  5.162   1.00 72.15 ? 183 LEU A HD22 1  
ATOM 2950   H HD23 . LEU A 1 183 ? -3.007  -2.028  5.239   1.00 35.44 ? 183 LEU A HD23 1  
ATOM 2951   N N    . LEU A 1 184 ? -6.327  -0.515  5.495   1.00 62.33 ? 184 LEU A N    1  
ATOM 2952   C CA   . LEU A 1 184 ? -7.708  -0.421  5.954   1.00 35.34 ? 184 LEU A CA   1  
ATOM 2953   C C    . LEU A 1 184 ? -7.987  -1.446  7.048   1.00 54.42 ? 184 LEU A C    1  
ATOM 2954   O O    . LEU A 1 184 ? -7.256  -2.424  7.195   1.00 63.21 ? 184 LEU A O    1  
ATOM 2955   C CB   . LEU A 1 184 ? -8.673  -0.630  4.785   1.00 15.33 ? 184 LEU A CB   1  
ATOM 2956   C CG   . LEU A 1 184 ? -8.892  0.598   3.899   1.00 21.41 ? 184 LEU A CG   1  
ATOM 2957   C CD1  . LEU A 1 184 ? -7.906  0.604   2.741   1.00 53.15 ? 184 LEU A CD1  1  
ATOM 2958   C CD2  . LEU A 1 184 ? -10.323 0.634   3.383   1.00 73.33 ? 184 LEU A CD2  1  
ATOM 2959   H H    . LEU A 1 184 ? -5.862  -1.376  5.552   1.00 1.34  ? 184 LEU A H    1  
ATOM 2960   H HA   . LEU A 1 184 ? -7.856  0.569   6.359   1.00 41.13 ? 184 LEU A HA   1  
ATOM 2961   H HB2  . LEU A 1 184 ? -8.289  -1.430  4.168   1.00 20.34 ? 184 LEU A HB2  1  
ATOM 2962   H HB3  . LEU A 1 184 ? -9.629  -0.933  5.184   1.00 42.12 ? 184 LEU A HB3  1  
ATOM 2963   H HG   . LEU A 1 184 ? -8.724  1.491   4.484   1.00 21.42 ? 184 LEU A HG   1  
ATOM 2964   H HD11 . LEU A 1 184 ? -7.056  -0.016  2.988   1.00 54.34 ? 184 LEU A HD11 1  
ATOM 2965   H HD12 . LEU A 1 184 ? -7.572  1.615   2.558   1.00 12.41 ? 184 LEU A HD12 1  
ATOM 2966   H HD13 . LEU A 1 184 ? -8.388  0.218   1.855   1.00 43.32 ? 184 LEU A HD13 1  
ATOM 2967   H HD21 . LEU A 1 184 ? -11.004 0.724   4.216   1.00 4.22  ? 184 LEU A HD21 1  
ATOM 2968   H HD22 . LEU A 1 184 ? -10.533 -0.277  2.842   1.00 20.24 ? 184 LEU A HD22 1  
ATOM 2969   H HD23 . LEU A 1 184 ? -10.446 1.480   2.723   1.00 2.35  ? 184 LEU A HD23 1  
ATOM 2970   N N    . LEU A 1 185 ? -9.048  -1.216  7.814   1.00 74.21 ? 185 LEU A N    1  
ATOM 2971   C CA   . LEU A 1 185 ? -9.421  -2.122  8.894   1.00 41.11 ? 185 LEU A CA   1  
ATOM 2972   C C    . LEU A 1 185 ? -10.773 -2.772  8.618   1.00 12.25 ? 185 LEU A C    1  
ATOM 2973   O O    . LEU A 1 185 ? -11.673 -2.142  8.064   1.00 21.14 ? 185 LEU A O    1  
ATOM 2974   C CB   . LEU A 1 185 ? -9.463  -1.371  10.226  1.00 43.42 ? 185 LEU A CB   1  
ATOM 2975   C CG   . LEU A 1 185 ? -8.096  -1.006  10.806  1.00 63.31 ? 185 LEU A CG   1  
ATOM 2976   C CD1  . LEU A 1 185 ? -8.178  0.298   11.584  1.00 74.51 ? 185 LEU A CD1  1  
ATOM 2977   C CD2  . LEU A 1 185 ? -7.578  -2.128  11.693  1.00 11.22 ? 185 LEU A CD2  1  
ATOM 2978   H H    . LEU A 1 185 ? -9.593  -0.419  7.649   1.00 73.32 ? 185 LEU A H    1  
ATOM 2979   H HA   . LEU A 1 185 ? -8.669  -2.896  8.952   1.00 41.30 ? 185 LEU A HA   1  
ATOM 2980   H HB2  . LEU A 1 185 ? -10.027 -0.461  10.083  1.00 2.11  ? 185 LEU A HB2  1  
ATOM 2981   H HB3  . LEU A 1 185 ? -9.982  -1.986  10.946  1.00 44.22 ? 185 LEU A HB3  1  
ATOM 2982   H HG   . LEU A 1 185 ? -7.395  -0.867  9.996   1.00 53.44 ? 185 LEU A HG   1  
ATOM 2983   H HD11 . LEU A 1 185 ? -8.278  0.083   12.638  1.00 43.20 ? 185 LEU A HD11 1  
ATOM 2984   H HD12 . LEU A 1 185 ? -9.035  0.864   11.250  1.00 31.43 ? 185 LEU A HD12 1  
ATOM 2985   H HD13 . LEU A 1 185 ? -7.280  0.874   11.418  1.00 53.43 ? 185 LEU A HD13 1  
ATOM 2986   H HD21 . LEU A 1 185 ? -8.410  -2.713  12.055  1.00 63.13 ? 185 LEU A HD21 1  
ATOM 2987   H HD22 . LEU A 1 185 ? -7.042  -1.706  12.531  1.00 14.43 ? 185 LEU A HD22 1  
ATOM 2988   H HD23 . LEU A 1 185 ? -6.914  -2.760  11.123  1.00 40.41 ? 185 LEU A HD23 1  
ATOM 2989   N N    . ASN A 1 186 ? -10.907 -4.035  9.009   1.00 31.10 ? 186 ASN A N    1  
ATOM 2990   C CA   . ASN A 1 186 ? -12.150 -4.770  8.804   1.00 64.14 ? 186 ASN A CA   1  
ATOM 2991   C C    . ASN A 1 186 ? -13.293 -4.136  9.591   1.00 42.42 ? 186 ASN A C    1  
ATOM 2992   O O    . ASN A 1 186 ? -13.128 -3.764  10.753  1.00 1.00  ? 186 ASN A O    1  
ATOM 2993   C CB   . ASN A 1 186 ? -11.976 -6.232  9.219   1.00 34.22 ? 186 ASN A CB   1  
ATOM 2994   C CG   . ASN A 1 186 ? -12.807 -7.176  8.373   1.00 2.12  ? 186 ASN A CG   1  
ATOM 2995   O OD1  . ASN A 1 186 ? -14.030 -7.051  8.301   1.00 35.54 ? 186 ASN A OD1  1  
ATOM 2996   N ND2  . ASN A 1 186 ? -12.146 -8.128  7.726   1.00 70.52 ? 186 ASN A ND2  1  
ATOM 2997   H H    . ASN A 1 186 ? -10.153 -4.483  9.447   1.00 13.01 ? 186 ASN A H    1  
ATOM 2998   H HA   . ASN A 1 186 ? -12.388 -4.729  7.752   1.00 45.40 ? 186 ASN A HA   1  
ATOM 2999   H HB2  . ASN A 1 186 ? -10.937 -6.507  9.118   1.00 51.42 ? 186 ASN A HB2  1  
ATOM 3000   H HB3  . ASN A 1 186 ? -12.275 -6.344  10.251  1.00 23.22 ? 186 ASN A HB3  1  
ATOM 3001   H HD21 . ASN A 1 186 ? -11.172 -8.168  7.830   1.00 14.53 ? 186 ASN A HD21 1  
ATOM 3002   H HD22 . ASN A 1 186 ? -12.658 -8.753  7.171   1.00 5.33  ? 186 ASN A HD22 1  
ATOM 3003   N N    . TYR A 1 187 ? -14.451 -4.018  8.951   1.00 35.45 ? 187 TYR A N    1  
ATOM 3004   C CA   . TYR A 1 187 ? -15.622 -3.429  9.591   1.00 34.15 ? 187 TYR A CA   1  
ATOM 3005   C C    . TYR A 1 187 ? -16.028 -4.228  10.825  1.00 23.43 ? 187 TYR A C    1  
ATOM 3006   O O    . TYR A 1 187 ? -16.302 -3.659  11.882  1.00 32.30 ? 187 TYR A O    1  
ATOM 3007   C CB   . TYR A 1 187 ? -16.789 -3.364  8.604   1.00 13.41 ? 187 TYR A CB   1  
ATOM 3008   C CG   . TYR A 1 187 ? -17.932 -2.492  9.074   1.00 74.13 ? 187 TYR A CG   1  
ATOM 3009   C CD1  . TYR A 1 187 ? -18.937 -3.008  9.883   1.00 51.01 ? 187 TYR A CD1  1  
ATOM 3010   C CD2  . TYR A 1 187 ? -18.006 -1.154  8.708   1.00 50.00 ? 187 TYR A CD2  1  
ATOM 3011   C CE1  . TYR A 1 187 ? -19.983 -2.214  10.314  1.00 41.15 ? 187 TYR A CE1  1  
ATOM 3012   C CE2  . TYR A 1 187 ? -19.049 -0.354  9.135   1.00 44.33 ? 187 TYR A CE2  1  
ATOM 3013   C CZ   . TYR A 1 187 ? -20.034 -0.889  9.937   1.00 14.11 ? 187 TYR A CZ   1  
ATOM 3014   O OH   . TYR A 1 187 ? -21.075 -0.096  10.364  1.00 4.35  ? 187 TYR A OH   1  
ATOM 3015   H H    . TYR A 1 187 ? -14.520 -4.333  8.026   1.00 25.32 ? 187 TYR A H    1  
ATOM 3016   H HA   . TYR A 1 187 ? -15.363 -2.426  9.895   1.00 42.33 ? 187 TYR A HA   1  
ATOM 3017   H HB2  . TYR A 1 187 ? -16.435 -2.967  7.664   1.00 43.42 ? 187 TYR A HB2  1  
ATOM 3018   H HB3  . TYR A 1 187 ? -17.174 -4.361  8.446   1.00 61.22 ? 187 TYR A HB3  1  
ATOM 3019   H HD1  . TYR A 1 187 ? -18.893 -4.046  10.176  1.00 21.13 ? 187 TYR A HD1  1  
ATOM 3020   H HD2  . TYR A 1 187 ? -17.233 -0.738  8.079   1.00 13.52 ? 187 TYR A HD2  1  
ATOM 3021   H HE1  . TYR A 1 187 ? -20.755 -2.634  10.942  1.00 73.32 ? 187 TYR A HE1  1  
ATOM 3022   H HE2  . TYR A 1 187 ? -19.089 0.684   8.839   1.00 31.41 ? 187 TYR A HE2  1  
ATOM 3023   H HH   . TYR A 1 187 ? -21.484 0.331   9.608   1.00 72.13 ? 187 TYR A HH   1  
ATOM 3024   N N    . LYS A 1 188 ? -16.064 -5.549  10.684  1.00 2.52  ? 188 LYS A N    1  
ATOM 3025   C CA   . LYS A 1 188 ? -16.436 -6.425  11.789  1.00 73.31 ? 188 LYS A CA   1  
ATOM 3026   C C    . LYS A 1 188 ? -15.273 -6.596  12.761  1.00 44.21 ? 188 LYS A C    1  
ATOM 3027   O O    . LYS A 1 188 ? -15.469 -6.657  13.974  1.00 10.43 ? 188 LYS A O    1  
ATOM 3028   C CB   . LYS A 1 188 ? -16.879 -7.790  11.259  1.00 72.03 ? 188 LYS A CB   1  
ATOM 3029   C CG   . LYS A 1 188 ? -18.345 -7.842  10.861  1.00 70.13 ? 188 LYS A CG   1  
ATOM 3030   C CD   . LYS A 1 188 ? -18.855 -9.273  10.803  1.00 13.35 ? 188 LYS A CD   1  
ATOM 3031   C CE   . LYS A 1 188 ? -20.192 -9.358  10.083  1.00 63.42 ? 188 LYS A CE   1  
ATOM 3032   N NZ   . LYS A 1 188 ? -20.593 -10.768 9.821   1.00 21.41 ? 188 LYS A NZ   1  
ATOM 3033   H H    . LYS A 1 188 ? -15.835 -5.943  9.817   1.00 5.23  ? 188 LYS A H    1  
ATOM 3034   H HA   . LYS A 1 188 ? -17.262 -5.966  12.312  1.00 23.15 ? 188 LYS A HA   1  
ATOM 3035   H HB2  . LYS A 1 188 ? -16.284 -8.036  10.391  1.00 21.43 ? 188 LYS A HB2  1  
ATOM 3036   H HB3  . LYS A 1 188 ? -16.708 -8.533  12.024  1.00 1.02  ? 188 LYS A HB3  1  
ATOM 3037   H HG2  . LYS A 1 188 ? -18.925 -7.293  11.588  1.00 74.02 ? 188 LYS A HG2  1  
ATOM 3038   H HG3  . LYS A 1 188 ? -18.460 -7.387  9.888   1.00 34.31 ? 188 LYS A HG3  1  
ATOM 3039   H HD2  . LYS A 1 188 ? -18.135 -9.880  10.276  1.00 43.04 ? 188 LYS A HD2  1  
ATOM 3040   H HD3  . LYS A 1 188 ? -18.974 -9.644  11.810  1.00 54.53 ? 188 LYS A HD3  1  
ATOM 3041   H HE2  . LYS A 1 188 ? -20.946 -8.886  10.696  1.00 0.41  ? 188 LYS A HE2  1  
ATOM 3042   H HE3  . LYS A 1 188 ? -20.114 -8.833  9.142   1.00 4.43  ? 188 LYS A HE3  1  
ATOM 3043   H HZ1  . LYS A 1 188 ? -21.033 -11.178 10.670  1.00 40.11 ? 188 LYS A HZ1  1  
ATOM 3044   H HZ2  . LYS A 1 188 ? -19.760 -11.335 9.568   1.00 3.01  ? 188 LYS A HZ2  1  
ATOM 3045   H HZ3  . LYS A 1 188 ? -21.276 -10.805 9.037   1.00 3.41  ? 188 LYS A HZ3  1  
ATOM 3046   N N    . ASN A 1 189 ? -14.063 -6.670  12.217  1.00 61.04 ? 189 ASN A N    1  
ATOM 3047   C CA   . ASN A 1 189 ? -12.866 -6.832  13.034  1.00 31.14 ? 189 ASN A CA   1  
ATOM 3048   C C    . ASN A 1 189 ? -12.041 -5.546  13.051  1.00 31.32 ? 189 ASN A C    1  
ATOM 3049   O O    . ASN A 1 189 ? -11.199 -5.330  12.179  1.00 23.51 ? 189 ASN A O    1  
ATOM 3050   C CB   . ASN A 1 189 ? -12.016 -7.989  12.506  1.00 64.50 ? 189 ASN A CB   1  
ATOM 3051   C CG   . ASN A 1 189 ? -12.800 -9.282  12.402  1.00 1.14  ? 189 ASN A CG   1  
ATOM 3052   O OD1  . ASN A 1 189 ? -12.592 -10.213 13.181  1.00 2.04  ? 189 ASN A OD1  1  
ATOM 3053   N ND2  . ASN A 1 189 ? -13.709 -9.347  11.436  1.00 42.24 ? 189 ASN A ND2  1  
ATOM 3054   H H    . ASN A 1 189 ? -13.972 -6.614  11.243  1.00 10.03 ? 189 ASN A H    1  
ATOM 3055   H HA   . ASN A 1 189 ? -13.180 -7.059  14.042  1.00 55.55 ? 189 ASN A HA   1  
ATOM 3056   H HB2  . ASN A 1 189 ? -11.644 -7.736  11.525  1.00 22.34 ? 189 ASN A HB2  1  
ATOM 3057   H HB3  . ASN A 1 189 ? -11.181 -8.148  13.173  1.00 53.44 ? 189 ASN A HB3  1  
ATOM 3058   H HD21 . ASN A 1 189 ? -13.821 -8.568  10.853  1.00 50.12 ? 189 ASN A HD21 1  
ATOM 3059   H HD22 . ASN A 1 189 ? -14.231 -10.172 11.346  1.00 20.41 ? 189 ASN A HD22 1  
ATOM 3060   N N    . PRO A 1 190 ? -12.274 -4.670  14.045  1.00 14.22 ? 190 PRO A N    1  
ATOM 3061   C CA   . PRO A 1 190 ? -11.545 -3.402  14.164  1.00 32.23 ? 190 PRO A CA   1  
ATOM 3062   C C    . PRO A 1 190 ? -10.063 -3.609  14.458  1.00 23.00 ? 190 PRO A C    1  
ATOM 3063   O O    . PRO A 1 190 ? -9.233  -2.756  14.141  1.00 40.24 ? 190 PRO A O    1  
ATOM 3064   C CB   . PRO A 1 190 ? -12.231 -2.699  15.340  1.00 54.00 ? 190 PRO A CB   1  
ATOM 3065   C CG   . PRO A 1 190 ? -12.863 -3.795  16.126  1.00 54.03 ? 190 PRO A CG   1  
ATOM 3066   C CD   . PRO A 1 190 ? -13.260 -4.845  15.127  1.00 40.23 ? 190 PRO A CD   1  
ATOM 3067   H HA   . PRO A 1 190 ? -11.652 -2.802  13.272  1.00 32.42 ? 190 PRO A HA   1  
ATOM 3068   H HB2  . PRO A 1 190 ? -11.493 -2.169  15.924  1.00 31.12 ? 190 PRO A HB2  1  
ATOM 3069   H HB3  . PRO A 1 190 ? -12.969 -2.006  14.968  1.00 64.41 ? 190 PRO A HB3  1  
ATOM 3070   H HG2  . PRO A 1 190 ? -12.151 -4.199  16.832  1.00 72.15 ? 190 PRO A HG2  1  
ATOM 3071   H HG3  . PRO A 1 190 ? -13.734 -3.421  16.643  1.00 13.31 ? 190 PRO A HG3  1  
ATOM 3072   H HD2  . PRO A 1 190 ? -13.184 -5.829  15.564  1.00 25.00 ? 190 PRO A HD2  1  
ATOM 3073   H HD3  . PRO A 1 190 ? -14.262 -4.665  14.768  1.00 33.33 ? 190 PRO A HD3  1  
ATOM 3074   N N    . ASP A 1 191 ? -9.736  -4.746  15.063  1.00 14.30 ? 191 ASP A N    1  
ATOM 3075   C CA   . ASP A 1 191 ? -8.352  -5.062  15.398  1.00 35.40 ? 191 ASP A CA   1  
ATOM 3076   C C    . ASP A 1 191 ? -7.641  -5.752  14.234  1.00 35.31 ? 191 ASP A C    1  
ATOM 3077   O O    . ASP A 1 191 ? -6.497  -6.187  14.368  1.00 40.40 ? 191 ASP A O    1  
ATOM 3078   C CB   . ASP A 1 191 ? -8.299  -5.953  16.640  1.00 35.24 ? 191 ASP A CB   1  
ATOM 3079   C CG   . ASP A 1 191 ? -9.193  -7.171  16.517  1.00 14.33 ? 191 ASP A CG   1  
ATOM 3080   O OD1  . ASP A 1 191 ? -8.951  -7.996  15.612  1.00 5.24  ? 191 ASP A OD1  1  
ATOM 3081   O OD2  . ASP A 1 191 ? -10.136 -7.299  17.327  1.00 63.40 ? 191 ASP A OD2  1  
ATOM 3082   H H    . ASP A 1 191 ? -10.442 -5.387  15.290  1.00 45.13 ? 191 ASP A H    1  
ATOM 3083   H HA   . ASP A 1 191 ? -7.845  -4.134  15.613  1.00 41.34 ? 191 ASP A HA   1  
ATOM 3084   H HB2  . ASP A 1 191 ? -7.284  -6.289  16.792  1.00 45.44 ? 191 ASP A HB2  1  
ATOM 3085   H HB3  . ASP A 1 191 ? -8.616  -5.380  17.500  1.00 3.14  ? 191 ASP A HB3  1  
ATOM 3086   N N    . GLN A 1 192 ? -8.320  -5.852  13.093  1.00 5.24  ? 192 GLN A N    1  
ATOM 3087   C CA   . GLN A 1 192 ? -7.743  -6.492  11.916  1.00 2.21  ? 192 GLN A CA   1  
ATOM 3088   C C    . GLN A 1 192 ? -7.342  -5.455  10.872  1.00 3.20  ? 192 GLN A C    1  
ATOM 3089   O O    . GLN A 1 192 ? -8.169  -4.662  10.421  1.00 52.53 ? 192 GLN A O    1  
ATOM 3090   C CB   . GLN A 1 192 ? -8.737  -7.486  11.312  1.00 32.41 ? 192 GLN A CB   1  
ATOM 3091   C CG   . GLN A 1 192 ? -8.097  -8.789  10.861  1.00 10.34 ? 192 GLN A CG   1  
ATOM 3092   C CD   . GLN A 1 192 ? -9.099  -9.920  10.742  1.00 1.44  ? 192 GLN A CD   1  
ATOM 3093   O OE1  . GLN A 1 192 ? -9.256  -10.516 9.676   1.00 3.51  ? 192 GLN A OE1  1  
ATOM 3094   N NE2  . GLN A 1 192 ? -9.784  -10.222 11.839  1.00 52.20 ? 192 GLN A NE2  1  
ATOM 3095   H H    . GLN A 1 192 ? -9.229  -5.491  13.040  1.00 13.05 ? 192 GLN A H    1  
ATOM 3096   H HA   . GLN A 1 192 ? -6.860  -7.027  12.231  1.00 31.53 ? 192 GLN A HA   1  
ATOM 3097   H HB2  . GLN A 1 192 ? -9.490  -7.717  12.050  1.00 71.24 ? 192 GLN A HB2  1  
ATOM 3098   H HB3  . GLN A 1 192 ? -9.212  -7.029  10.457  1.00 34.31 ? 192 GLN A HB3  1  
ATOM 3099   H HG2  . GLN A 1 192 ? -7.636  -8.634  9.897   1.00 70.42 ? 192 GLN A HG2  1  
ATOM 3100   H HG3  . GLN A 1 192 ? -7.341  -9.070  11.580  1.00 30.45 ? 192 GLN A HG3  1  
ATOM 3101   H HE21 . GLN A 1 192 ? -9.608  -9.704  12.652  1.00 52.31 ? 192 GLN A HE21 1  
ATOM 3102   H HE22 . GLN A 1 192 ? -10.438 -10.950 11.790  1.00 33.32 ? 192 GLN A HE22 1  
ATOM 3103   N N    . VAL A 1 193 ? -6.069  -5.466  10.492  1.00 23.25 ? 193 VAL A N    1  
ATOM 3104   C CA   . VAL A 1 193 ? -5.558  -4.527  9.501   1.00 34.13 ? 193 VAL A CA   1  
ATOM 3105   C C    . VAL A 1 193 ? -5.391  -5.201  8.141   1.00 3.13  ? 193 VAL A C    1  
ATOM 3106   O O    . VAL A 1 193 ? -4.985  -6.360  8.056   1.00 72.01 ? 193 VAL A O    1  
ATOM 3107   C CB   . VAL A 1 193 ? -4.207  -3.927  9.939   1.00 4.34  ? 193 VAL A CB   1  
ATOM 3108   C CG1  . VAL A 1 193 ? -3.157  -5.019  10.091  1.00 4.31  ? 193 VAL A CG1  1  
ATOM 3109   C CG2  . VAL A 1 193 ? -3.745  -2.866  8.951   1.00 74.24 ? 193 VAL A CG2  1  
ATOM 3110   H H    . VAL A 1 193 ? -5.458  -6.122  10.888  1.00 62.34 ? 193 VAL A H    1  
ATOM 3111   H HA   . VAL A 1 193 ? -6.272  -3.722  9.407   1.00 31.50 ? 193 VAL A HA   1  
ATOM 3112   H HB   . VAL A 1 193 ? -4.342  -3.456  10.902  1.00 5.30  ? 193 VAL A HB   1  
ATOM 3113   H HG11 . VAL A 1 193 ? -3.004  -5.505  9.139   1.00 70.13 ? 193 VAL A HG11 1  
ATOM 3114   H HG12 . VAL A 1 193 ? -3.495  -5.744  10.816  1.00 4.10  ? 193 VAL A HG12 1  
ATOM 3115   H HG13 . VAL A 1 193 ? -2.229  -4.581  10.426  1.00 12.14 ? 193 VAL A HG13 1  
ATOM 3116   H HG21 . VAL A 1 193 ? -3.663  -3.302  7.967   1.00 11.44 ? 193 VAL A HG21 1  
ATOM 3117   H HG22 . VAL A 1 193 ? -2.782  -2.484  9.257   1.00 61.33 ? 193 VAL A HG22 1  
ATOM 3118   H HG23 . VAL A 1 193 ? -4.462  -2.059  8.929   1.00 52.11 ? 193 VAL A HG23 1  
ATOM 3119   N N    . TYR A 1 194 ? -5.709  -4.465  7.081   1.00 30.01 ? 194 TYR A N    1  
ATOM 3120   C CA   . TYR A 1 194 ? -5.597  -4.988  5.725   1.00 62.04 ? 194 TYR A CA   1  
ATOM 3121   C C    . TYR A 1 194 ? -4.845  -4.013  4.825   1.00 43.10 ? 194 TYR A C    1  
ATOM 3122   O O    . TYR A 1 194 ? -5.079  -2.805  4.871   1.00 55.43 ? 194 TYR A O    1  
ATOM 3123   C CB   . TYR A 1 194 ? -6.986  -5.263  5.145   1.00 74.12 ? 194 TYR A CB   1  
ATOM 3124   C CG   . TYR A 1 194 ? -7.650  -6.498  5.713   1.00 13.01 ? 194 TYR A CG   1  
ATOM 3125   C CD1  . TYR A 1 194 ? -7.999  -6.567  7.056   1.00 64.41 ? 194 TYR A CD1  1  
ATOM 3126   C CD2  . TYR A 1 194 ? -7.928  -7.594  4.906   1.00 24.24 ? 194 TYR A CD2  1  
ATOM 3127   C CE1  . TYR A 1 194 ? -8.607  -7.693  7.578   1.00 64.52 ? 194 TYR A CE1  1  
ATOM 3128   C CE2  . TYR A 1 194 ? -8.535  -8.723  5.421   1.00 41.12 ? 194 TYR A CE2  1  
ATOM 3129   C CZ   . TYR A 1 194 ? -8.872  -8.768  6.757   1.00 14.55 ? 194 TYR A CZ   1  
ATOM 3130   O OH   . TYR A 1 194 ? -9.477  -9.891  7.273   1.00 50.31 ? 194 TYR A OH   1  
ATOM 3131   H H    . TYR A 1 194 ? -6.028  -3.548  7.214   1.00 65.31 ? 194 TYR A H    1  
ATOM 3132   H HA   . TYR A 1 194 ? -5.046  -5.915  5.771   1.00 45.22 ? 194 TYR A HA   1  
ATOM 3133   H HB2  . TYR A 1 194 ? -7.627  -4.419  5.351   1.00 51.34 ? 194 TYR A HB2  1  
ATOM 3134   H HB3  . TYR A 1 194 ? -6.902  -5.393  4.076   1.00 51.33 ? 194 TYR A HB3  1  
ATOM 3135   H HD1  . TYR A 1 194 ? -7.790  -5.723  7.697   1.00 23.21 ? 194 TYR A HD1  1  
ATOM 3136   H HD2  . TYR A 1 194 ? -7.662  -7.556  3.860   1.00 73.15 ? 194 TYR A HD2  1  
ATOM 3137   H HE1  . TYR A 1 194 ? -8.871  -7.727  8.625   1.00 31.21 ? 194 TYR A HE1  1  
ATOM 3138   H HE2  . TYR A 1 194 ? -8.743  -9.565  4.777   1.00 75.02 ? 194 TYR A HE2  1  
ATOM 3139   H HH   . TYR A 1 194 ? -10.103 -10.240 6.635   1.00 2.20  ? 194 TYR A HH   1  
ATOM 3140   N N    . LEU A 1 195 ? -3.945  -4.545  4.004   1.00 63.41 ? 195 LEU A N    1  
ATOM 3141   C CA   . LEU A 1 195 ? -3.163  -3.721  3.090   1.00 2.43  ? 195 LEU A CA   1  
ATOM 3142   C C    . LEU A 1 195 ? -3.656  -3.885  1.657   1.00 1.00  ? 195 LEU A C    1  
ATOM 3143   O O    . LEU A 1 195 ? -3.291  -4.838  0.969   1.00 13.12 ? 195 LEU A O    1  
ATOM 3144   C CB   . LEU A 1 195 ? -1.680  -4.089  3.178   1.00 32.33 ? 195 LEU A CB   1  
ATOM 3145   C CG   . LEU A 1 195 ? -0.710  -2.958  2.832   1.00 72.54 ? 195 LEU A CG   1  
ATOM 3146   C CD1  . LEU A 1 195 ? 0.628   -3.173  3.522   1.00 42.30 ? 195 LEU A CD1  1  
ATOM 3147   C CD2  . LEU A 1 195 ? -0.526  -2.858  1.325   1.00 23.43 ? 195 LEU A CD2  1  
ATOM 3148   H H    . LEU A 1 195 ? -3.806  -5.515  4.012   1.00 4.44  ? 195 LEU A H    1  
ATOM 3149   H HA   . LEU A 1 195 ? -3.286  -2.689  3.385   1.00 42.35 ? 195 LEU A HA   1  
ATOM 3150   H HB2  . LEU A 1 195 ? -1.472  -4.419  4.186   1.00 13.51 ? 195 LEU A HB2  1  
ATOM 3151   H HB3  . LEU A 1 195 ? -1.495  -4.911  2.503   1.00 41.45 ? 195 LEU A HB3  1  
ATOM 3152   H HG   . LEU A 1 195 ? -1.120  -2.022  3.183   1.00 73.44 ? 195 LEU A HG   1  
ATOM 3153   H HD11 . LEU A 1 195 ? 1.422   -2.802  2.891   1.00 23.32 ? 195 LEU A HD11 1  
ATOM 3154   H HD12 . LEU A 1 195 ? 0.775   -4.228  3.701   1.00 10.13 ? 195 LEU A HD12 1  
ATOM 3155   H HD13 . LEU A 1 195 ? 0.637   -2.643  4.463   1.00 34.54 ? 195 LEU A HD13 1  
ATOM 3156   H HD21 . LEU A 1 195 ? 0.488   -2.557  1.106   1.00 15.34 ? 195 LEU A HD21 1  
ATOM 3157   H HD22 . LEU A 1 195 ? -1.213  -2.126  0.927   1.00 10.14 ? 195 LEU A HD22 1  
ATOM 3158   H HD23 . LEU A 1 195 ? -0.722  -3.819  0.874   1.00 4.33  ? 195 LEU A HD23 1  
ATOM 3159   N N    . VAL A 1 196 ? -4.492  -2.951  1.214   1.00 74.44 ? 196 VAL A N    1  
ATOM 3160   C CA   . VAL A 1 196 ? -5.040  -2.995  -0.137  1.00 22.24 ? 196 VAL A CA   1  
ATOM 3161   C C    . VAL A 1 196 ? -4.509  -1.845  -0.986  1.00 5.42  ? 196 VAL A C    1  
ATOM 3162   O O    . VAL A 1 196 ? -3.881  -0.919  -0.473  1.00 74.41 ? 196 VAL A O    1  
ATOM 3163   C CB   . VAL A 1 196 ? -6.580  -2.940  -0.122  1.00 63.22 ? 196 VAL A CB   1  
ATOM 3164   C CG1  . VAL A 1 196 ? -7.154  -4.164  0.579   1.00 12.13 ? 196 VAL A CG1  1  
ATOM 3165   C CG2  . VAL A 1 196 ? -7.065  -1.656  0.539   1.00 14.50 ? 196 VAL A CG2  1  
ATOM 3166   H H    . VAL A 1 196 ? -4.749  -2.217  1.811   1.00 12.23 ? 196 VAL A H    1  
ATOM 3167   H HA   . VAL A 1 196 ? -4.739  -3.929  -0.588  1.00 42.51 ? 196 VAL A HA   1  
ATOM 3168   H HB   . VAL A 1 196 ? -6.928  -2.945  -1.145  1.00 14.11 ? 196 VAL A HB   1  
ATOM 3169   H HG11 . VAL A 1 196 ? -7.763  -3.850  1.414   1.00 21.52 ? 196 VAL A HG11 1  
ATOM 3170   H HG12 . VAL A 1 196 ? -6.347  -4.786  0.937   1.00 50.12 ? 196 VAL A HG12 1  
ATOM 3171   H HG13 . VAL A 1 196 ? -7.760  -4.725  -0.117  1.00 52.42 ? 196 VAL A HG13 1  
ATOM 3172   H HG21 . VAL A 1 196 ? -7.831  -1.890  1.264   1.00 63.22 ? 196 VAL A HG21 1  
ATOM 3173   H HG22 . VAL A 1 196 ? -7.472  -0.996  -0.213  1.00 4.42  ? 196 VAL A HG22 1  
ATOM 3174   H HG23 . VAL A 1 196 ? -6.238  -1.169  1.034   1.00 24.35 ? 196 VAL A HG23 1  
ATOM 3175   N N    . ASP A 1 197 ? -4.767  -1.912  -2.288  1.00 22.42 ? 197 ASP A N    1  
ATOM 3176   C CA   . ASP A 1 197 ? -4.316  -0.877  -3.211  1.00 51.12 ? 197 ASP A CA   1  
ATOM 3177   C C    . ASP A 1 197 ? -2.797  -0.748  -3.183  1.00 31.34 ? 197 ASP A C    1  
ATOM 3178   O O    . ASP A 1 197 ? -2.253  0.186   -2.594  1.00 12.25 ? 197 ASP A O    1  
ATOM 3179   C CB   . ASP A 1 197 ? -4.962  0.465   -2.860  1.00 74.32 ? 197 ASP A CB   1  
ATOM 3180   C CG   . ASP A 1 197 ? -6.243  0.710   -3.633  1.00 52.42 ? 197 ASP A CG   1  
ATOM 3181   O OD1  . ASP A 1 197 ? -6.398  0.124   -4.725  1.00 30.42 ? 197 ASP A OD1  1  
ATOM 3182   O OD2  . ASP A 1 197 ? -7.090  1.488   -3.146  1.00 2.44  ? 197 ASP A OD2  1  
ATOM 3183   H H    . ASP A 1 197 ? -5.273  -2.675  -2.637  1.00 2.05  ? 197 ASP A H    1  
ATOM 3184   H HA   . ASP A 1 197 ? -4.623  -1.164  -4.206  1.00 72.23 ? 197 ASP A HA   1  
ATOM 3185   H HB2  . ASP A 1 197 ? -5.191  0.482   -1.805  1.00 45.01 ? 197 ASP A HB2  1  
ATOM 3186   H HB3  . ASP A 1 197 ? -4.268  1.262   -3.086  1.00 34.13 ? 197 ASP A HB3  1  
ATOM 3187   N N    . TYR A 1 198 ? -2.116  -1.692  -3.824  1.00 10.24 ? 198 TYR A N    1  
ATOM 3188   C CA   . TYR A 1 198 ? -0.659  -1.682  -3.872  1.00 71.33 ? 198 TYR A CA   1  
ATOM 3189   C C    . TYR A 1 198 ? -0.151  -0.454  -4.622  1.00 14.42 ? 198 TYR A C    1  
ATOM 3190   O O    . TYR A 1 198 ? 0.579   0.367   -4.067  1.00 72.42 ? 198 TYR A O    1  
ATOM 3191   C CB   . TYR A 1 198 ? -0.140  -2.956  -4.541  1.00 53.11 ? 198 TYR A CB   1  
ATOM 3192   C CG   . TYR A 1 198 ? 0.177   -4.068  -3.565  1.00 45.33 ? 198 TYR A CG   1  
ATOM 3193   C CD1  . TYR A 1 198 ? -0.837  -4.739  -2.892  1.00 72.23 ? 198 TYR A CD1  1  
ATOM 3194   C CD2  . TYR A 1 198 ? 1.491   -4.446  -3.317  1.00 41.52 ? 198 TYR A CD2  1  
ATOM 3195   C CE1  . TYR A 1 198 ? -0.550  -5.755  -2.000  1.00 3.43  ? 198 TYR A CE1  1  
ATOM 3196   C CE2  . TYR A 1 198 ? 1.785   -5.461  -2.427  1.00 12.20 ? 198 TYR A CE2  1  
ATOM 3197   C CZ   . TYR A 1 198 ? 0.762   -6.112  -1.771  1.00 62.13 ? 198 TYR A CZ   1  
ATOM 3198   O OH   . TYR A 1 198 ? 1.051   -7.123  -0.884  1.00 62.23 ? 198 TYR A OH   1  
ATOM 3199   H H    . TYR A 1 198 ? -2.605  -2.412  -4.276  1.00 74.42 ? 198 TYR A H    1  
ATOM 3200   H HA   . TYR A 1 198 ? -0.294  -1.645  -2.856  1.00 12.03 ? 198 TYR A HA   1  
ATOM 3201   H HB2  . TYR A 1 198 ? -0.887  -3.323  -5.229  1.00 51.04 ? 198 TYR A HB2  1  
ATOM 3202   H HB3  . TYR A 1 198 ? 0.763   -2.725  -5.087  1.00 10.44 ? 198 TYR A HB3  1  
ATOM 3203   H HD1  . TYR A 1 198 ? -1.863  -4.458  -3.074  1.00 2.51  ? 198 TYR A HD1  1  
ATOM 3204   H HD2  . TYR A 1 198 ? 2.290   -3.933  -3.831  1.00 11.02 ? 198 TYR A HD2  1  
ATOM 3205   H HE1  . TYR A 1 198 ? -1.352  -6.265  -1.487  1.00 24.31 ? 198 TYR A HE1  1  
ATOM 3206   H HE2  . TYR A 1 198 ? 2.813   -5.740  -2.247  1.00 4.12  ? 198 TYR A HE2  1  
ATOM 3207   H HH   . TYR A 1 198 ? 0.530   -7.899  -1.102  1.00 50.53 ? 198 TYR A HH   1  
ATOM 3208   N N    . GLY A 1 199 ? -0.544  -0.335  -5.886  1.00 22.44 ? 199 GLY A N    1  
ATOM 3209   C CA   . GLY A 1 199 ? -0.121  0.796   -6.691  1.00 50.23 ? 199 GLY A CA   1  
ATOM 3210   C C    . GLY A 1 199 ? 1.387   0.904   -6.803  1.00 15.51 ? 199 GLY A C    1  
ATOM 3211   O O    . GLY A 1 199 ? 1.915   1.971   -7.116  1.00 53.35 ? 199 GLY A O    1  
ATOM 3212   H H    . GLY A 1 199 ? -1.127  -1.021  -6.274  1.00 71.21 ? 199 GLY A H    1  
ATOM 3213   H HA2  . GLY A 1 199 ? -0.535  0.694   -7.682  1.00 4.32  ? 199 GLY A HA2  1  
ATOM 3214   H HA3  . GLY A 1 199 ? -0.502  1.702   -6.246  1.00 63.23 ? 199 GLY A HA3  1  
ATOM 3215   N N    . LEU A 1 200 ? 2.084   -0.199  -6.548  1.00 42.44 ? 200 LEU A N    1  
ATOM 3216   C CA   . LEU A 1 200 ? 3.540   -0.210  -6.626  1.00 52.10 ? 200 LEU A CA   1  
ATOM 3217   C C    . LEU A 1 200 ? 4.102   -1.606  -6.372  1.00 14.41 ? 200 LEU A C    1  
ATOM 3218   O O    . LEU A 1 200 ? 5.205   -1.749  -5.845  1.00 45.32 ? 200 LEU A O    1  
ATOM 3219   C CB   . LEU A 1 200 ? 4.128   0.778   -5.615  1.00 11.52 ? 200 LEU A CB   1  
ATOM 3220   C CG   . LEU A 1 200 ? 5.314   1.597   -6.124  1.00 71.14 ? 200 LEU A CG   1  
ATOM 3221   C CD1  . LEU A 1 200 ? 6.408   0.682   -6.652  1.00 3.41  ? 200 LEU A CD1  1  
ATOM 3222   C CD2  . LEU A 1 200 ? 4.863   2.572   -7.202  1.00 14.25 ? 200 LEU A CD2  1  
ATOM 3223   H H    . LEU A 1 200 ? 1.610   -1.021  -6.303  1.00 73.05 ? 200 LEU A H    1  
ATOM 3224   H HA   . LEU A 1 200 ? 3.819   0.102   -7.621  1.00 21.54 ? 200 LEU A HA   1  
ATOM 3225   H HB2  . LEU A 1 200 ? 3.346   1.461   -5.316  1.00 73.53 ? 200 LEU A HB2  1  
ATOM 3226   H HB3  . LEU A 1 200 ? 4.449   0.224   -4.746  1.00 52.34 ? 200 LEU A HB3  1  
ATOM 3227   H HG   . LEU A 1 200 ? 5.725   2.170   -5.305  1.00 34.43 ? 200 LEU A HG   1  
ATOM 3228   H HD11 . LEU A 1 200 ? 6.976   0.285   -5.824  1.00 74.21 ? 200 LEU A HD11 1  
ATOM 3229   H HD12 . LEU A 1 200 ? 7.064   1.242   -7.302  1.00 33.54 ? 200 LEU A HD12 1  
ATOM 3230   H HD13 . LEU A 1 200 ? 5.961   -0.131  -7.205  1.00 50.55 ? 200 LEU A HD13 1  
ATOM 3231   H HD21 . LEU A 1 200 ? 4.090   2.113   -7.801  1.00 30.25 ? 200 LEU A HD21 1  
ATOM 3232   H HD22 . LEU A 1 200 ? 5.702   2.827   -7.831  1.00 64.53 ? 200 LEU A HD22 1  
ATOM 3233   H HD23 . LEU A 1 200 ? 4.475   3.467   -6.738  1.00 62.32 ? 200 LEU A HD23 1  
ATOM 3234   N N    . ALA A 1 201 ? 3.351   -2.635  -6.756  1.00 30.04 ? 201 ALA A N    1  
ATOM 3235   C CA   . ALA A 1 201 ? 3.795   -4.011  -6.572  1.00 23.53 ? 201 ALA A CA   1  
ATOM 3236   C C    . ALA A 1 201 ? 4.402   -4.563  -7.857  1.00 41.10 ? 201 ALA A C    1  
ATOM 3237   O O    . ALA A 1 201 ? 3.692   -4.807  -8.832  1.00 64.24 ? 201 ALA A O    1  
ATOM 3238   C CB   . ALA A 1 201 ? 2.635   -4.884  -6.115  1.00 53.11 ? 201 ALA A CB   1  
ATOM 3239   H H    . ALA A 1 201 ? 2.484   -2.475  -7.184  1.00 10.01 ? 201 ALA A H    1  
ATOM 3240   H HA   . ALA A 1 201 ? 4.547   -4.017  -5.798  1.00 4.54  ? 201 ALA A HA   1  
ATOM 3241   H HB1  . ALA A 1 201 ? 1.821   -4.256  -5.784  1.00 31.51 ? 201 ALA A HB1  1  
ATOM 3242   H HB2  . ALA A 1 201 ? 2.958   -5.514  -5.299  1.00 53.33 ? 201 ALA A HB2  1  
ATOM 3243   H HB3  . ALA A 1 201 ? 2.302   -5.501  -6.936  1.00 13.30 ? 201 ALA A HB3  1  
ATOM 3244   N N    . TYR A 1 202 ? 5.717   -4.756  -7.858  1.00 41.01 ? 202 TYR A N    1  
ATOM 3245   C CA   . TYR A 1 202 ? 6.405   -5.276  -9.035  1.00 24.21 ? 202 TYR A CA   1  
ATOM 3246   C C    . TYR A 1 202 ? 7.414   -6.357  -8.655  1.00 32.32 ? 202 TYR A C    1  
ATOM 3247   O O    . TYR A 1 202 ? 7.876   -6.417  -7.515  1.00 3.25  ? 202 TYR A O    1  
ATOM 3248   C CB   . TYR A 1 202 ? 7.105   -4.139  -9.786  1.00 15.24 ? 202 TYR A CB   1  
ATOM 3249   C CG   . TYR A 1 202 ? 6.550   -3.902  -11.172 1.00 73.30 ? 202 TYR A CG   1  
ATOM 3250   C CD1  . TYR A 1 202 ? 5.196   -3.658  -11.366 1.00 52.22 ? 202 TYR A CD1  1  
ATOM 3251   C CD2  . TYR A 1 202 ? 7.379   -3.924  -12.286 1.00 14.32 ? 202 TYR A CD2  1  
ATOM 3252   C CE1  . TYR A 1 202 ? 4.683   -3.443  -12.632 1.00 71.01 ? 202 TYR A CE1  1  
ATOM 3253   C CE2  . TYR A 1 202 ? 6.874   -3.709  -13.555 1.00 13.53 ? 202 TYR A CE2  1  
ATOM 3254   C CZ   . TYR A 1 202 ? 5.527   -3.469  -13.722 1.00 72.51 ? 202 TYR A CZ   1  
ATOM 3255   O OH   . TYR A 1 202 ? 5.021   -3.255  -14.984 1.00 0.00  ? 202 TYR A OH   1  
ATOM 3256   H H    . TYR A 1 202 ? 6.235   -4.542  -7.053  1.00 24.24 ? 202 TYR A H    1  
ATOM 3257   H HA   . TYR A 1 202 ? 5.661   -5.714  -9.683  1.00 72.31 ? 202 TYR A HA   1  
ATOM 3258   H HB2  . TYR A 1 202 ? 6.993   -3.224  -9.224  1.00 51.13 ? 202 TYR A HB2  1  
ATOM 3259   H HB3  . TYR A 1 202 ? 8.156   -4.370  -9.883  1.00 24.12 ? 202 TYR A HB3  1  
ATOM 3260   H HD1  . TYR A 1 202 ? 4.539   -3.637  -10.510 1.00 42.51 ? 202 TYR A HD1  1  
ATOM 3261   H HD2  . TYR A 1 202 ? 8.434   -4.112  -12.152 1.00 10.43 ? 202 TYR A HD2  1  
ATOM 3262   H HE1  . TYR A 1 202 ? 3.627   -3.255  -12.762 1.00 53.10 ? 202 TYR A HE1  1  
ATOM 3263   H HE2  . TYR A 1 202 ? 7.535   -3.730  -14.409 1.00 5.44  ? 202 TYR A HE2  1  
ATOM 3264   H HH   . TYR A 1 202 ? 4.535   -4.032  -15.270 1.00 4.24  ? 202 TYR A HH   1  
ATOM 3265   N N    . ARG A 1 203 ? 7.749   -7.209  -9.620  1.00 62.30 ? 203 ARG A N    1  
ATOM 3266   C CA   . ARG A 1 203 ? 8.700   -8.292  -9.395  1.00 3.11  ? 203 ARG A CA   1  
ATOM 3267   C C    . ARG A 1 203 ? 10.074  -7.938  -9.955  1.00 43.13 ? 203 ARG A C    1  
ATOM 3268   O O    . ARG A 1 203 ? 10.189  -7.435  -11.073 1.00 35.53 ? 203 ARG A O    1  
ATOM 3269   C CB   . ARG A 1 203 ? 8.195   -9.585  -10.039 1.00 53.12 ? 203 ARG A CB   1  
ATOM 3270   C CG   . ARG A 1 203 ? 6.902   -10.104 -9.432  1.00 61.41 ? 203 ARG A CG   1  
ATOM 3271   C CD   . ARG A 1 203 ? 6.882   -11.623 -9.370  1.00 54.54 ? 203 ARG A CD   1  
ATOM 3272   N NE   . ARG A 1 203 ? 6.039   -12.204 -10.413 1.00 43.44 ? 203 ARG A NE   1  
ATOM 3273   C CZ   . ARG A 1 203 ? 6.441   -12.407 -11.666 1.00 73.01 ? 203 ARG A CZ   1  
ATOM 3274   N NH1  . ARG A 1 203 ? 7.672   -12.080 -12.039 1.00 31.45 ? 203 ARG A NH1  1  
ATOM 3275   N NH2  . ARG A 1 203 ? 5.608   -12.940 -12.550 1.00 45.14 ? 203 ARG A NH2  1  
ATOM 3276   H H    . ARG A 1 203 ? 7.344   -7.107  -10.507 1.00 34.24 ? 203 ARG A H    1  
ATOM 3277   H HA   . ARG A 1 203 ? 8.786   -8.441  -8.330  1.00 65.32 ? 203 ARG A HA   1  
ATOM 3278   H HB2  . ARG A 1 203 ? 8.028   -9.408  -11.091 1.00 4.32  ? 203 ARG A HB2  1  
ATOM 3279   H HB3  . ARG A 1 203 ? 8.952   -10.348 -9.927  1.00 54.35 ? 203 ARG A HB3  1  
ATOM 3280   H HG2  . ARG A 1 203 ? 6.803   -9.712  -8.431  1.00 22.43 ? 203 ARG A HG2  1  
ATOM 3281   H HG3  . ARG A 1 203 ? 6.072   -9.766  -10.036 1.00 41.11 ? 203 ARG A HG3  1  
ATOM 3282   H HD2  . ARG A 1 203 ? 7.891   -11.990 -9.490  1.00 1.42  ? 203 ARG A HD2  1  
ATOM 3283   H HD3  . ARG A 1 203 ? 6.503   -11.926 -8.405  1.00 72.20 ? 203 ARG A HD3  1  
ATOM 3284   H HE   . ARG A 1 203 ? 5.125   -12.456 -10.167 1.00 50.42 ? 203 ARG A HE   1  
ATOM 3285   H HH11 . ARG A 1 203 ? 8.306   -11.678 -11.379 1.00 73.40 ? 203 ARG A HH11 1  
ATOM 3286   H HH12 . ARG A 1 203 ? 7.966   -12.236 -12.982 1.00 11.40 ? 203 ARG A HH12 1  
ATOM 3287   H HH21 . ARG A 1 203 ? 4.680   -13.189 -12.275 1.00 63.51 ? 203 ARG A HH21 1  
ATOM 3288   H HH22 . ARG A 1 203 ? 5.909   -13.093 -13.492 1.00 53.43 ? 203 ARG A HH22 1  
ATOM 3289   N N    . TYR A 1 204 ? 11.115  -8.203  -9.170  1.00 31.14 ? 204 TYR A N    1  
ATOM 3290   C CA   . TYR A 1 204 ? 12.481  -7.911  -9.589  1.00 24.23 ? 204 TYR A CA   1  
ATOM 3291   C C    . TYR A 1 204 ? 13.343  -9.172  -9.569  1.00 71.05 ? 204 TYR A C    1  
ATOM 3292   O O    . TYR A 1 204 ? 14.552  -9.104  -9.349  1.00 2.05  ? 204 TYR A O    1  
ATOM 3293   C CB   . TYR A 1 204 ? 13.095  -6.837  -8.685  1.00 54.34 ? 204 TYR A CB   1  
ATOM 3294   C CG   . TYR A 1 204 ? 13.449  -7.330  -7.298  1.00 60.43 ? 204 TYR A CG   1  
ATOM 3295   C CD1  . TYR A 1 204 ? 12.458  -7.675  -6.388  1.00 51.32 ? 204 TYR A CD1  1  
ATOM 3296   C CD2  . TYR A 1 204 ? 14.775  -7.451  -6.901  1.00 74.42 ? 204 TYR A CD2  1  
ATOM 3297   C CE1  . TYR A 1 204 ? 12.778  -8.125  -5.121  1.00 61.21 ? 204 TYR A CE1  1  
ATOM 3298   C CE2  . TYR A 1 204 ? 15.103  -7.902  -5.637  1.00 74.04 ? 204 TYR A CE2  1  
ATOM 3299   C CZ   . TYR A 1 204 ? 14.101  -8.237  -4.751  1.00 61.12 ? 204 TYR A CZ   1  
ATOM 3300   O OH   . TYR A 1 204 ? 14.424  -8.685  -3.490  1.00 53.41 ? 204 TYR A OH   1  
ATOM 3301   H H    . TYR A 1 204 ? 10.960  -8.604  -8.290  1.00 50.31 ? 204 TYR A H    1  
ATOM 3302   H HA   . TYR A 1 204 ? 12.443  -7.535  -10.601 1.00 51.32 ? 204 TYR A HA   1  
ATOM 3303   H HB2  . TYR A 1 204 ? 13.999  -6.466  -9.143  1.00 2.42  ? 204 TYR A HB2  1  
ATOM 3304   H HB3  . TYR A 1 204 ? 12.393  -6.023  -8.579  1.00 72.03 ? 204 TYR A HB3  1  
ATOM 3305   H HD1  . TYR A 1 204 ? 11.423  -7.587  -6.681  1.00 51.35 ? 204 TYR A HD1  1  
ATOM 3306   H HD2  . TYR A 1 204 ? 15.558  -7.188  -7.598  1.00 2.10  ? 204 TYR A HD2  1  
ATOM 3307   H HE1  . TYR A 1 204 ? 11.993  -8.388  -4.427  1.00 24.23 ? 204 TYR A HE1  1  
ATOM 3308   H HE2  . TYR A 1 204 ? 16.140  -7.989  -5.347  1.00 24.25 ? 204 TYR A HE2  1  
ATOM 3309   H HH   . TYR A 1 204 ? 13.814  -8.310  -2.851  1.00 41.14 ? 204 TYR A HH   1  
ATOM 3310   N N    . CYS A 1 205 ? 12.713  -10.320 -9.799  1.00 32.50 ? 205 CYS A N    1  
ATOM 3311   C CA   . CYS A 1 205 ? 13.426  -11.593 -9.805  1.00 61.12 ? 205 CYS A CA   1  
ATOM 3312   C C    . CYS A 1 205 ? 12.857  -12.533 -10.868 1.00 73.14 ? 205 CYS A C    1  
ATOM 3313   O O    . CYS A 1 205 ? 12.421  -13.642 -10.560 1.00 63.25 ? 205 CYS A O    1  
ATOM 3314   C CB   . CYS A 1 205 ? 13.347  -12.251 -8.426  1.00 53.00 ? 205 CYS A CB   1  
ATOM 3315   S SG   . CYS A 1 205 ? 14.174  -11.319 -7.116  1.00 65.13 ? 205 CYS A SG   1  
ATOM 3316   H H    . CYS A 1 205 ? 11.748  -10.311 -9.968  1.00 1.04  ? 205 CYS A H    1  
ATOM 3317   H HA   . CYS A 1 205 ? 14.460  -11.391 -10.039 1.00 45.24 ? 205 CYS A HA   1  
ATOM 3318   H HB2  . CYS A 1 205 ? 12.310  -12.361 -8.146  1.00 43.41 ? 205 CYS A HB2  1  
ATOM 3319   H HB3  . CYS A 1 205 ? 13.806  -13.228 -8.476  1.00 35.14 ? 205 CYS A HB3  1  
ATOM 3320   H HG   . CYS A 1 205 ? 15.032  -11.043 -7.445  1.00 53.34 ? 205 CYS A HG   1  
ATOM 3321   N N    . PRO A 1 206 ? 12.854  -12.098 -12.140 1.00 34.13 ? 206 PRO A N    1  
ATOM 3322   C CA   . PRO A 1 206 ? 12.336  -12.904 -13.249 1.00 10.24 ? 206 PRO A CA   1  
ATOM 3323   C C    . PRO A 1 206 ? 13.283  -14.036 -13.636 1.00 54.53 ? 206 PRO A C    1  
ATOM 3324   O O    . PRO A 1 206 ? 14.473  -13.813 -13.859 1.00 71.11 ? 206 PRO A O    1  
ATOM 3325   C CB   . PRO A 1 206 ? 12.218  -11.893 -14.389 1.00 74.13 ? 206 PRO A CB   1  
ATOM 3326   C CG   . PRO A 1 206 ? 13.264  -10.874 -14.096 1.00 52.45 ? 206 PRO A CG   1  
ATOM 3327   C CD   . PRO A 1 206 ? 13.355  -10.786 -12.596 1.00 2.53  ? 206 PRO A CD   1  
ATOM 3328   H HA   . PRO A 1 206 ? 11.362  -13.312 -13.022 1.00 44.01 ? 206 PRO A HA   1  
ATOM 3329   H HB2  . PRO A 1 206 ? 12.398  -12.387 -15.333 1.00 30.35 ? 206 PRO A HB2  1  
ATOM 3330   H HB3  . PRO A 1 206 ? 11.231  -11.456 -14.386 1.00 12.22 ? 206 PRO A HB3  1  
ATOM 3331   H HG2  . PRO A 1 206 ? 14.210  -11.191 -14.511 1.00 22.20 ? 206 PRO A HG2  1  
ATOM 3332   H HG3  . PRO A 1 206 ? 12.973  -9.920  -14.510 1.00 73.40 ? 206 PRO A HG3  1  
ATOM 3333   H HD2  . PRO A 1 206 ? 14.379  -10.638 -12.288 1.00 15.14 ? 206 PRO A HD2  1  
ATOM 3334   H HD3  . PRO A 1 206 ? 12.730  -9.987  -12.227 1.00 61.41 ? 206 PRO A HD3  1  
ATOM 3335   N N    . GLU A 1 207 ? 12.747  -15.250 -13.715 1.00 2.40  ? 207 GLU A N    1  
ATOM 3336   C CA   . GLU A 1 207 ? 13.544  -16.417 -14.077 1.00 74.31 ? 207 GLU A CA   1  
ATOM 3337   C C    . GLU A 1 207 ? 14.699  -16.611 -13.098 1.00 71.44 ? 207 GLU A C    1  
ATOM 3338   O O    . GLU A 1 207 ? 15.833  -16.871 -13.502 1.00 32.45 ? 207 GLU A O    1  
ATOM 3339   C CB   . GLU A 1 207 ? 14.084  -16.270 -15.501 1.00 52.02 ? 207 GLU A CB   1  
ATOM 3340   C CG   . GLU A 1 207 ? 14.239  -17.593 -16.233 1.00 45.00 ? 207 GLU A CG   1  
ATOM 3341   C CD   . GLU A 1 207 ? 15.485  -17.640 -17.094 1.00 52.12 ? 207 GLU A CD   1  
ATOM 3342   O OE1  . GLU A 1 207 ? 16.597  -17.688 -16.528 1.00 35.43 ? 207 GLU A OE1  1  
ATOM 3343   O OE2  . GLU A 1 207 ? 15.350  -17.628 -18.336 1.00 54.11 ? 207 GLU A OE2  1  
ATOM 3344   H H    . GLU A 1 207 ? 11.792  -15.364 -13.526 1.00 3.22  ? 207 GLU A H    1  
ATOM 3345   H HA   . GLU A 1 207 ? 12.902  -17.284 -14.033 1.00 54.31 ? 207 GLU A HA   1  
ATOM 3346   H HB2  . GLU A 1 207 ? 13.407  -15.647 -16.067 1.00 15.25 ? 207 GLU A HB2  1  
ATOM 3347   H HB3  . GLU A 1 207 ? 15.051  -15.791 -15.460 1.00 13.44 ? 207 GLU A HB3  1  
ATOM 3348   H HG2  . GLU A 1 207 ? 14.293  -18.388 -15.505 1.00 45.33 ? 207 GLU A HG2  1  
ATOM 3349   H HG3  . GLU A 1 207 ? 13.376  -17.743 -16.865 1.00 5.23  ? 207 GLU A HG3  1  
ATOM 3350   N N    . GLY A 1 208 ? 14.400  -16.490 -11.809 1.00 23.14 ? 208 GLY A N    1  
ATOM 3351   C CA   . GLY A 1 208 ? 15.419  -16.659 -10.787 1.00 54.33 ? 208 GLY A CA   1  
ATOM 3352   C C    . GLY A 1 208 ? 16.540  -15.638 -10.879 1.00 34.33 ? 208 GLY A C    1  
ATOM 3353   O O    . GLY A 1 208 ? 17.551  -15.762 -10.187 1.00 5.23  ? 208 GLY A O    1  
ATOM 3354   H H    . GLY A 1 208 ? 13.477  -16.292 -11.546 1.00 71.34 ? 208 GLY A H    1  
ATOM 3355   H HA2  . GLY A 1 208 ? 14.952  -16.574 -9.817  1.00 74.33 ? 208 GLY A HA2  1  
ATOM 3356   H HA3  . GLY A 1 208 ? 15.842  -17.649 -10.882 1.00 75.54 ? 208 GLY A HA3  1  
ATOM 3357   N N    . VAL A 1 209 ? 16.374  -14.630 -11.732 1.00 32.54 ? 209 VAL A N    1  
ATOM 3358   C CA   . VAL A 1 209 ? 17.392  -13.600 -11.900 1.00 74.03 ? 209 VAL A CA   1  
ATOM 3359   C C    . VAL A 1 209 ? 17.102  -12.388 -11.022 1.00 72.00 ? 209 VAL A C    1  
ATOM 3360   O O    . VAL A 1 209 ? 16.265  -11.551 -11.360 1.00 72.33 ? 209 VAL A O    1  
ATOM 3361   C CB   . VAL A 1 209 ? 17.494  -13.144 -13.368 1.00 62.40 ? 209 VAL A CB   1  
ATOM 3362   C CG1  . VAL A 1 209 ? 18.663  -12.187 -13.552 1.00 12.11 ? 209 VAL A CG1  1  
ATOM 3363   C CG2  . VAL A 1 209 ? 17.628  -14.344 -14.294 1.00 2.24  ? 209 VAL A CG2  1  
ATOM 3364   H H    . VAL A 1 209 ? 15.555  -14.578 -12.265 1.00 45.44 ? 209 VAL A H    1  
ATOM 3365   H HA   . VAL A 1 209 ? 18.343  -14.023 -11.609 1.00 61.05 ? 209 VAL A HA   1  
ATOM 3366   H HB   . VAL A 1 209 ? 16.586  -12.618 -13.624 1.00 74.00 ? 209 VAL A HB   1  
ATOM 3367   H HG11 . VAL A 1 209 ? 19.591  -12.732 -13.465 1.00 21.34 ? 209 VAL A HG11 1  
ATOM 3368   H HG12 . VAL A 1 209 ? 18.624  -11.421 -12.792 1.00 12.14 ? 209 VAL A HG12 1  
ATOM 3369   H HG13 . VAL A 1 209 ? 18.604  -11.729 -14.528 1.00 40.41 ? 209 VAL A HG13 1  
ATOM 3370   H HG21 . VAL A 1 209 ? 16.980  -14.213 -15.148 1.00 33.12 ? 209 VAL A HG21 1  
ATOM 3371   H HG22 . VAL A 1 209 ? 17.348  -15.242 -13.764 1.00 21.15 ? 209 VAL A HG22 1  
ATOM 3372   H HG23 . VAL A 1 209 ? 18.651  -14.428 -14.630 1.00 32.15 ? 209 VAL A HG23 1  
ATOM 3373   N N    . HIS A 1 210 ? 17.801  -12.299 -9.896  1.00 21.51 ? 210 HIS A N    1  
ATOM 3374   C CA   . HIS A 1 210 ? 17.621  -11.186 -8.972  1.00 35.14 ? 210 HIS A CA   1  
ATOM 3375   C C    . HIS A 1 210 ? 18.205  -9.903  -9.553  1.00 61.51 ? 210 HIS A C    1  
ATOM 3376   O O    . HIS A 1 210 ? 19.346  -9.883  -10.014 1.00 0.21  ? 210 HIS A O    1  
ATOM 3377   C CB   . HIS A 1 210 ? 18.283  -11.499 -7.628  1.00 63.23 ? 210 HIS A CB   1  
ATOM 3378   C CG   . HIS A 1 210 ? 19.753  -11.762 -7.733  1.00 62.22 ? 210 HIS A CG   1  
ATOM 3379   N ND1  . HIS A 1 210 ? 20.281  -13.022 -7.926  1.00 31.14 ? 210 HIS A ND1  1  
ATOM 3380   C CD2  . HIS A 1 210 ? 20.811  -10.919 -7.673  1.00 22.41 ? 210 HIS A CD2  1  
ATOM 3381   C CE1  . HIS A 1 210 ? 21.599  -12.942 -7.979  1.00 52.11 ? 210 HIS A CE1  1  
ATOM 3382   N NE2  . HIS A 1 210 ? 21.945  -11.677 -7.828  1.00 11.04 ? 210 HIS A NE2  1  
ATOM 3383   H H    . HIS A 1 210 ? 18.456  -12.997 -9.683  1.00 74.21 ? 210 HIS A H    1  
ATOM 3384   H HA   . HIS A 1 210 ? 16.561  -11.050 -8.819  1.00 30.41 ? 210 HIS A HA   1  
ATOM 3385   H HB2  . HIS A 1 210 ? 18.143  -10.662 -6.962  1.00 42.45 ? 210 HIS A HB2  1  
ATOM 3386   H HB3  . HIS A 1 210 ? 17.817  -12.375 -7.201  1.00 73.14 ? 210 HIS A HB3  1  
ATOM 3387   H HD1  . HIS A 1 210 ? 19.766  -13.851 -8.011  1.00 1.32  ? 210 HIS A HD1  1  
ATOM 3388   H HD2  . HIS A 1 210 ? 20.770  -9.848  -7.529  1.00 43.32 ? 210 HIS A HD2  1  
ATOM 3389   H HE1  . HIS A 1 210 ? 22.277  -13.770 -8.122  1.00 20.00 ? 210 HIS A HE1  1  
ATOM 3390   H HE2  . HIS A 1 210 ? 22.856  -11.326 -7.919  1.00 37.47 ? 210 HIS A HE2  1  
ATOM 3391   N N    . LYS A 1 211 ? 17.415  -8.835  -9.531  1.00 43.15 ? 211 LYS A N    1  
ATOM 3392   C CA   . LYS A 1 211 ? 17.854  -7.548  -10.060 1.00 45.40 ? 211 LYS A CA   1  
ATOM 3393   C C    . LYS A 1 211 ? 19.141  -7.088  -9.383  1.00 64.52 ? 211 LYS A C    1  
ATOM 3394   O O    . LYS A 1 211 ? 19.177  -6.880  -8.170  1.00 51.40 ? 211 LYS A O    1  
ATOM 3395   C CB   . LYS A 1 211 ? 16.760  -6.496  -9.870  1.00 43.32 ? 211 LYS A CB   1  
ATOM 3396   C CG   . LYS A 1 211 ? 16.620  -5.546  -11.048 1.00 1.20  ? 211 LYS A CG   1  
ATOM 3397   C CD   . LYS A 1 211 ? 15.864  -6.191  -12.198 1.00 53.14 ? 211 LYS A CD   1  
ATOM 3398   C CE   . LYS A 1 211 ? 16.214  -5.542  -13.528 1.00 35.20 ? 211 LYS A CE   1  
ATOM 3399   N NZ   . LYS A 1 211 ? 17.239  -6.323  -14.274 1.00 2.35  ? 211 LYS A NZ   1  
ATOM 3400   H H    . LYS A 1 211 ? 16.514  -8.914  -9.153  1.00 51.32 ? 211 LYS A H    1  
ATOM 3401   H HA   . LYS A 1 211 ? 18.042  -7.671  -11.116 1.00 34.35 ? 211 LYS A HA   1  
ATOM 3402   H HB2  . LYS A 1 211 ? 15.815  -6.999  -9.728  1.00 23.11 ? 211 LYS A HB2  1  
ATOM 3403   H HB3  . LYS A 1 211 ? 16.984  -5.914  -8.989  1.00 75.24 ? 211 LYS A HB3  1  
ATOM 3404   H HG2  . LYS A 1 211 ? 16.083  -4.666  -10.726 1.00 72.33 ? 211 LYS A HG2  1  
ATOM 3405   H HG3  . LYS A 1 211 ? 17.606  -5.264  -11.389 1.00 24.53 ? 211 LYS A HG3  1  
ATOM 3406   H HD2  . LYS A 1 211 ? 16.121  -7.239  -12.242 1.00 53.25 ? 211 LYS A HD2  1  
ATOM 3407   H HD3  . LYS A 1 211 ? 14.804  -6.084  -12.023 1.00 30.13 ? 211 LYS A HD3  1  
ATOM 3408   H HE2  . LYS A 1 211 ? 15.319  -5.476  -14.128 1.00 31.30 ? 211 LYS A HE2  1  
ATOM 3409   H HE3  . LYS A 1 211 ? 16.595  -4.549  -13.340 1.00 1.30  ? 211 LYS A HE3  1  
ATOM 3410   H HZ1  . LYS A 1 211 ? 17.194  -6.095  -15.288 1.00 23.11 ? 211 LYS A HZ1  1  
ATOM 3411   H HZ2  . LYS A 1 211 ? 17.072  -7.342  -14.151 1.00 73.31 ? 211 LYS A HZ2  1  
ATOM 3412   H HZ3  . LYS A 1 211 ? 18.190  -6.094  -13.920 1.00 2.04  ? 211 LYS A HZ3  1  
ATOM 3413   N N    . GLU A 1 212 ? 20.196  -6.931  -10.176 1.00 54.32 ? 212 GLU A N    1  
ATOM 3414   C CA   . GLU A 1 212 ? 21.487  -6.494  -9.657  1.00 55.12 ? 212 GLU A CA   1  
ATOM 3415   C C    . GLU A 1 212 ? 21.558  -4.972  -9.591  1.00 63.22 ? 212 GLU A C    1  
ATOM 3416   O O    . GLU A 1 212 ? 20.882  -4.277  -10.350 1.00 23.43 ? 212 GLU A O    1  
ATOM 3417   C CB   . GLU A 1 212 ? 22.621  -7.032  -10.532 1.00 22.42 ? 212 GLU A CB   1  
ATOM 3418   C CG   . GLU A 1 212 ? 23.125  -8.400  -10.101 1.00 0.04  ? 212 GLU A CG   1  
ATOM 3419   C CD   . GLU A 1 212 ? 24.618  -8.564  -10.313 1.00 14.50 ? 212 GLU A CD   1  
ATOM 3420   O OE1  . GLU A 1 212 ? 25.395  -7.863  -9.631  1.00 14.14 ? 212 GLU A OE1  1  
ATOM 3421   O OE2  . GLU A 1 212 ? 25.009  -9.392  -11.162 1.00 34.31 ? 212 GLU A OE2  1  
ATOM 3422   H H    . GLU A 1 212 ? 20.104  -7.112  -11.135 1.00 32.45 ? 212 GLU A H    1  
ATOM 3423   H HA   . GLU A 1 212 ? 21.595  -6.892  -8.659  1.00 41.22 ? 212 GLU A HA   1  
ATOM 3424   H HB2  . GLU A 1 212 ? 22.269  -7.107  -11.551 1.00 32.32 ? 212 GLU A HB2  1  
ATOM 3425   H HB3  . GLU A 1 212 ? 23.448  -6.339  -10.496 1.00 72.41 ? 212 GLU A HB3  1  
ATOM 3426   H HG2  . GLU A 1 212 ? 22.910  -8.534  -9.052  1.00 44.32 ? 212 GLU A HG2  1  
ATOM 3427   H HG3  . GLU A 1 212 ? 22.610  -9.157  -10.674 1.00 31.31 ? 212 GLU A HG3  1  
ATOM 3428   N N    . TYR A 1 213 ? 22.380  -4.461  -8.680  1.00 24.14 ? 213 TYR A N    1  
ATOM 3429   C CA   . TYR A 1 213 ? 22.538  -3.020  -8.517  1.00 51.41 ? 213 TYR A CA   1  
ATOM 3430   C C    . TYR A 1 213 ? 22.982  -2.367  -9.822  1.00 51.13 ? 213 TYR A C    1  
ATOM 3431   O O    . TYR A 1 213 ? 24.177  -2.235  -10.087 1.00 30.35 ? 213 TYR A O    1  
ATOM 3432   C CB   . TYR A 1 213 ? 23.553  -2.718  -7.413  1.00 21.15 ? 213 TYR A CB   1  
ATOM 3433   C CG   . TYR A 1 213 ? 23.635  -1.253  -7.048  1.00 61.50 ? 213 TYR A CG   1  
ATOM 3434   C CD1  . TYR A 1 213 ? 22.747  -0.694  -6.138  1.00 63.13 ? 213 TYR A CD1  1  
ATOM 3435   C CD2  . TYR A 1 213 ? 24.599  -0.429  -7.615  1.00 70.44 ? 213 TYR A CD2  1  
ATOM 3436   C CE1  . TYR A 1 213 ? 22.818  0.645   -5.803  1.00 11.13 ? 213 TYR A CE1  1  
ATOM 3437   C CE2  . TYR A 1 213 ? 24.677  0.910   -7.285  1.00 15.20 ? 213 TYR A CE2  1  
ATOM 3438   C CZ   . TYR A 1 213 ? 23.784  1.442   -6.379  1.00 44.34 ? 213 TYR A CZ   1  
ATOM 3439   O OH   . TYR A 1 213 ? 23.859  2.776   -6.047  1.00 11.50 ? 213 TYR A OH   1  
ATOM 3440   H H    . TYR A 1 213 ? 22.893  -5.065  -8.105  1.00 74.11 ? 213 TYR A H    1  
ATOM 3441   H HA   . TYR A 1 213 ? 21.579  -2.612  -8.233  1.00 23.50 ? 213 TYR A HA   1  
ATOM 3442   H HB2  . TYR A 1 213 ? 23.280  -3.266  -6.523  1.00 11.12 ? 213 TYR A HB2  1  
ATOM 3443   H HB3  . TYR A 1 213 ? 24.533  -3.036  -7.738  1.00 61.23 ? 213 TYR A HB3  1  
ATOM 3444   H HD1  . TYR A 1 213 ? 21.991  -1.321  -5.688  1.00 2.20  ? 213 TYR A HD1  1  
ATOM 3445   H HD2  . TYR A 1 213 ? 25.296  -0.849  -8.325  1.00 50.11 ? 213 TYR A HD2  1  
ATOM 3446   H HE1  . TYR A 1 213 ? 22.119  1.062   -5.093  1.00 3.42  ? 213 TYR A HE1  1  
ATOM 3447   H HE2  . TYR A 1 213 ? 25.434  1.534   -7.736  1.00 11.03 ? 213 TYR A HE2  1  
ATOM 3448   H HH   . TYR A 1 213 ? 23.693  2.882   -5.108  1.00 1.43  ? 213 TYR A HH   1  
ATOM 3449   N N    . LYS A 1 214 ? 22.011  -1.961  -10.634 1.00 4.10  ? 214 LYS A N    1  
ATOM 3450   C CA   . LYS A 1 214 ? 22.301  -1.322  -11.912 1.00 42.12 ? 214 LYS A CA   1  
ATOM 3451   C C    . LYS A 1 214 ? 21.428  -0.087  -12.110 1.00 71.41 ? 214 LYS A C    1  
ATOM 3452   O O    . LYS A 1 214 ? 20.410  0.078   -11.441 1.00 53.20 ? 214 LYS A O    1  
ATOM 3453   C CB   . LYS A 1 214 ? 22.079  -2.307  -13.061 1.00 31.34 ? 214 LYS A CB   1  
ATOM 3454   C CG   . LYS A 1 214 ? 23.010  -2.083  -14.242 1.00 42.44 ? 214 LYS A CG   1  
ATOM 3455   C CD   . LYS A 1 214 ? 23.302  -3.382  -14.975 1.00 12.32 ? 214 LYS A CD   1  
ATOM 3456   C CE   . LYS A 1 214 ? 24.028  -3.130  -16.287 1.00 13.54 ? 214 LYS A CE   1  
ATOM 3457   N NZ   . LYS A 1 214 ? 24.327  -4.398  -17.009 1.00 61.53 ? 214 LYS A NZ   1  
ATOM 3458   H H    . LYS A 1 214 ? 21.078  -2.094  -10.367 1.00 22.03 ? 214 LYS A H    1  
ATOM 3459   H HA   . LYS A 1 214 ? 23.337  -1.019  -11.904 1.00 21.33 ? 214 LYS A HA   1  
ATOM 3460   H HB2  . LYS A 1 214 ? 22.234  -3.311  -12.694 1.00 71.42 ? 214 LYS A HB2  1  
ATOM 3461   H HB3  . LYS A 1 214 ? 21.062  -2.213  -13.410 1.00 15.04 ? 214 LYS A HB3  1  
ATOM 3462   H HG2  . LYS A 1 214 ? 22.545  -1.391  -14.928 1.00 53.43 ? 214 LYS A HG2  1  
ATOM 3463   H HG3  . LYS A 1 214 ? 23.939  -1.666  -13.881 1.00 33.14 ? 214 LYS A HG3  1  
ATOM 3464   H HD2  . LYS A 1 214 ? 23.921  -4.007  -14.348 1.00 22.44 ? 214 LYS A HD2  1  
ATOM 3465   H HD3  . LYS A 1 214 ? 22.369  -3.886  -15.181 1.00 33.13 ? 214 LYS A HD3  1  
ATOM 3466   H HE2  . LYS A 1 214 ? 23.407  -2.508  -16.913 1.00 10.10 ? 214 LYS A HE2  1  
ATOM 3467   H HE3  . LYS A 1 214 ? 24.956  -2.618  -16.077 1.00 72.05 ? 214 LYS A HE3  1  
ATOM 3468   H HZ1  . LYS A 1 214 ? 23.591  -4.586  -17.719 1.00 32.51 ? 214 LYS A HZ1  1  
ATOM 3469   H HZ2  . LYS A 1 214 ? 24.357  -5.192  -16.339 1.00 44.41 ? 214 LYS A HZ2  1  
ATOM 3470   H HZ3  . LYS A 1 214 ? 25.247  -4.328  -17.488 1.00 21.51 ? 214 LYS A HZ3  1  
ATOM 3471   N N    . GLU A 1 215 ? 21.836  0.778   -13.031 1.00 63.35 ? 215 GLU A N    1  
ATOM 3472   C CA   . GLU A 1 215 ? 21.091  1.999   -13.316 1.00 54.31 ? 215 GLU A CA   1  
ATOM 3473   C C    . GLU A 1 215 ? 19.883  1.709   -14.201 1.00 0.44  ? 215 GLU A C    1  
ATOM 3474   O O    . GLU A 1 215 ? 20.026  1.238   -15.330 1.00 24.30 ? 215 GLU A O    1  
ATOM 3475   C CB   . GLU A 1 215 ? 21.998  3.028   -13.993 1.00 11.24 ? 215 GLU A CB   1  
ATOM 3476   C CG   . GLU A 1 215 ? 22.900  3.775   -13.024 1.00 23.41 ? 215 GLU A CG   1  
ATOM 3477   C CD   . GLU A 1 215 ? 23.613  4.944   -13.675 1.00 25.41 ? 215 GLU A CD   1  
ATOM 3478   O OE1  . GLU A 1 215 ? 23.017  6.040   -13.744 1.00 63.03 ? 215 GLU A OE1  1  
ATOM 3479   O OE2  . GLU A 1 215 ? 24.768  4.764   -14.116 1.00 43.45 ? 215 GLU A OE2  1  
ATOM 3480   H H    . GLU A 1 215 ? 22.656  0.591   -13.531 1.00 52.32 ? 215 GLU A H    1  
ATOM 3481   H HA   . GLU A 1 215 ? 20.745  2.402   -12.376 1.00 11.54 ? 215 GLU A HA   1  
ATOM 3482   H HB2  . GLU A 1 215 ? 22.623  2.521   -14.714 1.00 11.41 ? 215 GLU A HB2  1  
ATOM 3483   H HB3  . GLU A 1 215 ? 21.383  3.750   -14.509 1.00 12.41 ? 215 GLU A HB3  1  
ATOM 3484   H HG2  . GLU A 1 215 ? 22.299  4.150   -12.209 1.00 53.33 ? 215 GLU A HG2  1  
ATOM 3485   H HG3  . GLU A 1 215 ? 23.640  3.090   -12.639 1.00 53.20 ? 215 GLU A HG3  1  
ATOM 3486   N N    . ASP A 1 216 ? 18.693  1.994   -13.681 1.00 22.12 ? 216 ASP A N    1  
ATOM 3487   C CA   . ASP A 1 216 ? 17.460  1.765   -14.425 1.00 53.41 ? 216 ASP A CA   1  
ATOM 3488   C C    . ASP A 1 216 ? 16.345  2.688   -13.932 1.00 3.45  ? 216 ASP A C    1  
ATOM 3489   O O    . ASP A 1 216 ? 15.341  2.228   -13.389 1.00 72.15 ? 216 ASP A O    1  
ATOM 3490   C CB   . ASP A 1 216 ? 17.026  0.303   -14.294 1.00 22.34 ? 216 ASP A CB   1  
ATOM 3491   C CG   . ASP A 1 216 ? 17.572  -0.564  -15.411 1.00 51.31 ? 216 ASP A CG   1  
ATOM 3492   O OD1  . ASP A 1 216 ? 18.768  -0.919  -15.356 1.00 73.43 ? 216 ASP A OD1  1  
ATOM 3493   O OD2  . ASP A 1 216 ? 16.804  -0.889  -16.341 1.00 73.24 ? 216 ASP A OD2  1  
ATOM 3494   H H    . ASP A 1 216 ? 18.646  2.367   -12.777 1.00 44.11 ? 216 ASP A H    1  
ATOM 3495   H HA   . ASP A 1 216 ? 17.655  1.980   -15.464 1.00 73.21 ? 216 ASP A HA   1  
ATOM 3496   H HB2  . ASP A 1 216 ? 17.382  -0.089  -13.353 1.00 32.43 ? 216 ASP A HB2  1  
ATOM 3497   H HB3  . ASP A 1 216 ? 15.947  0.251   -14.317 1.00 50.20 ? 216 ASP A HB3  1  
ATOM 3498   N N    . PRO A 1 217 ? 16.510  4.009   -14.117 1.00 23.02 ? 217 PRO A N    1  
ATOM 3499   C CA   . PRO A 1 217 ? 15.513  4.998   -13.689 1.00 12.34 ? 217 PRO A CA   1  
ATOM 3500   C C    . PRO A 1 217 ? 14.171  4.806   -14.388 1.00 70.14 ? 217 PRO A C    1  
ATOM 3501   O O    . PRO A 1 217 ? 13.118  5.100   -13.823 1.00 10.43 ? 217 PRO A O    1  
ATOM 3502   C CB   . PRO A 1 217 ? 16.133  6.343   -14.089 1.00 3.03  ? 217 PRO A CB   1  
ATOM 3503   C CG   . PRO A 1 217 ? 17.586  6.065   -14.275 1.00 1.10  ? 217 PRO A CG   1  
ATOM 3504   C CD   . PRO A 1 217 ? 17.674  4.645   -14.754 1.00 35.33 ? 217 PRO A CD   1  
ATOM 3505   H HA   . PRO A 1 217 ? 15.366  4.971   -12.619 1.00 24.20 ? 217 PRO A HA   1  
ATOM 3506   H HB2  . PRO A 1 217 ? 15.679  6.692   -15.005 1.00 41.54 ? 217 PRO A HB2  1  
ATOM 3507   H HB3  . PRO A 1 217 ? 15.968  7.065   -13.303 1.00 14.44 ? 217 PRO A HB3  1  
ATOM 3508   H HG2  . PRO A 1 217 ? 17.997  6.737   -15.013 1.00 32.04 ? 217 PRO A HG2  1  
ATOM 3509   H HG3  . PRO A 1 217 ? 18.104  6.176   -13.334 1.00 74.02 ? 217 PRO A HG3  1  
ATOM 3510   H HD2  . PRO A 1 217 ? 17.598  4.604   -15.831 1.00 72.32 ? 217 PRO A HD2  1  
ATOM 3511   H HD3  . PRO A 1 217 ? 18.594  4.190   -14.420 1.00 23.23 ? 217 PRO A HD3  1  
ATOM 3512   N N    . LYS A 1 218 ? 14.217  4.312   -15.621 1.00 13.13 ? 218 LYS A N    1  
ATOM 3513   C CA   . LYS A 1 218 ? 13.006  4.083   -16.401 1.00 44.40 ? 218 LYS A CA   1  
ATOM 3514   C C    . LYS A 1 218 ? 12.055  3.136   -15.675 1.00 10.43 ? 218 LYS A C    1  
ATOM 3515   O O    . LYS A 1 218 ? 10.837  3.230   -15.823 1.00 55.54 ? 218 LYS A O    1  
ATOM 3516   C CB   . LYS A 1 218 ? 13.360  3.512   -17.775 1.00 33.22 ? 218 LYS A CB   1  
ATOM 3517   C CG   . LYS A 1 218 ? 12.340  3.841   -18.852 1.00 65.20 ? 218 LYS A CG   1  
ATOM 3518   C CD   . LYS A 1 218 ? 12.708  3.202   -20.182 1.00 34.42 ? 218 LYS A CD   1  
ATOM 3519   C CE   . LYS A 1 218 ? 11.485  3.002   -21.061 1.00 54.21 ? 218 LYS A CE   1  
ATOM 3520   N NZ   . LYS A 1 218 ? 11.603  1.783   -21.908 1.00 65.04 ? 218 LYS A NZ   1  
ATOM 3521   H H    . LYS A 1 218 ? 15.088  4.099   -16.018 1.00 43.44 ? 218 LYS A H    1  
ATOM 3522   H HA   . LYS A 1 218 ? 12.513  5.035   -16.534 1.00 3.41  ? 218 LYS A HA   1  
ATOM 3523   H HB2  . LYS A 1 218 ? 14.316  3.910   -18.082 1.00 54.41 ? 218 LYS A HB2  1  
ATOM 3524   H HB3  . LYS A 1 218 ? 13.436  2.438   -17.697 1.00 3.20  ? 218 LYS A HB3  1  
ATOM 3525   H HG2  . LYS A 1 218 ? 11.373  3.472   -18.543 1.00 12.23 ? 218 LYS A HG2  1  
ATOM 3526   H HG3  . LYS A 1 218 ? 12.295  4.913   -18.977 1.00 40.12 ? 218 LYS A HG3  1  
ATOM 3527   H HD2  . LYS A 1 218 ? 13.408  3.844   -20.696 1.00 2.13  ? 218 LYS A HD2  1  
ATOM 3528   H HD3  . LYS A 1 218 ? 13.167  2.243   -19.994 1.00 0.31  ? 218 LYS A HD3  1  
ATOM 3529   H HE2  . LYS A 1 218 ? 10.614  2.907   -20.429 1.00 34.20 ? 218 LYS A HE2  1  
ATOM 3530   H HE3  . LYS A 1 218 ? 11.372  3.865   -21.701 1.00 71.33 ? 218 LYS A HE3  1  
ATOM 3531   H HZ1  . LYS A 1 218 ? 12.365  1.904   -22.604 1.00 55.13 ? 218 LYS A HZ1  1  
ATOM 3532   H HZ2  . LYS A 1 218 ? 10.711  1.611   -22.414 1.00 72.12 ? 218 LYS A HZ2  1  
ATOM 3533   H HZ3  . LYS A 1 218 ? 11.817  0.955   -21.315 1.00 52.20 ? 218 LYS A HZ3  1  
ATOM 3534   N N    . ARG A 1 219 ? 12.620  2.223   -14.891 1.00 10.21 ? 219 ARG A N    1  
ATOM 3535   C CA   . ARG A 1 219 ? 11.820  1.258   -14.144 1.00 20.10 ? 219 ARG A CA   1  
ATOM 3536   C C    . ARG A 1 219 ? 11.880  1.543   -12.647 1.00 31.01 ? 219 ARG A C    1  
ATOM 3537   O O    . ARG A 1 219 ? 12.909  1.974   -12.127 1.00 42.00 ? 219 ARG A O    1  
ATOM 3538   C CB   . ARG A 1 219 ? 12.307  -0.165  -14.425 1.00 2.33  ? 219 ARG A CB   1  
ATOM 3539   C CG   . ARG A 1 219 ? 11.185  -1.188  -14.498 1.00 42.34 ? 219 ARG A CG   1  
ATOM 3540   C CD   . ARG A 1 219 ? 11.475  -2.260  -15.536 1.00 34.22 ? 219 ARG A CD   1  
ATOM 3541   N NE   . ARG A 1 219 ? 11.982  -3.488  -14.927 1.00 63.11 ? 219 ARG A NE   1  
ATOM 3542   C CZ   . ARG A 1 219 ? 12.171  -4.623  -15.596 1.00 13.23 ? 219 ARG A CZ   1  
ATOM 3543   N NH1  . ARG A 1 219 ? 11.896  -4.692  -16.893 1.00 22.43 ? 219 ARG A NH1  1  
ATOM 3544   N NH2  . ARG A 1 219 ? 12.636  -5.694  -14.966 1.00 42.54 ? 219 ARG A NH2  1  
ATOM 3545   H H    . ARG A 1 219 ? 13.596  2.196   -14.815 1.00 44.33 ? 219 ARG A H    1  
ATOM 3546   H HA   . ARG A 1 219 ? 10.796  1.350   -14.475 1.00 24.41 ? 219 ARG A HA   1  
ATOM 3547   H HB2  . ARG A 1 219 ? 12.834  -0.173  -15.367 1.00 44.03 ? 219 ARG A HB2  1  
ATOM 3548   H HB3  . ARG A 1 219 ? 12.985  -0.462  -13.639 1.00 55.53 ? 219 ARG A HB3  1  
ATOM 3549   H HG2  . ARG A 1 219 ? 11.075  -1.657  -13.532 1.00 73.45 ? 219 ARG A HG2  1  
ATOM 3550   H HG3  . ARG A 1 219 ? 10.267  -0.683  -14.762 1.00 61.11 ? 219 ARG A HG3  1  
ATOM 3551   H HD2  . ARG A 1 219 ? 10.562  -2.484  -16.068 1.00 65.21 ? 219 ARG A HD2  1  
ATOM 3552   H HD3  . ARG A 1 219 ? 12.211  -1.882  -16.230 1.00 43.12 ? 219 ARG A HD3  1  
ATOM 3553   H HE   . ARG A 1 219 ? 12.194  -3.465  -13.971 1.00 51.53 ? 219 ARG A HE   1  
ATOM 3554   H HH11 . ARG A 1 219 ? 11.545  -3.888  -17.374 1.00 20.14 ? 219 ARG A HH11 1  
ATOM 3555   H HH12 . ARG A 1 219 ? 12.040  -5.548  -17.389 1.00 44.30 ? 219 ARG A HH12 1  
ATOM 3556   H HH21 . ARG A 1 219 ? 12.845  -5.648  -13.990 1.00 2.43  ? 219 ARG A HH21 1  
ATOM 3557   H HH22 . ARG A 1 219 ? 12.777  -6.547  -15.468 1.00 40.34 ? 219 ARG A HH22 1  
ATOM 3558   N N    . CYS A 1 220 ? 10.770  1.296   -11.958 1.00 71.14 ? 220 CYS A N    1  
ATOM 3559   C CA   . CYS A 1 220 ? 10.696  1.523   -10.519 1.00 71.01 ? 220 CYS A CA   1  
ATOM 3560   C C    . CYS A 1 220 ? 10.969  2.987   -10.184 1.00 1.55  ? 220 CYS A C    1  
ATOM 3561   O O    . CYS A 1 220 ? 11.729  3.293   -9.265  1.00 64.13 ? 220 CYS A O    1  
ATOM 3562   C CB   . CYS A 1 220 ? 11.695  0.623   -9.789  1.00 60.34 ? 220 CYS A CB   1  
ATOM 3563   S SG   . CYS A 1 220 ? 11.701  -1.092  -10.364 1.00 21.45 ? 220 CYS A SG   1  
ATOM 3564   H H    . CYS A 1 220 ? 9.982   0.951   -12.428 1.00 11.01 ? 220 CYS A H    1  
ATOM 3565   H HA   . CYS A 1 220 ? 9.697   1.273   -10.196 1.00 34.30 ? 220 CYS A HA   1  
ATOM 3566   H HB2  . CYS A 1 220 ? 12.690  1.017   -9.925  1.00 3.15  ? 220 CYS A HB2  1  
ATOM 3567   H HB3  . CYS A 1 220 ? 11.457  0.615   -8.735  1.00 74.12 ? 220 CYS A HB3  1  
ATOM 3568   H HG   . CYS A 1 220 ? 10.948  -1.211  -10.948 1.00 73.35 ? 220 CYS A HG   1  
ATOM 3569   N N    . HIS A 1 221 ? 10.344  3.886   -10.936 1.00 11.30 ? 221 HIS A N    1  
ATOM 3570   C CA   . HIS A 1 221 ? 10.519  5.318   -10.720 1.00 53.33 ? 221 HIS A CA   1  
ATOM 3571   C C    . HIS A 1 221 ? 9.230   5.964   -10.211 1.00 53.34 ? 221 HIS A C    1  
ATOM 3572   O O    . HIS A 1 221 ? 9.247   7.087   -9.707  1.00 11.05 ? 221 HIS A O    1  
ATOM 3573   C CB   . HIS A 1 221 ? 10.966  5.997   -12.017 1.00 52.51 ? 221 HIS A CB   1  
ATOM 3574   C CG   . HIS A 1 221 ? 12.218  6.805   -11.867 1.00 12.35 ? 221 HIS A CG   1  
ATOM 3575   N ND1  . HIS A 1 221 ? 12.285  8.152   -12.157 1.00 13.35 ? 221 HIS A ND1  1  
ATOM 3576   C CD2  . HIS A 1 221 ? 13.458  6.449   -11.455 1.00 32.22 ? 221 HIS A CD2  1  
ATOM 3577   C CE1  . HIS A 1 221 ? 13.511  8.589   -11.931 1.00 62.50 ? 221 HIS A CE1  1  
ATOM 3578   N NE2  . HIS A 1 221 ? 14.242  7.576   -11.503 1.00 25.52 ? 221 HIS A NE2  1  
ATOM 3579   H H    . HIS A 1 221 ? 9.751   3.580   -11.654 1.00 25.03 ? 221 HIS A H    1  
ATOM 3580   H HA   . HIS A 1 221 ? 11.289  5.448   -9.974  1.00 14.34 ? 221 HIS A HA   1  
ATOM 3581   H HB2  . HIS A 1 221 ? 11.147  5.242   -12.766 1.00 42.41 ? 221 HIS A HB2  1  
ATOM 3582   H HB3  . HIS A 1 221 ? 10.183  6.658   -12.360 1.00 51.24 ? 221 HIS A HB3  1  
ATOM 3583   H HD1  . HIS A 1 221 ? 11.544  8.705   -12.482 1.00 55.44 ? 221 HIS A HD1  1  
ATOM 3584   H HD2  . HIS A 1 221 ? 13.772  5.463   -11.144 1.00 42.11 ? 221 HIS A HD2  1  
ATOM 3585   H HE1  . HIS A 1 221 ? 13.856  9.603   -12.070 1.00 42.44 ? 221 HIS A HE1  1  
ATOM 3586   H HE2  . HIS A 1 221 ? 15.165  7.642   -11.180 1.00 37.47 ? 221 HIS A HE2  1  
ATOM 3587   N N    . ASP A 1 222 ? 8.114   5.251   -10.345 1.00 1.42  ? 222 ASP A N    1  
ATOM 3588   C CA   . ASP A 1 222 ? 6.824   5.763   -9.898  1.00 15.43 ? 222 ASP A CA   1  
ATOM 3589   C C    . ASP A 1 222 ? 6.774   5.866   -8.377  1.00 50.52 ? 222 ASP A C    1  
ATOM 3590   O O    . ASP A 1 222 ? 6.917   4.868   -7.672  1.00 74.21 ? 222 ASP A O    1  
ATOM 3591   C CB   . ASP A 1 222 ? 5.694   4.861   -10.396 1.00 52.31 ? 222 ASP A CB   1  
ATOM 3592   C CG   . ASP A 1 222 ? 4.323   5.399   -10.035 1.00 10.31 ? 222 ASP A CG   1  
ATOM 3593   O OD1  . ASP A 1 222 ? 4.068   6.595   -10.291 1.00 60.23 ? 222 ASP A OD1  1  
ATOM 3594   O OD2  . ASP A 1 222 ? 3.504   4.625   -9.497  1.00 2.22  ? 222 ASP A OD2  1  
ATOM 3595   H H    . ASP A 1 222 ? 8.158   4.362   -10.754 1.00 41.32 ? 222 ASP A H    1  
ATOM 3596   H HA   . ASP A 1 222 ? 6.696   6.749   -10.317 1.00 51.53 ? 222 ASP A HA   1  
ATOM 3597   H HB2  . ASP A 1 222 ? 5.755   4.779   -11.470 1.00 71.15 ? 222 ASP A HB2  1  
ATOM 3598   H HB3  . ASP A 1 222 ? 5.803   3.881   -9.957  1.00 11.22 ? 222 ASP A HB3  1  
ATOM 3599   N N    . GLY A 1 223 ? 6.568   7.081   -7.879  1.00 45.22 ? 223 GLY A N    1  
ATOM 3600   C CA   . GLY A 1 223 ? 6.500   7.292   -6.446  1.00 52.20 ? 223 GLY A CA   1  
ATOM 3601   C C    . GLY A 1 223 ? 6.624   8.757   -6.069  1.00 50.43 ? 223 GLY A C    1  
ATOM 3602   O O    . GLY A 1 223 ? 7.238   9.541   -6.793  1.00 41.12 ? 223 GLY A O    1  
ATOM 3603   H H    . GLY A 1 223 ? 6.460   7.839   -8.490  1.00 3.34  ? 223 GLY A H    1  
ATOM 3604   H HA2  . GLY A 1 223 ? 5.555   6.916   -6.082  1.00 64.05 ? 223 GLY A HA2  1  
ATOM 3605   H HA3  . GLY A 1 223 ? 7.301   6.742   -5.974  1.00 54.01 ? 223 GLY A HA3  1  
ATOM 3606   N N    . THR A 1 224 ? 6.038   9.126   -4.934  1.00 73.52 ? 224 THR A N    1  
ATOM 3607   C CA   . THR A 1 224 ? 6.084   10.506  -4.462  1.00 64.22 ? 224 THR A CA   1  
ATOM 3608   C C    . THR A 1 224 ? 7.305   10.739  -3.579  1.00 34.40 ? 224 THR A C    1  
ATOM 3609   O O    . THR A 1 224 ? 7.645   9.903   -2.742  1.00 65.22 ? 224 THR A O    1  
ATOM 3610   C CB   . THR A 1 224 ? 4.810   10.844  -3.687  1.00 35.53 ? 224 THR A CB   1  
ATOM 3611   O OG1  . THR A 1 224 ? 3.745   9.995   -4.077  1.00 14.12 ? 224 THR A OG1  1  
ATOM 3612   C CG2  . THR A 1 224 ? 4.353   12.274  -3.881  1.00 62.40 ? 224 THR A CG2  1  
ATOM 3613   H H    . THR A 1 224 ? 5.563   8.456   -4.401  1.00 71.10 ? 224 THR A H    1  
ATOM 3614   H HA   . THR A 1 224 ? 6.151   11.150  -5.326  1.00 73.13 ? 224 THR A HA   1  
ATOM 3615   H HB   . THR A 1 224 ? 4.993   10.696  -2.632  1.00 75.32 ? 224 THR A HB   1  
ATOM 3616   H HG1  . THR A 1 224 ? 3.825   9.152   -3.626  1.00 70.02 ? 224 THR A HG1  1  
ATOM 3617   H HG21 . THR A 1 224 ? 4.476   12.820  -2.957  1.00 51.23 ? 224 THR A HG21 1  
ATOM 3618   H HG22 . THR A 1 224 ? 3.312   12.283  -4.168  1.00 1.11  ? 224 THR A HG22 1  
ATOM 3619   H HG23 . THR A 1 224 ? 4.944   12.739  -4.656  1.00 65.11 ? 224 THR A HG23 1  
ATOM 3620   N N    . ILE A 1 225 ? 7.963   11.880  -3.770  1.00 73.13 ? 225 ILE A N    1  
ATOM 3621   C CA   . ILE A 1 225 ? 9.149   12.226  -2.992  1.00 14.23 ? 225 ILE A CA   1  
ATOM 3622   C C    . ILE A 1 225 ? 8.924   12.016  -1.495  1.00 15.32 ? 225 ILE A C    1  
ATOM 3623   O O    . ILE A 1 225 ? 9.872   11.795  -0.741  1.00 33.21 ? 225 ILE A O    1  
ATOM 3624   C CB   . ILE A 1 225 ? 9.569   13.690  -3.238  1.00 50.31 ? 225 ILE A CB   1  
ATOM 3625   C CG1  . ILE A 1 225 ? 10.879  14.001  -2.510  1.00 1.32  ? 225 ILE A CG1  1  
ATOM 3626   C CG2  . ILE A 1 225 ? 8.469   14.642  -2.791  1.00 14.32 ? 225 ILE A CG2  1  
ATOM 3627   C CD1  . ILE A 1 225 ? 11.824  14.872  -3.309  1.00 53.15 ? 225 ILE A CD1  1  
ATOM 3628   H H    . ILE A 1 225 ? 7.646   12.510  -4.452  1.00 2.44  ? 225 ILE A H    1  
ATOM 3629   H HA   . ILE A 1 225 ? 9.956   11.587  -3.316  1.00 73.12 ? 225 ILE A HA   1  
ATOM 3630   H HB   . ILE A 1 225 ? 9.716   13.824  -4.299  1.00 41.21 ? 225 ILE A HB   1  
ATOM 3631   H HG12 . ILE A 1 225 ? 10.658  14.514  -1.586  1.00 75.45 ? 225 ILE A HG12 1  
ATOM 3632   H HG13 . ILE A 1 225 ? 11.389  13.074  -2.288  1.00 40.40 ? 225 ILE A HG13 1  
ATOM 3633   H HG21 . ILE A 1 225 ? 8.802   15.662  -2.915  1.00 44.35 ? 225 ILE A HG21 1  
ATOM 3634   H HG22 . ILE A 1 225 ? 8.238   14.463  -1.751  1.00 65.22 ? 225 ILE A HG22 1  
ATOM 3635   H HG23 . ILE A 1 225 ? 7.585   14.477  -3.389  1.00 10.51 ? 225 ILE A HG23 1  
ATOM 3636   H HD11 . ILE A 1 225 ? 11.599  14.776  -4.361  1.00 44.34 ? 225 ILE A HD11 1  
ATOM 3637   H HD12 . ILE A 1 225 ? 12.842  14.559  -3.128  1.00 35.24 ? 225 ILE A HD12 1  
ATOM 3638   H HD13 . ILE A 1 225 ? 11.705  15.902  -3.008  1.00 45.11 ? 225 ILE A HD13 1  
ATOM 3639   N N    . GLU A 1 226 ? 7.666   12.093  -1.072  1.00 62.10 ? 226 GLU A N    1  
ATOM 3640   C CA   . GLU A 1 226 ? 7.317   11.918  0.334   1.00 11.22 ? 226 GLU A CA   1  
ATOM 3641   C C    . GLU A 1 226 ? 7.934   10.646  0.915   1.00 71.53 ? 226 GLU A C    1  
ATOM 3642   O O    . GLU A 1 226 ? 8.265   10.597  2.099   1.00 73.11 ? 226 GLU A O    1  
ATOM 3643   C CB   . GLU A 1 226 ? 5.796   11.879  0.500   1.00 33.31 ? 226 GLU A CB   1  
ATOM 3644   C CG   . GLU A 1 226 ? 5.187   13.232  0.831   1.00 33.44 ? 226 GLU A CG   1  
ATOM 3645   C CD   . GLU A 1 226 ? 3.698   13.285  0.548   1.00 3.20  ? 226 GLU A CD   1  
ATOM 3646   O OE1  . GLU A 1 226 ? 3.269   12.728  -0.484  1.00 64.13 ? 226 GLU A OE1  1  
ATOM 3647   O OE2  . GLU A 1 226 ? 2.961   13.885  1.359   1.00 0.33  ? 226 GLU A OE2  1  
ATOM 3648   H H    . GLU A 1 226 ? 6.955   12.278  -1.719  1.00 51.33 ? 226 GLU A H    1  
ATOM 3649   H HA   . GLU A 1 226 ? 7.703   12.767  0.876   1.00 72.23 ? 226 GLU A HA   1  
ATOM 3650   H HB2  . GLU A 1 226 ? 5.354   11.525  -0.420  1.00 65.14 ? 226 GLU A HB2  1  
ATOM 3651   H HB3  . GLU A 1 226 ? 5.549   11.193  1.296   1.00 5.34  ? 226 GLU A HB3  1  
ATOM 3652   H HG2  . GLU A 1 226 ? 5.346   13.437  1.879   1.00 14.31 ? 226 GLU A HG2  1  
ATOM 3653   H HG3  . GLU A 1 226 ? 5.679   13.989  0.238   1.00 12.23 ? 226 GLU A HG3  1  
ATOM 3654   N N    . PHE A 1 227 ? 8.084   9.617   0.083   1.00 23.44 ? 227 PHE A N    1  
ATOM 3655   C CA   . PHE A 1 227 ? 8.657   8.355   0.543   1.00 15.21 ? 227 PHE A CA   1  
ATOM 3656   C C    . PHE A 1 227 ? 9.249   7.545   -0.609  1.00 2.02  ? 227 PHE A C    1  
ATOM 3657   O O    . PHE A 1 227 ? 9.287   6.316   -0.553  1.00 62.51 ? 227 PHE A O    1  
ATOM 3658   C CB   . PHE A 1 227 ? 7.592   7.526   1.263   1.00 40.50 ? 227 PHE A CB   1  
ATOM 3659   C CG   . PHE A 1 227 ? 7.140   8.128   2.563   1.00 74.43 ? 227 PHE A CG   1  
ATOM 3660   C CD1  . PHE A 1 227 ? 7.791   7.822   3.746   1.00 1.23  ? 227 PHE A CD1  1  
ATOM 3661   C CD2  . PHE A 1 227 ? 6.065   9.001   2.600   1.00 65.13 ? 227 PHE A CD2  1  
ATOM 3662   C CE1  . PHE A 1 227 ? 7.379   8.376   4.944   1.00 33.41 ? 227 PHE A CE1  1  
ATOM 3663   C CE2  . PHE A 1 227 ? 5.647   9.558   3.794   1.00 72.04 ? 227 PHE A CE2  1  
ATOM 3664   C CZ   . PHE A 1 227 ? 6.305   9.245   4.967   1.00 11.55 ? 227 PHE A CZ   1  
ATOM 3665   H H    . PHE A 1 227 ? 7.799   9.705   -0.850  1.00 21.51 ? 227 PHE A H    1  
ATOM 3666   H HA   . PHE A 1 227 ? 9.445   8.589   1.242   1.00 61.31 ? 227 PHE A HA   1  
ATOM 3667   H HB2  . PHE A 1 227 ? 6.728   7.429   0.624   1.00 21.12 ? 227 PHE A HB2  1  
ATOM 3668   H HB3  . PHE A 1 227 ? 7.992   6.544   1.472   1.00 45.34 ? 227 PHE A HB3  1  
ATOM 3669   H HD1  . PHE A 1 227 ? 8.631   7.143   3.728   1.00 3.32  ? 227 PHE A HD1  1  
ATOM 3670   H HD2  . PHE A 1 227 ? 5.550   9.246   1.683   1.00 62.53 ? 227 PHE A HD2  1  
ATOM 3671   H HE1  . PHE A 1 227 ? 7.895   8.129   5.860   1.00 74.42 ? 227 PHE A HE1  1  
ATOM 3672   H HE2  . PHE A 1 227 ? 4.808   10.237  3.809   1.00 11.22 ? 227 PHE A HE2  1  
ATOM 3673   H HZ   . PHE A 1 227 ? 5.981   9.679   5.902   1.00 44.00 ? 227 PHE A HZ   1  
ATOM 3674   N N    . THR A 1 228 ? 9.717   8.231   -1.647  1.00 33.14 ? 228 THR A N    1  
ATOM 3675   C CA   . THR A 1 228 ? 10.312  7.551   -2.795  1.00 12.11 ? 228 THR A CA   1  
ATOM 3676   C C    . THR A 1 228 ? 11.626  6.884   -2.405  1.00 61.24 ? 228 THR A C    1  
ATOM 3677   O O    . THR A 1 228 ? 12.537  7.538   -1.897  1.00 61.02 ? 228 THR A O    1  
ATOM 3678   C CB   . THR A 1 228 ? 10.557  8.534   -3.940  1.00 3.24  ? 228 THR A CB   1  
ATOM 3679   O OG1  . THR A 1 228 ? 11.066  9.760   -3.449  1.00 25.24 ? 228 THR A OG1  1  
ATOM 3680   C CG2  . THR A 1 228 ? 9.314   8.839   -4.748  1.00 42.34 ? 228 THR A CG2  1  
ATOM 3681   H H    . THR A 1 228 ? 9.668   9.209   -1.640  1.00 55.13 ? 228 THR A H    1  
ATOM 3682   H HA   . THR A 1 228 ? 9.620   6.791   -3.125  1.00 70.05 ? 228 THR A HA   1  
ATOM 3683   H HB   . THR A 1 228 ? 11.290  8.109   -4.611  1.00 72.41 ? 228 THR A HB   1  
ATOM 3684   H HG1  . THR A 1 228 ? 11.259  10.344  -4.185  1.00 41.33 ? 228 THR A HG1  1  
ATOM 3685   H HG21 . THR A 1 228 ? 8.445   8.473   -4.223  1.00 44.34 ? 228 THR A HG21 1  
ATOM 3686   H HG22 . THR A 1 228 ? 9.384   8.354   -5.711  1.00 25.34 ? 228 THR A HG22 1  
ATOM 3687   H HG23 . THR A 1 228 ? 9.229   9.906   -4.888  1.00 34.22 ? 228 THR A HG23 1  
ATOM 3688   N N    . SER A 1 229 ? 11.721  5.580   -2.644  1.00 23.31 ? 229 SER A N    1  
ATOM 3689   C CA   . SER A 1 229 ? 12.928  4.829   -2.317  1.00 44.10 ? 229 SER A CA   1  
ATOM 3690   C C    . SER A 1 229 ? 14.155  5.460   -2.969  1.00 1.53  ? 229 SER A C    1  
ATOM 3691   O O    . SER A 1 229 ? 14.083  5.968   -4.088  1.00 73.33 ? 229 SER A O    1  
ATOM 3692   C CB   . SER A 1 229 ? 12.787  3.374   -2.768  1.00 0.01  ? 229 SER A CB   1  
ATOM 3693   O OG   . SER A 1 229 ? 13.810  2.566   -2.213  1.00 24.10 ? 229 SER A OG   1  
ATOM 3694   H H    . SER A 1 229 ? 10.962  5.111   -3.050  1.00 41.45 ? 229 SER A H    1  
ATOM 3695   H HA   . SER A 1 229 ? 13.053  4.854   -1.245  1.00 42.34 ? 229 SER A HA   1  
ATOM 3696   H HB2  . SER A 1 229 ? 11.830  2.991   -2.447  1.00 65.34 ? 229 SER A HB2  1  
ATOM 3697   H HB3  . SER A 1 229 ? 12.851  3.326   -3.845  1.00 23.40 ? 229 SER A HB3  1  
ATOM 3698   H HG   . SER A 1 229 ? 14.449  2.344   -2.895  1.00 65.20 ? 229 SER A HG   1  
ATOM 3699   N N    . ILE A 1 230 ? 15.280  5.425   -2.262  1.00 31.14 ? 230 ILE A N    1  
ATOM 3700   C CA   . ILE A 1 230 ? 16.523  5.994   -2.772  1.00 51.11 ? 230 ILE A CA   1  
ATOM 3701   C C    . ILE A 1 230 ? 16.904  5.383   -4.117  1.00 1.12  ? 230 ILE A C    1  
ATOM 3702   O O    . ILE A 1 230 ? 17.655  5.980   -4.889  1.00 63.43 ? 230 ILE A O    1  
ATOM 3703   C CB   . ILE A 1 230 ? 17.685  5.787   -1.780  1.00 75.53 ? 230 ILE A CB   1  
ATOM 3704   C CG1  . ILE A 1 230 ? 17.895  4.296   -1.510  1.00 24.30 ? 230 ILE A CG1  1  
ATOM 3705   C CG2  . ILE A 1 230 ? 17.414  6.534   -0.483  1.00 32.32 ? 230 ILE A CG2  1  
ATOM 3706   C CD1  . ILE A 1 230 ? 19.178  3.991   -0.768  1.00 73.40 ? 230 ILE A CD1  1  
ATOM 3707   H H    . ILE A 1 230 ? 15.275  5.007   -1.375  1.00 13.05 ? 230 ILE A H    1  
ATOM 3708   H HA   . ILE A 1 230 ? 16.374  7.056   -2.900  1.00 23.25 ? 230 ILE A HA   1  
ATOM 3709   H HB   . ILE A 1 230 ? 18.581  6.195   -2.221  1.00 42.23 ? 230 ILE A HB   1  
ATOM 3710   H HG12 . ILE A 1 230 ? 17.073  3.925   -0.917  1.00 12.20 ? 230 ILE A HG12 1  
ATOM 3711   H HG13 . ILE A 1 230 ? 17.921  3.766   -2.451  1.00 72.41 ? 230 ILE A HG13 1  
ATOM 3712   H HG21 . ILE A 1 230 ? 18.332  6.974   -0.123  1.00 71.54 ? 230 ILE A HG21 1  
ATOM 3713   H HG22 . ILE A 1 230 ? 17.032  5.845   0.256   1.00 45.45 ? 230 ILE A HG22 1  
ATOM 3714   H HG23 . ILE A 1 230 ? 16.687  7.312   -0.660  1.00 52.11 ? 230 ILE A HG23 1  
ATOM 3715   H HD11 . ILE A 1 230 ? 19.049  3.093   -0.182  1.00 25.01 ? 230 ILE A HD11 1  
ATOM 3716   H HD12 . ILE A 1 230 ? 19.420  4.816   -0.115  1.00 70.54 ? 230 ILE A HD12 1  
ATOM 3717   H HD13 . ILE A 1 230 ? 19.978  3.846   -1.478  1.00 22.40 ? 230 ILE A HD13 1  
ATOM 3718   N N    . ASP A 1 231 ? 16.385  4.189   -4.393  1.00 10.42 ? 231 ASP A N    1  
ATOM 3719   C CA   . ASP A 1 231 ? 16.675  3.501   -5.646  1.00 64.13 ? 231 ASP A CA   1  
ATOM 3720   C C    . ASP A 1 231 ? 16.286  4.359   -6.846  1.00 53.24 ? 231 ASP A C    1  
ATOM 3721   O O    . ASP A 1 231 ? 17.048  4.485   -7.804  1.00 70.43 ? 231 ASP A O    1  
ATOM 3722   C CB   . ASP A 1 231 ? 15.935  2.163   -5.700  1.00 63.24 ? 231 ASP A CB   1  
ATOM 3723   C CG   . ASP A 1 231 ? 16.564  1.117   -4.801  1.00 52.12 ? 231 ASP A CG   1  
ATOM 3724   O OD1  . ASP A 1 231 ? 17.758  0.807   -4.996  1.00 63.23 ? 231 ASP A OD1  1  
ATOM 3725   O OD2  . ASP A 1 231 ? 15.862  0.608   -3.901  1.00 70.11 ? 231 ASP A OD2  1  
ATOM 3726   H H    . ASP A 1 231 ? 15.795  3.761   -3.739  1.00 23.04 ? 231 ASP A H    1  
ATOM 3727   H HA   . ASP A 1 231 ? 17.738  3.315   -5.681  1.00 50.01 ? 231 ASP A HA   1  
ATOM 3728   H HB2  . ASP A 1 231 ? 14.912  2.312   -5.387  1.00 22.14 ? 231 ASP A HB2  1  
ATOM 3729   H HB3  . ASP A 1 231 ? 15.946  1.793   -6.715  1.00 25.24 ? 231 ASP A HB3  1  
ATOM 3730   N N    . ALA A 1 232 ? 15.096  4.948   -6.786  1.00 20.23 ? 232 ALA A N    1  
ATOM 3731   C CA   . ALA A 1 232 ? 14.607  5.795   -7.868  1.00 35.32 ? 232 ALA A CA   1  
ATOM 3732   C C    . ALA A 1 232 ? 15.237  7.182   -7.807  1.00 3.41  ? 232 ALA A C    1  
ATOM 3733   O O    . ALA A 1 232 ? 15.520  7.792   -8.838  1.00 54.41 ? 232 ALA A O    1  
ATOM 3734   C CB   . ALA A 1 232 ? 13.091  5.899   -7.813  1.00 34.35 ? 232 ALA A CB   1  
ATOM 3735   H H    . ALA A 1 232 ? 14.533  4.811   -5.995  1.00 22.14 ? 232 ALA A H    1  
ATOM 3736   H HA   . ALA A 1 232 ? 14.879  5.328   -8.804  1.00 1.43  ? 232 ALA A HA   1  
ATOM 3737   H HB1  . ALA A 1 232 ? 12.714  6.190   -8.782  1.00 40.03 ? 232 ALA A HB1  1  
ATOM 3738   H HB2  . ALA A 1 232 ? 12.807  6.639   -7.080  1.00 23.41 ? 232 ALA A HB2  1  
ATOM 3739   H HB3  . ALA A 1 232 ? 12.674  4.941   -7.537  1.00 2.21  ? 232 ALA A HB3  1  
ATOM 3740   N N    . HIS A 1 233 ? 15.456  7.674   -6.592  1.00 54.33 ? 233 HIS A N    1  
ATOM 3741   C CA   . HIS A 1 233 ? 16.053  8.990   -6.395  1.00 13.34 ? 233 HIS A CA   1  
ATOM 3742   C C    . HIS A 1 233 ? 17.430  9.068   -7.049  1.00 41.33 ? 233 HIS A C    1  
ATOM 3743   O O    . HIS A 1 233 ? 17.863  10.137  -7.480  1.00 42.33 ? 233 HIS A O    1  
ATOM 3744   C CB   . HIS A 1 233 ? 16.163  9.303   -4.900  1.00 53.15 ? 233 HIS A CB   1  
ATOM 3745   C CG   . HIS A 1 233 ? 15.157  10.304  -4.424  1.00 10.44 ? 233 HIS A CG   1  
ATOM 3746   N ND1  . HIS A 1 233 ? 15.468  11.330  -3.557  1.00 60.23 ? 233 HIS A ND1  1  
ATOM 3747   C CD2  . HIS A 1 233 ? 13.837  10.433  -4.698  1.00 24.45 ? 233 HIS A CD2  1  
ATOM 3748   C CE1  . HIS A 1 233 ? 14.384  12.046  -3.318  1.00 44.41 ? 233 HIS A CE1  1  
ATOM 3749   N NE2  . HIS A 1 233 ? 13.381  11.524  -3.999  1.00 12.13 ? 233 HIS A NE2  1  
ATOM 3750   H H    . HIS A 1 233 ? 15.209  7.138   -5.810  1.00 35.03 ? 233 HIS A H    1  
ATOM 3751   H HA   . HIS A 1 233 ? 15.406  9.719   -6.859  1.00 0.43  ? 233 HIS A HA   1  
ATOM 3752   H HB2  . HIS A 1 233 ? 16.018  8.393   -4.338  1.00 43.13 ? 233 HIS A HB2  1  
ATOM 3753   H HB3  . HIS A 1 233 ? 17.148  9.695   -4.692  1.00 64.42 ? 233 HIS A HB3  1  
ATOM 3754   H HD1  . HIS A 1 233 ? 16.353  11.507  -3.173  1.00 0.43  ? 233 HIS A HD1  1  
ATOM 3755   H HD2  . HIS A 1 233 ? 13.252  9.797   -5.347  1.00 53.04 ? 233 HIS A HD2  1  
ATOM 3756   H HE1  . HIS A 1 233 ? 14.328  12.913  -2.676  1.00 13.01 ? 233 HIS A HE1  1  
ATOM 3757   H HE2  . HIS A 1 233 ? 12.487  11.916  -4.077  1.00 37.47 ? 233 HIS A HE2  1  
ATOM 3758   N N    . ASN A 1 234 ? 18.113  7.930   -7.118  1.00 12.53 ? 234 ASN A N    1  
ATOM 3759   C CA   . ASN A 1 234 ? 19.441  7.871   -7.719  1.00 30.33 ? 234 ASN A CA   1  
ATOM 3760   C C    . ASN A 1 234 ? 19.378  7.321   -9.142  1.00 74.32 ? 234 ASN A C    1  
ATOM 3761   O O    . ASN A 1 234 ? 20.280  7.554   -9.946  1.00 54.20 ? 234 ASN A O    1  
ATOM 3762   C CB   . ASN A 1 234 ? 20.370  7.004   -6.867  1.00 32.23 ? 234 ASN A CB   1  
ATOM 3763   C CG   . ASN A 1 234 ? 21.111  7.809   -5.817  1.00 34.01 ? 234 ASN A CG   1  
ATOM 3764   O OD1  . ASN A 1 234 ? 22.241  8.246   -6.037  1.00 50.44 ? 234 ASN A OD1  1  
ATOM 3765   N ND2  . ASN A 1 234 ? 20.477  8.010   -4.668  1.00 1.41  ? 234 ASN A ND2  1  
ATOM 3766   H H    . ASN A 1 234 ? 17.716  7.111   -6.756  1.00 2.24  ? 234 ASN A H    1  
ATOM 3767   H HA   . ASN A 1 234 ? 19.834  8.876   -7.752  1.00 74.21 ? 234 ASN A HA   1  
ATOM 3768   H HB2  . ASN A 1 234 ? 19.786  6.247   -6.365  1.00 2.51  ? 234 ASN A HB2  1  
ATOM 3769   H HB3  . ASN A 1 234 ? 21.096  6.527   -7.508  1.00 24.31 ? 234 ASN A HB3  1  
ATOM 3770   H HD21 . ASN A 1 234 ? 19.579  7.632   -4.563  1.00 72.22 ? 234 ASN A HD21 1  
ATOM 3771   H HD22 . ASN A 1 234 ? 20.933  8.527   -3.972  1.00 23.41 ? 234 ASN A HD22 1  
ATOM 3772   N N    . GLY A 1 235 ? 18.309  6.590   -9.447  1.00 75.00 ? 235 GLY A N    1  
ATOM 3773   C CA   . GLY A 1 235 ? 18.156  6.021   -10.773 1.00 44.40 ? 235 GLY A CA   1  
ATOM 3774   C C    . GLY A 1 235 ? 18.698  4.608   -10.864 1.00 62.25 ? 235 GLY A C    1  
ATOM 3775   O O    . GLY A 1 235 ? 19.118  4.164   -11.933 1.00 54.24 ? 235 GLY A O    1  
ATOM 3776   H H    . GLY A 1 235 ? 17.621  6.435   -8.767  1.00 74.33 ? 235 GLY A H    1  
ATOM 3777   H HA2  . GLY A 1 235 ? 17.106  6.010   -11.028 1.00 12.30 ? 235 GLY A HA2  1  
ATOM 3778   H HA3  . GLY A 1 235 ? 18.681  6.643   -11.482 1.00 25.02 ? 235 GLY A HA3  1  
ATOM 3779   N N    . VAL A 1 236 ? 18.687  3.900   -9.739  1.00 20.33 ? 236 VAL A N    1  
ATOM 3780   C CA   . VAL A 1 236 ? 19.181  2.529   -9.693  1.00 72.30 ? 236 VAL A CA   1  
ATOM 3781   C C    . VAL A 1 236 ? 18.040  1.531   -9.901  1.00 40.10 ? 236 VAL A C    1  
ATOM 3782   O O    . VAL A 1 236 ? 16.879  1.921   -10.022 1.00 0.42  ? 236 VAL A O    1  
ATOM 3783   C CB   . VAL A 1 236 ? 19.901  2.241   -8.354  1.00 21.32 ? 236 VAL A CB   1  
ATOM 3784   C CG1  . VAL A 1 236 ? 18.914  1.832   -7.268  1.00 24.32 ? 236 VAL A CG1  1  
ATOM 3785   C CG2  . VAL A 1 236 ? 20.972  1.176   -8.539  1.00 21.03 ? 236 VAL A CG2  1  
ATOM 3786   H H    . VAL A 1 236 ? 18.339  4.309   -8.920  1.00 41.20 ? 236 VAL A H    1  
ATOM 3787   H HA   . VAL A 1 236 ? 19.896  2.409   -10.494 1.00 22.24 ? 236 VAL A HA   1  
ATOM 3788   H HB   . VAL A 1 236 ? 20.388  3.150   -8.034  1.00 42.22 ? 236 VAL A HB   1  
ATOM 3789   H HG11 . VAL A 1 236 ? 17.953  2.282   -7.467  1.00 61.35 ? 236 VAL A HG11 1  
ATOM 3790   H HG12 . VAL A 1 236 ? 19.277  2.168   -6.307  1.00 14.45 ? 236 VAL A HG12 1  
ATOM 3791   H HG13 . VAL A 1 236 ? 18.813  0.757   -7.259  1.00 45.33 ? 236 VAL A HG13 1  
ATOM 3792   H HG21 . VAL A 1 236 ? 20.596  0.223   -8.195  1.00 62.23 ? 236 VAL A HG21 1  
ATOM 3793   H HG22 . VAL A 1 236 ? 21.849  1.444   -7.968  1.00 52.03 ? 236 VAL A HG22 1  
ATOM 3794   H HG23 . VAL A 1 236 ? 21.231  1.104   -9.584  1.00 64.42 ? 236 VAL A HG23 1  
ATOM 3795   N N    . ALA A 1 237 ? 18.377  0.246   -9.937  1.00 31.43 ? 237 ALA A N    1  
ATOM 3796   C CA   . ALA A 1 237 ? 17.379  -0.799  -10.125 1.00 31.23 ? 237 ALA A CA   1  
ATOM 3797   C C    . ALA A 1 237 ? 16.689  -1.138  -8.805  1.00 61.30 ? 237 ALA A C    1  
ATOM 3798   O O    . ALA A 1 237 ? 17.172  -0.775  -7.733  1.00 3.15  ? 237 ALA A O    1  
ATOM 3799   C CB   . ALA A 1 237 ? 18.023  -2.042  -10.722 1.00 55.34 ? 237 ALA A CB   1  
ATOM 3800   H H    . ALA A 1 237 ? 19.317  -0.006  -9.828  1.00 30.55 ? 237 ALA A H    1  
ATOM 3801   H HA   . ALA A 1 237 ? 16.640  -0.434  -10.823 1.00 10.21 ? 237 ALA A HA   1  
ATOM 3802   H HB1  . ALA A 1 237 ? 17.555  -2.924  -10.310 1.00 14.34 ? 237 ALA A HB1  1  
ATOM 3803   H HB2  . ALA A 1 237 ? 19.076  -2.050  -10.486 1.00 2.03  ? 237 ALA A HB2  1  
ATOM 3804   H HB3  . ALA A 1 237 ? 17.894  -2.034  -11.794 1.00 41.34 ? 237 ALA A HB3  1  
ATOM 3805   N N    . PRO A 1 238 ? 15.545  -1.842  -8.866  1.00 24.44 ? 238 PRO A N    1  
ATOM 3806   C CA   . PRO A 1 238 ? 14.792  -2.227  -7.668  1.00 3.35  ? 238 PRO A CA   1  
ATOM 3807   C C    . PRO A 1 238 ? 15.601  -3.126  -6.739  1.00 30.14 ? 238 PRO A C    1  
ATOM 3808   O O    . PRO A 1 238 ? 16.107  -4.169  -7.154  1.00 5.12  ? 238 PRO A O    1  
ATOM 3809   C CB   . PRO A 1 238 ? 13.580  -2.986  -8.224  1.00 40.25 ? 238 PRO A CB   1  
ATOM 3810   C CG   . PRO A 1 238 ? 13.973  -3.389  -9.604  1.00 63.34 ? 238 PRO A CG   1  
ATOM 3811   C CD   . PRO A 1 238 ? 14.898  -2.316  -10.100 1.00 30.12 ? 238 PRO A CD   1  
ATOM 3812   H HA   . PRO A 1 238 ? 14.455  -1.360  -7.119  1.00 71.22 ? 238 PRO A HA   1  
ATOM 3813   H HB2  . PRO A 1 238 ? 13.377  -3.847  -7.604  1.00 53.24 ? 238 PRO A HB2  1  
ATOM 3814   H HB3  . PRO A 1 238 ? 12.719  -2.335  -8.234  1.00 31.35 ? 238 PRO A HB3  1  
ATOM 3815   H HG2  . PRO A 1 238 ? 14.482  -4.342  -9.578  1.00 1.43  ? 238 PRO A HG2  1  
ATOM 3816   H HG3  . PRO A 1 238 ? 13.097  -3.449  -10.233 1.00 42.32 ? 238 PRO A HG3  1  
ATOM 3817   H HD2  . PRO A 1 238 ? 15.625  -2.729  -10.784 1.00 54.45 ? 238 PRO A HD2  1  
ATOM 3818   H HD3  . PRO A 1 238 ? 14.339  -1.522  -10.572 1.00 55.24 ? 238 PRO A HD3  1  
ATOM 3819   N N    . SER A 1 239 ? 15.720  -2.714  -5.481  1.00 62.11 ? 239 SER A N    1  
ATOM 3820   C CA   . SER A 1 239 ? 16.468  -3.481  -4.492  1.00 51.32 ? 239 SER A CA   1  
ATOM 3821   C C    . SER A 1 239 ? 15.584  -3.844  -3.303  1.00 72.11 ? 239 SER A C    1  
ATOM 3822   O O    . SER A 1 239 ? 14.440  -3.399  -3.209  1.00 61.51 ? 239 SER A O    1  
ATOM 3823   C CB   . SER A 1 239 ? 17.686  -2.687  -4.014  1.00 5.30  ? 239 SER A CB   1  
ATOM 3824   O OG   . SER A 1 239 ? 18.612  -3.527  -3.346  1.00 13.34 ? 239 SER A OG   1  
ATOM 3825   H H    . SER A 1 239 ? 15.294  -1.874  -5.211  1.00 54.13 ? 239 SER A H    1  
ATOM 3826   H HA   . SER A 1 239 ? 16.806  -4.391  -4.965  1.00 20.32 ? 239 SER A HA   1  
ATOM 3827   H HB2  . SER A 1 239 ? 18.176  -2.237  -4.865  1.00 21.14 ? 239 SER A HB2  1  
ATOM 3828   H HB3  . SER A 1 239 ? 17.363  -1.913  -3.333  1.00 52.12 ? 239 SER A HB3  1  
ATOM 3829   H HG   . SER A 1 239 ? 19.153  -2.999  -2.754  1.00 3.32  ? 239 SER A HG   1  
ATOM 3830   N N    . ARG A 1 240 ? 16.122  -4.654  -2.397  1.00 32.02 ? 240 ARG A N    1  
ATOM 3831   C CA   . ARG A 1 240 ? 15.383  -5.077  -1.214  1.00 0.31  ? 240 ARG A CA   1  
ATOM 3832   C C    . ARG A 1 240 ? 15.355  -3.971  -0.164  1.00 23.20 ? 240 ARG A C    1  
ATOM 3833   O O    . ARG A 1 240 ? 14.358  -3.790  0.536   1.00 40.32 ? 240 ARG A O    1  
ATOM 3834   C CB   . ARG A 1 240 ? 16.007  -6.343  -0.623  1.00 43.32 ? 240 ARG A CB   1  
ATOM 3835   C CG   . ARG A 1 240 ? 14.985  -7.330  -0.083  1.00 44.43 ? 240 ARG A CG   1  
ATOM 3836   C CD   . ARG A 1 240 ? 15.392  -8.767  -0.368  1.00 72.23 ? 240 ARG A CD   1  
ATOM 3837   N NE   . ARG A 1 240 ? 16.796  -9.012  -0.048  1.00 62.44 ? 240 ARG A NE   1  
ATOM 3838   C CZ   . ARG A 1 240 ? 17.495  -10.042 -0.520  1.00 52.52 ? 240 ARG A CZ   1  
ATOM 3839   N NH1  . ARG A 1 240 ? 16.926  -10.923 -1.333  1.00 2.14  ? 240 ARG A NH1  1  
ATOM 3840   N NH2  . ARG A 1 240 ? 18.768  -10.190 -0.180  1.00 3.03  ? 240 ARG A NH2  1  
ATOM 3841   H H    . ARG A 1 240 ? 17.039  -4.976  -2.528  1.00 35.24 ? 240 ARG A H    1  
ATOM 3842   H HA   . ARG A 1 240 ? 14.369  -5.294  -1.517  1.00 1.51  ? 240 ARG A HA   1  
ATOM 3843   H HB2  . ARG A 1 240 ? 16.583  -6.837  -1.391  1.00 3.03  ? 240 ARG A HB2  1  
ATOM 3844   H HB3  . ARG A 1 240 ? 16.666  -6.062  0.185   1.00 22.44 ? 240 ARG A HB3  1  
ATOM 3845   H HG2  . ARG A 1 240 ? 14.899  -7.196  0.985   1.00 10.22 ? 240 ARG A HG2  1  
ATOM 3846   H HG3  . ARG A 1 240 ? 14.030  -7.136  -0.549  1.00 43.13 ? 240 ARG A HG3  1  
ATOM 3847   H HD2  . ARG A 1 240 ? 14.777  -9.426  0.226   1.00 53.25 ? 240 ARG A HD2  1  
ATOM 3848   H HD3  . ARG A 1 240 ? 15.230  -8.971  -1.416  1.00 25.32 ? 240 ARG A HD3  1  
ATOM 3849   H HE   . ARG A 1 240 ? 17.241  -8.377  0.551   1.00 13.43 ? 240 ARG A HE   1  
ATOM 3850   H HH11 . ARG A 1 240 ? 15.966  -10.818 -1.594  1.00 14.25 ? 240 ARG A HH11 1  
ATOM 3851   H HH12 . ARG A 1 240 ? 17.457  -11.694 -1.684  1.00 14.24 ? 240 ARG A HH12 1  
ATOM 3852   H HH21 . ARG A 1 240 ? 19.202  -9.529  0.432   1.00 41.14 ? 240 ARG A HH21 1  
ATOM 3853   H HH22 . ARG A 1 240 ? 19.294  -10.964 -0.534  1.00 33.30 ? 240 ARG A HH22 1  
ATOM 3854   N N    . ARG A 1 241 ? 16.456  -3.234  -0.058  1.00 20.44 ? 241 ARG A N    1  
ATOM 3855   C CA   . ARG A 1 241 ? 16.560  -2.146  0.908   1.00 42.42 ? 241 ARG A CA   1  
ATOM 3856   C C    . ARG A 1 241 ? 15.481  -1.094  0.664   1.00 71.12 ? 241 ARG A C    1  
ATOM 3857   O O    . ARG A 1 241 ? 15.043  -0.415  1.592   1.00 62.33 ? 241 ARG A O    1  
ATOM 3858   C CB   . ARG A 1 241 ? 17.944  -1.500  0.832   1.00 72.30 ? 241 ARG A CB   1  
ATOM 3859   C CG   . ARG A 1 241 ? 19.037  -2.322  1.497   1.00 4.14  ? 241 ARG A CG   1  
ATOM 3860   C CD   . ARG A 1 241 ? 19.831  -3.125  0.478   1.00 11.11 ? 241 ARG A CD   1  
ATOM 3861   N NE   . ARG A 1 241 ? 21.267  -2.873  0.581   1.00 13.53 ? 241 ARG A NE   1  
ATOM 3862   C CZ   . ARG A 1 241 ? 21.848  -1.736  0.204   1.00 3.41  ? 241 ARG A CZ   1  
ATOM 3863   N NH1  . ARG A 1 241 ? 21.122  -0.747  -0.301  1.00 40.51 ? 241 ARG A NH1  1  
ATOM 3864   N NH2  . ARG A 1 241 ? 23.160  -1.589  0.333   1.00 62.54 ? 241 ARG A NH2  1  
ATOM 3865   H H    . ARG A 1 241 ? 17.218  -3.428  -0.643  1.00 53.03 ? 241 ARG A H    1  
ATOM 3866   H HA   . ARG A 1 241 ? 16.421  -2.564  1.893   1.00 51.20 ? 241 ARG A HA   1  
ATOM 3867   H HB2  . ARG A 1 241 ? 18.208  -1.361  -0.206  1.00 43.43 ? 241 ARG A HB2  1  
ATOM 3868   H HB3  . ARG A 1 241 ? 17.905  -0.535  1.316   1.00 54.24 ? 241 ARG A HB3  1  
ATOM 3869   H HG2  . ARG A 1 241 ? 19.709  -1.656  2.017   1.00 44.41 ? 241 ARG A HG2  1  
ATOM 3870   H HG3  . ARG A 1 241 ? 18.583  -3.002  2.203   1.00 14.14 ? 241 ARG A HG3  1  
ATOM 3871   H HD2  . ARG A 1 241 ? 19.648  -4.176  0.646   1.00 72.21 ? 241 ARG A HD2  1  
ATOM 3872   H HD3  . ARG A 1 241 ? 19.499  -2.857  -0.514  1.00 41.25 ? 241 ARG A HD3  1  
ATOM 3873   H HE   . ARG A 1 241 ? 21.827  -3.587  0.951   1.00 12.45 ? 241 ARG A HE   1  
ATOM 3874   H HH11 . ARG A 1 241 ? 20.133  -0.851  -0.400  1.00 23.33 ? 241 ARG A HH11 1  
ATOM 3875   H HH12 . ARG A 1 241 ? 21.565  0.105   -0.582  1.00 71.34 ? 241 ARG A HH12 1  
ATOM 3876   H HH21 . ARG A 1 241 ? 23.712  -2.331  0.713   1.00 35.12 ? 241 ARG A HH21 1  
ATOM 3877   H HH22 . ARG A 1 241 ? 23.597  -0.735  0.049   1.00 53.11 ? 241 ARG A HH22 1  
ATOM 3878   N N    . GLY A 1 242 ? 15.059  -0.964  -0.590  1.00 40.24 ? 242 GLY A N    1  
ATOM 3879   C CA   . GLY A 1 242 ? 14.037  0.009   -0.931  1.00 11.32 ? 242 GLY A CA   1  
ATOM 3880   C C    . GLY A 1 242 ? 12.751  -0.200  -0.156  1.00 63.22 ? 242 GLY A C    1  
ATOM 3881   O O    . GLY A 1 242 ? 12.087  0.763   0.228   1.00 1.53  ? 242 GLY A O    1  
ATOM 3882   H H    . GLY A 1 242 ? 15.446  -1.531  -1.289  1.00 21.45 ? 242 GLY A H    1  
ATOM 3883   H HA2  . GLY A 1 242 ? 14.414  0.999   -0.721  1.00 55.23 ? 242 GLY A HA2  1  
ATOM 3884   H HA3  . GLY A 1 242 ? 13.824  -0.066  -1.987  1.00 55.55 ? 242 GLY A HA3  1  
ATOM 3885   N N    . ASP A 1 243 ? 12.398  -1.460  0.075   1.00 15.01 ? 243 ASP A N    1  
ATOM 3886   C CA   . ASP A 1 243 ? 11.182  -1.791  0.809   1.00 65.03 ? 243 ASP A CA   1  
ATOM 3887   C C    . ASP A 1 243 ? 11.293  -1.362  2.268   1.00 30.35 ? 243 ASP A C    1  
ATOM 3888   O O    . ASP A 1 243 ? 10.425  -0.660  2.787   1.00 11.32 ? 243 ASP A O    1  
ATOM 3889   C CB   . ASP A 1 243 ? 10.905  -3.294  0.725   1.00 32.12 ? 243 ASP A CB   1  
ATOM 3890   C CG   . ASP A 1 243 ? 9.937   -3.643  -0.389  1.00 41.45 ? 243 ASP A CG   1  
ATOM 3891   O OD1  . ASP A 1 243 ? 9.694   -2.779  -1.258  1.00 52.23 ? 243 ASP A OD1  1  
ATOM 3892   O OD2  . ASP A 1 243 ? 9.421   -4.780  -0.392  1.00 5.31  ? 243 ASP A OD2  1  
ATOM 3893   H H    . ASP A 1 243 ? 12.968  -2.185  -0.257  1.00 52.22 ? 243 ASP A H    1  
ATOM 3894   H HA   . ASP A 1 243 ? 10.363  -1.258  0.351   1.00 71.20 ? 243 ASP A HA   1  
ATOM 3895   H HB2  . ASP A 1 243 ? 11.833  -3.815  0.545   1.00 23.14 ? 243 ASP A HB2  1  
ATOM 3896   H HB3  . ASP A 1 243 ? 10.484  -3.629  1.662   1.00 35.14 ? 243 ASP A HB3  1  
ATOM 3897   N N    . LEU A 1 244 ? 12.365  -1.790  2.926   1.00 33.32 ? 244 LEU A N    1  
ATOM 3898   C CA   . LEU A 1 244 ? 12.589  -1.451  4.327   1.00 22.31 ? 244 LEU A CA   1  
ATOM 3899   C C    . LEU A 1 244 ? 12.663  0.061   4.519   1.00 24.35 ? 244 LEU A C    1  
ATOM 3900   O O    . LEU A 1 244 ? 12.322  0.579   5.582   1.00 65.43 ? 244 LEU A O    1  
ATOM 3901   C CB   . LEU A 1 244 ? 13.878  -2.103  4.831   1.00 31.44 ? 244 LEU A CB   1  
ATOM 3902   C CG   . LEU A 1 244 ? 13.831  -3.628  4.941   1.00 12.52 ? 244 LEU A CG   1  
ATOM 3903   C CD1  . LEU A 1 244 ? 15.237  -4.199  5.052   1.00 4.25  ? 244 LEU A CD1  1  
ATOM 3904   C CD2  . LEU A 1 244 ? 12.987  -4.049  6.134   1.00 53.53 ? 244 LEU A CD2  1  
ATOM 3905   H H    . LEU A 1 244 ? 13.022  -2.348  2.459   1.00 1.43  ? 244 LEU A H    1  
ATOM 3906   H HA   . LEU A 1 244 ? 11.757  -1.833  4.897   1.00 63.42 ? 244 LEU A HA   1  
ATOM 3907   H HB2  . LEU A 1 244 ? 14.679  -1.835  4.157   1.00 63.20 ? 244 LEU A HB2  1  
ATOM 3908   H HB3  . LEU A 1 244 ? 14.102  -1.701  5.807   1.00 25.25 ? 244 LEU A HB3  1  
ATOM 3909   H HG   . LEU A 1 244 ? 13.377  -4.033  4.048   1.00 74.33 ? 244 LEU A HG   1  
ATOM 3910   H HD11 . LEU A 1 244 ? 15.870  -3.496  5.574   1.00 11.43 ? 244 LEU A HD11 1  
ATOM 3911   H HD12 . LEU A 1 244 ? 15.633  -4.375  4.063   1.00 33.32 ? 244 LEU A HD12 1  
ATOM 3912   H HD13 . LEU A 1 244 ? 15.205  -5.129  5.599   1.00 21.21 ? 244 LEU A HD13 1  
ATOM 3913   H HD21 . LEU A 1 244 ? 11.959  -4.169  5.823   1.00 44.51 ? 244 LEU A HD21 1  
ATOM 3914   H HD22 . LEU A 1 244 ? 13.044  -3.291  6.901   1.00 25.23 ? 244 LEU A HD22 1  
ATOM 3915   H HD23 . LEU A 1 244 ? 13.356  -4.986  6.524   1.00 34.22 ? 244 LEU A HD23 1  
ATOM 3916   N N    . GLU A 1 245 ? 13.112  0.764   3.484   1.00 42.22 ? 245 GLU A N    1  
ATOM 3917   C CA   . GLU A 1 245 ? 13.231  2.217   3.540   1.00 53.42 ? 245 GLU A CA   1  
ATOM 3918   C C    . GLU A 1 245 ? 11.858  2.874   3.646   1.00 22.43 ? 245 GLU A C    1  
ATOM 3919   O O    . GLU A 1 245 ? 11.668  3.814   4.417   1.00 74.24 ? 245 GLU A O    1  
ATOM 3920   C CB   . GLU A 1 245 ? 13.965  2.737   2.303   1.00 3.34  ? 245 GLU A CB   1  
ATOM 3921   C CG   . GLU A 1 245 ? 15.471  2.831   2.484   1.00 41.54 ? 245 GLU A CG   1  
ATOM 3922   C CD   . GLU A 1 245 ? 16.143  3.630   1.384   1.00 35.44 ? 245 GLU A CD   1  
ATOM 3923   O OE1  . GLU A 1 245 ? 15.428  4.326   0.633   1.00 71.21 ? 245 GLU A OE1  1  
ATOM 3924   O OE2  . GLU A 1 245 ? 17.385  3.560   1.275   1.00 71.25 ? 245 GLU A OE2  1  
ATOM 3925   H H    . GLU A 1 245 ? 13.370  0.296   2.663   1.00 52.31 ? 245 GLU A H    1  
ATOM 3926   H HA   . GLU A 1 245 ? 13.805  2.467   4.419   1.00 45.31 ? 245 GLU A HA   1  
ATOM 3927   H HB2  . GLU A 1 245 ? 13.764  2.074   1.474   1.00 40.12 ? 245 GLU A HB2  1  
ATOM 3928   H HB3  . GLU A 1 245 ? 13.591  3.722   2.064   1.00 22.31 ? 245 GLU A HB3  1  
ATOM 3929   H HG2  . GLU A 1 245 ? 15.678  3.306   3.431   1.00 75.34 ? 245 GLU A HG2  1  
ATOM 3930   H HG3  . GLU A 1 245 ? 15.883  1.832   2.486   1.00 32.55 ? 245 GLU A HG3  1  
ATOM 3931   N N    . ILE A 1 246 ? 10.905  2.374   2.866   1.00 34.25 ? 246 ILE A N    1  
ATOM 3932   C CA   . ILE A 1 246 ? 9.551   2.914   2.874   1.00 4.33  ? 246 ILE A CA   1  
ATOM 3933   C C    . ILE A 1 246 ? 8.928   2.808   4.263   1.00 2.04  ? 246 ILE A C    1  
ATOM 3934   O O    . ILE A 1 246 ? 8.385   3.781   4.787   1.00 53.41 ? 246 ILE A O    1  
ATOM 3935   C CB   . ILE A 1 246 ? 8.648   2.187   1.857   1.00 30.41 ? 246 ILE A CB   1  
ATOM 3936   C CG1  . ILE A 1 246 ? 9.297   2.195   0.472   1.00 60.13 ? 246 ILE A CG1  1  
ATOM 3937   C CG2  . ILE A 1 246 ? 7.272   2.836   1.806   1.00 11.45 ? 246 ILE A CG2  1  
ATOM 3938   C CD1  . ILE A 1 246 ? 9.058   0.925   -0.315  1.00 33.53 ? 246 ILE A CD1  1  
ATOM 3939   H H    . ILE A 1 246 ? 11.117  1.624   2.272   1.00 42.24 ? 246 ILE A H    1  
ATOM 3940   H HA   . ILE A 1 246 ? 9.606   3.956   2.595   1.00 23.24 ? 246 ILE A HA   1  
ATOM 3941   H HB   . ILE A 1 246 ? 8.525   1.166   2.184   1.00 11.45 ? 246 ILE A HB   1  
ATOM 3942   H HG12 . ILE A 1 246 ? 8.897   3.018   -0.101  1.00 74.13 ? 246 ILE A HG12 1  
ATOM 3943   H HG13 . ILE A 1 246 ? 10.364  2.323   0.581   1.00 21.22 ? 246 ILE A HG13 1  
ATOM 3944   H HG21 . ILE A 1 246 ? 6.599   2.209   1.241   1.00 70.23 ? 246 ILE A HG21 1  
ATOM 3945   H HG22 . ILE A 1 246 ? 7.348   3.803   1.331   1.00 11.44 ? 246 ILE A HG22 1  
ATOM 3946   H HG23 . ILE A 1 246 ? 6.894   2.957   2.810   1.00 51.33 ? 246 ILE A HG23 1  
ATOM 3947   H HD11 . ILE A 1 246 ? 10.006  0.476   -0.571  1.00 65.32 ? 246 ILE A HD11 1  
ATOM 3948   H HD12 . ILE A 1 246 ? 8.514   1.158   -1.219  1.00 44.34 ? 246 ILE A HD12 1  
ATOM 3949   H HD13 . ILE A 1 246 ? 8.482   0.234   0.283   1.00 14.34 ? 246 ILE A HD13 1  
ATOM 3950   N N    . LEU A 1 247 ? 9.014   1.622   4.856   1.00 65.41 ? 247 LEU A N    1  
ATOM 3951   C CA   . LEU A 1 247 ? 8.463   1.391   6.185   1.00 54.43 ? 247 LEU A CA   1  
ATOM 3952   C C    . LEU A 1 247 ? 9.268   2.144   7.240   1.00 43.21 ? 247 LEU A C    1  
ATOM 3953   O O    . LEU A 1 247 ? 8.714   2.653   8.214   1.00 53.22 ? 247 LEU A O    1  
ATOM 3954   C CB   . LEU A 1 247 ? 8.452   -0.105  6.504   1.00 52.21 ? 247 LEU A CB   1  
ATOM 3955   C CG   . LEU A 1 247 ? 7.960   -0.467  7.907   1.00 33.23 ? 247 LEU A CG   1  
ATOM 3956   C CD1  . LEU A 1 247 ? 6.446   -0.603  7.923   1.00 5.40  ? 247 LEU A CD1  1  
ATOM 3957   C CD2  . LEU A 1 247 ? 8.618   -1.751  8.387   1.00 34.40 ? 247 LEU A CD2  1  
ATOM 3958   H H    . LEU A 1 247 ? 9.462   0.885   4.389   1.00 24.22 ? 247 LEU A H    1  
ATOM 3959   H HA   . LEU A 1 247 ? 7.448   1.760   6.193   1.00 43.52 ? 247 LEU A HA   1  
ATOM 3960   H HB2  . LEU A 1 247 ? 7.818   -0.601  5.784   1.00 63.14 ? 247 LEU A HB2  1  
ATOM 3961   H HB3  . LEU A 1 247 ? 9.458   -0.483  6.392   1.00 13.31 ? 247 LEU A HB3  1  
ATOM 3962   H HG   . LEU A 1 247 ? 8.230   0.325   8.591   1.00 23.22 ? 247 LEU A HG   1  
ATOM 3963   H HD11 . LEU A 1 247 ? 6.158   -1.330  8.668   1.00 21.21 ? 247 LEU A HD11 1  
ATOM 3964   H HD12 . LEU A 1 247 ? 6.104   -0.929  6.952   1.00 70.40 ? 247 LEU A HD12 1  
ATOM 3965   H HD13 . LEU A 1 247 ? 6.000   0.352   8.159   1.00 13.34 ? 247 LEU A HD13 1  
ATOM 3966   H HD21 . LEU A 1 247 ? 8.913   -2.345  7.534   1.00 62.44 ? 247 LEU A HD21 1  
ATOM 3967   H HD22 . LEU A 1 247 ? 7.919   -2.310  8.991   1.00 12.21 ? 247 LEU A HD22 1  
ATOM 3968   H HD23 . LEU A 1 247 ? 9.491   -1.510  8.976   1.00 32.44 ? 247 LEU A HD23 1  
ATOM 3969   N N    . GLY A 1 248 ? 10.579  2.209   7.035   1.00 11.31 ? 248 GLY A N    1  
ATOM 3970   C CA   . GLY A 1 248 ? 11.445  2.900   7.972   1.00 23.51 ? 248 GLY A CA   1  
ATOM 3971   C C    . GLY A 1 248 ? 11.136  4.381   8.064   1.00 42.23 ? 248 GLY A C    1  
ATOM 3972   O O    . GLY A 1 248 ? 11.180  4.965   9.147   1.00 23.25 ? 248 GLY A O    1  
ATOM 3973   H H    . GLY A 1 248 ? 10.960  1.782   6.239   1.00 74.11 ? 248 GLY A H    1  
ATOM 3974   H HA2  . GLY A 1 248 ? 11.325  2.457   8.949   1.00 33.44 ? 248 GLY A HA2  1  
ATOM 3975   H HA3  . GLY A 1 248 ? 12.470  2.776   7.656   1.00 41.14 ? 248 GLY A HA3  1  
ATOM 3976   N N    . TYR A 1 249 ? 10.825  4.991   6.925   1.00 31.33 ? 249 TYR A N    1  
ATOM 3977   C CA   . TYR A 1 249 ? 10.509  6.414   6.880   1.00 2.45  ? 249 TYR A CA   1  
ATOM 3978   C C    . TYR A 1 249 ? 9.205   6.707   7.617   1.00 34.34 ? 249 TYR A C    1  
ATOM 3979   O O    . TYR A 1 249 ? 9.185   7.473   8.581   1.00 34.32 ? 249 TYR A O    1  
ATOM 3980   C CB   . TYR A 1 249 ? 10.410  6.890   5.430   1.00 52.21 ? 249 TYR A CB   1  
ATOM 3981   C CG   . TYR A 1 249 ? 11.750  7.212   4.803   1.00 32.05 ? 249 TYR A CG   1  
ATOM 3982   C CD1  . TYR A 1 249 ? 12.878  6.457   5.100   1.00 41.22 ? 249 TYR A CD1  1  
ATOM 3983   C CD2  . TYR A 1 249 ? 11.885  8.271   3.913   1.00 22.03 ? 249 TYR A CD2  1  
ATOM 3984   C CE1  . TYR A 1 249 ? 14.103  6.749   4.529   1.00 60.50 ? 249 TYR A CE1  1  
ATOM 3985   C CE2  . TYR A 1 249 ? 13.106  8.568   3.338   1.00 23.04 ? 249 TYR A CE2  1  
ATOM 3986   C CZ   . TYR A 1 249 ? 14.211  7.805   3.649   1.00 2.14  ? 249 TYR A CZ   1  
ATOM 3987   O OH   . TYR A 1 249 ? 15.428  8.098   3.078   1.00 32.33 ? 249 TYR A OH   1  
ATOM 3988   H H    . TYR A 1 249 ? 10.807  4.472   6.094   1.00 63.12 ? 249 TYR A H    1  
ATOM 3989   H HA   . TYR A 1 249 ? 11.311  6.946   7.370   1.00 22.12 ? 249 TYR A HA   1  
ATOM 3990   H HB2  . TYR A 1 249 ? 9.944   6.119   4.836   1.00 3.01  ? 249 TYR A HB2  1  
ATOM 3991   H HB3  . TYR A 1 249 ? 9.803   7.783   5.392   1.00 71.44 ? 249 TYR A HB3  1  
ATOM 3992   H HD1  . TYR A 1 249 ? 12.791  5.630   5.789   1.00 14.42 ? 249 TYR A HD1  1  
ATOM 3993   H HD2  . TYR A 1 249 ? 11.018  8.868   3.672   1.00 45.43 ? 249 TYR A HD2  1  
ATOM 3994   H HE1  . TYR A 1 249 ? 14.968  6.150   4.772   1.00 12.41 ? 249 TYR A HE1  1  
ATOM 3995   H HE2  . TYR A 1 249 ? 13.190  9.395   2.649   1.00 2.12  ? 249 TYR A HE2  1  
ATOM 3996   H HH   . TYR A 1 249 ? 16.123  7.992   3.732   1.00 41.51 ? 249 TYR A HH   1  
ATOM 3997   N N    . CYS A 1 250 ? 8.119   6.090   7.160   1.00 2.11  ? 250 CYS A N    1  
ATOM 3998   C CA   . CYS A 1 250 ? 6.812   6.284   7.781   1.00 2.31  ? 250 CYS A CA   1  
ATOM 3999   C C    . CYS A 1 250 ? 6.856   5.901   9.257   1.00 64.50 ? 250 CYS A C    1  
ATOM 4000   O O    . CYS A 1 250 ? 6.239   6.554   10.099  1.00 63.41 ? 250 CYS A O    1  
ATOM 4001   C CB   . CYS A 1 250 ? 5.751   5.454   7.056   1.00 34.54 ? 250 CYS A CB   1  
ATOM 4002   S SG   . CYS A 1 250 ? 5.125   6.218   5.542   1.00 45.12 ? 250 CYS A SG   1  
ATOM 4003   H H    . CYS A 1 250 ? 8.198   5.489   6.390   1.00 31.10 ? 250 CYS A H    1  
ATOM 4004   H HA   . CYS A 1 250 ? 6.558   7.330   7.700   1.00 44.10 ? 250 CYS A HA   1  
ATOM 4005   H HB2  . CYS A 1 250 ? 6.174   4.497   6.790   1.00 13.40 ? 250 CYS A HB2  1  
ATOM 4006   H HB3  . CYS A 1 250 ? 4.912   5.299   7.719   1.00 61.11 ? 250 CYS A HB3  1  
ATOM 4007   H HG   . CYS A 1 250 ? 5.078   5.538   4.865   1.00 22.55 ? 250 CYS A HG   1  
ATOM 4008   N N    . MET A 1 251 ? 7.594   4.838   9.560   1.00 71.45 ? 251 MET A N    1  
ATOM 4009   C CA   . MET A 1 251 ? 7.728   4.362   10.933  1.00 32.24 ? 251 MET A CA   1  
ATOM 4010   C C    . MET A 1 251 ? 8.130   5.503   11.864  1.00 11.52 ? 251 MET A C    1  
ATOM 4011   O O    . MET A 1 251 ? 7.590   5.643   12.961  1.00 41.33 ? 251 MET A O    1  
ATOM 4012   C CB   . MET A 1 251 ? 8.763   3.238   11.008  1.00 51.11 ? 251 MET A CB   1  
ATOM 4013   C CG   . MET A 1 251 ? 8.157   1.847   10.909  1.00 74.52 ? 251 MET A CG   1  
ATOM 4014   S SD   . MET A 1 251 ? 9.397   0.542   11.005  1.00 71.20 ? 251 MET A SD   1  
ATOM 4015   C CE   . MET A 1 251 ? 9.438   0.243   12.770  1.00 60.50 ? 251 MET A CE   1  
ATOM 4016   H H    . MET A 1 251 ? 8.059   4.366   8.838   1.00 15.13 ? 251 MET A H    1  
ATOM 4017   H HA   . MET A 1 251 ? 6.769   3.979   11.246  1.00 4.50  ? 251 MET A HA   1  
ATOM 4018   H HB2  . MET A 1 251 ? 9.467   3.358   10.198  1.00 63.44 ? 251 MET A HB2  1  
ATOM 4019   H HB3  . MET A 1 251 ? 9.291   3.311   11.947  1.00 53.31 ? 251 MET A HB3  1  
ATOM 4020   H HG2  . MET A 1 251 ? 7.455   1.717   11.720  1.00 42.53 ? 251 MET A HG2  1  
ATOM 4021   H HG3  . MET A 1 251 ? 7.636   1.762   9.967   1.00 21.55 ? 251 MET A HG3  1  
ATOM 4022   H HE1  . MET A 1 251 ? 10.164  0.898   13.229  1.00 41.41 ? 251 MET A HE1  1  
ATOM 4023   H HE2  . MET A 1 251 ? 9.712   -0.785  12.956  1.00 62.50 ? 251 MET A HE2  1  
ATOM 4024   H HE3  . MET A 1 251 ? 8.462   0.436   13.191  1.00 60.52 ? 251 MET A HE3  1  
ATOM 4025   N N    . ILE A 1 252 ? 9.078   6.319   11.413  1.00 43.52 ? 252 ILE A N    1  
ATOM 4026   C CA   . ILE A 1 252 ? 9.552   7.453   12.198  1.00 55.44 ? 252 ILE A CA   1  
ATOM 4027   C C    . ILE A 1 252 ? 8.633   8.662   12.035  1.00 45.13 ? 252 ILE A C    1  
ATOM 4028   O O    . ILE A 1 252 ? 8.642   9.574   12.861  1.00 23.14 ? 252 ILE A O    1  
ATOM 4029   C CB   . ILE A 1 252 ? 10.986  7.853   11.800  1.00 34.44 ? 252 ILE A CB   1  
ATOM 4030   C CG1  . ILE A 1 252 ? 11.902  6.628   11.800  1.00 2.53  ? 252 ILE A CG1  1  
ATOM 4031   C CG2  . ILE A 1 252 ? 11.520  8.920   12.744  1.00 62.42 ? 252 ILE A CG2  1  
ATOM 4032   C CD1  . ILE A 1 252 ? 13.108  6.775   10.898  1.00 1.12  ? 252 ILE A CD1  1  
ATOM 4033   H H    . ILE A 1 252 ? 9.466   6.156   10.528  1.00 40.03 ? 252 ILE A H    1  
ATOM 4034   H HA   . ILE A 1 252 ? 9.559   7.159   13.237  1.00 43.42 ? 252 ILE A HA   1  
ATOM 4035   H HB   . ILE A 1 252 ? 10.955  8.271   10.805  1.00 25.45 ? 252 ILE A HB   1  
ATOM 4036   H HG12 . ILE A 1 252 ? 12.259  6.454   12.804  1.00 3.12  ? 252 ILE A HG12 1  
ATOM 4037   H HG13 . ILE A 1 252 ? 11.341  5.767   11.468  1.00 63.44 ? 252 ILE A HG13 1  
ATOM 4038   H HG21 . ILE A 1 252 ? 11.131  8.750   13.737  1.00 4.02  ? 252 ILE A HG21 1  
ATOM 4039   H HG22 . ILE A 1 252 ? 11.210  9.895   12.398  1.00 3.32  ? 252 ILE A HG22 1  
ATOM 4040   H HG23 . ILE A 1 252 ? 12.599  8.873   12.767  1.00 74.05 ? 252 ILE A HG23 1  
ATOM 4041   H HD11 . ILE A 1 252 ? 13.551  5.805   10.729  1.00 12.30 ? 252 ILE A HD11 1  
ATOM 4042   H HD12 . ILE A 1 252 ? 13.831  7.425   11.368  1.00 44.04 ? 252 ILE A HD12 1  
ATOM 4043   H HD13 . ILE A 1 252 ? 12.802  7.200   9.954   1.00 53.23 ? 252 ILE A HD13 1  
ATOM 4044   N N    . GLN A 1 253 ? 7.844   8.665   10.964  1.00 24.41 ? 253 GLN A N    1  
ATOM 4045   C CA   . GLN A 1 253 ? 6.924   9.765   10.695  1.00 2.42  ? 253 GLN A CA   1  
ATOM 4046   C C    . GLN A 1 253 ? 5.808   9.811   11.733  1.00 13.21 ? 253 GLN A C    1  
ATOM 4047   O O    . GLN A 1 253 ? 5.473   10.877  12.251  1.00 21.31 ? 253 GLN A O    1  
ATOM 4048   C CB   . GLN A 1 253 ? 6.325   9.624   9.294   1.00 42.12 ? 253 GLN A CB   1  
ATOM 4049   C CG   . GLN A 1 253 ? 5.767   10.924  8.739   1.00 2.34  ? 253 GLN A CG   1  
ATOM 4050   C CD   . GLN A 1 253 ? 4.287   11.090  9.023   1.00 61.23 ? 253 GLN A CD   1  
ATOM 4051   O OE1  . GLN A 1 253 ? 3.609   10.143  9.419   1.00 75.21 ? 253 GLN A OE1  1  
ATOM 4052   N NE2  . GLN A 1 253 ? 3.778   12.300  8.821   1.00 64.51 ? 253 GLN A NE2  1  
ATOM 4053   H H    . GLN A 1 253 ? 7.881   7.911   10.339  1.00 50.24 ? 253 GLN A H    1  
ATOM 4054   H HA   . GLN A 1 253 ? 7.485   10.686  10.746  1.00 11.41 ? 253 GLN A HA   1  
ATOM 4055   H HB2  . GLN A 1 253 ? 7.092   9.270   8.621   1.00 62.32 ? 253 GLN A HB2  1  
ATOM 4056   H HB3  . GLN A 1 253 ? 5.525   8.900   9.329   1.00 72.02 ? 253 GLN A HB3  1  
ATOM 4057   H HG2  . GLN A 1 253 ? 6.299   11.750  9.188   1.00 31.32 ? 253 GLN A HG2  1  
ATOM 4058   H HG3  . GLN A 1 253 ? 5.918   10.938  7.670   1.00 10.23 ? 253 GLN A HG3  1  
ATOM 4059   H HE21 . GLN A 1 253 ? 4.378   13.008  8.505   1.00 54.23 ? 253 GLN A HE21 1  
ATOM 4060   H HE22 . GLN A 1 253 ? 2.824   12.436  8.996   1.00 11.10 ? 253 GLN A HE22 1  
ATOM 4061   N N    . TRP A 1 254 ? 5.233   8.651   12.031  1.00 52.34 ? 254 TRP A N    1  
ATOM 4062   C CA   . TRP A 1 254 ? 4.152   8.561   13.006  1.00 13.24 ? 254 TRP A CA   1  
ATOM 4063   C C    . TRP A 1 254 ? 4.697   8.610   14.430  1.00 34.43 ? 254 TRP A C    1  
ATOM 4064   O O    . TRP A 1 254 ? 4.079   9.191   15.322  1.00 34.13 ? 254 TRP A O    1  
ATOM 4065   C CB   . TRP A 1 254 ? 3.355   7.272   12.797  1.00 64.24 ? 254 TRP A CB   1  
ATOM 4066   C CG   . TRP A 1 254 ? 2.933   7.058   11.376  1.00 33.31 ? 254 TRP A CG   1  
ATOM 4067   C CD1  . TRP A 1 254 ? 2.354   7.974   10.545  1.00 62.10 ? 254 TRP A CD1  1  
ATOM 4068   C CD2  . TRP A 1 254 ? 3.054   5.848   10.618  1.00 24.14 ? 254 TRP A CD2  1  
ATOM 4069   N NE1  . TRP A 1 254 ? 2.108   7.408   9.317   1.00 20.24 ? 254 TRP A NE1  1  
ATOM 4070   C CE2  . TRP A 1 254 ? 2.530   6.104   9.337   1.00 70.51 ? 254 TRP A CE2  1  
ATOM 4071   C CE3  . TRP A 1 254 ? 3.557   4.574   10.898  1.00 24.43 ? 254 TRP A CE3  1  
ATOM 4072   C CZ2  . TRP A 1 254 ? 2.493   5.133   8.339   1.00 0.14  ? 254 TRP A CZ2  1  
ATOM 4073   C CZ3  . TRP A 1 254 ? 3.520   3.611   9.907   1.00 53.54 ? 254 TRP A CZ3  1  
ATOM 4074   C CH2  . TRP A 1 254 ? 2.992   3.895   8.641   1.00 60.44 ? 254 TRP A CH2  1  
ATOM 4075   H H    . TRP A 1 254 ? 5.542   7.835   11.584  1.00 75.24 ? 254 TRP A H    1  
ATOM 4076   H HA   . TRP A 1 254 ? 3.498   9.407   12.854  1.00 24.22 ? 254 TRP A HA   1  
ATOM 4077   H HB2  . TRP A 1 254 ? 3.962   6.430   13.095  1.00 45.12 ? 254 TRP A HB2  1  
ATOM 4078   H HB3  . TRP A 1 254 ? 2.466   7.304   13.409  1.00 61.22 ? 254 TRP A HB3  1  
ATOM 4079   H HD1  . TRP A 1 254 ? 2.127   8.992   10.826  1.00 42.00 ? 254 TRP A HD1  1  
ATOM 4080   H HE1  . TRP A 1 254 ? 1.699   7.864   8.552   1.00 50.32 ? 254 TRP A HE1  1  
ATOM 4081   H HE3  . TRP A 1 254 ? 3.968   4.337   11.868  1.00 63.31 ? 254 TRP A HE3  1  
ATOM 4082   H HZ2  . TRP A 1 254 ? 2.090   5.335   7.358   1.00 51.31 ? 254 TRP A HZ2  1  
ATOM 4083   H HZ3  . TRP A 1 254 ? 3.903   2.621   10.106  1.00 31.33 ? 254 TRP A HZ3  1  
ATOM 4084   H HH2  . TRP A 1 254 ? 2.983   3.112   7.898   1.00 13.23 ? 254 TRP A HH2  1  
ATOM 4085   N N    . LEU A 1 255 ? 5.855   7.993   14.635  1.00 52.42 ? 255 LEU A N    1  
ATOM 4086   C CA   . LEU A 1 255 ? 6.483   7.963   15.951  1.00 74.12 ? 255 LEU A CA   1  
ATOM 4087   C C    . LEU A 1 255 ? 6.871   9.367   16.404  1.00 33.45 ? 255 LEU A C    1  
ATOM 4088   O O    . LEU A 1 255 ? 6.700   9.722   17.571  1.00 14.13 ? 255 LEU A O    1  
ATOM 4089   C CB   . LEU A 1 255 ? 7.718   7.060   15.929  1.00 33.02 ? 255 LEU A CB   1  
ATOM 4090   C CG   . LEU A 1 255 ? 7.885   6.162   17.156  1.00 41.03 ? 255 LEU A CG   1  
ATOM 4091   C CD1  . LEU A 1 255 ? 8.892   5.058   16.876  1.00 73.03 ? 255 LEU A CD1  1  
ATOM 4092   C CD2  . LEU A 1 255 ? 8.313   6.983   18.363  1.00 15.34 ? 255 LEU A CD2  1  
ATOM 4093   H H    . LEU A 1 255 ? 6.296   7.545   13.883  1.00 54.33 ? 255 LEU A H    1  
ATOM 4094   H HA   . LEU A 1 255 ? 5.766   7.559   16.649  1.00 53.42 ? 255 LEU A HA   1  
ATOM 4095   H HB2  . LEU A 1 255 ? 7.662   6.430   15.053  1.00 33.33 ? 255 LEU A HB2  1  
ATOM 4096   H HB3  . LEU A 1 255 ? 8.595   7.684   15.847  1.00 11.32 ? 255 LEU A HB3  1  
ATOM 4097   H HG   . LEU A 1 255 ? 6.936   5.697   17.385  1.00 73.02 ? 255 LEU A HG   1  
ATOM 4098   H HD11 . LEU A 1 255 ? 8.750   4.687   15.871  1.00 21.15 ? 255 LEU A HD11 1  
ATOM 4099   H HD12 . LEU A 1 255 ? 8.748   4.252   17.580  1.00 0.42  ? 255 LEU A HD12 1  
ATOM 4100   H HD13 . LEU A 1 255 ? 9.893   5.450   16.977  1.00 5.35  ? 255 LEU A HD13 1  
ATOM 4101   H HD21 . LEU A 1 255 ? 9.385   6.921   18.478  1.00 70.25 ? 255 LEU A HD21 1  
ATOM 4102   H HD22 . LEU A 1 255 ? 7.833   6.597   19.250  1.00 1.33  ? 255 LEU A HD22 1  
ATOM 4103   H HD23 . LEU A 1 255 ? 8.025   8.014   18.217  1.00 53.03 ? 255 LEU A HD23 1  
ATOM 4104   N N    . THR A 1 256 ? 7.393   10.163  15.476  1.00 3.45  ? 256 THR A N    1  
ATOM 4105   C CA   . THR A 1 256 ? 7.804   11.528  15.786  1.00 63.42 ? 256 THR A CA   1  
ATOM 4106   C C    . THR A 1 256 ? 6.690   12.520  15.465  1.00 20.40 ? 256 THR A C    1  
ATOM 4107   O O    . THR A 1 256 ? 6.497   13.503  16.180  1.00 20.22 ? 256 THR A O    1  
ATOM 4108   C CB   . THR A 1 256 ? 9.067   11.891  15.003  1.00 73.35 ? 256 THR A CB   1  
ATOM 4109   O OG1  . THR A 1 256 ? 8.798   11.947  13.614  1.00 23.31 ? 256 THR A OG1  1  
ATOM 4110   C CG2  . THR A 1 256 ? 10.203  10.912  15.211  1.00 11.20 ? 256 THR A CG2  1  
ATOM 4111   H H    . THR A 1 256 ? 7.505   9.825   14.563  1.00 14.11 ? 256 THR A H    1  
ATOM 4112   H HA   . THR A 1 256 ? 8.020   11.577  16.842  1.00 72.11 ? 256 THR A HA   1  
ATOM 4113   H HB   . THR A 1 256 ? 9.408   12.866  15.322  1.00 55.13 ? 256 THR A HB   1  
ATOM 4114   H HG1  . THR A 1 256 ? 8.150   12.633  13.440  1.00 52.40 ? 256 THR A HG1  1  
ATOM 4115   H HG21 . THR A 1 256 ? 9.802   9.951   15.497  1.00 21.24 ? 256 THR A HG21 1  
ATOM 4116   H HG22 . THR A 1 256 ? 10.854  11.277  15.992  1.00 4.05  ? 256 THR A HG22 1  
ATOM 4117   H HG23 . THR A 1 256 ? 10.763  10.810  14.294  1.00 34.11 ? 256 THR A HG23 1  
ATOM 4118   N N    . GLY A 1 257 ? 5.961   12.256  14.386  1.00 60.13 ? 257 GLY A N    1  
ATOM 4119   C CA   . GLY A 1 257 ? 4.877   13.136  13.990  1.00 21.00 ? 257 GLY A CA   1  
ATOM 4120   C C    . GLY A 1 257 ? 5.160   13.854  12.685  1.00 22.11 ? 257 GLY A C    1  
ATOM 4121   O O    . GLY A 1 257 ? 4.295   13.937  11.814  1.00 4.31  ? 257 GLY A O    1  
ATOM 4122   H H    . GLY A 1 257 ? 6.162   11.459  13.852  1.00 11.10 ? 257 GLY A H    1  
ATOM 4123   H HA2  . GLY A 1 257 ? 3.976   12.551  13.878  1.00 1.43  ? 257 GLY A HA2  1  
ATOM 4124   H HA3  . GLY A 1 257 ? 4.722   13.871  14.766  1.00 14.53 ? 257 GLY A HA3  1  
ATOM 4125   N N    . HIS A 1 258 ? 6.377   14.373  12.551  1.00 3.34  ? 258 HIS A N    1  
ATOM 4126   C CA   . HIS A 1 258 ? 6.774   15.088  11.343  1.00 42.04 ? 258 HIS A CA   1  
ATOM 4127   C C    . HIS A 1 258 ? 8.205   14.736  10.949  1.00 4.52  ? 258 HIS A C    1  
ATOM 4128   O O    . HIS A 1 258 ? 9.053   14.492  11.807  1.00 10.12 ? 258 HIS A O    1  
ATOM 4129   C CB   . HIS A 1 258 ? 6.646   16.598  11.554  1.00 54.50 ? 258 HIS A CB   1  
ATOM 4130   C CG   . HIS A 1 258 ? 5.268   17.124  11.295  1.00 22.24 ? 258 HIS A CG   1  
ATOM 4131   N ND1  . HIS A 1 258 ? 4.969   17.972  10.249  1.00 41.32 ? 258 HIS A ND1  1  
ATOM 4132   C CD2  . HIS A 1 258 ? 4.102   16.917  11.953  1.00 0.32  ? 258 HIS A CD2  1  
ATOM 4133   C CE1  . HIS A 1 258 ? 3.681   18.265  10.276  1.00 32.21 ? 258 HIS A CE1  1  
ATOM 4134   N NE2  . HIS A 1 258 ? 3.133   17.637  11.299  1.00 61.15 ? 258 HIS A NE2  1  
ATOM 4135   H H    . HIS A 1 258 ? 7.022   14.273  13.281  1.00 32.01 ? 258 HIS A H    1  
ATOM 4136   H HA   . HIS A 1 258 ? 6.110   14.787  10.547  1.00 32.51 ? 258 HIS A HA   1  
ATOM 4137   H HB2  . HIS A 1 258 ? 6.905   16.835  12.575  1.00 52.44 ? 258 HIS A HB2  1  
ATOM 4138   H HB3  . HIS A 1 258 ? 7.327   17.106  10.887  1.00 21.25 ? 258 HIS A HB3  1  
ATOM 4139   H HD1  . HIS A 1 258 ? 5.607   18.310  9.586   1.00 74.24 ? 258 HIS A HD1  1  
ATOM 4140   H HD2  . HIS A 1 258 ? 3.961   16.300  12.830  1.00 22.21 ? 258 HIS A HD2  1  
ATOM 4141   H HE1  . HIS A 1 258 ? 3.164   18.907  9.578   1.00 22.22 ? 258 HIS A HE1  1  
ATOM 4142   H HE2  . HIS A 1 258 ? 2.176   17.625  11.509  1.00 37.47 ? 258 HIS A HE2  1  
ATOM 4143   N N    . LEU A 1 259 ? 8.467   14.711  9.646   1.00 1.23  ? 259 LEU A N    1  
ATOM 4144   C CA   . LEU A 1 259 ? 9.796   14.388  9.141   1.00 31.21 ? 259 LEU A CA   1  
ATOM 4145   C C    . LEU A 1 259 ? 10.623  15.655  8.932   1.00 1.12  ? 259 LEU A C    1  
ATOM 4146   O O    . LEU A 1 259 ? 10.076  16.736  8.716   1.00 44.01 ? 259 LEU A O    1  
ATOM 4147   C CB   . LEU A 1 259 ? 9.689   13.607  7.829   1.00 50.44 ? 259 LEU A CB   1  
ATOM 4148   C CG   . LEU A 1 259 ? 9.375   12.117  7.989   1.00 61.41 ? 259 LEU A CG   1  
ATOM 4149   C CD1  . LEU A 1 259 ? 8.286   11.690  7.017   1.00 72.11 ? 259 LEU A CD1  1  
ATOM 4150   C CD2  . LEU A 1 259 ? 10.630  11.281  7.783   1.00 1.03  ? 259 LEU A CD2  1  
ATOM 4151   H H    . LEU A 1 259 ? 7.749   14.914  9.010   1.00 70.45 ? 259 LEU A H    1  
ATOM 4152   H HA   . LEU A 1 259 ? 10.287  13.770  9.877   1.00 72.25 ? 259 LEU A HA   1  
ATOM 4153   H HB2  . LEU A 1 259 ? 8.911   14.058  7.230   1.00 25.41 ? 259 LEU A HB2  1  
ATOM 4154   H HB3  . LEU A 1 259 ? 10.626  13.701  7.301   1.00 42.15 ? 259 LEU A HB3  1  
ATOM 4155   H HG   . LEU A 1 259 ? 9.015   11.938  8.992   1.00 72.40 ? 259 LEU A HG   1  
ATOM 4156   H HD11 . LEU A 1 259 ? 7.484   12.414  7.034   1.00 73.44 ? 259 LEU A HD11 1  
ATOM 4157   H HD12 . LEU A 1 259 ? 7.903   10.723  7.308   1.00 32.13 ? 259 LEU A HD12 1  
ATOM 4158   H HD13 . LEU A 1 259 ? 8.696   11.629  6.020   1.00 71.43 ? 259 LEU A HD13 1  
ATOM 4159   H HD21 . LEU A 1 259 ? 11.503  11.901  7.922   1.00 74.53 ? 259 LEU A HD21 1  
ATOM 4160   H HD22 . LEU A 1 259 ? 10.632  10.876  6.782   1.00 53.43 ? 259 LEU A HD22 1  
ATOM 4161   H HD23 . LEU A 1 259 ? 10.645  10.472  8.499   1.00 50.51 ? 259 LEU A HD23 1  
ATOM 4162   N N    . PRO A 1 260 ? 11.961  15.537  9.002   1.00 34.31 ? 260 PRO A N    1  
ATOM 4163   C CA   . PRO A 1 260 ? 12.867  16.679  8.827   1.00 21.12 ? 260 PRO A CA   1  
ATOM 4164   C C    . PRO A 1 260 ? 12.644  17.411  7.508   1.00 1.54  ? 260 PRO A C    1  
ATOM 4165   O O    . PRO A 1 260 ? 12.692  18.640  7.456   1.00 11.53 ? 260 PRO A O    1  
ATOM 4166   C CB   . PRO A 1 260 ? 14.259  16.040  8.850   1.00 74.23 ? 260 PRO A CB   1  
ATOM 4167   C CG   . PRO A 1 260 ? 14.081  14.760  9.591   1.00 12.14 ? 260 PRO A CG   1  
ATOM 4168   C CD   . PRO A 1 260 ? 12.694  14.285  9.264   1.00 54.23 ? 260 PRO A CD   1  
ATOM 4169   H HA   . PRO A 1 260 ? 12.779  17.380  9.644   1.00 54.24 ? 260 PRO A HA   1  
ATOM 4170   H HB2  . PRO A 1 260 ? 14.595  15.868  7.838   1.00 23.53 ? 260 PRO A HB2  1  
ATOM 4171   H HB3  . PRO A 1 260 ? 14.950  16.696  9.358   1.00 65.31 ? 260 PRO A HB3  1  
ATOM 4172   H HG2  . PRO A 1 260 ? 14.813  14.039  9.259   1.00 34.14 ? 260 PRO A HG2  1  
ATOM 4173   H HG3  . PRO A 1 260 ? 14.177  14.933  10.652  1.00 62.52 ? 260 PRO A HG3  1  
ATOM 4174   H HD2  . PRO A 1 260 ? 12.708  13.655  8.386   1.00 31.22 ? 260 PRO A HD2  1  
ATOM 4175   H HD3  . PRO A 1 260 ? 12.267  13.757  10.104  1.00 64.10 ? 260 PRO A HD3  1  
ATOM 4176   N N    . TRP A 1 261 ? 12.405  16.652  6.443   1.00 53.14 ? 261 TRP A N    1  
ATOM 4177   C CA   . TRP A 1 261 ? 12.181  17.237  5.126   1.00 35.25 ? 261 TRP A CA   1  
ATOM 4178   C C    . TRP A 1 261 ? 10.690  17.368  4.827   1.00 40.04 ? 261 TRP A C    1  
ATOM 4179   O O    . TRP A 1 261 ? 10.234  17.034  3.733   1.00 71.14 ? 261 TRP A O    1  
ATOM 4180   C CB   . TRP A 1 261 ? 12.863  16.393  4.046   1.00 65.34 ? 261 TRP A CB   1  
ATOM 4181   C CG   . TRP A 1 261 ? 12.298  15.010  3.921   1.00 20.24 ? 261 TRP A CG   1  
ATOM 4182   C CD1  . TRP A 1 261 ? 11.337  14.594  3.047   1.00 14.14 ? 261 TRP A CD1  1  
ATOM 4183   C CD2  . TRP A 1 261 ? 12.662  13.862  4.696   1.00 61.50 ? 261 TRP A CD2  1  
ATOM 4184   N NE1  . TRP A 1 261 ? 11.080  13.256  3.231   1.00 12.44 ? 261 TRP A NE1  1  
ATOM 4185   C CE2  . TRP A 1 261 ? 11.881  12.785  4.238   1.00 23.13 ? 261 TRP A CE2  1  
ATOM 4186   C CE3  . TRP A 1 261 ? 13.573  13.640  5.733   1.00 0.43  ? 261 TRP A CE3  1  
ATOM 4187   C CZ2  . TRP A 1 261 ? 11.983  11.507  4.780   1.00 62.11 ? 261 TRP A CZ2  1  
ATOM 4188   C CZ3  . TRP A 1 261 ? 13.674  12.371  6.271   1.00 50.35 ? 261 TRP A CZ3  1  
ATOM 4189   C CH2  . TRP A 1 261 ? 12.883  11.318  5.793   1.00 61.21 ? 261 TRP A CH2  1  
ATOM 4190   H H    . TRP A 1 261 ? 12.382  15.678  6.545   1.00 22.33 ? 261 TRP A H    1  
ATOM 4191   H HA   . TRP A 1 261 ? 12.621  18.223  5.125   1.00 5.23  ? 261 TRP A HA   1  
ATOM 4192   H HB2  . TRP A 1 261 ? 12.751  16.884  3.091   1.00 2.54  ? 261 TRP A HB2  1  
ATOM 4193   H HB3  . TRP A 1 261 ? 13.914  16.305  4.278   1.00 52.54 ? 261 TRP A HB3  1  
ATOM 4194   H HD1  . TRP A 1 261 ? 10.856  15.233  2.321   1.00 73.34 ? 261 TRP A HD1  1  
ATOM 4195   H HE1  . TRP A 1 261 ? 10.429  12.727  2.724   1.00 72.02 ? 261 TRP A HE1  1  
ATOM 4196   H HE3  . TRP A 1 261 ? 14.191  14.440  6.114   1.00 44.24 ? 261 TRP A HE3  1  
ATOM 4197   H HZ2  . TRP A 1 261 ? 11.381  10.684  4.423   1.00 54.51 ? 261 TRP A HZ2  1  
ATOM 4198   H HZ3  . TRP A 1 261 ? 14.372  12.181  7.073   1.00 3.04  ? 261 TRP A HZ3  1  
ATOM 4199   H HH2  . TRP A 1 261 ? 12.995  10.343  6.244   1.00 20.43 ? 261 TRP A HH2  1  
ATOM 4200   N N    . GLU A 1 262 ? 9.936   17.859  5.805   1.00 75.40 ? 262 GLU A N    1  
ATOM 4201   C CA   . GLU A 1 262 ? 8.497   18.037  5.646   1.00 15.14 ? 262 GLU A CA   1  
ATOM 4202   C C    . GLU A 1 262 ? 8.183   19.406  5.049   1.00 21.21 ? 262 GLU A C    1  
ATOM 4203   O O    . GLU A 1 262 ? 7.207   19.566  4.317   1.00 51.04 ? 262 GLU A O    1  
ATOM 4204   C CB   . GLU A 1 262 ? 7.789   17.880  6.994   1.00 3.42  ? 262 GLU A CB   1  
ATOM 4205   C CG   . GLU A 1 262 ? 7.147   16.516  7.188   1.00 10.32 ? 262 GLU A CG   1  
ATOM 4206   C CD   . GLU A 1 262 ? 6.004   16.268  6.224   1.00 64.32 ? 262 GLU A CD   1  
ATOM 4207   O OE1  . GLU A 1 262 ? 4.912   16.835  6.439   1.00 14.11 ? 262 GLU A OE1  1  
ATOM 4208   O OE2  . GLU A 1 262 ? 6.200   15.507  5.253   1.00 25.52 ? 262 GLU A OE2  1  
ATOM 4209   H H    . GLU A 1 262 ? 10.357  18.109  6.654   1.00 51.04 ? 262 GLU A H    1  
ATOM 4210   H HA   . GLU A 1 262 ? 8.142   17.273  4.971   1.00 45.30 ? 262 GLU A HA   1  
ATOM 4211   H HB2  . GLU A 1 262 ? 8.508   18.031  7.785   1.00 12.14 ? 262 GLU A HB2  1  
ATOM 4212   H HB3  . GLU A 1 262 ? 7.017   18.631  7.073   1.00 1.13  ? 262 GLU A HB3  1  
ATOM 4213   H HG2  . GLU A 1 262 ? 7.897   15.754  7.037   1.00 72.12 ? 262 GLU A HG2  1  
ATOM 4214   H HG3  . GLU A 1 262 ? 6.768   16.451  8.198   1.00 21.25 ? 262 GLU A HG3  1  
ATOM 4215   N N    . ASP A 1 263 ? 9.018   20.390  5.368   1.00 25.11 ? 263 ASP A N    1  
ATOM 4216   C CA   . ASP A 1 263 ? 8.830   21.746  4.864   1.00 10.22 ? 263 ASP A CA   1  
ATOM 4217   C C    . ASP A 1 263 ? 9.822   22.057  3.748   1.00 54.34 ? 263 ASP A C    1  
ATOM 4218   O O    . ASP A 1 263 ? 10.222  23.207  3.563   1.00 61.12 ? 263 ASP A O    1  
ATOM 4219   C CB   . ASP A 1 263 ? 8.986   22.760  5.999   1.00 35.13 ? 263 ASP A CB   1  
ATOM 4220   C CG   . ASP A 1 263 ? 8.254   24.058  5.719   1.00 23.32 ? 263 ASP A CG   1  
ATOM 4221   O OD1  . ASP A 1 263 ? 7.015   24.085  5.872   1.00 53.42 ? 263 ASP A OD1  1  
ATOM 4222   O OD2  . ASP A 1 263 ? 8.920   25.047  5.346   1.00 25.11 ? 263 ASP A OD2  1  
ATOM 4223   H H    . ASP A 1 263 ? 9.778   20.199  5.956   1.00 31.53 ? 263 ASP A H    1  
ATOM 4224   H HA   . ASP A 1 263 ? 7.828   21.815  4.468   1.00 13.20 ? 263 ASP A HA   1  
ATOM 4225   H HB2  . ASP A 1 263 ? 8.592   22.336  6.910   1.00 62.33 ? 263 ASP A HB2  1  
ATOM 4226   H HB3  . ASP A 1 263 ? 10.035  22.981  6.134   1.00 71.44 ? 263 ASP A HB3  1  
ATOM 4227   N N    . ASN A 1 264 ? 10.215  21.027  3.006   1.00 62.25 ? 264 ASN A N    1  
ATOM 4228   C CA   . ASN A 1 264 ? 11.161  21.195  1.907   1.00 32.42 ? 264 ASN A CA   1  
ATOM 4229   C C    . ASN A 1 264 ? 10.939  20.138  0.831   1.00 44.13 ? 264 ASN A C    1  
ATOM 4230   O O    . ASN A 1 264 ? 11.889  19.656  0.214   1.00 33.30 ? 264 ASN A O    1  
ATOM 4231   C CB   . ASN A 1 264 ? 12.600  21.121  2.424   1.00 74.52 ? 264 ASN A CB   1  
ATOM 4232   C CG   . ASN A 1 264 ? 13.521  22.088  1.708   1.00 73.42 ? 264 ASN A CG   1  
ATOM 4233   O OD1  . ASN A 1 264 ? 13.691  23.232  2.131   1.00 43.31 ? 264 ASN A OD1  1  
ATOM 4234   N ND2  . ASN A 1 264 ? 14.123  21.632  0.615   1.00 33.24 ? 264 ASN A ND2  1  
ATOM 4235   H H    . ASN A 1 264 ? 9.861   20.134  3.202   1.00 3.23  ? 264 ASN A H    1  
ATOM 4236   H HA   . ASN A 1 264 ? 10.994  22.171  1.475   1.00 53.42 ? 264 ASN A HA   1  
ATOM 4237   H HB2  . ASN A 1 264 ? 12.611  21.357  3.478   1.00 40.20 ? 264 ASN A HB2  1  
ATOM 4238   H HB3  . ASN A 1 264 ? 12.977  20.119  2.280   1.00 72.23 ? 264 ASN A HB3  1  
ATOM 4239   H HD21 . ASN A 1 264 ? 13.941  20.711  0.337   1.00 41.51 ? 264 ASN A HD21 1  
ATOM 4240   H HD22 . ASN A 1 264 ? 14.725  22.236  0.132   1.00 72.14 ? 264 ASN A HD22 1  
ATOM 4241   N N    . LEU A 1 265 ? 9.678   19.784  0.608   1.00 22.23 ? 265 LEU A N    1  
ATOM 4242   C CA   . LEU A 1 265 ? 9.330   18.785  -0.396  1.00 13.51 ? 265 LEU A CA   1  
ATOM 4243   C C    . LEU A 1 265 ? 9.518   19.342  -1.803  1.00 52.22 ? 265 LEU A C    1  
ATOM 4244   O O    . LEU A 1 265 ? 9.828   18.603  -2.738  1.00 33.20 ? 265 LEU A O    1  
ATOM 4245   C CB   . LEU A 1 265 ? 7.884   18.322  -0.206  1.00 33.11 ? 265 LEU A CB   1  
ATOM 4246   C CG   . LEU A 1 265 ? 7.650   17.409  0.998   1.00 71.13 ? 265 LEU A CG   1  
ATOM 4247   C CD1  . LEU A 1 265 ? 6.164   17.299  1.303   1.00 71.15 ? 265 LEU A CD1  1  
ATOM 4248   C CD2  . LEU A 1 265 ? 8.248   16.033  0.747   1.00 42.53 ? 265 LEU A CD2  1  
ATOM 4249   H H    . LEU A 1 265 ? 8.964   20.206  1.130   1.00 40.13 ? 265 LEU A H    1  
ATOM 4250   H HA   . LEU A 1 265 ? 9.989   17.940  -0.265  1.00 60.22 ? 265 LEU A HA   1  
ATOM 4251   H HB2  . LEU A 1 265 ? 7.260   19.197  -0.096  1.00 71.51 ? 265 LEU A HB2  1  
ATOM 4252   H HB3  . LEU A 1 265 ? 7.578   17.792  -1.096  1.00 22.31 ? 265 LEU A HB3  1  
ATOM 4253   H HG   . LEU A 1 265 ? 8.137   17.834  1.864   1.00 63.23 ? 265 LEU A HG   1  
ATOM 4254   H HD11 . LEU A 1 265 ? 5.607   17.284  0.377   1.00 71.35 ? 265 LEU A HD11 1  
ATOM 4255   H HD12 . LEU A 1 265 ? 5.854   18.146  1.896   1.00 50.31 ? 265 LEU A HD12 1  
ATOM 4256   H HD13 . LEU A 1 265 ? 5.975   16.388  1.851   1.00 24.34 ? 265 LEU A HD13 1  
ATOM 4257   H HD21 . LEU A 1 265 ? 7.785   15.593  -0.124  1.00 41.13 ? 265 LEU A HD21 1  
ATOM 4258   H HD22 . LEU A 1 265 ? 8.073   15.402  1.605   1.00 4.12  ? 265 LEU A HD22 1  
ATOM 4259   H HD23 . LEU A 1 265 ? 9.311   16.128  0.580   1.00 40.10 ? 265 LEU A HD23 1  
ATOM 4260   N N    . LYS A 1 266 ? 9.328   20.649  -1.947  1.00 2.11  ? 266 LYS A N    1  
ATOM 4261   C CA   . LYS A 1 266 ? 9.477   21.307  -3.240  1.00 23.40 ? 266 LYS A CA   1  
ATOM 4262   C C    . LYS A 1 266 ? 10.901  21.162  -3.768  1.00 1.33  ? 266 LYS A C    1  
ATOM 4263   O O    . LYS A 1 266 ? 11.132  21.209  -4.976  1.00 14.41 ? 266 LYS A O    1  
ATOM 4264   C CB   . LYS A 1 266 ? 9.112   22.788  -3.126  1.00 43.54 ? 266 LYS A CB   1  
ATOM 4265   C CG   . LYS A 1 266 ? 7.641   23.073  -3.382  1.00 34.12 ? 266 LYS A CG   1  
ATOM 4266   C CD   . LYS A 1 266 ? 7.378   24.564  -3.520  1.00 1.23  ? 266 LYS A CD   1  
ATOM 4267   C CE   . LYS A 1 266 ? 6.342   24.850  -4.594  1.00 74.43 ? 266 LYS A CE   1  
ATOM 4268   N NZ   . LYS A 1 266 ? 6.973   25.232  -5.888  1.00 0.33  ? 266 LYS A NZ   1  
ATOM 4269   H H    . LYS A 1 266 ? 9.083   21.185  -1.164  1.00 40.33 ? 266 LYS A H    1  
ATOM 4270   H HA   . LYS A 1 266 ? 8.799   20.831  -3.933  1.00 33.42 ? 266 LYS A HA   1  
ATOM 4271   H HB2  . LYS A 1 266 ? 9.356   23.132  -2.132  1.00 63.42 ? 266 LYS A HB2  1  
ATOM 4272   H HB3  . LYS A 1 266 ? 9.694   23.347  -3.844  1.00 0.31  ? 266 LYS A HB3  1  
ATOM 4273   H HG2  . LYS A 1 266 ? 7.341   22.579  -4.294  1.00 1.44  ? 266 LYS A HG2  1  
ATOM 4274   H HG3  . LYS A 1 266 ? 7.061   22.689  -2.555  1.00 43.34 ? 266 LYS A HG3  1  
ATOM 4275   H HD2  . LYS A 1 266 ? 7.018   24.945  -2.576  1.00 65.13 ? 266 LYS A HD2  1  
ATOM 4276   H HD3  . LYS A 1 266 ? 8.302   25.060  -3.781  1.00 33.03 ? 266 LYS A HD3  1  
ATOM 4277   H HE2  . LYS A 1 266 ? 5.743   23.964  -4.744  1.00 44.20 ? 266 LYS A HE2  1  
ATOM 4278   H HE3  . LYS A 1 266 ? 5.709   25.659  -4.260  1.00 45.44 ? 266 LYS A HE3  1  
ATOM 4279   H HZ1  . LYS A 1 266 ? 6.415   24.858  -6.682  1.00 23.25 ? 266 LYS A HZ1  1  
ATOM 4280   H HZ2  . LYS A 1 266 ? 7.937   24.844  -5.943  1.00 3.13  ? 266 LYS A HZ2  1  
ATOM 4281   H HZ3  . LYS A 1 266 ? 7.023   26.267  -5.969  1.00 74.44 ? 266 LYS A HZ3  1  
ATOM 4282   N N    . ASP A 1 267 ? 11.854  20.986  -2.857  1.00 13.20 ? 267 ASP A N    1  
ATOM 4283   C CA   . ASP A 1 267 ? 13.255  20.836  -3.236  1.00 3.13  ? 267 ASP A CA   1  
ATOM 4284   C C    . ASP A 1 267 ? 13.646  19.360  -3.300  1.00 30.25 ? 267 ASP A C    1  
ATOM 4285   O O    . ASP A 1 267 ? 13.904  18.735  -2.271  1.00 4.12  ? 267 ASP A O    1  
ATOM 4286   C CB   . ASP A 1 267 ? 14.154  21.570  -2.239  1.00 0.10  ? 267 ASP A CB   1  
ATOM 4287   C CG   . ASP A 1 267 ? 15.288  22.311  -2.921  1.00 2.41  ? 267 ASP A CG   1  
ATOM 4288   O OD1  . ASP A 1 267 ? 15.034  23.397  -3.483  1.00 64.22 ? 267 ASP A OD1  1  
ATOM 4289   O OD2  . ASP A 1 267 ? 16.429  21.805  -2.892  1.00 20.50 ? 267 ASP A OD2  1  
ATOM 4290   H H    . ASP A 1 267 ? 11.611  20.958  -1.908  1.00 50.53 ? 267 ASP A H    1  
ATOM 4291   H HA   . ASP A 1 267 ? 13.382  21.276  -4.212  1.00 13.01 ? 267 ASP A HA   1  
ATOM 4292   H HB2  . ASP A 1 267 ? 13.562  22.285  -1.688  1.00 4.04  ? 267 ASP A HB2  1  
ATOM 4293   H HB3  . ASP A 1 267 ? 14.578  20.854  -1.551  1.00 12.20 ? 267 ASP A HB3  1  
ATOM 4294   N N    . PRO A 1 268 ? 13.697  18.778  -4.513  1.00 63.21 ? 268 PRO A N    1  
ATOM 4295   C CA   . PRO A 1 268 ? 14.061  17.368  -4.694  1.00 42.55 ? 268 PRO A CA   1  
ATOM 4296   C C    . PRO A 1 268 ? 15.518  17.096  -4.336  1.00 54.20 ? 268 PRO A C    1  
ATOM 4297   O O    . PRO A 1 268 ? 15.855  16.019  -3.843  1.00 51.32 ? 268 PRO A O    1  
ATOM 4298   C CB   . PRO A 1 268 ? 13.822  17.123  -6.187  1.00 13.23 ? 268 PRO A CB   1  
ATOM 4299   C CG   . PRO A 1 268 ? 13.928  18.468  -6.816  1.00 74.15 ? 268 PRO A CG   1  
ATOM 4300   C CD   . PRO A 1 268 ? 13.407  19.443  -5.797  1.00 54.22 ? 268 PRO A CD   1  
ATOM 4301   H HA   . PRO A 1 268 ? 13.422  16.719  -4.113  1.00 3.45  ? 268 PRO A HA   1  
ATOM 4302   H HB2  . PRO A 1 268 ? 14.574  16.447  -6.568  1.00 45.14 ? 268 PRO A HB2  1  
ATOM 4303   H HB3  . PRO A 1 268 ? 12.840  16.697  -6.331  1.00 54.13 ? 268 PRO A HB3  1  
ATOM 4304   H HG2  . PRO A 1 268 ? 14.960  18.685  -7.049  1.00 31.53 ? 268 PRO A HG2  1  
ATOM 4305   H HG3  . PRO A 1 268 ? 13.324  18.504  -7.711  1.00 34.44 ? 268 PRO A HG3  1  
ATOM 4306   H HD2  . PRO A 1 268 ? 13.932  20.383  -5.873  1.00 3.15  ? 268 PRO A HD2  1  
ATOM 4307   H HD3  . PRO A 1 268 ? 12.345  19.589  -5.924  1.00 12.54 ? 268 PRO A HD3  1  
ATOM 4308   N N    . LYS A 1 269 ? 16.378  18.077  -4.586  1.00 71.23 ? 269 LYS A N    1  
ATOM 4309   C CA   . LYS A 1 269 ? 17.799  17.942  -4.289  1.00 64.23 ? 269 LYS A CA   1  
ATOM 4310   C C    . LYS A 1 269 ? 18.035  17.861  -2.784  1.00 41.53 ? 269 LYS A C    1  
ATOM 4311   O O    . LYS A 1 269 ? 18.894  17.113  -2.319  1.00 60.13 ? 269 LYS A O    1  
ATOM 4312   C CB   . LYS A 1 269 ? 18.579  19.119  -4.876  1.00 1.04  ? 269 LYS A CB   1  
ATOM 4313   C CG   . LYS A 1 269 ? 20.070  18.857  -5.008  1.00 4.01  ? 269 LYS A CG   1  
ATOM 4314   C CD   . LYS A 1 269 ? 20.661  19.589  -6.201  1.00 34.01 ? 269 LYS A CD   1  
ATOM 4315   C CE   . LYS A 1 269 ? 22.180  19.628  -6.135  1.00 31.13 ? 269 LYS A CE   1  
ATOM 4316   N NZ   . LYS A 1 269 ? 22.798  19.529  -7.486  1.00 22.25 ? 269 LYS A NZ   1  
ATOM 4317   H H    . LYS A 1 269 ? 16.051  18.913  -4.980  1.00 51.43 ? 269 LYS A H    1  
ATOM 4318   H HA   . LYS A 1 269 ? 18.148  17.027  -4.746  1.00 71.22 ? 269 LYS A HA   1  
ATOM 4319   H HB2  . LYS A 1 269 ? 18.187  19.342  -5.857  1.00 10.34 ? 269 LYS A HB2  1  
ATOM 4320   H HB3  . LYS A 1 269 ? 18.442  19.981  -4.239  1.00 53.23 ? 269 LYS A HB3  1  
ATOM 4321   H HG2  . LYS A 1 269 ? 20.566  19.194  -4.110  1.00 54.51 ? 269 LYS A HG2  1  
ATOM 4322   H HG3  . LYS A 1 269 ? 20.229  17.796  -5.133  1.00 31.35 ? 269 LYS A HG3  1  
ATOM 4323   H HD2  . LYS A 1 269 ? 20.364  19.082  -7.107  1.00 61.32 ? 269 LYS A HD2  1  
ATOM 4324   H HD3  . LYS A 1 269 ? 20.285  20.602  -6.213  1.00 71.42 ? 269 LYS A HD3  1  
ATOM 4325   H HE2  . LYS A 1 269 ? 22.484  20.557  -5.677  1.00 33.35 ? 269 LYS A HE2  1  
ATOM 4326   H HE3  . LYS A 1 269 ? 22.522  18.800  -5.530  1.00 73.15 ? 269 LYS A HE3  1  
ATOM 4327   H HZ1  . LYS A 1 269 ? 23.831  19.627  -7.415  1.00 31.15 ? 269 LYS A HZ1  1  
ATOM 4328   H HZ2  . LYS A 1 269 ? 22.431  20.282  -8.103  1.00 11.22 ? 269 LYS A HZ2  1  
ATOM 4329   H HZ3  . LYS A 1 269 ? 22.576  18.607  -7.914  1.00 52.10 ? 269 LYS A HZ3  1  
ATOM 4330   N N    . TYR A 1 270 ? 17.266  18.638  -2.028  1.00 24.21 ? 270 TYR A N    1  
ATOM 4331   C CA   . TYR A 1 270 ? 17.391  18.656  -0.575  1.00 34.20 ? 270 TYR A CA   1  
ATOM 4332   C C    . TYR A 1 270 ? 16.985  17.314  0.024   1.00 5.33  ? 270 TYR A C    1  
ATOM 4333   O O    . TYR A 1 270 ? 17.681  16.770  0.882   1.00 24.43 ? 270 TYR A O    1  
ATOM 4334   C CB   . TYR A 1 270 ? 16.529  19.774  0.016   1.00 42.24 ? 270 TYR A CB   1  
ATOM 4335   C CG   . TYR A 1 270 ? 16.626  19.883  1.521   1.00 22.54 ? 270 TYR A CG   1  
ATOM 4336   C CD1  . TYR A 1 270 ? 16.037  18.932  2.345   1.00 40.31 ? 270 TYR A CD1  1  
ATOM 4337   C CD2  . TYR A 1 270 ? 17.305  20.938  2.118   1.00 65.24 ? 270 TYR A CD2  1  
ATOM 4338   C CE1  . TYR A 1 270 ? 16.123  19.029  3.721   1.00 25.23 ? 270 TYR A CE1  1  
ATOM 4339   C CE2  . TYR A 1 270 ? 17.396  21.041  3.493   1.00 52.15 ? 270 TYR A CE2  1  
ATOM 4340   C CZ   . TYR A 1 270 ? 16.803  20.085  4.290   1.00 70.51 ? 270 TYR A CZ   1  
ATOM 4341   O OH   . TYR A 1 270 ? 16.891  20.185  5.659   1.00 33.31 ? 270 TYR A OH   1  
ATOM 4342   H H    . TYR A 1 270 ? 16.600  19.214  -2.458  1.00 64.21 ? 270 TYR A H    1  
ATOM 4343   H HA   . TYR A 1 270 ? 18.426  18.847  -0.334  1.00 41.20 ? 270 TYR A HA   1  
ATOM 4344   H HB2  . TYR A 1 270 ? 16.839  20.719  -0.405  1.00 10.01 ? 270 TYR A HB2  1  
ATOM 4345   H HB3  . TYR A 1 270 ? 15.495  19.594  -0.239  1.00 42.52 ? 270 TYR A HB3  1  
ATOM 4346   H HD1  . TYR A 1 270 ? 15.505  18.106  1.896   1.00 2.20  ? 270 TYR A HD1  1  
ATOM 4347   H HD2  . TYR A 1 270 ? 17.768  21.686  1.491   1.00 70.40 ? 270 TYR A HD2  1  
ATOM 4348   H HE1  . TYR A 1 270 ? 15.658  18.280  4.345   1.00 62.34 ? 270 TYR A HE1  1  
ATOM 4349   H HE2  . TYR A 1 270 ? 17.929  21.869  3.938   1.00 14.02 ? 270 TYR A HE2  1  
ATOM 4350   H HH   . TYR A 1 270 ? 17.807  20.322  5.912   1.00 30.22 ? 270 TYR A HH   1  
ATOM 4351   N N    . VAL A 1 271 ? 15.853  16.784  -0.430  1.00 14.10 ? 271 VAL A N    1  
ATOM 4352   C CA   . VAL A 1 271 ? 15.353  15.506  0.063   1.00 0.15  ? 271 VAL A CA   1  
ATOM 4353   C C    . VAL A 1 271 ? 16.398  14.405  -0.091  1.00 23.53 ? 271 VAL A C    1  
ATOM 4354   O O    . VAL A 1 271 ? 16.603  13.600  0.817   1.00 41.12 ? 271 VAL A O    1  
ATOM 4355   C CB   . VAL A 1 271 ? 14.068  15.083  -0.674  1.00 21.11 ? 271 VAL A CB   1  
ATOM 4356   C CG1  . VAL A 1 271 ? 13.450  13.860  -0.014  1.00 1.55  ? 271 VAL A CG1  1  
ATOM 4357   C CG2  . VAL A 1 271 ? 13.074  16.234  -0.719  1.00 43.43 ? 271 VAL A CG2  1  
ATOM 4358   H H    . VAL A 1 271 ? 15.341  17.266  -1.113  1.00 62.03 ? 271 VAL A H    1  
ATOM 4359   H HA   . VAL A 1 271 ? 15.119  15.621  1.111   1.00 41.01 ? 271 VAL A HA   1  
ATOM 4360   H HB   . VAL A 1 271 ? 14.329  14.822  -1.690  1.00 4.02  ? 271 VAL A HB   1  
ATOM 4361   H HG11 . VAL A 1 271 ? 14.203  13.344  0.565   1.00 33.34 ? 271 VAL A HG11 1  
ATOM 4362   H HG12 . VAL A 1 271 ? 13.064  13.197  -0.774  1.00 41.52 ? 271 VAL A HG12 1  
ATOM 4363   H HG13 . VAL A 1 271 ? 12.646  14.170  0.637   1.00 2.32  ? 271 VAL A HG13 1  
ATOM 4364   H HG21 . VAL A 1 271 ? 13.315  16.948  0.055   1.00 2.11  ? 271 VAL A HG21 1  
ATOM 4365   H HG22 . VAL A 1 271 ? 12.076  15.855  -0.561  1.00 3.14  ? 271 VAL A HG22 1  
ATOM 4366   H HG23 . VAL A 1 271 ? 13.127  16.717  -1.683  1.00 12.42 ? 271 VAL A HG23 1  
ATOM 4367   N N    . ARG A 1 272 ? 17.055  14.376  -1.246  1.00 44.25 ? 272 ARG A N    1  
ATOM 4368   C CA   . ARG A 1 272 ? 18.079  13.373  -1.516  1.00 71.14 ? 272 ARG A CA   1  
ATOM 4369   C C    . ARG A 1 272 ? 19.332  13.635  -0.686  1.00 53.30 ? 272 ARG A C    1  
ATOM 4370   O O    . ARG A 1 272 ? 20.039  12.705  -0.300  1.00 13.21 ? 272 ARG A O    1  
ATOM 4371   C CB   . ARG A 1 272 ? 18.430  13.358  -3.005  1.00 44.24 ? 272 ARG A CB   1  
ATOM 4372   C CG   . ARG A 1 272 ? 19.075  14.645  -3.493  1.00 24.54 ? 272 ARG A CG   1  
ATOM 4373   C CD   . ARG A 1 272 ? 19.813  14.436  -4.806  1.00 3.14  ? 272 ARG A CD   1  
ATOM 4374   N NE   . ARG A 1 272 ? 19.006  14.833  -5.957  1.00 12.44 ? 272 ARG A NE   1  
ATOM 4375   C CZ   . ARG A 1 272 ? 19.498  15.009  -7.182  1.00 21.24 ? 272 ARG A CZ   1  
ATOM 4376   N NH1  . ARG A 1 272 ? 20.791  14.823  -7.418  1.00 3.03  ? 272 ARG A NH1  1  
ATOM 4377   N NH2  . ARG A 1 272 ? 18.695  15.371  -8.173  1.00 14.21 ? 272 ARG A NH2  1  
ATOM 4378   H H    . ARG A 1 272 ? 16.848  15.045  -1.931  1.00 31.25 ? 272 ARG A H    1  
ATOM 4379   H HA   . ARG A 1 272 ? 17.677  12.409  -1.242  1.00 73.01 ? 272 ARG A HA   1  
ATOM 4380   H HB2  . ARG A 1 272 ? 19.115  12.544  -3.193  1.00 44.10 ? 272 ARG A HB2  1  
ATOM 4381   H HB3  . ARG A 1 272 ? 17.527  13.195  -3.575  1.00 52.34 ? 272 ARG A HB3  1  
ATOM 4382   H HG2  . ARG A 1 272 ? 18.306  15.388  -3.638  1.00 52.00 ? 272 ARG A HG2  1  
ATOM 4383   H HG3  . ARG A 1 272 ? 19.776  14.990  -2.747  1.00 55.21 ? 272 ARG A HG3  1  
ATOM 4384   H HD2  . ARG A 1 272 ? 20.718  15.025  -4.792  1.00 63.35 ? 272 ARG A HD2  1  
ATOM 4385   H HD3  . ARG A 1 272 ? 20.066  13.390  -4.899  1.00 31.20 ? 272 ARG A HD3  1  
ATOM 4386   H HE   . ARG A 1 272 ? 18.048  14.977  -5.811  1.00 23.13 ? 272 ARG A HE   1  
ATOM 4387   H HH11 . ARG A 1 272 ? 21.402  14.550  -6.675  1.00 24.40 ? 272 ARG A HH11 1  
ATOM 4388   H HH12 . ARG A 1 272 ? 21.154  14.957  -8.340  1.00 71.01 ? 272 ARG A HH12 1  
ATOM 4389   H HH21 . ARG A 1 272 ? 17.720  15.512  -8.001  1.00 25.03 ? 272 ARG A HH21 1  
ATOM 4390   H HH22 . ARG A 1 272 ? 19.065  15.503  -9.093  1.00 2.42  ? 272 ARG A HH22 1  
ATOM 4391   N N    . ASP A 1 273 ? 19.599  14.908  -0.414  1.00 72.02 ? 273 ASP A N    1  
ATOM 4392   C CA   . ASP A 1 273 ? 20.766  15.292  0.372   1.00 54.20 ? 273 ASP A CA   1  
ATOM 4393   C C    . ASP A 1 273 ? 20.630  14.810  1.812   1.00 41.42 ? 273 ASP A C    1  
ATOM 4394   O O    . ASP A 1 273 ? 21.453  14.035  2.299   1.00 0.42  ? 273 ASP A O    1  
ATOM 4395   C CB   . ASP A 1 273 ? 20.949  16.811  0.345   1.00 23.33 ? 273 ASP A CB   1  
ATOM 4396   C CG   . ASP A 1 273 ? 21.843  17.265  -0.792  1.00 12.14 ? 273 ASP A CG   1  
ATOM 4397   O OD1  . ASP A 1 273 ? 21.494  17.005  -1.963  1.00 61.12 ? 273 ASP A OD1  1  
ATOM 4398   O OD2  . ASP A 1 273 ? 22.893  17.881  -0.512  1.00 71.33 ? 273 ASP A OD2  1  
ATOM 4399   H H    . ASP A 1 273 ? 18.998  15.606  -0.748  1.00 62.12 ? 273 ASP A H    1  
ATOM 4400   H HA   . ASP A 1 273 ? 21.633  14.825  -0.071  1.00 52.34 ? 273 ASP A HA   1  
ATOM 4401   H HB2  . ASP A 1 273 ? 19.984  17.281  0.228   1.00 50.33 ? 273 ASP A HB2  1  
ATOM 4402   H HB3  . ASP A 1 273 ? 21.391  17.131  1.277   1.00 23.14 ? 273 ASP A HB3  1  
ATOM 4403   N N    . SER A 1 274 ? 19.583  15.273  2.489   1.00 55.35 ? 274 SER A N    1  
ATOM 4404   C CA   . SER A 1 274 ? 19.335  14.890  3.875   1.00 42.13 ? 274 SER A CA   1  
ATOM 4405   C C    . SER A 1 274 ? 19.271  13.372  4.018   1.00 43.04 ? 274 SER A C    1  
ATOM 4406   O O    . SER A 1 274 ? 19.617  12.822  5.064   1.00 34.00 ? 274 SER A O    1  
ATOM 4407   C CB   . SER A 1 274 ? 18.031  15.516  4.372   1.00 51.14 ? 274 SER A CB   1  
ATOM 4408   O OG   . SER A 1 274 ? 18.217  16.880  4.709   1.00 52.22 ? 274 SER A OG   1  
ATOM 4409   H H    . SER A 1 274 ? 18.963  15.889  2.045   1.00 1.54  ? 274 SER A H    1  
ATOM 4410   H HA   . SER A 1 274 ? 20.154  15.261  4.472   1.00 61.24 ? 274 SER A HA   1  
ATOM 4411   H HB2  . SER A 1 274 ? 17.283  15.449  3.597   1.00 31.11 ? 274 SER A HB2  1  
ATOM 4412   H HB3  . SER A 1 274 ? 17.691  14.985  5.249   1.00 14.34 ? 274 SER A HB3  1  
ATOM 4413   H HG   . SER A 1 274 ? 18.135  17.419  3.919   1.00 52.33 ? 274 SER A HG   1  
ATOM 4414   N N    . LYS A 1 275 ? 18.827  12.700  2.960   1.00 53.42 ? 275 LYS A N    1  
ATOM 4415   C CA   . LYS A 1 275 ? 18.720  11.246  2.969   1.00 13.05 ? 275 LYS A CA   1  
ATOM 4416   C C    . LYS A 1 275 ? 20.090  10.603  3.164   1.00 71.31 ? 275 LYS A C    1  
ATOM 4417   O O    . LYS A 1 275 ? 20.300  9.840   4.107   1.00 51.21 ? 275 LYS A O    1  
ATOM 4418   C CB   . LYS A 1 275 ? 18.090  10.753  1.663   1.00 4.30  ? 275 LYS A CB   1  
ATOM 4419   C CG   . LYS A 1 275 ? 16.666  10.243  1.830   1.00 74.52 ? 275 LYS A CG   1  
ATOM 4420   C CD   . LYS A 1 275 ? 15.686  11.024  0.968   1.00 41.04 ? 275 LYS A CD   1  
ATOM 4421   C CE   . LYS A 1 275 ? 14.572  10.132  0.444   1.00 73.41 ? 275 LYS A CE   1  
ATOM 4422   N NZ   . LYS A 1 275 ? 14.835  9.675   -0.949  1.00 43.14 ? 275 LYS A NZ   1  
ATOM 4423   H H    . LYS A 1 275 ? 18.567  13.194  2.155   1.00 1.21  ? 275 LYS A H    1  
ATOM 4424   H HA   . LYS A 1 275 ? 18.083  10.966  3.794   1.00 44.01 ? 275 LYS A HA   1  
ATOM 4425   H HB2  . LYS A 1 275 ? 18.078  11.567  0.953   1.00 64.25 ? 275 LYS A HB2  1  
ATOM 4426   H HB3  . LYS A 1 275 ? 18.692  9.949   1.265   1.00 63.44 ? 275 LYS A HB3  1  
ATOM 4427   H HG2  . LYS A 1 275 ? 16.631  9.203   1.543   1.00 22.03 ? 275 LYS A HG2  1  
ATOM 4428   H HG3  . LYS A 1 275 ? 16.379  10.342  2.866   1.00 2.12  ? 275 LYS A HG3  1  
ATOM 4429   H HD2  . LYS A 1 275 ? 15.252  11.815  1.561   1.00 31.03 ? 275 LYS A HD2  1  
ATOM 4430   H HD3  . LYS A 1 275 ? 16.219  11.450  0.130   1.00 31.33 ? 275 LYS A HD3  1  
ATOM 4431   H HE2  . LYS A 1 275 ? 14.487  9.268   1.086   1.00 12.53 ? 275 LYS A HE2  1  
ATOM 4432   H HE3  . LYS A 1 275 ? 13.646  10.686  0.463   1.00 64.54 ? 275 LYS A HE3  1  
ATOM 4433   H HZ1  . LYS A 1 275 ? 15.478  10.338  -1.427  1.00 20.11 ? 275 LYS A HZ1  1  
ATOM 4434   H HZ2  . LYS A 1 275 ? 13.945  9.627   -1.483  1.00 61.32 ? 275 LYS A HZ2  1  
ATOM 4435   H HZ3  . LYS A 1 275 ? 15.272  8.731   -0.939  1.00 33.44 ? 275 LYS A HZ3  1  
ATOM 4436   N N    . ILE A 1 276 ? 21.018  10.918  2.266   1.00 42.02 ? 276 ILE A N    1  
ATOM 4437   C CA   . ILE A 1 276 ? 22.368  10.371  2.339   1.00 51.42 ? 276 ILE A CA   1  
ATOM 4438   C C    . ILE A 1 276 ? 23.088  10.855  3.594   1.00 52.21 ? 276 ILE A C    1  
ATOM 4439   O O    . ILE A 1 276 ? 23.828  10.102  4.226   1.00 24.33 ? 276 ILE A O    1  
ATOM 4440   C CB   . ILE A 1 276 ? 23.200  10.758  1.101   1.00 20.44 ? 276 ILE A CB   1  
ATOM 4441   C CG1  . ILE A 1 276 ? 22.435  10.423  -0.182  1.00 2.50  ? 276 ILE A CG1  1  
ATOM 4442   C CG2  . ILE A 1 276 ? 24.545  10.046  1.122   1.00 33.14 ? 276 ILE A CG2  1  
ATOM 4443   C CD1  . ILE A 1 276 ? 22.562  11.483  -1.255  1.00 3.05  ? 276 ILE A CD1  1  
ATOM 4444   H H    . ILE A 1 276 ? 20.789  11.532  1.537   1.00 4.54  ? 276 ILE A H    1  
ATOM 4445   H HA   . ILE A 1 276 ? 22.290  9.294   2.374   1.00 42.24 ? 276 ILE A HA   1  
ATOM 4446   H HB   . ILE A 1 276 ? 23.383  11.821  1.135   1.00 65.20 ? 276 ILE A HB   1  
ATOM 4447   H HG12 . ILE A 1 276 ? 22.812  9.496   -0.587  1.00 2.35  ? 276 ILE A HG12 1  
ATOM 4448   H HG13 . ILE A 1 276 ? 21.386  10.309  0.050   1.00 40.32 ? 276 ILE A HG13 1  
ATOM 4449   H HG21 . ILE A 1 276 ? 24.408  9.010   0.849   1.00 31.32 ? 276 ILE A HG21 1  
ATOM 4450   H HG22 . ILE A 1 276 ? 24.968  10.104  2.114   1.00 10.02 ? 276 ILE A HG22 1  
ATOM 4451   H HG23 . ILE A 1 276 ? 25.213  10.518  0.417   1.00 25.40 ? 276 ILE A HG23 1  
ATOM 4452   H HD11 . ILE A 1 276 ? 21.755  11.375  -1.965  1.00 53.11 ? 276 ILE A HD11 1  
ATOM 4453   H HD12 . ILE A 1 276 ? 23.508  11.369  -1.764  1.00 21.22 ? 276 ILE A HD12 1  
ATOM 4454   H HD13 . ILE A 1 276 ? 22.514  12.462  -0.801  1.00 21.11 ? 276 ILE A HD13 1  
ATOM 4455   N N    . ARG A 1 277 ? 22.866  12.117  3.948   1.00 22.13 ? 277 ARG A N    1  
ATOM 4456   C CA   . ARG A 1 277 ? 23.494  12.700  5.128   1.00 52.14 ? 277 ARG A CA   1  
ATOM 4457   C C    . ARG A 1 277 ? 23.002  12.017  6.399   1.00 61.02 ? 277 ARG A C    1  
ATOM 4458   O O    . ARG A 1 277 ? 23.783  11.737  7.309   1.00 54.34 ? 277 ARG A O    1  
ATOM 4459   C CB   . ARG A 1 277 ? 23.205  14.201  5.196   1.00 73.43 ? 277 ARG A CB   1  
ATOM 4460   C CG   . ARG A 1 277 ? 24.361  15.019  5.748   1.00 11.43 ? 277 ARG A CG   1  
ATOM 4461   C CD   . ARG A 1 277 ? 24.367  16.429  5.180   1.00 2.42  ? 277 ARG A CD   1  
ATOM 4462   N NE   . ARG A 1 277 ? 25.226  17.326  5.949   1.00 43.34 ? 277 ARG A NE   1  
ATOM 4463   C CZ   . ARG A 1 277 ? 25.150  18.654  5.894   1.00 72.42 ? 277 ARG A CZ   1  
ATOM 4464   N NH1  . ARG A 1 277 ? 24.255  19.242  5.109   1.00 52.53 ? 277 ARG A NH1  1  
ATOM 4465   N NH2  . ARG A 1 277 ? 25.969  19.396  6.626   1.00 33.10 ? 277 ARG A NH2  1  
ATOM 4466   H H    . ARG A 1 277 ? 22.266  12.668  3.404   1.00 52.34 ? 277 ARG A H    1  
ATOM 4467   H HA   . ARG A 1 277 ? 24.560  12.552  5.044   1.00 50.11 ? 277 ARG A HA   1  
ATOM 4468   H HB2  . ARG A 1 277 ? 22.981  14.559  4.202   1.00 42.13 ? 277 ARG A HB2  1  
ATOM 4469   H HB3  . ARG A 1 277 ? 22.345  14.362  5.829   1.00 52.15 ? 277 ARG A HB3  1  
ATOM 4470   H HG2  . ARG A 1 277 ? 24.270  15.075  6.822   1.00 11.43 ? 277 ARG A HG2  1  
ATOM 4471   H HG3  . ARG A 1 277 ? 25.290  14.532  5.488   1.00 64.42 ? 277 ARG A HG3  1  
ATOM 4472   H HD2  . ARG A 1 277 ? 24.723  16.391  4.161   1.00 52.23 ? 277 ARG A HD2  1  
ATOM 4473   H HD3  . ARG A 1 277 ? 23.357  16.813  5.194   1.00 20.50 ? 277 ARG A HD3  1  
ATOM 4474   H HE   . ARG A 1 277 ? 25.896  16.918  6.536   1.00 75.43 ? 277 ARG A HE   1  
ATOM 4475   H HH11 . ARG A 1 277 ? 23.634  18.688  4.554   1.00 51.42 ? 277 ARG A HH11 1  
ATOM 4476   H HH12 . ARG A 1 277 ? 24.202  20.240  5.072   1.00 0.04  ? 277 ARG A HH12 1  
ATOM 4477   H HH21 . ARG A 1 277 ? 26.645  18.958  7.219   1.00 61.22 ? 277 ARG A HH21 1  
ATOM 4478   H HH22 . ARG A 1 277 ? 25.912  20.393  6.585   1.00 63.43 ? 277 ARG A HH22 1  
ATOM 4479   N N    . TYR A 1 278 ? 21.701  11.752  6.455   1.00 21.34 ? 278 TYR A N    1  
ATOM 4480   C CA   . TYR A 1 278 ? 21.102  11.101  7.615   1.00 53.24 ? 278 TYR A CA   1  
ATOM 4481   C C    . TYR A 1 278 ? 21.413  9.606   7.626   1.00 21.33 ? 278 TYR A C    1  
ATOM 4482   O O    . TYR A 1 278 ? 21.374  8.964   8.676   1.00 14.13 ? 278 TYR A O    1  
ATOM 4483   C CB   . TYR A 1 278 ? 19.588  11.318  7.622   1.00 12.04 ? 278 TYR A CB   1  
ATOM 4484   C CG   . TYR A 1 278 ? 19.177  12.712  8.041   1.00 2.25  ? 278 TYR A CG   1  
ATOM 4485   C CD1  . TYR A 1 278 ? 19.769  13.332  9.134   1.00 3.31  ? 278 TYR A CD1  1  
ATOM 4486   C CD2  . TYR A 1 278 ? 18.197  13.406  7.344   1.00 10.42 ? 278 TYR A CD2  1  
ATOM 4487   C CE1  . TYR A 1 278 ? 19.395  14.605  9.521   1.00 63.32 ? 278 TYR A CE1  1  
ATOM 4488   C CE2  . TYR A 1 278 ? 17.818  14.680  7.724   1.00 41.24 ? 278 TYR A CE2  1  
ATOM 4489   C CZ   . TYR A 1 278 ? 18.420  15.275  8.812   1.00 72.42 ? 278 TYR A CZ   1  
ATOM 4490   O OH   . TYR A 1 278 ? 18.045  16.542  9.194   1.00 4.04  ? 278 TYR A OH   1  
ATOM 4491   H H    . TYR A 1 278 ? 21.130  12.000  5.699   1.00 11.54 ? 278 TYR A H    1  
ATOM 4492   H HA   . TYR A 1 278 ? 21.525  11.550  8.501   1.00 74.23 ? 278 TYR A HA   1  
ATOM 4493   H HB2  . TYR A 1 278 ? 19.202  11.144  6.629   1.00 4.14  ? 278 TYR A HB2  1  
ATOM 4494   H HB3  . TYR A 1 278 ? 19.135  10.617  8.307   1.00 30.03 ? 278 TYR A HB3  1  
ATOM 4495   H HD1  . TYR A 1 278 ? 20.533  12.806  9.687   1.00 70.13 ? 278 TYR A HD1  1  
ATOM 4496   H HD2  . TYR A 1 278 ? 17.727  12.938  6.492   1.00 32.41 ? 278 TYR A HD2  1  
ATOM 4497   H HE1  . TYR A 1 278 ? 19.867  15.071  10.373  1.00 4.32  ? 278 TYR A HE1  1  
ATOM 4498   H HE2  . TYR A 1 278 ? 17.054  15.204  7.169   1.00 52.01 ? 278 TYR A HE2  1  
ATOM 4499   H HH   . TYR A 1 278 ? 17.436  16.488  9.934   1.00 33.03 ? 278 TYR A HH   1  
ATOM 4500   N N    . ARG A 1 279 ? 21.721  9.057   6.455   1.00 32.32 ? 279 ARG A N    1  
ATOM 4501   C CA   . ARG A 1 279 ? 22.038  7.639   6.337   1.00 50.02 ? 279 ARG A CA   1  
ATOM 4502   C C    . ARG A 1 279 ? 23.349  7.315   7.046   1.00 14.31 ? 279 ARG A C    1  
ATOM 4503   O O    . ARG A 1 279 ? 23.409  6.408   7.876   1.00 61.51 ? 279 ARG A O    1  
ATOM 4504   C CB   . ARG A 1 279 ? 22.128  7.235   4.864   1.00 52.43 ? 279 ARG A CB   1  
ATOM 4505   C CG   . ARG A 1 279 ? 20.796  6.803   4.270   1.00 61.41 ? 279 ARG A CG   1  
ATOM 4506   C CD   . ARG A 1 279 ? 20.959  5.619   3.329   1.00 22.34 ? 279 ARG A CD   1  
ATOM 4507   N NE   . ARG A 1 279 ? 20.829  6.011   1.927   1.00 31.24 ? 279 ARG A NE   1  
ATOM 4508   C CZ   . ARG A 1 279 ? 21.815  6.548   1.211   1.00 73.14 ? 279 ARG A CZ   1  
ATOM 4509   N NH1  . ARG A 1 279 ? 23.005  6.759   1.760   1.00 71.42 ? 279 ARG A NH1  1  
ATOM 4510   N NH2  . ARG A 1 279 ? 21.610  6.874   -0.057  1.00 32.13 ? 279 ARG A NH2  1  
ATOM 4511   H H    . ARG A 1 279 ? 21.738  9.619   5.652   1.00 63.14 ? 279 ARG A H    1  
ATOM 4512   H HA   . ARG A 1 279 ? 21.241  7.081   6.806   1.00 22.04 ? 279 ARG A HA   1  
ATOM 4513   H HB2  . ARG A 1 279 ? 22.497  8.075   4.294   1.00 63.33 ? 279 ARG A HB2  1  
ATOM 4514   H HB3  . ARG A 1 279 ? 22.823  6.414   4.770   1.00 35.44 ? 279 ARG A HB3  1  
ATOM 4515   H HG2  . ARG A 1 279 ? 20.129  6.523   5.071   1.00 23.10 ? 279 ARG A HG2  1  
ATOM 4516   H HG3  . ARG A 1 279 ? 20.373  7.632   3.721   1.00 34.43 ? 279 ARG A HG3  1  
ATOM 4517   H HD2  . ARG A 1 279 ? 21.935  5.184   3.482   1.00 41.41 ? 279 ARG A HD2  1  
ATOM 4518   H HD3  . ARG A 1 279 ? 20.200  4.887   3.560   1.00 42.12 ? 279 ARG A HD3  1  
ATOM 4519   H HE   . ARG A 1 279 ? 19.961  5.867   1.497   1.00 70.02 ? 279 ARG A HE   1  
ATOM 4520   H HH11 . ARG A 1 279 ? 23.167  6.516   2.716   1.00 32.30 ? 279 ARG A HH11 1  
ATOM 4521   H HH12 . ARG A 1 279 ? 23.741  7.162   1.215   1.00 34.24 ? 279 ARG A HH12 1  
ATOM 4522   H HH21 . ARG A 1 279 ? 20.716  6.717   -0.476  1.00 72.23 ? 279 ARG A HH21 1  
ATOM 4523   H HH22 . ARG A 1 279 ? 22.350  7.277   -0.596  1.00 43.40 ? 279 ARG A HH22 1  
ATOM 4524   N N    . GLU A 1 280 ? 24.396  8.063   6.714   1.00 13.13 ? 280 GLU A N    1  
ATOM 4525   C CA   . GLU A 1 280 ? 25.706  7.856   7.321   1.00 60.24 ? 280 GLU A CA   1  
ATOM 4526   C C    . GLU A 1 280 ? 25.642  8.061   8.831   1.00 62.21 ? 280 GLU A C    1  
ATOM 4527   O O    . GLU A 1 280 ? 26.174  7.260   9.599   1.00 54.42 ? 280 GLU A O    1  
ATOM 4528   C CB   . GLU A 1 280 ? 26.732  8.809   6.707   1.00 12.32 ? 280 GLU A CB   1  
ATOM 4529   C CG   . GLU A 1 280 ? 26.351  10.275  6.832   1.00 11.14 ? 280 GLU A CG   1  
ATOM 4530   C CD   . GLU A 1 280 ? 27.311  11.192  6.099   1.00 11.25 ? 280 GLU A CD   1  
ATOM 4531   O OE1  . GLU A 1 280 ? 28.462  11.338  6.561   1.00 64.14 ? 280 GLU A OE1  1  
ATOM 4532   O OE2  . GLU A 1 280 ? 26.911  11.763  5.063   1.00 64.34 ? 280 GLU A OE2  1  
ATOM 4533   H H    . GLU A 1 280 ? 24.285  8.772   6.047   1.00 62.32 ? 280 GLU A H    1  
ATOM 4534   H HA   . GLU A 1 280 ? 26.007  6.839   7.120   1.00 35.31 ? 280 GLU A HA   1  
ATOM 4535   H HB2  . GLU A 1 280 ? 27.682  8.663   7.200   1.00 23.40 ? 280 GLU A HB2  1  
ATOM 4536   H HB3  . GLU A 1 280 ? 26.841  8.576   5.658   1.00 23.44 ? 280 GLU A HB3  1  
ATOM 4537   H HG2  . GLU A 1 280 ? 25.362  10.413  6.421   1.00 62.41 ? 280 GLU A HG2  1  
ATOM 4538   H HG3  . GLU A 1 280 ? 26.346  10.545  7.878   1.00 35.32 ? 280 GLU A HG3  1  
ATOM 4539   N N    . ASN A 1 281 ? 24.988  9.140   9.248   1.00 31.30 ? 281 ASN A N    1  
ATOM 4540   C CA   . ASN A 1 281 ? 24.853  9.452   10.666  1.00 72.52 ? 281 ASN A CA   1  
ATOM 4541   C C    . ASN A 1 281 ? 23.395  9.361   11.105  1.00 33.44 ? 281 ASN A C    1  
ATOM 4542   O O    . ASN A 1 281 ? 22.719  10.377  11.264  1.00 72.24 ? 281 ASN A O    1  
ATOM 4543   C CB   . ASN A 1 281 ? 25.400  10.851  10.956  1.00 40.05 ? 281 ASN A CB   1  
ATOM 4544   C CG   . ASN A 1 281 ? 25.975  10.970  12.354  1.00 3.02  ? 281 ASN A CG   1  
ATOM 4545   O OD1  . ASN A 1 281 ? 26.490  10.000  12.910  1.00 22.34 ? 281 ASN A OD1  1  
ATOM 4546   N ND2  . ASN A 1 281 ? 25.889  12.163  12.930  1.00 70.43 ? 281 ASN A ND2  1  
ATOM 4547   H H    . ASN A 1 281 ? 24.586  9.741   8.587   1.00 33.23 ? 281 ASN A H    1  
ATOM 4548   H HA   . ASN A 1 281 ? 25.430  8.727   11.222  1.00 13.42 ? 281 ASN A HA   1  
ATOM 4549   H HB2  . ASN A 1 281 ? 26.181  11.080  10.246  1.00 45.31 ? 281 ASN A HB2  1  
ATOM 4550   H HB3  . ASN A 1 281 ? 24.602  11.571  10.852  1.00 11.53 ? 281 ASN A HB3  1  
ATOM 4551   H HD21 . ASN A 1 281 ? 25.465  12.890  12.427  1.00 43.14 ? 281 ASN A HD21 1  
ATOM 4552   H HD22 . ASN A 1 281 ? 26.252  12.268  13.834  1.00 2.43  ? 281 ASN A HD22 1  
ATOM 4553   N N    . ILE A 1 282 ? 22.917  8.136   11.299  1.00 21.43 ? 282 ILE A N    1  
ATOM 4554   C CA   . ILE A 1 282 ? 21.539  7.911   11.719  1.00 4.22  ? 282 ILE A CA   1  
ATOM 4555   C C    . ILE A 1 282 ? 21.298  8.450   13.125  1.00 3.43  ? 282 ILE A C    1  
ATOM 4556   O O    . ILE A 1 282 ? 20.209  8.934   13.437  1.00 73.12 ? 282 ILE A O    1  
ATOM 4557   C CB   . ILE A 1 282 ? 21.177  6.414   11.686  1.00 64.23 ? 282 ILE A CB   1  
ATOM 4558   C CG1  . ILE A 1 282 ? 21.573  5.801   10.341  1.00 34.35 ? 282 ILE A CG1  1  
ATOM 4559   C CG2  . ILE A 1 282 ? 19.690  6.222   11.944  1.00 73.24 ? 282 ILE A CG2  1  
ATOM 4560   C CD1  . ILE A 1 282 ? 22.901  5.076   10.375  1.00 32.23 ? 282 ILE A CD1  1  
ATOM 4561   H H    . ILE A 1 282 ? 23.504  7.365   11.156  1.00 41.42 ? 282 ILE A H    1  
ATOM 4562   H HA   . ILE A 1 282 ? 20.891  8.432   11.029  1.00 53.22 ? 282 ILE A HA   1  
ATOM 4563   H HB   . ILE A 1 282 ? 21.721  5.917   12.475  1.00 24.41 ? 282 ILE A HB   1  
ATOM 4564   H HG12 . ILE A 1 282 ? 20.817  5.091   10.039  1.00 34.43 ? 282 ILE A HG12 1  
ATOM 4565   H HG13 . ILE A 1 282 ? 21.641  6.585   9.601   1.00 35.20 ? 282 ILE A HG13 1  
ATOM 4566   H HG21 . ILE A 1 282 ? 19.528  5.270   12.428  1.00 20.44 ? 282 ILE A HG21 1  
ATOM 4567   H HG22 . ILE A 1 282 ? 19.155  6.244   11.006  1.00 35.21 ? 282 ILE A HG22 1  
ATOM 4568   H HG23 . ILE A 1 282 ? 19.330  7.015   12.583  1.00 42.20 ? 282 ILE A HG23 1  
ATOM 4569   H HD11 . ILE A 1 282 ? 23.124  4.780   11.390  1.00 61.05 ? 282 ILE A HD11 1  
ATOM 4570   H HD12 . ILE A 1 282 ? 23.678  5.732   10.012  1.00 21.43 ? 282 ILE A HD12 1  
ATOM 4571   H HD13 . ILE A 1 282 ? 22.849  4.199   9.748   1.00 71.33 ? 282 ILE A HD13 1  
ATOM 4572   N N    . ALA A 1 283 ? 22.319  8.362   13.972  1.00 0.41  ? 283 ALA A N    1  
ATOM 4573   C CA   . ALA A 1 283 ? 22.219  8.838   15.347  1.00 54.21 ? 283 ALA A CA   1  
ATOM 4574   C C    . ALA A 1 283 ? 21.895  10.329  15.407  1.00 35.31 ? 283 ALA A C    1  
ATOM 4575   O O    . ALA A 1 283 ? 21.479  10.837  16.448  1.00 50.33 ? 283 ALA A O    1  
ATOM 4576   C CB   . ALA A 1 283 ? 23.510  8.549   16.097  1.00 25.02 ? 283 ALA A CB   1  
ATOM 4577   H H    . ALA A 1 283 ? 23.162  7.964   13.670  1.00 30.31 ? 283 ALA A H    1  
ATOM 4578   H HA   . ALA A 1 283 ? 21.423  8.290   15.829  1.00 31.42 ? 283 ALA A HA   1  
ATOM 4579   H HB1  . ALA A 1 283 ? 23.445  7.578   16.565  1.00 32.41 ? 283 ALA A HB1  1  
ATOM 4580   H HB2  . ALA A 1 283 ? 23.664  9.304   16.854  1.00 20.52 ? 283 ALA A HB2  1  
ATOM 4581   H HB3  . ALA A 1 283 ? 24.339  8.560   15.404  1.00 65.45 ? 283 ALA A HB3  1  
ATOM 4582   N N    . SER A 1 284 ? 22.081  11.029  14.290  1.00 52.42 ? 284 SER A N    1  
ATOM 4583   C CA   . SER A 1 284 ? 21.798  12.458  14.234  1.00 53.25 ? 284 SER A CA   1  
ATOM 4584   C C    . SER A 1 284 ? 20.304  12.703  14.051  1.00 41.13 ? 284 SER A C    1  
ATOM 4585   O O    . SER A 1 284 ? 19.758  13.684  14.557  1.00 34.14 ? 284 SER A O    1  
ATOM 4586   C CB   . SER A 1 284 ? 22.578  13.110  13.091  1.00 52.34 ? 284 SER A CB   1  
ATOM 4587   O OG   . SER A 1 284 ? 23.823  13.613  13.544  1.00 61.14 ? 284 SER A OG   1  
ATOM 4588   H H    . SER A 1 284 ? 22.407  10.579  13.485  1.00 33.20 ? 284 SER A H    1  
ATOM 4589   H HA   . SER A 1 284 ? 22.112  12.896  15.170  1.00 44.30 ? 284 SER A HA   1  
ATOM 4590   H HB2  . SER A 1 284 ? 22.760  12.379  12.318  1.00 65.41 ? 284 SER A HB2  1  
ATOM 4591   H HB3  . SER A 1 284 ? 22.001  13.928  12.684  1.00 3.24  ? 284 SER A HB3  1  
ATOM 4592   H HG   . SER A 1 284 ? 23.864  14.559  13.386  1.00 65.43 ? 284 SER A HG   1  
ATOM 4593   N N    . LEU A 1 285 ? 19.648  11.802  13.327  1.00 54.42 ? 285 LEU A N    1  
ATOM 4594   C CA   . LEU A 1 285 ? 18.216  11.915  13.079  1.00 51.55 ? 285 LEU A CA   1  
ATOM 4595   C C    . LEU A 1 285 ? 17.428  11.740  14.373  1.00 75.41 ? 285 LEU A C    1  
ATOM 4596   O O    . LEU A 1 285 ? 16.543  12.537  14.686  1.00 31.20 ? 285 LEU A O    1  
ATOM 4597   C CB   . LEU A 1 285 ? 17.771  10.871  12.053  1.00 33.51 ? 285 LEU A CB   1  
ATOM 4598   C CG   . LEU A 1 285 ? 16.548  11.261  11.220  1.00 32.25 ? 285 LEU A CG   1  
ATOM 4599   C CD1  . LEU A 1 285 ? 16.976  11.973  9.947   1.00 63.44 ? 285 LEU A CD1  1  
ATOM 4600   C CD2  . LEU A 1 285 ? 15.714  10.031  10.890  1.00 75.14 ? 285 LEU A CD2  1  
ATOM 4601   H H    . LEU A 1 285 ? 20.139  11.041  12.953  1.00 44.44 ? 285 LEU A H    1  
ATOM 4602   H HA   . LEU A 1 285 ? 18.024  12.901  12.684  1.00 4.43  ? 285 LEU A HA   1  
ATOM 4603   H HB2  . LEU A 1 285 ? 18.595  10.685  11.380  1.00 14.25 ? 285 LEU A HB2  1  
ATOM 4604   H HB3  . LEU A 1 285 ? 17.543  9.955   12.578  1.00 21.42 ? 285 LEU A HB3  1  
ATOM 4605   H HG   . LEU A 1 285 ? 15.933  11.940  11.792  1.00 12.32 ? 285 LEU A HG   1  
ATOM 4606   H HD11 . LEU A 1 285 ? 17.581  11.308  9.348   1.00 52.24 ? 285 LEU A HD11 1  
ATOM 4607   H HD12 . LEU A 1 285 ? 17.550  12.852  10.201  1.00 70.44 ? 285 LEU A HD12 1  
ATOM 4608   H HD13 . LEU A 1 285 ? 16.100  12.266  9.386   1.00 63.01 ? 285 LEU A HD13 1  
ATOM 4609   H HD21 . LEU A 1 285 ? 15.970  9.677   9.902   1.00 20.24 ? 285 LEU A HD21 1  
ATOM 4610   H HD22 . LEU A 1 285 ? 14.666  10.289  10.920  1.00 61.32 ? 285 LEU A HD22 1  
ATOM 4611   H HD23 . LEU A 1 285 ? 15.915  9.255   11.614  1.00 51.11 ? 285 LEU A HD23 1  
ATOM 4612   N N    . MET A 1 286 ? 17.758  10.693  15.122  1.00 53.11 ? 286 MET A N    1  
ATOM 4613   C CA   . MET A 1 286 ? 17.083  10.414  16.384  1.00 32.13 ? 286 MET A CA   1  
ATOM 4614   C C    . MET A 1 286 ? 17.394  11.491  17.419  1.00 61.13 ? 286 MET A C    1  
ATOM 4615   O O    . MET A 1 286 ? 16.580  11.775  18.298  1.00 55.02 ? 286 MET A O    1  
ATOM 4616   C CB   . MET A 1 286 ? 17.500  9.042   16.918  1.00 71.30 ? 286 MET A CB   1  
ATOM 4617   C CG   . MET A 1 286 ? 16.767  7.884   16.261  1.00 75.35 ? 286 MET A CG   1  
ATOM 4618   S SD   . MET A 1 286 ? 15.127  7.614   16.959  1.00 65.13 ? 286 MET A SD   1  
ATOM 4619   C CE   . MET A 1 286 ? 14.089  8.135   15.596  1.00 3.03  ? 286 MET A CE   1  
ATOM 4620   H H    . MET A 1 286 ? 18.473  10.094  14.820  1.00 44.35 ? 286 MET A H    1  
ATOM 4621   H HA   . MET A 1 286 ? 16.019  10.408  16.197  1.00 21.32 ? 286 MET A HA   1  
ATOM 4622   H HB2  . MET A 1 286 ? 18.559  8.911   16.751  1.00 0.42  ? 286 MET A HB2  1  
ATOM 4623   H HB3  . MET A 1 286 ? 17.305  9.007   17.980  1.00 1.14  ? 286 MET A HB3  1  
ATOM 4624   H HG2  . MET A 1 286 ? 16.663  8.094   15.206  1.00 54.31 ? 286 MET A HG2  1  
ATOM 4625   H HG3  . MET A 1 286 ? 17.352  6.985   16.391  1.00 74.24 ? 286 MET A HG3  1  
ATOM 4626   H HE1  . MET A 1 286 ? 14.520  7.795   14.666  1.00 51.03 ? 286 MET A HE1  1  
ATOM 4627   H HE2  . MET A 1 286 ? 14.019  9.213   15.588  1.00 2.22  ? 286 MET A HE2  1  
ATOM 4628   H HE3  . MET A 1 286 ? 13.103  7.711   15.713  1.00 53.32 ? 286 MET A HE3  1  
ATOM 4629   N N    . ASP A 1 287 ? 18.577  12.087  17.308  1.00 55.15 ? 287 ASP A N    1  
ATOM 4630   C CA   . ASP A 1 287 ? 18.995  13.133  18.235  1.00 1.33  ? 287 ASP A CA   1  
ATOM 4631   C C    . ASP A 1 287 ? 18.233  14.428  17.974  1.00 31.41 ? 287 ASP A C    1  
ATOM 4632   O O    . ASP A 1 287 ? 17.774  15.088  18.906  1.00 34.04 ? 287 ASP A O    1  
ATOM 4633   C CB   . ASP A 1 287 ? 20.500  13.380  18.113  1.00 0.10  ? 287 ASP A CB   1  
ATOM 4634   C CG   . ASP A 1 287 ? 21.083  14.023  19.355  1.00 55.14 ? 287 ASP A CG   1  
ATOM 4635   O OD1  . ASP A 1 287 ? 21.472  13.281  20.281  1.00 43.12 ? 287 ASP A OD1  1  
ATOM 4636   O OD2  . ASP A 1 287 ? 21.150  15.270  19.403  1.00 51.52 ? 287 ASP A OD2  1  
ATOM 4637   H H    . ASP A 1 287 ? 19.183  11.818  16.587  1.00 5.42  ? 287 ASP A H    1  
ATOM 4638   H HA   . ASP A 1 287 ? 18.775  12.796  19.236  1.00 54.11 ? 287 ASP A HA   1  
ATOM 4639   H HB2  . ASP A 1 287 ? 21.001  12.438  17.949  1.00 34.00 ? 287 ASP A HB2  1  
ATOM 4640   H HB3  . ASP A 1 287 ? 20.684  14.032  17.271  1.00 24.31 ? 287 ASP A HB3  1  
ATOM 4641   N N    . LYS A 1 288 ? 18.102  14.787  16.701  1.00 51.42 ? 288 LYS A N    1  
ATOM 4642   C CA   . LYS A 1 288 ? 17.395  16.004  16.319  1.00 13.21 ? 288 LYS A CA   1  
ATOM 4643   C C    . LYS A 1 288 ? 15.888  15.832  16.487  1.00 34.31 ? 288 LYS A C    1  
ATOM 4644   O O    . LYS A 1 288 ? 15.211  16.703  17.032  1.00 5.32  ? 288 LYS A O    1  
ATOM 4645   C CB   . LYS A 1 288 ? 17.723  16.375  14.871  1.00 75.14 ? 288 LYS A CB   1  
ATOM 4646   C CG   . LYS A 1 288 ? 18.654  17.570  14.746  1.00 75.13 ? 288 LYS A CG   1  
ATOM 4647   C CD   . LYS A 1 288 ? 20.108  17.137  14.652  1.00 35.20 ? 288 LYS A CD   1  
ATOM 4648   C CE   . LYS A 1 288 ? 21.035  18.330  14.485  1.00 62.32 ? 288 LYS A CE   1  
ATOM 4649   N NZ   . LYS A 1 288 ? 22.434  17.911  14.195  1.00 42.55 ? 288 LYS A NZ   1  
ATOM 4650   H H    . LYS A 1 288 ? 18.490  14.220  16.002  1.00 54.43 ? 288 LYS A H    1  
ATOM 4651   H HA   . LYS A 1 288 ? 17.729  16.798  16.969  1.00 23.22 ? 288 LYS A HA   1  
ATOM 4652   H HB2  . LYS A 1 288 ? 18.194  15.529  14.392  1.00 73.22 ? 288 LYS A HB2  1  
ATOM 4653   H HB3  . LYS A 1 288 ? 16.805  16.606  14.351  1.00 22.04 ? 288 LYS A HB3  1  
ATOM 4654   H HG2  . LYS A 1 288 ? 18.396  18.125  13.856  1.00 24.31 ? 288 LYS A HG2  1  
ATOM 4655   H HG3  . LYS A 1 288 ? 18.531  18.202  15.614  1.00 70.15 ? 288 LYS A HG3  1  
ATOM 4656   H HD2  . LYS A 1 288 ? 20.376  16.610  15.555  1.00 63.02 ? 288 LYS A HD2  1  
ATOM 4657   H HD3  . LYS A 1 288 ? 20.223  16.481  13.802  1.00 32.13 ? 288 LYS A HD3  1  
ATOM 4658   H HE2  . LYS A 1 288 ? 20.674  18.939  13.669  1.00 44.13 ? 288 LYS A HE2  1  
ATOM 4659   H HE3  . LYS A 1 288 ? 21.023  18.909  15.397  1.00 30.41 ? 288 LYS A HE3  1  
ATOM 4660   H HZ1  . LYS A 1 288 ? 22.909  17.620  15.073  1.00 0.34  ? 288 LYS A HZ1  1  
ATOM 4661   H HZ2  . LYS A 1 288 ? 22.963  18.700  13.772  1.00 23.25 ? 288 LYS A HZ2  1  
ATOM 4662   H HZ3  . LYS A 1 288 ? 22.436  17.111  13.530  1.00 21.01 ? 288 LYS A HZ3  1  
ATOM 4663   N N    . CYS A 1 289 ? 15.370  14.703  16.015  1.00 22.01 ? 289 CYS A N    1  
ATOM 4664   C CA   . CYS A 1 289 ? 13.944  14.417  16.114  1.00 34.43 ? 289 CYS A CA   1  
ATOM 4665   C C    . CYS A 1 289 ? 13.540  14.156  17.562  1.00 33.11 ? 289 CYS A C    1  
ATOM 4666   O O    . CYS A 1 289 ? 12.633  14.800  18.089  1.00 23.52 ? 289 CYS A O    1  
ATOM 4667   C CB   . CYS A 1 289 ? 13.583  13.210  15.245  1.00 45.20 ? 289 CYS A CB   1  
ATOM 4668   S SG   . CYS A 1 289 ? 12.017  13.382  14.358  1.00 65.51 ? 289 CYS A SG   1  
ATOM 4669   H H    . CYS A 1 289 ? 15.961  14.046  15.591  1.00 53.34 ? 289 CYS A H    1  
ATOM 4670   H HA   . CYS A 1 289 ? 13.407  15.282  15.754  1.00 53.24 ? 289 CYS A HA   1  
ATOM 4671   H HB2  . CYS A 1 289 ? 14.360  13.060  14.511  1.00 75.24 ? 289 CYS A HB2  1  
ATOM 4672   H HB3  . CYS A 1 289 ? 13.512  12.333  15.871  1.00 62.02 ? 289 CYS A HB3  1  
ATOM 4673   H HG   . CYS A 1 289 ? 12.130  13.004  13.482  1.00 35.50 ? 289 CYS A HG   1  
ATOM 4674   N N    . PHE A 1 290 ? 14.220  13.208  18.199  1.00 41.32 ? 290 PHE A N    1  
ATOM 4675   C CA   . PHE A 1 290 ? 13.932  12.863  19.586  1.00 31.10 ? 290 PHE A CA   1  
ATOM 4676   C C    . PHE A 1 290 ? 14.903  13.566  20.534  1.00 74.45 ? 290 PHE A C    1  
ATOM 4677   O O    . PHE A 1 290 ? 16.050  13.830  20.176  1.00 5.14  ? 290 PHE A O    1  
ATOM 4678   C CB   . PHE A 1 290 ? 14.012  11.348  19.784  1.00 61.23 ? 290 PHE A CB   1  
ATOM 4679   C CG   . PHE A 1 290 ? 12.674  10.666  19.746  1.00 51.30 ? 290 PHE A CG   1  
ATOM 4680   C CD1  . PHE A 1 290 ? 12.080  10.343  18.537  1.00 24.12 ? 290 PHE A CD1  1  
ATOM 4681   C CD2  . PHE A 1 290 ? 12.010  10.350  20.921  1.00 35.45 ? 290 PHE A CD2  1  
ATOM 4682   C CE1  . PHE A 1 290 ? 10.849  9.716   18.500  1.00 71.33 ? 290 PHE A CE1  1  
ATOM 4683   C CE2  . PHE A 1 290 ? 10.779  9.723   20.890  1.00 4.01  ? 290 PHE A CE2  1  
ATOM 4684   C CZ   . PHE A 1 290 ? 10.198  9.406   19.677  1.00 54.21 ? 290 PHE A CZ   1  
ATOM 4685   H H    . PHE A 1 290 ? 14.932  12.730  17.725  1.00 74.34 ? 290 PHE A H    1  
ATOM 4686   H HA   . PHE A 1 290 ? 12.929  13.194  19.809  1.00 25.22 ? 290 PHE A HA   1  
ATOM 4687   H HB2  . PHE A 1 290 ? 14.623  10.921  19.002  1.00 42.35 ? 290 PHE A HB2  1  
ATOM 4688   H HB3  . PHE A 1 290 ? 14.466  11.139  20.742  1.00 74.41 ? 290 PHE A HB3  1  
ATOM 4689   H HD1  . PHE A 1 290 ? 12.589  10.584  17.615  1.00 51.11 ? 290 PHE A HD1  1  
ATOM 4690   H HD2  . PHE A 1 290 ? 12.464  10.598  21.869  1.00 35.24 ? 290 PHE A HD2  1  
ATOM 4691   H HE1  . PHE A 1 290 ? 10.397  9.469   17.550  1.00 21.41 ? 290 PHE A HE1  1  
ATOM 4692   H HE2  . PHE A 1 290 ? 10.272  9.481   21.812  1.00 43.02 ? 290 PHE A HE2  1  
ATOM 4693   H HZ   . PHE A 1 290 ? 9.235   8.916   19.651  1.00 11.04 ? 290 PHE A HZ   1  
ATOM 4694   N N    . PRO A 1 291 ? 14.452  13.878  21.761  1.00 41.13 ? 291 PRO A N    1  
ATOM 4695   C CA   . PRO A 1 291 ? 15.286  14.554  22.760  1.00 74.43 ? 291 PRO A CA   1  
ATOM 4696   C C    . PRO A 1 291 ? 16.408  13.660  23.279  1.00 31.32 ? 291 PRO A C    1  
ATOM 4697   O O    . PRO A 1 291 ? 16.385  12.444  23.091  1.00 41.50 ? 291 PRO A O    1  
ATOM 4698   C CB   . PRO A 1 291 ? 14.301  14.881  23.885  1.00 60.43 ? 291 PRO A CB   1  
ATOM 4699   C CG   . PRO A 1 291 ? 13.214  13.874  23.743  1.00 45.24 ? 291 PRO A CG   1  
ATOM 4700   C CD   . PRO A 1 291 ? 13.096  13.599  22.269  1.00 63.11 ? 291 PRO A CD   1  
ATOM 4701   H HA   . PRO A 1 291 ? 15.708  15.468  22.370  1.00 64.53 ? 291 PRO A HA   1  
ATOM 4702   H HB2  . PRO A 1 291 ? 14.799  14.795  24.840  1.00 20.03 ? 291 PRO A HB2  1  
ATOM 4703   H HB3  . PRO A 1 291 ? 13.927  15.886  23.758  1.00 35.45 ? 291 PRO A HB3  1  
ATOM 4704   H HG2  . PRO A 1 291 ? 13.478  12.971  24.273  1.00 51.50 ? 291 PRO A HG2  1  
ATOM 4705   H HG3  . PRO A 1 291 ? 12.287  14.277  24.124  1.00 64.54 ? 291 PRO A HG3  1  
ATOM 4706   H HD2  . PRO A 1 291 ? 12.825  12.567  22.099  1.00 24.32 ? 291 PRO A HD2  1  
ATOM 4707   H HD3  . PRO A 1 291 ? 12.372  14.260  21.818  1.00 2.23  ? 291 PRO A HD3  1  
ATOM 4708   N N    . GLU A 1 292 ? 17.390  14.273  23.933  1.00 41.52 ? 292 GLU A N    1  
ATOM 4709   C CA   . GLU A 1 292 ? 18.523  13.535  24.480  1.00 75.12 ? 292 GLU A CA   1  
ATOM 4710   C C    . GLU A 1 292 ? 18.096  12.674  25.667  1.00 54.11 ? 292 GLU A C    1  
ATOM 4711   O O    . GLU A 1 292 ? 18.766  11.701  26.011  1.00 52.31 ? 292 GLU A O    1  
ATOM 4712   C CB   . GLU A 1 292 ? 19.627  14.502  24.911  1.00 73.10 ? 292 GLU A CB   1  
ATOM 4713   C CG   . GLU A 1 292 ? 20.455  15.035  23.753  1.00 64.24 ? 292 GLU A CG   1  
ATOM 4714   C CD   . GLU A 1 292 ? 21.736  15.703  24.211  1.00 13.40 ? 292 GLU A CD   1  
ATOM 4715   O OE1  . GLU A 1 292 ? 22.458  15.101  25.034  1.00 2.35  ? 292 GLU A OE1  1  
ATOM 4716   O OE2  . GLU A 1 292 ? 22.017  16.828  23.748  1.00 40.32 ? 292 GLU A OE2  1  
ATOM 4717   H H    . GLU A 1 292 ? 17.352  15.245  24.051  1.00 24.04 ? 292 GLU A H    1  
ATOM 4718   H HA   . GLU A 1 292 ? 18.905  12.891  23.703  1.00 14.34 ? 292 GLU A HA   1  
ATOM 4719   H HB2  . GLU A 1 292 ? 19.176  15.342  25.419  1.00 4.50  ? 292 GLU A HB2  1  
ATOM 4720   H HB3  . GLU A 1 292 ? 20.290  13.992  25.594  1.00 0.13  ? 292 GLU A HB3  1  
ATOM 4721   H HG2  . GLU A 1 292 ? 20.710  14.213  23.101  1.00 73.21 ? 292 GLU A HG2  1  
ATOM 4722   H HG3  . GLU A 1 292 ? 19.864  15.756  23.207  1.00 33.21 ? 292 GLU A HG3  1  
ATOM 4723   N N    . LYS A 1 293 ? 16.977  13.037  26.288  1.00 44.23 ? 293 LYS A N    1  
ATOM 4724   C CA   . LYS A 1 293 ? 16.464  12.296  27.436  1.00 62.14 ? 293 LYS A CA   1  
ATOM 4725   C C    . LYS A 1 293 ? 15.448  11.240  27.005  1.00 54.33 ? 293 LYS A C    1  
ATOM 4726   O O    . LYS A 1 293 ? 14.632  10.790  27.809  1.00 63.24 ? 293 LYS A O    1  
ATOM 4727   C CB   . LYS A 1 293 ? 15.823  13.255  28.441  1.00 42.43 ? 293 LYS A CB   1  
ATOM 4728   C CG   . LYS A 1 293 ? 16.035  12.849  29.890  1.00 12.21 ? 293 LYS A CG   1  
ATOM 4729   C CD   . LYS A 1 293 ? 16.116  14.063  30.802  1.00 3.55  ? 293 LYS A CD   1  
ATOM 4730   C CE   . LYS A 1 293 ? 15.824  13.694  32.248  1.00 53.45 ? 293 LYS A CE   1  
ATOM 4731   N NZ   . LYS A 1 293 ? 14.418  14.003  32.627  1.00 24.14 ? 293 LYS A NZ   1  
ATOM 4732   H H    . LYS A 1 293 ? 16.485  13.822  25.970  1.00 1.10  ? 293 LYS A H    1  
ATOM 4733   H HA   . LYS A 1 293 ? 17.299  11.801  27.909  1.00 37.47 ? 293 LYS A HA   1  
ATOM 4734   H HB2  . LYS A 1 293 ? 16.244  14.240  28.300  1.00 24.44 ? 293 LYS A HB2  1  
ATOM 4735   H HB3  . LYS A 1 293 ? 14.760  13.297  28.253  1.00 0.43  ? 293 LYS A HB3  1  
ATOM 4736   H HG2  . LYS A 1 293 ? 15.208  12.230  30.205  1.00 0.30  ? 293 LYS A HG2  1  
ATOM 4737   H HG3  . LYS A 1 293 ? 16.956  12.290  29.966  1.00 4.22  ? 293 LYS A HG3  1  
ATOM 4738   H HD2  . LYS A 1 293 ? 17.109  14.481  30.741  1.00 43.42 ? 293 LYS A HD2  1  
ATOM 4739   H HD3  . LYS A 1 293 ? 15.394  14.796  30.474  1.00 11.02 ? 293 LYS A HD3  1  
ATOM 4740   H HE2  . LYS A 1 293 ? 15.998  12.636  32.378  1.00 63.34 ? 293 LYS A HE2  1  
ATOM 4741   H HE3  . LYS A 1 293 ? 16.492  14.249  32.889  1.00 64.43 ? 293 LYS A HE3  1  
ATOM 4742   H HZ1  . LYS A 1 293 ? 14.317  15.018  32.830  1.00 65.12 ? 293 LYS A HZ1  1  
ATOM 4743   H HZ2  . LYS A 1 293 ? 14.150  13.464  33.475  1.00 75.23 ? 293 LYS A HZ2  1  
ATOM 4744   H HZ3  . LYS A 1 293 ? 13.774  13.749  31.851  1.00 70.14 ? 293 LYS A HZ3  1  
ATOM 4745   N N    . ASN A 1 294 ? 15.501  10.848  25.735  1.00 1.22  ? 294 ASN A N    1  
ATOM 4746   C CA   . ASN A 1 294 ? 14.583  9.845   25.207  1.00 60.43 ? 294 ASN A CA   1  
ATOM 4747   C C    . ASN A 1 294 ? 15.041  9.358   23.836  1.00 32.42 ? 294 ASN A C    1  
ATOM 4748   O O    . ASN A 1 294 ? 14.710  9.955   22.812  1.00 22.34 ? 294 ASN A O    1  
ATOM 4749   C CB   . ASN A 1 294 ? 13.169  10.419  25.111  1.00 12.31 ? 294 ASN A CB   1  
ATOM 4750   C CG   . ASN A 1 294 ? 12.102  9.346   25.208  1.00 34.44 ? 294 ASN A CG   1  
ATOM 4751   O OD1  . ASN A 1 294 ? 12.141  8.494   26.095  1.00 33.44 ? 294 ASN A OD1  1  
ATOM 4752   N ND2  . ASN A 1 294 ? 11.140  9.384   24.292  1.00 53.20 ? 294 ASN A ND2  1  
ATOM 4753   H H    . ASN A 1 294 ? 16.173  11.239  25.139  1.00 50.24 ? 294 ASN A H    1  
ATOM 4754   H HA   . ASN A 1 294 ? 14.577  9.009   25.890  1.00 32.43 ? 294 ASN A HA   1  
ATOM 4755   H HB2  . ASN A 1 294 ? 13.017  11.124  25.914  1.00 63.12 ? 294 ASN A HB2  1  
ATOM 4756   H HB3  . ASN A 1 294 ? 13.057  10.928  24.164  1.00 32.21 ? 294 ASN A HB3  1  
ATOM 4757   H HD21 . ASN A 1 294 ? 11.173  10.091  23.615  1.00 73.03 ? 294 ASN A HD21 1  
ATOM 4758   H HD22 . ASN A 1 294 ? 10.437  8.702   24.331  1.00 22.24 ? 294 ASN A HD22 1  
ATOM 4759   N N    . LYS A 1 295 ? 15.803  8.268   23.824  1.00 12.22 ? 295 LYS A N    1  
ATOM 4760   C CA   . LYS A 1 295 ? 16.304  7.700   22.578  1.00 5.13  ? 295 LYS A CA   1  
ATOM 4761   C C    . LYS A 1 295 ? 15.848  6.251   22.419  1.00 32.14 ? 295 LYS A C    1  
ATOM 4762   O O    . LYS A 1 295 ? 16.450  5.338   22.984  1.00 13.01 ? 295 LYS A O    1  
ATOM 4763   C CB   . LYS A 1 295 ? 17.832  7.771   22.541  1.00 31.10 ? 295 LYS A CB   1  
ATOM 4764   C CG   . LYS A 1 295 ? 18.394  8.055   21.158  1.00 53.31 ? 295 LYS A CG   1  
ATOM 4765   C CD   . LYS A 1 295 ? 19.720  8.794   21.237  1.00 34.41 ? 295 LYS A CD   1  
ATOM 4766   C CE   . LYS A 1 295 ? 20.392  8.877   19.876  1.00 54.41 ? 295 LYS A CE   1  
ATOM 4767   N NZ   . LYS A 1 295 ? 21.870  8.728   19.976  1.00 24.25 ? 295 LYS A NZ   1  
ATOM 4768   H H    . LYS A 1 295 ? 16.031  7.835   24.673  1.00 50.12 ? 295 LYS A H    1  
ATOM 4769   H HA   . LYS A 1 295 ? 15.907  8.285   21.763  1.00 23.30 ? 295 LYS A HA   1  
ATOM 4770   H HB2  . LYS A 1 295 ? 18.161  8.555   23.208  1.00 52.33 ? 295 LYS A HB2  1  
ATOM 4771   H HB3  . LYS A 1 295 ? 18.233  6.829   22.883  1.00 45.40 ? 295 LYS A HB3  1  
ATOM 4772   H HG2  . LYS A 1 295 ? 18.546  7.118   20.643  1.00 64.23 ? 295 LYS A HG2  1  
ATOM 4773   H HG3  . LYS A 1 295 ? 17.687  8.659   20.610  1.00 42.22 ? 295 LYS A HG3  1  
ATOM 4774   H HD2  . LYS A 1 295 ? 19.543  9.795   21.601  1.00 41.24 ? 295 LYS A HD2  1  
ATOM 4775   H HD3  . LYS A 1 295 ? 20.373  8.270   21.920  1.00 61.23 ? 295 LYS A HD3  1  
ATOM 4776   H HE2  . LYS A 1 295 ? 20.003  8.091   19.247  1.00 64.31 ? 295 LYS A HE2  1  
ATOM 4777   H HE3  . LYS A 1 295 ? 20.165  9.836   19.434  1.00 51.44 ? 295 LYS A HE3  1  
ATOM 4778   H HZ1  . LYS A 1 295 ? 22.229  9.263   20.794  1.00 72.40 ? 295 LYS A HZ1  1  
ATOM 4779   H HZ2  . LYS A 1 295 ? 22.326  9.089   19.114  1.00 34.34 ? 295 LYS A HZ2  1  
ATOM 4780   H HZ3  . LYS A 1 295 ? 22.121  7.726   20.094  1.00 74.22 ? 295 LYS A HZ3  1  
ATOM 4781   N N    . PRO A 1 296 ? 14.770  6.019   21.648  1.00 22.40 ? 296 PRO A N    1  
ATOM 4782   C CA   . PRO A 1 296 ? 14.234  4.672   21.422  1.00 30.10 ? 296 PRO A CA   1  
ATOM 4783   C C    . PRO A 1 296 ? 15.213  3.775   20.672  1.00 74.14 ? 296 PRO A C    1  
ATOM 4784   O O    . PRO A 1 296 ? 15.379  3.899   19.458  1.00 21.11 ? 296 PRO A O    1  
ATOM 4785   C CB   . PRO A 1 296 ? 12.977  4.912   20.574  1.00 61.01 ? 296 PRO A CB   1  
ATOM 4786   C CG   . PRO A 1 296 ? 12.667  6.363   20.728  1.00 10.11 ? 296 PRO A CG   1  
ATOM 4787   C CD   . PRO A 1 296 ? 13.986  7.044   20.943  1.00 14.11 ? 296 PRO A CD   1  
ATOM 4788   H HA   . PRO A 1 296 ? 13.957  4.198   22.352  1.00 0.12  ? 296 PRO A HA   1  
ATOM 4789   H HB2  . PRO A 1 296 ? 13.183  4.662   19.543  1.00 21.22 ? 296 PRO A HB2  1  
ATOM 4790   H HB3  . PRO A 1 296 ? 12.169  4.297   20.942  1.00 30.22 ? 296 PRO A HB3  1  
ATOM 4791   H HG2  . PRO A 1 296 ? 12.193  6.735   19.832  1.00 23.42 ? 296 PRO A HG2  1  
ATOM 4792   H HG3  . PRO A 1 296 ? 12.024  6.512   21.583  1.00 42.41 ? 296 PRO A HG3  1  
ATOM 4793   H HD2  . PRO A 1 296 ? 14.441  7.296   19.996  1.00 13.43 ? 296 PRO A HD2  1  
ATOM 4794   H HD3  . PRO A 1 296 ? 13.863  7.925   21.554  1.00 45.24 ? 296 PRO A HD3  1  
ATOM 4795   N N    . GLY A 1 297 ? 15.857  2.868   21.400  1.00 13.33 ? 297 GLY A N    1  
ATOM 4796   C CA   . GLY A 1 297 ? 16.807  1.960   20.784  1.00 54.04 ? 297 GLY A CA   1  
ATOM 4797   C C    . GLY A 1 297 ? 16.186  1.137   19.670  1.00 33.40 ? 297 GLY A C    1  
ATOM 4798   O O    . GLY A 1 297 ? 16.890  0.623   18.801  1.00 60.23 ? 297 GLY A O    1  
ATOM 4799   H H    . GLY A 1 297 ? 15.683  2.813   22.363  1.00 62.44 ? 297 GLY A H    1  
ATOM 4800   H HA2  . GLY A 1 297 ? 17.626  2.535   20.378  1.00 65.42 ? 297 GLY A HA2  1  
ATOM 4801   H HA3  . GLY A 1 297 ? 17.191  1.291   21.539  1.00 45.41 ? 297 GLY A HA3  1  
ATOM 4802   N N    . GLU A 1 298 ? 14.862  1.015   19.695  1.00 45.54 ? 298 GLU A N    1  
ATOM 4803   C CA   . GLU A 1 298 ? 14.145  0.254   18.679  1.00 32.25 ? 298 GLU A CA   1  
ATOM 4804   C C    . GLU A 1 298 ? 14.297  0.908   17.309  1.00 51.22 ? 298 GLU A C    1  
ATOM 4805   O O    . GLU A 1 298 ? 14.345  0.227   16.285  1.00 72.34 ? 298 GLU A O    1  
ATOM 4806   C CB   . GLU A 1 298 ? 12.663  0.141   19.044  1.00 44.11 ? 298 GLU A CB   1  
ATOM 4807   C CG   . GLU A 1 298 ? 12.043  1.456   19.485  1.00 60.54 ? 298 GLU A CG   1  
ATOM 4808   C CD   . GLU A 1 298 ? 11.858  1.538   20.988  1.00 30.24 ? 298 GLU A CD   1  
ATOM 4809   O OE1  . GLU A 1 298 ? 12.850  1.815   21.694  1.00 34.31 ? 298 GLU A OE1  1  
ATOM 4810   O OE2  . GLU A 1 298 ? 10.721  1.326   21.458  1.00 40.21 ? 298 GLU A OE2  1  
ATOM 4811   H H    . GLU A 1 298 ? 14.359  1.453   20.413  1.00 22.21 ? 298 GLU A H    1  
ATOM 4812   H HA   . GLU A 1 298 ? 14.575  -0.736  18.642  1.00 11.24 ? 298 GLU A HA   1  
ATOM 4813   H HB2  . GLU A 1 298 ? 12.119  -0.218  18.183  1.00 52.40 ? 298 GLU A HB2  1  
ATOM 4814   H HB3  . GLU A 1 298 ? 12.556  -0.571  19.849  1.00 61.43 ? 298 GLU A HB3  1  
ATOM 4815   H HG2  . GLU A 1 298 ? 12.685  2.266   19.173  1.00 1.40  ? 298 GLU A HG2  1  
ATOM 4816   H HG3  . GLU A 1 298 ? 11.078  1.561   19.012  1.00 31.24 ? 298 GLU A HG3  1  
ATOM 4817   N N    . ILE A 1 299 ? 14.374  2.235   17.302  1.00 15.25 ? 299 ILE A N    1  
ATOM 4818   C CA   . ILE A 1 299 ? 14.523  2.986   16.061  1.00 64.12 ? 299 ILE A CA   1  
ATOM 4819   C C    . ILE A 1 299 ? 15.983  3.038   15.625  1.00 72.35 ? 299 ILE A C    1  
ATOM 4820   O O    . ILE A 1 299 ? 16.293  2.902   14.441  1.00 23.35 ? 299 ILE A O    1  
ATOM 4821   C CB   . ILE A 1 299 ? 13.991  4.424   16.207  1.00 40.34 ? 299 ILE A CB   1  
ATOM 4822   C CG1  . ILE A 1 299 ? 12.598  4.415   16.838  1.00 1.02  ? 299 ILE A CG1  1  
ATOM 4823   C CG2  . ILE A 1 299 ? 13.962  5.118   14.853  1.00 64.14 ? 299 ILE A CG2  1  
ATOM 4824   C CD1  . ILE A 1 299 ? 11.549  3.741   15.980  1.00 15.40 ? 299 ILE A CD1  1  
ATOM 4825   H H    . ILE A 1 299 ? 14.332  2.719   18.153  1.00 53.14 ? 299 ILE A H    1  
ATOM 4826   H HA   . ILE A 1 299 ? 13.947  2.486   15.297  1.00 31.52 ? 299 ILE A HA   1  
ATOM 4827   H HB   . ILE A 1 299 ? 14.666  4.971   16.848  1.00 72.44 ? 299 ILE A HB   1  
ATOM 4828   H HG12 . ILE A 1 299 ? 12.640  3.892   17.781  1.00 21.22 ? 299 ILE A HG12 1  
ATOM 4829   H HG13 . ILE A 1 299 ? 12.281  5.434   17.010  1.00 72.43 ? 299 ILE A HG13 1  
ATOM 4830   H HG21 . ILE A 1 299 ? 13.853  4.379   14.072  1.00 43.24 ? 299 ILE A HG21 1  
ATOM 4831   H HG22 . ILE A 1 299 ? 14.883  5.662   14.707  1.00 34.34 ? 299 ILE A HG22 1  
ATOM 4832   H HG23 . ILE A 1 299 ? 13.128  5.804   14.818  1.00 23.50 ? 299 ILE A HG23 1  
ATOM 4833   H HD11 . ILE A 1 299 ? 10.863  3.197   16.612  1.00 14.44 ? 299 ILE A HD11 1  
ATOM 4834   H HD12 . ILE A 1 299 ? 12.030  3.056   15.297  1.00 55.13 ? 299 ILE A HD12 1  
ATOM 4835   H HD13 . ILE A 1 299 ? 11.007  4.488   15.419  1.00 11.15 ? 299 ILE A HD13 1  
ATOM 4836   N N    . ALA A 1 300 ? 16.877  3.237   16.589  1.00 64.23 ? 300 ALA A N    1  
ATOM 4837   C CA   . ALA A 1 300 ? 18.306  3.308   16.305  1.00 61.42 ? 300 ALA A CA   1  
ATOM 4838   C C    . ALA A 1 300 ? 18.795  2.035   15.621  1.00 33.52 ? 300 ALA A C    1  
ATOM 4839   O O    . ALA A 1 300 ? 19.420  2.089   14.562  1.00 13.20 ? 300 ALA A O    1  
ATOM 4840   C CB   . ALA A 1 300 ? 19.086  3.552   17.588  1.00 51.44 ? 300 ALA A CB   1  
ATOM 4841   H H    . ALA A 1 300 ? 16.568  3.339   17.513  1.00 34.12 ? 300 ALA A H    1  
ATOM 4842   H HA   . ALA A 1 300 ? 18.473  4.147   15.645  1.00 12.31 ? 300 ALA A HA   1  
ATOM 4843   H HB1  . ALA A 1 300 ? 18.490  4.146   18.265  1.00 54.44 ? 300 ALA A HB1  1  
ATOM 4844   H HB2  . ALA A 1 300 ? 20.001  4.077   17.359  1.00 52.10 ? 300 ALA A HB2  1  
ATOM 4845   H HB3  . ALA A 1 300 ? 19.321  2.605   18.052  1.00 51.14 ? 300 ALA A HB3  1  
ATOM 4846   N N    . LYS A 1 301 ? 18.506  0.891   16.233  1.00 53.31 ? 301 LYS A N    1  
ATOM 4847   C CA   . LYS A 1 301 ? 18.916  -0.396  15.681  1.00 34.34 ? 301 LYS A CA   1  
ATOM 4848   C C    . LYS A 1 301 ? 18.195  -0.676  14.366  1.00 74.50 ? 301 LYS A C    1  
ATOM 4849   O O    . LYS A 1 301 ? 18.770  -1.251  13.441  1.00 33.13 ? 301 LYS A O    1  
ATOM 4850   C CB   . LYS A 1 301 ? 18.632  -1.517  16.682  1.00 43.45 ? 301 LYS A CB   1  
ATOM 4851   C CG   . LYS A 1 301 ? 19.307  -1.315  18.029  1.00 4.32  ? 301 LYS A CG   1  
ATOM 4852   C CD   . LYS A 1 301 ? 19.689  -2.641  18.666  1.00 34.12 ? 301 LYS A CD   1  
ATOM 4853   C CE   . LYS A 1 301 ? 20.082  -2.467  20.124  1.00 72.22 ? 301 LYS A CE   1  
ATOM 4854   N NZ   . LYS A 1 301 ? 19.746  -3.669  20.937  1.00 4.42  ? 301 LYS A NZ   1  
ATOM 4855   H H    . LYS A 1 301 ? 18.004  0.911   17.074  1.00 72.03 ? 301 LYS A H    1  
ATOM 4856   H HA   . LYS A 1 301 ? 19.978  -0.352  15.494  1.00 65.52 ? 301 LYS A HA   1  
ATOM 4857   H HB2  . LYS A 1 301 ? 17.566  -1.579  16.843  1.00 43.44 ? 301 LYS A HB2  1  
ATOM 4858   H HB3  . LYS A 1 301 ? 18.980  -2.451  16.266  1.00 64.32 ? 301 LYS A HB3  1  
ATOM 4859   H HG2  . LYS A 1 301 ? 20.200  -0.724  17.889  1.00 5.24  ? 301 LYS A HG2  1  
ATOM 4860   H HG3  . LYS A 1 301 ? 18.627  -0.793  18.686  1.00 74.10 ? 301 LYS A HG3  1  
ATOM 4861   H HD2  . LYS A 1 301 ? 18.845  -3.313  18.609  1.00 33.13 ? 301 LYS A HD2  1  
ATOM 4862   H HD3  . LYS A 1 301 ? 20.524  -3.062  18.124  1.00 23.24 ? 301 LYS A HD3  1  
ATOM 4863   H HE2  . LYS A 1 301 ? 21.146  -2.293  20.178  1.00 41.41 ? 301 LYS A HE2  1  
ATOM 4864   H HE3  . LYS A 1 301 ? 19.557  -1.613  20.525  1.00 30.32 ? 301 LYS A HE3  1  
ATOM 4865   H HZ1  . LYS A 1 301 ? 18.819  -3.545  21.391  1.00 60.04 ? 301 LYS A HZ1  1  
ATOM 4866   H HZ2  . LYS A 1 301 ? 20.464  -3.813  21.675  1.00 3.14  ? 301 LYS A HZ2  1  
ATOM 4867   H HZ3  . LYS A 1 301 ? 19.714  -4.513  20.330  1.00 72.35 ? 301 LYS A HZ3  1  
ATOM 4868   N N    . TYR A 1 302 ? 16.933  -0.264  14.291  1.00 22.14 ? 302 TYR A N    1  
ATOM 4869   C CA   . TYR A 1 302 ? 16.130  -0.469  13.089  1.00 1.34  ? 302 TYR A CA   1  
ATOM 4870   C C    . TYR A 1 302 ? 16.850  0.064   11.853  1.00 54.02 ? 302 TYR A C    1  
ATOM 4871   O O    . TYR A 1 302 ? 16.978  -0.635  10.847  1.00 2.04  ? 302 TYR A O    1  
ATOM 4872   C CB   . TYR A 1 302 ? 14.770  0.217   13.235  1.00 35.44 ? 302 TYR A CB   1  
ATOM 4873   C CG   . TYR A 1 302 ? 13.876  0.056   12.026  1.00 51.13 ? 302 TYR A CG   1  
ATOM 4874   C CD1  . TYR A 1 302 ? 13.956  0.939   10.956  1.00 41.43 ? 302 TYR A CD1  1  
ATOM 4875   C CD2  . TYR A 1 302 ? 12.952  -0.980  11.954  1.00 3.31  ? 302 TYR A CD2  1  
ATOM 4876   C CE1  . TYR A 1 302 ? 13.142  0.795   9.849   1.00 23.32 ? 302 TYR A CE1  1  
ATOM 4877   C CE2  . TYR A 1 302 ? 12.135  -1.131  10.850  1.00 4.43  ? 302 TYR A CE2  1  
ATOM 4878   C CZ   . TYR A 1 302 ? 12.233  -0.241  9.801   1.00 60.53 ? 302 TYR A CZ   1  
ATOM 4879   O OH   . TYR A 1 302 ? 11.421  -0.388  8.700   1.00 33.43 ? 302 TYR A OH   1  
ATOM 4880   H H    . TYR A 1 302 ? 16.535  0.187   15.064  1.00 42.50 ? 302 TYR A H    1  
ATOM 4881   H HA   . TYR A 1 302 ? 15.976  -1.531  12.970  1.00 60.11 ? 302 TYR A HA   1  
ATOM 4882   H HB2  . TYR A 1 302 ? 14.253  -0.201  14.086  1.00 73.21 ? 302 TYR A HB2  1  
ATOM 4883   H HB3  . TYR A 1 302 ? 14.923  1.274   13.397  1.00 12.24 ? 302 TYR A HB3  1  
ATOM 4884   H HD1  . TYR A 1 302 ? 14.670  1.749   10.997  1.00 42.22 ? 302 TYR A HD1  1  
ATOM 4885   H HD2  . TYR A 1 302 ? 12.877  -1.675  12.777  1.00 4.50  ? 302 TYR A HD2  1  
ATOM 4886   H HE1  . TYR A 1 302 ? 13.220  1.491   9.028   1.00 23.34 ? 302 TYR A HE1  1  
ATOM 4887   H HE2  . TYR A 1 302 ? 11.423  -1.942  10.813  1.00 52.02 ? 302 TYR A HE2  1  
ATOM 4888   H HH   . TYR A 1 302 ? 11.467  -1.294  8.386   1.00 3.43  ? 302 TYR A HH   1  
ATOM 4889   N N    . MET A 1 303 ? 17.320  1.304   11.936  1.00 71.32 ? 303 MET A N    1  
ATOM 4890   C CA   . MET A 1 303 ? 18.028  1.932   10.827  1.00 22.12 ? 303 MET A CA   1  
ATOM 4891   C C    . MET A 1 303 ? 19.427  1.345   10.672  1.00 13.40 ? 303 MET A C    1  
ATOM 4892   O O    . MET A 1 303 ? 19.909  1.152   9.556   1.00 23.51 ? 303 MET A O    1  
ATOM 4893   C CB   . MET A 1 303 ? 18.118  3.444   11.041  1.00 24.41 ? 303 MET A CB   1  
ATOM 4894   C CG   . MET A 1 303 ? 16.799  4.169   10.824  1.00 3.33  ? 303 MET A CG   1  
ATOM 4895   S SD   . MET A 1 303 ? 16.704  4.969   9.211   1.00 71.21 ? 303 MET A SD   1  
ATOM 4896   C CE   . MET A 1 303 ? 15.429  3.989   8.422   1.00 42.03 ? 303 MET A CE   1  
ATOM 4897   H H    . MET A 1 303 ? 17.187  1.810   12.763  1.00 1.11  ? 303 MET A H    1  
ATOM 4898   H HA   . MET A 1 303 ? 17.467  1.738   9.924   1.00 11.21 ? 303 MET A HA   1  
ATOM 4899   H HB2  . MET A 1 303 ? 18.445  3.633   12.053  1.00 62.41 ? 303 MET A HB2  1  
ATOM 4900   H HB3  . MET A 1 303 ? 18.845  3.850   10.354  1.00 4.05  ? 303 MET A HB3  1  
ATOM 4901   H HG2  . MET A 1 303 ? 15.994  3.454   10.902  1.00 21.52 ? 303 MET A HG2  1  
ATOM 4902   H HG3  . MET A 1 303 ? 16.687  4.920   11.591  1.00 55.35 ? 303 MET A HG3  1  
ATOM 4903   H HE1  . MET A 1 303 ? 15.181  3.147   9.051   1.00 45.13 ? 303 MET A HE1  1  
ATOM 4904   H HE2  . MET A 1 303 ? 15.788  3.633   7.468   1.00 3.00  ? 303 MET A HE2  1  
ATOM 4905   H HE3  . MET A 1 303 ? 14.549  4.597   8.271   1.00 21.11 ? 303 MET A HE3  1  
ATOM 4906   N N    . GLU A 1 304 ? 20.073  1.060   11.799  1.00 25.40 ? 304 GLU A N    1  
ATOM 4907   C CA   . GLU A 1 304 ? 21.417  0.491   11.788  1.00 4.50  ? 304 GLU A CA   1  
ATOM 4908   C C    . GLU A 1 304 ? 21.467  -0.766  10.923  1.00 54.20 ? 304 GLU A C    1  
ATOM 4909   O O    . GLU A 1 304 ? 22.500  -1.091  10.339  1.00 23.42 ? 304 GLU A O    1  
ATOM 4910   C CB   . GLU A 1 304 ? 21.868  0.164   13.213  1.00 3.05  ? 304 GLU A CB   1  
ATOM 4911   C CG   . GLU A 1 304 ? 22.623  1.298   13.887  1.00 2.42  ? 304 GLU A CG   1  
ATOM 4912   C CD   . GLU A 1 304 ? 23.571  0.808   14.964  1.00 32.42 ? 304 GLU A CD   1  
ATOM 4913   O OE1  . GLU A 1 304 ? 24.644  0.274   14.613  1.00 42.44 ? 304 GLU A OE1  1  
ATOM 4914   O OE2  . GLU A 1 304 ? 23.240  0.959   16.159  1.00 54.31 ? 304 GLU A OE2  1  
ATOM 4915   H H    . GLU A 1 304 ? 19.636  1.234   12.659  1.00 2.02  ? 304 GLU A H    1  
ATOM 4916   H HA   . GLU A 1 304 ? 22.085  1.228   11.368  1.00 1.44  ? 304 GLU A HA   1  
ATOM 4917   H HB2  . GLU A 1 304 ? 20.998  -0.065  13.810  1.00 4.40  ? 304 GLU A HB2  1  
ATOM 4918   H HB3  . GLU A 1 304 ? 22.513  -0.702  13.185  1.00 53.00 ? 304 GLU A HB3  1  
ATOM 4919   H HG2  . GLU A 1 304 ? 23.195  1.827   13.140  1.00 25.53 ? 304 GLU A HG2  1  
ATOM 4920   H HG3  . GLU A 1 304 ? 21.908  1.972   14.336  1.00 75.11 ? 304 GLU A HG3  1  
ATOM 4921   N N    . THR A 1 305 ? 20.339  -1.464  10.844  1.00 21.11 ? 305 THR A N    1  
ATOM 4922   C CA   . THR A 1 305 ? 20.244  -2.681  10.048  1.00 21.42 ? 305 THR A CA   1  
ATOM 4923   C C    . THR A 1 305 ? 19.976  -2.343  8.584   1.00 71.43 ? 305 THR A C    1  
ATOM 4924   O O    . THR A 1 305 ? 20.500  -2.991  7.678   1.00 50.13 ? 305 THR A O    1  
ATOM 4925   C CB   . THR A 1 305 ? 19.133  -3.580  10.594  1.00 11.10 ? 305 THR A CB   1  
ATOM 4926   O OG1  . THR A 1 305 ? 19.429  -3.996  11.915  1.00 43.12 ? 305 THR A OG1  1  
ATOM 4927   C CG2  . THR A 1 305 ? 18.899  -4.824  9.764   1.00 52.22 ? 305 THR A CG2  1  
ATOM 4928   H H    . THR A 1 305 ? 19.548  -1.150  11.329  1.00 75.11 ? 305 THR A H    1  
ATOM 4929   H HA   . THR A 1 305 ? 21.188  -3.201  10.120  1.00 73.42 ? 305 THR A HA   1  
ATOM 4930   H HB   . THR A 1 305 ? 18.209  -3.019  10.615  1.00 53.42 ? 305 THR A HB   1  
ATOM 4931   H HG1  . THR A 1 305 ? 20.343  -4.285  11.962  1.00 42.45 ? 305 THR A HG1  1  
ATOM 4932   H HG21 . THR A 1 305 ? 18.972  -5.697  10.395  1.00 4.40  ? 305 THR A HG21 1  
ATOM 4933   H HG22 . THR A 1 305 ? 19.643  -4.880  8.983   1.00 52.11 ? 305 THR A HG22 1  
ATOM 4934   H HG23 . THR A 1 305 ? 17.915  -4.780  9.321   1.00 53.54 ? 305 THR A HG23 1  
ATOM 4935   N N    . VAL A 1 306 ? 19.156  -1.322  8.365   1.00 33.24 ? 306 VAL A N    1  
ATOM 4936   C CA   . VAL A 1 306 ? 18.814  -0.890  7.016   1.00 32.33 ? 306 VAL A CA   1  
ATOM 4937   C C    . VAL A 1 306 ? 20.032  -0.315  6.300   1.00 13.42 ? 306 VAL A C    1  
ATOM 4938   O O    . VAL A 1 306 ? 20.357  -0.718  5.183   1.00 61.30 ? 306 VAL A O    1  
ATOM 4939   C CB   . VAL A 1 306 ? 17.693  0.167   7.029   1.00 55.22 ? 306 VAL A CB   1  
ATOM 4940   C CG1  . VAL A 1 306 ? 17.239  0.483   5.613   1.00 53.21 ? 306 VAL A CG1  1  
ATOM 4941   C CG2  . VAL A 1 306 ? 16.522  -0.304  7.880   1.00 20.54 ? 306 VAL A CG2  1  
ATOM 4942   H H    . VAL A 1 306 ? 18.774  -0.849  9.134   1.00 33.22 ? 306 VAL A H    1  
ATOM 4943   H HA   . VAL A 1 306 ? 18.461  -1.752  6.469   1.00 13.55 ? 306 VAL A HA   1  
ATOM 4944   H HB   . VAL A 1 306 ? 18.086  1.073   7.467   1.00 71.41 ? 306 VAL A HB   1  
ATOM 4945   H HG11 . VAL A 1 306 ? 16.449  1.219   5.643   1.00 34.52 ? 306 VAL A HG11 1  
ATOM 4946   H HG12 . VAL A 1 306 ? 16.873  -0.418  5.143   1.00 34.51 ? 306 VAL A HG12 1  
ATOM 4947   H HG13 . VAL A 1 306 ? 18.071  0.872   5.046   1.00 55.24 ? 306 VAL A HG13 1  
ATOM 4948   H HG21 . VAL A 1 306 ? 15.734  -0.667  7.237   1.00 12.41 ? 306 VAL A HG21 1  
ATOM 4949   H HG22 . VAL A 1 306 ? 16.152  0.521   8.471   1.00 4.21  ? 306 VAL A HG22 1  
ATOM 4950   H HG23 . VAL A 1 306 ? 16.848  -1.098  8.534   1.00 14.20 ? 306 VAL A HG23 1  
ATOM 4951   N N    . LYS A 1 307 ? 20.702  0.629   6.953   1.00 4.42  ? 307 LYS A N    1  
ATOM 4952   C CA   . LYS A 1 307 ? 21.885  1.262   6.381   1.00 14.43 ? 307 LYS A CA   1  
ATOM 4953   C C    . LYS A 1 307 ? 23.049  0.277   6.298   1.00 14.54 ? 307 LYS A C    1  
ATOM 4954   O O    . LYS A 1 307 ? 23.926  0.410   5.445   1.00 72.13 ? 307 LYS A O    1  
ATOM 4955   C CB   . LYS A 1 307 ? 22.290  2.480   7.215   1.00 61.12 ? 307 LYS A CB   1  
ATOM 4956   C CG   . LYS A 1 307 ? 21.847  3.803   6.612   1.00 21.01 ? 307 LYS A CG   1  
ATOM 4957   C CD   . LYS A 1 307 ? 20.435  4.167   7.041   1.00 65.24 ? 307 LYS A CD   1  
ATOM 4958   C CE   . LYS A 1 307 ? 19.396  3.547   6.121   1.00 64.12 ? 307 LYS A CE   1  
ATOM 4959   N NZ   . LYS A 1 307 ? 18.039  3.550   6.734   1.00 61.02 ? 307 LYS A NZ   1  
ATOM 4960   H H    . LYS A 1 307 ? 20.394  0.907   7.840   1.00 71.12 ? 307 LYS A H    1  
ATOM 4961   H HA   . LYS A 1 307 ? 21.635  1.589   5.383   1.00 54.11 ? 307 LYS A HA   1  
ATOM 4962   H HB2  . LYS A 1 307 ? 21.849  2.391   8.197   1.00 63.43 ? 307 LYS A HB2  1  
ATOM 4963   H HB3  . LYS A 1 307 ? 23.365  2.496   7.313   1.00 34.24 ? 307 LYS A HB3  1  
ATOM 4964   H HG2  . LYS A 1 307 ? 22.522  4.580   6.939   1.00 71.40 ? 307 LYS A HG2  1  
ATOM 4965   H HG3  . LYS A 1 307 ? 21.878  3.726   5.535   1.00 33.04 ? 307 LYS A HG3  1  
ATOM 4966   H HD2  . LYS A 1 307 ? 20.270  3.807   8.046   1.00 53.22 ? 307 LYS A HD2  1  
ATOM 4967   H HD3  . LYS A 1 307 ? 20.328  5.241   7.019   1.00 54.30 ? 307 LYS A HD3  1  
ATOM 4968   H HE2  . LYS A 1 307 ? 19.366  4.111   5.201   1.00 23.52 ? 307 LYS A HE2  1  
ATOM 4969   H HE3  . LYS A 1 307 ? 19.683  2.528   5.908   1.00 13.43 ? 307 LYS A HE3  1  
ATOM 4970   H HZ1  . LYS A 1 307 ? 17.642  4.512   6.718   1.00 11.32 ? 307 LYS A HZ1  1  
ATOM 4971   H HZ2  . LYS A 1 307 ? 18.091  3.225   7.720   1.00 23.05 ? 307 LYS A HZ2  1  
ATOM 4972   H HZ3  . LYS A 1 307 ? 17.406  2.917   6.205   1.00 63.12 ? 307 LYS A HZ3  1  
ATOM 4973   N N    . LEU A 1 308 ? 23.051  -0.710  7.188   1.00 70.13 ? 308 LEU A N    1  
ATOM 4974   C CA   . LEU A 1 308 ? 24.110  -1.714  7.212   1.00 3.51  ? 308 LEU A CA   1  
ATOM 4975   C C    . LEU A 1 308 ? 23.695  -2.966  6.446   1.00 74.20 ? 308 LEU A C    1  
ATOM 4976   O O    . LEU A 1 308 ? 24.113  -4.075  6.779   1.00 22.05 ? 308 LEU A O    1  
ATOM 4977   C CB   . LEU A 1 308 ? 24.464  -2.077  8.656   1.00 23.51 ? 308 LEU A CB   1  
ATOM 4978   C CG   . LEU A 1 308 ? 25.830  -2.744  8.839   1.00 10.13 ? 308 LEU A CG   1  
ATOM 4979   C CD1  . LEU A 1 308 ? 26.568  -2.136  10.023  1.00 72.23 ? 308 LEU A CD1  1  
ATOM 4980   C CD2  . LEU A 1 308 ? 25.671  -4.246  9.022   1.00 12.55 ? 308 LEU A CD2  1  
ATOM 4981   H H    . LEU A 1 308 ? 22.326  -0.764  7.845   1.00 1.11  ? 308 LEU A H    1  
ATOM 4982   H HA   . LEU A 1 308 ? 24.979  -1.287  6.736   1.00 60.55 ? 308 LEU A HA   1  
ATOM 4983   H HB2  . LEU A 1 308 ? 24.444  -1.172  9.246   1.00 54.13 ? 308 LEU A HB2  1  
ATOM 4984   H HB3  . LEU A 1 308 ? 23.707  -2.749  9.032   1.00 74.53 ? 308 LEU A HB3  1  
ATOM 4985   H HG   . LEU A 1 308 ? 26.426  -2.575  7.954   1.00 14.42 ? 308 LEU A HG   1  
ATOM 4986   H HD11 . LEU A 1 308 ? 27.329  -2.823  10.364  1.00 63.04 ? 308 LEU A HD11 1  
ATOM 4987   H HD12 . LEU A 1 308 ? 25.869  -1.947  10.825  1.00 71.03 ? 308 LEU A HD12 1  
ATOM 4988   H HD13 . LEU A 1 308 ? 27.030  -1.208  9.722   1.00 54.44 ? 308 LEU A HD13 1  
ATOM 4989   H HD21 . LEU A 1 308 ? 26.404  -4.602  9.732   1.00 3.22  ? 308 LEU A HD21 1  
ATOM 4990   H HD22 . LEU A 1 308 ? 25.818  -4.742  8.074   1.00 62.11 ? 308 LEU A HD22 1  
ATOM 4991   H HD23 . LEU A 1 308 ? 24.679  -4.461  9.391   1.00 3.30  ? 308 LEU A HD23 1  
ATOM 4992   N N    . LEU A 1 309 ? 22.875  -2.783  5.416   1.00 21.14 ? 309 LEU A N    1  
ATOM 4993   C CA   . LEU A 1 309 ? 22.410  -3.900  4.602   1.00 72.43 ? 309 LEU A CA   1  
ATOM 4994   C C    . LEU A 1 309 ? 23.119  -3.918  3.251   1.00 22.11 ? 309 LEU A C    1  
ATOM 4995   O O    . LEU A 1 309 ? 23.220  -2.891  2.579   1.00 3.14  ? 309 LEU A O    1  
ATOM 4996   C CB   . LEU A 1 309 ? 20.896  -3.815  4.397   1.00 24.22 ? 309 LEU A CB   1  
ATOM 4997   C CG   . LEU A 1 309 ? 20.155  -5.150  4.481   1.00 32.42 ? 309 LEU A CG   1  
ATOM 4998   C CD1  . LEU A 1 309 ? 18.744  -4.946  5.012   1.00 61.41 ? 309 LEU A CD1  1  
ATOM 4999   C CD2  . LEU A 1 309 ? 20.121  -5.826  3.118   1.00 24.22 ? 309 LEU A CD2  1  
ATOM 5000   H H    . LEU A 1 309 ? 22.578  -1.876  5.196   1.00 12.35 ? 309 LEU A H    1  
ATOM 5001   H HA   . LEU A 1 309 ? 22.642  -4.813  5.129   1.00 1.44  ? 309 LEU A HA   1  
ATOM 5002   H HB2  . LEU A 1 309 ? 20.489  -3.153  5.149   1.00 71.22 ? 309 LEU A HB2  1  
ATOM 5003   H HB3  . LEU A 1 309 ? 20.708  -3.385  3.425   1.00 1.23  ? 309 LEU A HB3  1  
ATOM 5004   H HG   . LEU A 1 309 ? 20.678  -5.802  5.166   1.00 14.14 ? 309 LEU A HG   1  
ATOM 5005   H HD11 . LEU A 1 309 ? 18.455  -5.802  5.603   1.00 4.55  ? 309 LEU A HD11 1  
ATOM 5006   H HD12 . LEU A 1 309 ? 18.061  -4.833  4.183   1.00 63.15 ? 309 LEU A HD12 1  
ATOM 5007   H HD13 . LEU A 1 309 ? 18.716  -4.058  5.625   1.00 3.44  ? 309 LEU A HD13 1  
ATOM 5008   H HD21 . LEU A 1 309 ? 19.917  -6.879  3.244   1.00 53.31 ? 309 LEU A HD21 1  
ATOM 5009   H HD22 . LEU A 1 309 ? 21.076  -5.699  2.630   1.00 41.43 ? 309 LEU A HD22 1  
ATOM 5010   H HD23 . LEU A 1 309 ? 19.345  -5.379  2.514   1.00 3.13  ? 309 LEU A HD23 1  
ATOM 5011   N N    . ASP A 1 310 ? 23.608  -5.089  2.860   1.00 30.21 ? 310 ASP A N    1  
ATOM 5012   C CA   . ASP A 1 310 ? 24.307  -5.238  1.589   1.00 53.24 ? 310 ASP A CA   1  
ATOM 5013   C C    . ASP A 1 310 ? 23.358  -5.727  0.500   1.00 74.31 ? 310 ASP A C    1  
ATOM 5014   O O    . ASP A 1 310 ? 22.341  -6.359  0.787   1.00 60.03 ? 310 ASP A O    1  
ATOM 5015   C CB   . ASP A 1 310 ? 25.479  -6.210  1.737   1.00 3.50  ? 310 ASP A CB   1  
ATOM 5016   C CG   . ASP A 1 310 ? 26.696  -5.774  0.946   1.00 41.34 ? 310 ASP A CG   1  
ATOM 5017   O OD1  . ASP A 1 310 ? 26.793  -6.140  -0.245  1.00 31.35 ? 310 ASP A OD1  1  
ATOM 5018   O OD2  . ASP A 1 310 ? 27.553  -5.067  1.516   1.00 3.12  ? 310 ASP A OD2  1  
ATOM 5019   H H    . ASP A 1 310 ? 23.496  -5.872  3.438   1.00 53.31 ? 310 ASP A H    1  
ATOM 5020   H HA   . ASP A 1 310 ? 24.690  -4.268  1.306   1.00 30.15 ? 310 ASP A HA   1  
ATOM 5021   H HB2  . ASP A 1 310 ? 25.755  -6.275  2.779   1.00 53.32 ? 310 ASP A HB2  1  
ATOM 5022   H HB3  . ASP A 1 310 ? 25.176  -7.186  1.388   1.00 53.54 ? 310 ASP A HB3  1  
ATOM 5023   N N    . TYR A 1 311 ? 23.697  -5.430  -0.751  1.00 74.42 ? 311 TYR A N    1  
ATOM 5024   C CA   . TYR A 1 311 ? 22.874  -5.839  -1.884  1.00 21.23 ? 311 TYR A CA   1  
ATOM 5025   C C    . TYR A 1 311 ? 22.705  -7.354  -1.919  1.00 73.21 ? 311 TYR A C    1  
ATOM 5026   O O    . TYR A 1 311 ? 21.678  -7.864  -2.369  1.00 44.04 ? 311 TYR A O    1  
ATOM 5027   C CB   . TYR A 1 311 ? 23.499  -5.354  -3.194  1.00 41.50 ? 311 TYR A CB   1  
ATOM 5028   C CG   . TYR A 1 311 ? 22.495  -5.151  -4.305  1.00 3.22  ? 311 TYR A CG   1  
ATOM 5029   C CD1  . TYR A 1 311 ? 22.122  -6.203  -5.131  1.00 10.41 ? 311 TYR A CD1  1  
ATOM 5030   C CD2  . TYR A 1 311 ? 21.920  -3.906  -4.528  1.00 70.24 ? 311 TYR A CD2  1  
ATOM 5031   C CE1  . TYR A 1 311 ? 21.205  -6.021  -6.149  1.00 13.40 ? 311 TYR A CE1  1  
ATOM 5032   C CE2  . TYR A 1 311 ? 21.001  -3.716  -5.543  1.00 34.41 ? 311 TYR A CE2  1  
ATOM 5033   C CZ   . TYR A 1 311 ? 20.647  -4.776  -6.350  1.00 10.34 ? 311 TYR A CZ   1  
ATOM 5034   O OH   . TYR A 1 311 ? 19.733  -4.591  -7.362  1.00 35.22 ? 311 TYR A OH   1  
ATOM 5035   H H    . TYR A 1 311 ? 24.519  -4.923  -0.916  1.00 1.15  ? 311 TYR A H    1  
ATOM 5036   H HA   . TYR A 1 311 ? 21.902  -5.382  -1.770  1.00 2.43  ? 311 TYR A HA   1  
ATOM 5037   H HB2  . TYR A 1 311 ? 23.996  -4.412  -3.020  1.00 54.52 ? 311 TYR A HB2  1  
ATOM 5038   H HB3  . TYR A 1 311 ? 24.224  -6.082  -3.529  1.00 4.40  ? 311 TYR A HB3  1  
ATOM 5039   H HD1  . TYR A 1 311 ? 22.560  -7.177  -4.971  1.00 14.15 ? 311 TYR A HD1  1  
ATOM 5040   H HD2  . TYR A 1 311 ? 22.199  -3.077  -3.894  1.00 14.05 ? 311 TYR A HD2  1  
ATOM 5041   H HE1  . TYR A 1 311 ? 20.928  -6.852  -6.780  1.00 41.22 ? 311 TYR A HE1  1  
ATOM 5042   H HE2  . TYR A 1 311 ? 20.565  -2.741  -5.701  1.00 55.42 ? 311 TYR A HE2  1  
ATOM 5043   H HH   . TYR A 1 311 ? 19.946  -3.788  -7.843  1.00 12.01 ? 311 TYR A HH   1  
ATOM 5044   N N    . THR A 1 312 ? 23.717  -8.069  -1.440  1.00 43.44 ? 312 THR A N    1  
ATOM 5045   C CA   . THR A 1 312 ? 23.680  -9.527  -1.415  1.00 53.55 ? 312 THR A CA   1  
ATOM 5046   C C    . THR A 1 312 ? 23.137  -10.039 -0.084  1.00 14.33 ? 312 THR A C    1  
ATOM 5047   O O    . THR A 1 312 ? 22.625  -11.156 -0.001  1.00 42.42 ? 312 THR A O    1  
ATOM 5048   C CB   . THR A 1 312 ? 25.078  -10.097 -1.660  1.00 30.50 ? 312 THR A CB   1  
ATOM 5049   O OG1  . THR A 1 312 ? 25.982  -9.656  -0.662  1.00 45.43 ? 312 THR A OG1  1  
ATOM 5050   C CG2  . THR A 1 312 ? 25.655  -9.710  -3.005  1.00 73.20 ? 312 THR A CG2  1  
ATOM 5051   H H    . THR A 1 312 ? 24.508  -7.605  -1.094  1.00 61.14 ? 312 THR A H    1  
ATOM 5052   H HA   . THR A 1 312 ? 23.024  -9.854  -2.207  1.00 54.13 ? 312 THR A HA   1  
ATOM 5053   H HB   . THR A 1 312 ? 25.028  -11.176 -1.620  1.00 23.43 ? 312 THR A HB   1  
ATOM 5054   H HG1  . THR A 1 312 ? 26.138  -8.714  -0.765  1.00 50.40 ? 312 THR A HG1  1  
ATOM 5055   H HG21 . THR A 1 312 ? 26.262  -10.519 -3.383  1.00 4.15  ? 312 THR A HG21 1  
ATOM 5056   H HG22 . THR A 1 312 ? 26.263  -8.825  -2.895  1.00 22.53 ? 312 THR A HG22 1  
ATOM 5057   H HG23 . THR A 1 312 ? 24.850  -9.510  -3.698  1.00 31.42 ? 312 THR A HG23 1  
ATOM 5058   N N    . GLU A 1 313 ? 23.250  -9.218  0.956   1.00 13.21 ? 313 GLU A N    1  
ATOM 5059   C CA   . GLU A 1 313 ? 22.770  -9.592  2.281   1.00 3.12  ? 313 GLU A CA   1  
ATOM 5060   C C    . GLU A 1 313 ? 21.267  -9.849  2.263   1.00 25.22 ? 313 GLU A C    1  
ATOM 5061   O O    . GLU A 1 313 ? 20.500  -9.070  1.697   1.00 22.14 ? 313 GLU A O    1  
ATOM 5062   C CB   . GLU A 1 313 ? 23.099  -8.494  3.294   1.00 64.34 ? 313 GLU A CB   1  
ATOM 5063   C CG   . GLU A 1 313 ? 23.497  -9.027  4.661   1.00 31.04 ? 313 GLU A CG   1  
ATOM 5064   C CD   . GLU A 1 313 ? 24.958  -9.426  4.729   1.00 40.04 ? 313 GLU A CD   1  
ATOM 5065   O OE1  . GLU A 1 313 ? 25.823  -8.540  4.565   1.00 42.13 ? 313 GLU A OE1  1  
ATOM 5066   O OE2  . GLU A 1 313 ? 25.237  -10.623 4.946   1.00 15.24 ? 313 GLU A OE2  1  
ATOM 5067   H H    . GLU A 1 313 ? 23.667  -8.340  0.830   1.00 32.11 ? 313 GLU A H    1  
ATOM 5068   H HA   . GLU A 1 313 ? 23.275  -10.501 2.572   1.00 64.31 ? 313 GLU A HA   1  
ATOM 5069   H HB2  . GLU A 1 313 ? 23.917  -7.901  2.912   1.00 1.44  ? 313 GLU A HB2  1  
ATOM 5070   H HB3  . GLU A 1 313 ? 22.233  -7.861  3.417   1.00 1.05  ? 313 GLU A HB3  1  
ATOM 5071   H HG2  . GLU A 1 313 ? 23.314  -8.261  5.400   1.00 11.01 ? 313 GLU A HG2  1  
ATOM 5072   H HG3  . GLU A 1 313 ? 22.892  -9.894  4.885   1.00 23.33 ? 313 GLU A HG3  1  
ATOM 5073   N N    . LYS A 1 314 ? 20.852  -10.947 2.886   1.00 23.30 ? 314 LYS A N    1  
ATOM 5074   C CA   . LYS A 1 314 ? 19.441  -11.308 2.943   1.00 2.22  ? 314 LYS A CA   1  
ATOM 5075   C C    . LYS A 1 314 ? 18.731  -10.551 4.063   1.00 2.11  ? 314 LYS A C    1  
ATOM 5076   O O    . LYS A 1 314 ? 19.376  -9.990  4.950   1.00 10.04 ? 314 LYS A O    1  
ATOM 5077   C CB   . LYS A 1 314 ? 19.287  -12.816 3.152   1.00 73.43 ? 314 LYS A CB   1  
ATOM 5078   C CG   . LYS A 1 314 ? 19.122  -13.596 1.858   1.00 23.12 ? 314 LYS A CG   1  
ATOM 5079   C CD   . LYS A 1 314 ? 18.578  -14.991 2.114   1.00 20.50 ? 314 LYS A CD   1  
ATOM 5080   C CE   . LYS A 1 314 ? 19.234  -16.020 1.207   1.00 33.41 ? 314 LYS A CE   1  
ATOM 5081   N NZ   . LYS A 1 314 ? 18.431  -17.271 1.114   1.00 0.41  ? 314 LYS A NZ   1  
ATOM 5082   H H    . LYS A 1 314 ? 21.512  -11.528 3.319   1.00 11.25 ? 314 LYS A H    1  
ATOM 5083   H HA   . LYS A 1 314 ? 18.991  -11.036 2.000   1.00 41.33 ? 314 LYS A HA   1  
ATOM 5084   H HB2  . LYS A 1 314 ? 20.163  -13.188 3.662   1.00 53.45 ? 314 LYS A HB2  1  
ATOM 5085   H HB3  . LYS A 1 314 ? 18.419  -12.996 3.769   1.00 63.45 ? 314 LYS A HB3  1  
ATOM 5086   H HG2  . LYS A 1 314 ? 18.437  -13.065 1.214   1.00 62.12 ? 314 LYS A HG2  1  
ATOM 5087   H HG3  . LYS A 1 314 ? 20.084  -13.677 1.373   1.00 31.25 ? 314 LYS A HG3  1  
ATOM 5088   H HD2  . LYS A 1 314 ? 18.769  -15.259 3.142   1.00 3.15  ? 314 LYS A HD2  1  
ATOM 5089   H HD3  . LYS A 1 314 ? 17.513  -14.991 1.932   1.00 0.51  ? 314 LYS A HD3  1  
ATOM 5090   H HE2  . LYS A 1 314 ? 19.338  -15.596 0.220   1.00 1.43  ? 314 LYS A HE2  1  
ATOM 5091   H HE3  . LYS A 1 314 ? 20.211  -16.258 1.602   1.00 53.32 ? 314 LYS A HE3  1  
ATOM 5092   H HZ1  . LYS A 1 314 ? 18.146  -17.584 2.064   1.00 13.14 ? 314 LYS A HZ1  1  
ATOM 5093   H HZ2  . LYS A 1 314 ? 18.992  -18.024 0.667   1.00 51.04 ? 314 LYS A HZ2  1  
ATOM 5094   H HZ3  . LYS A 1 314 ? 17.577  -17.106 0.544   1.00 32.43 ? 314 LYS A HZ3  1  
ATOM 5095   N N    . PRO A 1 315 ? 17.387  -10.526 4.039   1.00 10.43 ? 315 PRO A N    1  
ATOM 5096   C CA   . PRO A 1 315 ? 16.592  -9.834  5.060   1.00 41.14 ? 315 PRO A CA   1  
ATOM 5097   C C    . PRO A 1 315 ? 16.744  -10.469 6.437   1.00 64.24 ? 315 PRO A C    1  
ATOM 5098   O O    . PRO A 1 315 ? 16.778  -11.693 6.567   1.00 64.15 ? 315 PRO A O    1  
ATOM 5099   C CB   . PRO A 1 315 ? 15.152  -9.979  4.558   1.00 34.23 ? 315 PRO A CB   1  
ATOM 5100   C CG   . PRO A 1 315 ? 15.178  -11.165 3.656   1.00 64.05 ? 315 PRO A CG   1  
ATOM 5101   C CD   . PRO A 1 315 ? 16.539  -11.169 3.021   1.00 23.21 ? 315 PRO A CD   1  
ATOM 5102   H HA   . PRO A 1 315 ? 16.852  -8.787  5.118   1.00 73.32 ? 315 PRO A HA   1  
ATOM 5103   H HB2  . PRO A 1 315 ? 14.491  -10.135 5.398   1.00 41.25 ? 315 PRO A HB2  1  
ATOM 5104   H HB3  . PRO A 1 315 ? 14.862  -9.086  4.026   1.00 64.31 ? 315 PRO A HB3  1  
ATOM 5105   H HG2  . PRO A 1 315 ? 15.028  -12.067 4.231   1.00 2.14  ? 315 PRO A HG2  1  
ATOM 5106   H HG3  . PRO A 1 315 ? 14.412  -11.068 2.901   1.00 12.25 ? 315 PRO A HG3  1  
ATOM 5107   H HD2  . PRO A 1 315 ? 16.863  -12.182 2.831   1.00 13.32 ? 315 PRO A HD2  1  
ATOM 5108   H HD3  . PRO A 1 315 ? 16.531  -10.595 2.106   1.00 51.13 ? 315 PRO A HD3  1  
ATOM 5109   N N    . LEU A 1 316 ? 16.837  -9.630  7.464   1.00 4.21  ? 316 LEU A N    1  
ATOM 5110   C CA   . LEU A 1 316 ? 16.987  -10.111 8.832   1.00 45.44 ? 316 LEU A CA   1  
ATOM 5111   C C    . LEU A 1 316 ? 15.741  -9.807  9.658   1.00 54.34 ? 316 LEU A C    1  
ATOM 5112   O O    . LEU A 1 316 ? 15.755  -8.932  10.524  1.00 11.23 ? 316 LEU A O    1  
ATOM 5113   C CB   . LEU A 1 316 ? 18.216  -9.475  9.486   1.00 55.20 ? 316 LEU A CB   1  
ATOM 5114   C CG   . LEU A 1 316 ? 19.557  -10.082 9.072   1.00 75.13 ? 316 LEU A CG   1  
ATOM 5115   C CD1  . LEU A 1 316 ? 20.646  -9.021  9.069   1.00 23.05 ? 316 LEU A CD1  1  
ATOM 5116   C CD2  . LEU A 1 316 ? 19.930  -11.229 9.999   1.00 2.11  ? 316 LEU A CD2  1  
ATOM 5117   H H    . LEU A 1 316 ? 16.804  -8.665  7.297   1.00 34.40 ? 316 LEU A H    1  
ATOM 5118   H HA   . LEU A 1 316 ? 17.125  -11.181 8.794   1.00 73.52 ? 316 LEU A HA   1  
ATOM 5119   H HB2  . LEU A 1 316 ? 18.226  -8.424  9.235   1.00 35.44 ? 316 LEU A HB2  1  
ATOM 5120   H HB3  . LEU A 1 316 ? 18.118  -9.571  10.557  1.00 71.34 ? 316 LEU A HB3  1  
ATOM 5121   H HG   . LEU A 1 316 ? 19.472  -10.476 8.069   1.00 42.31 ? 316 LEU A HG   1  
ATOM 5122   H HD11 . LEU A 1 316 ? 20.697  -8.556  10.042  1.00 21.12 ? 316 LEU A HD11 1  
ATOM 5123   H HD12 . LEU A 1 316 ? 20.417  -8.272  8.325   1.00 24.40 ? 316 LEU A HD12 1  
ATOM 5124   H HD13 . LEU A 1 316 ? 21.596  -9.479  8.838   1.00 14.53 ? 316 LEU A HD13 1  
ATOM 5125   H HD21 . LEU A 1 316 ? 20.747  -11.789 9.568   1.00 34.54 ? 316 LEU A HD21 1  
ATOM 5126   H HD22 . LEU A 1 316 ? 19.077  -11.879 10.129  1.00 23.34 ? 316 LEU A HD22 1  
ATOM 5127   H HD23 . LEU A 1 316 ? 20.231  -10.833 10.958  1.00 62.44 ? 316 LEU A HD23 1  
ATOM 5128   N N    . TYR A 1 317 ? 14.663  -10.536 9.385   1.00 31.02 ? 317 TYR A N    1  
ATOM 5129   C CA   . TYR A 1 317 ? 13.410  -10.344 10.105  1.00 24.33 ? 317 TYR A CA   1  
ATOM 5130   C C    . TYR A 1 317 ? 13.549  -10.786 11.558  1.00 12.24 ? 317 TYR A C    1  
ATOM 5131   O O    . TYR A 1 317 ? 13.028  -10.139 12.467  1.00 5.54  ? 317 TYR A O    1  
ATOM 5132   C CB   . TYR A 1 317 ? 12.283  -11.125 9.427   1.00 75.31 ? 317 TYR A CB   1  
ATOM 5133   C CG   . TYR A 1 317 ? 11.633  -10.381 8.282   1.00 52.44 ? 317 TYR A CG   1  
ATOM 5134   C CD1  . TYR A 1 317 ? 12.326  -10.144 7.101   1.00 21.20 ? 317 TYR A CD1  1  
ATOM 5135   C CD2  . TYR A 1 317 ? 10.328  -9.916  8.382   1.00 44.41 ? 317 TYR A CD2  1  
ATOM 5136   C CE1  . TYR A 1 317 ? 11.736  -9.463  6.053   1.00 15.10 ? 317 TYR A CE1  1  
ATOM 5137   C CE2  . TYR A 1 317 ? 9.731   -9.236  7.338   1.00 72.41 ? 317 TYR A CE2  1  
ATOM 5138   C CZ   . TYR A 1 317 ? 10.439  -9.012  6.176   1.00 52.14 ? 317 TYR A CZ   1  
ATOM 5139   O OH   . TYR A 1 317 ? 9.848   -8.335  5.134   1.00 11.14 ? 317 TYR A OH   1  
ATOM 5140   H H    . TYR A 1 317 ? 14.713  -11.219 8.684   1.00 61.53 ? 317 TYR A H    1  
ATOM 5141   H HA   . TYR A 1 317 ? 13.172  -9.291  10.082  1.00 52.21 ? 317 TYR A HA   1  
ATOM 5142   H HB2  . TYR A 1 317 ? 12.679  -12.051 9.037   1.00 11.11 ? 317 TYR A HB2  1  
ATOM 5143   H HB3  . TYR A 1 317 ? 11.518  -11.346 10.157  1.00 1.53  ? 317 TYR A HB3  1  
ATOM 5144   H HD1  . TYR A 1 317 ? 13.341  -10.499 7.008   1.00 73.24 ? 317 TYR A HD1  1  
ATOM 5145   H HD2  . TYR A 1 317 ? 9.776   -10.092 9.294   1.00 32.53 ? 317 TYR A HD2  1  
ATOM 5146   H HE1  . TYR A 1 317 ? 12.290  -9.289  5.143   1.00 41.54 ? 317 TYR A HE1  1  
ATOM 5147   H HE2  . TYR A 1 317 ? 8.715   -8.882  7.435   1.00 10.31 ? 317 TYR A HE2  1  
ATOM 5148   H HH   . TYR A 1 317 ? 10.080  -8.757  4.304   1.00 2.34  ? 317 TYR A HH   1  
ATOM 5149   N N    . GLU A 1 318 ? 14.258  -11.890 11.768  1.00 75.01 ? 318 GLU A N    1  
ATOM 5150   C CA   . GLU A 1 318 ? 14.470  -12.420 13.111  1.00 21.24 ? 318 GLU A CA   1  
ATOM 5151   C C    . GLU A 1 318 ? 15.153  -11.386 14.000  1.00 44.43 ? 318 GLU A C    1  
ATOM 5152   O O    . GLU A 1 318 ? 14.637  -11.023 15.057  1.00 20.33 ? 318 GLU A O    1  
ATOM 5153   C CB   . GLU A 1 318 ? 15.311  -13.697 13.052  1.00 15.13 ? 318 GLU A CB   1  
ATOM 5154   C CG   . GLU A 1 318 ? 15.179  -14.569 14.290  1.00 11.11 ? 318 GLU A CG   1  
ATOM 5155   C CD   . GLU A 1 318 ? 15.342  -16.045 13.982  1.00 4.54  ? 318 GLU A CD   1  
ATOM 5156   O OE1  . GLU A 1 318 ? 16.489  -16.537 14.023  1.00 33.13 ? 318 GLU A OE1  1  
ATOM 5157   O OE2  . GLU A 1 318 ? 14.322  -16.709 13.701  1.00 12.24 ? 318 GLU A OE2  1  
ATOM 5158   H H    . GLU A 1 318 ? 14.648  -12.359 11.001  1.00 13.50 ? 318 GLU A H    1  
ATOM 5159   H HA   . GLU A 1 318 ? 13.503  -12.654 13.530  1.00 42.12 ? 318 GLU A HA   1  
ATOM 5160   H HB2  . GLU A 1 318 ? 15.004  -14.277 12.195  1.00 4.33  ? 318 GLU A HB2  1  
ATOM 5161   H HB3  . GLU A 1 318 ? 16.350  -13.424 12.939  1.00 73.21 ? 318 GLU A HB3  1  
ATOM 5162   H HG2  . GLU A 1 318 ? 15.938  -14.280 15.001  1.00 14.24 ? 318 GLU A HG2  1  
ATOM 5163   H HG3  . GLU A 1 318 ? 14.202  -14.412 14.723  1.00 64.01 ? 318 GLU A HG3  1  
ATOM 5164   N N    . ASN A 1 319 ? 16.316  -10.915 13.562  1.00 1.41  ? 319 ASN A N    1  
ATOM 5165   C CA   . ASN A 1 319 ? 17.072  -9.920  14.316  1.00 34.33 ? 319 ASN A CA   1  
ATOM 5166   C C    . ASN A 1 319 ? 16.199  -8.715  14.656  1.00 3.11  ? 319 ASN A C    1  
ATOM 5167   O O    . ASN A 1 319 ? 15.983  -8.402  15.827  1.00 73.23 ? 319 ASN A O    1  
ATOM 5168   C CB   . ASN A 1 319 ? 18.297  -9.468  13.519  1.00 64.04 ? 319 ASN A CB   1  
ATOM 5169   C CG   . ASN A 1 319 ? 19.238  -8.610  14.343  1.00 75.22 ? 319 ASN A CG   1  
ATOM 5170   O OD1  . ASN A 1 319 ? 19.078  -7.392  14.420  1.00 53.31 ? 319 ASN A OD1  1  
ATOM 5171   N ND2  . ASN A 1 319 ? 20.226  -9.243  14.963  1.00 64.23 ? 319 ASN A ND2  1  
ATOM 5172   H H    . ASN A 1 319 ? 16.673  -11.245 12.711  1.00 34.42 ? 319 ASN A H    1  
ATOM 5173   H HA   . ASN A 1 319 ? 17.401  -10.381 15.235  1.00 10.40 ? 319 ASN A HA   1  
ATOM 5174   H HB2  . ASN A 1 319 ? 18.839  -10.338 13.179  1.00 33.02 ? 319 ASN A HB2  1  
ATOM 5175   H HB3  . ASN A 1 319 ? 17.971  -8.894  12.664  1.00 14.22 ? 319 ASN A HB3  1  
ATOM 5176   H HD21 . ASN A 1 319 ? 20.292  -10.215 14.856  1.00 0.13  ? 319 ASN A HD21 1  
ATOM 5177   H HD22 . ASN A 1 319 ? 20.849  -8.713  15.503  1.00 63.03 ? 319 ASN A HD22 1  
ATOM 5178   N N    . LEU A 1 320 ? 15.701  -8.041  13.623  1.00 13.10 ? 320 LEU A N    1  
ATOM 5179   C CA   . LEU A 1 320 ? 14.852  -6.868  13.809  1.00 44.21 ? 320 LEU A CA   1  
ATOM 5180   C C    . LEU A 1 320 ? 13.668  -7.184  14.718  1.00 12.14 ? 320 LEU A C    1  
ATOM 5181   O O    . LEU A 1 320 ? 13.239  -6.344  15.509  1.00 24.22 ? 320 LEU A O    1  
ATOM 5182   C CB   . LEU A 1 320 ? 14.347  -6.359  12.457  1.00 11.31 ? 320 LEU A CB   1  
ATOM 5183   C CG   . LEU A 1 320 ? 15.439  -6.066  11.427  1.00 25.30 ? 320 LEU A CG   1  
ATOM 5184   C CD1  . LEU A 1 320 ? 14.938  -6.358  10.021  1.00 40.32 ? 320 LEU A CD1  1  
ATOM 5185   C CD2  . LEU A 1 320 ? 15.903  -4.622  11.539  1.00 73.44 ? 320 LEU A CD2  1  
ATOM 5186   H H    . LEU A 1 320 ? 15.912  -8.337  12.713  1.00 35.41 ? 320 LEU A H    1  
ATOM 5187   H HA   . LEU A 1 320 ? 15.450  -6.098  14.272  1.00 60.03 ? 320 LEU A HA   1  
ATOM 5188   H HB2  . LEU A 1 320 ? 13.679  -7.101  12.044  1.00 24.33 ? 320 LEU A HB2  1  
ATOM 5189   H HB3  . LEU A 1 320 ? 13.789  -5.450  12.625  1.00 41.51 ? 320 LEU A HB3  1  
ATOM 5190   H HG   . LEU A 1 320 ? 16.287  -6.707  11.618  1.00 30.12 ? 320 LEU A HG   1  
ATOM 5191   H HD11 . LEU A 1 320 ? 14.326  -7.248  10.034  1.00 13.11 ? 320 LEU A HD11 1  
ATOM 5192   H HD12 . LEU A 1 320 ? 15.780  -6.511  9.363   1.00 64.53 ? 320 LEU A HD12 1  
ATOM 5193   H HD13 . LEU A 1 320 ? 14.351  -5.523  9.667   1.00 40.31 ? 320 LEU A HD13 1  
ATOM 5194   H HD21 . LEU A 1 320 ? 15.388  -4.020  10.805  1.00 54.33 ? 320 LEU A HD21 1  
ATOM 5195   H HD22 . LEU A 1 320 ? 16.968  -4.571  11.364  1.00 34.44 ? 320 LEU A HD22 1  
ATOM 5196   H HD23 . LEU A 1 320 ? 15.683  -4.249  12.529  1.00 42.43 ? 320 LEU A HD23 1  
ATOM 5197   N N    . ARG A 1 321 ? 13.145  -8.401  14.603  1.00 40.31 ? 321 ARG A N    1  
ATOM 5198   C CA   . ARG A 1 321 ? 12.012  -8.824  15.417  1.00 72.25 ? 321 ARG A CA   1  
ATOM 5199   C C    . ARG A 1 321 ? 12.355  -8.750  16.902  1.00 73.15 ? 321 ARG A C    1  
ATOM 5200   O O    . ARG A 1 321 ? 11.497  -8.453  17.734  1.00 23.52 ? 321 ARG A O    1  
ATOM 5201   C CB   . ARG A 1 321 ? 11.594  -10.249 15.047  1.00 2.43  ? 321 ARG A CB   1  
ATOM 5202   C CG   . ARG A 1 321 ? 10.475  -10.307 14.020  1.00 54.54 ? 321 ARG A CG   1  
ATOM 5203   C CD   . ARG A 1 321 ? 9.896   -11.708 13.906  1.00 45.43 ? 321 ARG A CD   1  
ATOM 5204   N NE   . ARG A 1 321 ? 8.483   -11.687 13.536  1.00 74.10 ? 321 ARG A NE   1  
ATOM 5205   C CZ   . ARG A 1 321 ? 7.657   -12.718 13.706  1.00 35.14 ? 321 ARG A CZ   1  
ATOM 5206   N NH1  . ARG A 1 321 ? 8.099   -13.850 14.238  1.00 24.03 ? 321 ARG A NH1  1  
ATOM 5207   N NH2  . ARG A 1 321 ? 6.386   -12.615 13.343  1.00 75.05 ? 321 ARG A NH2  1  
ATOM 5208   H H    . ARG A 1 321 ? 13.530  -9.029  13.956  1.00 62.15 ? 321 ARG A H    1  
ATOM 5209   H HA   . ARG A 1 321 ? 11.190  -8.154  15.216  1.00 12.43 ? 321 ARG A HA   1  
ATOM 5210   H HB2  . ARG A 1 321 ? 12.450  -10.770 14.645  1.00 75.15 ? 321 ARG A HB2  1  
ATOM 5211   H HB3  . ARG A 1 321 ? 11.260  -10.758 15.940  1.00 50.35 ? 321 ARG A HB3  1  
ATOM 5212   H HG2  . ARG A 1 321 ? 9.691   -9.628  14.317  1.00 25.40 ? 321 ARG A HG2  1  
ATOM 5213   H HG3  . ARG A 1 321 ? 10.867  -10.010 13.058  1.00 51.15 ? 321 ARG A HG3  1  
ATOM 5214   H HD2  . ARG A 1 321 ? 10.447  -12.251 13.153  1.00 61.21 ? 321 ARG A HD2  1  
ATOM 5215   H HD3  . ARG A 1 321 ? 10.003  -12.206 14.858  1.00 23.14 ? 321 ARG A HD3  1  
ATOM 5216   H HE   . ARG A 1 321 ? 8.131   -10.863 13.140  1.00 73.54 ? 321 ARG A HE   1  
ATOM 5217   H HH11 . ARG A 1 321 ? 9.056   -13.935 14.514  1.00 4.41  ? 321 ARG A HH11 1  
ATOM 5218   H HH12 . ARG A 1 321 ? 7.474   -14.621 14.363  1.00 53.41 ? 321 ARG A HH12 1  
ATOM 5219   H HH21 . ARG A 1 321 ? 6.048   -11.764 12.941  1.00 20.53 ? 321 ARG A HH21 1  
ATOM 5220   H HH22 . ARG A 1 321 ? 5.766   -13.389 13.470  1.00 65.22 ? 321 ARG A HH22 1  
ATOM 5221   N N    . ASP A 1 322 ? 13.615  -9.017  17.225  1.00 54.00 ? 322 ASP A N    1  
ATOM 5222   C CA   . ASP A 1 322 ? 14.075  -8.977  18.608  1.00 43.32 ? 322 ASP A CA   1  
ATOM 5223   C C    . ASP A 1 322 ? 14.158  -7.539  19.108  1.00 3.24  ? 322 ASP A C    1  
ATOM 5224   O O    . ASP A 1 322 ? 13.959  -7.270  20.292  1.00 24.34 ? 322 ASP A O    1  
ATOM 5225   C CB   . ASP A 1 322 ? 15.441  -9.654  18.734  1.00 74.10 ? 322 ASP A CB   1  
ATOM 5226   C CG   . ASP A 1 322 ? 15.330  -11.159 18.878  1.00 40.42 ? 322 ASP A CG   1  
ATOM 5227   O OD1  . ASP A 1 322 ? 14.787  -11.805 17.957  1.00 60.53 ? 322 ASP A OD1  1  
ATOM 5228   O OD2  . ASP A 1 322 ? 15.786  -11.692 19.911  1.00 2.12  ? 322 ASP A OD2  1  
ATOM 5229   H H    . ASP A 1 322 ? 14.253  -9.244  16.516  1.00 41.32 ? 322 ASP A H    1  
ATOM 5230   H HA   . ASP A 1 322 ? 13.359  -9.515  19.211  1.00 11.35 ? 322 ASP A HA   1  
ATOM 5231   H HB2  . ASP A 1 322 ? 16.025  -9.438  17.852  1.00 24.24 ? 322 ASP A HB2  1  
ATOM 5232   H HB3  . ASP A 1 322 ? 15.950  -9.264  19.603  1.00 13.53 ? 322 ASP A HB3  1  
ATOM 5233   N N    . ILE A 1 323 ? 14.453  -6.618  18.196  1.00 30.04 ? 323 ILE A N    1  
ATOM 5234   C CA   . ILE A 1 323 ? 14.561  -5.206  18.543  1.00 4.42  ? 323 ILE A CA   1  
ATOM 5235   C C    . ILE A 1 323 ? 13.200  -4.630  18.917  1.00 55.53 ? 323 ILE A C    1  
ATOM 5236   O O    . ILE A 1 323 ? 13.100  -3.761  19.783  1.00 70.21 ? 323 ILE A O    1  
ATOM 5237   C CB   . ILE A 1 323 ? 15.155  -4.384  17.382  1.00 74.03 ? 323 ILE A CB   1  
ATOM 5238   C CG1  . ILE A 1 323 ? 16.444  -5.033  16.875  1.00 74.12 ? 323 ILE A CG1  1  
ATOM 5239   C CG2  . ILE A 1 323 ? 15.415  -2.952  17.825  1.00 61.55 ? 323 ILE A CG2  1  
ATOM 5240   C CD1  . ILE A 1 323 ? 17.087  -4.284  15.728  1.00 43.43 ? 323 ILE A CD1  1  
ATOM 5241   H H    . ILE A 1 323 ? 14.600  -6.894  17.267  1.00 72.34 ? 323 ILE A H    1  
ATOM 5242   H HA   . ILE A 1 323 ? 15.223  -5.122  19.393  1.00 31.45 ? 323 ILE A HA   1  
ATOM 5243   H HB   . ILE A 1 323 ? 14.432  -4.362  16.580  1.00 63.23 ? 323 ILE A HB   1  
ATOM 5244   H HG12 . ILE A 1 323 ? 17.159  -5.078  17.683  1.00 54.34 ? 323 ILE A HG12 1  
ATOM 5245   H HG13 . ILE A 1 323 ? 16.227  -6.035  16.537  1.00 22.13 ? 323 ILE A HG13 1  
ATOM 5246   H HG21 . ILE A 1 323 ? 14.798  -2.722  18.681  1.00 2.35  ? 323 ILE A HG21 1  
ATOM 5247   H HG22 . ILE A 1 323 ? 15.175  -2.276  17.017  1.00 20.33 ? 323 ILE A HG22 1  
ATOM 5248   H HG23 . ILE A 1 323 ? 16.456  -2.840  18.090  1.00 10.13 ? 323 ILE A HG23 1  
ATOM 5249   H HD11 . ILE A 1 323 ? 16.855  -4.781  14.798  1.00 1.30  ? 323 ILE A HD11 1  
ATOM 5250   H HD12 . ILE A 1 323 ? 18.158  -4.263  15.867  1.00 60.12 ? 323 ILE A HD12 1  
ATOM 5251   H HD13 . ILE A 1 323 ? 16.708  -3.273  15.700  1.00 24.32 ? 323 ILE A HD13 1  
ATOM 5252   N N    . LEU A 1 324 ? 12.154  -5.121  18.259  1.00 3.02  ? 324 LEU A N    1  
ATOM 5253   C CA   . LEU A 1 324 ? 10.798  -4.655  18.525  1.00 14.51 ? 324 LEU A CA   1  
ATOM 5254   C C    . LEU A 1 324 ? 10.371  -5.019  19.943  1.00 43.23 ? 324 LEU A C    1  
ATOM 5255   O O    . LEU A 1 324 ? 10.008  -4.148  20.736  1.00 21.12 ? 324 LEU A O    1  
ATOM 5256   C CB   . LEU A 1 324 ? 9.822   -5.259  17.513  1.00 34.44 ? 324 LEU A CB   1  
ATOM 5257   C CG   . LEU A 1 324 ? 9.592   -4.419  16.255  1.00 53.12 ? 324 LEU A CG   1  
ATOM 5258   C CD1  . LEU A 1 324 ? 8.831   -3.147  16.595  1.00 40.15 ? 324 LEU A CD1  1  
ATOM 5259   C CD2  . LEU A 1 324 ? 10.917  -4.086  15.587  1.00 34.33 ? 324 LEU A CD2  1  
ATOM 5260   H H    . LEU A 1 324 ? 12.298  -5.813  17.581  1.00 53.10 ? 324 LEU A H    1  
ATOM 5261   H HA   . LEU A 1 324 ? 10.791  -3.580  18.423  1.00 3.43  ? 324 LEU A HA   1  
ATOM 5262   H HB2  . LEU A 1 324 ? 10.201  -6.225  17.211  1.00 33.44 ? 324 LEU A HB2  1  
ATOM 5263   H HB3  . LEU A 1 324 ? 8.870   -5.401  18.002  1.00 53.52 ? 324 LEU A HB3  1  
ATOM 5264   H HG   . LEU A 1 324 ? 8.996   -4.986  15.555  1.00 14.12 ? 324 LEU A HG   1  
ATOM 5265   H HD11 . LEU A 1 324 ? 7.883   -3.403  17.044  1.00 51.45 ? 324 LEU A HD11 1  
ATOM 5266   H HD12 . LEU A 1 324 ? 8.660   -2.578  15.693  1.00 32.41 ? 324 LEU A HD12 1  
ATOM 5267   H HD13 . LEU A 1 324 ? 9.410   -2.556  17.289  1.00 71.14 ? 324 LEU A HD13 1  
ATOM 5268   H HD21 . LEU A 1 324 ? 10.732  -3.557  14.663  1.00 13.33 ? 324 LEU A HD21 1  
ATOM 5269   H HD22 . LEU A 1 324 ? 11.454  -4.999  15.377  1.00 14.31 ? 324 LEU A HD22 1  
ATOM 5270   H HD23 . LEU A 1 324 ? 11.506  -3.464  16.245  1.00 72.44 ? 324 LEU A HD23 1  
ATOM 5271   N N    . LEU A 1 325 ? 10.419  -6.309  20.259  1.00 13.24 ? 325 LEU A N    1  
ATOM 5272   C CA   . LEU A 1 325 ? 10.040  -6.786  21.583  1.00 2.42  ? 325 LEU A CA   1  
ATOM 5273   C C    . LEU A 1 325 ? 10.898  -6.130  22.659  1.00 54.24 ? 325 LEU A C    1  
ATOM 5274   O O    . LEU A 1 325 ? 10.435  -5.881  23.772  1.00 10.24 ? 325 LEU A O    1  
ATOM 5275   C CB   . LEU A 1 325 ? 10.178  -8.308  21.660  1.00 34.42 ? 325 LEU A CB   1  
ATOM 5276   C CG   . LEU A 1 325 ? 8.995   -9.096  21.096  1.00 61.41 ? 325 LEU A CG   1  
ATOM 5277   C CD1  . LEU A 1 325 ? 9.230   -10.591 21.245  1.00 11.12 ? 325 LEU A CD1  1  
ATOM 5278   C CD2  . LEU A 1 325 ? 7.704   -8.685  21.789  1.00 3.24  ? 325 LEU A CD2  1  
ATOM 5279   H H    . LEU A 1 325 ? 10.719  -6.956  19.586  1.00 2.32  ? 325 LEU A H    1  
ATOM 5280   H HA   . LEU A 1 325 ? 9.007   -6.518  21.750  1.00 3.11  ? 325 LEU A HA   1  
ATOM 5281   H HB2  . LEU A 1 325 ? 11.067  -8.595  21.117  1.00 44.03 ? 325 LEU A HB2  1  
ATOM 5282   H HB3  . LEU A 1 325 ? 10.305  -8.585  22.696  1.00 71.41 ? 325 LEU A HB3  1  
ATOM 5283   H HG   . LEU A 1 325 ? 8.895   -8.877  20.043  1.00 53.14 ? 325 LEU A HG   1  
ATOM 5284   H HD11 . LEU A 1 325 ? 9.223   -10.854 22.292  1.00 30.50 ? 325 LEU A HD11 1  
ATOM 5285   H HD12 . LEU A 1 325 ? 10.186  -10.850 20.815  1.00 34.04 ? 325 LEU A HD12 1  
ATOM 5286   H HD13 . LEU A 1 325 ? 8.447   -11.131 20.733  1.00 75.11 ? 325 LEU A HD13 1  
ATOM 5287   H HD21 . LEU A 1 325 ? 7.281   -7.830  21.284  1.00 25.22 ? 325 LEU A HD21 1  
ATOM 5288   H HD22 . LEU A 1 325 ? 7.913   -8.429  22.817  1.00 12.32 ? 325 LEU A HD22 1  
ATOM 5289   H HD23 . LEU A 1 325 ? 7.002   -9.505  21.758  1.00 31.24 ? 325 LEU A HD23 1  
ATOM 5290   N N    . GLN A 1 326 ? 12.152  -5.851  22.317  1.00 63.25 ? 326 GLN A N    1  
ATOM 5291   C CA   . GLN A 1 326 ? 13.077  -5.221  23.252  1.00 1.11  ? 326 GLN A CA   1  
ATOM 5292   C C    . GLN A 1 326 ? 12.650  -3.787  23.548  1.00 51.41 ? 326 GLN A C    1  
ATOM 5293   O O    . GLN A 1 326 ? 12.834  -3.292  24.660  1.00 24.23 ? 326 GLN A O    1  
ATOM 5294   C CB   . GLN A 1 326 ? 14.499  -5.240  22.686  1.00 53.11 ? 326 GLN A CB   1  
ATOM 5295   C CG   . GLN A 1 326 ? 15.399  -6.277  23.339  1.00 13.11 ? 326 GLN A CG   1  
ATOM 5296   C CD   . GLN A 1 326 ? 15.634  -7.486  22.455  1.00 71.23 ? 326 GLN A CD   1  
ATOM 5297   O OE1  . GLN A 1 326 ? 14.823  -8.412  22.422  1.00 0.12  ? 326 GLN A OE1  1  
ATOM 5298   N NE2  . GLN A 1 326 ? 16.749  -7.484  21.734  1.00 14.35 ? 326 GLN A NE2  1  
ATOM 5299   H H    . GLN A 1 326 ? 12.462  -6.073  21.414  1.00 41.14 ? 326 GLN A H    1  
ATOM 5300   H HA   . GLN A 1 326 ? 13.056  -5.787  24.171  1.00 2.31  ? 326 GLN A HA   1  
ATOM 5301   H HB2  . GLN A 1 326 ? 14.450  -5.453  21.628  1.00 23.42 ? 326 GLN A HB2  1  
ATOM 5302   H HB3  . GLN A 1 326 ? 14.946  -4.267  22.828  1.00 62.43 ? 326 GLN A HB3  1  
ATOM 5303   H HG2  . GLN A 1 326 ? 16.353  -5.820  23.558  1.00 53.43 ? 326 GLN A HG2  1  
ATOM 5304   H HG3  . GLN A 1 326 ? 14.939  -6.605  24.259  1.00 35.32 ? 326 GLN A HG3  1  
ATOM 5305   H HE21 . GLN A 1 326 ? 17.349  -6.713  21.811  1.00 61.11 ? 326 GLN A HE21 1  
ATOM 5306   H HE22 . GLN A 1 326 ? 16.926  -8.254  21.153  1.00 53.35 ? 326 GLN A HE22 1  
ATOM 5307   N N    . GLY A 1 327 ? 12.078  -3.126  22.547  1.00 63.11 ? 327 GLY A N    1  
ATOM 5308   C CA   . GLY A 1 327 ? 11.632  -1.756  22.723  1.00 32.45 ? 327 GLY A CA   1  
ATOM 5309   C C    . GLY A 1 327 ? 10.533  -1.638  23.758  1.00 41.11 ? 327 GLY A C    1  
ATOM 5310   O O    . GLY A 1 327 ? 10.528  -0.708  24.566  1.00 32.50 ? 327 GLY A O    1  
ATOM 5311   H H    . GLY A 1 327 ? 11.955  -3.571  21.683  1.00 41.24 ? 327 GLY A H    1  
ATOM 5312   H HA2  . GLY A 1 327 ? 12.472  -1.153  23.034  1.00 45.03 ? 327 GLY A HA2  1  
ATOM 5313   H HA3  . GLY A 1 327 ? 11.264  -1.384  21.778  1.00 63.23 ? 327 GLY A HA3  1  
ATOM 5314   N N    . LEU A 1 328 ? 9.603   -2.586  23.740  1.00 51.42 ? 328 LEU A N    1  
ATOM 5315   C CA   . LEU A 1 328 ? 8.496   -2.588  24.690  1.00 33.53 ? 328 LEU A CA   1  
ATOM 5316   C C    . LEU A 1 328 ? 8.980   -3.006  26.074  1.00 62.00 ? 328 LEU A C    1  
ATOM 5317   O O    . LEU A 1 328 ? 8.638   -2.382  27.078  1.00 33.45 ? 328 LEU A O    1  
ATOM 5318   C CB   . LEU A 1 328 ? 7.389   -3.532  24.214  1.00 72.11 ? 328 LEU A CB   1  
ATOM 5319   C CG   . LEU A 1 328 ? 7.032   -3.416  22.731  1.00 62.30 ? 328 LEU A CG   1  
ATOM 5320   C CD1  . LEU A 1 328 ? 6.187   -4.601  22.292  1.00 50.55 ? 328 LEU A CD1  1  
ATOM 5321   C CD2  . LEU A 1 328 ? 6.303   -2.109  22.460  1.00 74.21 ? 328 LEU A CD2  1  
ATOM 5322   H H    . LEU A 1 328 ? 9.665   -3.307  23.078  1.00 14.44 ? 328 LEU A H    1  
ATOM 5323   H HA   . LEU A 1 328 ? 8.104   -1.584  24.745  1.00 34.02 ? 328 LEU A HA   1  
ATOM 5324   H HB2  . LEU A 1 328 ? 7.702   -4.547  24.410  1.00 22.40 ? 328 LEU A HB2  1  
ATOM 5325   H HB3  . LEU A 1 328 ? 6.500   -3.329  24.792  1.00 2.23  ? 328 LEU A HB3  1  
ATOM 5326   H HG   . LEU A 1 328 ? 7.941   -3.420  22.147  1.00 32.30 ? 328 LEU A HG   1  
ATOM 5327   H HD11 . LEU A 1 328 ? 5.483   -4.282  21.538  1.00 23.22 ? 328 LEU A HD11 1  
ATOM 5328   H HD12 . LEU A 1 328 ? 5.651   -4.996  23.142  1.00 11.23 ? 328 LEU A HD12 1  
ATOM 5329   H HD13 . LEU A 1 328 ? 6.828   -5.368  21.883  1.00 54.12 ? 328 LEU A HD13 1  
ATOM 5330   H HD21 . LEU A 1 328 ? 5.801   -1.783  23.359  1.00 30.15 ? 328 LEU A HD21 1  
ATOM 5331   H HD22 . LEU A 1 328 ? 5.576   -2.258  21.676  1.00 51.20 ? 328 LEU A HD22 1  
ATOM 5332   H HD23 . LEU A 1 328 ? 7.015   -1.357  22.153  1.00 72.23 ? 328 LEU A HD23 1  
ATOM 5333   N N    . LYS A 1 329 ? 9.783   -4.063  26.115  1.00 44.52 ? 329 LYS A N    1  
ATOM 5334   C CA   . LYS A 1 329 ? 10.324  -4.564  27.372  1.00 74.15 ? 329 LYS A CA   1  
ATOM 5335   C C    . LYS A 1 329 ? 11.210  -3.513  28.032  1.00 24.15 ? 329 LYS A C    1  
ATOM 5336   O O    . LYS A 1 329 ? 11.316  -3.454  29.257  1.00 42.34 ? 329 LYS A O    1  
ATOM 5337   C CB   . LYS A 1 329 ? 11.122  -5.847  27.135  1.00 2.23  ? 329 LYS A CB   1  
ATOM 5338   C CG   . LYS A 1 329 ? 10.269  -7.105  27.138  1.00 35.33 ? 329 LYS A CG   1  
ATOM 5339   C CD   . LYS A 1 329 ? 11.114  -8.353  26.942  1.00 0.12  ? 329 LYS A CD   1  
ATOM 5340   C CE   . LYS A 1 329 ? 10.451  -9.576  27.554  1.00 62.45 ? 329 LYS A CE   1  
ATOM 5341   N NZ   . LYS A 1 329 ? 11.198  -10.827 27.242  1.00 65.43 ? 329 LYS A NZ   1  
ATOM 5342   H H    . LYS A 1 329 ? 10.021  -4.512  25.276  1.00 24.32 ? 329 LYS A H    1  
ATOM 5343   H HA   . LYS A 1 329 ? 9.494   -4.782  28.027  1.00 14.04 ? 329 LYS A HA   1  
ATOM 5344   H HB2  . LYS A 1 329 ? 11.619  -5.777  26.178  1.00 44.14 ? 329 LYS A HB2  1  
ATOM 5345   H HB3  . LYS A 1 329 ? 11.868  -5.942  27.911  1.00 24.23 ? 329 LYS A HB3  1  
ATOM 5346   H HG2  . LYS A 1 329 ? 9.754   -7.176  28.084  1.00 14.55 ? 329 LYS A HG2  1  
ATOM 5347   H HG3  . LYS A 1 329 ? 9.547   -7.040  26.337  1.00 45.41 ? 329 LYS A HG3  1  
ATOM 5348   H HD2  . LYS A 1 329 ? 11.250  -8.521  25.884  1.00 74.01 ? 329 LYS A HD2  1  
ATOM 5349   H HD3  . LYS A 1 329 ? 12.075  -8.202  27.411  1.00 55.22 ? 329 LYS A HD3  1  
ATOM 5350   H HE2  . LYS A 1 329 ? 10.411  -9.450  28.625  1.00 20.42 ? 329 LYS A HE2  1  
ATOM 5351   H HE3  . LYS A 1 329 ? 9.448   -9.659  27.163  1.00 51.52 ? 329 LYS A HE3  1  
ATOM 5352   H HZ1  . LYS A 1 329 ? 12.220  -10.636 27.217  1.00 63.42 ? 329 LYS A HZ1  1  
ATOM 5353   H HZ2  . LYS A 1 329 ? 10.903  -11.198 26.317  1.00 4.42  ? 329 LYS A HZ2  1  
ATOM 5354   H HZ3  . LYS A 1 329 ? 11.008  -11.546 27.969  1.00 23.14 ? 329 LYS A HZ3  1  
ATOM 5355   N N    . ALA A 1 330 ? 11.844  -2.683  27.209  1.00 45.14 ? 330 ALA A N    1  
ATOM 5356   C CA   . ALA A 1 330 ? 12.720  -1.631  27.708  1.00 64.34 ? 330 ALA A CA   1  
ATOM 5357   C C    . ALA A 1 330 ? 11.920  -0.538  28.408  1.00 74.54 ? 330 ALA A C    1  
ATOM 5358   O O    . ALA A 1 330 ? 12.364  0.025   29.409  1.00 24.43 ? 330 ALA A O    1  
ATOM 5359   C CB   . ALA A 1 330 ? 13.538  -1.041  26.568  1.00 5.14  ? 330 ALA A CB   1  
ATOM 5360   H H    . ALA A 1 330 ? 11.717  -2.781  26.242  1.00 54.11 ? 330 ALA A H    1  
ATOM 5361   H HA   . ALA A 1 330 ? 13.403  -2.074  28.418  1.00 64.52 ? 330 ALA A HA   1  
ATOM 5362   H HB1  . ALA A 1 330 ? 14.055  -0.159  26.915  1.00 3.40  ? 330 ALA A HB1  1  
ATOM 5363   H HB2  . ALA A 1 330 ? 12.881  -0.777  25.753  1.00 0.32  ? 330 ALA A HB2  1  
ATOM 5364   H HB3  . ALA A 1 330 ? 14.259  -1.770  26.228  1.00 61.44 ? 330 ALA A HB3  1  
ATOM 5365   N N    . ILE A 1 331 ? 10.738  -0.241  27.875  1.00 45.32 ? 331 ILE A N    1  
ATOM 5366   C CA   . ILE A 1 331 ? 9.877   0.785   28.452  1.00 53.22 ? 331 ILE A CA   1  
ATOM 5367   C C    . ILE A 1 331 ? 8.839   0.177   29.391  1.00 55.41 ? 331 ILE A C    1  
ATOM 5368   O O    . ILE A 1 331 ? 7.781   0.762   29.623  1.00 4.10  ? 331 ILE A O    1  
ATOM 5369   C CB   . ILE A 1 331 ? 9.152   1.592   27.357  1.00 32.52 ? 331 ILE A CB   1  
ATOM 5370   C CG1  . ILE A 1 331 ? 8.299   0.665   26.489  1.00 71.04 ? 331 ILE A CG1  1  
ATOM 5371   C CG2  . ILE A 1 331 ? 10.158  2.349   26.503  1.00 72.30 ? 331 ILE A CG2  1  
ATOM 5372   C CD1  . ILE A 1 331 ? 7.033   1.316   25.975  1.00 22.14 ? 331 ILE A CD1  1  
ATOM 5373   H H    . ILE A 1 331 ? 10.438  -0.724  27.076  1.00 24.01 ? 331 ILE A H    1  
ATOM 5374   H HA   . ILE A 1 331 ? 10.501  1.465   29.014  1.00 22.34 ? 331 ILE A HA   1  
ATOM 5375   H HB   . ILE A 1 331 ? 8.511   2.314   27.839  1.00 54.04 ? 331 ILE A HB   1  
ATOM 5376   H HG12 . ILE A 1 331 ? 8.877   0.349   25.634  1.00 12.50 ? 331 ILE A HG12 1  
ATOM 5377   H HG13 . ILE A 1 331 ? 8.016   -0.202  27.068  1.00 21.02 ? 331 ILE A HG13 1  
ATOM 5378   H HG21 . ILE A 1 331 ? 10.373  1.780   25.611  1.00 71.55 ? 331 ILE A HG21 1  
ATOM 5379   H HG22 . ILE A 1 331 ? 11.069  2.496   27.065  1.00 70.41 ? 331 ILE A HG22 1  
ATOM 5380   H HG23 . ILE A 1 331 ? 9.746   3.309   26.228  1.00 73.21 ? 331 ILE A HG23 1  
ATOM 5381   H HD11 . ILE A 1 331 ? 6.435   0.581   25.457  1.00 63.13 ? 331 ILE A HD11 1  
ATOM 5382   H HD12 . ILE A 1 331 ? 7.289   2.116   25.296  1.00 34.32 ? 331 ILE A HD12 1  
ATOM 5383   H HD13 . ILE A 1 331 ? 6.471   1.716   26.806  1.00 73.30 ? 331 ILE A HD13 1  
ATOM 5384   N N    . GLY A 1 332 ? 9.149   -1.000  29.932  1.00 12.42 ? 332 GLY A N    1  
ATOM 5385   C CA   . GLY A 1 332 ? 8.235   -1.668  30.845  1.00 20.51 ? 332 GLY A CA   1  
ATOM 5386   C C    . GLY A 1 332 ? 6.804   -1.688  30.340  1.00 55.55 ? 332 GLY A C    1  
ATOM 5387   O O    . GLY A 1 332 ? 5.861   -1.579  31.125  1.00 0.23  ? 332 GLY A O    1  
ATOM 5388   H H    . GLY A 1 332 ? 10.008  -1.416  29.714  1.00 55.35 ? 332 GLY A H    1  
ATOM 5389   H HA2  . GLY A 1 332 ? 8.567   -2.686  30.985  1.00 22.55 ? 332 GLY A HA2  1  
ATOM 5390   H HA3  . GLY A 1 332 ? 8.262   -1.160  31.797  1.00 64.30 ? 332 GLY A HA3  1  
ATOM 5391   N N    . SER A 1 333 ? 6.640   -1.825  29.029  1.00 12.33 ? 333 SER A N    1  
ATOM 5392   C CA   . SER A 1 333 ? 5.313   -1.856  28.425  1.00 62.03 ? 333 SER A CA   1  
ATOM 5393   C C    . SER A 1 333 ? 5.166   -3.052  27.490  1.00 31.42 ? 333 SER A C    1  
ATOM 5394   O O    . SER A 1 333 ? 6.155   -3.589  26.991  1.00 20.23 ? 333 SER A O    1  
ATOM 5395   C CB   . SER A 1 333 ? 5.049   -0.560  27.657  1.00 44.25 ? 333 SER A CB   1  
ATOM 5396   O OG   . SER A 1 333 ? 3.700   -0.150  27.796  1.00 42.41 ? 333 SER A OG   1  
ATOM 5397   H H    . SER A 1 333 ? 7.430   -1.906  28.454  1.00 13.43 ? 333 SER A H    1  
ATOM 5398   H HA   . SER A 1 333 ? 4.589   -1.946  29.220  1.00 62.04 ? 333 SER A HA   1  
ATOM 5399   H HB2  . SER A 1 333 ? 5.690   0.220   28.041  1.00 2.10  ? 333 SER A HB2  1  
ATOM 5400   H HB3  . SER A 1 333 ? 5.259   -0.715  26.609  1.00 1.34  ? 333 SER A HB3  1  
ATOM 5401   H HG   . SER A 1 333 ? 3.670   0.734   28.171  1.00 65.34 ? 333 SER A HG   1  
ATOM 5402   N N    . LYS A 1 334 ? 3.924   -3.464  27.257  1.00 22.11 ? 334 LYS A N    1  
ATOM 5403   C CA   . LYS A 1 334 ? 3.644   -4.597  26.382  1.00 53.31 ? 334 LYS A CA   1  
ATOM 5404   C C    . LYS A 1 334 ? 2.472   -4.290  25.454  1.00 22.21 ? 334 LYS A C    1  
ATOM 5405   O O    . LYS A 1 334 ? 1.719   -3.344  25.682  1.00 63.33 ? 334 LYS A O    1  
ATOM 5406   C CB   . LYS A 1 334 ? 3.341   -5.846  27.211  1.00 63.41 ? 334 LYS A CB   1  
ATOM 5407   C CG   . LYS A 1 334 ? 3.809   -7.137  26.559  1.00 55.14 ? 334 LYS A CG   1  
ATOM 5408   C CD   . LYS A 1 334 ? 4.260   -8.153  27.597  1.00 65.22 ? 334 LYS A CD   1  
ATOM 5409   C CE   . LYS A 1 334 ? 3.163   -9.159  27.904  1.00 65.10 ? 334 LYS A CE   1  
ATOM 5410   N NZ   . LYS A 1 334 ? 2.282   -8.700  29.013  1.00 11.03 ? 334 LYS A NZ   1  
ATOM 5411   H H    . LYS A 1 334 ? 3.176   -2.996  27.684  1.00 40.01 ? 334 LYS A H    1  
ATOM 5412   H HA   . LYS A 1 334 ? 4.524   -4.778  25.783  1.00 63.43 ? 334 LYS A HA   1  
ATOM 5413   H HB2  . LYS A 1 334 ? 3.828   -5.755  28.170  1.00 61.40 ? 334 LYS A HB2  1  
ATOM 5414   H HB3  . LYS A 1 334 ? 2.274   -5.912  27.364  1.00 13.20 ? 334 LYS A HB3  1  
ATOM 5415   H HG2  . LYS A 1 334 ? 2.994   -7.558  25.989  1.00 1.34  ? 334 LYS A HG2  1  
ATOM 5416   H HG3  . LYS A 1 334 ? 4.636   -6.917  25.900  1.00 30.34 ? 334 LYS A HG3  1  
ATOM 5417   H HD2  . LYS A 1 334 ? 5.123   -8.680  27.219  1.00 4.23  ? 334 LYS A HD2  1  
ATOM 5418   H HD3  . LYS A 1 334 ? 4.523   -7.632  28.505  1.00 22.54 ? 334 LYS A HD3  1  
ATOM 5419   H HE2  . LYS A 1 334 ? 2.564   -9.302  27.017  1.00 13.01 ? 334 LYS A HE2  1  
ATOM 5420   H HE3  . LYS A 1 334 ? 3.621   -10.097 28.183  1.00 31.13 ? 334 LYS A HE3  1  
ATOM 5421   H HZ1  . LYS A 1 334 ? 1.468   -9.340  29.110  1.00 41.43 ? 334 LYS A HZ1  1  
ATOM 5422   H HZ2  . LYS A 1 334 ? 1.934   -7.740  28.819  1.00 75.24 ? 334 LYS A HZ2  1  
ATOM 5423   H HZ3  . LYS A 1 334 ? 2.811   -8.690  29.909  1.00 10.20 ? 334 LYS A HZ3  1  
ATOM 5424   N N    . ASP A 1 335 ? 2.325   -5.096  24.408  1.00 21.13 ? 335 ASP A N    1  
ATOM 5425   C CA   . ASP A 1 335 ? 1.246   -4.910  23.445  1.00 24.43 ? 335 ASP A CA   1  
ATOM 5426   C C    . ASP A 1 335 ? -0.116  -4.975  24.130  1.00 52.31 ? 335 ASP A C    1  
ATOM 5427   O O    . ASP A 1 335 ? -0.693  -6.051  24.287  1.00 40.04 ? 335 ASP A O    1  
ATOM 5428   C CB   . ASP A 1 335 ? 1.326   -5.972  22.346  1.00 22.44 ? 335 ASP A CB   1  
ATOM 5429   C CG   . ASP A 1 335 ? 2.422   -5.680  21.340  1.00 54.41 ? 335 ASP A CG   1  
ATOM 5430   O OD1  . ASP A 1 335 ? 3.611   -5.795  21.706  1.00 73.44 ? 335 ASP A OD1  1  
ATOM 5431   O OD2  . ASP A 1 335 ? 2.092   -5.336  20.185  1.00 33.45 ? 335 ASP A OD2  1  
ATOM 5432   H H    . ASP A 1 335 ? 2.959   -5.833  24.279  1.00 34.44 ? 335 ASP A H    1  
ATOM 5433   H HA   . ASP A 1 335 ? 1.365   -3.934  22.999  1.00 51.12 ? 335 ASP A HA   1  
ATOM 5434   H HB2  . ASP A 1 335 ? 1.524   -6.933  22.796  1.00 24.23 ? 335 ASP A HB2  1  
ATOM 5435   H HB3  . ASP A 1 335 ? 0.382   -6.011  21.822  1.00 31.51 ? 335 ASP A HB3  1  
ATOM 5436   N N    . ASP A 1 336 ? -0.624  -3.816  24.536  1.00 44.01 ? 336 ASP A N    1  
ATOM 5437   C CA   . ASP A 1 336 ? -1.918  -3.739  25.205  1.00 71.25 ? 336 ASP A CA   1  
ATOM 5438   C C    . ASP A 1 336 ? -2.803  -2.680  24.555  1.00 42.05 ? 336 ASP A C    1  
ATOM 5439   O O    . ASP A 1 336 ? -3.519  -1.949  25.240  1.00 44.34 ? 336 ASP A O    1  
ATOM 5440   C CB   . ASP A 1 336 ? -1.730  -3.424  26.690  1.00 0.23  ? 336 ASP A CB   1  
ATOM 5441   C CG   . ASP A 1 336 ? -2.729  -4.154  27.567  1.00 51.32 ? 336 ASP A CG   1  
ATOM 5442   O OD1  . ASP A 1 336 ? -3.882  -3.685  27.669  1.00 5.53  ? 336 ASP A OD1  1  
ATOM 5443   O OD2  . ASP A 1 336 ? -2.358  -5.193  28.152  1.00 21.53 ? 336 ASP A OD2  1  
ATOM 5444   H H    . ASP A 1 336 ? -0.116  -2.992  24.383  1.00 70.31 ? 336 ASP A H    1  
ATOM 5445   H HA   . ASP A 1 336 ? -2.398  -4.701  25.108  1.00 30.10 ? 336 ASP A HA   1  
ATOM 5446   H HB2  . ASP A 1 336 ? -0.735  -3.717  26.991  1.00 21.44 ? 336 ASP A HB2  1  
ATOM 5447   H HB3  . ASP A 1 336 ? -1.850  -2.362  26.845  1.00 14.24 ? 336 ASP A HB3  1  
ATOM 5448   N N    . GLY A 1 337 ? -2.748  -2.603  23.230  1.00 61.34 ? 337 GLY A N    1  
ATOM 5449   C CA   . GLY A 1 337 ? -3.549  -1.631  22.509  1.00 11.31 ? 337 GLY A CA   1  
ATOM 5450   C C    . GLY A 1 337 ? -4.023  -2.147  21.164  1.00 0.32  ? 337 GLY A C    1  
ATOM 5451   O O    . GLY A 1 337 ? -5.170  -1.926  20.777  1.00 43.11 ? 337 GLY A O    1  
ATOM 5452   H H    . GLY A 1 337 ? -2.159  -3.212  22.738  1.00 4.31  ? 337 GLY A H    1  
ATOM 5453   H HA2  . GLY A 1 337 ? -4.411  -1.376  23.108  1.00 33.13 ? 337 GLY A HA2  1  
ATOM 5454   H HA3  . GLY A 1 337 ? -2.958  -0.740  22.352  1.00 60.53 ? 337 GLY A HA3  1  
ATOM 5455   N N    . LYS A 1 338 ? -3.138  -2.837  20.451  1.00 53.42 ? 338 LYS A N    1  
ATOM 5456   C CA   . LYS A 1 338 ? -3.472  -3.388  19.141  1.00 21.34 ? 338 LYS A CA   1  
ATOM 5457   C C    . LYS A 1 338 ? -3.773  -2.272  18.144  1.00 63.10 ? 338 LYS A C    1  
ATOM 5458   O O    . LYS A 1 338 ? -3.497  -1.102  18.405  1.00 35.23 ? 338 LYS A O    1  
ATOM 5459   C CB   . LYS A 1 338 ? -4.671  -4.333  19.251  1.00 54.33 ? 338 LYS A CB   1  
ATOM 5460   C CG   . LYS A 1 338 ? -4.467  -5.660  18.539  1.00 72.51 ? 338 LYS A CG   1  
ATOM 5461   C CD   . LYS A 1 338 ? -5.652  -6.590  18.743  1.00 24.23 ? 338 LYS A CD   1  
ATOM 5462   C CE   . LYS A 1 338 ? -5.626  -7.232  20.120  1.00 21.32 ? 338 LYS A CE   1  
ATOM 5463   N NZ   . LYS A 1 338 ? -6.721  -8.227  20.291  1.00 64.33 ? 338 LYS A NZ   1  
ATOM 5464   H H    . LYS A 1 338 ? -2.240  -2.980  20.814  1.00 41.10 ? 338 LYS A H    1  
ATOM 5465   H HA   . LYS A 1 338 ? -2.617  -3.946  18.790  1.00 4.24  ? 338 LYS A HA   1  
ATOM 5466   H HB2  . LYS A 1 338 ? -4.860  -4.536  20.295  1.00 64.31 ? 338 LYS A HB2  1  
ATOM 5467   H HB3  . LYS A 1 338 ? -5.538  -3.850  18.825  1.00 2.24  ? 338 LYS A HB3  1  
ATOM 5468   H HG2  . LYS A 1 338 ? -4.345  -5.476  17.482  1.00 34.43 ? 338 LYS A HG2  1  
ATOM 5469   H HG3  . LYS A 1 338 ? -3.578  -6.134  18.929  1.00 32.25 ? 338 LYS A HG3  1  
ATOM 5470   H HD2  . LYS A 1 338 ? -6.564  -6.023  18.638  1.00 42.25 ? 338 LYS A HD2  1  
ATOM 5471   H HD3  . LYS A 1 338 ? -5.620  -7.367  17.992  1.00 4.05  ? 338 LYS A HD3  1  
ATOM 5472   H HE2  . LYS A 1 338 ? -4.677  -7.729  20.254  1.00 44.13 ? 338 LYS A HE2  1  
ATOM 5473   H HE3  . LYS A 1 338 ? -5.735  -6.458  20.866  1.00 14.42 ? 338 LYS A HE3  1  
ATOM 5474   H HZ1  . LYS A 1 338 ? -6.954  -8.661  19.375  1.00 60.51 ? 338 LYS A HZ1  1  
ATOM 5475   H HZ2  . LYS A 1 338 ? -7.571  -7.762  20.668  1.00 71.13 ? 338 LYS A HZ2  1  
ATOM 5476   H HZ3  . LYS A 1 338 ? -6.425  -8.974  20.951  1.00 25.22 ? 338 LYS A HZ3  1  
ATOM 5477   N N    . LEU A 1 339 ? -4.339  -2.644  17.000  1.00 4.24  ? 339 LEU A N    1  
ATOM 5478   C CA   . LEU A 1 339 ? -4.676  -1.676  15.963  1.00 70.24 ? 339 LEU A CA   1  
ATOM 5479   C C    . LEU A 1 339 ? -5.802  -0.754  16.422  1.00 4.13  ? 339 LEU A C    1  
ATOM 5480   O O    . LEU A 1 339 ? -6.942  -0.880  15.974  1.00 41.51 ? 339 LEU A O    1  
ATOM 5481   C CB   . LEU A 1 339 ? -5.082  -2.396  14.676  1.00 23.45 ? 339 LEU A CB   1  
ATOM 5482   C CG   . LEU A 1 339 ? -3.935  -3.077  13.926  1.00 23.33 ? 339 LEU A CG   1  
ATOM 5483   C CD1  . LEU A 1 339 ? -4.424  -4.342  13.237  1.00 40.34 ? 339 LEU A CD1  1  
ATOM 5484   C CD2  . LEU A 1 339 ? -3.320  -2.121  12.914  1.00 73.03 ? 339 LEU A CD2  1  
ATOM 5485   H H    . LEU A 1 339 ? -4.534  -3.593  16.849  1.00 4.13  ? 339 LEU A H    1  
ATOM 5486   H HA   . LEU A 1 339 ? -3.797  -1.080  15.769  1.00 40.42 ? 339 LEU A HA   1  
ATOM 5487   H HB2  . LEU A 1 339 ? -5.817  -3.147  14.926  1.00 4.12  ? 339 LEU A HB2  1  
ATOM 5488   H HB3  . LEU A 1 339 ? -5.538  -1.676  14.013  1.00 53.12 ? 339 LEU A HB3  1  
ATOM 5489   H HG   . LEU A 1 339 ? -3.167  -3.357  14.632  1.00 54.44 ? 339 LEU A HG   1  
ATOM 5490   H HD11 . LEU A 1 339 ? -5.366  -4.144  12.747  1.00 45.20 ? 339 LEU A HD11 1  
ATOM 5491   H HD12 . LEU A 1 339 ? -4.557  -5.123  13.972  1.00 43.50 ? 339 LEU A HD12 1  
ATOM 5492   H HD13 . LEU A 1 339 ? -3.696  -4.658  12.505  1.00 41.31 ? 339 LEU A HD13 1  
ATOM 5493   H HD21 . LEU A 1 339 ? -4.088  -1.473  12.519  1.00 64.12 ? 339 LEU A HD21 1  
ATOM 5494   H HD22 . LEU A 1 339 ? -2.876  -2.687  12.108  1.00 23.42 ? 339 LEU A HD22 1  
ATOM 5495   H HD23 . LEU A 1 339 ? -2.560  -1.526  13.398  1.00 54.12 ? 339 LEU A HD23 1  
ATOM 5496   N N    . ASP A 1 340 ? -5.474  0.173   17.316  1.00 62.11 ? 340 ASP A N    1  
ATOM 5497   C CA   . ASP A 1 340 ? -6.458  1.117   17.833  1.00 62.51 ? 340 ASP A CA   1  
ATOM 5498   C C    . ASP A 1 340 ? -6.808  2.166   16.782  1.00 15.24 ? 340 ASP A C    1  
ATOM 5499   O O    . ASP A 1 340 ? -6.432  3.332   16.902  1.00 70.34 ? 340 ASP A O    1  
ATOM 5500   C CB   . ASP A 1 340 ? -5.926  1.798   19.096  1.00 52.11 ? 340 ASP A CB   1  
ATOM 5501   C CG   . ASP A 1 340 ? -7.039  2.306   19.992  1.00 74.03 ? 340 ASP A CG   1  
ATOM 5502   O OD1  . ASP A 1 340 ? -7.801  1.470   20.524  1.00 32.12 ? 340 ASP A OD1  1  
ATOM 5503   O OD2  . ASP A 1 340 ? -7.150  3.538   20.161  1.00 0.03  ? 340 ASP A OD2  1  
ATOM 5504   H H    . ASP A 1 340 ? -4.550  0.224   17.634  1.00 62.41 ? 340 ASP A H    1  
ATOM 5505   H HA   . ASP A 1 340 ? -7.350  0.563   18.083  1.00 75.00 ? 340 ASP A HA   1  
ATOM 5506   H HB2  . ASP A 1 340 ? -5.333  1.091   19.657  1.00 71.32 ? 340 ASP A HB2  1  
ATOM 5507   H HB3  . ASP A 1 340 ? -5.307  2.636   18.812  1.00 13.34 ? 340 ASP A HB3  1  
ATOM 5508   N N    . LEU A 1 341 ? -7.530  1.741   15.751  1.00 1.42  ? 341 LEU A N    1  
ATOM 5509   C CA   . LEU A 1 341 ? -7.932  2.641   14.676  1.00 64.01 ? 341 LEU A CA   1  
ATOM 5510   C C    . LEU A 1 341 ? -9.330  2.297   14.173  1.00 63.23 ? 341 LEU A C    1  
ATOM 5511   O O    . LEU A 1 341 ? -9.567  2.215   12.968  1.00 35.22 ? 341 LEU A O    1  
ATOM 5512   C CB   . LEU A 1 341 ? -6.927  2.571   13.524  1.00 22.25 ? 341 LEU A CB   1  
ATOM 5513   C CG   . LEU A 1 341 ? -5.575  3.229   13.803  1.00 35.23 ? 341 LEU A CG   1  
ATOM 5514   C CD1  . LEU A 1 341 ? -4.464  2.496   13.067  1.00 23.14 ? 341 LEU A CD1  1  
ATOM 5515   C CD2  . LEU A 1 341 ? -5.604  4.696   13.403  1.00 24.45 ? 341 LEU A CD2  1  
ATOM 5516   H H    . LEU A 1 341 ? -7.799  0.800   15.711  1.00 74.31 ? 341 LEU A H    1  
ATOM 5517   H HA   . LEU A 1 341 ? -7.942  3.646   15.072  1.00 70.52 ? 341 LEU A HA   1  
ATOM 5518   H HB2  . LEU A 1 341 ? -6.757  1.531   13.286  1.00 74.32 ? 341 LEU A HB2  1  
ATOM 5519   H HB3  . LEU A 1 341 ? -7.365  3.053   12.663  1.00 51.13 ? 341 LEU A HB3  1  
ATOM 5520   H HG   . LEU A 1 341 ? -5.366  3.173   14.861  1.00 22.10 ? 341 LEU A HG   1  
ATOM 5521   H HD11 . LEU A 1 341 ? -4.025  1.757   13.720  1.00 30.31 ? 341 LEU A HD11 1  
ATOM 5522   H HD12 . LEU A 1 341 ? -3.706  3.203   12.763  1.00 64.11 ? 341 LEU A HD12 1  
ATOM 5523   H HD13 . LEU A 1 341 ? -4.871  2.008   12.193  1.00 73.35 ? 341 LEU A HD13 1  
ATOM 5524   H HD21 . LEU A 1 341 ? -6.626  5.046   13.392  1.00 73.31 ? 341 LEU A HD21 1  
ATOM 5525   H HD22 . LEU A 1 341 ? -5.174  4.810   12.419  1.00 53.35 ? 341 LEU A HD22 1  
ATOM 5526   H HD23 . LEU A 1 341 ? -5.033  5.274   14.115  1.00 11.24 ? 341 LEU A HD23 1  
ATOM 5527   N N    . SER A 1 342 ? -10.254 2.096   15.107  1.00 21.02 ? 342 SER A N    1  
ATOM 5528   C CA   . SER A 1 342 ? -11.631 1.761   14.761  1.00 40.43 ? 342 SER A CA   1  
ATOM 5529   C C    . SER A 1 342 ? -12.539 2.978   14.899  1.00 4.02  ? 342 SER A C    1  
ATOM 5530   O O    . SER A 1 342 ? -12.742 3.492   15.999  1.00 65.53 ? 342 SER A O    1  
ATOM 5531   C CB   . SER A 1 342 ? -12.141 0.626   15.651  1.00 75.51 ? 342 SER A CB   1  
ATOM 5532   O OG   . SER A 1 342 ? -13.417 0.178   15.227  1.00 4.31  ? 342 SER A OG   1  
ATOM 5533   H H    . SER A 1 342 ? -10.004 2.176   16.051  1.00 13.43 ? 342 SER A H    1  
ATOM 5534   H HA   . SER A 1 342 ? -11.643 1.432   13.733  1.00 61.35 ? 342 SER A HA   1  
ATOM 5535   H HB2  . SER A 1 342 ? -11.450 -0.202  15.607  1.00 32.24 ? 342 SER A HB2  1  
ATOM 5536   H HB3  . SER A 1 342 ? -12.217 0.978   16.670  1.00 14.40 ? 342 SER A HB3  1  
ATOM 5537   H HG   . SER A 1 342 ? -13.978 0.036   15.993  1.00 22.34 ? 342 SER A HG   1  
ATOM 5538   N N    . VAL A 1 343 ? -13.083 3.436   13.776  1.00 63.14 ? 343 VAL A N    1  
ATOM 5539   C CA   . VAL A 1 343 ? -13.970 4.595   13.769  1.00 12.51 ? 343 VAL A CA   1  
ATOM 5540   C C    . VAL A 1 343 ? -14.873 4.588   12.536  1.00 24.23 ? 343 VAL A C    1  
ATOM 5541   O O    . VAL A 1 343 ? -16.036 4.987   12.605  1.00 71.42 ? 343 VAL A O    1  
ATOM 5542   C CB   . VAL A 1 343 ? -13.171 5.913   13.806  1.00 4.44  ? 343 VAL A CB   1  
ATOM 5543   C CG1  . VAL A 1 343 ? -12.280 6.037   12.579  1.00 2.43  ? 343 VAL A CG1  1  
ATOM 5544   C CG2  . VAL A 1 343 ? -14.110 7.106   13.915  1.00 14.14 ? 343 VAL A CG2  1  
ATOM 5545   H H    . VAL A 1 343 ? -12.885 2.987   12.929  1.00 22.33 ? 343 VAL A H    1  
ATOM 5546   H HA   . VAL A 1 343 ? -14.587 4.547   14.654  1.00 71.33 ? 343 VAL A HA   1  
ATOM 5547   H HB   . VAL A 1 343 ? -12.538 5.901   14.681  1.00 15.35 ? 343 VAL A HB   1  
ATOM 5548   H HG11 . VAL A 1 343 ? -12.892 6.052   11.690  1.00 1.20  ? 343 VAL A HG11 1  
ATOM 5549   H HG12 . VAL A 1 343 ? -11.606 5.195   12.538  1.00 1.53  ? 343 VAL A HG12 1  
ATOM 5550   H HG13 . VAL A 1 343 ? -11.710 6.952   12.639  1.00 70.55 ? 343 VAL A HG13 1  
ATOM 5551   H HG21 . VAL A 1 343 ? -13.641 7.881   14.503  1.00 74.04 ? 343 VAL A HG21 1  
ATOM 5552   H HG22 . VAL A 1 343 ? -15.029 6.798   14.392  1.00 2.01  ? 343 VAL A HG22 1  
ATOM 5553   H HG23 . VAL A 1 343 ? -14.327 7.485   12.927  1.00 15.20 ? 343 VAL A HG23 1  
ATOM 5554   N N    . VAL A 1 344 ? -14.325 4.131   11.409  1.00 21.34 ? 344 VAL A N    1  
ATOM 5555   C CA   . VAL A 1 344 ? -15.066 4.062   10.149  1.00 13.51 ? 344 VAL A CA   1  
ATOM 5556   C C    . VAL A 1 344 ? -15.080 5.412   9.439   1.00 32.42 ? 344 VAL A C    1  
ATOM 5557   O O    . VAL A 1 344 ? -15.293 6.452   10.062  1.00 62.04 ? 344 VAL A O    1  
ATOM 5558   C CB   . VAL A 1 344 ? -16.520 3.587   10.353  1.00 22.21 ? 344 VAL A CB   1  
ATOM 5559   C CG1  . VAL A 1 344 ? -17.142 3.187   9.024   1.00 44.43 ? 344 VAL A CG1  1  
ATOM 5560   C CG2  . VAL A 1 344 ? -16.573 2.431   11.342  1.00 14.51 ? 344 VAL A CG2  1  
ATOM 5561   H H    . VAL A 1 344 ? -13.393 3.832   11.427  1.00 40.11 ? 344 VAL A H    1  
ATOM 5562   H HA   . VAL A 1 344 ? -14.565 3.345   9.514   1.00 43.33 ? 344 VAL A HA   1  
ATOM 5563   H HB   . VAL A 1 344 ? -17.093 4.407   10.759  1.00 52.22 ? 344 VAL A HB   1  
ATOM 5564   H HG11 . VAL A 1 344 ? -18.202 3.029   9.155   1.00 60.02 ? 344 VAL A HG11 1  
ATOM 5565   H HG12 . VAL A 1 344 ? -16.682 2.276   8.671   1.00 24.50 ? 344 VAL A HG12 1  
ATOM 5566   H HG13 . VAL A 1 344 ? -16.982 3.974   8.301   1.00 31.22 ? 344 VAL A HG13 1  
ATOM 5567   H HG21 . VAL A 1 344 ? -15.652 1.870   11.290  1.00 31.54 ? 344 VAL A HG21 1  
ATOM 5568   H HG22 . VAL A 1 344 ? -17.403 1.785   11.096  1.00 65.32 ? 344 VAL A HG22 1  
ATOM 5569   H HG23 . VAL A 1 344 ? -16.703 2.819   12.342  1.00 43.51 ? 344 VAL A HG23 1  
ATOM 5570   N N    . GLU A 1 345 ? -14.851 5.382   8.130   1.00 21.30 ? 345 GLU A N    1  
ATOM 5571   C CA   . GLU A 1 345 ? -14.836 6.596   7.320   1.00 60.20 ? 345 GLU A CA   1  
ATOM 5572   C C    . GLU A 1 345 ? -14.462 6.277   5.875   1.00 40.10 ? 345 GLU A C    1  
ATOM 5573   O O    . GLU A 1 345 ? -13.335 6.522   5.446   1.00 1.44  ? 345 GLU A O    1  
ATOM 5574   C CB   . GLU A 1 345 ? -13.851 7.615   7.902   1.00 54.05 ? 345 GLU A CB   1  
ATOM 5575   C CG   . GLU A 1 345 ? -14.520 8.712   8.715   1.00 53.32 ? 345 GLU A CG   1  
ATOM 5576   C CD   . GLU A 1 345 ? -13.935 10.083  8.437   1.00 54.40 ? 345 GLU A CD   1  
ATOM 5577   O OE1  . GLU A 1 345 ? -13.544 10.338  7.279   1.00 44.34 ? 345 GLU A OE1  1  
ATOM 5578   O OE2  . GLU A 1 345 ? -13.868 10.901  9.378   1.00 64.35 ? 345 GLU A OE2  1  
ATOM 5579   H H    . GLU A 1 345 ? -14.690 4.518   7.696   1.00 64.01 ? 345 GLU A H    1  
ATOM 5580   H HA   . GLU A 1 345 ? -15.829 7.018   7.337   1.00 15.32 ? 345 GLU A HA   1  
ATOM 5581   H HB2  . GLU A 1 345 ? -13.152 7.098   8.543   1.00 15.45 ? 345 GLU A HB2  1  
ATOM 5582   H HB3  . GLU A 1 345 ? -13.307 8.078   7.092   1.00 22.03 ? 345 GLU A HB3  1  
ATOM 5583   H HG2  . GLU A 1 345 ? -15.572 8.731   8.472   1.00 51.33 ? 345 GLU A HG2  1  
ATOM 5584   H HG3  . GLU A 1 345 ? -14.397 8.489   9.765   1.00 11.43 ? 345 GLU A HG3  1  
ATOM 5585   N N    . ASN A 1 346 ? -15.416 5.726   5.131   1.00 2.33  ? 346 ASN A N    1  
ATOM 5586   C CA   . ASN A 1 346 ? -15.186 5.372   3.735   1.00 34.44 ? 346 ASN A CA   1  
ATOM 5587   C C    . ASN A 1 346 ? -15.682 6.473   2.804   1.00 50.34 ? 346 ASN A C    1  
ATOM 5588   O O    . ASN A 1 346 ? -16.403 7.378   3.225   1.00 53.14 ? 346 ASN A O    1  
ATOM 5589   C CB   . ASN A 1 346 ? -15.885 4.053   3.401   1.00 2.31  ? 346 ASN A CB   1  
ATOM 5590   C CG   . ASN A 1 346 ? -15.313 3.393   2.161   1.00 1.20  ? 346 ASN A CG   1  
ATOM 5591   O OD1  . ASN A 1 346 ? -14.326 2.662   2.232   1.00 51.21 ? 346 ASN A OD1  1  
ATOM 5592   N ND2  . ASN A 1 346 ? -15.934 3.649   1.015   1.00 54.14 ? 346 ASN A ND2  1  
ATOM 5593   H H    . ASN A 1 346 ? -16.294 5.555   5.529   1.00 22.11 ? 346 ASN A H    1  
ATOM 5594   H HA   . ASN A 1 346 ? -14.122 5.250   3.594   1.00 63.34 ? 346 ASN A HA   1  
ATOM 5595   H HB2  . ASN A 1 346 ? -15.773 3.372   4.232   1.00 43.20 ? 346 ASN A HB2  1  
ATOM 5596   H HB3  . ASN A 1 346 ? -16.936 4.241   3.234   1.00 32.44 ? 346 ASN A HB3  1  
ATOM 5597   H HD21 . ASN A 1 346 ? -16.714 4.242   1.033   1.00 51.12 ? 346 ASN A HD21 1  
ATOM 5598   H HD22 . ASN A 1 346 ? -15.585 3.236   0.198   1.00 3.23  ? 346 ASN A HD22 1  
ATOM 5599   N N    . GLY A 1 347 ? -15.292 6.389   1.536   1.00 74.52 ? 347 GLY A N    1  
ATOM 5600   C CA   . GLY A 1 347 ? -15.707 7.385   0.566   1.00 73.43 ? 347 GLY A CA   1  
ATOM 5601   C C    . GLY A 1 347 ? -14.959 7.265   -0.748  1.00 24.41 ? 347 GLY A C    1  
ATOM 5602   O O    . GLY A 1 347 ? -14.545 8.269   -1.328  1.00 73.14 ? 347 GLY A O    1  
ATOM 5603   H H    . GLY A 1 347 ? -14.718 5.646   1.257   1.00 33.33 ? 347 GLY A H    1  
ATOM 5604   H HA2  . GLY A 1 347 ? -16.764 7.269   0.377   1.00 3.54  ? 347 GLY A HA2  1  
ATOM 5605   H HA3  . GLY A 1 347 ? -15.532 8.368   0.978   1.00 74.20 ? 347 GLY A HA3  1  
ATOM 5606   N N    . GLY A 1 348 ? -14.786 6.034   -1.219  1.00 54.42 ? 348 GLY A N    1  
ATOM 5607   C CA   . GLY A 1 348 ? -14.085 5.810   -2.470  1.00 53.03 ? 348 GLY A CA   1  
ATOM 5608   C C    . GLY A 1 348 ? -12.805 5.019   -2.287  1.00 33.20 ? 348 GLY A C    1  
ATOM 5609   O O    . GLY A 1 348 ? -12.150 5.116   -1.249  1.00 32.21 ? 348 GLY A O    1  
ATOM 5610   H H    . GLY A 1 348 ? -15.139 5.271   -0.715  1.00 12.51 ? 348 GLY A H    1  
ATOM 5611   H HA2  . GLY A 1 348 ? -14.735 5.270   -3.142  1.00 60.23 ? 348 GLY A HA2  1  
ATOM 5612   H HA3  . GLY A 1 348 ? -13.844 6.766   -2.911  1.00 34.54 ? 348 GLY A HA3  1  
ATOM 5613   N N    . LEU A 1 349 ? -12.448 4.234   -3.298  1.00 74.15 ? 349 LEU A N    1  
ATOM 5614   C CA   . LEU A 1 349 ? -11.237 3.422   -3.247  1.00 11.42 ? 349 LEU A CA   1  
ATOM 5615   C C    . LEU A 1 349 ? -10.418 3.590   -4.523  1.00 43.40 ? 349 LEU A C    1  
ATOM 5616   O O    . LEU A 1 349 ? -10.786 4.358   -5.412  1.00 13.14 ? 349 LEU A O    1  
ATOM 5617   C CB   . LEU A 1 349 ? -11.592 1.946   -3.045  1.00 41.03 ? 349 LEU A CB   1  
ATOM 5618   C CG   . LEU A 1 349 ? -12.850 1.474   -3.778  1.00 2.12  ? 349 LEU A CG   1  
ATOM 5619   C CD1  . LEU A 1 349 ? -12.670 0.052   -4.287  1.00 2.03  ? 349 LEU A CD1  1  
ATOM 5620   C CD2  . LEU A 1 349 ? -14.063 1.567   -2.865  1.00 35.13 ? 349 LEU A CD2  1  
ATOM 5621   H H    . LEU A 1 349 ? -13.012 4.200   -4.099  1.00 74.12 ? 349 LEU A H    1  
ATOM 5622   H HA   . LEU A 1 349 ? -10.648 3.759   -2.408  1.00 51.22 ? 349 LEU A HA   1  
ATOM 5623   H HB2  . LEU A 1 349 ? -10.758 1.349   -3.382  1.00 22.34 ? 349 LEU A HB2  1  
ATOM 5624   H HB3  . LEU A 1 349 ? -11.733 1.774   -1.989  1.00 1.31  ? 349 LEU A HB3  1  
ATOM 5625   H HG   . LEU A 1 349 ? -13.023 2.114   -4.632  1.00 53.35 ? 349 LEU A HG   1  
ATOM 5626   H HD11 . LEU A 1 349 ? -11.621 -0.140  -4.456  1.00 71.11 ? 349 LEU A HD11 1  
ATOM 5627   H HD12 . LEU A 1 349 ? -13.212 -0.070  -5.213  1.00 31.45 ? 349 LEU A HD12 1  
ATOM 5628   H HD13 . LEU A 1 349 ? -13.050 -0.643  -3.553  1.00 70.12 ? 349 LEU A HD13 1  
ATOM 5629   H HD21 . LEU A 1 349 ? -13.752 1.439   -1.839  1.00 13.00 ? 349 LEU A HD21 1  
ATOM 5630   H HD22 . LEU A 1 349 ? -14.770 0.793   -3.126  1.00 11.21 ? 349 LEU A HD22 1  
ATOM 5631   H HD23 . LEU A 1 349 ? -14.529 2.534   -2.983  1.00 31.45 ? 349 LEU A HD23 1  
ATOM 5632   N N    . LYS A 1 350 ? -9.304  2.868   -4.606  1.00 3.14  ? 350 LYS A N    1  
ATOM 5633   C CA   . LYS A 1 350 ? -8.433  2.940   -5.774  1.00 53.34 ? 350 LYS A CA   1  
ATOM 5634   C C    . LYS A 1 350 ? -8.126  1.547   -6.314  1.00 74.50 ? 350 LYS A C    1  
ATOM 5635   O O    . LYS A 1 350 ? -8.609  0.545   -5.787  1.00 60.40 ? 350 LYS A O    1  
ATOM 5636   C CB   . LYS A 1 350 ? -7.130  3.660   -5.419  1.00 11.30 ? 350 LYS A CB   1  
ATOM 5637   C CG   . LYS A 1 350 ? -7.335  5.087   -4.938  1.00 45.12 ? 350 LYS A CG   1  
ATOM 5638   C CD   . LYS A 1 350 ? -7.087  6.092   -6.051  1.00 23.11 ? 350 LYS A CD   1  
ATOM 5639   C CE   . LYS A 1 350 ? -6.368  7.329   -5.535  1.00 42.52 ? 350 LYS A CE   1  
ATOM 5640   N NZ   . LYS A 1 350 ? -6.026  8.272   -6.635  1.00 35.21 ? 350 LYS A NZ   1  
ATOM 5641   H H    . LYS A 1 350 ? -9.062  2.274   -3.865  1.00 51.21 ? 350 LYS A H    1  
ATOM 5642   H HA   . LYS A 1 350 ? -8.948  3.504   -6.537  1.00 54.32 ? 350 LYS A HA   1  
ATOM 5643   H HB2  . LYS A 1 350 ? -6.629  3.108   -4.638  1.00 62.45 ? 350 LYS A HB2  1  
ATOM 5644   H HB3  . LYS A 1 350 ? -6.497  3.685   -6.294  1.00 12.01 ? 350 LYS A HB3  1  
ATOM 5645   H HG2  . LYS A 1 350 ? -8.350  5.197   -4.588  1.00 15.00 ? 350 LYS A HG2  1  
ATOM 5646   H HG3  . LYS A 1 350 ? -6.649  5.284   -4.127  1.00 61.44 ? 350 LYS A HG3  1  
ATOM 5647   H HD2  . LYS A 1 350 ? -6.480  5.628   -6.814  1.00 42.43 ? 350 LYS A HD2  1  
ATOM 5648   H HD3  . LYS A 1 350 ? -8.036  6.388   -6.473  1.00 13.13 ? 350 LYS A HD3  1  
ATOM 5649   H HE2  . LYS A 1 350 ? -7.009  7.833   -4.827  1.00 43.33 ? 350 LYS A HE2  1  
ATOM 5650   H HE3  . LYS A 1 350 ? -5.459  7.021   -5.040  1.00 32.14 ? 350 LYS A HE3  1  
ATOM 5651   H HZ1  . LYS A 1 350 ? -6.723  8.193   -7.403  1.00 75.25 ? 350 LYS A HZ1  1  
ATOM 5652   H HZ2  . LYS A 1 350 ? -5.083  8.052   -7.014  1.00 54.31 ? 350 LYS A HZ2  1  
ATOM 5653   H HZ3  . LYS A 1 350 ? -6.025  9.250   -6.280  1.00 30.13 ? 350 LYS A HZ3  1  
ATOM 5654   N N    . ALA A 1 351 ? -7.320  1.494   -7.370  1.00 61.45 ? 351 ALA A N    1  
ATOM 5655   C CA   . ALA A 1 351 ? -6.946  0.226   -7.985  1.00 53.32 ? 351 ALA A CA   1  
ATOM 5656   C C    . ALA A 1 351 ? -5.722  0.392   -8.879  1.00 21.23 ? 351 ALA A C    1  
ATOM 5657   O O    . ALA A 1 351 ? -5.833  0.833   -10.023 1.00 31.41 ? 351 ALA A O    1  
ATOM 5658   C CB   . ALA A 1 351 ? -8.112  -0.338  -8.783  1.00 53.13 ? 351 ALA A CB   1  
ATOM 5659   H H    . ALA A 1 351 ? -6.968  2.328   -7.744  1.00 14.23 ? 351 ALA A H    1  
ATOM 5660   H HA   . ALA A 1 351 ? -6.710  -0.472  -7.194  1.00 12.21 ? 351 ALA A HA   1  
ATOM 5661   H HB1  . ALA A 1 351 ? -8.946  -0.522  -8.121  1.00 3.23  ? 351 ALA A HB1  1  
ATOM 5662   H HB2  . ALA A 1 351 ? -7.814  -1.264  -9.252  1.00 41.24 ? 351 ALA A HB2  1  
ATOM 5663   H HB3  . ALA A 1 351 ? -8.405  0.372   -9.542  1.00 71.43 ? 351 ALA A HB3  1  
ATOM 5664   N N    . LYS A 1 352 ? -4.556  0.034   -8.350  1.00 72.14 ? 352 LYS A N    1  
ATOM 5665   C CA   . LYS A 1 352 ? -3.308  0.142   -9.099  1.00 70.44 ? 352 LYS A CA   1  
ATOM 5666   C C    . LYS A 1 352 ? -2.246  -0.788  -8.523  1.00 35.42 ? 352 LYS A C    1  
ATOM 5667   O O    . LYS A 1 352 ? -2.419  -1.348  -7.440  1.00 40.13 ? 352 LYS A O    1  
ATOM 5668   C CB   . LYS A 1 352 ? -2.795  1.585   -9.078  1.00 11.13 ? 352 LYS A CB   1  
ATOM 5669   C CG   . LYS A 1 352 ? -3.836  2.614   -9.487  1.00 23.12 ? 352 LYS A CG   1  
ATOM 5670   C CD   . LYS A 1 352 ? -3.233  4.006   -9.589  1.00 53.34 ? 352 LYS A CD   1  
ATOM 5671   C CE   . LYS A 1 352 ? -4.228  5.004   -10.157 1.00 54.44 ? 352 LYS A CE   1  
ATOM 5672   N NZ   . LYS A 1 352 ? -3.558  6.241   -10.644 1.00 74.21 ? 352 LYS A NZ   1  
ATOM 5673   H H    . LYS A 1 352 ? -4.535  -0.315  -7.435  1.00 10.50 ? 352 LYS A H    1  
ATOM 5674   H HA   . LYS A 1 352 ? -3.508  -0.145  -10.119 1.00 2.54  ? 352 LYS A HA   1  
ATOM 5675   H HB2  . LYS A 1 352 ? -2.461  1.821   -8.078  1.00 54.03 ? 352 LYS A HB2  1  
ATOM 5676   H HB3  . LYS A 1 352 ? -1.956  1.665   -9.755  1.00 52.14 ? 352 LYS A HB3  1  
ATOM 5677   H HG2  . LYS A 1 352 ? -4.244  2.339   -10.447 1.00 40.05 ? 352 LYS A HG2  1  
ATOM 5678   H HG3  . LYS A 1 352 ? -4.624  2.627   -8.749  1.00 52.15 ? 352 LYS A HG3  1  
ATOM 5679   H HD2  . LYS A 1 352 ? -2.934  4.331   -8.603  1.00 5.14  ? 352 LYS A HD2  1  
ATOM 5680   H HD3  . LYS A 1 352 ? -2.368  3.966   -10.234 1.00 71.21 ? 352 LYS A HD3  1  
ATOM 5681   H HE2  . LYS A 1 352 ? -4.752  4.542   -10.980 1.00 10.53 ? 352 LYS A HE2  1  
ATOM 5682   H HE3  . LYS A 1 352 ? -4.935  5.268   -9.384  1.00 15.14 ? 352 LYS A HE3  1  
ATOM 5683   H HZ1  . LYS A 1 352 ? -4.159  7.070   -10.459 1.00 74.32 ? 352 LYS A HZ1  1  
ATOM 5684   H HZ2  . LYS A 1 352 ? -3.384  6.175   -11.666 1.00 35.11 ? 352 LYS A HZ2  1  
ATOM 5685   H HZ3  . LYS A 1 352 ? -2.648  6.370   -10.156 1.00 12.10 ? 352 LYS A HZ3  1  
ATOM 5686   N N    . THR A 1 353 ? -1.141  -0.942  -9.248  1.00 11.34 ? 353 THR A N    1  
ATOM 5687   C CA   . THR A 1 353 ? -0.047  -1.796  -8.801  1.00 21.40 ? 353 THR A CA   1  
ATOM 5688   C C    . THR A 1 353 ? 1.249   -1.446  -9.526  1.00 61.11 ? 353 THR A C    1  
ATOM 5689   O O    . THR A 1 353 ? 2.309   -1.356  -8.906  1.00 13.14 ? 353 THR A O    1  
ATOM 5690   C CB   . THR A 1 353 ? -0.390  -3.270  -9.019  1.00 74.15 ? 353 THR A CB   1  
ATOM 5691   O OG1  . THR A 1 353 ? -1.787  -3.442  -9.173  1.00 0.32  ? 353 THR A OG1  1  
ATOM 5692   C CG2  . THR A 1 353 ? 0.060   -4.163  -7.883  1.00 11.00 ? 353 THR A CG2  1  
ATOM 5693   H H    . THR A 1 353 ? -1.056  -0.466  -10.101 1.00 42.32 ? 353 THR A H    1  
ATOM 5694   H HA   . THR A 1 353 ? 0.092   -1.624  -7.744  1.00 51.44 ? 353 THR A HA   1  
ATOM 5695   H HB   . THR A 1 353 ? 0.096   -3.611  -9.919  1.00 73.40 ? 353 THR A HB   1  
ATOM 5696   H HG1  . THR A 1 353 ? -2.226  -3.277  -8.335  1.00 1.12  ? 353 THR A HG1  1  
ATOM 5697   H HG21 . THR A 1 353 ? 0.831   -4.832  -8.235  1.00 21.51 ? 353 THR A HG21 1  
ATOM 5698   H HG22 . THR A 1 353 ? -0.780  -4.739  -7.524  1.00 3.35  ? 353 THR A HG22 1  
ATOM 5699   H HG23 . THR A 1 353 ? 0.450   -3.555  -7.080  1.00 2.04  ? 353 THR A HG23 1  
ATOM 5700   N N    . ILE A 1 354 ? 1.163   -1.248  -10.843 1.00 53.25 ? 354 ILE A N    1  
ATOM 5701   C CA   . ILE A 1 354 ? 2.340   -0.904  -11.643 1.00 74.41 ? 354 ILE A CA   1  
ATOM 5702   C C    . ILE A 1 354 ? 3.150   0.218   -10.999 1.00 44.30 ? 354 ILE A C    1  
ATOM 5703   O O    . ILE A 1 354 ? 2.750   0.790   -9.985  1.00 73.10 ? 354 ILE A O    1  
ATOM 5704   C CB   . ILE A 1 354 ? 1.957   -0.464  -13.070 1.00 63.24 ? 354 ILE A CB   1  
ATOM 5705   C CG1  . ILE A 1 354 ? 0.999   0.726   -13.020 1.00 2.12  ? 354 ILE A CG1  1  
ATOM 5706   C CG2  . ILE A 1 354 ? 1.347   -1.620  -13.846 1.00 32.14 ? 354 ILE A CG2  1  
ATOM 5707   C CD1  . ILE A 1 354 ? 1.702   2.056   -12.856 1.00 4.40  ? 354 ILE A CD1  1  
ATOM 5708   H H    . ILE A 1 354 ? 0.290   -1.336  -11.287 1.00 61.23 ? 354 ILE A H    1  
ATOM 5709   H HA   . ILE A 1 354 ? 2.960   -1.784  -11.715 1.00 24.41 ? 354 ILE A HA   1  
ATOM 5710   H HB   . ILE A 1 354 ? 2.861   -0.163  -13.580 1.00 12.12 ? 354 ILE A HB   1  
ATOM 5711   H HG12 . ILE A 1 354 ? 0.429   0.762   -13.936 1.00 43.00 ? 354 ILE A HG12 1  
ATOM 5712   H HG13 . ILE A 1 354 ? 0.324   0.602   -12.185 1.00 70.21 ? 354 ILE A HG13 1  
ATOM 5713   H HG21 . ILE A 1 354 ? 1.215   -2.466  -13.189 1.00 31.34 ? 354 ILE A HG21 1  
ATOM 5714   H HG22 . ILE A 1 354 ? 2.004   -1.895  -14.658 1.00 72.20 ? 354 ILE A HG22 1  
ATOM 5715   H HG23 . ILE A 1 354 ? 0.389   -1.322  -14.245 1.00 41.20 ? 354 ILE A HG23 1  
ATOM 5716   H HD11 . ILE A 1 354 ? 1.355   2.539   -11.955 1.00 4.42  ? 354 ILE A HD11 1  
ATOM 5717   H HD12 . ILE A 1 354 ? 1.485   2.685   -13.708 1.00 42.24 ? 354 ILE A HD12 1  
ATOM 5718   H HD13 . ILE A 1 354 ? 2.768   1.894   -12.790 1.00 42.14 ? 354 ILE A HD13 1  
ATOM 5719   N N    . THR A 1 355 ? 4.291   0.530   -11.605 1.00 55.32 ? 355 THR A N    1  
ATOM 5720   C CA   . THR A 1 355 ? 5.166   1.585   -11.105 1.00 71.54 ? 355 THR A CA   1  
ATOM 5721   C C    . THR A 1 355 ? 6.006   2.170   -12.236 1.00 44.23 ? 355 THR A C    1  
ATOM 5722   O O    . THR A 1 355 ? 7.171   1.810   -12.403 1.00 23.15 ? 355 THR A O    1  
ATOM 5723   C CB   . THR A 1 355 ? 6.077   1.039   -10.003 1.00 41.12 ? 355 THR A CB   1  
ATOM 5724   O OG1  . THR A 1 355 ? 7.192   1.891   -9.802  1.00 64.32 ? 355 THR A OG1  1  
ATOM 5725   C CG2  . THR A 1 355 ? 6.604   -0.349  -10.297 1.00 62.51 ? 355 THR A CG2  1  
ATOM 5726   H H    . THR A 1 355 ? 4.549   0.042   -12.414 1.00 63.13 ? 355 THR A H    1  
ATOM 5727   H HA   . THR A 1 355 ? 4.544   2.365   -10.692 1.00 64.14 ? 355 THR A HA   1  
ATOM 5728   H HB   . THR A 1 355 ? 5.517   0.991   -9.081  1.00 53.23 ? 355 THR A HB   1  
ATOM 5729   H HG1  . THR A 1 355 ? 7.795   1.812   -10.544 1.00 41.20 ? 355 THR A HG1  1  
ATOM 5730   H HG21 . THR A 1 355 ? 6.228   -1.040  -9.557  1.00 32.30 ? 355 THR A HG21 1  
ATOM 5731   H HG22 . THR A 1 355 ? 7.683   -0.338  -10.265 1.00 5.55  ? 355 THR A HG22 1  
ATOM 5732   H HG23 . THR A 1 355 ? 6.275   -0.657  -11.278 1.00 22.42 ? 355 THR A HG23 1  
ATOM 5733   N N    . LYS A 1 356 ? 5.413   3.073   -13.010 1.00 71.00 ? 356 LYS A N    1  
ATOM 5734   C CA   . LYS A 1 356 ? 6.116   3.702   -14.123 1.00 50.10 ? 356 LYS A CA   1  
ATOM 5735   C C    . LYS A 1 356 ? 5.241   4.760   -14.790 1.00 62.13 ? 356 LYS A C    1  
ATOM 5736   O O    . LYS A 1 356 ? 4.973   4.694   -15.990 1.00 61.22 ? 356 LYS A O    1  
ATOM 5737   C CB   . LYS A 1 356 ? 6.537   2.648   -15.149 1.00 23.43 ? 356 LYS A CB   1  
ATOM 5738   C CG   . LYS A 1 356 ? 7.450   3.189   -16.237 1.00 12.32 ? 356 LYS A CG   1  
ATOM 5739   C CD   . LYS A 1 356 ? 7.180   2.521   -17.575 1.00 13.43 ? 356 LYS A CD   1  
ATOM 5740   C CE   . LYS A 1 356 ? 8.024   3.131   -18.683 1.00 34.32 ? 356 LYS A CE   1  
ATOM 5741   N NZ   . LYS A 1 356 ? 7.638   4.541   -18.963 1.00 53.25 ? 356 LYS A NZ   1  
ATOM 5742   H H    . LYS A 1 356 ? 4.483   3.325   -12.831 1.00 33.21 ? 356 LYS A H    1  
ATOM 5743   H HA   . LYS A 1 356 ? 6.999   4.180   -13.728 1.00 14.32 ? 356 LYS A HA   1  
ATOM 5744   H HB2  . LYS A 1 356 ? 7.057   1.851   -14.637 1.00 5.02  ? 356 LYS A HB2  1  
ATOM 5745   H HB3  . LYS A 1 356 ? 5.652   2.245   -15.619 1.00 75.13 ? 356 LYS A HB3  1  
ATOM 5746   H HG2  . LYS A 1 356 ? 7.285   4.252   -16.337 1.00 1.21  ? 356 LYS A HG2  1  
ATOM 5747   H HG3  . LYS A 1 356 ? 8.477   3.008   -15.955 1.00 54.03 ? 356 LYS A HG3  1  
ATOM 5748   H HD2  . LYS A 1 356 ? 7.413   1.470   -17.496 1.00 13.02 ? 356 LYS A HD2  1  
ATOM 5749   H HD3  . LYS A 1 356 ? 6.135   2.642   -17.822 1.00 21.33 ? 356 LYS A HD3  1  
ATOM 5750   H HE2  . LYS A 1 356 ? 9.061   3.104   -18.384 1.00 30.35 ? 356 LYS A HE2  1  
ATOM 5751   H HE3  . LYS A 1 356 ? 7.893   2.545   -19.581 1.00 61.04 ? 356 LYS A HE3  1  
ATOM 5752   H HZ1  . LYS A 1 356 ? 8.202   5.189   -18.377 1.00 30.21 ? 356 LYS A HZ1  1  
ATOM 5753   H HZ2  . LYS A 1 356 ? 6.630   4.686   -18.749 1.00 53.33 ? 356 LYS A HZ2  1  
ATOM 5754   H HZ3  . LYS A 1 356 ? 7.803   4.764   -19.966 1.00 63.33 ? 356 LYS A HZ3  1  
ATOM 5755   N N    . LYS A 1 357 ? 4.800   5.737   -14.004 1.00 42.23 ? 357 LYS A N    1  
ATOM 5756   C CA   . LYS A 1 357 ? 3.956   6.809   -14.518 1.00 20.34 ? 357 LYS A CA   1  
ATOM 5757   C C    . LYS A 1 357 ? 4.781   8.058   -14.811 1.00 43.23 ? 357 LYS A C    1  
ATOM 5758   O O    . LYS A 1 357 ? 5.354   8.663   -13.904 1.00 53.31 ? 357 LYS A O    1  
ATOM 5759   C CB   . LYS A 1 357 ? 2.848   7.139   -13.517 1.00 21.21 ? 357 LYS A CB   1  
ATOM 5760   C CG   . LYS A 1 357 ? 1.607   7.740   -14.157 1.00 65.11 ? 357 LYS A CG   1  
ATOM 5761   C CD   . LYS A 1 357 ? 0.553   6.680   -14.431 1.00 30.12 ? 357 LYS A CD   1  
ATOM 5762   C CE   . LYS A 1 357 ? -0.358  7.084   -15.579 1.00 75.12 ? 357 LYS A CE   1  
ATOM 5763   N NZ   . LYS A 1 357 ? 0.156   6.605   -16.891 1.00 3.32  ? 357 LYS A NZ   1  
ATOM 5764   H H    . LYS A 1 357 ? 5.047   5.736   -13.056 1.00 2.11  ? 357 LYS A H    1  
ATOM 5765   H HA   . LYS A 1 357 ? 3.507   6.466   -15.438 1.00 55.55 ? 357 LYS A HA   1  
ATOM 5766   H HB2  . LYS A 1 357 ? 2.559   6.233   -13.005 1.00 71.32 ? 357 LYS A HB2  1  
ATOM 5767   H HB3  . LYS A 1 357 ? 3.230   7.844   -12.793 1.00 63.12 ? 357 LYS A HB3  1  
ATOM 5768   H HG2  . LYS A 1 357 ? 1.193   8.482   -13.491 1.00 2.02  ? 357 LYS A HG2  1  
ATOM 5769   H HG3  . LYS A 1 357 ? 1.887   8.207   -15.091 1.00 61.25 ? 357 LYS A HG3  1  
ATOM 5770   H HD2  . LYS A 1 357 ? 1.045   5.753   -14.685 1.00 12.42 ? 357 LYS A HD2  1  
ATOM 5771   H HD3  . LYS A 1 357 ? -0.043  6.541   -13.541 1.00 11.52 ? 357 LYS A HD3  1  
ATOM 5772   H HE2  . LYS A 1 357 ? -1.338  6.661   -15.410 1.00 22.43 ? 357 LYS A HE2  1  
ATOM 5773   H HE3  . LYS A 1 357 ? -0.431  8.161   -15.601 1.00 63.52 ? 357 LYS A HE3  1  
ATOM 5774   H HZ1  . LYS A 1 357 ? -0.186  5.640   -17.079 1.00 64.43 ? 357 LYS A HZ1  1  
ATOM 5775   H HZ2  . LYS A 1 357 ? 1.195   6.596   -16.887 1.00 15.14 ? 357 LYS A HZ2  1  
ATOM 5776   H HZ3  . LYS A 1 357 ? -0.171  7.232   -17.654 1.00 32.34 ? 357 LYS A HZ3  1  
ATOM 5777   N N    . ARG A 1 358 ? 4.838   8.440   -16.083 1.00 3.14  ? 358 ARG A N    1  
ATOM 5778   C CA   . ARG A 1 358 ? 5.593   9.617   -16.494 1.00 64.11 ? 358 ARG A CA   1  
ATOM 5779   C C    . ARG A 1 358 ? 5.168   10.078  -17.884 1.00 31.13 ? 358 ARG A C    1  
ATOM 5780   O O    . ARG A 1 358 ? 4.605   11.161  -18.045 1.00 33.33 ? 358 ARG A O    1  
ATOM 5781   C CB   . ARG A 1 358 ? 7.093   9.317   -16.481 1.00 44.21 ? 358 ARG A CB   1  
ATOM 5782   C CG   . ARG A 1 358 ? 7.962   10.560  -16.384 1.00 22.31 ? 358 ARG A CG   1  
ATOM 5783   C CD   . ARG A 1 358 ? 8.400   11.042  -17.757 1.00 40.24 ? 358 ARG A CD   1  
ATOM 5784   N NE   . ARG A 1 358 ? 9.488   12.015  -17.675 1.00 42.34 ? 358 ARG A NE   1  
ATOM 5785   C CZ   . ARG A 1 358 ? 9.820   12.840  -18.664 1.00 64.43 ? 358 ARG A CZ   1  
ATOM 5786   N NH1  . ARG A 1 358 ? 9.154   12.815  -19.812 1.00 23.05 ? 358 ARG A NH1  1  
ATOM 5787   N NH2  . ARG A 1 358 ? 10.823  13.694  -18.506 1.00 34.01 ? 358 ARG A NH2  1  
ATOM 5788   H H    . ARG A 1 358 ? 4.361   7.917   -16.760 1.00 42.14 ? 358 ARG A H    1  
ATOM 5789   H HA   . ARG A 1 358 ? 5.387   10.407  -15.787 1.00 43.02 ? 358 ARG A HA   1  
ATOM 5790   H HB2  . ARG A 1 358 ? 7.314   8.683   -15.635 1.00 51.21 ? 358 ARG A HB2  1  
ATOM 5791   H HB3  . ARG A 1 358 ? 7.352   8.794   -17.390 1.00 74.12 ? 358 ARG A HB3  1  
ATOM 5792   H HG2  . ARG A 1 358 ? 7.398   11.345  -15.901 1.00 53.12 ? 358 ARG A HG2  1  
ATOM 5793   H HG3  . ARG A 1 358 ? 8.838   10.330  -15.795 1.00 54.53 ? 358 ARG A HG3  1  
ATOM 5794   H HD2  . ARG A 1 358 ? 8.734   10.192  -18.333 1.00 13.15 ? 358 ARG A HD2  1  
ATOM 5795   H HD3  . ARG A 1 358 ? 7.556   11.501  -18.250 1.00 51.50 ? 358 ARG A HD3  1  
ATOM 5796   H HE   . ARG A 1 358 ? 9.997   12.055  -16.838 1.00 25.53 ? 358 ARG A HE   1  
ATOM 5797   H HH11 . ARG A 1 358 ? 8.397   12.174  -19.937 1.00 42.02 ? 358 ARG A HH11 1  
ATOM 5798   H HH12 . ARG A 1 358 ? 9.408   13.438  -20.551 1.00 42.11 ? 358 ARG A HH12 1  
ATOM 5799   H HH21 . ARG A 1 358 ? 11.328  13.718  -17.644 1.00 12.44 ? 358 ARG A HH21 1  
ATOM 5800   H HH22 . ARG A 1 358 ? 11.073  14.315  -19.249 1.00 33.35 ? 358 ARG A HH22 1  
ATOM 5801   N N    . LYS A 1 359 ? 5.440   9.249   -18.887 1.00 62.14 ? 359 LYS A N    1  
ATOM 5802   C CA   . LYS A 1 359 ? 5.085   9.571   -20.264 1.00 52.30 ? 359 LYS A CA   1  
ATOM 5803   C C    . LYS A 1 359 ? 3.989   8.641   -20.775 1.00 13.03 ? 359 LYS A C    1  
ATOM 5804   O O    . LYS A 1 359 ? 3.107   9.058   -21.526 1.00 72.45 ? 359 LYS A O    1  
ATOM 5805   C CB   . LYS A 1 359 ? 6.316   9.472   -21.166 1.00 23.32 ? 359 LYS A CB   1  
ATOM 5806   C CG   . LYS A 1 359 ? 6.895   8.070   -21.253 1.00 3.12  ? 359 LYS A CG   1  
ATOM 5807   C CD   . LYS A 1 359 ? 7.985   7.982   -22.309 1.00 35.02 ? 359 LYS A CD   1  
ATOM 5808   C CE   . LYS A 1 359 ? 7.399   7.862   -23.706 1.00 71.34 ? 359 LYS A CE   1  
ATOM 5809   N NZ   . LYS A 1 359 ? 7.097   9.194   -24.298 1.00 52.53 ? 359 LYS A NZ   1  
ATOM 5810   H H    . LYS A 1 359 ? 5.890   8.399   -18.695 1.00 32.14 ? 359 LYS A H    1  
ATOM 5811   H HA   . LYS A 1 359 ? 4.716   10.586  -20.283 1.00 42.20 ? 359 LYS A HA   1  
ATOM 5812   H HB2  . LYS A 1 359 ? 6.044   9.788   -22.163 1.00 62.03 ? 359 LYS A HB2  1  
ATOM 5813   H HB3  . LYS A 1 359 ? 7.081   10.131  -20.785 1.00 10.10 ? 359 LYS A HB3  1  
ATOM 5814   H HG2  . LYS A 1 359 ? 7.315   7.804   -20.295 1.00 30.35 ? 359 LYS A HG2  1  
ATOM 5815   H HG3  . LYS A 1 359 ? 6.104   7.379   -21.507 1.00 62.25 ? 359 LYS A HG3  1  
ATOM 5816   H HD2  . LYS A 1 359 ? 8.593   8.873   -22.260 1.00 72.42 ? 359 LYS A HD2  1  
ATOM 5817   H HD3  . LYS A 1 359 ? 8.597   7.114   -22.109 1.00 24.20 ? 359 LYS A HD3  1  
ATOM 5818   H HE2  . LYS A 1 359 ? 8.109   7.350   -24.339 1.00 32.11 ? 359 LYS A HE2  1  
ATOM 5819   H HE3  . LYS A 1 359 ? 6.486   7.286   -23.652 1.00 70.31 ? 359 LYS A HE3  1  
ATOM 5820   H HZ1  . LYS A 1 359 ? 6.097   9.436   -24.144 1.00 20.12 ? 359 LYS A HZ1  1  
ATOM 5821   H HZ2  . LYS A 1 359 ? 7.284   9.182   -25.321 1.00 12.15 ? 359 LYS A HZ2  1  
ATOM 5822   H HZ3  . LYS A 1 359 ? 7.691   9.925   -23.857 1.00 42.31 ? 359 LYS A HZ3  1  
ATOM 5823   N N    . LYS A 1 360 ? 4.052   7.379   -20.364 1.00 44.32 ? 360 LYS A N    1  
ATOM 5824   C CA   . LYS A 1 360 ? 3.065   6.389   -20.780 1.00 61.14 ? 360 LYS A CA   1  
ATOM 5825   C C    . LYS A 1 360 ? 3.068   6.222   -22.296 1.00 53.44 ? 360 LYS A C    1  
ATOM 5826   O O    . LYS A 1 360 ? 2.301   6.874   -23.004 1.00 61.14 ? 360 LYS A O    1  
ATOM 5827   C CB   . LYS A 1 360 ? 1.670   6.798   -20.303 1.00 31.10 ? 360 LYS A CB   1  
ATOM 5828   C CG   . LYS A 1 360 ? 0.665   5.657   -20.315 1.00 61.23 ? 360 LYS A CG   1  
ATOM 5829   C CD   . LYS A 1 360 ? -0.141  5.638   -21.603 1.00 22.33 ? 360 LYS A CD   1  
ATOM 5830   C CE   . LYS A 1 360 ? -1.576  5.202   -21.356 1.00 30.24 ? 360 LYS A CE   1  
ATOM 5831   N NZ   . LYS A 1 360 ? -2.392  6.292   -20.753 1.00 55.52 ? 360 LYS A NZ   1  
ATOM 5832   H H    . LYS A 1 360 ? 4.779   7.106   -19.766 1.00 41.42 ? 360 LYS A H    1  
ATOM 5833   H HA   . LYS A 1 360 ? 3.329   5.446   -20.325 1.00 73.41 ? 360 LYS A HA   1  
ATOM 5834   H HB2  . LYS A 1 360 ? 1.743   7.175   -19.294 1.00 74.44 ? 360 LYS A HB2  1  
ATOM 5835   H HB3  . LYS A 1 360 ? 1.298   7.583   -20.945 1.00 52.55 ? 360 LYS A HB3  1  
ATOM 5836   H HG2  . LYS A 1 360 ? 1.196   4.722   -20.220 1.00 15.10 ? 360 LYS A HG2  1  
ATOM 5837   H HG3  . LYS A 1 360 ? -0.010  5.777   -19.480 1.00 21.31 ? 360 LYS A HG3  1  
ATOM 5838   H HD2  . LYS A 1 360 ? -0.145  6.630   -22.029 1.00 2.44  ? 360 LYS A HD2  1  
ATOM 5839   H HD3  . LYS A 1 360 ? 0.321   4.949   -22.295 1.00 35.33 ? 360 LYS A HD3  1  
ATOM 5840   H HE2  . LYS A 1 360 ? -2.019  4.913   -22.298 1.00 54.25 ? 360 LYS A HE2  1  
ATOM 5841   H HE3  . LYS A 1 360 ? -1.571  4.355   -20.686 1.00 51.33 ? 360 LYS A HE3  1  
ATOM 5842   H HZ1  . LYS A 1 360 ? -3.260  5.899   -20.335 1.00 41.15 ? 360 LYS A HZ1  1  
ATOM 5843   H HZ2  . LYS A 1 360 ? -2.655  6.987   -21.481 1.00 51.34 ? 360 LYS A HZ2  1  
ATOM 5844   H HZ3  . LYS A 1 360 ? -1.849  6.775   -20.009 1.00 44.03 ? 360 LYS A HZ3  1  
ATOM 5845   N N    . GLU A 1 361 ? 3.937   5.345   -22.788 1.00 20.41 ? 361 GLU A N    1  
ATOM 5846   C CA   . GLU A 1 361 ? 4.040   5.092   -24.220 1.00 31.43 ? 361 GLU A CA   1  
ATOM 5847   C C    . GLU A 1 361 ? 2.719   4.573   -24.777 1.00 65.45 ? 361 GLU A C    1  
ATOM 5848   O O    . GLU A 1 361 ? 2.699   3.781   -25.720 1.00 5.42  ? 361 GLU A O    1  
ATOM 5849   C CB   . GLU A 1 361 ? 5.156   4.084   -24.502 1.00 75.03 ? 361 GLU A CB   1  
ATOM 5850   C CG   . GLU A 1 361 ? 6.535   4.716   -24.605 1.00 10.34 ? 361 GLU A CG   1  
ATOM 5851   C CD   . GLU A 1 361 ? 7.280   4.707   -23.284 1.00 64.12 ? 361 GLU A CD   1  
ATOM 5852   O OE1  . GLU A 1 361 ? 6.866   5.444   -22.364 1.00 52.50 ? 361 GLU A OE1  1  
ATOM 5853   O OE2  . GLU A 1 361 ? 8.277   3.964   -23.170 1.00 34.23 ? 361 GLU A OE2  1  
ATOM 5854   H H    . GLU A 1 361 ? 4.523   4.856   -22.172 1.00 21.12 ? 361 GLU A H    1  
ATOM 5855   H HA   . GLU A 1 361 ? 4.280   6.026   -24.705 1.00 32.31 ? 361 GLU A HA   1  
ATOM 5856   H HB2  . GLU A 1 361 ? 5.177   3.355   -23.706 1.00 33.25 ? 361 GLU A HB2  1  
ATOM 5857   H HB3  . GLU A 1 361 ? 4.944   3.581   -25.434 1.00 43.40 ? 361 GLU A HB3  1  
ATOM 5858   H HG2  . GLU A 1 361 ? 7.115   4.167   -25.331 1.00 62.24 ? 361 GLU A HG2  1  
ATOM 5859   H HG3  . GLU A 1 361 ? 6.424   5.739   -24.932 1.00 0.33  ? 361 GLU A HG3  1  
ATOM 5860   N N    . MET A 1 1   ? -15.020 26.082  -9.881  1.00 0.00  ? 1   MET A N    2  
ATOM 5861   C CA   . MET A 1 1   ? -15.750 26.891  -10.894 1.00 52.33 ? 1   MET A CA   2  
ATOM 5862   C C    . MET A 1 1   ? -16.975 26.144  -11.418 1.00 61.21 ? 1   MET A C    2  
ATOM 5863   O O    . MET A 1 1   ? -16.991 24.914  -11.460 1.00 42.31 ? 1   MET A O    2  
ATOM 5864   C CB   . MET A 1 1   ? -14.794 27.207  -12.045 1.00 23.53 ? 1   MET A CB   2  
ATOM 5865   C CG   . MET A 1 1   ? -14.043 28.518  -11.870 1.00 51.21 ? 1   MET A CG   2  
ATOM 5866   S SD   . MET A 1 1   ? -14.799 29.878  -12.781 1.00 40.01 ? 1   MET A SD   2  
ATOM 5867   C CE   . MET A 1 1   ? -15.030 31.076  -11.471 1.00 2.12  ? 1   MET A CE   2  
ATOM 5868   H H1   . MET A 1 1   ? -15.609 26.041  -9.025  1.00 37.47 ? 1   MET A H1   2  
ATOM 5869   H H2   . MET A 1 1   ? -14.114 26.557  -9.692  1.00 37.47 ? 1   MET A H2   2  
ATOM 5870   H H3   . MET A 1 1   ? -14.873 25.134  -10.279 1.00 37.47 ? 1   MET A H3   2  
ATOM 5871   H HA   . MET A 1 1   ? -16.070 27.813  -10.433 1.00 30.52 ? 1   MET A HA   2  
ATOM 5872   H HB2  . MET A 1 1   ? -14.069 26.410  -12.125 1.00 72.44 ? 1   MET A HB2  2  
ATOM 5873   H HB3  . MET A 1 1   ? -15.359 27.261  -12.964 1.00 64.11 ? 1   MET A HB3  2  
ATOM 5874   H HG2  . MET A 1 1   ? -14.030 28.771  -10.820 1.00 54.21 ? 1   MET A HG2  2  
ATOM 5875   H HG3  . MET A 1 1   ? -13.031 28.386  -12.220 1.00 61.24 ? 1   MET A HG3  2  
ATOM 5876   H HE1  . MET A 1 1   ? -15.751 30.699  -10.760 1.00 74.22 ? 1   MET A HE1  2  
ATOM 5877   H HE2  . MET A 1 1   ? -15.389 32.005  -11.890 1.00 63.15 ? 1   MET A HE2  2  
ATOM 5878   H HE3  . MET A 1 1   ? -14.089 31.249  -10.970 1.00 73.11 ? 1   MET A HE3  2  
ATOM 5879   N N    . PRO A 1 2   ? -18.021 26.883  -11.825 1.00 4.24  ? 2   PRO A N    2  
ATOM 5880   C CA   . PRO A 1 2   ? -19.254 26.285  -12.348 1.00 22.41 ? 2   PRO A CA   2  
ATOM 5881   C C    . PRO A 1 2   ? -19.051 25.643  -13.716 1.00 34.03 ? 2   PRO A C    2  
ATOM 5882   O O    . PRO A 1 2   ? -18.688 26.316  -14.681 1.00 1.34  ? 2   PRO A O    2  
ATOM 5883   C CB   . PRO A 1 2   ? -20.211 27.474  -12.451 1.00 63.33 ? 2   PRO A CB   2  
ATOM 5884   C CG   . PRO A 1 2   ? -19.325 28.661  -12.604 1.00 65.42 ? 2   PRO A CG   2  
ATOM 5885   C CD   . PRO A 1 2   ? -18.084 28.356  -11.810 1.00 14.44 ? 2   PRO A CD   2  
ATOM 5886   H HA   . PRO A 1 2   ? -19.658 25.552  -11.664 1.00 73.31 ? 2   PRO A HA   2  
ATOM 5887   H HB2  . PRO A 1 2   ? -20.854 27.347  -13.310 1.00 3.52  ? 2   PRO A HB2  2  
ATOM 5888   H HB3  . PRO A 1 2   ? -20.807 27.540  -11.554 1.00 65.42 ? 2   PRO A HB3  2  
ATOM 5889   H HG2  . PRO A 1 2   ? -19.077 28.803  -13.646 1.00 31.33 ? 2   PRO A HG2  2  
ATOM 5890   H HG3  . PRO A 1 2   ? -19.815 29.539  -12.210 1.00 32.25 ? 2   PRO A HG3  2  
ATOM 5891   H HD2  . PRO A 1 2   ? -17.216 28.785  -12.287 1.00 33.31 ? 2   PRO A HD2  2  
ATOM 5892   H HD3  . PRO A 1 2   ? -18.184 28.727  -10.800 1.00 35.13 ? 2   PRO A HD3  2  
ATOM 5893   N N    . ARG A 1 3   ? -19.289 24.337  -13.793 1.00 42.01 ? 3   ARG A N    2  
ATOM 5894   C CA   . ARG A 1 3   ? -19.132 23.604  -15.044 1.00 14.14 ? 3   ARG A CA   2  
ATOM 5895   C C    . ARG A 1 3   ? -20.490 23.253  -15.643 1.00 42.15 ? 3   ARG A C    2  
ATOM 5896   O O    . ARG A 1 3   ? -20.812 23.662  -16.758 1.00 21.51 ? 3   ARG A O    2  
ATOM 5897   C CB   . ARG A 1 3   ? -18.318 22.330  -14.814 1.00 35.14 ? 3   ARG A CB   2  
ATOM 5898   C CG   . ARG A 1 3   ? -17.661 21.792  -16.075 1.00 75.13 ? 3   ARG A CG   2  
ATOM 5899   C CD   . ARG A 1 3   ? -17.610 20.274  -16.072 1.00 44.21 ? 3   ARG A CD   2  
ATOM 5900   N NE   . ARG A 1 3   ? -16.422 19.763  -16.753 1.00 33.14 ? 3   ARG A NE   2  
ATOM 5901   C CZ   . ARG A 1 3   ? -16.191 18.472  -16.973 1.00 61.02 ? 3   ARG A CZ   2  
ATOM 5902   N NH1  . ARG A 1 3   ? -17.063 17.556  -16.570 1.00 63.33 ? 3   ARG A NH1  2  
ATOM 5903   N NH2  . ARG A 1 3   ? -15.085 18.094  -17.599 1.00 22.40 ? 3   ARG A NH2  2  
ATOM 5904   H H    . ARG A 1 3   ? -19.577 23.856  -12.990 1.00 60.32 ? 3   ARG A H    2  
ATOM 5905   H HA   . ARG A 1 3   ? -18.601 24.241  -15.736 1.00 14.51 ? 3   ARG A HA   2  
ATOM 5906   H HB2  . ARG A 1 3   ? -17.544 22.537  -14.091 1.00 45.41 ? 3   ARG A HB2  2  
ATOM 5907   H HB3  . ARG A 1 3   ? -18.971 21.565  -14.421 1.00 53.12 ? 3   ARG A HB3  2  
ATOM 5908   H HG2  . ARG A 1 3   ? -18.227 22.122  -16.933 1.00 35.11 ? 3   ARG A HG2  2  
ATOM 5909   H HG3  . ARG A 1 3   ? -16.653 22.177  -16.137 1.00 22.21 ? 3   ARG A HG3  2  
ATOM 5910   H HD2  . ARG A 1 3   ? -17.603 19.928  -15.048 1.00 10.22 ? 3   ARG A HD2  2  
ATOM 5911   H HD3  . ARG A 1 3   ? -18.490 19.895  -16.572 1.00 74.21 ? 3   ARG A HD3  2  
ATOM 5912   H HE   . ARG A 1 3   ? -15.762 20.418  -17.061 1.00 10.14 ? 3   ARG A HE   2  
ATOM 5913   H HH11 . ARG A 1 3   ? -17.899 17.834  -16.097 1.00 65.00 ? 3   ARG A HH11 2  
ATOM 5914   H HH12 . ARG A 1 3   ? -16.884 16.587  -16.738 1.00 1.34  ? 3   ARG A HH12 2  
ATOM 5915   H HH21 . ARG A 1 3   ? -14.425 18.779  -17.906 1.00 54.24 ? 3   ARG A HH21 2  
ATOM 5916   H HH22 . ARG A 1 3   ? -14.911 17.123  -17.766 1.00 73.41 ? 3   ARG A HH22 2  
ATOM 5917   N N    . VAL A 1 4   ? -21.283 22.494  -14.893 1.00 23.01 ? 4   VAL A N    2  
ATOM 5918   C CA   . VAL A 1 4   ? -22.606 22.087  -15.350 1.00 3.23  ? 4   VAL A CA   2  
ATOM 5919   C C    . VAL A 1 4   ? -23.679 23.046  -14.847 1.00 42.03 ? 4   VAL A C    2  
ATOM 5920   O O    . VAL A 1 4   ? -23.493 23.729  -13.840 1.00 64.11 ? 4   VAL A O    2  
ATOM 5921   C CB   . VAL A 1 4   ? -22.948 20.660  -14.882 1.00 45.13 ? 4   VAL A CB   2  
ATOM 5922   C CG1  . VAL A 1 4   ? -22.022 19.647  -15.536 1.00 15.44 ? 4   VAL A CG1  2  
ATOM 5923   C CG2  . VAL A 1 4   ? -22.873 20.563  -13.366 1.00 51.32 ? 4   VAL A CG2  2  
ATOM 5924   H H    . VAL A 1 4   ? -20.969 22.200  -14.013 1.00 64.52 ? 4   VAL A H    2  
ATOM 5925   H HA   . VAL A 1 4   ? -22.604 22.099  -16.430 1.00 22.42 ? 4   VAL A HA   2  
ATOM 5926   H HB   . VAL A 1 4   ? -23.961 20.438  -15.185 1.00 22.33 ? 4   VAL A HB   2  
ATOM 5927   H HG11 . VAL A 1 4   ? -21.612 20.066  -16.442 1.00 13.31 ? 4   VAL A HG11 2  
ATOM 5928   H HG12 . VAL A 1 4   ? -22.580 18.752  -15.774 1.00 13.40 ? 4   VAL A HG12 2  
ATOM 5929   H HG13 . VAL A 1 4   ? -21.220 19.401  -14.856 1.00 65.03 ? 4   VAL A HG13 2  
ATOM 5930   H HG21 . VAL A 1 4   ? -23.467 21.350  -12.924 1.00 42.32 ? 4   VAL A HG21 2  
ATOM 5931   H HG22 . VAL A 1 4   ? -21.845 20.668  -13.050 1.00 72.23 ? 4   VAL A HG22 2  
ATOM 5932   H HG23 . VAL A 1 4   ? -23.252 19.603  -13.047 1.00 70.53 ? 4   VAL A HG23 2  
ATOM 5933   N N    . LYS A 1 5   ? -24.804 23.092  -15.553 1.00 14.23 ? 5   LYS A N    2  
ATOM 5934   C CA   . LYS A 1 5   ? -25.908 23.966  -15.178 1.00 0.33  ? 5   LYS A CA   2  
ATOM 5935   C C    . LYS A 1 5   ? -26.687 23.386  -14.002 1.00 31.43 ? 5   LYS A C    2  
ATOM 5936   O O    . LYS A 1 5   ? -27.197 22.268  -14.074 1.00 75.44 ? 5   LYS A O    2  
ATOM 5937   C CB   . LYS A 1 5   ? -26.844 24.182  -16.368 1.00 3.03  ? 5   LYS A CB   2  
ATOM 5938   C CG   . LYS A 1 5   ? -26.303 25.160  -17.398 1.00 51.31 ? 5   LYS A CG   2  
ATOM 5939   C CD   . LYS A 1 5   ? -27.321 25.436  -18.493 1.00 24.32 ? 5   LYS A CD   2  
ATOM 5940   C CE   . LYS A 1 5   ? -26.655 25.560  -19.854 1.00 2.13  ? 5   LYS A CE   2  
ATOM 5941   N NZ   . LYS A 1 5   ? -27.489 24.967  -20.936 1.00 70.24 ? 5   LYS A NZ   2  
ATOM 5942   H H    . LYS A 1 5   ? -24.893 22.523  -16.346 1.00 55.41 ? 5   LYS A H    2  
ATOM 5943   H HA   . LYS A 1 5   ? -25.491 24.918  -14.883 1.00 1.23  ? 5   LYS A HA   2  
ATOM 5944   H HB2  . LYS A 1 5   ? -27.010 23.233  -16.857 1.00 43.13 ? 5   LYS A HB2  2  
ATOM 5945   H HB3  . LYS A 1 5   ? -27.789 24.560  -16.005 1.00 51.25 ? 5   LYS A HB3  2  
ATOM 5946   H HG2  . LYS A 1 5   ? -26.060 26.089  -16.905 1.00 33.43 ? 5   LYS A HG2  2  
ATOM 5947   H HG3  . LYS A 1 5   ? -25.413 24.743  -17.843 1.00 21.42 ? 5   LYS A HG3  2  
ATOM 5948   H HD2  . LYS A 1 5   ? -28.032 24.623  -18.523 1.00 74.12 ? 5   LYS A HD2  2  
ATOM 5949   H HD3  . LYS A 1 5   ? -27.836 26.358  -18.268 1.00 4.02  ? 5   LYS A HD3  2  
ATOM 5950   H HE2  . LYS A 1 5   ? -26.496 26.606  -20.068 1.00 71.01 ? 5   LYS A HE2  2  
ATOM 5951   H HE3  . LYS A 1 5   ? -25.705 25.050  -19.822 1.00 43.44 ? 5   LYS A HE3  2  
ATOM 5952   H HZ1  . LYS A 1 5   ? -26.907 24.792  -21.781 1.00 41.23 ? 5   LYS A HZ1  2  
ATOM 5953   H HZ2  . LYS A 1 5   ? -28.262 25.615  -21.189 1.00 62.53 ? 5   LYS A HZ2  2  
ATOM 5954   H HZ3  . LYS A 1 5   ? -27.899 24.065  -20.618 1.00 74.42 ? 5   LYS A HZ3  2  
ATOM 5955   N N    . ALA A 1 6   ? -26.775 24.153  -12.920 1.00 31.03 ? 6   ALA A N    2  
ATOM 5956   C CA   . ALA A 1 6   ? -27.491 23.715  -11.729 1.00 74.24 ? 6   ALA A CA   2  
ATOM 5957   C C    . ALA A 1 6   ? -28.945 24.173  -11.764 1.00 62.13 ? 6   ALA A C    2  
ATOM 5958   O O    . ALA A 1 6   ? -29.230 25.371  -11.736 1.00 70.02 ? 6   ALA A O    2  
ATOM 5959   C CB   . ALA A 1 6   ? -26.802 24.235  -10.477 1.00 64.31 ? 6   ALA A CB   2  
ATOM 5960   H H    . ALA A 1 6   ? -26.348 25.034  -12.924 1.00 15.55 ? 6   ALA A H    2  
ATOM 5961   H HA   . ALA A 1 6   ? -27.466 22.635  -11.703 1.00 52.43 ? 6   ALA A HA   2  
ATOM 5962   H HB1  . ALA A 1 6   ? -27.035 23.590  -9.643  1.00 74.21 ? 6   ALA A HB1  2  
ATOM 5963   H HB2  . ALA A 1 6   ? -27.147 25.236  -10.265 1.00 34.51 ? 6   ALA A HB2  2  
ATOM 5964   H HB3  . ALA A 1 6   ? -25.734 24.248  -10.635 1.00 74.42 ? 6   ALA A HB3  2  
ATOM 5965   N N    . ALA A 1 7   ? -29.862 23.213  -11.824 1.00 75.43 ? 7   ALA A N    2  
ATOM 5966   C CA   . ALA A 1 7   ? -31.287 23.518  -11.863 1.00 74.22 ? 7   ALA A CA   2  
ATOM 5967   C C    . ALA A 1 7   ? -32.112 22.362  -11.307 1.00 72.15 ? 7   ALA A C    2  
ATOM 5968   O O    . ALA A 1 7   ? -33.018 22.564  -10.498 1.00 41.21 ? 7   ALA A O    2  
ATOM 5969   C CB   . ALA A 1 7   ? -31.720 23.841  -13.285 1.00 44.00 ? 7   ALA A CB   2  
ATOM 5970   H H    . ALA A 1 7   ? -29.573 22.277  -11.844 1.00 63.51 ? 7   ALA A H    2  
ATOM 5971   H HA   . ALA A 1 7   ? -31.456 24.393  -11.253 1.00 11.01 ? 7   ALA A HA   2  
ATOM 5972   H HB1  . ALA A 1 7   ? -32.445 24.641  -13.268 1.00 44.11 ? 7   ALA A HB1  2  
ATOM 5973   H HB2  . ALA A 1 7   ? -32.161 22.964  -13.735 1.00 64.14 ? 7   ALA A HB2  2  
ATOM 5974   H HB3  . ALA A 1 7   ? -30.859 24.147  -13.862 1.00 1.10  ? 7   ALA A HB3  2  
ATOM 5975   N N    . GLN A 1 8   ? -31.791 21.149  -11.746 1.00 20.10 ? 8   GLN A N    2  
ATOM 5976   C CA   . GLN A 1 8   ? -32.502 19.959  -11.291 1.00 20.41 ? 8   GLN A CA   2  
ATOM 5977   C C    . GLN A 1 8   ? -33.983 20.043  -11.646 1.00 70.20 ? 8   GLN A C    2  
ATOM 5978   O O    . GLN A 1 8   ? -34.734 20.808  -11.040 1.00 25.22 ? 8   GLN A O    2  
ATOM 5979   C CB   . GLN A 1 8   ? -32.336 19.786  -9.781  1.00 0.11  ? 8   GLN A CB   2  
ATOM 5980   C CG   . GLN A 1 8   ? -30.936 19.364  -9.367  1.00 24.45 ? 8   GLN A CG   2  
ATOM 5981   C CD   . GLN A 1 8   ? -30.847 17.889  -9.031  1.00 52.25 ? 8   GLN A CD   2  
ATOM 5982   O OE1  . GLN A 1 8   ? -31.607 17.381  -8.207  1.00 55.32 ? 8   GLN A OE1  2  
ATOM 5983   N NE2  . GLN A 1 8   ? -29.915 17.192  -9.669  1.00 44.43 ? 8   GLN A NE2  2  
ATOM 5984   H H    . GLN A 1 8   ? -31.059 21.051  -12.390 1.00 51.25 ? 8   GLN A H    2  
ATOM 5985   H HA   . GLN A 1 8   ? -32.072 19.106  -11.792 1.00 3.53  ? 8   GLN A HA   2  
ATOM 5986   H HB2  . GLN A 1 8   ? -32.565 20.724  -9.295  1.00 71.14 ? 8   GLN A HB2  2  
ATOM 5987   H HB3  . GLN A 1 8   ? -33.031 19.034  -9.437  1.00 62.25 ? 8   GLN A HB3  2  
ATOM 5988   H HG2  . GLN A 1 8   ? -30.256 19.574  -10.179 1.00 61.33 ? 8   GLN A HG2  2  
ATOM 5989   H HG3  . GLN A 1 8   ? -30.644 19.935  -8.498  1.00 61.21 ? 8   GLN A HG3  2  
ATOM 5990   H HE21 . GLN A 1 8   ? -29.344 17.662  -10.312 1.00 61.32 ? 8   GLN A HE21 2  
ATOM 5991   H HE22 . GLN A 1 8   ? -29.835 16.235  -9.471  1.00 1.23  ? 8   GLN A HE22 2  
ATOM 5992   N N    . ALA A 1 9   ? -34.396 19.251  -12.630 1.00 34.23 ? 9   ALA A N    2  
ATOM 5993   C CA   . ALA A 1 9   ? -35.787 19.234  -13.064 1.00 43.41 ? 9   ALA A CA   2  
ATOM 5994   C C    . ALA A 1 9   ? -36.137 17.912  -13.737 1.00 21.44 ? 9   ALA A C    2  
ATOM 5995   O O    . ALA A 1 9   ? -35.285 17.274  -14.354 1.00 51.44 ? 9   ALA A O    2  
ATOM 5996   C CB   . ALA A 1 9   ? -36.058 20.397  -14.009 1.00 72.25 ? 9   ALA A CB   2  
ATOM 5997   H H    . ALA A 1 9   ? -33.750 18.664  -13.074 1.00 34.44 ? 9   ALA A H    2  
ATOM 5998   H HA   . ALA A 1 9   ? -36.411 19.359  -12.191 1.00 22.40 ? 9   ALA A HA   2  
ATOM 5999   H HB1  . ALA A 1 9   ? -35.593 20.201  -14.964 1.00 10.22 ? 9   ALA A HB1  2  
ATOM 6000   H HB2  . ALA A 1 9   ? -35.650 21.304  -13.588 1.00 64.20 ? 9   ALA A HB2  2  
ATOM 6001   H HB3  . ALA A 1 9   ? -37.124 20.510  -14.144 1.00 60.25 ? 9   ALA A HB3  2  
ATOM 6002   N N    . GLY A 1 10  ? -37.396 17.506  -13.614 1.00 24.43 ? 10  GLY A N    2  
ATOM 6003   C CA   . GLY A 1 10  ? -37.836 16.261  -14.216 1.00 2.41  ? 10  GLY A CA   2  
ATOM 6004   C C    . GLY A 1 10  ? -38.566 16.476  -15.526 1.00 25.51 ? 10  GLY A C    2  
ATOM 6005   O O    . GLY A 1 10  ? -38.349 17.477  -16.208 1.00 53.23 ? 10  GLY A O    2  
ATOM 6006   H H    . GLY A 1 10  ? -38.032 18.057  -13.111 1.00 34.20 ? 10  GLY A H    2  
ATOM 6007   H HA2  . GLY A 1 10  ? -36.974 15.636  -14.394 1.00 63.13 ? 10  GLY A HA2  2  
ATOM 6008   H HA3  . GLY A 1 10  ? -38.498 15.755  -13.528 1.00 61.04 ? 10  GLY A HA3  2  
ATOM 6009   N N    . ARG A 1 11  ? -39.433 15.533  -15.881 1.00 21.23 ? 11  ARG A N    2  
ATOM 6010   C CA   . ARG A 1 11  ? -40.197 15.623  -17.121 1.00 51.05 ? 11  ARG A CA   2  
ATOM 6011   C C    . ARG A 1 11  ? -39.268 15.670  -18.330 1.00 13.04 ? 11  ARG A C    2  
ATOM 6012   O O    . ARG A 1 11  ? -38.661 16.700  -18.621 1.00 5.23  ? 11  ARG A O    2  
ATOM 6013   C CB   . ARG A 1 11  ? -41.091 16.863  -17.102 1.00 14.54 ? 11  ARG A CB   2  
ATOM 6014   C CG   . ARG A 1 11  ? -42.355 16.690  -16.275 1.00 24.04 ? 11  ARG A CG   2  
ATOM 6015   C CD   . ARG A 1 11  ? -43.192 17.958  -16.265 1.00 71.30 ? 11  ARG A CD   2  
ATOM 6016   N NE   . ARG A 1 11  ? -42.964 18.754  -15.061 1.00 22.35 ? 11  ARG A NE   2  
ATOM 6017   C CZ   . ARG A 1 11  ? -43.702 19.807  -14.718 1.00 10.33 ? 11  ARG A CZ   2  
ATOM 6018   N NH1  . ARG A 1 11  ? -44.715 20.195  -15.484 1.00 13.53 ? 11  ARG A NH1  2  
ATOM 6019   N NH2  . ARG A 1 11  ? -43.429 20.476  -13.606 1.00 53.15 ? 11  ARG A NH2  2  
ATOM 6020   H H    . ARG A 1 11  ? -39.562 14.758  -15.296 1.00 52.41 ? 11  ARG A H    2  
ATOM 6021   H HA   . ARG A 1 11  ? -40.817 14.742  -17.191 1.00 44.13 ? 11  ARG A HA   2  
ATOM 6022   H HB2  . ARG A 1 11  ? -40.531 17.692  -16.695 1.00 52.02 ? 11  ARG A HB2  2  
ATOM 6023   H HB3  . ARG A 1 11  ? -41.381 17.099  -18.116 1.00 72.42 ? 11  ARG A HB3  2  
ATOM 6024   H HG2  . ARG A 1 11  ? -42.941 15.887  -16.696 1.00 12.23 ? 11  ARG A HG2  2  
ATOM 6025   H HG3  . ARG A 1 11  ? -42.078 16.443  -15.261 1.00 24.30 ? 11  ARG A HG3  2  
ATOM 6026   H HD2  . ARG A 1 11  ? -42.935 18.552  -17.130 1.00 74.32 ? 11  ARG A HD2  2  
ATOM 6027   H HD3  . ARG A 1 11  ? -44.236 17.686  -16.313 1.00 14.14 ? 11  ARG A HD3  2  
ATOM 6028   H HE   . ARG A 1 11  ? -42.223 18.490  -14.477 1.00 35.02 ? 11  ARG A HE   2  
ATOM 6029   H HH11 . ARG A 1 11  ? -44.928 19.696  -16.324 1.00 25.30 ? 11  ARG A HH11 2  
ATOM 6030   H HH12 . ARG A 1 11  ? -45.265 20.987  -15.221 1.00 44.54 ? 11  ARG A HH12 2  
ATOM 6031   H HH21 . ARG A 1 11  ? -42.667 20.187  -13.025 1.00 12.05 ? 11  ARG A HH21 2  
ATOM 6032   H HH22 . ARG A 1 11  ? -43.982 21.267  -13.349 1.00 42.22 ? 11  ARG A HH22 2  
ATOM 6033   N N    . GLN A 1 12  ? -39.163 14.545  -19.031 1.00 11.30 ? 12  GLN A N    2  
ATOM 6034   C CA   . GLN A 1 12  ? -38.308 14.458  -20.211 1.00 3.25  ? 12  GLN A CA   2  
ATOM 6035   C C    . GLN A 1 12  ? -38.643 13.218  -21.035 1.00 14.12 ? 12  GLN A C    2  
ATOM 6036   O O    . GLN A 1 12  ? -38.738 13.283  -22.260 1.00 53.12 ? 12  GLN A O    2  
ATOM 6037   C CB   . GLN A 1 12  ? -36.836 14.427  -19.797 1.00 33.13 ? 12  GLN A CB   2  
ATOM 6038   C CG   . GLN A 1 12  ? -35.918 15.166  -20.758 1.00 40.11 ? 12  GLN A CG   2  
ATOM 6039   C CD   . GLN A 1 12  ? -35.952 16.667  -20.556 1.00 52.52 ? 12  GLN A CD   2  
ATOM 6040   O OE1  . GLN A 1 12  ? -35.150 17.222  -19.803 1.00 15.22 ? 12  GLN A OE1  2  
ATOM 6041   N NE2  . GLN A 1 12  ? -36.883 17.335  -21.228 1.00 50.52 ? 12  GLN A NE2  2  
ATOM 6042   H H    . GLN A 1 12  ? -39.672 13.756  -18.751 1.00 73.51 ? 12  GLN A H    2  
ATOM 6043   H HA   . GLN A 1 12  ? -38.485 15.335  -20.813 1.00 73.02 ? 12  GLN A HA   2  
ATOM 6044   H HB2  . GLN A 1 12  ? -36.738 14.878  -18.821 1.00 32.22 ? 12  GLN A HB2  2  
ATOM 6045   H HB3  . GLN A 1 12  ? -36.510 13.398  -19.742 1.00 11.24 ? 12  GLN A HB3  2  
ATOM 6046   H HG2  . GLN A 1 12  ? -34.906 14.820  -20.608 1.00 33.11 ? 12  GLN A HG2  2  
ATOM 6047   H HG3  . GLN A 1 12  ? -36.226 14.945  -21.770 1.00 72.01 ? 12  GLN A HG3  2  
ATOM 6048   H HE21 . GLN A 1 12  ? -37.487 16.827  -21.808 1.00 30.24 ? 12  GLN A HE21 2  
ATOM 6049   H HE22 . GLN A 1 12  ? -36.927 18.308  -21.115 1.00 30.52 ? 12  GLN A HE22 2  
ATOM 6050   N N    . SER A 1 13  ? -38.824 12.092  -20.352 1.00 5.14  ? 13  SER A N    2  
ATOM 6051   C CA   . SER A 1 13  ? -39.149 10.837  -21.021 1.00 71.35 ? 13  SER A CA   2  
ATOM 6052   C C    . SER A 1 13  ? -40.469 10.273  -20.506 1.00 24.32 ? 13  SER A C    2  
ATOM 6053   O O    . SER A 1 13  ? -41.327 9.864   -21.288 1.00 31.51 ? 13  SER A O    2  
ATOM 6054   C CB   . SER A 1 13  ? -38.028 9.818   -20.811 1.00 11.22 ? 13  SER A CB   2  
ATOM 6055   O OG   . SER A 1 13  ? -37.621 9.779   -19.454 1.00 2.35  ? 13  SER A OG   2  
ATOM 6056   H H    . SER A 1 13  ? -38.735 12.104  -19.376 1.00 31.54 ? 13  SER A H    2  
ATOM 6057   H HA   . SER A 1 13  ? -39.246 11.039  -22.077 1.00 20.44 ? 13  SER A HA   2  
ATOM 6058   H HB2  . SER A 1 13  ? -38.378 8.837   -21.096 1.00 41.43 ? 13  SER A HB2  2  
ATOM 6059   H HB3  . SER A 1 13  ? -37.179 10.088  -21.422 1.00 15.33 ? 13  SER A HB3  2  
ATOM 6060   H HG   . SER A 1 13  ? -37.155 10.589  -19.236 1.00 54.43 ? 13  SER A HG   2  
ATOM 6061   N N    . SER A 1 14  ? -40.623 10.254  -19.187 1.00 12.21 ? 14  SER A N    2  
ATOM 6062   C CA   . SER A 1 14  ? -41.838 9.739   -18.566 1.00 13.22 ? 14  SER A CA   2  
ATOM 6063   C C    . SER A 1 14  ? -42.239 10.590  -17.366 1.00 10.14 ? 14  SER A C    2  
ATOM 6064   O O    . SER A 1 14  ? -43.383 11.030  -17.257 1.00 63.32 ? 14  SER A O    2  
ATOM 6065   C CB   . SER A 1 14  ? -41.640 8.286   -18.133 1.00 61.20 ? 14  SER A CB   2  
ATOM 6066   O OG   . SER A 1 14  ? -40.531 8.161   -17.258 1.00 53.21 ? 14  SER A OG   2  
ATOM 6067   H H    . SER A 1 14  ? -39.903 10.594  -18.616 1.00 3.35  ? 14  SER A H    2  
ATOM 6068   H HA   . SER A 1 14  ? -42.628 9.781   -19.301 1.00 22.24 ? 14  SER A HA   2  
ATOM 6069   H HB2  . SER A 1 14  ? -42.526 7.940   -17.621 1.00 70.33 ? 14  SER A HB2  2  
ATOM 6070   H HB3  . SER A 1 14  ? -41.465 7.673   -19.005 1.00 3.03  ? 14  SER A HB3  2  
ATOM 6071   H HG   . SER A 1 14  ? -39.751 8.534   -17.675 1.00 30.35 ? 14  SER A HG   2  
ATOM 6072   N N    . ALA A 1 15  ? -41.288 10.817  -16.465 1.00 51.52 ? 15  ALA A N    2  
ATOM 6073   C CA   . ALA A 1 15  ? -41.541 11.615  -15.271 1.00 71.44 ? 15  ALA A CA   2  
ATOM 6074   C C    . ALA A 1 15  ? -40.253 11.870  -14.498 1.00 4.14  ? 15  ALA A C    2  
ATOM 6075   O O    . ALA A 1 15  ? -39.761 12.997  -14.443 1.00 62.22 ? 15  ALA A O    2  
ATOM 6076   C CB   . ALA A 1 15  ? -42.565 10.925  -14.383 1.00 1.12  ? 15  ALA A CB   2  
ATOM 6077   H H    . ALA A 1 15  ? -40.395 10.439  -16.606 1.00 1.23  ? 15  ALA A H    2  
ATOM 6078   H HA   . ALA A 1 15  ? -41.954 12.564  -15.586 1.00 23.25 ? 15  ALA A HA   2  
ATOM 6079   H HB1  . ALA A 1 15  ? -42.056 10.395  -13.591 1.00 3.03  ? 15  ALA A HB1  2  
ATOM 6080   H HB2  . ALA A 1 15  ? -43.140 10.226  -14.972 1.00 53.13 ? 15  ALA A HB2  2  
ATOM 6081   H HB3  . ALA A 1 15  ? -43.226 11.664  -13.955 1.00 4.23  ? 15  ALA A HB3  2  
ATOM 6082   N N    . LYS A 1 16  ? -39.709 10.814  -13.900 1.00 71.51 ? 16  LYS A N    2  
ATOM 6083   C CA   . LYS A 1 16  ? -38.476 10.923  -13.130 1.00 62.22 ? 16  LYS A CA   2  
ATOM 6084   C C    . LYS A 1 16  ? -37.870 9.546   -12.875 1.00 4.41  ? 16  LYS A C    2  
ATOM 6085   O O    . LYS A 1 16  ? -37.238 9.315   -11.844 1.00 25.03 ? 16  LYS A O    2  
ATOM 6086   C CB   . LYS A 1 16  ? -38.743 11.629  -11.799 1.00 5.24  ? 16  LYS A CB   2  
ATOM 6087   C CG   . LYS A 1 16  ? -37.557 12.429  -11.287 1.00 14.52 ? 16  LYS A CG   2  
ATOM 6088   C CD   . LYS A 1 16  ? -37.944 13.310  -10.110 1.00 62.35 ? 16  LYS A CD   2  
ATOM 6089   C CE   . LYS A 1 16  ? -38.373 14.695  -10.568 1.00 73.55 ? 16  LYS A CE   2  
ATOM 6090   N NZ   . LYS A 1 16  ? -37.251 15.673  -10.504 1.00 5.43  ? 16  LYS A NZ   2  
ATOM 6091   H H    . LYS A 1 16  ? -40.147 9.941   -13.981 1.00 43.40 ? 16  LYS A H    2  
ATOM 6092   H HA   . LYS A 1 16  ? -37.776 11.510  -13.704 1.00 30.45 ? 16  LYS A HA   2  
ATOM 6093   H HB2  . LYS A 1 16  ? -39.577 12.303  -11.923 1.00 52.11 ? 16  LYS A HB2  2  
ATOM 6094   H HB3  . LYS A 1 16  ? -38.998 10.887  -11.056 1.00 51.53 ? 16  LYS A HB3  2  
ATOM 6095   H HG2  . LYS A 1 16  ? -36.782 11.745  -10.971 1.00 64.13 ? 16  LYS A HG2  2  
ATOM 6096   H HG3  . LYS A 1 16  ? -37.184 13.054  -12.086 1.00 60.11 ? 16  LYS A HG3  2  
ATOM 6097   H HD2  . LYS A 1 16  ? -38.765 12.848  -9.582  1.00 54.53 ? 16  LYS A HD2  2  
ATOM 6098   H HD3  . LYS A 1 16  ? -37.096 13.405  -9.449  1.00 64.31 ? 16  LYS A HD3  2  
ATOM 6099   H HE2  . LYS A 1 16  ? -38.722 14.631  -11.588 1.00 4.22  ? 16  LYS A HE2  2  
ATOM 6100   H HE3  . LYS A 1 16  ? -39.176 15.037  -9.934  1.00 22.44 ? 16  LYS A HE3  2  
ATOM 6101   H HZ1  . LYS A 1 16  ? -37.625 16.638  -10.402 1.00 21.25 ? 16  LYS A HZ1  2  
ATOM 6102   H HZ2  . LYS A 1 16  ? -36.683 15.622  -11.373 1.00 44.40 ? 16  LYS A HZ2  2  
ATOM 6103   H HZ3  . LYS A 1 16  ? -36.640 15.460  -9.689  1.00 3.43  ? 16  LYS A HZ3  2  
ATOM 6104   N N    . ARG A 1 17  ? -38.067 8.634   -13.822 1.00 73.44 ? 17  ARG A N    2  
ATOM 6105   C CA   . ARG A 1 17  ? -37.540 7.281   -13.700 1.00 24.43 ? 17  ARG A CA   2  
ATOM 6106   C C    . ARG A 1 17  ? -36.227 7.137   -14.463 1.00 34.01 ? 17  ARG A C    2  
ATOM 6107   O O    . ARG A 1 17  ? -35.217 6.709   -13.905 1.00 15.22 ? 17  ARG A O    2  
ATOM 6108   C CB   . ARG A 1 17  ? -38.559 6.265   -14.221 1.00 45.10 ? 17  ARG A CB   2  
ATOM 6109   C CG   . ARG A 1 17  ? -38.606 4.980   -13.411 1.00 71.43 ? 17  ARG A CG   2  
ATOM 6110   C CD   . ARG A 1 17  ? -39.266 5.198   -12.059 1.00 2.12  ? 17  ARG A CD   2  
ATOM 6111   N NE   . ARG A 1 17  ? -38.849 4.198   -11.078 1.00 34.11 ? 17  ARG A NE   2  
ATOM 6112   C CZ   . ARG A 1 17  ? -39.339 2.962   -11.025 1.00 53.14 ? 17  ARG A CZ   2  
ATOM 6113   N NH1  . ARG A 1 17  ? -40.263 2.569   -11.893 1.00 21.13 ? 17  ARG A NH1  2  
ATOM 6114   N NH2  . ARG A 1 17  ? -38.904 2.116   -10.100 1.00 12.25 ? 17  ARG A NH2  2  
ATOM 6115   H H    . ARG A 1 17  ? -38.579 8.878   -14.621 1.00 1.33  ? 17  ARG A H    2  
ATOM 6116   H HA   . ARG A 1 17  ? -37.357 7.088   -12.654 1.00 42.53 ? 17  ARG A HA   2  
ATOM 6117   H HB2  . ARG A 1 17  ? -39.541 6.714   -14.199 1.00 72.52 ? 17  ARG A HB2  2  
ATOM 6118   H HB3  . ARG A 1 17  ? -38.311 6.013   -15.241 1.00 55.52 ? 17  ARG A HB3  2  
ATOM 6119   H HG2  . ARG A 1 17  ? -39.169 4.239   -13.960 1.00 54.33 ? 17  ARG A HG2  2  
ATOM 6120   H HG3  . ARG A 1 17  ? -37.597 4.627   -13.257 1.00 74.31 ? 17  ARG A HG3  2  
ATOM 6121   H HD2  . ARG A 1 17  ? -38.998 6.178   -11.696 1.00 3.24  ? 17  ARG A HD2  2  
ATOM 6122   H HD3  . ARG A 1 17  ? -40.339 5.141   -12.183 1.00 41.00 ? 17  ARG A HD3  2  
ATOM 6123   H HE   . ARG A 1 17  ? -38.167 4.462   -10.425 1.00 41.22 ? 17  ARG A HE   2  
ATOM 6124   H HH11 . ARG A 1 17  ? -40.595 3.201   -12.592 1.00 51.01 ? 17  ARG A HH11 2  
ATOM 6125   H HH12 . ARG A 1 17  ? -40.627 1.639   -11.847 1.00 53.34 ? 17  ARG A HH12 2  
ATOM 6126   H HH21 . ARG A 1 17  ? -38.208 2.407   -9.445  1.00 31.53 ? 17  ARG A HH21 2  
ATOM 6127   H HH22 . ARG A 1 17  ? -39.273 1.188   -10.060 1.00 63.15 ? 17  ARG A HH22 2  
ATOM 6128   N N    . HIS A 1 18  ? -36.249 7.500   -15.741 1.00 33.51 ? 18  HIS A N    2  
ATOM 6129   C CA   . HIS A 1 18  ? -35.060 7.412   -16.581 1.00 72.11 ? 18  HIS A CA   2  
ATOM 6130   C C    . HIS A 1 18  ? -34.041 8.480   -16.194 1.00 70.22 ? 18  HIS A C    2  
ATOM 6131   O O    . HIS A 1 18  ? -34.370 9.663   -16.110 1.00 14.22 ? 18  HIS A O    2  
ATOM 6132   C CB   . HIS A 1 18  ? -35.439 7.563   -18.056 1.00 32.23 ? 18  HIS A CB   2  
ATOM 6133   C CG   . HIS A 1 18  ? -35.774 6.266   -18.723 1.00 20.25 ? 18  HIS A CG   2  
ATOM 6134   N ND1  . HIS A 1 18  ? -34.976 5.688   -19.689 1.00 34.01 ? 18  HIS A ND1  2  
ATOM 6135   C CD2  . HIS A 1 18  ? -36.826 5.430   -18.558 1.00 21.22 ? 18  HIS A CD2  2  
ATOM 6136   C CE1  . HIS A 1 18  ? -35.526 4.554   -20.091 1.00 22.30 ? 18  HIS A CE1  2  
ATOM 6137   N NE2  . HIS A 1 18  ? -36.648 4.375   -19.420 1.00 2.44  ? 18  HIS A NE2  2  
ATOM 6138   H H    . HIS A 1 18  ? -37.085 7.834   -16.130 1.00 35.43 ? 18  HIS A H    2  
ATOM 6139   H HA   . HIS A 1 18  ? -34.618 6.439   -16.430 1.00 13.23 ? 18  HIS A HA   2  
ATOM 6140   H HB2  . HIS A 1 18  ? -36.301 8.208   -18.134 1.00 2.35  ? 18  HIS A HB2  2  
ATOM 6141   H HB3  . HIS A 1 18  ? -34.611 8.008   -18.588 1.00 52.43 ? 18  HIS A HB3  2  
ATOM 6142   H HD1  . HIS A 1 18  ? -34.134 6.055   -20.030 1.00 0.21  ? 18  HIS A HD1  2  
ATOM 6143   H HD2  . HIS A 1 18  ? -37.654 5.567   -17.875 1.00 1.53  ? 18  HIS A HD2  2  
ATOM 6144   H HE1  . HIS A 1 18  ? -35.123 3.888   -20.839 1.00 2.02  ? 18  HIS A HE1  2  
ATOM 6145   H HE2  . HIS A 1 18  ? -37.295 3.658   -19.583 1.00 37.47 ? 18  HIS A HE2  2  
ATOM 6146   N N    . LEU A 1 19  ? -32.805 8.053   -15.960 1.00 15.11 ? 19  LEU A N    2  
ATOM 6147   C CA   . LEU A 1 19  ? -31.738 8.973   -15.581 1.00 3.13  ? 19  LEU A CA   2  
ATOM 6148   C C    . LEU A 1 19  ? -30.385 8.268   -15.586 1.00 0.23  ? 19  LEU A C    2  
ATOM 6149   O O    . LEU A 1 19  ? -29.389 8.821   -16.051 1.00 64.43 ? 19  LEU A O    2  
ATOM 6150   C CB   . LEU A 1 19  ? -32.014 9.565   -14.198 1.00 22.41 ? 19  LEU A CB   2  
ATOM 6151   C CG   . LEU A 1 19  ? -31.576 11.019  -14.017 1.00 13.15 ? 19  LEU A CG   2  
ATOM 6152   C CD1  . LEU A 1 19  ? -32.674 11.967  -14.473 1.00 13.10 ? 19  LEU A CD1  2  
ATOM 6153   C CD2  . LEU A 1 19  ? -31.206 11.287  -12.566 1.00 23.15 ? 19  LEU A CD2  2  
ATOM 6154   H H    . LEU A 1 19  ? -32.606 7.098   -16.042 1.00 60.54 ? 19  LEU A H    2  
ATOM 6155   H HA   . LEU A 1 19  ? -31.717 9.772   -16.307 1.00 65.12 ? 19  LEU A HA   2  
ATOM 6156   H HB2  . LEU A 1 19  ? -33.076 9.504   -14.009 1.00 2.14  ? 19  LEU A HB2  2  
ATOM 6157   H HB3  . LEU A 1 19  ? -31.499 8.964   -13.463 1.00 5.15  ? 19  LEU A HB3  2  
ATOM 6158   H HG   . LEU A 1 19  ? -30.702 11.203  -14.626 1.00 3.00  ? 19  LEU A HG   2  
ATOM 6159   H HD11 . LEU A 1 19  ? -32.245 12.932  -14.699 1.00 64.13 ? 19  LEU A HD11 2  
ATOM 6160   H HD12 . LEU A 1 19  ? -33.407 12.075  -13.686 1.00 11.14 ? 19  LEU A HD12 2  
ATOM 6161   H HD13 . LEU A 1 19  ? -33.149 11.569  -15.357 1.00 61.51 ? 19  LEU A HD13 2  
ATOM 6162   H HD21 . LEU A 1 19  ? -30.426 10.605  -12.261 1.00 71.24 ? 19  LEU A HD21 2  
ATOM 6163   H HD22 . LEU A 1 19  ? -32.075 11.144  -11.940 1.00 31.43 ? 19  LEU A HD22 2  
ATOM 6164   H HD23 . LEU A 1 19  ? -30.854 12.303  -12.465 1.00 34.23 ? 19  LEU A HD23 2  
ATOM 6165   N N    . ALA A 1 20  ? -30.359 7.046   -15.065 1.00 15.31 ? 20  ALA A N    2  
ATOM 6166   C CA   . ALA A 1 20  ? -29.128 6.266   -15.010 1.00 60.21 ? 20  ALA A CA   2  
ATOM 6167   C C    . ALA A 1 20  ? -28.553 6.047   -16.405 1.00 3.11  ? 20  ALA A C    2  
ATOM 6168   O O    . ALA A 1 20  ? -29.165 6.420   -17.405 1.00 5.15  ? 20  ALA A O    2  
ATOM 6169   C CB   . ALA A 1 20  ? -29.381 4.931   -14.325 1.00 44.35 ? 20  ALA A CB   2  
ATOM 6170   H H    . ALA A 1 20  ? -31.186 6.659   -14.710 1.00 74.31 ? 20  ALA A H    2  
ATOM 6171   H HA   . ALA A 1 20  ? -28.411 6.817   -14.418 1.00 41.34 ? 20  ALA A HA   2  
ATOM 6172   H HB1  . ALA A 1 20  ? -30.237 5.017   -13.673 1.00 31.12 ? 20  ALA A HB1  2  
ATOM 6173   H HB2  . ALA A 1 20  ? -28.513 4.654   -13.745 1.00 14.23 ? 20  ALA A HB2  2  
ATOM 6174   H HB3  . ALA A 1 20  ? -29.571 4.174   -15.072 1.00 24.41 ? 20  ALA A HB3  2  
ATOM 6175   N N    . GLU A 1 21  ? -27.372 5.439   -16.464 1.00 25.24 ? 21  GLU A N    2  
ATOM 6176   C CA   . GLU A 1 21  ? -26.713 5.169   -17.738 1.00 64.03 ? 21  GLU A CA   2  
ATOM 6177   C C    . GLU A 1 21  ? -25.387 4.446   -17.520 1.00 52.10 ? 21  GLU A C    2  
ATOM 6178   O O    . GLU A 1 21  ? -24.317 5.047   -17.618 1.00 21.21 ? 21  GLU A O    2  
ATOM 6179   C CB   . GLU A 1 21  ? -26.479 6.473   -18.503 1.00 52.23 ? 21  GLU A CB   2  
ATOM 6180   C CG   . GLU A 1 21  ? -27.518 6.741   -19.580 1.00 13.44 ? 21  GLU A CG   2  
ATOM 6181   C CD   . GLU A 1 21  ? -26.960 6.581   -20.981 1.00 2.20  ? 21  GLU A CD   2  
ATOM 6182   O OE1  . GLU A 1 21  ? -26.534 5.459   -21.326 1.00 41.44 ? 21  GLU A OE1  2  
ATOM 6183   O OE2  . GLU A 1 21  ? -26.951 7.579   -21.734 1.00 71.40 ? 21  GLU A OE2  2  
ATOM 6184   H H    . GLU A 1 21  ? -26.934 5.164   -15.632 1.00 3.11  ? 21  GLU A H    2  
ATOM 6185   H HA   . GLU A 1 21  ? -27.364 4.533   -18.319 1.00 62.15 ? 21  GLU A HA   2  
ATOM 6186   H HB2  . GLU A 1 21  ? -26.498 7.296   -17.803 1.00 31.54 ? 21  GLU A HB2  2  
ATOM 6187   H HB3  . GLU A 1 21  ? -25.507 6.434   -18.972 1.00 22.13 ? 21  GLU A HB3  2  
ATOM 6188   H HG2  . GLU A 1 21  ? -28.335 6.047   -19.454 1.00 34.10 ? 21  GLU A HG2  2  
ATOM 6189   H HG3  . GLU A 1 21  ? -27.883 7.751   -19.466 1.00 10.45 ? 21  GLU A HG3  2  
ATOM 6190   N N    . GLN A 1 22  ? -25.465 3.152   -17.223 1.00 32.42 ? 22  GLN A N    2  
ATOM 6191   C CA   . GLN A 1 22  ? -24.272 2.348   -16.992 1.00 24.04 ? 22  GLN A CA   2  
ATOM 6192   C C    . GLN A 1 22  ? -24.638 0.885   -16.760 1.00 34.32 ? 22  GLN A C    2  
ATOM 6193   O O    . GLN A 1 22  ? -24.458 0.043   -17.640 1.00 34.21 ? 22  GLN A O    2  
ATOM 6194   C CB   . GLN A 1 22  ? -23.492 2.889   -15.791 1.00 62.14 ? 22  GLN A CB   2  
ATOM 6195   C CG   . GLN A 1 22  ? -22.340 3.804   -16.177 1.00 63.10 ? 22  GLN A CG   2  
ATOM 6196   C CD   . GLN A 1 22  ? -22.390 5.139   -15.461 1.00 62.43 ? 22  GLN A CD   2  
ATOM 6197   O OE1  . GLN A 1 22  ? -23.459 5.606   -15.067 1.00 15.11 ? 22  GLN A OE1  2  
ATOM 6198   N NE2  . GLN A 1 22  ? -21.229 5.762   -15.290 1.00 22.25 ? 22  GLN A NE2  2  
ATOM 6199   H H    . GLN A 1 22  ? -26.347 2.729   -17.159 1.00 72.12 ? 22  GLN A H    2  
ATOM 6200   H HA   . GLN A 1 22  ? -23.651 2.416   -17.873 1.00 14.24 ? 22  GLN A HA   2  
ATOM 6201   H HB2  . GLN A 1 22  ? -24.167 3.443   -15.157 1.00 43.42 ? 22  GLN A HB2  2  
ATOM 6202   H HB3  . GLN A 1 22  ? -23.089 2.056   -15.233 1.00 51.24 ? 22  GLN A HB3  2  
ATOM 6203   H HG2  . GLN A 1 22  ? -21.409 3.314   -15.929 1.00 2.15  ? 22  GLN A HG2  2  
ATOM 6204   H HG3  . GLN A 1 22  ? -22.379 3.981   -17.242 1.00 42.02 ? 22  GLN A HG3  2  
ATOM 6205   H HE21 . GLN A 1 22  ? -20.418 5.331   -15.629 1.00 73.31 ? 22  GLN A HE21 2  
ATOM 6206   H HE22 . GLN A 1 22  ? -21.232 6.628   -14.829 1.00 71.22 ? 22  GLN A HE22 2  
ATOM 6207   N N    . PHE A 1 23  ? -25.152 0.590   -15.571 1.00 35.51 ? 23  PHE A N    2  
ATOM 6208   C CA   . PHE A 1 23  ? -25.543 -0.771  -15.224 1.00 64.13 ? 23  PHE A CA   2  
ATOM 6209   C C    . PHE A 1 23  ? -26.923 -0.792  -14.575 1.00 32.31 ? 23  PHE A C    2  
ATOM 6210   O O    . PHE A 1 23  ? -27.241 0.053   -13.740 1.00 65.21 ? 23  PHE A O    2  
ATOM 6211   C CB   . PHE A 1 23  ? -24.515 -1.394  -14.278 1.00 25.33 ? 23  PHE A CB   2  
ATOM 6212   C CG   . PHE A 1 23  ? -23.369 -2.056  -14.989 1.00 34.14 ? 23  PHE A CG   2  
ATOM 6213   C CD1  . PHE A 1 23  ? -22.480 -1.307  -15.743 1.00 61.34 ? 23  PHE A CD1  2  
ATOM 6214   C CD2  . PHE A 1 23  ? -23.180 -3.425  -14.902 1.00 21.51 ? 23  PHE A CD2  2  
ATOM 6215   C CE1  . PHE A 1 23  ? -21.424 -1.913  -16.398 1.00 63.30 ? 23  PHE A CE1  2  
ATOM 6216   C CE2  . PHE A 1 23  ? -22.126 -4.038  -15.554 1.00 31.21 ? 23  PHE A CE2  2  
ATOM 6217   C CZ   . PHE A 1 23  ? -21.248 -3.280  -16.304 1.00 74.41 ? 23  PHE A CZ   2  
ATOM 6218   H H    . PHE A 1 23  ? -25.271 1.304   -14.911 1.00 53.00 ? 23  PHE A H    2  
ATOM 6219   H HA   . PHE A 1 23  ? -25.578 -1.349  -16.135 1.00 23.22 ? 23  PHE A HA   2  
ATOM 6220   H HB2  . PHE A 1 23  ? -24.108 -0.623  -13.641 1.00 33.14 ? 23  PHE A HB2  2  
ATOM 6221   H HB3  . PHE A 1 23  ? -25.003 -2.140  -13.668 1.00 23.23 ? 23  PHE A HB3  2  
ATOM 6222   H HD1  . PHE A 1 23  ? -22.616 -0.239  -15.817 1.00 71.30 ? 23  PHE A HD1  2  
ATOM 6223   H HD2  . PHE A 1 23  ? -23.868 -4.019  -14.317 1.00 13.13 ? 23  PHE A HD2  2  
ATOM 6224   H HE1  . PHE A 1 23  ? -20.738 -1.319  -16.983 1.00 55.22 ? 23  PHE A HE1  2  
ATOM 6225   H HE2  . PHE A 1 23  ? -21.991 -5.106  -15.478 1.00 4.13  ? 23  PHE A HE2  2  
ATOM 6226   H HZ   . PHE A 1 23  ? -20.423 -3.756  -16.814 1.00 35.32 ? 23  PHE A HZ   2  
ATOM 6227   N N    . ALA A 1 24  ? -27.740 -1.765  -14.966 1.00 15.04 ? 24  ALA A N    2  
ATOM 6228   C CA   . ALA A 1 24  ? -29.087 -1.897  -14.422 1.00 63.24 ? 24  ALA A CA   2  
ATOM 6229   C C    . ALA A 1 24  ? -29.048 -2.375  -12.975 1.00 73.23 ? 24  ALA A C    2  
ATOM 6230   O O    . ALA A 1 24  ? -28.328 -3.317  -12.642 1.00 62.02 ? 24  ALA A O    2  
ATOM 6231   C CB   . ALA A 1 24  ? -29.909 -2.852  -15.275 1.00 53.51 ? 24  ALA A CB   2  
ATOM 6232   H H    . ALA A 1 24  ? -27.430 -2.410  -15.635 1.00 4.34  ? 24  ALA A H    2  
ATOM 6233   H HA   . ALA A 1 24  ? -29.557 -0.925  -14.457 1.00 63.20 ? 24  ALA A HA   2  
ATOM 6234   H HB1  . ALA A 1 24  ? -30.921 -2.484  -15.353 1.00 11.41 ? 24  ALA A HB1  2  
ATOM 6235   H HB2  . ALA A 1 24  ? -29.915 -3.830  -14.815 1.00 0.23  ? 24  ALA A HB2  2  
ATOM 6236   H HB3  . ALA A 1 24  ? -29.473 -2.921  -16.260 1.00 25.35 ? 24  ALA A HB3  2  
ATOM 6237   N N    . VAL A 1 25  ? -29.834 -1.728  -12.121 1.00 21.11 ? 25  VAL A N    2  
ATOM 6238   C CA   . VAL A 1 25  ? -29.898 -2.096  -10.713 1.00 3.24  ? 25  VAL A CA   2  
ATOM 6239   C C    . VAL A 1 25  ? -30.691 -3.384  -10.520 1.00 55.12 ? 25  VAL A C    2  
ATOM 6240   O O    . VAL A 1 25  ? -31.880 -3.440  -10.830 1.00 13.03 ? 25  VAL A O    2  
ATOM 6241   C CB   . VAL A 1 25  ? -30.541 -0.980  -9.869  1.00 44.54 ? 25  VAL A CB   2  
ATOM 6242   C CG1  . VAL A 1 25  ? -30.422 -1.294  -8.385  1.00 53.10 ? 25  VAL A CG1  2  
ATOM 6243   C CG2  . VAL A 1 25  ? -29.907 0.365   -10.188 1.00 53.45 ? 25  VAL A CG2  2  
ATOM 6244   H H    . VAL A 1 25  ? -30.398 -0.997  -12.449 1.00 13.21 ? 25  VAL A H    2  
ATOM 6245   H HA   . VAL A 1 25  ? -28.888 -2.249  -10.361 1.00 65.12 ? 25  VAL A HA   2  
ATOM 6246   H HB   . VAL A 1 25  ? -31.591 -0.927  -10.119 1.00 4.33  ? 25  VAL A HB   2  
ATOM 6247   H HG11 . VAL A 1 25  ? -31.078 -0.644  -7.825  1.00 60.42 ? 25  VAL A HG11 2  
ATOM 6248   H HG12 . VAL A 1 25  ? -29.402 -1.140  -8.065  1.00 31.34 ? 25  VAL A HG12 2  
ATOM 6249   H HG13 . VAL A 1 25  ? -30.702 -2.323  -8.212  1.00 32.42 ? 25  VAL A HG13 2  
ATOM 6250   H HG21 . VAL A 1 25  ? -30.305 1.119   -9.525  1.00 52.00 ? 25  VAL A HG21 2  
ATOM 6251   H HG22 . VAL A 1 25  ? -30.128 0.633   -11.211 1.00 40.41 ? 25  VAL A HG22 2  
ATOM 6252   H HG23 . VAL A 1 25  ? -28.837 0.298   -10.057 1.00 53.31 ? 25  VAL A HG23 2  
ATOM 6253   N N    . GLY A 1 26  ? -30.031 -4.417  -10.006 1.00 53.22 ? 26  GLY A N    2  
ATOM 6254   C CA   . GLY A 1 26  ? -30.707 -5.684  -9.786  1.00 11.23 ? 26  GLY A CA   2  
ATOM 6255   C C    . GLY A 1 26  ? -30.340 -6.736  -10.816 1.00 14.21 ? 26  GLY A C    2  
ATOM 6256   O O    . GLY A 1 26  ? -30.969 -7.793  -10.883 1.00 71.41 ? 26  GLY A O    2  
ATOM 6257   H H    . GLY A 1 26  ? -29.081 -4.321  -9.774  1.00 63.01 ? 26  GLY A H    2  
ATOM 6258   H HA2  . GLY A 1 26  ? -30.444 -6.051  -8.805  1.00 41.25 ? 26  GLY A HA2  2  
ATOM 6259   H HA3  . GLY A 1 26  ? -31.774 -5.519  -9.822  1.00 73.01 ? 26  GLY A HA3  2  
ATOM 6260   N N    . GLU A 1 27  ? -29.314 -6.457  -11.613 1.00 75.21 ? 27  GLU A N    2  
ATOM 6261   C CA   . GLU A 1 27  ? -28.859 -7.397  -12.631 1.00 14.31 ? 27  GLU A CA   2  
ATOM 6262   C C    . GLU A 1 27  ? -27.747 -8.274  -12.071 1.00 44.43 ? 27  GLU A C    2  
ATOM 6263   O O    . GLU A 1 27  ? -27.010 -7.851  -11.180 1.00 72.21 ? 27  GLU A O    2  
ATOM 6264   C CB   . GLU A 1 27  ? -28.365 -6.648  -13.870 1.00 73.41 ? 27  GLU A CB   2  
ATOM 6265   C CG   . GLU A 1 27  ? -29.451 -6.396  -14.902 1.00 61.00 ? 27  GLU A CG   2  
ATOM 6266   C CD   . GLU A 1 27  ? -29.682 -7.589  -15.808 1.00 2.24  ? 27  GLU A CD   2  
ATOM 6267   O OE1  . GLU A 1 27  ? -30.217 -8.608  -15.323 1.00 73.00 ? 27  GLU A OE1  2  
ATOM 6268   O OE2  . GLU A 1 27  ? -29.326 -7.506  -17.002 1.00 24.02 ? 27  GLU A OE2  2  
ATOM 6269   H H    . GLU A 1 27  ? -28.839 -5.607  -11.501 1.00 3.34  ? 27  GLU A H    2  
ATOM 6270   H HA   . GLU A 1 27  ? -29.695 -8.023  -12.905 1.00 71.14 ? 27  GLU A HA   2  
ATOM 6271   H HB2  . GLU A 1 27  ? -27.963 -5.693  -13.562 1.00 50.22 ? 27  GLU A HB2  2  
ATOM 6272   H HB3  . GLU A 1 27  ? -27.581 -7.224  -14.336 1.00 11.23 ? 27  GLU A HB3  2  
ATOM 6273   H HG2  . GLU A 1 27  ? -30.374 -6.170  -14.388 1.00 2.30  ? 27  GLU A HG2  2  
ATOM 6274   H HG3  . GLU A 1 27  ? -29.163 -5.550  -15.510 1.00 73.25 ? 27  GLU A HG3  2  
ATOM 6275   N N    . ILE A 1 28  ? -27.616 -9.489  -12.594 1.00 42.53 ? 28  ILE A N    2  
ATOM 6276   C CA   . ILE A 1 28  ? -26.576 -10.395 -12.122 1.00 23.04 ? 28  ILE A CA   2  
ATOM 6277   C C    . ILE A 1 28  ? -25.668 -10.844 -13.259 1.00 15.13 ? 28  ILE A C    2  
ATOM 6278   O O    . ILE A 1 28  ? -26.061 -11.651 -14.101 1.00 34.12 ? 28  ILE A O    2  
ATOM 6279   C CB   . ILE A 1 28  ? -27.184 -11.646 -11.456 1.00 54.14 ? 28  ILE A CB   2  
ATOM 6280   C CG1  . ILE A 1 28  ? -28.301 -12.223 -12.329 1.00 33.55 ? 28  ILE A CG1  2  
ATOM 6281   C CG2  . ILE A 1 28  ? -27.711 -11.306 -10.073 1.00 1.42  ? 28  ILE A CG2  2  
ATOM 6282   C CD1  . ILE A 1 28  ? -28.386 -13.734 -12.280 1.00 72.10 ? 28  ILE A CD1  2  
ATOM 6283   H H    . ILE A 1 28  ? -28.223 -9.774  -13.309 1.00 72.00 ? 28  ILE A H    2  
ATOM 6284   H HA   . ILE A 1 28  ? -25.986 -9.872  -11.386 1.00 51.12 ? 28  ILE A HA   2  
ATOM 6285   H HB   . ILE A 1 28  ? -26.404 -12.384 -11.346 1.00 52.51 ? 28  ILE A HB   2  
ATOM 6286   H HG12 . ILE A 1 28  ? -29.249 -11.829 -11.996 1.00 25.23 ? 28  ILE A HG12 2  
ATOM 6287   H HG13 . ILE A 1 28  ? -28.135 -11.932 -13.355 1.00 12.40 ? 28  ILE A HG13 2  
ATOM 6288   H HG21 . ILE A 1 28  ? -28.492 -10.565 -10.158 1.00 3.33  ? 28  ILE A HG21 2  
ATOM 6289   H HG22 . ILE A 1 28  ? -26.908 -10.916 -9.467  1.00 72.41 ? 28  ILE A HG22 2  
ATOM 6290   H HG23 . ILE A 1 28  ? -28.112 -12.197 -9.611  1.00 52.22 ? 28  ILE A HG23 2  
ATOM 6291   H HD11 . ILE A 1 28  ? -28.099 -14.079 -11.297 1.00 3.11  ? 28  ILE A HD11 2  
ATOM 6292   H HD12 . ILE A 1 28  ? -27.722 -14.155 -13.019 1.00 53.14 ? 28  ILE A HD12 2  
ATOM 6293   H HD13 . ILE A 1 28  ? -29.400 -14.044 -12.488 1.00 3.41  ? 28  ILE A HD13 2  
ATOM 6294   N N    . ILE A 1 29  ? -24.455 -10.300 -13.290 1.00 3.54  ? 29  ILE A N    2  
ATOM 6295   C CA   . ILE A 1 29  ? -23.495 -10.629 -14.338 1.00 43.02 ? 29  ILE A CA   2  
ATOM 6296   C C    . ILE A 1 29  ? -22.704 -11.890 -14.013 1.00 0.21  ? 29  ILE A C    2  
ATOM 6297   O O    . ILE A 1 29  ? -22.784 -12.421 -12.906 1.00 13.54 ? 29  ILE A O    2  
ATOM 6298   C CB   . ILE A 1 29  ? -22.517 -9.468  -14.600 1.00 63.03 ? 29  ILE A CB   2  
ATOM 6299   C CG1  . ILE A 1 29  ? -21.715 -9.141  -13.341 1.00 34.40 ? 29  ILE A CG1  2  
ATOM 6300   C CG2  . ILE A 1 29  ? -23.273 -8.240  -15.085 1.00 74.24 ? 29  ILE A CG2  2  
ATOM 6301   C CD1  . ILE A 1 29  ? -20.724 -8.014  -13.536 1.00 53.24 ? 29  ILE A CD1  2  
ATOM 6302   H H    . ILE A 1 29  ? -24.205 -9.628  -12.618 1.00 23.02 ? 29  ILE A H    2  
ATOM 6303   H HA   . ILE A 1 29  ? -24.054 -10.802 -15.247 1.00 42.24 ? 29  ILE A HA   2  
ATOM 6304   H HB   . ILE A 1 29  ? -21.837 -9.770  -15.382 1.00 50.41 ? 29  ILE A HB   2  
ATOM 6305   H HG12 . ILE A 1 29  ? -22.394 -8.852  -12.552 1.00 73.32 ? 29  ILE A HG12 2  
ATOM 6306   H HG13 . ILE A 1 29  ? -21.165 -10.018 -13.033 1.00 52.23 ? 29  ILE A HG13 2  
ATOM 6307   H HG21 . ILE A 1 29  ? -24.025 -8.538  -15.800 1.00 32.24 ? 29  ILE A HG21 2  
ATOM 6308   H HG22 . ILE A 1 29  ? -22.584 -7.553  -15.552 1.00 73.02 ? 29  ILE A HG22 2  
ATOM 6309   H HG23 . ILE A 1 29  ? -23.750 -7.755  -14.244 1.00 11.13 ? 29  ILE A HG23 2  
ATOM 6310   H HD11 . ILE A 1 29  ? -19.719 -8.407  -13.496 1.00 51.13 ? 29  ILE A HD11 2  
ATOM 6311   H HD12 . ILE A 1 29  ? -20.855 -7.279  -12.756 1.00 2.31  ? 29  ILE A HD12 2  
ATOM 6312   H HD13 . ILE A 1 29  ? -20.892 -7.551  -14.498 1.00 5.31  ? 29  ILE A HD13 2  
ATOM 6313   N N    . THR A 1 30  ? -21.936 -12.358 -14.991 1.00 75.42 ? 30  THR A N    2  
ATOM 6314   C CA   . THR A 1 30  ? -21.117 -13.553 -14.825 1.00 0.13  ? 30  THR A CA   2  
ATOM 6315   C C    . THR A 1 30  ? -19.634 -13.212 -14.943 1.00 44.22 ? 30  THR A C    2  
ATOM 6316   O O    . THR A 1 30  ? -19.120 -13.005 -16.042 1.00 11.00 ? 30  THR A O    2  
ATOM 6317   C CB   . THR A 1 30  ? -21.495 -14.606 -15.868 1.00 22.15 ? 30  THR A CB   2  
ATOM 6318   O OG1  . THR A 1 30  ? -22.874 -14.530 -16.179 1.00 40.12 ? 30  THR A OG1  2  
ATOM 6319   C CG2  . THR A 1 30  ? -21.201 -16.022 -15.421 1.00 24.40 ? 30  THR A CG2  2  
ATOM 6320   H H    . THR A 1 30  ? -21.906 -11.871 -15.842 1.00 65.50 ? 30  THR A H    2  
ATOM 6321   H HA   . THR A 1 30  ? -21.306 -13.951 -13.839 1.00 72.33 ? 30  THR A HA   2  
ATOM 6322   H HB   . THR A 1 30  ? -20.931 -14.420 -16.771 1.00 52.24 ? 30  THR A HB   2  
ATOM 6323   H HG1  . THR A 1 30  ? -23.063 -13.687 -16.597 1.00 31.23 ? 30  THR A HG1  2  
ATOM 6324   H HG21 . THR A 1 30  ? -20.912 -16.019 -14.381 1.00 61.34 ? 30  THR A HG21 2  
ATOM 6325   H HG22 . THR A 1 30  ? -20.397 -16.428 -16.018 1.00 33.01 ? 30  THR A HG22 2  
ATOM 6326   H HG23 . THR A 1 30  ? -22.084 -16.630 -15.548 1.00 22.55 ? 30  THR A HG23 2  
ATOM 6327   N N    . ASP A 1 31  ? -18.952 -13.151 -13.803 1.00 21.44 ? 31  ASP A N    2  
ATOM 6328   C CA   . ASP A 1 31  ? -17.529 -12.832 -13.777 1.00 32.21 ? 31  ASP A CA   2  
ATOM 6329   C C    . ASP A 1 31  ? -16.722 -13.862 -14.560 1.00 23.30 ? 31  ASP A C    2  
ATOM 6330   O O    . ASP A 1 31  ? -17.273 -14.827 -15.090 1.00 51.15 ? 31  ASP A O    2  
ATOM 6331   C CB   . ASP A 1 31  ? -17.028 -12.761 -12.332 1.00 42.22 ? 31  ASP A CB   2  
ATOM 6332   C CG   . ASP A 1 31  ? -16.782 -11.338 -11.869 1.00 72.34 ? 31  ASP A CG   2  
ATOM 6333   O OD1  . ASP A 1 31  ? -17.186 -10.400 -12.588 1.00 41.34 ? 31  ASP A OD1  2  
ATOM 6334   O OD2  . ASP A 1 31  ? -16.188 -11.161 -10.785 1.00 71.11 ? 31  ASP A OD2  2  
ATOM 6335   H H    . ASP A 1 31  ? -19.419 -13.324 -12.958 1.00 62.53 ? 31  ASP A H    2  
ATOM 6336   H HA   . ASP A 1 31  ? -17.398 -11.865 -14.240 1.00 11.00 ? 31  ASP A HA   2  
ATOM 6337   H HB2  . ASP A 1 31  ? -17.764 -13.208 -11.681 1.00 21.33 ? 31  ASP A HB2  2  
ATOM 6338   H HB3  . ASP A 1 31  ? -16.102 -13.312 -12.251 1.00 44.34 ? 31  ASP A HB3  2  
ATOM 6339   N N    . MET A 1 32  ? -15.411 -13.651 -14.626 1.00 71.31 ? 32  MET A N    2  
ATOM 6340   C CA   . MET A 1 32  ? -14.523 -14.560 -15.342 1.00 61.04 ? 32  MET A CA   2  
ATOM 6341   C C    . MET A 1 32  ? -14.534 -15.950 -14.711 1.00 62.23 ? 32  MET A C    2  
ATOM 6342   O O    . MET A 1 32  ? -14.249 -16.945 -15.376 1.00 54.24 ? 32  MET A O    2  
ATOM 6343   C CB   . MET A 1 32  ? -13.097 -14.006 -15.357 1.00 73.41 ? 32  MET A CB   2  
ATOM 6344   C CG   . MET A 1 32  ? -12.500 -13.827 -13.970 1.00 10.13 ? 32  MET A CG   2  
ATOM 6345   S SD   . MET A 1 32  ? -11.448 -15.207 -13.483 1.00 52.10 ? 32  MET A SD   2  
ATOM 6346   C CE   . MET A 1 32  ? -9.886  -14.713 -14.207 1.00 31.34 ? 32  MET A CE   2  
ATOM 6347   H H    . MET A 1 32  ? -15.032 -12.864 -14.182 1.00 52.22 ? 32  MET A H    2  
ATOM 6348   H HA   . MET A 1 32  ? -14.879 -14.638 -16.359 1.00 64.32 ? 32  MET A HA   2  
ATOM 6349   H HB2  . MET A 1 32  ? -12.465 -14.684 -15.913 1.00 62.25 ? 32  MET A HB2  2  
ATOM 6350   H HB3  . MET A 1 32  ? -13.101 -13.046 -15.850 1.00 41.02 ? 32  MET A HB3  2  
ATOM 6351   H HG2  . MET A 1 32  ? -11.910 -12.922 -13.962 1.00 4.22  ? 32  MET A HG2  2  
ATOM 6352   H HG3  . MET A 1 32  ? -13.305 -13.736 -13.255 1.00 44.40 ? 32  MET A HG3  2  
ATOM 6353   H HE1  . MET A 1 32  ? -9.555  -13.791 -13.755 1.00 71.23 ? 32  MET A HE1  2  
ATOM 6354   H HE2  . MET A 1 32  ? -10.011 -14.569 -15.271 1.00 21.30 ? 32  MET A HE2  2  
ATOM 6355   H HE3  . MET A 1 32  ? -9.149  -15.484 -14.033 1.00 53.31 ? 32  MET A HE3  2  
ATOM 6356   N N    . ALA A 1 33  ? -14.865 -16.010 -13.424 1.00 12.32 ? 33  ALA A N    2  
ATOM 6357   C CA   . ALA A 1 33  ? -14.912 -17.279 -12.707 1.00 22.24 ? 33  ALA A CA   2  
ATOM 6358   C C    . ALA A 1 33  ? -16.291 -17.930 -12.809 1.00 71.51 ? 33  ALA A C    2  
ATOM 6359   O O    . ALA A 1 33  ? -16.591 -18.881 -12.086 1.00 5.41  ? 33  ALA A O    2  
ATOM 6360   C CB   . ALA A 1 33  ? -14.532 -17.073 -11.249 1.00 40.40 ? 33  ALA A CB   2  
ATOM 6361   H H    . ALA A 1 33  ? -15.082 -15.183 -12.945 1.00 3.21  ? 33  ALA A H    2  
ATOM 6362   H HA   . ALA A 1 33  ? -14.182 -17.940 -13.153 1.00 13.42 ? 33  ALA A HA   2  
ATOM 6363   H HB1  . ALA A 1 33  ? -15.118 -16.266 -10.835 1.00 63.15 ? 33  ALA A HB1  2  
ATOM 6364   H HB2  . ALA A 1 33  ? -13.483 -16.829 -11.181 1.00 64.14 ? 33  ALA A HB2  2  
ATOM 6365   H HB3  . ALA A 1 33  ? -14.727 -17.980 -10.695 1.00 42.23 ? 33  ALA A HB3  2  
ATOM 6366   N N    . LYS A 1 34  ? -17.129 -17.412 -13.705 1.00 52.22 ? 34  LYS A N    2  
ATOM 6367   C CA   . LYS A 1 34  ? -18.475 -17.944 -13.893 1.00 21.21 ? 34  LYS A CA   2  
ATOM 6368   C C    . LYS A 1 34  ? -19.322 -17.733 -12.641 1.00 52.42 ? 34  LYS A C    2  
ATOM 6369   O O    . LYS A 1 34  ? -20.237 -18.506 -12.361 1.00 32.23 ? 34  LYS A O    2  
ATOM 6370   C CB   . LYS A 1 34  ? -18.418 -19.433 -14.245 1.00 1.44  ? 34  LYS A CB   2  
ATOM 6371   C CG   . LYS A 1 34  ? -18.460 -19.705 -15.741 1.00 75.55 ? 34  LYS A CG   2  
ATOM 6372   C CD   . LYS A 1 34  ? -19.314 -20.920 -16.064 1.00 53.23 ? 34  LYS A CD   2  
ATOM 6373   C CE   . LYS A 1 34  ? -19.013 -21.459 -17.453 1.00 52.31 ? 34  LYS A CE   2  
ATOM 6374   N NZ   . LYS A 1 34  ? -18.066 -22.609 -17.410 1.00 52.35 ? 34  LYS A NZ   2  
ATOM 6375   H H    . LYS A 1 34  ? -16.839 -16.652 -14.248 1.00 22.43 ? 34  LYS A H    2  
ATOM 6376   H HA   . LYS A 1 34  ? -18.929 -17.408 -14.712 1.00 64.31 ? 34  LYS A HA   2  
ATOM 6377   H HB2  . LYS A 1 34  ? -17.504 -19.851 -13.851 1.00 0.42  ? 34  LYS A HB2  2  
ATOM 6378   H HB3  . LYS A 1 34  ? -19.259 -19.933 -13.788 1.00 22.21 ? 34  LYS A HB3  2  
ATOM 6379   H HG2  . LYS A 1 34  ? -18.874 -18.843 -16.242 1.00 31.23 ? 34  LYS A HG2  2  
ATOM 6380   H HG3  . LYS A 1 34  ? -17.453 -19.879 -16.092 1.00 53.31 ? 34  LYS A HG3  2  
ATOM 6381   H HD2  . LYS A 1 34  ? -19.112 -21.693 -15.337 1.00 54.42 ? 34  LYS A HD2  2  
ATOM 6382   H HD3  . LYS A 1 34  ? -20.355 -20.638 -16.014 1.00 73.22 ? 34  LYS A HD3  2  
ATOM 6383   H HE2  . LYS A 1 34  ? -19.936 -21.783 -17.908 1.00 65.43 ? 34  LYS A HE2  2  
ATOM 6384   H HE3  . LYS A 1 34  ? -18.577 -20.668 -18.046 1.00 5.22  ? 34  LYS A HE3  2  
ATOM 6385   H HZ1  . LYS A 1 34  ? -17.455 -22.536 -16.571 1.00 21.52 ? 34  LYS A HZ1  2  
ATOM 6386   H HZ2  . LYS A 1 34  ? -17.470 -22.613 -18.260 1.00 11.20 ? 34  LYS A HZ2  2  
ATOM 6387   H HZ3  . LYS A 1 34  ? -18.594 -23.504 -17.365 1.00 32.53 ? 34  LYS A HZ3  2  
ATOM 6388   N N    . LYS A 1 35  ? -19.011 -16.678 -11.894 1.00 23.04 ? 35  LYS A N    2  
ATOM 6389   C CA   . LYS A 1 35  ? -19.745 -16.362 -10.675 1.00 52.21 ? 35  LYS A CA   2  
ATOM 6390   C C    . LYS A 1 35  ? -20.851 -15.352 -10.960 1.00 53.13 ? 35  LYS A C    2  
ATOM 6391   O O    . LYS A 1 35  ? -20.641 -14.374 -11.677 1.00 21.21 ? 35  LYS A O    2  
ATOM 6392   C CB   . LYS A 1 35  ? -18.796 -15.811 -9.610  1.00 11.51 ? 35  LYS A CB   2  
ATOM 6393   C CG   . LYS A 1 35  ? -19.242 -16.104 -8.187  1.00 60.11 ? 35  LYS A CG   2  
ATOM 6394   C CD   . LYS A 1 35  ? -18.070 -16.075 -7.218  1.00 52.04 ? 35  LYS A CD   2  
ATOM 6395   C CE   . LYS A 1 35  ? -18.198 -17.159 -6.160  1.00 32.25 ? 35  LYS A CE   2  
ATOM 6396   N NZ   . LYS A 1 35  ? -17.214 -16.975 -5.057  1.00 40.25 ? 35  LYS A NZ   2  
ATOM 6397   H H    . LYS A 1 35  ? -18.272 -16.097 -12.172 1.00 3.51  ? 35  LYS A H    2  
ATOM 6398   H HA   . LYS A 1 35  ? -20.192 -17.275 -10.310 1.00 50.21 ? 35  LYS A HA   2  
ATOM 6399   H HB2  . LYS A 1 35  ? -17.818 -16.247 -9.755  1.00 25.31 ? 35  LYS A HB2  2  
ATOM 6400   H HB3  . LYS A 1 35  ? -18.723 -14.740 -9.728  1.00 54.45 ? 35  LYS A HB3  2  
ATOM 6401   H HG2  . LYS A 1 35  ? -19.963 -15.359 -7.885  1.00 30.14 ? 35  LYS A HG2  2  
ATOM 6402   H HG3  . LYS A 1 35  ? -19.699 -17.082 -8.158  1.00 33.22 ? 35  LYS A HG3  2  
ATOM 6403   H HD2  . LYS A 1 35  ? -17.155 -16.231 -7.770  1.00 62.43 ? 35  LYS A HD2  2  
ATOM 6404   H HD3  . LYS A 1 35  ? -18.040 -15.110 -6.733  1.00 35.44 ? 35  LYS A HD3  2  
ATOM 6405   H HE2  . LYS A 1 35  ? -19.196 -17.126 -5.748  1.00 1.44  ? 35  LYS A HE2  2  
ATOM 6406   H HE3  . LYS A 1 35  ? -18.031 -18.119 -6.624  1.00 22.22 ? 35  LYS A HE3  2  
ATOM 6407   H HZ1  . LYS A 1 35  ? -17.194 -15.980 -4.757  1.00 2.23  ? 35  LYS A HZ1  2  
ATOM 6408   H HZ2  . LYS A 1 35  ? -16.262 -17.247 -5.378  1.00 0.02  ? 35  LYS A HZ2  2  
ATOM 6409   H HZ3  . LYS A 1 35  ? -17.475 -17.567 -4.243  1.00 74.43 ? 35  LYS A HZ3  2  
ATOM 6410   N N    . GLU A 1 36  ? -22.029 -15.596 -10.397 1.00 50.21 ? 36  GLU A N    2  
ATOM 6411   C CA   . GLU A 1 36  ? -23.167 -14.708 -10.596 1.00 44.13 ? 36  GLU A CA   2  
ATOM 6412   C C    . GLU A 1 36  ? -23.402 -13.836 -9.367  1.00 31.41 ? 36  GLU A C    2  
ATOM 6413   O O    . GLU A 1 36  ? -23.597 -14.342 -8.262  1.00 53.11 ? 36  GLU A O    2  
ATOM 6414   C CB   . GLU A 1 36  ? -24.425 -15.521 -10.906 1.00 42.24 ? 36  GLU A CB   2  
ATOM 6415   C CG   . GLU A 1 36  ? -25.324 -14.876 -11.949 1.00 52.15 ? 36  GLU A CG   2  
ATOM 6416   C CD   . GLU A 1 36  ? -25.925 -15.887 -12.905 1.00 4.53  ? 36  GLU A CD   2  
ATOM 6417   O OE1  . GLU A 1 36  ? -26.945 -16.512 -12.544 1.00 22.00 ? 36  GLU A OE1  2  
ATOM 6418   O OE2  . GLU A 1 36  ? -25.376 -16.055 -14.014 1.00 50.40 ? 36  GLU A OE2  2  
ATOM 6419   H H    . GLU A 1 36  ? -22.137 -16.393 -9.837  1.00 22.34 ? 36  GLU A H    2  
ATOM 6420   H HA   . GLU A 1 36  ? -22.946 -14.070 -11.437 1.00 71.23 ? 36  GLU A HA   2  
ATOM 6421   H HB2  . GLU A 1 36  ? -24.130 -16.495 -11.270 1.00 43.51 ? 36  GLU A HB2  2  
ATOM 6422   H HB3  . GLU A 1 36  ? -24.995 -15.643 -9.997  1.00 5.22  ? 36  GLU A HB3  2  
ATOM 6423   H HG2  . GLU A 1 36  ? -26.126 -14.360 -11.444 1.00 12.43 ? 36  GLU A HG2  2  
ATOM 6424   H HG3  . GLU A 1 36  ? -24.742 -14.166 -12.518 1.00 73.52 ? 36  GLU A HG3  2  
ATOM 6425   N N    . TRP A 1 37  ? -23.387 -12.521 -9.567  1.00 64.44 ? 37  TRP A N    2  
ATOM 6426   C CA   . TRP A 1 37  ? -23.603 -11.582 -8.474  1.00 12.15 ? 37  TRP A CA   2  
ATOM 6427   C C    . TRP A 1 37  ? -24.453 -10.398 -8.928  1.00 45.44 ? 37  TRP A C    2  
ATOM 6428   O O    . TRP A 1 37  ? -24.318 -9.915  -10.056 1.00 23.32 ? 37  TRP A O    2  
ATOM 6429   C CB   . TRP A 1 37  ? -22.268 -11.087 -7.917  1.00 31.11 ? 37  TRP A CB   2  
ATOM 6430   C CG   . TRP A 1 37  ? -21.292 -10.677 -8.975  1.00 23.03 ? 37  TRP A CG   2  
ATOM 6431   C CD1  . TRP A 1 37  ? -20.590 -11.500 -9.808  1.00 61.34 ? 37  TRP A CD1  2  
ATOM 6432   C CD2  . TRP A 1 37  ? -20.906 -9.340  -9.311  1.00 64.50 ? 37  TRP A CD2  2  
ATOM 6433   N NE1  . TRP A 1 37  ? -19.792 -10.757 -10.642 1.00 75.45 ? 37  TRP A NE1  2  
ATOM 6434   C CE2  . TRP A 1 37  ? -19.968 -9.427  -10.356 1.00 54.32 ? 37  TRP A CE2  2  
ATOM 6435   C CE3  . TRP A 1 37  ? -21.264 -8.077  -8.831  1.00 34.44 ? 37  TRP A CE3  2  
ATOM 6436   C CZ2  . TRP A 1 37  ? -19.384 -8.300  -10.928 1.00 31.32 ? 37  TRP A CZ2  2  
ATOM 6437   C CZ3  . TRP A 1 37  ? -20.684 -6.959  -9.399  1.00 12.12 ? 37  TRP A CZ3  2  
ATOM 6438   C CH2  . TRP A 1 37  ? -19.754 -7.078  -10.438 1.00 51.22 ? 37  TRP A CH2  2  
ATOM 6439   H H    . TRP A 1 37  ? -23.229 -12.176 -10.471 1.00 74.12 ? 37  TRP A H    2  
ATOM 6440   H HA   . TRP A 1 37  ? -24.134 -12.106 -7.692  1.00 71.25 ? 37  TRP A HA   2  
ATOM 6441   H HB2  . TRP A 1 37  ? -22.445 -10.234 -7.280  1.00 70.42 ? 37  TRP A HB2  2  
ATOM 6442   H HB3  . TRP A 1 37  ? -21.815 -11.877 -7.334  1.00 4.40  ? 37  TRP A HB3  2  
ATOM 6443   H HD1  . TRP A 1 37  ? -20.661 -12.578 -9.800  1.00 1.24  ? 37  TRP A HD1  2  
ATOM 6444   H HE1  . TRP A 1 37  ? -19.194 -11.118 -11.330 1.00 32.53 ? 37  TRP A HE1  2  
ATOM 6445   H HE3  . TRP A 1 37  ? -21.981 -7.968  -8.030  1.00 43.11 ? 37  TRP A HE3  2  
ATOM 6446   H HZ2  . TRP A 1 37  ? -18.665 -8.374  -11.731 1.00 63.30 ? 37  TRP A HZ2  2  
ATOM 6447   H HZ3  . TRP A 1 37  ? -20.948 -5.976  -9.041  1.00 63.33 ? 37  TRP A HZ3  2  
ATOM 6448   H HH2  . TRP A 1 37  ? -19.326 -6.177  -10.853 1.00 51.04 ? 37  TRP A HH2  2  
ATOM 6449   N N    . LYS A 1 38  ? -25.334 -9.947  -8.037  1.00 72.31 ? 38  LYS A N    2  
ATOM 6450   C CA   . LYS A 1 38  ? -26.223 -8.828  -8.323  1.00 51.12 ? 38  LYS A CA   2  
ATOM 6451   C C    . LYS A 1 38  ? -25.523 -7.491  -8.092  1.00 51.12 ? 38  LYS A C    2  
ATOM 6452   O O    . LYS A 1 38  ? -24.807 -7.317  -7.107  1.00 24.42 ? 38  LYS A O    2  
ATOM 6453   C CB   . LYS A 1 38  ? -27.475 -8.916  -7.445  1.00 71.23 ? 38  LYS A CB   2  
ATOM 6454   C CG   . LYS A 1 38  ? -28.773 -8.977  -8.233  1.00 20.04 ? 38  LYS A CG   2  
ATOM 6455   C CD   . LYS A 1 38  ? -29.889 -8.221  -7.529  1.00 33.12 ? 38  LYS A CD   2  
ATOM 6456   C CE   . LYS A 1 38  ? -30.554 -9.072  -6.458  1.00 70.00 ? 38  LYS A CE   2  
ATOM 6457   N NZ   . LYS A 1 38  ? -32.011 -9.245  -6.712  1.00 1.02  ? 38  LYS A NZ   2  
ATOM 6458   H H    . LYS A 1 38  ? -25.389 -10.385 -7.162  1.00 11.42 ? 38  LYS A H    2  
ATOM 6459   H HA   . LYS A 1 38  ? -26.516 -8.895  -9.359  1.00 53.33 ? 38  LYS A HA   2  
ATOM 6460   H HB2  . LYS A 1 38  ? -27.410 -9.805  -6.834  1.00 61.24 ? 38  LYS A HB2  2  
ATOM 6461   H HB3  . LYS A 1 38  ? -27.512 -8.051  -6.799  1.00 24.13 ? 38  LYS A HB3  2  
ATOM 6462   H HG2  . LYS A 1 38  ? -28.614 -8.539  -9.206  1.00 13.43 ? 38  LYS A HG2  2  
ATOM 6463   H HG3  . LYS A 1 38  ? -29.067 -10.010 -8.343  1.00 34.12 ? 38  LYS A HG3  2  
ATOM 6464   H HD2  . LYS A 1 38  ? -29.477 -7.337  -7.068  1.00 12.21 ? 38  LYS A HD2  2  
ATOM 6465   H HD3  . LYS A 1 38  ? -30.632 -7.934  -8.260  1.00 21.52 ? 38  LYS A HD3  2  
ATOM 6466   H HE2  . LYS A 1 38  ? -30.084 -10.044 -6.443  1.00 53.41 ? 38  LYS A HE2  2  
ATOM 6467   H HE3  . LYS A 1 38  ? -30.418 -8.592  -5.500  1.00 13.33 ? 38  LYS A HE3  2  
ATOM 6468   H HZ1  . LYS A 1 38  ? -32.517 -8.359  -6.509  1.00 14.20 ? 38  LYS A HZ1  2  
ATOM 6469   H HZ2  . LYS A 1 38  ? -32.394 -9.997  -6.103  1.00 51.00 ? 38  LYS A HZ2  2  
ATOM 6470   H HZ3  . LYS A 1 38  ? -32.173 -9.503  -7.706  1.00 22.25 ? 38  LYS A HZ3  2  
ATOM 6471   N N    . VAL A 1 39  ? -25.743 -6.548  -9.003  1.00 23.11 ? 39  VAL A N    2  
ATOM 6472   C CA   . VAL A 1 39  ? -25.141 -5.224  -8.895  1.00 13.43 ? 39  VAL A CA   2  
ATOM 6473   C C    . VAL A 1 39  ? -26.202 -4.171  -8.599  1.00 30.55 ? 39  VAL A C    2  
ATOM 6474   O O    . VAL A 1 39  ? -27.219 -4.092  -9.290  1.00 51.04 ? 39  VAL A O    2  
ATOM 6475   C CB   . VAL A 1 39  ? -24.394 -4.838  -10.185 1.00 32.44 ? 39  VAL A CB   2  
ATOM 6476   C CG1  . VAL A 1 39  ? -23.611 -3.549  -9.983  1.00 23.30 ? 39  VAL A CG1  2  
ATOM 6477   C CG2  . VAL A 1 39  ? -23.474 -5.965  -10.628 1.00 44.35 ? 39  VAL A CG2  2  
ATOM 6478   H H    . VAL A 1 39  ? -26.327 -6.743  -9.765  1.00 50.00 ? 39  VAL A H    2  
ATOM 6479   H HA   . VAL A 1 39  ? -24.432 -5.245  -8.083  1.00 73.34 ? 39  VAL A HA   2  
ATOM 6480   H HB   . VAL A 1 39  ? -25.123 -4.670  -10.963 1.00 14.35 ? 39  VAL A HB   2  
ATOM 6481   H HG11 . VAL A 1 39  ? -22.578 -3.784  -9.776  1.00 33.53 ? 39  VAL A HG11 2  
ATOM 6482   H HG12 . VAL A 1 39  ? -24.030 -3.000  -9.152  1.00 71.31 ? 39  VAL A HG12 2  
ATOM 6483   H HG13 . VAL A 1 39  ? -23.671 -2.948  -10.878 1.00 21.12 ? 39  VAL A HG13 2  
ATOM 6484   H HG21 . VAL A 1 39  ? -22.633 -5.554  -11.165 1.00 2.12  ? 39  VAL A HG21 2  
ATOM 6485   H HG22 . VAL A 1 39  ? -24.017 -6.641  -11.271 1.00 31.55 ? 39  VAL A HG22 2  
ATOM 6486   H HG23 . VAL A 1 39  ? -23.119 -6.501  -9.760  1.00 40.22 ? 39  VAL A HG23 2  
ATOM 6487   N N    . GLY A 1 40  ? -25.966 -3.365  -7.569  1.00 3.42  ? 40  GLY A N    2  
ATOM 6488   C CA   . GLY A 1 40  ? -26.918 -2.332  -7.206  1.00 45.45 ? 40  GLY A CA   2  
ATOM 6489   C C    . GLY A 1 40  ? -26.498 -0.956  -7.685  1.00 63.31 ? 40  GLY A C    2  
ATOM 6490   O O    . GLY A 1 40  ? -25.989 -0.807  -8.796  1.00 64.44 ? 40  GLY A O    2  
ATOM 6491   H H    . GLY A 1 40  ? -25.141 -3.471  -7.048  1.00 15.41 ? 40  GLY A H    2  
ATOM 6492   H HA2  . GLY A 1 40  ? -27.877 -2.575  -7.639  1.00 34.14 ? 40  GLY A HA2  2  
ATOM 6493   H HA3  . GLY A 1 40  ? -27.017 -2.312  -6.130  1.00 65.14 ? 40  GLY A HA3  2  
ATOM 6494   N N    . LEU A 1 41  ? -26.714 0.050   -6.844  1.00 22.13 ? 41  LEU A N    2  
ATOM 6495   C CA   . LEU A 1 41  ? -26.359 1.422   -7.186  1.00 41.14 ? 41  LEU A CA   2  
ATOM 6496   C C    . LEU A 1 41  ? -24.872 1.677   -6.951  1.00 71.55 ? 41  LEU A C    2  
ATOM 6497   O O    . LEU A 1 41  ? -24.235 0.995   -6.147  1.00 60.21 ? 41  LEU A O    2  
ATOM 6498   C CB   . LEU A 1 41  ? -27.192 2.406   -6.362  1.00 41.21 ? 41  LEU A CB   2  
ATOM 6499   C CG   . LEU A 1 41  ? -28.683 2.073   -6.269  1.00 31.20 ? 41  LEU A CG   2  
ATOM 6500   C CD1  . LEU A 1 41  ? -28.970 1.251   -5.022  1.00 31.31 ? 41  LEU A CD1  2  
ATOM 6501   C CD2  . LEU A 1 41  ? -29.515 3.347   -6.273  1.00 70.22 ? 41  LEU A CD2  2  
ATOM 6502   H H    . LEU A 1 41  ? -27.125 -0.134  -5.974  1.00 43.35 ? 41  LEU A H    2  
ATOM 6503   H HA   . LEU A 1 41  ? -26.576 1.570   -8.233  1.00 54.10 ? 41  LEU A HA   2  
ATOM 6504   H HB2  . LEU A 1 41  ? -26.788 2.436   -5.360  1.00 61.11 ? 41  LEU A HB2  2  
ATOM 6505   H HB3  . LEU A 1 41  ? -27.092 3.387   -6.802  1.00 2.01  ? 41  LEU A HB3  2  
ATOM 6506   H HG   . LEU A 1 41  ? -28.968 1.484   -7.130  1.00 44.44 ? 41  LEU A HG   2  
ATOM 6507   H HD11 . LEU A 1 41  ? -28.209 1.445   -4.281  1.00 61.14 ? 41  LEU A HD11 2  
ATOM 6508   H HD12 . LEU A 1 41  ? -28.966 0.201   -5.274  1.00 53.22 ? 41  LEU A HD12 2  
ATOM 6509   H HD13 . LEU A 1 41  ? -29.937 1.523   -4.626  1.00 11.25 ? 41  LEU A HD13 2  
ATOM 6510   H HD21 . LEU A 1 41  ? -30.494 3.139   -5.868  1.00 32.21 ? 41  LEU A HD21 2  
ATOM 6511   H HD22 . LEU A 1 41  ? -29.613 3.710   -7.285  1.00 61.24 ? 41  LEU A HD22 2  
ATOM 6512   H HD23 . LEU A 1 41  ? -29.027 4.098   -5.668  1.00 42.25 ? 41  LEU A HD23 2  
ATOM 6513   N N    . PRO A 1 42  ? -24.297 2.667   -7.655  1.00 53.31 ? 42  PRO A N    2  
ATOM 6514   C CA   . PRO A 1 42  ? -22.879 3.012   -7.522  1.00 42.12 ? 42  PRO A CA   2  
ATOM 6515   C C    . PRO A 1 42  ? -22.589 3.792   -6.244  1.00 41.44 ? 42  PRO A C    2  
ATOM 6516   O O    . PRO A 1 42  ? -23.501 4.317   -5.605  1.00 44.04 ? 42  PRO A O    2  
ATOM 6517   C CB   . PRO A 1 42  ? -22.617 3.882   -8.750  1.00 44.00 ? 42  PRO A CB   2  
ATOM 6518   C CG   . PRO A 1 42  ? -23.928 4.526   -9.039  1.00 15.54 ? 42  PRO A CG   2  
ATOM 6519   C CD   . PRO A 1 42  ? -24.984 3.529   -8.638  1.00 64.33 ? 42  PRO A CD   2  
ATOM 6520   H HA   . PRO A 1 42  ? -22.253 2.133   -7.558  1.00 72.13 ? 42  PRO A HA   2  
ATOM 6521   H HB2  . PRO A 1 42  ? -21.856 4.613   -8.520  1.00 22.22 ? 42  PRO A HB2  2  
ATOM 6522   H HB3  . PRO A 1 42  ? -22.293 3.262   -9.572  1.00 3.14  ? 42  PRO A HB3  2  
ATOM 6523   H HG2  . PRO A 1 42  ? -24.028 5.430   -8.457  1.00 24.22 ? 42  PRO A HG2  2  
ATOM 6524   H HG3  . PRO A 1 42  ? -24.004 4.748   -10.093 1.00 15.30 ? 42  PRO A HG3  2  
ATOM 6525   H HD2  . PRO A 1 42  ? -25.825 4.033   -8.186  1.00 64.24 ? 42  PRO A HD2  2  
ATOM 6526   H HD3  . PRO A 1 42  ? -25.303 2.955   -9.496  1.00 12.44 ? 42  PRO A HD3  2  
ATOM 6527   N N    . ILE A 1 43  ? -21.314 3.864   -5.878  1.00 4.12  ? 43  ILE A N    2  
ATOM 6528   C CA   . ILE A 1 43  ? -20.902 4.581   -4.678  1.00 34.24 ? 43  ILE A CA   2  
ATOM 6529   C C    . ILE A 1 43  ? -19.443 5.016   -4.773  1.00 63.41 ? 43  ILE A C    2  
ATOM 6530   O O    . ILE A 1 43  ? -18.607 4.300   -5.322  1.00 75.45 ? 43  ILE A O    2  
ATOM 6531   C CB   . ILE A 1 43  ? -21.087 3.719   -3.415  1.00 45.04 ? 43  ILE A CB   2  
ATOM 6532   C CG1  . ILE A 1 43  ? -20.287 2.421   -3.533  1.00 25.01 ? 43  ILE A CG1  2  
ATOM 6533   C CG2  . ILE A 1 43  ? -22.561 3.419   -3.188  1.00 4.12  ? 43  ILE A CG2  2  
ATOM 6534   C CD1  . ILE A 1 43  ? -19.991 1.768   -2.200  1.00 23.54 ? 43  ILE A CD1  2  
ATOM 6535   H H    . ILE A 1 43  ? -20.633 3.426   -6.430  1.00 72.11 ? 43  ILE A H    2  
ATOM 6536   H HA   . ILE A 1 43  ? -21.524 5.459   -4.583  1.00 41.43 ? 43  ILE A HA   2  
ATOM 6537   H HB   . ILE A 1 43  ? -20.724 4.280   -2.566  1.00 51.52 ? 43  ILE A HB   2  
ATOM 6538   H HG12 . ILE A 1 43  ? -20.843 1.714   -4.131  1.00 12.23 ? 43  ILE A HG12 2  
ATOM 6539   H HG13 . ILE A 1 43  ? -19.343 2.630   -4.017  1.00 73.50 ? 43  ILE A HG13 2  
ATOM 6540   H HG21 . ILE A 1 43  ? -23.138 4.321   -3.334  1.00 21.54 ? 43  ILE A HG21 2  
ATOM 6541   H HG22 . ILE A 1 43  ? -22.705 3.060   -2.180  1.00 74.41 ? 43  ILE A HG22 2  
ATOM 6542   H HG23 . ILE A 1 43  ? -22.888 2.666   -3.889  1.00 35.22 ? 43  ILE A HG23 2  
ATOM 6543   H HD11 . ILE A 1 43  ? -19.302 2.384   -1.643  1.00 50.42 ? 43  ILE A HD11 2  
ATOM 6544   H HD12 . ILE A 1 43  ? -19.553 0.795   -2.365  1.00 54.12 ? 43  ILE A HD12 2  
ATOM 6545   H HD13 . ILE A 1 43  ? -20.909 1.660   -1.641  1.00 14.10 ? 43  ILE A HD13 2  
ATOM 6546   N N    . GLY A 1 44  ? -19.147 6.194   -4.236  1.00 13.42 ? 44  GLY A N    2  
ATOM 6547   C CA   . GLY A 1 44  ? -17.789 6.704   -4.272  1.00 22.14 ? 44  GLY A CA   2  
ATOM 6548   C C    . GLY A 1 44  ? -17.646 7.911   -5.178  1.00 72.13 ? 44  GLY A C    2  
ATOM 6549   O O    . GLY A 1 44  ? -17.395 7.769   -6.376  1.00 71.22 ? 44  GLY A O    2  
ATOM 6550   H H    . GLY A 1 44  ? -19.855 6.722   -3.811  1.00 22.45 ? 44  GLY A H    2  
ATOM 6551   H HA2  . GLY A 1 44  ? -17.494 6.984   -3.270  1.00 31.21 ? 44  GLY A HA2  2  
ATOM 6552   H HA3  . GLY A 1 44  ? -17.131 5.924   -4.623  1.00 31.20 ? 44  GLY A HA3  2  
ATOM 6553   N N    . GLN A 1 45  ? -17.805 9.100   -4.609  1.00 31.05 ? 45  GLN A N    2  
ATOM 6554   C CA   . GLN A 1 45  ? -17.693 10.337  -5.375  1.00 1.44  ? 45  GLN A CA   2  
ATOM 6555   C C    . GLN A 1 45  ? -16.307 10.467  -5.997  1.00 73.43 ? 45  GLN A C    2  
ATOM 6556   O O    . GLN A 1 45  ? -15.293 10.381  -5.304  1.00 34.15 ? 45  GLN A O    2  
ATOM 6557   C CB   . GLN A 1 45  ? -17.978 11.544  -4.479  1.00 74.14 ? 45  GLN A CB   2  
ATOM 6558   C CG   . GLN A 1 45  ? -19.449 11.924  -4.421  1.00 10.03 ? 45  GLN A CG   2  
ATOM 6559   C CD   . GLN A 1 45  ? -19.663 13.425  -4.415  1.00 42.53 ? 45  GLN A CD   2  
ATOM 6560   O OE1  . GLN A 1 45  ? -20.449 13.955  -5.200  1.00 74.25 ? 45  GLN A OE1  2  
ATOM 6561   N NE2  . GLN A 1 45  ? -18.961 14.118  -3.526  1.00 60.10 ? 45  GLN A NE2  2  
ATOM 6562   H H    . GLN A 1 45  ? -18.003 9.148   -3.650  1.00 41.22 ? 45  GLN A H    2  
ATOM 6563   H HA   . GLN A 1 45  ? -18.428 10.304  -6.164  1.00 52.22 ? 45  GLN A HA   2  
ATOM 6564   H HB2  . GLN A 1 45  ? -17.646 11.319  -3.476  1.00 22.24 ? 45  GLN A HB2  2  
ATOM 6565   H HB3  . GLN A 1 45  ? -17.423 12.392  -4.851  1.00 62.34 ? 45  GLN A HB3  2  
ATOM 6566   H HG2  . GLN A 1 45  ? -19.949 11.508  -5.282  1.00 24.04 ? 45  GLN A HG2  2  
ATOM 6567   H HG3  . GLN A 1 45  ? -19.879 11.510  -3.521  1.00 73.24 ? 45  GLN A HG3  2  
ATOM 6568   H HE21 . GLN A 1 45  ? -18.353 13.630  -2.933  1.00 73.21 ? 45  GLN A HE21 2  
ATOM 6569   H HE22 . GLN A 1 45  ? -19.080 15.091  -3.501  1.00 65.43 ? 45  GLN A HE22 2  
ATOM 6570   N N    . GLY A 1 46  ? -16.270 10.674  -7.309  1.00 14.45 ? 46  GLY A N    2  
ATOM 6571   C CA   . GLY A 1 46  ? -15.003 10.813  -8.003  1.00 22.41 ? 46  GLY A CA   2  
ATOM 6572   C C    . GLY A 1 46  ? -15.174 10.915  -9.506  1.00 64.12 ? 46  GLY A C    2  
ATOM 6573   O O    . GLY A 1 46  ? -14.423 11.624  -10.176 1.00 42.30 ? 46  GLY A O    2  
ATOM 6574   H H    . GLY A 1 46  ? -17.111 10.734  -7.811  1.00 4.05  ? 46  GLY A H    2  
ATOM 6575   H HA2  . GLY A 1 46  ? -14.506 11.703  -7.647  1.00 2.14  ? 46  GLY A HA2  2  
ATOM 6576   H HA3  . GLY A 1 46  ? -14.387 9.955   -7.780  1.00 53.03 ? 46  GLY A HA3  2  
ATOM 6577   N N    . GLY A 1 47  ? -16.164 10.205  -10.037 1.00 70.53 ? 47  GLY A N    2  
ATOM 6578   C CA   . GLY A 1 47  ? -16.413 10.233  -11.466 1.00 3.13  ? 47  GLY A CA   2  
ATOM 6579   C C    . GLY A 1 47  ? -15.658 9.148   -12.208 1.00 34.54 ? 47  GLY A C    2  
ATOM 6580   O O    . GLY A 1 47  ? -14.516 8.836   -11.870 1.00 32.42 ? 47  GLY A O    2  
ATOM 6581   H H    . GLY A 1 47  ? -16.731 9.659   -9.454  1.00 2.23  ? 47  GLY A H    2  
ATOM 6582   H HA2  . GLY A 1 47  ? -17.471 10.102  -11.638 1.00 52.14 ? 47  GLY A HA2  2  
ATOM 6583   H HA3  . GLY A 1 47  ? -16.112 11.195  -11.854 1.00 44.32 ? 47  GLY A HA3  2  
ATOM 6584   N N    . PHE A 1 48  ? -16.296 8.573   -13.223 1.00 25.45 ? 48  PHE A N    2  
ATOM 6585   C CA   . PHE A 1 48  ? -15.680 7.516   -14.019 1.00 34.43 ? 48  PHE A CA   2  
ATOM 6586   C C    . PHE A 1 48  ? -15.439 6.268   -13.173 1.00 50.11 ? 48  PHE A C    2  
ATOM 6587   O O    . PHE A 1 48  ? -16.188 5.295   -13.259 1.00 35.01 ? 48  PHE A O    2  
ATOM 6588   C CB   . PHE A 1 48  ? -14.362 8.005   -14.625 1.00 43.32 ? 48  PHE A CB   2  
ATOM 6589   C CG   . PHE A 1 48  ? -14.404 8.145   -16.120 1.00 43.30 ? 48  PHE A CG   2  
ATOM 6590   C CD1  . PHE A 1 48  ? -14.273 7.033   -16.937 1.00 53.15 ? 48  PHE A CD1  2  
ATOM 6591   C CD2  . PHE A 1 48  ? -14.576 9.388   -16.708 1.00 61.30 ? 48  PHE A CD2  2  
ATOM 6592   C CE1  . PHE A 1 48  ? -14.313 7.159   -18.313 1.00 62.33 ? 48  PHE A CE1  2  
ATOM 6593   C CE2  . PHE A 1 48  ? -14.616 9.520   -18.083 1.00 35.30 ? 48  PHE A CE2  2  
ATOM 6594   C CZ   . PHE A 1 48  ? -14.485 8.404   -18.886 1.00 25.21 ? 48  PHE A CZ   2  
ATOM 6595   H H    . PHE A 1 48  ? -17.204 8.868   -13.443 1.00 13.10 ? 48  PHE A H    2  
ATOM 6596   H HA   . PHE A 1 48  ? -16.361 7.266   -14.818 1.00 74.20 ? 48  PHE A HA   2  
ATOM 6597   H HB2  . PHE A 1 48  ? -14.118 8.970   -14.209 1.00 44.45 ? 48  PHE A HB2  2  
ATOM 6598   H HB3  . PHE A 1 48  ? -13.576 7.304   -14.378 1.00 70.31 ? 48  PHE A HB3  2  
ATOM 6599   H HD1  . PHE A 1 48  ? -14.139 6.059   -16.490 1.00 62.25 ? 48  PHE A HD1  2  
ATOM 6600   H HD2  . PHE A 1 48  ? -14.680 10.261  -16.080 1.00 42.21 ? 48  PHE A HD2  2  
ATOM 6601   H HE1  . PHE A 1 48  ? -14.208 6.285   -18.939 1.00 32.04 ? 48  PHE A HE1  2  
ATOM 6602   H HE2  . PHE A 1 48  ? -14.750 10.494  -18.529 1.00 40.00 ? 48  PHE A HE2  2  
ATOM 6603   H HZ   . PHE A 1 48  ? -14.516 8.505   -19.961 1.00 70.21 ? 48  PHE A HZ   2  
ATOM 6604   N N    . GLY A 1 49  ? -14.389 6.303   -12.359 1.00 44.01 ? 49  GLY A N    2  
ATOM 6605   C CA   . GLY A 1 49  ? -14.070 5.168   -11.511 1.00 5.03  ? 49  GLY A CA   2  
ATOM 6606   C C    . GLY A 1 49  ? -14.967 5.083   -10.292 1.00 75.22 ? 49  GLY A C    2  
ATOM 6607   O O    . GLY A 1 49  ? -14.544 5.395   -9.179  1.00 10.40 ? 49  GLY A O    2  
ATOM 6608   H H    . GLY A 1 49  ? -13.828 7.105   -12.332 1.00 11.34 ? 49  GLY A H    2  
ATOM 6609   H HA2  . GLY A 1 49  ? -14.177 4.262   -12.088 1.00 53.44 ? 49  GLY A HA2  2  
ATOM 6610   H HA3  . GLY A 1 49  ? -13.044 5.255   -11.184 1.00 53.12 ? 49  GLY A HA3  2  
ATOM 6611   N N    . CYS A 1 50  ? -16.209 4.659   -10.501 1.00 33.30 ? 50  CYS A N    2  
ATOM 6612   C CA   . CYS A 1 50  ? -17.168 4.532   -9.410  1.00 73.35 ? 50  CYS A CA   2  
ATOM 6613   C C    . CYS A 1 50  ? -17.225 3.095   -8.902  1.00 15.23 ? 50  CYS A C    2  
ATOM 6614   O O    . CYS A 1 50  ? -16.997 2.150   -9.656  1.00 51.12 ? 50  CYS A O    2  
ATOM 6615   C CB   . CYS A 1 50  ? -18.556 4.980   -9.869  1.00 51.31 ? 50  CYS A CB   2  
ATOM 6616   S SG   . CYS A 1 50  ? -19.495 5.878   -8.612  1.00 40.11 ? 50  CYS A SG   2  
ATOM 6617   H H    . CYS A 1 50  ? -16.486 4.424   -11.411 1.00 24.32 ? 50  CYS A H    2  
ATOM 6618   H HA   . CYS A 1 50  ? -16.840 5.173   -8.606  1.00 63.31 ? 50  CYS A HA   2  
ATOM 6619   H HB2  . CYS A 1 50  ? -18.452 5.629   -10.726 1.00 10.13 ? 50  CYS A HB2  2  
ATOM 6620   H HB3  . CYS A 1 50  ? -19.132 4.111   -10.152 1.00 70.42 ? 50  CYS A HB3  2  
ATOM 6621   H HG   . CYS A 1 50  ? -18.870 6.242   -7.979  1.00 33.42 ? 50  CYS A HG   2  
ATOM 6622   N N    . ILE A 1 51  ? -17.531 2.939   -7.618  1.00 11.32 ? 51  ILE A N    2  
ATOM 6623   C CA   . ILE A 1 51  ? -17.618 1.617   -7.009  1.00 43.33 ? 51  ILE A CA   2  
ATOM 6624   C C    . ILE A 1 51  ? -19.067 1.159   -6.893  1.00 34.11 ? 51  ILE A C    2  
ATOM 6625   O O    . ILE A 1 51  ? -19.857 1.746   -6.153  1.00 12.35 ? 51  ILE A O    2  
ATOM 6626   C CB   . ILE A 1 51  ? -16.973 1.599   -5.610  1.00 70.50 ? 51  ILE A CB   2  
ATOM 6627   C CG1  . ILE A 1 51  ? -15.600 2.272   -5.647  1.00 24.05 ? 51  ILE A CG1  2  
ATOM 6628   C CG2  . ILE A 1 51  ? -16.856 0.171   -5.099  1.00 11.15 ? 51  ILE A CG2  2  
ATOM 6629   C CD1  . ILE A 1 51  ? -15.627 3.725   -5.222  1.00 30.14 ? 51  ILE A CD1  2  
ATOM 6630   H H    . ILE A 1 51  ? -17.701 3.732   -7.067  1.00 23.42 ? 51  ILE A H    2  
ATOM 6631   H HA   . ILE A 1 51  ? -17.081 0.924   -7.639  1.00 34.25 ? 51  ILE A HA   2  
ATOM 6632   H HB   . ILE A 1 51  ? -17.616 2.144   -4.935  1.00 51.32 ? 51  ILE A HB   2  
ATOM 6633   H HG12 . ILE A 1 51  ? -14.929 1.747   -4.984  1.00 74.31 ? 51  ILE A HG12 2  
ATOM 6634   H HG13 . ILE A 1 51  ? -15.211 2.228   -6.653  1.00 52.31 ? 51  ILE A HG13 2  
ATOM 6635   H HG21 . ILE A 1 51  ? -17.656 -0.426  -5.511  1.00 41.31 ? 51  ILE A HG21 2  
ATOM 6636   H HG22 . ILE A 1 51  ? -16.923 0.167   -4.021  1.00 53.53 ? 51  ILE A HG22 2  
ATOM 6637   H HG23 . ILE A 1 51  ? -15.905 -0.243  -5.402  1.00 44.50 ? 51  ILE A HG23 2  
ATOM 6638   H HD11 . ILE A 1 51  ? -16.508 3.909   -4.624  1.00 54.33 ? 51  ILE A HD11 2  
ATOM 6639   H HD12 . ILE A 1 51  ? -15.650 4.355   -6.099  1.00 41.53 ? 51  ILE A HD12 2  
ATOM 6640   H HD13 . ILE A 1 51  ? -14.745 3.947   -4.641  1.00 62.50 ? 51  ILE A HD13 2  
ATOM 6641   N N    . TYR A 1 52  ? -19.412 0.106   -7.628  1.00 3.23  ? 52  TYR A N    2  
ATOM 6642   C CA   . TYR A 1 52  ? -20.767 -0.431  -7.605  1.00 20.41 ? 52  TYR A CA   2  
ATOM 6643   C C    . TYR A 1 52  ? -20.872 -1.602  -6.634  1.00 73.12 ? 52  TYR A C    2  
ATOM 6644   O O    . TYR A 1 52  ? -20.005 -2.475  -6.602  1.00 74.21 ? 52  TYR A O    2  
ATOM 6645   C CB   . TYR A 1 52  ? -21.185 -0.877  -9.008  1.00 32.03 ? 52  TYR A CB   2  
ATOM 6646   C CG   . TYR A 1 52  ? -21.332 0.263   -9.989  1.00 73.34 ? 52  TYR A CG   2  
ATOM 6647   C CD1  . TYR A 1 52  ? -20.228 1.012   -10.382 1.00 43.40 ? 52  TYR A CD1  2  
ATOM 6648   C CD2  . TYR A 1 52  ? -22.571 0.591   -10.523 1.00 1.44  ? 52  TYR A CD2  2  
ATOM 6649   C CE1  . TYR A 1 52  ? -20.359 2.056   -11.279 1.00 12.50 ? 52  TYR A CE1  2  
ATOM 6650   C CE2  . TYR A 1 52  ? -22.709 1.632   -11.422 1.00 73.11 ? 52  TYR A CE2  2  
ATOM 6651   C CZ   . TYR A 1 52  ? -21.599 2.361   -11.796 1.00 15.43 ? 52  TYR A CZ   2  
ATOM 6652   O OH   . TYR A 1 52  ? -21.731 3.399   -12.690 1.00 3.50  ? 52  TYR A OH   2  
ATOM 6653   H H    . TYR A 1 52  ? -18.738 -0.320  -8.197  1.00 43.31 ? 52  TYR A H    2  
ATOM 6654   H HA   . TYR A 1 52  ? -21.430 0.355   -7.275  1.00 71.02 ? 52  TYR A HA   2  
ATOM 6655   H HB2  . TYR A 1 52  ? -20.443 -1.557  -9.397  1.00 53.54 ? 52  TYR A HB2  2  
ATOM 6656   H HB3  . TYR A 1 52  ? -22.136 -1.388  -8.946  1.00 43.32 ? 52  TYR A HB3  2  
ATOM 6657   H HD1  . TYR A 1 52  ? -19.258 0.769   -9.976  1.00 71.35 ? 52  TYR A HD1  2  
ATOM 6658   H HD2  . TYR A 1 52  ? -23.438 0.018   -10.228 1.00 12.43 ? 52  TYR A HD2  2  
ATOM 6659   H HE1  . TYR A 1 52  ? -19.489 2.626   -11.572 1.00 12.25 ? 52  TYR A HE1  2  
ATOM 6660   H HE2  . TYR A 1 52  ? -23.681 1.871   -11.825 1.00 55.13 ? 52  TYR A HE2  2  
ATOM 6661   H HH   . TYR A 1 52  ? -22.536 3.887   -12.497 1.00 11.12 ? 52  TYR A HH   2  
ATOM 6662   N N    . LEU A 1 53  ? -21.940 -1.614  -5.842  1.00 31.32 ? 53  LEU A N    2  
ATOM 6663   C CA   . LEU A 1 53  ? -22.157 -2.679  -4.870  1.00 14.15 ? 53  LEU A CA   2  
ATOM 6664   C C    . LEU A 1 53  ? -22.324 -4.025  -5.567  1.00 30.04 ? 53  LEU A C    2  
ATOM 6665   O O    . LEU A 1 53  ? -22.877 -4.104  -6.663  1.00 25.34 ? 53  LEU A O    2  
ATOM 6666   C CB   . LEU A 1 53  ? -23.389 -2.374  -4.015  1.00 74.33 ? 53  LEU A CB   2  
ATOM 6667   C CG   . LEU A 1 53  ? -23.275 -1.123  -3.143  1.00 3.41  ? 53  LEU A CG   2  
ATOM 6668   C CD1  . LEU A 1 53  ? -24.624 -0.773  -2.534  1.00 33.32 ? 53  LEU A CD1  2  
ATOM 6669   C CD2  . LEU A 1 53  ? -22.233 -1.326  -2.053  1.00 51.03 ? 53  LEU A CD2  2  
ATOM 6670   H H    . LEU A 1 53  ? -22.597 -0.889  -5.913  1.00 63.33 ? 53  LEU A H    2  
ATOM 6671   H HA   . LEU A 1 53  ? -21.288 -2.724  -4.230  1.00 44.43 ? 53  LEU A HA   2  
ATOM 6672   H HB2  . LEU A 1 53  ? -24.237 -2.255  -4.673  1.00 51.44 ? 53  LEU A HB2  2  
ATOM 6673   H HB3  . LEU A 1 53  ? -23.571 -3.220  -3.369  1.00 12.12 ? 53  LEU A HB3  2  
ATOM 6674   H HG   . LEU A 1 53  ? -22.961 -0.292  -3.757  1.00 65.54 ? 53  LEU A HG   2  
ATOM 6675   H HD11 . LEU A 1 53  ? -25.324 -0.536  -3.321  1.00 63.14 ? 53  LEU A HD11 2  
ATOM 6676   H HD12 . LEU A 1 53  ? -24.513 0.080   -1.881  1.00 5.44  ? 53  LEU A HD12 2  
ATOM 6677   H HD13 . LEU A 1 53  ? -24.993 -1.615  -1.967  1.00 61.54 ? 53  LEU A HD13 2  
ATOM 6678   H HD21 . LEU A 1 53  ? -21.562 -2.122  -2.340  1.00 51.51 ? 53  LEU A HD21 2  
ATOM 6679   H HD22 . LEU A 1 53  ? -22.725 -1.586  -1.127  1.00 73.14 ? 53  LEU A HD22 2  
ATOM 6680   H HD23 . LEU A 1 53  ? -21.672 -0.413  -1.918  1.00 62.11 ? 53  LEU A HD23 2  
ATOM 6681   N N    . ALA A 1 54  ? -21.837 -5.083  -4.924  1.00 22.22 ? 54  ALA A N    2  
ATOM 6682   C CA   . ALA A 1 54  ? -21.930 -6.426  -5.486  1.00 3.24  ? 54  ALA A CA   2  
ATOM 6683   C C    . ALA A 1 54  ? -22.309 -7.450  -4.420  1.00 53.11 ? 54  ALA A C    2  
ATOM 6684   O O    . ALA A 1 54  ? -21.934 -7.319  -3.255  1.00 53.25 ? 54  ALA A O    2  
ATOM 6685   C CB   . ALA A 1 54  ? -20.613 -6.811  -6.143  1.00 63.33 ? 54  ALA A CB   2  
ATOM 6686   H H    . ALA A 1 54  ? -21.404 -4.956  -4.055  1.00 41.24 ? 54  ALA A H    2  
ATOM 6687   H HA   . ALA A 1 54  ? -22.694 -6.415  -6.249  1.00 12.34 ? 54  ALA A HA   2  
ATOM 6688   H HB1  . ALA A 1 54  ? -20.462 -6.208  -7.026  1.00 54.12 ? 54  ALA A HB1  2  
ATOM 6689   H HB2  . ALA A 1 54  ? -20.641 -7.854  -6.421  1.00 14.02 ? 54  ALA A HB2  2  
ATOM 6690   H HB3  . ALA A 1 54  ? -19.802 -6.646  -5.450  1.00 61.24 ? 54  ALA A HB3  2  
ATOM 6691   N N    . ASP A 1 55  ? -23.054 -8.470  -4.833  1.00 54.14 ? 55  ASP A N    2  
ATOM 6692   C CA   . ASP A 1 55  ? -23.487 -9.521  -3.920  1.00 23.44 ? 55  ASP A CA   2  
ATOM 6693   C C    . ASP A 1 55  ? -23.842 -10.794 -4.682  1.00 64.53 ? 55  ASP A C    2  
ATOM 6694   O O    . ASP A 1 55  ? -24.175 -10.748 -5.867  1.00 42.15 ? 55  ASP A O    2  
ATOM 6695   C CB   . ASP A 1 55  ? -24.692 -9.052  -3.102  1.00 32.02 ? 55  ASP A CB   2  
ATOM 6696   C CG   . ASP A 1 55  ? -24.786 -9.748  -1.759  1.00 23.04 ? 55  ASP A CG   2  
ATOM 6697   O OD1  . ASP A 1 55  ? -24.278 -10.883 -1.641  1.00 75.53 ? 55  ASP A OD1  2  
ATOM 6698   O OD2  . ASP A 1 55  ? -25.368 -9.159  -0.825  1.00 2.21  ? 55  ASP A OD2  2  
ATOM 6699   H H    . ASP A 1 55  ? -23.318 -8.514  -5.776  1.00 31.33 ? 55  ASP A H    2  
ATOM 6700   H HA   . ASP A 1 55  ? -22.670 -9.734  -3.248  1.00 12.25 ? 55  ASP A HA   2  
ATOM 6701   H HB2  . ASP A 1 55  ? -24.611 -7.989  -2.931  1.00 71.21 ? 55  ASP A HB2  2  
ATOM 6702   H HB3  . ASP A 1 55  ? -25.596 -9.255  -3.657  1.00 4.45  ? 55  ASP A HB3  2  
ATOM 6703   N N    . MET A 1 56  ? -23.768 -11.929 -3.995  1.00 61.25 ? 56  MET A N    2  
ATOM 6704   C CA   . MET A 1 56  ? -24.082 -13.214 -4.608  1.00 20.44 ? 56  MET A CA   2  
ATOM 6705   C C    . MET A 1 56  ? -25.585 -13.361 -4.822  1.00 72.34 ? 56  MET A C    2  
ATOM 6706   O O    . MET A 1 56  ? -26.386 -12.810 -4.066  1.00 24.12 ? 56  MET A O    2  
ATOM 6707   C CB   . MET A 1 56  ? -23.564 -14.359 -3.735  1.00 21.21 ? 56  MET A CB   2  
ATOM 6708   C CG   . MET A 1 56  ? -22.049 -14.473 -3.717  1.00 65.44 ? 56  MET A CG   2  
ATOM 6709   S SD   . MET A 1 56  ? -21.308 -13.652 -2.293  1.00 3.44  ? 56  MET A SD   2  
ATOM 6710   C CE   . MET A 1 56  ? -20.304 -14.976 -1.624  1.00 14.22 ? 56  MET A CE   2  
ATOM 6711   H H    . MET A 1 56  ? -23.497 -11.901 -3.054  1.00 13.34 ? 56  MET A H    2  
ATOM 6712   H HA   . MET A 1 56  ? -23.589 -13.253 -5.568  1.00 43.33 ? 56  MET A HA   2  
ATOM 6713   H HB2  . MET A 1 56  ? -23.904 -14.205 -2.721  1.00 23.21 ? 56  MET A HB2  2  
ATOM 6714   H HB3  . MET A 1 56  ? -23.970 -15.289 -4.104  1.00 71.20 ? 56  MET A HB3  2  
ATOM 6715   H HG2  . MET A 1 56  ? -21.780 -15.519 -3.691  1.00 22.31 ? 56  MET A HG2  2  
ATOM 6716   H HG3  . MET A 1 56  ? -21.658 -14.024 -4.619  1.00 42.11 ? 56  MET A HG3  2  
ATOM 6717   H HE1  . MET A 1 56  ? -20.669 -15.924 -1.990  1.00 63.25 ? 56  MET A HE1  2  
ATOM 6718   H HE2  . MET A 1 56  ? -20.359 -14.960 -0.546  1.00 44.41 ? 56  MET A HE2  2  
ATOM 6719   H HE3  . MET A 1 56  ? -19.278 -14.841 -1.934  1.00 15.33 ? 56  MET A HE3  2  
ATOM 6720   N N    . ASN A 1 57  ? -25.962 -14.108 -5.855  1.00 40.34 ? 57  ASN A N    2  
ATOM 6721   C CA   . ASN A 1 57  ? -27.370 -14.327 -6.166  1.00 33.15 ? 57  ASN A CA   2  
ATOM 6722   C C    . ASN A 1 57  ? -28.090 -14.989 -4.996  1.00 63.03 ? 57  ASN A C    2  
ATOM 6723   O O    . ASN A 1 57  ? -28.017 -16.205 -4.817  1.00 44.11 ? 57  ASN A O    2  
ATOM 6724   C CB   . ASN A 1 57  ? -27.507 -15.192 -7.420  1.00 11.32 ? 57  ASN A CB   2  
ATOM 6725   C CG   . ASN A 1 57  ? -26.671 -16.455 -7.346  1.00 4.50  ? 57  ASN A CG   2  
ATOM 6726   O OD1  . ASN A 1 57  ? -25.478 -16.407 -7.046  1.00 1.43  ? 57  ASN A OD1  2  
ATOM 6727   N ND2  . ASN A 1 57  ? -27.296 -17.595 -7.619  1.00 1.11  ? 57  ASN A ND2  2  
ATOM 6728   H H    . ASN A 1 57  ? -25.276 -14.521 -6.421  1.00 72.25 ? 57  ASN A H    2  
ATOM 6729   H HA   . ASN A 1 57  ? -27.821 -13.364 -6.353  1.00 52.24 ? 57  ASN A HA   2  
ATOM 6730   H HB2  . ASN A 1 57  ? -28.542 -15.475 -7.543  1.00 51.04 ? 57  ASN A HB2  2  
ATOM 6731   H HB3  . ASN A 1 57  ? -27.189 -14.622 -8.280  1.00 2.02  ? 57  ASN A HB3  2  
ATOM 6732   H HD21 . ASN A 1 57  ? -28.247 -17.558 -7.849  1.00 14.14 ? 57  ASN A HD21 2  
ATOM 6733   H HD22 . ASN A 1 57  ? -26.778 -18.427 -7.578  1.00 40.24 ? 57  ASN A HD22 2  
ATOM 6734   N N    . SER A 1 58  ? -28.786 -14.182 -4.202  1.00 20.22 ? 58  SER A N    2  
ATOM 6735   C CA   . SER A 1 58  ? -29.519 -14.691 -3.048  1.00 74.21 ? 58  SER A CA   2  
ATOM 6736   C C    . SER A 1 58  ? -30.299 -13.575 -2.361  1.00 24.04 ? 58  SER A C    2  
ATOM 6737   O O    . SER A 1 58  ? -31.526 -13.518 -2.447  1.00 4.14  ? 58  SER A O    2  
ATOM 6738   C CB   . SER A 1 58  ? -28.558 -15.343 -2.054  1.00 34.45 ? 58  SER A CB   2  
ATOM 6739   O OG   . SER A 1 58  ? -28.426 -16.732 -2.307  1.00 73.34 ? 58  SER A OG   2  
ATOM 6740   H H    . SER A 1 58  ? -28.806 -13.222 -4.395  1.00 31.54 ? 58  SER A H    2  
ATOM 6741   H HA   . SER A 1 58  ? -30.216 -15.436 -3.403  1.00 4.01  ? 58  SER A HA   2  
ATOM 6742   H HB2  . SER A 1 58  ? -27.586 -14.881 -2.141  1.00 34.13 ? 58  SER A HB2  2  
ATOM 6743   H HB3  . SER A 1 58  ? -28.933 -15.207 -1.050  1.00 42.12 ? 58  SER A HB3  2  
ATOM 6744   H HG   . SER A 1 58  ? -28.136 -17.176 -1.507  1.00 22.52 ? 58  SER A HG   2  
ATOM 6745   N N    . SER A 1 59  ? -29.580 -12.689 -1.680  1.00 61.11 ? 59  SER A N    2  
ATOM 6746   C CA   . SER A 1 59  ? -30.204 -11.574 -0.976  1.00 23.11 ? 59  SER A CA   2  
ATOM 6747   C C    . SER A 1 59  ? -30.991 -10.692 -1.940  1.00 10.14 ? 59  SER A C    2  
ATOM 6748   O O    . SER A 1 59  ? -30.464 -10.244 -2.959  1.00 45.30 ? 59  SER A O    2  
ATOM 6749   C CB   . SER A 1 59  ? -29.143 -10.742 -0.255  1.00 4.04  ? 59  SER A CB   2  
ATOM 6750   O OG   . SER A 1 59  ? -27.893 -10.825 -0.915  1.00 12.44 ? 59  SER A OG   2  
ATOM 6751   H H    . SER A 1 59  ? -28.605 -12.789 -1.648  1.00 35.44 ? 59  SER A H    2  
ATOM 6752   H HA   . SER A 1 59  ? -30.885 -11.984 -0.246  1.00 74.14 ? 59  SER A HA   2  
ATOM 6753   H HB2  . SER A 1 59  ? -29.455 -9.708  -0.230  1.00 2.41  ? 59  SER A HB2  2  
ATOM 6754   H HB3  . SER A 1 59  ? -29.028 -11.106 0.755   1.00 72.10 ? 59  SER A HB3  2  
ATOM 6755   H HG   . SER A 1 59  ? -27.206 -10.467 -0.348  1.00 30.33 ? 59  SER A HG   2  
ATOM 6756   N N    . GLU A 1 60  ? -32.255 -10.444 -1.610  1.00 71.14 ? 60  GLU A N    2  
ATOM 6757   C CA   . GLU A 1 60  ? -33.115 -9.615  -2.446  1.00 35.25 ? 60  GLU A CA   2  
ATOM 6758   C C    . GLU A 1 60  ? -32.555 -8.202  -2.568  1.00 45.51 ? 60  GLU A C    2  
ATOM 6759   O O    . GLU A 1 60  ? -32.533 -7.445  -1.597  1.00 63.40 ? 60  GLU A O    2  
ATOM 6760   C CB   . GLU A 1 60  ? -34.531 -9.568  -1.868  1.00 72.42 ? 60  GLU A CB   2  
ATOM 6761   C CG   . GLU A 1 60  ? -35.439 -10.668 -2.390  1.00 22.20 ? 60  GLU A CG   2  
ATOM 6762   C CD   . GLU A 1 60  ? -36.837 -10.170 -2.706  1.00 73.41 ? 60  GLU A CD   2  
ATOM 6763   O OE1  . GLU A 1 60  ? -36.960 -9.059  -3.262  1.00 31.25 ? 60  GLU A OE1  2  
ATOM 6764   O OE2  . GLU A 1 60  ? -37.808 -10.892 -2.394  1.00 12.35 ? 60  GLU A OE2  2  
ATOM 6765   H H    . GLU A 1 60  ? -32.618 -10.830 -0.785  1.00 11.14 ? 60  GLU A H    2  
ATOM 6766   H HA   . GLU A 1 60  ? -33.152 -10.060 -3.428  1.00 71.42 ? 60  GLU A HA   2  
ATOM 6767   H HB2  . GLU A 1 60  ? -34.472 -9.659  -0.793  1.00 5.33  ? 60  GLU A HB2  2  
ATOM 6768   H HB3  . GLU A 1 60  ? -34.976 -8.615  -2.114  1.00 41.23 ? 60  GLU A HB3  2  
ATOM 6769   H HG2  . GLU A 1 60  ? -35.008 -11.075 -3.293  1.00 53.33 ? 60  GLU A HG2  2  
ATOM 6770   H HG3  . GLU A 1 60  ? -35.508 -11.445 -1.643  1.00 23.55 ? 60  GLU A HG3  2  
ATOM 6771   N N    . SER A 1 61  ? -32.103 -7.852  -3.767  1.00 22.14 ? 61  SER A N    2  
ATOM 6772   C CA   . SER A 1 61  ? -31.542 -6.529  -4.017  1.00 65.24 ? 61  SER A CA   2  
ATOM 6773   C C    . SER A 1 61  ? -30.331 -6.275  -3.127  1.00 15.44 ? 61  SER A C    2  
ATOM 6774   O O    . SER A 1 61  ? -30.050 -7.047  -2.210  1.00 33.43 ? 61  SER A O    2  
ATOM 6775   C CB   . SER A 1 61  ? -32.600 -5.450  -3.781  1.00 44.21 ? 61  SER A CB   2  
ATOM 6776   O OG   . SER A 1 61  ? -33.834 -5.805  -4.379  1.00 73.44 ? 61  SER A OG   2  
ATOM 6777   H H    . SER A 1 61  ? -32.147 -8.499  -4.502  1.00 71.44 ? 61  SER A H    2  
ATOM 6778   H HA   . SER A 1 61  ? -31.228 -6.492  -5.050  1.00 54.34 ? 61  SER A HA   2  
ATOM 6779   H HB2  . SER A 1 61  ? -32.753 -5.326  -2.719  1.00 21.33 ? 61  SER A HB2  2  
ATOM 6780   H HB3  . SER A 1 61  ? -32.261 -4.517  -4.207  1.00 34.23 ? 61  SER A HB3  2  
ATOM 6781   H HG   . SER A 1 61  ? -33.762 -5.724  -5.333  1.00 73.42 ? 61  SER A HG   2  
ATOM 6782   N N    . VAL A 1 62  ? -29.616 -5.187  -3.400  1.00 40.41 ? 62  VAL A N    2  
ATOM 6783   C CA   . VAL A 1 62  ? -28.436 -4.832  -2.622  1.00 73.23 ? 62  VAL A CA   2  
ATOM 6784   C C    . VAL A 1 62  ? -28.203 -3.326  -2.641  1.00 53.51 ? 62  VAL A C    2  
ATOM 6785   O O    . VAL A 1 62  ? -28.283 -2.689  -3.692  1.00 23.33 ? 62  VAL A O    2  
ATOM 6786   C CB   . VAL A 1 62  ? -27.176 -5.539  -3.155  1.00 75.15 ? 62  VAL A CB   2  
ATOM 6787   C CG1  . VAL A 1 62  ? -26.008 -5.341  -2.200  1.00 21.52 ? 62  VAL A CG1  2  
ATOM 6788   C CG2  . VAL A 1 62  ? -27.445 -7.019  -3.378  1.00 0.32  ? 62  VAL A CG2  2  
ATOM 6789   H H    . VAL A 1 62  ? -29.890 -4.609  -4.142  1.00 20.44 ? 62  VAL A H    2  
ATOM 6790   H HA   . VAL A 1 62  ? -28.599 -5.150  -1.603  1.00 35.20 ? 62  VAL A HA   2  
ATOM 6791   H HB   . VAL A 1 62  ? -26.913 -5.095  -4.104  1.00 34.34 ? 62  VAL A HB   2  
ATOM 6792   H HG11 . VAL A 1 62  ? -25.940 -4.299  -1.927  1.00 70.23 ? 62  VAL A HG11 2  
ATOM 6793   H HG12 . VAL A 1 62  ? -25.092 -5.647  -2.683  1.00 23.23 ? 62  VAL A HG12 2  
ATOM 6794   H HG13 . VAL A 1 62  ? -26.163 -5.937  -1.313  1.00 11.23 ? 62  VAL A HG13 2  
ATOM 6795   H HG21 . VAL A 1 62  ? -26.541 -7.502  -3.718  1.00 53.41 ? 62  VAL A HG21 2  
ATOM 6796   H HG22 . VAL A 1 62  ? -28.217 -7.136  -4.125  1.00 20.41 ? 62  VAL A HG22 2  
ATOM 6797   H HG23 . VAL A 1 62  ? -27.768 -7.471  -2.452  1.00 60.20 ? 62  VAL A HG23 2  
ATOM 6798   N N    . GLY A 1 63  ? -27.915 -2.759  -1.474  1.00 51.14 ? 63  GLY A N    2  
ATOM 6799   C CA   . GLY A 1 63  ? -27.677 -1.330  -1.385  1.00 44.34 ? 63  GLY A CA   2  
ATOM 6800   C C    . GLY A 1 63  ? -26.961 -0.935  -0.109  1.00 70.30 ? 63  GLY A C    2  
ATOM 6801   O O    . GLY A 1 63  ? -25.926 -0.269  -0.151  1.00 3.22  ? 63  GLY A O    2  
ATOM 6802   H H    . GLY A 1 63  ? -27.865 -3.315  -0.669  1.00 52.43 ? 63  GLY A H    2  
ATOM 6803   H HA2  . GLY A 1 63  ? -27.078 -1.025  -2.230  1.00 12.43 ? 63  GLY A HA2  2  
ATOM 6804   H HA3  . GLY A 1 63  ? -28.626 -0.817  -1.427  1.00 30.25 ? 63  GLY A HA3  2  
ATOM 6805   N N    . SER A 1 64  ? -27.516 -1.338  1.029   1.00 64.23 ? 64  SER A N    2  
ATOM 6806   C CA   . SER A 1 64  ? -26.926 -1.015  2.323   1.00 20.14 ? 64  SER A CA   2  
ATOM 6807   C C    . SER A 1 64  ? -25.884 -2.052  2.730   1.00 61.32 ? 64  SER A C    2  
ATOM 6808   O O    . SER A 1 64  ? -24.681 -1.809  2.629   1.00 42.31 ? 64  SER A O    2  
ATOM 6809   C CB   . SER A 1 64  ? -28.016 -0.923  3.393   1.00 74.21 ? 64  SER A CB   2  
ATOM 6810   O OG   . SER A 1 64  ? -28.507 0.401   3.511   1.00 42.41 ? 64  SER A OG   2  
ATOM 6811   H H    . SER A 1 64  ? -28.345 -1.862  0.998   1.00 55.04 ? 64  SER A H    2  
ATOM 6812   H HA   . SER A 1 64  ? -26.443 -0.053  2.234   1.00 54.31 ? 64  SER A HA   2  
ATOM 6813   H HB2  . SER A 1 64  ? -28.835 -1.575  3.127   1.00 40.15 ? 64  SER A HB2  2  
ATOM 6814   H HB3  . SER A 1 64  ? -27.609 -1.229  4.346   1.00 32.33 ? 64  SER A HB3  2  
ATOM 6815   H HG   . SER A 1 64  ? -28.726 0.739   2.638   1.00 32.40 ? 64  SER A HG   2  
ATOM 6816   N N    . ASP A 1 65  ? -26.351 -3.206  3.194   1.00 25.41 ? 65  ASP A N    2  
ATOM 6817   C CA   . ASP A 1 65  ? -25.458 -4.276  3.623   1.00 64.12 ? 65  ASP A CA   2  
ATOM 6818   C C    . ASP A 1 65  ? -24.904 -5.047  2.427   1.00 33.30 ? 65  ASP A C    2  
ATOM 6819   O O    . ASP A 1 65  ? -25.296 -6.187  2.177   1.00 13.41 ? 65  ASP A O    2  
ATOM 6820   C CB   . ASP A 1 65  ? -26.191 -5.233  4.566   1.00 74.14 ? 65  ASP A CB   2  
ATOM 6821   C CG   . ASP A 1 65  ? -26.065 -4.820  6.019   1.00 72.21 ? 65  ASP A CG   2  
ATOM 6822   O OD1  . ASP A 1 65  ? -26.072 -3.601  6.294   1.00 63.42 ? 65  ASP A OD1  2  
ATOM 6823   O OD2  . ASP A 1 65  ? -25.958 -5.716  6.883   1.00 45.23 ? 65  ASP A OD2  2  
ATOM 6824   H H    . ASP A 1 65  ? -27.320 -3.339  3.255   1.00 4.21  ? 65  ASP A H    2  
ATOM 6825   H HA   . ASP A 1 65  ? -24.633 -3.825  4.155   1.00 3.31  ? 65  ASP A HA   2  
ATOM 6826   H HB2  . ASP A 1 65  ? -27.239 -5.251  4.307   1.00 12.43 ? 65  ASP A HB2  2  
ATOM 6827   H HB3  . ASP A 1 65  ? -25.779 -6.225  4.455   1.00 64.25 ? 65  ASP A HB3  2  
ATOM 6828   N N    . ALA A 1 66  ? -23.991 -4.419  1.693   1.00 23.54 ? 66  ALA A N    2  
ATOM 6829   C CA   . ALA A 1 66  ? -23.382 -5.048  0.528   1.00 35.21 ? 66  ALA A CA   2  
ATOM 6830   C C    . ALA A 1 66  ? -22.098 -5.782  0.912   1.00 4.31  ? 66  ALA A C    2  
ATOM 6831   O O    . ALA A 1 66  ? -21.100 -5.153  1.266   1.00 60.14 ? 66  ALA A O    2  
ATOM 6832   C CB   . ALA A 1 66  ? -23.095 -4.005  -0.542  1.00 41.41 ? 66  ALA A CB   2  
ATOM 6833   H H    . ALA A 1 66  ? -23.718 -3.510  1.943   1.00 71.11 ? 66  ALA A H    2  
ATOM 6834   H HA   . ALA A 1 66  ? -24.090 -5.756  0.125   1.00 31.42 ? 66  ALA A HA   2  
ATOM 6835   H HB1  . ALA A 1 66  ? -23.002 -4.491  -1.502  1.00 5.10  ? 66  ALA A HB1  2  
ATOM 6836   H HB2  . ALA A 1 66  ? -22.173 -3.492  -0.308  1.00 15.00 ? 66  ALA A HB2  2  
ATOM 6837   H HB3  . ALA A 1 66  ? -23.905 -3.292  -0.577  1.00 32.13 ? 66  ALA A HB3  2  
ATOM 6838   N N    . PRO A 1 67  ? -22.101 -7.127  0.851   1.00 13.11 ? 67  PRO A N    2  
ATOM 6839   C CA   . PRO A 1 67  ? -20.927 -7.934  1.200   1.00 43.52 ? 67  PRO A CA   2  
ATOM 6840   C C    . PRO A 1 67  ? -19.679 -7.509  0.434   1.00 11.12 ? 67  PRO A C    2  
ATOM 6841   O O    . PRO A 1 67  ? -18.699 -7.057  1.027   1.00 20.53 ? 67  PRO A O    2  
ATOM 6842   C CB   . PRO A 1 67  ? -21.338 -9.356  0.809   1.00 74.41 ? 67  PRO A CB   2  
ATOM 6843   C CG   . PRO A 1 67  ? -22.826 -9.348  0.857   1.00 2.25  ? 67  PRO A CG   2  
ATOM 6844   C CD   . PRO A 1 67  ? -23.246 -7.965  0.444   1.00 14.11 ? 67  PRO A CD   2  
ATOM 6845   H HA   . PRO A 1 67  ? -20.724 -7.896  2.261   1.00 51.03 ? 67  PRO A HA   2  
ATOM 6846   H HB2  . PRO A 1 67  ? -20.975 -9.578  -0.184  1.00 41.55 ? 67  PRO A HB2  2  
ATOM 6847   H HB3  . PRO A 1 67  ? -20.925 -10.061 1.515   1.00 4.45  ? 67  PRO A HB3  2  
ATOM 6848   H HG2  . PRO A 1 67  ? -23.220 -10.081 0.168   1.00 20.43 ? 67  PRO A HG2  2  
ATOM 6849   H HG3  . PRO A 1 67  ? -23.162 -9.557  1.862   1.00 43.23 ? 67  PRO A HG3  2  
ATOM 6850   H HD2  . PRO A 1 67  ? -23.395 -7.919  -0.625  1.00 33.12 ? 67  PRO A HD2  2  
ATOM 6851   H HD3  . PRO A 1 67  ? -24.143 -7.671  0.965   1.00 22.32 ? 67  PRO A HD3  2  
ATOM 6852   N N    . CYS A 1 68  ? -19.717 -7.659  -0.887  1.00 13.12 ? 68  CYS A N    2  
ATOM 6853   C CA   . CYS A 1 68  ? -18.586 -7.292  -1.731  1.00 0.13  ? 68  CYS A CA   2  
ATOM 6854   C C    . CYS A 1 68  ? -18.917 -6.077  -2.589  1.00 52.41 ? 68  CYS A C    2  
ATOM 6855   O O    . CYS A 1 68  ? -20.085 -5.737  -2.777  1.00 13.14 ? 68  CYS A O    2  
ATOM 6856   C CB   . CYS A 1 68  ? -18.187 -8.467  -2.624  1.00 0.40  ? 68  CYS A CB   2  
ATOM 6857   S SG   . CYS A 1 68  ? -18.063 -10.047 -1.753  1.00 2.31  ? 68  CYS A SG   2  
ATOM 6858   H H    . CYS A 1 68  ? -20.525 -8.026  -1.303  1.00 40.11 ? 68  CYS A H    2  
ATOM 6859   H HA   . CYS A 1 68  ? -17.757 -7.046  -1.084  1.00 74.24 ? 68  CYS A HA   2  
ATOM 6860   H HB2  . CYS A 1 68  ? -18.923 -8.582  -3.406  1.00 61.34 ? 68  CYS A HB2  2  
ATOM 6861   H HB3  . CYS A 1 68  ? -17.225 -8.261  -3.070  1.00 11.13 ? 68  CYS A HB3  2  
ATOM 6862   H HG   . CYS A 1 68  ? -18.446 -10.726 -2.314  1.00 1.24  ? 68  CYS A HG   2  
ATOM 6863   N N    . VAL A 1 69  ? -17.882 -5.424  -3.108  1.00 11.41 ? 69  VAL A N    2  
ATOM 6864   C CA   . VAL A 1 69  ? -18.068 -4.246  -3.946  1.00 22.14 ? 69  VAL A CA   2  
ATOM 6865   C C    . VAL A 1 69  ? -17.195 -4.313  -5.194  1.00 41.22 ? 69  VAL A C    2  
ATOM 6866   O O    . VAL A 1 69  ? -16.046 -4.752  -5.139  1.00 34.22 ? 69  VAL A O    2  
ATOM 6867   C CB   . VAL A 1 69  ? -17.744 -2.952  -3.177  1.00 71.13 ? 69  VAL A CB   2  
ATOM 6868   C CG1  . VAL A 1 69  ? -18.769 -2.712  -2.079  1.00 73.15 ? 69  VAL A CG1  2  
ATOM 6869   C CG2  . VAL A 1 69  ? -16.337 -3.012  -2.601  1.00 14.23 ? 69  VAL A CG2  2  
ATOM 6870   H H    . VAL A 1 69  ? -16.973 -5.741  -2.922  1.00 1.54  ? 69  VAL A H    2  
ATOM 6871   H HA   . VAL A 1 69  ? -19.105 -4.210  -4.246  1.00 62.42 ? 69  VAL A HA   2  
ATOM 6872   H HB   . VAL A 1 69  ? -17.791 -2.124  -3.870  1.00 63.42 ? 69  VAL A HB   2  
ATOM 6873   H HG11 . VAL A 1 69  ? -19.179 -3.657  -1.757  1.00 65.01 ? 69  VAL A HG11 2  
ATOM 6874   H HG12 . VAL A 1 69  ? -19.561 -2.083  -2.456  1.00 41.02 ? 69  VAL A HG12 2  
ATOM 6875   H HG13 . VAL A 1 69  ? -18.291 -2.224  -1.242  1.00 13.33 ? 69  VAL A HG13 2  
ATOM 6876   H HG21 . VAL A 1 69  ? -15.753 -3.734  -3.152  1.00 61.53 ? 69  VAL A HG21 2  
ATOM 6877   H HG22 . VAL A 1 69  ? -16.386 -3.304  -1.563  1.00 5.41  ? 69  VAL A HG22 2  
ATOM 6878   H HG23 . VAL A 1 69  ? -15.875 -2.039  -2.680  1.00 54.31 ? 69  VAL A HG23 2  
ATOM 6879   N N    . VAL A 1 70  ? -17.750 -3.874  -6.319  1.00 24.25 ? 70  VAL A N    2  
ATOM 6880   C CA   . VAL A 1 70  ? -17.030 -3.882  -7.586  1.00 14.31 ? 70  VAL A CA   2  
ATOM 6881   C C    . VAL A 1 70  ? -16.632 -2.468  -7.995  1.00 23.25 ? 70  VAL A C    2  
ATOM 6882   O O    . VAL A 1 70  ? -17.273 -1.496  -7.595  1.00 25.44 ? 70  VAL A O    2  
ATOM 6883   C CB   . VAL A 1 70  ? -17.882 -4.513  -8.705  1.00 14.34 ? 70  VAL A CB   2  
ATOM 6884   C CG1  . VAL A 1 70  ? -19.176 -3.738  -8.896  1.00 60.24 ? 70  VAL A CG1  2  
ATOM 6885   C CG2  . VAL A 1 70  ? -17.096 -4.582  -10.006 1.00 63.52 ? 70  VAL A CG2  2  
ATOM 6886   H H    . VAL A 1 70  ? -18.671 -3.540  -6.296  1.00 54.54 ? 70  VAL A H    2  
ATOM 6887   H HA   . VAL A 1 70  ? -16.137 -4.477  -7.460  1.00 3.23  ? 70  VAL A HA   2  
ATOM 6888   H HB   . VAL A 1 70  ? -18.136 -5.520  -8.410  1.00 52.24 ? 70  VAL A HB   2  
ATOM 6889   H HG11 . VAL A 1 70  ? -19.026 -2.710  -8.606  1.00 14.03 ? 70  VAL A HG11 2  
ATOM 6890   H HG12 . VAL A 1 70  ? -19.951 -4.177  -8.286  1.00 75.43 ? 70  VAL A HG12 2  
ATOM 6891   H HG13 . VAL A 1 70  ? -19.469 -3.779  -9.935  1.00 4.53  ? 70  VAL A HG13 2  
ATOM 6892   H HG21 . VAL A 1 70  ? -17.071 -3.604  -10.463 1.00 22.31 ? 70  VAL A HG21 2  
ATOM 6893   H HG22 . VAL A 1 70  ? -17.572 -5.280  -10.678 1.00 45.32 ? 70  VAL A HG22 2  
ATOM 6894   H HG23 . VAL A 1 70  ? -16.087 -4.910  -9.802  1.00 52.11 ? 70  VAL A HG23 2  
ATOM 6895   N N    . LYS A 1 71  ? -15.578 -2.357  -8.798  1.00 2.44  ? 71  LYS A N    2  
ATOM 6896   C CA   . LYS A 1 71  ? -15.106 -1.057  -9.260  1.00 23.22 ? 71  LYS A CA   2  
ATOM 6897   C C    . LYS A 1 71  ? -14.749 -1.115  -10.743 1.00 43.12 ? 71  LYS A C    2  
ATOM 6898   O O    . LYS A 1 71  ? -13.940 -1.943  -11.165 1.00 3.52  ? 71  LYS A O    2  
ATOM 6899   C CB   . LYS A 1 71  ? -13.888 -0.614  -8.446  1.00 71.42 ? 71  LYS A CB   2  
ATOM 6900   C CG   . LYS A 1 71  ? -13.678 0.892   -8.436  1.00 4.02  ? 71  LYS A CG   2  
ATOM 6901   C CD   . LYS A 1 71  ? -12.372 1.280   -9.111  1.00 10.51 ? 71  LYS A CD   2  
ATOM 6902   C CE   . LYS A 1 71  ? -11.198 1.183   -8.150  1.00 35.12 ? 71  LYS A CE   2  
ATOM 6903   N NZ   . LYS A 1 71  ? -11.216 -0.091  -7.378  1.00 2.24  ? 71  LYS A NZ   2  
ATOM 6904   H H    . LYS A 1 71  ? -15.101 -3.160  -9.095  1.00 74.00 ? 71  LYS A H    2  
ATOM 6905   H HA   . LYS A 1 71  ? -15.903 -0.344  -9.119  1.00 54.35 ? 71  LYS A HA   2  
ATOM 6906   H HB2  . LYS A 1 71  ? -14.013 -0.944  -7.425  1.00 40.13 ? 71  LYS A HB2  2  
ATOM 6907   H HB3  . LYS A 1 71  ? -13.006 -1.078  -8.860  1.00 4.13  ? 71  LYS A HB3  2  
ATOM 6908   H HG2  . LYS A 1 71  ? -14.496 1.363   -8.962  1.00 65.44 ? 71  LYS A HG2  2  
ATOM 6909   H HG3  . LYS A 1 71  ? -13.661 1.237   -7.412  1.00 62.31 ? 71  LYS A HG3  2  
ATOM 6910   H HD2  . LYS A 1 71  ? -12.198 0.617   -9.945  1.00 11.43 ? 71  LYS A HD2  2  
ATOM 6911   H HD3  . LYS A 1 71  ? -12.450 2.297   -9.467  1.00 20.24 ? 71  LYS A HD3  2  
ATOM 6912   H HE2  . LYS A 1 71  ? -10.280 1.236   -8.716  1.00 62.22 ? 71  LYS A HE2  2  
ATOM 6913   H HE3  . LYS A 1 71  ? -11.244 2.012   -7.460  1.00 11.44 ? 71  LYS A HE3  2  
ATOM 6914   H HZ1  . LYS A 1 71  ? -12.076 -0.142  -6.794  1.00 55.22 ? 71  LYS A HZ1  2  
ATOM 6915   H HZ2  . LYS A 1 71  ? -10.386 -0.143  -6.756  1.00 32.11 ? 71  LYS A HZ2  2  
ATOM 6916   H HZ3  . LYS A 1 71  ? -11.202 -0.903  -8.027  1.00 2.45  ? 71  LYS A HZ3  2  
ATOM 6917   N N    . VAL A 1 72  ? -15.366 -0.237  -11.528 1.00 24.04 ? 72  VAL A N    2  
ATOM 6918   C CA   . VAL A 1 72  ? -15.123 -0.193  -12.965 1.00 40.04 ? 72  VAL A CA   2  
ATOM 6919   C C    . VAL A 1 72  ? -14.100 0.878   -13.328 1.00 43.25 ? 72  VAL A C    2  
ATOM 6920   O O    . VAL A 1 72  ? -14.137 1.992   -12.803 1.00 3.52  ? 72  VAL A O    2  
ATOM 6921   C CB   . VAL A 1 72  ? -16.424 0.076   -13.747 1.00 60.21 ? 72  VAL A CB   2  
ATOM 6922   C CG1  . VAL A 1 72  ? -17.376 -1.104  -13.624 1.00 33.30 ? 72  VAL A CG1  2  
ATOM 6923   C CG2  . VAL A 1 72  ? -17.086 1.357   -13.259 1.00 52.32 ? 72  VAL A CG2  2  
ATOM 6924   H H    . VAL A 1 72  ? -16.008 0.388   -11.131 1.00 71.42 ? 72  VAL A H    2  
ATOM 6925   H HA   . VAL A 1 72  ? -14.741 -1.156  -13.268 1.00 13.42 ? 72  VAL A HA   2  
ATOM 6926   H HB   . VAL A 1 72  ? -16.175 0.201   -14.789 1.00 53.34 ? 72  VAL A HB   2  
ATOM 6927   H HG11 . VAL A 1 72  ? -17.172 -1.638  -12.707 1.00 31.32 ? 72  VAL A HG11 2  
ATOM 6928   H HG12 . VAL A 1 72  ? -17.237 -1.767  -14.465 1.00 53.14 ? 72  VAL A HG12 2  
ATOM 6929   H HG13 . VAL A 1 72  ? -18.395 -0.745  -13.613 1.00 61.23 ? 72  VAL A HG13 2  
ATOM 6930   H HG21 . VAL A 1 72  ? -17.436 1.926   -14.107 1.00 23.42 ? 72  VAL A HG21 2  
ATOM 6931   H HG22 . VAL A 1 72  ? -16.370 1.944   -12.702 1.00 22.04 ? 72  VAL A HG22 2  
ATOM 6932   H HG23 . VAL A 1 72  ? -17.922 1.110   -12.620 1.00 4.42  ? 72  VAL A HG23 2  
ATOM 6933   N N    . GLU A 1 73  ? -13.188 0.532   -14.231 1.00 73.23 ? 73  GLU A N    2  
ATOM 6934   C CA   . GLU A 1 73  ? -12.153 1.459   -14.669 1.00 11.33 ? 73  GLU A CA   2  
ATOM 6935   C C    . GLU A 1 73  ? -11.828 1.254   -16.149 1.00 22.44 ? 73  GLU A C    2  
ATOM 6936   O O    . GLU A 1 73  ? -12.189 0.236   -16.738 1.00 70.34 ? 73  GLU A O    2  
ATOM 6937   C CB   . GLU A 1 73  ? -10.889 1.283   -13.823 1.00 1.10  ? 73  GLU A CB   2  
ATOM 6938   C CG   . GLU A 1 73  ? -10.472 2.543   -13.083 1.00 61.21 ? 73  GLU A CG   2  
ATOM 6939   C CD   . GLU A 1 73  ? -11.062 2.621   -11.689 1.00 63.24 ? 73  GLU A CD   2  
ATOM 6940   O OE1  . GLU A 1 73  ? -12.221 3.069   -11.559 1.00 63.40 ? 73  GLU A OE1  2  
ATOM 6941   O OE2  . GLU A 1 73  ? -10.366 2.236   -10.726 1.00 40.44 ? 73  GLU A OE2  2  
ATOM 6942   H H    . GLU A 1 73  ? -13.214 -0.372  -14.610 1.00 72.23 ? 73  GLU A H    2  
ATOM 6943   H HA   . GLU A 1 73  ? -12.528 2.462   -14.533 1.00 51.43 ? 73  GLU A HA   2  
ATOM 6944   H HB2  . GLU A 1 73  ? -11.064 0.505   -13.095 1.00 12.12 ? 73  GLU A HB2  2  
ATOM 6945   H HB3  . GLU A 1 73  ? -10.075 0.984   -14.467 1.00 62.05 ? 73  GLU A HB3  2  
ATOM 6946   H HG2  . GLU A 1 73  ? -9.395  2.558   -13.002 1.00 73.42 ? 73  GLU A HG2  2  
ATOM 6947   H HG3  . GLU A 1 73  ? -10.802 3.402   -13.647 1.00 43.40 ? 73  GLU A HG3  2  
ATOM 6948   N N    . PRO A 1 74  ? -11.140 2.228   -16.769 1.00 72.03 ? 74  PRO A N    2  
ATOM 6949   C CA   . PRO A 1 74  ? -10.767 2.158   -18.188 1.00 1.34  ? 74  PRO A CA   2  
ATOM 6950   C C    . PRO A 1 74  ? -9.941  0.924   -18.519 1.00 53.23 ? 74  PRO A C    2  
ATOM 6951   O O    . PRO A 1 74  ? -9.153  0.450   -17.700 1.00 45.23 ? 74  PRO A O    2  
ATOM 6952   C CB   . PRO A 1 74  ? -9.938  3.428   -18.409 1.00 35.23 ? 74  PRO A CB   2  
ATOM 6953   C CG   . PRO A 1 74  ? -10.351 4.352   -17.316 1.00 30.24 ? 74  PRO A CG   2  
ATOM 6954   C CD   . PRO A 1 74  ? -10.676 3.477   -16.140 1.00 62.52 ? 74  PRO A CD   2  
ATOM 6955   H HA   . PRO A 1 74  ? -11.635 2.179   -18.826 1.00 72.13 ? 74  PRO A HA   2  
ATOM 6956   H HB2  . PRO A 1 74  ? -8.886  3.187   -18.348 1.00 72.15 ? 74  PRO A HB2  2  
ATOM 6957   H HB3  . PRO A 1 74  ? -10.162 3.841   -19.381 1.00 44.13 ? 74  PRO A HB3  2  
ATOM 6958   H HG2  . PRO A 1 74  ? -9.539  5.020   -17.074 1.00 72.21 ? 74  PRO A HG2  2  
ATOM 6959   H HG3  . PRO A 1 74  ? -11.223 4.912   -17.619 1.00 23.10 ? 74  PRO A HG3  2  
ATOM 6960   H HD2  . PRO A 1 74  ? -9.793  3.304   -15.542 1.00 54.00 ? 74  PRO A HD2  2  
ATOM 6961   H HD3  . PRO A 1 74  ? -11.458 3.921   -15.542 1.00 30.31 ? 74  PRO A HD3  2  
ATOM 6962   N N    . SER A 1 75  ? -10.120 0.414   -19.734 1.00 12.41 ? 75  SER A N    2  
ATOM 6963   C CA   . SER A 1 75  ? -9.384  -0.759  -20.187 1.00 45.43 ? 75  SER A CA   2  
ATOM 6964   C C    . SER A 1 75  ? -8.109  -0.349  -20.918 1.00 42.30 ? 75  SER A C    2  
ATOM 6965   O O    . SER A 1 75  ? -7.597  -1.089  -21.757 1.00 62.23 ? 75  SER A O    2  
ATOM 6966   C CB   . SER A 1 75  ? -10.258 -1.615  -21.106 1.00 12.11 ? 75  SER A CB   2  
ATOM 6967   O OG   . SER A 1 75  ? -10.407 -1.007  -22.377 1.00 4.12  ? 75  SER A OG   2  
ATOM 6968   H H    . SER A 1 75  ? -10.757 0.841   -20.343 1.00 73.53 ? 75  SER A H    2  
ATOM 6969   H HA   . SER A 1 75  ? -9.116  -1.339  -19.317 1.00 61.14 ? 75  SER A HA   2  
ATOM 6970   H HB2  . SER A 1 75  ? -9.799  -2.584  -21.235 1.00 65.32 ? 75  SER A HB2  2  
ATOM 6971   H HB3  . SER A 1 75  ? -11.234 -1.735  -20.661 1.00 33.11 ? 75  SER A HB3  2  
ATOM 6972   H HG   . SER A 1 75  ? -11.049 -0.296  -22.320 1.00 15.20 ? 75  SER A HG   2  
ATOM 6973   N N    . ASP A 1 76  ? -7.598  0.836   -20.588 1.00 12.12 ? 76  ASP A N    2  
ATOM 6974   C CA   . ASP A 1 76  ? -6.380  1.343   -21.208 1.00 52.15 ? 76  ASP A CA   2  
ATOM 6975   C C    . ASP A 1 76  ? -5.187  0.446   -20.884 1.00 13.31 ? 76  ASP A C    2  
ATOM 6976   O O    . ASP A 1 76  ? -4.132  0.556   -21.507 1.00 24.31 ? 76  ASP A O    2  
ATOM 6977   C CB   . ASP A 1 76  ? -6.101  2.772   -20.738 1.00 64.33 ? 76  ASP A CB   2  
ATOM 6978   C CG   . ASP A 1 76  ? -7.017  3.786   -21.396 1.00 13.33 ? 76  ASP A CG   2  
ATOM 6979   O OD1  . ASP A 1 76  ? -8.230  3.767   -21.104 1.00 32.51 ? 76  ASP A OD1  2  
ATOM 6980   O OD2  . ASP A 1 76  ? -6.519  4.599   -22.202 1.00 24.35 ? 76  ASP A OD2  2  
ATOM 6981   H H    . ASP A 1 76  ? -8.046  1.381   -19.910 1.00 2.11  ? 76  ASP A H    2  
ATOM 6982   H HA   . ASP A 1 76  ? -6.530  1.348   -22.277 1.00 43.24 ? 76  ASP A HA   2  
ATOM 6983   H HB2  . ASP A 1 76  ? -6.243  2.827   -19.669 1.00 34.35 ? 76  ASP A HB2  2  
ATOM 6984   H HB3  . ASP A 1 76  ? -5.079  3.029   -20.976 1.00 44.03 ? 76  ASP A HB3  2  
ATOM 6985   N N    . ASN A 1 77  ? -5.360  -0.446  -19.907 1.00 62.32 ? 77  ASN A N    2  
ATOM 6986   C CA   . ASN A 1 77  ? -4.298  -1.366  -19.507 1.00 62.54 ? 77  ASN A CA   2  
ATOM 6987   C C    . ASN A 1 77  ? -3.227  -0.652  -18.690 1.00 32.00 ? 77  ASN A C    2  
ATOM 6988   O O    . ASN A 1 77  ? -2.317  -0.032  -19.242 1.00 44.21 ? 77  ASN A O    2  
ATOM 6989   C CB   . ASN A 1 77  ? -3.663  -2.025  -20.737 1.00 33.12 ? 77  ASN A CB   2  
ATOM 6990   C CG   . ASN A 1 77  ? -3.348  -3.491  -20.508 1.00 54.33 ? 77  ASN A CG   2  
ATOM 6991   O OD1  . ASN A 1 77  ? -3.583  -4.331  -21.377 1.00 2.11  ? 77  ASN A OD1  2  
ATOM 6992   N ND2  . ASN A 1 77  ? -2.813  -3.805  -19.334 1.00 15.33 ? 77  ASN A ND2  2  
ATOM 6993   H H    . ASN A 1 77  ? -6.226  -0.494  -19.446 1.00 73.31 ? 77  ASN A H    2  
ATOM 6994   H HA   . ASN A 1 77  ? -4.744  -2.134  -18.894 1.00 51.24 ? 77  ASN A HA   2  
ATOM 6995   H HB2  . ASN A 1 77  ? -4.345  -1.949  -21.571 1.00 63.23 ? 77  ASN A HB2  2  
ATOM 6996   H HB3  . ASN A 1 77  ? -2.745  -1.511  -20.980 1.00 32.33 ? 77  ASN A HB3  2  
ATOM 6997   H HD21 . ASN A 1 77  ? -2.654  -3.084  -18.690 1.00 52.32 ? 77  ASN A HD21 2  
ATOM 6998   H HD22 . ASN A 1 77  ? -2.599  -4.746  -19.161 1.00 12.13 ? 77  ASN A HD22 2  
ATOM 6999   N N    . GLY A 1 78  ? -3.343  -0.748  -17.370 1.00 42.11 ? 78  GLY A N    2  
ATOM 7000   C CA   . GLY A 1 78  ? -2.381  -0.112  -16.488 1.00 75.24 ? 78  GLY A CA   2  
ATOM 7001   C C    . GLY A 1 78  ? -2.602  -0.484  -15.034 1.00 4.34  ? 78  GLY A C    2  
ATOM 7002   O O    . GLY A 1 78  ? -3.059  -1.589  -14.743 1.00 62.52 ? 78  GLY A O    2  
ATOM 7003   H H    . GLY A 1 78  ? -4.089  -1.255  -16.990 1.00 74.22 ? 78  GLY A H    2  
ATOM 7004   H HA2  . GLY A 1 78  ? -1.386  -0.413  -16.781 1.00 22.32 ? 78  GLY A HA2  2  
ATOM 7005   H HA3  . GLY A 1 78  ? -2.467  0.960   -16.592 1.00 23.33 ? 78  GLY A HA3  2  
ATOM 7006   N N    . PRO A 1 79  ? -2.285  0.425   -14.093 1.00 23.13 ? 79  PRO A N    2  
ATOM 7007   C CA   . PRO A 1 79  ? -2.453  0.187   -12.659 1.00 44.52 ? 79  PRO A CA   2  
ATOM 7008   C C    . PRO A 1 79  ? -3.673  -0.672  -12.330 1.00 55.25 ? 79  PRO A C    2  
ATOM 7009   O O    . PRO A 1 79  ? -3.627  -1.512  -11.432 1.00 23.15 ? 79  PRO A O    2  
ATOM 7010   C CB   . PRO A 1 79  ? -2.633  1.600   -12.115 1.00 13.23 ? 79  PRO A CB   2  
ATOM 7011   C CG   . PRO A 1 79  ? -1.811  2.465   -13.014 1.00 15.22 ? 79  PRO A CG   2  
ATOM 7012   C CD   . PRO A 1 79  ? -1.729  1.766   -14.352 1.00 13.31 ? 79  PRO A CD   2  
ATOM 7013   H HA   . PRO A 1 79  ? -1.570  -0.258  -12.224 1.00 65.11 ? 79  PRO A HA   2  
ATOM 7014   H HB2  . PRO A 1 79  ? -3.678  1.871   -12.151 1.00 64.51 ? 79  PRO A HB2  2  
ATOM 7015   H HB3  . PRO A 1 79  ? -2.279  1.643   -11.096 1.00 51.43 ? 79  PRO A HB3  2  
ATOM 7016   H HG2  . PRO A 1 79  ? -2.287  3.427   -13.127 1.00 4.31  ? 79  PRO A HG2  2  
ATOM 7017   H HG3  . PRO A 1 79  ? -0.823  2.587   -12.597 1.00 65.21 ? 79  PRO A HG3  2  
ATOM 7018   H HD2  . PRO A 1 79  ? -2.322  2.290   -15.087 1.00 34.22 ? 79  PRO A HD2  2  
ATOM 7019   H HD3  . PRO A 1 79  ? -0.700  1.698   -14.676 1.00 71.11 ? 79  PRO A HD3  2  
ATOM 7020   N N    . LEU A 1 80  ? -4.760  -0.462  -13.066 1.00 15.42 ? 80  LEU A N    2  
ATOM 7021   C CA   . LEU A 1 80  ? -5.985  -1.224  -12.848 1.00 1.43  ? 80  LEU A CA   2  
ATOM 7022   C C    . LEU A 1 80  ? -5.744  -2.709  -13.092 1.00 3.43  ? 80  LEU A C    2  
ATOM 7023   O O    . LEU A 1 80  ? -6.068  -3.548  -12.250 1.00 55.10 ? 80  LEU A O    2  
ATOM 7024   C CB   . LEU A 1 80  ? -7.100  -0.720  -13.766 1.00 52.22 ? 80  LEU A CB   2  
ATOM 7025   C CG   . LEU A 1 80  ? -8.417  -1.494  -13.667 1.00 72.44 ? 80  LEU A CG   2  
ATOM 7026   C CD1  . LEU A 1 80  ? -9.208  -1.045  -12.449 1.00 64.33 ? 80  LEU A CD1  2  
ATOM 7027   C CD2  . LEU A 1 80  ? -9.237  -1.316  -14.935 1.00 13.14 ? 80  LEU A CD2  2  
ATOM 7028   H H    . LEU A 1 80  ? -4.739  0.217   -13.773 1.00 2.53  ? 80  LEU A H    2  
ATOM 7029   H HA   . LEU A 1 80  ? -6.285  -1.083  -11.821 1.00 50.44 ? 80  LEU A HA   2  
ATOM 7030   H HB2  . LEU A 1 80  ? -7.295  0.315   -13.526 1.00 61.34 ? 80  LEU A HB2  2  
ATOM 7031   H HB3  . LEU A 1 80  ? -6.752  -0.776  -14.787 1.00 61.11 ? 80  LEU A HB3  2  
ATOM 7032   H HG   . LEU A 1 80  ? -8.199  -2.546  -13.553 1.00 53.35 ? 80  LEU A HG   2  
ATOM 7033   H HD11 . LEU A 1 80  ? -10.232 -1.372  -12.544 1.00 73.24 ? 80  LEU A HD11 2  
ATOM 7034   H HD12 . LEU A 1 80  ? -9.179  0.032   -12.378 1.00 43.10 ? 80  LEU A HD12 2  
ATOM 7035   H HD13 . LEU A 1 80  ? -8.773  -1.475  -11.558 1.00 53.11 ? 80  LEU A HD13 2  
ATOM 7036   H HD21 . LEU A 1 80  ? -10.288 -1.301  -14.685 1.00 43.04 ? 80  LEU A HD21 2  
ATOM 7037   H HD22 . LEU A 1 80  ? -9.040  -2.136  -15.610 1.00 14.31 ? 80  LEU A HD22 2  
ATOM 7038   H HD23 . LEU A 1 80  ? -8.967  -0.385  -15.411 1.00 50.55 ? 80  LEU A HD23 2  
ATOM 7039   N N    . PHE A 1 81  ? -5.167  -3.026  -14.246 1.00 61.34 ? 81  PHE A N    2  
ATOM 7040   C CA   . PHE A 1 81  ? -4.874  -4.410  -14.598 1.00 40.34 ? 81  PHE A CA   2  
ATOM 7041   C C    . PHE A 1 81  ? -3.869  -5.012  -13.621 1.00 21.15 ? 81  PHE A C    2  
ATOM 7042   O O    . PHE A 1 81  ? -3.821  -6.228  -13.433 1.00 1.02  ? 81  PHE A O    2  
ATOM 7043   C CB   . PHE A 1 81  ? -4.330  -4.492  -16.025 1.00 10.41 ? 81  PHE A CB   2  
ATOM 7044   C CG   . PHE A 1 81  ? -4.185  -5.899  -16.533 1.00 4.20  ? 81  PHE A CG   2  
ATOM 7045   C CD1  . PHE A 1 81  ? -5.257  -6.549  -17.125 1.00 55.10 ? 81  PHE A CD1  2  
ATOM 7046   C CD2  . PHE A 1 81  ? -2.979  -6.570  -16.417 1.00 1.32  ? 81  PHE A CD2  2  
ATOM 7047   C CE1  . PHE A 1 81  ? -5.127  -7.842  -17.592 1.00 3.55  ? 81  PHE A CE1  2  
ATOM 7048   C CE2  . PHE A 1 81  ? -2.843  -7.864  -16.884 1.00 13.50 ? 81  PHE A CE2  2  
ATOM 7049   C CZ   . PHE A 1 81  ? -3.919  -8.501  -17.472 1.00 2.13  ? 81  PHE A CZ   2  
ATOM 7050   H H    . PHE A 1 81  ? -4.927  -2.311  -14.871 1.00 74.54 ? 81  PHE A H    2  
ATOM 7051   H HA   . PHE A 1 81  ? -5.796  -4.970  -14.540 1.00 53.30 ? 81  PHE A HA   2  
ATOM 7052   H HB2  . PHE A 1 81  ? -4.999  -3.967  -16.690 1.00 73.43 ? 81  PHE A HB2  2  
ATOM 7053   H HB3  . PHE A 1 81  ? -3.357  -4.023  -16.059 1.00 51.42 ? 81  PHE A HB3  2  
ATOM 7054   H HD1  . PHE A 1 81  ? -6.202  -6.035  -17.220 1.00 3.52  ? 81  PHE A HD1  2  
ATOM 7055   H HD2  . PHE A 1 81  ? -2.138  -6.073  -15.957 1.00 21.34 ? 81  PHE A HD2  2  
ATOM 7056   H HE1  . PHE A 1 81  ? -5.969  -8.338  -18.052 1.00 11.02 ? 81  PHE A HE1  2  
ATOM 7057   H HE2  . PHE A 1 81  ? -1.897  -8.377  -16.788 1.00 30.04 ? 81  PHE A HE2  2  
ATOM 7058   H HZ   . PHE A 1 81  ? -3.815  -9.512  -17.837 1.00 13.43 ? 81  PHE A HZ   2  
ATOM 7059   N N    . THR A 1 82  ? -3.070  -4.151  -12.999 1.00 53.53 ? 82  THR A N    2  
ATOM 7060   C CA   . THR A 1 82  ? -2.066  -4.591  -12.039 1.00 22.10 ? 82  THR A CA   2  
ATOM 7061   C C    . THR A 1 82  ? -2.722  -5.099  -10.759 1.00 53.13 ? 82  THR A C    2  
ATOM 7062   O O    . THR A 1 82  ? -2.472  -6.224  -10.326 1.00 13.14 ? 82  THR A O    2  
ATOM 7063   C CB   . THR A 1 82  ? -1.104  -3.449  -11.717 1.00 14.44 ? 82  THR A CB   2  
ATOM 7064   O OG1  . THR A 1 82  ? -1.212  -2.418  -12.682 1.00 24.22 ? 82  THR A OG1  2  
ATOM 7065   C CG2  . THR A 1 82  ? 0.343   -3.891  -11.671 1.00 3.03  ? 82  THR A CG2  2  
ATOM 7066   H H    . THR A 1 82  ? -3.157  -3.194  -13.190 1.00 34.31 ? 82  THR A H    2  
ATOM 7067   H HA   . THR A 1 82  ? -1.509  -5.397  -12.488 1.00 24.43 ? 82  THR A HA   2  
ATOM 7068   H HB   . THR A 1 82  ? -1.357  -3.039  -10.752 1.00 53.13 ? 82  THR A HB   2  
ATOM 7069   H HG1  . THR A 1 82  ? -1.168  -2.797  -13.563 1.00 11.32 ? 82  THR A HG1  2  
ATOM 7070   H HG21 . THR A 1 82  ? 0.720   -3.995  -12.678 1.00 64.11 ? 82  THR A HG21 2  
ATOM 7071   H HG22 . THR A 1 82  ? 0.412   -4.840  -11.161 1.00 74.13 ? 82  THR A HG22 2  
ATOM 7072   H HG23 . THR A 1 82  ? 0.926   -3.153  -11.140 1.00 73.22 ? 82  THR A HG23 2  
ATOM 7073   N N    . GLU A 1 83  ? -3.563  -4.263  -10.159 1.00 41.34 ? 83  GLU A N    2  
ATOM 7074   C CA   . GLU A 1 83  ? -4.257  -4.627  -8.928  1.00 73.10 ? 83  GLU A CA   2  
ATOM 7075   C C    . GLU A 1 83  ? -5.069  -5.903  -9.123  1.00 64.20 ? 83  GLU A C    2  
ATOM 7076   O O    . GLU A 1 83  ? -5.187  -6.725  -8.213  1.00 60.21 ? 83  GLU A O    2  
ATOM 7077   C CB   . GLU A 1 83  ? -5.176  -3.488  -8.480  1.00 31.54 ? 83  GLU A CB   2  
ATOM 7078   C CG   . GLU A 1 83  ? -5.488  -3.509  -6.992  1.00 43.42 ? 83  GLU A CG   2  
ATOM 7079   C CD   . GLU A 1 83  ? -6.897  -3.987  -6.700  1.00 41.41 ? 83  GLU A CD   2  
ATOM 7080   O OE1  . GLU A 1 83  ? -7.171  -5.188  -6.902  1.00 2.54  ? 83  GLU A OE1  2  
ATOM 7081   O OE2  . GLU A 1 83  ? -7.727  -3.159  -6.267  1.00 33.35 ? 83  GLU A OE2  2  
ATOM 7082   H H    . GLU A 1 83  ? -3.721  -3.380  -10.552 1.00 43.12 ? 83  GLU A H    2  
ATOM 7083   H HA   . GLU A 1 83  ? -3.511  -4.798  -8.164  1.00 54.33 ? 83  GLU A HA   2  
ATOM 7084   H HB2  . GLU A 1 83  ? -4.702  -2.547  -8.713  1.00 71.31 ? 83  GLU A HB2  2  
ATOM 7085   H HB3  . GLU A 1 83  ? -6.106  -3.557  -9.023  1.00 63.32 ? 83  GLU A HB3  2  
ATOM 7086   H HG2  . GLU A 1 83  ? -4.791  -4.171  -6.500  1.00 52.05 ? 83  GLU A HG2  2  
ATOM 7087   H HG3  . GLU A 1 83  ? -5.373  -2.510  -6.599  1.00 51.12 ? 83  GLU A HG3  2  
ATOM 7088   N N    . LEU A 1 84  ? -5.626  -6.062  -10.319 1.00 3.14  ? 84  LEU A N    2  
ATOM 7089   C CA   . LEU A 1 84  ? -6.428  -7.235  -10.643 1.00 11.40 ? 84  LEU A CA   2  
ATOM 7090   C C    . LEU A 1 84  ? -5.569  -8.496  -10.650 1.00 2.02  ? 84  LEU A C    2  
ATOM 7091   O O    . LEU A 1 84  ? -5.968  -9.535  -10.125 1.00 43.11 ? 84  LEU A O    2  
ATOM 7092   C CB   . LEU A 1 84  ? -7.102  -7.058  -12.006 1.00 41.04 ? 84  LEU A CB   2  
ATOM 7093   C CG   . LEU A 1 84  ? -8.135  -8.129  -12.362 1.00 43.14 ? 84  LEU A CG   2  
ATOM 7094   C CD1  . LEU A 1 84  ? -9.066  -7.628  -13.455 1.00 34.34 ? 84  LEU A CD1  2  
ATOM 7095   C CD2  . LEU A 1 84  ? -7.443  -9.412  -12.796 1.00 73.24 ? 84  LEU A CD2  2  
ATOM 7096   H H    . LEU A 1 84  ? -5.493  -5.370  -11.001 1.00 40.01 ? 84  LEU A H    2  
ATOM 7097   H HA   . LEU A 1 84  ? -7.189  -7.337  -9.884  1.00 34.43 ? 84  LEU A HA   2  
ATOM 7098   H HB2  . LEU A 1 84  ? -7.592  -6.095  -12.017 1.00 23.12 ? 84  LEU A HB2  2  
ATOM 7099   H HB3  . LEU A 1 84  ? -6.335  -7.062  -12.766 1.00 12.32 ? 84  LEU A HB3  2  
ATOM 7100   H HG   . LEU A 1 84  ? -8.732  -8.348  -11.489 1.00 43.01 ? 84  LEU A HG   2  
ATOM 7101   H HD11 . LEU A 1 84  ? -9.896  -7.101  -13.007 1.00 41.42 ? 84  LEU A HD11 2  
ATOM 7102   H HD12 . LEU A 1 84  ? -9.437  -8.468  -14.024 1.00 14.34 ? 84  LEU A HD12 2  
ATOM 7103   H HD13 . LEU A 1 84  ? -8.527  -6.960  -14.110 1.00 21.30 ? 84  LEU A HD13 2  
ATOM 7104   H HD21 . LEU A 1 84  ? -7.256  -10.030 -11.931 1.00 71.10 ? 84  LEU A HD21 2  
ATOM 7105   H HD22 . LEU A 1 84  ? -6.506  -9.172  -13.275 1.00 45.14 ? 84  LEU A HD22 2  
ATOM 7106   H HD23 . LEU A 1 84  ? -8.076  -9.946  -13.490 1.00 54.12 ? 84  LEU A HD23 2  
ATOM 7107   N N    . LYS A 1 85  ? -4.387  -8.396  -11.250 1.00 22.42 ? 85  LYS A N    2  
ATOM 7108   C CA   . LYS A 1 85  ? -3.471  -9.529  -11.326 1.00 62.21 ? 85  LYS A CA   2  
ATOM 7109   C C    . LYS A 1 85  ? -2.876  -9.841  -9.958  1.00 31.32 ? 85  LYS A C    2  
ATOM 7110   O O    . LYS A 1 85  ? -2.614  -11.000 -9.634  1.00 43.31 ? 85  LYS A O    2  
ATOM 7111   C CB   . LYS A 1 85  ? -2.352  -9.238  -12.328 1.00 42.14 ? 85  LYS A CB   2  
ATOM 7112   C CG   . LYS A 1 85  ? -1.926  -10.454 -13.135 1.00 53.11 ? 85  LYS A CG   2  
ATOM 7113   C CD   . LYS A 1 85  ? -1.185  -10.051 -14.399 1.00 13.30 ? 85  LYS A CD   2  
ATOM 7114   C CE   . LYS A 1 85  ? 0.321   -10.157 -14.220 1.00 3.31  ? 85  LYS A CE   2  
ATOM 7115   N NZ   . LYS A 1 85  ? 0.923   -8.864  -13.794 1.00 51.03 ? 85  LYS A NZ   2  
ATOM 7116   H H    . LYS A 1 85  ? -4.125  -7.542  -11.651 1.00 70.23 ? 85  LYS A H    2  
ATOM 7117   H HA   . LYS A 1 85  ? -4.032  -10.385 -11.667 1.00 73.03 ? 85  LYS A HA   2  
ATOM 7118   H HB2  . LYS A 1 85  ? -2.689  -8.476  -13.016 1.00 21.23 ? 85  LYS A HB2  2  
ATOM 7119   H HB3  . LYS A 1 85  ? -1.490  -8.869  -11.791 1.00 34.33 ? 85  LYS A HB3  2  
ATOM 7120   H HG2  . LYS A 1 85  ? -1.277  -11.067 -12.528 1.00 20.52 ? 85  LYS A HG2  2  
ATOM 7121   H HG3  . LYS A 1 85  ? -2.806  -11.018 -13.408 1.00 40.40 ? 85  LYS A HG3  2  
ATOM 7122   H HD2  . LYS A 1 85  ? -1.487  -10.703 -15.206 1.00 13.02 ? 85  LYS A HD2  2  
ATOM 7123   H HD3  . LYS A 1 85  ? -1.438  -9.030  -14.645 1.00 22.33 ? 85  LYS A HD3  2  
ATOM 7124   H HE2  . LYS A 1 85  ? 0.530   -10.905 -13.469 1.00 13.22 ? 85  LYS A HE2  2  
ATOM 7125   H HE3  . LYS A 1 85  ? 0.763   -10.458 -15.159 1.00 70.23 ? 85  LYS A HE3  2  
ATOM 7126   H HZ1  . LYS A 1 85  ? 1.289   -8.350  -14.621 1.00 23.22 ? 85  LYS A HZ1  2  
ATOM 7127   H HZ2  . LYS A 1 85  ? 1.705   -9.034  -13.130 1.00 23.20 ? 85  LYS A HZ2  2  
ATOM 7128   H HZ3  . LYS A 1 85  ? 0.206   -8.275  -13.323 1.00 72.43 ? 85  LYS A HZ3  2  
ATOM 7129   N N    . PHE A 1 86  ? -2.666  -8.801  -9.157  1.00 44.24 ? 86  PHE A N    2  
ATOM 7130   C CA   . PHE A 1 86  ? -2.102  -8.967  -7.822  1.00 34.15 ? 86  PHE A CA   2  
ATOM 7131   C C    . PHE A 1 86  ? -3.095  -9.659  -6.893  1.00 5.23  ? 86  PHE A C    2  
ATOM 7132   O O    . PHE A 1 86  ? -2.708  -10.448 -6.033  1.00 41.30 ? 86  PHE A O    2  
ATOM 7133   C CB   . PHE A 1 86  ? -1.703  -7.610  -7.243  1.00 30.13 ? 86  PHE A CB   2  
ATOM 7134   C CG   . PHE A 1 86  ? -0.514  -7.675  -6.327  1.00 43.13 ? 86  PHE A CG   2  
ATOM 7135   C CD1  . PHE A 1 86  ? 0.761   -7.855  -6.838  1.00 25.50 ? 86  PHE A CD1  2  
ATOM 7136   C CD2  . PHE A 1 86  ? -0.672  -7.556  -4.955  1.00 21.34 ? 86  PHE A CD2  2  
ATOM 7137   C CE1  . PHE A 1 86  ? 1.857   -7.916  -5.997  1.00 70.32 ? 86  PHE A CE1  2  
ATOM 7138   C CE2  . PHE A 1 86  ? 0.420   -7.616  -4.111  1.00 21.02 ? 86  PHE A CE2  2  
ATOM 7139   C CZ   . PHE A 1 86  ? 1.686   -7.796  -4.633  1.00 64.32 ? 86  PHE A CZ   2  
ATOM 7140   H H    . PHE A 1 86  ? -2.896  -7.902  -9.471  1.00 11.42 ? 86  PHE A H    2  
ATOM 7141   H HA   . PHE A 1 86  ? -1.221  -9.584  -7.910  1.00 63.40 ? 86  PHE A HA   2  
ATOM 7142   H HB2  . PHE A 1 86  ? -1.462  -6.936  -8.052  1.00 62.13 ? 86  PHE A HB2  2  
ATOM 7143   H HB3  . PHE A 1 86  ? -2.534  -7.207  -6.682  1.00 25.11 ? 86  PHE A HB3  2  
ATOM 7144   H HD1  . PHE A 1 86  ? 0.896   -7.949  -7.905  1.00 22.21 ? 86  PHE A HD1  2  
ATOM 7145   H HD2  . PHE A 1 86  ? -1.662  -7.415  -4.547  1.00 51.12 ? 86  PHE A HD2  2  
ATOM 7146   H HE1  . PHE A 1 86  ? 2.847   -8.057  -6.408  1.00 33.33 ? 86  PHE A HE1  2  
ATOM 7147   H HE2  . PHE A 1 86  ? 0.283   -7.522  -3.043  1.00 71.22 ? 86  PHE A HE2  2  
ATOM 7148   H HZ   . PHE A 1 86  ? 2.541   -7.844  -3.974  1.00 2.00  ? 86  PHE A HZ   2  
ATOM 7149   N N    . TYR A 1 87  ? -4.376  -9.354  -7.073  1.00 50.13 ? 87  TYR A N    2  
ATOM 7150   C CA   . TYR A 1 87  ? -5.424  -9.946  -6.248  1.00 34.31 ? 87  TYR A CA   2  
ATOM 7151   C C    . TYR A 1 87  ? -5.651  -11.408 -6.618  1.00 74.41 ? 87  TYR A C    2  
ATOM 7152   O O    . TYR A 1 87  ? -5.699  -12.279 -5.749  1.00 73.52 ? 87  TYR A O    2  
ATOM 7153   C CB   . TYR A 1 87  ? -6.728  -9.160  -6.405  1.00 32.30 ? 87  TYR A CB   2  
ATOM 7154   C CG   . TYR A 1 87  ? -6.832  -7.969  -5.479  1.00 20.41 ? 87  TYR A CG   2  
ATOM 7155   C CD1  . TYR A 1 87  ? -5.805  -7.037  -5.397  1.00 54.22 ? 87  TYR A CD1  2  
ATOM 7156   C CD2  . TYR A 1 87  ? -7.957  -7.776  -4.688  1.00 64.32 ? 87  TYR A CD2  2  
ATOM 7157   C CE1  . TYR A 1 87  ? -5.896  -5.947  -4.553  1.00 64.21 ? 87  TYR A CE1  2  
ATOM 7158   C CE2  . TYR A 1 87  ? -8.056  -6.688  -3.842  1.00 34.50 ? 87  TYR A CE2  2  
ATOM 7159   C CZ   . TYR A 1 87  ? -7.024  -5.777  -3.778  1.00 13.12 ? 87  TYR A CZ   2  
ATOM 7160   O OH   . TYR A 1 87  ? -7.118  -4.692  -2.935  1.00 51.00 ? 87  TYR A OH   2  
ATOM 7161   H H    . TYR A 1 87  ? -4.621  -8.714  -7.773  1.00 34.43 ? 87  TYR A H    2  
ATOM 7162   H HA   . TYR A 1 87  ? -5.105  -9.893  -5.218  1.00 23.50 ? 87  TYR A HA   2  
ATOM 7163   H HB2  . TYR A 1 87  ? -6.803  -8.799  -7.419  1.00 64.44 ? 87  TYR A HB2  2  
ATOM 7164   H HB3  . TYR A 1 87  ? -7.561  -9.815  -6.198  1.00 33.42 ? 87  TYR A HB3  2  
ATOM 7165   H HD1  . TYR A 1 87  ? -4.924  -7.173  -6.007  1.00 54.33 ? 87  TYR A HD1  2  
ATOM 7166   H HD2  . TYR A 1 87  ? -8.765  -8.491  -4.740  1.00 1.14  ? 87  TYR A HD2  2  
ATOM 7167   H HE1  . TYR A 1 87  ? -5.087  -5.233  -4.504  1.00 11.02 ? 87  TYR A HE1  2  
ATOM 7168   H HE2  . TYR A 1 87  ? -8.939  -6.556  -3.234  1.00 12.30 ? 87  TYR A HE2  2  
ATOM 7169   H HH   . TYR A 1 87  ? -8.017  -4.353  -2.949  1.00 3.40  ? 87  TYR A HH   2  
ATOM 7170   N N    . GLN A 1 88  ? -5.795  -11.671 -7.912  1.00 54.40 ? 88  GLN A N    2  
ATOM 7171   C CA   . GLN A 1 88  ? -6.020  -13.028 -8.398  1.00 65.42 ? 88  GLN A CA   2  
ATOM 7172   C C    . GLN A 1 88  ? -4.788  -13.908 -8.196  1.00 41.33 ? 88  GLN A C    2  
ATOM 7173   O O    . GLN A 1 88  ? -4.869  -15.133 -8.291  1.00 60.30 ? 88  GLN A O    2  
ATOM 7174   C CB   . GLN A 1 88  ? -6.401  -13.002 -9.879  1.00 53.12 ? 88  GLN A CB   2  
ATOM 7175   C CG   . GLN A 1 88  ? -7.377  -14.098 -10.277 1.00 23.35 ? 88  GLN A CG   2  
ATOM 7176   C CD   . GLN A 1 88  ? -6.872  -14.939 -11.433 1.00 21.45 ? 88  GLN A CD   2  
ATOM 7177   O OE1  . GLN A 1 88  ? -7.341  -14.806 -12.564 1.00 23.21 ? 88  GLN A OE1  2  
ATOM 7178   N NE2  . GLN A 1 88  ? -5.911  -15.812 -11.155 1.00 1.52  ? 88  GLN A NE2  2  
ATOM 7179   H H    . GLN A 1 88  ? -5.752  -10.936 -8.559  1.00 21.34 ? 88  GLN A H    2  
ATOM 7180   H HA   . GLN A 1 88  ? -6.841  -13.447 -7.835  1.00 41.11 ? 88  GLN A HA   2  
ATOM 7181   H HB2  . GLN A 1 88  ? -6.853  -12.047 -10.106 1.00 41.03 ? 88  GLN A HB2  2  
ATOM 7182   H HB3  . GLN A 1 88  ? -5.505  -13.115 -10.472 1.00 3.52  ? 88  GLN A HB3  2  
ATOM 7183   H HG2  . GLN A 1 88  ? -7.538  -14.744 -9.427  1.00 5.01  ? 88  GLN A HG2  2  
ATOM 7184   H HG3  . GLN A 1 88  ? -8.313  -13.642 -10.564 1.00 4.12  ? 88  GLN A HG3  2  
ATOM 7185   H HE21 . GLN A 1 88  ? -5.585  -15.864 -10.232 1.00 73.02 ? 88  GLN A HE21 2  
ATOM 7186   H HE22 . GLN A 1 88  ? -5.565  -16.369 -11.884 1.00 34.23 ? 88  GLN A HE22 2  
ATOM 7187   N N    . ARG A 1 89  ? -3.646  -13.284 -7.919  1.00 74.14 ? 89  ARG A N    2  
ATOM 7188   C CA   . ARG A 1 89  ? -2.406  -14.023 -7.710  1.00 62.44 ? 89  ARG A CA   2  
ATOM 7189   C C    . ARG A 1 89  ? -2.024  -14.057 -6.233  1.00 60.34 ? 89  ARG A C    2  
ATOM 7190   O O    . ARG A 1 89  ? -1.619  -15.096 -5.712  1.00 64.13 ? 89  ARG A O    2  
ATOM 7191   C CB   . ARG A 1 89  ? -1.272  -13.401 -8.527  1.00 52.33 ? 89  ARG A CB   2  
ATOM 7192   C CG   . ARG A 1 89  ? -1.351  -13.713 -10.013 1.00 33.33 ? 89  ARG A CG   2  
ATOM 7193   C CD   . ARG A 1 89  ? 0.009   -14.094 -10.578 1.00 44.03 ? 89  ARG A CD   2  
ATOM 7194   N NE   . ARG A 1 89  ? -0.109  -14.839 -11.830 1.00 72.21 ? 89  ARG A NE   2  
ATOM 7195   C CZ   . ARG A 1 89  ? 0.881   -15.551 -12.363 1.00 65.45 ? 89  ARG A CZ   2  
ATOM 7196   N NH1  . ARG A 1 89  ? 2.061   -15.619 -11.760 1.00 72.22 ? 89  ARG A NH1  2  
ATOM 7197   N NH2  . ARG A 1 89  ? 0.689   -16.200 -13.505 1.00 43.02 ? 89  ARG A NH2  2  
ATOM 7198   H H    . ARG A 1 89  ? -3.636  -12.306 -7.854  1.00 14.41 ? 89  ARG A H    2  
ATOM 7199   H HA   . ARG A 1 89  ? -2.564  -15.035 -8.049  1.00 44.23 ? 89  ARG A HA   2  
ATOM 7200   H HB2  . ARG A 1 89  ? -1.302  -12.328 -8.404  1.00 42.45 ? 89  ARG A HB2  2  
ATOM 7201   H HB3  . ARG A 1 89  ? -0.329  -13.771 -8.153  1.00 43.31 ? 89  ARG A HB3  2  
ATOM 7202   H HG2  . ARG A 1 89  ? -2.034  -14.535 -10.162 1.00 65.42 ? 89  ARG A HG2  2  
ATOM 7203   H HG3  . ARG A 1 89  ? -1.715  -12.841 -10.535 1.00 62.10 ? 89  ARG A HG3  2  
ATOM 7204   H HD2  . ARG A 1 89  ? 0.575   -13.193 -10.759 1.00 33.13 ? 89  ARG A HD2  2  
ATOM 7205   H HD3  . ARG A 1 89  ? 0.527   -14.704 -9.853  1.00 11.15 ? 89  ARG A HD3  2  
ATOM 7206   H HE   . ARG A 1 89  ? -0.969  -14.807 -12.296 1.00 41.41 ? 89  ARG A HE   2  
ATOM 7207   H HH11 . ARG A 1 89  ? 2.212   -15.133 -10.899 1.00 52.20 ? 89  ARG A HH11 2  
ATOM 7208   H HH12 . ARG A 1 89  ? 2.800   -16.156 -12.167 1.00 22.14 ? 89  ARG A HH12 2  
ATOM 7209   H HH21 . ARG A 1 89  ? -0.197  -16.152 -13.964 1.00 23.30 ? 89  ARG A HH21 2  
ATOM 7210   H HH22 . ARG A 1 89  ? 1.433   -16.735 -13.906 1.00 70.22 ? 89  ARG A HH22 2  
ATOM 7211   N N    . ALA A 1 90  ? -2.153  -12.916 -5.566  1.00 74.03 ? 90  ALA A N    2  
ATOM 7212   C CA   . ALA A 1 90  ? -1.819  -12.819 -4.149  1.00 33.41 ? 90  ALA A CA   2  
ATOM 7213   C C    . ALA A 1 90  ? -3.062  -12.956 -3.278  1.00 0.43  ? 90  ALA A C    2  
ATOM 7214   O O    . ALA A 1 90  ? -3.033  -13.617 -2.239  1.00 10.54 ? 90  ALA A O    2  
ATOM 7215   C CB   . ALA A 1 90  ? -1.116  -11.500 -3.865  1.00 63.41 ? 90  ALA A CB   2  
ATOM 7216   H H    . ALA A 1 90  ? -2.481  -12.121 -6.035  1.00 3.04  ? 90  ALA A H    2  
ATOM 7217   H HA   . ALA A 1 90  ? -1.135  -13.621 -3.914  1.00 75.41 ? 90  ALA A HA   2  
ATOM 7218   H HB1  . ALA A 1 90  ? -0.692  -11.113 -4.779  1.00 12.11 ? 90  ALA A HB1  2  
ATOM 7219   H HB2  . ALA A 1 90  ? -0.329  -11.660 -3.142  1.00 53.12 ? 90  ALA A HB2  2  
ATOM 7220   H HB3  . ALA A 1 90  ? -1.829  -10.791 -3.470  1.00 33.00 ? 90  ALA A HB3  2  
ATOM 7221   N N    . ALA A 1 91  ? -4.151  -12.326 -3.704  1.00 24.12 ? 91  ALA A N    2  
ATOM 7222   C CA   . ALA A 1 91  ? -5.404  -12.375 -2.960  1.00 44.22 ? 91  ALA A CA   2  
ATOM 7223   C C    . ALA A 1 91  ? -6.247  -13.580 -3.369  1.00 41.11 ? 91  ALA A C    2  
ATOM 7224   O O    . ALA A 1 91  ? -7.436  -13.449 -3.664  1.00 0.24  ? 91  ALA A O    2  
ATOM 7225   C CB   . ALA A 1 91  ? -6.186  -11.086 -3.163  1.00 74.22 ? 91  ALA A CB   2  
ATOM 7226   H H    . ALA A 1 91  ? -4.109  -11.812 -4.537  1.00 12.23 ? 91  ALA A H    2  
ATOM 7227   H HA   . ALA A 1 91  ? -5.163  -12.458 -1.909  1.00 54.20 ? 91  ALA A HA   2  
ATOM 7228   H HB1  . ALA A 1 91  ? -5.498  -10.263 -3.288  1.00 53.22 ? 91  ALA A HB1  2  
ATOM 7229   H HB2  . ALA A 1 91  ? -6.813  -10.905 -2.303  1.00 13.12 ? 91  ALA A HB2  2  
ATOM 7230   H HB3  . ALA A 1 91  ? -6.803  -11.175 -4.046  1.00 4.40  ? 91  ALA A HB3  2  
ATOM 7231   N N    . LYS A 1 92  ? -5.625  -14.755 -3.380  1.00 64.13 ? 92  LYS A N    2  
ATOM 7232   C CA   . LYS A 1 92  ? -6.320  -15.983 -3.750  1.00 63.51 ? 92  LYS A CA   2  
ATOM 7233   C C    . LYS A 1 92  ? -6.878  -16.682 -2.512  1.00 41.42 ? 92  LYS A C    2  
ATOM 7234   O O    . LYS A 1 92  ? -6.335  -16.546 -1.415  1.00 74.14 ? 92  LYS A O    2  
ATOM 7235   C CB   . LYS A 1 92  ? -5.374  -16.923 -4.500  1.00 0.22  ? 92  LYS A CB   2  
ATOM 7236   C CG   . LYS A 1 92  ? -5.482  -16.813 -6.014  1.00 14.04 ? 92  LYS A CG   2  
ATOM 7237   C CD   . LYS A 1 92  ? -6.020  -18.095 -6.632  1.00 73.32 ? 92  LYS A CD   2  
ATOM 7238   C CE   . LYS A 1 92  ? -7.001  -17.802 -7.755  1.00 1.32  ? 92  LYS A CE   2  
ATOM 7239   N NZ   . LYS A 1 92  ? -6.368  -17.937 -9.096  1.00 0.11  ? 92  LYS A NZ   2  
ATOM 7240   H H    . LYS A 1 92  ? -4.679  -14.799 -3.132  1.00 4.32  ? 92  LYS A H    2  
ATOM 7241   H HA   . LYS A 1 92  ? -7.141  -15.718 -4.398  1.00 31.02 ? 92  LYS A HA   2  
ATOM 7242   H HB2  . LYS A 1 92  ? -4.357  -16.693 -4.216  1.00 53.33 ? 92  LYS A HB2  2  
ATOM 7243   H HB3  . LYS A 1 92  ? -5.596  -17.941 -4.217  1.00 23.41 ? 92  LYS A HB3  2  
ATOM 7244   H HG2  . LYS A 1 92  ? -6.149  -16.000 -6.259  1.00 22.35 ? 92  LYS A HG2  2  
ATOM 7245   H HG3  . LYS A 1 92  ? -4.502  -16.612 -6.420  1.00 10.13 ? 92  LYS A HG3  2  
ATOM 7246   H HD2  . LYS A 1 92  ? -5.194  -18.665 -7.029  1.00 4.24  ? 92  LYS A HD2  2  
ATOM 7247   H HD3  . LYS A 1 92  ? -6.523  -18.668 -5.867  1.00 14.53 ? 92  LYS A HD3  2  
ATOM 7248   H HE2  . LYS A 1 92  ? -7.825  -18.497 -7.687  1.00 55.22 ? 92  LYS A HE2  2  
ATOM 7249   H HE3  . LYS A 1 92  ? -7.371  -16.794 -7.641  1.00 35.50 ? 92  LYS A HE3  2  
ATOM 7250   H HZ1  . LYS A 1 92  ? -6.953  -17.468 -9.817  1.00 31.42 ? 92  LYS A HZ1  2  
ATOM 7251   H HZ2  . LYS A 1 92  ? -6.269  -18.940 -9.347  1.00 64.15 ? 92  LYS A HZ2  2  
ATOM 7252   H HZ3  . LYS A 1 92  ? -5.424  -17.498 -9.091  1.00 42.34 ? 92  LYS A HZ3  2  
ATOM 7253   N N    . PRO A 1 93  ? -7.974  -17.444 -2.672  1.00 53.53 ? 93  PRO A N    2  
ATOM 7254   C CA   . PRO A 1 93  ? -8.604  -18.165 -1.560  1.00 63.23 ? 93  PRO A CA   2  
ATOM 7255   C C    . PRO A 1 93  ? -7.734  -19.304 -1.041  1.00 3.10  ? 93  PRO A C    2  
ATOM 7256   O O    . PRO A 1 93  ? -7.751  -19.619 0.150   1.00 22.11 ? 93  PRO A O    2  
ATOM 7257   C CB   . PRO A 1 93  ? -9.894  -18.714 -2.174  1.00 24.11 ? 93  PRO A CB   2  
ATOM 7258   C CG   . PRO A 1 93  ? -9.612  -18.802 -3.634  1.00 24.25 ? 93  PRO A CG   2  
ATOM 7259   C CD   . PRO A 1 93  ? -8.685  -17.661 -3.946  1.00 35.33 ? 93  PRO A CD   2  
ATOM 7260   H HA   . PRO A 1 93  ? -8.844  -17.498 -0.745  1.00 13.50 ? 93  PRO A HA   2  
ATOM 7261   H HB2  . PRO A 1 93  ? -10.111 -19.684 -1.753  1.00 44.33 ? 93  PRO A HB2  2  
ATOM 7262   H HB3  . PRO A 1 93  ? -10.709 -18.036 -1.970  1.00 14.13 ? 93  PRO A HB3  2  
ATOM 7263   H HG2  . PRO A 1 93  ? -9.138  -19.744 -3.860  1.00 15.52 ? 93  PRO A HG2  2  
ATOM 7264   H HG3  . PRO A 1 93  ? -10.532 -18.699 -4.191  1.00 14.34 ? 93  PRO A HG3  2  
ATOM 7265   H HD2  . PRO A 1 93  ? -7.995  -17.939 -4.730  1.00 13.14 ? 93  PRO A HD2  2  
ATOM 7266   H HD3  . PRO A 1 93  ? -9.246  -16.783 -4.228  1.00 63.22 ? 93  PRO A HD3  2  
ATOM 7267   N N    . GLU A 1 94  ? -6.975  -19.921 -1.941  1.00 35.01 ? 94  GLU A N    2  
ATOM 7268   C CA   . GLU A 1 94  ? -6.098  -21.027 -1.572  1.00 42.33 ? 94  GLU A CA   2  
ATOM 7269   C C    . GLU A 1 94  ? -4.764  -20.514 -1.041  1.00 5.14  ? 94  GLU A C    2  
ATOM 7270   O O    . GLU A 1 94  ? -4.330  -20.892 0.046   1.00 41.44 ? 94  GLU A O    2  
ATOM 7271   C CB   . GLU A 1 94  ? -5.864  -21.941 -2.777  1.00 70.24 ? 94  GLU A CB   2  
ATOM 7272   C CG   . GLU A 1 94  ? -6.978  -22.951 -3.000  1.00 33.34 ? 94  GLU A CG   2  
ATOM 7273   C CD   . GLU A 1 94  ? -6.887  -23.628 -4.354  1.00 13.14 ? 94  GLU A CD   2  
ATOM 7274   O OE1  . GLU A 1 94  ? -5.791  -24.115 -4.702  1.00 10.40 ? 94  GLU A OE1  2  
ATOM 7275   O OE2  . GLU A 1 94  ? -7.913  -23.671 -5.065  1.00 4.03  ? 94  GLU A OE2  2  
ATOM 7276   H H    . GLU A 1 94  ? -7.004  -19.625 -2.874  1.00 14.42 ? 94  GLU A H    2  
ATOM 7277   H HA   . GLU A 1 94  ? -6.589  -21.592 -0.793  1.00 14.34 ? 94  GLU A HA   2  
ATOM 7278   H HB2  . GLU A 1 94  ? -5.775  -21.333 -3.664  1.00 0.02  ? 94  GLU A HB2  2  
ATOM 7279   H HB3  . GLU A 1 94  ? -4.941  -22.483 -2.628  1.00 54.50 ? 94  GLU A HB3  2  
ATOM 7280   H HG2  . GLU A 1 94  ? -6.921  -23.708 -2.232  1.00 73.32 ? 94  GLU A HG2  2  
ATOM 7281   H HG3  . GLU A 1 94  ? -7.927  -22.441 -2.931  1.00 44.33 ? 94  GLU A HG3  2  
ATOM 7282   N N    . GLN A 1 95  ? -4.114  -19.654 -1.819  1.00 74.41 ? 95  GLN A N    2  
ATOM 7283   C CA   . GLN A 1 95  ? -2.825  -19.090 -1.431  1.00 24.13 ? 95  GLN A CA   2  
ATOM 7284   C C    . GLN A 1 95  ? -2.896  -18.447 -0.048  1.00 44.30 ? 95  GLN A C    2  
ATOM 7285   O O    . GLN A 1 95  ? -1.929  -18.482 0.713   1.00 43.13 ? 95  GLN A O    2  
ATOM 7286   C CB   . GLN A 1 95  ? -2.368  -18.055 -2.462  1.00 33.23 ? 95  GLN A CB   2  
ATOM 7287   C CG   . GLN A 1 95  ? -1.973  -18.662 -3.799  1.00 30.20 ? 95  GLN A CG   2  
ATOM 7288   C CD   . GLN A 1 95  ? -1.347  -17.649 -4.736  1.00 23.52 ? 95  GLN A CD   2  
ATOM 7289   O OE1  . GLN A 1 95  ? -0.500  -16.851 -4.332  1.00 24.14 ? 95  GLN A OE1  2  
ATOM 7290   N NE2  . GLN A 1 95  ? -1.761  -17.674 -5.998  1.00 55.32 ? 95  GLN A NE2  2  
ATOM 7291   H H    . GLN A 1 95  ? -4.511  -19.396 -2.677  1.00 41.13 ? 95  GLN A H    2  
ATOM 7292   H HA   . GLN A 1 95  ? -2.107  -19.895 -1.403  1.00 31.35 ? 95  GLN A HA   2  
ATOM 7293   H HB2  . GLN A 1 95  ? -3.172  -17.355 -2.633  1.00 41.11 ? 95  GLN A HB2  2  
ATOM 7294   H HB3  . GLN A 1 95  ? -1.516  -17.523 -2.067  1.00 64.12 ? 95  GLN A HB3  2  
ATOM 7295   H HG2  . GLN A 1 95  ? -1.261  -19.455 -3.623  1.00 53.21 ? 95  GLN A HG2  2  
ATOM 7296   H HG3  . GLN A 1 95  ? -2.856  -19.070 -4.269  1.00 25.22 ? 95  GLN A HG3  2  
ATOM 7297   H HE21 . GLN A 1 95  ? -2.439  -18.338 -6.249  1.00 12.10 ? 95  GLN A HE21 2  
ATOM 7298   H HE22 . GLN A 1 95  ? -1.373  -17.030 -6.626  1.00 0.31  ? 95  GLN A HE22 2  
ATOM 7299   N N    . ILE A 1 96  ? -4.044  -17.859 0.270   1.00 14.43 ? 96  ILE A N    2  
ATOM 7300   C CA   . ILE A 1 96  ? -4.236  -17.206 1.560   1.00 53.12 ? 96  ILE A CA   2  
ATOM 7301   C C    . ILE A 1 96  ? -4.458  -18.229 2.672   1.00 44.40 ? 96  ILE A C    2  
ATOM 7302   O O    . ILE A 1 96  ? -3.873  -18.124 3.750   1.00 53.05 ? 96  ILE A O    2  
ATOM 7303   C CB   . ILE A 1 96  ? -5.430  -16.229 1.525   1.00 51.31 ? 96  ILE A CB   2  
ATOM 7304   C CG1  . ILE A 1 96  ? -5.519  -15.448 2.838   1.00 72.22 ? 96  ILE A CG1  2  
ATOM 7305   C CG2  . ILE A 1 96  ? -6.728  -16.976 1.258   1.00 11.35 ? 96  ILE A CG2  2  
ATOM 7306   C CD1  . ILE A 1 96  ? -5.908  -13.998 2.654   1.00 64.12 ? 96  ILE A CD1  2  
ATOM 7307   H H    . ILE A 1 96  ? -4.776  -17.862 -0.381  1.00 61.35 ? 96  ILE A H    2  
ATOM 7308   H HA   . ILE A 1 96  ? -3.343  -16.641 1.781   1.00 2.21  ? 96  ILE A HA   2  
ATOM 7309   H HB   . ILE A 1 96  ? -5.271  -15.534 0.713   1.00 2.21  ? 96  ILE A HB   2  
ATOM 7310   H HG12 . ILE A 1 96  ? -6.257  -15.911 3.475   1.00 1.32  ? 96  ILE A HG12 2  
ATOM 7311   H HG13 . ILE A 1 96  ? -4.558  -15.475 3.331   1.00 71.41 ? 96  ILE A HG13 2  
ATOM 7312   H HG21 . ILE A 1 96  ? -7.066  -17.447 2.169   1.00 22.30 ? 96  ILE A HG21 2  
ATOM 7313   H HG22 . ILE A 1 96  ? -6.560  -17.732 0.503   1.00 21.24 ? 96  ILE A HG22 2  
ATOM 7314   H HG23 . ILE A 1 96  ? -7.478  -16.282 0.911   1.00 2.45  ? 96  ILE A HG23 2  
ATOM 7315   H HD11 . ILE A 1 96  ? -5.028  -13.415 2.427   1.00 3.42  ? 96  ILE A HD11 2  
ATOM 7316   H HD12 . ILE A 1 96  ? -6.361  -13.629 3.562   1.00 34.12 ? 96  ILE A HD12 2  
ATOM 7317   H HD13 . ILE A 1 96  ? -6.614  -13.915 1.840   1.00 62.45 ? 96  ILE A HD13 2  
ATOM 7318   N N    . GLN A 1 97  ? -5.307  -19.215 2.404   1.00 15.35 ? 97  GLN A N    2  
ATOM 7319   C CA   . GLN A 1 97  ? -5.608  -20.254 3.385   1.00 73.40 ? 97  GLN A CA   2  
ATOM 7320   C C    . GLN A 1 97  ? -4.414  -21.183 3.584   1.00 62.22 ? 97  GLN A C    2  
ATOM 7321   O O    . GLN A 1 97  ? -4.068  -21.531 4.713   1.00 41.42 ? 97  GLN A O    2  
ATOM 7322   C CB   . GLN A 1 97  ? -6.828  -21.063 2.941   1.00 42.23 ? 97  GLN A CB   2  
ATOM 7323   C CG   . GLN A 1 97  ? -7.621  -21.650 4.098   1.00 75.41 ? 97  GLN A CG   2  
ATOM 7324   C CD   . GLN A 1 97  ? -8.992  -22.139 3.675   1.00 45.24 ? 97  GLN A CD   2  
ATOM 7325   O OE1  . GLN A 1 97  ? -9.237  -23.343 3.597   1.00 64.25 ? 97  GLN A OE1  2  
ATOM 7326   N NE2  . GLN A 1 97  ? -9.895  -21.205 3.400   1.00 62.01 ? 97  GLN A NE2  2  
ATOM 7327   H H    . GLN A 1 97  ? -5.744  -19.244 1.528   1.00 35.04 ? 97  GLN A H    2  
ATOM 7328   H HA   . GLN A 1 97  ? -5.831  -19.768 4.322   1.00 72.33 ? 97  GLN A HA   2  
ATOM 7329   H HB2  . GLN A 1 97  ? -7.485  -20.420 2.373   1.00 71.23 ? 97  GLN A HB2  2  
ATOM 7330   H HB3  . GLN A 1 97  ? -6.498  -21.875 2.311   1.00 32.21 ? 97  GLN A HB3  2  
ATOM 7331   H HG2  . GLN A 1 97  ? -7.069  -22.483 4.509   1.00 52.41 ? 97  GLN A HG2  2  
ATOM 7332   H HG3  . GLN A 1 97  ? -7.743  -20.890 4.856   1.00 63.22 ? 97  GLN A HG3  2  
ATOM 7333   H HE21 . GLN A 1 97  ? -9.630  -20.265 3.485   1.00 41.51 ? 97  GLN A HE21 2  
ATOM 7334   H HE22 . GLN A 1 97  ? -10.790 -21.494 3.125   1.00 33.20 ? 97  GLN A HE22 2  
ATOM 7335   N N    . LYS A 1 98  ? -3.791  -21.583 2.481   1.00 64.45 ? 98  LYS A N    2  
ATOM 7336   C CA   . LYS A 1 98  ? -2.638  -22.476 2.532   1.00 4.23  ? 98  LYS A CA   2  
ATOM 7337   C C    . LYS A 1 98  ? -1.526  -21.892 3.399   1.00 52.23 ? 98  LYS A C    2  
ATOM 7338   O O    . LYS A 1 98  ? -0.948  -22.588 4.234   1.00 34.20 ? 98  LYS A O    2  
ATOM 7339   C CB   . LYS A 1 98  ? -2.112  -22.742 1.121   1.00 14.15 ? 98  LYS A CB   2  
ATOM 7340   C CG   . LYS A 1 98  ? -1.543  -24.139 0.937   1.00 51.54 ? 98  LYS A CG   2  
ATOM 7341   C CD   . LYS A 1 98  ? -0.778  -24.261 -0.371  1.00 2.10  ? 98  LYS A CD   2  
ATOM 7342   C CE   . LYS A 1 98  ? -0.991  -25.621 -1.016  1.00 45.22 ? 98  LYS A CE   2  
ATOM 7343   N NZ   . LYS A 1 98  ? -0.922  -25.548 -2.502  1.00 54.51 ? 98  LYS A NZ   2  
ATOM 7344   H H    . LYS A 1 98  ? -4.117  -21.274 1.611   1.00 54.34 ? 98  LYS A H    2  
ATOM 7345   H HA   . LYS A 1 98  ? -2.963  -23.409 2.966   1.00 34.40 ? 98  LYS A HA   2  
ATOM 7346   H HB2  . LYS A 1 98  ? -2.920  -22.610 0.417   1.00 2.33  ? 98  LYS A HB2  2  
ATOM 7347   H HB3  . LYS A 1 98  ? -1.333  -22.027 0.899   1.00 12.00 ? 98  LYS A HB3  2  
ATOM 7348   H HG2  . LYS A 1 98  ? -0.873  -24.355 1.755   1.00 52.43 ? 98  LYS A HG2  2  
ATOM 7349   H HG3  . LYS A 1 98  ? -2.355  -24.850 0.936   1.00 74.23 ? 98  LYS A HG3  2  
ATOM 7350   H HD2  . LYS A 1 98  ? -1.119  -23.494 -1.050  1.00 41.14 ? 98  LYS A HD2  2  
ATOM 7351   H HD3  . LYS A 1 98  ? 0.276   -24.126 -0.175  1.00 52.53 ? 98  LYS A HD3  2  
ATOM 7352   H HE2  . LYS A 1 98  ? -0.226  -26.297 -0.663  1.00 14.45 ? 98  LYS A HE2  2  
ATOM 7353   H HE3  . LYS A 1 98  ? -1.962  -25.994 -0.727  1.00 33.32 ? 98  LYS A HE3  2  
ATOM 7354   H HZ1  . LYS A 1 98  ? -0.166  -24.895 -2.793  1.00 43.15 ? 98  LYS A HZ1  2  
ATOM 7355   H HZ2  . LYS A 1 98  ? -1.825  -25.206 -2.886  1.00 62.44 ? 98  LYS A HZ2  2  
ATOM 7356   H HZ3  . LYS A 1 98  ? -0.724  -26.489 -2.897  1.00 2.21  ? 98  LYS A HZ3  2  
ATOM 7357   N N    . TRP A 1 99  ? -1.230  -20.612 3.194   1.00 21.25 ? 99  TRP A N    2  
ATOM 7358   C CA   . TRP A 1 99  ? -0.184  -19.939 3.957   1.00 22.43 ? 99  TRP A CA   2  
ATOM 7359   C C    . TRP A 1 99  ? -0.455  -20.020 5.455   1.00 43.42 ? 99  TRP A C    2  
ATOM 7360   O O    . TRP A 1 99  ? 0.371   -20.517 6.219   1.00 13.05 ? 99  TRP A O    2  
ATOM 7361   C CB   . TRP A 1 99  ? -0.073  -18.475 3.525   1.00 74.52 ? 99  TRP A CB   2  
ATOM 7362   C CG   . TRP A 1 99  ? 1.339   -17.981 3.459   1.00 21.14 ? 99  TRP A CG   2  
ATOM 7363   C CD1  . TRP A 1 99  ? 1.881   -16.949 4.170   1.00 13.33 ? 99  TRP A CD1  2  
ATOM 7364   C CD2  . TRP A 1 99  ? 2.391   -18.497 2.635   1.00 30.15 ? 99  TRP A CD2  2  
ATOM 7365   N NE1  . TRP A 1 99  ? 3.206   -16.793 3.840   1.00 13.22 ? 99  TRP A NE1  2  
ATOM 7366   C CE2  . TRP A 1 99  ? 3.542   -17.732 2.899   1.00 20.54 ? 99  TRP A CE2  2  
ATOM 7367   C CE3  . TRP A 1 99  ? 2.471   -19.534 1.700   1.00 34.33 ? 99  TRP A CE3  2  
ATOM 7368   C CZ2  . TRP A 1 99  ? 4.757   -17.970 2.262   1.00 32.15 ? 99  TRP A CZ2  2  
ATOM 7369   C CZ3  . TRP A 1 99  ? 3.678   -19.769 1.069   1.00 74.43 ? 99  TRP A CZ3  2  
ATOM 7370   C CH2  . TRP A 1 99  ? 4.807   -18.990 1.353   1.00 55.54 ? 99  TRP A CH2  2  
ATOM 7371   H H    . TRP A 1 99  ? -1.723  -20.108 2.513   1.00 62.12 ? 99  TRP A H    2  
ATOM 7372   H HA   . TRP A 1 99  ? 0.751   -20.437 3.746   1.00 4.42  ? 99  TRP A HA   2  
ATOM 7373   H HB2  . TRP A 1 99  ? -0.512  -18.361 2.545   1.00 14.44 ? 99  TRP A HB2  2  
ATOM 7374   H HB3  . TRP A 1 99  ? -0.611  -17.857 4.229   1.00 61.45 ? 99  TRP A HB3  2  
ATOM 7375   H HD1  . TRP A 1 99  ? 1.337   -16.351 4.886   1.00 55.34 ? 99  TRP A HD1  2  
ATOM 7376   H HE1  . TRP A 1 99  ? 3.811   -16.120 4.215   1.00 30.12 ? 99  TRP A HE1  2  
ATOM 7377   H HE3  . TRP A 1 99  ? 1.611   -20.145 1.469   1.00 53.24 ? 99  TRP A HE3  2  
ATOM 7378   H HZ2  . TRP A 1 99  ? 5.637   -17.380 2.470   1.00 22.44 ? 99  TRP A HZ2  2  
ATOM 7379   H HZ3  . TRP A 1 99  ? 3.759   -20.566 0.344   1.00 22.10 ? 99  TRP A HZ3  2  
ATOM 7380   H HH2  . TRP A 1 99  ? 5.729   -19.210 0.835   1.00 71.33 ? 99  TRP A HH2  2  
ATOM 7381   N N    . ILE A 1 100 ? -1.618  -19.524 5.871   1.00 51.33 ? 100 ILE A N    2  
ATOM 7382   C CA   . ILE A 1 100 ? -1.998  -19.538 7.281   1.00 3.20  ? 100 ILE A CA   2  
ATOM 7383   C C    . ILE A 1 100 ? -1.812  -20.924 7.893   1.00 24.21 ? 100 ILE A C    2  
ATOM 7384   O O    . ILE A 1 100 ? -1.449  -21.053 9.063   1.00 72.21 ? 100 ILE A O    2  
ATOM 7385   C CB   . ILE A 1 100 ? -3.462  -19.093 7.475   1.00 51.30 ? 100 ILE A CB   2  
ATOM 7386   C CG1  . ILE A 1 100 ? -3.690  -17.718 6.842   1.00 23.34 ? 100 ILE A CG1  2  
ATOM 7387   C CG2  . ILE A 1 100 ? -3.821  -19.062 8.954   1.00 25.22 ? 100 ILE A CG2  2  
ATOM 7388   C CD1  . ILE A 1 100 ? -5.038  -17.579 6.168   1.00 54.34 ? 100 ILE A CD1  2  
ATOM 7389   H H    . ILE A 1 100 ? -2.234  -19.137 5.214   1.00 15.44 ? 100 ILE A H    2  
ATOM 7390   H HA   . ILE A 1 100 ? -1.360  -18.838 7.803   1.00 75.15 ? 100 ILE A HA   2  
ATOM 7391   H HB   . ILE A 1 100 ? -4.102  -19.814 6.989   1.00 21.30 ? 100 ILE A HB   2  
ATOM 7392   H HG12 . ILE A 1 100 ? -3.624  -16.961 7.608   1.00 75.22 ? 100 ILE A HG12 2  
ATOM 7393   H HG13 . ILE A 1 100 ? -2.926  -17.539 6.099   1.00 23.23 ? 100 ILE A HG13 2  
ATOM 7394   H HG21 . ILE A 1 100 ? -3.101  -18.460 9.487   1.00 53.32 ? 100 ILE A HG21 2  
ATOM 7395   H HG22 . ILE A 1 100 ? -3.812  -20.068 9.347   1.00 1.42  ? 100 ILE A HG22 2  
ATOM 7396   H HG23 . ILE A 1 100 ? -4.807  -18.637 9.077   1.00 53.53 ? 100 ILE A HG23 2  
ATOM 7397   H HD11 . ILE A 1 100 ? -5.748  -17.162 6.867   1.00 2.32  ? 100 ILE A HD11 2  
ATOM 7398   H HD12 . ILE A 1 100 ? -5.380  -18.551 5.843   1.00 4.23  ? 100 ILE A HD12 2  
ATOM 7399   H HD13 . ILE A 1 100 ? -4.947  -16.925 5.314   1.00 72.15 ? 100 ILE A HD13 2  
ATOM 7400   N N    . ARG A 1 101 ? -2.061  -21.958 7.096   1.00 12.41 ? 101 ARG A N    2  
ATOM 7401   C CA   . ARG A 1 101 ? -1.919  -23.333 7.562   1.00 20.11 ? 101 ARG A CA   2  
ATOM 7402   C C    . ARG A 1 101 ? -0.450  -23.700 7.747   1.00 62.42 ? 101 ARG A C    2  
ATOM 7403   O O    . ARG A 1 101 ? -0.033  -24.104 8.832   1.00 2.51  ? 101 ARG A O    2  
ATOM 7404   C CB   . ARG A 1 101 ? -2.577  -24.298 6.575   1.00 41.45 ? 101 ARG A CB   2  
ATOM 7405   C CG   . ARG A 1 101 ? -3.234  -25.497 7.241   1.00 52.54 ? 101 ARG A CG   2  
ATOM 7406   C CD   . ARG A 1 101 ? -3.070  -26.757 6.408   1.00 62.01 ? 101 ARG A CD   2  
ATOM 7407   N NE   . ARG A 1 101 ? -2.916  -27.948 7.240   1.00 70.44 ? 101 ARG A NE   2  
ATOM 7408   C CZ   . ARG A 1 101 ? -2.414  -29.099 6.801   1.00 72.22 ? 101 ARG A CZ   2  
ATOM 7409   N NH1  . ARG A 1 101 ? -2.016  -29.221 5.540   1.00 64.13 ? 101 ARG A NH1  2  
ATOM 7410   N NH2  . ARG A 1 101 ? -2.308  -30.134 7.625   1.00 44.20 ? 101 ARG A NH2  2  
ATOM 7411   H H    . ARG A 1 101 ? -2.347  -21.795 6.173   1.00 71.04 ? 101 ARG A H    2  
ATOM 7412   H HA   . ARG A 1 101 ? -2.420  -23.412 8.516   1.00 22.43 ? 101 ARG A HA   2  
ATOM 7413   H HB2  . ARG A 1 101 ? -3.333  -23.765 6.017   1.00 13.20 ? 101 ARG A HB2  2  
ATOM 7414   H HB3  . ARG A 1 101 ? -1.825  -24.662 5.890   1.00 1.22  ? 101 ARG A HB3  2  
ATOM 7415   H HG2  . ARG A 1 101 ? -2.778  -25.654 8.207   1.00 42.24 ? 101 ARG A HG2  2  
ATOM 7416   H HG3  . ARG A 1 101 ? -4.287  -25.294 7.366   1.00 22.15 ? 101 ARG A HG3  2  
ATOM 7417   H HD2  . ARG A 1 101 ? -3.943  -26.877 5.783   1.00 44.32 ? 101 ARG A HD2  2  
ATOM 7418   H HD3  . ARG A 1 101 ? -2.195  -26.650 5.784   1.00 11.41 ? 101 ARG A HD3  2  
ATOM 7419   H HE   . ARG A 1 101 ? -3.202  -27.886 8.175   1.00 40.43 ? 101 ARG A HE   2  
ATOM 7420   H HH11 . ARG A 1 101 ? -2.093  -28.446 4.915   1.00 23.23 ? 101 ARG A HH11 2  
ATOM 7421   H HH12 . ARG A 1 101 ? -1.639  -30.089 5.218   1.00 71.02 ? 101 ARG A HH12 2  
ATOM 7422   H HH21 . ARG A 1 101 ? -2.606  -30.048 8.576   1.00 45.54 ? 101 ARG A HH21 2  
ATOM 7423   H HH22 . ARG A 1 101 ? -1.932  -30.999 7.296   1.00 22.45 ? 101 ARG A HH22 2  
ATOM 7424   N N    . THR A 1 102 ? 0.329   -23.556 6.680   1.00 14.00 ? 102 THR A N    2  
ATOM 7425   C CA   . THR A 1 102 ? 1.752   -23.874 6.724   1.00 64.53 ? 102 THR A CA   2  
ATOM 7426   C C    . THR A 1 102 ? 2.476   -23.000 7.744   1.00 1.22  ? 102 THR A C    2  
ATOM 7427   O O    . THR A 1 102 ? 3.293   -23.487 8.525   1.00 25.23 ? 102 THR A O    2  
ATOM 7428   C CB   . THR A 1 102 ? 2.380   -23.690 5.342   1.00 64.02 ? 102 THR A CB   2  
ATOM 7429   O OG1  . THR A 1 102 ? 1.705   -24.477 4.376   1.00 1.24  ? 102 THR A OG1  2  
ATOM 7430   C CG2  . THR A 1 102 ? 3.845   -24.063 5.295   1.00 53.22 ? 102 THR A CG2  2  
ATOM 7431   H H    . THR A 1 102 ? -0.062  -23.231 5.843   1.00 71.24 ? 102 THR A H    2  
ATOM 7432   H HA   . THR A 1 102 ? 1.851   -24.908 7.020   1.00 32.43 ? 102 THR A HA   2  
ATOM 7433   H HB   . THR A 1 102 ? 2.294   -22.652 5.054   1.00 24.03 ? 102 THR A HB   2  
ATOM 7434   H HG1  . THR A 1 102 ? 1.871   -25.407 4.548   1.00 23.32 ? 102 THR A HG1  2  
ATOM 7435   H HG21 . THR A 1 102 ? 4.200   -24.004 4.277   1.00 34.22 ? 102 THR A HG21 2  
ATOM 7436   H HG22 . THR A 1 102 ? 3.972   -25.071 5.663   1.00 33.05 ? 102 THR A HG22 2  
ATOM 7437   H HG23 . THR A 1 102 ? 4.410   -23.381 5.913   1.00 1.44  ? 102 THR A HG23 2  
ATOM 7438   N N    . ARG A 1 103 ? 2.171   -21.706 7.730   1.00 53.05 ? 103 ARG A N    2  
ATOM 7439   C CA   . ARG A 1 103 ? 2.793   -20.764 8.653   1.00 21.53 ? 103 ARG A CA   2  
ATOM 7440   C C    . ARG A 1 103 ? 2.241   -20.923 10.069  1.00 60.13 ? 103 ARG A C    2  
ATOM 7441   O O    . ARG A 1 103 ? 2.767   -20.338 11.016  1.00 4.23  ? 103 ARG A O    2  
ATOM 7442   C CB   . ARG A 1 103 ? 2.579   -19.329 8.168   1.00 0.53  ? 103 ARG A CB   2  
ATOM 7443   C CG   . ARG A 1 103 ? 3.728   -18.790 7.332   1.00 73.22 ? 103 ARG A CG   2  
ATOM 7444   C CD   . ARG A 1 103 ? 4.613   -17.852 8.138   1.00 34.32 ? 103 ARG A CD   2  
ATOM 7445   N NE   . ARG A 1 103 ? 6.021   -17.975 7.768   1.00 54.13 ? 103 ARG A NE   2  
ATOM 7446   C CZ   . ARG A 1 103 ? 6.819   -18.951 8.197   1.00 52.42 ? 103 ARG A CZ   2  
ATOM 7447   N NH1  . ARG A 1 103 ? 6.351   -19.890 9.010   1.00 50.31 ? 103 ARG A NH1  2  
ATOM 7448   N NH2  . ARG A 1 103 ? 8.087   -18.988 7.813   1.00 33.15 ? 103 ARG A NH2  2  
ATOM 7449   H H    . ARG A 1 103 ? 1.512   -21.378 7.083   1.00 4.50  ? 103 ARG A H    2  
ATOM 7450   H HA   . ARG A 1 103 ? 3.853   -20.971 8.669   1.00 42.13 ? 103 ARG A HA   2  
ATOM 7451   H HB2  . ARG A 1 103 ? 1.680   -19.294 7.569   1.00 43.31 ? 103 ARG A HB2  2  
ATOM 7452   H HB3  . ARG A 1 103 ? 2.452   -18.685 9.026   1.00 74.13 ? 103 ARG A HB3  2  
ATOM 7453   H HG2  . ARG A 1 103 ? 4.325   -19.619 6.982   1.00 44.53 ? 103 ARG A HG2  2  
ATOM 7454   H HG3  . ARG A 1 103 ? 3.324   -18.251 6.487   1.00 41.42 ? 103 ARG A HG3  2  
ATOM 7455   H HD2  . ARG A 1 103 ? 4.293   -16.836 7.963   1.00 64.30 ? 103 ARG A HD2  2  
ATOM 7456   H HD3  . ARG A 1 103 ? 4.504   -18.088 9.187   1.00 40.13 ? 103 ARG A HD3  2  
ATOM 7457   H HE   . ARG A 1 103 ? 6.393   -17.295 7.169   1.00 43.22 ? 103 ARG A HE   2  
ATOM 7458   H HH11 . ARG A 1 103 ? 5.396   -19.868 9.304   1.00 73.31 ? 103 ARG A HH11 2  
ATOM 7459   H HH12 . ARG A 1 103 ? 6.956   -20.621 9.329   1.00 11.13 ? 103 ARG A HH12 2  
ATOM 7460   H HH21 . ARG A 1 103 ? 8.444   -18.282 7.200   1.00 13.31 ? 103 ARG A HH21 2  
ATOM 7461   H HH22 . ARG A 1 103 ? 8.686   -19.720 8.135   1.00 11.32 ? 103 ARG A HH22 2  
ATOM 7462   N N    . LYS A 1 104 ? 1.181   -21.715 10.211  1.00 71.04 ? 104 LYS A N    2  
ATOM 7463   C CA   . LYS A 1 104 ? 0.568   -21.941 11.515  1.00 51.32 ? 104 LYS A CA   2  
ATOM 7464   C C    . LYS A 1 104 ? 0.057   -20.634 12.111  1.00 73.44 ? 104 LYS A C    2  
ATOM 7465   O O    . LYS A 1 104 ? 0.091   -20.438 13.325  1.00 71.43 ? 104 LYS A O    2  
ATOM 7466   C CB   . LYS A 1 104 ? 1.573   -22.591 12.469  1.00 64.43 ? 104 LYS A CB   2  
ATOM 7467   C CG   . LYS A 1 104 ? 1.602   -24.108 12.379  1.00 5.34  ? 104 LYS A CG   2  
ATOM 7468   C CD   . LYS A 1 104 ? 2.041   -24.734 13.694  1.00 5.14  ? 104 LYS A CD   2  
ATOM 7469   C CE   . LYS A 1 104 ? 2.607   -26.128 13.485  1.00 21.44 ? 104 LYS A CE   2  
ATOM 7470   N NZ   . LYS A 1 104 ? 2.274   -27.039 14.615  1.00 33.33 ? 104 LYS A NZ   2  
ATOM 7471   H H    . LYS A 1 104 ? 0.801   -22.157 9.424   1.00 33.14 ? 104 LYS A H    2  
ATOM 7472   H HA   . LYS A 1 104 ? -0.268  -22.610 11.377  1.00 54.24 ? 104 LYS A HA   2  
ATOM 7473   H HB2  . LYS A 1 104 ? 2.561   -22.220 12.239  1.00 11.43 ? 104 LYS A HB2  2  
ATOM 7474   H HB3  . LYS A 1 104 ? 1.320   -22.316 13.481  1.00 12.45 ? 104 LYS A HB3  2  
ATOM 7475   H HG2  . LYS A 1 104 ? 0.612   -24.464 12.136  1.00 41.35 ? 104 LYS A HG2  2  
ATOM 7476   H HG3  . LYS A 1 104 ? 2.294   -24.400 11.604  1.00 24.15 ? 104 LYS A HG3  2  
ATOM 7477   H HD2  . LYS A 1 104 ? 2.800   -24.112 14.143  1.00 55.22 ? 104 LYS A HD2  2  
ATOM 7478   H HD3  . LYS A 1 104 ? 1.187   -24.797 14.353  1.00 15.11 ? 104 LYS A HD3  2  
ATOM 7479   H HE2  . LYS A 1 104 ? 2.199   -26.537 12.573  1.00 64.23 ? 104 LYS A HE2  2  
ATOM 7480   H HE3  . LYS A 1 104 ? 3.682   -26.056 13.396  1.00 42.05 ? 104 LYS A HE3  2  
ATOM 7481   H HZ1  . LYS A 1 104 ? 1.425   -27.595 14.387  1.00 33.31 ? 104 LYS A HZ1  2  
ATOM 7482   H HZ2  . LYS A 1 104 ? 2.094   -26.488 15.477  1.00 62.32 ? 104 LYS A HZ2  2  
ATOM 7483   H HZ3  . LYS A 1 104 ? 3.065   -27.692 14.793  1.00 33.42 ? 104 LYS A HZ3  2  
ATOM 7484   N N    . LEU A 1 105 ? -0.415  -19.741 11.247  1.00 61.01 ? 105 LEU A N    2  
ATOM 7485   C CA   . LEU A 1 105 ? -0.934  -18.452 11.686  1.00 22.42 ? 105 LEU A CA   2  
ATOM 7486   C C    . LEU A 1 105 ? -2.429  -18.537 11.978  1.00 21.05 ? 105 LEU A C    2  
ATOM 7487   O O    . LEU A 1 105 ? -3.098  -19.485 11.567  1.00 43.44 ? 105 LEU A O    2  
ATOM 7488   C CB   . LEU A 1 105 ? -0.670  -17.383 10.623  1.00 22.54 ? 105 LEU A CB   2  
ATOM 7489   C CG   . LEU A 1 105 ? 0.685   -16.681 10.733  1.00 31.13 ? 105 LEU A CG   2  
ATOM 7490   C CD1  . LEU A 1 105 ? 1.124   -16.156 9.375   1.00 52.31 ? 105 LEU A CD1  2  
ATOM 7491   C CD2  . LEU A 1 105 ? 0.618   -15.551 11.748  1.00 45.01 ? 105 LEU A CD2  2  
ATOM 7492   H H    . LEU A 1 105 ? -0.417  -19.956 10.290  1.00 41.24 ? 105 LEU A H    2  
ATOM 7493   H HA   . LEU A 1 105 ? -0.417  -18.179 12.594  1.00 71.44 ? 105 LEU A HA   2  
ATOM 7494   H HB2  . LEU A 1 105 ? -0.735  -17.849 9.650   1.00 41.24 ? 105 LEU A HB2  2  
ATOM 7495   H HB3  . LEU A 1 105 ? -1.444  -16.634 10.696  1.00 13.40 ? 105 LEU A HB3  2  
ATOM 7496   H HG   . LEU A 1 105 ? 1.425   -17.392 11.071  1.00 52.45 ? 105 LEU A HG   2  
ATOM 7497   H HD11 . LEU A 1 105 ? 0.858   -16.870 8.609   1.00 23.21 ? 105 LEU A HD11 2  
ATOM 7498   H HD12 . LEU A 1 105 ? 2.195   -16.011 9.375   1.00 24.31 ? 105 LEU A HD12 2  
ATOM 7499   H HD13 . LEU A 1 105 ? 0.633   -15.216 9.176   1.00 71.53 ? 105 LEU A HD13 2  
ATOM 7500   H HD21 . LEU A 1 105 ? 0.055   -15.874 12.610  1.00 3.21  ? 105 LEU A HD21 2  
ATOM 7501   H HD22 . LEU A 1 105 ? 0.133   -14.695 11.301  1.00 25.01 ? 105 LEU A HD22 2  
ATOM 7502   H HD23 . LEU A 1 105 ? 1.619   -15.280 12.051  1.00 73.31 ? 105 LEU A HD23 2  
ATOM 7503   N N    . LYS A 1 106 ? -2.945  -17.541 12.689  1.00 34.11 ? 106 LYS A N    2  
ATOM 7504   C CA   . LYS A 1 106 ? -4.362  -17.504 13.035  1.00 15.40 ? 106 LYS A CA   2  
ATOM 7505   C C    . LYS A 1 106 ? -5.179  -16.872 11.914  1.00 73.23 ? 106 LYS A C    2  
ATOM 7506   O O    . LYS A 1 106 ? -6.307  -17.285 11.645  1.00 60.54 ? 106 LYS A O    2  
ATOM 7507   C CB   . LYS A 1 106 ? -4.570  -16.726 14.336  1.00 2.12  ? 106 LYS A CB   2  
ATOM 7508   C CG   . LYS A 1 106 ? -5.674  -17.296 15.214  1.00 21.12 ? 106 LYS A CG   2  
ATOM 7509   C CD   . LYS A 1 106 ? -5.296  -17.249 16.685  1.00 42.45 ? 106 LYS A CD   2  
ATOM 7510   C CE   . LYS A 1 106 ? -4.361  -18.390 17.057  1.00 4.12  ? 106 LYS A CE   2  
ATOM 7511   N NZ   . LYS A 1 106 ? -3.340  -17.969 18.055  1.00 34.12 ? 106 LYS A NZ   2  
ATOM 7512   H H    . LYS A 1 106 ? -2.362  -16.813 12.988  1.00 25.10 ? 106 LYS A H    2  
ATOM 7513   H HA   . LYS A 1 106 ? -4.694  -18.522 13.177  1.00 20.20 ? 106 LYS A HA   2  
ATOM 7514   H HB2  . LYS A 1 106 ? -3.648  -16.737 14.899  1.00 71.40 ? 106 LYS A HB2  2  
ATOM 7515   H HB3  . LYS A 1 106 ? -4.823  -15.705 14.094  1.00 60.51 ? 106 LYS A HB3  2  
ATOM 7516   H HG2  . LYS A 1 106 ? -6.573  -16.717 15.066  1.00 12.01 ? 106 LYS A HG2  2  
ATOM 7517   H HG3  . LYS A 1 106 ? -5.853  -18.322 14.929  1.00 45.33 ? 106 LYS A HG3  2  
ATOM 7518   H HD2  . LYS A 1 106 ? -4.801  -16.312 16.892  1.00 44.10 ? 106 LYS A HD2  2  
ATOM 7519   H HD3  . LYS A 1 106 ? -6.194  -17.324 17.280  1.00 33.40 ? 106 LYS A HD3  2  
ATOM 7520   H HE2  . LYS A 1 106 ? -4.946  -19.196 17.473  1.00 50.02 ? 106 LYS A HE2  2  
ATOM 7521   H HE3  . LYS A 1 106 ? -3.860  -18.733 16.163  1.00 74.41 ? 106 LYS A HE3  2  
ATOM 7522   H HZ1  . LYS A 1 106 ? -3.199  -16.940 18.009  1.00 14.42 ? 106 LYS A HZ1  2  
ATOM 7523   H HZ2  . LYS A 1 106 ? -2.434  -18.441 17.860  1.00 61.50 ? 106 LYS A HZ2  2  
ATOM 7524   H HZ3  . LYS A 1 106 ? -3.651  -18.224 19.015  1.00 72.42 ? 106 LYS A HZ3  2  
ATOM 7525   N N    . TYR A 1 107 ? -4.604  -15.867 11.262  1.00 21.25 ? 107 TYR A N    2  
ATOM 7526   C CA   . TYR A 1 107 ? -5.279  -15.177 10.169  1.00 63.33 ? 107 TYR A CA   2  
ATOM 7527   C C    . TYR A 1 107 ? -4.296  -14.321 9.377   1.00 34.40 ? 107 TYR A C    2  
ATOM 7528   O O    . TYR A 1 107 ? -3.207  -14.005 9.855   1.00 0.00  ? 107 TYR A O    2  
ATOM 7529   C CB   . TYR A 1 107 ? -6.411  -14.305 10.712  1.00 12.35 ? 107 TYR A CB   2  
ATOM 7530   C CG   . TYR A 1 107 ? -6.022  -13.490 11.925  1.00 5.41  ? 107 TYR A CG   2  
ATOM 7531   C CD1  . TYR A 1 107 ? -5.183  -12.389 11.805  1.00 13.33 ? 107 TYR A CD1  2  
ATOM 7532   C CD2  . TYR A 1 107 ? -6.492  -13.822 13.189  1.00 72.21 ? 107 TYR A CD2  2  
ATOM 7533   C CE1  . TYR A 1 107 ? -4.824  -11.643 12.911  1.00 22.22 ? 107 TYR A CE1  2  
ATOM 7534   C CE2  . TYR A 1 107 ? -6.138  -13.080 14.299  1.00 34.43 ? 107 TYR A CE2  2  
ATOM 7535   C CZ   . TYR A 1 107 ? -5.304  -11.992 14.155  1.00 61.14 ? 107 TYR A CZ   2  
ATOM 7536   O OH   . TYR A 1 107 ? -4.949  -11.250 15.259  1.00 44.45 ? 107 TYR A OH   2  
ATOM 7537   H H    . TYR A 1 107 ? -3.702  -15.582 11.521  1.00 32.32 ? 107 TYR A H    2  
ATOM 7538   H HA   . TYR A 1 107 ? -5.696  -15.926 9.513   1.00 21.44 ? 107 TYR A HA   2  
ATOM 7539   H HB2  . TYR A 1 107 ? -6.730  -13.620 9.941   1.00 55.55 ? 107 TYR A HB2  2  
ATOM 7540   H HB3  . TYR A 1 107 ? -7.243  -14.938 10.990  1.00 73.50 ? 107 TYR A HB3  2  
ATOM 7541   H HD1  . TYR A 1 107 ? -4.808  -12.119 10.829  1.00 1.44  ? 107 TYR A HD1  2  
ATOM 7542   H HD2  . TYR A 1 107 ? -7.146  -14.675 13.299  1.00 44.43 ? 107 TYR A HD2  2  
ATOM 7543   H HE1  . TYR A 1 107 ? -4.170  -10.790 12.798  1.00 2.44  ? 107 TYR A HE1  2  
ATOM 7544   H HE2  . TYR A 1 107 ? -6.515  -13.353 15.274  1.00 54.32 ? 107 TYR A HE2  2  
ATOM 7545   H HH   . TYR A 1 107 ? -3.994  -11.160 15.290  1.00 34.20 ? 107 TYR A HH   2  
ATOM 7546   N N    . LEU A 1 108 ? -4.689  -13.948 8.163   1.00 72.34 ? 108 LEU A N    2  
ATOM 7547   C CA   . LEU A 1 108 ? -3.843  -13.127 7.305   1.00 44.45 ? 108 LEU A CA   2  
ATOM 7548   C C    . LEU A 1 108 ? -4.589  -11.881 6.838   1.00 52.25 ? 108 LEU A C    2  
ATOM 7549   O O    . LEU A 1 108 ? -5.498  -11.963 6.012   1.00 12.21 ? 108 LEU A O    2  
ATOM 7550   C CB   . LEU A 1 108 ? -3.371  -13.936 6.095   1.00 64.44 ? 108 LEU A CB   2  
ATOM 7551   C CG   . LEU A 1 108 ? -1.959  -13.607 5.606   1.00 23.24 ? 108 LEU A CG   2  
ATOM 7552   C CD1  . LEU A 1 108 ? -0.930  -14.449 6.343   1.00 2.01  ? 108 LEU A CD1  2  
ATOM 7553   C CD2  . LEU A 1 108 ? -1.852  -13.823 4.105   1.00 14.23 ? 108 LEU A CD2  2  
ATOM 7554   H H    . LEU A 1 108 ? -5.569  -14.232 7.837   1.00 64.20 ? 108 LEU A H    2  
ATOM 7555   H HA   . LEU A 1 108 ? -2.982  -12.822 7.880   1.00 62.42 ? 108 LEU A HA   2  
ATOM 7556   H HB2  . LEU A 1 108 ? -3.405  -14.984 6.354   1.00 30.43 ? 108 LEU A HB2  2  
ATOM 7557   H HB3  . LEU A 1 108 ? -4.058  -13.762 5.280   1.00 63.04 ? 108 LEU A HB3  2  
ATOM 7558   H HG   . LEU A 1 108 ? -1.748  -12.567 5.812   1.00 61.31 ? 108 LEU A HG   2  
ATOM 7559   H HD11 . LEU A 1 108 ? -1.135  -14.423 7.403   1.00 74.53 ? 108 LEU A HD11 2  
ATOM 7560   H HD12 . LEU A 1 108 ? 0.058   -14.054 6.157   1.00 51.35 ? 108 LEU A HD12 2  
ATOM 7561   H HD13 . LEU A 1 108 ? -0.982  -15.469 5.991   1.00 54.42 ? 108 LEU A HD13 2  
ATOM 7562   H HD21 . LEU A 1 108 ? -1.599  -14.854 3.907   1.00 52.53 ? 108 LEU A HD21 2  
ATOM 7563   H HD22 . LEU A 1 108 ? -1.084  -13.179 3.702   1.00 13.44 ? 108 LEU A HD22 2  
ATOM 7564   H HD23 . LEU A 1 108 ? -2.798  -13.589 3.639   1.00 3.34  ? 108 LEU A HD23 2  
ATOM 7565   N N    . GLY A 1 109 ? -4.198  -10.728 7.372   1.00 73.11 ? 109 GLY A N    2  
ATOM 7566   C CA   . GLY A 1 109 ? -4.840  -9.482  6.999   1.00 2.54  ? 109 GLY A CA   2  
ATOM 7567   C C    . GLY A 1 109 ? -4.673  -9.159  5.527   1.00 71.04 ? 109 GLY A C    2  
ATOM 7568   O O    . GLY A 1 109 ? -3.780  -8.402  5.149   1.00 61.43 ? 109 GLY A O    2  
ATOM 7569   H H    . GLY A 1 109 ? -3.468  -10.725 8.027   1.00 72.32 ? 109 GLY A H    2  
ATOM 7570   H HA2  . GLY A 1 109 ? -5.894  -9.552  7.224   1.00 23.52 ? 109 GLY A HA2  2  
ATOM 7571   H HA3  . GLY A 1 109 ? -4.411  -8.681  7.583   1.00 22.52 ? 109 GLY A HA3  2  
ATOM 7572   N N    . VAL A 1 110 ? -5.538  -9.733  4.696   1.00 11.03 ? 110 VAL A N    2  
ATOM 7573   C CA   . VAL A 1 110 ? -5.485  -9.501  3.257   1.00 32.14 ? 110 VAL A CA   2  
ATOM 7574   C C    . VAL A 1 110 ? -6.852  -9.735  2.616   1.00 12.22 ? 110 VAL A C    2  
ATOM 7575   O O    . VAL A 1 110 ? -7.447  -10.799 2.781   1.00 51.14 ? 110 VAL A O    2  
ATOM 7576   C CB   . VAL A 1 110 ? -4.449  -10.418 2.577   1.00 44.11 ? 110 VAL A CB   2  
ATOM 7577   C CG1  . VAL A 1 110 ? -4.313  -10.072 1.101   1.00 14.23 ? 110 VAL A CG1  2  
ATOM 7578   C CG2  . VAL A 1 110 ? -3.103  -10.321 3.279   1.00 74.51 ? 110 VAL A CG2  2  
ATOM 7579   H H    . VAL A 1 110 ? -6.229  -10.324 5.059   1.00 70.45 ? 110 VAL A H    2  
ATOM 7580   H HA   . VAL A 1 110 ? -5.187  -8.476  3.097   1.00 64.25 ? 110 VAL A HA   2  
ATOM 7581   H HB   . VAL A 1 110 ? -4.797  -11.439 2.652   1.00 42.31 ? 110 VAL A HB   2  
ATOM 7582   H HG11 . VAL A 1 110 ? -3.575  -10.716 0.647   1.00 44.14 ? 110 VAL A HG11 2  
ATOM 7583   H HG12 . VAL A 1 110 ? -4.005  -9.043  1.001   1.00 22.43 ? 110 VAL A HG12 2  
ATOM 7584   H HG13 . VAL A 1 110 ? -5.265  -10.213 0.609   1.00 32.54 ? 110 VAL A HG13 2  
ATOM 7585   H HG21 . VAL A 1 110 ? -3.186  -10.725 4.276   1.00 71.12 ? 110 VAL A HG21 2  
ATOM 7586   H HG22 . VAL A 1 110 ? -2.800  -9.286  3.334   1.00 31.14 ? 110 VAL A HG22 2  
ATOM 7587   H HG23 . VAL A 1 110 ? -2.366  -10.882 2.723   1.00 22.04 ? 110 VAL A HG23 2  
ATOM 7588   N N    . PRO A 1 111 ? -7.373  -8.741  1.871   1.00 13.51 ? 111 PRO A N    2  
ATOM 7589   C CA   . PRO A 1 111 ? -8.677  -8.856  1.207   1.00 5.14  ? 111 PRO A CA   2  
ATOM 7590   C C    . PRO A 1 111 ? -8.773  -10.104 0.336   1.00 53.43 ? 111 PRO A C    2  
ATOM 7591   O O    . PRO A 1 111 ? -7.763  -10.607 -0.155  1.00 11.41 ? 111 PRO A O    2  
ATOM 7592   C CB   . PRO A 1 111 ? -8.754  -7.594  0.344   1.00 12.24 ? 111 PRO A CB   2  
ATOM 7593   C CG   . PRO A 1 111 ? -7.848  -6.621  1.013   1.00 50.05 ? 111 PRO A CG   2  
ATOM 7594   C CD   . PRO A 1 111 ? -6.738  -7.435  1.614   1.00 41.02 ? 111 PRO A CD   2  
ATOM 7595   H HA   . PRO A 1 111 ? -9.486  -8.856  1.924   1.00 1.11  ? 111 PRO A HA   2  
ATOM 7596   H HB2  . PRO A 1 111 ? -8.421  -7.821  -0.659  1.00 0.21  ? 111 PRO A HB2  2  
ATOM 7597   H HB3  . PRO A 1 111 ? -9.771  -7.233  0.319   1.00 72.13 ? 111 PRO A HB3  2  
ATOM 7598   H HG2  . PRO A 1 111 ? -7.453  -5.927  0.285   1.00 13.54 ? 111 PRO A HG2  2  
ATOM 7599   H HG3  . PRO A 1 111 ? -8.385  -6.090  1.786   1.00 4.55  ? 111 PRO A HG3  2  
ATOM 7600   H HD2  . PRO A 1 111 ? -5.920  -7.534  0.914   1.00 31.13 ? 111 PRO A HD2  2  
ATOM 7601   H HD3  . PRO A 1 111 ? -6.396  -6.986  2.535   1.00 2.11  ? 111 PRO A HD3  2  
ATOM 7602   N N    . LYS A 1 112 ? -9.992  -10.598 0.148   1.00 23.45 ? 112 LYS A N    2  
ATOM 7603   C CA   . LYS A 1 112 ? -10.216 -11.788 -0.665  1.00 22.12 ? 112 LYS A CA   2  
ATOM 7604   C C    . LYS A 1 112 ? -10.644 -11.406 -2.077  1.00 12.04 ? 112 LYS A C    2  
ATOM 7605   O O    . LYS A 1 112 ? -11.293 -10.381 -2.285  1.00 25.43 ? 112 LYS A O    2  
ATOM 7606   C CB   . LYS A 1 112 ? -11.279 -12.679 -0.020  1.00 51.12 ? 112 LYS A CB   2  
ATOM 7607   C CG   . LYS A 1 112 ? -10.855 -13.259 1.319   1.00 45.41 ? 112 LYS A CG   2  
ATOM 7608   C CD   . LYS A 1 112 ? -11.381 -14.672 1.507   1.00 74.31 ? 112 LYS A CD   2  
ATOM 7609   C CE   . LYS A 1 112 ? -10.530 -15.458 2.490   1.00 75.03 ? 112 LYS A CE   2  
ATOM 7610   N NZ   . LYS A 1 112 ? -10.894 -16.902 2.512   1.00 25.52 ? 112 LYS A NZ   2  
ATOM 7611   H H    . LYS A 1 112 ? -10.760 -10.153 0.566   1.00 30.30 ? 112 LYS A H    2  
ATOM 7612   H HA   . LYS A 1 112 ? -9.286  -12.332 -0.718  1.00 73.14 ? 112 LYS A HA   2  
ATOM 7613   H HB2  . LYS A 1 112 ? -12.177 -12.098 0.131   1.00 23.32 ? 112 LYS A HB2  2  
ATOM 7614   H HB3  . LYS A 1 112 ? -11.499 -13.498 -0.689  1.00 4.33  ? 112 LYS A HB3  2  
ATOM 7615   H HG2  . LYS A 1 112 ? -9.776  -13.278 1.368   1.00 42.23 ? 112 LYS A HG2  2  
ATOM 7616   H HG3  . LYS A 1 112 ? -11.242 -12.632 2.111   1.00 13.30 ? 112 LYS A HG3  2  
ATOM 7617   H HD2  . LYS A 1 112 ? -12.393 -14.623 1.883   1.00 23.51 ? 112 LYS A HD2  2  
ATOM 7618   H HD3  . LYS A 1 112 ? -11.374 -15.179 0.552   1.00 24.13 ? 112 LYS A HD3  2  
ATOM 7619   H HE2  . LYS A 1 112 ? -9.493  -15.362 2.206   1.00 33.44 ? 112 LYS A HE2  2  
ATOM 7620   H HE3  . LYS A 1 112 ? -10.671 -15.045 3.479   1.00 21.34 ? 112 LYS A HE3  2  
ATOM 7621   H HZ1  . LYS A 1 112 ? -11.728 -17.052 3.115   1.00 74.33 ? 112 LYS A HZ1  2  
ATOM 7622   H HZ2  . LYS A 1 112 ? -10.104 -17.465 2.887   1.00 74.23 ? 112 LYS A HZ2  2  
ATOM 7623   H HZ3  . LYS A 1 112 ? -11.112 -17.230 1.548   1.00 60.31 ? 112 LYS A HZ3  2  
ATOM 7624   N N    . TYR A 1 113 ? -10.278 -12.238 -3.047  1.00 62.04 ? 113 TYR A N    2  
ATOM 7625   C CA   . TYR A 1 113 ? -10.626 -11.987 -4.440  1.00 3.53  ? 113 TYR A CA   2  
ATOM 7626   C C    . TYR A 1 113 ? -11.881 -12.759 -4.833  1.00 53.21 ? 113 TYR A C    2  
ATOM 7627   O O    . TYR A 1 113 ? -12.108 -13.874 -4.364  1.00 63.33 ? 113 TYR A O    2  
ATOM 7628   C CB   . TYR A 1 113 ? -9.465  -12.377 -5.356  1.00 64.43 ? 113 TYR A CB   2  
ATOM 7629   C CG   . TYR A 1 113 ? -9.678  -11.987 -6.802  1.00 5.05  ? 113 TYR A CG   2  
ATOM 7630   C CD1  . TYR A 1 113 ? -9.697  -10.652 -7.186  1.00 24.03 ? 113 TYR A CD1  2  
ATOM 7631   C CD2  . TYR A 1 113 ? -9.859  -12.954 -7.783  1.00 34.41 ? 113 TYR A CD2  2  
ATOM 7632   C CE1  . TYR A 1 113 ? -9.890  -10.291 -8.506  1.00 51.51 ? 113 TYR A CE1  2  
ATOM 7633   C CE2  . TYR A 1 113 ? -10.055 -12.601 -9.105  1.00 13.21 ? 113 TYR A CE2  2  
ATOM 7634   C CZ   . TYR A 1 113 ? -10.068 -11.269 -9.461  1.00 12.22 ? 113 TYR A CZ   2  
ATOM 7635   O OH   . TYR A 1 113 ? -10.262 -10.914 -10.776 1.00 11.43 ? 113 TYR A OH   2  
ATOM 7636   H H    . TYR A 1 113 ? -9.762  -13.041 -2.820  1.00 12.22 ? 113 TYR A H    2  
ATOM 7637   H HA   . TYR A 1 113 ? -10.819 -10.930 -4.547  1.00 43.44 ? 113 TYR A HA   2  
ATOM 7638   H HB2  . TYR A 1 113 ? -8.565  -11.891 -5.011  1.00 5.34  ? 113 TYR A HB2  2  
ATOM 7639   H HB3  . TYR A 1 113 ? -9.329  -13.448 -5.317  1.00 32.32 ? 113 TYR A HB3  2  
ATOM 7640   H HD1  . TYR A 1 113 ? -9.556  -9.888  -6.435  1.00 21.44 ? 113 TYR A HD1  2  
ATOM 7641   H HD2  . TYR A 1 113 ? -9.849  -13.996 -7.501  1.00 73.14 ? 113 TYR A HD2  2  
ATOM 7642   H HE1  . TYR A 1 113 ? -9.901  -9.248  -8.784  1.00 61.34 ? 113 TYR A HE1  2  
ATOM 7643   H HE2  . TYR A 1 113 ? -10.194 -13.367 -9.853  1.00 32.44 ? 113 TYR A HE2  2  
ATOM 7644   H HH   . TYR A 1 113 ? -10.812 -10.129 -10.818 1.00 21.01 ? 113 TYR A HH   2  
ATOM 7645   N N    . TRP A 1 114 ? -12.691 -12.160 -5.699  1.00 71.33 ? 114 TRP A N    2  
ATOM 7646   C CA   . TRP A 1 114 ? -13.921 -12.798 -6.155  1.00 23.23 ? 114 TRP A CA   2  
ATOM 7647   C C    . TRP A 1 114 ? -13.878 -13.061 -7.658  1.00 44.30 ? 114 TRP A C    2  
ATOM 7648   O O    . TRP A 1 114 ? -14.028 -14.200 -8.100  1.00 41.14 ? 114 TRP A O    2  
ATOM 7649   C CB   . TRP A 1 114 ? -15.135 -11.939 -5.801  1.00 4.23  ? 114 TRP A CB   2  
ATOM 7650   C CG   . TRP A 1 114 ? -15.141 -11.484 -4.374  1.00 23.31 ? 114 TRP A CG   2  
ATOM 7651   C CD1  . TRP A 1 114 ? -15.016 -10.202 -3.921  1.00 61.32 ? 114 TRP A CD1  2  
ATOM 7652   C CD2  . TRP A 1 114 ? -15.278 -12.309 -3.211  1.00 43.45 ? 114 TRP A CD2  2  
ATOM 7653   N NE1  . TRP A 1 114 ? -15.065 -10.179 -2.549  1.00 63.33 ? 114 TRP A NE1  2  
ATOM 7654   C CE2  . TRP A 1 114 ? -15.227 -11.460 -2.089  1.00 31.32 ? 114 TRP A CE2  2  
ATOM 7655   C CE3  . TRP A 1 114 ? -15.440 -13.682 -3.010  1.00 74.43 ? 114 TRP A CE3  2  
ATOM 7656   C CZ2  . TRP A 1 114 ? -15.331 -11.940 -0.786  1.00 23.13 ? 114 TRP A CZ2  2  
ATOM 7657   C CZ3  . TRP A 1 114 ? -15.543 -14.158 -1.716  1.00 12.32 ? 114 TRP A CZ3  2  
ATOM 7658   C CH2  . TRP A 1 114 ? -15.489 -13.289 -0.619  1.00 42.43 ? 114 TRP A CH2  2  
ATOM 7659   H H    . TRP A 1 114 ? -12.450 -11.269 -6.039  1.00 22.42 ? 114 TRP A H    2  
ATOM 7660   H HA   . TRP A 1 114 ? -14.007 -13.746 -5.644  1.00 64.30 ? 114 TRP A HA   2  
ATOM 7661   H HB2  . TRP A 1 114 ? -15.143 -11.063 -6.429  1.00 53.25 ? 114 TRP A HB2  2  
ATOM 7662   H HB3  . TRP A 1 114 ? -16.035 -12.509 -5.974  1.00 42.10 ? 114 TRP A HB3  2  
ATOM 7663   H HD1  . TRP A 1 114 ? -14.894 -9.340  -4.562  1.00 14.42 ? 114 TRP A HD1  2  
ATOM 7664   H HE1  . TRP A 1 114 ? -14.997 -9.377  -1.991  1.00 61.23 ? 114 TRP A HE1  2  
ATOM 7665   H HE3  . TRP A 1 114 ? -15.484 -14.368 -3.843  1.00 73.33 ? 114 TRP A HE3  2  
ATOM 7666   H HZ2  . TRP A 1 114 ? -15.291 -11.284 0.070   1.00 4.14  ? 114 TRP A HZ2  2  
ATOM 7667   H HZ3  . TRP A 1 114 ? -15.668 -15.216 -1.541  1.00 33.43 ? 114 TRP A HZ3  2  
ATOM 7668   H HH2  . TRP A 1 114 ? -15.573 -13.704 0.374   1.00 41.31 ? 114 TRP A HH2  2  
ATOM 7669   N N    . GLY A 1 115 ? -13.671 -12.005 -8.439  1.00 24.40 ? 115 GLY A N    2  
ATOM 7670   C CA   . GLY A 1 115 ? -13.612 -12.163 -9.881  1.00 75.13 ? 115 GLY A CA   2  
ATOM 7671   C C    . GLY A 1 115 ? -13.442 -10.853 -10.623 1.00 32.31 ? 115 GLY A C    2  
ATOM 7672   O O    . GLY A 1 115 ? -12.935 -9.874  -10.074 1.00 63.02 ? 115 GLY A O    2  
ATOM 7673   H H    . GLY A 1 115 ? -13.558 -11.122 -8.030  1.00 14.51 ? 115 GLY A H    2  
ATOM 7674   H HA2  . GLY A 1 115 ? -12.782 -12.808 -10.124 1.00 45.51 ? 115 GLY A HA2  2  
ATOM 7675   H HA3  . GLY A 1 115 ? -14.526 -12.634 -10.214 1.00 11.43 ? 115 GLY A HA3  2  
ATOM 7676   N N    . SER A 1 116 ? -13.867 -10.844 -11.883 1.00 61.44 ? 116 SER A N    2  
ATOM 7677   C CA   . SER A 1 116 ? -13.763 -9.656  -12.723 1.00 40.04 ? 116 SER A CA   2  
ATOM 7678   C C    . SER A 1 116 ? -14.632 -9.789  -13.971 1.00 31.11 ? 116 SER A C    2  
ATOM 7679   O O    . SER A 1 116 ? -15.031 -10.891 -14.348 1.00 62.21 ? 116 SER A O    2  
ATOM 7680   C CB   . SER A 1 116 ? -12.305 -9.417  -13.123 1.00 13.15 ? 116 SER A CB   2  
ATOM 7681   O OG   . SER A 1 116 ? -11.883 -8.113  -12.766 1.00 44.45 ? 116 SER A OG   2  
ATOM 7682   H H    . SER A 1 116 ? -14.258 -11.663 -12.251 1.00 22.35 ? 116 SER A H    2  
ATOM 7683   H HA   . SER A 1 116 ? -14.110 -8.812  -12.146 1.00 0.34  ? 116 SER A HA   2  
ATOM 7684   H HB2  . SER A 1 116 ? -11.675 -10.135 -12.621 1.00 4.53  ? 116 SER A HB2  2  
ATOM 7685   H HB3  . SER A 1 116 ? -12.202 -9.535  -14.192 1.00 3.33  ? 116 SER A HB3  2  
ATOM 7686   H HG   . SER A 1 116 ? -11.291 -8.164  -12.011 1.00 40.25 ? 116 SER A HG   2  
ATOM 7687   N N    . GLY A 1 117 ? -14.918 -8.657  -14.607 1.00 71.14 ? 117 GLY A N    2  
ATOM 7688   C CA   . GLY A 1 117 ? -15.734 -8.663  -15.807 1.00 21.34 ? 117 GLY A CA   2  
ATOM 7689   C C    . GLY A 1 117 ? -15.445 -7.475  -16.703 1.00 10.43 ? 117 GLY A C    2  
ATOM 7690   O O    . GLY A 1 117 ? -15.152 -6.382  -16.220 1.00 73.31 ? 117 GLY A O    2  
ATOM 7691   H H    . GLY A 1 117 ? -14.569 -7.810  -14.258 1.00 2.21  ? 117 GLY A H    2  
ATOM 7692   H HA2  . GLY A 1 117 ? -15.540 -9.572  -16.357 1.00 54.30 ? 117 GLY A HA2  2  
ATOM 7693   H HA3  . GLY A 1 117 ? -16.774 -8.640  -15.522 1.00 5.30  ? 117 GLY A HA3  2  
ATOM 7694   N N    . LEU A 1 118 ? -15.523 -7.688  -18.013 1.00 4.41  ? 118 LEU A N    2  
ATOM 7695   C CA   . LEU A 1 118 ? -15.263 -6.623  -18.975 1.00 31.02 ? 118 LEU A CA   2  
ATOM 7696   C C    . LEU A 1 118 ? -16.398 -6.507  -19.988 1.00 25.15 ? 118 LEU A C    2  
ATOM 7697   O O    . LEU A 1 118 ? -17.304 -7.339  -20.018 1.00 30.12 ? 118 LEU A O    2  
ATOM 7698   C CB   . LEU A 1 118 ? -13.941 -6.877  -19.704 1.00 32.44 ? 118 LEU A CB   2  
ATOM 7699   C CG   . LEU A 1 118 ? -12.720 -7.033  -18.797 1.00 44.30 ? 118 LEU A CG   2  
ATOM 7700   C CD1  . LEU A 1 118 ? -12.696 -8.417  -18.167 1.00 74.52 ? 118 LEU A CD1  2  
ATOM 7701   C CD2  . LEU A 1 118 ? -11.441 -6.778  -19.578 1.00 51.33 ? 118 LEU A CD2  2  
ATOM 7702   H H    . LEU A 1 118 ? -15.758 -8.581  -18.341 1.00 31.14 ? 118 LEU A H    2  
ATOM 7703   H HA   . LEU A 1 118 ? -15.188 -5.694  -18.430 1.00 62.42 ? 118 LEU A HA   2  
ATOM 7704   H HB2  . LEU A 1 118 ? -14.047 -7.778  -20.291 1.00 34.14 ? 118 LEU A HB2  2  
ATOM 7705   H HB3  . LEU A 1 118 ? -13.759 -6.051  -20.375 1.00 5.21  ? 118 LEU A HB3  2  
ATOM 7706   H HG   . LEU A 1 118 ? -12.777 -6.305  -17.999 1.00 11.33 ? 118 LEU A HG   2  
ATOM 7707   H HD11 . LEU A 1 118 ? -13.233 -9.109  -18.799 1.00 75.25 ? 118 LEU A HD11 2  
ATOM 7708   H HD12 . LEU A 1 118 ? -13.165 -8.379  -17.195 1.00 10.32 ? 118 LEU A HD12 2  
ATOM 7709   H HD13 . LEU A 1 118 ? -11.673 -8.747  -18.061 1.00 4.43  ? 118 LEU A HD13 2  
ATOM 7710   H HD21 . LEU A 1 118 ? -10.643 -7.383  -19.171 1.00 50.33 ? 118 LEU A HD21 2  
ATOM 7711   H HD22 . LEU A 1 118 ? -11.175 -5.734  -19.505 1.00 64.31 ? 118 LEU A HD22 2  
ATOM 7712   H HD23 . LEU A 1 118 ? -11.595 -7.038  -20.615 1.00 70.53 ? 118 LEU A HD23 2  
ATOM 7713   N N    . HIS A 1 119 ? -16.340 -5.467  -20.815 1.00 32.24 ? 119 HIS A N    2  
ATOM 7714   C CA   . HIS A 1 119 ? -17.359 -5.237  -21.832 1.00 41.53 ? 119 HIS A CA   2  
ATOM 7715   C C    . HIS A 1 119 ? -16.934 -4.119  -22.780 1.00 63.00 ? 119 HIS A C    2  
ATOM 7716   O O    . HIS A 1 119 ? -16.587 -3.021  -22.343 1.00 24.43 ? 119 HIS A O    2  
ATOM 7717   C CB   . HIS A 1 119 ? -18.697 -4.887  -21.173 1.00 30.43 ? 119 HIS A CB   2  
ATOM 7718   C CG   . HIS A 1 119 ? -19.828 -5.762  -21.614 1.00 42.32 ? 119 HIS A CG   2  
ATOM 7719   N ND1  . HIS A 1 119 ? -20.000 -7.054  -21.164 1.00 11.00 ? 119 HIS A ND1  2  
ATOM 7720   C CD2  . HIS A 1 119 ? -20.850 -5.525  -22.469 1.00 12.30 ? 119 HIS A CD2  2  
ATOM 7721   C CE1  . HIS A 1 119 ? -21.078 -7.574  -21.724 1.00 42.01 ? 119 HIS A CE1  2  
ATOM 7722   N NE2  . HIS A 1 119 ? -21.612 -6.666  -22.519 1.00 14.53 ? 119 HIS A NE2  2  
ATOM 7723   H H    . HIS A 1 119 ? -15.591 -4.840  -20.740 1.00 33.42 ? 119 HIS A H    2  
ATOM 7724   H HA   . HIS A 1 119 ? -17.475 -6.149  -22.398 1.00 4.32  ? 119 HIS A HA   2  
ATOM 7725   H HB2  . HIS A 1 119 ? -18.599 -4.987  -20.102 1.00 33.30 ? 119 HIS A HB2  2  
ATOM 7726   H HB3  . HIS A 1 119 ? -18.953 -3.865  -21.411 1.00 20.22 ? 119 HIS A HB3  2  
ATOM 7727   H HD1  . HIS A 1 119 ? -19.418 -7.522  -20.528 1.00 0.53  ? 119 HIS A HD1  2  
ATOM 7728   H HD2  . HIS A 1 119 ? -21.033 -4.608  -23.012 1.00 45.41 ? 119 HIS A HD2  2  
ATOM 7729   H HE1  . HIS A 1 119 ? -21.458 -8.571  -21.558 1.00 0.30  ? 119 HIS A HE1  2  
ATOM 7730   H HE2  . HIS A 1 119 ? -22.471 -6.757  -22.983 1.00 37.47 ? 119 HIS A HE2  2  
ATOM 7731   N N    . ASP A 1 120 ? -16.960 -4.405  -24.078 1.00 51.42 ? 120 ASP A N    2  
ATOM 7732   C CA   . ASP A 1 120 ? -16.574 -3.422  -25.084 1.00 34.13 ? 120 ASP A CA   2  
ATOM 7733   C C    . ASP A 1 120 ? -17.798 -2.720  -25.662 1.00 10.23 ? 120 ASP A C    2  
ATOM 7734   O O    . ASP A 1 120 ? -18.878 -3.304  -25.749 1.00 22.24 ? 120 ASP A O    2  
ATOM 7735   C CB   . ASP A 1 120 ? -15.781 -4.094  -26.206 1.00 71.54 ? 120 ASP A CB   2  
ATOM 7736   C CG   . ASP A 1 120 ? -14.689 -5.007  -25.681 1.00 63.33 ? 120 ASP A CG   2  
ATOM 7737   O OD1  . ASP A 1 120 ? -14.463 -5.017  -24.452 1.00 33.14 ? 120 ASP A OD1  2  
ATOM 7738   O OD2  . ASP A 1 120 ? -14.062 -5.712  -26.498 1.00 32.21 ? 120 ASP A OD2  2  
ATOM 7739   H H    . ASP A 1 120 ? -17.245 -5.297  -24.368 1.00 73.41 ? 120 ASP A H    2  
ATOM 7740   H HA   . ASP A 1 120 ? -15.947 -2.686  -24.604 1.00 22.52 ? 120 ASP A HA   2  
ATOM 7741   H HB2  . ASP A 1 120 ? -16.454 -4.682  -26.812 1.00 33.53 ? 120 ASP A HB2  2  
ATOM 7742   H HB3  . ASP A 1 120 ? -15.323 -3.332  -26.821 1.00 44.13 ? 120 ASP A HB3  2  
ATOM 7743   N N    . LYS A 1 121 ? -17.621 -1.461  -26.056 1.00 20.12 ? 121 LYS A N    2  
ATOM 7744   C CA   . LYS A 1 121 ? -18.713 -0.680  -26.625 1.00 12.03 ? 121 LYS A CA   2  
ATOM 7745   C C    . LYS A 1 121 ? -18.190 0.358   -27.615 1.00 22.42 ? 121 LYS A C    2  
ATOM 7746   O O    . LYS A 1 121 ? -17.643 1.388   -27.220 1.00 63.54 ? 121 LYS A O    2  
ATOM 7747   C CB   . LYS A 1 121 ? -19.503 0.015   -25.514 1.00 20.30 ? 121 LYS A CB   2  
ATOM 7748   C CG   . LYS A 1 121 ? -20.685 -0.797  -25.009 1.00 74.11 ? 121 LYS A CG   2  
ATOM 7749   C CD   . LYS A 1 121 ? -20.945 -0.543  -23.533 1.00 0.30  ? 121 LYS A CD   2  
ATOM 7750   C CE   . LYS A 1 121 ? -22.434 -0.494  -23.229 1.00 45.41 ? 121 LYS A CE   2  
ATOM 7751   N NZ   . LYS A 1 121 ? -22.971 -1.835  -22.869 1.00 73.43 ? 121 LYS A NZ   2  
ATOM 7752   H H    . LYS A 1 121 ? -16.737 -1.050  -25.959 1.00 54.12 ? 121 LYS A H    2  
ATOM 7753   H HA   . LYS A 1 121 ? -19.369 -1.359  -27.148 1.00 1.40  ? 121 LYS A HA   2  
ATOM 7754   H HB2  . LYS A 1 121 ? -18.842 0.203   -24.681 1.00 4.14  ? 121 LYS A HB2  2  
ATOM 7755   H HB3  . LYS A 1 121 ? -19.875 0.957   -25.886 1.00 1.44  ? 121 LYS A HB3  2  
ATOM 7756   H HG2  . LYS A 1 121 ? -21.564 -0.522  -25.571 1.00 44.14 ? 121 LYS A HG2  2  
ATOM 7757   H HG3  . LYS A 1 121 ? -20.476 -1.847  -25.153 1.00 51.31 ? 121 LYS A HG3  2  
ATOM 7758   H HD2  . LYS A 1 121 ? -20.497 -1.338  -22.956 1.00 2.33  ? 121 LYS A HD2  2  
ATOM 7759   H HD3  . LYS A 1 121 ? -20.499 0.401   -23.256 1.00 53.10 ? 121 LYS A HD3  2  
ATOM 7760   H HE2  . LYS A 1 121 ? -22.599 0.183   -22.405 1.00 63.23 ? 121 LYS A HE2  2  
ATOM 7761   H HE3  . LYS A 1 121 ? -22.954 -0.130  -24.103 1.00 51.41 ? 121 LYS A HE3  2  
ATOM 7762   H HZ1  . LYS A 1 121 ? -23.700 -1.742  -22.132 1.00 44.11 ? 121 LYS A HZ1  2  
ATOM 7763   H HZ2  . LYS A 1 121 ? -22.208 -2.443  -22.510 1.00 22.32 ? 121 LYS A HZ2  2  
ATOM 7764   H HZ3  . LYS A 1 121 ? -23.395 -2.287  -23.704 1.00 44.13 ? 121 LYS A HZ3  2  
ATOM 7765   N N    . ASN A 1 122 ? -18.366 0.080   -28.904 1.00 22.32 ? 122 ASN A N    2  
ATOM 7766   C CA   . ASN A 1 122 ? -17.919 0.989   -29.954 1.00 23.44 ? 122 ASN A CA   2  
ATOM 7767   C C    . ASN A 1 122 ? -16.413 1.224   -29.881 1.00 22.34 ? 122 ASN A C    2  
ATOM 7768   O O    . ASN A 1 122 ? -15.935 2.330   -30.136 1.00 32.45 ? 122 ASN A O    2  
ATOM 7769   C CB   . ASN A 1 122 ? -18.660 2.324   -29.847 1.00 54.22 ? 122 ASN A CB   2  
ATOM 7770   C CG   . ASN A 1 122 ? -20.165 2.151   -29.847 1.00 43.24 ? 122 ASN A CG   2  
ATOM 7771   O OD1  . ASN A 1 122 ? -20.687 1.142   -29.371 1.00 72.12 ? 122 ASN A OD1  2  
ATOM 7772   N ND2  . ASN A 1 122 ? -20.874 3.138   -30.384 1.00 64.15 ? 122 ASN A ND2  2  
ATOM 7773   H H    . ASN A 1 122 ? -18.813 -0.756  -29.154 1.00 52.33 ? 122 ASN A H    2  
ATOM 7774   H HA   . ASN A 1 122 ? -18.153 0.535   -30.904 1.00 53.15 ? 122 ASN A HA   2  
ATOM 7775   H HB2  . ASN A 1 122 ? -18.372 2.815   -28.931 1.00 60.21 ? 122 ASN A HB2  2  
ATOM 7776   H HB3  . ASN A 1 122 ? -18.386 2.948   -30.687 1.00 31.11 ? 122 ASN A HB3  2  
ATOM 7777   H HD21 . ASN A 1 122 ? -20.393 3.912   -30.745 1.00 40.44 ? 122 ASN A HD21 2  
ATOM 7778   H HD22 . ASN A 1 122 ? -21.850 3.053   -30.397 1.00 23.23 ? 122 ASN A HD22 2  
ATOM 7779   N N    . GLY A 1 123 ? -15.669 0.180   -29.533 1.00 3.30  ? 123 GLY A N    2  
ATOM 7780   C CA   . GLY A 1 123 ? -14.225 0.297   -29.436 1.00 42.43 ? 123 GLY A CA   2  
ATOM 7781   C C    . GLY A 1 123 ? -13.755 0.560   -28.017 1.00 33.14 ? 123 GLY A C    2  
ATOM 7782   O O    . GLY A 1 123 ? -12.596 0.317   -27.686 1.00 2.35  ? 123 GLY A O    2  
ATOM 7783   H H    . GLY A 1 123 ? -16.102 -0.678  -29.340 1.00 62.43 ? 123 GLY A H    2  
ATOM 7784   H HA2  . GLY A 1 123 ? -13.776 -0.620  -29.787 1.00 3.41  ? 123 GLY A HA2  2  
ATOM 7785   H HA3  . GLY A 1 123 ? -13.898 1.109   -30.068 1.00 10.35 ? 123 GLY A HA3  2  
ATOM 7786   N N    . LYS A 1 124 ? -14.660 1.054   -27.177 1.00 14.24 ? 124 LYS A N    2  
ATOM 7787   C CA   . LYS A 1 124 ? -14.329 1.343   -25.787 1.00 62.33 ? 124 LYS A CA   2  
ATOM 7788   C C    . LYS A 1 124 ? -14.488 0.093   -24.930 1.00 71.51 ? 124 LYS A C    2  
ATOM 7789   O O    . LYS A 1 124 ? -15.579 -0.467  -24.829 1.00 3.15  ? 124 LYS A O    2  
ATOM 7790   C CB   . LYS A 1 124 ? -15.221 2.463   -25.249 1.00 13.04 ? 124 LYS A CB   2  
ATOM 7791   C CG   . LYS A 1 124 ? -14.745 3.855   -25.629 1.00 3.35  ? 124 LYS A CG   2  
ATOM 7792   C CD   . LYS A 1 124 ? -13.904 4.477   -24.526 1.00 24.23 ? 124 LYS A CD   2  
ATOM 7793   C CE   . LYS A 1 124 ? -14.736 5.387   -23.637 1.00 72.24 ? 124 LYS A CE   2  
ATOM 7794   N NZ   . LYS A 1 124 ? -14.594 6.818   -24.019 1.00 54.54 ? 124 LYS A NZ   2  
ATOM 7795   H H    . LYS A 1 124 ? -15.569 1.223   -27.501 1.00 33.22 ? 124 LYS A H    2  
ATOM 7796   H HA   . LYS A 1 124 ? -13.299 1.664   -25.750 1.00 22.20 ? 124 LYS A HA   2  
ATOM 7797   H HB2  . LYS A 1 124 ? -16.221 2.330   -25.637 1.00 1.43  ? 124 LYS A HB2  2  
ATOM 7798   H HB3  . LYS A 1 124 ? -15.251 2.398   -24.172 1.00 63.30 ? 124 LYS A HB3  2  
ATOM 7799   H HG2  . LYS A 1 124 ? -14.149 3.789   -26.527 1.00 4.24  ? 124 LYS A HG2  2  
ATOM 7800   H HG3  . LYS A 1 124 ? -15.605 4.483   -25.811 1.00 65.31 ? 124 LYS A HG3  2  
ATOM 7801   H HD2  . LYS A 1 124 ? -13.480 3.688   -23.922 1.00 33.11 ? 124 LYS A HD2  2  
ATOM 7802   H HD3  . LYS A 1 124 ? -13.109 5.055   -24.974 1.00 70.32 ? 124 LYS A HD3  2  
ATOM 7803   H HE2  . LYS A 1 124 ? -15.774 5.103   -23.723 1.00 4.35  ? 124 LYS A HE2  2  
ATOM 7804   H HE3  . LYS A 1 124 ? -14.413 5.261   -22.613 1.00 44.35 ? 124 LYS A HE3  2  
ATOM 7805   H HZ1  . LYS A 1 124 ? -15.435 7.354   -23.722 1.00 35.34 ? 124 LYS A HZ1  2  
ATOM 7806   H HZ2  . LYS A 1 124 ? -14.488 6.906   -25.050 1.00 42.14 ? 124 LYS A HZ2  2  
ATOM 7807   H HZ3  . LYS A 1 124 ? -13.755 7.229   -23.560 1.00 14.54 ? 124 LYS A HZ3  2  
ATOM 7808   N N    . SER A 1 125 ? -13.393 -0.346  -24.317 1.00 2.04  ? 125 SER A N    2  
ATOM 7809   C CA   . SER A 1 125 ? -13.418 -1.535  -23.475 1.00 50.44 ? 125 SER A CA   2  
ATOM 7810   C C    . SER A 1 125 ? -13.388 -1.164  -21.997 1.00 53.44 ? 125 SER A C    2  
ATOM 7811   O O    . SER A 1 125 ? -12.641 -0.277  -21.582 1.00 64.33 ? 125 SER A O    2  
ATOM 7812   C CB   . SER A 1 125 ? -12.235 -2.446  -23.809 1.00 61.43 ? 125 SER A CB   2  
ATOM 7813   O OG   . SER A 1 125 ? -12.591 -3.408  -24.786 1.00 51.40 ? 125 SER A OG   2  
ATOM 7814   H H    . SER A 1 125 ? -12.548 0.135   -24.435 1.00 30.31 ? 125 SER A H    2  
ATOM 7815   H HA   . SER A 1 125 ? -14.336 -2.066  -23.679 1.00 73.41 ? 125 SER A HA   2  
ATOM 7816   H HB2  . SER A 1 125 ? -11.420 -1.849  -24.191 1.00 41.11 ? 125 SER A HB2  2  
ATOM 7817   H HB3  . SER A 1 125 ? -11.915 -2.960  -22.914 1.00 15.53 ? 125 SER A HB3  2  
ATOM 7818   H HG   . SER A 1 125 ? -12.946 -2.963  -25.560 1.00 22.12 ? 125 SER A HG   2  
ATOM 7819   N N    . TYR A 1 126 ? -14.206 -1.852  -21.208 1.00 60.31 ? 126 TYR A N    2  
ATOM 7820   C CA   . TYR A 1 126 ? -14.276 -1.603  -19.773 1.00 32.22 ? 126 TYR A CA   2  
ATOM 7821   C C    . TYR A 1 126 ? -13.865 -2.843  -18.987 1.00 3.30  ? 126 TYR A C    2  
ATOM 7822   O O    . TYR A 1 126 ? -13.912 -3.961  -19.502 1.00 20.22 ? 126 TYR A O    2  
ATOM 7823   C CB   . TYR A 1 126 ? -15.692 -1.180  -19.378 1.00 21.34 ? 126 TYR A CB   2  
ATOM 7824   C CG   . TYR A 1 126 ? -15.959 0.296   -19.567 1.00 41.23 ? 126 TYR A CG   2  
ATOM 7825   C CD1  . TYR A 1 126 ? -15.622 1.214   -18.580 1.00 0.10  ? 126 TYR A CD1  2  
ATOM 7826   C CD2  . TYR A 1 126 ? -16.548 0.770   -20.733 1.00 52.31 ? 126 TYR A CD2  2  
ATOM 7827   C CE1  . TYR A 1 126 ? -15.865 2.564   -18.751 1.00 45.10 ? 126 TYR A CE1  2  
ATOM 7828   C CE2  . TYR A 1 126 ? -16.793 2.119   -20.910 1.00 1.52  ? 126 TYR A CE2  2  
ATOM 7829   C CZ   . TYR A 1 126 ? -16.449 3.011   -19.917 1.00 52.24 ? 126 TYR A CZ   2  
ATOM 7830   O OH   . TYR A 1 126 ? -16.693 4.355   -20.090 1.00 11.02 ? 126 TYR A OH   2  
ATOM 7831   H H    . TYR A 1 126 ? -14.775 -2.547  -21.600 1.00 42.15 ? 126 TYR A H    2  
ATOM 7832   H HA   . TYR A 1 126 ? -13.592 -0.800  -19.541 1.00 2.43  ? 126 TYR A HA   2  
ATOM 7833   H HB2  . TYR A 1 126 ? -16.404 -1.726  -19.978 1.00 2.12  ? 126 TYR A HB2  2  
ATOM 7834   H HB3  . TYR A 1 126 ? -15.852 -1.416  -18.335 1.00 23.04 ? 126 TYR A HB3  2  
ATOM 7835   H HD1  . TYR A 1 126 ? -15.164 0.862   -17.669 1.00 31.53 ? 126 TYR A HD1  2  
ATOM 7836   H HD2  . TYR A 1 126 ? -16.815 0.069   -21.509 1.00 15.35 ? 126 TYR A HD2  2  
ATOM 7837   H HE1  . TYR A 1 126 ? -15.596 3.263   -17.972 1.00 3.44  ? 126 TYR A HE1  2  
ATOM 7838   H HE2  . TYR A 1 126 ? -17.251 2.469   -21.823 1.00 34.22 ? 126 TYR A HE2  2  
ATOM 7839   H HH   . TYR A 1 126 ? -15.898 4.784   -20.414 1.00 74.51 ? 126 TYR A HH   2  
ATOM 7840   N N    . ARG A 1 127 ? -13.462 -2.638  -17.739 1.00 30.11 ? 127 ARG A N    2  
ATOM 7841   C CA   . ARG A 1 127 ? -13.043 -3.738  -16.878 1.00 54.03 ? 127 ARG A CA   2  
ATOM 7842   C C    . ARG A 1 127 ? -13.282 -3.393  -15.413 1.00 53.54 ? 127 ARG A C    2  
ATOM 7843   O O    . ARG A 1 127 ? -13.095 -2.249  -14.998 1.00 21.12 ? 127 ARG A O    2  
ATOM 7844   C CB   . ARG A 1 127 ? -11.565 -4.057  -17.106 1.00 1.55  ? 127 ARG A CB   2  
ATOM 7845   C CG   . ARG A 1 127 ? -11.060 -5.226  -16.273 1.00 12.22 ? 127 ARG A CG   2  
ATOM 7846   C CD   . ARG A 1 127 ? -9.844  -5.878  -16.909 1.00 14.12 ? 127 ARG A CD   2  
ATOM 7847   N NE   . ARG A 1 127 ? -9.808  -7.320  -16.673 1.00 42.41 ? 127 ARG A NE   2  
ATOM 7848   C CZ   . ARG A 1 127 ? -9.077  -8.171  -17.389 1.00 52.21 ? 127 ARG A CZ   2  
ATOM 7849   N NH1  . ARG A 1 127 ? -8.319  -7.731  -18.385 1.00 43.22 ? 127 ARG A NH1  2  
ATOM 7850   N NH2  . ARG A 1 127 ? -9.103  -9.466  -17.106 1.00 4.33  ? 127 ARG A NH2  2  
ATOM 7851   H H    . ARG A 1 127 ? -13.447 -1.724  -17.385 1.00 1.44  ? 127 ARG A H    2  
ATOM 7852   H HA   . ARG A 1 127 ? -13.635 -4.604  -17.134 1.00 74.32 ? 127 ARG A HA   2  
ATOM 7853   H HB2  . ARG A 1 127 ? -11.416 -4.295  -18.148 1.00 51.41 ? 127 ARG A HB2  2  
ATOM 7854   H HB3  . ARG A 1 127 ? -10.977 -3.187  -16.856 1.00 2.25  ? 127 ARG A HB3  2  
ATOM 7855   H HG2  . ARG A 1 127 ? -10.791 -4.867  -15.292 1.00 1.02  ? 127 ARG A HG2  2  
ATOM 7856   H HG3  . ARG A 1 127 ? -11.847 -5.960  -16.188 1.00 61.34 ? 127 ARG A HG3  2  
ATOM 7857   H HD2  . ARG A 1 127 ? -9.868  -5.698  -17.973 1.00 43.34 ? 127 ARG A HD2  2  
ATOM 7858   H HD3  . ARG A 1 127 ? -8.952  -5.433  -16.491 1.00 31.32 ? 127 ARG A HD3  2  
ATOM 7859   H HE   . ARG A 1 127 ? -10.360 -7.672  -15.944 1.00 12.50 ? 127 ARG A HE   2  
ATOM 7860   H HH11 . ARG A 1 127 ? -8.295  -6.756  -18.603 1.00 30.22 ? 127 ARG A HH11 2  
ATOM 7861   H HH12 . ARG A 1 127 ? -7.771  -8.376  -18.918 1.00 15.50 ? 127 ARG A HH12 2  
ATOM 7862   H HH21 . ARG A 1 127 ? -9.672  -9.804  -16.356 1.00 52.02 ? 127 ARG A HH21 2  
ATOM 7863   H HH22 . ARG A 1 127 ? -8.553  -10.106 -17.643 1.00 74.25 ? 127 ARG A HH22 2  
ATOM 7864   N N    . PHE A 1 128 ? -13.700 -4.384  -14.632 1.00 72.43 ? 128 PHE A N    2  
ATOM 7865   C CA   . PHE A 1 128 ? -13.966 -4.172  -13.215 1.00 31.02 ? 128 PHE A CA   2  
ATOM 7866   C C    . PHE A 1 128 ? -13.553 -5.385  -12.389 1.00 51.52 ? 128 PHE A C    2  
ATOM 7867   O O    . PHE A 1 128 ? -13.790 -6.528  -12.781 1.00 63.23 ? 128 PHE A O    2  
ATOM 7868   C CB   . PHE A 1 128 ? -15.451 -3.876  -12.995 1.00 34.35 ? 128 PHE A CB   2  
ATOM 7869   C CG   . PHE A 1 128 ? -16.367 -4.817  -13.724 1.00 74.41 ? 128 PHE A CG   2  
ATOM 7870   C CD1  . PHE A 1 128 ? -16.671 -6.060  -13.191 1.00 24.32 ? 128 PHE A CD1  2  
ATOM 7871   C CD2  . PHE A 1 128 ? -16.926 -4.458  -14.939 1.00 43.24 ? 128 PHE A CD2  2  
ATOM 7872   C CE1  . PHE A 1 128 ? -17.516 -6.927  -13.860 1.00 40.45 ? 128 PHE A CE1  2  
ATOM 7873   C CE2  . PHE A 1 128 ? -17.770 -5.320  -15.612 1.00 44.31 ? 128 PHE A CE2  2  
ATOM 7874   C CZ   . PHE A 1 128 ? -18.065 -6.556  -15.072 1.00 12.03 ? 128 PHE A CZ   2  
ATOM 7875   H H    . PHE A 1 128 ? -13.835 -5.276  -15.016 1.00 43.24 ? 128 PHE A H    2  
ATOM 7876   H HA   . PHE A 1 128 ? -13.388 -3.319  -12.894 1.00 13.53 ? 128 PHE A HA   2  
ATOM 7877   H HB2  . PHE A 1 128 ? -15.671 -3.947  -11.941 1.00 65.21 ? 128 PHE A HB2  2  
ATOM 7878   H HB3  . PHE A 1 128 ? -15.664 -2.874  -13.335 1.00 61.50 ? 128 PHE A HB3  2  
ATOM 7879   H HD1  . PHE A 1 128 ? -16.242 -6.350  -12.244 1.00 73.13 ? 128 PHE A HD1  2  
ATOM 7880   H HD2  . PHE A 1 128 ? -16.694 -3.491  -15.363 1.00 43.32 ? 128 PHE A HD2  2  
ATOM 7881   H HE1  . PHE A 1 128 ? -17.745 -7.893  -13.435 1.00 44.33 ? 128 PHE A HE1  2  
ATOM 7882   H HE2  . PHE A 1 128 ? -18.200 -5.028  -16.559 1.00 52.10 ? 128 PHE A HE2  2  
ATOM 7883   H HZ   . PHE A 1 128 ? -18.726 -7.232  -15.595 1.00 45.02 ? 128 PHE A HZ   2  
ATOM 7884   N N    . MET A 1 129 ? -12.943 -5.125  -11.237 1.00 44.14 ? 129 MET A N    2  
ATOM 7885   C CA   . MET A 1 129 ? -12.504 -6.192  -10.344 1.00 15.13 ? 129 MET A CA   2  
ATOM 7886   C C    . MET A 1 129 ? -13.408 -6.257  -9.119  1.00 33.10 ? 129 MET A C    2  
ATOM 7887   O O    . MET A 1 129 ? -13.855 -5.226  -8.617  1.00 23.41 ? 129 MET A O    2  
ATOM 7888   C CB   . MET A 1 129 ? -11.054 -5.965  -9.912  1.00 51.31 ? 129 MET A CB   2  
ATOM 7889   C CG   . MET A 1 129 ? -10.136 -5.562  -11.055 1.00 1.34  ? 129 MET A CG   2  
ATOM 7890   S SD   . MET A 1 129 ? -9.323  -3.977  -10.774 1.00 33.22 ? 129 MET A SD   2  
ATOM 7891   C CE   . MET A 1 129 ? -8.493  -4.292  -9.219  1.00 73.14 ? 129 MET A CE   2  
ATOM 7892   H H    . MET A 1 129 ? -12.791 -4.190  -10.979 1.00 1.14  ? 129 MET A H    2  
ATOM 7893   H HA   . MET A 1 129 ? -12.572 -7.127  -10.880 1.00 55.25 ? 129 MET A HA   2  
ATOM 7894   H HB2  . MET A 1 129 ? -11.032 -5.184  -9.166  1.00 53.40 ? 129 MET A HB2  2  
ATOM 7895   H HB3  . MET A 1 129 ? -10.673 -6.877  -9.477  1.00 44.21 ? 129 MET A HB3  2  
ATOM 7896   H HG2  . MET A 1 129 ? -9.378  -6.321  -11.174 1.00 1.15  ? 129 MET A HG2  2  
ATOM 7897   H HG3  . MET A 1 129 ? -10.720 -5.495  -11.961 1.00 43.44 ? 129 MET A HG3  2  
ATOM 7898   H HE1  . MET A 1 129 ? -8.233  -3.354  -8.753  1.00 62.34 ? 129 MET A HE1  2  
ATOM 7899   H HE2  . MET A 1 129 ? -7.595  -4.865  -9.400  1.00 44.41 ? 129 MET A HE2  2  
ATOM 7900   H HE3  . MET A 1 129 ? -9.150  -4.849  -8.567  1.00 42.22 ? 129 MET A HE3  2  
ATOM 7901   N N    . ILE A 1 130 ? -13.689 -7.467  -8.644  1.00 62.12 ? 130 ILE A N    2  
ATOM 7902   C CA   . ILE A 1 130 ? -14.554 -7.645  -7.485  1.00 14.02 ? 130 ILE A CA   2  
ATOM 7903   C C    . ILE A 1 130 ? -13.750 -7.874  -6.209  1.00 55.33 ? 130 ILE A C    2  
ATOM 7904   O O    . ILE A 1 130 ? -12.909 -8.773  -6.141  1.00 51.51 ? 130 ILE A O    2  
ATOM 7905   C CB   . ILE A 1 130 ? -15.511 -8.835  -7.686  1.00 32.12 ? 130 ILE A CB   2  
ATOM 7906   C CG1  . ILE A 1 130 ? -16.180 -8.756  -9.058  1.00 24.23 ? 130 ILE A CG1  2  
ATOM 7907   C CG2  . ILE A 1 130 ? -16.554 -8.871  -6.581  1.00 31.15 ? 130 ILE A CG2  2  
ATOM 7908   C CD1  . ILE A 1 130 ? -17.046 -7.532  -9.235  1.00 50.12 ? 130 ILE A CD1  2  
ATOM 7909   H H    . ILE A 1 130 ? -13.323 -8.266  -9.075  1.00 61.12 ? 130 ILE A H    2  
ATOM 7910   H HA   . ILE A 1 130 ? -15.148 -6.750  -7.371  1.00 54.54 ? 130 ILE A HA   2  
ATOM 7911   H HB   . ILE A 1 130 ? -14.931 -9.741  -7.631  1.00 41.02 ? 130 ILE A HB   2  
ATOM 7912   H HG12 . ILE A 1 130 ? -15.419 -8.736  -9.823  1.00 30.23 ? 130 ILE A HG12 2  
ATOM 7913   H HG13 . ILE A 1 130 ? -16.802 -9.628  -9.198  1.00 12.21 ? 130 ILE A HG13 2  
ATOM 7914   H HG21 . ILE A 1 130 ? -17.462 -8.398  -6.927  1.00 64.22 ? 130 ILE A HG21 2  
ATOM 7915   H HG22 . ILE A 1 130 ? -16.181 -8.344  -5.715  1.00 72.51 ? 130 ILE A HG22 2  
ATOM 7916   H HG23 . ILE A 1 130 ? -16.763 -9.897  -6.316  1.00 45.04 ? 130 ILE A HG23 2  
ATOM 7917   H HD11 . ILE A 1 130 ? -16.570 -6.685  -8.765  1.00 70.23 ? 130 ILE A HD11 2  
ATOM 7918   H HD12 . ILE A 1 130 ? -18.009 -7.704  -8.776  1.00 22.20 ? 130 ILE A HD12 2  
ATOM 7919   H HD13 . ILE A 1 130 ? -17.178 -7.333  -10.288 1.00 32.33 ? 130 ILE A HD13 2  
ATOM 7920   N N    . MET A 1 131 ? -14.033 -7.062  -5.195  1.00 54.04 ? 131 MET A N    2  
ATOM 7921   C CA   . MET A 1 131 ? -13.358 -7.169  -3.906  1.00 61.23 ? 131 MET A CA   2  
ATOM 7922   C C    . MET A 1 131 ? -14.373 -7.082  -2.771  1.00 45.24 ? 131 MET A C    2  
ATOM 7923   O O    . MET A 1 131 ? -15.543 -6.777  -3.001  1.00 34.31 ? 131 MET A O    2  
ATOM 7924   C CB   . MET A 1 131 ? -12.309 -6.065  -3.759  1.00 11.43 ? 131 MET A CB   2  
ATOM 7925   C CG   . MET A 1 131 ? -12.894 -4.663  -3.773  1.00 53.22 ? 131 MET A CG   2  
ATOM 7926   S SD   . MET A 1 131 ? -11.635 -3.387  -3.966  1.00 13.50 ? 131 MET A SD   2  
ATOM 7927   C CE   . MET A 1 131 ? -12.632 -1.906  -3.839  1.00 42.12 ? 131 MET A CE   2  
ATOM 7928   H H    . MET A 1 131 ? -14.724 -6.377  -5.313  1.00 23.23 ? 131 MET A H    2  
ATOM 7929   H HA   . MET A 1 131 ? -12.869 -8.131  -3.865  1.00 44.03 ? 131 MET A HA   2  
ATOM 7930   H HB2  . MET A 1 131 ? -11.785 -6.204  -2.824  1.00 75.41 ? 131 MET A HB2  2  
ATOM 7931   H HB3  . MET A 1 131 ? -11.602 -6.146  -4.572  1.00 55.43 ? 131 MET A HB3  2  
ATOM 7932   H HG2  . MET A 1 131 ? -13.592 -4.587  -4.593  1.00 65.50 ? 131 MET A HG2  2  
ATOM 7933   H HG3  . MET A 1 131 ? -13.416 -4.497  -2.842  1.00 23.14 ? 131 MET A HG3  2  
ATOM 7934   H HE1  . MET A 1 131 ? -13.370 -2.033  -3.062  1.00 62.14 ? 131 MET A HE1  2  
ATOM 7935   H HE2  . MET A 1 131 ? -13.130 -1.724  -4.781  1.00 41.11 ? 131 MET A HE2  2  
ATOM 7936   H HE3  . MET A 1 131 ? -11.999 -1.064  -3.599  1.00 4.33  ? 131 MET A HE3  2  
ATOM 7937   N N    . ASP A 1 132 ? -13.928 -7.349  -1.547  1.00 14.23 ? 132 ASP A N    2  
ATOM 7938   C CA   . ASP A 1 132 ? -14.814 -7.297  -0.390  1.00 33.45 ? 132 ASP A CA   2  
ATOM 7939   C C    . ASP A 1 132 ? -14.918 -5.877  0.157   1.00 1.35  ? 132 ASP A C    2  
ATOM 7940   O O    . ASP A 1 132 ? -14.225 -4.971  -0.306  1.00 31.52 ? 132 ASP A O    2  
ATOM 7941   C CB   . ASP A 1 132 ? -14.313 -8.242  0.705   1.00 61.10 ? 132 ASP A CB   2  
ATOM 7942   C CG   . ASP A 1 132 ? -15.446 -8.838  1.517   1.00 73.01 ? 132 ASP A CG   2  
ATOM 7943   O OD1  . ASP A 1 132 ? -16.452 -8.134  1.741   1.00 11.51 ? 132 ASP A OD1  2  
ATOM 7944   O OD2  . ASP A 1 132 ? -15.325 -10.011 1.929   1.00 41.25 ? 132 ASP A OD2  2  
ATOM 7945   H H    . ASP A 1 132 ? -12.987 -7.588  -1.413  1.00 24.13 ? 132 ASP A H    2  
ATOM 7946   H HA   . ASP A 1 132 ? -15.794 -7.620  -0.709  1.00 64.22 ? 132 ASP A HA   2  
ATOM 7947   H HB2  . ASP A 1 132 ? -13.758 -9.047  0.249   1.00 44.02 ? 132 ASP A HB2  2  
ATOM 7948   H HB3  . ASP A 1 132 ? -13.664 -7.695  1.372   1.00 43.52 ? 132 ASP A HB3  2  
ATOM 7949   N N    . ARG A 1 133 ? -15.788 -5.691  1.144   1.00 35.13 ? 133 ARG A N    2  
ATOM 7950   C CA   . ARG A 1 133 ? -15.984 -4.382  1.755   1.00 11.43 ? 133 ARG A CA   2  
ATOM 7951   C C    . ARG A 1 133 ? -15.007 -4.169  2.907   1.00 54.22 ? 133 ARG A C    2  
ATOM 7952   O O    . ARG A 1 133 ? -14.282 -5.084  3.297   1.00 61.21 ? 133 ARG A O    2  
ATOM 7953   C CB   . ARG A 1 133 ? -17.424 -4.241  2.256   1.00 1.04  ? 133 ARG A CB   2  
ATOM 7954   C CG   . ARG A 1 133 ? -18.034 -2.876  1.978   1.00 52.20 ? 133 ARG A CG   2  
ATOM 7955   C CD   . ARG A 1 133 ? -18.078 -2.015  3.231   1.00 1.34  ? 133 ARG A CD   2  
ATOM 7956   N NE   . ARG A 1 133 ? -19.375 -1.364  3.401   1.00 74.43 ? 133 ARG A NE   2  
ATOM 7957   C CZ   . ARG A 1 133 ? -19.855 -0.440  2.573   1.00 52.13 ? 133 ARG A CZ   2  
ATOM 7958   N NH1  . ARG A 1 133 ? -19.150 -0.055  1.516   1.00 14.34 ? 133 ARG A NH1  2  
ATOM 7959   N NH2  . ARG A 1 133 ? -21.045 0.100   2.800   1.00 62.34 ? 133 ARG A NH2  2  
ATOM 7960   H H    . ARG A 1 133 ? -16.312 -6.454  1.469   1.00 3.31  ? 133 ARG A H    2  
ATOM 7961   H HA   . ARG A 1 133 ? -15.800 -3.633  1.000   1.00 44.23 ? 133 ARG A HA   2  
ATOM 7962   H HB2  . ARG A 1 133 ? -18.035 -4.989  1.772   1.00 32.20 ? 133 ARG A HB2  2  
ATOM 7963   H HB3  . ARG A 1 133 ? -17.441 -4.410  3.322   1.00 33.44 ? 133 ARG A HB3  2  
ATOM 7964   H HG2  . ARG A 1 133 ? -17.439 -2.373  1.230   1.00 50.23 ? 133 ARG A HG2  2  
ATOM 7965   H HG3  . ARG A 1 133 ? -19.039 -3.011  1.609   1.00 55.31 ? 133 ARG A HG3  2  
ATOM 7966   H HD2  . ARG A 1 133 ? -17.885 -2.640  4.091   1.00 62.14 ? 133 ARG A HD2  2  
ATOM 7967   H HD3  . ARG A 1 133 ? -17.312 -1.257  3.159   1.00 4.41  ? 133 ARG A HD3  2  
ATOM 7968   H HE   . ARG A 1 133 ? -19.916 -1.630  4.174   1.00 11.35 ? 133 ARG A HE   2  
ATOM 7969   H HH11 . ARG A 1 133 ? -18.252 -0.459  1.339   1.00 64.33 ? 133 ARG A HH11 2  
ATOM 7970   H HH12 . ARG A 1 133 ? -19.516 0.640   0.897   1.00 63.22 ? 133 ARG A HH12 2  
ATOM 7971   H HH21 . ARG A 1 133 ? -21.580 -0.187  3.594   1.00 62.44 ? 133 ARG A HH21 2  
ATOM 7972   H HH22 . ARG A 1 133 ? -21.406 0.794   2.178   1.00 43.13 ? 133 ARG A HH22 2  
ATOM 7973   N N    . PHE A 1 134 ? -14.995 -2.955  3.448   1.00 12.13 ? 134 PHE A N    2  
ATOM 7974   C CA   . PHE A 1 134 ? -14.108 -2.620  4.557   1.00 72.24 ? 134 PHE A CA   2  
ATOM 7975   C C    . PHE A 1 134 ? -14.726 -1.544  5.443   1.00 24.24 ? 134 PHE A C    2  
ATOM 7976   O O    . PHE A 1 134 ? -15.856 -1.111  5.215   1.00 12.24 ? 134 PHE A O    2  
ATOM 7977   C CB   . PHE A 1 134 ? -12.752 -2.149  4.027   1.00 62.24 ? 134 PHE A CB   2  
ATOM 7978   C CG   . PHE A 1 134 ? -11.739 -3.251  3.916   1.00 33.14 ? 134 PHE A CG   2  
ATOM 7979   C CD1  . PHE A 1 134 ? -11.113 -3.752  5.046   1.00 23.54 ? 134 PHE A CD1  2  
ATOM 7980   C CD2  . PHE A 1 134 ? -11.411 -3.787  2.680   1.00 62.15 ? 134 PHE A CD2  2  
ATOM 7981   C CE1  . PHE A 1 134 ? -10.181 -4.766  4.947   1.00 72.41 ? 134 PHE A CE1  2  
ATOM 7982   C CE2  . PHE A 1 134 ? -10.480 -4.802  2.575   1.00 4.04  ? 134 PHE A CE2  2  
ATOM 7983   C CZ   . PHE A 1 134 ? -9.863  -5.292  3.710   1.00 33.21 ? 134 PHE A CZ   2  
ATOM 7984   H H    . PHE A 1 134 ? -15.597 -2.268  3.094   1.00 10.14 ? 134 PHE A H    2  
ATOM 7985   H HA   . PHE A 1 134 ? -13.963 -3.514  5.145   1.00 21.22 ? 134 PHE A HA   2  
ATOM 7986   H HB2  . PHE A 1 134 ? -12.886 -1.720  3.046   1.00 22.33 ? 134 PHE A HB2  2  
ATOM 7987   H HB3  . PHE A 1 134 ? -12.356 -1.396  4.693   1.00 75.44 ? 134 PHE A HB3  2  
ATOM 7988   H HD1  . PHE A 1 134 ? -11.360 -3.341  6.014   1.00 22.30 ? 134 PHE A HD1  2  
ATOM 7989   H HD2  . PHE A 1 134 ? -11.892 -3.404  1.792   1.00 13.50 ? 134 PHE A HD2  2  
ATOM 7990   H HE1  . PHE A 1 134 ? -9.701  -5.148  5.836   1.00 31.51 ? 134 PHE A HE1  2  
ATOM 7991   H HE2  . PHE A 1 134 ? -10.233 -5.212  1.606   1.00 4.14  ? 134 PHE A HE2  2  
ATOM 7992   H HZ   . PHE A 1 134 ? -9.135  -6.086  3.631   1.00 52.23 ? 134 PHE A HZ   2  
ATOM 7993   N N    . GLY A 1 135 ? -13.978 -1.115  6.454   1.00 34.25 ? 135 GLY A N    2  
ATOM 7994   C CA   . GLY A 1 135 ? -14.469 -0.092  7.358   1.00 45.13 ? 135 GLY A CA   2  
ATOM 7995   C C    . GLY A 1 135 ? -14.010 1.299   6.964   1.00 33.32 ? 135 GLY A C    2  
ATOM 7996   O O    . GLY A 1 135 ? -14.781 2.077   6.401   1.00 2.23  ? 135 GLY A O    2  
ATOM 7997   H H    . GLY A 1 135 ? -13.083 -1.493  6.586   1.00 31.43 ? 135 GLY A H    2  
ATOM 7998   H HA2  . GLY A 1 135 ? -15.549 -0.116  7.359   1.00 40.11 ? 135 GLY A HA2  2  
ATOM 7999   H HA3  . GLY A 1 135 ? -14.114 -0.307  8.355   1.00 63.21 ? 135 GLY A HA3  2  
ATOM 8000   N N    . SER A 1 136 ? -12.753 1.611   7.260   1.00 60.02 ? 136 SER A N    2  
ATOM 8001   C CA   . SER A 1 136 ? -12.193 2.917   6.933   1.00 44.21 ? 136 SER A CA   2  
ATOM 8002   C C    . SER A 1 136 ? -10.673 2.844   6.824   1.00 72.30 ? 136 SER A C    2  
ATOM 8003   O O    . SER A 1 136 ? -10.057 1.866   7.247   1.00 2.34  ? 136 SER A O    2  
ATOM 8004   C CB   . SER A 1 136 ? -12.590 3.947   7.993   1.00 71.23 ? 136 SER A CB   2  
ATOM 8005   O OG   . SER A 1 136 ? -11.884 3.733   9.203   1.00 45.05 ? 136 SER A OG   2  
ATOM 8006   H H    . SER A 1 136 ? -12.187 0.948   7.709   1.00 11.31 ? 136 SER A H    2  
ATOM 8007   H HA   . SER A 1 136 ? -12.595 3.221   5.979   1.00 72.45 ? 136 SER A HA   2  
ATOM 8008   H HB2  . SER A 1 136 ? -12.365 4.939   7.630   1.00 15.53 ? 136 SER A HB2  2  
ATOM 8009   H HB3  . SER A 1 136 ? -13.650 3.867   8.188   1.00 44.42 ? 136 SER A HB3  2  
ATOM 8010   H HG   . SER A 1 136 ? -12.501 3.473   9.891   1.00 34.33 ? 136 SER A HG   2  
ATOM 8011   N N    . ASP A 1 137 ? -10.074 3.885   6.254   1.00 23.43 ? 137 ASP A N    2  
ATOM 8012   C CA   . ASP A 1 137 ? -8.625  3.937   6.090   1.00 31.44 ? 137 ASP A CA   2  
ATOM 8013   C C    . ASP A 1 137 ? -7.945  4.356   7.389   1.00 2.01  ? 137 ASP A C    2  
ATOM 8014   O O    . ASP A 1 137 ? -8.609  4.711   8.363   1.00 23.33 ? 137 ASP A O    2  
ATOM 8015   C CB   . ASP A 1 137 ? -8.253  4.909   4.969   1.00 72.42 ? 137 ASP A CB   2  
ATOM 8016   C CG   . ASP A 1 137 ? -8.887  6.274   5.154   1.00 24.44 ? 137 ASP A CG   2  
ATOM 8017   O OD1  . ASP A 1 137 ? -10.112 6.333   5.388   1.00 22.30 ? 137 ASP A OD1  2  
ATOM 8018   O OD2  . ASP A 1 137 ? -8.158  7.284   5.063   1.00 5.02  ? 137 ASP A OD2  2  
ATOM 8019   H H    . ASP A 1 137 ? -10.618 4.635   5.936   1.00 4.42  ? 137 ASP A H    2  
ATOM 8020   H HA   . ASP A 1 137 ? -8.286  2.948   5.823   1.00 51.01 ? 137 ASP A HA   2  
ATOM 8021   H HB2  . ASP A 1 137 ? -7.181  5.032   4.948   1.00 52.21 ? 137 ASP A HB2  2  
ATOM 8022   H HB3  . ASP A 1 137 ? -8.583  4.504   4.025   1.00 71.20 ? 137 ASP A HB3  2  
ATOM 8023   N N    . LEU A 1 138 ? -6.616  4.312   7.396   1.00 60.14 ? 138 LEU A N    2  
ATOM 8024   C CA   . LEU A 1 138 ? -5.845  4.687   8.575   1.00 2.10  ? 138 LEU A CA   2  
ATOM 8025   C C    . LEU A 1 138 ? -5.379  6.138   8.482   1.00 52.10 ? 138 LEU A C    2  
ATOM 8026   O O    . LEU A 1 138 ? -5.350  6.857   9.481   1.00 61.24 ? 138 LEU A O    2  
ATOM 8027   C CB   . LEU A 1 138 ? -4.639  3.757   8.738   1.00 43.42 ? 138 LEU A CB   2  
ATOM 8028   C CG   . LEU A 1 138 ? -4.458  3.170   10.139  1.00 30.11 ? 138 LEU A CG   2  
ATOM 8029   C CD1  . LEU A 1 138 ? -3.471  2.014   10.108  1.00 63.33 ? 138 LEU A CD1  2  
ATOM 8030   C CD2  . LEU A 1 138 ? -3.994  4.244   11.110  1.00 22.43 ? 138 LEU A CD2  2  
ATOM 8031   H H    . LEU A 1 138 ? -6.143  4.021   6.589   1.00 73.34 ? 138 LEU A H    2  
ATOM 8032   H HA   . LEU A 1 138 ? -6.486  4.583   9.437   1.00 73.43 ? 138 LEU A HA   2  
ATOM 8033   H HB2  . LEU A 1 138 ? -4.744  2.941   8.038   1.00 43.02 ? 138 LEU A HB2  2  
ATOM 8034   H HB3  . LEU A 1 138 ? -3.745  4.310   8.486   1.00 13.05 ? 138 LEU A HB3  2  
ATOM 8035   H HG   . LEU A 1 138 ? -5.407  2.789   10.487  1.00 72.11 ? 138 LEU A HG   2  
ATOM 8036   H HD11 . LEU A 1 138 ? -2.563  2.329   9.615   1.00 60.04 ? 138 LEU A HD11 2  
ATOM 8037   H HD12 . LEU A 1 138 ? -3.904  1.185   9.569   1.00 42.53 ? 138 LEU A HD12 2  
ATOM 8038   H HD13 . LEU A 1 138 ? -3.244  1.707   11.119  1.00 31.53 ? 138 LEU A HD13 2  
ATOM 8039   H HD21 . LEU A 1 138 ? -4.825  4.889   11.357  1.00 31.53 ? 138 LEU A HD21 2  
ATOM 8040   H HD22 . LEU A 1 138 ? -3.209  4.828   10.653  1.00 64.03 ? 138 LEU A HD22 2  
ATOM 8041   H HD23 . LEU A 1 138 ? -3.620  3.778   12.010  1.00 15.34 ? 138 LEU A HD23 2  
ATOM 8042   N N    . GLN A 1 139 ? -5.015  6.559   7.275   1.00 5.34  ? 139 GLN A N    2  
ATOM 8043   C CA   . GLN A 1 139 ? -4.550  7.923   7.048   1.00 71.14 ? 139 GLN A CA   2  
ATOM 8044   C C    . GLN A 1 139 ? -5.582  8.941   7.525   1.00 3.12  ? 139 GLN A C    2  
ATOM 8045   O O    . GLN A 1 139 ? -5.235  10.057  7.912   1.00 25.05 ? 139 GLN A O    2  
ATOM 8046   C CB   . GLN A 1 139 ? -4.250  8.141   5.563   1.00 34.31 ? 139 GLN A CB   2  
ATOM 8047   C CG   . GLN A 1 139 ? -3.726  9.532   5.245   1.00 1.34  ? 139 GLN A CG   2  
ATOM 8048   C CD   . GLN A 1 139 ? -2.210  9.598   5.244   1.00 31.45 ? 139 GLN A CD   2  
ATOM 8049   O OE1  . GLN A 1 139 ? -1.582  9.679   6.300   1.00 60.33 ? 139 GLN A OE1  2  
ATOM 8050   N NE2  . GLN A 1 139 ? -1.617  9.563   4.057   1.00 11.13 ? 139 GLN A NE2  2  
ATOM 8051   H H    . GLN A 1 139 ? -5.061  5.936   6.520   1.00 23.03 ? 139 GLN A H    2  
ATOM 8052   H HA   . GLN A 1 139 ? -3.640  8.061   7.613   1.00 75.41 ? 139 GLN A HA   2  
ATOM 8053   H HB2  . GLN A 1 139 ? -3.510  7.421   5.248   1.00 52.42 ? 139 GLN A HB2  2  
ATOM 8054   H HB3  . GLN A 1 139 ? -5.156  7.984   4.997   1.00 64.11 ? 139 GLN A HB3  2  
ATOM 8055   H HG2  . GLN A 1 139 ? -4.083  9.824   4.268   1.00 23.23 ? 139 GLN A HG2  2  
ATOM 8056   H HG3  . GLN A 1 139 ? -4.101  10.223  5.985   1.00 24.30 ? 139 GLN A HG3  2  
ATOM 8057   H HE21 . GLN A 1 139 ? -2.182  9.498   3.259   1.00 4.13  ? 139 GLN A HE21 2  
ATOM 8058   H HE22 . GLN A 1 139 ? -0.639  9.603   4.028   1.00 0.34  ? 139 GLN A HE22 2  
ATOM 8059   N N    . LYS A 1 140 ? -6.853  8.549   7.495   1.00 71.24 ? 140 LYS A N    2  
ATOM 8060   C CA   . LYS A 1 140 ? -7.933  9.428   7.926   1.00 3.24  ? 140 LYS A CA   2  
ATOM 8061   C C    . LYS A 1 140 ? -7.779  9.801   9.397   1.00 50.11 ? 140 LYS A C    2  
ATOM 8062   O O    . LYS A 1 140 ? -7.929  10.963  9.773   1.00 71.41 ? 140 LYS A O    2  
ATOM 8063   C CB   . LYS A 1 140 ? -9.288  8.755   7.697   1.00 4.24  ? 140 LYS A CB   2  
ATOM 8064   C CG   . LYS A 1 140 ? -10.382 9.721   7.267   1.00 51.33 ? 140 LYS A CG   2  
ATOM 8065   C CD   . LYS A 1 140 ? -11.341 9.072   6.282   1.00 1.20  ? 140 LYS A CD   2  
ATOM 8066   C CE   . LYS A 1 140 ? -12.364 10.069  5.763   1.00 53.42 ? 140 LYS A CE   2  
ATOM 8067   N NZ   . LYS A 1 140 ? -11.812 10.910  4.664   1.00 72.24 ? 140 LYS A NZ   2  
ATOM 8068   H H    . LYS A 1 140 ? -7.068  7.648   7.176   1.00 64.30 ? 140 LYS A H    2  
ATOM 8069   H HA   . LYS A 1 140 ? -7.884  10.329  7.332   1.00 72.44 ? 140 LYS A HA   2  
ATOM 8070   H HB2  . LYS A 1 140 ? -9.178  8.004   6.930   1.00 63.12 ? 140 LYS A HB2  2  
ATOM 8071   H HB3  . LYS A 1 140 ? -9.599  8.278   8.614   1.00 20.32 ? 140 LYS A HB3  2  
ATOM 8072   H HG2  . LYS A 1 140 ? -10.934 10.034  8.139   1.00 5.32  ? 140 LYS A HG2  2  
ATOM 8073   H HG3  . LYS A 1 140 ? -9.925  10.580  6.798   1.00 51.21 ? 140 LYS A HG3  2  
ATOM 8074   H HD2  . LYS A 1 140 ? -10.777 8.683   5.448   1.00 33.21 ? 140 LYS A HD2  2  
ATOM 8075   H HD3  . LYS A 1 140 ? -11.858 8.264   6.778   1.00 63.20 ? 140 LYS A HD3  2  
ATOM 8076   H HE2  . LYS A 1 140 ? -13.221 9.527   5.393   1.00 64.34 ? 140 LYS A HE2  2  
ATOM 8077   H HE3  . LYS A 1 140 ? -12.669 10.710  6.577   1.00 60.04 ? 140 LYS A HE3  2  
ATOM 8078   H HZ1  . LYS A 1 140 ? -12.042 10.488  3.742   1.00 32.14 ? 140 LYS A HZ1  2  
ATOM 8079   H HZ2  . LYS A 1 140 ? -10.779 10.980  4.753   1.00 24.41 ? 140 LYS A HZ2  2  
ATOM 8080   H HZ3  . LYS A 1 140 ? -12.219 11.866  4.707   1.00 73.03 ? 140 LYS A HZ3  2  
ATOM 8081   N N    . ILE A 1 141 ? -7.480  8.805   10.227  1.00 5.00  ? 141 ILE A N    2  
ATOM 8082   C CA   . ILE A 1 141 ? -7.305  9.029   11.657  1.00 54.50 ? 141 ILE A CA   2  
ATOM 8083   C C    . ILE A 1 141 ? -6.044  9.838   11.936  1.00 64.13 ? 141 ILE A C    2  
ATOM 8084   O O    . ILE A 1 141 ? -5.989  10.609  12.894  1.00 75.42 ? 141 ILE A O    2  
ATOM 8085   C CB   . ILE A 1 141 ? -7.230  7.698   12.430  1.00 1.30  ? 141 ILE A CB   2  
ATOM 8086   C CG1  . ILE A 1 141 ? -8.397  6.787   12.038  1.00 62.32 ? 141 ILE A CG1  2  
ATOM 8087   C CG2  . ILE A 1 141 ? -7.231  7.956   13.930  1.00 53.33 ? 141 ILE A CG2  2  
ATOM 8088   C CD1  . ILE A 1 141 ? -8.003  5.674   11.092  1.00 51.41 ? 141 ILE A CD1  2  
ATOM 8089   H H    . ILE A 1 141 ? -7.373  7.900   9.868   1.00 21.53 ? 141 ILE A H    2  
ATOM 8090   H HA   . ILE A 1 141 ? -8.162  9.582   12.015  1.00 51.35 ? 141 ILE A HA   2  
ATOM 8091   H HB   . ILE A 1 141 ? -6.302  7.211   12.175  1.00 33.03 ? 141 ILE A HB   2  
ATOM 8092   H HG12 . ILE A 1 141 ? -8.808  6.334   12.929  1.00 33.02 ? 141 ILE A HG12 2  
ATOM 8093   H HG13 . ILE A 1 141 ? -9.161  7.379   11.556  1.00 54.14 ? 141 ILE A HG13 2  
ATOM 8094   H HG21 . ILE A 1 141 ? -6.896  8.964   14.122  1.00 21.24 ? 141 ILE A HG21 2  
ATOM 8095   H HG22 . ILE A 1 141 ? -6.567  7.256   14.416  1.00 43.25 ? 141 ILE A HG22 2  
ATOM 8096   H HG23 . ILE A 1 141 ? -8.232  7.830   14.316  1.00 25.50 ? 141 ILE A HG23 2  
ATOM 8097   H HD11 . ILE A 1 141 ? -8.043  6.035   10.075  1.00 65.13 ? 141 ILE A HD11 2  
ATOM 8098   H HD12 . ILE A 1 141 ? -8.685  4.845   11.209  1.00 12.22 ? 141 ILE A HD12 2  
ATOM 8099   H HD13 . ILE A 1 141 ? -6.998  5.349   11.319  1.00 65.32 ? 141 ILE A HD13 2  
ATOM 8100   N N    . TYR A 1 142 ? -5.032  9.659   11.093  1.00 31.20 ? 142 TYR A N    2  
ATOM 8101   C CA   . TYR A 1 142 ? -3.769  10.373  11.249  1.00 64.35 ? 142 TYR A CA   2  
ATOM 8102   C C    . TYR A 1 142 ? -3.994  11.882  11.238  1.00 24.54 ? 142 TYR A C    2  
ATOM 8103   O O    . TYR A 1 142 ? -3.647  12.579  12.192  1.00 75.32 ? 142 TYR A O    2  
ATOM 8104   C CB   . TYR A 1 142 ? -2.797  9.982   10.135  1.00 75.45 ? 142 TYR A CB   2  
ATOM 8105   C CG   . TYR A 1 142 ? -1.443  10.645  10.253  1.00 52.20 ? 142 TYR A CG   2  
ATOM 8106   C CD1  . TYR A 1 142 ? -0.713  10.573  11.432  1.00 43.43 ? 142 TYR A CD1  2  
ATOM 8107   C CD2  . TYR A 1 142 ? -0.895  11.342  9.183   1.00 42.44 ? 142 TYR A CD2  2  
ATOM 8108   C CE1  . TYR A 1 142 ? 0.525   11.176  11.544  1.00 33.43 ? 142 TYR A CE1  2  
ATOM 8109   C CE2  . TYR A 1 142 ? 0.343   11.949  9.286   1.00 35.43 ? 142 TYR A CE2  2  
ATOM 8110   C CZ   . TYR A 1 142 ? 1.048   11.863  10.468  1.00 42.41 ? 142 TYR A CZ   2  
ATOM 8111   O OH   . TYR A 1 142 ? 2.280   12.465  10.575  1.00 64.32 ? 142 TYR A OH   2  
ATOM 8112   H H    . TYR A 1 142 ? -5.137  9.031   10.348  1.00 43.12 ? 142 TYR A H    2  
ATOM 8113   H HA   . TYR A 1 142 ? -3.345  10.091  12.201  1.00 43.02 ? 142 TYR A HA   2  
ATOM 8114   H HB2  . TYR A 1 142 ? -2.646  8.913   10.158  1.00 11.55 ? 142 TYR A HB2  2  
ATOM 8115   H HB3  . TYR A 1 142 ? -3.223  10.261  9.181   1.00 54.32 ? 142 TYR A HB3  2  
ATOM 8116   H HD1  . TYR A 1 142 ? -1.126  10.034  12.273  1.00 60.02 ? 142 TYR A HD1  2  
ATOM 8117   H HD2  . TYR A 1 142 ? -1.450  11.408  8.259   1.00 65.44 ? 142 TYR A HD2  2  
ATOM 8118   H HE1  . TYR A 1 142 ? 1.077   11.109  12.469  1.00 15.12 ? 142 TYR A HE1  2  
ATOM 8119   H HE2  . TYR A 1 142 ? 0.753   12.486  8.444   1.00 1.11  ? 142 TYR A HE2  2  
ATOM 8120   H HH   . TYR A 1 142 ? 2.872   11.899  11.076  1.00 31.43 ? 142 TYR A HH   2  
ATOM 8121   N N    . GLU A 1 143 ? -4.578  12.380  10.154  1.00 4.14  ? 143 GLU A N    2  
ATOM 8122   C CA   . GLU A 1 143 ? -4.851  13.806  10.020  1.00 12.15 ? 143 GLU A CA   2  
ATOM 8123   C C    . GLU A 1 143 ? -5.944  14.241  10.990  1.00 5.12  ? 143 GLU A C    2  
ATOM 8124   O O    . GLU A 1 143 ? -5.940  15.370  11.481  1.00 4.54  ? 143 GLU A O    2  
ATOM 8125   C CB   . GLU A 1 143 ? -5.266  14.136  8.585   1.00 21.55 ? 143 GLU A CB   2  
ATOM 8126   C CG   . GLU A 1 143 ? -4.107  14.141  7.602   1.00 14.20 ? 143 GLU A CG   2  
ATOM 8127   C CD   . GLU A 1 143 ? -4.050  12.880  6.763   1.00 13.33 ? 143 GLU A CD   2  
ATOM 8128   O OE1  . GLU A 1 143 ? -5.018  12.618  6.018   1.00 60.12 ? 143 GLU A OE1  2  
ATOM 8129   O OE2  . GLU A 1 143 ? -3.037  12.153  6.849   1.00 72.34 ? 143 GLU A OE2  2  
ATOM 8130   H H    . GLU A 1 143 ? -4.834  11.775  9.427   1.00 43.41 ? 143 GLU A H    2  
ATOM 8131   H HA   . GLU A 1 143 ? -3.943  14.341  10.255  1.00 10.32 ? 143 GLU A HA   2  
ATOM 8132   H HB2  . GLU A 1 143 ? -5.988  13.404  8.254   1.00 63.43 ? 143 GLU A HB2  2  
ATOM 8133   H HB3  . GLU A 1 143 ? -5.726  15.113  8.571   1.00 55.42 ? 143 GLU A HB3  2  
ATOM 8134   H HG2  . GLU A 1 143 ? -4.213  14.989  6.943   1.00 44.53 ? 143 GLU A HG2  2  
ATOM 8135   H HG3  . GLU A 1 143 ? -3.183  14.230  8.156   1.00 61.52 ? 143 GLU A HG3  2  
ATOM 8136   N N    . ALA A 1 144 ? -6.877  13.336  11.264  1.00 45.43 ? 144 ALA A N    2  
ATOM 8137   C CA   . ALA A 1 144 ? -7.977  13.622  12.177  1.00 71.20 ? 144 ALA A CA   2  
ATOM 8138   C C    . ALA A 1 144 ? -7.475  13.798  13.606  1.00 43.12 ? 144 ALA A C    2  
ATOM 8139   O O    . ALA A 1 144 ? -8.087  14.508  14.405  1.00 24.34 ? 144 ALA A O    2  
ATOM 8140   C CB   . ALA A 1 144 ? -9.018  12.513  12.113  1.00 14.33 ? 144 ALA A CB   2  
ATOM 8141   H H    . ALA A 1 144 ? -6.825  12.453  10.841  1.00 71.31 ? 144 ALA A H    2  
ATOM 8142   H HA   . ALA A 1 144 ? -8.446  14.541  11.855  1.00 61.35 ? 144 ALA A HA   2  
ATOM 8143   H HB1  . ALA A 1 144 ? -8.526  11.567  11.939  1.00 23.23 ? 144 ALA A HB1  2  
ATOM 8144   H HB2  . ALA A 1 144 ? -9.708  12.713  11.306  1.00 11.22 ? 144 ALA A HB2  2  
ATOM 8145   H HB3  . ALA A 1 144 ? -9.557  12.472  13.048  1.00 73.13 ? 144 ALA A HB3  2  
ATOM 8146   N N    . ASN A 1 145 ? -6.361  13.147  13.923  1.00 11.11 ? 145 ASN A N    2  
ATOM 8147   C CA   . ASN A 1 145 ? -5.780  13.234  15.259  1.00 61.31 ? 145 ASN A CA   2  
ATOM 8148   C C    . ASN A 1 145 ? -4.633  14.242  15.296  1.00 20.45 ? 145 ASN A C    2  
ATOM 8149   O O    . ASN A 1 145 ? -3.794  14.206  16.196  1.00 25.33 ? 145 ASN A O    2  
ATOM 8150   C CB   . ASN A 1 145 ? -5.279  11.860  15.709  1.00 11.14 ? 145 ASN A CB   2  
ATOM 8151   C CG   . ASN A 1 145 ? -5.527  11.610  17.184  1.00 52.30 ? 145 ASN A CG   2  
ATOM 8152   O OD1  . ASN A 1 145 ? -6.474  10.918  17.557  1.00 61.13 ? 145 ASN A OD1  2  
ATOM 8153   N ND2  . ASN A 1 145 ? -4.675  12.175  18.031  1.00 20.44 ? 145 ASN A ND2  2  
ATOM 8154   H H    . ASN A 1 145 ? -5.918  12.596  13.244  1.00 75.45 ? 145 ASN A H    2  
ATOM 8155   H HA   . ASN A 1 145 ? -6.554  13.563  15.935  1.00 13.34 ? 145 ASN A HA   2  
ATOM 8156   H HB2  . ASN A 1 145 ? -5.790  11.095  15.144  1.00 13.35 ? 145 ASN A HB2  2  
ATOM 8157   H HB3  . ASN A 1 145 ? -4.217  11.792  15.524  1.00 13.41 ? 145 ASN A HB3  2  
ATOM 8158   H HD21 . ASN A 1 145 ? -3.944  12.713  17.662  1.00 3.51  ? 145 ASN A HD21 2  
ATOM 8159   H HD22 . ASN A 1 145 ? -4.811  12.029  18.991  1.00 62.34 ? 145 ASN A HD22 2  
ATOM 8160   N N    . ALA A 1 146 ? -4.602  15.140  14.315  1.00 5.54  ? 146 ALA A N    2  
ATOM 8161   C CA   . ALA A 1 146 ? -3.557  16.155  14.240  1.00 71.15 ? 146 ALA A CA   2  
ATOM 8162   C C    . ALA A 1 146 ? -2.185  15.521  14.031  1.00 55.30 ? 146 ALA A C    2  
ATOM 8163   O O    . ALA A 1 146 ? -1.166  16.076  14.439  1.00 20.53 ? 146 ALA A O    2  
ATOM 8164   C CB   . ALA A 1 146 ? -3.557  17.010  15.499  1.00 22.42 ? 146 ALA A CB   2  
ATOM 8165   H H    . ALA A 1 146 ? -5.296  15.120  13.624  1.00 74.05 ? 146 ALA A H    2  
ATOM 8166   H HA   . ALA A 1 146 ? -3.776  16.797  13.399  1.00 13.11 ? 146 ALA A HA   2  
ATOM 8167   H HB1  . ALA A 1 146 ? -3.013  16.501  16.280  1.00 62.55 ? 146 ALA A HB1  2  
ATOM 8168   H HB2  . ALA A 1 146 ? -4.576  17.177  15.820  1.00 25.11 ? 146 ALA A HB2  2  
ATOM 8169   H HB3  . ALA A 1 146 ? -3.085  17.959  15.291  1.00 24.01 ? 146 ALA A HB3  2  
ATOM 8170   N N    . LYS A 1 147 ? -2.168  14.353  13.393  1.00 53.31 ? 147 LYS A N    2  
ATOM 8171   C CA   . LYS A 1 147 ? -0.922  13.642  13.129  1.00 64.32 ? 147 LYS A CA   2  
ATOM 8172   C C    . LYS A 1 147 ? -0.260  13.203  14.431  1.00 13.51 ? 147 LYS A C    2  
ATOM 8173   O O    . LYS A 1 147 ? 0.880   13.571  14.718  1.00 44.14 ? 147 LYS A O    2  
ATOM 8174   C CB   . LYS A 1 147 ? 0.036   14.526  12.324  1.00 4.44  ? 147 LYS A CB   2  
ATOM 8175   C CG   . LYS A 1 147 ? -0.577  15.083  11.050  1.00 2.03  ? 147 LYS A CG   2  
ATOM 8176   C CD   . LYS A 1 147 ? 0.332   16.114  10.400  1.00 14.35 ? 147 LYS A CD   2  
ATOM 8177   C CE   . LYS A 1 147 ? -0.244  16.612  9.084   1.00 14.51 ? 147 LYS A CE   2  
ATOM 8178   N NZ   . LYS A 1 147 ? 0.640   17.621  8.438   1.00 21.44 ? 147 LYS A NZ   2  
ATOM 8179   H H    . LYS A 1 147 ? -3.014  13.960  13.092  1.00 61.25 ? 147 LYS A H    2  
ATOM 8180   H HA   . LYS A 1 147 ? -1.160  12.765  12.547  1.00 63.10 ? 147 LYS A HA   2  
ATOM 8181   H HB2  . LYS A 1 147 ? 0.346   15.356  12.942  1.00 63.32 ? 147 LYS A HB2  2  
ATOM 8182   H HB3  . LYS A 1 147 ? 0.904   13.943  12.056  1.00 10.43 ? 147 LYS A HB3  2  
ATOM 8183   H HG2  . LYS A 1 147 ? -0.739  14.272  10.355  1.00 30.32 ? 147 LYS A HG2  2  
ATOM 8184   H HG3  . LYS A 1 147 ? -1.522  15.549  11.290  1.00 43.41 ? 147 LYS A HG3  2  
ATOM 8185   H HD2  . LYS A 1 147 ? 0.447   16.952  11.070  1.00 53.22 ? 147 LYS A HD2  2  
ATOM 8186   H HD3  . LYS A 1 147 ? 1.295   15.664  10.213  1.00 63.53 ? 147 LYS A HD3  2  
ATOM 8187   H HE2  . LYS A 1 147 ? -0.364  15.773  8.417   1.00 44.34 ? 147 LYS A HE2  2  
ATOM 8188   H HE3  . LYS A 1 147 ? -1.208  17.060  9.275   1.00 21.22 ? 147 LYS A HE3  2  
ATOM 8189   H HZ1  . LYS A 1 147 ? 0.113   18.143  7.708   1.00 2.51  ? 147 LYS A HZ1  2  
ATOM 8190   H HZ2  . LYS A 1 147 ? 1.453   17.151  7.991   1.00 71.34 ? 147 LYS A HZ2  2  
ATOM 8191   H HZ3  . LYS A 1 147 ? 0.991   18.296  9.147   1.00 5.43  ? 147 LYS A HZ3  2  
ATOM 8192   N N    . ARG A 1 148 ? -0.982  12.411  15.217  1.00 41.41 ? 148 ARG A N    2  
ATOM 8193   C CA   . ARG A 1 148 ? -0.466  11.919  16.490  1.00 43.50 ? 148 ARG A CA   2  
ATOM 8194   C C    . ARG A 1 148 ? -0.626  10.406  16.592  1.00 61.53 ? 148 ARG A C    2  
ATOM 8195   O O    . ARG A 1 148 ? -1.710  9.868   16.369  1.00 34.21 ? 148 ARG A O    2  
ATOM 8196   C CB   . ARG A 1 148 ? -1.187  12.604  17.655  1.00 21.01 ? 148 ARG A CB   2  
ATOM 8197   C CG   . ARG A 1 148 ? -0.307  13.575  18.426  1.00 20.20 ? 148 ARG A CG   2  
ATOM 8198   C CD   . ARG A 1 148 ? 0.274   12.929  19.674  1.00 75.44 ? 148 ARG A CD   2  
ATOM 8199   N NE   . ARG A 1 148 ? 1.145   13.844  20.408  1.00 30.12 ? 148 ARG A NE   2  
ATOM 8200   C CZ   . ARG A 1 148 ? 2.403   14.109  20.062  1.00 4.10  ? 148 ARG A CZ   2  
ATOM 8201   N NH1  . ARG A 1 148 ? 2.940   13.532  18.993  1.00 25.24 ? 148 ARG A NH1  2  
ATOM 8202   N NH2  . ARG A 1 148 ? 3.125   14.952  20.784  1.00 40.21 ? 148 ARG A NH2  2  
ATOM 8203   H H    . ARG A 1 148 ? -1.883  12.152  14.934  1.00 65.21 ? 148 ARG A H    2  
ATOM 8204   H HA   . ARG A 1 148 ? 0.586   12.162  16.536  1.00 73.13 ? 148 ARG A HA   2  
ATOM 8205   H HB2  . ARG A 1 148 ? -2.033  13.151  17.266  1.00 32.42 ? 148 ARG A HB2  2  
ATOM 8206   H HB3  . ARG A 1 148 ? -1.540  11.850  18.342  1.00 64.23 ? 148 ARG A HB3  2  
ATOM 8207   H HG2  . ARG A 1 148 ? 0.503   13.897  17.789  1.00 51.12 ? 148 ARG A HG2  2  
ATOM 8208   H HG3  . ARG A 1 148 ? -0.900  14.430  18.716  1.00 13.04 ? 148 ARG A HG3  2  
ATOM 8209   H HD2  . ARG A 1 148 ? -0.538  12.626  20.318  1.00 73.50 ? 148 ARG A HD2  2  
ATOM 8210   H HD3  . ARG A 1 148 ? 0.845   12.060  19.381  1.00 41.14 ? 148 ARG A HD3  2  
ATOM 8211   H HE   . ARG A 1 148 ? 0.774   14.284  21.202  1.00 15.40 ? 148 ARG A HE   2  
ATOM 8212   H HH11 . ARG A 1 148 ? 2.400   12.895  18.443  1.00 44.42 ? 148 ARG A HH11 2  
ATOM 8213   H HH12 . ARG A 1 148 ? 3.885   13.735  18.738  1.00 45.51 ? 148 ARG A HH12 2  
ATOM 8214   H HH21 . ARG A 1 148 ? 2.726   15.390  21.590  1.00 64.33 ? 148 ARG A HH21 2  
ATOM 8215   H HH22 . ARG A 1 148 ? 4.070   15.152  20.524  1.00 53.25 ? 148 ARG A HH22 2  
ATOM 8216   N N    . PHE A 1 149 ? 0.463   9.723   16.934  1.00 62.43 ? 149 PHE A N    2  
ATOM 8217   C CA   . PHE A 1 149 ? 0.444   8.271   17.067  1.00 2.24  ? 149 PHE A CA   2  
ATOM 8218   C C    . PHE A 1 149 ? 1.116   7.835   18.366  1.00 55.32 ? 149 PHE A C    2  
ATOM 8219   O O    . PHE A 1 149 ? 1.774   8.633   19.033  1.00 13.40 ? 149 PHE A O    2  
ATOM 8220   C CB   . PHE A 1 149 ? 1.144   7.619   15.872  1.00 4.41  ? 149 PHE A CB   2  
ATOM 8221   C CG   . PHE A 1 149 ? 0.192   7.086   14.838  1.00 62.41 ? 149 PHE A CG   2  
ATOM 8222   C CD1  . PHE A 1 149 ? -0.363  7.929   13.889  1.00 15.32 ? 149 PHE A CD1  2  
ATOM 8223   C CD2  . PHE A 1 149 ? -0.145  5.743   14.816  1.00 31.30 ? 149 PHE A CD2  2  
ATOM 8224   C CE1  . PHE A 1 149 ? -1.238  7.442   12.937  1.00 20.11 ? 149 PHE A CE1  2  
ATOM 8225   C CE2  . PHE A 1 149 ? -1.020  5.250   13.867  1.00 34.11 ? 149 PHE A CE2  2  
ATOM 8226   C CZ   . PHE A 1 149 ? -1.567  6.100   12.925  1.00 22.11 ? 149 PHE A CZ   2  
ATOM 8227   H H    . PHE A 1 149 ? 1.298   10.207  17.099  1.00 3.24  ? 149 PHE A H    2  
ATOM 8228   H HA   . PHE A 1 149 ? -0.587  7.953   17.087  1.00 73.02 ? 149 PHE A HA   2  
ATOM 8229   H HB2  . PHE A 1 149 ? 1.777   8.350   15.393  1.00 33.15 ? 149 PHE A HB2  2  
ATOM 8230   H HB3  . PHE A 1 149 ? 1.750   6.796   16.222  1.00 31.25 ? 149 PHE A HB3  2  
ATOM 8231   H HD1  . PHE A 1 149 ? -0.107  8.978   13.897  1.00 51.22 ? 149 PHE A HD1  2  
ATOM 8232   H HD2  . PHE A 1 149 ? 0.280   5.077   15.552  1.00 40.02 ? 149 PHE A HD2  2  
ATOM 8233   H HE1  . PHE A 1 149 ? -1.664  8.109   12.202  1.00 20.21 ? 149 PHE A HE1  2  
ATOM 8234   H HE2  . PHE A 1 149 ? -1.276  4.200   13.860  1.00 62.33 ? 149 PHE A HE2  2  
ATOM 8235   H HZ   . PHE A 1 149 ? -2.250  5.718   12.183  1.00 63.14 ? 149 PHE A HZ   2  
ATOM 8236   N N    . SER A 1 150 ? 0.946   6.566   18.718  1.00 71.33 ? 150 SER A N    2  
ATOM 8237   C CA   . SER A 1 150 ? 1.536   6.025   19.937  1.00 22.53 ? 150 SER A CA   2  
ATOM 8238   C C    . SER A 1 150 ? 2.772   5.190   19.620  1.00 64.43 ? 150 SER A C    2  
ATOM 8239   O O    . SER A 1 150 ? 3.002   4.816   18.470  1.00 43.14 ? 150 SER A O    2  
ATOM 8240   C CB   . SER A 1 150 ? 0.512   5.175   20.691  1.00 22.44 ? 150 SER A CB   2  
ATOM 8241   O OG   . SER A 1 150 ? -0.805  5.648   20.471  1.00 53.42 ? 150 SER A OG   2  
ATOM 8242   H H    . SER A 1 150 ? 0.410   5.978   18.146  1.00 65.22 ? 150 SER A H    2  
ATOM 8243   H HA   . SER A 1 150 ? 1.828   6.856   20.562  1.00 62.43 ? 150 SER A HA   2  
ATOM 8244   H HB2  . SER A 1 150 ? 0.575   4.152   20.349  1.00 64.11 ? 150 SER A HB2  2  
ATOM 8245   H HB3  . SER A 1 150 ? 0.723   5.214   21.750  1.00 62.10 ? 150 SER A HB3  2  
ATOM 8246   H HG   . SER A 1 150 ? -1.207  5.882   21.311  1.00 72.32 ? 150 SER A HG   2  
ATOM 8247   N N    . ARG A 1 151 ? 3.565   4.902   20.647  1.00 73.44 ? 151 ARG A N    2  
ATOM 8248   C CA   . ARG A 1 151 ? 4.779   4.110   20.477  1.00 12.24 ? 151 ARG A CA   2  
ATOM 8249   C C    . ARG A 1 151 ? 4.447   2.629   20.331  1.00 33.02 ? 151 ARG A C    2  
ATOM 8250   O O    . ARG A 1 151 ? 5.130   1.897   19.614  1.00 3.40  ? 151 ARG A O    2  
ATOM 8251   C CB   . ARG A 1 151 ? 5.718   4.319   21.666  1.00 52.44 ? 151 ARG A CB   2  
ATOM 8252   C CG   . ARG A 1 151 ? 6.653   5.506   21.501  1.00 21.14 ? 151 ARG A CG   2  
ATOM 8253   C CD   . ARG A 1 151 ? 5.970   6.810   21.880  1.00 32.15 ? 151 ARG A CD   2  
ATOM 8254   N NE   . ARG A 1 151 ? 6.897   7.753   22.501  1.00 62.05 ? 151 ARG A NE   2  
ATOM 8255   C CZ   . ARG A 1 151 ? 6.646   9.053   22.644  1.00 50.33 ? 151 ARG A CZ   2  
ATOM 8256   N NH1  . ARG A 1 151 ? 5.501   9.567   22.213  1.00 13.44 ? 151 ARG A NH1  2  
ATOM 8257   N NH2  . ARG A 1 151 ? 7.543   9.841   23.221  1.00 33.33 ? 151 ARG A NH2  2  
ATOM 8258   H H    . ARG A 1 151 ? 3.328   5.228   21.540  1.00 51.34 ? 151 ARG A H    2  
ATOM 8259   H HA   . ARG A 1 151 ? 5.271   4.448   19.578  1.00 10.03 ? 151 ARG A HA   2  
ATOM 8260   H HB2  . ARG A 1 151 ? 5.126   4.476   22.555  1.00 71.24 ? 151 ARG A HB2  2  
ATOM 8261   H HB3  . ARG A 1 151 ? 6.319   3.431   21.795  1.00 41.12 ? 151 ARG A HB3  2  
ATOM 8262   H HG2  . ARG A 1 151 ? 7.514   5.365   22.138  1.00 4.44  ? 151 ARG A HG2  2  
ATOM 8263   H HG3  . ARG A 1 151 ? 6.970   5.562   20.470  1.00 20.21 ? 151 ARG A HG3  2  
ATOM 8264   H HD2  . ARG A 1 151 ? 5.559   7.259   20.988  1.00 23.31 ? 151 ARG A HD2  2  
ATOM 8265   H HD3  . ARG A 1 151 ? 5.171   6.595   22.574  1.00 1.43  ? 151 ARG A HD3  2  
ATOM 8266   H HE   . ARG A 1 151 ? 7.750   7.401   22.828  1.00 50.52 ? 151 ARG A HE   2  
ATOM 8267   H HH11 . ARG A 1 151 ? 4.820   8.978   21.778  1.00 63.13 ? 151 ARG A HH11 2  
ATOM 8268   H HH12 . ARG A 1 151 ? 5.318   10.543  22.324  1.00 33.15 ? 151 ARG A HH12 2  
ATOM 8269   H HH21 . ARG A 1 151 ? 8.408   9.459   23.548  1.00 31.03 ? 151 ARG A HH21 2  
ATOM 8270   H HH22 . ARG A 1 151 ? 7.355   10.817  23.328  1.00 74.40 ? 151 ARG A HH22 2  
ATOM 8271   N N    . LYS A 1 152 ? 3.394   2.193   21.014  1.00 21.22 ? 152 LYS A N    2  
ATOM 8272   C CA   . LYS A 1 152 ? 2.972   0.797   20.959  1.00 32.30 ? 152 LYS A CA   2  
ATOM 8273   C C    . LYS A 1 152 ? 2.159   0.524   19.698  1.00 43.32 ? 152 LYS A C    2  
ATOM 8274   O O    . LYS A 1 152 ? 2.225   -0.565  19.129  1.00 1.21  ? 152 LYS A O    2  
ATOM 8275   C CB   . LYS A 1 152 ? 2.150   0.441   22.201  1.00 44.51 ? 152 LYS A CB   2  
ATOM 8276   C CG   . LYS A 1 152 ? 0.825   1.181   22.286  1.00 54.31 ? 152 LYS A CG   2  
ATOM 8277   C CD   . LYS A 1 152 ? 0.471   1.526   23.724  1.00 22.14 ? 152 LYS A CD   2  
ATOM 8278   C CE   . LYS A 1 152 ? -0.270  2.849   23.814  1.00 40.01 ? 152 LYS A CE   2  
ATOM 8279   N NZ   . LYS A 1 152 ? -0.092  3.497   25.143  1.00 71.51 ? 152 LYS A NZ   2  
ATOM 8280   H H    . LYS A 1 152 ? 2.889   2.824   21.568  1.00 22.13 ? 152 LYS A H    2  
ATOM 8281   H HA   . LYS A 1 152 ? 3.860   0.184   20.940  1.00 24.54 ? 152 LYS A HA   2  
ATOM 8282   H HB2  . LYS A 1 152 ? 1.945   -0.619  22.190  1.00 73.55 ? 152 LYS A HB2  2  
ATOM 8283   H HB3  . LYS A 1 152 ? 2.728   0.679   23.081  1.00 60.50 ? 152 LYS A HB3  2  
ATOM 8284   H HG2  . LYS A 1 152 ? 0.896   2.096   21.716  1.00 30.33 ? 152 LYS A HG2  2  
ATOM 8285   H HG3  . LYS A 1 152 ? 0.048   0.557   21.872  1.00 64.45 ? 152 LYS A HG3  2  
ATOM 8286   H HD2  . LYS A 1 152 ? -0.159  0.745   24.126  1.00 21.40 ? 152 LYS A HD2  2  
ATOM 8287   H HD3  . LYS A 1 152 ? 1.380   1.591   24.303  1.00 31.12 ? 152 LYS A HD3  2  
ATOM 8288   H HE2  . LYS A 1 152 ? 0.108   3.512   23.048  1.00 11.14 ? 152 LYS A HE2  2  
ATOM 8289   H HE3  . LYS A 1 152 ? -1.322  2.671   23.647  1.00 63.30 ? 152 LYS A HE3  2  
ATOM 8290   H HZ1  . LYS A 1 152 ? -0.321  2.823   25.901  1.00 43.12 ? 152 LYS A HZ1  2  
ATOM 8291   H HZ2  . LYS A 1 152 ? -0.719  4.322   25.226  1.00 22.14 ? 152 LYS A HZ2  2  
ATOM 8292   H HZ3  . LYS A 1 152 ? 0.894   3.811   25.259  1.00 71.14 ? 152 LYS A HZ3  2  
ATOM 8293   N N    . THR A 1 153 ? 1.393   1.520   19.267  1.00 25.53 ? 153 THR A N    2  
ATOM 8294   C CA   . THR A 1 153 ? 0.567   1.388   18.072  1.00 43.32 ? 153 THR A CA   2  
ATOM 8295   C C    . THR A 1 153 ? 1.433   1.209   16.830  1.00 65.03 ? 153 THR A C    2  
ATOM 8296   O O    . THR A 1 153 ? 1.140   0.379   15.970  1.00 23.34 ? 153 THR A O    2  
ATOM 8297   C CB   . THR A 1 153 ? -0.333  2.614   17.910  1.00 14.53 ? 153 THR A CB   2  
ATOM 8298   O OG1  . THR A 1 153 ? 0.441   3.774   17.665  1.00 32.24 ? 153 THR A OG1  2  
ATOM 8299   C CG2  . THR A 1 153 ? -1.198  2.886   19.121  1.00 12.32 ? 153 THR A CG2  2  
ATOM 8300   H H    . THR A 1 153 ? 1.383   2.366   19.763  1.00 75.45 ? 153 THR A H    2  
ATOM 8301   H HA   . THR A 1 153 ? -0.053  0.511   18.193  1.00 64.11 ? 153 THR A HA   2  
ATOM 8302   H HB   . THR A 1 153 ? -0.988  2.457   17.064  1.00 14.33 ? 153 THR A HB   2  
ATOM 8303   H HG1  . THR A 1 153 ? 1.172   3.809   18.286  1.00 52.33 ? 153 THR A HG1  2  
ATOM 8304   H HG21 . THR A 1 153 ? -2.105  2.302   19.054  1.00 1.02  ? 153 THR A HG21 2  
ATOM 8305   H HG22 . THR A 1 153 ? -1.448  3.936   19.157  1.00 22.23 ? 153 THR A HG22 2  
ATOM 8306   H HG23 . THR A 1 153 ? -0.661  2.612   20.016  1.00 22.41 ? 153 THR A HG23 2  
ATOM 8307   N N    . VAL A 1 154 ? 2.501   1.995   16.742  1.00 53.02 ? 154 VAL A N    2  
ATOM 8308   C CA   . VAL A 1 154 ? 3.412   1.923   15.606  1.00 40.14 ? 154 VAL A CA   2  
ATOM 8309   C C    . VAL A 1 154 ? 4.103   0.565   15.543  1.00 22.43 ? 154 VAL A C    2  
ATOM 8310   O O    . VAL A 1 154 ? 4.114   -0.089  14.502  1.00 11.15 ? 154 VAL A O    2  
ATOM 8311   C CB   . VAL A 1 154 ? 4.481   3.031   15.669  1.00 72.24 ? 154 VAL A CB   2  
ATOM 8312   C CG1  . VAL A 1 154 ? 5.325   3.034   14.403  1.00 64.03 ? 154 VAL A CG1  2  
ATOM 8313   C CG2  . VAL A 1 154 ? 3.832   4.390   15.889  1.00 34.13 ? 154 VAL A CG2  2  
ATOM 8314   H H    . VAL A 1 154 ? 2.683   2.638   17.460  1.00 73.43 ? 154 VAL A H    2  
ATOM 8315   H HA   . VAL A 1 154 ? 2.831   2.062   14.705  1.00 43.23 ? 154 VAL A HA   2  
ATOM 8316   H HB   . VAL A 1 154 ? 5.131   2.826   16.507  1.00 23.44 ? 154 VAL A HB   2  
ATOM 8317   H HG11 . VAL A 1 154 ? 6.196   2.414   14.550  1.00 15.41 ? 154 VAL A HG11 2  
ATOM 8318   H HG12 . VAL A 1 154 ? 5.634   4.044   14.179  1.00 20.30 ? 154 VAL A HG12 2  
ATOM 8319   H HG13 . VAL A 1 154 ? 4.741   2.646   13.581  1.00 61.00 ? 154 VAL A HG13 2  
ATOM 8320   H HG21 . VAL A 1 154 ? 3.788   4.923   14.951  1.00 32.43 ? 154 VAL A HG21 2  
ATOM 8321   H HG22 . VAL A 1 154 ? 4.418   4.957   16.597  1.00 71.44 ? 154 VAL A HG22 2  
ATOM 8322   H HG23 . VAL A 1 154 ? 2.833   4.254   16.274  1.00 1.12  ? 154 VAL A HG23 2  
ATOM 8323   N N    . LEU A 1 155 ? 4.679   0.149   16.666  1.00 45.15 ? 155 LEU A N    2  
ATOM 8324   C CA   . LEU A 1 155 ? 5.373   -1.132  16.740  1.00 3.33  ? 155 LEU A CA   2  
ATOM 8325   C C    . LEU A 1 155 ? 4.419   -2.284  16.443  1.00 73.24 ? 155 LEU A C    2  
ATOM 8326   O O    . LEU A 1 155 ? 4.752   -3.204  15.696  1.00 33.11 ? 155 LEU A O    2  
ATOM 8327   C CB   . LEU A 1 155 ? 6.000   -1.317  18.123  1.00 23.21 ? 155 LEU A CB   2  
ATOM 8328   C CG   . LEU A 1 155 ? 6.896   -0.167  18.586  1.00 62.44 ? 155 LEU A CG   2  
ATOM 8329   C CD1  . LEU A 1 155 ? 6.950   -0.112  20.105  1.00 5.53  ? 155 LEU A CD1  2  
ATOM 8330   C CD2  . LEU A 1 155 ? 8.294   -0.316  18.006  1.00 2.21  ? 155 LEU A CD2  2  
ATOM 8331   H H    . LEU A 1 155 ? 4.636   0.716   17.465  1.00 61.13 ? 155 LEU A H    2  
ATOM 8332   H HA   . LEU A 1 155 ? 6.155   -1.128  15.997  1.00 5.13  ? 155 LEU A HA   2  
ATOM 8333   H HB2  . LEU A 1 155 ? 5.204   -1.439  18.842  1.00 51.04 ? 155 LEU A HB2  2  
ATOM 8334   H HB3  . LEU A 1 155 ? 6.591   -2.220  18.108  1.00 50.22 ? 155 LEU A HB3  2  
ATOM 8335   H HG   . LEU A 1 155 ? 6.483   0.767   18.233  1.00 24.22 ? 155 LEU A HG   2  
ATOM 8336   H HD11 . LEU A 1 155 ? 7.503   0.763   20.414  1.00 45.34 ? 155 LEU A HD11 2  
ATOM 8337   H HD12 . LEU A 1 155 ? 7.440   -0.999  20.481  1.00 15.33 ? 155 LEU A HD12 2  
ATOM 8338   H HD13 . LEU A 1 155 ? 5.946   -0.060  20.499  1.00 21.14 ? 155 LEU A HD13 2  
ATOM 8339   H HD21 . LEU A 1 155 ? 8.967   0.363   18.510  1.00 3.41  ? 155 LEU A HD21 2  
ATOM 8340   H HD22 . LEU A 1 155 ? 8.273   -0.085  16.951  1.00 31.30 ? 155 LEU A HD22 2  
ATOM 8341   H HD23 . LEU A 1 155 ? 8.636   -1.331  18.145  1.00 73.41 ? 155 LEU A HD23 2  
ATOM 8342   N N    . GLN A 1 156 ? 3.229   -2.227  17.032  1.00 61.32 ? 156 GLN A N    2  
ATOM 8343   C CA   . GLN A 1 156 ? 2.225   -3.265  16.831  1.00 2.33  ? 156 GLN A CA   2  
ATOM 8344   C C    . GLN A 1 156 ? 1.851   -3.382  15.357  1.00 2.35  ? 156 GLN A C    2  
ATOM 8345   O O    . GLN A 1 156 ? 1.532   -4.469  14.872  1.00 3.33  ? 156 GLN A O    2  
ATOM 8346   C CB   . GLN A 1 156 ? 0.977   -2.966  17.664  1.00 21.31 ? 156 GLN A CB   2  
ATOM 8347   C CG   . GLN A 1 156 ? 1.024   -3.559  19.063  1.00 21.12 ? 156 GLN A CG   2  
ATOM 8348   C CD   . GLN A 1 156 ? -0.109  -3.065  19.942  1.00 12.22 ? 156 GLN A CD   2  
ATOM 8349   O OE1  . GLN A 1 156 ? 0.097   -2.728  21.108  1.00 70.23 ? 156 GLN A OE1  2  
ATOM 8350   N NE2  . GLN A 1 156 ? -1.314  -3.021  19.386  1.00 71.32 ? 156 GLN A NE2  2  
ATOM 8351   H H    . GLN A 1 156 ? 3.021   -1.468  17.617  1.00 51.15 ? 156 GLN A H    2  
ATOM 8352   H HA   . GLN A 1 156 ? 2.648   -4.203  17.159  1.00 4.10  ? 156 GLN A HA   2  
ATOM 8353   H HB2  . GLN A 1 156 ? 0.866   -1.895  17.753  1.00 11.21 ? 156 GLN A HB2  2  
ATOM 8354   H HB3  . GLN A 1 156 ? 0.114   -3.367  17.154  1.00 21.04 ? 156 GLN A HB3  2  
ATOM 8355   H HG2  . GLN A 1 156 ? 0.958   -4.633  18.988  1.00 23.34 ? 156 GLN A HG2  2  
ATOM 8356   H HG3  . GLN A 1 156 ? 1.962   -3.288  19.524  1.00 32.42 ? 156 GLN A HG3  2  
ATOM 8357   H HE21 . GLN A 1 156 ? -1.404  -3.305  18.453  1.00 41.41 ? 156 GLN A HE21 2  
ATOM 8358   H HE22 . GLN A 1 156 ? -2.065  -2.706  19.932  1.00 54.44 ? 156 GLN A HE22 2  
ATOM 8359   N N    . LEU A 1 157 ? 1.892   -2.258  14.650  1.00 53.33 ? 157 LEU A N    2  
ATOM 8360   C CA   . LEU A 1 157 ? 1.558   -2.237  13.230  1.00 3.24  ? 157 LEU A CA   2  
ATOM 8361   C C    . LEU A 1 157 ? 2.708   -2.786  12.392  1.00 2.40  ? 157 LEU A C    2  
ATOM 8362   O O    . LEU A 1 157 ? 2.497   -3.582  11.477  1.00 72.31 ? 157 LEU A O    2  
ATOM 8363   C CB   . LEU A 1 157 ? 1.220   -0.812  12.786  1.00 1.41  ? 157 LEU A CB   2  
ATOM 8364   C CG   . LEU A 1 157 ? -0.247  -0.414  12.950  1.00 21.41 ? 157 LEU A CG   2  
ATOM 8365   C CD1  . LEU A 1 157 ? -0.375  1.094   13.108  1.00 51.20 ? 157 LEU A CD1  2  
ATOM 8366   C CD2  . LEU A 1 157 ? -1.067  -0.899  11.764  1.00 70.31 ? 157 LEU A CD2  2  
ATOM 8367   H H    . LEU A 1 157 ? 2.155   -1.423  15.090  1.00 52.11 ? 157 LEU A H    2  
ATOM 8368   H HA   . LEU A 1 157 ? 0.691   -2.864  13.085  1.00 11.14 ? 157 LEU A HA   2  
ATOM 8369   H HB2  . LEU A 1 157 ? 1.826   -0.126  13.359  1.00 31.22 ? 157 LEU A HB2  2  
ATOM 8370   H HB3  . LEU A 1 157 ? 1.482   -0.711  11.743  1.00 62.31 ? 157 LEU A HB3  2  
ATOM 8371   H HG   . LEU A 1 157 ? -0.642  -0.877  13.843  1.00 73.24 ? 157 LEU A HG   2  
ATOM 8372   H HD11 . LEU A 1 157 ? 0.461   1.579   12.626  1.00 24.55 ? 157 LEU A HD11 2  
ATOM 8373   H HD12 . LEU A 1 157 ? -0.382  1.347   14.157  1.00 10.13 ? 157 LEU A HD12 2  
ATOM 8374   H HD13 . LEU A 1 157 ? -1.296  1.426   12.651  1.00 42.11 ? 157 LEU A HD13 2  
ATOM 8375   H HD21 . LEU A 1 157 ? -0.713  -0.420  10.862  1.00 61.11 ? 157 LEU A HD21 2  
ATOM 8376   H HD22 . LEU A 1 157 ? -2.106  -0.651  11.919  1.00 33.42 ? 157 LEU A HD22 2  
ATOM 8377   H HD23 . LEU A 1 157 ? -0.962  -1.969  11.668  1.00 33.53 ? 157 LEU A HD23 2  
ATOM 8378   N N    . SER A 1 158 ? 3.924   -2.353  12.709  1.00 41.31 ? 158 SER A N    2  
ATOM 8379   C CA   . SER A 1 158 ? 5.109   -2.801  11.984  1.00 34.02 ? 158 SER A CA   2  
ATOM 8380   C C    . SER A 1 158 ? 5.204   -4.323  11.980  1.00 54.13 ? 158 SER A C    2  
ATOM 8381   O O    . SER A 1 158 ? 5.718   -4.921  11.034  1.00 11.40 ? 158 SER A O    2  
ATOM 8382   C CB   . SER A 1 158 ? 6.371   -2.201  12.608  1.00 51.00 ? 158 SER A CB   2  
ATOM 8383   O OG   . SER A 1 158 ? 6.282   -2.181  14.021  1.00 71.33 ? 158 SER A OG   2  
ATOM 8384   H H    . SER A 1 158 ? 4.029   -1.717  13.448  1.00 32.31 ? 158 SER A H    2  
ATOM 8385   H HA   . SER A 1 158 ? 5.024   -2.455  10.964  1.00 24.14 ? 158 SER A HA   2  
ATOM 8386   H HB2  . SER A 1 158 ? 7.227   -2.794  12.322  1.00 35.22 ? 158 SER A HB2  2  
ATOM 8387   H HB3  . SER A 1 158 ? 6.500   -1.189  12.252  1.00 61.45 ? 158 SER A HB3  2  
ATOM 8388   H HG   . SER A 1 158 ? 6.012   -3.046  14.338  1.00 72.32 ? 158 SER A HG   2  
ATOM 8389   N N    . LEU A 1 159 ? 4.702   -4.945  13.042  1.00 43.03 ? 159 LEU A N    2  
ATOM 8390   C CA   . LEU A 1 159 ? 4.728   -6.398  13.159  1.00 2.12  ? 159 LEU A CA   2  
ATOM 8391   C C    . LEU A 1 159 ? 3.670   -7.031  12.261  1.00 35.11 ? 159 LEU A C    2  
ATOM 8392   O O    . LEU A 1 159 ? 3.930   -8.027  11.585  1.00 44.54 ? 159 LEU A O    2  
ATOM 8393   C CB   . LEU A 1 159 ? 4.499   -6.819  14.612  1.00 73.44 ? 159 LEU A CB   2  
ATOM 8394   C CG   . LEU A 1 159 ? 5.484   -6.227  15.621  1.00 32.33 ? 159 LEU A CG   2  
ATOM 8395   C CD1  . LEU A 1 159 ? 4.837   -6.103  16.991  1.00 44.21 ? 159 LEU A CD1  2  
ATOM 8396   C CD2  . LEU A 1 159 ? 6.742   -7.079  15.699  1.00 43.14 ? 159 LEU A CD2  2  
ATOM 8397   H H    . LEU A 1 159 ? 4.304   -4.414  13.764  1.00 34.24 ? 159 LEU A H    2  
ATOM 8398   H HA   . LEU A 1 159 ? 5.702   -6.740  12.844  1.00 51.22 ? 159 LEU A HA   2  
ATOM 8399   H HB2  . LEU A 1 159 ? 3.500   -6.521  14.898  1.00 54.31 ? 159 LEU A HB2  2  
ATOM 8400   H HB3  . LEU A 1 159 ? 4.565   -7.895  14.668  1.00 3.33  ? 159 LEU A HB3  2  
ATOM 8401   H HG   . LEU A 1 159 ? 5.770   -5.236  15.297  1.00 3.40  ? 159 LEU A HG   2  
ATOM 8402   H HD11 . LEU A 1 159 ? 4.425   -5.111  17.107  1.00 21.41 ? 159 LEU A HD11 2  
ATOM 8403   H HD12 . LEU A 1 159 ? 5.577   -6.278  17.758  1.00 72.23 ? 159 LEU A HD12 2  
ATOM 8404   H HD13 . LEU A 1 159 ? 4.046   -6.833  17.082  1.00 60.30 ? 159 LEU A HD13 2  
ATOM 8405   H HD21 . LEU A 1 159 ? 7.482   -6.692  15.014  1.00 72.31 ? 159 LEU A HD21 2  
ATOM 8406   H HD22 . LEU A 1 159 ? 6.503   -8.098  15.432  1.00 1.33  ? 159 LEU A HD22 2  
ATOM 8407   H HD23 . LEU A 1 159 ? 7.134   -7.053  16.705  1.00 32.01 ? 159 LEU A HD23 2  
ATOM 8408   N N    . ARG A 1 160 ? 2.478   -6.445  12.258  1.00 43.53 ? 160 ARG A N    2  
ATOM 8409   C CA   . ARG A 1 160 ? 1.380   -6.949  11.442  1.00 11.35 ? 160 ARG A CA   2  
ATOM 8410   C C    . ARG A 1 160 ? 1.648   -6.703  9.961   1.00 10.02 ? 160 ARG A C    2  
ATOM 8411   O O    . ARG A 1 160 ? 1.290   -7.518  9.111   1.00 40.03 ? 160 ARG A O    2  
ATOM 8412   C CB   . ARG A 1 160 ? 0.065   -6.283  11.852  1.00 14.30 ? 160 ARG A CB   2  
ATOM 8413   C CG   . ARG A 1 160 ? -0.640  -6.985  13.002  1.00 11.23 ? 160 ARG A CG   2  
ATOM 8414   C CD   . ARG A 1 160 ? -1.798  -7.838  12.509  1.00 52.21 ? 160 ARG A CD   2  
ATOM 8415   N NE   . ARG A 1 160 ? -2.871  -7.927  13.497  1.00 20.33 ? 160 ARG A NE   2  
ATOM 8416   C CZ   . ARG A 1 160 ? -4.116  -8.297  13.207  1.00 24.42 ? 160 ARG A CZ   2  
ATOM 8417   N NH1  . ARG A 1 160 ? -4.450  -8.612  11.962  1.00 32.43 ? 160 ARG A NH1  2  
ATOM 8418   N NH2  . ARG A 1 160 ? -5.032  -8.351  14.165  1.00 65.10 ? 160 ARG A NH2  2  
ATOM 8419   H H    . ARG A 1 160 ? 2.332   -5.653  12.819  1.00 41.44 ? 160 ARG A H    2  
ATOM 8420   H HA   . ARG A 1 160 ? 1.302   -8.012  11.610  1.00 21.42 ? 160 ARG A HA   2  
ATOM 8421   H HB2  . ARG A 1 160 ? 0.268   -5.265  12.151  1.00 2.41  ? 160 ARG A HB2  2  
ATOM 8422   H HB3  . ARG A 1 160 ? -0.601  -6.273  11.001  1.00 42.50 ? 160 ARG A HB3  2  
ATOM 8423   H HG2  . ARG A 1 160 ? 0.069   -7.619  13.513  1.00 1.50  ? 160 ARG A HG2  2  
ATOM 8424   H HG3  . ARG A 1 160 ? -1.019  -6.240  13.687  1.00 64.43 ? 160 ARG A HG3  2  
ATOM 8425   H HD2  . ARG A 1 160 ? -2.191  -7.400  11.604  1.00 74.40 ? 160 ARG A HD2  2  
ATOM 8426   H HD3  . ARG A 1 160 ? -1.432  -8.833  12.299  1.00 65.54 ? 160 ARG A HD3  2  
ATOM 8427   H HE   . ARG A 1 160 ? -2.653  -7.699  14.425  1.00 24.21 ? 160 ARG A HE   2  
ATOM 8428   H HH11 . ARG A 1 160 ? -3.765  -8.574  11.234  1.00 31.21 ? 160 ARG A HH11 2  
ATOM 8429   H HH12 . ARG A 1 160 ? -5.388  -8.890  11.750  1.00 50.42 ? 160 ARG A HH12 2  
ATOM 8430   H HH21 . ARG A 1 160 ? -4.786  -8.115  15.105  1.00 32.32 ? 160 ARG A HH21 2  
ATOM 8431   H HH22 . ARG A 1 160 ? -5.968  -8.628  13.948  1.00 51.35 ? 160 ARG A HH22 2  
ATOM 8432   N N    . ILE A 1 161 ? 2.280   -5.573  9.660   1.00 22.24 ? 161 ILE A N    2  
ATOM 8433   C CA   . ILE A 1 161 ? 2.598   -5.219  8.282   1.00 51.54 ? 161 ILE A CA   2  
ATOM 8434   C C    . ILE A 1 161 ? 3.790   -6.021  7.770   1.00 14.24 ? 161 ILE A C    2  
ATOM 8435   O O    . ILE A 1 161 ? 3.894   -6.304  6.576   1.00 22.31 ? 161 ILE A O    2  
ATOM 8436   C CB   . ILE A 1 161 ? 2.906   -3.715  8.144   1.00 44.11 ? 161 ILE A CB   2  
ATOM 8437   C CG1  . ILE A 1 161 ? 1.788   -2.881  8.772   1.00 60.21 ? 161 ILE A CG1  2  
ATOM 8438   C CG2  . ILE A 1 161 ? 3.092   -3.342  6.680   1.00 23.54 ? 161 ILE A CG2  2  
ATOM 8439   C CD1  . ILE A 1 161 ? 2.266   -1.568  9.353   1.00 41.33 ? 161 ILE A CD1  2  
ATOM 8440   H H    . ILE A 1 161 ? 2.540   -4.964  10.382  1.00 61.24 ? 161 ILE A H    2  
ATOM 8441   H HA   . ILE A 1 161 ? 1.736   -5.446  7.673   1.00 35.21 ? 161 ILE A HA   2  
ATOM 8442   H HB   . ILE A 1 161 ? 3.831   -3.511  8.662   1.00 12.40 ? 161 ILE A HB   2  
ATOM 8443   H HG12 . ILE A 1 161 ? 1.046   -2.658  8.019   1.00 31.45 ? 161 ILE A HG12 2  
ATOM 8444   H HG13 . ILE A 1 161 ? 1.327   -3.448  9.568   1.00 50.33 ? 161 ILE A HG13 2  
ATOM 8445   H HG21 . ILE A 1 161 ? 4.140   -3.394  6.426   1.00 45.21 ? 161 ILE A HG21 2  
ATOM 8446   H HG22 . ILE A 1 161 ? 2.731   -2.337  6.516   1.00 42.51 ? 161 ILE A HG22 2  
ATOM 8447   H HG23 . ILE A 1 161 ? 2.536   -4.030  6.060   1.00 51.14 ? 161 ILE A HG23 2  
ATOM 8448   H HD11 . ILE A 1 161 ? 2.722   -0.975  8.574   1.00 32.24 ? 161 ILE A HD11 2  
ATOM 8449   H HD12 . ILE A 1 161 ? 2.991   -1.761  10.130  1.00 41.14 ? 161 ILE A HD12 2  
ATOM 8450   H HD13 . ILE A 1 161 ? 1.427   -1.031  9.770   1.00 75.22 ? 161 ILE A HD13 2  
ATOM 8451   N N    . LEU A 1 162 ? 4.687   -6.386  8.681   1.00 34.32 ? 162 LEU A N    2  
ATOM 8452   C CA   . LEU A 1 162 ? 5.871   -7.157  8.320   1.00 72.21 ? 162 LEU A CA   2  
ATOM 8453   C C    . LEU A 1 162 ? 5.479   -8.512  7.739   1.00 1.11  ? 162 LEU A C    2  
ATOM 8454   O O    . LEU A 1 162 ? 6.009   -8.934  6.711   1.00 70.14 ? 162 LEU A O    2  
ATOM 8455   C CB   . LEU A 1 162 ? 6.770   -7.353  9.543   1.00 4.54  ? 162 LEU A CB   2  
ATOM 8456   C CG   . LEU A 1 162 ? 7.886   -6.317  9.697   1.00 13.35 ? 162 LEU A CG   2  
ATOM 8457   C CD1  . LEU A 1 162 ? 8.349   -6.245  11.144  1.00 53.00 ? 162 LEU A CD1  2  
ATOM 8458   C CD2  . LEU A 1 162 ? 9.051   -6.651  8.778   1.00 4.34  ? 162 LEU A CD2  2  
ATOM 8459   H H    . LEU A 1 162 ? 4.549   -6.132  9.617   1.00 31.34 ? 162 LEU A H    2  
ATOM 8460   H HA   . LEU A 1 162 ? 6.413   -6.601  7.570   1.00 0.32  ? 162 LEU A HA   2  
ATOM 8461   H HB2  . LEU A 1 162 ? 6.151   -7.320  10.427  1.00 73.21 ? 162 LEU A HB2  2  
ATOM 8462   H HB3  . LEU A 1 162 ? 7.225   -8.331  9.478   1.00 34.23 ? 162 LEU A HB3  2  
ATOM 8463   H HG   . LEU A 1 162 ? 7.506   -5.345  9.419   1.00 32.10 ? 162 LEU A HG   2  
ATOM 8464   H HD11 . LEU A 1 162 ? 7.806   -5.465  11.657  1.00 3.23  ? 162 LEU A HD11 2  
ATOM 8465   H HD12 . LEU A 1 162 ? 9.406   -6.026  11.173  1.00 10.32 ? 162 LEU A HD12 2  
ATOM 8466   H HD13 . LEU A 1 162 ? 8.165   -7.191  11.630  1.00 33.11 ? 162 LEU A HD13 2  
ATOM 8467   H HD21 . LEU A 1 162 ? 8.696   -6.736  7.762   1.00 70.21 ? 162 LEU A HD21 2  
ATOM 8468   H HD22 . LEU A 1 162 ? 9.495   -7.586  9.084   1.00 12.33 ? 162 LEU A HD22 2  
ATOM 8469   H HD23 . LEU A 1 162 ? 9.791   -5.866  8.837   1.00 35.34 ? 162 LEU A HD23 2  
ATOM 8470   N N    . ASP A 1 163 ? 4.545   -9.187  8.401   1.00 54.24 ? 163 ASP A N    2  
ATOM 8471   C CA   . ASP A 1 163 ? 4.081   -10.493 7.950   1.00 13.30 ? 163 ASP A CA   2  
ATOM 8472   C C    . ASP A 1 163 ? 3.525   -10.413 6.531   1.00 75.14 ? 163 ASP A C    2  
ATOM 8473   O O    . ASP A 1 163 ? 3.706   -11.330 5.731   1.00 54.21 ? 163 ASP A O    2  
ATOM 8474   C CB   . ASP A 1 163 ? 3.009   -11.033 8.900   1.00 74.11 ? 163 ASP A CB   2  
ATOM 8475   C CG   . ASP A 1 163 ? 3.568   -11.377 10.266  1.00 31.14 ? 163 ASP A CG   2  
ATOM 8476   O OD1  . ASP A 1 163 ? 3.991   -10.447 10.986  1.00 13.52 ? 163 ASP A OD1  2  
ATOM 8477   O OD2  . ASP A 1 163 ? 3.584   -12.575 10.617  1.00 2.20  ? 163 ASP A OD2  2  
ATOM 8478   H H    . ASP A 1 163 ? 4.160   -8.796  9.214   1.00 32.54 ? 163 ASP A H    2  
ATOM 8479   H HA   . ASP A 1 163 ? 4.925   -11.166 7.956   1.00 23.32 ? 163 ASP A HA   2  
ATOM 8480   H HB2  . ASP A 1 163 ? 2.238   -10.287 9.024   1.00 52.42 ? 163 ASP A HB2  2  
ATOM 8481   H HB3  . ASP A 1 163 ? 2.575   -11.925 8.473   1.00 41.15 ? 163 ASP A HB3  2  
ATOM 8482   N N    . ILE A 1 164 ? 2.851   -9.310  6.227   1.00 41.23 ? 164 ILE A N    2  
ATOM 8483   C CA   . ILE A 1 164 ? 2.271   -9.108  4.905   1.00 52.24 ? 164 ILE A CA   2  
ATOM 8484   C C    . ILE A 1 164 ? 3.356   -8.835  3.869   1.00 51.45 ? 164 ILE A C    2  
ATOM 8485   O O    . ILE A 1 164 ? 3.277   -9.304  2.733   1.00 70.32 ? 164 ILE A O    2  
ATOM 8486   C CB   . ILE A 1 164 ? 1.266   -7.940  4.902   1.00 13.33 ? 164 ILE A CB   2  
ATOM 8487   C CG1  . ILE A 1 164 ? 0.254   -8.105  6.038   1.00 71.25 ? 164 ILE A CG1  2  
ATOM 8488   C CG2  . ILE A 1 164 ? 0.555   -7.854  3.560   1.00 64.42 ? 164 ILE A CG2  2  
ATOM 8489   C CD1  . ILE A 1 164 ? -0.417  -6.810  6.441   1.00 55.13 ? 164 ILE A CD1  2  
ATOM 8490   H H    . ILE A 1 164 ? 2.742   -8.612  6.908   1.00 33.00 ? 164 ILE A H    2  
ATOM 8491   H HA   . ILE A 1 164 ? 1.744   -10.011 4.631   1.00 41.24 ? 164 ILE A HA   2  
ATOM 8492   H HB   . ILE A 1 164 ? 1.815   -7.022  5.050   1.00 63.31 ? 164 ILE A HB   2  
ATOM 8493   H HG12 . ILE A 1 164 ? -0.517  -8.793  5.726   1.00 4.35  ? 164 ILE A HG12 2  
ATOM 8494   H HG13 . ILE A 1 164 ? 0.757   -8.504  6.905   1.00 3.22  ? 164 ILE A HG13 2  
ATOM 8495   H HG21 . ILE A 1 164 ? 0.391   -8.849  3.175   1.00 55.22 ? 164 ILE A HG21 2  
ATOM 8496   H HG22 . ILE A 1 164 ? 1.165   -7.295  2.864   1.00 63.43 ? 164 ILE A HG22 2  
ATOM 8497   H HG23 . ILE A 1 164 ? -0.395  -7.356  3.687   1.00 44.20 ? 164 ILE A HG23 2  
ATOM 8498   H HD11 . ILE A 1 164 ? -0.370  -6.701  7.514   1.00 72.31 ? 164 ILE A HD11 2  
ATOM 8499   H HD12 . ILE A 1 164 ? -1.450  -6.826  6.126   1.00 55.24 ? 164 ILE A HD12 2  
ATOM 8500   H HD13 . ILE A 1 164 ? 0.090   -5.980  5.972   1.00 43.14 ? 164 ILE A HD13 2  
ATOM 8501   N N    . LEU A 1 165 ? 4.369   -8.074  4.268   1.00 52.41 ? 165 LEU A N    2  
ATOM 8502   C CA   . LEU A 1 165 ? 5.472   -7.739  3.374   1.00 1.54  ? 165 LEU A CA   2  
ATOM 8503   C C    . LEU A 1 165 ? 6.264   -8.988  2.999   1.00 51.23 ? 165 LEU A C    2  
ATOM 8504   O O    . LEU A 1 165 ? 6.655   -9.163  1.845   1.00 44.03 ? 165 LEU A O    2  
ATOM 8505   C CB   . LEU A 1 165 ? 6.396   -6.712  4.032   1.00 13.11 ? 165 LEU A CB   2  
ATOM 8506   C CG   . LEU A 1 165 ? 5.994   -5.252  3.824   1.00 55.11 ? 165 LEU A CG   2  
ATOM 8507   C CD1  . LEU A 1 165 ? 6.617   -4.368  4.894   1.00 1.35  ? 165 LEU A CD1  2  
ATOM 8508   C CD2  . LEU A 1 165 ? 6.404   -4.781  2.436   1.00 61.25 ? 165 LEU A CD2  2  
ATOM 8509   H H    . LEU A 1 165 ? 4.376   -7.730  5.185   1.00 4.14  ? 165 LEU A H    2  
ATOM 8510   H HA   . LEU A 1 165 ? 5.053   -7.310  2.477   1.00 62.21 ? 165 LEU A HA   2  
ATOM 8511   H HB2  . LEU A 1 165 ? 6.420   -6.910  5.094   1.00 25.52 ? 165 LEU A HB2  2  
ATOM 8512   H HB3  . LEU A 1 165 ? 7.391   -6.849  3.636   1.00 55.42 ? 165 LEU A HB3  2  
ATOM 8513   H HG   . LEU A 1 165 ? 4.920   -5.166  3.903   1.00 31.13 ? 165 LEU A HG   2  
ATOM 8514   H HD11 . LEU A 1 165 ? 6.297   -4.706  5.869   1.00 43.10 ? 165 LEU A HD11 2  
ATOM 8515   H HD12 . LEU A 1 165 ? 6.302   -3.346  4.745   1.00 40.12 ? 165 LEU A HD12 2  
ATOM 8516   H HD13 . LEU A 1 165 ? 7.693   -4.427  4.828   1.00 13.00 ? 165 LEU A HD13 2  
ATOM 8517   H HD21 . LEU A 1 165 ? 7.414   -4.401  2.468   1.00 5.55  ? 165 LEU A HD21 2  
ATOM 8518   H HD22 . LEU A 1 165 ? 5.736   -3.997  2.110   1.00 34.54 ? 165 LEU A HD22 2  
ATOM 8519   H HD23 . LEU A 1 165 ? 6.351   -5.608  1.745   1.00 72.05 ? 165 LEU A HD23 2  
ATOM 8520   N N    . GLU A 1 166 ? 6.495   -9.852  3.981   1.00 55.11 ? 166 GLU A N    2  
ATOM 8521   C CA   . GLU A 1 166 ? 7.239   -11.086 3.754   1.00 70.33 ? 166 GLU A CA   2  
ATOM 8522   C C    . GLU A 1 166 ? 6.524   -11.971 2.740   1.00 10.54 ? 166 GLU A C    2  
ATOM 8523   O O    . GLU A 1 166 ? 7.161   -12.646 1.932   1.00 62.30 ? 166 GLU A O    2  
ATOM 8524   C CB   . GLU A 1 166 ? 7.425   -11.844 5.071   1.00 50.22 ? 166 GLU A CB   2  
ATOM 8525   C CG   . GLU A 1 166 ? 8.690   -12.685 5.114   1.00 34.04 ? 166 GLU A CG   2  
ATOM 8526   C CD   . GLU A 1 166 ? 8.417   -14.159 4.891   1.00 74.23 ? 166 GLU A CD   2  
ATOM 8527   O OE1  . GLU A 1 166 ? 8.111   -14.539 3.742   1.00 35.52 ? 166 GLU A OE1  2  
ATOM 8528   O OE2  . GLU A 1 166 ? 8.512   -14.935 5.867   1.00 53.12 ? 166 GLU A OE2  2  
ATOM 8529   H H    . GLU A 1 166 ? 6.157   -9.656  4.880   1.00 25.10 ? 166 GLU A H    2  
ATOM 8530   H HA   . GLU A 1 166 ? 8.210   -10.820 3.362   1.00 42.00 ? 166 GLU A HA   2  
ATOM 8531   H HB2  . GLU A 1 166 ? 7.464   -11.131 5.881   1.00 42.30 ? 166 GLU A HB2  2  
ATOM 8532   H HB3  . GLU A 1 166 ? 6.579   -12.498 5.218   1.00 5.44  ? 166 GLU A HB3  2  
ATOM 8533   H HG2  . GLU A 1 166 ? 9.364   -12.338 4.344   1.00 32.34 ? 166 GLU A HG2  2  
ATOM 8534   H HG3  . GLU A 1 166 ? 9.156   -12.561 6.081   1.00 34.12 ? 166 GLU A HG3  2  
ATOM 8535   N N    . TYR A 1 167 ? 5.195   -11.963 2.788   1.00 55.22 ? 167 TYR A N    2  
ATOM 8536   C CA   . TYR A 1 167 ? 4.392   -12.765 1.873   1.00 12.31 ? 167 TYR A CA   2  
ATOM 8537   C C    . TYR A 1 167 ? 4.677   -12.384 0.424   1.00 12.14 ? 167 TYR A C    2  
ATOM 8538   O O    . TYR A 1 167 ? 4.896   -13.248 -0.424  1.00 20.14 ? 167 TYR A O    2  
ATOM 8539   C CB   . TYR A 1 167 ? 2.903   -12.586 2.179   1.00 52.11 ? 167 TYR A CB   2  
ATOM 8540   C CG   . TYR A 1 167 ? 1.996   -13.381 1.266   1.00 22.31 ? 167 TYR A CG   2  
ATOM 8541   C CD1  . TYR A 1 167 ? 1.680   -12.919 -0.005  1.00 34.22 ? 167 TYR A CD1  2  
ATOM 8542   C CD2  . TYR A 1 167 ? 1.456   -14.593 1.678   1.00 40.24 ? 167 TYR A CD2  2  
ATOM 8543   C CE1  . TYR A 1 167 ? 0.851   -13.643 -0.841  1.00 11.02 ? 167 TYR A CE1  2  
ATOM 8544   C CE2  . TYR A 1 167 ? 0.626   -15.324 0.846   1.00 73.45 ? 167 TYR A CE2  2  
ATOM 8545   C CZ   . TYR A 1 167 ? 0.328   -14.844 -0.411  1.00 42.13 ? 167 TYR A CZ   2  
ATOM 8546   O OH   . TYR A 1 167 ? -0.498  -15.567 -1.241  1.00 43.23 ? 167 TYR A OH   2  
ATOM 8547   H H    . TYR A 1 167 ? 4.745   -11.404 3.455   1.00 34.34 ? 167 TYR A H    2  
ATOM 8548   H HA   . TYR A 1 167 ? 4.658   -13.801 2.019   1.00 62.20 ? 167 TYR A HA   2  
ATOM 8549   H HB2  . TYR A 1 167 ? 2.710   -12.900 3.192   1.00 12.23 ? 167 TYR A HB2  2  
ATOM 8550   H HB3  . TYR A 1 167 ? 2.645   -11.542 2.076   1.00 64.01 ? 167 TYR A HB3  2  
ATOM 8551   H HD1  . TYR A 1 167 ? 2.092   -11.979 -0.340  1.00 72.01 ? 167 TYR A HD1  2  
ATOM 8552   H HD2  . TYR A 1 167 ? 1.692   -14.966 2.663   1.00 0.14  ? 167 TYR A HD2  2  
ATOM 8553   H HE1  . TYR A 1 167 ? 0.617   -13.267 -1.826  1.00 63.43 ? 167 TYR A HE1  2  
ATOM 8554   H HE2  . TYR A 1 167 ? 0.216   -16.263 1.184   1.00 25.33 ? 167 TYR A HE2  2  
ATOM 8555   H HH   . TYR A 1 167 ? 0.032   -16.139 -1.802  1.00 65.13 ? 167 TYR A HH   2  
ATOM 8556   N N    . ILE A 1 168 ? 4.671   -11.084 0.147   1.00 10.12 ? 168 ILE A N    2  
ATOM 8557   C CA   . ILE A 1 168 ? 4.929   -10.588 -1.199  1.00 62.52 ? 168 ILE A CA   2  
ATOM 8558   C C    . ILE A 1 168 ? 6.420   -10.606 -1.514  1.00 11.25 ? 168 ILE A C    2  
ATOM 8559   O O    . ILE A 1 168 ? 6.821   -10.810 -2.660  1.00 61.20 ? 168 ILE A O    2  
ATOM 8560   C CB   . ILE A 1 168 ? 4.395   -9.155  -1.383  1.00 73.55 ? 168 ILE A CB   2  
ATOM 8561   C CG1  . ILE A 1 168 ? 5.029   -8.214  -0.356  1.00 55.41 ? 168 ILE A CG1  2  
ATOM 8562   C CG2  . ILE A 1 168 ? 2.878   -9.134  -1.265  1.00 10.44 ? 168 ILE A CG2  2  
ATOM 8563   C CD1  . ILE A 1 168 ? 4.717   -6.754  -0.601  1.00 55.20 ? 168 ILE A CD1  2  
ATOM 8564   H H    . ILE A 1 168 ? 4.489   -10.442 0.866   1.00 2.43  ? 168 ILE A H    2  
ATOM 8565   H HA   . ILE A 1 168 ? 4.415   -11.233 -1.897  1.00 2.41  ? 168 ILE A HA   2  
ATOM 8566   H HB   . ILE A 1 168 ? 4.658   -8.821  -2.376  1.00 64.33 ? 168 ILE A HB   2  
ATOM 8567   H HG12 . ILE A 1 168 ? 4.665   -8.469  0.628   1.00 62.51 ? 168 ILE A HG12 2  
ATOM 8568   H HG13 . ILE A 1 168 ? 6.101   -8.335  -0.380  1.00 14.41 ? 168 ILE A HG13 2  
ATOM 8569   H HG21 . ILE A 1 168 ? 2.553   -9.974  -0.668  1.00 71.20 ? 168 ILE A HG21 2  
ATOM 8570   H HG22 . ILE A 1 168 ? 2.439   -9.202  -2.248  1.00 14.21 ? 168 ILE A HG22 2  
ATOM 8571   H HG23 . ILE A 1 168 ? 2.566   -8.215  -0.792  1.00 60.32 ? 168 ILE A HG23 2  
ATOM 8572   H HD11 . ILE A 1 168 ? 3.890   -6.453  0.024   1.00 61.41 ? 168 ILE A HD11 2  
ATOM 8573   H HD12 . ILE A 1 168 ? 4.455   -6.611  -1.639  1.00 31.41 ? 168 ILE A HD12 2  
ATOM 8574   H HD13 . ILE A 1 168 ? 5.584   -6.156  -0.363  1.00 40.13 ? 168 ILE A HD13 2  
ATOM 8575   N N    . HIS A 1 169 ? 7.239   -10.392 -0.489  1.00 22.33 ? 169 HIS A N    2  
ATOM 8576   C CA   . HIS A 1 169 ? 8.688   -10.384 -0.657  1.00 61.03 ? 169 HIS A CA   2  
ATOM 8577   C C    . HIS A 1 169 ? 9.182   -11.732 -1.173  1.00 22.10 ? 169 HIS A C    2  
ATOM 8578   O O    . HIS A 1 169 ? 10.100  -11.794 -1.992  1.00 65.42 ? 169 HIS A O    2  
ATOM 8579   C CB   . HIS A 1 169 ? 9.373   -10.051 0.669   1.00 72.52 ? 169 HIS A CB   2  
ATOM 8580   C CG   . HIS A 1 169 ? 10.769  -9.534  0.508   1.00 25.35 ? 169 HIS A CG   2  
ATOM 8581   N ND1  . HIS A 1 169 ? 11.058  -8.305  -0.047  1.00 44.14 ? 169 HIS A ND1  2  
ATOM 8582   C CD2  . HIS A 1 169 ? 11.962  -10.087 0.834   1.00 61.24 ? 169 HIS A CD2  2  
ATOM 8583   C CE1  . HIS A 1 169 ? 12.366  -8.125  -0.057  1.00 53.33 ? 169 HIS A CE1  2  
ATOM 8584   N NE2  . HIS A 1 169 ? 12.937  -9.191  0.473   1.00 53.12 ? 169 HIS A NE2  2  
ATOM 8585   H H    . HIS A 1 169 ? 6.860   -10.236 0.401   1.00 64.42 ? 169 HIS A H    2  
ATOM 8586   H HA   . HIS A 1 169 ? 8.934   -9.622  -1.380  1.00 11.11 ? 169 HIS A HA   2  
ATOM 8587   H HB2  . HIS A 1 169 ? 8.798   -9.297  1.185   1.00 74.53 ? 169 HIS A HB2  2  
ATOM 8588   H HB3  . HIS A 1 169 ? 9.416   -10.942 1.279   1.00 1.32  ? 169 HIS A HB3  2  
ATOM 8589   H HD1  . HIS A 1 169 ? 10.401  -7.661  -0.385  1.00 40.45 ? 169 HIS A HD1  2  
ATOM 8590   H HD2  . HIS A 1 169 ? 12.117  -11.053 1.294   1.00 0.24  ? 169 HIS A HD2  2  
ATOM 8591   H HE1  . HIS A 1 169 ? 12.882  -7.253  -0.433  1.00 63.15 ? 169 HIS A HE1  2  
ATOM 8592   H HE2  . HIS A 1 169 ? 13.894  -9.281  0.668   1.00 37.47 ? 169 HIS A HE2  2  
ATOM 8593   N N    . GLU A 1 170 ? 8.568   -12.807 -0.690  1.00 13.22 ? 170 GLU A N    2  
ATOM 8594   C CA   . GLU A 1 170 ? 8.946   -14.153 -1.104  1.00 71.13 ? 170 GLU A CA   2  
ATOM 8595   C C    . GLU A 1 170 ? 8.292   -14.528 -2.433  1.00 25.31 ? 170 GLU A C    2  
ATOM 8596   O O    . GLU A 1 170 ? 8.703   -15.486 -3.086  1.00 13.30 ? 170 GLU A O    2  
ATOM 8597   C CB   . GLU A 1 170 ? 8.554   -15.167 -0.027  1.00 42.24 ? 170 GLU A CB   2  
ATOM 8598   C CG   . GLU A 1 170 ? 7.054   -15.271 0.193   1.00 24.34 ? 170 GLU A CG   2  
ATOM 8599   C CD   . GLU A 1 170 ? 6.567   -16.706 0.232   1.00 54.45 ? 170 GLU A CD   2  
ATOM 8600   O OE1  . GLU A 1 170 ? 7.228   -17.540 0.887   1.00 31.14 ? 170 GLU A OE1  2  
ATOM 8601   O OE2  . GLU A 1 170 ? 5.526   -16.997 -0.393  1.00 70.30 ? 170 GLU A OE2  2  
ATOM 8602   H H    . GLU A 1 170 ? 7.843   -12.692 -0.040  1.00 1.32  ? 170 GLU A H    2  
ATOM 8603   H HA   . GLU A 1 170 ? 10.018  -14.172 -1.228  1.00 25.13 ? 170 GLU A HA   2  
ATOM 8604   H HB2  . GLU A 1 170 ? 8.923   -16.141 -0.316  1.00 22.13 ? 170 GLU A HB2  2  
ATOM 8605   H HB3  . GLU A 1 170 ? 9.015   -14.880 0.906   1.00 40.31 ? 170 GLU A HB3  2  
ATOM 8606   H HG2  . GLU A 1 170 ? 6.807   -14.798 1.132   1.00 1.22  ? 170 GLU A HG2  2  
ATOM 8607   H HG3  . GLU A 1 170 ? 6.549   -14.756 -0.611  1.00 13.31 ? 170 GLU A HG3  2  
ATOM 8608   N N    . HIS A 1 171 ? 7.273   -13.769 -2.829  1.00 42.55 ? 171 HIS A N    2  
ATOM 8609   C CA   . HIS A 1 171 ? 6.570   -14.028 -4.080  1.00 12.02 ? 171 HIS A CA   2  
ATOM 8610   C C    . HIS A 1 171 ? 7.077   -13.111 -5.189  1.00 62.01 ? 171 HIS A C    2  
ATOM 8611   O O    . HIS A 1 171 ? 6.326   -12.732 -6.088  1.00 11.43 ? 171 HIS A O    2  
ATOM 8612   C CB   . HIS A 1 171 ? 5.064   -13.839 -3.892  1.00 2.22  ? 171 HIS A CB   2  
ATOM 8613   C CG   . HIS A 1 171 ? 4.238   -14.872 -4.593  1.00 23.41 ? 171 HIS A CG   2  
ATOM 8614   N ND1  . HIS A 1 171 ? 3.538   -14.619 -5.753  1.00 53.15 ? 171 HIS A ND1  2  
ATOM 8615   C CD2  . HIS A 1 171 ? 4.001   -16.171 -4.290  1.00 43.34 ? 171 HIS A CD2  2  
ATOM 8616   C CE1  . HIS A 1 171 ? 2.908   -15.715 -6.134  1.00 34.45 ? 171 HIS A CE1  2  
ATOM 8617   N NE2  . HIS A 1 171 ? 3.172   -16.671 -5.265  1.00 72.43 ? 171 HIS A NE2  2  
ATOM 8618   H H    . HIS A 1 171 ? 6.987   -13.018 -2.269  1.00 73.33 ? 171 HIS A H    2  
ATOM 8619   H HA   . HIS A 1 171 ? 6.762   -15.053 -4.362  1.00 52.40 ? 171 HIS A HA   2  
ATOM 8620   H HB2  . HIS A 1 171 ? 4.830   -13.886 -2.839  1.00 33.14 ? 171 HIS A HB2  2  
ATOM 8621   H HB3  . HIS A 1 171 ? 4.779   -12.869 -4.275  1.00 13.21 ? 171 HIS A HB3  2  
ATOM 8622   H HD1  . HIS A 1 171 ? 3.508   -13.761 -6.228  1.00 12.34 ? 171 HIS A HD1  2  
ATOM 8623   H HD2  . HIS A 1 171 ? 4.392   -16.714 -3.441  1.00 13.00 ? 171 HIS A HD2  2  
ATOM 8624   H HE1  . HIS A 1 171 ? 2.282   -15.812 -7.010  1.00 72.31 ? 171 HIS A HE1  2  
ATOM 8625   H HE2  . HIS A 1 171 ? 2.764   -17.562 -5.262  1.00 37.47 ? 171 HIS A HE2  2  
ATOM 8626   N N    . GLU A 1 172 ? 8.357   -12.758 -5.119  1.00 70.41 ? 172 GLU A N    2  
ATOM 8627   C CA   . GLU A 1 172 ? 8.969   -11.887 -6.115  1.00 20.32 ? 172 GLU A CA   2  
ATOM 8628   C C    . GLU A 1 172 ? 8.176   -10.591 -6.273  1.00 52.52 ? 172 GLU A C    2  
ATOM 8629   O O    . GLU A 1 172 ? 7.855   -10.177 -7.388  1.00 14.11 ? 172 GLU A O    2  
ATOM 8630   C CB   . GLU A 1 172 ? 9.066   -12.608 -7.462  1.00 65.13 ? 172 GLU A CB   2  
ATOM 8631   C CG   . GLU A 1 172 ? 9.741   -13.967 -7.377  1.00 11.01 ? 172 GLU A CG   2  
ATOM 8632   C CD   . GLU A 1 172 ? 8.751   -15.114 -7.416  1.00 54.11 ? 172 GLU A CD   2  
ATOM 8633   O OE1  . GLU A 1 172 ? 8.096   -15.369 -6.383  1.00 24.01 ? 172 GLU A OE1  2  
ATOM 8634   O OE2  . GLU A 1 172 ? 8.630   -15.757 -8.479  1.00 23.50 ? 172 GLU A OE2  2  
ATOM 8635   H H    . GLU A 1 172 ? 8.904   -13.096 -4.378  1.00 10.42 ? 172 GLU A H    2  
ATOM 8636   H HA   . GLU A 1 172 ? 9.964   -11.644 -5.776  1.00 0.34  ? 172 GLU A HA   2  
ATOM 8637   H HB2  . GLU A 1 172 ? 8.069   -12.749 -7.853  1.00 11.21 ? 172 GLU A HB2  2  
ATOM 8638   H HB3  . GLU A 1 172 ? 9.629   -11.992 -8.148  1.00 64.14 ? 172 GLU A HB3  2  
ATOM 8639   H HG2  . GLU A 1 172 ? 10.420  -14.069 -8.209  1.00 21.22 ? 172 GLU A HG2  2  
ATOM 8640   H HG3  . GLU A 1 172 ? 10.297  -14.021 -6.451  1.00 53.43 ? 172 GLU A HG3  2  
ATOM 8641   N N    . TYR A 1 173 ? 7.861   -9.955  -5.149  1.00 5.53  ? 173 TYR A N    2  
ATOM 8642   C CA   . TYR A 1 173 ? 7.104   -8.708  -5.164  1.00 33.14 ? 173 TYR A CA   2  
ATOM 8643   C C    . TYR A 1 173 ? 7.543   -7.790  -4.029  1.00 3.43  ? 173 TYR A C    2  
ATOM 8644   O O    . TYR A 1 173 ? 7.840   -8.249  -2.925  1.00 23.20 ? 173 TYR A O    2  
ATOM 8645   C CB   . TYR A 1 173 ? 5.607   -8.995  -5.053  1.00 74.12 ? 173 TYR A CB   2  
ATOM 8646   C CG   . TYR A 1 173 ? 5.001   -9.556  -6.319  1.00 51.02 ? 173 TYR A CG   2  
ATOM 8647   C CD1  . TYR A 1 173 ? 5.143   -8.895  -7.533  1.00 54.45 ? 173 TYR A CD1  2  
ATOM 8648   C CD2  . TYR A 1 173 ? 4.287   -10.748 -6.302  1.00 74.32 ? 173 TYR A CD2  2  
ATOM 8649   C CE1  . TYR A 1 173 ? 4.590   -9.404  -8.692  1.00 25.10 ? 173 TYR A CE1  2  
ATOM 8650   C CE2  . TYR A 1 173 ? 3.732   -11.265 -7.457  1.00 3.42  ? 173 TYR A CE2  2  
ATOM 8651   C CZ   . TYR A 1 173 ? 3.886   -10.589 -8.649  1.00 3.43  ? 173 TYR A CZ   2  
ATOM 8652   O OH   . TYR A 1 173 ? 3.335   -11.100 -9.801  1.00 74.45 ? 173 TYR A OH   2  
ATOM 8653   H H    . TYR A 1 173 ? 8.143   -10.333 -4.290  1.00 51.40 ? 173 TYR A H    2  
ATOM 8654   H HA   . TYR A 1 173 ? 7.298   -8.215  -6.105  1.00 72.20 ? 173 TYR A HA   2  
ATOM 8655   H HB2  . TYR A 1 173 ? 5.442   -9.711  -4.261  1.00 20.43 ? 173 TYR A HB2  2  
ATOM 8656   H HB3  . TYR A 1 173 ? 5.088   -8.078  -4.814  1.00 34.25 ? 173 TYR A HB3  2  
ATOM 8657   H HD1  . TYR A 1 173 ? 5.694   -7.967  -7.563  1.00 41.31 ? 173 TYR A HD1  2  
ATOM 8658   H HD2  . TYR A 1 173 ? 4.167   -11.274 -5.366  1.00 0.45  ? 173 TYR A HD2  2  
ATOM 8659   H HE1  . TYR A 1 173 ? 4.712   -8.875  -9.626  1.00 23.23 ? 173 TYR A HE1  2  
ATOM 8660   H HE2  . TYR A 1 173 ? 3.181   -12.192 -7.423  1.00 12.32 ? 173 TYR A HE2  2  
ATOM 8661   H HH   . TYR A 1 173 ? 2.440   -10.768 -9.903  1.00 73.32 ? 173 TYR A HH   2  
ATOM 8662   N N    . VAL A 1 174 ? 7.581   -6.490  -4.305  1.00 52.54 ? 174 VAL A N    2  
ATOM 8663   C CA   . VAL A 1 174 ? 7.983   -5.507  -3.307  1.00 64.12 ? 174 VAL A CA   2  
ATOM 8664   C C    . VAL A 1 174 ? 6.951   -4.391  -3.192  1.00 52.23 ? 174 VAL A C    2  
ATOM 8665   O O    . VAL A 1 174 ? 6.478   -3.863  -4.199  1.00 55.04 ? 174 VAL A O    2  
ATOM 8666   C CB   . VAL A 1 174 ? 9.354   -4.891  -3.645  1.00 43.51 ? 174 VAL A CB   2  
ATOM 8667   C CG1  . VAL A 1 174 ? 10.441  -5.956  -3.611  1.00 43.25 ? 174 VAL A CG1  2  
ATOM 8668   C CG2  . VAL A 1 174 ? 9.313   -4.202  -5.002  1.00 62.34 ? 174 VAL A CG2  2  
ATOM 8669   H H    . VAL A 1 174 ? 7.333   -6.186  -5.203  1.00 73.24 ? 174 VAL A H    2  
ATOM 8670   H HA   . VAL A 1 174 ? 8.062   -6.011  -2.355  1.00 52.15 ? 174 VAL A HA   2  
ATOM 8671   H HB   . VAL A 1 174 ? 9.586   -4.148  -2.895  1.00 53.44 ? 174 VAL A HB   2  
ATOM 8672   H HG11 . VAL A 1 174 ? 10.966  -5.903  -2.668  1.00 62.41 ? 174 VAL A HG11 2  
ATOM 8673   H HG12 . VAL A 1 174 ? 11.135  -5.788  -4.420  1.00 71.32 ? 174 VAL A HG12 2  
ATOM 8674   H HG13 . VAL A 1 174 ? 9.992   -6.932  -3.717  1.00 43.12 ? 174 VAL A HG13 2  
ATOM 8675   H HG21 . VAL A 1 174 ? 8.478   -4.582  -5.572  1.00 33.12 ? 174 VAL A HG21 2  
ATOM 8676   H HG22 . VAL A 1 174 ? 10.231  -4.399  -5.534  1.00 74.03 ? 174 VAL A HG22 2  
ATOM 8677   H HG23 . VAL A 1 174 ? 9.198   -3.138  -4.862  1.00 2.13  ? 174 VAL A HG23 2  
ATOM 8678   N N    . HIS A 1 175 ? 6.606   -4.033  -1.960  1.00 30.05 ? 175 HIS A N    2  
ATOM 8679   C CA   . HIS A 1 175 ? 5.629   -2.979  -1.716  1.00 31.50 ? 175 HIS A CA   2  
ATOM 8680   C C    . HIS A 1 175 ? 6.250   -1.603  -1.929  1.00 2.43  ? 175 HIS A C    2  
ATOM 8681   O O    . HIS A 1 175 ? 5.806   -0.836  -2.784  1.00 72.32 ? 175 HIS A O    2  
ATOM 8682   C CB   . HIS A 1 175 ? 5.076   -3.086  -0.293  1.00 71.33 ? 175 HIS A CB   2  
ATOM 8683   C CG   . HIS A 1 175 ? 3.616   -2.771  -0.194  1.00 73.04 ? 175 HIS A CG   2  
ATOM 8684   N ND1  . HIS A 1 175 ? 2.652   -3.732  0.027   1.00 55.32 ? 175 HIS A ND1  2  
ATOM 8685   C CD2  . HIS A 1 175 ? 2.955   -1.594  -0.288  1.00 53.52 ? 175 HIS A CD2  2  
ATOM 8686   C CE1  . HIS A 1 175 ? 1.462   -3.159  0.064   1.00 64.44 ? 175 HIS A CE1  2  
ATOM 8687   N NE2  . HIS A 1 175 ? 1.619   -1.862  -0.124  1.00 33.14 ? 175 HIS A NE2  2  
ATOM 8688   H H    . HIS A 1 175 ? 7.018   -4.490  -1.197  1.00 3.23  ? 175 HIS A H    2  
ATOM 8689   H HA   . HIS A 1 175 ? 4.819   -3.108  -2.418  1.00 13.31 ? 175 HIS A HA   2  
ATOM 8690   H HB2  . HIS A 1 175 ? 5.223   -4.094  0.068   1.00 42.53 ? 175 HIS A HB2  2  
ATOM 8691   H HB3  . HIS A 1 175 ? 5.609   -2.399  0.347   1.00 44.05 ? 175 HIS A HB3  2  
ATOM 8692   H HD1  . HIS A 1 175 ? 2.815   -4.693  0.139   1.00 60.11 ? 175 HIS A HD1  2  
ATOM 8693   H HD2  . HIS A 1 175 ? 3.397   -0.622  -0.460  1.00 20.32 ? 175 HIS A HD2  2  
ATOM 8694   H HE1  . HIS A 1 175 ? 0.521   -3.665  0.222   1.00 2.43  ? 175 HIS A HE1  2  
ATOM 8695   H HE2  . HIS A 1 175 ? 0.890   -1.216  -0.237  1.00 37.47 ? 175 HIS A HE2  2  
ATOM 8696   N N    . GLY A 1 176 ? 7.279   -1.296  -1.147  1.00 23.35 ? 176 GLY A N    2  
ATOM 8697   C CA   . GLY A 1 176 ? 7.944   -0.012  -1.266  1.00 50.20 ? 176 GLY A CA   2  
ATOM 8698   C C    . GLY A 1 176 ? 7.209   1.091   -0.532  1.00 12.12 ? 176 GLY A C    2  
ATOM 8699   O O    . GLY A 1 176 ? 7.546   1.420   0.606   1.00 34.02 ? 176 GLY A O    2  
ATOM 8700   H H    . GLY A 1 176 ? 7.590   -1.946  -0.484  1.00 52.31 ? 176 GLY A H    2  
ATOM 8701   H HA2  . GLY A 1 176 ? 8.942   -0.097  -0.863  1.00 25.24 ? 176 GLY A HA2  2  
ATOM 8702   H HA3  . GLY A 1 176 ? 8.011   0.250   -2.311  1.00 60.50 ? 176 GLY A HA3  2  
ATOM 8703   N N    . ASP A 1 177 ? 6.203   1.662   -1.182  1.00 63.40 ? 177 ASP A N    2  
ATOM 8704   C CA   . ASP A 1 177 ? 5.417   2.735   -0.584  1.00 61.02 ? 177 ASP A CA   2  
ATOM 8705   C C    . ASP A 1 177 ? 4.143   2.186   0.050   1.00 4.41  ? 177 ASP A C    2  
ATOM 8706   O O    . ASP A 1 177 ? 3.077   2.200   -0.565  1.00 13.44 ? 177 ASP A O    2  
ATOM 8707   C CB   . ASP A 1 177 ? 5.065   3.786   -1.637  1.00 31.11 ? 177 ASP A CB   2  
ATOM 8708   C CG   . ASP A 1 177 ? 6.290   4.493   -2.181  1.00 71.31 ? 177 ASP A CG   2  
ATOM 8709   O OD1  . ASP A 1 177 ? 6.785   5.425   -1.511  1.00 35.14 ? 177 ASP A OD1  2  
ATOM 8710   O OD2  . ASP A 1 177 ? 6.757   4.116   -3.277  1.00 54.21 ? 177 ASP A OD2  2  
ATOM 8711   H H    . ASP A 1 177 ? 5.982   1.355   -2.085  1.00 33.13 ? 177 ASP A H    2  
ATOM 8712   H HA   . ASP A 1 177 ? 6.018   3.197   0.186   1.00 54.43 ? 177 ASP A HA   2  
ATOM 8713   H HB2  . ASP A 1 177 ? 4.555   3.306   -2.460  1.00 45.01 ? 177 ASP A HB2  2  
ATOM 8714   H HB3  . ASP A 1 177 ? 4.411   4.525   -1.196  1.00 43.22 ? 177 ASP A HB3  2  
ATOM 8715   N N    . ILE A 1 178 ? 4.262   1.703   1.283   1.00 43.31 ? 178 ILE A N    2  
ATOM 8716   C CA   . ILE A 1 178 ? 3.119   1.150   1.997   1.00 23.10 ? 178 ILE A CA   2  
ATOM 8717   C C    . ILE A 1 178 ? 2.100   2.237   2.323   1.00 75.43 ? 178 ILE A C    2  
ATOM 8718   O O    . ILE A 1 178 ? 0.982   2.226   1.809   1.00 51.33 ? 178 ILE A O    2  
ATOM 8719   C CB   . ILE A 1 178 ? 3.557   0.460   3.305   1.00 22.25 ? 178 ILE A CB   2  
ATOM 8720   C CG1  . ILE A 1 178 ? 4.675   -0.547  3.027   1.00 22.10 ? 178 ILE A CG1  2  
ATOM 8721   C CG2  . ILE A 1 178 ? 2.373   -0.227  3.968   1.00 4.21  ? 178 ILE A CG2  2  
ATOM 8722   C CD1  . ILE A 1 178 ? 5.629   -0.724  4.188   1.00 53.41 ? 178 ILE A CD1  2  
ATOM 8723   H H    . ILE A 1 178 ? 5.138   1.719   1.720   1.00 24.32 ? 178 ILE A H    2  
ATOM 8724   H HA   . ILE A 1 178 ? 2.653   0.411   1.362   1.00 40.15 ? 178 ILE A HA   2  
ATOM 8725   H HB   . ILE A 1 178 ? 3.925   1.218   3.979   1.00 24.04 ? 178 ILE A HB   2  
ATOM 8726   H HG12 . ILE A 1 178 ? 4.238   -1.509  2.810   1.00 1.00  ? 178 ILE A HG12 2  
ATOM 8727   H HG13 . ILE A 1 178 ? 5.247   -0.215  2.174   1.00 1.21  ? 178 ILE A HG13 2  
ATOM 8728   H HG21 . ILE A 1 178 ? 2.142   -1.138  3.437   1.00 4.30  ? 178 ILE A HG21 2  
ATOM 8729   H HG22 . ILE A 1 178 ? 1.517   0.430   3.946   1.00 65.34 ? 178 ILE A HG22 2  
ATOM 8730   H HG23 . ILE A 1 178 ? 2.622   -0.461  4.993   1.00 11.33 ? 178 ILE A HG23 2  
ATOM 8731   H HD11 . ILE A 1 178 ? 6.040   0.235   4.467   1.00 63.31 ? 178 ILE A HD11 2  
ATOM 8732   H HD12 . ILE A 1 178 ? 6.430   -1.387  3.898   1.00 53.44 ? 178 ILE A HD12 2  
ATOM 8733   H HD13 . ILE A 1 178 ? 5.100   -1.146  5.029   1.00 55.23 ? 178 ILE A HD13 2  
ATOM 8734   N N    . LYS A 1 179 ? 2.500   3.179   3.172   1.00 24.15 ? 179 LYS A N    2  
ATOM 8735   C CA   . LYS A 1 179 ? 1.628   4.282   3.565   1.00 3.11  ? 179 LYS A CA   2  
ATOM 8736   C C    . LYS A 1 179 ? 0.365   3.771   4.253   1.00 25.32 ? 179 LYS A C    2  
ATOM 8737   O O    . LYS A 1 179 ? -0.247  2.797   3.814   1.00 71.32 ? 179 LYS A O    2  
ATOM 8738   C CB   . LYS A 1 179 ? 1.251   5.120   2.343   1.00 70.22 ? 179 LYS A CB   2  
ATOM 8739   C CG   . LYS A 1 179 ? 2.450   5.700   1.610   1.00 11.41 ? 179 LYS A CG   2  
ATOM 8740   C CD   . LYS A 1 179 ? 2.046   6.318   0.281   1.00 43.53 ? 179 LYS A CD   2  
ATOM 8741   C CE   . LYS A 1 179 ? 2.808   7.605   0.010   1.00 23.10 ? 179 LYS A CE   2  
ATOM 8742   N NZ   . LYS A 1 179 ? 1.979   8.596   -0.729  1.00 51.34 ? 179 LYS A NZ   2  
ATOM 8743   H H    . LYS A 1 179 ? 3.407   3.133   3.541   1.00 5.30  ? 179 LYS A H    2  
ATOM 8744   H HA   . LYS A 1 179 ? 2.174   4.902   4.259   1.00 3.44  ? 179 LYS A HA   2  
ATOM 8745   H HB2  . LYS A 1 179 ? 0.700   4.499   1.651   1.00 73.22 ? 179 LYS A HB2  2  
ATOM 8746   H HB3  . LYS A 1 179 ? 0.621   5.937   2.661   1.00 63.11 ? 179 LYS A HB3  2  
ATOM 8747   H HG2  . LYS A 1 179 ? 2.902   6.463   2.227   1.00 71.01 ? 179 LYS A HG2  2  
ATOM 8748   H HG3  . LYS A 1 179 ? 3.165   4.911   1.428   1.00 73.15 ? 179 LYS A HG3  2  
ATOM 8749   H HD2  . LYS A 1 179 ? 2.256   5.614   -0.511  1.00 12.22 ? 179 LYS A HD2  2  
ATOM 8750   H HD3  . LYS A 1 179 ? 0.988   6.534   0.303   1.00 23.30 ? 179 LYS A HD3  2  
ATOM 8751   H HE2  . LYS A 1 179 ? 3.111   8.035   0.953   1.00 70.10 ? 179 LYS A HE2  2  
ATOM 8752   H HE3  . LYS A 1 179 ? 3.684   7.373   -0.576  1.00 71.24 ? 179 LYS A HE3  2  
ATOM 8753   H HZ1  . LYS A 1 179 ? 2.272   9.563   -0.481  1.00 51.34 ? 179 LYS A HZ1  2  
ATOM 8754   H HZ2  . LYS A 1 179 ? 0.976   8.477   -0.484  1.00 64.03 ? 179 LYS A HZ2  2  
ATOM 8755   H HZ3  . LYS A 1 179 ? 2.092   8.464   -1.754  1.00 3.12  ? 179 LYS A HZ3  2  
ATOM 8756   N N    . ALA A 1 180 ? -0.024  4.438   5.335   1.00 31.24 ? 180 ALA A N    2  
ATOM 8757   C CA   . ALA A 1 180 ? -1.215  4.054   6.083   1.00 34.04 ? 180 ALA A CA   2  
ATOM 8758   C C    . ALA A 1 180 ? -2.492  4.426   5.328   1.00 64.10 ? 180 ALA A C    2  
ATOM 8759   O O    . ALA A 1 180 ? -3.591  4.044   5.731   1.00 62.32 ? 180 ALA A O    2  
ATOM 8760   C CB   . ALA A 1 180 ? -1.206  4.708   7.457   1.00 51.42 ? 180 ALA A CB   2  
ATOM 8761   H H    . ALA A 1 180 ? 0.504   5.206   5.639   1.00 72.02 ? 180 ALA A H    2  
ATOM 8762   H HA   . ALA A 1 180 ? -1.191  2.984   6.221   1.00 24.34 ? 180 ALA A HA   2  
ATOM 8763   H HB1  . ALA A 1 180 ? -1.759  5.635   7.418   1.00 55.35 ? 180 ALA A HB1  2  
ATOM 8764   H HB2  . ALA A 1 180 ? -0.187  4.908   7.753   1.00 61.52 ? 180 ALA A HB2  2  
ATOM 8765   H HB3  . ALA A 1 180 ? -1.666  4.043   8.174   1.00 44.45 ? 180 ALA A HB3  2  
ATOM 8766   N N    . SER A 1 181 ? -2.343  5.170   4.235   1.00 74.22 ? 181 SER A N    2  
ATOM 8767   C CA   . SER A 1 181 ? -3.487  5.586   3.431   1.00 34.32 ? 181 SER A CA   2  
ATOM 8768   C C    . SER A 1 181 ? -4.085  4.409   2.660   1.00 13.42 ? 181 SER A C    2  
ATOM 8769   O O    . SER A 1 181 ? -5.179  4.512   2.109   1.00 11.50 ? 181 SER A O    2  
ATOM 8770   C CB   . SER A 1 181 ? -3.075  6.690   2.455   1.00 32.13 ? 181 SER A CB   2  
ATOM 8771   O OG   . SER A 1 181 ? -4.192  7.466   2.059   1.00 72.40 ? 181 SER A OG   2  
ATOM 8772   H H    . SER A 1 181 ? -1.443  5.444   3.961   1.00 42.02 ? 181 SER A H    2  
ATOM 8773   H HA   . SER A 1 181 ? -4.237  5.976   4.102   1.00 31.21 ? 181 SER A HA   2  
ATOM 8774   H HB2  . SER A 1 181 ? -2.353  7.337   2.931   1.00 4.32  ? 181 SER A HB2  2  
ATOM 8775   H HB3  . SER A 1 181 ? -2.632  6.244   1.576   1.00 63.42 ? 181 SER A HB3  2  
ATOM 8776   H HG   . SER A 1 181 ? -4.061  7.784   1.164   1.00 42.34 ? 181 SER A HG   2  
ATOM 8777   N N    . ASN A 1 182 ? -3.363  3.291   2.626   1.00 10.12 ? 182 ASN A N    2  
ATOM 8778   C CA   . ASN A 1 182 ? -3.831  2.102   1.922   1.00 72.53 ? 182 ASN A CA   2  
ATOM 8779   C C    . ASN A 1 182 ? -4.089  0.958   2.897   1.00 61.11 ? 182 ASN A C    2  
ATOM 8780   O O    . ASN A 1 182 ? -3.976  -0.214  2.538   1.00 11.22 ? 182 ASN A O    2  
ATOM 8781   C CB   . ASN A 1 182 ? -2.808  1.670   0.870   1.00 23.44 ? 182 ASN A CB   2  
ATOM 8782   C CG   . ASN A 1 182 ? -2.815  2.574   -0.348  1.00 74.41 ? 182 ASN A CG   2  
ATOM 8783   O OD1  . ASN A 1 182 ? -2.043  3.530   -0.428  1.00 55.32 ? 182 ASN A OD1  2  
ATOM 8784   N ND2  . ASN A 1 182 ? -3.688  2.275   -1.302  1.00 11.53 ? 182 ASN A ND2  2  
ATOM 8785   H H    . ASN A 1 182 ? -2.498  3.263   3.084   1.00 54.24 ? 182 ASN A H    2  
ATOM 8786   H HA   . ASN A 1 182 ? -4.758  2.354   1.428   1.00 14.20 ? 182 ASN A HA   2  
ATOM 8787   H HB2  . ASN A 1 182 ? -1.822  1.693   1.306   1.00 70.33 ? 182 ASN A HB2  2  
ATOM 8788   H HB3  . ASN A 1 182 ? -3.034  0.664   0.550   1.00 0.35  ? 182 ASN A HB3  2  
ATOM 8789   H HD21 . ASN A 1 182 ? -4.271  1.499   -1.169  1.00 4.11  ? 182 ASN A HD21 2  
ATOM 8790   H HD22 . ASN A 1 182 ? -3.714  2.843   -2.100  1.00 22.12 ? 182 ASN A HD22 2  
ATOM 8791   N N    . LEU A 1 183 ? -4.438  1.305   4.132   1.00 3.21  ? 183 LEU A N    2  
ATOM 8792   C CA   . LEU A 1 183 ? -4.713  0.307   5.159   1.00 43.33 ? 183 LEU A CA   2  
ATOM 8793   C C    . LEU A 1 183 ? -6.114  0.488   5.733   1.00 42.10 ? 183 LEU A C    2  
ATOM 8794   O O    . LEU A 1 183 ? -6.476  1.575   6.182   1.00 21.14 ? 183 LEU A O    2  
ATOM 8795   C CB   . LEU A 1 183 ? -3.675  0.397   6.279   1.00 11.33 ? 183 LEU A CB   2  
ATOM 8796   C CG   . LEU A 1 183 ? -2.269  -0.073  5.900   1.00 25.40 ? 183 LEU A CG   2  
ATOM 8797   C CD1  . LEU A 1 183 ? -1.235  0.519   6.846   1.00 35.52 ? 183 LEU A CD1  2  
ATOM 8798   C CD2  . LEU A 1 183 ? -2.196  -1.592  5.912   1.00 2.03  ? 183 LEU A CD2  2  
ATOM 8799   H H    . LEU A 1 183 ? -4.512  2.256   4.358   1.00 23.35 ? 183 LEU A H    2  
ATOM 8800   H HA   . LEU A 1 183 ? -4.648  -0.668  4.699   1.00 12.45 ? 183 LEU A HA   2  
ATOM 8801   H HB2  . LEU A 1 183 ? -3.614  1.427   6.601   1.00 21.40 ? 183 LEU A HB2  2  
ATOM 8802   H HB3  . LEU A 1 183 ? -4.018  -0.201  7.109   1.00 11.41 ? 183 LEU A HB3  2  
ATOM 8803   H HG   . LEU A 1 183 ? -2.040  0.267   4.901   1.00 53.21 ? 183 LEU A HG   2  
ATOM 8804   H HD11 . LEU A 1 183 ? -1.648  1.390   7.332   1.00 4.25  ? 183 LEU A HD11 2  
ATOM 8805   H HD12 . LEU A 1 183 ? -0.357  0.803   6.286   1.00 32.21 ? 183 LEU A HD12 2  
ATOM 8806   H HD13 . LEU A 1 183 ? -0.965  -0.215  7.590   1.00 10.03 ? 183 LEU A HD13 2  
ATOM 8807   H HD21 . LEU A 1 183 ? -2.728  -1.985  5.058   1.00 25.13 ? 183 LEU A HD21 2  
ATOM 8808   H HD22 . LEU A 1 183 ? -2.645  -1.968  6.820   1.00 72.15 ? 183 LEU A HD22 2  
ATOM 8809   H HD23 . LEU A 1 183 ? -1.163  -1.904  5.865   1.00 35.44 ? 183 LEU A HD23 2  
ATOM 8810   N N    . LEU A 1 184 ? -6.898  -0.586  5.714   1.00 62.33 ? 184 LEU A N    2  
ATOM 8811   C CA   . LEU A 1 184 ? -8.260  -0.546  6.233   1.00 35.34 ? 184 LEU A CA   2  
ATOM 8812   C C    . LEU A 1 184 ? -8.433  -1.535  7.381   1.00 54.42 ? 184 LEU A C    2  
ATOM 8813   O O    . LEU A 1 184 ? -7.699  -2.517  7.482   1.00 63.21 ? 184 LEU A O    2  
ATOM 8814   C CB   . LEU A 1 184 ? -9.261  -0.859  5.119   1.00 15.33 ? 184 LEU A CB   2  
ATOM 8815   C CG   . LEU A 1 184 ? -9.323  0.175   3.995   1.00 21.41 ? 184 LEU A CG   2  
ATOM 8816   C CD1  . LEU A 1 184 ? -8.307  -0.151  2.912   1.00 53.15 ? 184 LEU A CD1  2  
ATOM 8817   C CD2  . LEU A 1 184 ? -10.726 0.242   3.409   1.00 73.33 ? 184 LEU A CD2  2  
ATOM 8818   H H    . LEU A 1 184 ? -6.553  -1.424  5.342   1.00 1.34  ? 184 LEU A H    2  
ATOM 8819   H HA   . LEU A 1 184 ? -8.446  0.451   6.601   1.00 41.13 ? 184 LEU A HA   2  
ATOM 8820   H HB2  . LEU A 1 184 ? -9.001  -1.815  4.688   1.00 20.34 ? 184 LEU A HB2  2  
ATOM 8821   H HB3  . LEU A 1 184 ? -10.245 -0.938  5.559   1.00 42.12 ? 184 LEU A HB3  2  
ATOM 8822   H HG   . LEU A 1 184 ? -9.081  1.148   4.396   1.00 21.42 ? 184 LEU A HG   2  
ATOM 8823   H HD11 . LEU A 1 184 ? -7.521  -0.764  3.329   1.00 54.34 ? 184 LEU A HD11 2  
ATOM 8824   H HD12 . LEU A 1 184 ? -7.883  0.765   2.527   1.00 12.41 ? 184 LEU A HD12 2  
ATOM 8825   H HD13 . LEU A 1 184 ? -8.794  -0.687  2.110   1.00 43.32 ? 184 LEU A HD13 2  
ATOM 8826   H HD21 . LEU A 1 184 ? -11.440 0.411   4.203   1.00 4.22  ? 184 LEU A HD21 2  
ATOM 8827   H HD22 . LEU A 1 184 ? -10.953 -0.689  2.913   1.00 20.24 ? 184 LEU A HD22 2  
ATOM 8828   H HD23 . LEU A 1 184 ? -10.781 1.052   2.696   1.00 2.35  ? 184 LEU A HD23 2  
ATOM 8829   N N    . LEU A 1 185 ? -9.408  -1.268  8.245   1.00 74.21 ? 185 LEU A N    2  
ATOM 8830   C CA   . LEU A 1 185 ? -9.675  -2.136  9.386   1.00 41.11 ? 185 LEU A CA   2  
ATOM 8831   C C    . LEU A 1 185 ? -10.950 -2.943  9.169   1.00 12.25 ? 185 LEU A C    2  
ATOM 8832   O O    . LEU A 1 185 ? -11.909 -2.458  8.570   1.00 21.14 ? 185 LEU A O    2  
ATOM 8833   C CB   . LEU A 1 185 ? -9.795  -1.305  10.666  1.00 43.42 ? 185 LEU A CB   2  
ATOM 8834   C CG   . LEU A 1 185 ? -8.497  -0.641  11.130  1.00 63.31 ? 185 LEU A CG   2  
ATOM 8835   C CD1  . LEU A 1 185 ? -8.766  0.771   11.631  1.00 74.51 ? 185 LEU A CD1  2  
ATOM 8836   C CD2  . LEU A 1 185 ? -7.829  -1.476  12.214  1.00 11.22 ? 185 LEU A CD2  2  
ATOM 8837   H H    . LEU A 1 185 ? -9.960  -0.470  8.111   1.00 73.32 ? 185 LEU A H    2  
ATOM 8838   H HA   . LEU A 1 185 ? -8.843  -2.817  9.487   1.00 41.30 ? 185 LEU A HA   2  
ATOM 8839   H HB2  . LEU A 1 185 ? -10.533 -0.533  10.500  1.00 2.11  ? 185 LEU A HB2  2  
ATOM 8840   H HB3  . LEU A 1 185 ? -10.147 -1.951  11.457  1.00 44.22 ? 185 LEU A HB3  2  
ATOM 8841   H HG   . LEU A 1 185 ? -7.816  -0.573  10.293  1.00 53.44 ? 185 LEU A HG   2  
ATOM 8842   H HD11 . LEU A 1 185 ? -8.165  0.963   12.508  1.00 43.20 ? 185 LEU A HD11 2  
ATOM 8843   H HD12 . LEU A 1 185 ? -9.812  0.869   11.883  1.00 31.43 ? 185 LEU A HD12 2  
ATOM 8844   H HD13 . LEU A 1 185 ? -8.514  1.481   10.858  1.00 53.43 ? 185 LEU A HD13 2  
ATOM 8845   H HD21 . LEU A 1 185 ? -8.586  -1.982  12.795  1.00 63.13 ? 185 LEU A HD21 2  
ATOM 8846   H HD22 . LEU A 1 185 ? -7.251  -0.832  12.859  1.00 14.43 ? 185 LEU A HD22 2  
ATOM 8847   H HD23 . LEU A 1 185 ? -7.179  -2.206  11.756  1.00 40.41 ? 185 LEU A HD23 2  
ATOM 8848   N N    . ASN A 1 186 ? -10.954 -4.178  9.660   1.00 31.10 ? 186 ASN A N    2  
ATOM 8849   C CA   . ASN A 1 186 ? -12.113 -5.052  9.519   1.00 64.14 ? 186 ASN A CA   2  
ATOM 8850   C C    . ASN A 1 186 ? -13.338 -4.445  10.194  1.00 42.42 ? 186 ASN A C    2  
ATOM 8851   O O    . ASN A 1 186 ? -13.270 -3.998  11.340  1.00 1.00  ? 186 ASN A O    2  
ATOM 8852   C CB   . ASN A 1 186 ? -11.814 -6.430  10.113  1.00 34.22 ? 186 ASN A CB   2  
ATOM 8853   C CG   . ASN A 1 186 ? -12.400 -7.556  9.286   1.00 2.12  ? 186 ASN A CG   2  
ATOM 8854   O OD1  . ASN A 1 186 ? -12.138 -7.663  8.088   1.00 35.54 ? 186 ASN A OD1  2  
ATOM 8855   N ND2  . ASN A 1 186 ? -13.199 -8.406  9.922   1.00 70.52 ? 186 ASN A ND2  2  
ATOM 8856   H H    . ASN A 1 186 ? -10.158 -4.510  10.129  1.00 13.01 ? 186 ASN A H    2  
ATOM 8857   H HA   . ASN A 1 186 ? -12.316 -5.163  8.464   1.00 45.40 ? 186 ASN A HA   2  
ATOM 8858   H HB2  . ASN A 1 186 ? -10.745 -6.568  10.168  1.00 51.42 ? 186 ASN A HB2  2  
ATOM 8859   H HB3  . ASN A 1 186 ? -12.230 -6.484  11.108  1.00 23.22 ? 186 ASN A HB3  2  
ATOM 8860   H HD21 . ASN A 1 186 ? -13.364 -8.260  10.876  1.00 14.53 ? 186 ASN A HD21 2  
ATOM 8861   H HD22 . ASN A 1 186 ? -13.592 -9.143  9.410   1.00 5.33  ? 186 ASN A HD22 2  
ATOM 8862   N N    . TYR A 1 187 ? -14.456 -4.426  9.476   1.00 35.45 ? 187 TYR A N    2  
ATOM 8863   C CA   . TYR A 1 187 ? -15.696 -3.870  10.003  1.00 34.15 ? 187 TYR A CA   2  
ATOM 8864   C C    . TYR A 1 187 ? -16.140 -4.610  11.261  1.00 23.43 ? 187 TYR A C    2  
ATOM 8865   O O    . TYR A 1 187 ? -16.513 -3.990  12.258  1.00 32.30 ? 187 TYR A O    2  
ATOM 8866   C CB   . TYR A 1 187 ? -16.799 -3.936  8.945   1.00 13.41 ? 187 TYR A CB   2  
ATOM 8867   C CG   . TYR A 1 187 ? -17.977 -3.034  9.240   1.00 74.13 ? 187 TYR A CG   2  
ATOM 8868   C CD1  . TYR A 1 187 ? -18.904 -3.370  10.220  1.00 51.01 ? 187 TYR A CD1  2  
ATOM 8869   C CD2  . TYR A 1 187 ? -18.162 -1.849  8.540   1.00 50.00 ? 187 TYR A CD2  2  
ATOM 8870   C CE1  . TYR A 1 187 ? -19.982 -2.549  10.492  1.00 41.15 ? 187 TYR A CE1  2  
ATOM 8871   C CE2  . TYR A 1 187 ? -19.238 -1.023  8.806   1.00 44.33 ? 187 TYR A CE2  2  
ATOM 8872   C CZ   . TYR A 1 187 ? -20.145 -1.378  9.783   1.00 14.11 ? 187 TYR A CZ   2  
ATOM 8873   O OH   . TYR A 1 187 ? -21.216 -0.558  10.052  1.00 4.35  ? 187 TYR A OH   2  
ATOM 8874   H H    . TYR A 1 187 ? -14.446 -4.795  8.567   1.00 25.32 ? 187 TYR A H    2  
ATOM 8875   H HA   . TYR A 1 187 ? -15.514 -2.836  10.254  1.00 42.33 ? 187 TYR A HA   2  
ATOM 8876   H HB2  . TYR A 1 187 ? -16.390 -3.643  7.990   1.00 43.42 ? 187 TYR A HB2  2  
ATOM 8877   H HB3  . TYR A 1 187 ? -17.164 -4.951  8.879   1.00 61.22 ? 187 TYR A HB3  2  
ATOM 8878   H HD1  . TYR A 1 187 ? -18.773 -4.287  10.774  1.00 21.13 ? 187 TYR A HD1  2  
ATOM 8879   H HD2  . TYR A 1 187 ? -17.451 -1.575  7.775   1.00 13.52 ? 187 TYR A HD2  2  
ATOM 8880   H HE1  . TYR A 1 187 ? -20.692 -2.827  11.257  1.00 73.32 ? 187 TYR A HE1  2  
ATOM 8881   H HE2  . TYR A 1 187 ? -19.365 -0.106  8.251   1.00 31.41 ? 187 TYR A HE2  2  
ATOM 8882   H HH   . TYR A 1 187 ? -21.702 -0.389  9.240   1.00 72.13 ? 187 TYR A HH   2  
ATOM 8883   N N    . LYS A 1 188 ? -16.096 -5.937  11.209  1.00 2.52  ? 188 LYS A N    2  
ATOM 8884   C CA   . LYS A 1 188 ? -16.494 -6.759  12.347  1.00 73.31 ? 188 LYS A CA   2  
ATOM 8885   C C    . LYS A 1 188 ? -15.377 -6.832  13.382  1.00 44.21 ? 188 LYS A C    2  
ATOM 8886   O O    . LYS A 1 188 ? -15.635 -6.931  14.582  1.00 10.43 ? 188 LYS A O    2  
ATOM 8887   C CB   . LYS A 1 188 ? -16.865 -8.168  11.879  1.00 72.03 ? 188 LYS A CB   2  
ATOM 8888   C CG   . LYS A 1 188 ? -18.343 -8.335  11.568  1.00 70.13 ? 188 LYS A CG   2  
ATOM 8889   C CD   . LYS A 1 188 ? -18.808 -7.341  10.516  1.00 13.35 ? 188 LYS A CD   2  
ATOM 8890   C CE   . LYS A 1 188 ? -20.324 -7.258  10.460  1.00 63.42 ? 188 LYS A CE   2  
ATOM 8891   N NZ   . LYS A 1 188 ? -20.791 -6.339  9.384   1.00 21.41 ? 188 LYS A NZ   2  
ATOM 8892   H H    . LYS A 1 188 ? -15.789 -6.373  10.387  1.00 5.23  ? 188 LYS A H    2  
ATOM 8893   H HA   . LYS A 1 188 ? -17.360 -6.300  12.800  1.00 23.15 ? 188 LYS A HA   2  
ATOM 8894   H HB2  . LYS A 1 188 ? -16.303 -8.398  10.986  1.00 21.43 ? 188 LYS A HB2  2  
ATOM 8895   H HB3  . LYS A 1 188 ? -16.600 -8.873  12.653  1.00 1.02  ? 188 LYS A HB3  2  
ATOM 8896   H HG2  . LYS A 1 188 ? -18.513 -9.337  11.202  1.00 74.02 ? 188 LYS A HG2  2  
ATOM 8897   H HG3  . LYS A 1 188 ? -18.911 -8.180  12.474  1.00 34.31 ? 188 LYS A HG3  2  
ATOM 8898   H HD2  . LYS A 1 188 ? -18.413 -6.366  10.757  1.00 43.04 ? 188 LYS A HD2  2  
ATOM 8899   H HD3  . LYS A 1 188 ? -18.437 -7.653  9.551   1.00 54.53 ? 188 LYS A HD3  2  
ATOM 8900   H HE2  . LYS A 1 188 ? -20.720 -8.245  10.273  1.00 0.41  ? 188 LYS A HE2  2  
ATOM 8901   H HE3  . LYS A 1 188 ? -20.689 -6.899  11.411  1.00 4.43  ? 188 LYS A HE3  2  
ATOM 8902   H HZ1  . LYS A 1 188 ? -20.447 -6.668  8.460   1.00 40.11 ? 188 LYS A HZ1  2  
ATOM 8903   H HZ2  . LYS A 1 188 ? -20.431 -5.378  9.554   1.00 3.01  ? 188 LYS A HZ2  2  
ATOM 8904   H HZ3  . LYS A 1 188 ? -21.831 -6.310  9.365   1.00 3.41  ? 188 LYS A HZ3  2  
ATOM 8905   N N    . ASN A 1 189 ? -14.136 -6.782  12.910  1.00 61.04 ? 189 ASN A N    2  
ATOM 8906   C CA   . ASN A 1 189 ? -12.978 -6.843  13.794  1.00 31.14 ? 189 ASN A CA   2  
ATOM 8907   C C    . ASN A 1 189 ? -12.178 -5.544  13.734  1.00 31.32 ? 189 ASN A C    2  
ATOM 8908   O O    . ASN A 1 189 ? -11.277 -5.398  12.907  1.00 23.51 ? 189 ASN A O    2  
ATOM 8909   C CB   . ASN A 1 189 ? -12.083 -8.023  13.414  1.00 64.50 ? 189 ASN A CB   2  
ATOM 8910   C CG   . ASN A 1 189 ? -12.608 -9.343  13.943  1.00 1.14  ? 189 ASN A CG   2  
ATOM 8911   O OD1  . ASN A 1 189 ? -13.413 -10.010 13.293  1.00 2.04  ? 189 ASN A OD1  2  
ATOM 8912   N ND2  . ASN A 1 189 ? -12.155 -9.726  15.132  1.00 42.24 ? 189 ASN A ND2  2  
ATOM 8913   H H    . ASN A 1 189 ? -13.997 -6.703  11.944  1.00 10.03 ? 189 ASN A H    2  
ATOM 8914   H HA   . ASN A 1 189 ? -13.337 -6.986  14.802  1.00 55.55 ? 189 ASN A HA   2  
ATOM 8915   H HB2  . ASN A 1 189 ? -12.020 -8.088  12.337  1.00 22.34 ? 189 ASN A HB2  2  
ATOM 8916   H HB3  . ASN A 1 189 ? -11.093 -7.862  13.817  1.00 53.44 ? 189 ASN A HB3  2  
ATOM 8917   H HD21 . ASN A 1 189 ? -11.515 -9.144  15.592  1.00 50.12 ? 189 ASN A HD21 2  
ATOM 8918   H HD22 . ASN A 1 189 ? -12.479 -10.575 15.498  1.00 20.41 ? 189 ASN A HD22 2  
ATOM 8919   N N    . PRO A 1 190 ? -12.494 -4.577  14.614  1.00 14.22 ? 190 PRO A N    2  
ATOM 8920   C CA   . PRO A 1 190 ? -11.795 -3.288  14.654  1.00 32.23 ? 190 PRO A CA   2  
ATOM 8921   C C    . PRO A 1 190 ? -10.342 -3.427  15.102  1.00 23.00 ? 190 PRO A C    2  
ATOM 8922   O O    . PRO A 1 190 ? -9.541  -2.508  14.934  1.00 40.24 ? 190 PRO A O    2  
ATOM 8923   C CB   . PRO A 1 190 ? -12.594 -2.476  15.678  1.00 54.00 ? 190 PRO A CB   2  
ATOM 8924   C CG   . PRO A 1 190 ? -13.262 -3.495  16.535  1.00 54.03 ? 190 PRO A CG   2  
ATOM 8925   C CD   . PRO A 1 190 ? -13.552 -4.665  15.638  1.00 40.23 ? 190 PRO A CD   2  
ATOM 8926   H HA   . PRO A 1 190 ? -11.826 -2.793  13.695  1.00 32.42 ? 190 PRO A HA   2  
ATOM 8927   H HB2  . PRO A 1 190 ? -11.923 -1.855  16.251  1.00 31.12 ? 190 PRO A HB2  2  
ATOM 8928   H HB3  . PRO A 1 190 ? -13.317 -1.859  15.166  1.00 64.41 ? 190 PRO A HB3  2  
ATOM 8929   H HG2  . PRO A 1 190 ? -12.600 -3.791  17.336  1.00 72.15 ? 190 PRO A HG2  2  
ATOM 8930   H HG3  . PRO A 1 190 ? -14.181 -3.093  16.936  1.00 13.31 ? 190 PRO A HG3  2  
ATOM 8931   H HD2  . PRO A 1 190 ? -13.479 -5.591  16.190  1.00 25.00 ? 190 PRO A HD2  2  
ATOM 8932   H HD3  . PRO A 1 190 ? -14.529 -4.565  15.191  1.00 33.33 ? 190 PRO A HD3  2  
ATOM 8933   N N    . ASP A 1 191 ? -10.007 -4.581  15.673  1.00 14.30 ? 191 ASP A N    2  
ATOM 8934   C CA   . ASP A 1 191 ? -8.651  -4.836  16.144  1.00 35.40 ? 191 ASP A CA   2  
ATOM 8935   C C    . ASP A 1 191 ? -7.791  -5.471  15.049  1.00 35.31 ? 191 ASP A C    2  
ATOM 8936   O O    . ASP A 1 191 ? -6.647  -5.851  15.294  1.00 40.40 ? 191 ASP A O    2  
ATOM 8937   C CB   . ASP A 1 191 ? -8.679  -5.744  17.374  1.00 35.24 ? 191 ASP A CB   2  
ATOM 8938   C CG   . ASP A 1 191 ? -9.334  -7.081  17.089  1.00 14.33 ? 191 ASP A CG   2  
ATOM 8939   O OD1  . ASP A 1 191 ? -8.887  -7.775  16.153  1.00 63.40 ? 191 ASP A OD1  2  
ATOM 8940   O OD2  . ASP A 1 191 ? -10.295 -7.434  17.805  1.00 5.24  ? 191 ASP A OD2  2  
ATOM 8941   H H    . ASP A 1 191 ? -10.689 -5.276  15.781  1.00 45.13 ? 191 ASP A H    2  
ATOM 8942   H HA   . ASP A 1 191 ? -8.214  -3.887  16.419  1.00 41.34 ? 191 ASP A HA   2  
ATOM 8943   H HB2  . ASP A 1 191 ? -7.667  -5.924  17.704  1.00 45.44 ? 191 ASP A HB2  2  
ATOM 8944   H HB3  . ASP A 1 191 ? -9.229  -5.254  18.162  1.00 3.14  ? 191 ASP A HB3  2  
ATOM 8945   N N    . GLN A 1 192 ? -8.345  -5.583  13.844  1.00 5.24  ? 192 GLN A N    2  
ATOM 8946   C CA   . GLN A 1 192 ? -7.621  -6.173  12.723  1.00 2.21  ? 192 GLN A CA   2  
ATOM 8947   C C    . GLN A 1 192 ? -7.350  -5.134  11.640  1.00 3.20  ? 192 GLN A C    2  
ATOM 8948   O O    . GLN A 1 192 ? -8.199  -4.291  11.349  1.00 52.53 ? 192 GLN A O    2  
ATOM 8949   C CB   . GLN A 1 192 ? -8.411  -7.344  12.137  1.00 32.41 ? 192 GLN A CB   2  
ATOM 8950   C CG   . GLN A 1 192 ? -8.269  -8.633  12.930  1.00 10.34 ? 192 GLN A CG   2  
ATOM 8951   C CD   . GLN A 1 192 ? -9.493  -9.521  12.825  1.00 1.44  ? 192 GLN A CD   2  
ATOM 8952   O OE1  . GLN A 1 192 ? -9.941  -10.099 13.815  1.00 3.51  ? 192 GLN A OE1  2  
ATOM 8953   N NE2  . GLN A 1 192 ? -10.041 -9.634  11.621  1.00 52.20 ? 192 GLN A NE2  2  
ATOM 8954   H H    . GLN A 1 192 ? -9.261  -5.265  13.703  1.00 13.05 ? 192 GLN A H    2  
ATOM 8955   H HA   . GLN A 1 192 ? -6.676  -6.540  13.097  1.00 31.53 ? 192 GLN A HA   2  
ATOM 8956   H HB2  . GLN A 1 192 ? -9.458  -7.078  12.110  1.00 71.24 ? 192 GLN A HB2  2  
ATOM 8957   H HB3  . GLN A 1 192 ? -8.069  -7.526  11.129  1.00 34.31 ? 192 GLN A HB3  2  
ATOM 8958   H HG2  . GLN A 1 192 ? -7.415  -9.178  12.554  1.00 70.42 ? 192 GLN A HG2  2  
ATOM 8959   H HG3  . GLN A 1 192 ? -8.108  -8.386  13.969  1.00 30.45 ? 192 GLN A HG3  2  
ATOM 8960   H HE21 . GLN A 1 192 ? -9.630  -9.144  10.877  1.00 52.31 ? 192 GLN A HE21 2  
ATOM 8961   H HE22 . GLN A 1 192 ? -10.834 -10.202 11.525  1.00 33.32 ? 192 GLN A HE22 2  
ATOM 8962   N N    . VAL A 1 193 ? -6.162  -5.200  11.047  1.00 23.25 ? 193 VAL A N    2  
ATOM 8963   C CA   . VAL A 1 193 ? -5.780  -4.266  9.996   1.00 34.13 ? 193 VAL A CA   2  
ATOM 8964   C C    . VAL A 1 193 ? -5.532  -4.994  8.677   1.00 3.13  ? 193 VAL A C    2  
ATOM 8965   O O    . VAL A 1 193 ? -5.047  -6.125  8.662   1.00 72.01 ? 193 VAL A O    2  
ATOM 8966   C CB   . VAL A 1 193 ? -4.516  -3.472  10.383  1.00 4.34  ? 193 VAL A CB   2  
ATOM 8967   C CG1  . VAL A 1 193 ? -3.339  -4.410  10.608  1.00 4.31  ? 193 VAL A CG1  2  
ATOM 8968   C CG2  . VAL A 1 193 ? -4.188  -2.433  9.320   1.00 74.24 ? 193 VAL A CG2  2  
ATOM 8969   H H    . VAL A 1 193 ? -5.529  -5.895  11.322  1.00 62.34 ? 193 VAL A H    2  
ATOM 8970   H HA   . VAL A 1 193 ? -6.592  -3.566  9.861   1.00 31.50 ? 193 VAL A HA   2  
ATOM 8971   H HB   . VAL A 1 193 ? -4.714  -2.954  11.311  1.00 5.30  ? 193 VAL A HB   2  
ATOM 8972   H HG11 . VAL A 1 193 ? -2.439  -3.959  10.214  1.00 70.13 ? 193 VAL A HG11 2  
ATOM 8973   H HG12 . VAL A 1 193 ? -3.522  -5.346  10.104  1.00 4.10  ? 193 VAL A HG12 2  
ATOM 8974   H HG13 . VAL A 1 193 ? -3.218  -4.588  11.666  1.00 12.14 ? 193 VAL A HG13 2  
ATOM 8975   H HG21 . VAL A 1 193 ? -5.087  -2.171  8.783   1.00 11.44 ? 193 VAL A HG21 2  
ATOM 8976   H HG22 . VAL A 1 193 ? -3.462  -2.840  8.632   1.00 61.33 ? 193 VAL A HG22 2  
ATOM 8977   H HG23 . VAL A 1 193 ? -3.780  -1.551  9.793   1.00 52.11 ? 193 VAL A HG23 2  
ATOM 8978   N N    . TYR A 1 194 ? -5.870  -4.336  7.573   1.00 30.01 ? 194 TYR A N    2  
ATOM 8979   C CA   . TYR A 1 194 ? -5.686  -4.917  6.249   1.00 62.04 ? 194 TYR A CA   2  
ATOM 8980   C C    . TYR A 1 194 ? -5.057  -3.906  5.294   1.00 43.10 ? 194 TYR A C    2  
ATOM 8981   O O    . TYR A 1 194 ? -5.127  -2.699  5.519   1.00 55.43 ? 194 TYR A O    2  
ATOM 8982   C CB   . TYR A 1 194 ? -7.026  -5.395  5.688   1.00 74.12 ? 194 TYR A CB   2  
ATOM 8983   C CG   . TYR A 1 194 ? -7.525  -6.678  6.314   1.00 13.01 ? 194 TYR A CG   2  
ATOM 8984   C CD1  . TYR A 1 194 ? -7.908  -6.720  7.648   1.00 24.24 ? 194 TYR A CD1  2  
ATOM 8985   C CD2  . TYR A 1 194 ? -7.613  -7.848  5.567   1.00 64.41 ? 194 TYR A CD2  2  
ATOM 8986   C CE1  . TYR A 1 194 ? -8.367  -7.891  8.222   1.00 41.12 ? 194 TYR A CE1  2  
ATOM 8987   C CE2  . TYR A 1 194 ? -8.071  -9.023  6.135   1.00 64.52 ? 194 TYR A CE2  2  
ATOM 8988   C CZ   . TYR A 1 194 ? -8.445  -9.038  7.462   1.00 14.55 ? 194 TYR A CZ   2  
ATOM 8989   O OH   . TYR A 1 194 ? -8.901  -10.207 8.029   1.00 50.31 ? 194 TYR A OH   2  
ATOM 8990   H H    . TYR A 1 194 ? -6.252  -3.437  7.651   1.00 65.31 ? 194 TYR A H    2  
ATOM 8991   H HA   . TYR A 1 194 ? -5.023  -5.763  6.346   1.00 45.22 ? 194 TYR A HA   2  
ATOM 8992   H HB2  . TYR A 1 194 ? -7.771  -4.634  5.858   1.00 51.34 ? 194 TYR A HB2  2  
ATOM 8993   H HB3  . TYR A 1 194 ? -6.924  -5.560  4.625   1.00 51.33 ? 194 TYR A HB3  2  
ATOM 8994   H HD1  . TYR A 1 194 ? -7.847  -5.820  8.241   1.00 73.15 ? 194 TYR A HD1  2  
ATOM 8995   H HD2  . TYR A 1 194 ? -7.319  -7.832  4.529   1.00 23.21 ? 194 TYR A HD2  2  
ATOM 8996   H HE1  . TYR A 1 194 ? -8.660  -7.904  9.261   1.00 75.02 ? 194 TYR A HE1  2  
ATOM 8997   H HE2  . TYR A 1 194 ? -8.133  -9.921  5.539   1.00 31.21 ? 194 TYR A HE2  2  
ATOM 8998   H HH   . TYR A 1 194 ? -9.562  -10.604 7.458   1.00 2.20  ? 194 TYR A HH   2  
ATOM 8999   N N    . LEU A 1 195 ? -4.448  -4.410  4.225   1.00 63.41 ? 195 LEU A N    2  
ATOM 9000   C CA   . LEU A 1 195 ? -3.811  -3.551  3.233   1.00 2.43  ? 195 LEU A CA   2  
ATOM 9001   C C    . LEU A 1 195 ? -4.477  -3.714  1.871   1.00 1.00  ? 195 LEU A C    2  
ATOM 9002   O O    . LEU A 1 195 ? -4.171  -4.644  1.125   1.00 13.12 ? 195 LEU A O    2  
ATOM 9003   C CB   . LEU A 1 195 ? -2.319  -3.874  3.126   1.00 32.33 ? 195 LEU A CB   2  
ATOM 9004   C CG   . LEU A 1 195 ? -1.419  -2.677  2.814   1.00 72.54 ? 195 LEU A CG   2  
ATOM 9005   C CD1  . LEU A 1 195 ? -0.024  -2.898  3.376   1.00 42.30 ? 195 LEU A CD1  2  
ATOM 9006   C CD2  . LEU A 1 195 ? -1.360  -2.433  1.314   1.00 23.43 ? 195 LEU A CD2  2  
ATOM 9007   H H    . LEU A 1 195 ? -4.428  -5.382  4.099   1.00 4.44  ? 195 LEU A H    2  
ATOM 9008   H HA   . LEU A 1 195 ? -3.926  -2.528  3.557   1.00 42.35 ? 195 LEU A HA   2  
ATOM 9009   H HB2  . LEU A 1 195 ? -1.998  -4.305  4.064   1.00 13.51 ? 195 LEU A HB2  2  
ATOM 9010   H HB3  . LEU A 1 195 ? -2.186  -4.609  2.347   1.00 41.45 ? 195 LEU A HB3  2  
ATOM 9011   H HG   . LEU A 1 195 ? -1.831  -1.794  3.282   1.00 73.44 ? 195 LEU A HG   2  
ATOM 9012   H HD11 . LEU A 1 195 ? 0.359   -1.966  3.765   1.00 23.32 ? 195 LEU A HD11 2  
ATOM 9013   H HD12 . LEU A 1 195 ? 0.628   -3.255  2.592   1.00 10.13 ? 195 LEU A HD12 2  
ATOM 9014   H HD13 . LEU A 1 195 ? -0.066  -3.629  4.170   1.00 34.54 ? 195 LEU A HD13 2  
ATOM 9015   H HD21 . LEU A 1 195 ? -2.214  -1.846  1.011   1.00 15.34 ? 195 LEU A HD21 2  
ATOM 9016   H HD22 . LEU A 1 195 ? -1.372  -3.380  0.794   1.00 10.14 ? 195 LEU A HD22 2  
ATOM 9017   H HD23 . LEU A 1 195 ? -0.452  -1.901  1.071   1.00 4.33  ? 195 LEU A HD23 2  
ATOM 9018   N N    . VAL A 1 196 ? -5.394  -2.805  1.555   1.00 74.44 ? 196 VAL A N    2  
ATOM 9019   C CA   . VAL A 1 196 ? -6.108  -2.850  0.284   1.00 22.24 ? 196 VAL A CA   2  
ATOM 9020   C C    . VAL A 1 196 ? -5.425  -1.981  -0.766  1.00 5.42  ? 196 VAL A C    2  
ATOM 9021   O O    . VAL A 1 196 ? -5.003  -0.860  -0.481  1.00 74.41 ? 196 VAL A O    2  
ATOM 9022   C CB   . VAL A 1 196 ? -7.567  -2.387  0.444   1.00 63.22 ? 196 VAL A CB   2  
ATOM 9023   C CG1  . VAL A 1 196 ? -8.354  -2.648  -0.831  1.00 12.13 ? 196 VAL A CG1  2  
ATOM 9024   C CG2  . VAL A 1 196 ? -8.221  -3.076  1.633   1.00 14.50 ? 196 VAL A CG2  2  
ATOM 9025   H H    . VAL A 1 196 ? -5.597  -2.089  2.191   1.00 12.23 ? 196 VAL A H    2  
ATOM 9026   H HA   . VAL A 1 196 ? -6.114  -3.874  -0.059  1.00 42.51 ? 196 VAL A HA   2  
ATOM 9027   H HB   . VAL A 1 196 ? -7.569  -1.322  0.627   1.00 14.11 ? 196 VAL A HB   2  
ATOM 9028   H HG11 . VAL A 1 196 ? -8.368  -3.709  -1.034  1.00 21.52 ? 196 VAL A HG11 2  
ATOM 9029   H HG12 . VAL A 1 196 ? -7.887  -2.130  -1.655  1.00 50.12 ? 196 VAL A HG12 2  
ATOM 9030   H HG13 . VAL A 1 196 ? -9.366  -2.292  -0.710  1.00 52.42 ? 196 VAL A HG13 2  
ATOM 9031   H HG21 . VAL A 1 196 ? -9.183  -2.626  1.824   1.00 63.22 ? 196 VAL A HG21 2  
ATOM 9032   H HG22 . VAL A 1 196 ? -7.592  -2.965  2.503   1.00 4.42  ? 196 VAL A HG22 2  
ATOM 9033   H HG23 . VAL A 1 196 ? -8.351  -4.125  1.413   1.00 24.35 ? 196 VAL A HG23 2  
ATOM 9034   N N    . ASP A 1 197 ? -5.322  -2.506  -1.983  1.00 22.42 ? 197 ASP A N    2  
ATOM 9035   C CA   . ASP A 1 197 ? -4.693  -1.778  -3.079  1.00 51.12 ? 197 ASP A CA   2  
ATOM 9036   C C    . ASP A 1 197 ? -3.248  -1.421  -2.743  1.00 31.34 ? 197 ASP A C    2  
ATOM 9037   O O    . ASP A 1 197 ? -2.992  -0.539  -1.923  1.00 12.25 ? 197 ASP A O    2  
ATOM 9038   C CB   . ASP A 1 197 ? -5.487  -0.507  -3.396  1.00 74.32 ? 197 ASP A CB   2  
ATOM 9039   C CG   . ASP A 1 197 ? -5.769  -0.357  -4.877  1.00 52.42 ? 197 ASP A CG   2  
ATOM 9040   O OD1  . ASP A 1 197 ? -6.629  -1.099  -5.395  1.00 2.44  ? 197 ASP A OD1  2  
ATOM 9041   O OD2  . ASP A 1 197 ? -5.131  0.504   -5.518  1.00 30.42 ? 197 ASP A OD2  2  
ATOM 9042   H H    . ASP A 1 197 ? -5.680  -3.402  -2.148  1.00 2.05  ? 197 ASP A H    2  
ATOM 9043   H HA   . ASP A 1 197 ? -4.699  -2.419  -3.948  1.00 72.23 ? 197 ASP A HA   2  
ATOM 9044   H HB2  . ASP A 1 197 ? -6.430  -0.540  -2.870  1.00 45.01 ? 197 ASP A HB2  2  
ATOM 9045   H HB3  . ASP A 1 197 ? -4.925  0.354   -3.064  1.00 34.13 ? 197 ASP A HB3  2  
ATOM 9046   N N    . TYR A 1 198 ? -2.309  -2.108  -3.385  1.00 10.24 ? 198 TYR A N    2  
ATOM 9047   C CA   . TYR A 1 198 ? -0.891  -1.859  -3.156  1.00 71.33 ? 198 TYR A CA   2  
ATOM 9048   C C    . TYR A 1 198 ? -0.458  -0.556  -3.821  1.00 14.42 ? 198 TYR A C    2  
ATOM 9049   O O    . TYR A 1 198 ? 0.158   0.302   -3.188  1.00 72.42 ? 198 TYR A O    2  
ATOM 9050   C CB   . TYR A 1 198 ? -0.054  -3.022  -3.691  1.00 53.11 ? 198 TYR A CB   2  
ATOM 9051   C CG   . TYR A 1 198 ? 0.103   -4.159  -2.705  1.00 45.33 ? 198 TYR A CG   2  
ATOM 9052   C CD1  . TYR A 1 198 ? -0.974  -4.600  -1.947  1.00 41.52 ? 198 TYR A CD1  2  
ATOM 9053   C CD2  . TYR A 1 198 ? 1.328   -4.792  -2.536  1.00 72.23 ? 198 TYR A CD2  2  
ATOM 9054   C CE1  . TYR A 1 198 ? -0.835  -5.638  -1.046  1.00 12.20 ? 198 TYR A CE1  2  
ATOM 9055   C CE2  . TYR A 1 198 ? 1.475   -5.831  -1.637  1.00 3.43  ? 198 TYR A CE2  2  
ATOM 9056   C CZ   . TYR A 1 198 ? 0.391   -6.251  -0.895  1.00 62.13 ? 198 TYR A CZ   2  
ATOM 9057   O OH   . TYR A 1 198 ? 0.534   -7.285  0.002   1.00 62.23 ? 198 TYR A OH   2  
ATOM 9058   H H    . TYR A 1 198 ? -2.577  -2.796  -4.029  1.00 74.42 ? 198 TYR A H    2  
ATOM 9059   H HA   . TYR A 1 198 ? -0.737  -1.774  -2.091  1.00 12.03 ? 198 TYR A HA   2  
ATOM 9060   H HB2  . TYR A 1 198 ? -0.524  -3.417  -4.579  1.00 51.04 ? 198 TYR A HB2  2  
ATOM 9061   H HB3  . TYR A 1 198 ? 0.932   -2.661  -3.941  1.00 10.44 ? 198 TYR A HB3  2  
ATOM 9062   H HD1  . TYR A 1 198 ? -1.934  -4.119  -2.068  1.00 11.02 ? 198 TYR A HD1  2  
ATOM 9063   H HD2  . TYR A 1 198 ? 2.175   -4.461  -3.118  1.00 2.51  ? 198 TYR A HD2  2  
ATOM 9064   H HE1  . TYR A 1 198 ? -1.684  -5.967  -0.465  1.00 4.12  ? 198 TYR A HE1  2  
ATOM 9065   H HE2  . TYR A 1 198 ? 2.436   -6.311  -1.518  1.00 24.31 ? 198 TYR A HE2  2  
ATOM 9066   H HH   . TYR A 1 198 ? 0.106   -7.054  0.829   1.00 50.53 ? 198 TYR A HH   2  
ATOM 9067   N N    . GLY A 1 199 ? -0.788  -0.415  -5.101  1.00 22.44 ? 199 GLY A N    2  
ATOM 9068   C CA   . GLY A 1 199 ? -0.429  0.787   -5.831  1.00 50.23 ? 199 GLY A CA   2  
ATOM 9069   C C    . GLY A 1 199 ? 1.070   0.996   -5.920  1.00 15.51 ? 199 GLY A C    2  
ATOM 9070   O O    . GLY A 1 199 ? 1.531   2.113   -6.150  1.00 53.35 ? 199 GLY A O    2  
ATOM 9071   H H    . GLY A 1 199 ? -1.282  -1.134  -5.552  1.00 71.21 ? 199 GLY A H    2  
ATOM 9072   H HA2  . GLY A 1 199 ? -0.827  0.721   -6.830  1.00 4.32  ? 199 GLY A HA2  2  
ATOM 9073   H HA3  . GLY A 1 199 ? -0.870  1.640   -5.336  1.00 63.23 ? 199 GLY A HA3  2  
ATOM 9074   N N    . LEU A 1 200 ? 1.833   -0.076  -5.739  1.00 42.44 ? 200 LEU A N    2  
ATOM 9075   C CA   . LEU A 1 200 ? 3.287   0.010   -5.806  1.00 52.10 ? 200 LEU A CA   2  
ATOM 9076   C C    . LEU A 1 200 ? 3.935   -1.363  -5.653  1.00 14.41 ? 200 LEU A C    2  
ATOM 9077   O O    . LEU A 1 200 ? 5.039   -1.478  -5.122  1.00 45.32 ? 200 LEU A O    2  
ATOM 9078   C CB   . LEU A 1 200 ? 3.811   0.958   -4.724  1.00 11.52 ? 200 LEU A CB   2  
ATOM 9079   C CG   . LEU A 1 200 ? 4.875   1.949   -5.197  1.00 71.14 ? 200 LEU A CG   2  
ATOM 9080   C CD1  . LEU A 1 200 ? 6.054   1.211   -5.812  1.00 3.41  ? 200 LEU A CD1  2  
ATOM 9081   C CD2  . LEU A 1 200 ? 4.280   2.932   -6.193  1.00 14.25 ? 200 LEU A CD2  2  
ATOM 9082   H H    . LEU A 1 200 ? 1.411   -0.942  -5.559  1.00 73.05 ? 200 LEU A H    2  
ATOM 9083   H HA   . LEU A 1 200 ? 3.548   0.410   -6.775  1.00 21.54 ? 200 LEU A HA   2  
ATOM 9084   H HB2  . LEU A 1 200 ? 2.975   1.519   -4.332  1.00 73.53 ? 200 LEU A HB2  2  
ATOM 9085   H HB3  . LEU A 1 200 ? 4.232   0.365   -3.926  1.00 52.34 ? 200 LEU A HB3  2  
ATOM 9086   H HG   . LEU A 1 200 ? 5.239   2.509   -4.348  1.00 34.43 ? 200 LEU A HG   2  
ATOM 9087   H HD11 . LEU A 1 200 ? 6.653   1.903   -6.384  1.00 74.21 ? 200 LEU A HD11 2  
ATOM 9088   H HD12 . LEU A 1 200 ? 5.688   0.429   -6.462  1.00 33.54 ? 200 LEU A HD12 2  
ATOM 9089   H HD13 . LEU A 1 200 ? 6.655   0.775   -5.029  1.00 50.55 ? 200 LEU A HD13 2  
ATOM 9090   H HD21 . LEU A 1 200 ? 3.639   2.402   -6.883  1.00 30.25 ? 200 LEU A HD21 2  
ATOM 9091   H HD22 . LEU A 1 200 ? 5.075   3.417   -6.740  1.00 64.53 ? 200 LEU A HD22 2  
ATOM 9092   H HD23 . LEU A 1 200 ? 3.701   3.675   -5.664  1.00 62.32 ? 200 LEU A HD23 2  
ATOM 9093   N N    . ALA A 1 201 ? 3.258   -2.400  -6.137  1.00 30.04 ? 201 ALA A N    2  
ATOM 9094   C CA   . ALA A 1 201 ? 3.790   -3.755  -6.066  1.00 23.53 ? 201 ALA A CA   2  
ATOM 9095   C C    . ALA A 1 201 ? 4.438   -4.145  -7.390  1.00 41.10 ? 201 ALA A C    2  
ATOM 9096   O O    . ALA A 1 201 ? 3.748   -4.362  -8.386  1.00 64.24 ? 201 ALA A O    2  
ATOM 9097   C CB   . ALA A 1 201 ? 2.689   -4.739  -5.698  1.00 53.11 ? 201 ALA A CB   2  
ATOM 9098   H H    . ALA A 1 201 ? 2.393   -2.257  -6.573  1.00 10.01 ? 201 ALA A H    2  
ATOM 9099   H HA   . ALA A 1 201 ? 4.539   -3.779  -5.288  1.00 4.54  ? 201 ALA A HA   2  
ATOM 9100   H HB1  . ALA A 1 201 ? 3.039   -5.393  -4.914  1.00 31.51 ? 201 ALA A HB1  2  
ATOM 9101   H HB2  . ALA A 1 201 ? 2.425   -5.327  -6.565  1.00 53.33 ? 201 ALA A HB2  2  
ATOM 9102   H HB3  . ALA A 1 201 ? 1.821   -4.197  -5.354  1.00 13.30 ? 201 ALA A HB3  2  
ATOM 9103   N N    . TYR A 1 202 ? 5.764   -4.230  -7.401  1.00 41.01 ? 202 TYR A N    2  
ATOM 9104   C CA   . TYR A 1 202 ? 6.489   -4.591  -8.613  1.00 24.21 ? 202 TYR A CA   2  
ATOM 9105   C C    . TYR A 1 202 ? 7.408   -5.785  -8.368  1.00 32.32 ? 202 TYR A C    2  
ATOM 9106   O O    . TYR A 1 202 ? 7.982   -5.930  -7.289  1.00 3.25  ? 202 TYR A O    2  
ATOM 9107   C CB   . TYR A 1 202 ? 7.295   -3.394  -9.124  1.00 15.24 ? 202 TYR A CB   2  
ATOM 9108   C CG   . TYR A 1 202 ? 6.899   -2.949  -10.515 1.00 73.30 ? 202 TYR A CG   2  
ATOM 9109   C CD1  . TYR A 1 202 ? 5.595   -2.567  -10.796 1.00 52.22 ? 202 TYR A CD1  2  
ATOM 9110   C CD2  . TYR A 1 202 ? 7.832   -2.912  -11.544 1.00 14.32 ? 202 TYR A CD2  2  
ATOM 9111   C CE1  . TYR A 1 202 ? 5.228   -2.161  -12.066 1.00 71.01 ? 202 TYR A CE1  2  
ATOM 9112   C CE2  . TYR A 1 202 ? 7.473   -2.506  -12.815 1.00 13.53 ? 202 TYR A CE2  2  
ATOM 9113   C CZ   . TYR A 1 202 ? 6.171   -2.133  -13.072 1.00 72.51 ? 202 TYR A CZ   2  
ATOM 9114   O OH   . TYR A 1 202 ? 5.811   -1.728  -14.337 1.00 0.00  ? 202 TYR A OH   2  
ATOM 9115   H H    . TYR A 1 202 ? 6.263   -4.044  -6.579  1.00 24.24 ? 202 TYR A H    2  
ATOM 9116   H HA   . TYR A 1 202 ? 5.761   -4.865  -9.363  1.00 72.31 ? 202 TYR A HA   2  
ATOM 9117   H HB2  . TYR A 1 202 ? 7.146   -2.557  -8.457  1.00 51.13 ? 202 TYR A HB2  2  
ATOM 9118   H HB3  . TYR A 1 202 ? 8.344   -3.652  -9.142  1.00 24.12 ? 202 TYR A HB3  2  
ATOM 9119   H HD1  . TYR A 1 202 ? 4.858   -2.589  -10.007 1.00 42.51 ? 202 TYR A HD1  2  
ATOM 9120   H HD2  . TYR A 1 202 ? 8.851   -3.207  -11.340 1.00 10.43 ? 202 TYR A HD2  2  
ATOM 9121   H HE1  . TYR A 1 202 ? 4.207   -1.867  -12.266 1.00 53.10 ? 202 TYR A HE1  2  
ATOM 9122   H HE2  . TYR A 1 202 ? 8.212   -2.485  -13.603 1.00 5.44  ? 202 TYR A HE2  2  
ATOM 9123   H HH   . TYR A 1 202 ? 5.209   -0.983  -14.276 1.00 4.24  ? 202 TYR A HH   2  
ATOM 9124   N N    . ARG A 1 203 ? 7.537   -6.639  -9.379  1.00 62.30 ? 203 ARG A N    2  
ATOM 9125   C CA   . ARG A 1 203 ? 8.381   -7.825  -9.279  1.00 3.11  ? 203 ARG A CA   2  
ATOM 9126   C C    . ARG A 1 203 ? 9.829   -7.495  -9.632  1.00 43.13 ? 203 ARG A C    2  
ATOM 9127   O O    . ARG A 1 203 ? 10.098  -6.810  -10.618 1.00 35.53 ? 203 ARG A O    2  
ATOM 9128   C CB   . ARG A 1 203 ? 7.858   -8.927  -10.203 1.00 53.12 ? 203 ARG A CB   2  
ATOM 9129   C CG   . ARG A 1 203 ? 8.689   -10.199 -10.166 1.00 61.41 ? 203 ARG A CG   2  
ATOM 9130   C CD   . ARG A 1 203 ? 7.830   -11.432 -10.398 1.00 54.54 ? 203 ARG A CD   2  
ATOM 9131   N NE   . ARG A 1 203 ? 7.851   -11.859 -11.794 1.00 43.44 ? 203 ARG A NE   2  
ATOM 9132   C CZ   . ARG A 1 203 ? 7.149   -12.887 -12.266 1.00 73.01 ? 203 ARG A CZ   2  
ATOM 9133   N NH1  . ARG A 1 203 ? 6.370   -13.594 -11.457 1.00 31.45 ? 203 ARG A NH1  2  
ATOM 9134   N NH2  . ARG A 1 203 ? 7.225   -13.209 -13.550 1.00 45.14 ? 203 ARG A NH2  2  
ATOM 9135   H H    . ARG A 1 203 ? 7.052   -6.468  -10.213 1.00 34.24 ? 203 ARG A H    2  
ATOM 9136   H HA   . ARG A 1 203 ? 8.343   -8.173  -8.259  1.00 65.32 ? 203 ARG A HA   2  
ATOM 9137   H HB2  . ARG A 1 203 ? 6.848   -9.174  -9.911  1.00 4.32  ? 203 ARG A HB2  2  
ATOM 9138   H HB3  . ARG A 1 203 ? 7.849   -8.557  -11.217 1.00 54.35 ? 203 ARG A HB3  2  
ATOM 9139   H HG2  . ARG A 1 203 ? 9.441   -10.148 -10.939 1.00 22.43 ? 203 ARG A HG2  2  
ATOM 9140   H HG3  . ARG A 1 203 ? 9.165   -10.279 -9.201  1.00 41.11 ? 203 ARG A HG3  2  
ATOM 9141   H HD2  . ARG A 1 203 ? 8.203   -12.236 -9.780  1.00 1.42  ? 203 ARG A HD2  2  
ATOM 9142   H HD3  . ARG A 1 203 ? 6.813   -11.205 -10.116 1.00 72.20 ? 203 ARG A HD3  2  
ATOM 9143   H HE   . ARG A 1 203 ? 8.419   -11.355 -12.414 1.00 50.42 ? 203 ARG A HE   2  
ATOM 9144   H HH11 . ARG A 1 203 ? 6.307   -13.357 -10.488 1.00 73.40 ? 203 ARG A HH11 2  
ATOM 9145   H HH12 . ARG A 1 203 ? 5.844   -14.365 -11.817 1.00 11.40 ? 203 ARG A HH12 2  
ATOM 9146   H HH21 . ARG A 1 203 ? 7.810   -12.680 -14.164 1.00 63.51 ? 203 ARG A HH21 2  
ATOM 9147   H HH22 . ARG A 1 203 ? 6.697   -13.981 -13.905 1.00 53.43 ? 203 ARG A HH22 2  
ATOM 9148   N N    . TYR A 1 204 ? 10.757  -7.989  -8.818  1.00 31.14 ? 204 TYR A N    2  
ATOM 9149   C CA   . TYR A 1 204 ? 12.177  -7.748  -9.044  1.00 24.23 ? 204 TYR A CA   2  
ATOM 9150   C C    . TYR A 1 204 ? 12.946  -9.062  -9.160  1.00 71.05 ? 204 TYR A C    2  
ATOM 9151   O O    . TYR A 1 204 ? 14.130  -9.129  -8.831  1.00 2.05  ? 204 TYR A O    2  
ATOM 9152   C CB   . TYR A 1 204 ? 12.758  -6.900  -7.909  1.00 54.34 ? 204 TYR A CB   2  
ATOM 9153   C CG   . TYR A 1 204 ? 12.795  -7.612  -6.575  1.00 60.43 ? 204 TYR A CG   2  
ATOM 9154   C CD1  . TYR A 1 204 ? 11.624  -7.886  -5.879  1.00 74.42 ? 204 TYR A CD1  2  
ATOM 9155   C CD2  . TYR A 1 204 ? 14.001  -8.010  -6.012  1.00 51.32 ? 204 TYR A CD2  2  
ATOM 9156   C CE1  . TYR A 1 204 ? 11.653  -8.536  -4.660  1.00 74.04 ? 204 TYR A CE1  2  
ATOM 9157   C CE2  . TYR A 1 204 ? 14.039  -8.661  -4.793  1.00 61.21 ? 204 TYR A CE2  2  
ATOM 9158   C CZ   . TYR A 1 204 ? 12.863  -8.922  -4.122  1.00 61.12 ? 204 TYR A CZ   2  
ATOM 9159   O OH   . TYR A 1 204 ? 12.897  -9.570  -2.908  1.00 53.41 ? 204 TYR A OH   2  
ATOM 9160   H H    . TYR A 1 204 ? 10.480  -8.528  -8.048  1.00 50.31 ? 204 TYR A H    2  
ATOM 9161   H HA   . TYR A 1 204 ? 12.277  -7.205  -9.972  1.00 51.32 ? 204 TYR A HA   2  
ATOM 9162   H HB2  . TYR A 1 204 ? 13.769  -6.619  -8.161  1.00 2.42  ? 204 TYR A HB2  2  
ATOM 9163   H HB3  . TYR A 1 204 ? 12.160  -6.007  -7.794  1.00 72.03 ? 204 TYR A HB3  2  
ATOM 9164   H HD1  . TYR A 1 204 ? 10.678  -7.581  -6.304  1.00 2.10  ? 204 TYR A HD1  2  
ATOM 9165   H HD2  . TYR A 1 204 ? 14.920  -7.805  -6.540  1.00 51.35 ? 204 TYR A HD2  2  
ATOM 9166   H HE1  . TYR A 1 204 ? 10.732  -8.739  -4.134  1.00 24.25 ? 204 TYR A HE1  2  
ATOM 9167   H HE2  . TYR A 1 204 ? 14.986  -8.963  -4.372  1.00 24.23 ? 204 TYR A HE2  2  
ATOM 9168   H HH   . TYR A 1 204 ? 12.246  -9.181  -2.319  1.00 41.14 ? 204 TYR A HH   2  
ATOM 9169   N N    . CYS A 1 205 ? 12.266  -10.105 -9.628  1.00 32.50 ? 205 CYS A N    2  
ATOM 9170   C CA   . CYS A 1 205 ? 12.891  -11.413 -9.785  1.00 61.12 ? 205 CYS A CA   2  
ATOM 9171   C C    . CYS A 1 205 ? 12.172  -12.249 -10.844 1.00 73.14 ? 205 CYS A C    2  
ATOM 9172   O O    . CYS A 1 205 ? 11.820  -13.403 -10.600 1.00 63.25 ? 205 CYS A O    2  
ATOM 9173   C CB   . CYS A 1 205 ? 12.900  -12.158 -8.448  1.00 53.00 ? 205 CYS A CB   2  
ATOM 9174   S SG   . CYS A 1 205 ? 14.214  -11.635 -7.321  1.00 65.13 ? 205 CYS A SG   2  
ATOM 9175   H H    . CYS A 1 205 ? 11.324  -9.992  -9.875  1.00 1.04  ? 205 CYS A H    2  
ATOM 9176   H HA   . CYS A 1 205 ? 13.910  -11.255 -10.103 1.00 45.24 ? 205 CYS A HA   2  
ATOM 9177   H HB2  . CYS A 1 205 ? 11.957  -11.997 -7.948  1.00 43.41 ? 205 CYS A HB2  2  
ATOM 9178   H HB3  . CYS A 1 205 ? 13.027  -13.215 -8.635  1.00 35.14 ? 205 CYS A HB3  2  
ATOM 9179   H HG   . CYS A 1 205 ? 14.885  -12.321 -7.311  1.00 53.34 ? 205 CYS A HG   2  
ATOM 9180   N N    . PRO A 1 206 ? 11.940  -11.678 -12.040 1.00 34.13 ? 206 PRO A N    2  
ATOM 9181   C CA   . PRO A 1 206 ? 11.259  -12.380 -13.131 1.00 10.24 ? 206 PRO A CA   2  
ATOM 9182   C C    . PRO A 1 206 ? 12.182  -13.342 -13.874 1.00 54.53 ? 206 PRO A C    2  
ATOM 9183   O O    . PRO A 1 206 ? 13.310  -12.992 -14.221 1.00 71.11 ? 206 PRO A O    2  
ATOM 9184   C CB   . PRO A 1 206 ? 10.827  -11.241 -14.050 1.00 74.13 ? 206 PRO A CB   2  
ATOM 9185   C CG   . PRO A 1 206 ? 11.875  -10.198 -13.863 1.00 52.45 ? 206 PRO A CG   2  
ATOM 9186   C CD   . PRO A 1 206 ? 12.320  -10.303 -12.427 1.00 2.53  ? 206 PRO A CD   2  
ATOM 9187   H HA   . PRO A 1 206 ? 10.389  -12.914 -12.778 1.00 44.01 ? 206 PRO A HA   2  
ATOM 9188   H HB2  . PRO A 1 206 ? 10.792  -11.592 -15.071 1.00 30.35 ? 206 PRO A HB2  2  
ATOM 9189   H HB3  . PRO A 1 206 ? 9.854   -10.881 -13.751 1.00 12.22 ? 206 PRO A HB3  2  
ATOM 9190   H HG2  . PRO A 1 206 ? 12.704  -10.389 -14.528 1.00 22.20 ? 206 PRO A HG2  2  
ATOM 9191   H HG3  . PRO A 1 206 ? 11.457  -9.221  -14.056 1.00 73.40 ? 206 PRO A HG3  2  
ATOM 9192   H HD2  . PRO A 1 206 ? 13.388  -10.163 -12.353 1.00 15.14 ? 206 PRO A HD2  2  
ATOM 9193   H HD3  . PRO A 1 206 ? 11.801  -9.575  -11.820 1.00 61.41 ? 206 PRO A HD3  2  
ATOM 9194   N N    . GLU A 1 207 ? 11.692  -14.552 -14.122 1.00 2.40  ? 207 GLU A N    2  
ATOM 9195   C CA   . GLU A 1 207 ? 12.466  -15.565 -14.834 1.00 74.31 ? 207 GLU A CA   2  
ATOM 9196   C C    . GLU A 1 207 ? 13.735  -15.934 -14.070 1.00 71.44 ? 207 GLU A C    2  
ATOM 9197   O O    . GLU A 1 207 ? 14.761  -16.250 -14.671 1.00 32.45 ? 207 GLU A O    2  
ATOM 9198   C CB   . GLU A 1 207 ? 12.828  -15.067 -16.234 1.00 52.02 ? 207 GLU A CB   2  
ATOM 9199   C CG   . GLU A 1 207 ? 11.775  -15.383 -17.283 1.00 45.00 ? 207 GLU A CG   2  
ATOM 9200   C CD   . GLU A 1 207 ? 12.379  -15.839 -18.597 1.00 52.12 ? 207 GLU A CD   2  
ATOM 9201   O OE1  . GLU A 1 207 ? 12.825  -17.003 -18.674 1.00 54.11 ? 207 GLU A OE1  2  
ATOM 9202   O OE2  . GLU A 1 207 ? 12.407  -15.031 -19.549 1.00 35.43 ? 207 GLU A OE2  2  
ATOM 9203   H H    . GLU A 1 207 ? 10.783  -14.768 -13.824 1.00 3.22  ? 207 GLU A H    2  
ATOM 9204   H HA   . GLU A 1 207 ? 11.849  -16.447 -14.926 1.00 54.31 ? 207 GLU A HA   2  
ATOM 9205   H HB2  . GLU A 1 207 ? 12.961  -13.996 -16.200 1.00 15.25 ? 207 GLU A HB2  2  
ATOM 9206   H HB3  . GLU A 1 207 ? 13.757  -15.526 -16.538 1.00 13.44 ? 207 GLU A HB3  2  
ATOM 9207   H HG2  . GLU A 1 207 ? 11.135  -16.168 -16.908 1.00 45.33 ? 207 GLU A HG2  2  
ATOM 9208   H HG3  . GLU A 1 207 ? 11.186  -14.496 -17.462 1.00 5.23  ? 207 GLU A HG3  2  
ATOM 9209   N N    . GLY A 1 208 ? 13.656  -15.904 -12.742 1.00 23.14 ? 208 GLY A N    2  
ATOM 9210   C CA   . GLY A 1 208 ? 14.803  -16.253 -11.920 1.00 54.33 ? 208 GLY A CA   2  
ATOM 9211   C C    . GLY A 1 208 ? 15.814  -15.126 -11.771 1.00 34.33 ? 208 GLY A C    2  
ATOM 9212   O O    . GLY A 1 208 ? 16.564  -15.091 -10.796 1.00 5.23  ? 208 GLY A O    2  
ATOM 9213   H H    . GLY A 1 208 ? 12.808  -15.661 -12.316 1.00 71.34 ? 208 GLY A H    2  
ATOM 9214   H HA2  . GLY A 1 208 ? 14.451  -16.530 -10.938 1.00 74.33 ? 208 GLY A HA2  2  
ATOM 9215   H HA3  . GLY A 1 208 ? 15.298  -17.105 -12.362 1.00 75.54 ? 208 GLY A HA3  2  
ATOM 9216   N N    . VAL A 1 209 ? 15.844  -14.207 -12.732 1.00 32.54 ? 209 VAL A N    2  
ATOM 9217   C CA   . VAL A 1 209 ? 16.780  -13.091 -12.686 1.00 74.03 ? 209 VAL A CA   2  
ATOM 9218   C C    . VAL A 1 209 ? 16.221  -11.935 -11.867 1.00 72.00 ? 209 VAL A C    2  
ATOM 9219   O O    . VAL A 1 209 ? 15.048  -11.583 -11.991 1.00 72.33 ? 209 VAL A O    2  
ATOM 9220   C CB   . VAL A 1 209 ? 17.123  -12.584 -14.100 1.00 62.40 ? 209 VAL A CB   2  
ATOM 9221   C CG1  . VAL A 1 209 ? 17.934  -13.624 -14.858 1.00 12.11 ? 209 VAL A CG1  2  
ATOM 9222   C CG2  . VAL A 1 209 ? 15.857  -12.225 -14.862 1.00 2.24  ? 209 VAL A CG2  2  
ATOM 9223   H H    . VAL A 1 209 ? 15.230  -14.282 -13.489 1.00 45.44 ? 209 VAL A H    2  
ATOM 9224   H HA   . VAL A 1 209 ? 17.691  -13.440 -12.222 1.00 61.05 ? 209 VAL A HA   2  
ATOM 9225   H HB   . VAL A 1 209 ? 17.725  -11.692 -14.004 1.00 74.00 ? 209 VAL A HB   2  
ATOM 9226   H HG11 . VAL A 1 209 ? 18.987  -13.446 -14.699 1.00 21.34 ? 209 VAL A HG11 2  
ATOM 9227   H HG12 . VAL A 1 209 ? 17.713  -13.554 -15.913 1.00 12.14 ? 209 VAL A HG12 2  
ATOM 9228   H HG13 . VAL A 1 209 ? 17.678  -14.610 -14.501 1.00 40.41 ? 209 VAL A HG13 2  
ATOM 9229   H HG21 . VAL A 1 209 ? 16.115  -11.652 -15.740 1.00 33.12 ? 209 VAL A HG21 2  
ATOM 9230   H HG22 . VAL A 1 209 ? 15.209  -11.639 -14.227 1.00 21.15 ? 209 VAL A HG22 2  
ATOM 9231   H HG23 . VAL A 1 209 ? 15.347  -13.130 -15.159 1.00 32.15 ? 209 VAL A HG23 2  
ATOM 9232   N N    . HIS A 1 210 ? 17.068  -11.346 -11.029 1.00 21.51 ? 210 HIS A N    2  
ATOM 9233   C CA   . HIS A 1 210 ? 16.658  -10.228 -10.187 1.00 35.14 ? 210 HIS A CA   2  
ATOM 9234   C C    . HIS A 1 210 ? 17.117  -8.902  -10.786 1.00 61.51 ? 210 HIS A C    2  
ATOM 9235   O O    . HIS A 1 210 ? 18.117  -8.846  -11.501 1.00 0.21  ? 210 HIS A O    2  
ATOM 9236   C CB   . HIS A 1 210 ? 17.228  -10.389 -8.777  1.00 63.23 ? 210 HIS A CB   2  
ATOM 9237   C CG   . HIS A 1 210 ? 18.679  -10.754 -8.754  1.00 62.22 ? 210 HIS A CG   2  
ATOM 9238   N ND1  . HIS A 1 210 ? 19.135  -12.007 -8.402  1.00 31.14 ? 210 HIS A ND1  2  
ATOM 9239   C CD2  . HIS A 1 210 ? 19.782  -10.023 -9.045  1.00 22.41 ? 210 HIS A CD2  2  
ATOM 9240   C CE1  . HIS A 1 210 ? 20.454  -12.031 -8.475  1.00 52.11 ? 210 HIS A CE1  2  
ATOM 9241   N NE2  . HIS A 1 210 ? 20.871  -10.840 -8.863  1.00 11.04 ? 210 HIS A NE2  2  
ATOM 9242   H H    . HIS A 1 210 ? 17.991  -11.671 -10.975 1.00 74.21 ? 210 HIS A H    2  
ATOM 9243   H HA   . HIS A 1 210 ? 15.581  -10.231 -10.134 1.00 30.41 ? 210 HIS A HA   2  
ATOM 9244   H HB2  . HIS A 1 210 ? 17.112  -9.458  -8.241  1.00 42.45 ? 210 HIS A HB2  2  
ATOM 9245   H HB3  . HIS A 1 210 ? 16.680  -11.165 -8.262  1.00 73.14 ? 210 HIS A HB3  2  
ATOM 9246   H HD1  . HIS A 1 210 ? 18.575  -12.766 -8.137  1.00 1.32  ? 210 HIS A HD1  2  
ATOM 9247   H HD2  . HIS A 1 210 ? 19.801  -8.989  -9.361  1.00 43.32 ? 210 HIS A HD2  2  
ATOM 9248   H HE1  . HIS A 1 210 ? 21.084  -12.880 -8.256  1.00 20.00 ? 210 HIS A HE1  2  
ATOM 9249   H HE2  . HIS A 1 210 ? 21.808  -10.558 -8.917  1.00 37.47 ? 210 HIS A HE2  2  
ATOM 9250   N N    . LYS A 1 211 ? 16.379  -7.838  -10.488 1.00 43.15 ? 211 LYS A N    2  
ATOM 9251   C CA   . LYS A 1 211 ? 16.711  -6.511  -10.996 1.00 45.40 ? 211 LYS A CA   2  
ATOM 9252   C C    . LYS A 1 211 ? 18.118  -6.105  -10.574 1.00 64.52 ? 211 LYS A C    2  
ATOM 9253   O O    . LYS A 1 211 ? 18.317  -5.550  -9.493  1.00 51.40 ? 211 LYS A O    2  
ATOM 9254   C CB   . LYS A 1 211 ? 15.696  -5.482  -10.495 1.00 43.32 ? 211 LYS A CB   2  
ATOM 9255   C CG   . LYS A 1 211 ? 14.510  -5.293  -11.426 1.00 1.20  ? 211 LYS A CG   2  
ATOM 9256   C CD   . LYS A 1 211 ? 14.838  -4.334  -12.559 1.00 53.14 ? 211 LYS A CD   2  
ATOM 9257   C CE   . LYS A 1 211 ? 15.530  -5.046  -13.710 1.00 35.20 ? 211 LYS A CE   2  
ATOM 9258   N NZ   . LYS A 1 211 ? 15.198  -4.433  -15.024 1.00 2.35  ? 211 LYS A NZ   2  
ATOM 9259   H H    . LYS A 1 211 ? 15.593  -7.946  -9.912  1.00 51.32 ? 211 LYS A H    2  
ATOM 9260   H HA   . LYS A 1 211 ? 16.667  -6.550  -12.074 1.00 34.35 ? 211 LYS A HA   2  
ATOM 9261   H HB2  . LYS A 1 211 ? 15.324  -5.800  -9.532  1.00 23.11 ? 211 LYS A HB2  2  
ATOM 9262   H HB3  . LYS A 1 211 ? 16.193  -4.529  -10.383 1.00 75.24 ? 211 LYS A HB3  2  
ATOM 9263   H HG2  . LYS A 1 211 ? 14.239  -6.250  -11.847 1.00 72.33 ? 211 LYS A HG2  2  
ATOM 9264   H HG3  . LYS A 1 211 ? 13.680  -4.897  -10.860 1.00 24.53 ? 211 LYS A HG3  2  
ATOM 9265   H HD2  . LYS A 1 211 ? 13.922  -3.893  -12.922 1.00 53.25 ? 211 LYS A HD2  2  
ATOM 9266   H HD3  . LYS A 1 211 ? 15.489  -3.558  -12.183 1.00 30.13 ? 211 LYS A HD3  2  
ATOM 9267   H HE2  . LYS A 1 211 ? 16.599  -4.994  -13.558 1.00 31.30 ? 211 LYS A HE2  2  
ATOM 9268   H HE3  . LYS A 1 211 ? 15.220  -6.081  -13.715 1.00 1.30  ? 211 LYS A HE3  2  
ATOM 9269   H HZ1  . LYS A 1 211 ? 16.027  -4.457  -15.651 1.00 23.11 ? 211 LYS A HZ1  2  
ATOM 9270   H HZ2  . LYS A 1 211 ? 14.906  -3.443  -14.894 1.00 73.31 ? 211 LYS A HZ2  2  
ATOM 9271   H HZ3  . LYS A 1 211 ? 14.419  -4.956  -15.477 1.00 2.04  ? 211 LYS A HZ3  2  
ATOM 9272   N N    . GLU A 1 212 ? 19.091  -6.383  -11.435 1.00 54.32 ? 212 GLU A N    2  
ATOM 9273   C CA   . GLU A 1 212 ? 20.481  -6.046  -11.153 1.00 55.12 ? 212 GLU A CA   2  
ATOM 9274   C C    . GLU A 1 212 ? 20.669  -4.535  -11.078 1.00 63.22 ? 212 GLU A C    2  
ATOM 9275   O O    . GLU A 1 212 ? 19.919  -3.775  -11.690 1.00 23.43 ? 212 GLU A O    2  
ATOM 9276   C CB   . GLU A 1 212 ? 21.398  -6.633  -12.227 1.00 22.42 ? 212 GLU A CB   2  
ATOM 9277   C CG   . GLU A 1 212 ? 22.736  -7.114  -11.688 1.00 0.04  ? 212 GLU A CG   2  
ATOM 9278   C CD   . GLU A 1 212 ? 23.473  -8.005  -12.668 1.00 14.50 ? 212 GLU A CD   2  
ATOM 9279   O OE1  . GLU A 1 212 ? 22.842  -8.935  -13.215 1.00 14.14 ? 212 GLU A OE1  2  
ATOM 9280   O OE2  . GLU A 1 212 ? 24.681  -7.774  -12.889 1.00 34.31 ? 212 GLU A OE2  2  
ATOM 9281   H H    . GLU A 1 212 ? 18.869  -6.825  -12.281 1.00 32.45 ? 212 GLU A H    2  
ATOM 9282   H HA   . GLU A 1 212 ? 20.739  -6.477  -10.197 1.00 41.22 ? 212 GLU A HA   2  
ATOM 9283   H HB2  . GLU A 1 212 ? 20.900  -7.471  -12.691 1.00 32.32 ? 212 GLU A HB2  2  
ATOM 9284   H HB3  . GLU A 1 212 ? 21.587  -5.878  -12.975 1.00 72.41 ? 212 GLU A HB3  2  
ATOM 9285   H HG2  . GLU A 1 212 ? 23.353  -6.254  -11.473 1.00 44.32 ? 212 GLU A HG2  2  
ATOM 9286   H HG3  . GLU A 1 212 ? 22.564  -7.669  -10.778 1.00 31.31 ? 212 GLU A HG3  2  
ATOM 9287   N N    . TYR A 1 213 ? 21.675  -4.105  -10.321 1.00 24.14 ? 213 TYR A N    2  
ATOM 9288   C CA   . TYR A 1 213 ? 21.963  -2.683  -10.163 1.00 51.41 ? 213 TYR A CA   2  
ATOM 9289   C C    . TYR A 1 213 ? 22.163  -2.012  -11.518 1.00 51.13 ? 213 TYR A C    2  
ATOM 9290   O O    . TYR A 1 213 ? 23.280  -1.945  -12.031 1.00 30.35 ? 213 TYR A O    2  
ATOM 9291   C CB   . TYR A 1 213 ? 23.210  -2.490  -9.297  1.00 21.15 ? 213 TYR A CB   2  
ATOM 9292   C CG   . TYR A 1 213 ? 23.388  -1.073  -8.800  1.00 61.50 ? 213 TYR A CG   2  
ATOM 9293   C CD1  . TYR A 1 213 ? 23.815  -0.065  -9.655  1.00 63.13 ? 213 TYR A CD1  2  
ATOM 9294   C CD2  . TYR A 1 213 ? 23.131  -0.743  -7.475  1.00 70.44 ? 213 TYR A CD2  2  
ATOM 9295   C CE1  . TYR A 1 213 ? 23.981  1.231   -9.205  1.00 11.13 ? 213 TYR A CE1  2  
ATOM 9296   C CE2  . TYR A 1 213 ? 23.294  0.550   -7.017  1.00 15.20 ? 213 TYR A CE2  2  
ATOM 9297   C CZ   . TYR A 1 213 ? 23.718  1.533   -7.886  1.00 44.34 ? 213 TYR A CZ   2  
ATOM 9298   O OH   . TYR A 1 213 ? 23.881  2.823   -7.434  1.00 11.50 ? 213 TYR A OH   2  
ATOM 9299   H H    . TYR A 1 213 ? 22.235  -4.762  -9.857  1.00 74.11 ? 213 TYR A H    2  
ATOM 9300   H HA   . TYR A 1 213 ? 21.120  -2.227  -9.669  1.00 23.50 ? 213 TYR A HA   2  
ATOM 9301   H HB2  . TYR A 1 213 ? 23.145  -3.137  -8.434  1.00 11.12 ? 213 TYR A HB2  2  
ATOM 9302   H HB3  . TYR A 1 213 ? 24.085  -2.753  -9.873  1.00 61.23 ? 213 TYR A HB3  2  
ATOM 9303   H HD1  . TYR A 1 213 ? 24.020  -0.305  -10.688 1.00 2.20  ? 213 TYR A HD1  2  
ATOM 9304   H HD2  . TYR A 1 213 ? 22.800  -1.516  -6.797  1.00 50.11 ? 213 TYR A HD2  2  
ATOM 9305   H HE1  . TYR A 1 213 ? 24.313  2.000   -9.886  1.00 3.42  ? 213 TYR A HE1  2  
ATOM 9306   H HE2  . TYR A 1 213 ? 23.088  0.787   -5.983  1.00 11.03 ? 213 TYR A HE2  2  
ATOM 9307   H HH   . TYR A 1 213 ? 24.287  2.808   -6.563  1.00 1.43  ? 213 TYR A HH   2  
ATOM 9308   N N    . LYS A 1 214 ? 21.072  -1.516  -12.094 1.00 4.10  ? 214 LYS A N    2  
ATOM 9309   C CA   . LYS A 1 214 ? 21.126  -0.851  -13.391 1.00 42.12 ? 214 LYS A CA   2  
ATOM 9310   C C    . LYS A 1 214 ? 20.222  0.376   -13.412 1.00 71.41 ? 214 LYS A C    2  
ATOM 9311   O O    . LYS A 1 214 ? 19.331  0.520   -12.574 1.00 53.20 ? 214 LYS A O    2  
ATOM 9312   C CB   . LYS A 1 214 ? 20.717  -1.820  -14.501 1.00 31.34 ? 214 LYS A CB   2  
ATOM 9313   C CG   . LYS A 1 214 ? 21.859  -2.690  -15.001 1.00 42.44 ? 214 LYS A CG   2  
ATOM 9314   C CD   . LYS A 1 214 ? 21.719  -2.995  -16.483 1.00 12.32 ? 214 LYS A CD   2  
ATOM 9315   C CE   . LYS A 1 214 ? 23.072  -3.254  -17.129 1.00 13.54 ? 214 LYS A CE   2  
ATOM 9316   N NZ   . LYS A 1 214 ? 22.993  -3.220  -18.615 1.00 61.53 ? 214 LYS A NZ   2  
ATOM 9317   H H    . LYS A 1 214 ? 20.210  -1.602  -11.637 1.00 22.03 ? 214 LYS A H    2  
ATOM 9318   H HA   . LYS A 1 214 ? 22.145  -0.535  -13.558 1.00 21.33 ? 214 LYS A HA   2  
ATOM 9319   H HB2  . LYS A 1 214 ? 19.937  -2.467  -14.130 1.00 71.42 ? 214 LYS A HB2  2  
ATOM 9320   H HB3  . LYS A 1 214 ? 20.334  -1.252  -15.335 1.00 15.04 ? 214 LYS A HB3  2  
ATOM 9321   H HG2  . LYS A 1 214 ? 22.792  -2.172  -14.836 1.00 53.43 ? 214 LYS A HG2  2  
ATOM 9322   H HG3  . LYS A 1 214 ? 21.859  -3.619  -14.450 1.00 33.14 ? 214 LYS A HG3  2  
ATOM 9323   H HD2  . LYS A 1 214 ? 21.100  -3.871  -16.605 1.00 22.44 ? 214 LYS A HD2  2  
ATOM 9324   H HD3  . LYS A 1 214 ? 21.253  -2.152  -16.972 1.00 33.13 ? 214 LYS A HD3  2  
ATOM 9325   H HE2  . LYS A 1 214 ? 23.766  -2.498  -16.796 1.00 10.10 ? 214 LYS A HE2  2  
ATOM 9326   H HE3  . LYS A 1 214 ? 23.423  -4.227  -16.816 1.00 72.05 ? 214 LYS A HE3  2  
ATOM 9327   H HZ1  . LYS A 1 214 ? 23.241  -2.273  -18.964 1.00 32.51 ? 214 LYS A HZ1  2  
ATOM 9328   H HZ2  . LYS A 1 214 ? 22.029  -3.451  -18.928 1.00 44.41 ? 214 LYS A HZ2  2  
ATOM 9329   H HZ3  . LYS A 1 214 ? 23.653  -3.912  -19.023 1.00 21.51 ? 214 LYS A HZ3  2  
ATOM 9330   N N    . GLU A 1 215 ? 20.457  1.259   -14.376 1.00 63.35 ? 215 GLU A N    2  
ATOM 9331   C CA   . GLU A 1 215 ? 19.665  2.475   -14.511 1.00 54.31 ? 215 GLU A CA   2  
ATOM 9332   C C    . GLU A 1 215 ? 18.567  2.297   -15.554 1.00 0.44  ? 215 GLU A C    2  
ATOM 9333   O O    . GLU A 1 215 ? 18.819  1.822   -16.662 1.00 24.30 ? 215 GLU A O    2  
ATOM 9334   C CB   . GLU A 1 215 ? 20.562  3.654   -14.896 1.00 11.24 ? 215 GLU A CB   2  
ATOM 9335   C CG   . GLU A 1 215 ? 21.855  3.720   -14.099 1.00 23.41 ? 215 GLU A CG   2  
ATOM 9336   C CD   . GLU A 1 215 ? 23.007  3.028   -14.800 1.00 25.41 ? 215 GLU A CD   2  
ATOM 9337   O OE1  . GLU A 1 215 ? 23.105  3.144   -16.040 1.00 63.03 ? 215 GLU A OE1  2  
ATOM 9338   O OE2  . GLU A 1 215 ? 23.812  2.368   -14.108 1.00 43.45 ? 215 GLU A OE2  2  
ATOM 9339   H H    . GLU A 1 215 ? 21.180  1.087   -15.014 1.00 52.32 ? 215 GLU A H    2  
ATOM 9340   H HA   . GLU A 1 215 ? 19.207  2.680   -13.555 1.00 11.54 ? 215 GLU A HA   2  
ATOM 9341   H HB2  . GLU A 1 215 ? 20.814  3.572   -15.944 1.00 11.41 ? 215 GLU A HB2  2  
ATOM 9342   H HB3  . GLU A 1 215 ? 20.018  4.573   -14.736 1.00 12.41 ? 215 GLU A HB3  2  
ATOM 9343   H HG2  . GLU A 1 215 ? 22.116  4.757   -13.948 1.00 53.33 ? 215 GLU A HG2  2  
ATOM 9344   H HG3  . GLU A 1 215 ? 21.697  3.246   -13.142 1.00 53.20 ? 215 GLU A HG3  2  
ATOM 9345   N N    . ASP A 1 216 ? 17.346  2.680   -15.193 1.00 22.12 ? 216 ASP A N    2  
ATOM 9346   C CA   . ASP A 1 216 ? 16.209  2.562   -16.097 1.00 53.41 ? 216 ASP A CA   2  
ATOM 9347   C C    . ASP A 1 216 ? 15.060  3.460   -15.648 1.00 3.45  ? 216 ASP A C    2  
ATOM 9348   O O    . ASP A 1 216 ? 14.149  3.015   -14.950 1.00 72.15 ? 216 ASP A O    2  
ATOM 9349   C CB   . ASP A 1 216 ? 15.736  1.108   -16.169 1.00 22.34 ? 216 ASP A CB   2  
ATOM 9350   C CG   . ASP A 1 216 ? 15.180  0.748   -17.532 1.00 51.31 ? 216 ASP A CG   2  
ATOM 9351   O OD1  . ASP A 1 216 ? 14.215  1.409   -17.972 1.00 73.43 ? 216 ASP A OD1  2  
ATOM 9352   O OD2  . ASP A 1 216 ? 15.707  -0.194  -18.159 1.00 73.24 ? 216 ASP A OD2  2  
ATOM 9353   H H    . ASP A 1 216 ? 17.208  3.051   -14.296 1.00 44.11 ? 216 ASP A H    2  
ATOM 9354   H HA   . ASP A 1 216 ? 16.533  2.874   -17.078 1.00 73.21 ? 216 ASP A HA   2  
ATOM 9355   H HB2  . ASP A 1 216 ? 16.570  0.454   -15.958 1.00 32.43 ? 216 ASP A HB2  2  
ATOM 9356   H HB3  . ASP A 1 216 ? 14.964  0.951   -15.431 1.00 50.20 ? 216 ASP A HB3  2  
ATOM 9357   N N    . PRO A 1 217 ? 15.088  4.745   -16.045 1.00 23.02 ? 217 PRO A N    2  
ATOM 9358   C CA   . PRO A 1 217 ? 14.044  5.706   -15.679 1.00 12.34 ? 217 PRO A CA   2  
ATOM 9359   C C    . PRO A 1 217 ? 12.741  5.462   -16.434 1.00 70.14 ? 217 PRO A C    2  
ATOM 9360   O O    . PRO A 1 217 ? 11.655  5.730   -15.920 1.00 10.43 ? 217 PRO A O    2  
ATOM 9361   C CB   . PRO A 1 217 ? 14.650  7.052   -16.080 1.00 3.03  ? 217 PRO A CB   2  
ATOM 9362   C CG   . PRO A 1 217 ? 15.591  6.726   -17.187 1.00 1.10  ? 217 PRO A CG   2  
ATOM 9363   C CD   . PRO A 1 217 ? 16.140  5.358   -16.878 1.00 35.33 ? 217 PRO A CD   2  
ATOM 9364   H HA   . PRO A 1 217 ? 13.851  5.696   -14.616 1.00 24.20 ? 217 PRO A HA   2  
ATOM 9365   H HB2  . PRO A 1 217 ? 13.866  7.719   -16.409 1.00 41.54 ? 217 PRO A HB2  2  
ATOM 9366   H HB3  . PRO A 1 217 ? 15.168  7.483   -15.236 1.00 14.44 ? 217 PRO A HB3  2  
ATOM 9367   H HG2  . PRO A 1 217 ? 15.060  6.713   -18.128 1.00 32.04 ? 217 PRO A HG2  2  
ATOM 9368   H HG3  . PRO A 1 217 ? 16.389  7.452   -17.216 1.00 74.02 ? 217 PRO A HG3  2  
ATOM 9369   H HD2  . PRO A 1 217 ? 16.286  4.797   -17.789 1.00 72.32 ? 217 PRO A HD2  2  
ATOM 9370   H HD3  . PRO A 1 217 ? 17.067  5.439   -16.330 1.00 23.23 ? 217 PRO A HD3  2  
ATOM 9371   N N    . LYS A 1 218 ? 12.858  4.954   -17.657 1.00 13.13 ? 218 LYS A N    2  
ATOM 9372   C CA   . LYS A 1 218 ? 11.690  4.675   -18.486 1.00 44.40 ? 218 LYS A CA   2  
ATOM 9373   C C    . LYS A 1 218 ? 10.718  3.742   -17.768 1.00 10.43 ? 218 LYS A C    2  
ATOM 9374   O O    . LYS A 1 218 ? 9.503   3.846   -17.939 1.00 55.54 ? 218 LYS A O    2  
ATOM 9375   C CB   . LYS A 1 218 ? 12.120  4.055   -19.816 1.00 33.22 ? 218 LYS A CB   2  
ATOM 9376   C CG   . LYS A 1 218 ? 12.659  5.068   -20.813 1.00 65.20 ? 218 LYS A CG   2  
ATOM 9377   C CD   . LYS A 1 218 ? 13.301  4.385   -22.010 1.00 34.42 ? 218 LYS A CD   2  
ATOM 9378   C CE   . LYS A 1 218 ? 13.881  5.397   -22.983 1.00 54.21 ? 218 LYS A CE   2  
ATOM 9379   N NZ   . LYS A 1 218 ? 14.525  4.738   -24.153 1.00 65.04 ? 218 LYS A NZ   2  
ATOM 9380   H H    . LYS A 1 218 ? 13.751  4.764   -18.011 1.00 43.44 ? 218 LYS A H    2  
ATOM 9381   H HA   . LYS A 1 218 ? 11.192  5.612   -18.681 1.00 3.41  ? 218 LYS A HA   2  
ATOM 9382   H HB2  . LYS A 1 218 ? 12.891  3.323   -19.626 1.00 54.41 ? 218 LYS A HB2  2  
ATOM 9383   H HB3  . LYS A 1 218 ? 11.269  3.560   -20.262 1.00 3.20  ? 218 LYS A HB3  2  
ATOM 9384   H HG2  . LYS A 1 218 ? 11.844  5.686   -21.159 1.00 12.23 ? 218 LYS A HG2  2  
ATOM 9385   H HG3  . LYS A 1 218 ? 13.399  5.683   -20.321 1.00 40.12 ? 218 LYS A HG3  2  
ATOM 9386   H HD2  . LYS A 1 218 ? 14.094  3.740   -21.661 1.00 2.13  ? 218 LYS A HD2  2  
ATOM 9387   H HD3  . LYS A 1 218 ? 12.553  3.796   -22.519 1.00 0.31  ? 218 LYS A HD3  2  
ATOM 9388   H HE2  . LYS A 1 218 ? 13.085  6.036   -23.335 1.00 34.20 ? 218 LYS A HE2  2  
ATOM 9389   H HE3  . LYS A 1 218 ? 14.619  5.993   -22.466 1.00 71.33 ? 218 LYS A HE3  2  
ATOM 9390   H HZ1  . LYS A 1 218 ? 15.486  4.429   -23.905 1.00 55.13 ? 218 LYS A HZ1  2  
ATOM 9391   H HZ2  . LYS A 1 218 ? 14.582  5.402   -24.951 1.00 72.12 ? 218 LYS A HZ2  2  
ATOM 9392   H HZ3  . LYS A 1 218 ? 13.969  3.908   -24.446 1.00 52.20 ? 218 LYS A HZ3  2  
ATOM 9393   N N    . ARG A 1 219 ? 11.260  2.834   -16.964 1.00 10.21 ? 219 ARG A N    2  
ATOM 9394   C CA   . ARG A 1 219 ? 10.439  1.884   -16.220 1.00 20.10 ? 219 ARG A CA   2  
ATOM 9395   C C    . ARG A 1 219 ? 10.745  1.958   -14.728 1.00 31.01 ? 219 ARG A C    2  
ATOM 9396   O O    . ARG A 1 219 ? 11.864  2.275   -14.328 1.00 42.00 ? 219 ARG A O    2  
ATOM 9397   C CB   . ARG A 1 219 ? 10.678  0.462   -16.730 1.00 2.33  ? 219 ARG A CB   2  
ATOM 9398   C CG   . ARG A 1 219 ? 9.450   -0.430  -16.645 1.00 42.34 ? 219 ARG A CG   2  
ATOM 9399   C CD   . ARG A 1 219 ? 9.833   -1.896  -16.525 1.00 34.22 ? 219 ARG A CD   2  
ATOM 9400   N NE   . ARG A 1 219 ? 8.666   -2.773  -16.581 1.00 63.11 ? 219 ARG A NE   2  
ATOM 9401   C CZ   . ARG A 1 219 ? 8.016   -3.070  -17.704 1.00 13.23 ? 219 ARG A CZ   2  
ATOM 9402   N NH1  . ARG A 1 219 ? 8.414   -2.562  -18.864 1.00 22.43 ? 219 ARG A NH1  2  
ATOM 9403   N NH2  . ARG A 1 219 ? 6.964   -3.876  -17.668 1.00 42.54 ? 219 ARG A NH2  2  
ATOM 9404   H H    . ARG A 1 219 ? 12.235  2.800   -16.868 1.00 44.33 ? 219 ARG A H    2  
ATOM 9405   H HA   . ARG A 1 219 ? 9.404   2.145   -16.378 1.00 24.41 ? 219 ARG A HA   2  
ATOM 9406   H HB2  . ARG A 1 219 ? 10.989  0.510   -17.763 1.00 44.03 ? 219 ARG A HB2  2  
ATOM 9407   H HB3  . ARG A 1 219 ? 11.466  0.010   -16.148 1.00 55.53 ? 219 ARG A HB3  2  
ATOM 9408   H HG2  . ARG A 1 219 ? 8.872   -0.147  -15.777 1.00 73.45 ? 219 ARG A HG2  2  
ATOM 9409   H HG3  . ARG A 1 219 ? 8.855   -0.293  -17.536 1.00 61.11 ? 219 ARG A HG3  2  
ATOM 9410   H HD2  . ARG A 1 219 ? 10.501  -2.148  -17.335 1.00 65.21 ? 219 ARG A HD2  2  
ATOM 9411   H HD3  . ARG A 1 219 ? 10.339  -2.046  -15.582 1.00 43.12 ? 219 ARG A HD3  2  
ATOM 9412   H HE   . ARG A 1 219 ? 8.350   -3.161  -15.739 1.00 51.53 ? 219 ARG A HE   2  
ATOM 9413   H HH11 . ARG A 1 219 ? 9.207   -1.953  -18.899 1.00 20.14 ? 219 ARG A HH11 2  
ATOM 9414   H HH12 . ARG A 1 219 ? 7.922   -2.790  -19.704 1.00 44.30 ? 219 ARG A HH12 2  
ATOM 9415   H HH21 . ARG A 1 219 ? 6.659   -4.261  -16.797 1.00 2.43  ? 219 ARG A HH21 2  
ATOM 9416   H HH22 . ARG A 1 219 ? 6.475   -4.099  -18.510 1.00 40.34 ? 219 ARG A HH22 2  
ATOM 9417   N N    . CYS A 1 220 ? 9.740   1.665   -13.907 1.00 71.14 ? 220 CYS A N    2  
ATOM 9418   C CA   . CYS A 1 220 ? 9.904   1.700   -12.456 1.00 71.01 ? 220 CYS A CA   2  
ATOM 9419   C C    . CYS A 1 220 ? 10.388  3.071   -11.996 1.00 1.55  ? 220 CYS A C    2  
ATOM 9420   O O    . CYS A 1 220 ? 11.577  3.266   -11.742 1.00 64.13 ? 220 CYS A O    2  
ATOM 9421   C CB   . CYS A 1 220 ? 10.891  0.620   -12.008 1.00 60.34 ? 220 CYS A CB   2  
ATOM 9422   S SG   . CYS A 1 220 ? 10.433  -1.054  -12.515 1.00 21.45 ? 220 CYS A SG   2  
ATOM 9423   H H    . CYS A 1 220 ? 8.870   1.419   -14.283 1.00 11.01 ? 220 CYS A H    2  
ATOM 9424   H HA   . CYS A 1 220 ? 8.941   1.503   -12.010 1.00 34.30 ? 220 CYS A HA   2  
ATOM 9425   H HB2  . CYS A 1 220 ? 11.862  0.835   -12.427 1.00 3.15  ? 220 CYS A HB2  2  
ATOM 9426   H HB3  . CYS A 1 220 ? 10.959  0.631   -10.930 1.00 74.12 ? 220 CYS A HB3  2  
ATOM 9427   H HG   . CYS A 1 220 ? 9.782   -1.385  -11.891 1.00 73.35 ? 220 CYS A HG   2  
ATOM 9428   N N    . HIS A 1 221 ? 9.462   4.019   -11.892 1.00 11.30 ? 221 HIS A N    2  
ATOM 9429   C CA   . HIS A 1 221 ? 9.800   5.371   -11.463 1.00 53.33 ? 221 HIS A CA   2  
ATOM 9430   C C    . HIS A 1 221 ? 9.782   5.498   -9.941  1.00 53.34 ? 221 HIS A C    2  
ATOM 9431   O O    . HIS A 1 221 ? 9.943   6.594   -9.403  1.00 11.05 ? 221 HIS A O    2  
ATOM 9432   C CB   . HIS A 1 221 ? 8.833   6.383   -12.080 1.00 52.51 ? 221 HIS A CB   2  
ATOM 9433   C CG   . HIS A 1 221 ? 8.942   6.479   -13.570 1.00 12.35 ? 221 HIS A CG   2  
ATOM 9434   N ND1  . HIS A 1 221 ? 9.292   7.641   -14.226 1.00 13.35 ? 221 HIS A ND1  2  
ATOM 9435   C CD2  . HIS A 1 221 ? 8.748   5.550   -14.536 1.00 32.22 ? 221 HIS A CD2  2  
ATOM 9436   C CE1  . HIS A 1 221 ? 9.309   7.421   -15.529 1.00 62.50 ? 221 HIS A CE1  2  
ATOM 9437   N NE2  . HIS A 1 221 ? 8.983   6.161   -15.742 1.00 25.52 ? 221 HIS A NE2  2  
ATOM 9438   H H    . HIS A 1 221 ? 8.531   3.804   -12.109 1.00 25.03 ? 221 HIS A H    2  
ATOM 9439   H HA   . HIS A 1 221 ? 10.798  5.586   -11.814 1.00 14.34 ? 221 HIS A HA   2  
ATOM 9440   H HB2  . HIS A 1 221 ? 7.821   6.097   -11.838 1.00 42.41 ? 221 HIS A HB2  2  
ATOM 9441   H HB3  . HIS A 1 221 ? 9.035   7.360   -11.667 1.00 51.24 ? 221 HIS A HB3  2  
ATOM 9442   H HD1  . HIS A 1 221 ? 9.499   8.499   -13.800 1.00 55.44 ? 221 HIS A HD1  2  
ATOM 9443   H HD2  . HIS A 1 221 ? 8.461   4.518   -14.383 1.00 42.11 ? 221 HIS A HD2  2  
ATOM 9444   H HE1  . HIS A 1 221 ? 9.549   8.149   -16.289 1.00 42.44 ? 221 HIS A HE1  2  
ATOM 9445   H HE2  . HIS A 1 221 ? 8.832   5.758   -16.623 1.00 37.47 ? 221 HIS A HE2  2  
ATOM 9446   N N    . ASP A 1 222 ? 9.587   4.375   -9.246  1.00 1.42  ? 222 ASP A N    2  
ATOM 9447   C CA   . ASP A 1 222 ? 9.553   4.369   -7.784  1.00 15.43 ? 222 ASP A CA   2  
ATOM 9448   C C    . ASP A 1 222 ? 8.219   4.896   -7.264  1.00 50.52 ? 222 ASP A C    2  
ATOM 9449   O O    . ASP A 1 222 ? 7.409   4.137   -6.733  1.00 74.21 ? 222 ASP A O    2  
ATOM 9450   C CB   . ASP A 1 222 ? 10.705  5.198   -7.209  1.00 52.31 ? 222 ASP A CB   2  
ATOM 9451   C CG   . ASP A 1 222 ? 11.334  4.547   -5.993  1.00 10.31 ? 222 ASP A CG   2  
ATOM 9452   O OD1  . ASP A 1 222 ? 10.697  4.557   -4.918  1.00 2.22  ? 222 ASP A OD1  2  
ATOM 9453   O OD2  . ASP A 1 222 ? 12.463  4.028   -6.114  1.00 60.23 ? 222 ASP A OD2  2  
ATOM 9454   H H    . ASP A 1 222 ? 9.464   3.528   -9.724  1.00 41.32 ? 222 ASP A H    2  
ATOM 9455   H HA   . ASP A 1 222 ? 9.666   3.344   -7.461  1.00 51.53 ? 222 ASP A HA   2  
ATOM 9456   H HB2  . ASP A 1 222 ? 11.466  5.317   -7.964  1.00 71.15 ? 222 ASP A HB2  2  
ATOM 9457   H HB3  . ASP A 1 222 ? 10.332  6.171   -6.922  1.00 11.22 ? 222 ASP A HB3  2  
ATOM 9458   N N    . GLY A 1 223 ? 7.995   6.198   -7.416  1.00 45.22 ? 223 GLY A N    2  
ATOM 9459   C CA   . GLY A 1 223 ? 6.756   6.794   -6.952  1.00 52.20 ? 223 GLY A CA   2  
ATOM 9460   C C    . GLY A 1 223 ? 6.935   8.236   -6.522  1.00 50.43 ? 223 GLY A C    2  
ATOM 9461   O O    . GLY A 1 223 ? 7.267   9.097   -7.337  1.00 41.12 ? 223 GLY A O    2  
ATOM 9462   H H    . GLY A 1 223 ? 8.671   6.762   -7.845  1.00 3.34  ? 223 GLY A H    2  
ATOM 9463   H HA2  . GLY A 1 223 ? 6.029   6.754   -7.749  1.00 64.05 ? 223 GLY A HA2  2  
ATOM 9464   H HA3  . GLY A 1 223 ? 6.387   6.222   -6.113  1.00 54.01 ? 223 GLY A HA3  2  
ATOM 9465   N N    . THR A 1 224 ? 6.715   8.502   -5.238  1.00 73.52 ? 224 THR A N    2  
ATOM 9466   C CA   . THR A 1 224 ? 6.855   9.850   -4.701  1.00 64.22 ? 224 THR A CA   2  
ATOM 9467   C C    . THR A 1 224 ? 8.169   9.996   -3.941  1.00 34.40 ? 224 THR A C    2  
ATOM 9468   O O    . THR A 1 224 ? 8.564   9.103   -3.189  1.00 65.22 ? 224 THR A O    2  
ATOM 9469   C CB   . THR A 1 224 ? 5.680   10.180  -3.779  1.00 35.53 ? 224 THR A CB   2  
ATOM 9470   O OG1  . THR A 1 224 ? 5.197   9.008   -3.144  1.00 14.12 ? 224 THR A OG1  2  
ATOM 9471   C CG2  . THR A 1 224 ? 4.516   10.823  -4.501  1.00 62.40 ? 224 THR A CG2  2  
ATOM 9472   H H    . THR A 1 224 ? 6.455   7.771   -4.639  1.00 71.10 ? 224 THR A H    2  
ATOM 9473   H HA   . THR A 1 224 ? 6.856   10.540  -5.532  1.00 73.13 ? 224 THR A HA   2  
ATOM 9474   H HB   . THR A 1 224 ? 6.016   10.865  -3.015  1.00 75.32 ? 224 THR A HB   2  
ATOM 9475   H HG1  . THR A 1 224 ? 5.506   8.987   -2.236  1.00 70.02 ? 224 THR A HG1  2  
ATOM 9476   H HG21 . THR A 1 224 ? 4.265   11.756  -4.018  1.00 51.23 ? 224 THR A HG21 2  
ATOM 9477   H HG22 . THR A 1 224 ? 3.663   10.162  -4.472  1.00 1.11  ? 224 THR A HG22 2  
ATOM 9478   H HG23 . THR A 1 224 ? 4.790   11.014  -5.529  1.00 65.11 ? 224 THR A HG23 2  
ATOM 9479   N N    . ILE A 1 225 ? 8.845   11.124  -4.138  1.00 73.13 ? 225 ILE A N    2  
ATOM 9480   C CA   . ILE A 1 225 ? 10.114  11.381  -3.469  1.00 14.23 ? 225 ILE A CA   2  
ATOM 9481   C C    . ILE A 1 225 ? 9.957   11.326  -1.952  1.00 15.32 ? 225 ILE A C    2  
ATOM 9482   O O    . ILE A 1 225 ? 10.892  10.974  -1.232  1.00 33.21 ? 225 ILE A O    2  
ATOM 9483   C CB   . ILE A 1 225 ? 10.691  12.754  -3.873  1.00 50.31 ? 225 ILE A CB   2  
ATOM 9484   C CG1  . ILE A 1 225 ? 12.088  12.944  -3.276  1.00 1.32  ? 225 ILE A CG1  2  
ATOM 9485   C CG2  . ILE A 1 225 ? 9.760   13.875  -3.430  1.00 14.32 ? 225 ILE A CG2  2  
ATOM 9486   C CD1  . ILE A 1 225 ? 13.204  12.732  -4.275  1.00 53.15 ? 225 ILE A CD1  2  
ATOM 9487   H H    . ILE A 1 225 ? 8.484   11.800  -4.748  1.00 2.44  ? 225 ILE A H    2  
ATOM 9488   H HA   . ILE A 1 225 ? 10.812  10.617  -3.776  1.00 73.12 ? 225 ILE A HA   2  
ATOM 9489   H HB   . ILE A 1 225 ? 10.762  12.785  -4.949  1.00 41.21 ? 225 ILE A HB   2  
ATOM 9490   H HG12 . ILE A 1 225 ? 12.176  13.949  -2.891  1.00 75.45 ? 225 ILE A HG12 2  
ATOM 9491   H HG13 . ILE A 1 225 ? 12.228  12.242  -2.468  1.00 40.40 ? 225 ILE A HG13 2  
ATOM 9492   H HG21 . ILE A 1 225 ? 8.768   13.479  -3.278  1.00 44.35 ? 225 ILE A HG21 2  
ATOM 9493   H HG22 . ILE A 1 225 ? 9.730   14.639  -4.194  1.00 65.22 ? 225 ILE A HG22 2  
ATOM 9494   H HG23 . ILE A 1 225 ? 10.124  14.302  -2.507  1.00 10.51 ? 225 ILE A HG23 2  
ATOM 9495   H HD11 . ILE A 1 225 ? 13.981  13.465  -4.108  1.00 44.34 ? 225 ILE A HD11 2  
ATOM 9496   H HD12 . ILE A 1 225 ? 12.816  12.841  -5.277  1.00 35.24 ? 225 ILE A HD12 2  
ATOM 9497   H HD13 . ILE A 1 225 ? 13.614  11.740  -4.153  1.00 45.11 ? 225 ILE A HD13 2  
ATOM 9498   N N    . GLU A 1 226 ? 8.767   11.677  -1.472  1.00 62.10 ? 226 GLU A N    2  
ATOM 9499   C CA   . GLU A 1 226 ? 8.488   11.668  -0.041  1.00 11.22 ? 226 GLU A CA   2  
ATOM 9500   C C    . GLU A 1 226 ? 8.736   10.287  0.558   1.00 71.53 ? 226 GLU A C    2  
ATOM 9501   O O    . GLU A 1 226 ? 9.185   10.166  1.697   1.00 73.11 ? 226 GLU A O    2  
ATOM 9502   C CB   . GLU A 1 226 ? 7.041   12.096  0.219   1.00 33.31 ? 226 GLU A CB   2  
ATOM 9503   C CG   . GLU A 1 226 ? 6.846   13.604  0.229   1.00 33.44 ? 226 GLU A CG   2  
ATOM 9504   C CD   . GLU A 1 226 ? 5.443   14.011  -0.176  1.00 3.20  ? 226 GLU A CD   2  
ATOM 9505   O OE1  . GLU A 1 226 ? 4.989   13.581  -1.257  1.00 64.13 ? 226 GLU A OE1  2  
ATOM 9506   O OE2  . GLU A 1 226 ? 4.799   14.763  0.586   1.00 0.33  ? 226 GLU A OE2  2  
ATOM 9507   H H    . GLU A 1 226 ? 8.061   11.948  -2.095  1.00 51.33 ? 226 GLU A H    2  
ATOM 9508   H HA   . GLU A 1 226 ? 9.152   12.376  0.431   1.00 72.23 ? 226 GLU A HA   2  
ATOM 9509   H HB2  . GLU A 1 226 ? 6.410   11.678  -0.551  1.00 65.14 ? 226 GLU A HB2  2  
ATOM 9510   H HB3  . GLU A 1 226 ? 6.730   11.708  1.178   1.00 5.34  ? 226 GLU A HB3  2  
ATOM 9511   H HG2  . GLU A 1 226 ? 7.036   13.971  1.226   1.00 14.31 ? 226 GLU A HG2  2  
ATOM 9512   H HG3  . GLU A 1 226 ? 7.549   14.050  -0.459  1.00 12.23 ? 226 GLU A HG3  2  
ATOM 9513   N N    . PHE A 1 227 ? 8.438   9.247   -0.216  1.00 23.44 ? 227 PHE A N    2  
ATOM 9514   C CA   . PHE A 1 227 ? 8.629   7.876   0.242   1.00 15.21 ? 227 PHE A CA   2  
ATOM 9515   C C    . PHE A 1 227 ? 9.395   7.051   -0.789  1.00 2.02  ? 227 PHE A C    2  
ATOM 9516   O O    . PHE A 1 227 ? 9.262   5.829   -0.842  1.00 62.51 ? 227 PHE A O    2  
ATOM 9517   C CB   . PHE A 1 227 ? 7.278   7.221   0.532   1.00 40.50 ? 227 PHE A CB   2  
ATOM 9518   C CG   . PHE A 1 227 ? 6.623   7.727   1.786   1.00 74.43 ? 227 PHE A CG   2  
ATOM 9519   C CD1  . PHE A 1 227 ? 7.172   7.454   3.029   1.00 1.23  ? 227 PHE A CD1  2  
ATOM 9520   C CD2  . PHE A 1 227 ? 5.459   8.475   1.722   1.00 65.13 ? 227 PHE A CD2  2  
ATOM 9521   C CE1  . PHE A 1 227 ? 6.573   7.918   4.184   1.00 33.41 ? 227 PHE A CE1  2  
ATOM 9522   C CE2  . PHE A 1 227 ? 4.854   8.942   2.873   1.00 72.04 ? 227 PHE A CE2  2  
ATOM 9523   C CZ   . PHE A 1 227 ? 5.412   8.663   4.106   1.00 11.55 ? 227 PHE A CZ   2  
ATOM 9524   H H    . PHE A 1 227 ? 8.081   9.405   -1.116  1.00 21.51 ? 227 PHE A H    2  
ATOM 9525   H HA   . PHE A 1 227 ? 9.205   7.911   1.156   1.00 61.31 ? 227 PHE A HA   2  
ATOM 9526   H HB2  . PHE A 1 227 ? 6.608   7.413   -0.292  1.00 21.12 ? 227 PHE A HB2  2  
ATOM 9527   H HB3  . PHE A 1 227 ? 7.417   6.155   0.636   1.00 45.34 ? 227 PHE A HB3  2  
ATOM 9528   H HD1  . PHE A 1 227 ? 8.080   6.872   3.091   1.00 3.32  ? 227 PHE A HD1  2  
ATOM 9529   H HD2  . PHE A 1 227 ? 5.021   8.694   0.759   1.00 62.53 ? 227 PHE A HD2  2  
ATOM 9530   H HE1  . PHE A 1 227 ? 7.010   7.698   5.146   1.00 74.42 ? 227 PHE A HE1  2  
ATOM 9531   H HE2  . PHE A 1 227 ? 3.947   9.524   2.810   1.00 11.22 ? 227 PHE A HE2  2  
ATOM 9532   H HZ   . PHE A 1 227 ? 4.941   9.027   5.008   1.00 44.00 ? 227 PHE A HZ   2  
ATOM 9533   N N    . THR A 1 228 ? 10.199  7.725   -1.607  1.00 33.14 ? 228 THR A N    2  
ATOM 9534   C CA   . THR A 1 228 ? 10.985  7.049   -2.633  1.00 12.11 ? 228 THR A CA   2  
ATOM 9535   C C    . THR A 1 228 ? 12.117  6.239   -2.005  1.00 61.24 ? 228 THR A C    2  
ATOM 9536   O O    . THR A 1 228 ? 12.125  6.001   -0.797  1.00 61.02 ? 228 THR A O    2  
ATOM 9537   C CB   . THR A 1 228 ? 11.557  8.067   -3.622  1.00 3.24  ? 228 THR A CB   2  
ATOM 9538   O OG1  . THR A 1 228 ? 12.209  7.412   -4.695  1.00 25.24 ? 228 THR A OG1  2  
ATOM 9539   C CG2  . THR A 1 228 ? 12.552  9.020   -2.993  1.00 42.34 ? 228 THR A CG2  2  
ATOM 9540   H H    . THR A 1 228 ? 10.266  8.698   -1.519  1.00 55.13 ? 228 THR A H    2  
ATOM 9541   H HA   . THR A 1 228 ? 10.328  6.376   -3.164  1.00 70.05 ? 228 THR A HA   2  
ATOM 9542   H HB   . THR A 1 228 ? 10.745  8.655   -4.026  1.00 72.41 ? 228 THR A HB   2  
ATOM 9543   H HG1  . THR A 1 228 ? 11.589  7.282   -5.415  1.00 41.33 ? 228 THR A HG1  2  
ATOM 9544   H HG21 . THR A 1 228 ? 12.192  9.325   -2.021  1.00 44.34 ? 228 THR A HG21 2  
ATOM 9545   H HG22 . THR A 1 228 ? 12.665  9.889   -3.624  1.00 25.34 ? 228 THR A HG22 2  
ATOM 9546   H HG23 . THR A 1 228 ? 13.506  8.525   -2.885  1.00 34.22 ? 228 THR A HG23 2  
ATOM 9547   N N    . SER A 1 229 ? 13.069  5.817   -2.831  1.00 23.31 ? 229 SER A N    2  
ATOM 9548   C CA   . SER A 1 229 ? 14.203  5.034   -2.355  1.00 44.10 ? 229 SER A CA   2  
ATOM 9549   C C    . SER A 1 229 ? 15.523  5.655   -2.802  1.00 1.53  ? 229 SER A C    2  
ATOM 9550   O O    . SER A 1 229 ? 15.570  6.398   -3.783  1.00 73.33 ? 229 SER A O    2  
ATOM 9551   C CB   . SER A 1 229 ? 14.105  3.594   -2.863  1.00 0.01  ? 229 SER A CB   2  
ATOM 9552   O OG   . SER A 1 229 ? 14.097  3.553   -4.280  1.00 24.10 ? 229 SER A OG   2  
ATOM 9553   H H    . SER A 1 229 ? 13.007  6.037   -3.784  1.00 41.45 ? 229 SER A H    2  
ATOM 9554   H HA   . SER A 1 229 ? 14.170  5.027   -1.276  1.00 42.34 ? 229 SER A HA   2  
ATOM 9555   H HB2  . SER A 1 229 ? 14.953  3.029   -2.505  1.00 65.34 ? 229 SER A HB2  2  
ATOM 9556   H HB3  . SER A 1 229 ? 13.193  3.147   -2.496  1.00 23.40 ? 229 SER A HB3  2  
ATOM 9557   H HG   . SER A 1 229 ? 13.472  2.887   -4.577  1.00 65.20 ? 229 SER A HG   2  
ATOM 9558   N N    . ILE A 1 230 ? 16.593  5.342   -2.078  1.00 31.14 ? 230 ILE A N    2  
ATOM 9559   C CA   . ILE A 1 230 ? 17.914  5.867   -2.401  1.00 51.11 ? 230 ILE A CA   2  
ATOM 9560   C C    . ILE A 1 230 ? 18.414  5.320   -3.734  1.00 1.12  ? 230 ILE A C    2  
ATOM 9561   O O    . ILE A 1 230 ? 19.225  5.952   -4.410  1.00 63.43 ? 230 ILE A O    2  
ATOM 9562   C CB   . ILE A 1 230 ? 18.940  5.525   -1.301  1.00 75.53 ? 230 ILE A CB   2  
ATOM 9563   C CG1  . ILE A 1 230 ? 18.408  5.941   0.072   1.00 24.30 ? 230 ILE A CG1  2  
ATOM 9564   C CG2  . ILE A 1 230 ? 20.271  6.204   -1.586  1.00 32.32 ? 230 ILE A CG2  2  
ATOM 9565   C CD1  . ILE A 1 230 ? 19.343  5.602   1.212   1.00 73.40 ? 230 ILE A CD1  2  
ATOM 9566   H H    . ILE A 1 230 ? 16.491  4.743   -1.309  1.00 13.05 ? 230 ILE A H    2  
ATOM 9567   H HA   . ILE A 1 230 ? 17.838  6.943   -2.470  1.00 23.25 ? 230 ILE A HA   2  
ATOM 9568   H HB   . ILE A 1 230 ? 19.099  4.458   -1.308  1.00 42.23 ? 230 ILE A HB   2  
ATOM 9569   H HG12 . ILE A 1 230 ? 18.250  7.009   0.081   1.00 12.20 ? 230 ILE A HG12 2  
ATOM 9570   H HG13 . ILE A 1 230 ? 17.468  5.442   0.254   1.00 72.41 ? 230 ILE A HG13 2  
ATOM 9571   H HG21 . ILE A 1 230 ? 20.107  7.072   -2.207  1.00 71.54 ? 230 ILE A HG21 2  
ATOM 9572   H HG22 . ILE A 1 230 ? 20.924  5.513   -2.100  1.00 45.45 ? 230 ILE A HG22 2  
ATOM 9573   H HG23 . ILE A 1 230 ? 20.728  6.507   -0.655  1.00 52.11 ? 230 ILE A HG23 2  
ATOM 9574   H HD11 . ILE A 1 230 ? 19.686  4.583   1.104   1.00 25.01 ? 230 ILE A HD11 2  
ATOM 9575   H HD12 . ILE A 1 230 ? 18.821  5.709   2.150   1.00 70.54 ? 230 ILE A HD12 2  
ATOM 9576   H HD13 . ILE A 1 230 ? 20.192  6.271   1.193   1.00 22.40 ? 230 ILE A HD13 2  
ATOM 9577   N N    . ASP A 1 231 ? 17.923  4.141   -4.108  1.00 10.42 ? 231 ASP A N    2  
ATOM 9578   C CA   . ASP A 1 231 ? 18.319  3.512   -5.363  1.00 64.13 ? 231 ASP A CA   2  
ATOM 9579   C C    . ASP A 1 231 ? 17.997  4.416   -6.549  1.00 53.24 ? 231 ASP A C    2  
ATOM 9580   O O    . ASP A 1 231 ? 18.812  4.580   -7.455  1.00 70.43 ? 231 ASP A O    2  
ATOM 9581   C CB   . ASP A 1 231 ? 17.615  2.163   -5.523  1.00 63.24 ? 231 ASP A CB   2  
ATOM 9582   C CG   . ASP A 1 231 ? 18.522  0.993   -5.196  1.00 52.12 ? 231 ASP A CG   2  
ATOM 9583   O OD1  . ASP A 1 231 ? 19.569  1.216   -4.552  1.00 63.23 ? 231 ASP A OD1  2  
ATOM 9584   O OD2  . ASP A 1 231 ? 18.186  -0.146  -5.581  1.00 70.11 ? 231 ASP A OD2  2  
ATOM 9585   H H    . ASP A 1 231 ? 17.278  3.686   -3.528  1.00 23.04 ? 231 ASP A H    2  
ATOM 9586   H HA   . ASP A 1 231 ? 19.386  3.349   -5.329  1.00 50.01 ? 231 ASP A HA   2  
ATOM 9587   H HB2  . ASP A 1 231 ? 16.763  2.128   -4.862  1.00 22.14 ? 231 ASP A HB2  2  
ATOM 9588   H HB3  . ASP A 1 231 ? 17.277  2.058   -6.544  1.00 25.24 ? 231 ASP A HB3  2  
ATOM 9589   N N    . ALA A 1 232 ? 16.805  5.005   -6.530  1.00 20.23 ? 232 ALA A N    2  
ATOM 9590   C CA   . ALA A 1 232 ? 16.379  5.897   -7.601  1.00 35.32 ? 232 ALA A CA   2  
ATOM 9591   C C    . ALA A 1 232 ? 17.102  7.236   -7.511  1.00 3.41  ? 232 ALA A C    2  
ATOM 9592   O O    . ALA A 1 232 ? 17.334  7.898   -8.522  1.00 54.41 ? 232 ALA A O    2  
ATOM 9593   C CB   . ALA A 1 232 ? 14.872  6.103   -7.548  1.00 34.35 ? 232 ALA A CB   2  
ATOM 9594   H H    . ALA A 1 232 ? 16.201  4.839   -5.778  1.00 22.14 ? 232 ALA A H    2  
ATOM 9595   H HA   . ALA A 1 232 ? 16.623  5.429   -8.543  1.00 1.43  ? 232 ALA A HA   2  
ATOM 9596   H HB1  . ALA A 1 232 ? 14.494  6.254   -8.549  1.00 40.03 ? 232 ALA A HB1  2  
ATOM 9597   H HB2  . ALA A 1 232 ? 14.648  6.968   -6.943  1.00 23.41 ? 232 ALA A HB2  2  
ATOM 9598   H HB3  . ALA A 1 232 ? 14.406  5.230   -7.115  1.00 2.21  ? 232 ALA A HB3  2  
ATOM 9599   N N    . HIS A 1 233 ? 17.458  7.626   -6.291  1.00 54.33 ? 233 HIS A N    2  
ATOM 9600   C CA   . HIS A 1 233 ? 18.160  8.884   -6.065  1.00 13.34 ? 233 HIS A CA   2  
ATOM 9601   C C    . HIS A 1 233 ? 19.514  8.881   -6.767  1.00 41.33 ? 233 HIS A C    2  
ATOM 9602   O O    . HIS A 1 233 ? 20.010  9.928   -7.187  1.00 42.33 ? 233 HIS A O    2  
ATOM 9603   C CB   . HIS A 1 233 ? 18.348  9.126   -4.567  1.00 53.15 ? 233 HIS A CB   2  
ATOM 9604   C CG   . HIS A 1 233 ? 17.241  9.918   -3.944  1.00 10.44 ? 233 HIS A CG   2  
ATOM 9605   N ND1  . HIS A 1 233 ? 16.316  9.370   -3.081  1.00 60.23 ? 233 HIS A ND1  2  
ATOM 9606   C CD2  . HIS A 1 233 ? 16.911  11.227  -4.064  1.00 24.45 ? 233 HIS A CD2  2  
ATOM 9607   C CE1  . HIS A 1 233 ? 15.465  10.305  -2.697  1.00 44.41 ? 233 HIS A CE1  2  
ATOM 9608   N NE2  . HIS A 1 233 ? 15.805  11.441  -3.279  1.00 12.13 ? 233 HIS A NE2  2  
ATOM 9609   H H    . HIS A 1 233 ? 17.247  7.051   -5.526  1.00 35.03 ? 233 HIS A H    2  
ATOM 9610   H HA   . HIS A 1 233 ? 17.556  9.680   -6.477  1.00 0.43  ? 233 HIS A HA   2  
ATOM 9611   H HB2  . HIS A 1 233 ? 18.401  8.175   -4.060  1.00 43.13 ? 233 HIS A HB2  2  
ATOM 9612   H HB3  . HIS A 1 233 ? 19.272  9.664   -4.409  1.00 64.42 ? 233 HIS A HB3  2  
ATOM 9613   H HD1  . HIS A 1 233 ? 16.286  8.434   -2.792  1.00 0.43  ? 233 HIS A HD1  2  
ATOM 9614   H HD2  . HIS A 1 233 ? 17.424  11.964  -4.666  1.00 53.04 ? 233 HIS A HD2  2  
ATOM 9615   H HE1  . HIS A 1 233 ? 14.635  10.165  -2.021  1.00 13.01 ? 233 HIS A HE1  2  
ATOM 9616   H HE2  . HIS A 1 233 ? 15.394  12.312  -3.099  1.00 37.47 ? 233 HIS A HE2  2  
ATOM 9617   N N    . ASN A 1 234 ? 20.107  7.698   -6.891  1.00 12.53 ? 234 ASN A N    2  
ATOM 9618   C CA   . ASN A 1 234 ? 21.404  7.556   -7.543  1.00 30.33 ? 234 ASN A CA   2  
ATOM 9619   C C    . ASN A 1 234 ? 21.245  7.344   -9.047  1.00 74.32 ? 234 ASN A C    2  
ATOM 9620   O O    . ASN A 1 234 ? 22.177  7.577   -9.818  1.00 54.20 ? 234 ASN A O    2  
ATOM 9621   C CB   . ASN A 1 234 ? 22.179  6.387   -6.933  1.00 32.23 ? 234 ASN A CB   2  
ATOM 9622   C CG   . ASN A 1 234 ? 22.778  6.732   -5.584  1.00 34.01 ? 234 ASN A CG   2  
ATOM 9623   O OD1  . ASN A 1 234 ? 23.976  6.991   -5.471  1.00 50.44 ? 234 ASN A OD1  2  
ATOM 9624   N ND2  . ASN A 1 234 ? 21.944  6.736   -4.550  1.00 1.41  ? 234 ASN A ND2  2  
ATOM 9625   H H    . ASN A 1 234 ? 19.661  6.901   -6.537  1.00 2.24  ? 234 ASN A H    2  
ATOM 9626   H HA   . ASN A 1 234 ? 21.958  8.467   -7.378  1.00 74.21 ? 234 ASN A HA   2  
ATOM 9627   H HB2  . ASN A 1 234 ? 21.511  5.548   -6.805  1.00 2.51  ? 234 ASN A HB2  2  
ATOM 9628   H HB3  . ASN A 1 234 ? 22.980  6.106   -7.601  1.00 24.31 ? 234 ASN A HB3  2  
ATOM 9629   H HD21 . ASN A 1 234 ? 21.003  6.521   -4.714  1.00 72.22 ? 234 ASN A HD21 2  
ATOM 9630   H HD22 . ASN A 1 234 ? 22.304  6.956   -3.666  1.00 23.41 ? 234 ASN A HD22 2  
ATOM 9631   N N    . GLY A 1 235 ? 20.064  6.893   -9.458  1.00 75.00 ? 235 GLY A N    2  
ATOM 9632   C CA   . GLY A 1 235 ? 19.810  6.647   -10.866 1.00 44.40 ? 235 GLY A CA   2  
ATOM 9633   C C    . GLY A 1 235 ? 19.774  5.168   -11.194 1.00 62.25 ? 235 GLY A C    2  
ATOM 9634   O O    . GLY A 1 235 ? 20.040  4.767   -12.327 1.00 54.24 ? 235 GLY A O    2  
ATOM 9635   H H    . GLY A 1 235 ? 19.361  6.712   -8.800  1.00 74.33 ? 235 GLY A H    2  
ATOM 9636   H HA2  . GLY A 1 235 ? 18.861  7.089   -11.133 1.00 12.30 ? 235 GLY A HA2  2  
ATOM 9637   H HA3  . GLY A 1 235 ? 20.591  7.116   -11.448 1.00 25.02 ? 235 GLY A HA3  2  
ATOM 9638   N N    . VAL A 1 236 ? 19.436  4.357   -10.197 1.00 20.33 ? 236 VAL A N    2  
ATOM 9639   C CA   . VAL A 1 236 ? 19.353  2.913   -10.369 1.00 72.30 ? 236 VAL A CA   2  
ATOM 9640   C C    . VAL A 1 236 ? 18.046  2.381   -9.789  1.00 40.10 ? 236 VAL A C    2  
ATOM 9641   O O    . VAL A 1 236 ? 17.551  2.896   -8.787  1.00 0.42  ? 236 VAL A O    2  
ATOM 9642   C CB   . VAL A 1 236 ? 20.541  2.200   -9.691  1.00 21.32 ? 236 VAL A CB   2  
ATOM 9643   C CG1  . VAL A 1 236 ? 20.539  2.459   -8.192  1.00 24.32 ? 236 VAL A CG1  2  
ATOM 9644   C CG2  . VAL A 1 236 ? 20.512  0.706   -9.981  1.00 21.03 ? 236 VAL A CG2  2  
ATOM 9645   H H    . VAL A 1 236 ? 19.231  4.744   -9.319  1.00 41.20 ? 236 VAL A H    2  
ATOM 9646   H HA   . VAL A 1 236 ? 19.383  2.698   -11.428 1.00 22.24 ? 236 VAL A HA   2  
ATOM 9647   H HB   . VAL A 1 236 ? 21.456  2.605   -10.099 1.00 42.22 ? 236 VAL A HB   2  
ATOM 9648   H HG11 . VAL A 1 236 ? 21.238  1.792   -7.709  1.00 61.35 ? 236 VAL A HG11 2  
ATOM 9649   H HG12 . VAL A 1 236 ? 19.548  2.287   -7.798  1.00 14.45 ? 236 VAL A HG12 2  
ATOM 9650   H HG13 . VAL A 1 236 ? 20.828  3.482   -8.002  1.00 45.33 ? 236 VAL A HG13 2  
ATOM 9651   H HG21 . VAL A 1 236 ? 19.499  0.344   -9.905  1.00 62.23 ? 236 VAL A HG21 2  
ATOM 9652   H HG22 . VAL A 1 236 ? 21.133  0.189   -9.266  1.00 52.03 ? 236 VAL A HG22 2  
ATOM 9653   H HG23 . VAL A 1 236 ? 20.885  0.527   -10.977 1.00 64.42 ? 236 VAL A HG23 2  
ATOM 9654   N N    . ALA A 1 237 ? 17.482  1.353   -10.420 1.00 31.43 ? 237 ALA A N    2  
ATOM 9655   C CA   . ALA A 1 237 ? 16.227  0.767   -9.957  1.00 31.23 ? 237 ALA A CA   2  
ATOM 9656   C C    . ALA A 1 237 ? 16.261  0.478   -8.458  1.00 61.30 ? 237 ALA A C    2  
ATOM 9657   O O    . ALA A 1 237 ? 17.328  0.260   -7.883  1.00 3.15  ? 237 ALA A O    2  
ATOM 9658   C CB   . ALA A 1 237 ? 15.924  -0.506  -10.734 1.00 55.34 ? 237 ALA A CB   2  
ATOM 9659   H H    . ALA A 1 237 ? 17.911  0.977   -11.219 1.00 30.55 ? 237 ALA A H    2  
ATOM 9660   H HA   . ALA A 1 237 ? 15.436  1.476   -10.157 1.00 10.21 ? 237 ALA A HA   2  
ATOM 9661   H HB1  . ALA A 1 237 ? 15.549  -0.249  -11.713 1.00 14.34 ? 237 ALA A HB1  2  
ATOM 9662   H HB2  . ALA A 1 237 ? 15.181  -1.083  -10.203 1.00 2.03  ? 237 ALA A HB2  2  
ATOM 9663   H HB3  . ALA A 1 237 ? 16.828  -1.088  -10.834 1.00 41.34 ? 237 ALA A HB3  2  
ATOM 9664   N N    . PRO A 1 238 ? 15.087  0.474   -7.803  1.00 24.44 ? 238 PRO A N    2  
ATOM 9665   C CA   . PRO A 1 238 ? 14.983  0.212   -6.363  1.00 3.35  ? 238 PRO A CA   2  
ATOM 9666   C C    . PRO A 1 238 ? 15.639  -1.104  -5.964  1.00 30.14 ? 238 PRO A C    2  
ATOM 9667   O O    . PRO A 1 238 ? 16.337  -1.731  -6.762  1.00 5.12  ? 238 PRO A O    2  
ATOM 9668   C CB   . PRO A 1 238 ? 13.473  0.151   -6.117  1.00 40.25 ? 238 PRO A CB   2  
ATOM 9669   C CG   . PRO A 1 238 ? 12.872  0.940   -7.228  1.00 63.34 ? 238 PRO A CG   2  
ATOM 9670   C CD   . PRO A 1 238 ? 13.769  0.727   -8.416  1.00 30.12 ? 238 PRO A CD   2  
ATOM 9671   H HA   . PRO A 1 238 ? 15.412  1.016   -5.784  1.00 71.22 ? 238 PRO A HA   2  
ATOM 9672   H HB2  . PRO A 1 238 ? 13.144  -0.877  -6.138  1.00 53.24 ? 238 PRO A HB2  2  
ATOM 9673   H HB3  . PRO A 1 238 ? 13.244  0.588   -5.157  1.00 31.35 ? 238 PRO A HB3  2  
ATOM 9674   H HG2  . PRO A 1 238 ? 11.877  0.577   -7.441  1.00 1.43  ? 238 PRO A HG2  2  
ATOM 9675   H HG3  . PRO A 1 238 ? 12.842  1.986   -6.963  1.00 42.32 ? 238 PRO A HG3  2  
ATOM 9676   H HD2  . PRO A 1 238 ? 13.440  -0.126  -8.990  1.00 54.45 ? 238 PRO A HD2  2  
ATOM 9677   H HD3  . PRO A 1 238 ? 13.795  1.613   -9.033  1.00 55.24 ? 238 PRO A HD3  2  
ATOM 9678   N N    . SER A 1 239 ? 15.408  -1.519  -4.722  1.00 62.11 ? 239 SER A N    2  
ATOM 9679   C CA   . SER A 1 239 ? 15.975  -2.762  -4.213  1.00 51.32 ? 239 SER A CA   2  
ATOM 9680   C C    . SER A 1 239 ? 15.216  -3.240  -2.979  1.00 72.11 ? 239 SER A C    2  
ATOM 9681   O O    . SER A 1 239 ? 14.237  -2.620  -2.563  1.00 61.51 ? 239 SER A O    2  
ATOM 9682   C CB   . SER A 1 239 ? 17.455  -2.572  -3.873  1.00 5.30  ? 239 SER A CB   2  
ATOM 9683   O OG   . SER A 1 239 ? 18.256  -2.614  -5.041  1.00 13.34 ? 239 SER A OG   2  
ATOM 9684   H H    . SER A 1 239 ? 14.843  -0.977  -4.135  1.00 54.13 ? 239 SER A H    2  
ATOM 9685   H HA   . SER A 1 239 ? 15.887  -3.510  -4.987  1.00 20.32 ? 239 SER A HA   2  
ATOM 9686   H HB2  . SER A 1 239 ? 17.591  -1.614  -3.393  1.00 21.14 ? 239 SER A HB2  2  
ATOM 9687   H HB3  . SER A 1 239 ? 17.773  -3.358  -3.203  1.00 52.12 ? 239 SER A HB3  2  
ATOM 9688   H HG   . SER A 1 239 ? 18.075  -1.842  -5.582  1.00 3.32  ? 239 SER A HG   2  
ATOM 9689   N N    . ARG A 1 240 ? 15.672  -4.345  -2.398  1.00 32.02 ? 240 ARG A N    2  
ATOM 9690   C CA   . ARG A 1 240 ? 15.034  -4.905  -1.212  1.00 0.31  ? 240 ARG A CA   2  
ATOM 9691   C C    . ARG A 1 240 ? 15.043  -3.900  -0.063  1.00 23.20 ? 240 ARG A C    2  
ATOM 9692   O O    . ARG A 1 240 ? 14.041  -3.725  0.629   1.00 40.32 ? 240 ARG A O    2  
ATOM 9693   C CB   . ARG A 1 240 ? 15.743  -6.191  -0.786  1.00 43.32 ? 240 ARG A CB   2  
ATOM 9694   C CG   . ARG A 1 240 ? 15.587  -7.329  -1.781  1.00 44.43 ? 240 ARG A CG   2  
ATOM 9695   C CD   . ARG A 1 240 ? 16.788  -7.426  -2.708  1.00 72.23 ? 240 ARG A CD   2  
ATOM 9696   N NE   . ARG A 1 240 ? 17.134  -8.813  -3.012  1.00 62.44 ? 240 ARG A NE   2  
ATOM 9697   C CZ   . ARG A 1 240 ? 17.974  -9.172  -3.981  1.00 52.52 ? 240 ARG A CZ   2  
ATOM 9698   N NH1  . ARG A 1 240 ? 18.555  -8.251  -4.740  1.00 2.14  ? 240 ARG A NH1  2  
ATOM 9699   N NH2  . ARG A 1 240 ? 18.233  -10.455 -4.191  1.00 3.03  ? 240 ARG A NH2  2  
ATOM 9700   H H    . ARG A 1 240 ? 16.456  -4.794  -2.776  1.00 35.24 ? 240 ARG A H    2  
ATOM 9701   H HA   . ARG A 1 240 ? 14.010  -5.135  -1.464  1.00 1.51  ? 240 ARG A HA   2  
ATOM 9702   H HB2  . ARG A 1 240 ? 16.796  -5.986  -0.668  1.00 3.03  ? 240 ARG A HB2  2  
ATOM 9703   H HB3  . ARG A 1 240 ? 15.340  -6.513  0.163   1.00 22.44 ? 240 ARG A HB3  2  
ATOM 9704   H HG2  . ARG A 1 240 ? 15.489  -8.258  -1.238  1.00 10.22 ? 240 ARG A HG2  2  
ATOM 9705   H HG3  . ARG A 1 240 ? 14.700  -7.159  -2.372  1.00 43.13 ? 240 ARG A HG3  2  
ATOM 9706   H HD2  . ARG A 1 240 ? 16.558  -6.912  -3.629  1.00 53.25 ? 240 ARG A HD2  2  
ATOM 9707   H HD3  . ARG A 1 240 ? 17.633  -6.950  -2.232  1.00 25.32 ? 240 ARG A HD3  2  
ATOM 9708   H HE   . ARG A 1 240 ? 16.719  -9.513  -2.466  1.00 13.43 ? 240 ARG A HE   2  
ATOM 9709   H HH11 . ARG A 1 240 ? 18.364  -7.282  -4.587  1.00 14.25 ? 240 ARG A HH11 2  
ATOM 9710   H HH12 . ARG A 1 240 ? 19.185  -8.528  -5.467  1.00 14.24 ? 240 ARG A HH12 2  
ATOM 9711   H HH21 . ARG A 1 240 ? 17.799  -11.153 -3.622  1.00 41.14 ? 240 ARG A HH21 2  
ATOM 9712   H HH22 . ARG A 1 240 ? 18.864  -10.726 -4.918  1.00 33.30 ? 240 ARG A HH22 2  
ATOM 9713   N N    . ARG A 1 241 ? 16.182  -3.244  0.134   1.00 20.44 ? 241 ARG A N    2  
ATOM 9714   C CA   . ARG A 1 241 ? 16.321  -2.257  1.198   1.00 42.42 ? 241 ARG A CA   2  
ATOM 9715   C C    . ARG A 1 241 ? 15.331  -1.109  1.016   1.00 71.12 ? 241 ARG A C    2  
ATOM 9716   O O    . ARG A 1 241 ? 14.957  -0.442  1.982   1.00 62.33 ? 241 ARG A O    2  
ATOM 9717   C CB   . ARG A 1 241 ? 17.749  -1.709  1.230   1.00 72.30 ? 241 ARG A CB   2  
ATOM 9718   C CG   . ARG A 1 241 ? 18.779  -2.720  1.710   1.00 4.14  ? 241 ARG A CG   2  
ATOM 9719   C CD   . ARG A 1 241 ? 20.176  -2.122  1.734   1.00 11.11 ? 241 ARG A CD   2  
ATOM 9720   N NE   . ARG A 1 241 ? 20.881  -2.327  0.471   1.00 13.53 ? 241 ARG A NE   2  
ATOM 9721   C CZ   . ARG A 1 241 ? 21.966  -1.646  0.108   1.00 3.41  ? 241 ARG A CZ   2  
ATOM 9722   N NH1  . ARG A 1 241 ? 22.474  -0.719  0.909   1.00 40.51 ? 241 ARG A NH1  2  
ATOM 9723   N NH2  . ARG A 1 241 ? 22.545  -1.895  -1.058  1.00 62.54 ? 241 ARG A NH2  2  
ATOM 9724   H H    . ARG A 1 241 ? 16.946  -3.428  -0.452  1.00 53.03 ? 241 ARG A H    2  
ATOM 9725   H HA   . ARG A 1 241 ? 16.115  -2.750  2.136   1.00 51.20 ? 241 ARG A HA   2  
ATOM 9726   H HB2  . ARG A 1 241 ? 18.024  -1.395  0.233   1.00 43.43 ? 241 ARG A HB2  2  
ATOM 9727   H HB3  . ARG A 1 241 ? 17.781  -0.855  1.889   1.00 54.24 ? 241 ARG A HB3  2  
ATOM 9728   H HG2  . ARG A 1 241 ? 18.517  -3.039  2.708   1.00 44.41 ? 241 ARG A HG2  2  
ATOM 9729   H HG3  . ARG A 1 241 ? 18.771  -3.570  1.045   1.00 14.14 ? 241 ARG A HG3  2  
ATOM 9730   H HD2  . ARG A 1 241 ? 20.097  -1.062  1.922   1.00 72.21 ? 241 ARG A HD2  2  
ATOM 9731   H HD3  . ARG A 1 241 ? 20.739  -2.588  2.529   1.00 41.25 ? 241 ARG A HD3  2  
ATOM 9732   H HE   . ARG A 1 241 ? 20.527  -3.007  -0.140  1.00 12.45 ? 241 ARG A HE   2  
ATOM 9733   H HH11 . ARG A 1 241 ? 22.043  -0.526  1.791   1.00 23.33 ? 241 ARG A HH11 2  
ATOM 9734   H HH12 . ARG A 1 241 ? 23.290  -0.212  0.632   1.00 71.34 ? 241 ARG A HH12 2  
ATOM 9735   H HH21 . ARG A 1 241 ? 22.167  -2.593  -1.665  1.00 35.12 ? 241 ARG A HH21 2  
ATOM 9736   H HH22 . ARG A 1 241 ? 23.361  -1.384  -1.331  1.00 53.11 ? 241 ARG A HH22 2  
ATOM 9737   N N    . GLY A 1 242 ? 14.912  -0.884  -0.224  1.00 40.24 ? 242 GLY A N    2  
ATOM 9738   C CA   . GLY A 1 242 ? 13.973  0.186   -0.508  1.00 11.32 ? 242 GLY A CA   2  
ATOM 9739   C C    . GLY A 1 242 ? 12.686  0.061   0.286   1.00 63.22 ? 242 GLY A C    2  
ATOM 9740   O O    . GLY A 1 242 ? 12.235  1.025   0.905   1.00 1.53  ? 242 GLY A O    2  
ATOM 9741   H H    . GLY A 1 242 ? 15.245  -1.445  -0.955  1.00 21.45 ? 242 GLY A H    2  
ATOM 9742   H HA2  . GLY A 1 242 ? 14.438  1.131   -0.270  1.00 55.23 ? 242 GLY A HA2  2  
ATOM 9743   H HA3  . GLY A 1 242 ? 13.734  0.170   -1.562  1.00 55.55 ? 242 GLY A HA3  2  
ATOM 9744   N N    . ASP A 1 243 ? 12.090  -1.127  0.265   1.00 15.01 ? 243 ASP A N    2  
ATOM 9745   C CA   . ASP A 1 243 ? 10.847  -1.371  0.987   1.00 65.03 ? 243 ASP A CA   2  
ATOM 9746   C C    . ASP A 1 243 ? 11.035  -1.170  2.488   1.00 30.35 ? 243 ASP A C    2  
ATOM 9747   O O    . ASP A 1 243 ? 10.107  -0.775  3.192   1.00 11.32 ? 243 ASP A O    2  
ATOM 9748   C CB   . ASP A 1 243 ? 10.340  -2.787  0.710   1.00 32.12 ? 243 ASP A CB   2  
ATOM 9749   C CG   . ASP A 1 243 ? 11.342  -3.851  1.112   1.00 41.45 ? 243 ASP A CG   2  
ATOM 9750   O OD1  . ASP A 1 243 ? 11.712  -3.896  2.305   1.00 52.23 ? 243 ASP A OD1  2  
ATOM 9751   O OD2  . ASP A 1 243 ? 11.758  -4.638  0.237   1.00 5.31  ? 243 ASP A OD2  2  
ATOM 9752   H H    . ASP A 1 243 ? 12.497  -1.857  -0.247  1.00 52.22 ? 243 ASP A H    2  
ATOM 9753   H HA   . ASP A 1 243 ? 10.114  -0.661  0.631   1.00 71.20 ? 243 ASP A HA   2  
ATOM 9754   H HB2  . ASP A 1 243 ? 9.427   -2.951  1.263   1.00 23.14 ? 243 ASP A HB2  2  
ATOM 9755   H HB3  . ASP A 1 243 ? 10.137  -2.890  -0.347  1.00 35.14 ? 243 ASP A HB3  2  
ATOM 9756   N N    . LEU A 1 244 ? 12.243  -1.446  2.970   1.00 33.32 ? 244 LEU A N    2  
ATOM 9757   C CA   . LEU A 1 244 ? 12.550  -1.296  4.387   1.00 22.31 ? 244 LEU A CA   2  
ATOM 9758   C C    . LEU A 1 244 ? 12.854  0.159   4.728   1.00 24.35 ? 244 LEU A C    2  
ATOM 9759   O O    . LEU A 1 244 ? 12.402  0.676   5.750   1.00 65.43 ? 244 LEU A O    2  
ATOM 9760   C CB   . LEU A 1 244 ? 13.738  -2.181  4.769   1.00 31.44 ? 244 LEU A CB   2  
ATOM 9761   C CG   . LEU A 1 244 ? 13.388  -3.638  5.075   1.00 12.52 ? 244 LEU A CG   2  
ATOM 9762   C CD1  . LEU A 1 244 ? 14.647  -4.490  5.121   1.00 4.25  ? 244 LEU A CD1  2  
ATOM 9763   C CD2  . LEU A 1 244 ? 12.626  -3.737  6.388   1.00 53.53 ? 244 LEU A CD2  2  
ATOM 9764   H H    . LEU A 1 244 ? 12.942  -1.758  2.359   1.00 1.43  ? 244 LEU A H    2  
ATOM 9765   H HA   . LEU A 1 244 ? 11.683  -1.610  4.949   1.00 63.42 ? 244 LEU A HA   2  
ATOM 9766   H HB2  . LEU A 1 244 ? 14.447  -2.165  3.954   1.00 63.20 ? 244 LEU A HB2  2  
ATOM 9767   H HB3  . LEU A 1 244 ? 14.209  -1.756  5.643   1.00 25.25 ? 244 LEU A HB3  2  
ATOM 9768   H HG   . LEU A 1 244 ? 12.755  -4.022  4.289   1.00 74.33 ? 244 LEU A HG   2  
ATOM 9769   H HD11 . LEU A 1 244 ? 15.492  -3.871  5.388   1.00 11.43 ? 244 LEU A HD11 2  
ATOM 9770   H HD12 . LEU A 1 244 ? 14.817  -4.932  4.150   1.00 33.32 ? 244 LEU A HD12 2  
ATOM 9771   H HD13 . LEU A 1 244 ? 14.526  -5.271  5.857   1.00 21.21 ? 244 LEU A HD13 2  
ATOM 9772   H HD21 . LEU A 1 244 ? 12.882  -4.662  6.884   1.00 44.51 ? 244 LEU A HD21 2  
ATOM 9773   H HD22 . LEU A 1 244 ? 11.564  -3.718  6.191   1.00 25.23 ? 244 LEU A HD22 2  
ATOM 9774   H HD23 . LEU A 1 244 ? 12.890  -2.904  7.021   1.00 34.22 ? 244 LEU A HD23 2  
ATOM 9775   N N    . GLU A 1 245 ? 13.623  0.816   3.865   1.00 42.22 ? 245 GLU A N    2  
ATOM 9776   C CA   . GLU A 1 245 ? 13.989  2.213   4.075   1.00 53.42 ? 245 GLU A CA   2  
ATOM 9777   C C    . GLU A 1 245 ? 12.747  3.095   4.167   1.00 22.43 ? 245 GLU A C    2  
ATOM 9778   O O    . GLU A 1 245 ? 12.678  4.000   4.997   1.00 74.24 ? 245 GLU A O    2  
ATOM 9779   C CB   . GLU A 1 245 ? 14.893  2.699   2.940   1.00 3.34  ? 245 GLU A CB   2  
ATOM 9780   C CG   . GLU A 1 245 ? 16.330  2.220   3.058   1.00 41.54 ? 245 GLU A CG   2  
ATOM 9781   C CD   . GLU A 1 245 ? 17.332  3.265   2.609   1.00 35.44 ? 245 GLU A CD   2  
ATOM 9782   O OE1  . GLU A 1 245 ? 17.379  4.349   3.229   1.00 71.21 ? 245 GLU A OE1  2  
ATOM 9783   O OE2  . GLU A 1 245 ? 18.071  2.999   1.637   1.00 71.25 ? 245 GLU A OE2  2  
ATOM 9784   H H    . GLU A 1 245 ? 13.952  0.350   3.069   1.00 52.31 ? 245 GLU A H    2  
ATOM 9785   H HA   . GLU A 1 245 ? 14.531  2.277   5.006   1.00 45.31 ? 245 GLU A HA   2  
ATOM 9786   H HB2  . GLU A 1 245 ? 14.493  2.347   2.000   1.00 40.12 ? 245 GLU A HB2  2  
ATOM 9787   H HB3  . GLU A 1 245 ? 14.896  3.780   2.936   1.00 22.31 ? 245 GLU A HB3  2  
ATOM 9788   H HG2  . GLU A 1 245 ? 16.529  1.973   4.090   1.00 75.34 ? 245 GLU A HG2  2  
ATOM 9789   H HG3  . GLU A 1 245 ? 16.452  1.338   2.447   1.00 32.55 ? 245 GLU A HG3  2  
ATOM 9790   N N    . ILE A 1 246 ? 11.770  2.825   3.306   1.00 34.25 ? 246 ILE A N    2  
ATOM 9791   C CA   . ILE A 1 246 ? 10.533  3.595   3.291   1.00 4.33  ? 246 ILE A CA   2  
ATOM 9792   C C    . ILE A 1 246 ? 9.753   3.406   4.588   1.00 2.04  ? 246 ILE A C    2  
ATOM 9793   O O    . ILE A 1 246 ? 9.447   4.372   5.287   1.00 53.41 ? 246 ILE A O    2  
ATOM 9794   C CB   . ILE A 1 246 ? 9.640   3.198   2.098   1.00 30.41 ? 246 ILE A CB   2  
ATOM 9795   C CG1  . ILE A 1 246 ? 10.436  3.268   0.794   1.00 60.13 ? 246 ILE A CG1  2  
ATOM 9796   C CG2  . ILE A 1 246 ? 8.416   4.100   2.027   1.00 11.45 ? 246 ILE A CG2  2  
ATOM 9797   C CD1  . ILE A 1 246 ? 10.036  2.216   -0.217  1.00 33.53 ? 246 ILE A CD1  2  
ATOM 9798   H H    . ILE A 1 246 ? 11.885  2.091   2.668   1.00 42.24 ? 246 ILE A H    2  
ATOM 9799   H HA   . ILE A 1 246 ? 10.792  4.639   3.188   1.00 23.24 ? 246 ILE A HA   2  
ATOM 9800   H HB   . ILE A 1 246 ? 9.302   2.184   2.252   1.00 11.45 ? 246 ILE A HB   2  
ATOM 9801   H HG12 . ILE A 1 246 ? 10.286  4.236   0.340   1.00 74.13 ? 246 ILE A HG12 2  
ATOM 9802   H HG13 . ILE A 1 246 ? 11.486  3.138   1.013   1.00 21.22 ? 246 ILE A HG13 2  
ATOM 9803   H HG21 . ILE A 1 246 ? 7.592   3.631   2.545   1.00 70.23 ? 246 ILE A HG21 2  
ATOM 9804   H HG22 . ILE A 1 246 ? 8.147   4.260   0.993   1.00 11.44 ? 246 ILE A HG22 2  
ATOM 9805   H HG23 . ILE A 1 246 ? 8.640   5.049   2.491   1.00 51.33 ? 246 ILE A HG23 2  
ATOM 9806   H HD11 . ILE A 1 246 ? 9.760   1.308   0.299   1.00 65.32 ? 246 ILE A HD11 2  
ATOM 9807   H HD12 . ILE A 1 246 ? 10.868  2.015   -0.877  1.00 44.34 ? 246 ILE A HD12 2  
ATOM 9808   H HD13 . ILE A 1 246 ? 9.196   2.572   -0.794  1.00 14.34 ? 246 ILE A HD13 2  
ATOM 9809   N N    . LEU A 1 247 ? 9.435   2.153   4.906   1.00 65.41 ? 247 LEU A N    2  
ATOM 9810   C CA   . LEU A 1 247 ? 8.692   1.836   6.123   1.00 54.43 ? 247 LEU A CA   2  
ATOM 9811   C C    . LEU A 1 247 ? 9.353   2.470   7.344   1.00 43.21 ? 247 LEU A C    2  
ATOM 9812   O O    . LEU A 1 247 ? 8.673   2.960   8.247   1.00 53.22 ? 247 LEU A O    2  
ATOM 9813   C CB   . LEU A 1 247 ? 8.601   0.320   6.308   1.00 52.21 ? 247 LEU A CB   2  
ATOM 9814   C CG   . LEU A 1 247 ? 7.409   -0.160  7.138   1.00 33.23 ? 247 LEU A CG   2  
ATOM 9815   C CD1  . LEU A 1 247 ? 7.002   -1.565  6.720   1.00 5.40  ? 247 LEU A CD1  2  
ATOM 9816   C CD2  . LEU A 1 247 ? 7.741   -0.118  8.621   1.00 34.40 ? 247 LEU A CD2  2  
ATOM 9817   H H    . LEU A 1 247 ? 9.708   1.426   4.309   1.00 24.22 ? 247 LEU A H    2  
ATOM 9818   H HA   . LEU A 1 247 ? 7.697   2.237   6.018   1.00 43.52 ? 247 LEU A HA   2  
ATOM 9819   H HB2  . LEU A 1 247 ? 8.543   -0.138  5.331   1.00 63.14 ? 247 LEU A HB2  2  
ATOM 9820   H HB3  . LEU A 1 247 ? 9.505   -0.017  6.792   1.00 13.31 ? 247 LEU A HB3  2  
ATOM 9821   H HG   . LEU A 1 247 ? 6.569   0.496   6.963   1.00 23.22 ? 247 LEU A HG   2  
ATOM 9822   H HD11 . LEU A 1 247 ? 7.328   -1.749  5.708   1.00 21.21 ? 247 LEU A HD11 2  
ATOM 9823   H HD12 . LEU A 1 247 ? 5.927   -1.659  6.775   1.00 70.40 ? 247 LEU A HD12 2  
ATOM 9824   H HD13 . LEU A 1 247 ? 7.459   -2.285  7.383   1.00 13.34 ? 247 LEU A HD13 2  
ATOM 9825   H HD21 . LEU A 1 247 ? 7.416   0.825   9.036   1.00 62.44 ? 247 LEU A HD21 2  
ATOM 9826   H HD22 . LEU A 1 247 ? 8.808   -0.222  8.755   1.00 12.21 ? 247 LEU A HD22 2  
ATOM 9827   H HD23 . LEU A 1 247 ? 7.235   -0.928  9.127   1.00 32.44 ? 247 LEU A HD23 2  
ATOM 9828   N N    . GLY A 1 248 ? 10.682  2.459   7.363   1.00 11.31 ? 248 GLY A N    2  
ATOM 9829   C CA   . GLY A 1 248 ? 11.417  3.037   8.475   1.00 23.51 ? 248 GLY A CA   2  
ATOM 9830   C C    . GLY A 1 248 ? 11.058  4.491   8.713   1.00 42.23 ? 248 GLY A C    2  
ATOM 9831   O O    . GLY A 1 248 ? 10.566  4.847   9.784   1.00 23.25 ? 248 GLY A O    2  
ATOM 9832   H H    . GLY A 1 248 ? 11.166  2.054   6.614   1.00 74.11 ? 248 GLY A H    2  
ATOM 9833   H HA2  . GLY A 1 248 ? 11.198  2.472   9.369   1.00 33.44 ? 248 GLY A HA2  2  
ATOM 9834   H HA3  . GLY A 1 248 ? 12.474  2.968   8.267   1.00 41.14 ? 248 GLY A HA3  2  
ATOM 9835   N N    . TYR A 1 249 ? 11.305  5.333   7.715   1.00 31.33 ? 249 TYR A N    2  
ATOM 9836   C CA   . TYR A 1 249 ? 11.004  6.757   7.822   1.00 2.45  ? 249 TYR A CA   2  
ATOM 9837   C C    . TYR A 1 249 ? 9.526   6.981   8.123   1.00 34.34 ? 249 TYR A C    2  
ATOM 9838   O O    . TYR A 1 249 ? 9.164   7.900   8.858   1.00 34.32 ? 249 TYR A O    2  
ATOM 9839   C CB   . TYR A 1 249 ? 11.389  7.479   6.531   1.00 52.21 ? 249 TYR A CB   2  
ATOM 9840   C CG   . TYR A 1 249 ? 12.859  7.372   6.191   1.00 32.05 ? 249 TYR A CG   2  
ATOM 9841   C CD1  . TYR A 1 249 ? 13.825  7.940   7.014   1.00 22.03 ? 249 TYR A CD1  2  
ATOM 9842   C CD2  . TYR A 1 249 ? 13.281  6.704   5.049   1.00 41.22 ? 249 TYR A CD2  2  
ATOM 9843   C CE1  . TYR A 1 249 ? 15.168  7.844   6.707   1.00 23.04 ? 249 TYR A CE1  2  
ATOM 9844   C CE2  . TYR A 1 249 ? 14.623  6.603   4.736   1.00 60.50 ? 249 TYR A CE2  2  
ATOM 9845   C CZ   . TYR A 1 249 ? 15.562  7.174   5.567   1.00 2.14  ? 249 TYR A CZ   2  
ATOM 9846   O OH   . TYR A 1 249 ? 16.900  7.077   5.260   1.00 32.33 ? 249 TYR A OH   2  
ATOM 9847   H H    . TYR A 1 249 ? 11.699  4.990   6.886   1.00 63.12 ? 249 TYR A H    2  
ATOM 9848   H HA   . TYR A 1 249 ? 11.589  7.157   8.636   1.00 22.12 ? 249 TYR A HA   2  
ATOM 9849   H HB2  . TYR A 1 249 ? 10.828  7.058   5.710   1.00 3.01  ? 249 TYR A HB2  2  
ATOM 9850   H HB3  . TYR A 1 249 ? 11.145  8.527   6.626   1.00 71.44 ? 249 TYR A HB3  2  
ATOM 9851   H HD1  . TYR A 1 249 ? 13.513  8.462   7.906   1.00 45.43 ? 249 TYR A HD1  2  
ATOM 9852   H HD2  . TYR A 1 249 ? 12.543  6.257   4.400   1.00 14.42 ? 249 TYR A HD2  2  
ATOM 9853   H HE1  . TYR A 1 249 ? 15.904  8.291   7.359   1.00 2.12  ? 249 TYR A HE1  2  
ATOM 9854   H HE2  . TYR A 1 249 ? 14.932  6.079   3.844   1.00 12.41 ? 249 TYR A HE2  2  
ATOM 9855   H HH   . TYR A 1 249 ? 17.041  7.361   4.353   1.00 41.51 ? 249 TYR A HH   2  
ATOM 9856   N N    . CYS A 1 250 ? 8.675   6.135   7.551   1.00 2.11  ? 250 CYS A N    2  
ATOM 9857   C CA   . CYS A 1 250 ? 7.235   6.240   7.760   1.00 2.31  ? 250 CYS A CA   2  
ATOM 9858   C C    . CYS A 1 250 ? 6.888   6.101   9.239   1.00 64.50 ? 250 CYS A C    2  
ATOM 9859   O O    . CYS A 1 250 ? 5.904   6.669   9.713   1.00 63.41 ? 250 CYS A O    2  
ATOM 9860   C CB   . CYS A 1 250 ? 6.501   5.169   6.949   1.00 34.54 ? 250 CYS A CB   2  
ATOM 9861   S SG   . CYS A 1 250 ? 4.991   5.758   6.148   1.00 45.12 ? 250 CYS A SG   2  
ATOM 9862   H H    . CYS A 1 250 ? 9.023   5.421   6.977   1.00 31.10 ? 250 CYS A H    2  
ATOM 9863   H HA   . CYS A 1 250 ? 6.921   7.215   7.419   1.00 44.10 ? 250 CYS A HA   2  
ATOM 9864   H HB2  . CYS A 1 250 ? 7.159   4.800   6.177   1.00 13.40 ? 250 CYS A HB2  2  
ATOM 9865   H HB3  . CYS A 1 250 ? 6.230   4.354   7.603   1.00 61.11 ? 250 CYS A HB3  2  
ATOM 9866   H HG   . CYS A 1 250 ? 4.705   5.085   5.526   1.00 22.55 ? 250 CYS A HG   2  
ATOM 9867   N N    . MET A 1 251 ? 7.708   5.348   9.966   1.00 71.45 ? 251 MET A N    2  
ATOM 9868   C CA   . MET A 1 251 ? 7.490   5.138   11.392  1.00 32.24 ? 251 MET A CA   2  
ATOM 9869   C C    . MET A 1 251 ? 7.821   6.402   12.179  1.00 11.52 ? 251 MET A C    2  
ATOM 9870   O O    . MET A 1 251 ? 7.033   6.851   13.011  1.00 41.33 ? 251 MET A O    2  
ATOM 9871   C CB   . MET A 1 251 ? 8.340   3.970   11.896  1.00 51.11 ? 251 MET A CB   2  
ATOM 9872   C CG   . MET A 1 251 ? 7.644   2.623   11.796  1.00 74.52 ? 251 MET A CG   2  
ATOM 9873   S SD   . MET A 1 251 ? 8.804   1.254   11.626  1.00 71.20 ? 251 MET A SD   2  
ATOM 9874   C CE   . MET A 1 251 ? 9.003   0.764   13.337  1.00 60.50 ? 251 MET A CE   2  
ATOM 9875   H H    . MET A 1 251 ? 8.477   4.925   9.530   1.00 15.13 ? 251 MET A H    2  
ATOM 9876   H HA   . MET A 1 251 ? 6.447   4.901   11.536  1.00 4.50  ? 251 MET A HA   2  
ATOM 9877   H HB2  . MET A 1 251 ? 9.250   3.925   11.317  1.00 63.44 ? 251 MET A HB2  2  
ATOM 9878   H HB3  . MET A 1 251 ? 8.593   4.145   12.932  1.00 53.31 ? 251 MET A HB3  2  
ATOM 9879   H HG2  . MET A 1 251 ? 7.056   2.470   12.689  1.00 42.53 ? 251 MET A HG2  2  
ATOM 9880   H HG3  . MET A 1 251 ? 6.992   2.634   10.936  1.00 21.55 ? 251 MET A HG3  2  
ATOM 9881   H HE1  . MET A 1 251 ? 9.875   1.248   13.751  1.00 41.41 ? 251 MET A HE1  2  
ATOM 9882   H HE2  . MET A 1 251 ? 9.126   -0.308  13.393  1.00 62.50 ? 251 MET A HE2  2  
ATOM 9883   H HE3  . MET A 1 251 ? 8.129   1.055   13.900  1.00 60.52 ? 251 MET A HE3  2  
ATOM 9884   N N    . ILE A 1 252 ? 8.990   6.972   11.907  1.00 43.52 ? 252 ILE A N    2  
ATOM 9885   C CA   . ILE A 1 252 ? 9.425   8.186   12.587  1.00 55.44 ? 252 ILE A CA   2  
ATOM 9886   C C    . ILE A 1 252 ? 8.472   9.344   12.306  1.00 45.13 ? 252 ILE A C    2  
ATOM 9887   O O    . ILE A 1 252 ? 8.332   10.257  13.120  1.00 23.14 ? 252 ILE A O    2  
ATOM 9888   C CB   . ILE A 1 252 ? 10.849  8.592   12.159  1.00 34.44 ? 252 ILE A CB   2  
ATOM 9889   C CG1  . ILE A 1 252 ? 11.805  7.403   12.290  1.00 2.53  ? 252 ILE A CG1  2  
ATOM 9890   C CG2  . ILE A 1 252 ? 11.339  9.766   12.993  1.00 62.42 ? 252 ILE A CG2  2  
ATOM 9891   C CD1  . ILE A 1 252 ? 12.773  7.278   11.134  1.00 1.12  ? 252 ILE A CD1  2  
ATOM 9892   H H    . ILE A 1 252 ? 9.574   6.567   11.232  1.00 40.03 ? 252 ILE A H    2  
ATOM 9893   H HA   . ILE A 1 252 ? 9.432   7.989   13.649  1.00 43.42 ? 252 ILE A HA   2  
ATOM 9894   H HB   . ILE A 1 252 ? 10.815  8.906   11.127  1.00 25.45 ? 252 ILE A HB   2  
ATOM 9895   H HG12 . ILE A 1 252 ? 12.384  7.512   13.194  1.00 3.12  ? 252 ILE A HG12 2  
ATOM 9896   H HG13 . ILE A 1 252 ? 11.230  6.491   12.342  1.00 63.44 ? 252 ILE A HG13 2  
ATOM 9897   H HG21 . ILE A 1 252 ? 10.946  10.686  12.587  1.00 4.02  ? 252 ILE A HG21 2  
ATOM 9898   H HG22 . ILE A 1 252 ? 12.419  9.797   12.972  1.00 3.32  ? 252 ILE A HG22 2  
ATOM 9899   H HG23 . ILE A 1 252 ? 11.003  9.650   14.013  1.00 74.05 ? 252 ILE A HG23 2  
ATOM 9900   H HD11 . ILE A 1 252 ? 13.762  7.566   11.459  1.00 12.30 ? 252 ILE A HD11 2  
ATOM 9901   H HD12 . ILE A 1 252 ? 12.457  7.924   10.327  1.00 44.04 ? 252 ILE A HD12 2  
ATOM 9902   H HD13 . ILE A 1 252 ? 12.792  6.255   10.788  1.00 53.23 ? 252 ILE A HD13 2  
ATOM 9903   N N    . GLN A 1 253 ? 7.819   9.301   11.150  1.00 24.41 ? 253 GLN A N    2  
ATOM 9904   C CA   . GLN A 1 253 ? 6.879   10.346  10.764  1.00 2.42  ? 253 GLN A CA   2  
ATOM 9905   C C    . GLN A 1 253 ? 5.672   10.363  11.695  1.00 13.21 ? 253 GLN A C    2  
ATOM 9906   O O    . GLN A 1 253 ? 5.285   11.413  12.207  1.00 21.31 ? 253 GLN A O    2  
ATOM 9907   C CB   . GLN A 1 253 ? 6.421   10.141  9.319   1.00 42.12 ? 253 GLN A CB   2  
ATOM 9908   C CG   . GLN A 1 253 ? 5.776   11.372  8.704   1.00 2.34  ? 253 GLN A CG   2  
ATOM 9909   C CD   . GLN A 1 253 ? 4.729   11.024  7.663   1.00 61.23 ? 253 GLN A CD   2  
ATOM 9910   O OE1  . GLN A 1 253 ? 3.737   10.361  7.963   1.00 75.21 ? 253 GLN A OE1  2  
ATOM 9911   N NE2  . GLN A 1 253 ? 4.947   11.471  6.432   1.00 64.51 ? 253 GLN A NE2  2  
ATOM 9912   H H    . GLN A 1 253 ? 7.972   8.547   10.542  1.00 50.24 ? 253 GLN A H    2  
ATOM 9913   H HA   . GLN A 1 253 ? 7.389   11.295  10.838  1.00 11.41 ? 253 GLN A HA   2  
ATOM 9914   H HB2  . GLN A 1 253 ? 7.276   9.870   8.716   1.00 62.32 ? 253 GLN A HB2  2  
ATOM 9915   H HB3  . GLN A 1 253 ? 5.703   9.335   9.292   1.00 72.02 ? 253 GLN A HB3  2  
ATOM 9916   H HG2  . GLN A 1 253 ? 5.305   11.946  9.488   1.00 31.32 ? 253 GLN A HG2  2  
ATOM 9917   H HG3  . GLN A 1 253 ? 6.545   11.969  8.235   1.00 10.23 ? 253 GLN A HG3  2  
ATOM 9918   H HE21 . GLN A 1 253 ? 5.760   11.993  6.266   1.00 54.23 ? 253 GLN A HE21 2  
ATOM 9919   H HE22 . GLN A 1 253 ? 4.286   11.261  5.739   1.00 11.10 ? 253 GLN A HE22 2  
ATOM 9920   N N    . TRP A 1 254 ? 5.080   9.192   11.909  1.00 52.34 ? 254 TRP A N    2  
ATOM 9921   C CA   . TRP A 1 254 ? 3.916   9.073   12.779  1.00 13.24 ? 254 TRP A CA   2  
ATOM 9922   C C    . TRP A 1 254 ? 4.331   9.060   14.248  1.00 34.43 ? 254 TRP A C    2  
ATOM 9923   O O    . TRP A 1 254 ? 3.649   9.628   15.101  1.00 34.13 ? 254 TRP A O    2  
ATOM 9924   C CB   . TRP A 1 254 ? 3.135   7.800   12.449  1.00 64.24 ? 254 TRP A CB   2  
ATOM 9925   C CG   . TRP A 1 254 ? 2.797   7.671   10.994  1.00 33.31 ? 254 TRP A CG   2  
ATOM 9926   C CD1  . TRP A 1 254 ? 2.420   8.674   10.148  1.00 62.10 ? 254 TRP A CD1  2  
ATOM 9927   C CD2  . TRP A 1 254 ? 2.805   6.470   10.214  1.00 24.14 ? 254 TRP A CD2  2  
ATOM 9928   N NE1  . TRP A 1 254 ? 2.193   8.170   8.890   1.00 20.24 ? 254 TRP A NE1  2  
ATOM 9929   C CE2  . TRP A 1 254 ? 2.423   6.818   8.906   1.00 70.51 ? 254 TRP A CE2  2  
ATOM 9930   C CE3  . TRP A 1 254 ? 3.098   5.132   10.497  1.00 24.43 ? 254 TRP A CE3  2  
ATOM 9931   C CZ2  . TRP A 1 254 ? 2.327   5.879   7.882   1.00 0.14  ? 254 TRP A CZ2  2  
ATOM 9932   C CZ3  . TRP A 1 254 ? 3.003   4.201   9.480   1.00 53.54 ? 254 TRP A CZ3  2  
ATOM 9933   C CH2  . TRP A 1 254 ? 2.622   4.578   8.186   1.00 60.44 ? 254 TRP A CH2  2  
ATOM 9934   H H    . TRP A 1 254 ? 5.435   8.390   11.471  1.00 75.24 ? 254 TRP A H    2  
ATOM 9935   H HA   . TRP A 1 254 ? 3.282   9.929   12.605  1.00 24.22 ? 254 TRP A HA   2  
ATOM 9936   H HB2  . TRP A 1 254 ? 3.722   6.940   12.731  1.00 45.12 ? 254 TRP A HB2  2  
ATOM 9937   H HB3  . TRP A 1 254 ? 2.210   7.798   13.008  1.00 61.22 ? 254 TRP A HB3  2  
ATOM 9938   H HD1  . TRP A 1 254 ? 2.318   9.709   10.439  1.00 42.00 ? 254 TRP A HD1  2  
ATOM 9939   H HE1  . TRP A 1 254 ? 1.914   8.691   8.109   1.00 50.32 ? 254 TRP A HE1  2  
ATOM 9940   H HE3  . TRP A 1 254 ? 3.395   4.823   11.488  1.00 63.31 ? 254 TRP A HE3  2  
ATOM 9941   H HZ2  . TRP A 1 254 ? 2.035   6.154   6.879   1.00 51.31 ? 254 TRP A HZ2  2  
ATOM 9942   H HZ3  . TRP A 1 254 ? 3.226   3.162   9.679   1.00 31.33 ? 254 TRP A HZ3  2  
ATOM 9943   H HH2  . TRP A 1 254 ? 2.559   3.816   7.424   1.00 13.23 ? 254 TRP A HH2  2  
ATOM 9944   N N    . LEU A 1 255 ? 5.453   8.410   14.535  1.00 52.42 ? 255 LEU A N    2  
ATOM 9945   C CA   . LEU A 1 255 ? 5.959   8.323   15.900  1.00 74.12 ? 255 LEU A CA   2  
ATOM 9946   C C    . LEU A 1 255 ? 6.333   9.702   16.433  1.00 33.45 ? 255 LEU A C    2  
ATOM 9947   O O    . LEU A 1 255 ? 6.019   10.043  17.574  1.00 14.13 ? 255 LEU A O    2  
ATOM 9948   C CB   . LEU A 1 255 ? 7.172   7.393   15.962  1.00 33.02 ? 255 LEU A CB   2  
ATOM 9949   C CG   . LEU A 1 255 ? 7.413   6.731   17.320  1.00 41.03 ? 255 LEU A CG   2  
ATOM 9950   C CD1  . LEU A 1 255 ? 8.683   5.897   17.289  1.00 73.03 ? 255 LEU A CD1  2  
ATOM 9951   C CD2  . LEU A 1 255 ? 7.489   7.781   18.418  1.00 15.34 ? 255 LEU A CD2  2  
ATOM 9952   H H    . LEU A 1 255 ? 5.952   7.977   13.811  1.00 54.33 ? 255 LEU A H    2  
ATOM 9953   H HA   . LEU A 1 255 ? 5.172   7.914   16.518  1.00 53.42 ? 255 LEU A HA   2  
ATOM 9954   H HB2  . LEU A 1 255 ? 7.039   6.615   15.225  1.00 33.33 ? 255 LEU A HB2  2  
ATOM 9955   H HB3  . LEU A 1 255 ? 8.051   7.964   15.705  1.00 11.32 ? 255 LEU A HB3  2  
ATOM 9956   H HG   . LEU A 1 255 ? 6.587   6.072   17.543  1.00 73.02 ? 255 LEU A HG   2  
ATOM 9957   H HD11 . LEU A 1 255 ? 8.549   5.014   17.895  1.00 21.15 ? 255 LEU A HD11 2  
ATOM 9958   H HD12 . LEU A 1 255 ? 9.505   6.480   17.678  1.00 0.42  ? 255 LEU A HD12 2  
ATOM 9959   H HD13 . LEU A 1 255 ? 8.899   5.606   16.271  1.00 5.35  ? 255 LEU A HD13 2  
ATOM 9960   H HD21 . LEU A 1 255 ? 8.047   7.387   19.254  1.00 70.25 ? 255 LEU A HD21 2  
ATOM 9961   H HD22 . LEU A 1 255 ? 6.490   8.037   18.741  1.00 1.33  ? 255 LEU A HD22 2  
ATOM 9962   H HD23 . LEU A 1 255 ? 7.982   8.663   18.039  1.00 53.03 ? 255 LEU A HD23 2  
ATOM 9963   N N    . THR A 1 256 ? 7.006   10.492  15.603  1.00 3.45  ? 256 THR A N    2  
ATOM 9964   C CA   . THR A 1 256 ? 7.423   11.833  15.996  1.00 63.42 ? 256 THR A CA   2  
ATOM 9965   C C    . THR A 1 256 ? 6.372   12.867  15.603  1.00 20.40 ? 256 THR A C    2  
ATOM 9966   O O    . THR A 1 256 ? 6.135   13.832  16.330  1.00 20.22 ? 256 THR A O    2  
ATOM 9967   C CB   . THR A 1 256 ? 8.764   12.182  15.350  1.00 73.35 ? 256 THR A CB   2  
ATOM 9968   O OG1  . THR A 1 256 ? 9.747   11.218  15.683  1.00 23.31 ? 256 THR A OG1  2  
ATOM 9969   C CG2  . THR A 1 256 ? 9.293   13.539  15.763  1.00 11.20 ? 256 THR A CG2  2  
ATOM 9970   H H    . THR A 1 256 ? 7.228   10.164  14.706  1.00 14.11 ? 256 THR A H    2  
ATOM 9971   H HA   . THR A 1 256 ? 7.536   11.843  17.069  1.00 72.11 ? 256 THR A HA   2  
ATOM 9972   H HB   . THR A 1 256 ? 8.645   12.188  14.275  1.00 55.13 ? 256 THR A HB   2  
ATOM 9973   H HG1  . THR A 1 256 ? 9.960   11.286  16.617  1.00 52.40 ? 256 THR A HG1  2  
ATOM 9974   H HG21 . THR A 1 256 ? 9.061   14.264  14.998  1.00 21.24 ? 256 THR A HG21 2  
ATOM 9975   H HG22 . THR A 1 256 ? 10.363  13.483  15.895  1.00 4.05  ? 256 THR A HG22 2  
ATOM 9976   H HG23 . THR A 1 256 ? 8.830   13.837  16.694  1.00 34.11 ? 256 THR A HG23 2  
ATOM 9977   N N    . GLY A 1 257 ? 5.744   12.659  14.450  1.00 60.13 ? 257 GLY A N    2  
ATOM 9978   C CA   . GLY A 1 257 ? 4.726   13.583  13.983  1.00 21.00 ? 257 GLY A CA   2  
ATOM 9979   C C    . GLY A 1 257 ? 5.018   14.117  12.595  1.00 22.11 ? 257 GLY A C    2  
ATOM 9980   O O    . GLY A 1 257 ? 4.131   14.170  11.743  1.00 4.31  ? 257 GLY A O    2  
ATOM 9981   H H    . GLY A 1 257 ? 5.975   11.874  13.910  1.00 11.10 ? 257 GLY A H    2  
ATOM 9982   H HA2  . GLY A 1 257 ? 3.774   13.073  13.968  1.00 1.43  ? 257 GLY A HA2  2  
ATOM 9983   H HA3  . GLY A 1 257 ? 4.666   14.413  14.671  1.00 14.53 ? 257 GLY A HA3  2  
ATOM 9984   N N    . HIS A 1 258 ? 6.265   14.514  12.366  1.00 3.34  ? 258 HIS A N    2  
ATOM 9985   C CA   . HIS A 1 258 ? 6.672   15.048  11.070  1.00 42.04 ? 258 HIS A CA   2  
ATOM 9986   C C    . HIS A 1 258 ? 8.089   14.605  10.718  1.00 4.52  ? 258 HIS A C    2  
ATOM 9987   O O    . HIS A 1 258 ? 8.732   13.886  11.481  1.00 10.12 ? 258 HIS A O    2  
ATOM 9988   C CB   . HIS A 1 258 ? 6.587   16.576  11.076  1.00 54.50 ? 258 HIS A CB   2  
ATOM 9989   C CG   . HIS A 1 258 ? 6.014   17.148  9.817   1.00 22.24 ? 258 HIS A CG   2  
ATOM 9990   N ND1  . HIS A 1 258 ? 4.758   16.826  9.348   1.00 41.32 ? 258 HIS A ND1  2  
ATOM 9991   C CD2  . HIS A 1 258 ? 6.532   18.029  8.927   1.00 0.32  ? 258 HIS A CD2  2  
ATOM 9992   C CE1  . HIS A 1 258 ? 4.529   17.483  8.224   1.00 32.21 ? 258 HIS A CE1  2  
ATOM 9993   N NE2  . HIS A 1 258 ? 5.589   18.219  7.948   1.00 61.15 ? 258 HIS A NE2  2  
ATOM 9994   H H    . HIS A 1 258 ? 6.929   14.447  13.084  1.00 32.01 ? 258 HIS A H    2  
ATOM 9995   H HA   . HIS A 1 258 ? 5.992   14.662  10.326  1.00 32.51 ? 258 HIS A HA   2  
ATOM 9996   H HB2  . HIS A 1 258 ? 5.963   16.892  11.898  1.00 52.44 ? 258 HIS A HB2  2  
ATOM 9997   H HB3  . HIS A 1 258 ? 7.579   16.984  11.207  1.00 21.25 ? 258 HIS A HB3  2  
ATOM 9998   H HD1  . HIS A 1 258 ? 4.129   16.209  9.774   1.00 74.24 ? 258 HIS A HD1  2  
ATOM 9999   H HD2  . HIS A 1 258 ? 7.507   18.493  8.979   1.00 22.21 ? 258 HIS A HD2  2  
ATOM 10000  H HE1  . HIS A 1 258 ? 3.627   17.427  7.632   1.00 22.22 ? 258 HIS A HE1  2  
ATOM 10001  H HE2  . HIS A 1 258 ? 5.716   18.743  7.130   1.00 37.47 ? 258 HIS A HE2  2  
ATOM 10002  N N    . LEU A 1 259 ? 8.567   15.040  9.557   1.00 1.23  ? 259 LEU A N    2  
ATOM 10003  C CA   . LEU A 1 259 ? 9.908   14.689  9.102   1.00 31.21 ? 259 LEU A CA   2  
ATOM 10004  C C    . LEU A 1 259 ? 10.753  15.942  8.883   1.00 1.12  ? 259 LEU A C    2  
ATOM 10005  O O    . LEU A 1 259 ? 10.222  17.021  8.623   1.00 44.01 ? 259 LEU A O    2  
ATOM 10006  C CB   . LEU A 1 259 ? 9.833   13.876  7.808   1.00 50.44 ? 259 LEU A CB   2  
ATOM 10007  C CG   . LEU A 1 259 ? 9.645   12.369  8.000   1.00 61.41 ? 259 LEU A CG   2  
ATOM 10008  C CD1  . LEU A 1 259 ? 8.760   11.797  6.904   1.00 72.11 ? 259 LEU A CD1  2  
ATOM 10009  C CD2  . LEU A 1 259 ? 10.992  11.662  8.023   1.00 1.03  ? 259 LEU A CD2  2  
ATOM 10010  H H    . LEU A 1 259 ? 8.005   15.610  8.992   1.00 70.45 ? 259 LEU A H    2  
ATOM 10011  H HA   . LEU A 1 259 ? 10.369  14.087  9.869   1.00 72.25 ? 259 LEU A HA   2  
ATOM 10012  H HB2  . LEU A 1 259 ? 9.009   14.250  7.219   1.00 25.41 ? 259 LEU A HB2  2  
ATOM 10013  H HB3  . LEU A 1 259 ? 10.748  14.033  7.256   1.00 42.15 ? 259 LEU A HB3  2  
ATOM 10014  H HG   . LEU A 1 259 ? 9.156   12.192  8.948   1.00 72.40 ? 259 LEU A HG   2  
ATOM 10015  H HD11 . LEU A 1 259 ? 9.375   11.465  6.080   1.00 73.44 ? 259 LEU A HD11 2  
ATOM 10016  H HD12 . LEU A 1 259 ? 8.076   12.558  6.558   1.00 32.13 ? 259 LEU A HD12 2  
ATOM 10017  H HD13 . LEU A 1 259 ? 8.199   10.960  7.294   1.00 71.43 ? 259 LEU A HD13 2  
ATOM 10018  H HD21 . LEU A 1 259 ? 10.969  10.869  8.756   1.00 74.53 ? 259 LEU A HD21 2  
ATOM 10019  H HD22 . LEU A 1 259 ? 11.765  12.369  8.282   1.00 53.43 ? 259 LEU A HD22 2  
ATOM 10020  H HD23 . LEU A 1 259 ? 11.196  11.245  7.048   1.00 50.51 ? 259 LEU A HD23 2  
ATOM 10021  N N    . PRO A 1 260 ? 12.088  15.817  8.991   1.00 34.31 ? 260 PRO A N    2  
ATOM 10022  C CA   . PRO A 1 260 ? 13.006  16.947  8.807   1.00 21.12 ? 260 PRO A CA   2  
ATOM 10023  C C    . PRO A 1 260 ? 12.951  17.519  7.394   1.00 1.54  ? 260 PRO A C    2  
ATOM 10024  O O    . PRO A 1 260 ? 13.003  18.734  7.204   1.00 11.53 ? 260 PRO A O    2  
ATOM 10025  C CB   . PRO A 1 260 ? 14.392  16.345  9.081   1.00 74.23 ? 260 PRO A CB   2  
ATOM 10026  C CG   . PRO A 1 260 ? 14.130  15.071  9.809   1.00 12.14 ? 260 PRO A CG   2  
ATOM 10027  C CD   . PRO A 1 260 ? 12.808  14.572  9.303   1.00 54.23 ? 260 PRO A CD   2  
ATOM 10028  H HA   . PRO A 1 260 ? 12.807  17.734  9.518   1.00 54.24 ? 260 PRO A HA   2  
ATOM 10029  H HB2  . PRO A 1 260 ? 14.900  16.166  8.145   1.00 23.53 ? 260 PRO A HB2  2  
ATOM 10030  H HB3  . PRO A 1 260 ? 14.970  17.030  9.684   1.00 65.31 ? 260 PRO A HB3  2  
ATOM 10031  H HG2  . PRO A 1 260 ? 14.909  14.356  9.590   1.00 34.14 ? 260 PRO A HG2  2  
ATOM 10032  H HG3  . PRO A 1 260 ? 14.078  15.257  10.871  1.00 62.52 ? 260 PRO A HG3  2  
ATOM 10033  H HD2  . PRO A 1 260 ? 12.944  13.971  8.417   1.00 31.22 ? 260 PRO A HD2  2  
ATOM 10034  H HD3  . PRO A 1 260 ? 12.296  14.012  10.070  1.00 64.10 ? 260 PRO A HD3  2  
ATOM 10035  N N    . TRP A 1 261 ? 12.852  16.636  6.405   1.00 53.14 ? 261 TRP A N    2  
ATOM 10036  C CA   . TRP A 1 261 ? 12.798  17.056  5.008   1.00 35.25 ? 261 TRP A CA   2  
ATOM 10037  C C    . TRP A 1 261 ? 11.359  17.096  4.498   1.00 40.04 ? 261 TRP A C    2  
ATOM 10038  O O    . TRP A 1 261 ? 11.066  16.622  3.401   1.00 71.14 ? 261 TRP A O    2  
ATOM 10039  C CB   . TRP A 1 261 ? 13.633  16.113  4.140   1.00 65.34 ? 261 TRP A CB   2  
ATOM 10040  C CG   . TRP A 1 261 ? 13.176  14.687  4.199   1.00 20.24 ? 261 TRP A CG   2  
ATOM 10041  C CD1  . TRP A 1 261 ? 12.228  14.097  3.414   1.00 14.14 ? 261 TRP A CD1  2  
ATOM 10042  C CD2  . TRP A 1 261 ? 13.645  13.672  5.094   1.00 61.50 ? 261 TRP A CD2  2  
ATOM 10043  N NE1  . TRP A 1 261 ? 12.079  12.777  3.765   1.00 12.44 ? 261 TRP A NE1  2  
ATOM 10044  C CE2  . TRP A 1 261 ? 12.939  12.492  4.794   1.00 23.13 ? 261 TRP A CE2  2  
ATOM 10045  C CE3  . TRP A 1 261 ? 14.596  13.647  6.119   1.00 0.43  ? 261 TRP A CE3  2  
ATOM 10046  C CZ2  . TRP A 1 261 ? 13.153  11.300  5.482   1.00 62.11 ? 261 TRP A CZ2  2  
ATOM 10047  C CZ3  . TRP A 1 261 ? 14.807  12.463  6.801   1.00 50.35 ? 261 TRP A CZ3  2  
ATOM 10048  C CH2  . TRP A 1 261 ? 14.089  11.304  6.480   1.00 61.21 ? 261 TRP A CH2  2  
ATOM 10049  H H    . TRP A 1 261 ? 12.820  15.680  6.618   1.00 22.33 ? 261 TRP A H    2  
ATOM 10050  H HA   . TRP A 1 261 ? 13.215  18.049  4.945   1.00 5.23  ? 261 TRP A HA   2  
ATOM 10051  H HB2  . TRP A 1 261 ? 13.578  16.437  3.111   1.00 2.54  ? 261 TRP A HB2  2  
ATOM 10052  H HB3  . TRP A 1 261 ? 14.661  16.148  4.469   1.00 52.54 ? 261 TRP A HB3  2  
ATOM 10053  H HD1  . TRP A 1 261 ? 11.681  14.607  2.634   1.00 73.34 ? 261 TRP A HD1  2  
ATOM 10054  H HE1  . TRP A 1 261 ? 11.460  12.143  3.347   1.00 72.02 ? 261 TRP A HE1  2  
ATOM 10055  H HE3  . TRP A 1 261 ? 15.159  14.530  6.380   1.00 44.24 ? 261 TRP A HE3  2  
ATOM 10056  H HZ2  . TRP A 1 261 ? 12.609  10.398  5.246   1.00 54.51 ? 261 TRP A HZ2  2  
ATOM 10057  H HZ3  . TRP A 1 261 ? 15.537  12.424  7.596   1.00 3.04  ? 261 TRP A HZ3  2  
ATOM 10058  H HH2  . TRP A 1 261 ? 14.287  10.402  7.040   1.00 20.43 ? 261 TRP A HH2  2  
ATOM 10059  N N    . GLU A 1 262 ? 10.467  17.669  5.299   1.00 75.40 ? 262 GLU A N    2  
ATOM 10060  C CA   . GLU A 1 262 ? 9.061   17.772  4.923   1.00 15.14 ? 262 GLU A CA   2  
ATOM 10061  C C    . GLU A 1 262 ? 8.757   19.137  4.309   1.00 21.21 ? 262 GLU A C    2  
ATOM 10062  O O    . GLU A 1 262 ? 7.816   19.280  3.529   1.00 51.04 ? 262 GLU A O    2  
ATOM 10063  C CB   . GLU A 1 262 ? 8.165   17.533  6.141   1.00 3.42  ? 262 GLU A CB   2  
ATOM 10064  C CG   . GLU A 1 262 ? 7.437   16.199  6.106   1.00 10.32 ? 262 GLU A CG   2  
ATOM 10065  C CD   . GLU A 1 262 ? 5.957   16.350  5.809   1.00 64.32 ? 262 GLU A CD   2  
ATOM 10066  O OE1  . GLU A 1 262 ? 5.595   17.269  5.046   1.00 25.52 ? 262 GLU A OE1  2  
ATOM 10067  O OE2  . GLU A 1 262 ? 5.160   15.549  6.342   1.00 14.11 ? 262 GLU A OE2  2  
ATOM 10068  H H    . GLU A 1 262 ? 10.759  18.032  6.160   1.00 51.04 ? 262 GLU A H    2  
ATOM 10069  H HA   . GLU A 1 262 ? 8.860   17.008  4.186   1.00 45.30 ? 262 GLU A HA   2  
ATOM 10070  H HB2  . GLU A 1 262 ? 8.774   17.563  7.032   1.00 12.14 ? 262 GLU A HB2  2  
ATOM 10071  H HB3  . GLU A 1 262 ? 7.427   18.321  6.193   1.00 1.13  ? 262 GLU A HB3  2  
ATOM 10072  H HG2  . GLU A 1 262 ? 7.880   15.582  5.340   1.00 72.12 ? 262 GLU A HG2  2  
ATOM 10073  H HG3  . GLU A 1 262 ? 7.549   15.717  7.066   1.00 21.25 ? 262 GLU A HG3  2  
ATOM 10074  N N    . ASP A 1 263 ? 9.557   20.137  4.666   1.00 25.11 ? 263 ASP A N    2  
ATOM 10075  C CA   . ASP A 1 263 ? 9.369   21.487  4.147   1.00 10.22 ? 263 ASP A CA   2  
ATOM 10076  C C    . ASP A 1 263 ? 10.421  21.821  3.095   1.00 54.34 ? 263 ASP A C    2  
ATOM 10077  O O    . ASP A 1 263 ? 10.814  22.978  2.942   1.00 61.12 ? 263 ASP A O    2  
ATOM 10078  C CB   . ASP A 1 263 ? 9.429   22.506  5.287   1.00 35.13 ? 263 ASP A CB   2  
ATOM 10079  C CG   . ASP A 1 263 ? 8.562   23.722  5.023   1.00 23.32 ? 263 ASP A CG   2  
ATOM 10080  O OD1  . ASP A 1 263 ? 8.539   24.194  3.867   1.00 25.11 ? 263 ASP A OD1  2  
ATOM 10081  O OD2  . ASP A 1 263 ? 7.908   24.201  5.972   1.00 53.42 ? 263 ASP A OD2  2  
ATOM 10082  H H    . ASP A 1 263 ? 10.291  19.965  5.292   1.00 31.53 ? 263 ASP A H    2  
ATOM 10083  H HA   . ASP A 1 263 ? 8.392   21.532  3.689   1.00 13.20 ? 263 ASP A HA   2  
ATOM 10084  H HB2  . ASP A 1 263 ? 9.090   22.037  6.200   1.00 62.33 ? 263 ASP A HB2  2  
ATOM 10085  H HB3  . ASP A 1 263 ? 10.450  22.834  5.414   1.00 71.44 ? 263 ASP A HB3  2  
ATOM 10086  N N    . ASN A 1 264 ? 10.873  20.802  2.371   1.00 62.25 ? 264 ASN A N    2  
ATOM 10087  C CA   . ASN A 1 264 ? 11.880  20.991  1.333   1.00 32.42 ? 264 ASN A CA   2  
ATOM 10088  C C    . ASN A 1 264 ? 11.745  19.934  0.242   1.00 44.13 ? 264 ASN A C    2  
ATOM 10089  O O    . ASN A 1 264 ? 12.739  19.475  -0.320  1.00 33.30 ? 264 ASN A O    2  
ATOM 10090  C CB   . ASN A 1 264 ? 13.285  20.940  1.937   1.00 74.52 ? 264 ASN A CB   2  
ATOM 10091  C CG   . ASN A 1 264 ? 14.271  21.809  1.181   1.00 73.42 ? 264 ASN A CG   2  
ATOM 10092  O OD1  . ASN A 1 264 ? 14.592  21.542  0.023   1.00 43.31 ? 264 ASN A OD1  2  
ATOM 10093  N ND2  . ASN A 1 264 ? 14.759  22.858  1.835   1.00 33.24 ? 264 ASN A ND2  2  
ATOM 10094  H H    . ASN A 1 264 ? 10.522  19.903  2.540   1.00 3.23  ? 264 ASN A H    2  
ATOM 10095  H HA   . ASN A 1 264 ? 11.724  21.965  0.893   1.00 53.42 ? 264 ASN A HA   2  
ATOM 10096  H HB2  . ASN A 1 264 ? 13.245  21.283  2.961   1.00 40.20 ? 264 ASN A HB2  2  
ATOM 10097  H HB3  . ASN A 1 264 ? 13.643  19.921  1.917   1.00 72.23 ? 264 ASN A HB3  2  
ATOM 10098  H HD21 . ASN A 1 264 ? 14.460  23.009  2.757   1.00 41.51 ? 264 ASN A HD21 2  
ATOM 10099  H HD22 . ASN A 1 264 ? 15.398  23.437  1.371   1.00 72.14 ? 264 ASN A HD22 2  
ATOM 10100  N N    . LEU A 1 265 ? 10.507  19.552  -0.052  1.00 22.23 ? 265 LEU A N    2  
ATOM 10101  C CA   . LEU A 1 265 ? 10.239  18.548  -1.076  1.00 13.51 ? 265 LEU A CA   2  
ATOM 10102  C C    . LEU A 1 265 ? 10.468  19.119  -2.473  1.00 52.22 ? 265 LEU A C    2  
ATOM 10103  O O    . LEU A 1 265 ? 10.812  18.389  -3.403  1.00 33.20 ? 265 LEU A O    2  
ATOM 10104  C CB   . LEU A 1 265 ? 8.805   18.032  -0.952  1.00 33.11 ? 265 LEU A CB   2  
ATOM 10105  C CG   . LEU A 1 265 ? 8.580   17.004  0.157   1.00 71.13 ? 265 LEU A CG   2  
ATOM 10106  C CD1  . LEU A 1 265 ? 9.535   15.832  -0.001  1.00 71.15 ? 265 LEU A CD1  2  
ATOM 10107  C CD2  . LEU A 1 265 ? 8.746   17.651  1.523   1.00 42.53 ? 265 LEU A CD2  2  
ATOM 10108  H H    . LEU A 1 265 ? 9.755   19.955  0.430   1.00 40.13 ? 265 LEU A H    2  
ATOM 10109  H HA   . LEU A 1 265 ? 10.922  17.726  -0.920  1.00 60.22 ? 265 LEU A HA   2  
ATOM 10110  H HB2  . LEU A 1 265 ? 8.155   18.877  -0.770  1.00 71.51 ? 265 LEU A HB2  2  
ATOM 10111  H HB3  . LEU A 1 265 ? 8.524   17.582  -1.892  1.00 22.31 ? 265 LEU A HB3  2  
ATOM 10112  H HG   . LEU A 1 265 ? 7.571   16.623  0.086   1.00 63.23 ? 265 LEU A HG   2  
ATOM 10113  H HD11 . LEU A 1 265 ? 10.518  16.120  0.344   1.00 71.35 ? 265 LEU A HD11 2  
ATOM 10114  H HD12 . LEU A 1 265 ? 9.588   15.547  -1.041  1.00 50.31 ? 265 LEU A HD12 2  
ATOM 10115  H HD13 . LEU A 1 265 ? 9.180   14.996  0.583   1.00 24.34 ? 265 LEU A HD13 2  
ATOM 10116  H HD21 . LEU A 1 265 ? 8.121   17.142  2.241   1.00 41.13 ? 265 LEU A HD21 2  
ATOM 10117  H HD22 . LEU A 1 265 ? 8.458   18.690  1.467   1.00 4.12  ? 265 LEU A HD22 2  
ATOM 10118  H HD23 . LEU A 1 265 ? 9.779   17.580  1.831   1.00 40.10 ? 265 LEU A HD23 2  
ATOM 10119  N N    . LYS A 1 266 ? 10.274  20.426  -2.613  1.00 2.11  ? 266 LYS A N    2  
ATOM 10120  C CA   . LYS A 1 266 ? 10.458  21.095  -3.897  1.00 23.40 ? 266 LYS A CA   2  
ATOM 10121  C C    . LYS A 1 266 ? 11.883  20.913  -4.413  1.00 1.33  ? 266 LYS A C    2  
ATOM 10122  O O    . LYS A 1 266 ? 12.133  21.014  -5.614  1.00 14.41 ? 266 LYS A O    2  
ATOM 10123  C CB   . LYS A 1 266 ? 10.138  22.585  -3.769  1.00 43.54 ? 266 LYS A CB   2  
ATOM 10124  C CG   . LYS A 1 266 ? 9.495   23.178  -5.011  1.00 34.12 ? 266 LYS A CG   2  
ATOM 10125  C CD   . LYS A 1 266 ? 10.530  23.824  -5.919  1.00 1.23  ? 266 LYS A CD   2  
ATOM 10126  C CE   . LYS A 1 266 ? 10.580  25.330  -5.722  1.00 74.43 ? 266 LYS A CE   2  
ATOM 10127  N NZ   . LYS A 1 266 ? 11.421  25.998  -6.755  1.00 0.33  ? 266 LYS A NZ   2  
ATOM 10128  H H    . LYS A 1 266 ? 10.000  20.956  -1.835  1.00 40.33 ? 266 LYS A H    2  
ATOM 10129  H HA   . LYS A 1 266 ? 9.774   20.649  -4.602  1.00 33.42 ? 266 LYS A HA   2  
ATOM 10130  H HB2  . LYS A 1 266 ? 9.462   22.726  -2.939  1.00 63.42 ? 266 LYS A HB2  2  
ATOM 10131  H HB3  . LYS A 1 266 ? 11.053  23.123  -3.571  1.00 0.31  ? 266 LYS A HB3  2  
ATOM 10132  H HG2  . LYS A 1 266 ? 8.994   22.392  -5.556  1.00 1.44  ? 266 LYS A HG2  2  
ATOM 10133  H HG3  . LYS A 1 266 ? 8.776   23.925  -4.711  1.00 43.34 ? 266 LYS A HG3  2  
ATOM 10134  H HD2  . LYS A 1 266 ? 11.501  23.409  -5.694  1.00 65.13 ? 266 LYS A HD2  2  
ATOM 10135  H HD3  . LYS A 1 266 ? 10.274  23.611  -6.948  1.00 33.03 ? 266 LYS A HD3  2  
ATOM 10136  H HE2  . LYS A 1 266 ? 9.576   25.722  -5.780  1.00 44.20 ? 266 LYS A HE2  2  
ATOM 10137  H HE3  . LYS A 1 266 ? 10.991  25.539  -4.745  1.00 45.44 ? 266 LYS A HE3  2  
ATOM 10138  H HZ1  . LYS A 1 266 ? 11.187  25.628  -7.698  1.00 23.25 ? 266 LYS A HZ1  2  
ATOM 10139  H HZ2  . LYS A 1 266 ? 12.428  25.821  -6.565  1.00 3.13  ? 266 LYS A HZ2  2  
ATOM 10140  H HZ3  . LYS A 1 266 ? 11.252  27.023  -6.743  1.00 74.44 ? 266 LYS A HZ3  2  
ATOM 10141  N N    . ASP A 1 267 ? 12.815  20.647  -3.502  1.00 13.20 ? 267 ASP A N    2  
ATOM 10142  C CA   . ASP A 1 267 ? 14.212  20.454  -3.873  1.00 3.13  ? 267 ASP A CA   2  
ATOM 10143  C C    . ASP A 1 267 ? 14.637  19.000  -3.675  1.00 30.25 ? 267 ASP A C    2  
ATOM 10144  O O    . ASP A 1 267 ? 15.042  18.608  -2.581  1.00 4.12  ? 267 ASP A O    2  
ATOM 10145  C CB   . ASP A 1 267 ? 15.111  21.375  -3.045  1.00 0.10  ? 267 ASP A CB   2  
ATOM 10146  C CG   . ASP A 1 267 ? 16.300  21.886  -3.836  1.00 2.41  ? 267 ASP A CG   2  
ATOM 10147  O OD1  . ASP A 1 267 ? 16.105  22.767  -4.698  1.00 20.50 ? 267 ASP A OD1  2  
ATOM 10148  O OD2  . ASP A 1 267 ? 17.427  21.404  -3.591  1.00 64.22 ? 267 ASP A OD2  2  
ATOM 10149  H H    . ASP A 1 267 ? 12.559  20.580  -2.559  1.00 50.53 ? 267 ASP A H    2  
ATOM 10150  H HA   . ASP A 1 267 ? 14.317  20.710  -4.916  1.00 13.01 ? 267 ASP A HA   2  
ATOM 10151  H HB2  . ASP A 1 267 ? 14.535  22.225  -2.709  1.00 4.04  ? 267 ASP A HB2  2  
ATOM 10152  H HB3  . ASP A 1 267 ? 15.479  20.832  -2.186  1.00 12.20 ? 267 ASP A HB3  2  
ATOM 10153  N N    . PRO A 1 268 ? 14.549  18.177  -4.735  1.00 63.21 ? 268 PRO A N    2  
ATOM 10154  C CA   . PRO A 1 268 ? 14.927  16.761  -4.668  1.00 42.55 ? 268 PRO A CA   2  
ATOM 10155  C C    . PRO A 1 268 ? 16.328  16.562  -4.096  1.00 54.20 ? 268 PRO A C    2  
ATOM 10156  O O    . PRO A 1 268 ? 16.593  15.575  -3.412  1.00 51.32 ? 268 PRO A O    2  
ATOM 10157  C CB   . PRO A 1 268 ? 14.879  16.309  -6.129  1.00 13.23 ? 268 PRO A CB   2  
ATOM 10158  C CG   . PRO A 1 268 ? 13.918  17.239  -6.782  1.00 74.15 ? 268 PRO A CG   2  
ATOM 10159  C CD   . PRO A 1 268 ? 14.076  18.559  -6.079  1.00 54.22 ? 268 PRO A CD   2  
ATOM 10160  H HA   . PRO A 1 268 ? 14.219  16.190  -4.087  1.00 3.45  ? 268 PRO A HA   2  
ATOM 10161  H HB2  . PRO A 1 268 ? 15.864  16.386  -6.565  1.00 45.14 ? 268 PRO A HB2  2  
ATOM 10162  H HB3  . PRO A 1 268 ? 14.534  15.287  -6.181  1.00 54.13 ? 268 PRO A HB3  2  
ATOM 10163  H HG2  . PRO A 1 268 ? 14.159  17.340  -7.830  1.00 31.53 ? 268 PRO A HG2  2  
ATOM 10164  H HG3  . PRO A 1 268 ? 12.910  16.870  -6.663  1.00 34.44 ? 268 PRO A HG3  2  
ATOM 10165  H HD2  . PRO A 1 268 ? 14.808  19.171  -6.586  1.00 3.15  ? 268 PRO A HD2  2  
ATOM 10166  H HD3  . PRO A 1 268 ? 13.128  19.072  -6.022  1.00 12.54 ? 268 PRO A HD3  2  
ATOM 10167  N N    . LYS A 1 269 ? 17.219  17.505  -4.382  1.00 71.23 ? 269 LYS A N    2  
ATOM 10168  C CA   . LYS A 1 269 ? 18.592  17.432  -3.895  1.00 64.23 ? 269 LYS A CA   2  
ATOM 10169  C C    . LYS A 1 269 ? 18.638  17.566  -2.376  1.00 41.53 ? 269 LYS A C    2  
ATOM 10170  O O    . LYS A 1 269 ? 19.419  16.891  -1.707  1.00 60.13 ? 269 LYS A O    2  
ATOM 10171  C CB   . LYS A 1 269 ? 19.443  18.526  -4.542  1.00 1.04  ? 269 LYS A CB   2  
ATOM 10172  C CG   . LYS A 1 269 ? 20.098  18.095  -5.845  1.00 4.01  ? 269 LYS A CG   2  
ATOM 10173  C CD   . LYS A 1 269 ? 20.915  19.221  -6.456  1.00 34.01 ? 269 LYS A CD   2  
ATOM 10174  C CE   . LYS A 1 269 ? 21.971  18.688  -7.411  1.00 31.13 ? 269 LYS A CE   2  
ATOM 10175  N NZ   . LYS A 1 269 ? 21.495  18.686  -8.822  1.00 22.25 ? 269 LYS A NZ   2  
ATOM 10176  H H    . LYS A 1 269 ? 16.948  18.270  -4.933  1.00 51.43 ? 269 LYS A H    2  
ATOM 10177  H HA   . LYS A 1 269 ? 18.989  16.467  -4.171  1.00 71.22 ? 269 LYS A HA   2  
ATOM 10178  H HB2  . LYS A 1 269 ? 18.817  19.382  -4.745  1.00 10.34 ? 269 LYS A HB2  2  
ATOM 10179  H HB3  . LYS A 1 269 ? 20.222  18.815  -3.852  1.00 53.23 ? 269 LYS A HB3  2  
ATOM 10180  H HG2  . LYS A 1 269 ? 20.748  17.256  -5.651  1.00 54.51 ? 269 LYS A HG2  2  
ATOM 10181  H HG3  . LYS A 1 269 ? 19.328  17.801  -6.544  1.00 31.35 ? 269 LYS A HG3  2  
ATOM 10182  H HD2  . LYS A 1 269 ? 20.255  19.880  -6.999  1.00 61.32 ? 269 LYS A HD2  2  
ATOM 10183  H HD3  . LYS A 1 269 ? 21.404  19.769  -5.664  1.00 71.42 ? 269 LYS A HD3  2  
ATOM 10184  H HE2  . LYS A 1 269 ? 22.851  19.309  -7.339  1.00 33.35 ? 269 LYS A HE2  2  
ATOM 10185  H HE3  . LYS A 1 269 ? 22.221  17.677  -7.122  1.00 73.15 ? 269 LYS A HE3  2  
ATOM 10186  H HZ1  . LYS A 1 269 ? 20.477  18.477  -8.855  1.00 31.15 ? 269 LYS A HZ1  2  
ATOM 10187  H HZ2  . LYS A 1 269 ? 22.004  17.963  -9.370  1.00 11.22 ? 269 LYS A HZ2  2  
ATOM 10188  H HZ3  . LYS A 1 269 ? 21.661  19.616  -9.256  1.00 52.10 ? 269 LYS A HZ3  2  
ATOM 10189  N N    . TYR A 1 270 ? 17.797  18.444  -1.840  1.00 24.21 ? 270 TYR A N    2  
ATOM 10190  C CA   . TYR A 1 270 ? 17.741  18.665  -0.399  1.00 34.20 ? 270 TYR A CA   2  
ATOM 10191  C C    . TYR A 1 270 ? 17.262  17.412  0.324   1.00 5.33  ? 270 TYR A C    2  
ATOM 10192  O O    . TYR A 1 270 ? 17.874  16.973  1.299   1.00 24.43 ? 270 TYR A O    2  
ATOM 10193  C CB   . TYR A 1 270 ? 16.814  19.839  -0.078  1.00 42.24 ? 270 TYR A CB   2  
ATOM 10194  C CG   . TYR A 1 270 ? 16.806  20.222  1.385   1.00 22.54 ? 270 TYR A CG   2  
ATOM 10195  C CD1  . TYR A 1 270 ? 16.218  19.396  2.335   1.00 65.24 ? 270 TYR A CD1  2  
ATOM 10196  C CD2  . TYR A 1 270 ? 17.387  21.408  1.815   1.00 40.31 ? 270 TYR A CD2  2  
ATOM 10197  C CE1  . TYR A 1 270 ? 16.208  19.744  3.673   1.00 52.15 ? 270 TYR A CE1  2  
ATOM 10198  C CE2  . TYR A 1 270 ? 17.381  21.762  3.151   1.00 25.23 ? 270 TYR A CE2  2  
ATOM 10199  C CZ   . TYR A 1 270 ? 16.791  20.926  4.076   1.00 70.51 ? 270 TYR A CZ   2  
ATOM 10200  O OH   . TYR A 1 270 ? 16.783  21.275  5.406   1.00 33.31 ? 270 TYR A OH   2  
ATOM 10201  H H    . TYR A 1 270 ? 17.197  18.952  -2.425  1.00 64.21 ? 270 TYR A H    2  
ATOM 10202  H HA   . TYR A 1 270 ? 18.739  18.903  -0.062  1.00 41.20 ? 270 TYR A HA   2  
ATOM 10203  H HB2  . TYR A 1 270 ? 17.129  20.703  -0.644  1.00 10.01 ? 270 TYR A HB2  2  
ATOM 10204  H HB3  . TYR A 1 270 ? 15.805  19.578  -0.359  1.00 42.52 ? 270 TYR A HB3  2  
ATOM 10205  H HD1  . TYR A 1 270 ? 15.762  18.470  2.016   1.00 70.40 ? 270 TYR A HD1  2  
ATOM 10206  H HD2  . TYR A 1 270 ? 17.848  22.061  1.088   1.00 2.20  ? 270 TYR A HD2  2  
ATOM 10207  H HE1  . TYR A 1 270 ? 15.745  19.089  4.397   1.00 14.02 ? 270 TYR A HE1  2  
ATOM 10208  H HE2  . TYR A 1 270 ? 17.837  22.689  3.466   1.00 62.34 ? 270 TYR A HE2  2  
ATOM 10209  H HH   . TYR A 1 270 ? 16.580  22.210  5.492   1.00 30.22 ? 270 TYR A HH   2  
ATOM 10210  N N    . VAL A 1 271 ? 16.166  16.838  -0.160  1.00 14.10 ? 271 VAL A N    2  
ATOM 10211  C CA   . VAL A 1 271 ? 15.604  15.634  0.438   1.00 0.15  ? 271 VAL A CA   2  
ATOM 10212  C C    . VAL A 1 271 ? 16.614  14.490  0.418   1.00 23.53 ? 271 VAL A C    2  
ATOM 10213  O O    . VAL A 1 271 ? 16.720  13.727  1.377   1.00 41.12 ? 271 VAL A O    2  
ATOM 10214  C CB   . VAL A 1 271 ? 14.325  15.186  -0.294  1.00 21.11 ? 271 VAL A CB   2  
ATOM 10215  C CG1  . VAL A 1 271 ? 13.655  14.041  0.449   1.00 1.55  ? 271 VAL A CG1  2  
ATOM 10216  C CG2  . VAL A 1 271 ? 13.369  16.357  -0.461  1.00 43.43 ? 271 VAL A CG2  2  
ATOM 10217  H H    . VAL A 1 271 ? 15.724  17.234  -0.940  1.00 62.03 ? 271 VAL A H    2  
ATOM 10218  H HA   . VAL A 1 271 ? 15.349  15.858  1.463   1.00 41.01 ? 271 VAL A HA   2  
ATOM 10219  H HB   . VAL A 1 271 ? 14.602  14.833  -1.277  1.00 4.02  ? 271 VAL A HB   2  
ATOM 10220  H HG11 . VAL A 1 271 ? 13.317  13.300  -0.260  1.00 33.34 ? 271 VAL A HG11 2  
ATOM 10221  H HG12 . VAL A 1 271 ? 12.810  14.419  1.005   1.00 41.52 ? 271 VAL A HG12 2  
ATOM 10222  H HG13 . VAL A 1 271 ? 14.361  13.590  1.131   1.00 2.32  ? 271 VAL A HG13 2  
ATOM 10223  H HG21 . VAL A 1 271 ? 12.363  15.986  -0.585  1.00 2.11  ? 271 VAL A HG21 2  
ATOM 10224  H HG22 . VAL A 1 271 ? 13.651  16.932  -1.331  1.00 3.14  ? 271 VAL A HG22 2  
ATOM 10225  H HG23 . VAL A 1 271 ? 13.414  16.987  0.416   1.00 12.42 ? 271 VAL A HG23 2  
ATOM 10226  N N    . ARG A 1 272 ? 17.351  14.379  -0.681  1.00 44.25 ? 272 ARG A N    2  
ATOM 10227  C CA   . ARG A 1 272 ? 18.353  13.328  -0.827  1.00 71.14 ? 272 ARG A CA   2  
ATOM 10228  C C    . ARG A 1 272 ? 19.516  13.548  0.134   1.00 53.30 ? 272 ARG A C    2  
ATOM 10229  O O    . ARG A 1 272 ? 19.939  12.626  0.833   1.00 13.21 ? 272 ARG A O    2  
ATOM 10230  C CB   . ARG A 1 272 ? 18.867  13.283  -2.266  1.00 44.24 ? 272 ARG A CB   2  
ATOM 10231  C CG   . ARG A 1 272 ? 19.743  12.077  -2.561  1.00 24.54 ? 272 ARG A CG   2  
ATOM 10232  C CD   . ARG A 1 272 ? 20.461  12.221  -3.894  1.00 3.14  ? 272 ARG A CD   2  
ATOM 10233  N NE   . ARG A 1 272 ? 21.837  12.681  -3.728  1.00 12.44 ? 272 ARG A NE   2  
ATOM 10234  C CZ   . ARG A 1 272 ? 22.755  12.638  -4.691  1.00 21.24 ? 272 ARG A CZ   2  
ATOM 10235  N NH1  . ARG A 1 272 ? 22.447  12.157  -5.890  1.00 3.03  ? 272 ARG A NH1  2  
ATOM 10236  N NH2  . ARG A 1 272 ? 23.984  13.078  -4.457  1.00 14.21 ? 272 ARG A NH2  2  
ATOM 10237  H H    . ARG A 1 272 ? 17.220  15.019  -1.411  1.00 31.25 ? 272 ARG A H    2  
ATOM 10238  H HA   . ARG A 1 272 ? 17.881  12.387  -0.593  1.00 73.01 ? 272 ARG A HA   2  
ATOM 10239  H HB2  . ARG A 1 272 ? 18.022  13.260  -2.939  1.00 44.10 ? 272 ARG A HB2  2  
ATOM 10240  H HB3  . ARG A 1 272 ? 19.444  14.175  -2.459  1.00 52.34 ? 272 ARG A HB3  2  
ATOM 10241  H HG2  . ARG A 1 272 ? 20.479  11.977  -1.778  1.00 52.00 ? 272 ARG A HG2  2  
ATOM 10242  H HG3  . ARG A 1 272 ? 19.124  11.192  -2.590  1.00 55.21 ? 272 ARG A HG3  2  
ATOM 10243  H HD2  . ARG A 1 272 ? 20.471  11.262  -4.390  1.00 63.35 ? 272 ARG A HD2  2  
ATOM 10244  H HD3  . ARG A 1 272 ? 19.923  12.934  -4.502  1.00 31.20 ? 272 ARG A HD3  2  
ATOM 10245  H HE   . ARG A 1 272 ? 22.091  13.042  -2.852  1.00 23.13 ? 272 ARG A HE   2  
ATOM 10246  H HH11 . ARG A 1 272 ? 21.522  11.824  -6.074  1.00 24.40 ? 272 ARG A HH11 2  
ATOM 10247  H HH12 . ARG A 1 272 ? 23.141  12.128  -6.609  1.00 71.01 ? 272 ARG A HH12 2  
ATOM 10248  H HH21 . ARG A 1 272 ? 24.221  13.442  -3.556  1.00 25.03 ? 272 ARG A HH21 2  
ATOM 10249  H HH22 . ARG A 1 272 ? 24.673  13.045  -5.180  1.00 2.42  ? 272 ARG A HH22 2  
ATOM 10250  N N    . ASP A 1 273 ? 20.030  14.773  0.165   1.00 72.02 ? 273 ASP A N    2  
ATOM 10251  C CA   . ASP A 1 273 ? 21.146  15.114  1.041   1.00 54.20 ? 273 ASP A CA   2  
ATOM 10252  C C    . ASP A 1 273 ? 20.790  14.857  2.503   1.00 41.42 ? 273 ASP A C    2  
ATOM 10253  O O    . ASP A 1 273 ? 21.519  14.170  3.218   1.00 0.42  ? 273 ASP A O    2  
ATOM 10254  C CB   . ASP A 1 273 ? 21.542  16.579  0.850   1.00 23.33 ? 273 ASP A CB   2  
ATOM 10255  C CG   . ASP A 1 273 ? 22.607  16.756  -0.214  1.00 12.14 ? 273 ASP A CG   2  
ATOM 10256  O OD1  . ASP A 1 273 ? 22.295  16.552  -1.406  1.00 61.12 ? 273 ASP A OD1  2  
ATOM 10257  O OD2  . ASP A 1 273 ? 23.753  17.098  0.144   1.00 71.33 ? 273 ASP A OD2  2  
ATOM 10258  H H    . ASP A 1 273 ? 19.650  15.465  -0.415  1.00 62.12 ? 273 ASP A H    2  
ATOM 10259  H HA   . ASP A 1 273 ? 21.982  14.486  0.772   1.00 52.34 ? 273 ASP A HA   2  
ATOM 10260  H HB2  . ASP A 1 273 ? 20.671  17.146  0.558   1.00 50.33 ? 273 ASP A HB2  2  
ATOM 10261  H HB3  . ASP A 1 273 ? 21.922  16.967  1.784   1.00 23.14 ? 273 ASP A HB3  2  
ATOM 10262  N N    . SER A 1 274 ? 19.666  15.414  2.938   1.00 55.35 ? 274 SER A N    2  
ATOM 10263  C CA   . SER A 1 274 ? 19.213  15.247  4.315   1.00 42.13 ? 274 SER A CA   2  
ATOM 10264  C C    . SER A 1 274 ? 18.972  13.775  4.635   1.00 43.04 ? 274 SER A C    2  
ATOM 10265  O O    . SER A 1 274 ? 19.125  13.345  5.779   1.00 34.00 ? 274 SER A O    2  
ATOM 10266  C CB   . SER A 1 274 ? 17.934  16.049  4.554   1.00 51.14 ? 274 SER A CB   2  
ATOM 10267  O OG   . SER A 1 274 ? 17.027  15.899  3.475   1.00 52.22 ? 274 SER A OG   2  
ATOM 10268  H H    . SER A 1 274 ? 19.127  15.952  2.321   1.00 1.54  ? 274 SER A H    2  
ATOM 10269  H HA   . SER A 1 274 ? 19.989  15.621  4.966   1.00 61.24 ? 274 SER A HA   2  
ATOM 10270  H HB2  . SER A 1 274 ? 17.456  15.701  5.458   1.00 31.11 ? 274 SER A HB2  2  
ATOM 10271  H HB3  . SER A 1 274 ? 18.181  17.095  4.657   1.00 14.34 ? 274 SER A HB3  2  
ATOM 10272  H HG   . SER A 1 274 ? 17.199  16.575  2.815   1.00 52.33 ? 274 SER A HG   2  
ATOM 10273  N N    . LYS A 1 275 ? 18.592  13.007  3.618   1.00 53.42 ? 275 LYS A N    2  
ATOM 10274  C CA   . LYS A 1 275 ? 18.328  11.583  3.794   1.00 13.05 ? 275 LYS A CA   2  
ATOM 10275  C C    . LYS A 1 275 ? 19.629  10.797  3.916   1.00 71.31 ? 275 LYS A C    2  
ATOM 10276  O O    . LYS A 1 275 ? 19.819  10.034  4.862   1.00 51.21 ? 275 LYS A O    2  
ATOM 10277  C CB   . LYS A 1 275 ? 17.503  11.047  2.623   1.00 4.30  ? 275 LYS A CB   2  
ATOM 10278  C CG   . LYS A 1 275 ? 16.883  9.685   2.889   1.00 74.52 ? 275 LYS A CG   2  
ATOM 10279  C CD   . LYS A 1 275 ? 16.655  8.915   1.598   1.00 41.04 ? 275 LYS A CD   2  
ATOM 10280  C CE   . LYS A 1 275 ? 15.340  8.154   1.629   1.00 73.41 ? 275 LYS A CE   2  
ATOM 10281  N NZ   . LYS A 1 275 ? 15.115  7.381   0.376   1.00 43.14 ? 275 LYS A NZ   2  
ATOM 10282  H H    . LYS A 1 275 ? 18.486  13.406  2.730   1.00 1.21  ? 275 LYS A H    2  
ATOM 10283  H HA   . LYS A 1 275 ? 17.762  11.461  4.706   1.00 44.01 ? 275 LYS A HA   2  
ATOM 10284  H HB2  . LYS A 1 275 ? 16.707  11.745  2.410   1.00 64.25 ? 275 LYS A HB2  2  
ATOM 10285  H HB3  . LYS A 1 275 ? 18.140  10.966  1.756   1.00 63.44 ? 275 LYS A HB3  2  
ATOM 10286  H HG2  . LYS A 1 275 ? 17.547  9.116   3.522   1.00 22.03 ? 275 LYS A HG2  2  
ATOM 10287  H HG3  . LYS A 1 275 ? 15.935  9.823   3.388   1.00 2.12  ? 275 LYS A HG3  2  
ATOM 10288  H HD2  . LYS A 1 275 ? 16.636  9.612   0.773   1.00 31.03 ? 275 LYS A HD2  2  
ATOM 10289  H HD3  . LYS A 1 275 ? 17.464  8.214   1.461   1.00 31.33 ? 275 LYS A HD3  2  
ATOM 10290  H HE2  . LYS A 1 275 ? 15.353  7.470   2.465   1.00 12.53 ? 275 LYS A HE2  2  
ATOM 10291  H HE3  . LYS A 1 275 ? 14.532  8.860   1.756   1.00 64.54 ? 275 LYS A HE3  2  
ATOM 10292  H HZ1  . LYS A 1 275 ? 15.274  7.990   -0.453  1.00 20.11 ? 275 LYS A HZ1  2  
ATOM 10293  H HZ2  . LYS A 1 275 ? 14.140  7.022   0.347   1.00 61.32 ? 275 LYS A HZ2  2  
ATOM 10294  H HZ3  . LYS A 1 275 ? 15.771  6.575   0.332   1.00 33.44 ? 275 LYS A HZ3  2  
ATOM 10295  N N    . ILE A 1 276 ? 20.523  10.987  2.950   1.00 42.02 ? 276 ILE A N    2  
ATOM 10296  C CA   . ILE A 1 276 ? 21.806  10.294  2.951   1.00 51.42 ? 276 ILE A CA   2  
ATOM 10297  C C    . ILE A 1 276 ? 22.622  10.647  4.192   1.00 52.21 ? 276 ILE A C    2  
ATOM 10298  O O    . ILE A 1 276 ? 23.416  9.840   4.675   1.00 24.33 ? 276 ILE A O    2  
ATOM 10299  C CB   . ILE A 1 276 ? 22.629  10.631  1.690   1.00 20.44 ? 276 ILE A CB   2  
ATOM 10300  C CG1  . ILE A 1 276 ? 23.914  9.802   1.652   1.00 2.50  ? 276 ILE A CG1  2  
ATOM 10301  C CG2  . ILE A 1 276 ? 22.949  12.118  1.643   1.00 33.14 ? 276 ILE A CG2  2  
ATOM 10302  C CD1  . ILE A 1 276 ? 24.364  9.449   0.252   1.00 3.05  ? 276 ILE A CD1  2  
ATOM 10303  H H    . ILE A 1 276 ? 20.315  11.607  2.221   1.00 4.54  ? 276 ILE A H    2  
ATOM 10304  H HA   . ILE A 1 276 ? 21.610  9.231   2.953   1.00 42.24 ? 276 ILE A HA   2  
ATOM 10305  H HB   . ILE A 1 276 ? 22.029  10.392  0.824   1.00 65.20 ? 276 ILE A HB   2  
ATOM 10306  H HG12 . ILE A 1 276 ? 24.708  10.359  2.125   1.00 2.35  ? 276 ILE A HG12 2  
ATOM 10307  H HG13 . ILE A 1 276 ? 23.755  8.880   2.192   1.00 40.32 ? 276 ILE A HG13 2  
ATOM 10308  H HG21 . ILE A 1 276 ? 23.524  12.334  0.754   1.00 31.32 ? 276 ILE A HG21 2  
ATOM 10309  H HG22 . ILE A 1 276 ? 23.522  12.390  2.517   1.00 10.02 ? 276 ILE A HG22 2  
ATOM 10310  H HG23 . ILE A 1 276 ? 22.030  12.684  1.624   1.00 25.40 ? 276 ILE A HG23 2  
ATOM 10311  H HD11 . ILE A 1 276 ? 25.434  9.299   0.245   1.00 53.11 ? 276 ILE A HD11 2  
ATOM 10312  H HD12 . ILE A 1 276 ? 24.110  10.254  -0.422  1.00 21.22 ? 276 ILE A HD12 2  
ATOM 10313  H HD13 . ILE A 1 276 ? 23.873  8.542   -0.068  1.00 21.11 ? 276 ILE A HD13 2  
ATOM 10314  N N    . ARG A 1 277 ? 22.421  11.858  4.701   1.00 22.13 ? 277 ARG A N    2  
ATOM 10315  C CA   . ARG A 1 277 ? 23.139  12.317  5.885   1.00 52.14 ? 277 ARG A CA   2  
ATOM 10316  C C    . ARG A 1 277 ? 22.606  11.640  7.143   1.00 61.02 ? 277 ARG A C    2  
ATOM 10317  O O    . ARG A 1 277 ? 23.375  11.201  7.998   1.00 54.34 ? 277 ARG A O    2  
ATOM 10318  C CB   . ARG A 1 277 ? 23.021  13.836  6.021   1.00 73.43 ? 277 ARG A CB   2  
ATOM 10319  C CG   . ARG A 1 277 ? 24.010  14.603  5.159   1.00 11.43 ? 277 ARG A CG   2  
ATOM 10320  C CD   . ARG A 1 277 ? 24.385  15.934  5.791   1.00 2.42  ? 277 ARG A CD   2  
ATOM 10321  N NE   . ARG A 1 277 ? 25.754  16.327  5.468   1.00 43.34 ? 277 ARG A NE   2  
ATOM 10322  C CZ   . ARG A 1 277 ? 26.303  17.479  5.847   1.00 72.42 ? 277 ARG A CZ   2  
ATOM 10323  N NH1  . ARG A 1 277 ? 25.605  18.352  6.563   1.00 52.53 ? 277 ARG A NH1  2  
ATOM 10324  N NH2  . ARG A 1 277 ? 27.555  17.758  5.511   1.00 33.10 ? 277 ARG A NH2  2  
ATOM 10325  H H    . ARG A 1 277 ? 21.776  12.457  4.272   1.00 52.34 ? 277 ARG A H    2  
ATOM 10326  H HA   . ARG A 1 277 ? 24.179  12.056  5.764   1.00 50.11 ? 277 ARG A HA   2  
ATOM 10327  H HB2  . ARG A 1 277 ? 22.022  14.134  5.738   1.00 42.13 ? 277 ARG A HB2  2  
ATOM 10328  H HB3  . ARG A 1 277 ? 23.189  14.108  7.053   1.00 52.15 ? 277 ARG A HB3  2  
ATOM 10329  H HG2  . ARG A 1 277 ? 24.904  14.009  5.039   1.00 11.43 ? 277 ARG A HG2  2  
ATOM 10330  H HG3  . ARG A 1 277 ? 23.563  14.786  4.192   1.00 64.42 ? 277 ARG A HG3  2  
ATOM 10331  H HD2  . ARG A 1 277 ? 23.707  16.693  5.428   1.00 52.23 ? 277 ARG A HD2  2  
ATOM 10332  H HD3  . ARG A 1 277 ? 24.287  15.848  6.863   1.00 20.50 ? 277 ARG A HD3  2  
ATOM 10333  H HE   . ARG A 1 277 ? 26.292  15.701  4.941   1.00 75.43 ? 277 ARG A HE   2  
ATOM 10334  H HH11 . ARG A 1 277 ? 24.660  18.147  6.820   1.00 51.42 ? 277 ARG A HH11 2  
ATOM 10335  H HH12 . ARG A 1 277 ? 26.023  19.215  6.845   1.00 0.04  ? 277 ARG A HH12 2  
ATOM 10336  H HH21 . ARG A 1 277 ? 28.086  17.103  4.973   1.00 61.22 ? 277 ARG A HH21 2  
ATOM 10337  H HH22 . ARG A 1 277 ? 27.968  18.623  5.796   1.00 63.43 ? 277 ARG A HH22 2  
ATOM 10338  N N    . TYR A 1 278 ? 21.284  11.558  7.251   1.00 21.34 ? 278 TYR A N    2  
ATOM 10339  C CA   . TYR A 1 278 ? 20.647  10.933  8.406   1.00 53.24 ? 278 TYR A CA   2  
ATOM 10340  C C    . TYR A 1 278 ? 20.669  9.413   8.286   1.00 21.33 ? 278 TYR A C    2  
ATOM 10341  O O    . TYR A 1 278 ? 20.726  8.703   9.290   1.00 14.13 ? 278 TYR A O    2  
ATOM 10342  C CB   . TYR A 1 278 ? 19.206  11.425  8.548   1.00 12.04 ? 278 TYR A CB   2  
ATOM 10343  C CG   . TYR A 1 278 ? 19.097  12.841  9.067   1.00 2.25  ? 278 TYR A CG   2  
ATOM 10344  C CD1  . TYR A 1 278 ? 19.870  13.269  10.140  1.00 3.31  ? 278 TYR A CD1  2  
ATOM 10345  C CD2  . TYR A 1 278 ? 18.222  13.749  8.485   1.00 10.42 ? 278 TYR A CD2  2  
ATOM 10346  C CE1  . TYR A 1 278 ? 19.772  14.562  10.618  1.00 63.32 ? 278 TYR A CE1  2  
ATOM 10347  C CE2  . TYR A 1 278 ? 18.120  15.045  8.957   1.00 41.24 ? 278 TYR A CE2  2  
ATOM 10348  C CZ   . TYR A 1 278 ? 18.897  15.446  10.023  1.00 72.42 ? 278 TYR A CZ   2  
ATOM 10349  O OH   . TYR A 1 278 ? 18.798  16.734  10.496  1.00 4.04  ? 278 TYR A OH   2  
ATOM 10350  H H    . TYR A 1 278 ? 20.722  11.925  6.537   1.00 11.54 ? 278 TYR A H    2  
ATOM 10351  H HA   . TYR A 1 278 ? 21.205  11.221  9.286   1.00 74.23 ? 278 TYR A HA   2  
ATOM 10352  H HB2  . TYR A 1 278 ? 18.724  11.389  7.582   1.00 4.14  ? 278 TYR A HB2  2  
ATOM 10353  H HB3  . TYR A 1 278 ? 18.678  10.777  9.233   1.00 30.03 ? 278 TYR A HB3  2  
ATOM 10354  H HD1  . TYR A 1 278 ? 20.555  12.574  10.604  1.00 70.13 ? 278 TYR A HD1  2  
ATOM 10355  H HD2  . TYR A 1 278 ? 17.614  13.432  7.651   1.00 32.41 ? 278 TYR A HD2  2  
ATOM 10356  H HE1  . TYR A 1 278 ? 20.382  14.876  11.452  1.00 4.32  ? 278 TYR A HE1  2  
ATOM 10357  H HE2  . TYR A 1 278 ? 17.433  15.736  8.491   1.00 52.01 ? 278 TYR A HE2  2  
ATOM 10358  H HH   . TYR A 1 278 ? 17.960  16.844  10.952  1.00 33.03 ? 278 TYR A HH   2  
ATOM 10359  N N    . ARG A 1 279 ? 20.623  8.920   7.052   1.00 32.32 ? 279 ARG A N    2  
ATOM 10360  C CA   . ARG A 1 279 ? 20.638  7.484   6.802   1.00 50.02 ? 279 ARG A CA   2  
ATOM 10361  C C    . ARG A 1 279 ? 21.940  6.859   7.290   1.00 14.31 ? 279 ARG A C    2  
ATOM 10362  O O    . ARG A 1 279 ? 21.933  5.822   7.954   1.00 61.51 ? 279 ARG A O    2  
ATOM 10363  C CB   . ARG A 1 279 ? 20.452  7.203   5.309   1.00 52.43 ? 279 ARG A CB   2  
ATOM 10364  C CG   . ARG A 1 279 ? 20.164  5.743   4.996   1.00 61.41 ? 279 ARG A CG   2  
ATOM 10365  C CD   . ARG A 1 279 ? 21.418  4.892   5.099   1.00 22.34 ? 279 ARG A CD   2  
ATOM 10366  N NE   . ARG A 1 279 ? 21.476  3.872   4.054   1.00 31.24 ? 279 ARG A NE   2  
ATOM 10367  C CZ   . ARG A 1 279 ? 21.857  4.114   2.803   1.00 73.14 ? 279 ARG A CZ   2  
ATOM 10368  N NH1  . ARG A 1 279 ? 22.211  5.340   2.434   1.00 71.42 ? 279 ARG A NH1  2  
ATOM 10369  N NH2  . ARG A 1 279 ? 21.883  3.129   1.915   1.00 32.13 ? 279 ARG A NH2  2  
ATOM 10370  H H    . ARG A 1 279 ? 20.579  9.537   6.293   1.00 63.14 ? 279 ARG A H    2  
ATOM 10371  H HA   . ARG A 1 279 ? 19.816  7.044   7.347   1.00 22.04 ? 279 ARG A HA   2  
ATOM 10372  H HB2  . ARG A 1 279 ? 19.628  7.797   4.943   1.00 63.33 ? 279 ARG A HB2  2  
ATOM 10373  H HB3  . ARG A 1 279 ? 21.352  7.490   4.787   1.00 35.44 ? 279 ARG A HB3  2  
ATOM 10374  H HG2  . ARG A 1 279 ? 19.431  5.373   5.697   1.00 23.10 ? 279 ARG A HG2  2  
ATOM 10375  H HG3  . ARG A 1 279 ? 19.772  5.673   3.992   1.00 34.43 ? 279 ARG A HG3  2  
ATOM 10376  H HD2  . ARG A 1 279 ? 22.282  5.534   5.011   1.00 41.41 ? 279 ARG A HD2  2  
ATOM 10377  H HD3  . ARG A 1 279 ? 21.430  4.406   6.064   1.00 42.12 ? 279 ARG A HD3  2  
ATOM 10378  H HE   . ARG A 1 279 ? 21.220  2.958   4.299   1.00 70.02 ? 279 ARG A HE   2  
ATOM 10379  H HH11 . ARG A 1 279 ? 22.193  6.087   3.097   1.00 32.30 ? 279 ARG A HH11 2  
ATOM 10380  H HH12 . ARG A 1 279 ? 22.496  5.515   1.491   1.00 34.24 ? 279 ARG A HH12 2  
ATOM 10381  H HH21 . ARG A 1 279 ? 21.618  2.204   2.188   1.00 72.23 ? 279 ARG A HH21 2  
ATOM 10382  H HH22 . ARG A 1 279 ? 22.169  3.311   0.974   1.00 43.40 ? 279 ARG A HH22 2  
ATOM 10383  N N    . GLU A 1 280 ? 23.057  7.496   6.956   1.00 13.13 ? 280 GLU A N    2  
ATOM 10384  C CA   . GLU A 1 280 ? 24.369  7.002   7.358   1.00 60.24 ? 280 GLU A CA   2  
ATOM 10385  C C    . GLU A 1 280 ? 24.668  7.365   8.809   1.00 62.21 ? 280 GLU A C    2  
ATOM 10386  O O    . GLU A 1 280 ? 25.174  6.543   9.573   1.00 54.42 ? 280 GLU A O    2  
ATOM 10387  C CB   . GLU A 1 280 ? 25.455  7.573   6.444   1.00 12.32 ? 280 GLU A CB   2  
ATOM 10388  C CG   . GLU A 1 280 ? 25.757  6.697   5.238   1.00 11.14 ? 280 GLU A CG   2  
ATOM 10389  C CD   . GLU A 1 280 ? 27.034  7.103   4.529   1.00 11.25 ? 280 GLU A CD   2  
ATOM 10390  O OE1  . GLU A 1 280 ? 28.114  7.008   5.150   1.00 64.14 ? 280 GLU A OE1  2  
ATOM 10391  O OE2  . GLU A 1 280 ? 26.955  7.513   3.352   1.00 64.34 ? 280 GLU A OE2  2  
ATOM 10392  H H    . GLU A 1 280 ? 22.998  8.318   6.424   1.00 62.32 ? 280 GLU A H    2  
ATOM 10393  H HA   . GLU A 1 280 ? 24.360  5.927   7.264   1.00 35.31 ? 280 GLU A HA   2  
ATOM 10394  H HB2  . GLU A 1 280 ? 25.137  8.541   6.087   1.00 23.40 ? 280 GLU A HB2  2  
ATOM 10395  H HB3  . GLU A 1 280 ? 26.364  7.689   7.013   1.00 23.44 ? 280 GLU A HB3  2  
ATOM 10396  H HG2  . GLU A 1 280 ? 25.857  5.674   5.569   1.00 62.41 ? 280 GLU A HG2  2  
ATOM 10397  H HG3  . GLU A 1 280 ? 24.935  6.770   4.541   1.00 35.32 ? 280 GLU A HG3  2  
ATOM 10398  N N    . ASN A 1 281 ? 24.354  8.602   9.182   1.00 31.30 ? 281 ASN A N    2  
ATOM 10399  C CA   . ASN A 1 281 ? 24.592  9.072   10.541  1.00 72.52 ? 281 ASN A CA   2  
ATOM 10400  C C    . ASN A 1 281 ? 23.297  9.096   11.348  1.00 33.44 ? 281 ASN A C    2  
ATOM 10401  O O    . ASN A 1 281 ? 22.890  10.139  11.860  1.00 72.24 ? 281 ASN A O    2  
ATOM 10402  C CB   . ASN A 1 281 ? 25.221  10.468  10.518  1.00 40.05 ? 281 ASN A CB   2  
ATOM 10403  C CG   . ASN A 1 281 ? 26.736  10.418  10.520  1.00 3.02  ? 281 ASN A CG   2  
ATOM 10404  O OD1  . ASN A 1 281 ? 27.352  9.956   11.481  1.00 22.34 ? 281 ASN A OD1  2  
ATOM 10405  N ND2  . ASN A 1 281 ? 27.347  10.896  9.442   1.00 70.43 ? 281 ASN A ND2  2  
ATOM 10406  H H    . ASN A 1 281 ? 23.955  9.212   8.528   1.00 33.23 ? 281 ASN A H    2  
ATOM 10407  H HA   . ASN A 1 281 ? 25.281  8.386   11.012  1.00 13.42 ? 281 ASN A HA   2  
ATOM 10408  H HB2  . ASN A 1 281 ? 24.899  10.986  9.627   1.00 45.31 ? 281 ASN A HB2  2  
ATOM 10409  H HB3  . ASN A 1 281 ? 24.896  11.018  11.387  1.00 11.53 ? 281 ASN A HB3  2  
ATOM 10410  H HD21 . ASN A 1 281 ? 26.792  11.248  8.714   1.00 43.14 ? 281 ASN A HD21 2  
ATOM 10411  H HD22 . ASN A 1 281 ? 28.326  10.876  9.417   1.00 2.43  ? 281 ASN A HD22 2  
ATOM 10412  N N    . ILE A 1 282 ? 22.655  7.937   11.461  1.00 21.43 ? 282 ILE A N    2  
ATOM 10413  C CA   . ILE A 1 282 ? 21.407  7.825   12.210  1.00 4.22  ? 282 ILE A CA   2  
ATOM 10414  C C    . ILE A 1 282 ? 21.596  8.280   13.654  1.00 3.43  ? 282 ILE A C    2  
ATOM 10415  O O    . ILE A 1 282 ? 20.675  8.811   14.276  1.00 73.12 ? 282 ILE A O    2  
ATOM 10416  C CB   . ILE A 1 282 ? 20.876  6.379   12.206  1.00 64.23 ? 282 ILE A CB   2  
ATOM 10417  C CG1  . ILE A 1 282 ? 20.905  5.804   10.788  1.00 34.35 ? 282 ILE A CG1  2  
ATOM 10418  C CG2  . ILE A 1 282 ? 19.465  6.333   12.775  1.00 73.24 ? 282 ILE A CG2  2  
ATOM 10419  C CD1  . ILE A 1 282 ? 22.082  4.889   10.531  1.00 32.23 ? 282 ILE A CD1  2  
ATOM 10420  H H    . ILE A 1 282 ? 23.030  7.140   11.033  1.00 41.42 ? 282 ILE A H    2  
ATOM 10421  H HA   . ILE A 1 282 ? 20.674  8.459   11.735  1.00 53.22 ? 282 ILE A HA   2  
ATOM 10422  H HB   . ILE A 1 282 ? 21.512  5.783   12.842  1.00 24.41 ? 282 ILE A HB   2  
ATOM 10423  H HG12 . ILE A 1 282 ? 20.002  5.237   10.616  1.00 34.43 ? 282 ILE A HG12 2  
ATOM 10424  H HG13 . ILE A 1 282 ? 20.954  6.617   10.078  1.00 35.20 ? 282 ILE A HG13 2  
ATOM 10425  H HG21 . ILE A 1 282 ? 19.296  7.203   13.391  1.00 20.44 ? 282 ILE A HG21 2  
ATOM 10426  H HG22 . ILE A 1 282 ? 19.348  5.441   13.373  1.00 35.21 ? 282 ILE A HG22 2  
ATOM 10427  H HG23 . ILE A 1 282 ? 18.751  6.321   11.965  1.00 42.20 ? 282 ILE A HG23 2  
ATOM 10428  H HD11 . ILE A 1 282 ? 22.471  4.531   11.472  1.00 61.05 ? 282 ILE A HD11 2  
ATOM 10429  H HD12 . ILE A 1 282 ? 22.853  5.434   10.006  1.00 21.43 ? 282 ILE A HD12 2  
ATOM 10430  H HD13 . ILE A 1 282 ? 21.761  4.051   9.931   1.00 71.33 ? 282 ILE A HD13 2  
ATOM 10431  N N    . ALA A 1 283 ? 22.800  8.071   14.178  1.00 0.41  ? 283 ALA A N    2  
ATOM 10432  C CA   . ALA A 1 283 ? 23.119  8.460   15.547  1.00 54.21 ? 283 ALA A CA   2  
ATOM 10433  C C    . ALA A 1 283 ? 22.814  9.936   15.781  1.00 35.31 ? 283 ALA A C    2  
ATOM 10434  O O    . ALA A 1 283 ? 22.459  10.341  16.889  1.00 50.33 ? 283 ALA A O    2  
ATOM 10435  C CB   . ALA A 1 283 ? 24.579  8.166   15.852  1.00 25.02 ? 283 ALA A CB   2  
ATOM 10436  H H    . ALA A 1 283 ? 23.488  7.645   13.626  1.00 30.31 ? 283 ALA A H    2  
ATOM 10437  H HA   . ALA A 1 283 ? 22.509  7.867   16.214  1.00 31.42 ? 283 ALA A HA   2  
ATOM 10438  H HB1  . ALA A 1 283 ? 24.797  7.136   15.610  1.00 32.41 ? 283 ALA A HB1  2  
ATOM 10439  H HB2  . ALA A 1 283 ? 24.770  8.337   16.902  1.00 20.52 ? 283 ALA A HB2  2  
ATOM 10440  H HB3  . ALA A 1 283 ? 25.209  8.815   15.261  1.00 65.45 ? 283 ALA A HB3  2  
ATOM 10441  N N    . SER A 1 284 ? 22.950  10.736  14.728  1.00 52.42 ? 284 SER A N    2  
ATOM 10442  C CA   . SER A 1 284 ? 22.685  12.167  14.814  1.00 53.25 ? 284 SER A CA   2  
ATOM 10443  C C    . SER A 1 284 ? 21.201  12.456  14.604  1.00 41.13 ? 284 SER A C    2  
ATOM 10444  O O    . SER A 1 284 ? 20.662  13.418  15.149  1.00 34.14 ? 284 SER A O    2  
ATOM 10445  C CB   . SER A 1 284 ? 23.516  12.925  13.778  1.00 52.34 ? 284 SER A CB   2  
ATOM 10446  O OG   . SER A 1 284 ? 22.914  12.862  12.496  1.00 61.14 ? 284 SER A OG   2  
ATOM 10447  H H    . SER A 1 284 ? 23.229  10.352  13.871  1.00 33.20 ? 284 SER A H    2  
ATOM 10448  H HA   . SER A 1 284 ? 22.967  12.498  15.802  1.00 44.30 ? 284 SER A HA   2  
ATOM 10449  H HB2  . SER A 1 284 ? 23.598  13.960  14.072  1.00 65.41 ? 284 SER A HB2  2  
ATOM 10450  H HB3  . SER A 1 284 ? 24.502  12.487  13.720  1.00 3.24  ? 284 SER A HB3  2  
ATOM 10451  H HG   . SER A 1 284 ? 23.076  12.000  12.107  1.00 65.43 ? 284 SER A HG   2  
ATOM 10452  N N    . LEU A 1 285 ? 20.547  11.614  13.810  1.00 54.42 ? 285 LEU A N    2  
ATOM 10453  C CA   . LEU A 1 285 ? 19.125  11.775  13.529  1.00 51.55 ? 285 LEU A CA   2  
ATOM 10454  C C    . LEU A 1 285 ? 18.288  11.410  14.750  1.00 75.41 ? 285 LEU A C    2  
ATOM 10455  O O    . LEU A 1 285 ? 17.349  12.121  15.107  1.00 31.20 ? 285 LEU A O    2  
ATOM 10456  C CB   . LEU A 1 285 ? 18.718  10.907  12.337  1.00 33.51 ? 285 LEU A CB   2  
ATOM 10457  C CG   . LEU A 1 285 ? 17.229  10.938  11.989  1.00 32.25 ? 285 LEU A CG   2  
ATOM 10458  C CD1  . LEU A 1 285 ? 16.936  12.045  10.989  1.00 63.44 ? 285 LEU A CD1  2  
ATOM 10459  C CD2  . LEU A 1 285 ? 16.782  9.590   11.441  1.00 75.14 ? 285 LEU A CD2  2  
ATOM 10460  H H    . LEU A 1 285 ? 21.031  10.863  13.406  1.00 44.44 ? 285 LEU A H    2  
ATOM 10461  H HA   . LEU A 1 285 ? 18.952  12.812  13.285  1.00 4.43  ? 285 LEU A HA   2  
ATOM 10462  H HB2  . LEU A 1 285 ? 19.276  11.236  11.472  1.00 14.25 ? 285 LEU A HB2  2  
ATOM 10463  H HB3  . LEU A 1 285 ? 18.993  9.885   12.553  1.00 21.42 ? 285 LEU A HB3  2  
ATOM 10464  H HG   . LEU A 1 285 ? 16.660  11.140  12.886  1.00 12.32 ? 285 LEU A HG   2  
ATOM 10465  H HD11 . LEU A 1 285 ? 17.058  11.664  9.986   1.00 52.24 ? 285 LEU A HD11 2  
ATOM 10466  H HD12 . LEU A 1 285 ? 17.622  12.864  11.149  1.00 70.44 ? 285 LEU A HD12 2  
ATOM 10467  H HD13 . LEU A 1 285 ? 15.923  12.392  11.122  1.00 63.01 ? 285 LEU A HD13 2  
ATOM 10468  H HD21 . LEU A 1 285 ? 17.050  9.520   10.398  1.00 20.24 ? 285 LEU A HD21 2  
ATOM 10469  H HD22 . LEU A 1 285 ? 15.711  9.496   11.545  1.00 61.32 ? 285 LEU A HD22 2  
ATOM 10470  H HD23 . LEU A 1 285 ? 17.268  8.799   11.993  1.00 51.11 ? 285 LEU A HD23 2  
ATOM 10471  N N    . MET A 1 286 ? 18.636  10.296  15.387  1.00 53.11 ? 286 MET A N    2  
ATOM 10472  C CA   . MET A 1 286 ? 17.917  9.836   16.569  1.00 32.13 ? 286 MET A CA   2  
ATOM 10473  C C    . MET A 1 286 ? 18.165  10.768  17.751  1.00 61.13 ? 286 MET A C    2  
ATOM 10474  O O    . MET A 1 286 ? 17.266  11.024  18.552  1.00 55.02 ? 286 MET A O    2  
ATOM 10475  C CB   . MET A 1 286 ? 18.340  8.409   16.926  1.00 71.30 ? 286 MET A CB   2  
ATOM 10476  C CG   . MET A 1 286 ? 17.265  7.370   16.654  1.00 75.35 ? 286 MET A CG   2  
ATOM 10477  S SD   . MET A 1 286 ? 17.090  6.995   14.898  1.00 65.13 ? 286 MET A SD   2  
ATOM 10478  C CE   . MET A 1 286 ? 15.522  7.784   14.539  1.00 3.03  ? 286 MET A CE   2  
ATOM 10479  H H    . MET A 1 286 ? 19.394  9.772   15.055  1.00 44.35 ? 286 MET A H    2  
ATOM 10480  H HA   . MET A 1 286 ? 16.862  9.842   16.337  1.00 21.32 ? 286 MET A HA   2  
ATOM 10481  H HB2  . MET A 1 286 ? 19.215  8.150   16.348  1.00 0.42  ? 286 MET A HB2  2  
ATOM 10482  H HB3  . MET A 1 286 ? 18.590  8.369   17.976  1.00 1.14  ? 286 MET A HB3  2  
ATOM 10483  H HG2  . MET A 1 286 ? 17.521  6.461   17.177  1.00 54.31 ? 286 MET A HG2  2  
ATOM 10484  H HG3  . MET A 1 286 ? 16.321  7.743   17.024  1.00 74.24 ? 286 MET A HG3  2  
ATOM 10485  H HE1  . MET A 1 286 ? 14.799  7.509   15.293  1.00 51.03 ? 286 MET A HE1  2  
ATOM 10486  H HE2  . MET A 1 286 ? 15.172  7.461   13.569  1.00 2.22  ? 286 MET A HE2  2  
ATOM 10487  H HE3  . MET A 1 286 ? 15.651  8.856   14.536  1.00 53.32 ? 286 MET A HE3  2  
ATOM 10488  N N    . ASP A 1 287 ? 19.390  11.275  17.852  1.00 55.15 ? 287 ASP A N    2  
ATOM 10489  C CA   . ASP A 1 287 ? 19.755  12.180  18.936  1.00 1.33  ? 287 ASP A CA   2  
ATOM 10490  C C    . ASP A 1 287 ? 19.067  13.532  18.771  1.00 31.41 ? 287 ASP A C    2  
ATOM 10491  O O    . ASP A 1 287 ? 18.732  14.192  19.754  1.00 34.04 ? 287 ASP A O    2  
ATOM 10492  C CB   . ASP A 1 287 ? 21.273  12.368  18.982  1.00 0.10  ? 287 ASP A CB   2  
ATOM 10493  C CG   . ASP A 1 287 ? 21.952  11.365  19.891  1.00 55.14 ? 287 ASP A CG   2  
ATOM 10494  O OD1  . ASP A 1 287 ? 22.205  10.228  19.438  1.00 43.12 ? 287 ASP A OD1  2  
ATOM 10495  O OD2  . ASP A 1 287 ? 22.233  11.714  21.057  1.00 51.52 ? 287 ASP A OD2  2  
ATOM 10496  H H    . ASP A 1 287 ? 20.064  11.035  17.181  1.00 5.42  ? 287 ASP A H    2  
ATOM 10497  H HA   . ASP A 1 287 ? 19.428  11.734  19.863  1.00 54.11 ? 287 ASP A HA   2  
ATOM 10498  H HB2  . ASP A 1 287 ? 21.674  12.253  17.986  1.00 34.00 ? 287 ASP A HB2  2  
ATOM 10499  H HB3  . ASP A 1 287 ? 21.495  13.362  19.342  1.00 24.31 ? 287 ASP A HB3  2  
ATOM 10500  N N    . LYS A 1 288 ? 18.861  13.937  17.522  1.00 51.42 ? 288 LYS A N    2  
ATOM 10501  C CA   . LYS A 1 288 ? 18.215  15.211  17.229  1.00 13.21 ? 288 LYS A CA   2  
ATOM 10502  C C    . LYS A 1 288 ? 16.698  15.054  17.180  1.00 34.31 ? 288 LYS A C    2  
ATOM 10503  O O    . LYS A 1 288 ? 15.961  15.896  17.694  1.00 5.32  ? 288 LYS A O    2  
ATOM 10504  C CB   . LYS A 1 288 ? 18.724  15.771  15.899  1.00 75.14 ? 288 LYS A CB   2  
ATOM 10505  C CG   . LYS A 1 288 ? 19.906  16.716  16.050  1.00 75.13 ? 288 LYS A CG   2  
ATOM 10506  C CD   . LYS A 1 288 ? 19.466  18.170  16.002  1.00 35.20 ? 288 LYS A CD   2  
ATOM 10507  C CE   . LYS A 1 288 ? 19.328  18.758  17.397  1.00 62.32 ? 288 LYS A CE   2  
ATOM 10508  N NZ   . LYS A 1 288 ? 20.527  19.551  17.788  1.00 42.55 ? 288 LYS A NZ   2  
ATOM 10509  H H    . LYS A 1 288 ? 19.152  13.366  16.779  1.00 54.43 ? 288 LYS A H    2  
ATOM 10510  H HA   . LYS A 1 288 ? 18.467  15.900  18.020  1.00 23.22 ? 288 LYS A HA   2  
ATOM 10511  H HB2  . LYS A 1 288 ? 19.028  14.949  15.268  1.00 73.22 ? 288 LYS A HB2  2  
ATOM 10512  H HB3  . LYS A 1 288 ? 17.922  16.308  15.415  1.00 22.04 ? 288 LYS A HB3  2  
ATOM 10513  H HG2  . LYS A 1 288 ? 20.385  16.527  16.999  1.00 24.31 ? 288 LYS A HG2  2  
ATOM 10514  H HG3  . LYS A 1 288 ? 20.606  16.534  15.248  1.00 70.15 ? 288 LYS A HG3  2  
ATOM 10515  H HD2  . LYS A 1 288 ? 20.202  18.741  15.454  1.00 63.02 ? 288 LYS A HD2  2  
ATOM 10516  H HD3  . LYS A 1 288 ? 18.513  18.231  15.499  1.00 32.13 ? 288 LYS A HD3  2  
ATOM 10517  H HE2  . LYS A 1 288 ? 18.460  19.400  17.418  1.00 44.13 ? 288 LYS A HE2  2  
ATOM 10518  H HE3  . LYS A 1 288 ? 19.195  17.950  18.102  1.00 30.41 ? 288 LYS A HE3  2  
ATOM 10519  H HZ1  . LYS A 1 288 ? 20.904  20.058  16.961  1.00 0.34  ? 288 LYS A HZ1  2  
ATOM 10520  H HZ2  . LYS A 1 288 ? 21.266  18.921  18.160  1.00 23.25 ? 288 LYS A HZ2  2  
ATOM 10521  H HZ3  . LYS A 1 288 ? 20.274  20.242  18.521  1.00 21.01 ? 288 LYS A HZ3  2  
ATOM 10522  N N    . CYS A 1 289 ? 16.238  13.973  16.558  1.00 22.01 ? 289 CYS A N    2  
ATOM 10523  C CA   . CYS A 1 289 ? 14.808  13.708  16.443  1.00 34.43 ? 289 CYS A CA   2  
ATOM 10524  C C    . CYS A 1 289 ? 14.168  13.574  17.822  1.00 33.11 ? 289 CYS A C    2  
ATOM 10525  O O    . CYS A 1 289 ? 13.281  14.347  18.183  1.00 23.52 ? 289 CYS A O    2  
ATOM 10526  C CB   . CYS A 1 289 ? 14.567  12.435  15.631  1.00 45.20 ? 289 CYS A CB   2  
ATOM 10527  S SG   . CYS A 1 289 ? 14.679  12.671  13.841  1.00 65.51 ? 289 CYS A SG   2  
ATOM 10528  H H    . CYS A 1 289 ? 16.875  13.338  16.168  1.00 53.34 ? 289 CYS A H    2  
ATOM 10529  H HA   . CYS A 1 289 ? 14.358  14.544  15.930  1.00 53.24 ? 289 CYS A HA   2  
ATOM 10530  H HB2  . CYS A 1 289 ? 15.301  11.695  15.911  1.00 75.24 ? 289 CYS A HB2  2  
ATOM 10531  H HB3  . CYS A 1 289 ? 13.579  12.058  15.852  1.00 62.02 ? 289 CYS A HB3  2  
ATOM 10532  H HG   . CYS A 1 289 ? 14.146  11.994  13.420  1.00 35.50 ? 289 CYS A HG   2  
ATOM 10533  N N    . PHE A 1 290 ? 14.627  12.591  18.587  1.00 41.32 ? 290 PHE A N    2  
ATOM 10534  C CA   . PHE A 1 290 ? 14.100  12.355  19.927  1.00 31.10 ? 290 PHE A CA   2  
ATOM 10535  C C    . PHE A 1 290 ? 15.062  12.884  20.989  1.00 74.45 ? 290 PHE A C    2  
ATOM 10536  O O    . PHE A 1 290 ? 16.279  12.864  20.800  1.00 5.14  ? 290 PHE A O    2  
ATOM 10537  C CB   . PHE A 1 290 ? 13.846  10.862  20.143  1.00 61.23 ? 290 PHE A CB   2  
ATOM 10538  C CG   . PHE A 1 290 ? 12.397  10.478  20.045  1.00 51.30 ? 290 PHE A CG   2  
ATOM 10539  C CD1  . PHE A 1 290 ? 11.819  10.205  18.814  1.00 35.45 ? 290 PHE A CD1  2  
ATOM 10540  C CD2  . PHE A 1 290 ? 11.612  10.392  21.184  1.00 24.12 ? 290 PHE A CD2  2  
ATOM 10541  C CE1  . PHE A 1 290 ? 10.487  9.852   18.722  1.00 4.01  ? 290 PHE A CE1  2  
ATOM 10542  C CE2  . PHE A 1 290 ? 10.278  10.040  21.097  1.00 71.33 ? 290 PHE A CE2  2  
ATOM 10543  C CZ   . PHE A 1 290 ? 9.715   9.770   19.865  1.00 54.21 ? 290 PHE A CZ   2  
ATOM 10544  H H    . PHE A 1 290 ? 15.337  12.008  18.244  1.00 74.34 ? 290 PHE A H    2  
ATOM 10545  H HA   . PHE A 1 290 ? 13.163  12.886  20.010  1.00 25.22 ? 290 PHE A HA   2  
ATOM 10546  H HB2  . PHE A 1 290 ? 14.388  10.300  19.396  1.00 42.35 ? 290 PHE A HB2  2  
ATOM 10547  H HB3  . PHE A 1 290 ? 14.200  10.581  21.124  1.00 74.41 ? 290 PHE A HB3  2  
ATOM 10548  H HD1  . PHE A 1 290 ? 12.422  10.270  17.920  1.00 35.24 ? 290 PHE A HD1  2  
ATOM 10549  H HD2  . PHE A 1 290 ? 12.051  10.603  22.147  1.00 51.11 ? 290 PHE A HD2  2  
ATOM 10550  H HE1  . PHE A 1 290 ? 10.048  9.643   17.758  1.00 43.02 ? 290 PHE A HE1  2  
ATOM 10551  H HE2  . PHE A 1 290 ? 9.677   9.976   21.991  1.00 21.41 ? 290 PHE A HE2  2  
ATOM 10552  H HZ   . PHE A 1 290 ? 8.673   9.495   19.795  1.00 11.04 ? 290 PHE A HZ   2  
ATOM 10553  N N    . PRO A 1 291 ? 14.528  13.366  22.125  1.00 41.13 ? 291 PRO A N    2  
ATOM 10554  C CA   . PRO A 1 291 ? 15.347  13.902  23.217  1.00 74.43 ? 291 PRO A CA   2  
ATOM 10555  C C    . PRO A 1 291 ? 16.436  12.930  23.658  1.00 31.32 ? 291 PRO A C    2  
ATOM 10556  O O    . PRO A 1 291 ? 16.353  11.729  23.399  1.00 41.50 ? 291 PRO A O    2  
ATOM 10557  C CB   . PRO A 1 291 ? 14.337  14.121  24.346  1.00 60.43 ? 291 PRO A CB   2  
ATOM 10558  C CG   . PRO A 1 291 ? 13.030  14.298  23.656  1.00 45.24 ? 291 PRO A CG   2  
ATOM 10559  C CD   . PRO A 1 291 ? 13.087  13.428  22.432  1.00 63.11 ? 291 PRO A CD   2  
ATOM 10560  H HA   . PRO A 1 291 ? 15.798  14.846  22.946  1.00 64.53 ? 291 PRO A HA   2  
ATOM 10561  H HB2  . PRO A 1 291 ? 14.328  13.258  24.997  1.00 20.03 ? 291 PRO A HB2  2  
ATOM 10562  H HB3  . PRO A 1 291 ? 14.608  15.002  24.909  1.00 35.45 ? 291 PRO A HB3  2  
ATOM 10563  H HG2  . PRO A 1 291 ? 12.226  13.980  24.305  1.00 51.50 ? 291 PRO A HG2  2  
ATOM 10564  H HG3  . PRO A 1 291 ? 12.900  15.333  23.375  1.00 64.54 ? 291 PRO A HG3  2  
ATOM 10565  H HD2  . PRO A 1 291 ? 12.695  12.445  22.648  1.00 24.32 ? 291 PRO A HD2  2  
ATOM 10566  H HD3  . PRO A 1 291 ? 12.539  13.883  21.619  1.00 2.23  ? 291 PRO A HD3  2  
ATOM 10567  N N    . GLU A 1 292 ? 17.455  13.457  24.328  1.00 41.52 ? 292 GLU A N    2  
ATOM 10568  C CA   . GLU A 1 292 ? 18.562  12.638  24.808  1.00 75.12 ? 292 GLU A CA   2  
ATOM 10569  C C    . GLU A 1 292 ? 18.124  11.740  25.965  1.00 54.11 ? 292 GLU A C    2  
ATOM 10570  O O    . GLU A 1 292 ? 18.803  10.771  26.301  1.00 52.31 ? 292 GLU A O    2  
ATOM 10571  C CB   . GLU A 1 292 ? 19.726  13.527  25.252  1.00 73.10 ? 292 GLU A CB   2  
ATOM 10572  C CG   . GLU A 1 292 ? 19.323  14.604  26.246  1.00 64.24 ? 292 GLU A CG   2  
ATOM 10573  C CD   . GLU A 1 292 ? 20.507  15.164  27.010  1.00 13.40 ? 292 GLU A CD   2  
ATOM 10574  O OE1  . GLU A 1 292 ? 21.376  15.797  26.375  1.00 40.32 ? 292 GLU A OE1  2  
ATOM 10575  O OE2  . GLU A 1 292 ? 20.563  14.970  28.242  1.00 2.35  ? 292 GLU A OE2  2  
ATOM 10576  H H    . GLU A 1 292 ? 17.464  14.421  24.504  1.00 24.04 ? 292 GLU A H    2  
ATOM 10577  H HA   . GLU A 1 292 ? 18.891  12.013  23.991  1.00 14.34 ? 292 GLU A HA   2  
ATOM 10578  H HB2  . GLU A 1 292 ? 20.481  12.907  25.712  1.00 4.50  ? 292 GLU A HB2  2  
ATOM 10579  H HB3  . GLU A 1 292 ? 20.148  14.008  24.383  1.00 0.13  ? 292 GLU A HB3  2  
ATOM 10580  H HG2  . GLU A 1 292 ? 18.846  15.411  25.709  1.00 73.21 ? 292 GLU A HG2  2  
ATOM 10581  H HG3  . GLU A 1 292 ? 18.624  14.181  26.952  1.00 33.21 ? 292 GLU A HG3  2  
ATOM 10582  N N    . LYS A 1 293 ? 16.986  12.070  26.572  1.00 44.23 ? 293 LYS A N    2  
ATOM 10583  C CA   . LYS A 1 293 ? 16.461  11.293  27.690  1.00 62.14 ? 293 LYS A CA   2  
ATOM 10584  C C    . LYS A 1 293 ? 15.478  10.228  27.210  1.00 54.33 ? 293 LYS A C    2  
ATOM 10585  O O    . LYS A 1 293 ? 14.651  9.743   27.983  1.00 63.24 ? 293 LYS A O    2  
ATOM 10586  C CB   . LYS A 1 293 ? 15.777  12.216  28.700  1.00 42.43 ? 293 LYS A CB   2  
ATOM 10587  C CG   . LYS A 1 293 ? 15.703  11.634  30.102  1.00 12.21 ? 293 LYS A CG   2  
ATOM 10588  C CD   . LYS A 1 293 ? 14.669  12.356  30.951  1.00 3.55  ? 293 LYS A CD   2  
ATOM 10589  C CE   . LYS A 1 293 ? 15.050  13.811  31.174  1.00 53.45 ? 293 LYS A CE   2  
ATOM 10590  N NZ   . LYS A 1 293 ? 15.715  14.015  32.491  1.00 24.14 ? 293 LYS A NZ   2  
ATOM 10591  H H    . LYS A 1 293 ? 16.488  12.854  26.263  1.00 1.10  ? 293 LYS A H    2  
ATOM 10592  H HA   . LYS A 1 293 ? 17.294  10.804  28.172  1.00 37.47 ? 293 LYS A HA   2  
ATOM 10593  H HB2  . LYS A 1 293 ? 16.323  13.146  28.748  1.00 24.44 ? 293 LYS A HB2  2  
ATOM 10594  H HB3  . LYS A 1 293 ? 14.770  12.416  28.363  1.00 0.43  ? 293 LYS A HB3  2  
ATOM 10595  H HG2  . LYS A 1 293 ? 15.433  10.590  30.035  1.00 0.30  ? 293 LYS A HG2  2  
ATOM 10596  H HG3  . LYS A 1 293 ? 16.671  11.728  30.572  1.00 4.22  ? 293 LYS A HG3  2  
ATOM 10597  H HD2  . LYS A 1 293 ? 13.714  12.317  30.449  1.00 43.42 ? 293 LYS A HD2  2  
ATOM 10598  H HD3  . LYS A 1 293 ? 14.594  11.861  31.909  1.00 11.02 ? 293 LYS A HD3  2  
ATOM 10599  H HE2  . LYS A 1 293 ? 15.724  14.119  30.389  1.00 63.34 ? 293 LYS A HE2  2  
ATOM 10600  H HE3  . LYS A 1 293 ? 14.154  14.414  31.136  1.00 64.43 ? 293 LYS A HE3  2  
ATOM 10601  H HZ1  . LYS A 1 293 ? 15.021  14.330  33.198  1.00 65.12 ? 293 LYS A HZ1  2  
ATOM 10602  H HZ2  . LYS A 1 293 ? 16.459  14.736  32.407  1.00 75.23 ? 293 LYS A HZ2  2  
ATOM 10603  H HZ3  . LYS A 1 293 ? 16.146  13.125  32.816  1.00 70.14 ? 293 LYS A HZ3  2  
ATOM 10604  N N    . ASN A 1 294 ? 15.572  9.864   25.934  1.00 1.22  ? 294 ASN A N    2  
ATOM 10605  C CA   . ASN A 1 294 ? 14.689  8.856   25.360  1.00 60.43 ? 294 ASN A CA   2  
ATOM 10606  C C    . ASN A 1 294 ? 15.116  8.508   23.938  1.00 32.42 ? 294 ASN A C    2  
ATOM 10607  O O    . ASN A 1 294 ? 14.716  9.170   22.980  1.00 22.34 ? 294 ASN A O    2  
ATOM 10608  C CB   . ASN A 1 294 ? 13.241  9.352   25.364  1.00 12.31 ? 294 ASN A CB   2  
ATOM 10609  C CG   . ASN A 1 294 ? 12.240  8.214   25.365  1.00 34.44 ? 294 ASN A CG   2  
ATOM 10610  O OD1  . ASN A 1 294 ? 12.204  7.402   24.441  1.00 33.44 ? 294 ASN A OD1  2  
ATOM 10611  N ND2  . ASN A 1 294 ? 11.419  8.150   26.407  1.00 53.20 ? 294 ASN A ND2  2  
ATOM 10612  H H    . ASN A 1 294 ? 16.251  10.279  25.364  1.00 50.24 ? 294 ASN A H    2  
ATOM 10613  H HA   . ASN A 1 294 ? 14.757  7.968   25.971  1.00 32.43 ? 294 ASN A HA   2  
ATOM 10614  H HB2  . ASN A 1 294 ? 13.076  9.954   26.245  1.00 63.12 ? 294 ASN A HB2  2  
ATOM 10615  H HB3  . ASN A 1 294 ? 13.073  9.956   24.484  1.00 32.21 ? 294 ASN A HB3  2  
ATOM 10616  H HD21 . ASN A 1 294 ? 11.504  8.831   27.106  1.00 73.03 ? 294 ASN A HD21 2  
ATOM 10617  H HD22 . ASN A 1 294 ? 10.761  7.424   26.434  1.00 22.24 ? 294 ASN A HD22 2  
ATOM 10618  N N    . LYS A 1 295 ? 15.932  7.466   23.807  1.00 12.22 ? 295 LYS A N    2  
ATOM 10619  C CA   . LYS A 1 295 ? 16.413  7.032   22.501  1.00 5.13  ? 295 LYS A CA   2  
ATOM 10620  C C    . LYS A 1 295 ? 15.823  5.673   22.127  1.00 32.14 ? 295 LYS A C    2  
ATOM 10621  O O    . LYS A 1 295 ? 16.318  4.633   22.563  1.00 13.01 ? 295 LYS A O    2  
ATOM 10622  C CB   . LYS A 1 295 ? 17.940  6.953   22.500  1.00 31.10 ? 295 LYS A CB   2  
ATOM 10623  C CG   . LYS A 1 295 ? 18.570  7.374   21.183  1.00 53.31 ? 295 LYS A CG   2  
ATOM 10624  C CD   . LYS A 1 295 ? 19.888  8.100   21.401  1.00 34.41 ? 295 LYS A CD   2  
ATOM 10625  C CE   . LYS A 1 295 ? 20.917  7.716   20.350  1.00 54.41 ? 295 LYS A CE   2  
ATOM 10626  N NZ   . LYS A 1 295 ? 22.303  7.745   20.894  1.00 24.25 ? 295 LYS A NZ   2  
ATOM 10627  H H    . LYS A 1 295 ? 16.215  6.977   24.609  1.00 50.12 ? 295 LYS A H    2  
ATOM 10628  H HA   . LYS A 1 295 ? 16.100  7.763   21.772  1.00 23.30 ? 295 LYS A HA   2  
ATOM 10629  H HB2  . LYS A 1 295 ? 18.323  7.596   23.279  1.00 52.33 ? 295 LYS A HB2  2  
ATOM 10630  H HB3  . LYS A 1 295 ? 18.238  5.936   22.708  1.00 45.40 ? 295 LYS A HB3  2  
ATOM 10631  H HG2  . LYS A 1 295 ? 18.752  6.494   20.584  1.00 64.23 ? 295 LYS A HG2  2  
ATOM 10632  H HG3  . LYS A 1 295 ? 17.889  8.030   20.662  1.00 42.22 ? 295 LYS A HG3  2  
ATOM 10633  H HD2  . LYS A 1 295 ? 19.714  9.165   21.348  1.00 41.24 ? 295 LYS A HD2  2  
ATOM 10634  H HD3  . LYS A 1 295 ? 20.272  7.845   22.378  1.00 61.23 ? 295 LYS A HD3  2  
ATOM 10635  H HE2  . LYS A 1 295 ? 20.699  6.720   19.998  1.00 64.31 ? 295 LYS A HE2  2  
ATOM 10636  H HE3  . LYS A 1 295 ? 20.848  8.412   19.526  1.00 51.44 ? 295 LYS A HE3  2  
ATOM 10637  H HZ1  . LYS A 1 295 ? 22.993  7.742   20.115  1.00 72.40 ? 295 LYS A HZ1  2  
ATOM 10638  H HZ2  . LYS A 1 295 ? 22.470  6.911   21.492  1.00 34.34 ? 295 LYS A HZ2  2  
ATOM 10639  H HZ3  . LYS A 1 295 ? 22.445  8.601   21.465  1.00 74.22 ? 295 LYS A HZ3  2  
ATOM 10640  N N    . PRO A 1 296 ? 14.752  5.662   21.314  1.00 22.40 ? 296 PRO A N    2  
ATOM 10641  C CA   . PRO A 1 296 ? 14.096  4.421   20.885  1.00 30.10 ? 296 PRO A CA   2  
ATOM 10642  C C    . PRO A 1 296 ? 15.018  3.535   20.053  1.00 74.14 ? 296 PRO A C    2  
ATOM 10643  O O    . PRO A 1 296 ? 15.151  3.726   18.844  1.00 21.11 ? 296 PRO A O    2  
ATOM 10644  C CB   . PRO A 1 296 ? 12.912  4.904   20.036  1.00 61.01 ? 296 PRO A CB   2  
ATOM 10645  C CG   . PRO A 1 296 ? 12.728  6.338   20.398  1.00 10.11 ? 296 PRO A CG   2  
ATOM 10646  C CD   . PRO A 1 296 ? 14.093  6.851   20.751  1.00 14.11 ? 296 PRO A CD   2  
ATOM 10647  H HA   . PRO A 1 296 ? 13.729  3.859   21.731  1.00 0.12  ? 296 PRO A HA   2  
ATOM 10648  H HB2  . PRO A 1 296 ? 13.150  4.790   18.988  1.00 21.22 ? 296 PRO A HB2  2  
ATOM 10649  H HB3  . PRO A 1 296 ? 12.035  4.322   20.274  1.00 30.22 ? 296 PRO A HB3  2  
ATOM 10650  H HG2  . PRO A 1 296 ? 12.329  6.882   19.554  1.00 23.42 ? 296 PRO A HG2  2  
ATOM 10651  H HG3  . PRO A 1 296 ? 12.065  6.420   21.247  1.00 42.41 ? 296 PRO A HG3  2  
ATOM 10652  H HD2  . PRO A 1 296 ? 14.608  7.198   19.867  1.00 13.43 ? 296 PRO A HD2  2  
ATOM 10653  H HD3  . PRO A 1 296 ? 14.024  7.639   21.486  1.00 45.24 ? 296 PRO A HD3  2  
ATOM 10654  N N    . GLY A 1 297 ? 15.650  2.566   20.707  1.00 13.33 ? 297 GLY A N    2  
ATOM 10655  C CA   . GLY A 1 297 ? 16.548  1.664   20.007  1.00 54.04 ? 297 GLY A CA   2  
ATOM 10656  C C    . GLY A 1 297 ? 15.856  0.911   18.885  1.00 33.40 ? 297 GLY A C    2  
ATOM 10657  O O    . GLY A 1 297 ? 16.507  0.432   17.957  1.00 60.23 ? 297 GLY A O    2  
ATOM 10658  H H    . GLY A 1 297 ? 15.503  2.460   21.670  1.00 62.44 ? 297 GLY A H    2  
ATOM 10659  H HA2  . GLY A 1 297 ? 17.364  2.236   19.592  1.00 65.42 ? 297 GLY A HA2  2  
ATOM 10660  H HA3  . GLY A 1 297 ? 16.945  0.950   20.713  1.00 45.41 ? 297 GLY A HA3  2  
ATOM 10661  N N    . GLU A 1 298 ? 14.534  0.810   18.971  1.00 45.54 ? 298 GLU A N    2  
ATOM 10662  C CA   . GLU A 1 298 ? 13.752  0.113   17.956  1.00 32.25 ? 298 GLU A CA   2  
ATOM 10663  C C    . GLU A 1 298 ? 13.942  0.760   16.587  1.00 51.22 ? 298 GLU A C    2  
ATOM 10664  O O    . GLU A 1 298 ? 14.175  0.074   15.592  1.00 72.34 ? 298 GLU A O    2  
ATOM 10665  C CB   . GLU A 1 298 ? 12.269  0.117   18.333  1.00 44.11 ? 298 GLU A CB   2  
ATOM 10666  C CG   . GLU A 1 298 ? 11.403  -0.713  17.401  1.00 60.54 ? 298 GLU A CG   2  
ATOM 10667  C CD   . GLU A 1 298 ? 10.748  0.121   16.316  1.00 30.24 ? 298 GLU A CD   2  
ATOM 10668  O OE1  . GLU A 1 298 ? 10.161  1.172   16.649  1.00 40.21 ? 298 GLU A OE1  2  
ATOM 10669  O OE2  . GLU A 1 298 ? 10.823  -0.277  15.135  1.00 34.31 ? 298 GLU A OE2  2  
ATOM 10670  H H    . GLU A 1 298 ? 14.074  1.217   19.735  1.00 22.21 ? 298 GLU A H    2  
ATOM 10671  H HA   . GLU A 1 298 ? 14.100  -0.907  17.911  1.00 11.24 ? 298 GLU A HA   2  
ATOM 10672  H HB2  . GLU A 1 298 ? 12.163  -0.276  19.333  1.00 52.40 ? 298 GLU A HB2  2  
ATOM 10673  H HB3  . GLU A 1 298 ? 11.908  1.134   18.315  1.00 61.43 ? 298 GLU A HB3  2  
ATOM 10674  H HG2  . GLU A 1 298 ? 12.019  -1.466  16.931  1.00 1.40  ? 298 GLU A HG2  2  
ATOM 10675  H HG3  . GLU A 1 298 ? 10.629  -1.194  17.981  1.00 31.24 ? 298 GLU A HG3  2  
ATOM 10676  N N    . ILE A 1 299 ? 13.846  2.084   16.549  1.00 15.25 ? 299 ILE A N    2  
ATOM 10677  C CA   . ILE A 1 299 ? 14.010  2.826   15.305  1.00 64.12 ? 299 ILE A CA   2  
ATOM 10678  C C    . ILE A 1 299 ? 15.487  2.948   14.935  1.00 72.35 ? 299 ILE A C    2  
ATOM 10679  O O    . ILE A 1 299 ? 15.852  2.848   13.764  1.00 23.35 ? 299 ILE A O    2  
ATOM 10680  C CB   . ILE A 1 299 ? 13.386  4.236   15.403  1.00 40.34 ? 299 ILE A CB   2  
ATOM 10681  C CG1  . ILE A 1 299 ? 11.882  4.130   15.664  1.00 1.02  ? 299 ILE A CG1  2  
ATOM 10682  C CG2  . ILE A 1 299 ? 13.650  5.033   14.132  1.00 64.14 ? 299 ILE A CG2  2  
ATOM 10683  C CD1  . ILE A 1 299 ? 11.500  4.341   17.112  1.00 15.40 ? 299 ILE A CD1  2  
ATOM 10684  H H    . ILE A 1 299 ? 13.662  2.571   17.379  1.00 53.14 ? 299 ILE A H    2  
ATOM 10685  H HA   . ILE A 1 299 ? 13.499  2.283   14.524  1.00 31.52 ? 299 ILE A HA   2  
ATOM 10686  H HB   . ILE A 1 299 ? 13.851  4.755   16.228  1.00 72.44 ? 299 ILE A HB   2  
ATOM 10687  H HG12 . ILE A 1 299 ? 11.367  4.875   15.076  1.00 21.22 ? 299 ILE A HG12 2  
ATOM 10688  H HG13 . ILE A 1 299 ? 11.540  3.147   15.369  1.00 72.43 ? 299 ILE A HG13 2  
ATOM 10689  H HG21 . ILE A 1 299 ? 13.213  6.015   14.225  1.00 43.24 ? 299 ILE A HG21 2  
ATOM 10690  H HG22 . ILE A 1 299 ? 13.211  4.521   13.288  1.00 34.34 ? 299 ILE A HG22 2  
ATOM 10691  H HG23 . ILE A 1 299 ? 14.716  5.126   13.981  1.00 23.50 ? 299 ILE A HG23 2  
ATOM 10692  H HD11 . ILE A 1 299 ? 12.072  3.671   17.736  1.00 14.44 ? 299 ILE A HD11 2  
ATOM 10693  H HD12 . ILE A 1 299 ? 10.447  4.140   17.239  1.00 55.13 ? 299 ILE A HD12 2  
ATOM 10694  H HD13 . ILE A 1 299 ? 11.709  5.362   17.394  1.00 11.15 ? 299 ILE A HD13 2  
ATOM 10695  N N    . ALA A 1 300 ? 16.330  3.160   15.940  1.00 64.23 ? 300 ALA A N    2  
ATOM 10696  C CA   . ALA A 1 300 ? 17.766  3.291   15.718  1.00 61.42 ? 300 ALA A CA   2  
ATOM 10697  C C    . ALA A 1 300 ? 18.318  2.077   14.978  1.00 33.52 ? 300 ALA A C    2  
ATOM 10698  O O    . ALA A 1 300 ? 18.856  2.199   13.877  1.00 13.20 ? 300 ALA A O    2  
ATOM 10699  C CB   . ALA A 1 300 ? 18.490  3.479   17.042  1.00 51.44 ? 300 ALA A CB   2  
ATOM 10700  H H    . ALA A 1 300 ? 15.980  3.230   16.853  1.00 34.12 ? 300 ALA A H    2  
ATOM 10701  H HA   . ALA A 1 300 ? 17.931  4.173   15.116  1.00 12.31 ? 300 ALA A HA   2  
ATOM 10702  H HB1  . ALA A 1 300 ? 18.408  4.509   17.354  1.00 54.44 ? 300 ALA A HB1  2  
ATOM 10703  H HB2  . ALA A 1 300 ? 19.532  3.221   16.923  1.00 52.10 ? 300 ALA A HB2  2  
ATOM 10704  H HB3  . ALA A 1 300 ? 18.044  2.840   17.791  1.00 51.14 ? 300 ALA A HB3  2  
ATOM 10705  N N    . LYS A 1 301 ? 18.179  0.905   15.590  1.00 53.31 ? 301 LYS A N    2  
ATOM 10706  C CA   . LYS A 1 301 ? 18.660  -0.333  14.987  1.00 34.34 ? 301 LYS A CA   2  
ATOM 10707  C C    . LYS A 1 301 ? 17.986  -0.575  13.640  1.00 74.50 ? 301 LYS A C    2  
ATOM 10708  O O    . LYS A 1 301 ? 18.587  -1.134  12.724  1.00 33.13 ? 301 LYS A O    2  
ATOM 10709  C CB   . LYS A 1 301 ? 18.400  -1.516  15.921  1.00 43.45 ? 301 LYS A CB   2  
ATOM 10710  C CG   . LYS A 1 301 ? 19.418  -1.642  17.042  1.00 4.32  ? 301 LYS A CG   2  
ATOM 10711  C CD   . LYS A 1 301 ? 20.493  -2.662  16.705  1.00 34.12 ? 301 LYS A CD   2  
ATOM 10712  C CE   . LYS A 1 301 ? 21.325  -3.019  17.927  1.00 72.22 ? 301 LYS A CE   2  
ATOM 10713  N NZ   . LYS A 1 301 ? 21.687  -4.463  17.949  1.00 4.42  ? 301 LYS A NZ   2  
ATOM 10714  H H    . LYS A 1 301 ? 17.740  0.872   16.465  1.00 72.03 ? 301 LYS A H    2  
ATOM 10715  H HA   . LYS A 1 301 ? 19.725  -0.235  14.831  1.00 65.52 ? 301 LYS A HA   2  
ATOM 10716  H HB2  . LYS A 1 301 ? 17.421  -1.401  16.364  1.00 43.44 ? 301 LYS A HB2  2  
ATOM 10717  H HB3  . LYS A 1 301 ? 18.417  -2.428  15.342  1.00 64.32 ? 301 LYS A HB3  2  
ATOM 10718  H HG2  . LYS A 1 301 ? 19.885  -0.682  17.201  1.00 5.24  ? 301 LYS A HG2  2  
ATOM 10719  H HG3  . LYS A 1 301 ? 18.911  -1.951  17.944  1.00 74.10 ? 301 LYS A HG3  2  
ATOM 10720  H HD2  . LYS A 1 301 ? 20.021  -3.558  16.330  1.00 33.13 ? 301 LYS A HD2  2  
ATOM 10721  H HD3  . LYS A 1 301 ? 21.142  -2.250  15.947  1.00 23.24 ? 301 LYS A HD3  2  
ATOM 10722  H HE2  . LYS A 1 301 ? 22.230  -2.430  17.915  1.00 41.41 ? 301 LYS A HE2  2  
ATOM 10723  H HE3  . LYS A 1 301 ? 20.755  -2.785  18.814  1.00 30.32 ? 301 LYS A HE3  2  
ATOM 10724  H HZ1  . LYS A 1 301 ? 20.907  -5.022  18.351  1.00 60.04 ? 301 LYS A HZ1  2  
ATOM 10725  H HZ2  . LYS A 1 301 ? 22.538  -4.609  18.531  1.00 3.14  ? 301 LYS A HZ2  2  
ATOM 10726  H HZ3  . LYS A 1 301 ? 21.879  -4.799  16.984  1.00 72.35 ? 301 LYS A HZ3  2  
ATOM 10727  N N    . TYR A 1 302 ? 16.731  -0.148  13.530  1.00 22.14 ? 302 TYR A N    2  
ATOM 10728  C CA   . TYR A 1 302 ? 15.966  -0.313  12.296  1.00 1.34  ? 302 TYR A CA   2  
ATOM 10729  C C    . TYR A 1 302 ? 16.768  0.162   11.087  1.00 54.02 ? 302 TYR A C    2  
ATOM 10730  O O    . TYR A 1 302 ? 16.847  -0.530  10.071  1.00 2.04  ? 302 TYR A O    2  
ATOM 10731  C CB   . TYR A 1 302 ? 14.648  0.456   12.382  1.00 35.44 ? 302 TYR A CB   2  
ATOM 10732  C CG   . TYR A 1 302 ? 13.572  -0.082  11.466  1.00 51.13 ? 302 TYR A CG   2  
ATOM 10733  C CD1  . TYR A 1 302 ? 13.764  -0.133  10.091  1.00 41.43 ? 302 TYR A CD1  2  
ATOM 10734  C CD2  . TYR A 1 302 ? 12.364  -0.541  11.976  1.00 3.31  ? 302 TYR A CD2  2  
ATOM 10735  C CE1  . TYR A 1 302 ? 12.783  -0.625  9.251   1.00 23.32 ? 302 TYR A CE1  2  
ATOM 10736  C CE2  . TYR A 1 302 ? 11.378  -1.035  11.143  1.00 4.43  ? 302 TYR A CE2  2  
ATOM 10737  C CZ   . TYR A 1 302 ? 11.592  -1.074  9.781   1.00 60.53 ? 302 TYR A CZ   2  
ATOM 10738  O OH   . TYR A 1 302 ? 10.613  -1.564  8.949   1.00 33.43 ? 302 TYR A OH   2  
ATOM 10739  H H    . TYR A 1 302 ? 16.309  0.289   14.300  1.00 42.50 ? 302 TYR A H    2  
ATOM 10740  H HA   . TYR A 1 302 ? 15.752  -1.365  12.179  1.00 60.11 ? 302 TYR A HA   2  
ATOM 10741  H HB2  . TYR A 1 302 ? 14.275  0.409   13.393  1.00 73.21 ? 302 TYR A HB2  2  
ATOM 10742  H HB3  . TYR A 1 302 ? 14.823  1.488   12.117  1.00 12.24 ? 302 TYR A HB3  2  
ATOM 10743  H HD1  . TYR A 1 302 ? 14.698  0.219   9.678   1.00 42.22 ? 302 TYR A HD1  2  
ATOM 10744  H HD2  . TYR A 1 302 ? 12.199  -0.509  13.043  1.00 4.50  ? 302 TYR A HD2  2  
ATOM 10745  H HE1  . TYR A 1 302 ? 12.951  -0.656  8.184   1.00 23.34 ? 302 TYR A HE1  2  
ATOM 10746  H HE2  . TYR A 1 302 ? 10.445  -1.386  11.559  1.00 52.02 ? 302 TYR A HE2  2  
ATOM 10747  H HH   . TYR A 1 302 ? 10.575  -1.032  8.151   1.00 3.43  ? 302 TYR A HH   2  
ATOM 10748  N N    . MET A 1 303 ? 17.357  1.348   11.202  1.00 71.32 ? 303 MET A N    2  
ATOM 10749  C CA   . MET A 1 303 ? 18.149  1.916   10.118  1.00 22.12 ? 303 MET A CA   2  
ATOM 10750  C C    . MET A 1 303 ? 19.517  1.242   10.024  1.00 13.40 ? 303 MET A C    2  
ATOM 10751  O O    . MET A 1 303 ? 20.147  1.242   8.965   1.00 23.51 ? 303 MET A O    2  
ATOM 10752  C CB   . MET A 1 303 ? 18.324  3.421   10.322  1.00 24.41 ? 303 MET A CB   2  
ATOM 10753  C CG   . MET A 1 303 ? 17.023  4.202   10.226  1.00 3.33  ? 303 MET A CG   2  
ATOM 10754  S SD   . MET A 1 303 ? 16.784  4.954   8.605   1.00 71.21 ? 303 MET A SD   2  
ATOM 10755  C CE   . MET A 1 303 ? 15.827  3.684   7.781   1.00 42.03 ? 303 MET A CE   2  
ATOM 10756  H H    . MET A 1 303 ? 17.255  1.856   12.033  1.00 1.11  ? 303 MET A H    2  
ATOM 10757  H HA   . MET A 1 303 ? 17.615  1.748   9.196   1.00 11.21 ? 303 MET A HA   2  
ATOM 10758  H HB2  . MET A 1 303 ? 18.750  3.593   11.300  1.00 62.41 ? 303 MET A HB2  2  
ATOM 10759  H HB3  . MET A 1 303 ? 19.002  3.798   9.571   1.00 4.05  ? 303 MET A HB3  2  
ATOM 10760  H HG2  . MET A 1 303 ? 16.200  3.532   10.420  1.00 21.52 ? 303 MET A HG2  2  
ATOM 10761  H HG3  . MET A 1 303 ? 17.033  4.985   10.971  1.00 55.35 ? 303 MET A HG3  2  
ATOM 10762  H HE1  . MET A 1 303 ? 16.115  3.634   6.741   1.00 45.13 ? 303 MET A HE1  2  
ATOM 10763  H HE2  . MET A 1 303 ? 14.777  3.922   7.852   1.00 3.00  ? 303 MET A HE2  2  
ATOM 10764  H HE3  . MET A 1 303 ? 16.013  2.730   8.251   1.00 21.11 ? 303 MET A HE3  2  
ATOM 10765  N N    . GLU A 1 304 ? 19.974  0.675   11.136  1.00 25.40 ? 304 GLU A N    2  
ATOM 10766  C CA   . GLU A 1 304 ? 21.270  0.005   11.177  1.00 4.50  ? 304 GLU A CA   2  
ATOM 10767  C C    . GLU A 1 304 ? 21.252  -1.284  10.360  1.00 54.20 ? 304 GLU A C    2  
ATOM 10768  O O    . GLU A 1 304 ? 22.196  -1.578  9.628   1.00 23.42 ? 304 GLU A O    2  
ATOM 10769  C CB   . GLU A 1 304 ? 21.661  -0.302  12.623  1.00 3.05  ? 304 GLU A CB   2  
ATOM 10770  C CG   . GLU A 1 304 ? 22.291  0.877   13.346  1.00 2.42  ? 304 GLU A CG   2  
ATOM 10771  C CD   . GLU A 1 304 ? 23.443  0.464   14.242  1.00 32.42 ? 304 GLU A CD   2  
ATOM 10772  O OE1  . GLU A 1 304 ? 24.589  0.410   13.749  1.00 42.44 ? 304 GLU A OE1  2  
ATOM 10773  O OE2  . GLU A 1 304 ? 23.198  0.194   15.437  1.00 54.31 ? 304 GLU A OE2  2  
ATOM 10774  H H    . GLU A 1 304 ? 19.429  0.711   11.950  1.00 2.02  ? 304 GLU A H    2  
ATOM 10775  H HA   . GLU A 1 304 ? 22.001  0.675   10.752  1.00 1.44  ? 304 GLU A HA   2  
ATOM 10776  H HB2  . GLU A 1 304 ? 20.777  -0.600  13.168  1.00 4.40  ? 304 GLU A HB2  2  
ATOM 10777  H HB3  . GLU A 1 304 ? 22.367  -1.118  12.628  1.00 53.00 ? 304 GLU A HB3  2  
ATOM 10778  H HG2  . GLU A 1 304 ? 22.661  1.577   12.612  1.00 25.53 ? 304 GLU A HG2  2  
ATOM 10779  H HG3  . GLU A 1 304 ? 21.536  1.357   13.952  1.00 75.11 ? 304 GLU A HG3  2  
ATOM 10780  N N    . THR A 1 305 ? 20.174  -2.051  10.491  1.00 21.11 ? 305 THR A N    2  
ATOM 10781  C CA   . THR A 1 305 ? 20.040  -3.310  9.765   1.00 21.42 ? 305 THR A CA   2  
ATOM 10782  C C    . THR A 1 305 ? 19.826  -3.060  8.275   1.00 71.43 ? 305 THR A C    2  
ATOM 10783  O O    . THR A 1 305 ? 20.478  -3.675  7.432   1.00 50.13 ? 305 THR A O    2  
ATOM 10784  C CB   . THR A 1 305 ? 18.881  -4.133  10.332  1.00 11.10 ? 305 THR A CB   2  
ATOM 10785  O OG1  . THR A 1 305 ? 18.738  -5.350  9.622   1.00 43.12 ? 305 THR A OG1  2  
ATOM 10786  C CG2  . THR A 1 305 ? 17.550  -3.414  10.280  1.00 52.22 ? 305 THR A CG2  2  
ATOM 10787  H H    . THR A 1 305 ? 19.454  -1.764  11.091  1.00 75.11 ? 305 THR A H    2  
ATOM 10788  H HA   . THR A 1 305 ? 20.959  -3.863  9.894   1.00 73.42 ? 305 THR A HA   2  
ATOM 10789  H HB   . THR A 1 305 ? 19.092  -4.366  11.365  1.00 53.42 ? 305 THR A HB   2  
ATOM 10790  H HG1  . THR A 1 305 ? 19.113  -6.069  10.138  1.00 42.45 ? 305 THR A HG1  2  
ATOM 10791  H HG21 . THR A 1 305 ? 17.628  -2.476  10.808  1.00 4.40  ? 305 THR A HG21 2  
ATOM 10792  H HG22 . THR A 1 305 ? 16.793  -4.026  10.745  1.00 52.11 ? 305 THR A HG22 2  
ATOM 10793  H HG23 . THR A 1 305 ? 17.281  -3.227  9.252   1.00 53.54 ? 305 THR A HG23 2  
ATOM 10794  N N    . VAL A 1 306 ? 18.906  -2.156  7.958   1.00 33.24 ? 306 VAL A N    2  
ATOM 10795  C CA   . VAL A 1 306 ? 18.606  -1.827  6.569   1.00 32.33 ? 306 VAL A CA   2  
ATOM 10796  C C    . VAL A 1 306 ? 19.823  -1.225  5.873   1.00 13.42 ? 306 VAL A C    2  
ATOM 10797  O O    . VAL A 1 306 ? 20.104  -1.534  4.715   1.00 61.30 ? 306 VAL A O    2  
ATOM 10798  C CB   . VAL A 1 306 ? 17.424  -0.844  6.465   1.00 55.22 ? 306 VAL A CB   2  
ATOM 10799  C CG1  . VAL A 1 306 ? 16.182  -1.431  7.119   1.00 53.21 ? 306 VAL A CG1  2  
ATOM 10800  C CG2  . VAL A 1 306 ? 17.779  0.496   7.091   1.00 20.54 ? 306 VAL A CG2  2  
ATOM 10801  H H    . VAL A 1 306 ? 18.420  -1.701  8.678   1.00 33.22 ? 306 VAL A H    2  
ATOM 10802  H HA   . VAL A 1 306 ? 18.332  -2.741  6.064   1.00 13.55 ? 306 VAL A HA   2  
ATOM 10803  H HB   . VAL A 1 306 ? 17.208  -0.682  5.419   1.00 71.41 ? 306 VAL A HB   2  
ATOM 10804  H HG11 . VAL A 1 306 ? 15.903  -2.341  6.609   1.00 34.52 ? 306 VAL A HG11 2  
ATOM 10805  H HG12 . VAL A 1 306 ? 15.372  -0.719  7.057   1.00 34.51 ? 306 VAL A HG12 2  
ATOM 10806  H HG13 . VAL A 1 306 ? 16.391  -1.649  8.155   1.00 55.24 ? 306 VAL A HG13 2  
ATOM 10807  H HG21 . VAL A 1 306 ? 16.874  1.036   7.324   1.00 12.41 ? 306 VAL A HG21 2  
ATOM 10808  H HG22 . VAL A 1 306 ? 18.373  1.072   6.397   1.00 4.21  ? 306 VAL A HG22 2  
ATOM 10809  H HG23 . VAL A 1 306 ? 18.344  0.331   7.996   1.00 14.20 ? 306 VAL A HG23 2  
ATOM 10810  N N    . LYS A 1 307 ? 20.542  -0.366  6.587   1.00 4.42  ? 307 LYS A N    2  
ATOM 10811  C CA   . LYS A 1 307 ? 21.729  0.280   6.040   1.00 14.43 ? 307 LYS A CA   2  
ATOM 10812  C C    . LYS A 1 307 ? 22.862  -0.725  5.857   1.00 14.54 ? 307 LYS A C    2  
ATOM 10813  O O    . LYS A 1 307 ? 23.723  -0.553  4.994   1.00 72.13 ? 307 LYS A O    2  
ATOM 10814  C CB   . LYS A 1 307 ? 22.184  1.416   6.958   1.00 61.12 ? 307 LYS A CB   2  
ATOM 10815  C CG   . LYS A 1 307 ? 23.395  2.172   6.435   1.00 21.01 ? 307 LYS A CG   2  
ATOM 10816  C CD   . LYS A 1 307 ? 24.216  2.762   7.570   1.00 65.24 ? 307 LYS A CD   2  
ATOM 10817  C CE   . LYS A 1 307 ? 25.646  3.041   7.136   1.00 64.12 ? 307 LYS A CE   2  
ATOM 10818  N NZ   . LYS A 1 307 ? 26.575  1.952   7.543   1.00 61.02 ? 307 LYS A NZ   2  
ATOM 10819  H H    . LYS A 1 307 ? 20.267  -0.162  7.506   1.00 71.12 ? 307 LYS A H    2  
ATOM 10820  H HA   . LYS A 1 307 ? 21.468  0.690   5.077   1.00 54.11 ? 307 LYS A HA   2  
ATOM 10821  H HB2  . LYS A 1 307 ? 21.371  2.118   7.073   1.00 63.43 ? 307 LYS A HB2  2  
ATOM 10822  H HB3  . LYS A 1 307 ? 22.433  1.005   7.925   1.00 34.24 ? 307 LYS A HB3  2  
ATOM 10823  H HG2  . LYS A 1 307 ? 24.015  1.493   5.870   1.00 71.40 ? 307 LYS A HG2  2  
ATOM 10824  H HG3  . LYS A 1 307 ? 23.057  2.973   5.793   1.00 33.04 ? 307 LYS A HG3  2  
ATOM 10825  H HD2  . LYS A 1 307 ? 23.761  3.687   7.890   1.00 53.22 ? 307 LYS A HD2  2  
ATOM 10826  H HD3  . LYS A 1 307 ? 24.230  2.061   8.393   1.00 54.30 ? 307 LYS A HD3  2  
ATOM 10827  H HE2  . LYS A 1 307 ? 25.670  3.138   6.061   1.00 23.52 ? 307 LYS A HE2  2  
ATOM 10828  H HE3  . LYS A 1 307 ? 25.971  3.967   7.587   1.00 13.43 ? 307 LYS A HE3  2  
ATOM 10829  H HZ1  . LYS A 1 307 ? 27.551  2.307   7.577   1.00 11.32 ? 307 LYS A HZ1  2  
ATOM 10830  H HZ2  . LYS A 1 307 ? 26.527  1.167   6.862   1.00 23.05 ? 307 LYS A HZ2  2  
ATOM 10831  H HZ3  . LYS A 1 307 ? 26.314  1.593   8.485   1.00 63.12 ? 307 LYS A HZ3  2  
ATOM 10832  N N    . LEU A 1 308 ? 22.858  -1.774  6.674   1.00 70.13 ? 308 LEU A N    2  
ATOM 10833  C CA   . LEU A 1 308 ? 23.887  -2.805  6.601   1.00 3.51  ? 308 LEU A CA   2  
ATOM 10834  C C    . LEU A 1 308 ? 23.418  -3.993  5.765   1.00 74.20 ? 308 LEU A C    2  
ATOM 10835  O O    . LEU A 1 308 ? 23.829  -5.128  5.997   1.00 22.05 ? 308 LEU A O    2  
ATOM 10836  C CB   . LEU A 1 308 ? 24.268  -3.275  8.007   1.00 23.51 ? 308 LEU A CB   2  
ATOM 10837  C CG   . LEU A 1 308 ? 25.410  -2.496  8.663   1.00 10.13 ? 308 LEU A CG   2  
ATOM 10838  C CD1  . LEU A 1 308 ? 24.893  -1.205  9.277   1.00 72.23 ? 308 LEU A CD1  2  
ATOM 10839  C CD2  . LEU A 1 308 ? 26.101  -3.351  9.715   1.00 12.55 ? 308 LEU A CD2  2  
ATOM 10840  H H    . LEU A 1 308 ? 22.146  -1.856  7.343   1.00 1.11  ? 308 LEU A H    2  
ATOM 10841  H HA   . LEU A 1 308 ? 24.756  -2.371  6.130   1.00 60.55 ? 308 LEU A HA   2  
ATOM 10842  H HB2  . LEU A 1 308 ? 23.396  -3.194  8.639   1.00 54.13 ? 308 LEU A HB2  2  
ATOM 10843  H HB3  . LEU A 1 308 ? 24.557  -4.313  7.951   1.00 74.53 ? 308 LEU A HB3  2  
ATOM 10844  H HG   . LEU A 1 308 ? 26.140  -2.239  7.909   1.00 14.42 ? 308 LEU A HG   2  
ATOM 10845  H HD11 . LEU A 1 308 ? 25.724  -0.544  9.477   1.00 63.04 ? 308 LEU A HD11 2  
ATOM 10846  H HD12 . LEU A 1 308 ? 24.378  -1.427  10.199  1.00 71.03 ? 308 LEU A HD12 2  
ATOM 10847  H HD13 . LEU A 1 308 ? 24.211  -0.728  8.589   1.00 54.44 ? 308 LEU A HD13 2  
ATOM 10848  H HD21 . LEU A 1 308 ? 26.485  -4.249  9.254   1.00 3.22  ? 308 LEU A HD21 2  
ATOM 10849  H HD22 . LEU A 1 308 ? 25.391  -3.618  10.484  1.00 62.11 ? 308 LEU A HD22 2  
ATOM 10850  H HD23 . LEU A 1 308 ? 26.915  -2.794  10.153  1.00 3.30  ? 308 LEU A HD23 2  
ATOM 10851  N N    . LEU A 1 309 ? 22.556  -3.723  4.789   1.00 21.14 ? 309 LEU A N    2  
ATOM 10852  C CA   . LEU A 1 309 ? 22.035  -4.770  3.918   1.00 72.43 ? 309 LEU A CA   2  
ATOM 10853  C C    . LEU A 1 309 ? 22.627  -4.654  2.518   1.00 22.11 ? 309 LEU A C    2  
ATOM 10854  O O    . LEU A 1 309 ? 22.664  -3.569  1.937   1.00 3.14  ? 309 LEU A O    2  
ATOM 10855  C CB   . LEU A 1 309 ? 20.508  -4.696  3.852   1.00 24.22 ? 309 LEU A CB   2  
ATOM 10856  C CG   . LEU A 1 309 ? 19.772  -5.658  4.786   1.00 32.42 ? 309 LEU A CG   2  
ATOM 10857  C CD1  . LEU A 1 309 ? 18.288  -5.328  4.830   1.00 61.41 ? 309 LEU A CD1  2  
ATOM 10858  C CD2  . LEU A 1 309 ? 19.988  -7.097  4.345   1.00 24.22 ? 309 LEU A CD2  2  
ATOM 10859  H H    . LEU A 1 309 ? 22.265  -2.797  4.649   1.00 12.35 ? 309 LEU A H    2  
ATOM 10860  H HA   . LEU A 1 309 ? 22.322  -5.723  4.340   1.00 1.44  ? 309 LEU A HA   2  
ATOM 10861  H HB2  . LEU A 1 309 ? 20.207  -3.688  4.098   1.00 71.22 ? 309 LEU A HB2  2  
ATOM 10862  H HB3  . LEU A 1 309 ? 20.200  -4.908  2.840   1.00 1.23  ? 309 LEU A HB3  2  
ATOM 10863  H HG   . LEU A 1 309 ? 20.166  -5.550  5.786   1.00 14.14 ? 309 LEU A HG   2  
ATOM 10864  H HD11 . LEU A 1 309 ? 18.004  -4.823  3.918   1.00 4.55  ? 309 LEU A HD11 2  
ATOM 10865  H HD12 . LEU A 1 309 ? 18.086  -4.686  5.674   1.00 63.15 ? 309 LEU A HD12 2  
ATOM 10866  H HD13 . LEU A 1 309 ? 17.719  -6.240  4.928   1.00 3.44  ? 309 LEU A HD13 2  
ATOM 10867  H HD21 . LEU A 1 309 ? 19.163  -7.705  4.686   1.00 53.31 ? 309 LEU A HD21 2  
ATOM 10868  H HD22 . LEU A 1 309 ? 20.909  -7.469  4.768   1.00 41.43 ? 309 LEU A HD22 2  
ATOM 10869  H HD23 . LEU A 1 309 ? 20.044  -7.138  3.267   1.00 3.13  ? 309 LEU A HD23 2  
ATOM 10870  N N    . ASP A 1 310 ? 23.090  -5.779  1.981   1.00 30.21 ? 310 ASP A N    2  
ATOM 10871  C CA   . ASP A 1 310 ? 23.681  -5.802  0.648   1.00 53.24 ? 310 ASP A CA   2  
ATOM 10872  C C    . ASP A 1 310 ? 22.652  -6.217  -0.398  1.00 74.31 ? 310 ASP A C    2  
ATOM 10873  O O    . ASP A 1 310 ? 21.637  -6.835  -0.075  1.00 60.03 ? 310 ASP A O    2  
ATOM 10874  C CB   . ASP A 1 310 ? 24.875  -6.758  0.614   1.00 3.50  ? 310 ASP A CB   2  
ATOM 10875  C CG   . ASP A 1 310 ? 26.002  -6.245  -0.261  1.00 41.34 ? 310 ASP A CG   2  
ATOM 10876  O OD1  . ASP A 1 310 ? 25.958  -6.482  -1.486  1.00 3.12  ? 310 ASP A OD1  2  
ATOM 10877  O OD2  . ASP A 1 310 ? 26.929  -5.606  0.279   1.00 31.35 ? 310 ASP A OD2  2  
ATOM 10878  H H    . ASP A 1 310 ? 23.033  -6.612  2.493   1.00 53.31 ? 310 ASP A H    2  
ATOM 10879  H HA   . ASP A 1 310 ? 24.025  -4.804  0.421   1.00 30.15 ? 310 ASP A HA   2  
ATOM 10880  H HB2  . ASP A 1 310 ? 25.253  -6.888  1.617   1.00 53.32 ? 310 ASP A HB2  2  
ATOM 10881  H HB3  . ASP A 1 310 ? 24.551  -7.714  0.229   1.00 53.54 ? 310 ASP A HB3  2  
ATOM 10882  N N    . TYR A 1 311 ? 22.921  -5.873  -1.654  1.00 74.42 ? 311 TYR A N    2  
ATOM 10883  C CA   . TYR A 1 311 ? 22.019  -6.209  -2.750  1.00 21.23 ? 311 TYR A CA   2  
ATOM 10884  C C    . TYR A 1 311 ? 21.787  -7.715  -2.825  1.00 73.21 ? 311 TYR A C    2  
ATOM 10885  O O    . TYR A 1 311 ? 20.719  -8.169  -3.237  1.00 44.04 ? 311 TYR A O    2  
ATOM 10886  C CB   . TYR A 1 311 ? 22.587  -5.703  -4.078  1.00 41.50 ? 311 TYR A CB   2  
ATOM 10887  C CG   . TYR A 1 311 ? 21.531  -5.210  -5.041  1.00 3.22  ? 311 TYR A CG   2  
ATOM 10888  C CD1  . TYR A 1 311 ? 20.560  -6.071  -5.538  1.00 70.24 ? 311 TYR A CD1  2  
ATOM 10889  C CD2  . TYR A 1 311 ? 21.505  -3.884  -5.455  1.00 10.41 ? 311 TYR A CD2  2  
ATOM 10890  C CE1  . TYR A 1 311 ? 19.593  -5.625  -6.419  1.00 34.41 ? 311 TYR A CE1  2  
ATOM 10891  C CE2  . TYR A 1 311 ? 20.541  -3.430  -6.334  1.00 13.40 ? 311 TYR A CE2  2  
ATOM 10892  C CZ   . TYR A 1 311 ? 19.588  -4.304  -6.814  1.00 10.34 ? 311 TYR A CZ   2  
ATOM 10893  O OH   . TYR A 1 311 ? 18.627  -3.855  -7.691  1.00 35.22 ? 311 TYR A OH   2  
ATOM 10894  H H    . TYR A 1 311 ? 23.745  -5.380  -1.849  1.00 1.15  ? 311 TYR A H    2  
ATOM 10895  H HA   . TYR A 1 311 ? 21.075  -5.720  -2.564  1.00 2.43  ? 311 TYR A HA   2  
ATOM 10896  H HB2  . TYR A 1 311 ? 23.265  -4.886  -3.883  1.00 54.52 ? 311 TYR A HB2  2  
ATOM 10897  H HB3  . TYR A 1 311 ? 23.127  -6.506  -4.559  1.00 4.40  ? 311 TYR A HB3  2  
ATOM 10898  H HD1  . TYR A 1 311 ? 20.566  -7.106  -5.226  1.00 14.05 ? 311 TYR A HD1  2  
ATOM 10899  H HD2  . TYR A 1 311 ? 22.253  -3.202  -5.078  1.00 14.15 ? 311 TYR A HD2  2  
ATOM 10900  H HE1  . TYR A 1 311 ? 18.847  -6.309  -6.794  1.00 55.42 ? 311 TYR A HE1  2  
ATOM 10901  H HE2  . TYR A 1 311 ? 20.538  -2.395  -6.644  1.00 41.22 ? 311 TYR A HE2  2  
ATOM 10902  H HH   . TYR A 1 311 ? 18.813  -4.195  -8.570  1.00 12.01 ? 311 TYR A HH   2  
ATOM 10903  N N    . THR A 1 312 ? 22.793  -8.484  -2.421  1.00 43.44 ? 312 THR A N    2  
ATOM 10904  C CA   . THR A 1 312 ? 22.698  -9.939  -2.440  1.00 53.55 ? 312 THR A CA   2  
ATOM 10905  C C    . THR A 1 312 ? 22.239  -10.477 -1.088  1.00 14.33 ? 312 THR A C    2  
ATOM 10906  O O    . THR A 1 312 ? 21.668  -11.563 -1.002  1.00 42.42 ? 312 THR A O    2  
ATOM 10907  C CB   . THR A 1 312 ? 24.047  -10.554 -2.815  1.00 30.50 ? 312 THR A CB   2  
ATOM 10908  O OG1  . THR A 1 312 ? 25.042  -10.190 -1.874  1.00 45.43 ? 312 THR A OG1  2  
ATOM 10909  C CG2  . THR A 1 312 ? 24.537  -10.135 -4.184  1.00 73.20 ? 312 THR A CG2  2  
ATOM 10910  H H    . THR A 1 312 ? 23.618  -8.064  -2.102  1.00 61.14 ? 312 THR A H    2  
ATOM 10911  H HA   . THR A 1 312 ? 21.969  -10.213 -3.188  1.00 54.13 ? 312 THR A HA   2  
ATOM 10912  H HB   . THR A 1 312 ? 23.955  -11.631 -2.812  1.00 23.43 ? 312 THR A HB   2  
ATOM 10913  H HG1  . THR A 1 312 ? 25.060  -10.833 -1.161  1.00 50.40 ? 312 THR A HG1  2  
ATOM 10914  H HG21 . THR A 1 312 ? 25.570  -9.828  -4.120  1.00 4.15  ? 312 THR A HG21 2  
ATOM 10915  H HG22 . THR A 1 312 ? 23.938  -9.311  -4.544  1.00 22.53 ? 312 THR A HG22 2  
ATOM 10916  H HG23 . THR A 1 312 ? 24.450  -10.967 -4.868  1.00 31.42 ? 312 THR A HG23 2  
ATOM 10917  N N    . GLU A 1 313 ? 22.493  -9.710  -0.032  1.00 13.21 ? 313 GLU A N    2  
ATOM 10918  C CA   . GLU A 1 313 ? 22.105  -10.111 1.315   1.00 3.12  ? 313 GLU A CA   2  
ATOM 10919  C C    . GLU A 1 313 ? 20.590  -10.248 1.428   1.00 25.22 ? 313 GLU A C    2  
ATOM 10920  O O    . GLU A 1 313 ? 19.841  -9.503  0.795   1.00 22.14 ? 313 GLU A O    2  
ATOM 10921  C CB   . GLU A 1 313 ? 22.616  -9.097  2.340   1.00 64.34 ? 313 GLU A CB   2  
ATOM 10922  C CG   . GLU A 1 313 ? 23.063  -9.727  3.650   1.00 31.04 ? 313 GLU A CG   2  
ATOM 10923  C CD   . GLU A 1 313 ? 24.062  -8.868  4.399   1.00 40.04 ? 313 GLU A CD   2  
ATOM 10924  O OE1  . GLU A 1 313 ? 25.147  -8.598  3.843   1.00 42.13 ? 313 GLU A OE1  2  
ATOM 10925  O OE2  . GLU A 1 313 ? 23.758  -8.463  5.541   1.00 15.24 ? 313 GLU A OE2  2  
ATOM 10926  H H    . GLU A 1 313 ? 22.951  -8.854  -0.161  1.00 32.11 ? 313 GLU A H    2  
ATOM 10927  H HA   . GLU A 1 313 ? 22.557  -11.072 1.517   1.00 64.31 ? 313 GLU A HA   2  
ATOM 10928  H HB2  . GLU A 1 313 ? 23.454  -8.566  1.916   1.00 1.44  ? 313 GLU A HB2  2  
ATOM 10929  H HB3  . GLU A 1 313 ? 21.826  -8.392  2.556   1.00 1.05  ? 313 GLU A HB3  2  
ATOM 10930  H HG2  . GLU A 1 313 ? 22.197  -9.875  4.277   1.00 11.01 ? 313 GLU A HG2  2  
ATOM 10931  H HG3  . GLU A 1 313 ? 23.520  -10.682 3.436   1.00 23.33 ? 313 GLU A HG3  2  
ATOM 10932  N N    . LYS A 1 314 ? 20.146  -11.203 2.238   1.00 23.30 ? 314 LYS A N    2  
ATOM 10933  C CA   . LYS A 1 314 ? 18.720  -11.437 2.434   1.00 2.22  ? 314 LYS A CA   2  
ATOM 10934  C C    . LYS A 1 314 ? 18.173  -10.561 3.558   1.00 2.11  ? 314 LYS A C    2  
ATOM 10935  O O    . LYS A 1 314 ? 18.936  -10.005 4.348   1.00 10.04 ? 314 LYS A O    2  
ATOM 10936  C CB   . LYS A 1 314 ? 18.464  -12.913 2.750   1.00 73.43 ? 314 LYS A CB   2  
ATOM 10937  C CG   . LYS A 1 314 ? 18.113  -13.745 1.527   1.00 23.12 ? 314 LYS A CG   2  
ATOM 10938  C CD   . LYS A 1 314 ? 17.875  -15.200 1.893   1.00 20.50 ? 314 LYS A CD   2  
ATOM 10939  C CE   . LYS A 1 314 ? 17.086  -15.925 0.814   1.00 33.41 ? 314 LYS A CE   2  
ATOM 10940  N NZ   . LYS A 1 314 ? 15.742  -15.318 0.607   1.00 0.41  ? 314 LYS A NZ   2  
ATOM 10941  H H    . LYS A 1 314 ? 20.792  -11.765 2.714   1.00 11.25 ? 314 LYS A H    2  
ATOM 10942  H HA   . LYS A 1 314 ? 18.212  -11.182 1.515   1.00 41.33 ? 314 LYS A HA   2  
ATOM 10943  H HB2  . LYS A 1 314 ? 19.352  -13.331 3.200   1.00 53.45 ? 314 LYS A HB2  2  
ATOM 10944  H HB3  . LYS A 1 314 ? 17.647  -12.983 3.453   1.00 63.45 ? 314 LYS A HB3  2  
ATOM 10945  H HG2  . LYS A 1 314 ? 17.216  -13.346 1.077   1.00 62.12 ? 314 LYS A HG2  2  
ATOM 10946  H HG3  . LYS A 1 314 ? 18.928  -13.689 0.820   1.00 31.25 ? 314 LYS A HG3  2  
ATOM 10947  H HD2  . LYS A 1 314 ? 18.829  -15.692 2.017   1.00 3.15  ? 314 LYS A HD2  2  
ATOM 10948  H HD3  . LYS A 1 314 ? 17.323  -15.243 2.820   1.00 0.51  ? 314 LYS A HD3  2  
ATOM 10949  H HE2  . LYS A 1 314 ? 17.639  -15.876 -0.112  1.00 1.43  ? 314 LYS A HE2  2  
ATOM 10950  H HE3  . LYS A 1 314 ? 16.966  -16.957 1.106   1.00 53.32 ? 314 LYS A HE3  2  
ATOM 10951  H HZ1  . LYS A 1 314 ? 15.119  -15.990 0.114   1.00 13.14 ? 314 LYS A HZ1  2  
ATOM 10952  H HZ2  . LYS A 1 314 ? 15.824  -14.454 0.035   1.00 51.04 ? 314 LYS A HZ2  2  
ATOM 10953  H HZ3  . LYS A 1 314 ? 15.315  -15.075 1.524   1.00 32.43 ? 314 LYS A HZ3  2  
ATOM 10954  N N    . PRO A 1 315 ? 16.839  -10.426 3.646   1.00 10.43 ? 315 PRO A N    2  
ATOM 10955  C CA   . PRO A 1 315 ? 16.193  -9.613  4.682   1.00 41.14 ? 315 PRO A CA   2  
ATOM 10956  C C    . PRO A 1 315 ? 16.404  -10.185 6.079   1.00 64.24 ? 315 PRO A C    2  
ATOM 10957  O O    . PRO A 1 315 ? 16.485  -11.401 6.257   1.00 64.15 ? 315 PRO A O    2  
ATOM 10958  C CB   . PRO A 1 315 ? 14.709  -9.656  4.305   1.00 34.23 ? 315 PRO A CB   2  
ATOM 10959  C CG   . PRO A 1 315 ? 14.559  -10.891 3.485   1.00 64.05 ? 315 PRO A CG   2  
ATOM 10960  C CD   . PRO A 1 315 ? 15.856  -11.056 2.745   1.00 23.21 ? 315 PRO A CD   2  
ATOM 10961  H HA   . PRO A 1 315 ? 16.544  -8.591  4.657   1.00 73.32 ? 315 PRO A HA   2  
ATOM 10962  H HB2  . PRO A 1 315 ? 14.109  -9.701  5.201   1.00 41.25 ? 315 PRO A HB2  2  
ATOM 10963  H HB3  . PRO A 1 315 ? 14.454  -8.774  3.737   1.00 64.31 ? 315 PRO A HB3  2  
ATOM 10964  H HG2  . PRO A 1 315 ? 14.383  -11.740 4.129   1.00 2.14  ? 315 PRO A HG2  2  
ATOM 10965  H HG3  . PRO A 1 315 ? 13.743  -10.773 2.788   1.00 12.25 ? 315 PRO A HG3  2  
ATOM 10966  H HD2  . PRO A 1 315 ? 16.079  -12.103 2.602   1.00 13.32 ? 315 PRO A HD2  2  
ATOM 10967  H HD3  . PRO A 1 315 ? 15.818  -10.542 1.797   1.00 51.13 ? 315 PRO A HD3  2  
ATOM 10968  N N    . LEU A 1 316 ? 16.495  -9.302  7.068   1.00 4.21  ? 316 LEU A N    2  
ATOM 10969  C CA   . LEU A 1 316 ? 16.698  -9.721  8.450   1.00 45.44 ? 316 LEU A CA   2  
ATOM 10970  C C    . LEU A 1 316 ? 15.463  -9.429  9.298   1.00 54.34 ? 316 LEU A C    2  
ATOM 10971  O O    . LEU A 1 316 ? 15.494  -8.574  10.185  1.00 11.23 ? 316 LEU A O    2  
ATOM 10972  C CB   . LEU A 1 316 ? 17.920  -9.015  9.043   1.00 55.20 ? 316 LEU A CB   2  
ATOM 10973  C CG   . LEU A 1 316 ? 19.254  -9.727  8.814   1.00 75.13 ? 316 LEU A CG   2  
ATOM 10974  C CD1  . LEU A 1 316 ? 20.386  -8.718  8.706   1.00 23.05 ? 316 LEU A CD1  2  
ATOM 10975  C CD2  . LEU A 1 316 ? 19.526  -10.720 9.934   1.00 2.11  ? 316 LEU A CD2  2  
ATOM 10976  H H    . LEU A 1 316 ? 16.423  -8.346  6.864   1.00 34.40 ? 316 LEU A H    2  
ATOM 10977  H HA   . LEU A 1 316 ? 16.876  -10.786 8.450   1.00 73.52 ? 316 LEU A HA   2  
ATOM 10978  H HB2  . LEU A 1 316 ? 17.983  -8.027  8.610   1.00 35.44 ? 316 LEU A HB2  2  
ATOM 10979  H HB3  . LEU A 1 316 ? 17.771  -8.914  10.107  1.00 71.34 ? 316 LEU A HB3  2  
ATOM 10980  H HG   . LEU A 1 316 ? 19.207  -10.276 7.884   1.00 42.31 ? 316 LEU A HG   2  
ATOM 10981  H HD11 . LEU A 1 316 ? 21.287  -9.143  9.123   1.00 21.12 ? 316 LEU A HD11 2  
ATOM 10982  H HD12 . LEU A 1 316 ? 20.125  -7.824  9.253   1.00 24.40 ? 316 LEU A HD12 2  
ATOM 10983  H HD13 . LEU A 1 316 ? 20.551  -8.471  7.669   1.00 14.53 ? 316 LEU A HD13 2  
ATOM 10984  H HD21 . LEU A 1 316 ? 20.308  -11.400 9.632   1.00 34.54 ? 316 LEU A HD21 2  
ATOM 10985  H HD22 . LEU A 1 316 ? 18.626  -11.278 10.147  1.00 23.34 ? 316 LEU A HD22 2  
ATOM 10986  H HD23 . LEU A 1 316 ? 19.836  -10.186 10.821  1.00 62.44 ? 316 LEU A HD23 2  
ATOM 10987  N N    . TYR A 1 317 ? 14.378  -10.145 9.022   1.00 31.02 ? 317 TYR A N    2  
ATOM 10988  C CA   . TYR A 1 317 ? 13.134  -9.963  9.762   1.00 24.33 ? 317 TYR A CA   2  
ATOM 10989  C C    . TYR A 1 317 ? 13.344  -10.242 11.246  1.00 12.24 ? 317 TYR A C    2  
ATOM 10990  O O    . TYR A 1 317 ? 12.700  -9.632  12.101  1.00 5.54  ? 317 TYR A O    2  
ATOM 10991  C CB   . TYR A 1 317 ? 12.046  -10.883 9.205   1.00 75.31 ? 317 TYR A CB   2  
ATOM 10992  C CG   . TYR A 1 317 ? 11.777  -10.679 7.731   1.00 52.44 ? 317 TYR A CG   2  
ATOM 10993  C CD1  . TYR A 1 317 ? 10.989  -9.624  7.289   1.00 21.20 ? 317 TYR A CD1  2  
ATOM 10994  C CD2  . TYR A 1 317 ? 12.309  -11.542 6.782   1.00 44.41 ? 317 TYR A CD2  2  
ATOM 10995  C CE1  . TYR A 1 317 ? 10.740  -9.435  5.943   1.00 15.10 ? 317 TYR A CE1  2  
ATOM 10996  C CE2  . TYR A 1 317 ? 12.066  -11.360 5.435   1.00 72.41 ? 317 TYR A CE2  2  
ATOM 10997  C CZ   . TYR A 1 317 ? 11.280  -10.306 5.020   1.00 52.14 ? 317 TYR A CZ   2  
ATOM 10998  O OH   . TYR A 1 317 ? 11.035  -10.120 3.679   1.00 11.14 ? 317 TYR A OH   2  
ATOM 10999  H H    . TYR A 1 317 ? 14.416  -10.812 8.305   1.00 61.53 ? 317 TYR A H    2  
ATOM 11000  H HA   . TYR A 1 317 ? 12.823  -8.936  9.640   1.00 52.21 ? 317 TYR A HA   2  
ATOM 11001  H HB2  . TYR A 1 317 ? 12.345  -11.910 9.348   1.00 11.11 ? 317 TYR A HB2  2  
ATOM 11002  H HB3  . TYR A 1 317 ? 11.125  -10.704 9.740   1.00 1.53  ? 317 TYR A HB3  2  
ATOM 11003  H HD1  . TYR A 1 317 ? 10.567  -8.944  8.014   1.00 73.24 ? 317 TYR A HD1  2  
ATOM 11004  H HD2  . TYR A 1 317 ? 12.925  -12.368 7.110   1.00 32.53 ? 317 TYR A HD2  2  
ATOM 11005  H HE1  . TYR A 1 317 ? 10.125  -8.609  5.619   1.00 41.54 ? 317 TYR A HE1  2  
ATOM 11006  H HE2  . TYR A 1 317 ? 12.490  -12.042 4.712   1.00 10.31 ? 317 TYR A HE2  2  
ATOM 11007  H HH   . TYR A 1 317 ? 11.266  -9.221  3.432   1.00 2.34  ? 317 TYR A HH   2  
ATOM 11008  N N    . GLU A 1 318 ? 14.249  -11.168 11.545  1.00 75.01 ? 318 GLU A N    2  
ATOM 11009  C CA   . GLU A 1 318 ? 14.546  -11.529 12.927  1.00 21.24 ? 318 GLU A CA   2  
ATOM 11010  C C    . GLU A 1 318 ? 15.066  -10.321 13.700  1.00 44.43 ? 318 GLU A C    2  
ATOM 11011  O O    . GLU A 1 318 ? 14.720  -10.119 14.864  1.00 20.33 ? 318 GLU A O    2  
ATOM 11012  C CB   . GLU A 1 318 ? 15.575  -12.659 12.972  1.00 15.13 ? 318 GLU A CB   2  
ATOM 11013  C CG   . GLU A 1 318 ? 14.956  -14.047 12.939  1.00 11.11 ? 318 GLU A CG   2  
ATOM 11014  C CD   . GLU A 1 318 ? 15.057  -14.699 11.573  1.00 4.54  ? 318 GLU A CD   2  
ATOM 11015  O OE1  . GLU A 1 318 ? 16.189  -14.832 11.061  1.00 33.13 ? 318 GLU A OE1  2  
ATOM 11016  O OE2  . GLU A 1 318 ? 14.005  -15.076 11.015  1.00 12.24 ? 318 GLU A OE2  2  
ATOM 11017  H H    . GLU A 1 318 ? 14.728  -11.618 10.819  1.00 13.50 ? 318 GLU A H    2  
ATOM 11018  H HA   . GLU A 1 318 ? 13.630  -11.868 13.387  1.00 42.12 ? 318 GLU A HA   2  
ATOM 11019  H HB2  . GLU A 1 318 ? 16.235  -12.564 12.122  1.00 4.33  ? 318 GLU A HB2  2  
ATOM 11020  H HB3  . GLU A 1 318 ? 16.154  -12.569 13.879  1.00 73.21 ? 318 GLU A HB3  2  
ATOM 11021  H HG2  . GLU A 1 318 ? 15.465  -14.672 13.657  1.00 14.24 ? 318 GLU A HG2  2  
ATOM 11022  H HG3  . GLU A 1 318 ? 13.913  -13.969 13.207  1.00 64.01 ? 318 GLU A HG3  2  
ATOM 11023  N N    . ASN A 1 319 ? 15.899  -9.521  13.042  1.00 1.41  ? 319 ASN A N    2  
ATOM 11024  C CA   . ASN A 1 319 ? 16.468  -8.331  13.665  1.00 34.33 ? 319 ASN A CA   2  
ATOM 11025  C C    . ASN A 1 319 ? 15.401  -7.260  13.863  1.00 3.11  ? 319 ASN A C    2  
ATOM 11026  O O    . ASN A 1 319 ? 15.319  -6.639  14.923  1.00 73.23 ? 319 ASN A O    2  
ATOM 11027  C CB   . ASN A 1 319 ? 17.610  -7.778  12.810  1.00 64.04 ? 319 ASN A CB   2  
ATOM 11028  C CG   . ASN A 1 319 ? 18.756  -7.249  13.650  1.00 75.22 ? 319 ASN A CG   2  
ATOM 11029  O OD1  . ASN A 1 319 ? 18.885  -7.584  14.827  1.00 53.31 ? 319 ASN A OD1  2  
ATOM 11030  N ND2  . ASN A 1 319 ? 19.596  -6.416  13.046  1.00 64.23 ? 319 ASN A ND2  2  
ATOM 11031  H H    . ASN A 1 319 ? 16.136  -9.737  12.116  1.00 34.42 ? 319 ASN A H    2  
ATOM 11032  H HA   . ASN A 1 319 ? 16.858  -8.616  14.630  1.00 10.40 ? 319 ASN A HA   2  
ATOM 11033  H HB2  . ASN A 1 319 ? 17.988  -8.565  12.175  1.00 33.02 ? 319 ASN A HB2  2  
ATOM 11034  H HB3  . ASN A 1 319 ? 17.235  -6.973  12.196  1.00 14.22 ? 319 ASN A HB3  2  
ATOM 11035  H HD21 . ASN A 1 319 ? 19.432  -6.194  12.106  1.00 0.13  ? 319 ASN A HD21 2  
ATOM 11036  H HD22 . ASN A 1 319 ? 20.346  -6.058  13.565  1.00 63.03 ? 319 ASN A HD22 2  
ATOM 11037  N N    . LEU A 1 320 ? 14.582  -7.050  12.836  1.00 13.10 ? 320 LEU A N    2  
ATOM 11038  C CA   . LEU A 1 320 ? 13.518  -6.054  12.897  1.00 44.21 ? 320 LEU A CA   2  
ATOM 11039  C C    . LEU A 1 320 ? 12.394  -6.514  13.820  1.00 12.14 ? 320 LEU A C    2  
ATOM 11040  O O    . LEU A 1 320 ? 11.713  -5.698  14.439  1.00 24.22 ? 320 LEU A O    2  
ATOM 11041  C CB   . LEU A 1 320 ? 12.966  -5.781  11.496  1.00 11.31 ? 320 LEU A CB   2  
ATOM 11042  C CG   . LEU A 1 320 ? 14.004  -5.335  10.466  1.00 25.30 ? 320 LEU A CG   2  
ATOM 11043  C CD1  . LEU A 1 320 ? 13.577  -5.746  9.065   1.00 40.32 ? 320 LEU A CD1  2  
ATOM 11044  C CD2  . LEU A 1 320 ? 14.215  -3.830  10.541  1.00 73.44 ? 320 LEU A CD2  2  
ATOM 11045  H H    . LEU A 1 320 ? 14.698  -7.576  12.019  1.00 35.41 ? 320 LEU A H    2  
ATOM 11046  H HA   . LEU A 1 320 ? 13.941  -5.141  13.291  1.00 60.03 ? 320 LEU A HA   2  
ATOM 11047  H HB2  . LEU A 1 320 ? 12.497  -6.686  11.136  1.00 24.33 ? 320 LEU A HB2  2  
ATOM 11048  H HB3  . LEU A 1 320 ? 12.214  -5.011  11.573  1.00 41.51 ? 320 LEU A HB3  2  
ATOM 11049  H HG   . LEU A 1 320 ? 14.947  -5.817  10.683  1.00 30.12 ? 320 LEU A HG   2  
ATOM 11050  H HD11 . LEU A 1 320 ? 14.202  -5.248  8.339   1.00 13.11 ? 320 LEU A HD11 2  
ATOM 11051  H HD12 . LEU A 1 320 ? 12.546  -5.466  8.907   1.00 64.53 ? 320 LEU A HD12 2  
ATOM 11052  H HD13 . LEU A 1 320 ? 13.681  -6.815  8.957   1.00 40.31 ? 320 LEU A HD13 2  
ATOM 11053  H HD21 . LEU A 1 320 ? 14.944  -3.531  9.803   1.00 54.33 ? 320 LEU A HD21 2  
ATOM 11054  H HD22 . LEU A 1 320 ? 14.571  -3.565  11.526  1.00 34.44 ? 320 LEU A HD22 2  
ATOM 11055  H HD23 . LEU A 1 320 ? 13.280  -3.326  10.349  1.00 42.43 ? 320 LEU A HD23 2  
ATOM 11056  N N    . ARG A 1 321 ? 12.206  -7.827  13.905  1.00 40.31 ? 321 ARG A N    2  
ATOM 11057  C CA   . ARG A 1 321 ? 11.164  -8.396  14.752  1.00 72.25 ? 321 ARG A CA   2  
ATOM 11058  C C    . ARG A 1 321 ? 11.540  -8.281  16.226  1.00 73.15 ? 321 ARG A C    2  
ATOM 11059  O O    . ARG A 1 321 ? 10.683  -8.045  17.079  1.00 23.52 ? 321 ARG A O    2  
ATOM 11060  C CB   . ARG A 1 321 ? 10.926  -9.862  14.387  1.00 2.43  ? 321 ARG A CB   2  
ATOM 11061  C CG   . ARG A 1 321 ? 10.083  -10.047 13.136  1.00 54.54 ? 321 ARG A CG   2  
ATOM 11062  C CD   . ARG A 1 321 ? 10.189  -11.465 12.597  1.00 45.43 ? 321 ARG A CD   2  
ATOM 11063  N NE   . ARG A 1 321 ? 9.076   -12.303 13.036  1.00 74.10 ? 321 ARG A NE   2  
ATOM 11064  C CZ   . ARG A 1 321 ? 8.810   -13.506 12.532  1.00 35.14 ? 321 ARG A CZ   2  
ATOM 11065  N NH1  . ARG A 1 321 ? 9.573   -14.014 11.572  1.00 24.03 ? 321 ARG A NH1  2  
ATOM 11066  N NH2  . ARG A 1 321 ? 7.777   -14.201 12.988  1.00 75.05 ? 321 ARG A NH2  2  
ATOM 11067  H H    . ARG A 1 321 ? 12.782  -8.426  13.386  1.00 62.15 ? 321 ARG A H    2  
ATOM 11068  H HA   . ARG A 1 321 ? 10.256  -7.839  14.579  1.00 12.43 ? 321 ARG A HA   2  
ATOM 11069  H HB2  . ARG A 1 321 ? 11.880  -10.342 14.226  1.00 75.15 ? 321 ARG A HB2  2  
ATOM 11070  H HB3  . ARG A 1 321 ? 10.423  -10.348 15.209  1.00 50.35 ? 321 ARG A HB3  2  
ATOM 11071  H HG2  . ARG A 1 321 ? 9.050   -9.841  13.375  1.00 25.40 ? 321 ARG A HG2  2  
ATOM 11072  H HG3  . ARG A 1 321 ? 10.424  -9.358  12.378  1.00 51.15 ? 321 ARG A HG3  2  
ATOM 11073  H HD2  . ARG A 1 321 ? 10.195  -11.427 11.518  1.00 61.21 ? 321 ARG A HD2  2  
ATOM 11074  H HD3  . ARG A 1 321 ? 11.115  -11.900 12.946  1.00 23.14 ? 321 ARG A HD3  2  
ATOM 11075  H HE   . ARG A 1 321 ? 8.496   -11.952 13.743  1.00 73.54 ? 321 ARG A HE   2  
ATOM 11076  H HH11 . ARG A 1 321 ? 10.353  -13.495 11.223  1.00 4.41  ? 321 ARG A HH11 2  
ATOM 11077  H HH12 . ARG A 1 321 ? 9.367   -14.918 11.197  1.00 53.41 ? 321 ARG A HH12 2  
ATOM 11078  H HH21 . ARG A 1 321 ? 7.199   -13.823 13.711  1.00 20.53 ? 321 ARG A HH21 2  
ATOM 11079  H HH22 . ARG A 1 321 ? 7.577   -15.105 12.609  1.00 65.22 ? 321 ARG A HH22 2  
ATOM 11080  N N    . ASP A 1 322 ? 12.824  -8.453  16.520  1.00 54.00 ? 322 ASP A N    2  
ATOM 11081  C CA   . ASP A 1 322 ? 13.313  -8.371  17.891  1.00 43.32 ? 322 ASP A CA   2  
ATOM 11082  C C    . ASP A 1 322 ? 13.274  -6.934  18.401  1.00 3.24  ? 322 ASP A C    2  
ATOM 11083  O O    . ASP A 1 322 ? 12.722  -6.658  19.467  1.00 24.34 ? 322 ASP A O    2  
ATOM 11084  C CB   . ASP A 1 322 ? 14.739  -8.916  17.980  1.00 74.10 ? 322 ASP A CB   2  
ATOM 11085  C CG   . ASP A 1 322 ? 14.773  -10.408 18.247  1.00 40.42 ? 322 ASP A CG   2  
ATOM 11086  O OD1  . ASP A 1 322 ? 14.569  -11.187 17.293  1.00 2.12  ? 322 ASP A OD1  2  
ATOM 11087  O OD2  . ASP A 1 322 ? 15.001  -10.798 19.412  1.00 60.53 ? 322 ASP A OD2  2  
ATOM 11088  H H    . ASP A 1 322 ? 13.458  -8.641  15.797  1.00 41.32 ? 322 ASP A H    2  
ATOM 11089  H HA   . ASP A 1 322 ? 12.667  -8.977  18.510  1.00 11.35 ? 322 ASP A HA   2  
ATOM 11090  H HB2  . ASP A 1 322 ? 15.249  -8.726  17.047  1.00 24.24 ? 322 ASP A HB2  2  
ATOM 11091  H HB3  . ASP A 1 322 ? 15.262  -8.413  18.780  1.00 13.53 ? 322 ASP A HB3  2  
ATOM 11092  N N    . ILE A 1 323 ? 13.864  -6.022  17.636  1.00 30.04 ? 323 ILE A N    2  
ATOM 11093  C CA   . ILE A 1 323 ? 13.898  -4.612  18.012  1.00 4.42  ? 323 ILE A CA   2  
ATOM 11094  C C    . ILE A 1 323 ? 12.489  -4.056  18.194  1.00 55.53 ? 323 ILE A C    2  
ATOM 11095  O O    . ILE A 1 323 ? 12.257  -3.195  19.044  1.00 70.21 ? 323 ILE A O    2  
ATOM 11096  C CB   . ILE A 1 323 ? 14.642  -3.764  16.963  1.00 74.03 ? 323 ILE A CB   2  
ATOM 11097  C CG1  . ILE A 1 323 ? 14.157  -4.111  15.552  1.00 74.12 ? 323 ILE A CG1  2  
ATOM 11098  C CG2  . ILE A 1 323 ? 16.144  -3.975  17.082  1.00 61.55 ? 323 ILE A CG2  2  
ATOM 11099  C CD1  . ILE A 1 323 ? 13.492  -2.952  14.841  1.00 43.43 ? 323 ILE A CD1  2  
ATOM 11100  H H    . ILE A 1 323 ? 14.288  -6.302  16.799  1.00 72.34 ? 323 ILE A H    2  
ATOM 11101  H HA   . ILE A 1 323 ? 14.428  -4.533  18.950  1.00 31.45 ? 323 ILE A HA   2  
ATOM 11102  H HB   . ILE A 1 323 ? 14.434  -2.724  17.161  1.00 63.23 ? 323 ILE A HB   2  
ATOM 11103  H HG12 . ILE A 1 323 ? 15.000  -4.425  14.954  1.00 54.34 ? 323 ILE A HG12 2  
ATOM 11104  H HG13 . ILE A 1 323 ? 13.443  -4.919  15.610  1.00 22.13 ? 323 ILE A HG13 2  
ATOM 11105  H HG21 . ILE A 1 323 ? 16.529  -3.373  17.891  1.00 2.35  ? 323 ILE A HG21 2  
ATOM 11106  H HG22 . ILE A 1 323 ? 16.623  -3.685  16.159  1.00 20.33 ? 323 ILE A HG22 2  
ATOM 11107  H HG23 . ILE A 1 323 ? 16.347  -5.017  17.280  1.00 10.13 ? 323 ILE A HG23 2  
ATOM 11108  H HD11 . ILE A 1 323 ? 12.509  -3.251  14.508  1.00 1.30  ? 323 ILE A HD11 2  
ATOM 11109  H HD12 . ILE A 1 323 ? 14.088  -2.663  13.988  1.00 60.12 ? 323 ILE A HD12 2  
ATOM 11110  H HD13 . ILE A 1 323 ? 13.404  -2.117  15.519  1.00 24.32 ? 323 ILE A HD13 2  
ATOM 11111  N N    . LEU A 1 324 ? 11.551  -4.553  17.394  1.00 3.02  ? 324 LEU A N    2  
ATOM 11112  C CA   . LEU A 1 324 ? 10.166  -4.104  17.471  1.00 14.51 ? 324 LEU A CA   2  
ATOM 11113  C C    . LEU A 1 324 ? 9.547   -4.485  18.813  1.00 43.23 ? 324 LEU A C    2  
ATOM 11114  O O    . LEU A 1 324 ? 9.068   -3.626  19.554  1.00 21.12 ? 324 LEU A O    2  
ATOM 11115  C CB   . LEU A 1 324 ? 9.348   -4.708  16.328  1.00 34.44 ? 324 LEU A CB   2  
ATOM 11116  C CG   . LEU A 1 324 ? 9.449   -3.964  14.996  1.00 53.12 ? 324 LEU A CG   2  
ATOM 11117  C CD1  . LEU A 1 324 ? 8.831   -4.786  13.876  1.00 40.15 ? 324 LEU A CD1  2  
ATOM 11118  C CD2  . LEU A 1 324 ? 8.775   -2.603  15.094  1.00 34.33 ? 324 LEU A CD2  2  
ATOM 11119  H H    . LEU A 1 324 ? 11.797  -5.239  16.738  1.00 53.10 ? 324 LEU A H    2  
ATOM 11120  H HA   . LEU A 1 324 ? 10.160  -3.028  17.377  1.00 3.43  ? 324 LEU A HA   2  
ATOM 11121  H HB2  . LEU A 1 324 ? 9.678   -5.725  16.176  1.00 33.44 ? 324 LEU A HB2  2  
ATOM 11122  H HB3  . LEU A 1 324 ? 8.310   -4.725  16.627  1.00 53.52 ? 324 LEU A HB3  2  
ATOM 11123  H HG   . LEU A 1 324 ? 10.491  -3.806  14.757  1.00 14.12 ? 324 LEU A HG   2  
ATOM 11124  H HD11 . LEU A 1 324 ? 9.098   -5.826  14.004  1.00 51.45 ? 324 LEU A HD11 2  
ATOM 11125  H HD12 . LEU A 1 324 ? 9.201   -4.434  12.925  1.00 32.41 ? 324 LEU A HD12 2  
ATOM 11126  H HD13 . LEU A 1 324 ? 7.757   -4.684  13.905  1.00 71.14 ? 324 LEU A HD13 2  
ATOM 11127  H HD21 . LEU A 1 324 ? 8.628   -2.201  14.103  1.00 13.33 ? 324 LEU A HD21 2  
ATOM 11128  H HD22 . LEU A 1 324 ? 9.401   -1.932  15.665  1.00 14.31 ? 324 LEU A HD22 2  
ATOM 11129  H HD23 . LEU A 1 324 ? 7.820   -2.709  15.585  1.00 72.44 ? 324 LEU A HD23 2  
ATOM 11130  N N    . LEU A 1 325 ? 9.566   -5.777  19.119  1.00 13.24 ? 325 LEU A N    2  
ATOM 11131  C CA   . LEU A 1 325 ? 9.011   -6.272  20.373  1.00 2.42  ? 325 LEU A CA   2  
ATOM 11132  C C    . LEU A 1 325 ? 9.732   -5.649  21.564  1.00 54.24 ? 325 LEU A C    2  
ATOM 11133  O O    . LEU A 1 325 ? 9.135   -5.419  22.615  1.00 10.24 ? 325 LEU A O    2  
ATOM 11134  C CB   . LEU A 1 325 ? 9.117   -7.797  20.438  1.00 34.42 ? 325 LEU A CB   2  
ATOM 11135  C CG   . LEU A 1 325 ? 8.022   -8.555  19.684  1.00 61.41 ? 325 LEU A CG   2  
ATOM 11136  C CD1  . LEU A 1 325 ? 8.555   -9.879  19.160  1.00 11.12 ? 325 LEU A CD1  2  
ATOM 11137  C CD2  . LEU A 1 325 ? 6.817   -8.781  20.584  1.00 3.24  ? 325 LEU A CD2  2  
ATOM 11138  H H    . LEU A 1 325 ? 9.964   -6.412  18.488  1.00 2.32  ? 325 LEU A H    2  
ATOM 11139  H HA   . LEU A 1 325 ? 7.969   -5.989  20.410  1.00 3.11  ? 325 LEU A HA   2  
ATOM 11140  H HB2  . LEU A 1 325 ? 10.074  -8.087  20.029  1.00 44.03 ? 325 LEU A HB2  2  
ATOM 11141  H HB3  . LEU A 1 325 ? 9.082   -8.096  21.474  1.00 71.41 ? 325 LEU A HB3  2  
ATOM 11142  H HG   . LEU A 1 325 ? 7.703   -7.965  18.837  1.00 53.14 ? 325 LEU A HG   2  
ATOM 11143  H HD11 . LEU A 1 325 ? 7.762   -10.613 19.165  1.00 30.50 ? 325 LEU A HD11 2  
ATOM 11144  H HD12 . LEU A 1 325 ? 9.364   -10.217 19.790  1.00 34.04 ? 325 LEU A HD12 2  
ATOM 11145  H HD13 . LEU A 1 325 ? 8.916   -9.747  18.150  1.00 75.11 ? 325 LEU A HD13 2  
ATOM 11146  H HD21 . LEU A 1 325 ? 7.118   -9.345  21.454  1.00 25.22 ? 325 LEU A HD21 2  
ATOM 11147  H HD22 . LEU A 1 325 ? 6.061   -9.331  20.042  1.00 12.32 ? 325 LEU A HD22 2  
ATOM 11148  H HD23 . LEU A 1 325 ? 6.415   -7.828  20.894  1.00 31.24 ? 325 LEU A HD23 2  
ATOM 11149  N N    . GLN A 1 326 ? 11.020  -5.377  21.388  1.00 63.25 ? 326 GLN A N    2  
ATOM 11150  C CA   . GLN A 1 326 ? 11.827  -4.779  22.444  1.00 1.11  ? 326 GLN A CA   2  
ATOM 11151  C C    . GLN A 1 326 ? 11.463  -3.311  22.641  1.00 51.41 ? 326 GLN A C    2  
ATOM 11152  O O    . GLN A 1 326 ? 11.493  -2.799  23.760  1.00 24.23 ? 326 GLN A O    2  
ATOM 11153  C CB   . GLN A 1 326 ? 13.316  -4.907  22.113  1.00 53.11 ? 326 GLN A CB   2  
ATOM 11154  C CG   . GLN A 1 326 ? 14.191  -5.140  23.333  1.00 13.11 ? 326 GLN A CG   2  
ATOM 11155  C CD   . GLN A 1 326 ? 15.253  -6.196  23.096  1.00 71.23 ? 326 GLN A CD   2  
ATOM 11156  O OE1  . GLN A 1 326 ? 16.445  -5.893  23.041  1.00 0.12  ? 326 GLN A OE1  2  
ATOM 11157  N NE2  . GLN A 1 326 ? 14.824  -7.444  22.951  1.00 14.35 ? 326 GLN A NE2  2  
ATOM 11158  H H    . GLN A 1 326 ? 11.439  -5.583  20.526  1.00 41.14 ? 326 GLN A H    2  
ATOM 11159  H HA   . GLN A 1 326 ? 11.623  -5.314  23.359  1.00 2.31  ? 326 GLN A HA   2  
ATOM 11160  H HB2  . GLN A 1 326 ? 13.451  -5.736  21.435  1.00 23.42 ? 326 GLN A HB2  2  
ATOM 11161  H HB3  . GLN A 1 326 ? 13.644  -3.999  21.629  1.00 62.43 ? 326 GLN A HB3  2  
ATOM 11162  H HG2  . GLN A 1 326 ? 14.679  -4.213  23.593  1.00 53.43 ? 326 GLN A HG2  2  
ATOM 11163  H HG3  . GLN A 1 326 ? 13.565  -5.459  24.154  1.00 35.32 ? 326 GLN A HG3  2  
ATOM 11164  H HE21 . GLN A 1 326 ? 13.860  -7.612  23.006  1.00 61.11 ? 326 GLN A HE21 2  
ATOM 11165  H HE22 . GLN A 1 326 ? 15.490  -8.148  22.796  1.00 53.35 ? 326 GLN A HE22 2  
ATOM 11166  N N    . GLY A 1 327 ? 11.118  -2.638  21.546  1.00 63.11 ? 327 GLY A N    2  
ATOM 11167  C CA   . GLY A 1 327 ? 10.754  -1.234  21.622  1.00 32.45 ? 327 GLY A CA   2  
ATOM 11168  C C    . GLY A 1 327 ? 9.591   -0.987  22.562  1.00 41.11 ? 327 GLY A C    2  
ATOM 11169  O O    . GLY A 1 327 ? 9.651   -0.103  23.417  1.00 32.50 ? 327 GLY A O    2  
ATOM 11170  H H    . GLY A 1 327 ? 11.112  -3.094  20.680  1.00 41.24 ? 327 GLY A H    2  
ATOM 11171  H HA2  . GLY A 1 327 ? 11.607  -0.670  21.967  1.00 45.03 ? 327 GLY A HA2  2  
ATOM 11172  H HA3  . GLY A 1 327 ? 10.483  -0.891  20.635  1.00 63.23 ? 327 GLY A HA3  2  
ATOM 11173  N N    . LEU A 1 328 ? 8.534   -1.778  22.414  1.00 51.42 ? 328 LEU A N    2  
ATOM 11174  C CA   . LEU A 1 328 ? 7.360   -1.643  23.267  1.00 33.53 ? 328 LEU A CA   2  
ATOM 11175  C C    . LEU A 1 328 ? 7.677   -2.107  24.684  1.00 62.00 ? 328 LEU A C    2  
ATOM 11176  O O    . LEU A 1 328 ? 7.214   -1.520  25.661  1.00 33.45 ? 328 LEU A O    2  
ATOM 11177  C CB   . LEU A 1 328 ? 6.183   -2.443  22.699  1.00 72.11 ? 328 LEU A CB   2  
ATOM 11178  C CG   . LEU A 1 328 ? 6.494   -3.894  22.323  1.00 62.30 ? 328 LEU A CG   2  
ATOM 11179  C CD1  . LEU A 1 328 ? 6.269   -4.815  23.511  1.00 50.55 ? 328 LEU A CD1  2  
ATOM 11180  C CD2  . LEU A 1 328 ? 5.640   -4.330  21.141  1.00 74.21 ? 328 LEU A CD2  2  
ATOM 11181  H H    . LEU A 1 328 ? 8.547   -2.474  21.725  1.00 14.44 ? 328 LEU A H    2  
ATOM 11182  H HA   . LEU A 1 328 ? 7.091   -0.598  23.297  1.00 34.02 ? 328 LEU A HA   2  
ATOM 11183  H HB2  . LEU A 1 328 ? 5.391   -2.447  23.436  1.00 22.40 ? 328 LEU A HB2  2  
ATOM 11184  H HB3  . LEU A 1 328 ? 5.825   -1.936  21.816  1.00 2.23  ? 328 LEU A HB3  2  
ATOM 11185  H HG   . LEU A 1 328 ? 7.531   -3.972  22.034  1.00 32.30 ? 328 LEU A HG   2  
ATOM 11186  H HD11 . LEU A 1 328 ? 5.558   -4.365  24.186  1.00 23.22 ? 328 LEU A HD11 2  
ATOM 11187  H HD12 . LEU A 1 328 ? 7.205   -4.971  24.027  1.00 11.23 ? 328 LEU A HD12 2  
ATOM 11188  H HD13 . LEU A 1 328 ? 5.887   -5.764  23.165  1.00 54.12 ? 328 LEU A HD13 2  
ATOM 11189  H HD21 . LEU A 1 328 ? 4.732   -3.746  21.119  1.00 30.15 ? 328 LEU A HD21 2  
ATOM 11190  H HD22 . LEU A 1 328 ? 5.393   -5.376  21.241  1.00 51.20 ? 328 LEU A HD22 2  
ATOM 11191  H HD23 . LEU A 1 328 ? 6.189   -4.176  20.224  1.00 72.23 ? 328 LEU A HD23 2  
ATOM 11192  N N    . LYS A 1 329 ? 8.478   -3.163  24.785  1.00 44.52 ? 329 LYS A N    2  
ATOM 11193  C CA   . LYS A 1 329 ? 8.869   -3.705  26.081  1.00 74.15 ? 329 LYS A CA   2  
ATOM 11194  C C    . LYS A 1 329 ? 9.749   -2.711  26.830  1.00 24.15 ? 329 LYS A C    2  
ATOM 11195  O O    . LYS A 1 329 ? 9.714   -2.637  28.059  1.00 42.34 ? 329 LYS A O    2  
ATOM 11196  C CB   . LYS A 1 329 ? 9.609   -5.033  25.901  1.00 2.23  ? 329 LYS A CB   2  
ATOM 11197  C CG   . LYS A 1 329 ? 8.728   -6.253  26.115  1.00 35.33 ? 329 LYS A CG   2  
ATOM 11198  C CD   . LYS A 1 329 ? 9.506   -7.544  25.913  1.00 0.12  ? 329 LYS A CD   2  
ATOM 11199  C CE   . LYS A 1 329 ? 9.939   -8.145  27.241  1.00 62.45 ? 329 LYS A CE   2  
ATOM 11200  N NZ   . LYS A 1 329 ? 9.854   -9.632  27.232  1.00 65.43 ? 329 LYS A NZ   2  
ATOM 11201  H H    . LYS A 1 329 ? 8.817   -3.584  23.967  1.00 24.32 ? 329 LYS A H    2  
ATOM 11202  H HA   . LYS A 1 329 ? 7.970   -3.876  26.653  1.00 14.04 ? 329 LYS A HA   2  
ATOM 11203  H HB2  . LYS A 1 329 ? 10.010  -5.076  24.900  1.00 44.14 ? 329 LYS A HB2  2  
ATOM 11204  H HB3  . LYS A 1 329 ? 10.425  -5.076  26.608  1.00 24.23 ? 329 LYS A HB3  2  
ATOM 11205  H HG2  . LYS A 1 329 ? 8.338   -6.232  27.122  1.00 14.55 ? 329 LYS A HG2  2  
ATOM 11206  H HG3  . LYS A 1 329 ? 7.910   -6.222  25.410  1.00 45.41 ? 329 LYS A HG3  2  
ATOM 11207  H HD2  . LYS A 1 329 ? 8.879   -8.254  25.396  1.00 74.01 ? 329 LYS A HD2  2  
ATOM 11208  H HD3  . LYS A 1 329 ? 10.384  -7.335  25.320  1.00 55.22 ? 329 LYS A HD3  2  
ATOM 11209  H HE2  . LYS A 1 329 ? 10.961  -7.855  27.438  1.00 20.42 ? 329 LYS A HE2  2  
ATOM 11210  H HE3  . LYS A 1 329 ? 9.300   -7.761  28.022  1.00 51.52 ? 329 LYS A HE3  2  
ATOM 11211  H HZ1  . LYS A 1 329 ? 10.614  -10.038 27.815  1.00 63.42 ? 329 LYS A HZ1  2  
ATOM 11212  H HZ2  . LYS A 1 329 ? 9.950   -9.989  26.259  1.00 4.42  ? 329 LYS A HZ2  2  
ATOM 11213  H HZ3  . LYS A 1 329 ? 8.936   -9.939  27.613  1.00 23.14 ? 329 LYS A HZ3  2  
ATOM 11214  N N    . ALA A 1 330 ? 10.536  -1.945  26.080  1.00 45.14 ? 330 ALA A N    2  
ATOM 11215  C CA   . ALA A 1 330 ? 11.424  -0.951  26.671  1.00 64.34 ? 330 ALA A CA   2  
ATOM 11216  C C    . ALA A 1 330 ? 10.625  0.176   27.316  1.00 74.54 ? 330 ALA A C    2  
ATOM 11217  O O    . ALA A 1 330 ? 11.027  0.731   28.339  1.00 24.43 ? 330 ALA A O    2  
ATOM 11218  C CB   . ALA A 1 330 ? 12.369  -0.394  25.616  1.00 5.14  ? 330 ALA A CB   2  
ATOM 11219  H H    . ALA A 1 330 ? 10.517  -2.050  25.107  1.00 54.11 ? 330 ALA A H    2  
ATOM 11220  H HA   . ALA A 1 330 ? 12.017  -1.441  27.430  1.00 64.52 ? 330 ALA A HA   2  
ATOM 11221  H HB1  . ALA A 1 330 ? 11.906  0.451   25.129  1.00 3.40  ? 330 ALA A HB1  2  
ATOM 11222  H HB2  . ALA A 1 330 ? 12.582  -1.160  24.884  1.00 0.32  ? 330 ALA A HB2  2  
ATOM 11223  H HB3  . ALA A 1 330 ? 13.288  -0.079  26.086  1.00 61.44 ? 330 ALA A HB3  2  
ATOM 11224  N N    . ILE A 1 331 ? 9.487   0.507   26.711  1.00 45.32 ? 331 ILE A N    2  
ATOM 11225  C CA   . ILE A 1 331 ? 8.626   1.567   27.226  1.00 53.22 ? 331 ILE A CA   2  
ATOM 11226  C C    . ILE A 1 331 ? 7.586   1.018   28.201  1.00 55.41 ? 331 ILE A C    2  
ATOM 11227  O O    . ILE A 1 331 ? 6.508   1.590   28.359  1.00 4.10  ? 331 ILE A O    2  
ATOM 11228  C CB   . ILE A 1 331 ? 7.899   2.302   26.083  1.00 32.52 ? 331 ILE A CB   2  
ATOM 11229  C CG1  . ILE A 1 331 ? 7.064   1.317   25.263  1.00 71.04 ? 331 ILE A CG1  2  
ATOM 11230  C CG2  . ILE A 1 331 ? 8.902   3.023   25.194  1.00 72.30 ? 331 ILE A CG2  2  
ATOM 11231  C CD1  . ILE A 1 331 ? 6.147   1.988   24.263  1.00 22.14 ? 331 ILE A CD1  2  
ATOM 11232  H H    . ILE A 1 331 ? 9.221   0.028   25.898  1.00 24.01 ? 331 ILE A H    2  
ATOM 11233  H HA   . ILE A 1 331 ? 9.250   2.280   27.743  1.00 22.34 ? 331 ILE A HA   2  
ATOM 11234  H HB   . ILE A 1 331 ? 7.245   3.042   26.520  1.00 54.04 ? 331 ILE A HB   2  
ATOM 11235  H HG12 . ILE A 1 331 ? 7.726   0.661   24.717  1.00 12.50 ? 331 ILE A HG12 2  
ATOM 11236  H HG13 . ILE A 1 331 ? 6.453   0.729   25.932  1.00 21.02 ? 331 ILE A HG13 2  
ATOM 11237  H HG21 . ILE A 1 331 ? 9.583   2.304   24.762  1.00 71.55 ? 331 ILE A HG21 2  
ATOM 11238  H HG22 . ILE A 1 331 ? 9.459   3.735   25.785  1.00 70.41 ? 331 ILE A HG22 2  
ATOM 11239  H HG23 . ILE A 1 331 ? 8.377   3.540   24.406  1.00 73.21 ? 331 ILE A HG23 2  
ATOM 11240  H HD11 . ILE A 1 331 ? 6.008   1.340   23.410  1.00 63.13 ? 331 ILE A HD11 2  
ATOM 11241  H HD12 . ILE A 1 331 ? 6.589   2.919   23.939  1.00 34.32 ? 331 ILE A HD12 2  
ATOM 11242  H HD13 . ILE A 1 331 ? 5.192   2.185   24.726  1.00 73.30 ? 331 ILE A HD13 2  
ATOM 11243  N N    . GLY A 1 332 ? 7.918   -0.091  28.859  1.00 12.42 ? 332 GLY A N    2  
ATOM 11244  C CA   . GLY A 1 332 ? 7.005   -0.694  29.813  1.00 20.51 ? 332 GLY A CA   2  
ATOM 11245  C C    . GLY A 1 332 ? 5.627   -0.945  29.228  1.00 55.55 ? 332 GLY A C    2  
ATOM 11246  O O    . GLY A 1 332 ?