data_2LB1
# 
_entry.id   2LB1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LB1         
RCSB  RCSB102177   
BMRB  17543        
WWPDB D_1000102177 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
17543 BMRB unspecified . 
2LAW  PDB  unspecified . 
2LAX  PDB  unspecified . 
2LAY  PDB  unspecified . 
2LAZ  PDB  unspecified . 
2LB0  PDB  unspecified . 
2LB2  PDB  unspecified . 
2LB3  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LB1 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-22 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Macias, M.J.'    1 
'Aragon, E.'      2 
'Goerner, N.'     3 
'Zaromytidou, A.' 4 
'Xi, Q.'          5 
'Escobedo, A.'    6 
'Massague, J.'    7 
# 
_citation.id                        primary 
_citation.title                     'A Smad action turnover switch operated by WW domain readers of a phosphoserine code.' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            25 
_citation.page_first                1275 
_citation.page_last                 1288 
_citation.year                      2011 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21685363 
_citation.pdbx_database_id_DOI      10.1101/gad.2060811 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Aragon, E.'        1 
primary 'Goerner, N.'       2 
primary 'Zaromytidou, A.I.' 3 
primary 'Xi, Q.'            4 
primary 'Escobedo, A.'      5 
primary 'Massague, J.'      6 
primary 'Macias, M.J.'      7 
# 
_cell.entry_id           2LB1 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2LB1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'E3 ubiquitin-protein ligase SMURF1'        4170.647 1 6.3.2.- ? 'residues 305-339' ? 
2 polymer syn 'Mothers against decapentaplegic homolog 1' 1477.592 1 ?       ? 'residues 221-233' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'hSMURF1, SMAD ubiquitination regulatory factor 1, SMAD-specific E3 ubiquitin-protein ligase 1' 
2 
;MAD homolog 1, Mothers against DPP homolog 1, JV4-1, Mad-related protein 1, SMAD family member 1, SMAD 1, Smad1, hSMAD1, Transforming growth factor-beta-signaling protein 1, BSP-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH A ? 
2 'polypeptide(L)' no yes 'ADTPPPAYLPPEDP(NH2)'                ADTPPPAYLPPEDPX                      B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LEU n 
1 2  GLY n 
1 3  PRO n 
1 4  LEU n 
1 5  PRO n 
1 6  PRO n 
1 7  GLY n 
1 8  TRP n 
1 9  GLU n 
1 10 VAL n 
1 11 ARG n 
1 12 SER n 
1 13 THR n 
1 14 VAL n 
1 15 SER n 
1 16 GLY n 
1 17 ARG n 
1 18 ILE n 
1 19 TYR n 
1 20 PHE n 
1 21 VAL n 
1 22 ASP n 
1 23 HIS n 
1 24 ASN n 
1 25 ASN n 
1 26 ARG n 
1 27 THR n 
1 28 THR n 
1 29 GLN n 
1 30 PHE n 
1 31 THR n 
1 32 ASP n 
1 33 PRO n 
1 34 ARG n 
1 35 LEU n 
1 36 HIS n 
2 1  ALA n 
2 2  ASP n 
2 3  THR n 
2 4  PRO n 
2 5  PRO n 
2 6  PRO n 
2 7  ALA n 
2 8  TYR n 
2 9  LEU n 
2 10 PRO n 
2 11 PRO n 
2 12 GLU n 
2 13 ASP n 
2 14 PRO n 
2 15 NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SMURF1, KIAA1625' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pETM11 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SMUF1_HUMAN Q9HCE7 1 LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH 305 ? 
2 UNP SMAD1_HUMAN Q15797 2 ADTPPPAYLPPEDP                       220 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LB1 A 1 ? 36 ? Q9HCE7 305 ? 340 ? 279 314 
2 2 2LB1 B 1 ? 14 ? Q15797 220 ? 233 ? 220 233 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             2LB1 
_struct_ref_seq_dif.mon_id                       NH2 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      15 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q15797 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      INSERTION 
_struct_ref_seq_dif.pdbx_auth_seq_num            234 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-1H NOESY' 
1 2 1 '2D 1H-1H TOCSY' 
1 3 3 '3D CBCA(CO)NH'  
1 4 3 '3D HNCACB'      
1 5 2 '2D 1H-15N HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.420 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         285 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 
'1 mM [U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 2 
'90% H2O/10% D2O' 
;1 mM [U-100% 13C; U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O
;
3 '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DRX' 
# 
_pdbx_nmr_refine.entry_id           2LB1 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with acceptable covalent geometry' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LB1 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LB1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS     1.3 1 
'Bartels et al.'                                    'chemical shift assignment' XEASY   ?   2 
'Bruker Biospin'                                    collection                  TOPSPIN ?   3 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe ?   4 
?                                                   refinement                  CNS     ?   5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Structure of the first domain of human Smurf1 in complex with a human Smad1 derived peptide.' 
_exptl.entry_id                   2LB1 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LB1 
_struct.title                     'Structure of the second domain of human Smurf1 in complex with a human Smad1 derived peptide' 
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase SMURF1 (E.C.6.3.2.-), Mothers against decapentaplegic homolog 1' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LB1 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/TRANSCRIPTION' 
_struct_keywords.text            'SMURF, SMAD, CDK, signal transduction, SIGNALING PROTEIN-TRANSCRIPTION complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           B 
_struct_conn.ptnr1_label_comp_id           PRO 
_struct_conn.ptnr1_label_seq_id            14 
_struct_conn.ptnr1_label_atom_id           C 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           NH2 
_struct_conn.ptnr2_label_seq_id            15 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            PRO 
_struct_conn.ptnr1_auth_seq_id             233 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            NH2 
_struct_conn.ptnr2_auth_seq_id             234 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.322 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 8  ? THR A 13 ? TRP A 286 THR A 291 
A 2 ARG A 17 ? ASP A 22 ? ARG A 295 ASP A 300 
A 3 THR A 27 ? GLN A 29 ? THR A 305 GLN A 307 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 9  ? N GLU A 287 O VAL A 21 ? O VAL A 299 
A 2 3 N PHE A 20 ? N PHE A 298 O GLN A 29 ? O GLN A 307 
# 
_atom_sites.entry_id                    2LB1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . LEU A 1 1  ? -13.582 1.050   -1.301  1.00 15.00 ?  279 LEU A N    1  
ATOM   2     C CA   . LEU A 1 1  ? -14.921 1.557   -1.676  1.00 15.00 ?  279 LEU A CA   1  
ATOM   3     C C    . LEU A 1 1  ? -15.254 2.856   -0.948  1.00 15.00 ?  279 LEU A C    1  
ATOM   4     O O    . LEU A 1 1  ? -16.321 3.433   -1.170  1.00 15.00 ?  279 LEU A O    1  
ATOM   5     C CB   . LEU A 1 1  ? -16.005 0.511   -1.373  1.00 15.00 ?  279 LEU A CB   1  
ATOM   6     C CG   . LEU A 1 1  ? -16.084 -0.682  -2.337  1.00 15.00 ?  279 LEU A CG   1  
ATOM   7     C CD1  . LEU A 1 1  ? -16.221 -0.206  -3.774  1.00 15.00 ?  279 LEU A CD1  1  
ATOM   8     C CD2  . LEU A 1 1  ? -14.877 -1.597  -2.186  1.00 15.00 ?  279 LEU A CD2  1  
ATOM   9     H H1   . LEU A 1 1  ? -12.888 1.824   -1.327  1.00 15.00 ?  279 LEU A H1   1  
ATOM   10    H H2   . LEU A 1 1  ? -13.279 0.321   -1.984  1.00 15.00 ?  279 LEU A H2   1  
ATOM   11    H H3   . LEU A 1 1  ? -13.598 0.634   -0.343  1.00 15.00 ?  279 LEU A H3   1  
ATOM   12    H HA   . LEU A 1 1  ? -14.916 1.752   -2.739  1.00 15.00 ?  279 LEU A HA   1  
ATOM   13    H HB2  . LEU A 1 1  ? -15.832 0.127   -0.379  1.00 15.00 ?  279 LEU A HB2  1  
ATOM   14    H HB3  . LEU A 1 1  ? -16.963 1.010   -1.382  1.00 15.00 ?  279 LEU A HB3  1  
ATOM   15    H HG   . LEU A 1 1  ? -16.966 -1.258  -2.099  1.00 15.00 ?  279 LEU A HG   1  
ATOM   16    H HD11 . LEU A 1 1  ? -16.257 -1.059  -4.434  1.00 15.00 ?  279 LEU A HD11 1  
ATOM   17    H HD12 . LEU A 1 1  ? -15.373 0.413   -4.030  1.00 15.00 ?  279 LEU A HD12 1  
ATOM   18    H HD13 . LEU A 1 1  ? -17.130 0.368   -3.878  1.00 15.00 ?  279 LEU A HD13 1  
ATOM   19    H HD21 . LEU A 1 1  ? -14.831 -1.968  -1.173  1.00 15.00 ?  279 LEU A HD21 1  
ATOM   20    H HD22 . LEU A 1 1  ? -13.976 -1.044  -2.408  1.00 15.00 ?  279 LEU A HD22 1  
ATOM   21    H HD23 . LEU A 1 1  ? -14.967 -2.429  -2.870  1.00 15.00 ?  279 LEU A HD23 1  
ATOM   22    N N    . GLY A 1 2  ? -14.351 3.335   -0.097  1.00 15.00 ?  280 GLY A N    1  
ATOM   23    C CA   . GLY A 1 2  ? -14.637 4.550   0.639   1.00 15.00 ?  280 GLY A CA   1  
ATOM   24    C C    . GLY A 1 2  ? -13.424 5.185   1.300   1.00 15.00 ?  280 GLY A C    1  
ATOM   25    O O    . GLY A 1 2  ? -12.681 5.929   0.658   1.00 15.00 ?  280 GLY A O    1  
ATOM   26    H H    . GLY A 1 2  ? -13.493 2.873   0.026   1.00 15.00 ?  280 GLY A H    1  
ATOM   27    H HA2  . GLY A 1 2  ? -15.069 5.268   -0.042  1.00 15.00 ?  280 GLY A HA2  1  
ATOM   28    H HA3  . GLY A 1 2  ? -15.367 4.322   1.404   1.00 15.00 ?  280 GLY A HA3  1  
ATOM   29    N N    . PRO A 1 3  ? -13.196 4.894   2.588   1.00 15.00 ?  281 PRO A N    1  
ATOM   30    C CA   . PRO A 1 3  ? -12.247 5.630   3.428   1.00 15.00 ?  281 PRO A CA   1  
ATOM   31    C C    . PRO A 1 3  ? -10.818 5.081   3.416   1.00 15.00 ?  281 PRO A C    1  
ATOM   32    O O    . PRO A 1 3  ? -10.594 3.881   3.259   1.00 15.00 ?  281 PRO A O    1  
ATOM   33    C CB   . PRO A 1 3  ? -12.860 5.441   4.809   1.00 15.00 ?  281 PRO A CB   1  
ATOM   34    C CG   . PRO A 1 3  ? -13.429 4.062   4.773   1.00 15.00 ?  281 PRO A CG   1  
ATOM   35    C CD   . PRO A 1 3  ? -13.865 3.819   3.348   1.00 15.00 ?  281 PRO A CD   1  
ATOM   36    H HA   . PRO A 1 3  ? -12.232 6.683   3.183   1.00 15.00 ?  281 PRO A HA   1  
ATOM   37    H HB2  . PRO A 1 3  ? -12.093 5.536   5.565   1.00 15.00 ?  281 PRO A HB2  1  
ATOM   38    H HB3  . PRO A 1 3  ? -13.629 6.180   4.971   1.00 15.00 ?  281 PRO A HB3  1  
ATOM   39    H HG2  . PRO A 1 3  ? -12.669 3.346   5.055   1.00 15.00 ?  281 PRO A HG2  1  
ATOM   40    H HG3  . PRO A 1 3  ? -14.276 3.995   5.440   1.00 15.00 ?  281 PRO A HG3  1  
ATOM   41    H HD2  . PRO A 1 3  ? -13.534 2.847   3.013   1.00 15.00 ?  281 PRO A HD2  1  
ATOM   42    H HD3  . PRO A 1 3  ? -14.939 3.901   3.264   1.00 15.00 ?  281 PRO A HD3  1  
ATOM   43    N N    . LEU A 1 4  ? -9.862  5.983   3.609   1.00 15.00 ?  282 LEU A N    1  
ATOM   44    C CA   . LEU A 1 4  ? -8.462  5.612   3.765   1.00 15.00 ?  282 LEU A CA   1  
ATOM   45    C C    . LEU A 1 4  ? -8.037  5.822   5.219   1.00 15.00 ?  282 LEU A C    1  
ATOM   46    O O    . LEU A 1 4  ? -8.090  6.942   5.728   1.00 15.00 ?  282 LEU A O    1  
ATOM   47    C CB   . LEU A 1 4  ? -7.580  6.453   2.834   1.00 15.00 ?  282 LEU A CB   1  
ATOM   48    C CG   . LEU A 1 4  ? -6.081  6.138   2.892   1.00 15.00 ?  282 LEU A CG   1  
ATOM   49    C CD1  . LEU A 1 4  ? -5.810  4.728   2.394   1.00 15.00 ?  282 LEU A CD1  1  
ATOM   50    C CD2  . LEU A 1 4  ? -5.295  7.153   2.078   1.00 15.00 ?  282 LEU A CD2  1  
ATOM   51    H H    . LEU A 1 4  ? -10.107 6.929   3.660   1.00 15.00 ?  282 LEU A H    1  
ATOM   52    H HA   . LEU A 1 4  ? -8.359  4.568   3.511   1.00 15.00 ?  282 LEU A HA   1  
ATOM   53    H HB2  . LEU A 1 4  ? -7.918  6.301   1.819   1.00 15.00 ?  282 LEU A HB2  1  
ATOM   54    H HB3  . LEU A 1 4  ? -7.714  7.493   3.088   1.00 15.00 ?  282 LEU A HB3  1  
ATOM   55    H HG   . LEU A 1 4  ? -5.747  6.199   3.918   1.00 15.00 ?  282 LEU A HG   1  
ATOM   56    H HD11 . LEU A 1 4  ? -6.146  4.637   1.372   1.00 15.00 ?  282 LEU A HD11 1  
ATOM   57    H HD12 . LEU A 1 4  ? -6.342  4.019   3.012   1.00 15.00 ?  282 LEU A HD12 1  
ATOM   58    H HD13 . LEU A 1 4  ? -4.750  4.525   2.445   1.00 15.00 ?  282 LEU A HD13 1  
ATOM   59    H HD21 . LEU A 1 4  ? -5.619  7.118   1.049   1.00 15.00 ?  282 LEU A HD21 1  
ATOM   60    H HD22 . LEU A 1 4  ? -4.242  6.920   2.132   1.00 15.00 ?  282 LEU A HD22 1  
ATOM   61    H HD23 . LEU A 1 4  ? -5.465  8.143   2.476   1.00 15.00 ?  282 LEU A HD23 1  
ATOM   62    N N    . PRO A 1 5  ? -7.636  4.746   5.911   1.00 15.00 ?  283 PRO A N    1  
ATOM   63    C CA   . PRO A 1 5  ? -7.214  4.812   7.317   1.00 15.00 ?  283 PRO A CA   1  
ATOM   64    C C    . PRO A 1 5  ? -5.884  5.546   7.503   1.00 15.00 ?  283 PRO A C    1  
ATOM   65    O O    . PRO A 1 5  ? -4.943  5.347   6.736   1.00 15.00 ?  283 PRO A O    1  
ATOM   66    C CB   . PRO A 1 5  ? -7.065  3.338   7.725   1.00 15.00 ?  283 PRO A CB   1  
ATOM   67    C CG   . PRO A 1 5  ? -7.712  2.550   6.635   1.00 15.00 ?  283 PRO A CG   1  
ATOM   68    C CD   . PRO A 1 5  ? -7.575  3.376   5.392   1.00 15.00 ?  283 PRO A CD   1  
ATOM   69    H HA   . PRO A 1 5  ? -7.969  5.281   7.931   1.00 15.00 ?  283 PRO A HA   1  
ATOM   70    H HB2  . PRO A 1 5  ? -6.017  3.093   7.815   1.00 15.00 ?  283 PRO A HB2  1  
ATOM   71    H HB3  . PRO A 1 5  ? -7.557  3.176   8.672   1.00 15.00 ?  283 PRO A HB3  1  
ATOM   72    H HG2  . PRO A 1 5  ? -7.204  1.606   6.515   1.00 15.00 ?  283 PRO A HG2  1  
ATOM   73    H HG3  . PRO A 1 5  ? -8.755  2.390   6.866   1.00 15.00 ?  283 PRO A HG3  1  
ATOM   74    H HD2  . PRO A 1 5  ? -6.628  3.183   4.910   1.00 15.00 ?  283 PRO A HD2  1  
ATOM   75    H HD3  . PRO A 1 5  ? -8.394  3.181   4.717   1.00 15.00 ?  283 PRO A HD3  1  
ATOM   76    N N    . PRO A 1 6  ? -5.792  6.402   8.536   1.00 15.00 ?  284 PRO A N    1  
ATOM   77    C CA   . PRO A 1 6  ? -4.556  7.124   8.865   1.00 15.00 ?  284 PRO A CA   1  
ATOM   78    C C    . PRO A 1 6  ? -3.420  6.171   9.242   1.00 15.00 ?  284 PRO A C    1  
ATOM   79    O O    . PRO A 1 6  ? -3.607  5.252   10.041  1.00 15.00 ?  284 PRO A O    1  
ATOM   80    C CB   . PRO A 1 6  ? -4.949  7.994   10.066  1.00 15.00 ?  284 PRO A CB   1  
ATOM   81    C CG   . PRO A 1 6  ? -6.177  7.362   10.625  1.00 15.00 ?  284 PRO A CG   1  
ATOM   82    C CD   . PRO A 1 6  ? -6.888  6.734   9.462   1.00 15.00 ?  284 PRO A CD   1  
ATOM   83    H HA   . PRO A 1 6  ? -4.237  7.755   8.048   1.00 15.00 ?  284 PRO A HA   1  
ATOM   84    H HB2  . PRO A 1 6  ? -4.145  7.999   10.787  1.00 15.00 ?  284 PRO A HB2  1  
ATOM   85    H HB3  . PRO A 1 6  ? -5.144  9.003   9.732   1.00 15.00 ?  284 PRO A HB3  1  
ATOM   86    H HG2  . PRO A 1 6  ? -5.905  6.609   11.349  1.00 15.00 ?  284 PRO A HG2  1  
ATOM   87    H HG3  . PRO A 1 6  ? -6.801  8.115   11.084  1.00 15.00 ?  284 PRO A HG3  1  
ATOM   88    H HD2  . PRO A 1 6  ? -7.411  5.843   9.776   1.00 15.00 ?  284 PRO A HD2  1  
ATOM   89    H HD3  . PRO A 1 6  ? -7.573  7.437   9.011   1.00 15.00 ?  284 PRO A HD3  1  
ATOM   90    N N    . GLY A 1 7  ? -2.246  6.404   8.667   1.00 15.00 ?  285 GLY A N    1  
ATOM   91    C CA   . GLY A 1 7  ? -1.114  5.525   8.904   1.00 15.00 ?  285 GLY A CA   1  
ATOM   92    C C    . GLY A 1 7  ? -0.809  4.677   7.688   1.00 15.00 ?  285 GLY A C    1  
ATOM   93    O O    . GLY A 1 7  ? 0.187   3.948   7.646   1.00 15.00 ?  285 GLY A O    1  
ATOM   94    H H    . GLY A 1 7  ? -2.145  7.178   8.077   1.00 15.00 ?  285 GLY A H    1  
ATOM   95    H HA2  . GLY A 1 7  ? -0.248  6.122   9.144   1.00 15.00 ?  285 GLY A HA2  1  
ATOM   96    H HA3  . GLY A 1 7  ? -1.339  4.876   9.738   1.00 15.00 ?  285 GLY A HA3  1  
ATOM   97    N N    . TRP A 1 8  ? -1.670  4.796   6.690   1.00 15.00 ?  286 TRP A N    1  
ATOM   98    C CA   . TRP A 1 8  ? -1.540  4.040   5.458   1.00 15.00 ?  286 TRP A CA   1  
ATOM   99    C C    . TRP A 1 8  ? -0.701  4.789   4.439   1.00 15.00 ?  286 TRP A C    1  
ATOM   100   O O    . TRP A 1 8  ? -1.098  5.847   3.948   1.00 15.00 ?  286 TRP A O    1  
ATOM   101   C CB   . TRP A 1 8  ? -2.929  3.752   4.871   1.00 15.00 ?  286 TRP A CB   1  
ATOM   102   C CG   . TRP A 1 8  ? -3.580  2.537   5.450   1.00 15.00 ?  286 TRP A CG   1  
ATOM   103   C CD1  . TRP A 1 8  ? -3.694  2.215   6.772   1.00 15.00 ?  286 TRP A CD1  1  
ATOM   104   C CD2  . TRP A 1 8  ? -4.198  1.473   4.720   1.00 15.00 ?  286 TRP A CD2  1  
ATOM   105   N NE1  . TRP A 1 8  ? -4.323  1.002   6.909   1.00 15.00 ?  286 TRP A NE1  1  
ATOM   106   C CE2  . TRP A 1 8  ? -4.640  0.524   5.665   1.00 15.00 ?  286 TRP A CE2  1  
ATOM   107   C CE3  . TRP A 1 8  ? -4.416  1.220   3.359   1.00 15.00 ?  286 TRP A CE3  1  
ATOM   108   C CZ2  . TRP A 1 8  ? -5.280  -0.656  5.292   1.00 15.00 ?  286 TRP A CZ2  1  
ATOM   109   C CZ3  . TRP A 1 8  ? -5.039  0.045   2.998   1.00 15.00 ?  286 TRP A CZ3  1  
ATOM   110   C CH2  . TRP A 1 8  ? -5.462  -0.883  3.957   1.00 15.00 ?  286 TRP A CH2  1  
ATOM   111   H H    . TRP A 1 8  ? -2.424  5.412   6.787   1.00 15.00 ?  286 TRP A H    1  
ATOM   112   H HA   . TRP A 1 8  ? -1.049  3.102   5.690   1.00 15.00 ?  286 TRP A HA   1  
ATOM   113   H HB2  . TRP A 1 8  ? -3.573  4.598   5.059   1.00 15.00 ?  286 TRP A HB2  1  
ATOM   114   H HB3  . TRP A 1 8  ? -2.837  3.606   3.805   1.00 15.00 ?  286 TRP A HB3  1  
ATOM   115   H HD1  . TRP A 1 8  ? -3.329  2.830   7.581   1.00 15.00 ?  286 TRP A HD1  1  
ATOM   116   H HE1  . TRP A 1 8  ? -4.509  0.551   7.759   1.00 15.00 ?  286 TRP A HE1  1  
ATOM   117   H HE3  . TRP A 1 8  ? -4.100  1.945   2.559   1.00 15.00 ?  286 TRP A HE3  1  
ATOM   118   H HZ2  . TRP A 1 8  ? -5.611  -1.384  6.021   1.00 15.00 ?  286 TRP A HZ2  1  
ATOM   119   H HZ3  . TRP A 1 8  ? -5.173  -0.179  1.949   1.00 15.00 ?  286 TRP A HZ3  1  
ATOM   120   H HH2  . TRP A 1 8  ? -5.945  -1.791  3.622   1.00 15.00 ?  286 TRP A HH2  1  
ATOM   121   N N    . GLU A 1 9  ? 0.462   4.241   4.131   1.00 15.00 ?  287 GLU A N    1  
ATOM   122   C CA   . GLU A 1 9  ? 1.302   4.795   3.093   1.00 15.00 ?  287 GLU A CA   1  
ATOM   123   C C    . GLU A 1 9  ? 1.070   4.036   1.799   1.00 15.00 ?  287 GLU A C    1  
ATOM   124   O O    . GLU A 1 9  ? 1.163   2.807   1.762   1.00 15.00 ?  287 GLU A O    1  
ATOM   125   C CB   . GLU A 1 9  ? 2.773   4.725   3.501   1.00 15.00 ?  287 GLU A CB   1  
ATOM   126   C CG   . GLU A 1 9  ? 3.380   6.074   3.858   1.00 15.00 ?  287 GLU A CG   1  
ATOM   127   C CD   . GLU A 1 9  ? 2.632   6.800   4.960   1.00 15.00 ?  287 GLU A CD   1  
ATOM   128   O OE1  . GLU A 1 9  ? 2.959   6.584   6.144   1.00 15.00 -1 287 GLU A OE1  1  
ATOM   129   O OE2  . GLU A 1 9  ? 1.737   7.611   4.644   1.00 15.00 ?  287 GLU A OE2  1  
ATOM   130   H H    . GLU A 1 9  ? 0.761   3.432   4.608   1.00 15.00 ?  287 GLU A H    1  
ATOM   131   H HA   . GLU A 1 9  ? 1.021   5.828   2.951   1.00 15.00 ?  287 GLU A HA   1  
ATOM   132   H HB2  . GLU A 1 9  ? 2.865   4.076   4.359   1.00 15.00 ?  287 GLU A HB2  1  
ATOM   133   H HB3  . GLU A 1 9  ? 3.340   4.307   2.684   1.00 15.00 ?  287 GLU A HB3  1  
ATOM   134   H HG2  . GLU A 1 9  ? 4.396   5.914   4.188   1.00 15.00 ?  287 GLU A HG2  1  
ATOM   135   H HG3  . GLU A 1 9  ? 3.388   6.694   2.975   1.00 15.00 ?  287 GLU A HG3  1  
ATOM   136   N N    . VAL A 1 10 ? 0.761   4.762   0.741   1.00 15.00 ?  288 VAL A N    1  
ATOM   137   C CA   . VAL A 1 10 ? 0.513   4.139   -0.544  1.00 15.00 ?  288 VAL A CA   1  
ATOM   138   C C    . VAL A 1 10 ? 1.814   4.028   -1.337  1.00 15.00 ?  288 VAL A C    1  
ATOM   139   O O    . VAL A 1 10 ? 2.316   5.001   -1.895  1.00 15.00 ?  288 VAL A O    1  
ATOM   140   C CB   . VAL A 1 10 ? -0.566  4.902   -1.363  1.00 15.00 ?  288 VAL A CB   1  
ATOM   141   C CG1  . VAL A 1 10 ? -1.898  4.881   -0.636  1.00 15.00 ?  288 VAL A CG1  1  
ATOM   142   C CG2  . VAL A 1 10 ? -0.160  6.343   -1.646  1.00 15.00 ?  288 VAL A CG2  1  
ATOM   143   H H    . VAL A 1 10 ? 0.685   5.739   0.831   1.00 15.00 ?  288 VAL A H    1  
ATOM   144   H HA   . VAL A 1 10 ? 0.145   3.141   -0.354  1.00 15.00 ?  288 VAL A HA   1  
ATOM   145   H HB   . VAL A 1 10 ? -0.692  4.395   -2.308  1.00 15.00 ?  288 VAL A HB   1  
ATOM   146   H HG11 . VAL A 1 10 ? -2.635  5.416   -1.218  1.00 15.00 ?  288 VAL A HG11 1  
ATOM   147   H HG12 . VAL A 1 10 ? -1.789  5.353   0.328   1.00 15.00 ?  288 VAL A HG12 1  
ATOM   148   H HG13 . VAL A 1 10 ? -2.219  3.858   -0.503  1.00 15.00 ?  288 VAL A HG13 1  
ATOM   149   H HG21 . VAL A 1 10 ? 0.715   6.349   -2.278  1.00 15.00 ?  288 VAL A HG21 1  
ATOM   150   H HG22 . VAL A 1 10 ? 0.063   6.845   -0.716  1.00 15.00 ?  288 VAL A HG22 1  
ATOM   151   H HG23 . VAL A 1 10 ? -0.970  6.854   -2.147  1.00 15.00 ?  288 VAL A HG23 1  
ATOM   152   N N    . ARG A 1 11 ? 2.389   2.836   -1.354  1.00 15.00 ?  289 ARG A N    1  
ATOM   153   C CA   . ARG A 1 11 ? 3.616   2.630   -2.090  1.00 15.00 ?  289 ARG A CA   1  
ATOM   154   C C    . ARG A 1 11 ? 3.245   2.136   -3.484  1.00 15.00 ?  289 ARG A C    1  
ATOM   155   O O    . ARG A 1 11 ? 2.804   1.003   -3.664  1.00 15.00 ?  289 ARG A O    1  
ATOM   156   C CB   . ARG A 1 11 ? 4.551   1.672   -1.319  1.00 15.00 ?  289 ARG A CB   1  
ATOM   157   C CG   . ARG A 1 11 ? 6.021   1.750   -1.719  1.00 15.00 ?  289 ARG A CG   1  
ATOM   158   C CD   . ARG A 1 11 ? 6.279   1.216   -3.119  1.00 15.00 ?  289 ARG A CD   1  
ATOM   159   N NE   . ARG A 1 11 ? 7.683   1.347   -3.500  1.00 15.00 ?  289 ARG A NE   1  
ATOM   160   C CZ   . ARG A 1 11 ? 8.355   0.462   -4.239  1.00 15.00 ?  289 ARG A CZ   1  
ATOM   161   N NH1  . ARG A 1 11 ? 7.781   -0.669  -4.618  1.00 15.00 1  289 ARG A NH1  1  
ATOM   162   N NH2  . ARG A 1 11 ? 9.616   0.703   -4.573  1.00 15.00 ?  289 ARG A NH2  1  
ATOM   163   H H    . ARG A 1 11 ? 1.968   2.077   -0.885  1.00 15.00 ?  289 ARG A H    1  
ATOM   164   H HA   . ARG A 1 11 ? 4.101   3.592   -2.188  1.00 15.00 ?  289 ARG A HA   1  
ATOM   165   H HB2  . ARG A 1 11 ? 4.489   1.919   -0.270  1.00 15.00 ?  289 ARG A HB2  1  
ATOM   166   H HB3  . ARG A 1 11 ? 4.217   0.657   -1.446  1.00 15.00 ?  289 ARG A HB3  1  
ATOM   167   H HG2  . ARG A 1 11 ? 6.335   2.781   -1.681  1.00 15.00 ?  289 ARG A HG2  1  
ATOM   168   H HG3  . ARG A 1 11 ? 6.599   1.171   -1.012  1.00 15.00 ?  289 ARG A HG3  1  
ATOM   169   H HD2  . ARG A 1 11 ? 6.003   0.172   -3.150  1.00 15.00 ?  289 ARG A HD2  1  
ATOM   170   H HD3  . ARG A 1 11 ? 5.672   1.769   -3.822  1.00 15.00 ?  289 ARG A HD3  1  
ATOM   171   H HE   . ARG A 1 11 ? 8.155   2.167   -3.195  1.00 15.00 ?  289 ARG A HE   1  
ATOM   172   H HH11 . ARG A 1 11 ? 6.842   -0.868  -4.345  1.00 15.00 ?  289 ARG A HH11 1  
ATOM   173   H HH12 . ARG A 1 11 ? 8.286   -1.333  -5.189  1.00 15.00 ?  289 ARG A HH12 1  
ATOM   174   H HH21 . ARG A 1 11 ? 10.069  1.556   -4.268  1.00 15.00 ?  289 ARG A HH21 1  
ATOM   175   H HH22 . ARG A 1 11 ? 10.129  0.045   -5.135  1.00 15.00 ?  289 ARG A HH22 1  
ATOM   176   N N    . SER A 1 12 ? 3.344   3.035   -4.448  1.00 15.00 ?  290 SER A N    1  
ATOM   177   C CA   . SER A 1 12 ? 2.864   2.784   -5.796  1.00 15.00 ?  290 SER A CA   1  
ATOM   178   C C    . SER A 1 12 ? 4.019   2.509   -6.752  1.00 15.00 ?  290 SER A C    1  
ATOM   179   O O    . SER A 1 12 ? 5.117   3.045   -6.589  1.00 15.00 ?  290 SER A O    1  
ATOM   180   C CB   . SER A 1 12 ? 2.077   4.008   -6.267  1.00 15.00 ?  290 SER A CB   1  
ATOM   181   O OG   . SER A 1 12 ? 2.847   5.188   -6.104  1.00 15.00 ?  290 SER A OG   1  
ATOM   182   H H    . SER A 1 12 ? 3.750   3.907   -4.251  1.00 15.00 ?  290 SER A H    1  
ATOM   183   H HA   . SER A 1 12 ? 2.209   1.929   -5.770  1.00 15.00 ?  290 SER A HA   1  
ATOM   184   H HB2  . SER A 1 12 ? 1.828   3.895   -7.312  1.00 15.00 ?  290 SER A HB2  1  
ATOM   185   H HB3  . SER A 1 12 ? 1.171   4.098   -5.686  1.00 15.00 ?  290 SER A HB3  1  
ATOM   186   H HG   . SER A 1 12 ? 2.258   5.950   -5.964  1.00 15.00 ?  290 SER A HG   1  
ATOM   187   N N    . THR A 1 13 ? 3.766   1.685   -7.757  1.00 15.00 ?  291 THR A N    1  
ATOM   188   C CA   . THR A 1 13 ? 4.753   1.436   -8.789  1.00 15.00 ?  291 THR A CA   1  
ATOM   189   C C    . THR A 1 13 ? 4.119   1.569   -10.171 1.00 15.00 ?  291 THR A C    1  
ATOM   190   O O    . THR A 1 13 ? 2.929   1.261   -10.353 1.00 15.00 ?  291 THR A O    1  
ATOM   191   C CB   . THR A 1 13 ? 5.424   0.057   -8.623  1.00 15.00 ?  291 THR A CB   1  
ATOM   192   O OG1  . THR A 1 13 ? 4.430   -0.968  -8.501  1.00 15.00 ?  291 THR A OG1  1  
ATOM   193   C CG2  . THR A 1 13 ? 6.320   0.044   -7.392  1.00 15.00 ?  291 THR A CG2  1  
ATOM   194   H H    . THR A 1 13 ? 2.890   1.246   -7.814  1.00 15.00 ?  291 THR A H    1  
ATOM   195   H HA   . THR A 1 13 ? 5.519   2.195   -8.692  1.00 15.00 ?  291 THR A HA   1  
ATOM   196   H HB   . THR A 1 13 ? 6.031   -0.140  -9.495  1.00 15.00 ?  291 THR A HB   1  
ATOM   197   H HG1  . THR A 1 13 ? 3.752   -0.681  -7.878  1.00 15.00 ?  291 THR A HG1  1  
ATOM   198   H HG21 . THR A 1 13 ? 7.011   0.880   -7.432  1.00 15.00 ?  291 THR A HG21 1  
ATOM   199   H HG22 . THR A 1 13 ? 6.876   -0.882  -7.363  1.00 15.00 ?  291 THR A HG22 1  
ATOM   200   H HG23 . THR A 1 13 ? 5.710   0.123   -6.504  1.00 15.00 ?  291 THR A HG23 1  
ATOM   201   N N    . VAL A 1 14 ? 4.936   1.994   -11.135 1.00 15.00 ?  292 VAL A N    1  
ATOM   202   C CA   . VAL A 1 14 ? 4.482   2.398   -12.468 1.00 15.00 ?  292 VAL A CA   1  
ATOM   203   C C    . VAL A 1 14 ? 3.762   1.265   -13.208 1.00 15.00 ?  292 VAL A C    1  
ATOM   204   O O    . VAL A 1 14 ? 3.083   1.498   -14.209 1.00 15.00 ?  292 VAL A O    1  
ATOM   205   C CB   . VAL A 1 14 ? 5.667   2.914   -13.319 1.00 15.00 ?  292 VAL A CB   1  
ATOM   206   C CG1  . VAL A 1 14 ? 6.590   1.778   -13.731 1.00 15.00 ?  292 VAL A CG1  1  
ATOM   207   C CG2  . VAL A 1 14 ? 5.177   3.687   -14.536 1.00 15.00 ?  292 VAL A CG2  1  
ATOM   208   H H    . VAL A 1 14 ? 5.904   2.049   -10.938 1.00 15.00 ?  292 VAL A H    1  
ATOM   209   H HA   . VAL A 1 14 ? 3.786   3.215   -12.340 1.00 15.00 ?  292 VAL A HA   1  
ATOM   210   H HB   . VAL A 1 14 ? 6.239   3.595   -12.706 1.00 15.00 ?  292 VAL A HB   1  
ATOM   211   H HG11 . VAL A 1 14 ? 6.985   1.297   -12.847 1.00 15.00 ?  292 VAL A HG11 1  
ATOM   212   H HG12 . VAL A 1 14 ? 7.404   2.172   -14.321 1.00 15.00 ?  292 VAL A HG12 1  
ATOM   213   H HG13 . VAL A 1 14 ? 6.035   1.058   -14.316 1.00 15.00 ?  292 VAL A HG13 1  
ATOM   214   H HG21 . VAL A 1 14 ? 6.024   4.037   -15.106 1.00 15.00 ?  292 VAL A HG21 1  
ATOM   215   H HG22 . VAL A 1 14 ? 4.586   4.531   -14.213 1.00 15.00 ?  292 VAL A HG22 1  
ATOM   216   H HG23 . VAL A 1 14 ? 4.572   3.039   -15.152 1.00 15.00 ?  292 VAL A HG23 1  
ATOM   217   N N    . SER A 1 15 ? 3.911   0.042   -12.715 1.00 15.00 ?  293 SER A N    1  
ATOM   218   C CA   . SER A 1 15 ? 3.199   -1.104  -13.265 1.00 15.00 ?  293 SER A CA   1  
ATOM   219   C C    . SER A 1 15 ? 1.683   -0.904  -13.180 1.00 15.00 ?  293 SER A C    1  
ATOM   220   O O    . SER A 1 15 ? 0.916   -1.627  -13.812 1.00 15.00 ?  293 SER A O    1  
ATOM   221   C CB   . SER A 1 15 ? 3.589   -2.372  -12.507 1.00 15.00 ?  293 SER A CB   1  
ATOM   222   O OG   . SER A 1 15 ? 4.998   -2.489  -12.403 1.00 15.00 ?  293 SER A OG   1  
ATOM   223   H H    . SER A 1 15 ? 4.519   -0.096  -11.958 1.00 15.00 ?  293 SER A H    1  
ATOM   224   H HA   . SER A 1 15 ? 3.484   -1.210  -14.300 1.00 15.00 ?  293 SER A HA   1  
ATOM   225   H HB2  . SER A 1 15 ? 3.169   -2.340  -11.513 1.00 15.00 ?  293 SER A HB2  1  
ATOM   226   H HB3  . SER A 1 15 ? 3.207   -3.235  -13.032 1.00 15.00 ?  293 SER A HB3  1  
ATOM   227   H HG   . SER A 1 15 ? 5.398   -2.310  -13.272 1.00 15.00 ?  293 SER A HG   1  
ATOM   228   N N    . GLY A 1 16 ? 1.262   0.070   -12.381 1.00 15.00 ?  294 GLY A N    1  
ATOM   229   C CA   . GLY A 1 16 ? -0.148  0.299   -12.170 1.00 15.00 ?  294 GLY A CA   1  
ATOM   230   C C    . GLY A 1 16 ? -0.663  -0.502  -11.001 1.00 15.00 ?  294 GLY A C    1  
ATOM   231   O O    . GLY A 1 16 ? -1.855  -0.801  -10.911 1.00 15.00 ?  294 GLY A O    1  
ATOM   232   H H    . GLY A 1 16 ? 1.922   0.643   -11.933 1.00 15.00 ?  294 GLY A H    1  
ATOM   233   H HA2  . GLY A 1 16 ? -0.310  1.349   -11.979 1.00 15.00 ?  294 GLY A HA2  1  
ATOM   234   H HA3  . GLY A 1 16 ? -0.690  0.013   -13.059 1.00 15.00 ?  294 GLY A HA3  1  
ATOM   235   N N    . ARG A 1 17 ? 0.243   -0.843  -10.095 1.00 15.00 ?  295 ARG A N    1  
ATOM   236   C CA   . ARG A 1 17 ? -0.121  -1.616  -8.920  1.00 15.00 ?  295 ARG A CA   1  
ATOM   237   C C    . ARG A 1 17 ? 0.173   -0.818  -7.660  1.00 15.00 ?  295 ARG A C    1  
ATOM   238   O O    . ARG A 1 17 ? 1.327   -0.484  -7.365  1.00 15.00 ?  295 ARG A O    1  
ATOM   239   C CB   . ARG A 1 17 ? 0.612   -2.969  -8.874  1.00 15.00 ?  295 ARG A CB   1  
ATOM   240   C CG   . ARG A 1 17 ? 2.120   -2.844  -8.964  1.00 15.00 ?  295 ARG A CG   1  
ATOM   241   C CD   . ARG A 1 17 ? 2.820   -4.187  -8.824  1.00 15.00 ?  295 ARG A CD   1  
ATOM   242   N NE   . ARG A 1 17 ? 4.269   -4.025  -8.690  1.00 15.00 ?  295 ARG A NE   1  
ATOM   243   C CZ   . ARG A 1 17 ? 5.129   -5.035  -8.523  1.00 15.00 ?  295 ARG A CZ   1  
ATOM   244   N NH1  . ARG A 1 17 ? 4.701   -6.293  -8.502  1.00 15.00 1  295 ARG A NH1  1  
ATOM   245   N NH2  . ARG A 1 17 ? 6.426   -4.787  -8.382  1.00 15.00 ?  295 ARG A NH2  1  
ATOM   246   H H    . ARG A 1 17 ? 1.173   -0.535  -10.205 1.00 15.00 ?  295 ARG A H    1  
ATOM   247   H HA   . ARG A 1 17 ? -1.186  -1.798  -8.967  1.00 15.00 ?  295 ARG A HA   1  
ATOM   248   H HB2  . ARG A 1 17 ? 0.372   -3.457  -7.942  1.00 15.00 ?  295 ARG A HB2  1  
ATOM   249   H HB3  . ARG A 1 17 ? 0.269   -3.590  -9.692  1.00 15.00 ?  295 ARG A HB3  1  
ATOM   250   H HG2  . ARG A 1 17 ? 2.373   -2.416  -9.919  1.00 15.00 ?  295 ARG A HG2  1  
ATOM   251   H HG3  . ARG A 1 17 ? 2.461   -2.189  -8.175  1.00 15.00 ?  295 ARG A HG3  1  
ATOM   252   H HD2  . ARG A 1 17 ? 2.438   -4.689  -7.947  1.00 15.00 ?  295 ARG A HD2  1  
ATOM   253   H HD3  . ARG A 1 17 ? 2.611   -4.782  -9.701  1.00 15.00 ?  295 ARG A HD3  1  
ATOM   254   H HE   . ARG A 1 17 ? 4.618   -3.103  -8.714  1.00 15.00 ?  295 ARG A HE   1  
ATOM   255   H HH11 . ARG A 1 17 ? 3.720   -6.504  -8.612  1.00 15.00 ?  295 ARG A HH11 1  
ATOM   256   H HH12 . ARG A 1 17 ? 5.352   -7.044  -8.376  1.00 15.00 ?  295 ARG A HH12 1  
ATOM   257   H HH21 . ARG A 1 17 ? 6.767   -3.846  -8.397  1.00 15.00 ?  295 ARG A HH21 1  
ATOM   258   H HH22 . ARG A 1 17 ? 7.075   -5.552  -8.263  1.00 15.00 ?  295 ARG A HH22 1  
ATOM   259   N N    . ILE A 1 18 ? -0.880  -0.478  -6.946  1.00 15.00 ?  296 ILE A N    1  
ATOM   260   C CA   . ILE A 1 18 ? -0.746  0.146   -5.647  1.00 15.00 ?  296 ILE A CA   1  
ATOM   261   C C    . ILE A 1 18 ? -0.716  -0.964  -4.604  1.00 15.00 ?  296 ILE A C    1  
ATOM   262   O O    . ILE A 1 18 ? -1.414  -1.968  -4.747  1.00 15.00 ?  296 ILE A O    1  
ATOM   263   C CB   . ILE A 1 18 ? -1.895  1.162   -5.379  1.00 15.00 ?  296 ILE A CB   1  
ATOM   264   C CG1  . ILE A 1 18 ? -1.599  2.034   -4.143  1.00 15.00 ?  296 ILE A CG1  1  
ATOM   265   C CG2  . ILE A 1 18 ? -3.237  0.448   -5.228  1.00 15.00 ?  296 ILE A CG2  1  
ATOM   266   C CD1  . ILE A 1 18 ? -2.096  1.458   -2.831  1.00 15.00 ?  296 ILE A CD1  1  
ATOM   267   H H    . ILE A 1 18 ? -1.773  -0.661  -7.299  1.00 15.00 ?  296 ILE A H    1  
ATOM   268   H HA   . ILE A 1 18 ? 0.198   0.675   -5.625  1.00 15.00 ?  296 ILE A HA   1  
ATOM   269   H HB   . ILE A 1 18 ? -1.968  1.805   -6.244  1.00 15.00 ?  296 ILE A HB   1  
ATOM   270   H HG12 . ILE A 1 18 ? -0.532  2.175   -4.056  1.00 15.00 ?  296 ILE A HG12 1  
ATOM   271   H HG13 . ILE A 1 18 ? -2.069  2.999   -4.279  1.00 15.00 ?  296 ILE A HG13 1  
ATOM   272   H HG21 . ILE A 1 18 ? -4.018  1.178   -5.069  1.00 15.00 ?  296 ILE A HG21 1  
ATOM   273   H HG22 . ILE A 1 18 ? -3.195  -0.221  -4.379  1.00 15.00 ?  296 ILE A HG22 1  
ATOM   274   H HG23 . ILE A 1 18 ? -3.448  -0.117  -6.123  1.00 15.00 ?  296 ILE A HG23 1  
ATOM   275   H HD11 . ILE A 1 18 ? -1.959  0.388   -2.830  1.00 15.00 ?  296 ILE A HD11 1  
ATOM   276   H HD12 . ILE A 1 18 ? -3.146  1.687   -2.712  1.00 15.00 ?  296 ILE A HD12 1  
ATOM   277   H HD13 . ILE A 1 18 ? -1.539  1.894   -2.015  1.00 15.00 ?  296 ILE A HD13 1  
ATOM   278   N N    . TYR A 1 19 ? 0.109   -0.814  -3.585  1.00 15.00 ?  297 TYR A N    1  
ATOM   279   C CA   . TYR A 1 19 ? 0.312   -1.893  -2.642  1.00 15.00 ?  297 TYR A CA   1  
ATOM   280   C C    . TYR A 1 19 ? 0.642   -1.298  -1.310  1.00 15.00 ?  297 TYR A C    1  
ATOM   281   O O    . TYR A 1 19 ? 1.449   -0.363  -1.197  1.00 15.00 ?  297 TYR A O    1  
ATOM   282   C CB   . TYR A 1 19 ? 1.354   -2.925  -3.122  1.00 15.00 ?  297 TYR A CB   1  
ATOM   283   C CG   . TYR A 1 19 ? 2.813   -2.639  -2.837  1.00 15.00 ?  297 TYR A CG   1  
ATOM   284   C CD1  . TYR A 1 19 ? 3.560   -1.844  -3.689  1.00 15.00 ?  297 TYR A CD1  1  
ATOM   285   C CD2  . TYR A 1 19 ? 3.456   -3.204  -1.735  1.00 15.00 ?  297 TYR A CD2  1  
ATOM   286   C CE1  . TYR A 1 19 ? 4.898   -1.614  -3.455  1.00 15.00 ?  297 TYR A CE1  1  
ATOM   287   C CE2  . TYR A 1 19 ? 4.793   -2.971  -1.493  1.00 15.00 ?  297 TYR A CE2  1  
ATOM   288   C CZ   . TYR A 1 19 ? 5.510   -2.176  -2.354  1.00 15.00 ?  297 TYR A CZ   1  
ATOM   289   O OH   . TYR A 1 19 ? 6.844   -1.941  -2.121  1.00 15.00 ?  297 TYR A OH   1  
ATOM   290   H H    . TYR A 1 19 ? 0.492   0.075   -3.391  1.00 15.00 ?  297 TYR A H    1  
ATOM   291   H HA   . TYR A 1 19 ? -0.641  -2.398  -2.542  1.00 15.00 ?  297 TYR A HA   1  
ATOM   292   H HB2  . TYR A 1 19 ? 1.126   -3.877  -2.671  1.00 15.00 ?  297 TYR A HB2  1  
ATOM   293   H HB3  . TYR A 1 19 ? 1.252   -3.021  -4.191  1.00 15.00 ?  297 TYR A HB3  1  
ATOM   294   H HD1  . TYR A 1 19 ? 3.079   -1.397  -4.547  1.00 15.00 ?  297 TYR A HD1  1  
ATOM   295   H HD2  . TYR A 1 19 ? 2.900   -3.837  -1.062  1.00 15.00 ?  297 TYR A HD2  1  
ATOM   296   H HE1  . TYR A 1 19 ? 5.463   -0.991  -4.133  1.00 15.00 ?  297 TYR A HE1  1  
ATOM   297   H HE2  . TYR A 1 19 ? 5.272   -3.416  -0.632  1.00 15.00 ?  297 TYR A HE2  1  
ATOM   298   H HH   . TYR A 1 19 ? 7.255   -2.737  -1.770  1.00 15.00 ?  297 TYR A HH   1  
ATOM   299   N N    . PHE A 1 20 ? -0.009  -1.812  -0.311  1.00 15.00 ?  298 PHE A N    1  
ATOM   300   C CA   . PHE A 1 20 ? -0.050  -1.142  0.930   1.00 15.00 ?  298 PHE A CA   1  
ATOM   301   C C    . PHE A 1 20 ? 1.042   -1.496  1.870   1.00 15.00 ?  298 PHE A C    1  
ATOM   302   O O    . PHE A 1 20 ? 1.355   -2.663  2.094   1.00 15.00 ?  298 PHE A O    1  
ATOM   303   C CB   . PHE A 1 20 ? -1.385  -1.303  1.579   1.00 15.00 ?  298 PHE A CB   1  
ATOM   304   C CG   . PHE A 1 20 ? -2.145  -0.091  1.288   1.00 15.00 ?  298 PHE A CG   1  
ATOM   305   C CD1  . PHE A 1 20 ? -1.736  1.097   1.855   1.00 15.00 ?  298 PHE A CD1  1  
ATOM   306   C CD2  . PHE A 1 20 ? -3.211  -0.105  0.418   1.00 15.00 ?  298 PHE A CD2  1  
ATOM   307   C CE1  . PHE A 1 20 ? -2.381  2.256   1.573   1.00 15.00 ?  298 PHE A CE1  1  
ATOM   308   C CE2  . PHE A 1 20 ? -3.868  1.061   0.136   1.00 15.00 ?  298 PHE A CE2  1  
ATOM   309   C CZ   . PHE A 1 20 ? -3.446  2.234   0.719   1.00 15.00 ?  298 PHE A CZ   1  
ATOM   310   H H    . PHE A 1 20 ? -0.509  -2.650  -0.428  1.00 15.00 ?  298 PHE A H    1  
ATOM   311   H HA   . PHE A 1 20 ? 0.052   -0.097  0.687   1.00 15.00 ?  298 PHE A HA   1  
ATOM   312   H HB2  . PHE A 1 20 ? -1.903  -2.163  1.173   1.00 15.00 ?  298 PHE A HB2  1  
ATOM   313   H HB3  . PHE A 1 20 ? -1.274  -1.396  2.648   1.00 15.00 ?  298 PHE A HB3  1  
ATOM   314   H HD1  . PHE A 1 20 ? -0.909  1.101   2.541   1.00 15.00 ?  298 PHE A HD1  1  
ATOM   315   H HD2  . PHE A 1 20 ? -3.530  -1.036  -0.029  1.00 15.00 ?  298 PHE A HD2  1  
ATOM   316   H HE1  . PHE A 1 20 ? -2.057  3.184   2.020   1.00 15.00 ?  298 PHE A HE1  1  
ATOM   317   H HE2  . PHE A 1 20 ? -4.707  1.065   -0.539  1.00 15.00 ?  298 PHE A HE2  1  
ATOM   318   H HZ   . PHE A 1 20 ? -3.955  3.117   0.530   1.00 15.00 ?  298 PHE A HZ   1  
ATOM   319   N N    . VAL A 1 21 ? 1.552   -0.435  2.455   1.00 15.00 ?  299 VAL A N    1  
ATOM   320   C CA   . VAL A 1 21 ? 2.620   -0.480  3.392   1.00 15.00 ?  299 VAL A CA   1  
ATOM   321   C C    . VAL A 1 21 ? 2.273   0.469   4.537   1.00 15.00 ?  299 VAL A C    1  
ATOM   322   O O    . VAL A 1 21 ? 2.552   1.671   4.502   1.00 15.00 ?  299 VAL A O    1  
ATOM   323   C CB   . VAL A 1 21 ? 3.944   -0.076  2.704   1.00 15.00 ?  299 VAL A CB   1  
ATOM   324   C CG1  . VAL A 1 21 ? 4.382   -1.154  1.720   1.00 15.00 ?  299 VAL A CG1  1  
ATOM   325   C CG2  . VAL A 1 21 ? 3.783   1.242   1.965   1.00 15.00 ?  299 VAL A CG2  1  
ATOM   326   H H    . VAL A 1 21 ? 1.164   0.440   2.252   1.00 15.00 ?  299 VAL A H    1  
ATOM   327   H HA   . VAL A 1 21 ? 2.708   -1.488  3.770   1.00 15.00 ?  299 VAL A HA   1  
ATOM   328   H HB   . VAL A 1 21 ? 4.711   0.040   3.460   1.00 15.00 ?  299 VAL A HB   1  
ATOM   329   H HG11 . VAL A 1 21 ? 3.619   -1.289  0.969   1.00 15.00 ?  299 VAL A HG11 1  
ATOM   330   H HG12 . VAL A 1 21 ? 4.536   -2.084  2.248   1.00 15.00 ?  299 VAL A HG12 1  
ATOM   331   H HG13 . VAL A 1 21 ? 5.304   -0.854  1.246   1.00 15.00 ?  299 VAL A HG13 1  
ATOM   332   H HG21 . VAL A 1 21 ? 4.709   1.492   1.467   1.00 15.00 ?  299 VAL A HG21 1  
ATOM   333   H HG22 . VAL A 1 21 ? 3.533   2.019   2.671   1.00 15.00 ?  299 VAL A HG22 1  
ATOM   334   H HG23 . VAL A 1 21 ? 2.994   1.153   1.233   1.00 15.00 ?  299 VAL A HG23 1  
ATOM   335   N N    . ASP A 1 22 ? 1.603   -0.061  5.532   1.00 15.00 ?  300 ASP A N    1  
ATOM   336   C CA   . ASP A 1 22 ? 1.180   0.752   6.649   1.00 15.00 ?  300 ASP A CA   1  
ATOM   337   C C    . ASP A 1 22 ? 2.275   0.739   7.693   1.00 15.00 ?  300 ASP A C    1  
ATOM   338   O O    . ASP A 1 22 ? 2.713   -0.325  8.139   1.00 15.00 ?  300 ASP A O    1  
ATOM   339   C CB   . ASP A 1 22 ? -0.171  0.262   7.197   1.00 15.00 ?  300 ASP A CB   1  
ATOM   340   C CG   . ASP A 1 22 ? -0.157  -0.045  8.681   1.00 15.00 ?  300 ASP A CG   1  
ATOM   341   O OD1  . ASP A 1 22 ? -0.095  0.900   9.494   1.00 15.00 -1 300 ASP A OD1  1  
ATOM   342   O OD2  . ASP A 1 22 ? -0.204  -1.238  9.036   1.00 15.00 ?  300 ASP A OD2  1  
ATOM   343   H H    . ASP A 1 22 ? 1.393   -1.023  5.520   1.00 15.00 ?  300 ASP A H    1  
ATOM   344   H HA   . ASP A 1 22 ? 1.066   1.766   6.287   1.00 15.00 ?  300 ASP A HA   1  
ATOM   345   H HB2  . ASP A 1 22 ? -0.912  1.026   7.021   1.00 15.00 ?  300 ASP A HB2  1  
ATOM   346   H HB3  . ASP A 1 22 ? -0.461  -0.633  6.667   1.00 15.00 ?  300 ASP A HB3  1  
ATOM   347   N N    . HIS A 1 23 ? 2.751   1.925   8.039   1.00 15.00 ?  301 HIS A N    1  
ATOM   348   C CA   . HIS A 1 23 ? 3.905   2.049   8.915   1.00 15.00 ?  301 HIS A CA   1  
ATOM   349   C C    . HIS A 1 23 ? 3.489   1.962   10.382  1.00 15.00 ?  301 HIS A C    1  
ATOM   350   O O    . HIS A 1 23 ? 4.335   1.818   11.266  1.00 15.00 ?  301 HIS A O    1  
ATOM   351   C CB   . HIS A 1 23 ? 4.646   3.378   8.702   1.00 15.00 ?  301 HIS A CB   1  
ATOM   352   C CG   . HIS A 1 23 ? 5.137   3.674   7.306   1.00 15.00 ?  301 HIS A CG   1  
ATOM   353   N ND1  . HIS A 1 23 ? 5.273   4.960   6.837   1.00 15.00 ?  301 HIS A ND1  1  
ATOM   354   C CD2  . HIS A 1 23 ? 5.619   2.876   6.322   1.00 15.00 ?  301 HIS A CD2  1  
ATOM   355   C CE1  . HIS A 1 23 ? 5.821   4.936   5.641   1.00 15.00 ?  301 HIS A CE1  1  
ATOM   356   N NE2  . HIS A 1 23 ? 6.051   3.684   5.302   1.00 15.00 ?  301 HIS A NE2  1  
ATOM   357   H H    . HIS A 1 23 ? 2.302   2.737   7.709   1.00 15.00 ?  301 HIS A H    1  
ATOM   358   H HA   . HIS A 1 23 ? 4.578   1.233   8.695   1.00 15.00 ?  301 HIS A HA   1  
ATOM   359   H HB2  . HIS A 1 23 ? 3.996   4.180   8.985   1.00 15.00 ?  301 HIS A HB2  1  
ATOM   360   H HB3  . HIS A 1 23 ? 5.507   3.388   9.354   1.00 15.00 ?  301 HIS A HB3  1  
ATOM   361   H HD1  . HIS A 1 23 ? 4.991   5.780   7.305   1.00 15.00 ?  301 HIS A HD1  1  
ATOM   362   H HD2  . HIS A 1 23 ? 5.632   1.796   6.318   1.00 15.00 ?  301 HIS A HD2  1  
ATOM   363   H HE1  . HIS A 1 23 ? 6.035   5.800   5.027   1.00 15.00 ?  301 HIS A HE1  1  
ATOM   364   H HE2  . HIS A 1 23 ? 6.735   3.417   4.643   1.00 15.00 ?  301 HIS A HE2  1  
ATOM   365   N N    . ASN A 1 24 ? 2.192   2.061   10.641  1.00 15.00 ?  302 ASN A N    1  
ATOM   366   C CA   . ASN A 1 24 ? 1.692   2.124   12.010  1.00 15.00 ?  302 ASN A CA   1  
ATOM   367   C C    . ASN A 1 24 ? 1.488   0.723   12.572  1.00 15.00 ?  302 ASN A C    1  
ATOM   368   O O    . ASN A 1 24 ? 2.117   0.337   13.559  1.00 15.00 ?  302 ASN A O    1  
ATOM   369   C CB   . ASN A 1 24 ? 0.378   2.912   12.064  1.00 15.00 ?  302 ASN A CB   1  
ATOM   370   C CG   . ASN A 1 24 ? -0.120  3.128   13.483  1.00 15.00 ?  302 ASN A CG   1  
ATOM   371   O OD1  . ASN A 1 24 ? 0.238   4.108   14.133  1.00 15.00 ?  302 ASN A OD1  1  
ATOM   372   N ND2  . ASN A 1 24 ? -0.961  2.225   13.965  1.00 15.00 ?  302 ASN A ND2  1  
ATOM   373   H H    . ASN A 1 24 ? 1.548   2.066   9.895   1.00 15.00 ?  302 ASN A H    1  
ATOM   374   H HA   . ASN A 1 24 ? 2.432   2.633   12.609  1.00 15.00 ?  302 ASN A HA   1  
ATOM   375   H HB2  . ASN A 1 24 ? 0.527   3.878   11.606  1.00 15.00 ?  302 ASN A HB2  1  
ATOM   376   H HB3  . ASN A 1 24 ? -0.379  2.371   11.515  1.00 15.00 ?  302 ASN A HB3  1  
ATOM   377   H HD21 . ASN A 1 24 ? -1.215  1.474   13.389  1.00 15.00 ?  302 ASN A HD21 1  
ATOM   378   H HD22 . ASN A 1 24 ? -1.291  2.343   14.880  1.00 15.00 ?  302 ASN A HD22 1  
ATOM   379   N N    . ASN A 1 25 ? 0.613   -0.039  11.932  1.00 15.00 ?  303 ASN A N    1  
ATOM   380   C CA   . ASN A 1 25 ? 0.321   -1.402  12.365  1.00 15.00 ?  303 ASN A CA   1  
ATOM   381   C C    . ASN A 1 25 ? 1.283   -2.385  11.702  1.00 15.00 ?  303 ASN A C    1  
ATOM   382   O O    . ASN A 1 25 ? 1.394   -3.539  12.119  1.00 15.00 ?  303 ASN A O    1  
ATOM   383   C CB   . ASN A 1 25 ? -1.136  -1.765  12.035  1.00 15.00 ?  303 ASN A CB   1  
ATOM   384   C CG   . ASN A 1 25 ? -1.553  -3.123  12.572  1.00 15.00 ?  303 ASN A CG   1  
ATOM   385   O OD1  . ASN A 1 25 ? -1.992  -3.243  13.715  1.00 15.00 ?  303 ASN A OD1  1  
ATOM   386   N ND2  . ASN A 1 25 ? -1.449  -4.150  11.744  1.00 15.00 ?  303 ASN A ND2  1  
ATOM   387   H H    . ASN A 1 25 ? 0.150   0.324   11.134  1.00 15.00 ?  303 ASN A H    1  
ATOM   388   H HA   . ASN A 1 25 ? 0.461   -1.447  13.434  1.00 15.00 ?  303 ASN A HA   1  
ATOM   389   H HB2  . ASN A 1 25 ? -1.788  -1.021  12.463  1.00 15.00 ?  303 ASN A HB2  1  
ATOM   390   H HB3  . ASN A 1 25 ? -1.262  -1.770  10.962  1.00 15.00 ?  303 ASN A HB3  1  
ATOM   391   H HD21 . ASN A 1 25 ? -1.109  -3.984  10.830  1.00 15.00 ?  303 ASN A HD21 1  
ATOM   392   H HD22 . ASN A 1 25 ? -1.712  -5.035  12.070  1.00 15.00 ?  303 ASN A HD22 1  
ATOM   393   N N    . ARG A 1 26 ? 1.968   -1.909  10.662  1.00 15.00 ?  304 ARG A N    1  
ATOM   394   C CA   . ARG A 1 26 ? 2.914   -2.713  9.901   1.00 15.00 ?  304 ARG A CA   1  
ATOM   395   C C    . ARG A 1 26 ? 2.177   -3.835  9.172   1.00 15.00 ?  304 ARG A C    1  
ATOM   396   O O    . ARG A 1 26 ? 2.192   -4.995  9.590   1.00 15.00 ?  304 ARG A O    1  
ATOM   397   C CB   . ARG A 1 26 ? 4.031   -3.248  10.808  1.00 15.00 ?  304 ARG A CB   1  
ATOM   398   C CG   . ARG A 1 26 ? 5.160   -3.939  10.066  1.00 15.00 ?  304 ARG A CG   1  
ATOM   399   C CD   . ARG A 1 26 ? 6.407   -4.041  10.930  1.00 15.00 ?  304 ARG A CD   1  
ATOM   400   N NE   . ARG A 1 26 ? 6.165   -4.768  12.175  1.00 15.00 ?  304 ARG A NE   1  
ATOM   401   C CZ   . ARG A 1 26 ? 6.858   -4.580  13.297  1.00 15.00 ?  304 ARG A CZ   1  
ATOM   402   N NH1  . ARG A 1 26 ? 7.816   -3.664  13.351  1.00 15.00 1  304 ARG A NH1  1  
ATOM   403   N NH2  . ARG A 1 26 ? 6.583   -5.296  14.379  1.00 15.00 ?  304 ARG A NH2  1  
ATOM   404   H H    . ARG A 1 26 ? 1.809   -0.986  10.380  1.00 15.00 ?  304 ARG A H    1  
ATOM   405   H HA   . ARG A 1 26 ? 3.356   -2.064  9.157   1.00 15.00 ?  304 ARG A HA   1  
ATOM   406   H HB2  . ARG A 1 26 ? 4.452   -2.423  11.363  1.00 15.00 ?  304 ARG A HB2  1  
ATOM   407   H HB3  . ARG A 1 26 ? 3.604   -3.954  11.505  1.00 15.00 ?  304 ARG A HB3  1  
ATOM   408   H HG2  . ARG A 1 26 ? 4.842   -4.933  9.790   1.00 15.00 ?  304 ARG A HG2  1  
ATOM   409   H HG3  . ARG A 1 26 ? 5.394   -3.372  9.177   1.00 15.00 ?  304 ARG A HG3  1  
ATOM   410   H HD2  . ARG A 1 26 ? 7.174   -4.556  10.370  1.00 15.00 ?  304 ARG A HD2  1  
ATOM   411   H HD3  . ARG A 1 26 ? 6.746   -3.043  11.167  1.00 15.00 ?  304 ARG A HD3  1  
ATOM   412   H HE   . ARG A 1 26 ? 5.448   -5.453  12.166  1.00 15.00 ?  304 ARG A HE   1  
ATOM   413   H HH11 . ARG A 1 26 ? 8.027   -3.098  12.547  1.00 15.00 ?  304 ARG A HH11 1  
ATOM   414   H HH12 . ARG A 1 26 ? 8.341   -3.535  14.203  1.00 15.00 ?  304 ARG A HH12 1  
ATOM   415   H HH21 . ARG A 1 26 ? 5.845   -5.984  14.361  1.00 15.00 ?  304 ARG A HH21 1  
ATOM   416   H HH22 . ARG A 1 26 ? 7.108   -5.153  15.222  1.00 15.00 ?  304 ARG A HH22 1  
ATOM   417   N N    . THR A 1 27 ? 1.490   -3.458  8.100   1.00 15.00 ?  305 THR A N    1  
ATOM   418   C CA   . THR A 1 27 ? 0.648   -4.384  7.350   1.00 15.00 ?  305 THR A CA   1  
ATOM   419   C C    . THR A 1 27 ? 0.782   -4.139  5.846   1.00 15.00 ?  305 THR A C    1  
ATOM   420   O O    . THR A 1 27 ? 1.048   -3.010  5.423   1.00 15.00 ?  305 THR A O    1  
ATOM   421   C CB   . THR A 1 27 ? -0.831  -4.221  7.754   1.00 15.00 ?  305 THR A CB   1  
ATOM   422   O OG1  . THR A 1 27 ? -0.917  -3.747  9.103   1.00 15.00 ?  305 THR A OG1  1  
ATOM   423   C CG2  . THR A 1 27 ? -1.577  -5.541  7.638   1.00 15.00 ?  305 THR A CG2  1  
ATOM   424   H H    . THR A 1 27 ? 1.536   -2.517  7.813   1.00 15.00 ?  305 THR A H    1  
ATOM   425   H HA   . THR A 1 27 ? 0.960   -5.394  7.578   1.00 15.00 ?  305 THR A HA   1  
ATOM   426   H HB   . THR A 1 27 ? -1.293  -3.501  7.094   1.00 15.00 ?  305 THR A HB   1  
ATOM   427   H HG1  . THR A 1 27 ? -0.612  -2.819  9.133   1.00 15.00 ?  305 THR A HG1  1  
ATOM   428   H HG21 . THR A 1 27 ? -1.525  -5.896  6.620   1.00 15.00 ?  305 THR A HG21 1  
ATOM   429   H HG22 . THR A 1 27 ? -2.610  -5.396  7.918   1.00 15.00 ?  305 THR A HG22 1  
ATOM   430   H HG23 . THR A 1 27 ? -1.124  -6.268  8.297   1.00 15.00 ?  305 THR A HG23 1  
ATOM   431   N N    . THR A 1 28 ? 0.614   -5.191  5.043   1.00 15.00 ?  306 THR A N    1  
ATOM   432   C CA   . THR A 1 28 ? 0.722   -5.068  3.593   1.00 15.00 ?  306 THR A CA   1  
ATOM   433   C C    . THR A 1 28 ? -0.486  -5.693  2.885   1.00 15.00 ?  306 THR A C    1  
ATOM   434   O O    . THR A 1 28 ? -0.877  -6.822  3.185   1.00 15.00 ?  306 THR A O    1  
ATOM   435   C CB   . THR A 1 28 ? 2.030   -5.704  3.075   1.00 15.00 ?  306 THR A CB   1  
ATOM   436   O OG1  . THR A 1 28 ? 2.162   -7.057  3.548   1.00 15.00 ?  306 THR A OG1  1  
ATOM   437   C CG2  . THR A 1 28 ? 3.233   -4.889  3.528   1.00 15.00 ?  306 THR A CG2  1  
ATOM   438   H H    . THR A 1 28 ? 0.409   -6.071  5.433   1.00 15.00 ?  306 THR A H    1  
ATOM   439   H HA   . THR A 1 28 ? 0.747   -4.013  3.357   1.00 15.00 ?  306 THR A HA   1  
ATOM   440   H HB   . THR A 1 28 ? 2.006   -5.711  1.995   1.00 15.00 ?  306 THR A HB   1  
ATOM   441   H HG1  . THR A 1 28 ? 2.984   -7.430  3.207   1.00 15.00 ?  306 THR A HG1  1  
ATOM   442   H HG21 . THR A 1 28 ? 3.152   -3.884  3.141   1.00 15.00 ?  306 THR A HG21 1  
ATOM   443   H HG22 . THR A 1 28 ? 4.138   -5.346  3.155   1.00 15.00 ?  306 THR A HG22 1  
ATOM   444   H HG23 . THR A 1 28 ? 3.263   -4.858  4.607   1.00 15.00 ?  306 THR A HG23 1  
ATOM   445   N N    . GLN A 1 29 ? -1.084  -4.950  1.953   1.00 15.00 ?  307 GLN A N    1  
ATOM   446   C CA   . GLN A 1 29 ? -2.303  -5.409  1.269   1.00 15.00 ?  307 GLN A CA   1  
ATOM   447   C C    . GLN A 1 29 ? -2.397  -4.851  -0.152  1.00 15.00 ?  307 GLN A C    1  
ATOM   448   O O    . GLN A 1 29 ? -2.020  -3.720  -0.391  1.00 15.00 ?  307 GLN A O    1  
ATOM   449   C CB   . GLN A 1 29 ? -3.535  -4.963  2.055   1.00 15.00 ?  307 GLN A CB   1  
ATOM   450   C CG   . GLN A 1 29 ? -4.478  -6.099  2.427   1.00 15.00 ?  307 GLN A CG   1  
ATOM   451   C CD   . GLN A 1 29 ? -4.824  -6.989  1.245   1.00 15.00 ?  307 GLN A CD   1  
ATOM   452   O OE1  . GLN A 1 29 ? -5.753  -6.711  0.496   1.00 15.00 ?  307 GLN A OE1  1  
ATOM   453   N NE2  . GLN A 1 29 ? -4.090  -8.079  1.081   1.00 15.00 ?  307 GLN A NE2  1  
ATOM   454   H H    . GLN A 1 29 ? -0.692  -4.076  1.712   1.00 15.00 ?  307 GLN A H    1  
ATOM   455   H HA   . GLN A 1 29 ? -2.281  -6.487  1.227   1.00 15.00 ?  307 GLN A HA   1  
ATOM   456   H HB2  . GLN A 1 29 ? -3.211  -4.477  2.963   1.00 15.00 ?  307 GLN A HB2  1  
ATOM   457   H HB3  . GLN A 1 29 ? -4.086  -4.251  1.456   1.00 15.00 ?  307 GLN A HB3  1  
ATOM   458   H HG2  . GLN A 1 29 ? -4.009  -6.703  3.189   1.00 15.00 ?  307 GLN A HG2  1  
ATOM   459   H HG3  . GLN A 1 29 ? -5.392  -5.673  2.818   1.00 15.00 ?  307 GLN A HG3  1  
ATOM   460   H HE21 . GLN A 1 29 ? -3.367  -8.257  1.730   1.00 15.00 ?  307 GLN A HE21 1  
ATOM   461   H HE22 . GLN A 1 29 ? -4.303  -8.671  0.330   1.00 15.00 ?  307 GLN A HE22 1  
ATOM   462   N N    . PHE A 1 30 ? -2.944  -5.623  -1.085  1.00 15.00 ?  308 PHE A N    1  
ATOM   463   C CA   . PHE A 1 30 ? -3.140  -5.133  -2.454  1.00 15.00 ?  308 PHE A CA   1  
ATOM   464   C C    . PHE A 1 30 ? -4.510  -4.483  -2.645  1.00 15.00 ?  308 PHE A C    1  
ATOM   465   O O    . PHE A 1 30 ? -4.742  -3.807  -3.645  1.00 15.00 ?  308 PHE A O    1  
ATOM   466   C CB   . PHE A 1 30 ? -2.942  -6.245  -3.489  1.00 15.00 ?  308 PHE A CB   1  
ATOM   467   C CG   . PHE A 1 30 ? -1.523  -6.363  -3.972  1.00 15.00 ?  308 PHE A CG   1  
ATOM   468   C CD1  . PHE A 1 30 ? -0.920  -5.305  -4.628  1.00 15.00 ?  308 PHE A CD1  1  
ATOM   469   C CD2  . PHE A 1 30 ? -0.798  -7.521  -3.782  1.00 15.00 ?  308 PHE A CD2  1  
ATOM   470   C CE1  . PHE A 1 30 ? 0.383   -5.398  -5.081  1.00 15.00 ?  308 PHE A CE1  1  
ATOM   471   C CE2  . PHE A 1 30 ? 0.500   -7.618  -4.228  1.00 15.00 ?  308 PHE A CE2  1  
ATOM   472   C CZ   . PHE A 1 30 ? 1.095   -6.557  -4.876  1.00 15.00 ?  308 PHE A CZ   1  
ATOM   473   H H    . PHE A 1 30 ? -3.224  -6.532  -0.854  1.00 15.00 ?  308 PHE A H    1  
ATOM   474   H HA   . PHE A 1 30 ? -2.389  -4.375  -2.626  1.00 15.00 ?  308 PHE A HA   1  
ATOM   475   H HB2  . PHE A 1 30 ? -3.223  -7.191  -3.050  1.00 15.00 ?  308 PHE A HB2  1  
ATOM   476   H HB3  . PHE A 1 30 ? -3.570  -6.047  -4.344  1.00 15.00 ?  308 PHE A HB3  1  
ATOM   477   H HD1  . PHE A 1 30 ? -1.476  -4.395  -4.776  1.00 15.00 ?  308 PHE A HD1  1  
ATOM   478   H HD2  . PHE A 1 30 ? -1.257  -8.364  -3.289  1.00 15.00 ?  308 PHE A HD2  1  
ATOM   479   H HE1  . PHE A 1 30 ? 0.843   -4.566  -5.599  1.00 15.00 ?  308 PHE A HE1  1  
ATOM   480   H HE2  . PHE A 1 30 ? 1.054   -8.536  -4.064  1.00 15.00 ?  308 PHE A HE2  1  
ATOM   481   H HZ   . PHE A 1 30 ? 2.113   -6.638  -5.228  1.00 15.00 ?  308 PHE A HZ   1  
ATOM   482   N N    . THR A 1 31 ? -5.426  -4.708  -1.713  1.00 15.00 ?  309 THR A N    1  
ATOM   483   C CA   . THR A 1 31 ? -6.752  -4.115  -1.809  1.00 15.00 ?  309 THR A CA   1  
ATOM   484   C C    . THR A 1 31 ? -6.732  -2.682  -1.286  1.00 15.00 ?  309 THR A C    1  
ATOM   485   O O    . THR A 1 31 ? -6.538  -2.452  -0.090  1.00 15.00 ?  309 THR A O    1  
ATOM   486   C CB   . THR A 1 31 ? -7.795  -4.926  -1.017  1.00 15.00 ?  309 THR A CB   1  
ATOM   487   O OG1  . THR A 1 31 ? -7.637  -6.324  -1.296  1.00 15.00 ?  309 THR A OG1  1  
ATOM   488   C CG2  . THR A 1 31 ? -9.209  -4.492  -1.375  1.00 15.00 ?  309 THR A CG2  1  
ATOM   489   H H    . THR A 1 31 ? -5.207  -5.272  -0.945  1.00 15.00 ?  309 THR A H    1  
ATOM   490   H HA   . THR A 1 31 ? -7.042  -4.107  -2.850  1.00 15.00 ?  309 THR A HA   1  
ATOM   491   H HB   . THR A 1 31 ? -7.638  -4.755  0.039   1.00 15.00 ?  309 THR A HB   1  
ATOM   492   H HG1  . THR A 1 31 ? -7.028  -6.704  -0.645  1.00 15.00 ?  309 THR A HG1  1  
ATOM   493   H HG21 . THR A 1 31 ? -9.338  -3.447  -1.134  1.00 15.00 ?  309 THR A HG21 1  
ATOM   494   H HG22 . THR A 1 31 ? -9.919  -5.081  -0.813  1.00 15.00 ?  309 THR A HG22 1  
ATOM   495   H HG23 . THR A 1 31 ? -9.375  -4.641  -2.431  1.00 15.00 ?  309 THR A HG23 1  
ATOM   496   N N    . ASP A 1 32 ? -6.919  -1.726  -2.183  1.00 15.00 ?  310 ASP A N    1  
ATOM   497   C CA   . ASP A 1 32 ? -6.925  -0.322  -1.800  1.00 15.00 ?  310 ASP A CA   1  
ATOM   498   C C    . ASP A 1 32 ? -8.350  0.136   -1.495  1.00 15.00 ?  310 ASP A C    1  
ATOM   499   O O    . ASP A 1 32 ? -9.236  0.063   -2.351  1.00 15.00 ?  310 ASP A O    1  
ATOM   500   C CB   . ASP A 1 32 ? -6.295  0.542   -2.900  1.00 15.00 ?  310 ASP A CB   1  
ATOM   501   C CG   . ASP A 1 32 ? -6.228  2.013   -2.532  1.00 15.00 ?  310 ASP A CG   1  
ATOM   502   O OD1  . ASP A 1 32 ? -7.274  2.684   -2.558  1.00 15.00 -1 310 ASP A OD1  1  
ATOM   503   O OD2  . ASP A 1 32 ? -5.126  2.510   -2.233  1.00 15.00 ?  310 ASP A OD2  1  
ATOM   504   H H    . ASP A 1 32 ? -7.060  -1.967  -3.122  1.00 15.00 ?  310 ASP A H    1  
ATOM   505   H HA   . ASP A 1 32 ? -6.339  -0.231  -0.900  1.00 15.00 ?  310 ASP A HA   1  
ATOM   506   H HB2  . ASP A 1 32 ? -5.291  0.197   -3.090  1.00 15.00 ?  310 ASP A HB2  1  
ATOM   507   H HB3  . ASP A 1 32 ? -6.872  0.443   -3.804  1.00 15.00 ?  310 ASP A HB3  1  
ATOM   508   N N    . PRO A 1 33 ? -8.579  0.618   -0.263  1.00 15.00 ?  311 PRO A N    1  
ATOM   509   C CA   . PRO A 1 33 ? -9.911  0.992   0.225   1.00 15.00 ?  311 PRO A CA   1  
ATOM   510   C C    . PRO A 1 33 ? -10.460 2.268   -0.412  1.00 15.00 ?  311 PRO A C    1  
ATOM   511   O O    . PRO A 1 33 ? -11.648 2.570   -0.279  1.00 15.00 ?  311 PRO A O    1  
ATOM   512   C CB   . PRO A 1 33 ? -9.697  1.188   1.726   1.00 15.00 ?  311 PRO A CB   1  
ATOM   513   C CG   . PRO A 1 33 ? -8.269  1.587   1.846   1.00 15.00 ?  311 PRO A CG   1  
ATOM   514   C CD   . PRO A 1 33 ? -7.541  0.839   0.762   1.00 15.00 ?  311 PRO A CD   1  
ATOM   515   H HA   . PRO A 1 33 ? -10.618 0.191   0.070   1.00 15.00 ?  311 PRO A HA   1  
ATOM   516   H HB2  . PRO A 1 33 ? -10.359 1.961   2.093   1.00 15.00 ?  311 PRO A HB2  1  
ATOM   517   H HB3  . PRO A 1 33 ? -9.891  0.261   2.245   1.00 15.00 ?  311 PRO A HB3  1  
ATOM   518   H HG2  . PRO A 1 33 ? -8.173  2.653   1.697   1.00 15.00 ?  311 PRO A HG2  1  
ATOM   519   H HG3  . PRO A 1 33 ? -7.888  1.306   2.816   1.00 15.00 ?  311 PRO A HG3  1  
ATOM   520   H HD2  . PRO A 1 33 ? -6.733  1.437   0.368   1.00 15.00 ?  311 PRO A HD2  1  
ATOM   521   H HD3  . PRO A 1 33 ? -7.167  -0.101  1.139   1.00 15.00 ?  311 PRO A HD3  1  
ATOM   522   N N    . ARG A 1 34 ? -9.599  3.034   -1.070  1.00 15.00 ?  312 ARG A N    1  
ATOM   523   C CA   . ARG A 1 34 ? -10.014 4.295   -1.671  1.00 15.00 ?  312 ARG A CA   1  
ATOM   524   C C    . ARG A 1 34 ? -10.845 4.030   -2.922  1.00 15.00 ?  312 ARG A C    1  
ATOM   525   O O    . ARG A 1 34 ? -11.647 4.867   -3.334  1.00 15.00 ?  312 ARG A O    1  
ATOM   526   C CB   . ARG A 1 34 ? -8.796  5.161   -2.012  1.00 15.00 ?  312 ARG A CB   1  
ATOM   527   C CG   . ARG A 1 34 ? -7.808  5.287   -0.863  1.00 15.00 ?  312 ARG A CG   1  
ATOM   528   C CD   . ARG A 1 34 ? -6.478  5.872   -1.319  1.00 15.00 ?  312 ARG A CD   1  
ATOM   529   N NE   . ARG A 1 34 ? -6.557  7.308   -1.581  1.00 15.00 ?  312 ARG A NE   1  
ATOM   530   C CZ   . ARG A 1 34 ? -5.529  8.051   -1.992  1.00 15.00 ?  312 ARG A CZ   1  
ATOM   531   N NH1  . ARG A 1 34 ? -4.369  7.482   -2.308  1.00 15.00 1  312 ARG A NH1  1  
ATOM   532   N NH2  . ARG A 1 34 ? -5.678  9.363   -2.119  1.00 15.00 ?  312 ARG A NH2  1  
ATOM   533   H H    . ARG A 1 34 ? -8.666  2.733   -1.178  1.00 15.00 ?  312 ARG A H    1  
ATOM   534   H HA   . ARG A 1 34 ? -10.626 4.817   -0.951  1.00 15.00 ?  312 ARG A HA   1  
ATOM   535   H HB2  . ARG A 1 34 ? -8.285  4.724   -2.857  1.00 15.00 ?  312 ARG A HB2  1  
ATOM   536   H HB3  . ARG A 1 34 ? -9.133  6.151   -2.279  1.00 15.00 ?  312 ARG A HB3  1  
ATOM   537   H HG2  . ARG A 1 34 ? -8.232  5.932   -0.107  1.00 15.00 ?  312 ARG A HG2  1  
ATOM   538   H HG3  . ARG A 1 34 ? -7.634  4.307   -0.444  1.00 15.00 ?  312 ARG A HG3  1  
ATOM   539   H HD2  . ARG A 1 34 ? -5.743  5.700   -0.546  1.00 15.00 ?  312 ARG A HD2  1  
ATOM   540   H HD3  . ARG A 1 34 ? -6.170  5.367   -2.224  1.00 15.00 ?  312 ARG A HD3  1  
ATOM   541   H HE   . ARG A 1 34 ? -7.425  7.753   -1.410  1.00 15.00 ?  312 ARG A HE   1  
ATOM   542   H HH11 . ARG A 1 34 ? -4.260  6.483   -2.244  1.00 15.00 ?  312 ARG A HH11 1  
ATOM   543   H HH12 . ARG A 1 34 ? -3.592  8.052   -2.613  1.00 15.00 ?  312 ARG A HH12 1  
ATOM   544   H HH21 . ARG A 1 34 ? -6.564  9.789   -1.909  1.00 15.00 ?  312 ARG A HH21 1  
ATOM   545   H HH22 . ARG A 1 34 ? -4.907  9.937   -2.415  1.00 15.00 ?  312 ARG A HH22 1  
ATOM   546   N N    . LEU A 1 35 ? -10.636 2.863   -3.528  1.00 15.00 ?  313 LEU A N    1  
ATOM   547   C CA   . LEU A 1 35 ? -11.423 2.444   -4.682  1.00 15.00 ?  313 LEU A CA   1  
ATOM   548   C C    . LEU A 1 35 ? -12.707 1.777   -4.216  1.00 15.00 ?  313 LEU A C    1  
ATOM   549   O O    . LEU A 1 35 ? -12.635 0.633   -3.726  1.00 15.00 ?  313 LEU A O    1  
ATOM   550   C CB   . LEU A 1 35 ? -10.649 1.470   -5.583  1.00 15.00 ?  313 LEU A CB   1  
ATOM   551   C CG   . LEU A 1 35 ? -9.440  2.045   -6.327  1.00 15.00 ?  313 LEU A CG   1  
ATOM   552   C CD1  . LEU A 1 35 ? -8.234  2.135   -5.413  1.00 15.00 ?  313 LEU A CD1  1  
ATOM   553   C CD2  . LEU A 1 35 ? -9.118  1.196   -7.545  1.00 15.00 ?  313 LEU A CD2  1  
ATOM   554   H H    . LEU A 1 35 ? -9.936  2.267   -3.186  1.00 15.00 ?  313 LEU A H    1  
ATOM   555   H HA   . LEU A 1 35 ? -11.676 3.327   -5.251  1.00 15.00 ?  313 LEU A HA   1  
ATOM   556   H HB2  . LEU A 1 35 ? -10.304 0.650   -4.970  1.00 15.00 ?  313 LEU A HB2  1  
ATOM   557   H HB3  . LEU A 1 35 ? -11.337 1.077   -6.316  1.00 15.00 ?  313 LEU A HB3  1  
ATOM   558   H HG   . LEU A 1 35 ? -9.675  3.043   -6.668  1.00 15.00 ?  313 LEU A HG   1  
ATOM   559   H HD11 . LEU A 1 35 ? -7.368  2.440   -5.981  1.00 15.00 ?  313 LEU A HD11 1  
ATOM   560   H HD12 . LEU A 1 35 ? -8.047  1.168   -4.968  1.00 15.00 ?  313 LEU A HD12 1  
ATOM   561   H HD13 . LEU A 1 35 ? -8.425  2.857   -4.633  1.00 15.00 ?  313 LEU A HD13 1  
ATOM   562   H HD21 . LEU A 1 35 ? -9.968  1.187   -8.213  1.00 15.00 ?  313 LEU A HD21 1  
ATOM   563   H HD22 . LEU A 1 35 ? -8.895  0.187   -7.232  1.00 15.00 ?  313 LEU A HD22 1  
ATOM   564   H HD23 . LEU A 1 35 ? -8.263  1.613   -8.056  1.00 15.00 ?  313 LEU A HD23 1  
ATOM   565   N N    . ASP B 2 2  ? -1.633  -9.225  -9.485  1.00 15.00 ?  221 ASP B N    1  
ATOM   566   C CA   . ASP B 2 2  ? -0.179  -9.269  -9.226  1.00 15.00 ?  221 ASP B CA   1  
ATOM   567   C C    . ASP B 2 2  ? 0.124   -10.350 -8.182  1.00 15.00 ?  221 ASP B C    1  
ATOM   568   O O    . ASP B 2 2  ? -0.782  -11.044 -7.715  1.00 15.00 ?  221 ASP B O    1  
ATOM   569   C CB   . ASP B 2 2  ? 0.322   -7.881  -8.773  1.00 15.00 ?  221 ASP B CB   1  
ATOM   570   C CG   . ASP B 2 2  ? 1.837   -7.768  -8.754  1.00 15.00 ?  221 ASP B CG   1  
ATOM   571   O OD1  . ASP B 2 2  ? 2.420   -7.389  -9.789  1.00 15.00 ?  221 ASP B OD1  1  
ATOM   572   O OD2  . ASP B 2 2  ? 2.452   -8.050  -7.710  1.00 15.00 -1 221 ASP B OD2  1  
ATOM   573   H H    . ASP B 2 2  ? -1.942  -10.123 -9.921  1.00 15.00 ?  221 ASP B H    1  
ATOM   574   H HA   . ASP B 2 2  ? 0.316   -9.537  -10.149 1.00 15.00 ?  221 ASP B HA   1  
ATOM   575   H HB2  . ASP B 2 2  ? -0.057  -7.136  -9.455  1.00 15.00 ?  221 ASP B HB2  1  
ATOM   576   H HB3  . ASP B 2 2  ? -0.049  -7.667  -7.783  1.00 15.00 ?  221 ASP B HB3  1  
ATOM   577   N N    . THR B 2 3  ? 1.394   -10.507 -7.846  1.00 15.00 ?  222 THR B N    1  
ATOM   578   C CA   . THR B 2 3  ? 1.841   -11.473 -6.852  1.00 15.00 ?  222 THR B CA   1  
ATOM   579   C C    . THR B 2 3  ? 1.443   -11.038 -5.441  1.00 15.00 ?  222 THR B C    1  
ATOM   580   O O    . THR B 2 3  ? 0.763   -10.039 -5.292  1.00 15.00 ?  222 THR B O    1  
ATOM   581   C CB   . THR B 2 3  ? 3.370   -11.642 -6.954  1.00 15.00 ?  222 THR B CB   1  
ATOM   582   O OG1  . THR B 2 3  ? 4.003   -10.352 -7.020  1.00 15.00 ?  222 THR B OG1  1  
ATOM   583   C CG2  . THR B 2 3  ? 3.740   -12.458 -8.185  1.00 15.00 ?  222 THR B CG2  1  
ATOM   584   H H    . THR B 2 3  ? 2.066   -9.935  -8.276  1.00 15.00 ?  222 THR B H    1  
ATOM   585   H HA   . THR B 2 3  ? 1.371   -12.416 -7.064  1.00 15.00 ?  222 THR B HA   1  
ATOM   586   H HB   . THR B 2 3  ? 3.720   -12.163 -6.075  1.00 15.00 ?  222 THR B HB   1  
ATOM   587   H HG1  . THR B 2 3  ? 3.330   -9.655  -6.955  1.00 15.00 ?  222 THR B HG1  1  
ATOM   588   H HG21 . THR B 2 3  ? 3.281   -13.433 -8.122  1.00 15.00 ?  222 THR B HG21 1  
ATOM   589   H HG22 . THR B 2 3  ? 4.813   -12.568 -8.233  1.00 15.00 ?  222 THR B HG22 1  
ATOM   590   H HG23 . THR B 2 3  ? 3.390   -11.951 -9.072  1.00 15.00 ?  222 THR B HG23 1  
ATOM   591   N N    . PRO B 2 4  ? 1.780   -11.814 -4.391  1.00 15.00 ?  223 PRO B N    1  
ATOM   592   C CA   . PRO B 2 4  ? 1.549   -11.388 -3.001  1.00 15.00 ?  223 PRO B CA   1  
ATOM   593   C C    . PRO B 2 4  ? 2.336   -10.117 -2.649  1.00 15.00 ?  223 PRO B C    1  
ATOM   594   O O    . PRO B 2 4  ? 3.435   -9.909  -3.172  1.00 15.00 ?  223 PRO B O    1  
ATOM   595   C CB   . PRO B 2 4  ? 2.049   -12.577 -2.170  1.00 15.00 ?  223 PRO B CB   1  
ATOM   596   C CG   . PRO B 2 4  ? 2.943   -13.340 -3.086  1.00 15.00 ?  223 PRO B CG   1  
ATOM   597   C CD   . PRO B 2 4  ? 2.366   -13.162 -4.457  1.00 15.00 ?  223 PRO B CD   1  
ATOM   598   H HA   . PRO B 2 4  ? 0.503   -11.227 -2.823  1.00 15.00 ?  223 PRO B HA   1  
ATOM   599   H HB2  . PRO B 2 4  ? 2.587   -12.213 -1.307  1.00 15.00 ?  223 PRO B HB2  1  
ATOM   600   H HB3  . PRO B 2 4  ? 1.208   -13.175 -1.851  1.00 15.00 ?  223 PRO B HB3  1  
ATOM   601   H HG2  . PRO B 2 4  ? 3.944   -12.935 -3.045  1.00 15.00 ?  223 PRO B HG2  1  
ATOM   602   H HG3  . PRO B 2 4  ? 2.948   -14.385 -2.813  1.00 15.00 ?  223 PRO B HG3  1  
ATOM   603   H HD2  . PRO B 2 4  ? 3.144   -13.211 -5.205  1.00 15.00 ?  223 PRO B HD2  1  
ATOM   604   H HD3  . PRO B 2 4  ? 1.606   -13.905 -4.649  1.00 15.00 ?  223 PRO B HD3  1  
ATOM   605   N N    . PRO B 2 5  ? 1.811   -9.259  -1.739  1.00 15.00 ?  224 PRO B N    1  
ATOM   606   C CA   . PRO B 2 5  ? 2.438   -7.971  -1.443  1.00 15.00 ?  224 PRO B CA   1  
ATOM   607   C C    . PRO B 2 5  ? 3.746   -8.092  -0.664  1.00 15.00 ?  224 PRO B C    1  
ATOM   608   O O    . PRO B 2 5  ? 3.853   -8.858  0.298   1.00 15.00 ?  224 PRO B O    1  
ATOM   609   C CB   . PRO B 2 5  ? 1.391   -7.226  -0.614  1.00 15.00 ?  224 PRO B CB   1  
ATOM   610   C CG   . PRO B 2 5  ? 0.513   -8.274  -0.027  1.00 15.00 ?  224 PRO B CG   1  
ATOM   611   C CD   . PRO B 2 5  ? 0.593   -9.480  -0.927  1.00 15.00 ?  224 PRO B CD   1  
ATOM   612   H HA   . PRO B 2 5  ? 2.626   -7.419  -2.352  1.00 15.00 ?  224 PRO B HA   1  
ATOM   613   H HB2  . PRO B 2 5  ? 1.885   -6.653  0.157   1.00 15.00 ?  224 PRO B HB2  1  
ATOM   614   H HB3  . PRO B 2 5  ? 0.832   -6.563  -1.255  1.00 15.00 ?  224 PRO B HB3  1  
ATOM   615   H HG2  . PRO B 2 5  ? 0.854   -8.525  0.966   1.00 15.00 ?  224 PRO B HG2  1  
ATOM   616   H HG3  . PRO B 2 5  ? -0.504  -7.905  0.007   1.00 15.00 ?  224 PRO B HG3  1  
ATOM   617   H HD2  . PRO B 2 5  ? 0.682   -10.381 -0.338  1.00 15.00 ?  224 PRO B HD2  1  
ATOM   618   H HD3  . PRO B 2 5  ? -0.286  -9.520  -1.544  1.00 15.00 ?  224 PRO B HD3  1  
ATOM   619   N N    . PRO B 2 6  ? 4.752   -7.313  -1.094  1.00 15.00 ?  225 PRO B N    1  
ATOM   620   C CA   . PRO B 2 6  ? 6.063   -7.206  -0.426  1.00 15.00 ?  225 PRO B CA   1  
ATOM   621   C C    . PRO B 2 6  ? 5.969   -6.756  1.035   1.00 15.00 ?  225 PRO B C    1  
ATOM   622   O O    . PRO B 2 6  ? 4.880   -6.522  1.558   1.00 15.00 ?  225 PRO B O    1  
ATOM   623   C CB   . PRO B 2 6  ? 6.770   -6.113  -1.236  1.00 15.00 ?  225 PRO B CB   1  
ATOM   624   C CG   . PRO B 2 6  ? 6.120   -6.138  -2.569  1.00 15.00 ?  225 PRO B CG   1  
ATOM   625   C CD   . PRO B 2 6  ? 4.687   -6.481  -2.309  1.00 15.00 ?  225 PRO B CD   1  
ATOM   626   H HA   . PRO B 2 6  ? 6.624   -8.126  -0.488  1.00 15.00 ?  225 PRO B HA   1  
ATOM   627   H HB2  . PRO B 2 6  ? 6.633   -5.158  -0.750  1.00 15.00 ?  225 PRO B HB2  1  
ATOM   628   H HB3  . PRO B 2 6  ? 7.816   -6.334  -1.306  1.00 15.00 ?  225 PRO B HB3  1  
ATOM   629   H HG2  . PRO B 2 6  ? 6.199   -5.166  -3.034  1.00 15.00 ?  225 PRO B HG2  1  
ATOM   630   H HG3  . PRO B 2 6  ? 6.579   -6.890  -3.189  1.00 15.00 ?  225 PRO B HG3  1  
ATOM   631   H HD2  . PRO B 2 6  ? 4.111   -5.584  -2.133  1.00 15.00 ?  225 PRO B HD2  1  
ATOM   632   H HD3  . PRO B 2 6  ? 4.276   -7.039  -3.137  1.00 15.00 ?  225 PRO B HD3  1  
ATOM   633   N N    . ALA B 2 7  ? 7.124   -6.638  1.689   1.00 15.00 ?  226 ALA B N    1  
ATOM   634   C CA   . ALA B 2 7  ? 7.195   -6.017  3.005   1.00 15.00 ?  226 ALA B CA   1  
ATOM   635   C C    . ALA B 2 7  ? 6.909   -4.524  2.872   1.00 15.00 ?  226 ALA B C    1  
ATOM   636   O O    . ALA B 2 7  ? 6.853   -3.999  1.758   1.00 15.00 ?  226 ALA B O    1  
ATOM   637   C CB   . ALA B 2 7  ? 8.556   -6.255  3.644   1.00 15.00 ?  226 ALA B CB   1  
ATOM   638   H H    . ALA B 2 7  ? 7.950   -6.977  1.272   1.00 15.00 ?  226 ALA B H    1  
ATOM   639   H HA   . ALA B 2 7  ? 6.438   -6.466  3.630   1.00 15.00 ?  226 ALA B HA   1  
ATOM   640   H HB1  . ALA B 2 7  ? 8.577   -5.804  4.626   1.00 15.00 ?  226 ALA B HB1  1  
ATOM   641   H HB2  . ALA B 2 7  ? 9.327   -5.813  3.030   1.00 15.00 ?  226 ALA B HB2  1  
ATOM   642   H HB3  . ALA B 2 7  ? 8.732   -7.316  3.733   1.00 15.00 ?  226 ALA B HB3  1  
ATOM   643   N N    . TYR B 2 8  ? 6.734   -3.832  3.987   1.00 15.00 ?  227 TYR B N    1  
ATOM   644   C CA   . TYR B 2 8  ? 6.299   -2.450  3.915   1.00 15.00 ?  227 TYR B CA   1  
ATOM   645   C C    . TYR B 2 8  ? 7.480   -1.484  3.880   1.00 15.00 ?  227 TYR B C    1  
ATOM   646   O O    . TYR B 2 8  ? 8.453   -1.617  4.624   1.00 15.00 ?  227 TYR B O    1  
ATOM   647   C CB   . TYR B 2 8  ? 5.351   -2.097  5.063   1.00 15.00 ?  227 TYR B CB   1  
ATOM   648   C CG   . TYR B 2 8  ? 6.046   -1.573  6.301   1.00 15.00 ?  227 TYR B CG   1  
ATOM   649   C CD1  . TYR B 2 8  ? 6.744   -2.415  7.157   1.00 15.00 ?  227 TYR B CD1  1  
ATOM   650   C CD2  . TYR B 2 8  ? 6.026   -0.220  6.591   1.00 15.00 ?  227 TYR B CD2  1  
ATOM   651   C CE1  . TYR B 2 8  ? 7.403   -1.913  8.266   1.00 15.00 ?  227 TYR B CE1  1  
ATOM   652   C CE2  . TYR B 2 8  ? 6.671   0.288   7.694   1.00 15.00 ?  227 TYR B CE2  1  
ATOM   653   C CZ   . TYR B 2 8  ? 7.362   -0.559  8.530   1.00 15.00 ?  227 TYR B CZ   1  
ATOM   654   O OH   . TYR B 2 8  ? 8.023   -0.051  9.622   1.00 15.00 ?  227 TYR B OH   1  
ATOM   655   H H    . TYR B 2 8  ? 6.909   -4.247  4.854   1.00 15.00 ?  227 TYR B H    1  
ATOM   656   H HA   . TYR B 2 8  ? 5.757   -2.342  2.985   1.00 15.00 ?  227 TYR B HA   1  
ATOM   657   H HB2  . TYR B 2 8  ? 4.668   -1.328  4.709   1.00 15.00 ?  227 TYR B HB2  1  
ATOM   658   H HB3  . TYR B 2 8  ? 4.787   -2.975  5.337   1.00 15.00 ?  227 TYR B HB3  1  
ATOM   659   H HD1  . TYR B 2 8  ? 6.772   -3.475  6.948   1.00 15.00 ?  227 TYR B HD1  1  
ATOM   660   H HD2  . TYR B 2 8  ? 5.482   0.448   5.939   1.00 15.00 ?  227 TYR B HD2  1  
ATOM   661   H HE1  . TYR B 2 8  ? 7.941   -2.581  8.922   1.00 15.00 ?  227 TYR B HE1  1  
ATOM   662   H HE2  . TYR B 2 8  ? 6.632   1.354   7.892   1.00 15.00 ?  227 TYR B HE2  1  
ATOM   663   H HH   . TYR B 2 8  ? 7.556   0.736   9.948   1.00 15.00 ?  227 TYR B HH   1  
ATOM   664   N N    . LEU B 2 9  ? 7.361   -0.516  2.996   1.00 15.00 ?  228 LEU B N    1  
ATOM   665   C CA   . LEU B 2 9  ? 8.347   0.533   2.808   1.00 15.00 ?  228 LEU B CA   1  
ATOM   666   C C    . LEU B 2 9  ? 7.656   1.887   2.813   1.00 15.00 ?  228 LEU B C    1  
ATOM   667   O O    . LEU B 2 9  ? 6.456   1.961   2.624   1.00 15.00 ?  228 LEU B O    1  
ATOM   668   C CB   . LEU B 2 9  ? 9.104   0.339   1.491   1.00 15.00 ?  228 LEU B CB   1  
ATOM   669   C CG   . LEU B 2 9  ? 10.070  -0.845  1.454   1.00 15.00 ?  228 LEU B CG   1  
ATOM   670   C CD1  . LEU B 2 9  ? 10.656  -0.999  0.062   1.00 15.00 ?  228 LEU B CD1  1  
ATOM   671   C CD2  . LEU B 2 9  ? 11.180  -0.655  2.475   1.00 15.00 ?  228 LEU B CD2  1  
ATOM   672   H H    . LEU B 2 9  ? 6.562   -0.502  2.431   1.00 15.00 ?  228 LEU B H    1  
ATOM   673   H HA   . LEU B 2 9  ? 9.032   0.491   3.638   1.00 15.00 ?  228 LEU B HA   1  
ATOM   674   H HB2  . LEU B 2 9  ? 8.378   0.207   0.703   1.00 15.00 ?  228 LEU B HB2  1  
ATOM   675   H HB3  . LEU B 2 9  ? 9.667   1.240   1.290   1.00 15.00 ?  228 LEU B HB3  1  
ATOM   676   H HG   . LEU B 2 9  ? 9.536   -1.752  1.698   1.00 15.00 ?  228 LEU B HG   1  
ATOM   677   H HD11 . LEU B 2 9  ? 11.186  -0.098  -0.206  1.00 15.00 ?  228 LEU B HD11 1  
ATOM   678   H HD12 . LEU B 2 9  ? 9.860   -1.174  -0.646  1.00 15.00 ?  228 LEU B HD12 1  
ATOM   679   H HD13 . LEU B 2 9  ? 11.339  -1.836  0.051   1.00 15.00 ?  228 LEU B HD13 1  
ATOM   680   H HD21 . LEU B 2 9  ? 10.751  -0.594  3.465   1.00 15.00 ?  228 LEU B HD21 1  
ATOM   681   H HD22 . LEU B 2 9  ? 11.717  0.257   2.258   1.00 15.00 ?  228 LEU B HD22 1  
ATOM   682   H HD23 . LEU B 2 9  ? 11.859  -1.493  2.427   1.00 15.00 ?  228 LEU B HD23 1  
ATOM   683   N N    . PRO B 2 10 ? 8.379   2.983   3.039   1.00 15.00 ?  229 PRO B N    1  
ATOM   684   C CA   . PRO B 2 10 ? 7.792   4.307   2.907   1.00 15.00 ?  229 PRO B CA   1  
ATOM   685   C C    . PRO B 2 10 ? 7.929   4.777   1.461   1.00 15.00 ?  229 PRO B C    1  
ATOM   686   O O    . PRO B 2 10 ? 8.954   4.537   0.823   1.00 15.00 ?  229 PRO B O    1  
ATOM   687   C CB   . PRO B 2 10 ? 8.656   5.174   3.842   1.00 15.00 ?  229 PRO B CB   1  
ATOM   688   C CG   . PRO B 2 10 ? 9.595   4.222   4.516   1.00 15.00 ?  229 PRO B CG   1  
ATOM   689   C CD   . PRO B 2 10 ? 9.727   3.049   3.590   1.00 15.00 ?  229 PRO B CD   1  
ATOM   690   H HA   . PRO B 2 10 ? 6.766   4.310   3.222   1.00 15.00 ?  229 PRO B HA   1  
ATOM   691   H HB2  . PRO B 2 10 ? 9.192   5.907   3.259   1.00 15.00 ?  229 PRO B HB2  1  
ATOM   692   H HB3  . PRO B 2 10 ? 8.022   5.672   4.560   1.00 15.00 ?  229 PRO B HB3  1  
ATOM   693   H HG2  . PRO B 2 10 ? 10.546  4.691   4.665   1.00 15.00 ?  229 PRO B HG2  1  
ATOM   694   H HG3  . PRO B 2 10 ? 9.180   3.905   5.461   1.00 15.00 ?  229 PRO B HG3  1  
ATOM   695   H HD2  . PRO B 2 10 ? 10.459  3.241   2.825   1.00 15.00 ?  229 PRO B HD2  1  
ATOM   696   H HD3  . PRO B 2 10 ? 9.966   2.154   4.141   1.00 15.00 ?  229 PRO B HD3  1  
ATOM   697   N N    . PRO B 2 11 ? 6.909   5.475   0.925   1.00 15.00 ?  230 PRO B N    1  
ATOM   698   C CA   . PRO B 2 11 ? 6.553   5.351   -0.485  1.00 15.00 ?  230 PRO B CA   1  
ATOM   699   C C    . PRO B 2 11 ? 7.253   6.309   -1.437  1.00 15.00 ?  230 PRO B C    1  
ATOM   700   O O    . PRO B 2 11 ? 7.511   7.473   -1.122  1.00 15.00 ?  230 PRO B O    1  
ATOM   701   C CB   . PRO B 2 11 ? 5.066   5.674   -0.436  1.00 15.00 ?  230 PRO B CB   1  
ATOM   702   C CG   . PRO B 2 11 ? 4.949   6.738   0.604   1.00 15.00 ?  230 PRO B CG   1  
ATOM   703   C CD   . PRO B 2 11 ? 6.054   6.484   1.602   1.00 15.00 ?  230 PRO B CD   1  
ATOM   704   H HA   . PRO B 2 11 ? 6.680   4.341   -0.838  1.00 15.00 ?  230 PRO B HA   1  
ATOM   705   H HB2  . PRO B 2 11 ? 4.740   6.026   -1.401  1.00 15.00 ?  230 PRO B HB2  1  
ATOM   706   H HB3  . PRO B 2 11 ? 4.511   4.790   -0.159  1.00 15.00 ?  230 PRO B HB3  1  
ATOM   707   H HG2  . PRO B 2 11 ? 5.072   7.710   0.149   1.00 15.00 ?  230 PRO B HG2  1  
ATOM   708   H HG3  . PRO B 2 11 ? 3.987   6.671   1.088   1.00 15.00 ?  230 PRO B HG3  1  
ATOM   709   H HD2  . PRO B 2 11 ? 6.606   7.395   1.787   1.00 15.00 ?  230 PRO B HD2  1  
ATOM   710   H HD3  . PRO B 2 11 ? 5.637   6.107   2.515   1.00 15.00 ?  230 PRO B HD3  1  
ATOM   711   N N    . GLU B 2 12 ? 7.543   5.786   -2.617  1.00 15.00 ?  231 GLU B N    1  
ATOM   712   C CA   . GLU B 2 12 ? 7.959   6.597   -3.746  1.00 15.00 ?  231 GLU B CA   1  
ATOM   713   C C    . GLU B 2 12 ? 6.739   6.884   -4.632  1.00 15.00 ?  231 GLU B C    1  
ATOM   714   O O    . GLU B 2 12 ? 6.312   6.018   -5.394  1.00 15.00 ?  231 GLU B O    1  
ATOM   715   C CB   . GLU B 2 12 ? 9.049   5.891   -4.571  1.00 15.00 ?  231 GLU B CB   1  
ATOM   716   C CG   . GLU B 2 12 ? 8.851   4.385   -4.718  1.00 15.00 ?  231 GLU B CG   1  
ATOM   717   C CD   . GLU B 2 12 ? 9.553   3.604   -3.631  1.00 15.00 ?  231 GLU B CD   1  
ATOM   718   O OE1  . GLU B 2 12 ? 8.977   3.461   -2.534  1.00 15.00 ?  231 GLU B OE1  1  
ATOM   719   O OE2  . GLU B 2 12 ? 10.656  3.088   -3.882  1.00 15.00 -1 231 GLU B OE2  1  
ATOM   720   H H    . GLU B 2 12 ? 7.478   4.807   -2.730  1.00 15.00 ?  231 GLU B H    1  
ATOM   721   H HA   . GLU B 2 12 ? 8.358   7.522   -3.359  1.00 15.00 ?  231 GLU B HA   1  
ATOM   722   H HB2  . GLU B 2 12 ? 9.071   6.324   -5.559  1.00 15.00 ?  231 GLU B HB2  1  
ATOM   723   H HB3  . GLU B 2 12 ? 10.005  6.059   -4.095  1.00 15.00 ?  231 GLU B HB3  1  
ATOM   724   H HG2  . GLU B 2 12 ? 7.794   4.165   -4.662  1.00 15.00 ?  231 GLU B HG2  1  
ATOM   725   H HG3  . GLU B 2 12 ? 9.231   4.065   -5.681  1.00 15.00 ?  231 GLU B HG3  1  
ATOM   726   N N    . ASP B 2 13 ? 6.145   8.067   -4.507  1.00 15.00 ?  232 ASP B N    1  
ATOM   727   C CA   . ASP B 2 13 ? 4.946   8.389   -5.270  1.00 15.00 ?  232 ASP B CA   1  
ATOM   728   C C    . ASP B 2 13 ? 5.013   9.817   -5.789  1.00 15.00 ?  232 ASP B C    1  
ATOM   729   O O    . ASP B 2 13 ? 5.039   10.770  -5.007  1.00 15.00 ?  232 ASP B O    1  
ATOM   730   C CB   . ASP B 2 13 ? 3.692   8.204   -4.407  1.00 15.00 ?  232 ASP B CB   1  
ATOM   731   C CG   . ASP B 2 13 ? 2.412   8.540   -5.153  1.00 15.00 ?  232 ASP B CG   1  
ATOM   732   O OD1  . ASP B 2 13 ? 1.849   7.638   -5.810  1.00 15.00 ?  232 ASP B OD1  1  
ATOM   733   O OD2  . ASP B 2 13 ? 1.963   9.706   -5.077  1.00 15.00 -1 232 ASP B OD2  1  
ATOM   734   H H    . ASP B 2 13 ? 6.514   8.744   -3.898  1.00 15.00 ?  232 ASP B H    1  
ATOM   735   H HA   . ASP B 2 13 ? 4.897   7.715   -6.111  1.00 15.00 ?  232 ASP B HA   1  
ATOM   736   H HB2  . ASP B 2 13 ? 3.637   7.175   -4.083  1.00 15.00 ?  232 ASP B HB2  1  
ATOM   737   H HB3  . ASP B 2 13 ? 3.762   8.845   -3.540  1.00 15.00 ?  232 ASP B HB3  1  
ATOM   738   N N    . PRO B 2 14 ? 5.084   9.981   -7.116  1.00 15.00 ?  233 PRO B N    1  
ATOM   739   C CA   . PRO B 2 14 ? 5.090   11.293  -7.753  1.00 15.00 ?  233 PRO B CA   1  
ATOM   740   C C    . PRO B 2 14 ? 3.687   11.888  -7.819  1.00 15.00 ?  233 PRO B C    1  
ATOM   741   O O    . PRO B 2 14 ? 2.985   11.756  -8.823  1.00 15.00 ?  233 PRO B O    1  
ATOM   742   C CB   . PRO B 2 14 ? 5.628   11.015  -9.168  1.00 15.00 ?  233 PRO B CB   1  
ATOM   743   C CG   . PRO B 2 14 ? 5.970   9.557   -9.204  1.00 15.00 ?  233 PRO B CG   1  
ATOM   744   C CD   . PRO B 2 14 ? 5.179   8.909   -8.106  1.00 15.00 ?  233 PRO B CD   1  
ATOM   745   H HA   . PRO B 2 14 ? 5.747   11.979  -7.240  1.00 15.00 ?  233 PRO B HA   1  
ATOM   746   H HB2  . PRO B 2 14 ? 4.866   11.255  -9.894  1.00 15.00 ?  233 PRO B HB2  1  
ATOM   747   H HB3  . PRO B 2 14 ? 6.501   11.626  -9.347  1.00 15.00 ?  233 PRO B HB3  1  
ATOM   748   H HG2  . PRO B 2 14 ? 5.692   9.140   -10.160 1.00 15.00 ?  233 PRO B HG2  1  
ATOM   749   H HG3  . PRO B 2 14 ? 7.028   9.425   -9.030  1.00 15.00 ?  233 PRO B HG3  1  
ATOM   750   H HD2  . PRO B 2 14 ? 4.200   8.620   -8.463  1.00 15.00 ?  233 PRO B HD2  1  
ATOM   751   H HD3  . PRO B 2 14 ? 5.708   8.058   -7.706  1.00 15.00 ?  233 PRO B HD3  1  
HETATM 752   N N    . NH2 B 2 15 ? 3.278   12.534  -6.741  1.00 15.00 ?  234 NH2 B N    1  
HETATM 753   H HN1  . NH2 B 2 15 ? 3.892   12.598  -5.979  1.00 15.00 ?  234 NH2 B HN1  1  
HETATM 754   H HN2  . NH2 B 2 15 ? 2.377   12.919  -6.745  1.00 15.00 ?  234 NH2 B HN2  1  
ATOM   755   N N    . LEU A 1 1  ? -12.677 2.578   -2.475  1.00 15.00 ?  279 LEU A N    2  
ATOM   756   C CA   . LEU A 1 1  ? -13.947 3.251   -2.824  1.00 15.00 ?  279 LEU A CA   2  
ATOM   757   C C    . LEU A 1 1  ? -14.337 4.252   -1.738  1.00 15.00 ?  279 LEU A C    2  
ATOM   758   O O    . LEU A 1 1  ? -15.288 5.022   -1.895  1.00 15.00 ?  279 LEU A O    2  
ATOM   759   C CB   . LEU A 1 1  ? -15.054 2.205   -3.008  1.00 15.00 ?  279 LEU A CB   2  
ATOM   760   C CG   . LEU A 1 1  ? -16.405 2.748   -3.483  1.00 15.00 ?  279 LEU A CG   2  
ATOM   761   C CD1  . LEU A 1 1  ? -16.262 3.435   -4.831  1.00 15.00 ?  279 LEU A CD1  2  
ATOM   762   C CD2  . LEU A 1 1  ? -17.431 1.628   -3.561  1.00 15.00 ?  279 LEU A CD2  2  
ATOM   763   H H1   . LEU A 1 1  ? -11.947 3.285   -2.251  1.00 15.00 ?  279 LEU A H1   2  
ATOM   764   H H2   . LEU A 1 1  ? -12.342 2.005   -3.285  1.00 15.00 ?  279 LEU A H2   2  
ATOM   765   H H3   . LEU A 1 1  ? -12.810 1.955   -1.653  1.00 15.00 ?  279 LEU A H3   2  
ATOM   766   H HA   . LEU A 1 1  ? -13.805 3.783   -3.752  1.00 15.00 ?  279 LEU A HA   2  
ATOM   767   H HB2  . LEU A 1 1  ? -14.713 1.475   -3.726  1.00 15.00 ?  279 LEU A HB2  2  
ATOM   768   H HB3  . LEU A 1 1  ? -15.207 1.707   -2.063  1.00 15.00 ?  279 LEU A HB3  2  
ATOM   769   H HG   . LEU A 1 1  ? -16.762 3.479   -2.771  1.00 15.00 ?  279 LEU A HG   2  
ATOM   770   H HD11 . LEU A 1 1  ? -17.224 3.817   -5.145  1.00 15.00 ?  279 LEU A HD11 2  
ATOM   771   H HD12 . LEU A 1 1  ? -15.901 2.727   -5.561  1.00 15.00 ?  279 LEU A HD12 2  
ATOM   772   H HD13 . LEU A 1 1  ? -15.563 4.253   -4.744  1.00 15.00 ?  279 LEU A HD13 2  
ATOM   773   H HD21 . LEU A 1 1  ? -17.091 0.874   -4.255  1.00 15.00 ?  279 LEU A HD21 2  
ATOM   774   H HD22 . LEU A 1 1  ? -18.376 2.027   -3.900  1.00 15.00 ?  279 LEU A HD22 2  
ATOM   775   H HD23 . LEU A 1 1  ? -17.557 1.187   -2.584  1.00 15.00 ?  279 LEU A HD23 2  
ATOM   776   N N    . GLY A 1 2  ? -13.588 4.262   -0.644  1.00 15.00 ?  280 GLY A N    2  
ATOM   777   C CA   . GLY A 1 2  ? -13.911 5.134   0.460   1.00 15.00 ?  280 GLY A CA   2  
ATOM   778   C C    . GLY A 1 2  ? -12.734 5.980   0.896   1.00 15.00 ?  280 GLY A C    2  
ATOM   779   O O    . GLY A 1 2  ? -12.111 6.651   0.075   1.00 15.00 ?  280 GLY A O    2  
ATOM   780   H H    . GLY A 1 2  ? -12.793 3.685   -0.591  1.00 15.00 ?  280 GLY A H    2  
ATOM   781   H HA2  . GLY A 1 2  ? -14.719 5.787   0.163   1.00 15.00 ?  280 GLY A HA2  2  
ATOM   782   H HA3  . GLY A 1 2  ? -14.237 4.534   1.296   1.00 15.00 ?  280 GLY A HA3  2  
ATOM   783   N N    . PRO A 1 3  ? -12.411 5.961   2.193   1.00 15.00 ?  281 PRO A N    2  
ATOM   784   C CA   . PRO A 1 3  ? -11.364 6.801   2.779   1.00 15.00 ?  281 PRO A CA   2  
ATOM   785   C C    . PRO A 1 3  ? -9.985  6.137   2.816   1.00 15.00 ?  281 PRO A C    2  
ATOM   786   O O    . PRO A 1 3  ? -9.869  4.919   2.951   1.00 15.00 ?  281 PRO A O    2  
ATOM   787   C CB   . PRO A 1 3  ? -11.885 6.957   4.201   1.00 15.00 ?  281 PRO A CB   2  
ATOM   788   C CG   . PRO A 1 3  ? -12.453 5.612   4.507   1.00 15.00 ?  281 PRO A CG   2  
ATOM   789   C CD   . PRO A 1 3  ? -13.066 5.125   3.221   1.00 15.00 ?  281 PRO A CD   2  
ATOM   790   H HA   . PRO A 1 3  ? -11.301 7.767   2.304   1.00 15.00 ?  281 PRO A HA   2  
ATOM   791   H HB2  . PRO A 1 3  ? -11.071 7.210   4.865   1.00 15.00 ?  281 PRO A HB2  2  
ATOM   792   H HB3  . PRO A 1 3  ? -12.643 7.724   4.232   1.00 15.00 ?  281 PRO A HB3  2  
ATOM   793   H HG2  . PRO A 1 3  ? -11.660 4.941   4.814   1.00 15.00 ?  281 PRO A HG2  2  
ATOM   794   H HG3  . PRO A 1 3  ? -13.205 5.693   5.280   1.00 15.00 ?  281 PRO A HG3  2  
ATOM   795   H HD2  . PRO A 1 3  ? -12.844 4.079   3.069   1.00 15.00 ?  281 PRO A HD2  2  
ATOM   796   H HD3  . PRO A 1 3  ? -14.135 5.288   3.227   1.00 15.00 ?  281 PRO A HD3  2  
ATOM   797   N N    . LEU A 1 4  ? -8.940  6.948   2.712   1.00 15.00 ?  282 LEU A N    2  
ATOM   798   C CA   . LEU A 1 4  ? -7.589  6.488   3.004   1.00 15.00 ?  282 LEU A CA   2  
ATOM   799   C C    . LEU A 1 4  ? -7.286  6.762   4.476   1.00 15.00 ?  282 LEU A C    2  
ATOM   800   O O    . LEU A 1 4  ? -7.130  7.915   4.875   1.00 15.00 ?  282 LEU A O    2  
ATOM   801   C CB   . LEU A 1 4  ? -6.558  7.193   2.113   1.00 15.00 ?  282 LEU A CB   2  
ATOM   802   C CG   . LEU A 1 4  ? -5.093  6.823   2.387   1.00 15.00 ?  282 LEU A CG   2  
ATOM   803   C CD1  . LEU A 1 4  ? -4.784  5.413   1.911   1.00 15.00 ?  282 LEU A CD1  2  
ATOM   804   C CD2  . LEU A 1 4  ? -4.153  7.817   1.730   1.00 15.00 ?  282 LEU A CD2  2  
ATOM   805   H H    . LEU A 1 4  ? -9.083  7.884   2.434   1.00 15.00 ?  282 LEU A H    2  
ATOM   806   H HA   . LEU A 1 4  ? -7.551  5.424   2.829   1.00 15.00 ?  282 LEU A HA   2  
ATOM   807   H HB2  . LEU A 1 4  ? -6.780  6.952   1.084   1.00 15.00 ?  282 LEU A HB2  2  
ATOM   808   H HB3  . LEU A 1 4  ? -6.666  8.258   2.246   1.00 15.00 ?  282 LEU A HB3  2  
ATOM   809   H HG   . LEU A 1 4  ? -4.918  6.858   3.453   1.00 15.00 ?  282 LEU A HG   2  
ATOM   810   H HD11 . LEU A 1 4  ? -5.214  5.262   0.932   1.00 15.00 ?  282 LEU A HD11 2  
ATOM   811   H HD12 . LEU A 1 4  ? -5.201  4.698   2.605   1.00 15.00 ?  282 LEU A HD12 2  
ATOM   812   H HD13 . LEU A 1 4  ? -3.707  5.281   1.852   1.00 15.00 ?  282 LEU A HD13 2  
ATOM   813   H HD21 . LEU A 1 4  ? -4.147  7.657   0.661   1.00 15.00 ?  282 LEU A HD21 2  
ATOM   814   H HD22 . LEU A 1 4  ? -3.156  7.678   2.126   1.00 15.00 ?  282 LEU A HD22 2  
ATOM   815   H HD23 . LEU A 1 4  ? -4.488  8.821   1.941   1.00 15.00 ?  282 LEU A HD23 2  
ATOM   816   N N    . PRO A 1 5  ? -7.240  5.712   5.306   1.00 15.00 ?  283 PRO A N    2  
ATOM   817   C CA   . PRO A 1 5  ? -7.065  5.855   6.755   1.00 15.00 ?  283 PRO A CA   2  
ATOM   818   C C    . PRO A 1 5  ? -5.687  6.399   7.133   1.00 15.00 ?  283 PRO A C    2  
ATOM   819   O O    . PRO A 1 5  ? -4.667  5.916   6.644   1.00 15.00 ?  283 PRO A O    2  
ATOM   820   C CB   . PRO A 1 5  ? -7.232  4.421   7.286   1.00 15.00 ?  283 PRO A CB   2  
ATOM   821   C CG   . PRO A 1 5  ? -7.847  3.651   6.166   1.00 15.00 ?  283 PRO A CG   2  
ATOM   822   C CD   . PRO A 1 5  ? -7.358  4.303   4.909   1.00 15.00 ?  283 PRO A CD   2  
ATOM   823   H HA   . PRO A 1 5  ? -7.827  6.489   7.184   1.00 15.00 ?  283 PRO A HA   2  
ATOM   824   H HB2  . PRO A 1 5  ? -6.265  4.020   7.555   1.00 15.00 ?  283 PRO A HB2  2  
ATOM   825   H HB3  . PRO A 1 5  ? -7.874  4.432   8.153   1.00 15.00 ?  283 PRO A HB3  2  
ATOM   826   H HG2  . PRO A 1 5  ? -7.523  2.621   6.206   1.00 15.00 ?  283 PRO A HG2  2  
ATOM   827   H HG3  . PRO A 1 5  ? -8.924  3.711   6.226   1.00 15.00 ?  283 PRO A HG3  2  
ATOM   828   H HD2  . PRO A 1 5  ? -6.398  3.899   4.619   1.00 15.00 ?  283 PRO A HD2  2  
ATOM   829   H HD3  . PRO A 1 5  ? -8.078  4.185   4.113   1.00 15.00 ?  283 PRO A HD3  2  
ATOM   830   N N    . PRO A 1 6  ? -5.647  7.422   8.004   1.00 15.00 ?  284 PRO A N    2  
ATOM   831   C CA   . PRO A 1 6  ? -4.390  7.965   8.527   1.00 15.00 ?  284 PRO A CA   2  
ATOM   832   C C    . PRO A 1 6  ? -3.551  6.882   9.199   1.00 15.00 ?  284 PRO A C    2  
ATOM   833   O O    . PRO A 1 6  ? -4.004  6.227   10.138  1.00 15.00 ?  284 PRO A O    2  
ATOM   834   C CB   . PRO A 1 6  ? -4.843  9.011   9.547   1.00 15.00 ?  284 PRO A CB   2  
ATOM   835   C CG   . PRO A 1 6  ? -6.223  9.382   9.127   1.00 15.00 ?  284 PRO A CG   2  
ATOM   836   C CD   . PRO A 1 6  ? -6.820  8.136   8.536   1.00 15.00 ?  284 PRO A CD   2  
ATOM   837   H HA   . PRO A 1 6  ? -3.810  8.438   7.749   1.00 15.00 ?  284 PRO A HA   2  
ATOM   838   H HB2  . PRO A 1 6  ? -4.835  8.582   10.539  1.00 15.00 ?  284 PRO A HB2  2  
ATOM   839   H HB3  . PRO A 1 6  ? -4.178  9.862   9.512   1.00 15.00 ?  284 PRO A HB3  2  
ATOM   840   H HG2  . PRO A 1 6  ? -6.795  9.704   9.985   1.00 15.00 ?  284 PRO A HG2  2  
ATOM   841   H HG3  . PRO A 1 6  ? -6.184  10.166  8.386   1.00 15.00 ?  284 PRO A HG3  2  
ATOM   842   H HD2  . PRO A 1 6  ? -7.313  7.555   9.300   1.00 15.00 ?  284 PRO A HD2  2  
ATOM   843   H HD3  . PRO A 1 6  ? -7.512  8.387   7.744   1.00 15.00 ?  284 PRO A HD3  2  
ATOM   844   N N    . GLY A 1 7  ? -2.340  6.688   8.703   1.00 15.00 ?  285 GLY A N    2  
ATOM   845   C CA   . GLY A 1 7  ? -1.509  5.600   9.178   1.00 15.00 ?  285 GLY A CA   2  
ATOM   846   C C    . GLY A 1 7  ? -1.205  4.634   8.057   1.00 15.00 ?  285 GLY A C    2  
ATOM   847   O O    . GLY A 1 7  ? -0.303  3.803   8.154   1.00 15.00 ?  285 GLY A O    2  
ATOM   848   H H    . GLY A 1 7  ? -2.001  7.288   7.998   1.00 15.00 ?  285 GLY A H    2  
ATOM   849   H HA2  . GLY A 1 7  ? -0.583  6.001   9.566   1.00 15.00 ?  285 GLY A HA2  2  
ATOM   850   H HA3  . GLY A 1 7  ? -2.028  5.073   9.964   1.00 15.00 ?  285 GLY A HA3  2  
ATOM   851   N N    . TRP A 1 8  ? -1.974  4.759   6.988   1.00 15.00 ?  286 TRP A N    2  
ATOM   852   C CA   . TRP A 1 8  ? -1.762  3.978   5.784   1.00 15.00 ?  286 TRP A CA   2  
ATOM   853   C C    . TRP A 1 8  ? -0.824  4.702   4.852   1.00 15.00 ?  286 TRP A C    2  
ATOM   854   O O    . TRP A 1 8  ? -1.171  5.747   4.298   1.00 15.00 ?  286 TRP A O    2  
ATOM   855   C CB   . TRP A 1 8  ? -3.093  3.741   5.050   1.00 15.00 ?  286 TRP A CB   2  
ATOM   856   C CG   . TRP A 1 8  ? -3.884  2.590   5.582   1.00 15.00 ?  286 TRP A CG   2  
ATOM   857   C CD1  . TRP A 1 8  ? -4.222  2.354   6.882   1.00 15.00 ?  286 TRP A CD1  2  
ATOM   858   C CD2  . TRP A 1 8  ? -4.423  1.502   4.819   1.00 15.00 ?  286 TRP A CD2  2  
ATOM   859   N NE1  . TRP A 1 8  ? -4.922  1.178   6.982   1.00 15.00 ?  286 TRP A NE1  2  
ATOM   860   C CE2  . TRP A 1 8  ? -5.053  0.631   5.732   1.00 15.00 ?  286 TRP A CE2  2  
ATOM   861   C CE3  . TRP A 1 8  ? -4.430  1.167   3.453   1.00 15.00 ?  286 TRP A CE3  2  
ATOM   862   C CZ2  . TRP A 1 8  ? -5.674  -0.550  5.331   1.00 15.00 ?  286 TRP A CZ2  2  
ATOM   863   C CZ3  . TRP A 1 8  ? -5.042  -0.010  3.067   1.00 15.00 ?  286 TRP A CZ3  2  
ATOM   864   C CH2  . TRP A 1 8  ? -5.648  -0.858  4.000   1.00 15.00 ?  286 TRP A CH2  2  
ATOM   865   H H    . TRP A 1 8  ? -2.715  5.402   7.009   1.00 15.00 ?  286 TRP A H    2  
ATOM   866   H HA   . TRP A 1 8  ? -1.314  3.027   6.059   1.00 15.00 ?  286 TRP A HA   2  
ATOM   867   H HB2  . TRP A 1 8  ? -3.700  4.632   5.126   1.00 15.00 ?  286 TRP A HB2  2  
ATOM   868   H HB3  . TRP A 1 8  ? -2.885  3.548   4.008   1.00 15.00 ?  286 TRP A HB3  2  
ATOM   869   H HD1  . TRP A 1 8  ? -3.964  3.005   7.706   1.00 15.00 ?  286 TRP A HD1  2  
ATOM   870   H HE1  . TRP A 1 8  ? -5.272  0.792   7.816   1.00 15.00 ?  286 TRP A HE1  2  
ATOM   871   H HE3  . TRP A 1 8  ? -3.978  1.835   2.672   1.00 15.00 ?  286 TRP A HE3  2  
ATOM   872   H HZ2  . TRP A 1 8  ? -6.146  -1.216  6.038   1.00 15.00 ?  286 TRP A HZ2  2  
ATOM   873   H HZ3  . TRP A 1 8  ? -5.017  -0.304  2.027   1.00 15.00 ?  286 TRP A HZ3  2  
ATOM   874   H HH2  . TRP A 1 8  ? -6.108  -1.770  3.646   1.00 15.00 ?  286 TRP A HH2  2  
ATOM   875   N N    . GLU A 1 9  ? 0.366   4.169   4.688   1.00 15.00 ?  287 GLU A N    2  
ATOM   876   C CA   . GLU A 1 9  ? 1.242   4.669   3.671   1.00 15.00 ?  287 GLU A CA   2  
ATOM   877   C C    . GLU A 1 9  ? 0.990   3.884   2.402   1.00 15.00 ?  287 GLU A C    2  
ATOM   878   O O    . GLU A 1 9  ? 1.239   2.683   2.334   1.00 15.00 ?  287 GLU A O    2  
ATOM   879   C CB   . GLU A 1 9  ? 2.703   4.592   4.110   1.00 15.00 ?  287 GLU A CB   2  
ATOM   880   C CG   . GLU A 1 9  ? 3.180   5.846   4.828   1.00 15.00 ?  287 GLU A CG   2  
ATOM   881   C CD   . GLU A 1 9  ? 2.432   6.125   6.114   1.00 15.00 ?  287 GLU A CD   2  
ATOM   882   O OE1  . GLU A 1 9  ? 2.561   5.328   7.064   1.00 15.00 -1 287 GLU A OE1  2  
ATOM   883   O OE2  . GLU A 1 9  ? 1.737   7.161   6.186   1.00 15.00 ?  287 GLU A OE2  2  
ATOM   884   H H    . GLU A 1 9  ? 0.657   3.413   5.251   1.00 15.00 ?  287 GLU A H    2  
ATOM   885   H HA   . GLU A 1 9  ? 0.982   5.704   3.497   1.00 15.00 ?  287 GLU A HA   2  
ATOM   886   H HB2  . GLU A 1 9  ? 2.821   3.753   4.780   1.00 15.00 ?  287 GLU A HB2  2  
ATOM   887   H HB3  . GLU A 1 9  ? 3.328   4.439   3.243   1.00 15.00 ?  287 GLU A HB3  2  
ATOM   888   H HG2  . GLU A 1 9  ? 4.227   5.731   5.063   1.00 15.00 ?  287 GLU A HG2  2  
ATOM   889   H HG3  . GLU A 1 9  ? 3.055   6.691   4.166   1.00 15.00 ?  287 GLU A HG3  2  
ATOM   890   N N    . VAL A 1 10 ? 0.444   4.557   1.417   1.00 15.00 ?  288 VAL A N    2  
ATOM   891   C CA   . VAL A 1 10 ? 0.100   3.914   0.171   1.00 15.00 ?  288 VAL A CA   2  
ATOM   892   C C    . VAL A 1 10 ? 1.279   3.985   -0.782  1.00 15.00 ?  288 VAL A C    2  
ATOM   893   O O    . VAL A 1 10 ? 1.654   5.059   -1.256  1.00 15.00 ?  288 VAL A O    2  
ATOM   894   C CB   . VAL A 1 10 ? -1.178  4.538   -0.456  1.00 15.00 ?  288 VAL A CB   2  
ATOM   895   C CG1  . VAL A 1 10 ? -1.364  5.983   -0.019  1.00 15.00 ?  288 VAL A CG1  2  
ATOM   896   C CG2  . VAL A 1 10 ? -1.147  4.448   -1.971  1.00 15.00 ?  288 VAL A CG2  2  
ATOM   897   H H    . VAL A 1 10 ? 0.261   5.512   1.530   1.00 15.00 ?  288 VAL A H    2  
ATOM   898   H HA   . VAL A 1 10 ? -0.104  2.874   0.387   1.00 15.00 ?  288 VAL A HA   2  
ATOM   899   H HB   . VAL A 1 10 ? -2.032  3.975   -0.107  1.00 15.00 ?  288 VAL A HB   2  
ATOM   900   H HG11 . VAL A 1 10 ? -1.684  6.009   1.013   1.00 15.00 ?  288 VAL A HG11 2  
ATOM   901   H HG12 . VAL A 1 10 ? -2.109  6.457   -0.640  1.00 15.00 ?  288 VAL A HG12 2  
ATOM   902   H HG13 . VAL A 1 10 ? -0.432  6.510   -0.114  1.00 15.00 ?  288 VAL A HG13 2  
ATOM   903   H HG21 . VAL A 1 10 ? -2.071  4.832   -2.374  1.00 15.00 ?  288 VAL A HG21 2  
ATOM   904   H HG22 . VAL A 1 10 ? -1.023  3.416   -2.269  1.00 15.00 ?  288 VAL A HG22 2  
ATOM   905   H HG23 . VAL A 1 10 ? -0.319  5.034   -2.346  1.00 15.00 ?  288 VAL A HG23 2  
ATOM   906   N N    . ARG A 1 11 ? 1.891   2.836   -1.024  1.00 15.00 ?  289 ARG A N    2  
ATOM   907   C CA   . ARG A 1 11 ? 3.048   2.781   -1.883  1.00 15.00 ?  289 ARG A CA   2  
ATOM   908   C C    . ARG A 1 11 ? 2.593   2.300   -3.252  1.00 15.00 ?  289 ARG A C    2  
ATOM   909   O O    . ARG A 1 11 ? 2.247   1.136   -3.447  1.00 15.00 ?  289 ARG A O    2  
ATOM   910   C CB   . ARG A 1 11 ? 4.134   1.886   -1.257  1.00 15.00 ?  289 ARG A CB   2  
ATOM   911   C CG   . ARG A 1 11 ? 5.563   2.216   -1.692  1.00 15.00 ?  289 ARG A CG   2  
ATOM   912   C CD   . ARG A 1 11 ? 5.806   1.963   -3.174  1.00 15.00 ?  289 ARG A CD   2  
ATOM   913   N NE   . ARG A 1 11 ? 7.168   2.316   -3.577  1.00 15.00 ?  289 ARG A NE   2  
ATOM   914   C CZ   . ARG A 1 11 ? 8.062   1.449   -4.059  1.00 15.00 ?  289 ARG A CZ   2  
ATOM   915   N NH1  . ARG A 1 11 ? 7.794   0.151   -4.081  1.00 15.00 1  289 ARG A NH1  2  
ATOM   916   N NH2  . ARG A 1 11 ? 9.236   1.887   -4.489  1.00 15.00 ?  289 ARG A NH2  2  
ATOM   917   H H    . ARG A 1 11 ? 1.538   1.996   -0.640  1.00 15.00 ?  289 ARG A H    2  
ATOM   918   H HA   . ARG A 1 11 ? 3.430   3.787   -1.981  1.00 15.00 ?  289 ARG A HA   2  
ATOM   919   H HB2  . ARG A 1 11 ? 4.085   2.002   -0.183  1.00 15.00 ?  289 ARG A HB2  2  
ATOM   920   H HB3  . ARG A 1 11 ? 3.929   0.855   -1.496  1.00 15.00 ?  289 ARG A HB3  2  
ATOM   921   H HG2  . ARG A 1 11 ? 5.756   3.256   -1.484  1.00 15.00 ?  289 ARG A HG2  2  
ATOM   922   H HG3  . ARG A 1 11 ? 6.246   1.606   -1.118  1.00 15.00 ?  289 ARG A HG3  2  
ATOM   923   H HD2  . ARG A 1 11 ? 5.642   0.916   -3.377  1.00 15.00 ?  289 ARG A HD2  2  
ATOM   924   H HD3  . ARG A 1 11 ? 5.107   2.553   -3.747  1.00 15.00 ?  289 ARG A HD3  2  
ATOM   925   H HE   . ARG A 1 11 ? 7.425   3.266   -3.506  1.00 15.00 ?  289 ARG A HE   2  
ATOM   926   H HH11 . ARG A 1 11 ? 6.920   -0.187  -3.731  1.00 15.00 ?  289 ARG A HH11 2  
ATOM   927   H HH12 . ARG A 1 11 ? 8.474   -0.505  -4.434  1.00 15.00 ?  289 ARG A HH12 2  
ATOM   928   H HH21 . ARG A 1 11 ? 9.449   2.875   -4.454  1.00 15.00 ?  289 ARG A HH21 2  
ATOM   929   H HH22 . ARG A 1 11 ? 9.916   1.247   -4.849  1.00 15.00 ?  289 ARG A HH22 2  
ATOM   930   N N    . SER A 1 12 ? 2.524   3.237   -4.173  1.00 15.00 ?  290 SER A N    2  
ATOM   931   C CA   . SER A 1 12 ? 1.984   2.984   -5.489  1.00 15.00 ?  290 SER A CA   2  
ATOM   932   C C    . SER A 1 12 ? 3.114   2.847   -6.495  1.00 15.00 ?  290 SER A C    2  
ATOM   933   O O    . SER A 1 12 ? 4.102   3.583   -6.441  1.00 15.00 ?  290 SER A O    2  
ATOM   934   C CB   . SER A 1 12 ? 1.054   4.134   -5.857  1.00 15.00 ?  290 SER A CB   2  
ATOM   935   O OG   . SER A 1 12 ? 0.516   3.987   -7.161  1.00 15.00 ?  290 SER A OG   2  
ATOM   936   H H    . SER A 1 12 ? 2.853   4.140   -3.963  1.00 15.00 ?  290 SER A H    2  
ATOM   937   H HA   . SER A 1 12 ? 1.422   2.063   -5.455  1.00 15.00 ?  290 SER A HA   2  
ATOM   938   H HB2  . SER A 1 12 ? 0.237   4.169   -5.151  1.00 15.00 ?  290 SER A HB2  2  
ATOM   939   H HB3  . SER A 1 12 ? 1.607   5.056   -5.806  1.00 15.00 ?  290 SER A HB3  2  
ATOM   940   H HG   . SER A 1 12 ? -0.181  4.637   -7.290  1.00 15.00 ?  290 SER A HG   2  
ATOM   941   N N    . THR A 1 13 ? 2.976   1.907   -7.415  1.00 15.00 ?  291 THR A N    2  
ATOM   942   C CA   . THR A 1 13 ? 4.031   1.653   -8.373  1.00 15.00 ?  291 THR A CA   2  
ATOM   943   C C    . THR A 1 13 ? 3.513   1.722   -9.813  1.00 15.00 ?  291 THR A C    2  
ATOM   944   O O    . THR A 1 13 ? 2.417   1.233   -10.122 1.00 15.00 ?  291 THR A O    2  
ATOM   945   C CB   . THR A 1 13 ? 4.714   0.301   -8.089  1.00 15.00 ?  291 THR A CB   2  
ATOM   946   O OG1  . THR A 1 13 ? 3.741   -0.752  -8.078  1.00 15.00 ?  291 THR A OG1  2  
ATOM   947   C CG2  . THR A 1 13 ? 5.429   0.342   -6.743  1.00 15.00 ?  291 THR A CG2  2  
ATOM   948   H H    . THR A 1 13 ? 2.146   1.387   -7.457  1.00 15.00 ?  291 THR A H    2  
ATOM   949   H HA   . THR A 1 13 ? 4.772   2.428   -8.244  1.00 15.00 ?  291 THR A HA   2  
ATOM   950   H HB   . THR A 1 13 ? 5.440   0.106   -8.863  1.00 15.00 ?  291 THR A HB   2  
ATOM   951   H HG1  . THR A 1 13 ? 2.990   -0.490  -7.534  1.00 15.00 ?  291 THR A HG1  2  
ATOM   952   H HG21 . THR A 1 13 ? 4.697   0.323   -5.948  1.00 15.00 ?  291 THR A HG21 2  
ATOM   953   H HG22 . THR A 1 13 ? 6.011   1.255   -6.668  1.00 15.00 ?  291 THR A HG22 2  
ATOM   954   H HG23 . THR A 1 13 ? 6.082   -0.512  -6.653  1.00 15.00 ?  291 THR A HG23 2  
ATOM   955   N N    . VAL A 1 14 ? 4.328   2.334   -10.682 1.00 15.00 ?  292 VAL A N    2  
ATOM   956   C CA   . VAL A 1 14 ? 3.952   2.644   -12.070 1.00 15.00 ?  292 VAL A CA   2  
ATOM   957   C C    . VAL A 1 14 ? 3.595   1.389   -12.879 1.00 15.00 ?  292 VAL A C    2  
ATOM   958   O O    . VAL A 1 14 ? 2.962   1.476   -13.934 1.00 15.00 ?  292 VAL A O    2  
ATOM   959   C CB   . VAL A 1 14 ? 5.093   3.405   -12.789 1.00 15.00 ?  292 VAL A CB   2  
ATOM   960   C CG1  . VAL A 1 14 ? 4.628   3.949   -14.131 1.00 15.00 ?  292 VAL A CG1  2  
ATOM   961   C CG2  . VAL A 1 14 ? 5.620   4.533   -11.913 1.00 15.00 ?  292 VAL A CG2  2  
ATOM   962   H H    . VAL A 1 14 ? 5.218   2.609   -10.368 1.00 15.00 ?  292 VAL A H    2  
ATOM   963   H HA   . VAL A 1 14 ? 3.088   3.292   -12.039 1.00 15.00 ?  292 VAL A HA   2  
ATOM   964   H HB   . VAL A 1 14 ? 5.902   2.713   -12.970 1.00 15.00 ?  292 VAL A HB   2  
ATOM   965   H HG11 . VAL A 1 14 ? 5.438   4.481   -14.607 1.00 15.00 ?  292 VAL A HG11 2  
ATOM   966   H HG12 . VAL A 1 14 ? 3.796   4.620   -13.979 1.00 15.00 ?  292 VAL A HG12 2  
ATOM   967   H HG13 . VAL A 1 14 ? 4.318   3.129   -14.763 1.00 15.00 ?  292 VAL A HG13 2  
ATOM   968   H HG21 . VAL A 1 14 ? 6.003   4.122   -10.991 1.00 15.00 ?  292 VAL A HG21 2  
ATOM   969   H HG22 . VAL A 1 14 ? 4.820   5.226   -11.695 1.00 15.00 ?  292 VAL A HG22 2  
ATOM   970   H HG23 . VAL A 1 14 ? 6.413   5.050   -12.433 1.00 15.00 ?  292 VAL A HG23 2  
ATOM   971   N N    . SER A 1 15 ? 3.981   0.226   -12.372 1.00 15.00 ?  293 SER A N    2  
ATOM   972   C CA   . SER A 1 15 ? 3.623   -1.051  -12.986 1.00 15.00 ?  293 SER A CA   2  
ATOM   973   C C    . SER A 1 15 ? 2.102   -1.238  -13.019 1.00 15.00 ?  293 SER A C    2  
ATOM   974   O O    . SER A 1 15 ? 1.582   -2.126  -13.699 1.00 15.00 ?  293 SER A O    2  
ATOM   975   C CB   . SER A 1 15 ? 4.301   -2.199  -12.243 1.00 15.00 ?  293 SER A CB   2  
ATOM   976   O OG   . SER A 1 15 ? 4.202   -2.020  -10.841 1.00 15.00 ?  293 SER A OG   2  
ATOM   977   H H    . SER A 1 15 ? 4.513   0.220   -11.551 1.00 15.00 ?  293 SER A H    2  
ATOM   978   H HA   . SER A 1 15 ? 3.985   -1.034  -14.003 1.00 15.00 ?  293 SER A HA   2  
ATOM   979   H HB2  . SER A 1 15 ? 3.824   -3.132  -12.509 1.00 15.00 ?  293 SER A HB2  2  
ATOM   980   H HB3  . SER A 1 15 ? 5.345   -2.237  -12.517 1.00 15.00 ?  293 SER A HB3  2  
ATOM   981   H HG   . SER A 1 15 ? 5.053   -2.209  -10.434 1.00 15.00 ?  293 SER A HG   2  
ATOM   982   N N    . GLY A 1 16 ? 1.402   -0.414  -12.248 1.00 15.00 ?  294 GLY A N    2  
ATOM   983   C CA   . GLY A 1 16 ? -0.040  -0.472  -12.209 1.00 15.00 ?  294 GLY A CA   2  
ATOM   984   C C    . GLY A 1 16 ? -0.538  -1.410  -11.141 1.00 15.00 ?  294 GLY A C    2  
ATOM   985   O O    . GLY A 1 16 ? -1.432  -2.223  -11.379 1.00 15.00 ?  294 GLY A O    2  
ATOM   986   H H    . GLY A 1 16 ? 1.879   0.239   -11.691 1.00 15.00 ?  294 GLY A H    2  
ATOM   987   H HA2  . GLY A 1 16 ? -0.425  0.521   -12.011 1.00 15.00 ?  294 GLY A HA2  2  
ATOM   988   H HA3  . GLY A 1 16 ? -0.404  -0.805  -13.168 1.00 15.00 ?  294 GLY A HA3  2  
ATOM   989   N N    . ARG A 1 17 ? 0.056   -1.311  -9.965  1.00 15.00 ?  295 ARG A N    2  
ATOM   990   C CA   . ARG A 1 17 ? -0.369  -2.117  -8.835  1.00 15.00 ?  295 ARG A CA   2  
ATOM   991   C C    . ARG A 1 17 ? -0.231  -1.333  -7.540  1.00 15.00 ?  295 ARG A C    2  
ATOM   992   O O    . ARG A 1 17 ? 0.810   -0.721  -7.273  1.00 15.00 ?  295 ARG A O    2  
ATOM   993   C CB   . ARG A 1 17 ? 0.432   -3.423  -8.760  1.00 15.00 ?  295 ARG A CB   2  
ATOM   994   C CG   . ARG A 1 17 ? 1.930   -3.224  -8.623  1.00 15.00 ?  295 ARG A CG   2  
ATOM   995   C CD   . ARG A 1 17 ? 2.658   -4.553  -8.556  1.00 15.00 ?  295 ARG A CD   2  
ATOM   996   N NE   . ARG A 1 17 ? 4.096   -4.384  -8.367  1.00 15.00 ?  295 ARG A NE   2  
ATOM   997   C CZ   . ARG A 1 17 ? 5.008   -5.248  -8.817  1.00 15.00 ?  295 ARG A CZ   2  
ATOM   998   N NH1  . ARG A 1 17 ? 4.633   -6.336  -9.478  1.00 15.00 1  295 ARG A NH1  2  
ATOM   999   N NH2  . ARG A 1 17 ? 6.297   -5.037  -8.590  1.00 15.00 ?  295 ARG A NH2  2  
ATOM   1000  H H    . ARG A 1 17 ? 0.800   -0.671  -9.849  1.00 15.00 ?  295 ARG A H    2  
ATOM   1001  H HA   . ARG A 1 17 ? -1.413  -2.358  -8.980  1.00 15.00 ?  295 ARG A HA   2  
ATOM   1002  H HB2  . ARG A 1 17 ? 0.091   -3.990  -7.906  1.00 15.00 ?  295 ARG A HB2  2  
ATOM   1003  H HB3  . ARG A 1 17 ? 0.249   -3.998  -9.656  1.00 15.00 ?  295 ARG A HB3  2  
ATOM   1004  H HG2  . ARG A 1 17 ? 2.289   -2.669  -9.477  1.00 15.00 ?  295 ARG A HG2  2  
ATOM   1005  H HG3  . ARG A 1 17 ? 2.127   -2.666  -7.719  1.00 15.00 ?  295 ARG A HG3  2  
ATOM   1006  H HD2  . ARG A 1 17 ? 2.262   -5.124  -7.729  1.00 15.00 ?  295 ARG A HD2  2  
ATOM   1007  H HD3  . ARG A 1 17 ? 2.487   -5.088  -9.478  1.00 15.00 ?  295 ARG A HD3  2  
ATOM   1008  H HE   . ARG A 1 17 ? 4.396   -3.590  -7.869  1.00 15.00 ?  295 ARG A HE   2  
ATOM   1009  H HH11 . ARG A 1 17 ? 3.657   -6.522  -9.643  1.00 15.00 ?  295 ARG A HH11 2  
ATOM   1010  H HH12 . ARG A 1 17 ? 5.327   -6.984  -9.815  1.00 15.00 ?  295 ARG A HH12 2  
ATOM   1011  H HH21 . ARG A 1 17 ? 6.594   -4.230  -8.073  1.00 15.00 ?  295 ARG A HH21 2  
ATOM   1012  H HH22 . ARG A 1 17 ? 6.980   -5.691  -8.933  1.00 15.00 ?  295 ARG A HH22 2  
ATOM   1013  N N    . ILE A 1 18 ? -1.288  -1.343  -6.750  1.00 15.00 ?  296 ILE A N    2  
ATOM   1014  C CA   . ILE A 1 18 ? -1.264  -0.724  -5.442  1.00 15.00 ?  296 ILE A CA   2  
ATOM   1015  C C    . ILE A 1 18 ? -0.807  -1.753  -4.418  1.00 15.00 ?  296 ILE A C    2  
ATOM   1016  O O    . ILE A 1 18 ? -1.177  -2.925  -4.515  1.00 15.00 ?  296 ILE A O    2  
ATOM   1017  C CB   . ILE A 1 18 ? -2.661  -0.169  -5.051  1.00 15.00 ?  296 ILE A CB   2  
ATOM   1018  C CG1  . ILE A 1 18 ? -2.564  0.681   -3.792  1.00 15.00 ?  296 ILE A CG1  2  
ATOM   1019  C CG2  . ILE A 1 18 ? -3.677  -1.283  -4.847  1.00 15.00 ?  296 ILE A CG2  2  
ATOM   1020  C CD1  . ILE A 1 18 ? -1.841  1.982   -4.017  1.00 15.00 ?  296 ILE A CD1  2  
ATOM   1021  H H    . ILE A 1 18 ? -2.108  -1.783  -7.053  1.00 15.00 ?  296 ILE A H    2  
ATOM   1022  H HA   . ILE A 1 18 ? -0.559  0.096   -5.467  1.00 15.00 ?  296 ILE A HA   2  
ATOM   1023  H HB   . ILE A 1 18 ? -3.011  0.452   -5.861  1.00 15.00 ?  296 ILE A HB   2  
ATOM   1024  H HG12 . ILE A 1 18 ? -3.558  0.909   -3.438  1.00 15.00 ?  296 ILE A HG12 2  
ATOM   1025  H HG13 . ILE A 1 18 ? -2.031  0.130   -3.031  1.00 15.00 ?  296 ILE A HG13 2  
ATOM   1026  H HG21 . ILE A 1 18 ? -4.620  -0.856  -4.536  1.00 15.00 ?  296 ILE A HG21 2  
ATOM   1027  H HG22 . ILE A 1 18 ? -3.321  -1.960  -4.083  1.00 15.00 ?  296 ILE A HG22 2  
ATOM   1028  H HG23 . ILE A 1 18 ? -3.814  -1.823  -5.773  1.00 15.00 ?  296 ILE A HG23 2  
ATOM   1029  H HD11 . ILE A 1 18 ? -2.410  2.593   -4.700  1.00 15.00 ?  296 ILE A HD11 2  
ATOM   1030  H HD12 . ILE A 1 18 ? -0.863  1.787   -4.435  1.00 15.00 ?  296 ILE A HD12 2  
ATOM   1031  H HD13 . ILE A 1 18 ? -1.735  2.497   -3.077  1.00 15.00 ?  296 ILE A HD13 2  
ATOM   1032  N N    . TYR A 1 19 ? 0.025   -1.346  -3.469  1.00 15.00 ?  297 TYR A N    2  
ATOM   1033  C CA   . TYR A 1 19 ? 0.484   -2.277  -2.457  1.00 15.00 ?  297 TYR A CA   2  
ATOM   1034  C C    . TYR A 1 19 ? 0.757   -1.495  -1.192  1.00 15.00 ?  297 TYR A C    2  
ATOM   1035  O O    . TYR A 1 19 ? 1.442   -0.459  -1.195  1.00 15.00 ?  297 TYR A O    2  
ATOM   1036  C CB   . TYR A 1 19 ? 1.693   -3.132  -2.911  1.00 15.00 ?  297 TYR A CB   2  
ATOM   1037  C CG   . TYR A 1 19 ? 3.065   -2.571  -2.622  1.00 15.00 ?  297 TYR A CG   2  
ATOM   1038  C CD1  . TYR A 1 19 ? 3.593   -1.536  -3.372  1.00 15.00 ?  297 TYR A CD1  2  
ATOM   1039  C CD2  . TYR A 1 19 ? 3.839   -3.098  -1.589  1.00 15.00 ?  297 TYR A CD2  2  
ATOM   1040  C CE1  . TYR A 1 19 ? 4.847   -1.036  -3.099  1.00 15.00 ?  297 TYR A CE1  2  
ATOM   1041  C CE2  . TYR A 1 19 ? 5.091   -2.597  -1.312  1.00 15.00 ?  297 TYR A CE2  2  
ATOM   1042  C CZ   . TYR A 1 19 ? 5.588   -1.565  -2.064  1.00 15.00 ?  297 TYR A CZ   2  
ATOM   1043  O OH   . TYR A 1 19 ? 6.839   -1.066  -1.789  1.00 15.00 ?  297 TYR A OH   2  
ATOM   1044  H H    . TYR A 1 19 ? 0.250   -0.382  -3.384  1.00 15.00 ?  297 TYR A H    2  
ATOM   1045  H HA   . TYR A 1 19 ? -0.346  -2.943  -2.255  1.00 15.00 ?  297 TYR A HA   2  
ATOM   1046  H HB2  . TYR A 1 19 ? 1.634   -4.093  -2.424  1.00 15.00 ?  297 TYR A HB2  2  
ATOM   1047  H HB3  . TYR A 1 19 ? 1.620   -3.282  -3.980  1.00 15.00 ?  297 TYR A HB3  2  
ATOM   1048  H HD1  . TYR A 1 19 ? 3.007   -1.115  -4.175  1.00 15.00 ?  297 TYR A HD1  2  
ATOM   1049  H HD2  . TYR A 1 19 ? 3.459   -3.927  -1.009  1.00 15.00 ?  297 TYR A HD2  2  
ATOM   1050  H HE1  . TYR A 1 19 ? 5.245   -0.227  -3.694  1.00 15.00 ?  297 TYR A HE1  2  
ATOM   1051  H HE2  . TYR A 1 19 ? 5.669   -3.008  -0.498  1.00 15.00 ?  297 TYR A HE2  2  
ATOM   1052  H HH   . TYR A 1 19 ? 7.449   -1.795  -1.638  1.00 15.00 ?  297 TYR A HH   2  
ATOM   1053  N N    . PHE A 1 20 ? 0.178   -1.963  -0.125  1.00 15.00 ?  298 PHE A N    2  
ATOM   1054  C CA   . PHE A 1 20 ? 0.137   -1.206  1.074   1.00 15.00 ?  298 PHE A CA   2  
ATOM   1055  C C    . PHE A 1 20 ? 1.209   -1.519  2.049   1.00 15.00 ?  298 PHE A C    2  
ATOM   1056  O O    . PHE A 1 20 ? 1.528   -2.680  2.305   1.00 15.00 ?  298 PHE A O    2  
ATOM   1057  C CB   . PHE A 1 20 ? -1.194  -1.354  1.724   1.00 15.00 ?  298 PHE A CB   2  
ATOM   1058  C CG   . PHE A 1 20 ? -1.979  -0.169  1.413   1.00 15.00 ?  298 PHE A CG   2  
ATOM   1059  C CD1  . PHE A 1 20 ? -1.628  1.026   1.994   1.00 15.00 ?  298 PHE A CD1  2  
ATOM   1060  C CD2  . PHE A 1 20 ? -3.019  -0.220  0.517   1.00 15.00 ?  298 PHE A CD2  2  
ATOM   1061  C CE1  . PHE A 1 20 ? -2.311  2.161   1.699   1.00 15.00 ?  298 PHE A CE1  2  
ATOM   1062  C CE2  . PHE A 1 20 ? -3.711  0.918   0.217   1.00 15.00 ?  298 PHE A CE2  2  
ATOM   1063  C CZ   . PHE A 1 20 ? -3.353  2.101   0.814   1.00 15.00 ?  298 PHE A CZ   2  
ATOM   1064  H H    . PHE A 1 20 ? -0.283  -2.830  -0.162  1.00 15.00 ?  298 PHE A H    2  
ATOM   1065  H HA   . PHE A 1 20 ? 0.242   -0.172  0.786   1.00 15.00 ?  298 PHE A HA   2  
ATOM   1066  H HB2  . PHE A 1 20 ? -1.702  -2.229  1.341   1.00 15.00 ?  298 PHE A HB2  2  
ATOM   1067  H HB3  . PHE A 1 20 ? -1.081  -1.424  2.795   1.00 15.00 ?  298 PHE A HB3  2  
ATOM   1068  H HD1  . PHE A 1 20 ? -0.805  1.056   2.691   1.00 15.00 ?  298 PHE A HD1  2  
ATOM   1069  H HD2  . PHE A 1 20 ? -3.292  -1.161  0.065   1.00 15.00 ?  298 PHE A HD2  2  
ATOM   1070  H HE1  . PHE A 1 20 ? -2.040  3.099   2.161   1.00 15.00 ?  298 PHE A HE1  2  
ATOM   1071  H HE2  . PHE A 1 20 ? -4.523  0.893   -0.487  1.00 15.00 ?  298 PHE A HE2  2  
ATOM   1072  H HZ   . PHE A 1 20 ? -3.897  2.959   0.612   1.00 15.00 ?  298 PHE A HZ   2  
ATOM   1073  N N    . VAL A 1 21 ? 1.679   -0.435  2.637   1.00 15.00 ?  299 VAL A N    2  
ATOM   1074  C CA   . VAL A 1 21 ? 2.690   -0.459  3.644   1.00 15.00 ?  299 VAL A CA   2  
ATOM   1075  C C    . VAL A 1 21 ? 2.199   0.351   4.853   1.00 15.00 ?  299 VAL A C    2  
ATOM   1076  O O    . VAL A 1 21 ? 2.350   1.575   4.939   1.00 15.00 ?  299 VAL A O    2  
ATOM   1077  C CB   . VAL A 1 21 ? 4.045   0.084   3.100   1.00 15.00 ?  299 VAL A CB   2  
ATOM   1078  C CG1  . VAL A 1 21 ? 4.504   -0.720  1.892   1.00 15.00 ?  299 VAL A CG1  2  
ATOM   1079  C CG2  . VAL A 1 21 ? 3.947   1.545   2.702   1.00 15.00 ?  299 VAL A CG2  2  
ATOM   1080  H H    . VAL A 1 21 ? 1.294   0.435   2.390   1.00 15.00 ?  299 VAL A H    2  
ATOM   1081  H HA   . VAL A 1 21 ? 2.829   -1.487  3.948   1.00 15.00 ?  299 VAL A HA   2  
ATOM   1082  H HB   . VAL A 1 21 ? 4.791   -0.011  3.874   1.00 15.00 ?  299 VAL A HB   2  
ATOM   1083  H HG11 . VAL A 1 21 ? 5.582   -0.788  1.884   1.00 15.00 ?  299 VAL A HG11 2  
ATOM   1084  H HG12 . VAL A 1 21 ? 4.182   -0.215  1.003   1.00 15.00 ?  299 VAL A HG12 2  
ATOM   1085  H HG13 . VAL A 1 21 ? 4.072   -1.712  1.916   1.00 15.00 ?  299 VAL A HG13 2  
ATOM   1086  H HG21 . VAL A 1 21 ? 4.903   1.880   2.326   1.00 15.00 ?  299 VAL A HG21 2  
ATOM   1087  H HG22 . VAL A 1 21 ? 3.673   2.132   3.565   1.00 15.00 ?  299 VAL A HG22 2  
ATOM   1088  H HG23 . VAL A 1 21 ? 3.195   1.662   1.935   1.00 15.00 ?  299 VAL A HG23 2  
ATOM   1089  N N    . ASP A 1 22 ? 1.542   -0.320  5.769   1.00 15.00 ?  300 ASP A N    2  
ATOM   1090  C CA   . ASP A 1 22 ? 1.140   0.334   6.996   1.00 15.00 ?  300 ASP A CA   2  
ATOM   1091  C C    . ASP A 1 22 ? 2.266   0.156   7.988   1.00 15.00 ?  300 ASP A C    2  
ATOM   1092  O O    . ASP A 1 22 ? 2.652   -0.969  8.316   1.00 15.00 ?  300 ASP A O    2  
ATOM   1093  C CB   . ASP A 1 22 ? -0.197  -0.216  7.521   1.00 15.00 ?  300 ASP A CB   2  
ATOM   1094  C CG   . ASP A 1 22 ? -0.132  -0.679  8.965   1.00 15.00 ?  300 ASP A CG   2  
ATOM   1095  O OD1  . ASP A 1 22 ? -0.104  0.172   9.884   1.00 15.00 -1 300 ASP A OD1  2  
ATOM   1096  O OD2  . ASP A 1 22 ? -0.096  -1.900  9.187   1.00 15.00 ?  300 ASP A OD2  2  
ATOM   1097  H H    . ASP A 1 22 ? 1.330   -1.270  5.625   1.00 15.00 ?  300 ASP A H    2  
ATOM   1098  H HA   . ASP A 1 22 ? 1.033   1.390   6.784   1.00 15.00 ?  300 ASP A HA   2  
ATOM   1099  H HB2  . ASP A 1 22 ? -0.942  0.562   7.451   1.00 15.00 ?  300 ASP A HB2  2  
ATOM   1100  H HB3  . ASP A 1 22 ? -0.504  -1.051  6.903   1.00 15.00 ?  300 ASP A HB3  2  
ATOM   1101  N N    . HIS A 1 23 ? 2.832   1.273   8.414   1.00 15.00 ?  301 HIS A N    2  
ATOM   1102  C CA   . HIS A 1 23 ? 4.067   1.245   9.175   1.00 15.00 ?  301 HIS A CA   2  
ATOM   1103  C C    . HIS A 1 23 ? 3.806   0.986   10.656  1.00 15.00 ?  301 HIS A C    2  
ATOM   1104  O O    . HIS A 1 23 ? 4.738   0.719   11.411  1.00 15.00 ?  301 HIS A O    2  
ATOM   1105  C CB   . HIS A 1 23 ? 4.851   2.558   9.043   1.00 15.00 ?  301 HIS A CB   2  
ATOM   1106  C CG   . HIS A 1 23 ? 5.153   3.031   7.650   1.00 15.00 ?  301 HIS A CG   2  
ATOM   1107  N ND1  . HIS A 1 23 ? 5.347   4.355   7.364   1.00 15.00 ?  301 HIS A ND1  2  
ATOM   1108  C CD2  . HIS A 1 23 ? 5.423   2.366   6.503   1.00 15.00 ?  301 HIS A CD2  2  
ATOM   1109  C CE1  . HIS A 1 23 ? 5.729   4.484   6.116   1.00 15.00 ?  301 HIS A CE1  2  
ATOM   1110  N NE2  . HIS A 1 23 ? 5.799   3.291   5.561   1.00 15.00 ?  301 HIS A NE2  2  
ATOM   1111  H H    . HIS A 1 23 ? 2.401   2.136   8.218   1.00 15.00 ?  301 HIS A H    2  
ATOM   1112  H HA   . HIS A 1 23 ? 4.671   0.440   8.786   1.00 15.00 ?  301 HIS A HA   2  
ATOM   1113  H HB2  . HIS A 1 23 ? 4.303   3.343   9.535   1.00 15.00 ?  301 HIS A HB2  2  
ATOM   1114  H HB3  . HIS A 1 23 ? 5.800   2.428   9.542   1.00 15.00 ?  301 HIS A HB3  2  
ATOM   1115  H HD1  . HIS A 1 23 ? 5.196   5.107   7.986   1.00 15.00 ?  301 HIS A HD1  2  
ATOM   1116  H HD2  . HIS A 1 23 ? 5.311   1.305   6.337   1.00 15.00 ?  301 HIS A HD2  2  
ATOM   1117  H HE1  . HIS A 1 23 ? 5.933   5.420   5.611   1.00 15.00 ?  301 HIS A HE1  2  
ATOM   1118  H HE2  . HIS A 1 23 ? 6.410   3.087   4.815   1.00 15.00 ?  301 HIS A HE2  2  
ATOM   1119  N N    . ASN A 1 24 ? 2.548   1.074   11.071  1.00 15.00 ?  302 ASN A N    2  
ATOM   1120  C CA   . ASN A 1 24 ? 2.213   0.956   12.488  1.00 15.00 ?  302 ASN A CA   2  
ATOM   1121  C C    . ASN A 1 24 ? 1.923   -0.491  12.860  1.00 15.00 ?  302 ASN A C    2  
ATOM   1122  O O    . ASN A 1 24 ? 2.495   -1.028  13.812  1.00 15.00 ?  302 ASN A O    2  
ATOM   1123  C CB   . ASN A 1 24 ? 1.011   1.841   12.841  1.00 15.00 ?  302 ASN A CB   2  
ATOM   1124  C CG   . ASN A 1 24 ? 0.673   1.800   14.321  1.00 15.00 ?  302 ASN A CG   2  
ATOM   1125  O OD1  . ASN A 1 24 ? -0.116  0.966   14.771  1.00 15.00 ?  302 ASN A OD1  2  
ATOM   1126  N ND2  . ASN A 1 24 ? 1.258   2.708   15.089  1.00 15.00 ?  302 ASN A ND2  2  
ATOM   1127  H H    . ASN A 1 24 ? 1.828   1.199   10.415  1.00 15.00 ?  302 ASN A H    2  
ATOM   1128  H HA   . ASN A 1 24 ? 3.069   1.290   13.056  1.00 15.00 ?  302 ASN A HA   2  
ATOM   1129  H HB2  . ASN A 1 24 ? 1.232   2.863   12.570  1.00 15.00 ?  302 ASN A HB2  2  
ATOM   1130  H HB3  . ASN A 1 24 ? 0.150   1.505   12.284  1.00 15.00 ?  302 ASN A HB3  2  
ATOM   1131  H HD21 . ASN A 1 24 ? 1.870   3.355   14.666  1.00 15.00 ?  302 ASN A HD21 2  
ATOM   1132  H HD22 . ASN A 1 24 ? 1.056   2.701   16.054  1.00 15.00 ?  302 ASN A HD22 2  
ATOM   1133  N N    . ASN A 1 25 ? 1.028   -1.116  12.113  1.00 15.00 ?  303 ASN A N    2  
ATOM   1134  C CA   . ASN A 1 25 ? 0.658   -2.503  12.370  1.00 15.00 ?  303 ASN A CA   2  
ATOM   1135  C C    . ASN A 1 25 ? 1.539   -3.448  11.561  1.00 15.00 ?  303 ASN A C    2  
ATOM   1136  O O    . ASN A 1 25 ? 1.581   -4.655  11.824  1.00 15.00 ?  303 ASN A O    2  
ATOM   1137  C CB   . ASN A 1 25 ? -0.814  -2.743  12.013  1.00 15.00 ?  303 ASN A CB   2  
ATOM   1138  C CG   . ASN A 1 25 ? -1.757  -1.746  12.663  1.00 15.00 ?  303 ASN A CG   2  
ATOM   1139  O OD1  . ASN A 1 25 ? -2.288  -1.986  13.749  1.00 15.00 ?  303 ASN A OD1  2  
ATOM   1140  N ND2  . ASN A 1 25 ? -1.973  -0.615  12.003  1.00 15.00 ?  303 ASN A ND2  2  
ATOM   1141  H H    . ASN A 1 25 ? 0.587   -0.627  11.373  1.00 15.00 ?  303 ASN A H    2  
ATOM   1142  H HA   . ASN A 1 25 ? 0.805   -2.700  13.420  1.00 15.00 ?  303 ASN A HA   2  
ATOM   1143  H HB2  . ASN A 1 25 ? -0.932  -2.670  10.944  1.00 15.00 ?  303 ASN A HB2  2  
ATOM   1144  H HB3  . ASN A 1 25 ? -1.094  -3.735  12.332  1.00 15.00 ?  303 ASN A HB3  2  
ATOM   1145  H HD21 . ASN A 1 25 ? -1.512  -0.485  11.138  1.00 15.00 ?  303 ASN A HD21 2  
ATOM   1146  H HD22 . ASN A 1 25 ? -2.580  0.044   12.397  1.00 15.00 ?  303 ASN A HD22 2  
ATOM   1147  N N    . ARG A 1 26 ? 2.236   -2.881  10.575  1.00 15.00 ?  304 ARG A N    2  
ATOM   1148  C CA   . ARG A 1 26 ? 3.049   -3.639  9.633   1.00 15.00 ?  304 ARG A CA   2  
ATOM   1149  C C    . ARG A 1 26 ? 2.179   -4.596  8.826   1.00 15.00 ?  304 ARG A C    2  
ATOM   1150  O O    . ARG A 1 26 ? 2.216   -5.814  9.018   1.00 15.00 ?  304 ARG A O    2  
ATOM   1151  C CB   . ARG A 1 26 ? 4.176   -4.399  10.340  1.00 15.00 ?  304 ARG A CB   2  
ATOM   1152  C CG   . ARG A 1 26 ? 5.122   -5.109  9.385   1.00 15.00 ?  304 ARG A CG   2  
ATOM   1153  C CD   . ARG A 1 26 ? 6.071   -6.033  10.124  1.00 15.00 ?  304 ARG A CD   2  
ATOM   1154  N NE   . ARG A 1 26 ? 5.343   -7.064  10.863  1.00 15.00 ?  304 ARG A NE   2  
ATOM   1155  C CZ   . ARG A 1 26 ? 5.855   -8.240  11.215  1.00 15.00 ?  304 ARG A CZ   2  
ATOM   1156  N NH1  . ARG A 1 26 ? 7.062   -8.601  10.797  1.00 15.00 1  304 ARG A NH1  2  
ATOM   1157  N NH2  . ARG A 1 26 ? 5.127   -9.076  11.945  1.00 15.00 ?  304 ARG A NH2  2  
ATOM   1158  H H    . ARG A 1 26 ? 2.188   -1.912  10.470  1.00 15.00 ?  304 ARG A H    2  
ATOM   1159  H HA   . ARG A 1 26 ? 3.490   -2.928  8.950   1.00 15.00 ?  304 ARG A HA   2  
ATOM   1160  H HB2  . ARG A 1 26 ? 4.752   -3.700  10.928  1.00 15.00 ?  304 ARG A HB2  2  
ATOM   1161  H HB3  . ARG A 1 26 ? 3.741   -5.136  10.998  1.00 15.00 ?  304 ARG A HB3  2  
ATOM   1162  H HG2  . ARG A 1 26 ? 4.540   -5.693  8.687   1.00 15.00 ?  304 ARG A HG2  2  
ATOM   1163  H HG3  . ARG A 1 26 ? 5.700   -4.371  8.847   1.00 15.00 ?  304 ARG A HG3  2  
ATOM   1164  H HD2  . ARG A 1 26 ? 6.727   -6.502  9.408   1.00 15.00 ?  304 ARG A HD2  2  
ATOM   1165  H HD3  . ARG A 1 26 ? 6.654   -5.449  10.819  1.00 15.00 ?  304 ARG A HD3  2  
ATOM   1166  H HE   . ARG A 1 26 ? 4.416   -6.855  11.130  1.00 15.00 ?  304 ARG A HE   2  
ATOM   1167  H HH11 . ARG A 1 26 ? 7.596   -7.991  10.200  1.00 15.00 ?  304 ARG A HH11 2  
ATOM   1168  H HH12 . ARG A 1 26 ? 7.451   -9.488  11.077  1.00 15.00 ?  304 ARG A HH12 2  
ATOM   1169  H HH21 . ARG A 1 26 ? 4.196   -8.820  12.217  1.00 15.00 ?  304 ARG A HH21 2  
ATOM   1170  H HH22 . ARG A 1 26 ? 5.507   -9.964  12.241  1.00 15.00 ?  304 ARG A HH22 2  
ATOM   1171  N N    . THR A 1 27 ? 1.360   -4.040  7.954   1.00 15.00 ?  305 THR A N    2  
ATOM   1172  C CA   . THR A 1 27 ? 0.507   -4.853  7.108   1.00 15.00 ?  305 THR A CA   2  
ATOM   1173  C C    . THR A 1 27 ? 0.741   -4.540  5.637   1.00 15.00 ?  305 THR A C    2  
ATOM   1174  O O    . THR A 1 27 ? 1.081   -3.409  5.273   1.00 15.00 ?  305 THR A O    2  
ATOM   1175  C CB   . THR A 1 27 ? -0.991  -4.682  7.455   1.00 15.00 ?  305 THR A CB   2  
ATOM   1176  O OG1  . THR A 1 27 ? -1.361  -3.299  7.435   1.00 15.00 ?  305 THR A OG1  2  
ATOM   1177  C CG2  . THR A 1 27 ? -1.305  -5.279  8.820   1.00 15.00 ?  305 THR A CG2  2  
ATOM   1178  H H    . THR A 1 27 ? 1.319   -3.056  7.884   1.00 15.00 ?  305 THR A H    2  
ATOM   1179  H HA   . THR A 1 27 ? 0.772   -5.887  7.282   1.00 15.00 ?  305 THR A HA   2  
ATOM   1180  H HB   . THR A 1 27 ? -1.571  -5.208  6.712   1.00 15.00 ?  305 THR A HB   2  
ATOM   1181  H HG1  . THR A 1 27 ? -0.885  -2.826  8.143   1.00 15.00 ?  305 THR A HG1  2  
ATOM   1182  H HG21 . THR A 1 27 ? -0.716  -4.780  9.576   1.00 15.00 ?  305 THR A HG21 2  
ATOM   1183  H HG22 . THR A 1 27 ? -1.066  -6.332  8.816   1.00 15.00 ?  305 THR A HG22 2  
ATOM   1184  H HG23 . THR A 1 27 ? -2.355  -5.149  9.038   1.00 15.00 ?  305 THR A HG23 2  
ATOM   1185  N N    . THR A 1 28 ? 0.588   -5.562  4.805   1.00 15.00 ?  306 THR A N    2  
ATOM   1186  C CA   . THR A 1 28 ? 0.755   -5.426  3.369   1.00 15.00 ?  306 THR A CA   2  
ATOM   1187  C C    . THR A 1 28 ? -0.543  -5.777  2.635   1.00 15.00 ?  306 THR A C    2  
ATOM   1188  O O    . THR A 1 28 ? -1.051  -6.898  2.741   1.00 15.00 ?  306 THR A O    2  
ATOM   1189  C CB   . THR A 1 28 ? 1.913   -6.310  2.874   1.00 15.00 ?  306 THR A CB   2  
ATOM   1190  O OG1  . THR A 1 28 ? 1.994   -7.507  3.669   1.00 15.00 ?  306 THR A OG1  2  
ATOM   1191  C CG2  . THR A 1 28 ? 3.233   -5.558  2.943   1.00 15.00 ?  306 THR A CG2  2  
ATOM   1192  H H    . THR A 1 28 ? 0.361   -6.442  5.171   1.00 15.00 ?  306 THR A H    2  
ATOM   1193  H HA   . THR A 1 28 ? 1.003   -4.395  3.161   1.00 15.00 ?  306 THR A HA   2  
ATOM   1194  H HB   . THR A 1 28 ? 1.724   -6.581  1.846   1.00 15.00 ?  306 THR A HB   2  
ATOM   1195  H HG1  . THR A 1 28 ? 2.243   -7.272  4.578   1.00 15.00 ?  306 THR A HG1  2  
ATOM   1196  H HG21 . THR A 1 28 ? 3.175   -4.673  2.327   1.00 15.00 ?  306 THR A HG21 2  
ATOM   1197  H HG22 . THR A 1 28 ? 4.030   -6.195  2.584   1.00 15.00 ?  306 THR A HG22 2  
ATOM   1198  H HG23 . THR A 1 28 ? 3.434   -5.273  3.965   1.00 15.00 ?  306 THR A HG23 2  
ATOM   1199  N N    . GLN A 1 29 ? -1.092  -4.803  1.915   1.00 15.00 ?  307 GLN A N    2  
ATOM   1200  C CA   . GLN A 1 29 ? -2.406  -4.964  1.272   1.00 15.00 ?  307 GLN A CA   2  
ATOM   1201  C C    . GLN A 1 29 ? -2.305  -4.842  -0.249  1.00 15.00 ?  307 GLN A C    2  
ATOM   1202  O O    . GLN A 1 29 ? -1.571  -4.015  -0.755  1.00 15.00 ?  307 GLN A O    2  
ATOM   1203  C CB   . GLN A 1 29 ? -3.403  -3.906  1.788   1.00 15.00 ?  307 GLN A CB   2  
ATOM   1204  C CG   . GLN A 1 29 ? -3.990  -4.182  3.171   1.00 15.00 ?  307 GLN A CG   2  
ATOM   1205  C CD   . GLN A 1 29 ? -3.113  -3.708  4.317   1.00 15.00 ?  307 GLN A CD   2  
ATOM   1206  O OE1  . GLN A 1 29 ? -1.898  -3.646  4.207   1.00 15.00 ?  307 GLN A OE1  2  
ATOM   1207  N NE2  . GLN A 1 29 ? -3.731  -3.385  5.440   1.00 15.00 ?  307 GLN A NE2  2  
ATOM   1208  H H    . GLN A 1 29 ? -0.600  -3.949  1.815   1.00 15.00 ?  307 GLN A H    2  
ATOM   1209  H HA   . GLN A 1 29 ? -2.779  -5.946  1.519   1.00 15.00 ?  307 GLN A HA   2  
ATOM   1210  H HB2  . GLN A 1 29 ? -2.900  -2.951  1.828   1.00 15.00 ?  307 GLN A HB2  2  
ATOM   1211  H HB3  . GLN A 1 29 ? -4.221  -3.835  1.085   1.00 15.00 ?  307 GLN A HB3  2  
ATOM   1212  H HG2  . GLN A 1 29 ? -4.942  -3.676  3.245   1.00 15.00 ?  307 GLN A HG2  2  
ATOM   1213  H HG3  . GLN A 1 29 ? -4.148  -5.244  3.273   1.00 15.00 ?  307 GLN A HG3  2  
ATOM   1214  H HE21 . GLN A 1 29 ? -4.707  -3.467  5.473   1.00 15.00 ?  307 GLN A HE21 2  
ATOM   1215  H HE22 . GLN A 1 29 ? -3.183  -3.078  6.198   1.00 15.00 ?  307 GLN A HE22 2  
ATOM   1216  N N    . PHE A 1 30 ? -3.041  -5.664  -0.980  1.00 15.00 ?  308 PHE A N    2  
ATOM   1217  C CA   . PHE A 1 30 ? -3.152  -5.483  -2.425  1.00 15.00 ?  308 PHE A CA   2  
ATOM   1218  C C    . PHE A 1 30 ? -4.453  -4.792  -2.801  1.00 15.00 ?  308 PHE A C    2  
ATOM   1219  O O    . PHE A 1 30 ? -4.626  -4.348  -3.936  1.00 15.00 ?  308 PHE A O    2  
ATOM   1220  C CB   . PHE A 1 30 ? -2.975  -6.797  -3.190  1.00 15.00 ?  308 PHE A CB   2  
ATOM   1221  C CG   . PHE A 1 30 ? -1.540  -7.051  -3.554  1.00 15.00 ?  308 PHE A CG   2  
ATOM   1222  C CD1  . PHE A 1 30 ? -0.708  -5.983  -3.859  1.00 15.00 ?  308 PHE A CD1  2  
ATOM   1223  C CD2  . PHE A 1 30 ? -1.017  -8.334  -3.599  1.00 15.00 ?  308 PHE A CD2  2  
ATOM   1224  C CE1  . PHE A 1 30 ? 0.613   -6.185  -4.198  1.00 15.00 ?  308 PHE A CE1  2  
ATOM   1225  C CE2  . PHE A 1 30 ? 0.301   -8.538  -3.938  1.00 15.00 ?  308 PHE A CE2  2  
ATOM   1226  C CZ   . PHE A 1 30 ? 1.118   -7.463  -4.236  1.00 15.00 ?  308 PHE A CZ   2  
ATOM   1227  H H    . PHE A 1 30 ? -3.528  -6.403  -0.545  1.00 15.00 ?  308 PHE A H    2  
ATOM   1228  H HA   . PHE A 1 30 ? -2.346  -4.824  -2.713  1.00 15.00 ?  308 PHE A HA   2  
ATOM   1229  H HB2  . PHE A 1 30 ? -3.319  -7.616  -2.575  1.00 15.00 ?  308 PHE A HB2  2  
ATOM   1230  H HB3  . PHE A 1 30 ? -3.553  -6.762  -4.101  1.00 15.00 ?  308 PHE A HB3  2  
ATOM   1231  H HD1  . PHE A 1 30 ? -1.105  -4.980  -3.829  1.00 15.00 ?  308 PHE A HD1  2  
ATOM   1232  H HD2  . PHE A 1 30 ? -1.646  -9.183  -3.372  1.00 15.00 ?  308 PHE A HD2  2  
ATOM   1233  H HE1  . PHE A 1 30 ? 1.250   -5.340  -4.435  1.00 15.00 ?  308 PHE A HE1  2  
ATOM   1234  H HE2  . PHE A 1 30 ? 0.699   -9.541  -3.968  1.00 15.00 ?  308 PHE A HE2  2  
ATOM   1235  H HZ   . PHE A 1 30 ? 2.152   -7.628  -4.502  1.00 15.00 ?  308 PHE A HZ   2  
ATOM   1236  N N    . THR A 1 31 ? -5.381  -4.740  -1.862  1.00 15.00 ?  309 THR A N    2  
ATOM   1237  C CA   . THR A 1 31 ? -6.609  -3.993  -2.062  1.00 15.00 ?  309 THR A CA   2  
ATOM   1238  C C    . THR A 1 31 ? -6.433  -2.563  -1.539  1.00 15.00 ?  309 THR A C    2  
ATOM   1239  O O    . THR A 1 31 ? -5.723  -2.339  -0.555  1.00 15.00 ?  309 THR A O    2  
ATOM   1240  C CB   . THR A 1 31 ? -7.808  -4.681  -1.370  1.00 15.00 ?  309 THR A CB   2  
ATOM   1241  O OG1  . THR A 1 31 ? -9.037  -4.082  -1.801  1.00 15.00 ?  309 THR A OG1  2  
ATOM   1242  C CG2  . THR A 1 31 ? -7.706  -4.595  0.148   1.00 15.00 ?  309 THR A CG2  2  
ATOM   1243  H H    . THR A 1 31 ? -5.235  -5.209  -1.016  1.00 15.00 ?  309 THR A H    2  
ATOM   1244  H HA   . THR A 1 31 ? -6.804  -3.953  -3.125  1.00 15.00 ?  309 THR A HA   2  
ATOM   1245  H HB   . THR A 1 31 ? -7.811  -5.726  -1.654  1.00 15.00 ?  309 THR A HB   2  
ATOM   1246  H HG1  . THR A 1 31 ? -9.387  -4.584  -2.556  1.00 15.00 ?  309 THR A HG1  2  
ATOM   1247  H HG21 . THR A 1 31 ? -6.797  -5.079  0.475   1.00 15.00 ?  309 THR A HG21 2  
ATOM   1248  H HG22 . THR A 1 31 ? -8.556  -5.087  0.595   1.00 15.00 ?  309 THR A HG22 2  
ATOM   1249  H HG23 . THR A 1 31 ? -7.689  -3.557  0.450   1.00 15.00 ?  309 THR A HG23 2  
ATOM   1250  N N    . ASP A 1 32 ? -7.057  -1.599  -2.204  1.00 15.00 ?  310 ASP A N    2  
ATOM   1251  C CA   . ASP A 1 32 ? -6.897  -0.194  -1.833  1.00 15.00 ?  310 ASP A CA   2  
ATOM   1252  C C    . ASP A 1 32 ? -8.245  0.459   -1.535  1.00 15.00 ?  310 ASP A C    2  
ATOM   1253  O O    . ASP A 1 32 ? -9.216  0.262   -2.268  1.00 15.00 ?  310 ASP A O    2  
ATOM   1254  C CB   . ASP A 1 32 ? -6.173  0.571   -2.950  1.00 15.00 ?  310 ASP A CB   2  
ATOM   1255  C CG   . ASP A 1 32 ? -6.113  2.062   -2.688  1.00 15.00 ?  310 ASP A CG   2  
ATOM   1256  O OD1  . ASP A 1 32 ? -5.165  2.527   -2.026  1.00 15.00 ?  310 ASP A OD1  2  
ATOM   1257  O OD2  . ASP A 1 32 ? -7.023  2.770   -3.143  1.00 15.00 -1 310 ASP A OD2  2  
ATOM   1258  H H    . ASP A 1 32 ? -7.641  -1.831  -2.955  1.00 15.00 ?  310 ASP A H    2  
ATOM   1259  H HA   . ASP A 1 32 ? -6.296  -0.163  -0.940  1.00 15.00 ?  310 ASP A HA   2  
ATOM   1260  H HB2  . ASP A 1 32 ? -5.162  0.205   -3.040  1.00 15.00 ?  310 ASP A HB2  2  
ATOM   1261  H HB3  . ASP A 1 32 ? -6.693  0.411   -3.884  1.00 15.00 ?  310 ASP A HB3  2  
ATOM   1262  N N    . PRO A 1 33 ? -8.316  1.249   -0.445  1.00 15.00 ?  311 PRO A N    2  
ATOM   1263  C CA   . PRO A 1 33 ? -9.541  1.931   -0.027  1.00 15.00 ?  311 PRO A CA   2  
ATOM   1264  C C    . PRO A 1 33 ? -9.829  3.218   -0.808  1.00 15.00 ?  311 PRO A C    2  
ATOM   1265  O O    . PRO A 1 33 ? -10.935 3.750   -0.738  1.00 15.00 ?  311 PRO A O    2  
ATOM   1266  C CB   . PRO A 1 33 ? -9.275  2.242   1.446   1.00 15.00 ?  311 PRO A CB   2  
ATOM   1267  C CG   . PRO A 1 33 ? -7.801  2.440   1.519   1.00 15.00 ?  311 PRO A CG   2  
ATOM   1268  C CD   . PRO A 1 33 ? -7.198  1.524   0.483   1.00 15.00 ?  311 PRO A CD   2  
ATOM   1269  H HA   . PRO A 1 33 ? -10.396 1.277   -0.102  1.00 15.00 ?  311 PRO A HA   2  
ATOM   1270  H HB2  . PRO A 1 33 ? -9.815  3.135   1.741   1.00 15.00 ?  311 PRO A HB2  2  
ATOM   1271  H HB3  . PRO A 1 33 ? -9.590  1.407   2.053   1.00 15.00 ?  311 PRO A HB3  2  
ATOM   1272  H HG2  . PRO A 1 33 ? -7.558  3.469   1.297   1.00 15.00 ?  311 PRO A HG2  2  
ATOM   1273  H HG3  . PRO A 1 33 ? -7.445  2.176   2.503   1.00 15.00 ?  311 PRO A HG3  2  
ATOM   1274  H HD2  . PRO A 1 33 ? -6.386  2.020   -0.029  1.00 15.00 ?  311 PRO A HD2  2  
ATOM   1275  H HD3  . PRO A 1 33 ? -6.850  0.613   0.947   1.00 15.00 ?  311 PRO A HD3  2  
ATOM   1276  N N    . ARG A 1 34 ? -8.839  3.729   -1.531  1.00 15.00 ?  312 ARG A N    2  
ATOM   1277  C CA   . ARG A 1 34 ? -8.978  5.004   -2.234  1.00 15.00 ?  312 ARG A CA   2  
ATOM   1278  C C    . ARG A 1 34 ? -9.860  4.852   -3.475  1.00 15.00 ?  312 ARG A C    2  
ATOM   1279  O O    . ARG A 1 34 ? -10.890 5.522   -3.592  1.00 15.00 ?  312 ARG A O    2  
ATOM   1280  C CB   . ARG A 1 34 ? -7.604  5.563   -2.626  1.00 15.00 ?  312 ARG A CB   2  
ATOM   1281  C CG   . ARG A 1 34 ? -6.666  5.739   -1.445  1.00 15.00 ?  312 ARG A CG   2  
ATOM   1282  C CD   . ARG A 1 34 ? -5.217  5.911   -1.885  1.00 15.00 ?  312 ARG A CD   2  
ATOM   1283  N NE   . ARG A 1 34 ? -4.957  7.201   -2.531  1.00 15.00 ?  312 ARG A NE   2  
ATOM   1284  C CZ   . ARG A 1 34 ? -3.837  7.469   -3.209  1.00 15.00 ?  312 ARG A CZ   2  
ATOM   1285  N NH1  . ARG A 1 34 ? -2.980  6.495   -3.480  1.00 15.00 1  312 ARG A NH1  2  
ATOM   1286  N NH2  . ARG A 1 34 ? -3.587  8.697   -3.649  1.00 15.00 ?  312 ARG A NH2  2  
ATOM   1287  H H    . ARG A 1 34 ? -8.001  3.219   -1.628  1.00 15.00 ?  312 ARG A H    2  
ATOM   1288  H HA   . ARG A 1 34 ? -9.454  5.699   -1.557  1.00 15.00 ?  312 ARG A HA   2  
ATOM   1289  H HB2  . ARG A 1 34 ? -7.141  4.889   -3.330  1.00 15.00 ?  312 ARG A HB2  2  
ATOM   1290  H HB3  . ARG A 1 34 ? -7.740  6.525   -3.097  1.00 15.00 ?  312 ARG A HB3  2  
ATOM   1291  H HG2  . ARG A 1 34 ? -6.966  6.613   -0.888  1.00 15.00 ?  312 ARG A HG2  2  
ATOM   1292  H HG3  . ARG A 1 34 ? -6.739  4.868   -0.812  1.00 15.00 ?  312 ARG A HG3  2  
ATOM   1293  H HD2  . ARG A 1 34 ? -4.582  5.831   -1.013  1.00 15.00 ?  312 ARG A HD2  2  
ATOM   1294  H HD3  . ARG A 1 34 ? -4.970  5.117   -2.578  1.00 15.00 ?  312 ARG A HD3  2  
ATOM   1295  H HE   . ARG A 1 34 ? -5.630  7.914   -2.411  1.00 15.00 ?  312 ARG A HE   2  
ATOM   1296  H HH11 . ARG A 1 34 ? -3.171  5.560   -3.179  1.00 15.00 ?  312 ARG A HH11 2  
ATOM   1297  H HH12 . ARG A 1 34 ? -2.123  6.691   -3.991  1.00 15.00 ?  312 ARG A HH12 2  
ATOM   1298  H HH21 . ARG A 1 34 ? -4.238  9.439   -3.481  1.00 15.00 ?  312 ARG A HH21 2  
ATOM   1299  H HH22 . ARG A 1 34 ? -2.719  8.890   -4.137  1.00 15.00 ?  312 ARG A HH22 2  
ATOM   1300  N N    . LEU A 1 35 ? -9.473  3.973   -4.400  1.00 15.00 ?  313 LEU A N    2  
ATOM   1301  C CA   . LEU A 1 35 ? -10.276 3.764   -5.605  1.00 15.00 ?  313 LEU A CA   2  
ATOM   1302  C C    . LEU A 1 35 ? -11.496 2.894   -5.307  1.00 15.00 ?  313 LEU A C    2  
ATOM   1303  O O    . LEU A 1 35 ? -12.614 3.297   -5.680  1.00 15.00 ?  313 LEU A O    2  
ATOM   1304  C CB   . LEU A 1 35 ? -9.476  3.217   -6.822  1.00 15.00 ?  313 LEU A CB   2  
ATOM   1305  C CG   . LEU A 1 35 ? -8.308  2.226   -6.596  1.00 15.00 ?  313 LEU A CG   2  
ATOM   1306  C CD1  . LEU A 1 35 ? -7.070  2.943   -6.085  1.00 15.00 ?  313 LEU A CD1  2  
ATOM   1307  C CD2  . LEU A 1 35 ? -8.693  1.088   -5.661  1.00 15.00 ?  313 LEU A CD2  2  
ATOM   1308  H H    . LEU A 1 35 ? -8.649  3.449   -4.260  1.00 15.00 ?  313 LEU A H    2  
ATOM   1309  H HA   . LEU A 1 35 ? -10.651 4.741   -5.877  1.00 15.00 ?  313 LEU A HA   2  
ATOM   1310  H HB2  . LEU A 1 35 ? -10.182 2.727   -7.477  1.00 15.00 ?  313 LEU A HB2  2  
ATOM   1311  H HB3  . LEU A 1 35 ? -9.080  4.071   -7.354  1.00 15.00 ?  313 LEU A HB3  2  
ATOM   1312  H HG   . LEU A 1 35 ? -8.049  1.788   -7.552  1.00 15.00 ?  313 LEU A HG   2  
ATOM   1313  H HD11 . LEU A 1 35 ? -7.230  3.256   -5.064  1.00 15.00 ?  313 LEU A HD11 2  
ATOM   1314  H HD12 . LEU A 1 35 ? -6.876  3.808   -6.701  1.00 15.00 ?  313 LEU A HD12 2  
ATOM   1315  H HD13 . LEU A 1 35 ? -6.223  2.273   -6.128  1.00 15.00 ?  313 LEU A HD13 2  
ATOM   1316  H HD21 . LEU A 1 35 ? -9.523  0.539   -6.082  1.00 15.00 ?  313 LEU A HD21 2  
ATOM   1317  H HD22 . LEU A 1 35 ? -8.980  1.492   -4.700  1.00 15.00 ?  313 LEU A HD22 2  
ATOM   1318  H HD23 . LEU A 1 35 ? -7.851  0.424   -5.535  1.00 15.00 ?  313 LEU A HD23 2  
ATOM   1319  N N    . ASP B 2 2  ? -1.646  -9.343  -7.955  1.00 15.00 ?  221 ASP B N    2  
ATOM   1320  C CA   . ASP B 2 2  ? -0.209  -9.392  -8.299  1.00 15.00 ?  221 ASP B CA   2  
ATOM   1321  C C    . ASP B 2 2  ? 0.493   -10.405 -7.397  1.00 15.00 ?  221 ASP B C    2  
ATOM   1322  O O    . ASP B 2 2  ? -0.123  -10.948 -6.476  1.00 15.00 ?  221 ASP B O    2  
ATOM   1323  C CB   . ASP B 2 2  ? 0.412   -7.990  -8.146  1.00 15.00 ?  221 ASP B CB   2  
ATOM   1324  C CG   . ASP B 2 2  ? 1.845   -7.914  -8.642  1.00 15.00 ?  221 ASP B CG   2  
ATOM   1325  O OD1  . ASP B 2 2  ? 2.055   -7.631  -9.841  1.00 15.00 ?  221 ASP B OD1  2  
ATOM   1326  O OD2  . ASP B 2 2  ? 2.771   -8.138  -7.840  1.00 15.00 -1 221 ASP B OD2  2  
ATOM   1327  H H    . ASP B 2 2  ? -2.070  -10.291 -8.058  1.00 15.00 ?  221 ASP B H    2  
ATOM   1328  H HA   . ASP B 2 2  ? -0.115  -9.716  -9.326  1.00 15.00 ?  221 ASP B HA   2  
ATOM   1329  H HB2  . ASP B 2 2  ? -0.177  -7.283  -8.713  1.00 15.00 ?  221 ASP B HB2  2  
ATOM   1330  H HB3  . ASP B 2 2  ? 0.395   -7.706  -7.104  1.00 15.00 ?  221 ASP B HB3  2  
ATOM   1331  N N    . THR B 2 3  ? 1.764   -10.668 -7.671  1.00 15.00 ?  222 THR B N    2  
ATOM   1332  C CA   . THR B 2 3  ? 2.563   -11.581 -6.869  1.00 15.00 ?  222 THR B CA   2  
ATOM   1333  C C    . THR B 2 3  ? 2.649   -11.100 -5.421  1.00 15.00 ?  222 THR B C    2  
ATOM   1334  O O    . THR B 2 3  ? 2.502   -9.911  -5.169  1.00 15.00 ?  222 THR B O    2  
ATOM   1335  C CB   . THR B 2 3  ? 3.976   -11.712 -7.471  1.00 15.00 ?  222 THR B CB   2  
ATOM   1336  O OG1  . THR B 2 3  ? 4.471   -10.410 -7.831  1.00 15.00 ?  222 THR B OG1  2  
ATOM   1337  C CG2  . THR B 2 3  ? 3.961   -12.613 -8.696  1.00 15.00 ?  222 THR B CG2  2  
ATOM   1338  H H    . THR B 2 3  ? 2.188   -10.214 -8.429  1.00 15.00 ?  222 THR B H    2  
ATOM   1339  H HA   . THR B 2 3  ? 2.084   -12.546 -6.886  1.00 15.00 ?  222 THR B HA   2  
ATOM   1340  H HB   . THR B 2 3  ? 4.629   -12.148 -6.727  1.00 15.00 ?  222 THR B HB   2  
ATOM   1341  H HG1  . THR B 2 3  ? 3.926   -9.729  -7.403  1.00 15.00 ?  222 THR B HG1  2  
ATOM   1342  H HG21 . THR B 2 3  ? 3.603   -13.593 -8.418  1.00 15.00 ?  222 THR B HG21 2  
ATOM   1343  H HG22 . THR B 2 3  ? 4.961   -12.696 -9.094  1.00 15.00 ?  222 THR B HG22 2  
ATOM   1344  H HG23 . THR B 2 3  ? 3.309   -12.190 -9.447  1.00 15.00 ?  222 THR B HG23 2  
ATOM   1345  N N    . PRO B 2 4  ? 2.929   -12.012 -4.465  1.00 15.00 ?  223 PRO B N    2  
ATOM   1346  C CA   . PRO B 2 4  ? 2.811   -11.726 -3.024  1.00 15.00 ?  223 PRO B CA   2  
ATOM   1347  C C    . PRO B 2 4  ? 3.488   -10.419 -2.608  1.00 15.00 ?  223 PRO B C    2  
ATOM   1348  O O    . PRO B 2 4  ? 4.594   -10.109 -3.058  1.00 15.00 ?  223 PRO B O    2  
ATOM   1349  C CB   . PRO B 2 4  ? 3.517   -12.915 -2.373  1.00 15.00 ?  223 PRO B CB   2  
ATOM   1350  C CG   . PRO B 2 4  ? 3.354   -14.028 -3.348  1.00 15.00 ?  223 PRO B CG   2  
ATOM   1351  C CD   . PRO B 2 4  ? 3.380   -13.394 -4.713  1.00 15.00 ?  223 PRO B CD   2  
ATOM   1352  H HA   . PRO B 2 4  ? 1.777   -11.709 -2.717  1.00 15.00 ?  223 PRO B HA   2  
ATOM   1353  H HB2  . PRO B 2 4  ? 4.559   -12.677 -2.214  1.00 15.00 ?  223 PRO B HB2  2  
ATOM   1354  H HB3  . PRO B 2 4  ? 3.046   -13.147 -1.429  1.00 15.00 ?  223 PRO B HB3  2  
ATOM   1355  H HG2  . PRO B 2 4  ? 4.167   -14.731 -3.244  1.00 15.00 ?  223 PRO B HG2  2  
ATOM   1356  H HG3  . PRO B 2 4  ? 2.409   -14.520 -3.184  1.00 15.00 ?  223 PRO B HG3  2  
ATOM   1357  H HD2  . PRO B 2 4  ? 4.383   -13.405 -5.114  1.00 15.00 ?  223 PRO B HD2  2  
ATOM   1358  H HD3  . PRO B 2 4  ? 2.701   -13.907 -5.379  1.00 15.00 ?  223 PRO B HD3  2  
ATOM   1359  N N    . PRO B 2 5  ? 2.834   -9.654  -1.709  1.00 15.00 ?  224 PRO B N    2  
ATOM   1360  C CA   . PRO B 2 5  ? 3.271   -8.301  -1.351  1.00 15.00 ?  224 PRO B CA   2  
ATOM   1361  C C    . PRO B 2 5  ? 4.654   -8.284  -0.709  1.00 15.00 ?  224 PRO B C    2  
ATOM   1362  O O    . PRO B 2 5  ? 4.963   -9.105  0.160   1.00 15.00 ?  224 PRO B O    2  
ATOM   1363  C CB   . PRO B 2 5  ? 2.206   -7.815  -0.363  1.00 15.00 ?  224 PRO B CB   2  
ATOM   1364  C CG   . PRO B 2 5  ? 1.549   -9.046  0.152   1.00 15.00 ?  224 PRO B CG   2  
ATOM   1365  C CD   . PRO B 2 5  ? 1.639   -10.064 -0.948  1.00 15.00 ?  224 PRO B CD   2  
ATOM   1366  H HA   . PRO B 2 5  ? 3.280   -7.654  -2.216  1.00 15.00 ?  224 PRO B HA   2  
ATOM   1367  H HB2  . PRO B 2 5  ? 2.678   -7.258  0.433   1.00 15.00 ?  224 PRO B HB2  2  
ATOM   1368  H HB3  . PRO B 2 5  ? 1.500   -7.181  -0.878  1.00 15.00 ?  224 PRO B HB3  2  
ATOM   1369  H HG2  . PRO B 2 5  ? 2.068   -9.398  1.031   1.00 15.00 ?  224 PRO B HG2  2  
ATOM   1370  H HG3  . PRO B 2 5  ? 0.516   -8.838  0.386   1.00 15.00 ?  224 PRO B HG3  2  
ATOM   1371  H HD2  . PRO B 2 5  ? 1.768   -11.052 -0.528  1.00 15.00 ?  224 PRO B HD2  2  
ATOM   1372  H HD3  . PRO B 2 5  ? 0.753   -10.024 -1.566  1.00 15.00 ?  224 PRO B HD3  2  
ATOM   1373  N N    . PRO B 2 6  ? 5.494   -7.331  -1.128  1.00 15.00 ?  225 PRO B N    2  
ATOM   1374  C CA   . PRO B 2 6  ? 6.869   -7.211  -0.651  1.00 15.00 ?  225 PRO B CA   2  
ATOM   1375  C C    . PRO B 2 6  ? 6.950   -6.573  0.732   1.00 15.00 ?  225 PRO B C    2  
ATOM   1376  O O    . PRO B 2 6  ? 5.926   -6.227  1.325   1.00 15.00 ?  225 PRO B O    2  
ATOM   1377  C CB   . PRO B 2 6  ? 7.507   -6.310  -1.705  1.00 15.00 ?  225 PRO B CB   2  
ATOM   1378  C CG   . PRO B 2 6  ? 6.409   -5.439  -2.171  1.00 15.00 ?  225 PRO B CG   2  
ATOM   1379  C CD   . PRO B 2 6  ? 5.159   -6.278  -2.107  1.00 15.00 ?  225 PRO B CD   2  
ATOM   1380  H HA   . PRO B 2 6  ? 7.369   -8.168  -0.637  1.00 15.00 ?  225 PRO B HA   2  
ATOM   1381  H HB2  . PRO B 2 6  ? 8.312   -5.740  -1.267  1.00 15.00 ?  225 PRO B HB2  2  
ATOM   1382  H HB3  . PRO B 2 6  ? 7.876   -6.908  -2.507  1.00 15.00 ?  225 PRO B HB3  2  
ATOM   1383  H HG2  . PRO B 2 6  ? 6.328   -4.586  -1.521  1.00 15.00 ?  225 PRO B HG2  2  
ATOM   1384  H HG3  . PRO B 2 6  ? 6.595   -5.122  -3.186  1.00 15.00 ?  225 PRO B HG3  2  
ATOM   1385  H HD2  . PRO B 2 6  ? 4.325   -5.683  -1.762  1.00 15.00 ?  225 PRO B HD2  2  
ATOM   1386  H HD3  . PRO B 2 6  ? 4.944   -6.707  -3.074  1.00 15.00 ?  225 PRO B HD3  2  
ATOM   1387  N N    . ALA B 2 7  ? 8.167   -6.425  1.245   1.00 15.00 ?  226 ALA B N    2  
ATOM   1388  C CA   . ALA B 2 7  ? 8.380   -5.773  2.531   1.00 15.00 ?  226 ALA B CA   2  
ATOM   1389  C C    . ALA B 2 7  ? 7.873   -4.337  2.485   1.00 15.00 ?  226 ALA B C    2  
ATOM   1390  O O    . ALA B 2 7  ? 7.871   -3.707  1.425   1.00 15.00 ?  226 ALA B O    2  
ATOM   1391  C CB   . ALA B 2 7  ? 9.852   -5.804  2.902   1.00 15.00 ?  226 ALA B CB   2  
ATOM   1392  H H    . ALA B 2 7  ? 8.939   -6.763  0.745   1.00 15.00 ?  226 ALA B H    2  
ATOM   1393  H HA   . ALA B 2 7  ? 7.827   -6.318  3.283   1.00 15.00 ?  226 ALA B HA   2  
ATOM   1394  H HB1  . ALA B 2 7  ? 10.419  -5.255  2.164   1.00 15.00 ?  226 ALA B HB1  2  
ATOM   1395  H HB2  . ALA B 2 7  ? 10.193  -6.828  2.929   1.00 15.00 ?  226 ALA B HB2  2  
ATOM   1396  H HB3  . ALA B 2 7  ? 9.991   -5.351  3.872   1.00 15.00 ?  226 ALA B HB3  2  
ATOM   1397  N N    . TYR B 2 8  ? 7.454   -3.810  3.627   1.00 15.00 ?  227 TYR B N    2  
ATOM   1398  C CA   . TYR B 2 8  ? 6.839   -2.498  3.639   1.00 15.00 ?  227 TYR B CA   2  
ATOM   1399  C C    . TYR B 2 8  ? 7.890   -1.403  3.839   1.00 15.00 ?  227 TYR B C    2  
ATOM   1400  O O    . TYR B 2 8  ? 8.705   -1.435  4.767   1.00 15.00 ?  227 TYR B O    2  
ATOM   1401  C CB   . TYR B 2 8  ? 5.733   -2.404  4.705   1.00 15.00 ?  227 TYR B CB   2  
ATOM   1402  C CG   . TYR B 2 8  ? 6.215   -1.989  6.074   1.00 15.00 ?  227 TYR B CG   2  
ATOM   1403  C CD1  . TYR B 2 8  ? 6.303   -0.645  6.405   1.00 15.00 ?  227 TYR B CD1  2  
ATOM   1404  C CD2  . TYR B 2 8  ? 6.596   -2.926  7.019   1.00 15.00 ?  227 TYR B CD2  2  
ATOM   1405  C CE1  . TYR B 2 8  ? 6.757   -0.243  7.639   1.00 15.00 ?  227 TYR B CE1  2  
ATOM   1406  C CE2  . TYR B 2 8  ? 7.052   -2.535  8.264   1.00 15.00 ?  227 TYR B CE2  2  
ATOM   1407  C CZ   . TYR B 2 8  ? 7.134   -1.189  8.569   1.00 15.00 ?  227 TYR B CZ   2  
ATOM   1408  O OH   . TYR B 2 8  ? 7.583   -0.792  9.809   1.00 15.00 ?  227 TYR B OH   2  
ATOM   1409  H H    . TYR B 2 8  ? 7.564   -4.307  4.465   1.00 15.00 ?  227 TYR B H    2  
ATOM   1410  H HA   . TYR B 2 8  ? 6.390   -2.353  2.669   1.00 15.00 ?  227 TYR B HA   2  
ATOM   1411  H HB2  . TYR B 2 8  ? 4.999   -1.673  4.381   1.00 15.00 ?  227 TYR B HB2  2  
ATOM   1412  H HB3  . TYR B 2 8  ? 5.253   -3.369  4.798   1.00 15.00 ?  227 TYR B HB3  2  
ATOM   1413  H HD1  . TYR B 2 8  ? 6.000   0.099   5.673   1.00 15.00 ?  227 TYR B HD1  2  
ATOM   1414  H HD2  . TYR B 2 8  ? 6.532   -3.975  6.775   1.00 15.00 ?  227 TYR B HD2  2  
ATOM   1415  H HE1  . TYR B 2 8  ? 6.826   0.816   7.863   1.00 15.00 ?  227 TYR B HE1  2  
ATOM   1416  H HE2  . TYR B 2 8  ? 7.345   -3.282  8.989   1.00 15.00 ?  227 TYR B HE2  2  
ATOM   1417  H HH   . TYR B 2 8  ? 6.995   -0.115  10.163  1.00 15.00 ?  227 TYR B HH   2  
ATOM   1418  N N    . LEU B 2 9  ? 7.872   -0.463  2.921   1.00 15.00 ?  228 LEU B N    2  
ATOM   1419  C CA   . LEU B 2 9  ? 8.711   0.721   2.970   1.00 15.00 ?  228 LEU B CA   2  
ATOM   1420  C C    . LEU B 2 9  ? 7.829   1.936   2.744   1.00 15.00 ?  228 LEU B C    2  
ATOM   1421  O O    . LEU B 2 9  ? 6.751   1.798   2.188   1.00 15.00 ?  228 LEU B O    2  
ATOM   1422  C CB   . LEU B 2 9  ? 9.841   0.665   1.926   1.00 15.00 ?  228 LEU B CB   2  
ATOM   1423  C CG   . LEU B 2 9  ? 10.960  -0.346  2.199   1.00 15.00 ?  228 LEU B CG   2  
ATOM   1424  C CD1  . LEU B 2 9  ? 10.560  -1.743  1.749   1.00 15.00 ?  228 LEU B CD1  2  
ATOM   1425  C CD2  . LEU B 2 9  ? 12.242  0.088   1.508   1.00 15.00 ?  228 LEU B CD2  2  
ATOM   1426  H H    . LEU B 2 9  ? 7.256   -0.562  2.165   1.00 15.00 ?  228 LEU B H    2  
ATOM   1427  H HA   . LEU B 2 9  ? 9.127   0.782   3.965   1.00 15.00 ?  228 LEU B HA   2  
ATOM   1428  H HB2  . LEU B 2 9  ? 9.403   0.426   0.969   1.00 15.00 ?  228 LEU B HB2  2  
ATOM   1429  H HB3  . LEU B 2 9  ? 10.286  1.647   1.860   1.00 15.00 ?  228 LEU B HB3  2  
ATOM   1430  H HG   . LEU B 2 9  ? 11.150  -0.383  3.261   1.00 15.00 ?  228 LEU B HG   2  
ATOM   1431  H HD11 . LEU B 2 9  ? 11.365  -2.432  1.956   1.00 15.00 ?  228 LEU B HD11 2  
ATOM   1432  H HD12 . LEU B 2 9  ? 10.355  -1.735  0.688   1.00 15.00 ?  228 LEU B HD12 2  
ATOM   1433  H HD13 . LEU B 2 9  ? 9.675   -2.052  2.285   1.00 15.00 ?  228 LEU B HD13 2  
ATOM   1434  H HD21 . LEU B 2 9  ? 13.021  -0.630  1.713   1.00 15.00 ?  228 LEU B HD21 2  
ATOM   1435  H HD22 . LEU B 2 9  ? 12.540  1.058   1.878   1.00 15.00 ?  228 LEU B HD22 2  
ATOM   1436  H HD23 . LEU B 2 9  ? 12.076  0.144   0.441   1.00 15.00 ?  228 LEU B HD23 2  
ATOM   1437  N N    . PRO B 2 10 ? 8.262   3.146   3.109   1.00 15.00 ?  229 PRO B N    2  
ATOM   1438  C CA   . PRO B 2 10 ? 7.381   4.308   3.041   1.00 15.00 ?  229 PRO B CA   2  
ATOM   1439  C C    . PRO B 2 10 ? 7.418   4.964   1.667   1.00 15.00 ?  229 PRO B C    2  
ATOM   1440  O O    . PRO B 2 10 ? 8.442   4.989   0.984   1.00 15.00 ?  229 PRO B O    2  
ATOM   1441  C CB   . PRO B 2 10 ? 7.988   5.269   4.074   1.00 15.00 ?  229 PRO B CB   2  
ATOM   1442  C CG   . PRO B 2 10 ? 9.046   4.491   4.780   1.00 15.00 ?  229 PRO B CG   2  
ATOM   1443  C CD   . PRO B 2 10 ? 9.499   3.441   3.814   1.00 15.00 ?  229 PRO B CD   2  
ATOM   1444  H HA   . PRO B 2 10 ? 6.369   4.056   3.311   1.00 15.00 ?  229 PRO B HA   2  
ATOM   1445  H HB2  . PRO B 2 10 ? 8.408   6.126   3.565   1.00 15.00 ?  229 PRO B HB2  2  
ATOM   1446  H HB3  . PRO B 2 10 ? 7.218   5.596   4.756   1.00 15.00 ?  229 PRO B HB3  2  
ATOM   1447  H HG2  . PRO B 2 10 ? 9.859   5.137   5.043   1.00 15.00 ?  229 PRO B HG2  2  
ATOM   1448  H HG3  . PRO B 2 10 ? 8.631   4.029   5.664   1.00 15.00 ?  229 PRO B HG3  2  
ATOM   1449  H HD2  . PRO B 2 10 ? 10.251  3.823   3.153   1.00 15.00 ?  229 PRO B HD2  2  
ATOM   1450  H HD3  . PRO B 2 10 ? 9.854   2.574   4.345   1.00 15.00 ?  229 PRO B HD3  2  
ATOM   1451  N N    . PRO B 2 11 ? 6.269   5.550   1.297   1.00 15.00 ?  230 PRO B N    2  
ATOM   1452  C CA   . PRO B 2 11 ? 5.708   5.432   -0.037  1.00 15.00 ?  230 PRO B CA   2  
ATOM   1453  C C    . PRO B 2 11 ? 5.972   6.560   -1.025  1.00 15.00 ?  230 PRO B C    2  
ATOM   1454  O O    . PRO B 2 11 ? 6.258   7.703   -0.668  1.00 15.00 ?  230 PRO B O    2  
ATOM   1455  C CB   . PRO B 2 11 ? 4.227   5.403   0.313   1.00 15.00 ?  230 PRO B CB   2  
ATOM   1456  C CG   . PRO B 2 11 ? 4.083   6.374   1.440   1.00 15.00 ?  230 PRO B CG   2  
ATOM   1457  C CD   . PRO B 2 11 ? 5.425   6.428   2.133   1.00 15.00 ?  230 PRO B CD   2  
ATOM   1458  H HA   . PRO B 2 11 ? 5.970   4.492   -0.491  1.00 15.00 ?  230 PRO B HA   2  
ATOM   1459  H HB2  . PRO B 2 11 ? 3.644   5.703   -0.540  1.00 15.00 ?  230 PRO B HB2  2  
ATOM   1460  H HB3  . PRO B 2 11 ? 3.946   4.406   0.617   1.00 15.00 ?  230 PRO B HB3  2  
ATOM   1461  H HG2  . PRO B 2 11 ? 3.824   7.348   1.052   1.00 15.00 ?  230 PRO B HG2  2  
ATOM   1462  H HG3  . PRO B 2 11 ? 3.324   6.027   2.125   1.00 15.00 ?  230 PRO B HG3  2  
ATOM   1463  H HD2  . PRO B 2 11 ? 5.806   7.439   2.136   1.00 15.00 ?  230 PRO B HD2  2  
ATOM   1464  H HD3  . PRO B 2 11 ? 5.342   6.053   3.139   1.00 15.00 ?  230 PRO B HD3  2  
ATOM   1465  N N    . GLU B 2 12 ? 5.817   6.188   -2.289  1.00 15.00 ?  231 GLU B N    2  
ATOM   1466  C CA   . GLU B 2 12 ? 5.758   7.117   -3.393  1.00 15.00 ?  231 GLU B CA   2  
ATOM   1467  C C    . GLU B 2 12 ? 4.397   6.940   -4.087  1.00 15.00 ?  231 GLU B C    2  
ATOM   1468  O O    . GLU B 2 12 ? 4.024   5.816   -4.427  1.00 15.00 ?  231 GLU B O    2  
ATOM   1469  C CB   . GLU B 2 12 ? 6.919   6.846   -4.363  1.00 15.00 ?  231 GLU B CB   2  
ATOM   1470  C CG   . GLU B 2 12 ? 6.957   5.429   -4.937  1.00 15.00 ?  231 GLU B CG   2  
ATOM   1471  C CD   . GLU B 2 12 ? 8.343   5.038   -5.400  1.00 15.00 ?  231 GLU B CD   2  
ATOM   1472  O OE1  . GLU B 2 12 ? 9.141   4.571   -4.563  1.00 15.00 -1 231 GLU B OE1  2  
ATOM   1473  O OE2  . GLU B 2 12 ? 8.643   5.193   -6.599  1.00 15.00 ?  231 GLU B OE2  2  
ATOM   1474  H H    . GLU B 2 12 ? 5.740   5.233   -2.486  1.00 15.00 ?  231 GLU B H    2  
ATOM   1475  H HA   . GLU B 2 12 ? 5.846   8.116   -2.992  1.00 15.00 ?  231 GLU B HA   2  
ATOM   1476  H HB2  . GLU B 2 12 ? 6.847   7.539   -5.188  1.00 15.00 ?  231 GLU B HB2  2  
ATOM   1477  H HB3  . GLU B 2 12 ? 7.850   7.022   -3.843  1.00 15.00 ?  231 GLU B HB3  2  
ATOM   1478  H HG2  . GLU B 2 12 ? 6.632   4.724   -4.184  1.00 15.00 ?  231 GLU B HG2  2  
ATOM   1479  H HG3  . GLU B 2 12 ? 6.286   5.380   -5.782  1.00 15.00 ?  231 GLU B HG3  2  
ATOM   1480  N N    . ASP B 2 13 ? 3.631   8.016   -4.266  1.00 15.00 ?  232 ASP B N    2  
ATOM   1481  C CA   . ASP B 2 13 ? 2.303   7.900   -4.867  1.00 15.00 ?  232 ASP B CA   2  
ATOM   1482  C C    . ASP B 2 13 ? 2.090   8.972   -5.928  1.00 15.00 ?  232 ASP B C    2  
ATOM   1483  O O    . ASP B 2 13 ? 2.081   10.169  -5.627  1.00 15.00 ?  232 ASP B O    2  
ATOM   1484  C CB   . ASP B 2 13 ? 1.217   7.992   -3.788  1.00 15.00 ?  232 ASP B CB   2  
ATOM   1485  C CG   . ASP B 2 13 ? -0.195  7.893   -4.352  1.00 15.00 ?  232 ASP B CG   2  
ATOM   1486  O OD1  . ASP B 2 13 ? -0.617  6.779   -4.723  1.00 15.00 ?  232 ASP B OD1  2  
ATOM   1487  O OD2  . ASP B 2 13 ? -0.905  8.925   -4.393  1.00 15.00 -1 232 ASP B OD2  2  
ATOM   1488  H H    . ASP B 2 13 ? 3.957   8.905   -3.997  1.00 15.00 ?  232 ASP B H    2  
ATOM   1489  H HA   . ASP B 2 13 ? 2.243   6.931   -5.340  1.00 15.00 ?  232 ASP B HA   2  
ATOM   1490  H HB2  . ASP B 2 13 ? 1.355   7.183   -3.084  1.00 15.00 ?  232 ASP B HB2  2  
ATOM   1491  H HB3  . ASP B 2 13 ? 1.312   8.935   -3.271  1.00 15.00 ?  232 ASP B HB3  2  
ATOM   1492  N N    . PRO B 2 14 ? 1.955   8.554   -7.195  1.00 15.00 ?  233 PRO B N    2  
ATOM   1493  C CA   . PRO B 2 14 ? 1.715   9.462   -8.316  1.00 15.00 ?  233 PRO B CA   2  
ATOM   1494  C C    . PRO B 2 14 ? 0.275   9.973   -8.343  1.00 15.00 ?  233 PRO B C    2  
ATOM   1495  O O    . PRO B 2 14 ? -0.603  9.367   -8.956  1.00 15.00 ?  233 PRO B O    2  
ATOM   1496  C CB   . PRO B 2 14 ? 2.002   8.599   -9.559  1.00 15.00 ?  233 PRO B CB   2  
ATOM   1497  C CG   . PRO B 2 14 ? 2.557   7.308   -9.044  1.00 15.00 ?  233 PRO B CG   2  
ATOM   1498  C CD   . PRO B 2 14 ? 2.042   7.162   -7.644  1.00 15.00 ?  233 PRO B CD   2  
ATOM   1499  H HA   . PRO B 2 14 ? 2.393   10.303  -8.294  1.00 15.00 ?  233 PRO B HA   2  
ATOM   1500  H HB2  . PRO B 2 14 ? 1.083   8.439   -10.106 1.00 15.00 ?  233 PRO B HB2  2  
ATOM   1501  H HB3  . PRO B 2 14 ? 2.714   9.106   -10.193 1.00 15.00 ?  233 PRO B HB3  2  
ATOM   1502  H HG2  . PRO B 2 14 ? 2.213   6.489   -9.658  1.00 15.00 ?  233 PRO B HG2  2  
ATOM   1503  H HG3  . PRO B 2 14 ? 3.636   7.350   -9.044  1.00 15.00 ?  233 PRO B HG3  2  
ATOM   1504  H HD2  . PRO B 2 14 ? 1.071   6.689   -7.644  1.00 15.00 ?  233 PRO B HD2  2  
ATOM   1505  H HD3  . PRO B 2 14 ? 2.740   6.603   -7.037  1.00 15.00 ?  233 PRO B HD3  2  
HETATM 1506  N N    . NH2 B 2 15 ? 0.035   11.090  -7.670  1.00 15.00 ?  234 NH2 B N    2  
HETATM 1507  H HN1  . NH2 B 2 15 ? 0.783   11.519  -7.205  1.00 15.00 ?  234 NH2 B HN1  2  
HETATM 1508  H HN2  . NH2 B 2 15 ? -0.879  11.438  -7.665  1.00 15.00 ?  234 NH2 B HN2  2  
ATOM   1509  N N    . LEU A 1 1  ? -14.282 2.388   -2.725  1.00 15.00 ?  279 LEU A N    3  
ATOM   1510  C CA   . LEU A 1 1  ? -14.605 3.797   -2.400  1.00 15.00 ?  279 LEU A CA   3  
ATOM   1511  C C    . LEU A 1 1  ? -14.906 3.931   -0.914  1.00 15.00 ?  279 LEU A C    3  
ATOM   1512  O O    . LEU A 1 1  ? -15.722 3.188   -0.376  1.00 15.00 ?  279 LEU A O    3  
ATOM   1513  C CB   . LEU A 1 1  ? -15.826 4.258   -3.207  1.00 15.00 ?  279 LEU A CB   3  
ATOM   1514  C CG   . LEU A 1 1  ? -15.659 4.249   -4.729  1.00 15.00 ?  279 LEU A CG   3  
ATOM   1515  C CD1  . LEU A 1 1  ? -16.993 4.515   -5.409  1.00 15.00 ?  279 LEU A CD1  3  
ATOM   1516  C CD2  . LEU A 1 1  ? -14.632 5.288   -5.161  1.00 15.00 ?  279 LEU A CD2  3  
ATOM   1517  H H1   . LEU A 1 1  ? -13.489 2.060   -2.138  1.00 15.00 ?  279 LEU A H1   3  
ATOM   1518  H H2   . LEU A 1 1  ? -14.019 2.297   -3.729  1.00 15.00 ?  279 LEU A H2   3  
ATOM   1519  H H3   . LEU A 1 1  ? -15.112 1.782   -2.535  1.00 15.00 ?  279 LEU A H3   3  
ATOM   1520  H HA   . LEU A 1 1  ? -13.755 4.415   -2.649  1.00 15.00 ?  279 LEU A HA   3  
ATOM   1521  H HB2  . LEU A 1 1  ? -16.657 3.615   -2.955  1.00 15.00 ?  279 LEU A HB2  3  
ATOM   1522  H HB3  . LEU A 1 1  ? -16.071 5.265   -2.902  1.00 15.00 ?  279 LEU A HB3  3  
ATOM   1523  H HG   . LEU A 1 1  ? -15.308 3.277   -5.044  1.00 15.00 ?  279 LEU A HG   3  
ATOM   1524  H HD11 . LEU A 1 1  ? -17.700 3.748   -5.129  1.00 15.00 ?  279 LEU A HD11 3  
ATOM   1525  H HD12 . LEU A 1 1  ? -16.859 4.505   -6.481  1.00 15.00 ?  279 LEU A HD12 3  
ATOM   1526  H HD13 . LEU A 1 1  ? -17.369 5.479   -5.102  1.00 15.00 ?  279 LEU A HD13 3  
ATOM   1527  H HD21 . LEU A 1 1  ? -14.531 5.269   -6.237  1.00 15.00 ?  279 LEU A HD21 3  
ATOM   1528  H HD22 . LEU A 1 1  ? -13.681 5.063   -4.706  1.00 15.00 ?  279 LEU A HD22 3  
ATOM   1529  H HD23 . LEU A 1 1  ? -14.959 6.269   -4.847  1.00 15.00 ?  279 LEU A HD23 3  
ATOM   1530  N N    . GLY A 1 2  ? -14.265 4.881   -0.250  1.00 15.00 ?  280 GLY A N    3  
ATOM   1531  C CA   . GLY A 1 2  ? -14.517 5.062   1.163   1.00 15.00 ?  280 GLY A CA   3  
ATOM   1532  C C    . GLY A 1 2  ? -13.380 5.740   1.904   1.00 15.00 ?  280 GLY A C    3  
ATOM   1533  O O    . GLY A 1 2  ? -12.746 6.661   1.383   1.00 15.00 ?  280 GLY A O    3  
ATOM   1534  H H    . GLY A 1 2  ? -13.631 5.469   -0.721  1.00 15.00 ?  280 GLY A H    3  
ATOM   1535  H HA2  . GLY A 1 2  ? -15.410 5.659   1.279   1.00 15.00 ?  280 GLY A HA2  3  
ATOM   1536  H HA3  . GLY A 1 2  ? -14.692 4.092   1.606   1.00 15.00 ?  280 GLY A HA3  3  
ATOM   1537  N N    . PRO A 1 3  ? -13.102 5.285   3.135   1.00 15.00 ?  281 PRO A N    3  
ATOM   1538  C CA   . PRO A 1 3  ? -12.143 5.919   4.040   1.00 15.00 ?  281 PRO A CA   3  
ATOM   1539  C C    . PRO A 1 3  ? -10.714 5.397   3.901   1.00 15.00 ?  281 PRO A C    3  
ATOM   1540  O O    . PRO A 1 3  ? -10.485 4.235   3.562   1.00 15.00 ?  281 PRO A O    3  
ATOM   1541  C CB   . PRO A 1 3  ? -12.706 5.525   5.401   1.00 15.00 ?  281 PRO A CB   3  
ATOM   1542  C CG   . PRO A 1 3  ? -13.237 4.148   5.186   1.00 15.00 ?  281 PRO A CG   3  
ATOM   1543  C CD   . PRO A 1 3  ? -13.730 4.102   3.761   1.00 15.00 ?  281 PRO A CD   3  
ATOM   1544  H HA   . PRO A 1 3  ? -12.151 6.993   3.944   1.00 15.00 ?  281 PRO A HA   3  
ATOM   1545  H HB2  . PRO A 1 3  ? -11.916 5.538   6.138   1.00 15.00 ?  281 PRO A HB2  3  
ATOM   1546  H HB3  . PRO A 1 3  ? -13.488 6.210   5.687   1.00 15.00 ?  281 PRO A HB3  3  
ATOM   1547  H HG2  . PRO A 1 3  ? -12.445 3.423   5.326   1.00 15.00 ?  281 PRO A HG2  3  
ATOM   1548  H HG3  . PRO A 1 3  ? -14.050 3.955   5.870   1.00 15.00 ?  281 PRO A HG3  3  
ATOM   1549  H HD2  . PRO A 1 3  ? -13.403 3.193   3.279   1.00 15.00 ?  281 PRO A HD2  3  
ATOM   1550  H HD3  . PRO A 1 3  ? -14.806 4.178   3.732   1.00 15.00 ?  281 PRO A HD3  3  
ATOM   1551  N N    . LEU A 1 4  ? -9.755  6.268   4.181   1.00 15.00 ?  282 LEU A N    3  
ATOM   1552  C CA   . LEU A 1 4  ? -8.360  5.869   4.266   1.00 15.00 ?  282 LEU A CA   3  
ATOM   1553  C C    . LEU A 1 4  ? -7.819  6.198   5.655   1.00 15.00 ?  282 LEU A C    3  
ATOM   1554  O O    . LEU A 1 4  ? -7.703  7.368   6.019   1.00 15.00 ?  282 LEU A O    3  
ATOM   1555  C CB   . LEU A 1 4  ? -7.521  6.576   3.197   1.00 15.00 ?  282 LEU A CB   3  
ATOM   1556  C CG   . LEU A 1 4  ? -6.055  6.134   3.130   1.00 15.00 ?  282 LEU A CG   3  
ATOM   1557  C CD1  . LEU A 1 4  ? -5.947  4.703   2.635   1.00 15.00 ?  282 LEU A CD1  3  
ATOM   1558  C CD2  . LEU A 1 4  ? -5.251  7.066   2.240   1.00 15.00 ?  282 LEU A CD2  3  
ATOM   1559  H H    . LEU A 1 4  ? -9.995  7.208   4.342   1.00 15.00 ?  282 LEU A H    3  
ATOM   1560  H HA   . LEU A 1 4  ? -8.308  4.801   4.111   1.00 15.00 ?  282 LEU A HA   3  
ATOM   1561  H HB2  . LEU A 1 4  ? -7.975  6.393   2.234   1.00 15.00 ?  282 LEU A HB2  3  
ATOM   1562  H HB3  . LEU A 1 4  ? -7.546  7.636   3.394   1.00 15.00 ?  282 LEU A HB3  3  
ATOM   1563  H HG   . LEU A 1 4  ? -5.630  6.175   4.122   1.00 15.00 ?  282 LEU A HG   3  
ATOM   1564  H HD11 . LEU A 1 4  ? -6.430  4.617   1.672   1.00 15.00 ?  282 LEU A HD11 3  
ATOM   1565  H HD12 . LEU A 1 4  ? -6.428  4.042   3.341   1.00 15.00 ?  282 LEU A HD12 3  
ATOM   1566  H HD13 . LEU A 1 4  ? -4.907  4.432   2.539   1.00 15.00 ?  282 LEU A HD13 3  
ATOM   1567  H HD21 . LEU A 1 4  ? -5.656  7.047   1.239   1.00 15.00 ?  282 LEU A HD21 3  
ATOM   1568  H HD22 . LEU A 1 4  ? -4.220  6.741   2.218   1.00 15.00 ?  282 LEU A HD22 3  
ATOM   1569  H HD23 . LEU A 1 4  ? -5.304  8.072   2.631   1.00 15.00 ?  282 LEU A HD23 3  
ATOM   1570  N N    . PRO A 1 5  ? -7.520  5.172   6.461   1.00 15.00 ?  283 PRO A N    3  
ATOM   1571  C CA   . PRO A 1 5  ? -7.027  5.357   7.832   1.00 15.00 ?  283 PRO A CA   3  
ATOM   1572  C C    . PRO A 1 5  ? -5.634  5.987   7.871   1.00 15.00 ?  283 PRO A C    3  
ATOM   1573  O O    . PRO A 1 5  ? -4.721  5.538   7.176   1.00 15.00 ?  283 PRO A O    3  
ATOM   1574  C CB   . PRO A 1 5  ? -6.981  3.929   8.400   1.00 15.00 ?  283 PRO A CB   3  
ATOM   1575  C CG   . PRO A 1 5  ? -7.789  3.100   7.458   1.00 15.00 ?  283 PRO A CG   3  
ATOM   1576  C CD   . PRO A 1 5  ? -7.645  3.750   6.116   1.00 15.00 ?  283 PRO A CD   3  
ATOM   1577  H HA   . PRO A 1 5  ? -7.707  5.958   8.416   1.00 15.00 ?  283 PRO A HA   3  
ATOM   1578  H HB2  . PRO A 1 5  ? -5.956  3.591   8.442   1.00 15.00 ?  283 PRO A HB2  3  
ATOM   1579  H HB3  . PRO A 1 5  ? -7.405  3.923   9.393   1.00 15.00 ?  283 PRO A HB3  3  
ATOM   1580  H HG2  . PRO A 1 5  ? -7.400  2.093   7.430   1.00 15.00 ?  283 PRO A HG2  3  
ATOM   1581  H HG3  . PRO A 1 5  ? -8.825  3.096   7.764   1.00 15.00 ?  283 PRO A HG3  3  
ATOM   1582  H HD2  . PRO A 1 5  ? -6.756  3.394   5.615   1.00 15.00 ?  283 PRO A HD2  3  
ATOM   1583  H HD3  . PRO A 1 5  ? -8.522  3.574   5.513   1.00 15.00 ?  283 PRO A HD3  3  
ATOM   1584  N N    . PRO A 1 6  ? -5.460  7.049   8.681   1.00 15.00 ?  284 PRO A N    3  
ATOM   1585  C CA   . PRO A 1 6  ? -4.155  7.693   8.874   1.00 15.00 ?  284 PRO A CA   3  
ATOM   1586  C C    . PRO A 1 6  ? -3.088  6.688   9.298   1.00 15.00 ?  284 PRO A C    3  
ATOM   1587  O O    . PRO A 1 6  ? -3.264  5.954   10.275  1.00 15.00 ?  284 PRO A O    3  
ATOM   1588  C CB   . PRO A 1 6  ? -4.417  8.704   9.993   1.00 15.00 ?  284 PRO A CB   3  
ATOM   1589  C CG   . PRO A 1 6  ? -5.878  8.985   9.918   1.00 15.00 ?  284 PRO A CG   3  
ATOM   1590  C CD   . PRO A 1 6  ? -6.524  7.705   9.462   1.00 15.00 ?  284 PRO A CD   3  
ATOM   1591  H HA   . PRO A 1 6  ? -3.831  8.209   7.982   1.00 15.00 ?  284 PRO A HA   3  
ATOM   1592  H HB2  . PRO A 1 6  ? -4.146  8.269   10.944  1.00 15.00 ?  284 PRO A HB2  3  
ATOM   1593  H HB3  . PRO A 1 6  ? -3.835  9.596   9.820   1.00 15.00 ?  284 PRO A HB3  3  
ATOM   1594  H HG2  . PRO A 1 6  ? -6.249  9.266   10.894  1.00 15.00 ?  284 PRO A HG2  3  
ATOM   1595  H HG3  . PRO A 1 6  ? -6.063  9.773   9.204   1.00 15.00 ?  284 PRO A HG3  3  
ATOM   1596  H HD2  . PRO A 1 6  ? -6.807  7.101   10.311  1.00 15.00 ?  284 PRO A HD2  3  
ATOM   1597  H HD3  . PRO A 1 6  ? -7.383  7.915   8.843   1.00 15.00 ?  284 PRO A HD3  3  
ATOM   1598  N N    . GLY A 1 7  ? -1.987  6.658   8.564   1.00 15.00 ?  285 GLY A N    3  
ATOM   1599  C CA   . GLY A 1 7  ? -0.961  5.663   8.805   1.00 15.00 ?  285 GLY A CA   3  
ATOM   1600  C C    . GLY A 1 7  ? -0.844  4.709   7.639   1.00 15.00 ?  285 GLY A C    3  
ATOM   1601  O O    . GLY A 1 7  ? 0.068   3.879   7.581   1.00 15.00 ?  285 GLY A O    3  
ATOM   1602  H H    . GLY A 1 7  ? -1.864  7.318   7.848   1.00 15.00 ?  285 GLY A H    3  
ATOM   1603  H HA2  . GLY A 1 7  ? -0.014  6.159   8.955   1.00 15.00 ?  285 GLY A HA2  3  
ATOM   1604  H HA3  . GLY A 1 7  ? -1.213  5.103   9.694   1.00 15.00 ?  285 GLY A HA3  3  
ATOM   1605  N N    . TRP A 1 8  ? -1.770  4.847   6.702   1.00 15.00 ?  286 TRP A N    3  
ATOM   1606  C CA   . TRP A 1 8  ? -1.764  4.051   5.490   1.00 15.00 ?  286 TRP A CA   3  
ATOM   1607  C C    . TRP A 1 8  ? -0.959  4.748   4.416   1.00 15.00 ?  286 TRP A C    3  
ATOM   1608  O O    . TRP A 1 8  ? -1.414  5.727   3.822   1.00 15.00 ?  286 TRP A O    3  
ATOM   1609  C CB   . TRP A 1 8  ? -3.198  3.826   4.975   1.00 15.00 ?  286 TRP A CB   3  
ATOM   1610  C CG   . TRP A 1 8  ? -3.865  2.614   5.537   1.00 15.00 ?  286 TRP A CG   3  
ATOM   1611  C CD1  . TRP A 1 8  ? -4.023  2.298   6.856   1.00 15.00 ?  286 TRP A CD1  3  
ATOM   1612  C CD2  . TRP A 1 8  ? -4.463  1.545   4.790   1.00 15.00 ?  286 TRP A CD2  3  
ATOM   1613  N NE1  . TRP A 1 8  ? -4.665  1.093   6.978   1.00 15.00 ?  286 TRP A NE1  3  
ATOM   1614  C CE2  . TRP A 1 8  ? -4.941  0.607   5.728   1.00 15.00 ?  286 TRP A CE2  3  
ATOM   1615  C CE3  . TRP A 1 8  ? -4.638  1.275   3.420   1.00 15.00 ?  286 TRP A CE3  3  
ATOM   1616  C CZ2  . TRP A 1 8  ? -5.572  -0.574  5.347   1.00 15.00 ?  286 TRP A CZ2  3  
ATOM   1617  C CZ3  . TRP A 1 8  ? -5.258  0.096   3.057   1.00 15.00 ?  286 TRP A CZ3  3  
ATOM   1618  C CH2  . TRP A 1 8  ? -5.712  -0.817  4.012   1.00 15.00 ?  286 TRP A CH2  3  
ATOM   1619  H H    . TRP A 1 8  ? -2.486  5.501   6.835   1.00 15.00 ?  286 TRP A H    3  
ATOM   1620  H HA   . TRP A 1 8  ? -1.303  3.096   5.714   1.00 15.00 ?  286 TRP A HA   3  
ATOM   1621  H HB2  . TRP A 1 8  ? -3.802  4.683   5.234   1.00 15.00 ?  286 TRP A HB2  3  
ATOM   1622  H HB3  . TRP A 1 8  ? -3.172  3.724   3.901   1.00 15.00 ?  286 TRP A HB3  3  
ATOM   1623  H HD1  . TRP A 1 8  ? -3.681  2.916   7.673   1.00 15.00 ?  286 TRP A HD1  3  
ATOM   1624  H HE1  . TRP A 1 8  ? -4.888  0.645   7.825   1.00 15.00 ?  286 TRP A HE1  3  
ATOM   1625  H HE3  . TRP A 1 8  ? -4.302  1.988   2.619   1.00 15.00 ?  286 TRP A HE3  3  
ATOM   1626  H HZ2  . TRP A 1 8  ? -5.929  -1.289  6.073   1.00 15.00 ?  286 TRP A HZ2  3  
ATOM   1627  H HZ3  . TRP A 1 8  ? -5.357  -0.150  2.007   1.00 15.00 ?  286 TRP A HZ3  3  
ATOM   1628  H HH2  . TRP A 1 8  ? -6.189  -1.724  3.674   1.00 15.00 ?  286 TRP A HH2  3  
ATOM   1629  N N    . GLU A 1 9  ? 0.249   4.270   4.190   1.00 15.00 ?  287 GLU A N    3  
ATOM   1630  C CA   . GLU A 1 9  ? 1.070   4.798   3.134   1.00 15.00 ?  287 GLU A CA   3  
ATOM   1631  C C    . GLU A 1 9  ? 0.827   3.985   1.882   1.00 15.00 ?  287 GLU A C    3  
ATOM   1632  O O    . GLU A 1 9  ? 0.995   2.767   1.884   1.00 15.00 ?  287 GLU A O    3  
ATOM   1633  C CB   . GLU A 1 9  ? 2.545   4.768   3.540   1.00 15.00 ?  287 GLU A CB   3  
ATOM   1634  C CG   . GLU A 1 9  ? 3.102   6.135   3.904   1.00 15.00 ?  287 GLU A CG   3  
ATOM   1635  C CD   . GLU A 1 9  ? 2.281   6.857   4.954   1.00 15.00 ?  287 GLU A CD   3  
ATOM   1636  O OE1  . GLU A 1 9  ? 2.521   6.631   6.155   1.00 15.00 ?  287 GLU A OE1  3  
ATOM   1637  O OE2  . GLU A 1 9  ? 1.405   7.667   4.580   1.00 15.00 -1 287 GLU A OE2  3  
ATOM   1638  H H    . GLU A 1 9  ? 0.591   3.523   4.737   1.00 15.00 ?  287 GLU A H    3  
ATOM   1639  H HA   . GLU A 1 9  ? 0.770   5.822   2.952   1.00 15.00 ?  287 GLU A HA   3  
ATOM   1640  H HB2  . GLU A 1 9  ? 2.653   4.120   4.398   1.00 15.00 ?  287 GLU A HB2  3  
ATOM   1641  H HB3  . GLU A 1 9  ? 3.130   4.370   2.726   1.00 15.00 ?  287 GLU A HB3  3  
ATOM   1642  H HG2  . GLU A 1 9  ? 4.103   6.007   4.285   1.00 15.00 ?  287 GLU A HG2  3  
ATOM   1643  H HG3  . GLU A 1 9  ? 3.139   6.740   3.013   1.00 15.00 ?  287 GLU A HG3  3  
ATOM   1644  N N    . VAL A 1 10 ? 0.396   4.638   0.821   1.00 15.00 ?  288 VAL A N    3  
ATOM   1645  C CA   . VAL A 1 10 ? 0.140   3.925   -0.407  1.00 15.00 ?  288 VAL A CA   3  
ATOM   1646  C C    . VAL A 1 10 ? 1.414   3.906   -1.240  1.00 15.00 ?  288 VAL A C    3  
ATOM   1647  O O    . VAL A 1 10 ? 1.942   4.940   -1.655  1.00 15.00 ?  288 VAL A O    3  
ATOM   1648  C CB   . VAL A 1 10 ? -1.085  4.495   -1.194  1.00 15.00 ?  288 VAL A CB   3  
ATOM   1649  C CG1  . VAL A 1 10 ? -2.099  5.101   -0.238  1.00 15.00 ?  288 VAL A CG1  3  
ATOM   1650  C CG2  . VAL A 1 10 ? -0.701  5.501   -2.272  1.00 15.00 ?  288 VAL A CG2  3  
ATOM   1651  H H    . VAL A 1 10 ? 0.248   5.606   0.868   1.00 15.00 ?  288 VAL A H    3  
ATOM   1652  H HA   . VAL A 1 10 ? -0.091  2.904   -0.134  1.00 15.00 ?  288 VAL A HA   3  
ATOM   1653  H HB   . VAL A 1 10 ? -1.569  3.660   -1.685  1.00 15.00 ?  288 VAL A HB   3  
ATOM   1654  H HG11 . VAL A 1 10 ? -1.646  5.923   0.296   1.00 15.00 ?  288 VAL A HG11 3  
ATOM   1655  H HG12 . VAL A 1 10 ? -2.423  4.349   0.469   1.00 15.00 ?  288 VAL A HG12 3  
ATOM   1656  H HG13 . VAL A 1 10 ? -2.952  5.460   -0.797  1.00 15.00 ?  288 VAL A HG13 3  
ATOM   1657  H HG21 . VAL A 1 10 ? -0.034  6.235   -1.856  1.00 15.00 ?  288 VAL A HG21 3  
ATOM   1658  H HG22 . VAL A 1 10 ? -1.590  5.991   -2.642  1.00 15.00 ?  288 VAL A HG22 3  
ATOM   1659  H HG23 . VAL A 1 10 ? -0.209  4.987   -3.085  1.00 15.00 ?  288 VAL A HG23 3  
ATOM   1660  N N    . ARG A 1 11 ? 1.970   2.725   -1.394  1.00 15.00 ?  289 ARG A N    3  
ATOM   1661  C CA   . ARG A 1 11 ? 3.154   2.568   -2.196  1.00 15.00 ?  289 ARG A CA   3  
ATOM   1662  C C    . ARG A 1 11 ? 2.699   2.126   -3.594  1.00 15.00 ?  289 ARG A C    3  
ATOM   1663  O O    . ARG A 1 11 ? 2.438   0.958   -3.845  1.00 15.00 ?  289 ARG A O    3  
ATOM   1664  C CB   . ARG A 1 11 ? 4.135   1.581   -1.499  1.00 15.00 ?  289 ARG A CB   3  
ATOM   1665  C CG   . ARG A 1 11 ? 5.614   2.001   -1.466  1.00 15.00 ?  289 ARG A CG   3  
ATOM   1666  C CD   . ARG A 1 11 ? 6.192   2.287   -2.843  1.00 15.00 ?  289 ARG A CD   3  
ATOM   1667  N NE   . ARG A 1 11 ? 5.754   3.588   -3.330  1.00 15.00 ?  289 ARG A NE   3  
ATOM   1668  C CZ   . ARG A 1 11 ? 5.369   3.820   -4.569  1.00 15.00 ?  289 ARG A CZ   3  
ATOM   1669  N NH1  . ARG A 1 11 ? 5.754   3.009   -5.538  1.00 15.00 1  289 ARG A NH1  3  
ATOM   1670  N NH2  . ARG A 1 11 ? 4.664   4.909   -4.853  1.00 15.00 ?  289 ARG A NH2  3  
ATOM   1671  H H    . ARG A 1 11 ? 1.566   1.935   -0.967  1.00 15.00 ?  289 ARG A H    3  
ATOM   1672  H HA   . ARG A 1 11 ? 3.625   3.538   -2.279  1.00 15.00 ?  289 ARG A HA   3  
ATOM   1673  H HB2  . ARG A 1 11 ? 3.815   1.474   -0.474  1.00 15.00 ?  289 ARG A HB2  3  
ATOM   1674  H HB3  . ARG A 1 11 ? 4.074   0.621   -1.964  1.00 15.00 ?  289 ARG A HB3  3  
ATOM   1675  H HG2  . ARG A 1 11 ? 5.707   2.897   -0.871  1.00 15.00 ?  289 ARG A HG2  3  
ATOM   1676  H HG3  . ARG A 1 11 ? 6.186   1.208   -1.006  1.00 15.00 ?  289 ARG A HG3  3  
ATOM   1677  H HD2  . ARG A 1 11 ? 7.270   2.276   -2.780  1.00 15.00 ?  289 ARG A HD2  3  
ATOM   1678  H HD3  . ARG A 1 11 ? 5.859   1.523   -3.530  1.00 15.00 ?  289 ARG A HD3  3  
ATOM   1679  H HE   . ARG A 1 11 ? 5.658   4.294   -2.670  1.00 15.00 ?  289 ARG A HE   3  
ATOM   1680  H HH11 . ARG A 1 11 ? 6.341   2.222   -5.335  1.00 15.00 ?  289 ARG A HH11 3  
ATOM   1681  H HH12 . ARG A 1 11 ? 5.464   3.184   -6.484  1.00 15.00 ?  289 ARG A HH12 3  
ATOM   1682  H HH21 . ARG A 1 11 ? 4.423   5.561   -4.133  1.00 15.00 ?  289 ARG A HH21 3  
ATOM   1683  H HH22 . ARG A 1 11 ? 4.374   5.091   -5.802  1.00 15.00 ?  289 ARG A HH22 3  
ATOM   1684  N N    . SER A 1 12 ? 2.475   3.116   -4.458  1.00 15.00 ?  290 SER A N    3  
ATOM   1685  C CA   . SER A 1 12 ? 1.954   2.893   -5.803  1.00 15.00 ?  290 SER A CA   3  
ATOM   1686  C C    . SER A 1 12 ? 3.075   2.833   -6.836  1.00 15.00 ?  290 SER A C    3  
ATOM   1687  O O    . SER A 1 12 ? 3.692   3.848   -7.164  1.00 15.00 ?  290 SER A O    3  
ATOM   1688  C CB   . SER A 1 12 ? 0.977   4.018   -6.135  1.00 15.00 ?  290 SER A CB   3  
ATOM   1689  O OG   . SER A 1 12 ? 1.390   5.223   -5.503  1.00 15.00 ?  290 SER A OG   3  
ATOM   1690  H H    . SER A 1 12 ? 2.657   4.044   -4.179  1.00 15.00 ?  290 SER A H    3  
ATOM   1691  H HA   . SER A 1 12 ? 1.427   1.957   -5.807  1.00 15.00 ?  290 SER A HA   3  
ATOM   1692  H HB2  . SER A 1 12 ? 0.952   4.171   -7.204  1.00 15.00 ?  290 SER A HB2  3  
ATOM   1693  H HB3  . SER A 1 12 ? -0.008  3.756   -5.781  1.00 15.00 ?  290 SER A HB3  3  
ATOM   1694  H HG   . SER A 1 12 ? 1.504   5.922   -6.170  1.00 15.00 ?  290 SER A HG   3  
ATOM   1695  N N    . THR A 1 13 ? 3.362   1.642   -7.329  1.00 15.00 ?  291 THR A N    3  
ATOM   1696  C CA   . THR A 1 13 ? 4.504   1.444   -8.205  1.00 15.00 ?  291 THR A CA   3  
ATOM   1697  C C    . THR A 1 13 ? 4.121   1.572   -9.682  1.00 15.00 ?  291 THR A C    3  
ATOM   1698  O O    . THR A 1 13 ? 2.984   1.277   -10.067 1.00 15.00 ?  291 THR A O    3  
ATOM   1699  C CB   . THR A 1 13 ? 5.174   0.085   -7.930  1.00 15.00 ?  291 THR A CB   3  
ATOM   1700  O OG1  . THR A 1 13 ? 4.185   -0.951  -7.912  1.00 15.00 ?  291 THR A OG1  3  
ATOM   1701  C CG2  . THR A 1 13 ? 5.913   0.111   -6.595  1.00 15.00 ?  291 THR A CG2  3  
ATOM   1702  H H    . THR A 1 13 ? 2.784   0.878   -7.113  1.00 15.00 ?  291 THR A H    3  
ATOM   1703  H HA   . THR A 1 13 ? 5.223   2.217   -7.975  1.00 15.00 ?  291 THR A HA   3  
ATOM   1704  H HB   . THR A 1 13 ? 5.886   -0.115  -8.717  1.00 15.00 ?  291 THR A HB   3  
ATOM   1705  H HG1  . THR A 1 13 ? 3.845   -1.049  -7.019  1.00 15.00 ?  291 THR A HG1  3  
ATOM   1706  H HG21 . THR A 1 13 ? 6.513   -0.781  -6.497  1.00 15.00 ?  291 THR A HG21 3  
ATOM   1707  H HG22 . THR A 1 13 ? 5.193   0.149   -5.792  1.00 15.00 ?  291 THR A HG22 3  
ATOM   1708  H HG23 . THR A 1 13 ? 6.551   0.989   -6.542  1.00 15.00 ?  291 THR A HG23 3  
ATOM   1709  N N    . VAL A 1 14 ? 5.080   2.019   -10.498 1.00 15.00 ?  292 VAL A N    3  
ATOM   1710  C CA   . VAL A 1 14 ? 4.843   2.307   -11.915 1.00 15.00 ?  292 VAL A CA   3  
ATOM   1711  C C    . VAL A 1 14 ? 4.428   1.050   -12.687 1.00 15.00 ?  292 VAL A C    3  
ATOM   1712  O O    . VAL A 1 14 ? 3.908   1.134   -13.800 1.00 15.00 ?  292 VAL A O    3  
ATOM   1713  C CB   . VAL A 1 14 ? 6.095   2.944   -12.572 1.00 15.00 ?  292 VAL A CB   3  
ATOM   1714  C CG1  . VAL A 1 14 ? 7.235   1.940   -12.671 1.00 15.00 ?  292 VAL A CG1  3  
ATOM   1715  C CG2  . VAL A 1 14 ? 5.761   3.531   -13.939 1.00 15.00 ?  292 VAL A CG2  3  
ATOM   1716  H H    . VAL A 1 14 ? 5.982   2.148   -10.137 1.00 15.00 ?  292 VAL A H    3  
ATOM   1717  H HA   . VAL A 1 14 ? 4.037   3.026   -11.970 1.00 15.00 ?  292 VAL A HA   3  
ATOM   1718  H HB   . VAL A 1 14 ? 6.425   3.753   -11.937 1.00 15.00 ?  292 VAL A HB   3  
ATOM   1719  H HG11 . VAL A 1 14 ? 8.093   2.412   -13.126 1.00 15.00 ?  292 VAL A HG11 3  
ATOM   1720  H HG12 . VAL A 1 14 ? 6.923   1.101   -13.276 1.00 15.00 ?  292 VAL A HG12 3  
ATOM   1721  H HG13 . VAL A 1 14 ? 7.497   1.594   -11.682 1.00 15.00 ?  292 VAL A HG13 3  
ATOM   1722  H HG21 . VAL A 1 14 ? 5.005   4.294   -13.829 1.00 15.00 ?  292 VAL A HG21 3  
ATOM   1723  H HG22 . VAL A 1 14 ? 5.392   2.749   -14.587 1.00 15.00 ?  292 VAL A HG22 3  
ATOM   1724  H HG23 . VAL A 1 14 ? 6.651   3.967   -14.371 1.00 15.00 ?  292 VAL A HG23 3  
ATOM   1725  N N    . SER A 1 15 ? 4.645   -0.112  -12.077 1.00 15.00 ?  293 SER A N    3  
ATOM   1726  C CA   . SER A 1 15 ? 4.187   -1.380  -12.634 1.00 15.00 ?  293 SER A CA   3  
ATOM   1727  C C    . SER A 1 15 ? 2.664   -1.387  -12.820 1.00 15.00 ?  293 SER A C    3  
ATOM   1728  O O    . SER A 1 15 ? 2.116   -2.252  -13.501 1.00 15.00 ?  293 SER A O    3  
ATOM   1729  C CB   . SER A 1 15 ? 4.616   -2.534  -11.724 1.00 15.00 ?  293 SER A CB   3  
ATOM   1730  O OG   . SER A 1 15 ? 6.022   -2.519  -11.526 1.00 15.00 ?  293 SER A OG   3  
ATOM   1731  H H    . SER A 1 15 ? 5.143   -0.119  -11.232 1.00 15.00 ?  293 SER A H    3  
ATOM   1732  H HA   . SER A 1 15 ? 4.653   -1.504  -13.600 1.00 15.00 ?  293 SER A HA   3  
ATOM   1733  H HB2  . SER A 1 15 ? 4.127   -2.438  -10.765 1.00 15.00 ?  293 SER A HB2  3  
ATOM   1734  H HB3  . SER A 1 15 ? 4.338   -3.473  -12.178 1.00 15.00 ?  293 SER A HB3  3  
ATOM   1735  H HG   . SER A 1 15 ? 6.439   -3.087  -12.185 1.00 15.00 ?  293 SER A HG   3  
ATOM   1736  N N    . GLY A 1 16 ? 1.991   -0.426  -12.197 1.00 15.00 ?  294 GLY A N    3  
ATOM   1737  C CA   . GLY A 1 16 ? 0.551   -0.337  -12.301 1.00 15.00 ?  294 GLY A CA   3  
ATOM   1738  C C    . GLY A 1 16 ? -0.139  -1.123  -11.214 1.00 15.00 ?  294 GLY A C    3  
ATOM   1739  O O    . GLY A 1 16 ? -1.097  -1.855  -11.467 1.00 15.00 ?  294 GLY A O    3  
ATOM   1740  H H    . GLY A 1 16 ? 2.483   0.233   -11.659 1.00 15.00 ?  294 GLY A H    3  
ATOM   1741  H HA2  . GLY A 1 16 ? 0.257   0.699   -12.225 1.00 15.00 ?  294 GLY A HA2  3  
ATOM   1742  H HA3  . GLY A 1 16 ? 0.242   -0.720  -13.262 1.00 15.00 ?  294 GLY A HA3  3  
ATOM   1743  N N    . ARG A 1 17 ? 0.358   -0.977  -9.998  1.00 15.00 ?  295 ARG A N    3  
ATOM   1744  C CA   . ARG A 1 17 ? -0.212  -1.663  -8.855  1.00 15.00 ?  295 ARG A CA   3  
ATOM   1745  C C    . ARG A 1 17 ? -0.019  -0.847  -7.586  1.00 15.00 ?  295 ARG A C    3  
ATOM   1746  O O    . ARG A 1 17 ? 1.099   -0.436  -7.254  1.00 15.00 ?  295 ARG A O    3  
ATOM   1747  C CB   . ARG A 1 17 ? 0.416   -3.055  -8.690  1.00 15.00 ?  295 ARG A CB   3  
ATOM   1748  C CG   . ARG A 1 17 ? 1.929   -3.035  -8.539  1.00 15.00 ?  295 ARG A CG   3  
ATOM   1749  C CD   . ARG A 1 17 ? 2.480   -4.429  -8.319  1.00 15.00 ?  295 ARG A CD   3  
ATOM   1750  N NE   . ARG A 1 17 ? 3.936   -4.440  -8.221  1.00 15.00 ?  295 ARG A NE   3  
ATOM   1751  C CZ   . ARG A 1 17 ? 4.710   -5.341  -8.821  1.00 15.00 ?  295 ARG A CZ   3  
ATOM   1752  N NH1  . ARG A 1 17 ? 4.173   -6.258  -9.620  1.00 15.00 1  295 ARG A NH1  3  
ATOM   1753  N NH2  . ARG A 1 17 ? 6.023   -5.310  -8.634  1.00 15.00 ?  295 ARG A NH2  3  
ATOM   1754  H H    . ARG A 1 17 ? 1.131   -0.387  -9.863  1.00 15.00 ?  295 ARG A H    3  
ATOM   1755  H HA   . ARG A 1 17 ? -1.271  -1.777  -9.035  1.00 15.00 ?  295 ARG A HA   3  
ATOM   1756  H HB2  . ARG A 1 17 ? -0.005  -3.525  -7.812  1.00 15.00 ?  295 ARG A HB2  3  
ATOM   1757  H HB3  . ARG A 1 17 ? 0.172   -3.652  -9.556  1.00 15.00 ?  295 ARG A HB3  3  
ATOM   1758  H HG2  . ARG A 1 17 ? 2.365   -2.624  -9.437  1.00 15.00 ?  295 ARG A HG2  3  
ATOM   1759  H HG3  . ARG A 1 17 ? 2.190   -2.416  -7.693  1.00 15.00 ?  295 ARG A HG3  3  
ATOM   1760  H HD2  . ARG A 1 17 ? 2.065   -4.825  -7.404  1.00 15.00 ?  295 ARG A HD2  3  
ATOM   1761  H HD3  . ARG A 1 17 ? 2.180   -5.053  -9.148  1.00 15.00 ?  295 ARG A HD3  3  
ATOM   1762  H HE   . ARG A 1 17 ? 4.357   -3.750  -7.664  1.00 15.00 ?  295 ARG A HE   3  
ATOM   1763  H HH11 . ARG A 1 17 ? 3.173   -6.280  -9.773  1.00 15.00 ?  295 ARG A HH11 3  
ATOM   1764  H HH12 . ARG A 1 17 ? 4.762   -6.930  -10.091 1.00 15.00 ?  295 ARG A HH12 3  
ATOM   1765  H HH21 . ARG A 1 17 ? 6.434   -4.604  -8.041  1.00 15.00 ?  295 ARG A HH21 3  
ATOM   1766  H HH22 . ARG A 1 17 ? 6.618   -5.996  -9.074  1.00 15.00 ?  295 ARG A HH22 3  
ATOM   1767  N N    . ILE A 1 18 ? -1.112  -0.591  -6.895  1.00 15.00 ?  296 ILE A N    3  
ATOM   1768  C CA   . ILE A 1 18 ? -1.052  -0.001  -5.573  1.00 15.00 ?  296 ILE A CA   3  
ATOM   1769  C C    . ILE A 1 18 ? -0.966  -1.143  -4.568  1.00 15.00 ?  296 ILE A C    3  
ATOM   1770  O O    . ILE A 1 18 ? -1.615  -2.175  -4.741  1.00 15.00 ?  296 ILE A O    3  
ATOM   1771  C CB   . ILE A 1 18 ? -2.273  0.933   -5.311  1.00 15.00 ?  296 ILE A CB   3  
ATOM   1772  C CG1  . ILE A 1 18 ? -2.057  1.843   -4.080  1.00 15.00 ?  296 ILE A CG1  3  
ATOM   1773  C CG2  . ILE A 1 18 ? -3.561  0.128   -5.168  1.00 15.00 ?  296 ILE A CG2  3  
ATOM   1774  C CD1  . ILE A 1 18 ? -2.323  1.180   -2.742  1.00 15.00 ?  296 ILE A CD1  3  
ATOM   1775  H H    . ILE A 1 18 ? -1.986  -0.817  -7.276  1.00 15.00 ?  296 ILE A H    3  
ATOM   1776  H HA   . ILE A 1 18 ? -0.146  0.584   -5.512  1.00 15.00 ?  296 ILE A HA   3  
ATOM   1777  H HB   . ILE A 1 18 ? -2.387  1.561   -6.181  1.00 15.00 ?  296 ILE A HB   3  
ATOM   1778  H HG12 . ILE A 1 18 ? -1.035  2.198   -4.071  1.00 15.00 ?  296 ILE A HG12 3  
ATOM   1779  H HG13 . ILE A 1 18 ? -2.718  2.692   -4.160  1.00 15.00 ?  296 ILE A HG13 3  
ATOM   1780  H HG21 . ILE A 1 18 ? -3.742  -0.425  -6.077  1.00 15.00 ?  296 ILE A HG21 3  
ATOM   1781  H HG22 . ILE A 1 18 ? -4.387  0.800   -4.986  1.00 15.00 ?  296 ILE A HG22 3  
ATOM   1782  H HG23 . ILE A 1 18 ? -3.468  -0.559  -4.339  1.00 15.00 ?  296 ILE A HG23 3  
ATOM   1783  H HD11 . ILE A 1 18 ? -3.376  0.951   -2.660  1.00 15.00 ?  296 ILE A HD11 3  
ATOM   1784  H HD12 . ILE A 1 18 ? -2.037  1.850   -1.945  1.00 15.00 ?  296 ILE A HD12 3  
ATOM   1785  H HD13 . ILE A 1 18 ? -1.753  0.269   -2.671  1.00 15.00 ?  296 ILE A HD13 3  
ATOM   1786  N N    . TYR A 1 19 ? -0.147  -0.986  -3.549  1.00 15.00 ?  297 TYR A N    3  
ATOM   1787  C CA   . TYR A 1 19 ? 0.113   -2.077  -2.631  1.00 15.00 ?  297 TYR A CA   3  
ATOM   1788  C C    . TYR A 1 19 ? 0.412   -1.467  -1.296  1.00 15.00 ?  297 TYR A C    3  
ATOM   1789  O O    . TYR A 1 19 ? 1.220   -0.536  -1.188  1.00 15.00 ?  297 TYR A O    3  
ATOM   1790  C CB   . TYR A 1 19 ? 1.234   -3.024  -3.129  1.00 15.00 ?  297 TYR A CB   3  
ATOM   1791  C CG   . TYR A 1 19 ? 2.666   -2.657  -2.770  1.00 15.00 ?  297 TYR A CG   3  
ATOM   1792  C CD1  . TYR A 1 19 ? 3.345   -1.660  -3.452  1.00 15.00 ?  297 TYR A CD1  3  
ATOM   1793  C CD2  . TYR A 1 19 ? 3.350   -3.334  -1.758  1.00 15.00 ?  297 TYR A CD2  3  
ATOM   1794  C CE1  . TYR A 1 19 ? 4.652   -1.340  -3.138  1.00 15.00 ?  297 TYR A CE1  3  
ATOM   1795  C CE2  . TYR A 1 19 ? 4.655   -3.017  -1.441  1.00 15.00 ?  297 TYR A CE2  3  
ATOM   1796  C CZ   . TYR A 1 19 ? 5.302   -2.020  -2.132  1.00 15.00 ?  297 TYR A CZ   3  
ATOM   1797  O OH   . TYR A 1 19 ? 6.600   -1.693  -1.814  1.00 15.00 ?  297 TYR A OH   3  
ATOM   1798  H H    . TYR A 1 19 ? 0.213   -0.085  -3.343  1.00 15.00 ?  297 TYR A H    3  
ATOM   1799  H HA   . TYR A 1 19 ? -0.807  -2.642  -2.542  1.00 15.00 ?  297 TYR A HA   3  
ATOM   1800  H HB2  . TYR A 1 19 ? 1.050   -4.009  -2.728  1.00 15.00 ?  297 TYR A HB2  3  
ATOM   1801  H HB3  . TYR A 1 19 ? 1.175   -3.078  -4.208  1.00 15.00 ?  297 TYR A HB3  3  
ATOM   1802  H HD1  . TYR A 1 19 ? 2.836   -1.122  -4.238  1.00 15.00 ?  297 TYR A HD1  3  
ATOM   1803  H HD2  . TYR A 1 19 ? 2.848   -4.122  -1.218  1.00 15.00 ?  297 TYR A HD2  3  
ATOM   1804  H HE1  . TYR A 1 19 ? 5.160   -0.559  -3.682  1.00 15.00 ?  297 TYR A HE1  3  
ATOM   1805  H HE2  . TYR A 1 19 ? 5.164   -3.558  -0.655  1.00 15.00 ?  297 TYR A HE2  3  
ATOM   1806  H HH   . TYR A 1 19 ? 7.073   -2.483  -1.536  1.00 15.00 ?  297 TYR A HH   3  
ATOM   1807  N N    . PHE A 1 20 ? -0.257  -1.951  -0.284  1.00 15.00 ?  298 PHE A N    3  
ATOM   1808  C CA   . PHE A 1 20 ? -0.312  -1.215  0.926   1.00 15.00 ?  298 PHE A CA   3  
ATOM   1809  C C    . PHE A 1 20 ? 0.779   -1.514  1.891   1.00 15.00 ?  298 PHE A C    3  
ATOM   1810  O O    . PHE A 1 20 ? 1.078   -2.660  2.205   1.00 15.00 ?  298 PHE A O    3  
ATOM   1811  C CB   . PHE A 1 20 ? -1.649  -1.365  1.571   1.00 15.00 ?  298 PHE A CB   3  
ATOM   1812  C CG   . PHE A 1 20 ? -2.403  -0.150  1.283   1.00 15.00 ?  298 PHE A CG   3  
ATOM   1813  C CD1  . PHE A 1 20 ? -1.962  1.044   1.812   1.00 15.00 ?  298 PHE A CD1  3  
ATOM   1814  C CD2  . PHE A 1 20 ? -3.500  -0.170  0.454   1.00 15.00 ?  298 PHE A CD2  3  
ATOM   1815  C CE1  . PHE A 1 20 ? -2.608  2.202   1.532   1.00 15.00 ?  298 PHE A CE1  3  
ATOM   1816  C CE2  . PHE A 1 20 ? -4.159  0.995   0.175   1.00 15.00 ?  298 PHE A CE2  3  
ATOM   1817  C CZ   . PHE A 1 20 ? -3.705  2.173   0.718   1.00 15.00 ?  298 PHE A CZ   3  
ATOM   1818  H H    . PHE A 1 20 ? -0.768  -2.785  -0.370  1.00 15.00 ?  298 PHE A H    3  
ATOM   1819  H HA   . PHE A 1 20 ? -0.218  -0.180  0.637   1.00 15.00 ?  298 PHE A HA   3  
ATOM   1820  H HB2  . PHE A 1 20 ? -2.171  -2.217  1.158   1.00 15.00 ?  298 PHE A HB2  3  
ATOM   1821  H HB3  . PHE A 1 20 ? -1.545  -1.464  2.641   1.00 15.00 ?  298 PHE A HB3  3  
ATOM   1822  H HD1  . PHE A 1 20 ? -1.106  1.053   2.463   1.00 15.00 ?  298 PHE A HD1  3  
ATOM   1823  H HD2  . PHE A 1 20 ? -3.842  -1.106  0.036   1.00 15.00 ?  298 PHE A HD2  3  
ATOM   1824  H HE1  . PHE A 1 20 ? -2.259  3.135   1.946   1.00 15.00 ?  298 PHE A HE1  3  
ATOM   1825  H HE2  . PHE A 1 20 ? -5.024  0.994   -0.466  1.00 15.00 ?  298 PHE A HE2  3  
ATOM   1826  H HZ   . PHE A 1 20 ? -4.214  3.056   0.530   1.00 15.00 ?  298 PHE A HZ   3  
ATOM   1827  N N    . VAL A 1 21 ? 1.330   -0.428  2.384   1.00 15.00 ?  299 VAL A N    3  
ATOM   1828  C CA   . VAL A 1 21 ? 2.402   -0.457  3.316   1.00 15.00 ?  299 VAL A CA   3  
ATOM   1829  C C    . VAL A 1 21 ? 2.040   0.458   4.494   1.00 15.00 ?  299 VAL A C    3  
ATOM   1830  O O    . VAL A 1 21 ? 2.279   1.672   4.492   1.00 15.00 ?  299 VAL A O    3  
ATOM   1831  C CB   . VAL A 1 21 ? 3.714   -0.024  2.610   1.00 15.00 ?  299 VAL A CB   3  
ATOM   1832  C CG1  . VAL A 1 21 ? 4.075   -1.004  1.494   1.00 15.00 ?  299 VAL A CG1  3  
ATOM   1833  C CG2  . VAL A 1 21 ? 3.577   1.368   2.018   1.00 15.00 ?  299 VAL A CG2  3  
ATOM   1834  H H    . VAL A 1 21 ? 0.980   0.445   2.111   1.00 15.00 ?  299 VAL A H    3  
ATOM   1835  H HA   . VAL A 1 21 ? 2.516   -1.470  3.672   1.00 15.00 ?  299 VAL A HA   3  
ATOM   1836  H HB   . VAL A 1 21 ? 4.515   -0.014  3.335   1.00 15.00 ?  299 VAL A HB   3  
ATOM   1837  H HG11 . VAL A 1 21 ? 4.062   -2.014  1.874   1.00 15.00 ?  299 VAL A HG11 3  
ATOM   1838  H HG12 . VAL A 1 21 ? 5.061   -0.775  1.118   1.00 15.00 ?  299 VAL A HG12 3  
ATOM   1839  H HG13 . VAL A 1 21 ? 3.356   -0.913  0.693   1.00 15.00 ?  299 VAL A HG13 3  
ATOM   1840  H HG21 . VAL A 1 21 ? 4.502   1.648   1.539   1.00 15.00 ?  299 VAL A HG21 3  
ATOM   1841  H HG22 . VAL A 1 21 ? 3.351   2.071   2.806   1.00 15.00 ?  299 VAL A HG22 3  
ATOM   1842  H HG23 . VAL A 1 21 ? 2.779   1.373   1.291   1.00 15.00 ?  299 VAL A HG23 3  
ATOM   1843  N N    . ASP A 1 22 ? 1.396   -0.120  5.484   1.00 15.00 ?  300 ASP A N    3  
ATOM   1844  C CA   . ASP A 1 22 ? 1.008   0.638   6.657   1.00 15.00 ?  300 ASP A CA   3  
ATOM   1845  C C    . ASP A 1 22 ? 2.132   0.560   7.667   1.00 15.00 ?  300 ASP A C    3  
ATOM   1846  O O    . ASP A 1 22 ? 2.540   -0.526  8.082   1.00 15.00 ?  300 ASP A O    3  
ATOM   1847  C CB   . ASP A 1 22 ? -0.329  0.129   7.222   1.00 15.00 ?  300 ASP A CB   3  
ATOM   1848  C CG   . ASP A 1 22 ? -0.287  -0.197  8.703   1.00 15.00 ?  300 ASP A CG   3  
ATOM   1849  O OD1  . ASP A 1 22 ? -0.323  0.736   9.537   1.00 15.00 -1 300 ASP A OD1  3  
ATOM   1850  O OD2  . ASP A 1 22 ? -0.221  -1.394  9.040   1.00 15.00 ?  300 ASP A OD2  3  
ATOM   1851  H H    . ASP A 1 22 ? 1.176   -1.078  5.430   1.00 15.00 ?  300 ASP A H    3  
ATOM   1852  H HA   . ASP A 1 22 ? 0.892   1.668   6.354   1.00 15.00 ?  300 ASP A HA   3  
ATOM   1853  H HB2  . ASP A 1 22 ? -1.080  0.887   7.069   1.00 15.00 ?  300 ASP A HB2  3  
ATOM   1854  H HB3  . ASP A 1 22 ? -0.620  -0.764  6.683   1.00 15.00 ?  300 ASP A HB3  3  
ATOM   1855  N N    . HIS A 1 23 ? 2.666   1.719   8.023   1.00 15.00 ?  301 HIS A N    3  
ATOM   1856  C CA   . HIS A 1 23 ? 3.855   1.766   8.855   1.00 15.00 ?  301 HIS A CA   3  
ATOM   1857  C C    . HIS A 1 23 ? 3.493   1.632   10.332  1.00 15.00 ?  301 HIS A C    3  
ATOM   1858  O O    . HIS A 1 23 ? 4.357   1.345   11.162  1.00 15.00 ?  301 HIS A O    3  
ATOM   1859  C CB   . HIS A 1 23 ? 4.651   3.064   8.662   1.00 15.00 ?  301 HIS A CB   3  
ATOM   1860  C CG   . HIS A 1 23 ? 4.981   3.462   7.250   1.00 15.00 ?  301 HIS A CG   3  
ATOM   1861  N ND1  . HIS A 1 23 ? 5.064   4.777   6.863   1.00 15.00 ?  301 HIS A ND1  3  
ATOM   1862  C CD2  . HIS A 1 23 ? 5.370   2.739   6.175   1.00 15.00 ?  301 HIS A CD2  3  
ATOM   1863  C CE1  . HIS A 1 23 ? 5.499   4.844   5.622   1.00 15.00 ?  301 HIS A CE1  3  
ATOM   1864  N NE2  . HIS A 1 23 ? 5.703   3.617   5.175   1.00 15.00 ?  301 HIS A NE2  3  
ATOM   1865  H H    . HIS A 1 23 ? 2.244   2.556   7.727   1.00 15.00 ?  301 HIS A H    3  
ATOM   1866  H HA   . HIS A 1 23 ? 4.479   0.930   8.577   1.00 15.00 ?  301 HIS A HA   3  
ATOM   1867  H HB2  . HIS A 1 23 ? 4.106   3.874   9.101   1.00 15.00 ?  301 HIS A HB2  3  
ATOM   1868  H HB3  . HIS A 1 23 ? 5.590   2.955   9.185   1.00 15.00 ?  301 HIS A HB3  3  
ATOM   1869  H HD1  . HIS A 1 23 ? 4.818   5.556   7.418   1.00 15.00 ?  301 HIS A HD1  3  
ATOM   1870  H HD2  . HIS A 1 23 ? 5.369   1.664   6.095   1.00 15.00 ?  301 HIS A HD2  3  
ATOM   1871  H HE1  . HIS A 1 23 ? 5.651   5.752   5.052   1.00 15.00 ?  301 HIS A HE1  3  
ATOM   1872  H HE2  . HIS A 1 23 ? 6.343   3.404   4.454   1.00 15.00 ?  301 HIS A HE2  3  
ATOM   1873  N N    . ASN A 1 24 ? 2.223   1.846   10.663  1.00 15.00 ?  302 ASN A N    3  
ATOM   1874  C CA   . ASN A 1 24 ? 1.801   1.841   12.061  1.00 15.00 ?  302 ASN A CA   3  
ATOM   1875  C C    . ASN A 1 24 ? 1.579   0.418   12.550  1.00 15.00 ?  302 ASN A C    3  
ATOM   1876  O O    . ASN A 1 24 ? 2.236   -0.037  13.484  1.00 15.00 ?  302 ASN A O    3  
ATOM   1877  C CB   . ASN A 1 24 ? 0.518   2.657   12.272  1.00 15.00 ?  302 ASN A CB   3  
ATOM   1878  C CG   . ASN A 1 24 ? 0.704   4.144   12.034  1.00 15.00 ?  302 ASN A CG   3  
ATOM   1879  O OD1  . ASN A 1 24 ? 1.816   4.669   12.093  1.00 15.00 ?  302 ASN A OD1  3  
ATOM   1880  N ND2  . ASN A 1 24 ? -0.397  4.841   11.806  1.00 15.00 ?  302 ASN A ND2  3  
ATOM   1881  H H    . ASN A 1 24 ? 1.555   1.990   9.957   1.00 15.00 ?  302 ASN A H    3  
ATOM   1882  H HA   . ASN A 1 24 ? 2.594   2.284   12.643  1.00 15.00 ?  302 ASN A HA   3  
ATOM   1883  H HB2  . ASN A 1 24 ? -0.241  2.300   11.591  1.00 15.00 ?  302 ASN A HB2  3  
ATOM   1884  H HB3  . ASN A 1 24 ? 0.175   2.515   13.287  1.00 15.00 ?  302 ASN A HB3  3  
ATOM   1885  H HD21 . ASN A 1 24 ? -1.257  4.364   11.808  1.00 15.00 ?  302 ASN A HD21 3  
ATOM   1886  H HD22 . ASN A 1 24 ? -0.312  5.803   11.647  1.00 15.00 ?  302 ASN A HD22 3  
ATOM   1887  N N    . ASN A 1 25 ? 0.662   -0.283  11.904  1.00 15.00 ?  303 ASN A N    3  
ATOM   1888  C CA   . ASN A 1 25 ? 0.315   -1.643  12.305  1.00 15.00 ?  303 ASN A CA   3  
ATOM   1889  C C    . ASN A 1 25 ? 1.260   -2.639  11.653  1.00 15.00 ?  303 ASN A C    3  
ATOM   1890  O O    . ASN A 1 25 ? 1.309   -3.809  12.035  1.00 15.00 ?  303 ASN A O    3  
ATOM   1891  C CB   . ASN A 1 25 ? -1.132  -1.975  11.924  1.00 15.00 ?  303 ASN A CB   3  
ATOM   1892  C CG   . ASN A 1 25 ? -2.138  -1.023  12.539  1.00 15.00 ?  303 ASN A CG   3  
ATOM   1893  O OD1  . ASN A 1 25 ? -2.639  -1.259  13.636  1.00 15.00 ?  303 ASN A OD1  3  
ATOM   1894  N ND2  . ASN A 1 25 ? -2.442  0.058   11.836  1.00 15.00 ?  303 ASN A ND2  3  
ATOM   1895  H H    . ASN A 1 25 ? 0.209   0.118   11.121  1.00 15.00 ?  303 ASN A H    3  
ATOM   1896  H HA   . ASN A 1 25 ? 0.422   -1.708  13.378  1.00 15.00 ?  303 ASN A HA   3  
ATOM   1897  H HB2  . ASN A 1 25 ? -1.235  -1.926  10.849  1.00 15.00 ?  303 ASN A HB2  3  
ATOM   1898  H HB3  . ASN A 1 25 ? -1.362  -2.975  12.257  1.00 15.00 ?  303 ASN A HB3  3  
ATOM   1899  H HD21 . ASN A 1 25 ? -2.001  0.185   10.964  1.00 15.00 ?  303 ASN A HD21 3  
ATOM   1900  H HD22 . ASN A 1 25 ? -3.098  0.687   12.212  1.00 15.00 ?  303 ASN A HD22 3  
ATOM   1901  N N    . ARG A 1 26 ? 1.981   -2.158  10.647  1.00 15.00 ?  304 ARG A N    3  
ATOM   1902  C CA   . ARG A 1 26 ? 2.892   -2.973  9.857   1.00 15.00 ?  304 ARG A CA   3  
ATOM   1903  C C    . ARG A 1 26 ? 2.130   -4.089  9.151   1.00 15.00 ?  304 ARG A C    3  
ATOM   1904  O O    . ARG A 1 26 ? 2.136   -5.247  9.580   1.00 15.00 ?  304 ARG A O    3  
ATOM   1905  C CB   . ARG A 1 26 ? 4.047   -3.523  10.707  1.00 15.00 ?  304 ARG A CB   3  
ATOM   1906  C CG   . ARG A 1 26 ? 5.073   -4.304  9.901   1.00 15.00 ?  304 ARG A CG   3  
ATOM   1907  C CD   . ARG A 1 26 ? 6.411   -4.398  10.623  1.00 15.00 ?  304 ARG A CD   3  
ATOM   1908  N NE   . ARG A 1 26 ? 6.974   -3.085  10.947  1.00 15.00 ?  304 ARG A NE   3  
ATOM   1909  C CZ   . ARG A 1 26 ? 7.760   -2.844  11.996  1.00 15.00 ?  304 ARG A CZ   3  
ATOM   1910  N NH1  . ARG A 1 26 ? 8.074   -3.818  12.841  1.00 15.00 1  304 ARG A NH1  3  
ATOM   1911  N NH2  . ARG A 1 26 ? 8.240   -1.624  12.196  1.00 15.00 ?  304 ARG A NH2  3  
ATOM   1912  H H    . ARG A 1 26 ? 1.877   -1.214  10.411  1.00 15.00 ?  304 ARG A H    3  
ATOM   1913  H HA   . ARG A 1 26 ? 3.309   -2.327  9.095   1.00 15.00 ?  304 ARG A HA   3  
ATOM   1914  H HB2  . ARG A 1 26 ? 4.552   -2.698  11.187  1.00 15.00 ?  304 ARG A HB2  3  
ATOM   1915  H HB3  . ARG A 1 26 ? 3.642   -4.177  11.465  1.00 15.00 ?  304 ARG A HB3  3  
ATOM   1916  H HG2  . ARG A 1 26 ? 4.695   -5.303  9.735   1.00 15.00 ?  304 ARG A HG2  3  
ATOM   1917  H HG3  . ARG A 1 26 ? 5.220   -3.813  8.952   1.00 15.00 ?  304 ARG A HG3  3  
ATOM   1918  H HD2  . ARG A 1 26 ? 6.272   -4.939  11.527  1.00 15.00 ?  304 ARG A HD2  3  
ATOM   1919  H HD3  . ARG A 1 26 ? 7.108   -4.928  9.992   1.00 15.00 ?  304 ARG A HD3  3  
ATOM   1920  H HE   . ARG A 1 26 ? 6.761   -2.340  10.340  1.00 15.00 ?  304 ARG A HE   3  
ATOM   1921  H HH11 . ARG A 1 26 ? 7.720   -4.754  12.698  1.00 15.00 ?  304 ARG A HH11 3  
ATOM   1922  H HH12 . ARG A 1 26 ? 8.659   -3.625  13.637  1.00 15.00 ?  304 ARG A HH12 3  
ATOM   1923  H HH21 . ARG A 1 26 ? 8.014   -0.881  11.559  1.00 15.00 ?  304 ARG A HH21 3  
ATOM   1924  H HH22 . ARG A 1 26 ? 8.835   -1.439  12.982  1.00 15.00 ?  304 ARG A HH22 3  
ATOM   1925  N N    . THR A 1 27 ? 1.417   -3.707  8.101   1.00 15.00 ?  305 THR A N    3  
ATOM   1926  C CA   . THR A 1 27 ? 0.644   -4.647  7.301   1.00 15.00 ?  305 THR A CA   3  
ATOM   1927  C C    . THR A 1 27 ? 0.799   -4.339  5.817   1.00 15.00 ?  305 THR A C    3  
ATOM   1928  O O    . THR A 1 27 ? 1.012   -3.183  5.436   1.00 15.00 ?  305 THR A O    3  
ATOM   1929  C CB   . THR A 1 27 ? -0.858  -4.623  7.670   1.00 15.00 ?  305 THR A CB   3  
ATOM   1930  O OG1  . THR A 1 27 ? -1.363  -3.281  7.639   1.00 15.00 ?  305 THR A OG1  3  
ATOM   1931  C CG2  . THR A 1 27 ? -1.098  -5.225  9.045   1.00 15.00 ?  305 THR A CG2  3  
ATOM   1932  H H    . THR A 1 27 ? 1.401   -2.750  7.859   1.00 15.00 ?  305 THR A H    3  
ATOM   1933  H HA   . THR A 1 27 ? 1.026   -5.641  7.493   1.00 15.00 ?  305 THR A HA   3  
ATOM   1934  H HB   . THR A 1 27 ? -1.396  -5.214  6.940   1.00 15.00 ?  305 THR A HB   3  
ATOM   1935  H HG1  . THR A 1 27 ? -0.773  -2.699  8.153   1.00 15.00 ?  305 THR A HG1  3  
ATOM   1936  H HG21 . THR A 1 27 ? -2.152  -5.181  9.278   1.00 15.00 ?  305 THR A HG21 3  
ATOM   1937  H HG22 . THR A 1 27 ? -0.542  -4.666  9.783   1.00 15.00 ?  305 THR A HG22 3  
ATOM   1938  H HG23 . THR A 1 27 ? -0.771  -6.254  9.050   1.00 15.00 ?  305 THR A HG23 3  
ATOM   1939  N N    . THR A 1 28 ? 0.706   -5.372  4.989   1.00 15.00 ?  306 THR A N    3  
ATOM   1940  C CA   . THR A 1 28 ? 0.818   -5.211  3.551   1.00 15.00 ?  306 THR A CA   3  
ATOM   1941  C C    . THR A 1 28 ? -0.364  -5.876  2.843   1.00 15.00 ?  306 THR A C    3  
ATOM   1942  O O    . THR A 1 28 ? -0.533  -7.094  2.905   1.00 15.00 ?  306 THR A O    3  
ATOM   1943  C CB   . THR A 1 28 ? 2.137   -5.804  3.021   1.00 15.00 ?  306 THR A CB   3  
ATOM   1944  O OG1  . THR A 1 28 ? 3.244   -5.329  3.803   1.00 15.00 ?  306 THR A OG1  3  
ATOM   1945  C CG2  . THR A 1 28 ? 2.349   -5.412  1.568   1.00 15.00 ?  306 THR A CG2  3  
ATOM   1946  H H    . THR A 1 28 ? 0.553   -6.273  5.356   1.00 15.00 ?  306 THR A H    3  
ATOM   1947  H HA   . THR A 1 28 ? 0.807   -4.152  3.332   1.00 15.00 ?  306 THR A HA   3  
ATOM   1948  H HB   . THR A 1 28 ? 2.089   -6.881  3.087   1.00 15.00 ?  306 THR A HB   3  
ATOM   1949  H HG1  . THR A 1 28 ? 3.954   -5.063  3.211   1.00 15.00 ?  306 THR A HG1  3  
ATOM   1950  H HG21 . THR A 1 28 ? 3.275   -5.838  1.211   1.00 15.00 ?  306 THR A HG21 3  
ATOM   1951  H HG22 . THR A 1 28 ? 2.392   -4.338  1.488   1.00 15.00 ?  306 THR A HG22 3  
ATOM   1952  H HG23 . THR A 1 28 ? 1.527   -5.785  0.973   1.00 15.00 ?  306 THR A HG23 3  
ATOM   1953  N N    . GLN A 1 29 ? -1.184  -5.069  2.177   1.00 15.00 ?  307 GLN A N    3  
ATOM   1954  C CA   . GLN A 1 29 ? -2.411  -5.568  1.554   1.00 15.00 ?  307 GLN A CA   3  
ATOM   1955  C C    . GLN A 1 29 ? -2.552  -5.028  0.130   1.00 15.00 ?  307 GLN A C    3  
ATOM   1956  O O    . GLN A 1 29 ? -2.291  -3.858  -0.114  1.00 15.00 ?  307 GLN A O    3  
ATOM   1957  C CB   . GLN A 1 29 ? -3.627  -5.137  2.386   1.00 15.00 ?  307 GLN A CB   3  
ATOM   1958  C CG   . GLN A 1 29 ? -3.538  -5.518  3.861   1.00 15.00 ?  307 GLN A CG   3  
ATOM   1959  C CD   . GLN A 1 29 ? -3.621  -7.017  4.101   1.00 15.00 ?  307 GLN A CD   3  
ATOM   1960  O OE1  . GLN A 1 29 ? -3.002  -7.545  5.029   1.00 15.00 ?  307 GLN A OE1  3  
ATOM   1961  N NE2  . GLN A 1 29 ? -4.414  -7.708  3.294   1.00 15.00 ?  307 GLN A NE2  3  
ATOM   1962  H H    . GLN A 1 29 ? -0.956  -4.117  2.094   1.00 15.00 ?  307 GLN A H    3  
ATOM   1963  H HA   . GLN A 1 29 ? -2.364  -6.645  1.523   1.00 15.00 ?  307 GLN A HA   3  
ATOM   1964  H HB2  . GLN A 1 29 ? -3.729  -4.064  2.321   1.00 15.00 ?  307 GLN A HB2  3  
ATOM   1965  H HB3  . GLN A 1 29 ? -4.511  -5.599  1.970   1.00 15.00 ?  307 GLN A HB3  3  
ATOM   1966  H HG2  . GLN A 1 29 ? -2.599  -5.160  4.254   1.00 15.00 ?  307 GLN A HG2  3  
ATOM   1967  H HG3  . GLN A 1 29 ? -4.351  -5.040  4.389   1.00 15.00 ?  307 GLN A HG3  3  
ATOM   1968  H HE21 . GLN A 1 29 ? -4.899  -7.224  2.597   1.00 15.00 ?  307 GLN A HE21 3  
ATOM   1969  H HE22 . GLN A 1 29 ? -4.489  -8.679  3.438   1.00 15.00 ?  307 GLN A HE22 3  
ATOM   1970  N N    . PHE A 1 30 ? -2.977  -5.872  -0.805  1.00 15.00 ?  308 PHE A N    3  
ATOM   1971  C CA   . PHE A 1 30 ? -3.231  -5.422  -2.178  1.00 15.00 ?  308 PHE A CA   3  
ATOM   1972  C C    . PHE A 1 30 ? -4.597  -4.746  -2.304  1.00 15.00 ?  308 PHE A C    3  
ATOM   1973  O O    . PHE A 1 30 ? -4.888  -4.095  -3.304  1.00 15.00 ?  308 PHE A O    3  
ATOM   1974  C CB   . PHE A 1 30 ? -3.127  -6.578  -3.181  1.00 15.00 ?  308 PHE A CB   3  
ATOM   1975  C CG   . PHE A 1 30 ? -1.745  -6.772  -3.742  1.00 15.00 ?  308 PHE A CG   3  
ATOM   1976  C CD1  . PHE A 1 30 ? -1.015  -5.685  -4.198  1.00 15.00 ?  308 PHE A CD1  3  
ATOM   1977  C CD2  . PHE A 1 30 ? -1.178  -8.036  -3.832  1.00 15.00 ?  308 PHE A CD2  3  
ATOM   1978  C CE1  . PHE A 1 30 ? 0.250   -5.852  -4.729  1.00 15.00 ?  308 PHE A CE1  3  
ATOM   1979  C CE2  . PHE A 1 30 ? 0.084   -8.202  -4.357  1.00 15.00 ?  308 PHE A CE2  3  
ATOM   1980  C CZ   . PHE A 1 30 ? 0.799   -7.112  -4.806  1.00 15.00 ?  308 PHE A CZ   3  
ATOM   1981  H H    . PHE A 1 30 ? -3.113  -6.815  -0.576  1.00 15.00 ?  308 PHE A H    3  
ATOM   1982  H HA   . PHE A 1 30 ? -2.472  -4.690  -2.420  1.00 15.00 ?  308 PHE A HA   3  
ATOM   1983  H HB2  . PHE A 1 30 ? -3.417  -7.496  -2.694  1.00 15.00 ?  308 PHE A HB2  3  
ATOM   1984  H HB3  . PHE A 1 30 ? -3.796  -6.389  -4.008  1.00 15.00 ?  308 PHE A HB3  3  
ATOM   1985  H HD1  . PHE A 1 30 ? -1.443  -4.696  -4.132  1.00 15.00 ?  308 PHE A HD1  3  
ATOM   1986  H HD2  . PHE A 1 30 ? -1.729  -8.898  -3.489  1.00 15.00 ?  308 PHE A HD2  3  
ATOM   1987  H HE1  . PHE A 1 30 ? 0.808   -4.996  -5.084  1.00 15.00 ?  308 PHE A HE1  3  
ATOM   1988  H HE2  . PHE A 1 30 ? 0.516   -9.190  -4.418  1.00 15.00 ?  308 PHE A HE2  3  
ATOM   1989  H HZ   . PHE A 1 30 ? 1.789   -7.246  -5.221  1.00 15.00 ?  308 PHE A HZ   3  
ATOM   1990  N N    . THR A 1 31 ? -5.443  -4.933  -1.303  1.00 15.00 ?  309 THR A N    3  
ATOM   1991  C CA   . THR A 1 31 ? -6.782  -4.364  -1.323  1.00 15.00 ?  309 THR A CA   3  
ATOM   1992  C C    . THR A 1 31 ? -6.765  -2.888  -0.927  1.00 15.00 ?  309 THR A C    3  
ATOM   1993  O O    . THR A 1 31 ? -6.388  -2.540  0.193   1.00 15.00 ?  309 THR A O    3  
ATOM   1994  C CB   . THR A 1 31 ? -7.714  -5.138  -0.375  1.00 15.00 ?  309 THR A CB   3  
ATOM   1995  O OG1  . THR A 1 31 ? -7.584  -6.545  -0.623  1.00 15.00 ?  309 THR A OG1  3  
ATOM   1996  C CG2  . THR A 1 31 ? -9.165  -4.719  -0.570  1.00 15.00 ?  309 THR A CG2  3  
ATOM   1997  H H    . THR A 1 31 ? -5.160  -5.454  -0.528  1.00 15.00 ?  309 THR A H    3  
ATOM   1998  H HA   . THR A 1 31 ? -7.168  -4.454  -2.328  1.00 15.00 ?  309 THR A HA   3  
ATOM   1999  H HB   . THR A 1 31 ? -7.424  -4.930  0.645   1.00 15.00 ?  309 THR A HB   3  
ATOM   2000  H HG1  . THR A 1 31 ? -7.317  -6.688  -1.538  1.00 15.00 ?  309 THR A HG1  3  
ATOM   2001  H HG21 . THR A 1 31 ? -9.472  -4.937  -1.583  1.00 15.00 ?  309 THR A HG21 3  
ATOM   2002  H HG22 . THR A 1 31 ? -9.261  -3.659  -0.386  1.00 15.00 ?  309 THR A HG22 3  
ATOM   2003  H HG23 . THR A 1 31 ? -9.792  -5.261  0.122   1.00 15.00 ?  309 THR A HG23 3  
ATOM   2004  N N    . ASP A 1 32 ? -7.165  -2.032  -1.858  1.00 15.00 ?  310 ASP A N    3  
ATOM   2005  C CA   . ASP A 1 32 ? -7.228  -0.596  -1.613  1.00 15.00 ?  310 ASP A CA   3  
ATOM   2006  C C    . ASP A 1 32 ? -8.664  -0.176  -1.304  1.00 15.00 ?  310 ASP A C    3  
ATOM   2007  O O    . ASP A 1 32 ? -9.581  -0.489  -2.062  1.00 15.00 ?  310 ASP A O    3  
ATOM   2008  C CB   . ASP A 1 32 ? -6.700  0.165   -2.835  1.00 15.00 ?  310 ASP A CB   3  
ATOM   2009  C CG   . ASP A 1 32 ? -6.647  1.666   -2.627  1.00 15.00 ?  310 ASP A CG   3  
ATOM   2010  O OD1  . ASP A 1 32 ? -7.717  2.306   -2.581  1.00 15.00 -1 310 ASP A OD1  3  
ATOM   2011  O OD2  . ASP A 1 32 ? -5.537  2.217   -2.504  1.00 15.00 ?  310 ASP A OD2  3  
ATOM   2012  H H    . ASP A 1 32 ? -7.425  -2.372  -2.738  1.00 15.00 ?  310 ASP A H    3  
ATOM   2013  H HA   . ASP A 1 32 ? -6.608  -0.379  -0.759  1.00 15.00 ?  310 ASP A HA   3  
ATOM   2014  H HB2  . ASP A 1 32 ? -5.702  -0.179  -3.060  1.00 15.00 ?  310 ASP A HB2  3  
ATOM   2015  H HB3  . ASP A 1 32 ? -7.343  -0.038  -3.678  1.00 15.00 ?  310 ASP A HB3  3  
ATOM   2016  N N    . PRO A 1 33 ? -8.876  0.543   -0.189  1.00 15.00 ?  311 PRO A N    3  
ATOM   2017  C CA   . PRO A 1 33 ? -10.215 0.931   0.268   1.00 15.00 ?  311 PRO A CA   3  
ATOM   2018  C C    . PRO A 1 33 ? -10.859 2.043   -0.568  1.00 15.00 ?  311 PRO A C    3  
ATOM   2019  O O    . PRO A 1 33 ? -12.064 2.281   -0.465  1.00 15.00 ?  311 PRO A O    3  
ATOM   2020  C CB   . PRO A 1 33 ? -9.979  1.397   1.705   1.00 15.00 ?  311 PRO A CB   3  
ATOM   2021  C CG   . PRO A 1 33 ? -8.567  1.871   1.723   1.00 15.00 ?  311 PRO A CG   3  
ATOM   2022  C CD   . PRO A 1 33 ? -7.822  1.020   0.727   1.00 15.00 ?  311 PRO A CD   3  
ATOM   2023  H HA   . PRO A 1 33 ? -10.878 0.077   0.279   1.00 15.00 ?  311 PRO A HA   3  
ATOM   2024  H HB2  . PRO A 1 33 ? -10.669 2.193   1.951   1.00 15.00 ?  311 PRO A HB2  3  
ATOM   2025  H HB3  . PRO A 1 33 ? -10.123 0.567   2.383   1.00 15.00 ?  311 PRO A HB3  3  
ATOM   2026  H HG2  . PRO A 1 33 ? -8.526  2.911   1.431   1.00 15.00 ?  311 PRO A HG2  3  
ATOM   2027  H HG3  . PRO A 1 33 ? -8.149  1.741   2.711   1.00 15.00 ?  311 PRO A HG3  3  
ATOM   2028  H HD2  . PRO A 1 33 ? -7.093  1.611   0.196   1.00 15.00 ?  311 PRO A HD2  3  
ATOM   2029  H HD3  . PRO A 1 33 ? -7.343  0.190   1.226   1.00 15.00 ?  311 PRO A HD3  3  
ATOM   2030  N N    . ARG A 1 34 ? -10.070 2.737   -1.380  1.00 15.00 ?  312 ARG A N    3  
ATOM   2031  C CA   . ARG A 1 34 ? -10.609 3.808   -2.208  1.00 15.00 ?  312 ARG A CA   3  
ATOM   2032  C C    . ARG A 1 34 ? -11.087 3.251   -3.538  1.00 15.00 ?  312 ARG A C    3  
ATOM   2033  O O    . ARG A 1 34 ? -11.932 3.846   -4.202  1.00 15.00 ?  312 ARG A O    3  
ATOM   2034  C CB   . ARG A 1 34 ? -9.587  4.921   -2.472  1.00 15.00 ?  312 ARG A CB   3  
ATOM   2035  C CG   . ARG A 1 34 ? -9.179  5.729   -1.247  1.00 15.00 ?  312 ARG A CG   3  
ATOM   2036  C CD   . ARG A 1 34 ? -8.139  5.006   -0.408  1.00 15.00 ?  312 ARG A CD   3  
ATOM   2037  N NE   . ARG A 1 34 ? -7.009  4.550   -1.217  1.00 15.00 ?  312 ARG A NE   3  
ATOM   2038  C CZ   . ARG A 1 34 ? -5.899  5.256   -1.432  1.00 15.00 ?  312 ARG A CZ   3  
ATOM   2039  N NH1  . ARG A 1 34 ? -5.799  6.506   -0.997  1.00 15.00 1  312 ARG A NH1  3  
ATOM   2040  N NH2  . ARG A 1 34 ? -4.904  4.713   -2.116  1.00 15.00 ?  312 ARG A NH2  3  
ATOM   2041  H H    . ARG A 1 34 ? -9.114  2.501   -1.453  1.00 15.00 ?  312 ARG A H    3  
ATOM   2042  H HA   . ARG A 1 34 ? -11.457 4.230   -1.687  1.00 15.00 ?  312 ARG A HA   3  
ATOM   2043  H HB2  . ARG A 1 34 ? -8.695  4.477   -2.888  1.00 15.00 ?  312 ARG A HB2  3  
ATOM   2044  H HB3  . ARG A 1 34 ? -10.003 5.604   -3.199  1.00 15.00 ?  312 ARG A HB3  3  
ATOM   2045  H HG2  . ARG A 1 34 ? -8.767  6.670   -1.572  1.00 15.00 ?  312 ARG A HG2  3  
ATOM   2046  H HG3  . ARG A 1 34 ? -10.055 5.908   -0.640  1.00 15.00 ?  312 ARG A HG3  3  
ATOM   2047  H HD2  . ARG A 1 34 ? -7.777  5.681   0.352   1.00 15.00 ?  312 ARG A HD2  3  
ATOM   2048  H HD3  . ARG A 1 34 ? -8.603  4.150   0.060   1.00 15.00 ?  312 ARG A HD3  3  
ATOM   2049  H HE   . ARG A 1 34 ? -7.076  3.640   -1.612  1.00 15.00 ?  312 ARG A HE   3  
ATOM   2050  H HH11 . ARG A 1 34 ? -6.562  6.934   -0.500  1.00 15.00 ?  312 ARG A HH11 3  
ATOM   2051  H HH12 . ARG A 1 34 ? -4.953  7.035   -1.159  1.00 15.00 ?  312 ARG A HH12 3  
ATOM   2052  H HH21 . ARG A 1 34 ? -4.992  3.761   -2.465  1.00 15.00 ?  312 ARG A HH21 3  
ATOM   2053  H HH22 . ARG A 1 34 ? -4.067  5.232   -2.289  1.00 15.00 ?  312 ARG A HH22 3  
ATOM   2054  N N    . LEU A 1 35 ? -10.527 2.117   -3.929  1.00 15.00 ?  313 LEU A N    3  
ATOM   2055  C CA   . LEU A 1 35 ? -10.908 1.475   -5.173  1.00 15.00 ?  313 LEU A CA   3  
ATOM   2056  C C    . LEU A 1 35 ? -12.201 0.691   -4.984  1.00 15.00 ?  313 LEU A C    3  
ATOM   2057  O O    . LEU A 1 35 ? -12.135 -0.503  -4.623  1.00 15.00 ?  313 LEU A O    3  
ATOM   2058  C CB   . LEU A 1 35 ? -9.790  0.554   -5.669  1.00 15.00 ?  313 LEU A CB   3  
ATOM   2059  C CG   . LEU A 1 35 ? -8.461  1.246   -5.985  1.00 15.00 ?  313 LEU A CG   3  
ATOM   2060  C CD1  . LEU A 1 35 ? -7.433  0.228   -6.456  1.00 15.00 ?  313 LEU A CD1  3  
ATOM   2061  C CD2  . LEU A 1 35 ? -8.654  2.327   -7.037  1.00 15.00 ?  313 LEU A CD2  3  
ATOM   2062  H H    . LEU A 1 35 ? -9.837  1.703   -3.365  1.00 15.00 ?  313 LEU A H    3  
ATOM   2063  H HA   . LEU A 1 35 ? -11.077 2.250   -5.907  1.00 15.00 ?  313 LEU A HA   3  
ATOM   2064  H HB2  . LEU A 1 35 ? -9.608  -0.194  -4.911  1.00 15.00 ?  313 LEU A HB2  3  
ATOM   2065  H HB3  . LEU A 1 35 ? -10.132 0.057   -6.565  1.00 15.00 ?  313 LEU A HB3  3  
ATOM   2066  H HG   . LEU A 1 35 ? -8.081  1.713   -5.088  1.00 15.00 ?  313 LEU A HG   3  
ATOM   2067  H HD11 . LEU A 1 35 ? -6.503  0.730   -6.674  1.00 15.00 ?  313 LEU A HD11 3  
ATOM   2068  H HD12 . LEU A 1 35 ? -7.795  -0.263  -7.346  1.00 15.00 ?  313 LEU A HD12 3  
ATOM   2069  H HD13 . LEU A 1 35 ? -7.274  -0.505  -5.679  1.00 15.00 ?  313 LEU A HD13 3  
ATOM   2070  H HD21 . LEU A 1 35 ? -9.030  1.882   -7.945  1.00 15.00 ?  313 LEU A HD21 3  
ATOM   2071  H HD22 . LEU A 1 35 ? -7.708  2.810   -7.236  1.00 15.00 ?  313 LEU A HD22 3  
ATOM   2072  H HD23 . LEU A 1 35 ? -9.362  3.057   -6.674  1.00 15.00 ?  313 LEU A HD23 3  
ATOM   2073  N N    . ASP B 2 2  ? -1.331  -9.325  -9.533  1.00 15.00 ?  221 ASP B N    3  
ATOM   2074  C CA   . ASP B 2 2  ? 0.070   -9.167  -9.084  1.00 15.00 ?  221 ASP B CA   3  
ATOM   2075  C C    . ASP B 2 2  ? 0.414   -10.206 -8.029  1.00 15.00 ?  221 ASP B C    3  
ATOM   2076  O O    . ASP B 2 2  ? -0.419  -10.549 -7.190  1.00 15.00 ?  221 ASP B O    3  
ATOM   2077  C CB   . ASP B 2 2  ? 0.296   -7.757  -8.529  1.00 15.00 ?  221 ASP B CB   3  
ATOM   2078  C CG   . ASP B 2 2  ? 0.376   -6.722  -9.626  1.00 15.00 ?  221 ASP B CG   3  
ATOM   2079  O OD1  . ASP B 2 2  ? 1.471   -6.550  -10.198 1.00 15.00 -1 221 ASP B OD1  3  
ATOM   2080  O OD2  . ASP B 2 2  ? -0.651  -6.080  -9.923  1.00 15.00 ?  221 ASP B OD2  3  
ATOM   2081  H H    . ASP B 2 2  ? -1.485  -10.296 -9.884  1.00 15.00 ?  221 ASP B H    3  
ATOM   2082  H HA   . ASP B 2 2  ? 0.716   -9.315  -9.939  1.00 15.00 ?  221 ASP B HA   3  
ATOM   2083  H HB2  . ASP B 2 2  ? -0.522  -7.496  -7.873  1.00 15.00 ?  221 ASP B HB2  3  
ATOM   2084  H HB3  . ASP B 2 2  ? 1.220   -7.735  -7.971  1.00 15.00 ?  221 ASP B HB3  3  
ATOM   2085  N N    . THR B 2 3  ? 1.648   -10.696 -8.082  1.00 15.00 ?  222 THR B N    3  
ATOM   2086  C CA   . THR B 2 3  ? 2.137   -11.703 -7.145  1.00 15.00 ?  222 THR B CA   3  
ATOM   2087  C C    . THR B 2 3  ? 2.144   -11.183 -5.706  1.00 15.00 ?  222 THR B C    3  
ATOM   2088  O O    . THR B 2 3  ? 2.001   -9.983  -5.492  1.00 15.00 ?  222 THR B O    3  
ATOM   2089  C CB   . THR B 2 3  ? 3.555   -12.154 -7.548  1.00 15.00 ?  222 THR B CB   3  
ATOM   2090  O OG1  . THR B 2 3  ? 4.397   -11.007 -7.740  1.00 15.00 ?  222 THR B OG1  3  
ATOM   2091  C CG2  . THR B 2 3  ? 3.522   -12.981 -8.825  1.00 15.00 ?  222 THR B CG2  3  
ATOM   2092  H H    . THR B 2 3  ? 2.256   -10.374 -8.785  1.00 15.00 ?  222 THR B H    3  
ATOM   2093  H HA   . THR B 2 3  ? 1.474   -12.554 -7.198  1.00 15.00 ?  222 THR B HA   3  
ATOM   2094  H HB   . THR B 2 3  ? 3.965   -12.763 -6.754  1.00 15.00 ?  222 THR B HB   3  
ATOM   2095  H HG1  . THR B 2 3  ? 4.075   -10.281 -7.193  1.00 15.00 ?  222 THR B HG1  3  
ATOM   2096  H HG21 . THR B 2 3  ? 2.909   -13.856 -8.671  1.00 15.00 ?  222 THR B HG21 3  
ATOM   2097  H HG22 . THR B 2 3  ? 4.526   -13.287 -9.083  1.00 15.00 ?  222 THR B HG22 3  
ATOM   2098  H HG23 . THR B 2 3  ? 3.108   -12.388 -9.627  1.00 15.00 ?  222 THR B HG23 3  
ATOM   2099  N N    . PRO B 2 4  ? 2.354   -12.075 -4.707  1.00 15.00 ?  223 PRO B N    3  
ATOM   2100  C CA   . PRO B 2 4  ? 2.221   -11.732 -3.280  1.00 15.00 ?  223 PRO B CA   3  
ATOM   2101  C C    . PRO B 2 4  ? 2.957   -10.446 -2.890  1.00 15.00 ?  223 PRO B C    3  
ATOM   2102  O O    . PRO B 2 4  ? 4.083   -10.195 -3.334  1.00 15.00 ?  223 PRO B O    3  
ATOM   2103  C CB   . PRO B 2 4  ? 2.853   -12.934 -2.578  1.00 15.00 ?  223 PRO B CB   3  
ATOM   2104  C CG   . PRO B 2 4  ? 2.615   -14.072 -3.504  1.00 15.00 ?  223 PRO B CG   3  
ATOM   2105  C CD   . PRO B 2 4  ? 2.710   -13.499 -4.890  1.00 15.00 ?  223 PRO B CD   3  
ATOM   2106  H HA   . PRO B 2 4  ? 1.185   -11.656 -2.997  1.00 15.00 ?  223 PRO B HA   3  
ATOM   2107  H HB2  . PRO B 2 4  ? 3.908   -12.756 -2.428  1.00 15.00 ?  223 PRO B HB2  3  
ATOM   2108  H HB3  . PRO B 2 4  ? 2.371   -13.095 -1.626  1.00 15.00 ?  223 PRO B HB3  3  
ATOM   2109  H HG2  . PRO B 2 4  ? 3.373   -14.829 -3.359  1.00 15.00 ?  223 PRO B HG2  3  
ATOM   2110  H HG3  . PRO B 2 4  ? 1.632   -14.484 -3.335  1.00 15.00 ?  223 PRO B HG3  3  
ATOM   2111  H HD2  . PRO B 2 4  ? 3.716   -13.600 -5.271  1.00 15.00 ?  223 PRO B HD2  3  
ATOM   2112  H HD3  . PRO B 2 4  ? 2.007   -13.989 -5.547  1.00 15.00 ?  223 PRO B HD3  3  
ATOM   2113  N N    . PRO B 2 5  ? 2.327   -9.631  -2.020  1.00 15.00 ?  224 PRO B N    3  
ATOM   2114  C CA   . PRO B 2 5  ? 2.796   -8.277  -1.706  1.00 15.00 ?  224 PRO B CA   3  
ATOM   2115  C C    . PRO B 2 5  ? 4.165   -8.243  -1.029  1.00 15.00 ?  224 PRO B C    3  
ATOM   2116  O O    . PRO B 2 5  ? 4.459   -9.044  -0.139  1.00 15.00 ?  224 PRO B O    3  
ATOM   2117  C CB   . PRO B 2 5  ? 1.718   -7.733  -0.767  1.00 15.00 ?  224 PRO B CB   3  
ATOM   2118  C CG   . PRO B 2 5  ? 1.069   -8.934  -0.183  1.00 15.00 ?  224 PRO B CG   3  
ATOM   2119  C CD   . PRO B 2 5  ? 1.113   -9.979  -1.255  1.00 15.00 ?  224 PRO B CD   3  
ATOM   2120  H HA   . PRO B 2 5  ? 2.832   -7.665  -2.595  1.00 15.00 ?  224 PRO B HA   3  
ATOM   2121  H HB2  . PRO B 2 5  ? 2.177   -7.122  -0.003  1.00 15.00 ?  224 PRO B HB2  3  
ATOM   2122  H HB3  . PRO B 2 5  ? 1.014   -7.140  -1.330  1.00 15.00 ?  224 PRO B HB3  3  
ATOM   2123  H HG2  . PRO B 2 5  ? 1.616   -9.264  0.689   1.00 15.00 ?  224 PRO B HG2  3  
ATOM   2124  H HG3  . PRO B 2 5  ? 0.045   -8.708  0.078   1.00 15.00 ?  224 PRO B HG3  3  
ATOM   2125  H HD2  . PRO B 2 5  ? 1.199   -10.963 -0.816  1.00 15.00 ?  224 PRO B HD2  3  
ATOM   2126  H HD3  . PRO B 2 5  ? 0.232   -9.913  -1.875  1.00 15.00 ?  224 PRO B HD3  3  
ATOM   2127  N N    . PRO B 2 6  ? 5.009   -7.294  -1.463  1.00 15.00 ?  225 PRO B N    3  
ATOM   2128  C CA   . PRO B 2 6  ? 6.337   -7.051  -0.879  1.00 15.00 ?  225 PRO B CA   3  
ATOM   2129  C C    . PRO B 2 6  ? 6.269   -6.580  0.572   1.00 15.00 ?  225 PRO B C    3  
ATOM   2130  O O    . PRO B 2 6  ? 5.194   -6.272  1.086   1.00 15.00 ?  225 PRO B O    3  
ATOM   2131  C CB   . PRO B 2 6  ? 6.905   -5.919  -1.745  1.00 15.00 ?  225 PRO B CB   3  
ATOM   2132  C CG   . PRO B 2 6  ? 6.090   -5.916  -2.987  1.00 15.00 ?  225 PRO B CG   3  
ATOM   2133  C CD   . PRO B 2 6  ? 4.728   -6.385  -2.582  1.00 15.00 ?  225 PRO B CD   3  
ATOM   2134  H HA   . PRO B 2 6  ? 6.974   -7.921  -0.952  1.00 15.00 ?  225 PRO B HA   3  
ATOM   2135  H HB2  . PRO B 2 6  ? 6.816   -4.981  -1.216  1.00 15.00 ?  225 PRO B HB2  3  
ATOM   2136  H HB3  . PRO B 2 6  ? 7.938   -6.113  -1.957  1.00 15.00 ?  225 PRO B HB3  3  
ATOM   2137  H HG2  . PRO B 2 6  ? 6.038   -4.914  -3.390  1.00 15.00 ?  225 PRO B HG2  3  
ATOM   2138  H HG3  . PRO B 2 6  ? 6.520   -6.588  -3.708  1.00 15.00 ?  225 PRO B HG3  3  
ATOM   2139  H HD2  . PRO B 2 6  ? 4.121   -5.551  -2.259  1.00 15.00 ?  225 PRO B HD2  3  
ATOM   2140  H HD3  . PRO B 2 6  ? 4.250   -6.910  -3.395  1.00 15.00 ?  225 PRO B HD3  3  
ATOM   2141  N N    . ALA B 2 7  ? 7.427   -6.500  1.222   1.00 15.00 ?  226 ALA B N    3  
ATOM   2142  C CA   . ALA B 2 7  ? 7.513   -5.905  2.550   1.00 15.00 ?  226 ALA B CA   3  
ATOM   2143  C C    . ALA B 2 7  ? 7.147   -4.426  2.464   1.00 15.00 ?  226 ALA B C    3  
ATOM   2144  O O    . ALA B 2 7  ? 7.169   -3.844  1.378   1.00 15.00 ?  226 ALA B O    3  
ATOM   2145  C CB   . ALA B 2 7  ? 8.911   -6.085  3.127   1.00 15.00 ?  226 ALA B CB   3  
ATOM   2146  H H    . ALA B 2 7  ? 8.242   -6.841  0.796   1.00 15.00 ?  226 ALA B H    3  
ATOM   2147  H HA   . ALA B 2 7  ? 6.806   -6.410  3.193   1.00 15.00 ?  226 ALA B HA   3  
ATOM   2148  H HB1  . ALA B 2 7  ? 9.630   -5.593  2.488   1.00 15.00 ?  226 ALA B HB1  3  
ATOM   2149  H HB2  . ALA B 2 7  ? 9.144   -7.138  3.188   1.00 15.00 ?  226 ALA B HB2  3  
ATOM   2150  H HB3  . ALA B 2 7  ? 8.951   -5.649  4.115   1.00 15.00 ?  226 ALA B HB3  3  
ATOM   2151  N N    . TYR B 2 8  ? 6.821   -3.800  3.587   1.00 15.00 ?  227 TYR B N    3  
ATOM   2152  C CA   . TYR B 2 8  ? 6.330   -2.439  3.520   1.00 15.00 ?  227 TYR B CA   3  
ATOM   2153  C C    . TYR B 2 8  ? 7.463   -1.431  3.607   1.00 15.00 ?  227 TYR B C    3  
ATOM   2154  O O    . TYR B 2 8  ? 8.342   -1.502  4.469   1.00 15.00 ?  227 TYR B O    3  
ATOM   2155  C CB   . TYR B 2 8  ? 5.265   -2.140  4.585   1.00 15.00 ?  227 TYR B CB   3  
ATOM   2156  C CG   . TYR B 2 8  ? 5.809   -1.698  5.932   1.00 15.00 ?  227 TYR B CG   3  
ATOM   2157  C CD1  . TYR B 2 8  ? 6.128   -2.623  6.915   1.00 15.00 ?  227 TYR B CD1  3  
ATOM   2158  C CD2  . TYR B 2 8  ? 6.002   -0.349  6.219   1.00 15.00 ?  227 TYR B CD2  3  
ATOM   2159  C CE1  . TYR B 2 8  ? 6.625   -2.219  8.140   1.00 15.00 ?  227 TYR B CE1  3  
ATOM   2160  C CE2  . TYR B 2 8  ? 6.497   0.063   7.438   1.00 15.00 ?  227 TYR B CE2  3  
ATOM   2161  C CZ   . TYR B 2 8  ? 6.808   -0.877  8.397   1.00 15.00 ?  227 TYR B CZ   3  
ATOM   2162  O OH   . TYR B 2 8  ? 7.306   -0.482  9.617   1.00 15.00 ?  227 TYR B OH   3  
ATOM   2163  H H    . TYR B 2 8  ? 6.920   -4.250  4.448   1.00 15.00 ?  227 TYR B H    3  
ATOM   2164  H HA   . TYR B 2 8  ? 5.869   -2.326  2.550   1.00 15.00 ?  227 TYR B HA   3  
ATOM   2165  H HB2  . TYR B 2 8  ? 4.628   -1.343  4.202   1.00 15.00 ?  227 TYR B HB2  3  
ATOM   2166  H HB3  . TYR B 2 8  ? 4.666   -3.026  4.741   1.00 15.00 ?  227 TYR B HB3  3  
ATOM   2167  H HD1  . TYR B 2 8  ? 5.985   -3.675  6.712   1.00 15.00 ?  227 TYR B HD1  3  
ATOM   2168  H HD2  . TYR B 2 8  ? 5.757   0.390   5.474   1.00 15.00 ?  227 TYR B HD2  3  
ATOM   2169  H HE1  . TYR B 2 8  ? 6.862   -2.963  8.906   1.00 15.00 ?  227 TYR B HE1  3  
ATOM   2170  H HE2  . TYR B 2 8  ? 6.635   1.125   7.627   1.00 15.00 ?  227 TYR B HE2  3  
ATOM   2171  H HH   . TYR B 2 8  ? 7.033   0.434   9.800   1.00 15.00 ?  227 TYR B HH   3  
ATOM   2172  N N    . LEU B 2 9  ? 7.409   -0.505  2.684   1.00 15.00 ?  228 LEU B N    3  
ATOM   2173  C CA   . LEU B 2 9  ? 8.334   0.601   2.587   1.00 15.00 ?  228 LEU B CA   3  
ATOM   2174  C C    . LEU B 2 9  ? 7.521   1.876   2.457   1.00 15.00 ?  228 LEU B C    3  
ATOM   2175  O O    . LEU B 2 9  ? 6.365   1.815   2.075   1.00 15.00 ?  228 LEU B O    3  
ATOM   2176  C CB   . LEU B 2 9  ? 9.258   0.425   1.376   1.00 15.00 ?  228 LEU B CB   3  
ATOM   2177  C CG   . LEU B 2 9  ? 10.191  -0.789  1.432   1.00 15.00 ?  228 LEU B CG   3  
ATOM   2178  C CD1  . LEU B 2 9  ? 10.950  -0.937  0.124   1.00 15.00 ?  228 LEU B CD1  3  
ATOM   2179  C CD2  . LEU B 2 9  ? 11.161  -0.660  2.596   1.00 15.00 ?  228 LEU B CD2  3  
ATOM   2180  H H    . LEU B 2 9  ? 6.691   -0.559  2.017   1.00 15.00 ?  228 LEU B H    3  
ATOM   2181  H HA   . LEU B 2 9  ? 8.914   0.638   3.498   1.00 15.00 ?  228 LEU B HA   3  
ATOM   2182  H HB2  . LEU B 2 9  ? 8.644   0.340   0.492   1.00 15.00 ?  228 LEU B HB2  3  
ATOM   2183  H HB3  . LEU B 2 9  ? 9.868   1.313   1.286   1.00 15.00 ?  228 LEU B HB3  3  
ATOM   2184  H HG   . LEU B 2 9  ? 9.602   -1.683  1.581   1.00 15.00 ?  228 LEU B HG   3  
ATOM   2185  H HD11 . LEU B 2 9  ? 11.605  -1.794  0.184   1.00 15.00 ?  228 LEU B HD11 3  
ATOM   2186  H HD12 . LEU B 2 9  ? 11.535  -0.048  -0.056  1.00 15.00 ?  228 LEU B HD12 3  
ATOM   2187  H HD13 . LEU B 2 9  ? 10.248  -1.076  -0.685  1.00 15.00 ?  228 LEU B HD13 3  
ATOM   2188  H HD21 . LEU B 2 9  ? 10.607  -0.602  3.521   1.00 15.00 ?  228 LEU B HD21 3  
ATOM   2189  H HD22 . LEU B 2 9  ? 11.753  0.235   2.474   1.00 15.00 ?  228 LEU B HD22 3  
ATOM   2190  H HD23 . LEU B 2 9  ? 11.812  -1.522  2.621   1.00 15.00 ?  228 LEU B HD23 3  
ATOM   2191  N N    . PRO B 2 10 ? 8.083   3.049   2.728   1.00 15.00 ?  229 PRO B N    3  
ATOM   2192  C CA   . PRO B 2 10 ? 7.324   4.285   2.611   1.00 15.00 ?  229 PRO B CA   3  
ATOM   2193  C C    . PRO B 2 10 ? 7.406   4.819   1.190   1.00 15.00 ?  229 PRO B C    3  
ATOM   2194  O O    . PRO B 2 10 ? 8.328   4.491   0.445   1.00 15.00 ?  229 PRO B O    3  
ATOM   2195  C CB   . PRO B 2 10 ? 8.051   5.245   3.572   1.00 15.00 ?  229 PRO B CB   3  
ATOM   2196  C CG   . PRO B 2 10 ? 9.118   4.438   4.237   1.00 15.00 ?  229 PRO B CG   3  
ATOM   2197  C CD   . PRO B 2 10 ? 9.386   3.262   3.344   1.00 15.00 ?  229 PRO B CD   3  
ATOM   2198  H HA   . PRO B 2 10 ? 6.294   4.156   2.909   1.00 15.00 ?  229 PRO B HA   3  
ATOM   2199  H HB2  . PRO B 2 10 ? 8.475   6.063   3.009   1.00 15.00 ?  229 PRO B HB2  3  
ATOM   2200  H HB3  . PRO B 2 10 ? 7.347   5.629   4.294   1.00 15.00 ?  229 PRO B HB3  3  
ATOM   2201  H HG2  . PRO B 2 10 ? 10.006  5.032   4.348   1.00 15.00 ?  229 PRO B HG2  3  
ATOM   2202  H HG3  . PRO B 2 10 ? 8.772   4.101   5.204   1.00 15.00 ?  229 PRO B HG3  3  
ATOM   2203  H HD2  . PRO B 2 10 ? 10.134  3.493   2.614   1.00 15.00 ?  229 PRO B HD2  3  
ATOM   2204  H HD3  . PRO B 2 10 ? 9.672   2.407   3.931   1.00 15.00 ?  229 PRO B HD3  3  
ATOM   2205  N N    . PRO B 2 11 ? 6.441   5.661   0.798   1.00 15.00 ?  230 PRO B N    3  
ATOM   2206  C CA   . PRO B 2 11 ? 5.977   5.709   -0.578  1.00 15.00 ?  230 PRO B CA   3  
ATOM   2207  C C    . PRO B 2 11 ? 6.733   6.666   -1.478  1.00 15.00 ?  230 PRO B C    3  
ATOM   2208  O O    . PRO B 2 11 ? 7.012   7.808   -1.119  1.00 15.00 ?  230 PRO B O    3  
ATOM   2209  C CB   . PRO B 2 11 ? 4.538   6.176   -0.397  1.00 15.00 ?  230 PRO B CB   3  
ATOM   2210  C CG   . PRO B 2 11 ? 4.573   7.087   0.784   1.00 15.00 ?  230 PRO B CG   3  
ATOM   2211  C CD   . PRO B 2 11 ? 5.730   6.643   1.643   1.00 15.00 ?  230 PRO B CD   3  
ATOM   2212  H HA   . PRO B 2 11 ? 5.974   4.725   -1.024  1.00 15.00 ?  230 PRO B HA   3  
ATOM   2213  H HB2  . PRO B 2 11 ? 4.214   6.694   -1.282  1.00 15.00 ?  230 PRO B HB2  3  
ATOM   2214  H HB3  . PRO B 2 11 ? 3.900   5.323   -0.219  1.00 15.00 ?  230 PRO B HB3  3  
ATOM   2215  H HG2  . PRO B 2 11 ? 4.722   8.105   0.454   1.00 15.00 ?  230 PRO B HG2  3  
ATOM   2216  H HG3  . PRO B 2 11 ? 3.647   7.006   1.335   1.00 15.00 ?  230 PRO B HG3  3  
ATOM   2217  H HD2  . PRO B 2 11 ? 6.368   7.484   1.877   1.00 15.00 ?  230 PRO B HD2  3  
ATOM   2218  H HD3  . PRO B 2 11 ? 5.367   6.185   2.549   1.00 15.00 ?  230 PRO B HD3  3  
ATOM   2219  N N    . GLU B 2 12 ? 7.057   6.161   -2.659  1.00 15.00 ?  231 GLU B N    3  
ATOM   2220  C CA   . GLU B 2 12 ? 7.706   6.952   -3.684  1.00 15.00 ?  231 GLU B CA   3  
ATOM   2221  C C    . GLU B 2 12 ? 6.701   7.293   -4.793  1.00 15.00 ?  231 GLU B C    3  
ATOM   2222  O O    . GLU B 2 12 ? 6.462   6.493   -5.692  1.00 15.00 ?  231 GLU B O    3  
ATOM   2223  C CB   . GLU B 2 12 ? 8.865   6.127   -4.249  1.00 15.00 ?  231 GLU B CB   3  
ATOM   2224  C CG   . GLU B 2 12 ? 8.435   4.746   -4.762  1.00 15.00 ?  231 GLU B CG   3  
ATOM   2225  C CD   . GLU B 2 12 ? 9.606   3.860   -5.135  1.00 15.00 ?  231 GLU B CD   3  
ATOM   2226  O OE1  . GLU B 2 12 ? 10.758  4.346   -5.118  1.00 15.00 ?  231 GLU B OE1  3  
ATOM   2227  O OE2  . GLU B 2 12 ? 9.375   2.680   -5.470  1.00 15.00 -1 231 GLU B OE2  3  
ATOM   2228  H H    . GLU B 2 12 ? 6.863   5.213   -2.845  1.00 15.00 ?  231 GLU B H    3  
ATOM   2229  H HA   . GLU B 2 12 ? 8.088   7.857   -3.236  1.00 15.00 ?  231 GLU B HA   3  
ATOM   2230  H HB2  . GLU B 2 12 ? 9.313   6.670   -5.070  1.00 15.00 ?  231 GLU B HB2  3  
ATOM   2231  H HB3  . GLU B 2 12 ? 9.606   5.986   -3.476  1.00 15.00 ?  231 GLU B HB3  3  
ATOM   2232  H HG2  . GLU B 2 12 ? 7.821   4.240   -4.000  1.00 15.00 ?  231 GLU B HG2  3  
ATOM   2233  H HG3  . GLU B 2 12 ? 7.829   4.894   -5.646  1.00 15.00 ?  231 GLU B HG3  3  
ATOM   2234  N N    . ASP B 2 13 ? 6.135   8.482   -4.774  1.00 15.00 ?  232 ASP B N    3  
ATOM   2235  C CA   . ASP B 2 13 ? 5.010   8.761   -5.659  1.00 15.00 ?  232 ASP B CA   3  
ATOM   2236  C C    . ASP B 2 13 ? 4.998   10.214  -6.107  1.00 15.00 ?  232 ASP B C    3  
ATOM   2237  O O    . ASP B 2 13 ? 4.816   11.128  -5.300  1.00 15.00 ?  232 ASP B O    3  
ATOM   2238  C CB   . ASP B 2 13 ? 3.690   8.393   -4.961  1.00 15.00 ?  232 ASP B CB   3  
ATOM   2239  C CG   . ASP B 2 13 ? 2.472   8.571   -5.852  1.00 15.00 ?  232 ASP B CG   3  
ATOM   2240  O OD1  . ASP B 2 13 ? 2.129   7.623   -6.590  1.00 15.00 ?  232 ASP B OD1  3  
ATOM   2241  O OD2  . ASP B 2 13 ? 1.832   9.644   -5.793  1.00 15.00 -1 232 ASP B OD2  3  
ATOM   2242  H H    . ASP B 2 13 ? 6.471   9.186   -4.170  1.00 15.00 ?  232 ASP B H    3  
ATOM   2243  H HA   . ASP B 2 13 ? 5.123   8.135   -6.531  1.00 15.00 ?  232 ASP B HA   3  
ATOM   2244  H HB2  . ASP B 2 13 ? 3.729   7.355   -4.652  1.00 15.00 ?  232 ASP B HB2  3  
ATOM   2245  H HB3  . ASP B 2 13 ? 3.566   9.017   -4.087  1.00 15.00 ?  232 ASP B HB3  3  
ATOM   2246  N N    . PRO B 2 14 ? 5.228   10.438  -7.406  1.00 15.00 ?  233 PRO B N    3  
ATOM   2247  C CA   . PRO B 2 14 ? 5.198   11.764  -8.010  1.00 15.00 ?  233 PRO B CA   3  
ATOM   2248  C C    . PRO B 2 14 ? 3.773   12.212  -8.313  1.00 15.00 ?  233 PRO B C    3  
ATOM   2249  O O    . PRO B 2 14 ? 3.252   11.978  -9.405  1.00 15.00 ?  233 PRO B O    3  
ATOM   2250  C CB   . PRO B 2 14 ? 5.995   11.589  -9.315  1.00 15.00 ?  233 PRO B CB   3  
ATOM   2251  C CG   . PRO B 2 14 ? 6.434   10.157  -9.351  1.00 15.00 ?  233 PRO B CG   3  
ATOM   2252  C CD   . PRO B 2 14 ? 5.548   9.413   -8.398  1.00 15.00 ?  233 PRO B CD   3  
ATOM   2253  H HA   . PRO B 2 14 ? 5.682   12.497  -7.383  1.00 15.00 ?  233 PRO B HA   3  
ATOM   2254  H HB2  . PRO B 2 14 ? 5.359   11.823  -10.155 1.00 15.00 ?  233 PRO B HB2  3  
ATOM   2255  H HB3  . PRO B 2 14 ? 6.844   12.257  -9.307  1.00 15.00 ?  233 PRO B HB3  3  
ATOM   2256  H HG2  . PRO B 2 14 ? 6.319   9.766   -10.350 1.00 15.00 ?  233 PRO B HG2  3  
ATOM   2257  H HG3  . PRO B 2 14 ? 7.465   10.084  -9.037  1.00 15.00 ?  233 PRO B HG3  3  
ATOM   2258  H HD2  . PRO B 2 14 ? 4.657   9.064   -8.899  1.00 15.00 ?  233 PRO B HD2  3  
ATOM   2259  H HD3  . PRO B 2 14 ? 6.081   8.588   -7.947  1.00 15.00 ?  233 PRO B HD3  3  
HETATM 2260  N N    . NH2 B 2 15 ? 3.139   12.839  -7.337  1.00 15.00 ?  234 NH2 B N    3  
HETATM 2261  H HN1  . NH2 B 2 15 ? 3.618   12.991  -6.496  1.00 15.00 ?  234 NH2 B HN1  3  
HETATM 2262  H HN2  . NH2 B 2 15 ? 2.214   13.124  -7.492  1.00 15.00 ?  234 NH2 B HN2  3  
ATOM   2263  N N    . LEU A 1 1  ? -13.052 2.683   -2.386  1.00 15.00 ?  279 LEU A N    4  
ATOM   2264  C CA   . LEU A 1 1  ? -14.086 2.637   -1.326  1.00 15.00 ?  279 LEU A CA   4  
ATOM   2265  C C    . LEU A 1 1  ? -14.330 4.023   -0.735  1.00 15.00 ?  279 LEU A C    4  
ATOM   2266  O O    . LEU A 1 1  ? -15.445 4.338   -0.325  1.00 15.00 ?  279 LEU A O    4  
ATOM   2267  C CB   . LEU A 1 1  ? -13.698 1.659   -0.203  1.00 15.00 ?  279 LEU A CB   4  
ATOM   2268  C CG   . LEU A 1 1  ? -13.753 0.165   -0.557  1.00 15.00 ?  279 LEU A CG   4  
ATOM   2269  C CD1  . LEU A 1 1  ? -12.599 -0.228  -1.464  1.00 15.00 ?  279 LEU A CD1  4  
ATOM   2270  C CD2  . LEU A 1 1  ? -13.744 -0.679  0.708   1.00 15.00 ?  279 LEU A CD2  4  
ATOM   2271  H H1   . LEU A 1 1  ? -12.146 3.008   -1.992  1.00 15.00 ?  279 LEU A H1   4  
ATOM   2272  H H2   . LEU A 1 1  ? -13.340 3.335   -3.144  1.00 15.00 ?  279 LEU A H2   4  
ATOM   2273  H H3   . LEU A 1 1  ? -12.918 1.737   -2.802  1.00 15.00 ?  279 LEU A H3   4  
ATOM   2274  H HA   . LEU A 1 1  ? -15.007 2.295   -1.779  1.00 15.00 ?  279 LEU A HA   4  
ATOM   2275  H HB2  . LEU A 1 1  ? -12.690 1.893   0.108   1.00 15.00 ?  279 LEU A HB2  4  
ATOM   2276  H HB3  . LEU A 1 1  ? -14.359 1.830   0.634   1.00 15.00 ?  279 LEU A HB3  4  
ATOM   2277  H HG   . LEU A 1 1  ? -14.673 -0.037  -1.085  1.00 15.00 ?  279 LEU A HG   4  
ATOM   2278  H HD11 . LEU A 1 1  ? -12.666 -1.280  -1.694  1.00 15.00 ?  279 LEU A HD11 4  
ATOM   2279  H HD12 . LEU A 1 1  ? -11.664 -0.027  -0.963  1.00 15.00 ?  279 LEU A HD12 4  
ATOM   2280  H HD13 . LEU A 1 1  ? -12.649 0.344   -2.378  1.00 15.00 ?  279 LEU A HD13 4  
ATOM   2281  H HD21 . LEU A 1 1  ? -12.846 -0.476  1.271   1.00 15.00 ?  279 LEU A HD21 4  
ATOM   2282  H HD22 . LEU A 1 1  ? -13.772 -1.725  0.441   1.00 15.00 ?  279 LEU A HD22 4  
ATOM   2283  H HD23 . LEU A 1 1  ? -14.608 -0.438  1.308   1.00 15.00 ?  279 LEU A HD23 4  
ATOM   2284  N N    . GLY A 1 2  ? -13.282 4.842   -0.651  1.00 15.00 ?  280 GLY A N    4  
ATOM   2285  C CA   . GLY A 1 2  ? -13.459 6.198   -0.164  1.00 15.00 ?  280 GLY A CA   4  
ATOM   2286  C C    . GLY A 1 2  ? -12.327 6.685   0.730   1.00 15.00 ?  280 GLY A C    4  
ATOM   2287  O O    . GLY A 1 2  ? -11.450 7.420   0.275   1.00 15.00 ?  280 GLY A O    4  
ATOM   2288  H H    . GLY A 1 2  ? -12.388 4.524   -0.901  1.00 15.00 ?  280 GLY A H    4  
ATOM   2289  H HA2  . GLY A 1 2  ? -13.535 6.861   -1.012  1.00 15.00 ?  280 GLY A HA2  4  
ATOM   2290  H HA3  . GLY A 1 2  ? -14.384 6.244   0.393   1.00 15.00 ?  280 GLY A HA3  4  
ATOM   2291  N N    . PRO A 1 3  ? -12.309 6.275   2.008   1.00 15.00 ?  281 PRO A N    4  
ATOM   2292  C CA   . PRO A 1 3  ? -11.393 6.829   3.008   1.00 15.00 ?  281 PRO A CA   4  
ATOM   2293  C C    . PRO A 1 3  ? -10.056 6.093   3.103   1.00 15.00 ?  281 PRO A C    4  
ATOM   2294  O O    . PRO A 1 3  ? -9.976  4.881   2.892   1.00 15.00 ?  281 PRO A O    4  
ATOM   2295  C CB   . PRO A 1 3  ? -12.188 6.640   4.296   1.00 15.00 ?  281 PRO A CB   4  
ATOM   2296  C CG   . PRO A 1 3  ? -12.948 5.371   4.084   1.00 15.00 ?  281 PRO A CG   4  
ATOM   2297  C CD   . PRO A 1 3  ? -13.201 5.259   2.599   1.00 15.00 ?  281 PRO A CD   4  
ATOM   2298  H HA   . PRO A 1 3  ? -11.215 7.882   2.846   1.00 15.00 ?  281 PRO A HA   4  
ATOM   2299  H HB2  . PRO A 1 3  ? -11.508 6.561   5.131   1.00 15.00 ?  281 PRO A HB2  4  
ATOM   2300  H HB3  . PRO A 1 3  ? -12.852 7.478   4.440   1.00 15.00 ?  281 PRO A HB3  4  
ATOM   2301  H HG2  . PRO A 1 3  ? -12.359 4.532   4.425   1.00 15.00 ?  281 PRO A HG2  4  
ATOM   2302  H HG3  . PRO A 1 3  ? -13.884 5.412   4.619   1.00 15.00 ?  281 PRO A HG3  4  
ATOM   2303  H HD2  . PRO A 1 3  ? -12.943 4.271   2.246   1.00 15.00 ?  281 PRO A HD2  4  
ATOM   2304  H HD3  . PRO A 1 3  ? -14.233 5.481   2.377   1.00 15.00 ?  281 PRO A HD3  4  
ATOM   2305  N N    . LEU A 1 4  ? -9.012  6.842   3.434   1.00 15.00 ?  282 LEU A N    4  
ATOM   2306  C CA   . LEU A 1 4  ? -7.692  6.277   3.671   1.00 15.00 ?  282 LEU A CA   4  
ATOM   2307  C C    . LEU A 1 4  ? -7.315  6.457   5.140   1.00 15.00 ?  282 LEU A C    4  
ATOM   2308  O O    . LEU A 1 4  ? -7.145  7.585   5.608   1.00 15.00 ?  282 LEU A O    4  
ATOM   2309  C CB   . LEU A 1 4  ? -6.647  6.956   2.779   1.00 15.00 ?  282 LEU A CB   4  
ATOM   2310  C CG   . LEU A 1 4  ? -5.258  6.309   2.795   1.00 15.00 ?  282 LEU A CG   4  
ATOM   2311  C CD1  . LEU A 1 4  ? -5.256  5.009   2.006   1.00 15.00 ?  282 LEU A CD1  4  
ATOM   2312  C CD2  . LEU A 1 4  ? -4.206  7.267   2.261   1.00 15.00 ?  282 LEU A CD2  4  
ATOM   2313  H H    . LEU A 1 4  ? -9.137  7.818   3.531   1.00 15.00 ?  282 LEU A H    4  
ATOM   2314  H HA   . LEU A 1 4  ? -7.730  5.223   3.442   1.00 15.00 ?  282 LEU A HA   4  
ATOM   2315  H HB2  . LEU A 1 4  ? -7.014  6.950   1.764   1.00 15.00 ?  282 LEU A HB2  4  
ATOM   2316  H HB3  . LEU A 1 4  ? -6.544  7.982   3.101   1.00 15.00 ?  282 LEU A HB3  4  
ATOM   2317  H HG   . LEU A 1 4  ? -4.999  6.070   3.817   1.00 15.00 ?  282 LEU A HG   4  
ATOM   2318  H HD11 . LEU A 1 4  ? -5.705  5.175   1.037   1.00 15.00 ?  282 LEU A HD11 4  
ATOM   2319  H HD12 . LEU A 1 4  ? -5.818  4.258   2.542   1.00 15.00 ?  282 LEU A HD12 4  
ATOM   2320  H HD13 . LEU A 1 4  ? -4.237  4.670   1.874   1.00 15.00 ?  282 LEU A HD13 4  
ATOM   2321  H HD21 . LEU A 1 4  ? -3.268  6.744   2.147   1.00 15.00 ?  282 LEU A HD21 4  
ATOM   2322  H HD22 . LEU A 1 4  ? -4.076  8.080   2.959   1.00 15.00 ?  282 LEU A HD22 4  
ATOM   2323  H HD23 . LEU A 1 4  ? -4.520  7.658   1.305   1.00 15.00 ?  282 LEU A HD23 4  
ATOM   2324  N N    . PRO A 1 5  ? -7.206  5.352   5.889   1.00 15.00 ?  283 PRO A N    4  
ATOM   2325  C CA   . PRO A 1 5  ? -6.891  5.385   7.324   1.00 15.00 ?  283 PRO A CA   4  
ATOM   2326  C C    . PRO A 1 5  ? -5.503  5.964   7.612   1.00 15.00 ?  283 PRO A C    4  
ATOM   2327  O O    . PRO A 1 5  ? -4.523  5.614   6.951   1.00 15.00 ?  283 PRO A O    4  
ATOM   2328  C CB   . PRO A 1 5  ? -6.951  3.909   7.742   1.00 15.00 ?  283 PRO A CB   4  
ATOM   2329  C CG   . PRO A 1 5  ? -7.708  3.225   6.657   1.00 15.00 ?  283 PRO A CG   4  
ATOM   2330  C CD   . PRO A 1 5  ? -7.383  3.976   5.402   1.00 15.00 ?  283 PRO A CD   4  
ATOM   2331  H HA   . PRO A 1 5  ? -7.632  5.947   7.874   1.00 15.00 ?  283 PRO A HA   4  
ATOM   2332  H HB2  . PRO A 1 5  ? -5.947  3.519   7.833   1.00 15.00 ?  283 PRO A HB2  4  
ATOM   2333  H HB3  . PRO A 1 5  ? -7.461  3.824   8.690   1.00 15.00 ?  283 PRO A HB3  4  
ATOM   2334  H HG2  . PRO A 1 5  ? -7.387  2.197   6.574   1.00 15.00 ?  283 PRO A HG2  4  
ATOM   2335  H HG3  . PRO A 1 5  ? -8.768  3.276   6.860   1.00 15.00 ?  283 PRO A HG3  4  
ATOM   2336  H HD2  . PRO A 1 5  ? -6.471  3.600   4.960   1.00 15.00 ?  283 PRO A HD2  4  
ATOM   2337  H HD3  . PRO A 1 5  ? -8.200  3.917   4.700   1.00 15.00 ?  283 PRO A HD3  4  
ATOM   2338  N N    . PRO A 1 6  ? -5.407  6.859   8.609   1.00 15.00 ?  284 PRO A N    4  
ATOM   2339  C CA   . PRO A 1 6  ? -4.131  7.443   9.033   1.00 15.00 ?  284 PRO A CA   4  
ATOM   2340  C C    . PRO A 1 6  ? -3.136  6.371   9.472   1.00 15.00 ?  284 PRO A C    4  
ATOM   2341  O O    . PRO A 1 6  ? -3.417  5.576   10.374  1.00 15.00 ?  284 PRO A O    4  
ATOM   2342  C CB   . PRO A 1 6  ? -4.509  8.350   10.213  1.00 15.00 ?  284 PRO A CB   4  
ATOM   2343  C CG   . PRO A 1 6  ? -5.866  7.902   10.638  1.00 15.00 ?  284 PRO A CG   4  
ATOM   2344  C CD   . PRO A 1 6  ? -6.534  7.373   9.402   1.00 15.00 ?  284 PRO A CD   4  
ATOM   2345  H HA   . PRO A 1 6  ? -3.689  8.038   8.246   1.00 15.00 ?  284 PRO A HA   4  
ATOM   2346  H HB2  . PRO A 1 6  ? -3.787  8.228   11.007  1.00 15.00 ?  284 PRO A HB2  4  
ATOM   2347  H HB3  . PRO A 1 6  ? -4.519  9.379   9.887   1.00 15.00 ?  284 PRO A HB3  4  
ATOM   2348  H HG2  . PRO A 1 6  ? -5.780  7.122   11.381  1.00 15.00 ?  284 PRO A HG2  4  
ATOM   2349  H HG3  . PRO A 1 6  ? -6.421  8.740   11.035  1.00 15.00 ?  284 PRO A HG3  4  
ATOM   2350  H HD2  . PRO A 1 6  ? -7.223  6.581   9.654   1.00 15.00 ?  284 PRO A HD2  4  
ATOM   2351  H HD3  . PRO A 1 6  ? -7.043  8.168   8.878   1.00 15.00 ?  284 PRO A HD3  4  
ATOM   2352  N N    . GLY A 1 7  ? -1.982  6.344   8.823   1.00 15.00 ?  285 GLY A N    4  
ATOM   2353  C CA   . GLY A 1 7  ? -1.001  5.309   9.089   1.00 15.00 ?  285 GLY A CA   4  
ATOM   2354  C C    . GLY A 1 7  ? -0.826  4.395   7.897   1.00 15.00 ?  285 GLY A C    4  
ATOM   2355  O O    . GLY A 1 7  ? 0.071   3.551   7.868   1.00 15.00 ?  285 GLY A O    4  
ATOM   2356  H H    . GLY A 1 7  ? -1.790  7.034   8.154   1.00 15.00 ?  285 GLY A H    4  
ATOM   2357  H HA2  . GLY A 1 7  ? -0.054  5.774   9.322   1.00 15.00 ?  285 GLY A HA2  4  
ATOM   2358  H HA3  . GLY A 1 7  ? -1.326  4.724   9.936   1.00 15.00 ?  285 GLY A HA3  4  
ATOM   2359  N N    . TRP A 1 8  ? -1.696  4.571   6.913   1.00 15.00 ?  286 TRP A N    4  
ATOM   2360  C CA   . TRP A 1 8  ? -1.625  3.818   5.672   1.00 15.00 ?  286 TRP A CA   4  
ATOM   2361  C C    . TRP A 1 8  ? -0.767  4.542   4.664   1.00 15.00 ?  286 TRP A C    4  
ATOM   2362  O O    . TRP A 1 8  ? -1.151  5.591   4.143   1.00 15.00 ?  286 TRP A O    4  
ATOM   2363  C CB   . TRP A 1 8  ? -3.027  3.617   5.072   1.00 15.00 ?  286 TRP A CB   4  
ATOM   2364  C CG   . TRP A 1 8  ? -3.744  2.418   5.594   1.00 15.00 ?  286 TRP A CG   4  
ATOM   2365  C CD1  . TRP A 1 8  ? -3.912  2.067   6.903   1.00 15.00 ?  286 TRP A CD1  4  
ATOM   2366  C CD2  . TRP A 1 8  ? -4.385  1.399   4.814   1.00 15.00 ?  286 TRP A CD2  4  
ATOM   2367  N NE1  . TRP A 1 8  ? -4.600  0.884   6.987   1.00 15.00 ?  286 TRP A NE1  4  
ATOM   2368  C CE2  . TRP A 1 8  ? -4.898  0.450   5.723   1.00 15.00 ?  286 TRP A CE2  4  
ATOM   2369  C CE3  . TRP A 1 8  ? -4.573  1.181   3.436   1.00 15.00 ?  286 TRP A CE3  4  
ATOM   2370  C CZ2  . TRP A 1 8  ? -5.575  -0.692  5.306   1.00 15.00 ?  286 TRP A CZ2  4  
ATOM   2371  C CZ3  . TRP A 1 8  ? -5.239  0.041   3.035   1.00 15.00 ?  286 TRP A CZ3  4  
ATOM   2372  C CH2  . TRP A 1 8  ? -5.728  -0.883  3.963   1.00 15.00 ?  286 TRP A CH2  4  
ATOM   2373  H H    . TRP A 1 8  ? -2.413  5.228   7.026   1.00 15.00 ?  286 TRP A H    4  
ATOM   2374  H HA   . TRP A 1 8  ? -1.175  2.854   5.882   1.00 15.00 ?  286 TRP A HA   4  
ATOM   2375  H HB2  . TRP A 1 8  ? -3.632  4.487   5.286   1.00 15.00 ?  286 TRP A HB2  4  
ATOM   2376  H HB3  . TRP A 1 8  ? -2.934  3.510   4.000   1.00 15.00 ?  286 TRP A HB3  4  
ATOM   2377  H HD1  . TRP A 1 8  ? -3.545  2.645   7.739   1.00 15.00 ?  286 TRP A HD1  4  
ATOM   2378  H HE1  . TRP A 1 8  ? -4.834  0.421   7.820   1.00 15.00 ?  286 TRP A HE1  4  
ATOM   2379  H HE3  . TRP A 1 8  ? -4.212  1.906   2.657   1.00 15.00 ?  286 TRP A HE3  4  
ATOM   2380  H HZ2  . TRP A 1 8  ? -5.960  -1.416  6.009   1.00 15.00 ?  286 TRP A HZ2  4  
ATOM   2381  H HZ3  . TRP A 1 8  ? -5.348  -0.163  1.976   1.00 15.00 ?  286 TRP A HZ3  4  
ATOM   2382  H HH2  . TRP A 1 8  ? -6.240  -1.761  3.595   1.00 15.00 ?  286 TRP A HH2  4  
ATOM   2383  N N    . GLU A 1 9  ? 0.398   3.993   4.393   1.00 15.00 ?  287 GLU A N    4  
ATOM   2384  C CA   . GLU A 1 9  ? 1.216   4.507   3.331   1.00 15.00 ?  287 GLU A CA   4  
ATOM   2385  C C    . GLU A 1 9  ? 0.847   3.777   2.060   1.00 15.00 ?  287 GLU A C    4  
ATOM   2386  O O    . GLU A 1 9  ? 0.995   2.562   1.957   1.00 15.00 ?  287 GLU A O    4  
ATOM   2387  C CB   . GLU A 1 9  ? 2.702   4.352   3.661   1.00 15.00 ?  287 GLU A CB   4  
ATOM   2388  C CG   . GLU A 1 9  ? 3.267   5.512   4.465   1.00 15.00 ?  287 GLU A CG   4  
ATOM   2389  C CD   . GLU A 1 9  ? 2.520   5.768   5.759   1.00 15.00 ?  287 GLU A CD   4  
ATOM   2390  O OE1  . GLU A 1 9  ? 2.715   5.001   6.724   1.00 15.00 -1 287 GLU A OE1  4  
ATOM   2391  O OE2  . GLU A 1 9  ? 1.754   6.752   5.816   1.00 15.00 ?  287 GLU A OE2  4  
ATOM   2392  H H    . GLU A 1 9  ? 0.715   3.218   4.914   1.00 15.00 ?  287 GLU A H    4  
ATOM   2393  H HA   . GLU A 1 9  ? 0.984   5.557   3.212   1.00 15.00 ?  287 GLU A HA   4  
ATOM   2394  H HB2  . GLU A 1 9  ? 2.839   3.446   4.233   1.00 15.00 ?  287 GLU A HB2  4  
ATOM   2395  H HB3  . GLU A 1 9  ? 3.262   4.271   2.742   1.00 15.00 ?  287 GLU A HB3  4  
ATOM   2396  H HG2  . GLU A 1 9  ? 4.296   5.292   4.705   1.00 15.00 ?  287 GLU A HG2  4  
ATOM   2397  H HG3  . GLU A 1 9  ? 3.227   6.406   3.860   1.00 15.00 ?  287 GLU A HG3  4  
ATOM   2398  N N    . VAL A 1 10 ? 0.320   4.517   1.111   1.00 15.00 ?  288 VAL A N    4  
ATOM   2399  C CA   . VAL A 1 10 ? -0.113  3.932   -0.135  1.00 15.00 ?  288 VAL A CA   4  
ATOM   2400  C C    . VAL A 1 10 ? 1.042   3.940   -1.120  1.00 15.00 ?  288 VAL A C    4  
ATOM   2401  O O    . VAL A 1 10 ? 1.415   4.980   -1.666  1.00 15.00 ?  288 VAL A O    4  
ATOM   2402  C CB   . VAL A 1 10 ? -1.354  4.669   -0.700  1.00 15.00 ?  288 VAL A CB   4  
ATOM   2403  C CG1  . VAL A 1 10 ? -1.177  6.178   -0.645  1.00 15.00 ?  288 VAL A CG1  4  
ATOM   2404  C CG2  . VAL A 1 10 ? -1.657  4.221   -2.120  1.00 15.00 ?  288 VAL A CG2  4  
ATOM   2405  H H    . VAL A 1 10 ? 0.221   5.481   1.251   1.00 15.00 ?  288 VAL A H    4  
ATOM   2406  H HA   . VAL A 1 10 ? -0.390  2.905   0.062   1.00 15.00 ?  288 VAL A HA   4  
ATOM   2407  H HB   . VAL A 1 10 ? -2.202  4.413   -0.083  1.00 15.00 ?  288 VAL A HB   4  
ATOM   2408  H HG11 . VAL A 1 10 ? -0.422  6.479   -1.357  1.00 15.00 ?  288 VAL A HG11 4  
ATOM   2409  H HG12 . VAL A 1 10 ? -0.869  6.466   0.348   1.00 15.00 ?  288 VAL A HG12 4  
ATOM   2410  H HG13 . VAL A 1 10 ? -2.116  6.656   -0.884  1.00 15.00 ?  288 VAL A HG13 4  
ATOM   2411  H HG21 . VAL A 1 10 ? -0.806  4.429   -2.752  1.00 15.00 ?  288 VAL A HG21 4  
ATOM   2412  H HG22 . VAL A 1 10 ? -2.518  4.756   -2.491  1.00 15.00 ?  288 VAL A HG22 4  
ATOM   2413  H HG23 . VAL A 1 10 ? -1.861  3.160   -2.128  1.00 15.00 ?  288 VAL A HG23 4  
ATOM   2414  N N    . ARG A 1 11 ? 1.649   2.780   -1.304  1.00 15.00 ?  289 ARG A N    4  
ATOM   2415  C CA   . ARG A 1 11 ? 2.813   2.689   -2.146  1.00 15.00 ?  289 ARG A CA   4  
ATOM   2416  C C    . ARG A 1 11 ? 2.371   2.219   -3.523  1.00 15.00 ?  289 ARG A C    4  
ATOM   2417  O O    . ARG A 1 11 ? 2.174   1.034   -3.768  1.00 15.00 ?  289 ARG A O    4  
ATOM   2418  C CB   . ARG A 1 11 ? 3.872   1.778   -1.490  1.00 15.00 ?  289 ARG A CB   4  
ATOM   2419  C CG   . ARG A 1 11 ? 5.311   2.058   -1.920  1.00 15.00 ?  289 ARG A CG   4  
ATOM   2420  C CD   . ARG A 1 11 ? 5.555   1.747   -3.386  1.00 15.00 ?  289 ARG A CD   4  
ATOM   2421  N NE   . ARG A 1 11 ? 6.893   2.144   -3.828  1.00 15.00 ?  289 ARG A NE   4  
ATOM   2422  C CZ   . ARG A 1 11 ? 7.885   1.289   -4.078  1.00 15.00 ?  289 ARG A CZ   4  
ATOM   2423  N NH1  . ARG A 1 11 ? 7.747   -0.001  -3.811  1.00 15.00 1  289 ARG A NH1  4  
ATOM   2424  N NH2  . ARG A 1 11 ? 9.033   1.731   -4.572  1.00 15.00 ?  289 ARG A NH2  4  
ATOM   2425  H H    . ARG A 1 11 ? 1.289   1.961   -0.884  1.00 15.00 ?  289 ARG A H    4  
ATOM   2426  H HA   . ARG A 1 11 ? 3.219   3.687   -2.241  1.00 15.00 ?  289 ARG A HA   4  
ATOM   2427  H HB2  . ARG A 1 11 ? 3.819   1.921   -0.420  1.00 15.00 ?  289 ARG A HB2  4  
ATOM   2428  H HB3  . ARG A 1 11 ? 3.642   0.743   -1.702  1.00 15.00 ?  289 ARG A HB3  4  
ATOM   2429  H HG2  . ARG A 1 11 ? 5.529   3.102   -1.746  1.00 15.00 ?  289 ARG A HG2  4  
ATOM   2430  H HG3  . ARG A 1 11 ? 5.972   1.449   -1.317  1.00 15.00 ?  289 ARG A HG3  4  
ATOM   2431  H HD2  . ARG A 1 11 ? 5.438   0.684   -3.537  1.00 15.00 ?  289 ARG A HD2  4  
ATOM   2432  H HD3  . ARG A 1 11 ? 4.820   2.275   -3.978  1.00 15.00 ?  289 ARG A HD3  4  
ATOM   2433  H HE   . ARG A 1 11 ? 7.051   3.102   -3.985  1.00 15.00 ?  289 ARG A HE   4  
ATOM   2434  H HH11 . ARG A 1 11 ? 6.894   -0.351  -3.410  1.00 15.00 ?  289 ARG A HH11 4  
ATOM   2435  H HH12 . ARG A 1 11 ? 8.499   -0.639  -4.013  1.00 15.00 ?  289 ARG A HH12 4  
ATOM   2436  H HH21 . ARG A 1 11 ? 9.159   2.723   -4.762  1.00 15.00 ?  289 ARG A HH21 4  
ATOM   2437  H HH22 . ARG A 1 11 ? 9.781   1.092   -4.763  1.00 15.00 ?  289 ARG A HH22 4  
ATOM   2438  N N    . SER A 1 12 ? 2.119   3.185   -4.386  1.00 15.00 ?  290 SER A N    4  
ATOM   2439  C CA   . SER A 1 12 ? 1.644   2.920   -5.727  1.00 15.00 ?  290 SER A CA   4  
ATOM   2440  C C    . SER A 1 12 ? 2.809   2.888   -6.703  1.00 15.00 ?  290 SER A C    4  
ATOM   2441  O O    . SER A 1 12 ? 3.627   3.804   -6.739  1.00 15.00 ?  290 SER A O    4  
ATOM   2442  C CB   . SER A 1 12 ? 0.622   3.989   -6.105  1.00 15.00 ?  290 SER A CB   4  
ATOM   2443  O OG   . SER A 1 12 ? 0.893   5.203   -5.420  1.00 15.00 ?  290 SER A OG   4  
ATOM   2444  H H    . SER A 1 12 ? 2.251   4.120   -4.112  1.00 15.00 ?  290 SER A H    4  
ATOM   2445  H HA   . SER A 1 12 ? 1.161   1.954   -5.726  1.00 15.00 ?  290 SER A HA   4  
ATOM   2446  H HB2  . SER A 1 12 ? 0.662   4.169   -7.170  1.00 15.00 ?  290 SER A HB2  4  
ATOM   2447  H HB3  . SER A 1 12 ? -0.363  3.647   -5.829  1.00 15.00 ?  290 SER A HB3  4  
ATOM   2448  H HG   . SER A 1 12 ? 0.770   5.953   -6.020  1.00 15.00 ?  290 SER A HG   4  
ATOM   2449  N N    . THR A 1 13 ? 2.889   1.827   -7.486  1.00 15.00 ?  291 THR A N    4  
ATOM   2450  C CA   . THR A 1 13 ? 4.026   1.636   -8.363  1.00 15.00 ?  291 THR A CA   4  
ATOM   2451  C C    . THR A 1 13 ? 3.625   1.702   -9.833  1.00 15.00 ?  291 THR A C    4  
ATOM   2452  O O    . THR A 1 13 ? 2.551   1.219   -10.224 1.00 15.00 ?  291 THR A O    4  
ATOM   2453  C CB   . THR A 1 13 ? 4.729   0.298   -8.064  1.00 15.00 ?  291 THR A CB   4  
ATOM   2454  O OG1  . THR A 1 13 ? 3.790   -0.784  -8.152  1.00 15.00 ?  291 THR A OG1  4  
ATOM   2455  C CG2  . THR A 1 13 ? 5.346   0.327   -6.674  1.00 15.00 ?  291 THR A CG2  4  
ATOM   2456  H H    . THR A 1 13 ? 2.167   1.164   -7.481  1.00 15.00 ?  291 THR A H    4  
ATOM   2457  H HA   . THR A 1 13 ? 4.728   2.431   -8.163  1.00 15.00 ?  291 THR A HA   4  
ATOM   2458  H HB   . THR A 1 13 ? 5.515   0.148   -8.790  1.00 15.00 ?  291 THR A HB   4  
ATOM   2459  H HG1  . THR A 1 13 ? 3.088   -0.655  -7.503  1.00 15.00 ?  291 THR A HG1  4  
ATOM   2460  H HG21 . THR A 1 13 ? 4.561   0.322   -5.933  1.00 15.00 ?  291 THR A HG21 4  
ATOM   2461  H HG22 . THR A 1 13 ? 5.939   1.227   -6.558  1.00 15.00 ?  291 THR A HG22 4  
ATOM   2462  H HG23 . THR A 1 13 ? 5.975   -0.542  -6.539  1.00 15.00 ?  291 THR A HG23 4  
ATOM   2463  N N    . VAL A 1 14 ? 4.518   2.287   -10.635 1.00 15.00 ?  292 VAL A N    4  
ATOM   2464  C CA   . VAL A 1 14 ? 4.304   2.497   -12.068 1.00 15.00 ?  292 VAL A CA   4  
ATOM   2465  C C    . VAL A 1 14 ? 4.164   1.162   -12.803 1.00 15.00 ?  292 VAL A C    4  
ATOM   2466  O O    . VAL A 1 14 ? 3.715   1.107   -13.949 1.00 15.00 ?  292 VAL A O    4  
ATOM   2467  C CB   . VAL A 1 14 ? 5.464   3.312   -12.687 1.00 15.00 ?  292 VAL A CB   4  
ATOM   2468  C CG1  . VAL A 1 14 ? 5.130   3.765   -14.101 1.00 15.00 ?  292 VAL A CG1  4  
ATOM   2469  C CG2  . VAL A 1 14 ? 5.798   4.512   -11.813 1.00 15.00 ?  292 VAL A CG2  4  
ATOM   2470  H H    . VAL A 1 14 ? 5.370   2.586   -10.243 1.00 15.00 ?  292 VAL A H    4  
ATOM   2471  H HA   . VAL A 1 14 ? 3.390   3.059   -12.188 1.00 15.00 ?  292 VAL A HA   4  
ATOM   2472  H HB   . VAL A 1 14 ? 6.337   2.678   -12.734 1.00 15.00 ?  292 VAL A HB   4  
ATOM   2473  H HG11 . VAL A 1 14 ? 5.956   4.333   -14.501 1.00 15.00 ?  292 VAL A HG11 4  
ATOM   2474  H HG12 . VAL A 1 14 ? 4.245   4.385   -14.079 1.00 15.00 ?  292 VAL A HG12 4  
ATOM   2475  H HG13 . VAL A 1 14 ? 4.949   2.902   -14.725 1.00 15.00 ?  292 VAL A HG13 4  
ATOM   2476  H HG21 . VAL A 1 14 ? 6.097   4.171   -10.833 1.00 15.00 ?  292 VAL A HG21 4  
ATOM   2477  H HG22 . VAL A 1 14 ? 4.927   5.144   -11.724 1.00 15.00 ?  292 VAL A HG22 4  
ATOM   2478  H HG23 . VAL A 1 14 ? 6.604   5.071   -12.263 1.00 15.00 ?  292 VAL A HG23 4  
ATOM   2479  N N    . SER A 1 15 ? 4.559   0.087   -12.130 1.00 15.00 ?  293 SER A N    4  
ATOM   2480  C CA   . SER A 1 15 ? 4.326   -1.269  -12.613 1.00 15.00 ?  293 SER A CA   4  
ATOM   2481  C C    . SER A 1 15 ? 2.822   -1.509  -12.829 1.00 15.00 ?  293 SER A C    4  
ATOM   2482  O O    . SER A 1 15 ? 2.415   -2.482  -13.468 1.00 15.00 ?  293 SER A O    4  
ATOM   2483  C CB   . SER A 1 15 ? 4.912   -2.286  -11.629 1.00 15.00 ?  293 SER A CB   4  
ATOM   2484  O OG   . SER A 1 15 ? 4.880   -3.599  -12.156 1.00 15.00 ?  293 SER A OG   4  
ATOM   2485  H H    . SER A 1 15 ? 5.039   0.211   -11.281 1.00 15.00 ?  293 SER A H    4  
ATOM   2486  H HA   . SER A 1 15 ? 4.829   -1.368  -13.564 1.00 15.00 ?  293 SER A HA   4  
ATOM   2487  H HB2  . SER A 1 15 ? 5.938   -2.023  -11.416 1.00 15.00 ?  293 SER A HB2  4  
ATOM   2488  H HB3  . SER A 1 15 ? 4.340   -2.265  -10.714 1.00 15.00 ?  293 SER A HB3  4  
ATOM   2489  H HG   . SER A 1 15 ? 5.470   -3.657  -12.924 1.00 15.00 ?  293 SER A HG   4  
ATOM   2490  N N    . GLY A 1 16 ? 2.006   -0.617  -12.274 1.00 15.00 ?  294 GLY A N    4  
ATOM   2491  C CA   . GLY A 1 16 ? 0.575   -0.680  -12.469 1.00 15.00 ?  294 GLY A CA   4  
ATOM   2492  C C    . GLY A 1 16 ? -0.133  -1.503  -11.420 1.00 15.00 ?  294 GLY A C    4  
ATOM   2493  O O    . GLY A 1 16 ? -1.047  -2.268  -11.733 1.00 15.00 ?  294 GLY A O    4  
ATOM   2494  H H    . GLY A 1 16 ? 2.390   0.103   -11.725 1.00 15.00 ?  294 GLY A H    4  
ATOM   2495  H HA2  . GLY A 1 16 ? 0.178   0.324   -12.448 1.00 15.00 ?  294 GLY A HA2  4  
ATOM   2496  H HA3  . GLY A 1 16 ? 0.379   -1.110  -13.440 1.00 15.00 ?  294 GLY A HA3  4  
ATOM   2497  N N    . ARG A 1 17 ? 0.298   -1.367  -10.174 1.00 15.00 ?  295 ARG A N    4  
ATOM   2498  C CA   . ARG A 1 17 ? -0.434  -1.959  -9.060  1.00 15.00 ?  295 ARG A CA   4  
ATOM   2499  C C    . ARG A 1 17 ? -0.243  -1.138  -7.791  1.00 15.00 ?  295 ARG A C    4  
ATOM   2500  O O    . ARG A 1 17 ? 0.872   -0.706  -7.472  1.00 15.00 ?  295 ARG A O    4  
ATOM   2501  C CB   . ARG A 1 17 ? -0.058  -3.437  -8.812  1.00 15.00 ?  295 ARG A CB   4  
ATOM   2502  C CG   . ARG A 1 17 ? 1.386   -3.698  -8.408  1.00 15.00 ?  295 ARG A CG   4  
ATOM   2503  C CD   . ARG A 1 17 ? 2.324   -3.687  -9.602  1.00 15.00 ?  295 ARG A CD   4  
ATOM   2504  N NE   . ARG A 1 17 ? 1.843   -4.533  -10.701 1.00 15.00 ?  295 ARG A NE   4  
ATOM   2505  C CZ   . ARG A 1 17 ? 2.542   -5.542  -11.229 1.00 15.00 ?  295 ARG A CZ   4  
ATOM   2506  N NH1  . ARG A 1 17 ? 3.690   -5.916  -10.682 1.00 15.00 1  295 ARG A NH1  4  
ATOM   2507  N NH2  . ARG A 1 17 ? 2.071   -6.202  -12.278 1.00 15.00 ?  295 ARG A NH2  4  
ATOM   2508  H H    . ARG A 1 17 ? 1.111   -0.833  -9.996  1.00 15.00 ?  295 ARG A H    4  
ATOM   2509  H HA   . ARG A 1 17 ? -1.483  -1.917  -9.321  1.00 15.00 ?  295 ARG A HA   4  
ATOM   2510  H HB2  . ARG A 1 17 ? -0.691  -3.821  -8.028  1.00 15.00 ?  295 ARG A HB2  4  
ATOM   2511  H HB3  . ARG A 1 17 ? -0.257  -3.995  -9.715  1.00 15.00 ?  295 ARG A HB3  4  
ATOM   2512  H HG2  . ARG A 1 17 ? 1.697   -2.931  -7.715  1.00 15.00 ?  295 ARG A HG2  4  
ATOM   2513  H HG3  . ARG A 1 17 ? 1.444   -4.664  -7.926  1.00 15.00 ?  295 ARG A HG3  4  
ATOM   2514  H HD2  . ARG A 1 17 ? 2.415   -2.678  -9.957  1.00 15.00 ?  295 ARG A HD2  4  
ATOM   2515  H HD3  . ARG A 1 17 ? 3.293   -4.044  -9.284  1.00 15.00 ?  295 ARG A HD3  4  
ATOM   2516  H HE   . ARG A 1 17 ? 0.965   -4.312  -11.084 1.00 15.00 ?  295 ARG A HE   4  
ATOM   2517  H HH11 . ARG A 1 17 ? 4.037   -5.443  -9.865  1.00 15.00 ?  295 ARG A HH11 4  
ATOM   2518  H HH12 . ARG A 1 17 ? 4.217   -6.683  -11.074 1.00 15.00 ?  295 ARG A HH12 4  
ATOM   2519  H HH21 . ARG A 1 17 ? 1.189   -5.949  -12.678 1.00 15.00 ?  295 ARG A HH21 4  
ATOM   2520  H HH22 . ARG A 1 17 ? 2.601   -6.963  -12.682 1.00 15.00 ?  295 ARG A HH22 4  
ATOM   2521  N N    . ILE A 1 18 ? -1.339  -0.923  -7.078  1.00 15.00 ?  296 ILE A N    4  
ATOM   2522  C CA   . ILE A 1 18 ? -1.296  -0.285  -5.775  1.00 15.00 ?  296 ILE A CA   4  
ATOM   2523  C C    . ILE A 1 18 ? -1.124  -1.377  -4.723  1.00 15.00 ?  296 ILE A C    4  
ATOM   2524  O O    . ILE A 1 18 ? -1.706  -2.457  -4.839  1.00 15.00 ?  296 ILE A O    4  
ATOM   2525  C CB   . ILE A 1 18 ? -2.580  0.562   -5.516  1.00 15.00 ?  296 ILE A CB   4  
ATOM   2526  C CG1  . ILE A 1 18 ? -2.396  1.517   -4.326  1.00 15.00 ?  296 ILE A CG1  4  
ATOM   2527  C CG2  . ILE A 1 18 ? -3.799  -0.330  -5.298  1.00 15.00 ?  296 ILE A CG2  4  
ATOM   2528  C CD1  . ILE A 1 18 ? -2.623  0.886   -2.966  1.00 15.00 ?  296 ILE A CD1  4  
ATOM   2529  H H    . ILE A 1 18 ? -2.210  -1.205  -7.443  1.00 15.00 ?  296 ILE A H    4  
ATOM   2530  H HA   . ILE A 1 18 ? -0.436  0.369   -5.747  1.00 15.00 ?  296 ILE A HA   4  
ATOM   2531  H HB   . ILE A 1 18 ? -2.765  1.151   -6.403  1.00 15.00 ?  296 ILE A HB   4  
ATOM   2532  H HG12 . ILE A 1 18 ? -1.388  1.901   -4.341  1.00 15.00 ?  296 ILE A HG12 4  
ATOM   2533  H HG13 . ILE A 1 18 ? -3.088  2.339   -4.429  1.00 15.00 ?  296 ILE A HG13 4  
ATOM   2534  H HG21 . ILE A 1 18 ? -3.935  -0.971  -6.156  1.00 15.00 ?  296 ILE A HG21 4  
ATOM   2535  H HG22 . ILE A 1 18 ? -4.677  0.285   -5.165  1.00 15.00 ?  296 ILE A HG22 4  
ATOM   2536  H HG23 . ILE A 1 18 ? -3.649  -0.936  -4.414  1.00 15.00 ?  296 ILE A HG23 4  
ATOM   2537  H HD11 . ILE A 1 18 ? -2.410  1.610   -2.192  1.00 15.00 ?  296 ILE A HD11 4  
ATOM   2538  H HD12 . ILE A 1 18 ? -1.973  0.032   -2.849  1.00 15.00 ?  296 ILE A HD12 4  
ATOM   2539  H HD13 . ILE A 1 18 ? -3.651  0.566   -2.886  1.00 15.00 ?  296 ILE A HD13 4  
ATOM   2540  N N    . TYR A 1 19 ? -0.297  -1.122  -3.724  1.00 15.00 ?  297 TYR A N    4  
ATOM   2541  C CA   . TYR A 1 19 ? 0.032   -2.156  -2.762  1.00 15.00 ?  297 TYR A CA   4  
ATOM   2542  C C    . TYR A 1 19 ? 0.330   -1.490  -1.445  1.00 15.00 ?  297 TYR A C    4  
ATOM   2543  O O    . TYR A 1 19 ? 1.076   -0.499  -1.377  1.00 15.00 ?  297 TYR A O    4  
ATOM   2544  C CB   . TYR A 1 19 ? 1.168   -3.085  -3.256  1.00 15.00 ?  297 TYR A CB   4  
ATOM   2545  C CG   . TYR A 1 19 ? 2.591   -2.690  -2.913  1.00 15.00 ?  297 TYR A CG   4  
ATOM   2546  C CD1  . TYR A 1 19 ? 3.221   -1.651  -3.574  1.00 15.00 ?  297 TYR A CD1  4  
ATOM   2547  C CD2  . TYR A 1 19 ? 3.317   -3.386  -1.944  1.00 15.00 ?  297 TYR A CD2  4  
ATOM   2548  C CE1  . TYR A 1 19 ? 4.522   -1.306  -3.279  1.00 15.00 ?  297 TYR A CE1  4  
ATOM   2549  C CE2  . TYR A 1 19 ? 4.618   -3.042  -1.644  1.00 15.00 ?  297 TYR A CE2  4  
ATOM   2550  C CZ   . TYR A 1 19 ? 5.215   -2.000  -2.314  1.00 15.00 ?  297 TYR A CZ   4  
ATOM   2551  O OH   . TYR A 1 19 ? 6.510   -1.647  -2.019  1.00 15.00 ?  297 TYR A OH   4  
ATOM   2552  H H    . TYR A 1 19 ? 0.001   -0.190  -3.553  1.00 15.00 ?  297 TYR A H    4  
ATOM   2553  H HA   . TYR A 1 19 ? -0.864  -2.751  -2.633  1.00 15.00 ?  297 TYR A HA   4  
ATOM   2554  H HB2  . TYR A 1 19 ? 1.008   -4.069  -2.848  1.00 15.00 ?  297 TYR A HB2  4  
ATOM   2555  H HB3  . TYR A 1 19 ? 1.103   -3.144  -4.334  1.00 15.00 ?  297 TYR A HB3  4  
ATOM   2556  H HD1  . TYR A 1 19 ? 2.675   -1.102  -4.327  1.00 15.00 ?  297 TYR A HD1  4  
ATOM   2557  H HD2  . TYR A 1 19 ? 2.854   -4.213  -1.424  1.00 15.00 ?  297 TYR A HD2  4  
ATOM   2558  H HE1  . TYR A 1 19 ? 4.994   -0.491  -3.808  1.00 15.00 ?  297 TYR A HE1  4  
ATOM   2559  H HE2  . TYR A 1 19 ? 5.162   -3.587  -0.886  1.00 15.00 ?  297 TYR A HE2  4  
ATOM   2560  H HH   . TYR A 1 19 ? 7.030   -2.447  -1.831  1.00 15.00 ?  297 TYR A HH   4  
ATOM   2561  N N    . PHE A 1 20 ? -0.290  -1.985  -0.409  1.00 15.00 ?  298 PHE A N    4  
ATOM   2562  C CA   . PHE A 1 20 ? -0.272  -1.288  0.829   1.00 15.00 ?  298 PHE A CA   4  
ATOM   2563  C C    . PHE A 1 20 ? 0.855   -1.633  1.737   1.00 15.00 ?  298 PHE A C    4  
ATOM   2564  O O    . PHE A 1 20 ? 1.198   -2.789  1.947   1.00 15.00 ?  298 PHE A O    4  
ATOM   2565  C CB   . PHE A 1 20 ? -1.580  -1.430  1.533   1.00 15.00 ?  298 PHE A CB   4  
ATOM   2566  C CG   . PHE A 1 20 ? -2.334  -0.209  1.281   1.00 15.00 ?  298 PHE A CG   4  
ATOM   2567  C CD1  . PHE A 1 20 ? -1.902  0.970   1.850   1.00 15.00 ?  298 PHE A CD1  4  
ATOM   2568  C CD2  . PHE A 1 20 ? -3.419  -0.206  0.438   1.00 15.00 ?  298 PHE A CD2  4  
ATOM   2569  C CE1  . PHE A 1 20 ? -2.542  2.135   1.591   1.00 15.00 ?  298 PHE A CE1  4  
ATOM   2570  C CE2  . PHE A 1 20 ? -4.073  0.964   0.181   1.00 15.00 ?  298 PHE A CE2  4  
ATOM   2571  C CZ   . PHE A 1 20 ? -3.628  2.127   0.763   1.00 15.00 ?  298 PHE A CZ   4  
ATOM   2572  H H    . PHE A 1 20 ? -0.819  -2.810  -0.495  1.00 15.00 ?  298 PHE A H    4  
ATOM   2573  H HA   . PHE A 1 20 ? -0.169  -0.245  0.571   1.00 15.00 ?  298 PHE A HA   4  
ATOM   2574  H HB2  . PHE A 1 20 ? -2.125  -2.278  1.144   1.00 15.00 ?  298 PHE A HB2  4  
ATOM   2575  H HB3  . PHE A 1 20 ? -1.427  -1.531  2.597   1.00 15.00 ?  298 PHE A HB3  4  
ATOM   2576  H HD1  . PHE A 1 20 ? -1.058  0.962   2.516   1.00 15.00 ?  298 PHE A HD1  4  
ATOM   2577  H HD2  . PHE A 1 20 ? -3.754  -1.128  -0.012  1.00 15.00 ?  298 PHE A HD2  4  
ATOM   2578  H HE1  . PHE A 1 20 ? -2.201  3.058   2.037   1.00 15.00 ?  298 PHE A HE1  4  
ATOM   2579  H HE2  . PHE A 1 20 ? -4.932  0.976   -0.472  1.00 15.00 ?  298 PHE A HE2  4  
ATOM   2580  H HZ   . PHE A 1 20 ? -4.132  3.015   0.588   1.00 15.00 ?  298 PHE A HZ   4  
ATOM   2581  N N    . VAL A 1 21 ? 1.377   -0.577  2.309   1.00 15.00 ?  299 VAL A N    4  
ATOM   2582  C CA   . VAL A 1 21 ? 2.466   -0.642  3.221   1.00 15.00 ?  299 VAL A CA   4  
ATOM   2583  C C    . VAL A 1 21 ? 2.165   0.279   4.405   1.00 15.00 ?  299 VAL A C    4  
ATOM   2584  O O    . VAL A 1 21 ? 2.457   1.474   4.396   1.00 15.00 ?  299 VAL A O    4  
ATOM   2585  C CB   . VAL A 1 21 ? 3.764   -0.230  2.494   1.00 15.00 ?  299 VAL A CB   4  
ATOM   2586  C CG1  . VAL A 1 21 ? 4.169   -1.297  1.482   1.00 15.00 ?  299 VAL A CG1  4  
ATOM   2587  C CG2  . VAL A 1 21 ? 3.560   1.086   1.766   1.00 15.00 ?  299 VAL A CG2  4  
ATOM   2588  H H    . VAL A 1 21 ? 0.998   0.305   2.106   1.00 15.00 ?  299 VAL A H    4  
ATOM   2589  H HA   . VAL A 1 21 ? 2.564   -1.660  3.570   1.00 15.00 ?  299 VAL A HA   4  
ATOM   2590  H HB   . VAL A 1 21 ? 4.556   -0.111  3.220   1.00 15.00 ?  299 VAL A HB   4  
ATOM   2591  H HG11 . VAL A 1 21 ? 3.421   -1.352  0.704   1.00 15.00 ?  299 VAL A HG11 4  
ATOM   2592  H HG12 . VAL A 1 21 ? 4.244   -2.254  1.971   1.00 15.00 ?  299 VAL A HG12 4  
ATOM   2593  H HG13 . VAL A 1 21 ? 5.122   -1.039  1.045   1.00 15.00 ?  299 VAL A HG13 4  
ATOM   2594  H HG21 . VAL A 1 21 ? 4.476   1.370   1.271   1.00 15.00 ?  299 VAL A HG21 4  
ATOM   2595  H HG22 . VAL A 1 21 ? 3.282   1.851   2.476   1.00 15.00 ?  299 VAL A HG22 4  
ATOM   2596  H HG23 . VAL A 1 21 ? 2.774   0.973   1.033   1.00 15.00 ?  299 VAL A HG23 4  
ATOM   2597  N N    . ASP A 1 22 ? 1.520   -0.269  5.410   1.00 15.00 ?  300 ASP A N    4  
ATOM   2598  C CA   . ASP A 1 22 ? 1.204   0.507   6.595   1.00 15.00 ?  300 ASP A CA   4  
ATOM   2599  C C    . ASP A 1 22 ? 2.354   0.375   7.578   1.00 15.00 ?  300 ASP A C    4  
ATOM   2600  O O    . ASP A 1 22 ? 2.736   -0.735  7.953   1.00 15.00 ?  300 ASP A O    4  
ATOM   2601  C CB   . ASP A 1 22 ? -0.149  0.064   7.195   1.00 15.00 ?  300 ASP A CB   4  
ATOM   2602  C CG   . ASP A 1 22 ? -0.068  -0.401  8.641   1.00 15.00 ?  300 ASP A CG   4  
ATOM   2603  O OD1  . ASP A 1 22 ? 0.024   0.451   9.545   1.00 15.00 -1 300 ASP A OD1  4  
ATOM   2604  O OD2  . ASP A 1 22 ? -0.102  -1.624  8.875   1.00 15.00 ?  300 ASP A OD2  4  
ATOM   2605  H H    . ASP A 1 22 ? 1.243   -1.209  5.356   1.00 15.00 ?  300 ASP A H    4  
ATOM   2606  H HA   . ASP A 1 22 ? 1.131   1.543   6.294   1.00 15.00 ?  300 ASP A HA   4  
ATOM   2607  H HB2  . ASP A 1 22 ? -0.834  0.896   7.153   1.00 15.00 ?  300 ASP A HB2  4  
ATOM   2608  H HB3  . ASP A 1 22 ? -0.549  -0.746  6.597   1.00 15.00 ?  300 ASP A HB3  4  
ATOM   2609  N N    . HIS A 1 23 ? 2.948   1.508   7.947   1.00 15.00 ?  301 HIS A N    4  
ATOM   2610  C CA   . HIS A 1 23 ? 4.130   1.492   8.802   1.00 15.00 ?  301 HIS A CA   4  
ATOM   2611  C C    . HIS A 1 23 ? 3.734   1.337   10.265  1.00 15.00 ?  301 HIS A C    4  
ATOM   2612  O O    . HIS A 1 23 ? 4.572   1.043   11.114  1.00 15.00 ?  301 HIS A O    4  
ATOM   2613  C CB   . HIS A 1 23 ? 4.958   2.779   8.684   1.00 15.00 ?  301 HIS A CB   4  
ATOM   2614  C CG   . HIS A 1 23 ? 5.359   3.227   7.304   1.00 15.00 ?  301 HIS A CG   4  
ATOM   2615  N ND1  . HIS A 1 23 ? 5.620   4.546   7.031   1.00 15.00 ?  301 HIS A ND1  4  
ATOM   2616  C CD2  . HIS A 1 23 ? 5.637   2.554   6.155   1.00 15.00 ?  301 HIS A CD2  4  
ATOM   2617  C CE1  . HIS A 1 23 ? 6.042   4.666   5.796   1.00 15.00 ?  301 HIS A CE1  4  
ATOM   2618  N NE2  . HIS A 1 23 ? 6.071   3.471   5.236   1.00 15.00 ?  301 HIS A NE2  4  
ATOM   2619  H H    . HIS A 1 23 ? 2.576   2.368   7.644   1.00 15.00 ?  301 HIS A H    4  
ATOM   2620  H HA   . HIS A 1 23 ? 4.739   0.650   8.512   1.00 15.00 ?  301 HIS A HA   4  
ATOM   2621  H HB2  . HIS A 1 23 ? 4.402   3.583   9.125   1.00 15.00 ?  301 HIS A HB2  4  
ATOM   2622  H HB3  . HIS A 1 23 ? 5.868   2.642   9.253   1.00 15.00 ?  301 HIS A HB3  4  
ATOM   2623  H HD1  . HIS A 1 23 ? 5.498   5.296   7.659   1.00 15.00 ?  301 HIS A HD1  4  
ATOM   2624  H HD2  . HIS A 1 23 ? 5.531   1.488   5.980   1.00 15.00 ?  301 HIS A HD2  4  
ATOM   2625  H HE1  . HIS A 1 23 ? 6.308   5.593   5.307   1.00 15.00 ?  301 HIS A HE1  4  
ATOM   2626  H HE2  . HIS A 1 23 ? 6.645   3.246   4.468   1.00 15.00 ?  301 HIS A HE2  4  
ATOM   2627  N N    . ASN A 1 24 ? 2.459   1.556   10.555  1.00 15.00 ?  302 ASN A N    4  
ATOM   2628  C CA   . ASN A 1 24 ? 1.979   1.574   11.932  1.00 15.00 ?  302 ASN A CA   4  
ATOM   2629  C C    . ASN A 1 24 ? 1.891   0.156   12.481  1.00 15.00 ?  302 ASN A C    4  
ATOM   2630  O O    . ASN A 1 24 ? 2.599   -0.202  13.425  1.00 15.00 ?  302 ASN A O    4  
ATOM   2631  C CB   . ASN A 1 24 ? 0.612   2.268   12.004  1.00 15.00 ?  302 ASN A CB   4  
ATOM   2632  C CG   . ASN A 1 24 ? 0.118   2.505   13.426  1.00 15.00 ?  302 ASN A CG   4  
ATOM   2633  O OD1  . ASN A 1 24 ? 0.407   1.745   14.349  1.00 15.00 ?  302 ASN A OD1  4  
ATOM   2634  N ND2  . ASN A 1 24 ? -0.642  3.574   13.610  1.00 15.00 ?  302 ASN A ND2  4  
ATOM   2635  H H    . ASN A 1 24 ? 1.814   1.686   9.823   1.00 15.00 ?  302 ASN A H    4  
ATOM   2636  H HA   . ASN A 1 24 ? 2.690   2.132   12.524  1.00 15.00 ?  302 ASN A HA   4  
ATOM   2637  H HB2  . ASN A 1 24 ? 0.679   3.226   11.510  1.00 15.00 ?  302 ASN A HB2  4  
ATOM   2638  H HB3  . ASN A 1 24 ? -0.116  1.659   11.489  1.00 15.00 ?  302 ASN A HB3  4  
ATOM   2639  H HD21 . ASN A 1 24 ? -0.841  4.142   12.837  1.00 15.00 ?  302 ASN A HD21 4  
ATOM   2640  H HD22 . ASN A 1 24 ? -0.968  3.759   14.518  1.00 15.00 ?  302 ASN A HD22 4  
ATOM   2641  N N    . ASN A 1 25 ? 1.030   -0.648  11.881  1.00 15.00 ?  303 ASN A N    4  
ATOM   2642  C CA   . ASN A 1 25 ? 0.855   -2.031  12.309  1.00 15.00 ?  303 ASN A CA   4  
ATOM   2643  C C    . ASN A 1 25 ? 1.757   -2.964  11.506  1.00 15.00 ?  303 ASN A C    4  
ATOM   2644  O O    . ASN A 1 25 ? 1.991   -4.107  11.901  1.00 15.00 ?  303 ASN A O    4  
ATOM   2645  C CB   . ASN A 1 25 ? -0.615  -2.449  12.162  1.00 15.00 ?  303 ASN A CB   4  
ATOM   2646  C CG   . ASN A 1 25 ? -0.877  -3.888  12.576  1.00 15.00 ?  303 ASN A CG   4  
ATOM   2647  O OD1  . ASN A 1 25 ? -1.100  -4.176  13.753  1.00 15.00 ?  303 ASN A OD1  4  
ATOM   2648  N ND2  . ASN A 1 25 ? -0.878  -4.799  11.611  1.00 15.00 ?  303 ASN A ND2  4  
ATOM   2649  H H    . ASN A 1 25 ? 0.488   -0.301  11.126  1.00 15.00 ?  303 ASN A H    4  
ATOM   2650  H HA   . ASN A 1 25 ? 1.134   -2.091  13.350  1.00 15.00 ?  303 ASN A HA   4  
ATOM   2651  H HB2  . ASN A 1 25 ? -1.226  -1.804  12.776  1.00 15.00 ?  303 ASN A HB2  4  
ATOM   2652  H HB3  . ASN A 1 25 ? -0.909  -2.334  11.129  1.00 15.00 ?  303 ASN A HB3  4  
ATOM   2653  H HD21 . ASN A 1 25 ? -0.710  -4.500  10.688  1.00 15.00 ?  303 ASN A HD21 4  
ATOM   2654  H HD22 . ASN A 1 25 ? -1.046  -5.736  11.855  1.00 15.00 ?  303 ASN A HD22 4  
ATOM   2655  N N    . ARG A 1 26 ? 2.282   -2.447  10.396  1.00 15.00 ?  304 ARG A N    4  
ATOM   2656  C CA   . ARG A 1 26 ? 3.019   -3.243  9.422   1.00 15.00 ?  304 ARG A CA   4  
ATOM   2657  C C    . ARG A 1 26 ? 2.090   -4.257  8.771   1.00 15.00 ?  304 ARG A C    4  
ATOM   2658  O O    . ARG A 1 26 ? 1.993   -5.410  9.199   1.00 15.00 ?  304 ARG A O    4  
ATOM   2659  C CB   . ARG A 1 26 ? 4.242   -3.927  10.040  1.00 15.00 ?  304 ARG A CB   4  
ATOM   2660  C CG   . ARG A 1 26 ? 4.990   -4.838  9.078   1.00 15.00 ?  304 ARG A CG   4  
ATOM   2661  C CD   . ARG A 1 26 ? 6.236   -5.411  9.724   1.00 15.00 ?  304 ARG A CD   4  
ATOM   2662  N NE   . ARG A 1 26 ? 5.936   -6.047  11.006  1.00 15.00 ?  304 ARG A NE   4  
ATOM   2663  C CZ   . ARG A 1 26 ? 6.773   -6.062  12.039  1.00 15.00 ?  304 ARG A CZ   4  
ATOM   2664  N NH1  . ARG A 1 26 ? 7.999   -5.570  11.909  1.00 15.00 1  304 ARG A NH1  4  
ATOM   2665  N NH2  . ARG A 1 26 ? 6.387   -6.584  13.192  1.00 15.00 ?  304 ARG A NH2  4  
ATOM   2666  H H    . ARG A 1 26 ? 2.155   -1.495  10.215  1.00 15.00 ?  304 ARG A H    4  
ATOM   2667  H HA   . ARG A 1 26 ? 3.360   -2.562  8.653   1.00 15.00 ?  304 ARG A HA   4  
ATOM   2668  H HB2  . ARG A 1 26 ? 4.928   -3.168  10.388  1.00 15.00 ?  304 ARG A HB2  4  
ATOM   2669  H HB3  . ARG A 1 26 ? 3.919   -4.520  10.884  1.00 15.00 ?  304 ARG A HB3  4  
ATOM   2670  H HG2  . ARG A 1 26 ? 4.340   -5.650  8.786   1.00 15.00 ?  304 ARG A HG2  4  
ATOM   2671  H HG3  . ARG A 1 26 ? 5.276   -4.269  8.204   1.00 15.00 ?  304 ARG A HG3  4  
ATOM   2672  H HD2  . ARG A 1 26 ? 6.673   -6.138  9.058   1.00 15.00 ?  304 ARG A HD2  4  
ATOM   2673  H HD3  . ARG A 1 26 ? 6.939   -4.609  9.889   1.00 15.00 ?  304 ARG A HD3  4  
ATOM   2674  H HE   . ARG A 1 26 ? 5.047   -6.460  11.108  1.00 15.00 ?  304 ARG A HE   4  
ATOM   2675  H HH11 . ARG A 1 26 ? 8.300   -5.189  11.026  1.00 15.00 ?  304 ARG A HH11 4  
ATOM   2676  H HH12 . ARG A 1 26 ? 8.633   -5.570  12.689  1.00 15.00 ?  304 ARG A HH12 4  
ATOM   2677  H HH21 . ARG A 1 26 ? 5.459   -6.975  13.285  1.00 15.00 ?  304 ARG A HH21 4  
ATOM   2678  H HH22 . ARG A 1 26 ? 7.012   -6.590  13.984  1.00 15.00 ?  304 ARG A HH22 4  
ATOM   2679  N N    . THR A 1 27 ? 1.354   -3.790  7.778   1.00 15.00 ?  305 THR A N    4  
ATOM   2680  C CA   . THR A 1 27 ? 0.414   -4.632  7.063   1.00 15.00 ?  305 THR A CA   4  
ATOM   2681  C C    . THR A 1 27 ? 0.513   -4.382  5.564   1.00 15.00 ?  305 THR A C    4  
ATOM   2682  O O    . THR A 1 27 ? 0.407   -3.241  5.107   1.00 15.00 ?  305 THR A O    4  
ATOM   2683  C CB   . THR A 1 27 ? -1.034  -4.361  7.521   1.00 15.00 ?  305 THR A CB   4  
ATOM   2684  O OG1  . THR A 1 27 ? -1.056  -4.029  8.916   1.00 15.00 ?  305 THR A OG1  4  
ATOM   2685  C CG2  . THR A 1 27 ? -1.912  -5.578  7.275   1.00 15.00 ?  305 THR A CG2  4  
ATOM   2686  H H    . THR A 1 27 ? 1.432   -2.839  7.533   1.00 15.00 ?  305 THR A H    4  
ATOM   2687  H HA   . THR A 1 27 ? 0.654   -5.664  7.270   1.00 15.00 ?  305 THR A HA   4  
ATOM   2688  H HB   . THR A 1 27 ? -1.428  -3.531  6.953   1.00 15.00 ?  305 THR A HB   4  
ATOM   2689  H HG1  . THR A 1 27 ? -0.639  -3.150  9.034   1.00 15.00 ?  305 THR A HG1  4  
ATOM   2690  H HG21 . THR A 1 27 ? -1.514  -6.426  7.815   1.00 15.00 ?  305 THR A HG21 4  
ATOM   2691  H HG22 . THR A 1 27 ? -1.929  -5.803  6.218   1.00 15.00 ?  305 THR A HG22 4  
ATOM   2692  H HG23 . THR A 1 27 ? -2.917  -5.373  7.615   1.00 15.00 ?  305 THR A HG23 4  
ATOM   2693  N N    . THR A 1 28 ? 0.738   -5.441  4.803   1.00 15.00 ?  306 THR A N    4  
ATOM   2694  C CA   . THR A 1 28 ? 0.801   -5.326  3.359   1.00 15.00 ?  306 THR A CA   4  
ATOM   2695  C C    . THR A 1 28 ? -0.466  -5.893  2.726   1.00 15.00 ?  306 THR A C    4  
ATOM   2696  O O    . THR A 1 28 ? -0.754  -7.086  2.848   1.00 15.00 ?  306 THR A O    4  
ATOM   2697  C CB   . THR A 1 28 ? 2.029   -6.053  2.788   1.00 15.00 ?  306 THR A CB   4  
ATOM   2698  O OG1  . THR A 1 28 ? 3.160   -5.870  3.653   1.00 15.00 ?  306 THR A OG1  4  
ATOM   2699  C CG2  . THR A 1 28 ? 2.359   -5.521  1.401   1.00 15.00 ?  306 THR A CG2  4  
ATOM   2700  H H    . THR A 1 28 ? 0.876   -6.316  5.223   1.00 15.00 ?  306 THR A H    4  
ATOM   2701  H HA   . THR A 1 28 ? 0.879   -4.276  3.110   1.00 15.00 ?  306 THR A HA   4  
ATOM   2702  H HB   . THR A 1 28 ? 1.806   -7.108  2.710   1.00 15.00 ?  306 THR A HB   4  
ATOM   2703  H HG1  . THR A 1 28 ? 3.976   -5.984  3.140   1.00 15.00 ?  306 THR A HG1  4  
ATOM   2704  H HG21 . THR A 1 28 ? 2.576   -4.464  1.463   1.00 15.00 ?  306 THR A HG21 4  
ATOM   2705  H HG22 . THR A 1 28 ? 1.515   -5.677  0.745   1.00 15.00 ?  306 THR A HG22 4  
ATOM   2706  H HG23 . THR A 1 28 ? 3.220   -6.042  1.010   1.00 15.00 ?  306 THR A HG23 4  
ATOM   2707  N N    . GLN A 1 29 ? -1.225  -5.035  2.056   1.00 15.00 ?  307 GLN A N    4  
ATOM   2708  C CA   . GLN A 1 29 ? -2.512  -5.429  1.493   1.00 15.00 ?  307 GLN A CA   4  
ATOM   2709  C C    . GLN A 1 29 ? -2.598  -5.056  0.016   1.00 15.00 ?  307 GLN A C    4  
ATOM   2710  O O    . GLN A 1 29 ? -2.286  -3.934  -0.358  1.00 15.00 ?  307 GLN A O    4  
ATOM   2711  C CB   . GLN A 1 29 ? -3.654  -4.729  2.243   1.00 15.00 ?  307 GLN A CB   4  
ATOM   2712  C CG   . GLN A 1 29 ? -3.611  -4.877  3.760   1.00 15.00 ?  307 GLN A CG   4  
ATOM   2713  C CD   . GLN A 1 29 ? -3.988  -6.263  4.261   1.00 15.00 ?  307 GLN A CD   4  
ATOM   2714  O OE1  . GLN A 1 29 ? -4.565  -6.397  5.339   1.00 15.00 ?  307 GLN A OE1  4  
ATOM   2715  N NE2  . GLN A 1 29 ? -3.641  -7.299  3.516   1.00 15.00 ?  307 GLN A NE2  4  
ATOM   2716  H H    . GLN A 1 29 ? -0.911  -4.112  1.934   1.00 15.00 ?  307 GLN A H    4  
ATOM   2717  H HA   . GLN A 1 29 ? -2.618  -6.498  1.598   1.00 15.00 ?  307 GLN A HA   4  
ATOM   2718  H HB2  . GLN A 1 29 ? -3.624  -3.675  2.010   1.00 15.00 ?  307 GLN A HB2  4  
ATOM   2719  H HB3  . GLN A 1 29 ? -4.593  -5.134  1.894   1.00 15.00 ?  307 GLN A HB3  4  
ATOM   2720  H HG2  . GLN A 1 29 ? -2.609  -4.657  4.096   1.00 15.00 ?  307 GLN A HG2  4  
ATOM   2721  H HG3  . GLN A 1 29 ? -4.293  -4.159  4.191   1.00 15.00 ?  307 GLN A HG3  4  
ATOM   2722  H HE21 . GLN A 1 29 ? -3.157  -7.131  2.687   1.00 15.00 ?  307 GLN A HE21 4  
ATOM   2723  H HE22 . GLN A 1 29 ? -3.885  -8.202  3.828   1.00 15.00 ?  307 GLN A HE22 4  
ATOM   2724  N N    . PHE A 1 30 ? -3.028  -5.991  -0.820  1.00 15.00 ?  308 PHE A N    4  
ATOM   2725  C CA   . PHE A 1 30 ? -3.347  -5.668  -2.208  1.00 15.00 ?  308 PHE A CA   4  
ATOM   2726  C C    . PHE A 1 30 ? -4.732  -5.027  -2.301  1.00 15.00 ?  308 PHE A C    4  
ATOM   2727  O O    . PHE A 1 30 ? -5.106  -4.463  -3.330  1.00 15.00 ?  308 PHE A O    4  
ATOM   2728  C CB   . PHE A 1 30 ? -3.229  -6.897  -3.125  1.00 15.00 ?  308 PHE A CB   4  
ATOM   2729  C CG   . PHE A 1 30 ? -1.851  -7.067  -3.719  1.00 15.00 ?  308 PHE A CG   4  
ATOM   2730  C CD1  . PHE A 1 30 ? -1.071  -5.952  -3.991  1.00 15.00 ?  308 PHE A CD1  4  
ATOM   2731  C CD2  . PHE A 1 30 ? -1.339  -8.323  -4.032  1.00 15.00 ?  308 PHE A CD2  4  
ATOM   2732  C CE1  . PHE A 1 30 ? 0.183   -6.082  -4.555  1.00 15.00 ?  308 PHE A CE1  4  
ATOM   2733  C CE2  . PHE A 1 30 ? -0.087  -8.450  -4.591  1.00 15.00 ?  308 PHE A CE2  4  
ATOM   2734  C CZ   . PHE A 1 30 ? 0.674   -7.330  -4.853  1.00 15.00 ?  308 PHE A CZ   4  
ATOM   2735  H H    . PHE A 1 30 ? -3.126  -6.913  -0.504  1.00 15.00 ?  308 PHE A H    4  
ATOM   2736  H HA   . PHE A 1 30 ? -2.622  -4.933  -2.531  1.00 15.00 ?  308 PHE A HA   4  
ATOM   2737  H HB2  . PHE A 1 30 ? -3.461  -7.786  -2.558  1.00 15.00 ?  308 PHE A HB2  4  
ATOM   2738  H HB3  . PHE A 1 30 ? -3.934  -6.800  -3.938  1.00 15.00 ?  308 PHE A HB3  4  
ATOM   2739  H HD1  . PHE A 1 30 ? -1.450  -4.973  -3.750  1.00 15.00 ?  308 PHE A HD1  4  
ATOM   2740  H HD2  . PHE A 1 30 ? -1.922  -9.208  -3.835  1.00 15.00 ?  308 PHE A HD2  4  
ATOM   2741  H HE1  . PHE A 1 30 ? 0.780   -5.206  -4.767  1.00 15.00 ?  308 PHE A HE1  4  
ATOM   2742  H HE2  . PHE A 1 30 ? 0.301   -9.431  -4.825  1.00 15.00 ?  308 PHE A HE2  4  
ATOM   2743  H HZ   . PHE A 1 30 ? 1.655   -7.434  -5.294  1.00 15.00 ?  308 PHE A HZ   4  
ATOM   2744  N N    . THR A 1 31 ? -5.501  -5.151  -1.225  1.00 15.00 ?  309 THR A N    4  
ATOM   2745  C CA   . THR A 1 31 ? -6.802  -4.504  -1.124  1.00 15.00 ?  309 THR A CA   4  
ATOM   2746  C C    . THR A 1 31 ? -6.640  -3.018  -0.801  1.00 15.00 ?  309 THR A C    4  
ATOM   2747  O O    . THR A 1 31 ? -6.065  -2.663  0.231   1.00 15.00 ?  309 THR A O    4  
ATOM   2748  C CB   . THR A 1 31 ? -7.658  -5.172  -0.032  1.00 15.00 ?  309 THR A CB   4  
ATOM   2749  O OG1  . THR A 1 31 ? -6.925  -5.202  1.202   1.00 15.00 ?  309 THR A OG1  4  
ATOM   2750  C CG2  . THR A 1 31 ? -8.044  -6.588  -0.432  1.00 15.00 ?  309 THR A CG2  4  
ATOM   2751  H H    . THR A 1 31 ? -5.183  -5.688  -0.473  1.00 15.00 ?  309 THR A H    4  
ATOM   2752  H HA   . THR A 1 31 ? -7.308  -4.611  -2.072  1.00 15.00 ?  309 THR A HA   4  
ATOM   2753  H HB   . THR A 1 31 ? -8.559  -4.592  0.106   1.00 15.00 ?  309 THR A HB   4  
ATOM   2754  H HG1  . THR A 1 31 ? -6.535  -4.331  1.360   1.00 15.00 ?  309 THR A HG1  4  
ATOM   2755  H HG21 . THR A 1 31 ? -8.632  -7.037  0.355   1.00 15.00 ?  309 THR A HG21 4  
ATOM   2756  H HG22 . THR A 1 31 ? -7.151  -7.174  -0.592  1.00 15.00 ?  309 THR A HG22 4  
ATOM   2757  H HG23 . THR A 1 31 ? -8.623  -6.559  -1.342  1.00 15.00 ?  309 THR A HG23 4  
ATOM   2758  N N    . ASP A 1 32 ? -7.147  -2.162  -1.678  1.00 15.00 ?  310 ASP A N    4  
ATOM   2759  C CA   . ASP A 1 32 ? -7.004  -0.716  -1.522  1.00 15.00 ?  310 ASP A CA   4  
ATOM   2760  C C    . ASP A 1 32 ? -8.357  -0.027  -1.359  1.00 15.00 ?  310 ASP A C    4  
ATOM   2761  O O    . ASP A 1 32 ? -9.286  -0.269  -2.132  1.00 15.00 ?  310 ASP A O    4  
ATOM   2762  C CB   . ASP A 1 32 ? -6.273  -0.128  -2.728  1.00 15.00 ?  310 ASP A CB   4  
ATOM   2763  C CG   . ASP A 1 32 ? -6.411  1.381   -2.803  1.00 15.00 ?  310 ASP A CG   4  
ATOM   2764  O OD1  . ASP A 1 32 ? -5.898  2.080   -1.907  1.00 15.00 ?  310 ASP A OD1  4  
ATOM   2765  O OD2  . ASP A 1 32 ? -7.050  1.870   -3.749  1.00 15.00 -1 310 ASP A OD2  4  
ATOM   2766  H H    . ASP A 1 32 ? -7.632  -2.509  -2.459  1.00 15.00 ?  310 ASP A H    4  
ATOM   2767  H HA   . ASP A 1 32 ? -6.414  -0.539  -0.636  1.00 15.00 ?  310 ASP A HA   4  
ATOM   2768  H HB2  . ASP A 1 32 ? -5.224  -0.371  -2.660  1.00 15.00 ?  310 ASP A HB2  4  
ATOM   2769  H HB3  . ASP A 1 32 ? -6.680  -0.554  -3.632  1.00 15.00 ?  310 ASP A HB3  4  
ATOM   2770  N N    . PRO A 1 33 ? -8.477  0.852   -0.348  1.00 15.00 ?  311 PRO A N    4  
ATOM   2771  C CA   . PRO A 1 33 ? -9.686  1.632   -0.108  1.00 15.00 ?  311 PRO A CA   4  
ATOM   2772  C C    . PRO A 1 33 ? -9.775  2.902   -0.962  1.00 15.00 ?  311 PRO A C    4  
ATOM   2773  O O    . PRO A 1 33 ? -10.839 3.523   -1.044  1.00 15.00 ?  311 PRO A O    4  
ATOM   2774  C CB   . PRO A 1 33 ? -9.574  1.987   1.371   1.00 15.00 ?  311 PRO A CB   4  
ATOM   2775  C CG   . PRO A 1 33 ? -8.109  2.093   1.619   1.00 15.00 ?  311 PRO A CG   4  
ATOM   2776  C CD   . PRO A 1 33 ? -7.441  1.131   0.665   1.00 15.00 ?  311 PRO A CD   4  
ATOM   2777  H HA   . PRO A 1 33 ? -10.573 1.035   -0.265  1.00 15.00 ?  311 PRO A HA   4  
ATOM   2778  H HB2  . PRO A 1 33 ? -10.077 2.925   1.559   1.00 15.00 ?  311 PRO A HB2  4  
ATOM   2779  H HB3  . PRO A 1 33 ? -10.019 1.206   1.968   1.00 15.00 ?  311 PRO A HB3  4  
ATOM   2780  H HG2  . PRO A 1 33 ? -7.778  3.103   1.425   1.00 15.00 ?  311 PRO A HG2  4  
ATOM   2781  H HG3  . PRO A 1 33 ? -7.890  1.817   2.641   1.00 15.00 ?  311 PRO A HG3  4  
ATOM   2782  H HD2  . PRO A 1 33 ? -6.577  1.591   0.210   1.00 15.00 ?  311 PRO A HD2  4  
ATOM   2783  H HD3  . PRO A 1 33 ? -7.157  0.227   1.183   1.00 15.00 ?  311 PRO A HD3  4  
ATOM   2784  N N    . ARG A 1 34 ? -8.660  3.310   -1.567  1.00 15.00 ?  312 ARG A N    4  
ATOM   2785  C CA   . ARG A 1 34 ? -8.642  4.509   -2.407  1.00 15.00 ?  312 ARG A CA   4  
ATOM   2786  C C    . ARG A 1 34 ? -9.458  4.280   -3.674  1.00 15.00 ?  312 ARG A C    4  
ATOM   2787  O O    . ARG A 1 34 ? -10.144 5.180   -4.155  1.00 15.00 ?  312 ARG A O    4  
ATOM   2788  C CB   . ARG A 1 34 ? -7.208  4.903   -2.781  1.00 15.00 ?  312 ARG A CB   4  
ATOM   2789  C CG   . ARG A 1 34 ? -6.352  5.350   -1.607  1.00 15.00 ?  312 ARG A CG   4  
ATOM   2790  C CD   . ARG A 1 34 ? -6.423  6.856   -1.392  1.00 15.00 ?  312 ARG A CD   4  
ATOM   2791  N NE   . ARG A 1 34 ? -7.721  7.297   -0.878  1.00 15.00 ?  312 ARG A NE   4  
ATOM   2792  C CZ   . ARG A 1 34 ? -8.062  8.580   -0.726  1.00 15.00 ?  312 ARG A CZ   4  
ATOM   2793  N NH1  . ARG A 1 34 ? -7.248  9.541   -1.143  1.00 15.00 1  312 ARG A NH1  4  
ATOM   2794  N NH2  . ARG A 1 34 ? -9.231  8.900   -0.184  1.00 15.00 ?  312 ARG A NH2  4  
ATOM   2795  H H    . ARG A 1 34 ? -7.832  2.781   -1.466  1.00 15.00 ?  312 ARG A H    4  
ATOM   2796  H HA   . ARG A 1 34 ? -9.094  5.313   -1.845  1.00 15.00 ?  312 ARG A HA   4  
ATOM   2797  H HB2  . ARG A 1 34 ? -6.726  4.054   -3.243  1.00 15.00 ?  312 ARG A HB2  4  
ATOM   2798  H HB3  . ARG A 1 34 ? -7.248  5.712   -3.498  1.00 15.00 ?  312 ARG A HB3  4  
ATOM   2799  H HG2  . ARG A 1 34 ? -6.702  4.856   -0.714  1.00 15.00 ?  312 ARG A HG2  4  
ATOM   2800  H HG3  . ARG A 1 34 ? -5.327  5.070   -1.796  1.00 15.00 ?  312 ARG A HG3  4  
ATOM   2801  H HD2  . ARG A 1 34 ? -5.657  7.139   -0.685  1.00 15.00 ?  312 ARG A HD2  4  
ATOM   2802  H HD3  . ARG A 1 34 ? -6.235  7.348   -2.335  1.00 15.00 ?  312 ARG A HD3  4  
ATOM   2803  H HE   . ARG A 1 34 ? -8.357  6.601   -0.609  1.00 15.00 ?  312 ARG A HE   4  
ATOM   2804  H HH11 . ARG A 1 34 ? -6.367  9.313   -1.578  1.00 15.00 ?  312 ARG A HH11 4  
ATOM   2805  H HH12 . ARG A 1 34 ? -7.508  10.508  -1.035  1.00 15.00 ?  312 ARG A HH12 4  
ATOM   2806  H HH21 . ARG A 1 34 ? -9.871  8.182   0.107   1.00 15.00 ?  312 ARG A HH21 4  
ATOM   2807  H HH22 . ARG A 1 34 ? -9.480  9.868   -0.046  1.00 15.00 ?  312 ARG A HH22 4  
ATOM   2808  N N    . LEU A 1 35 ? -9.343  3.081   -4.224  1.00 15.00 ?  313 LEU A N    4  
ATOM   2809  C CA   . LEU A 1 35 ? -10.134 2.680   -5.378  1.00 15.00 ?  313 LEU A CA   4  
ATOM   2810  C C    . LEU A 1 35 ? -11.566 2.393   -4.953  1.00 15.00 ?  313 LEU A C    4  
ATOM   2811  O O    . LEU A 1 35 ? -11.831 1.282   -4.450  1.00 15.00 ?  313 LEU A O    4  
ATOM   2812  C CB   . LEU A 1 35 ? -9.523  1.441   -6.039  1.00 15.00 ?  313 LEU A CB   4  
ATOM   2813  C CG   . LEU A 1 35 ? -8.112  1.628   -6.598  1.00 15.00 ?  313 LEU A CG   4  
ATOM   2814  C CD1  . LEU A 1 35 ? -7.545  0.297   -7.068  1.00 15.00 ?  313 LEU A CD1  4  
ATOM   2815  C CD2  . LEU A 1 35 ? -8.116  2.643   -7.733  1.00 15.00 ?  313 LEU A CD2  4  
ATOM   2816  H H    . LEU A 1 35 ? -8.677  2.447   -3.855  1.00 15.00 ?  313 LEU A H    4  
ATOM   2817  H HA   . LEU A 1 35 ? -10.133 3.495   -6.085  1.00 15.00 ?  313 LEU A HA   4  
ATOM   2818  H HB2  . LEU A 1 35 ? -9.495  0.646   -5.306  1.00 15.00 ?  313 LEU A HB2  4  
ATOM   2819  H HB3  . LEU A 1 35 ? -10.169 1.137   -6.847  1.00 15.00 ?  313 LEU A HB3  4  
ATOM   2820  H HG   . LEU A 1 35 ? -7.470  2.003   -5.814  1.00 15.00 ?  313 LEU A HG   4  
ATOM   2821  H HD11 . LEU A 1 35 ? -7.452  -0.372  -6.223  1.00 15.00 ?  313 LEU A HD11 4  
ATOM   2822  H HD12 . LEU A 1 35 ? -6.572  0.455   -7.509  1.00 15.00 ?  313 LEU A HD12 4  
ATOM   2823  H HD13 . LEU A 1 35 ? -8.208  -0.138  -7.802  1.00 15.00 ?  313 LEU A HD13 4  
ATOM   2824  H HD21 . LEU A 1 35 ? -8.767  2.300   -8.523  1.00 15.00 ?  313 LEU A HD21 4  
ATOM   2825  H HD22 . LEU A 1 35 ? -7.112  2.757   -8.118  1.00 15.00 ?  313 LEU A HD22 4  
ATOM   2826  H HD23 . LEU A 1 35 ? -8.469  3.595   -7.365  1.00 15.00 ?  313 LEU A HD23 4  
ATOM   2827  N N    . ASP B 2 2  ? 0.495   -8.468  -9.524  1.00 15.00 ?  221 ASP B N    4  
ATOM   2828  C CA   . ASP B 2 2  ? 1.789   -8.497  -8.809  1.00 15.00 ?  221 ASP B CA   4  
ATOM   2829  C C    . ASP B 2 2  ? 1.807   -9.716  -7.889  1.00 15.00 ?  221 ASP B C    4  
ATOM   2830  O O    . ASP B 2 2  ? 0.779   -10.363 -7.692  1.00 15.00 ?  221 ASP B O    4  
ATOM   2831  C CB   . ASP B 2 2  ? 1.981   -7.193  -8.009  1.00 15.00 ?  221 ASP B CB   4  
ATOM   2832  C CG   . ASP B 2 2  ? 3.437   -6.904  -7.651  1.00 15.00 ?  221 ASP B CG   4  
ATOM   2833  O OD1  . ASP B 2 2  ? 4.089   -7.744  -7.010  1.00 15.00 ?  221 ASP B OD1  4  
ATOM   2834  O OD2  . ASP B 2 2  ? 3.937   -5.814  -8.003  1.00 15.00 -1 221 ASP B OD2  4  
ATOM   2835  H H    . ASP B 2 2  ? -0.288  -8.383  -8.838  1.00 15.00 ?  221 ASP B H    4  
ATOM   2836  H HA   . ASP B 2 2  ? 2.581   -8.596  -9.538  1.00 15.00 ?  221 ASP B HA   4  
ATOM   2837  H HB2  . ASP B 2 2  ? 1.613   -6.363  -8.597  1.00 15.00 ?  221 ASP B HB2  4  
ATOM   2838  H HB3  . ASP B 2 2  ? 1.411   -7.256  -7.094  1.00 15.00 ?  221 ASP B HB3  4  
ATOM   2839  N N    . THR B 2 3  ? 2.961   -10.014 -7.329  1.00 15.00 ?  222 THR B N    4  
ATOM   2840  C CA   . THR B 2 3  ? 3.152   -11.189 -6.493  1.00 15.00 ?  222 THR B CA   4  
ATOM   2841  C C    . THR B 2 3  ? 2.617   -10.905 -5.091  1.00 15.00 ?  222 THR B C    4  
ATOM   2842  O O    . THR B 2 3  ? 2.494   -9.741  -4.718  1.00 15.00 ?  222 THR B O    4  
ATOM   2843  C CB   . THR B 2 3  ? 4.668   -11.548 -6.464  1.00 15.00 ?  222 THR B CB   4  
ATOM   2844  O OG1  . THR B 2 3  ? 4.917   -12.805 -5.820  1.00 15.00 ?  222 THR B OG1  4  
ATOM   2845  C CG2  . THR B 2 3  ? 5.467   -10.458 -5.765  1.00 15.00 ?  222 THR B CG2  4  
ATOM   2846  H H    . THR B 2 3  ? 3.716   -9.392  -7.446  1.00 15.00 ?  222 THR B H    4  
ATOM   2847  H HA   . THR B 2 3  ? 2.593   -12.006 -6.919  1.00 15.00 ?  222 THR B HA   4  
ATOM   2848  H HB   . THR B 2 3  ? 5.015   -11.612 -7.485  1.00 15.00 ?  222 THR B HB   4  
ATOM   2849  H HG1  . THR B 2 3  ? 5.576   -12.680 -5.119  1.00 15.00 ?  222 THR B HG1  4  
ATOM   2850  H HG21 . THR B 2 3  ? 6.513   -10.729 -5.752  1.00 15.00 ?  222 THR B HG21 4  
ATOM   2851  H HG22 . THR B 2 3  ? 5.112   -10.346 -4.752  1.00 15.00 ?  222 THR B HG22 4  
ATOM   2852  H HG23 . THR B 2 3  ? 5.345   -9.524  -6.295  1.00 15.00 ?  222 THR B HG23 4  
ATOM   2853  N N    . PRO B 2 4  ? 2.296   -11.950 -4.289  1.00 15.00 ?  223 PRO B N    4  
ATOM   2854  C CA   . PRO B 2 4  ? 1.695   -11.761 -2.964  1.00 15.00 ?  223 PRO B CA   4  
ATOM   2855  C C    . PRO B 2 4  ? 2.445   -10.722 -2.135  1.00 15.00 ?  223 PRO B C    4  
ATOM   2856  O O    . PRO B 2 4  ? 3.676   -10.625 -2.197  1.00 15.00 ?  223 PRO B O    4  
ATOM   2857  C CB   . PRO B 2 4  ? 1.830   -13.145 -2.329  1.00 15.00 ?  223 PRO B CB   4  
ATOM   2858  C CG   . PRO B 2 4  ? 1.761   -14.087 -3.478  1.00 15.00 ?  223 PRO B CG   4  
ATOM   2859  C CD   . PRO B 2 4  ? 2.418   -13.382 -4.633  1.00 15.00 ?  223 PRO B CD   4  
ATOM   2860  H HA   . PRO B 2 4  ? 0.653   -11.489 -3.031  1.00 15.00 ?  223 PRO B HA   4  
ATOM   2861  H HB2  . PRO B 2 4  ? 2.775   -13.217 -1.809  1.00 15.00 ?  223 PRO B HB2  4  
ATOM   2862  H HB3  . PRO B 2 4  ? 1.017   -13.306 -1.636  1.00 15.00 ?  223 PRO B HB3  4  
ATOM   2863  H HG2  . PRO B 2 4  ? 2.296   -14.994 -3.240  1.00 15.00 ?  223 PRO B HG2  4  
ATOM   2864  H HG3  . PRO B 2 4  ? 0.730   -14.307 -3.712  1.00 15.00 ?  223 PRO B HG3  4  
ATOM   2865  H HD2  . PRO B 2 4  ? 3.456   -13.671 -4.709  1.00 15.00 ?  223 PRO B HD2  4  
ATOM   2866  H HD3  . PRO B 2 4  ? 1.897   -13.602 -5.552  1.00 15.00 ?  223 PRO B HD3  4  
ATOM   2867  N N    . PRO B 2 5  ? 1.693   -9.980  -1.305  1.00 15.00 ?  224 PRO B N    4  
ATOM   2868  C CA   . PRO B 2 5  ? 2.137   -8.716  -0.713  1.00 15.00 ?  224 PRO B CA   4  
ATOM   2869  C C    . PRO B 2 5  ? 3.527   -8.769  -0.071  1.00 15.00 ?  224 PRO B C    4  
ATOM   2870  O O    . PRO B 2 5  ? 3.795   -9.555  0.841   1.00 15.00 ?  224 PRO B O    4  
ATOM   2871  C CB   . PRO B 2 5  ? 1.071   -8.408  0.348   1.00 15.00 ?  224 PRO B CB   4  
ATOM   2872  C CG   . PRO B 2 5  ? 0.138   -9.573  0.375   1.00 15.00 ?  224 PRO B CG   4  
ATOM   2873  C CD   . PRO B 2 5  ? 0.320   -10.311 -0.915  1.00 15.00 ?  224 PRO B CD   4  
ATOM   2874  H HA   . PRO B 2 5  ? 2.129   -7.928  -1.450  1.00 15.00 ?  224 PRO B HA   4  
ATOM   2875  H HB2  . PRO B 2 5  ? 1.550   -8.271  1.307   1.00 15.00 ?  224 PRO B HB2  4  
ATOM   2876  H HB3  . PRO B 2 5  ? 0.552   -7.499  0.075   1.00 15.00 ?  224 PRO B HB3  4  
ATOM   2877  H HG2  . PRO B 2 5  ? 0.379   -10.216 1.210   1.00 15.00 ?  224 PRO B HG2  4  
ATOM   2878  H HG3  . PRO B 2 5  ? -0.879  -9.218  0.458   1.00 15.00 ?  224 PRO B HG3  4  
ATOM   2879  H HD2  . PRO B 2 5  ? 0.210   -11.374 -0.761  1.00 15.00 ?  224 PRO B HD2  4  
ATOM   2880  H HD3  . PRO B 2 5  ? -0.385  -9.960  -1.655  1.00 15.00 ?  224 PRO B HD3  4  
ATOM   2881  N N    . PRO B 2 6  ? 4.417   -7.899  -0.575  1.00 15.00 ?  225 PRO B N    4  
ATOM   2882  C CA   . PRO B 2 6  ? 5.823   -7.804  -0.161  1.00 15.00 ?  225 PRO B CA   4  
ATOM   2883  C C    . PRO B 2 6  ? 6.004   -7.118  1.192   1.00 15.00 ?  225 PRO B C    4  
ATOM   2884  O O    . PRO B 2 6  ? 5.035   -6.723  1.837   1.00 15.00 ?  225 PRO B O    4  
ATOM   2885  C CB   . PRO B 2 6  ? 6.466   -6.937  -1.259  1.00 15.00 ?  225 PRO B CB   4  
ATOM   2886  C CG   . PRO B 2 6  ? 5.424   -6.753  -2.309  1.00 15.00 ?  225 PRO B CG   4  
ATOM   2887  C CD   . PRO B 2 6  ? 4.109   -6.916  -1.619  1.00 15.00 ?  225 PRO B CD   4  
ATOM   2888  H HA   . PRO B 2 6  ? 6.297   -8.773  -0.141  1.00 15.00 ?  225 PRO B HA   4  
ATOM   2889  H HB2  . PRO B 2 6  ? 6.765   -5.989  -0.837  1.00 15.00 ?  225 PRO B HB2  4  
ATOM   2890  H HB3  . PRO B 2 6  ? 7.326   -7.438  -1.653  1.00 15.00 ?  225 PRO B HB3  4  
ATOM   2891  H HG2  . PRO B 2 6  ? 5.502   -5.763  -2.735  1.00 15.00 ?  225 PRO B HG2  4  
ATOM   2892  H HG3  . PRO B 2 6  ? 5.539   -7.501  -3.077  1.00 15.00 ?  225 PRO B HG3  4  
ATOM   2893  H HD2  . PRO B 2 6  ? 3.787   -5.978  -1.189  1.00 15.00 ?  225 PRO B HD2  4  
ATOM   2894  H HD3  . PRO B 2 6  ? 3.366   -7.297  -2.302  1.00 15.00 ?  225 PRO B HD3  4  
ATOM   2895  N N    . ALA B 2 7  ? 7.255   -6.996  1.624   1.00 15.00 ?  226 ALA B N    4  
ATOM   2896  C CA   . ALA B 2 7  ? 7.582   -6.206  2.805   1.00 15.00 ?  226 ALA B CA   4  
ATOM   2897  C C    . ALA B 2 7  ? 7.208   -4.746  2.562   1.00 15.00 ?  226 ALA B C    4  
ATOM   2898  O O    . ALA B 2 7  ? 7.192   -4.291  1.414   1.00 15.00 ?  226 ALA B O    4  
ATOM   2899  C CB   . ALA B 2 7  ? 9.060   -6.331  3.137   1.00 15.00 ?  226 ALA B CB   4  
ATOM   2900  H H    . ALA B 2 7  ? 7.975   -7.445  1.136   1.00 15.00 ?  226 ALA B H    4  
ATOM   2901  H HA   . ALA B 2 7  ? 7.008   -6.587  3.637   1.00 15.00 ?  226 ALA B HA   4  
ATOM   2902  H HB1  . ALA B 2 7  ? 9.647   -5.952  2.313   1.00 15.00 ?  226 ALA B HB1  4  
ATOM   2903  H HB2  . ALA B 2 7  ? 9.305   -7.368  3.306   1.00 15.00 ?  226 ALA B HB2  4  
ATOM   2904  H HB3  . ALA B 2 7  ? 9.278   -5.760  4.029   1.00 15.00 ?  226 ALA B HB3  4  
ATOM   2905  N N    . TYR B 2 8  ? 6.925   -4.007  3.626   1.00 15.00 ?  227 TYR B N    4  
ATOM   2906  C CA   . TYR B 2 8  ? 6.388   -2.665  3.472   1.00 15.00 ?  227 TYR B CA   4  
ATOM   2907  C C    . TYR B 2 8  ? 7.488   -1.610  3.390   1.00 15.00 ?  227 TYR B C    4  
ATOM   2908  O O    . TYR B 2 8  ? 8.531   -1.703  4.042   1.00 15.00 ?  227 TYR B O    4  
ATOM   2909  C CB   . TYR B 2 8  ? 5.429   -2.319  4.610   1.00 15.00 ?  227 TYR B CB   4  
ATOM   2910  C CG   . TYR B 2 8  ? 6.130   -1.861  5.869   1.00 15.00 ?  227 TYR B CG   4  
ATOM   2911  C CD1  . TYR B 2 8  ? 6.684   -2.766  6.763   1.00 15.00 ?  227 TYR B CD1  4  
ATOM   2912  C CD2  . TYR B 2 8  ? 6.249   -0.513  6.148   1.00 15.00 ?  227 TYR B CD2  4  
ATOM   2913  C CE1  . TYR B 2 8  ? 7.341   -2.334  7.899   1.00 15.00 ?  227 TYR B CE1  4  
ATOM   2914  C CE2  . TYR B 2 8  ? 6.898   -0.068  7.275   1.00 15.00 ?  227 TYR B CE2  4  
ATOM   2915  C CZ   . TYR B 2 8  ? 7.447   -0.980  8.152   1.00 15.00 ?  227 TYR B CZ   4  
ATOM   2916  O OH   . TYR B 2 8  ? 8.096   -0.539  9.280   1.00 15.00 ?  227 TYR B OH   4  
ATOM   2917  H H    . TYR B 2 8  ? 7.068   -4.375  4.525   1.00 15.00 ?  227 TYR B H    4  
ATOM   2918  H HA   . TYR B 2 8  ? 5.835   -2.647  2.544   1.00 15.00 ?  227 TYR B HA   4  
ATOM   2919  H HB2  . TYR B 2 8  ? 4.774   -1.517  4.274   1.00 15.00 ?  227 TYR B HB2  4  
ATOM   2920  H HB3  . TYR B 2 8  ? 4.836   -3.188  4.851   1.00 15.00 ?  227 TYR B HB3  4  
ATOM   2921  H HD1  . TYR B 2 8  ? 6.598   -3.824  6.559   1.00 15.00 ?  227 TYR B HD1  4  
ATOM   2922  H HD2  . TYR B 2 8  ? 5.819   0.205   5.465   1.00 15.00 ?  227 TYR B HD2  4  
ATOM   2923  H HE1  . TYR B 2 8  ? 7.767   -3.056  8.583   1.00 15.00 ?  227 TYR B HE1  4  
ATOM   2924  H HE2  . TYR B 2 8  ? 6.977   0.999   7.458   1.00 15.00 ?  227 TYR B HE2  4  
ATOM   2925  H HH   . TYR B 2 8  ? 9.025   -0.810  9.242   1.00 15.00 ?  227 TYR B HH   4  
ATOM   2926  N N    . LEU B 2 9  ? 7.217   -0.613  2.570   1.00 15.00 ?  228 LEU B N    4  
ATOM   2927  C CA   . LEU B 2 9  ? 8.113   0.505   2.321   1.00 15.00 ?  228 LEU B CA   4  
ATOM   2928  C C    . LEU B 2 9  ? 7.362   1.824   2.462   1.00 15.00 ?  228 LEU B C    4  
ATOM   2929  O O    . LEU B 2 9  ? 6.149   1.840   2.423   1.00 15.00 ?  228 LEU B O    4  
ATOM   2930  C CB   . LEU B 2 9  ? 8.747   0.396   0.928   1.00 15.00 ?  228 LEU B CB   4  
ATOM   2931  C CG   . LEU B 2 9  ? 9.630   -0.834  0.696   1.00 15.00 ?  228 LEU B CG   4  
ATOM   2932  C CD1  . LEU B 2 9  ? 10.086  -0.896  -0.753  1.00 15.00 ?  228 LEU B CD1  4  
ATOM   2933  C CD2  . LEU B 2 9  ? 10.831  -0.813  1.627   1.00 15.00 ?  228 LEU B CD2  4  
ATOM   2934  H H    . LEU B 2 9  ? 6.355   -0.624  2.101   1.00 15.00 ?  228 LEU B H    4  
ATOM   2935  H HA   . LEU B 2 9  ? 8.874   0.474   3.081   1.00 15.00 ?  228 LEU B HA   4  
ATOM   2936  H HB2  . LEU B 2 9  ? 7.954   0.384   0.196   1.00 15.00 ?  228 LEU B HB2  4  
ATOM   2937  H HB3  . LEU B 2 9  ? 9.349   1.279   0.763   1.00 15.00 ?  228 LEU B HB3  4  
ATOM   2938  H HG   . LEU B 2 9  ? 9.057   -1.725  0.905   1.00 15.00 ?  228 LEU B HG   4  
ATOM   2939  H HD11 . LEU B 2 9  ? 10.714  -1.764  -0.897  1.00 15.00 ?  228 LEU B HD11 4  
ATOM   2940  H HD12 . LEU B 2 9  ? 10.645  -0.004  -0.995  1.00 15.00 ?  228 LEU B HD12 4  
ATOM   2941  H HD13 . LEU B 2 9  ? 9.223   -0.966  -1.399  1.00 15.00 ?  228 LEU B HD13 4  
ATOM   2942  H HD21 . LEU B 2 9  ? 11.418  0.076   1.439   1.00 15.00 ?  228 LEU B HD21 4  
ATOM   2943  H HD22 . LEU B 2 9  ? 11.438  -1.688  1.450   1.00 15.00 ?  228 LEU B HD22 4  
ATOM   2944  H HD23 . LEU B 2 9  ? 10.492  -0.809  2.652   1.00 15.00 ?  228 LEU B HD23 4  
ATOM   2945  N N    . PRO B 2 10 ? 8.051   2.952   2.645   1.00 15.00 ?  229 PRO B N    4  
ATOM   2946  C CA   . PRO B 2 10 ? 7.372   4.242   2.708   1.00 15.00 ?  229 PRO B CA   4  
ATOM   2947  C C    . PRO B 2 10 ? 7.212   4.842   1.309   1.00 15.00 ?  229 PRO B C    4  
ATOM   2948  O O    . PRO B 2 10 ? 8.053   4.633   0.432   1.00 15.00 ?  229 PRO B O    4  
ATOM   2949  C CB   . PRO B 2 10 ? 8.337   5.106   3.543   1.00 15.00 ?  229 PRO B CB   4  
ATOM   2950  C CG   . PRO B 2 10 ? 9.421   4.181   3.996   1.00 15.00 ?  229 PRO B CG   4  
ATOM   2951  C CD   . PRO B 2 10 ? 9.461   3.067   2.995   1.00 15.00 ?  229 PRO B CD   4  
ATOM   2952  H HA   . PRO B 2 10 ? 6.419   4.158   3.200   1.00 15.00 ?  229 PRO B HA   4  
ATOM   2953  H HB2  . PRO B 2 10 ? 8.732   5.902   2.929   1.00 15.00 ?  229 PRO B HB2  4  
ATOM   2954  H HB3  . PRO B 2 10 ? 7.806   5.529   4.384   1.00 15.00 ?  229 PRO B HB3  4  
ATOM   2955  H HG2  . PRO B 2 10 ? 10.360  4.701   4.013   1.00 15.00 ?  229 PRO B HG2  4  
ATOM   2956  H HG3  . PRO B 2 10 ? 9.190   3.795   4.978   1.00 15.00 ?  229 PRO B HG3  4  
ATOM   2957  H HD2  . PRO B 2 10 ? 10.058  3.333   2.145   1.00 15.00 ?  229 PRO B HD2  4  
ATOM   2958  H HD3  . PRO B 2 10 ? 9.821   2.161   3.452   1.00 15.00 ?  229 PRO B HD3  4  
ATOM   2959  N N    . PRO B 2 11 ? 6.135   5.630   1.099   1.00 15.00 ?  230 PRO B N    4  
ATOM   2960  C CA   . PRO B 2 11 ? 5.443   5.687   -0.189  1.00 15.00 ?  230 PRO B CA   4  
ATOM   2961  C C    . PRO B 2 11 ? 5.951   6.724   -1.183  1.00 15.00 ?  230 PRO B C    4  
ATOM   2962  O O    . PRO B 2 11 ? 6.490   7.775   -0.818  1.00 15.00 ?  230 PRO B O    4  
ATOM   2963  C CB   . PRO B 2 11 ? 4.033   6.054   0.258   1.00 15.00 ?  230 PRO B CB   4  
ATOM   2964  C CG   . PRO B 2 11 ? 4.245   7.003   1.388   1.00 15.00 ?  230 PRO B CG   4  
ATOM   2965  C CD   . PRO B 2 11 ? 5.521   6.573   2.069   1.00 15.00 ?  230 PRO B CD   4  
ATOM   2966  H HA   . PRO B 2 11 ? 5.417   4.719   -0.666  1.00 15.00 ?  230 PRO B HA   4  
ATOM   2967  H HB2  . PRO B 2 11 ? 3.503   6.517   -0.555  1.00 15.00 ?  230 PRO B HB2  4  
ATOM   2968  H HB3  . PRO B 2 11 ? 3.510   5.168   0.582   1.00 15.00 ?  230 PRO B HB3  4  
ATOM   2969  H HG2  . PRO B 2 11 ? 4.344   8.009   1.008   1.00 15.00 ?  230 PRO B HG2  4  
ATOM   2970  H HG3  . PRO B 2 11 ? 3.415   6.944   2.077   1.00 15.00 ?  230 PRO B HG3  4  
ATOM   2971  H HD2  . PRO B 2 11 ? 6.161   7.427   2.236   1.00 15.00 ?  230 PRO B HD2  4  
ATOM   2972  H HD3  . PRO B 2 11 ? 5.292   6.089   3.001   1.00 15.00 ?  230 PRO B HD3  4  
ATOM   2973  N N    . GLU B 2 12 ? 5.726   6.404   -2.453  1.00 15.00 ?  231 GLU B N    4  
ATOM   2974  C CA   . GLU B 2 12 ? 5.985   7.305   -3.558  1.00 15.00 ?  231 GLU B CA   4  
ATOM   2975  C C    . GLU B 2 12 ? 4.699   7.447   -4.395  1.00 15.00 ?  231 GLU B C    4  
ATOM   2976  O O    . GLU B 2 12 ? 4.193   6.451   -4.912  1.00 15.00 ?  231 GLU B O    4  
ATOM   2977  C CB   . GLU B 2 12 ? 7.136   6.763   -4.424  1.00 15.00 ?  231 GLU B CB   4  
ATOM   2978  C CG   . GLU B 2 12 ? 6.912   5.352   -4.967  1.00 15.00 ?  231 GLU B CG   4  
ATOM   2979  C CD   . GLU B 2 12 ? 8.095   4.846   -5.760  1.00 15.00 ?  231 GLU B CD   4  
ATOM   2980  O OE1  . GLU B 2 12 ? 9.016   4.266   -5.149  1.00 15.00 -1 231 GLU B OE1  4  
ATOM   2981  O OE2  . GLU B 2 12 ? 8.104   5.014   -6.993  1.00 15.00 ?  231 GLU B OE2  4  
ATOM   2982  H H    . GLU B 2 12 ? 5.357   5.522   -2.655  1.00 15.00 ?  231 GLU B H    4  
ATOM   2983  H HA   . GLU B 2 12 ? 6.271   8.260   -3.146  1.00 15.00 ?  231 GLU B HA   4  
ATOM   2984  H HB2  . GLU B 2 12 ? 7.277   7.426   -5.265  1.00 15.00 ?  231 GLU B HB2  4  
ATOM   2985  H HB3  . GLU B 2 12 ? 8.041   6.756   -3.831  1.00 15.00 ?  231 GLU B HB3  4  
ATOM   2986  H HG2  . GLU B 2 12 ? 6.739   4.675   -4.143  1.00 15.00 ?  231 GLU B HG2  4  
ATOM   2987  H HG3  . GLU B 2 12 ? 6.043   5.358   -5.610  1.00 15.00 ?  231 GLU B HG3  4  
ATOM   2988  N N    . ASP B 2 13 ? 4.134   8.652   -4.493  1.00 15.00 ?  232 ASP B N    4  
ATOM   2989  C CA   . ASP B 2 13 ? 2.918   8.848   -5.278  1.00 15.00 ?  232 ASP B CA   4  
ATOM   2990  C C    . ASP B 2 13 ? 2.868   10.257  -5.852  1.00 15.00 ?  232 ASP B C    4  
ATOM   2991  O O    . ASP B 2 13 ? 2.693   11.234  -5.119  1.00 15.00 ?  232 ASP B O    4  
ATOM   2992  C CB   . ASP B 2 13 ? 1.668   8.585   -4.430  1.00 15.00 ?  232 ASP B CB   4  
ATOM   2993  C CG   . ASP B 2 13 ? 0.383   8.740   -5.224  1.00 15.00 ?  232 ASP B CG   4  
ATOM   2994  O OD1  . ASP B 2 13 ? 0.035   7.817   -5.996  1.00 15.00 ?  232 ASP B OD1  4  
ATOM   2995  O OD2  . ASP B 2 13 ? -0.300  9.775   -5.066  1.00 15.00 -1 232 ASP B OD2  4  
ATOM   2996  H H    . ASP B 2 13 ? 4.533   9.423   -4.041  1.00 15.00 ?  232 ASP B H    4  
ATOM   2997  H HA   . ASP B 2 13 ? 2.938   8.142   -6.095  1.00 15.00 ?  232 ASP B HA   4  
ATOM   2998  H HB2  . ASP B 2 13 ? 1.710   7.578   -4.042  1.00 15.00 ?  232 ASP B HB2  4  
ATOM   2999  H HB3  . ASP B 2 13 ? 1.648   9.283   -3.607  1.00 15.00 ?  232 ASP B HB3  4  
ATOM   3000  N N    . PRO B 2 14 ? 3.056   10.381  -7.171  1.00 15.00 ?  233 PRO B N    4  
ATOM   3001  C CA   . PRO B 2 14 ? 3.028   11.656  -7.862  1.00 15.00 ?  233 PRO B CA   4  
ATOM   3002  C C    . PRO B 2 14 ? 1.655   11.961  -8.460  1.00 15.00 ?  233 PRO B C    4  
ATOM   3003  O O    . PRO B 2 14 ? 1.484   12.001  -9.681  1.00 15.00 ?  233 PRO B O    4  
ATOM   3004  C CB   . PRO B 2 14 ? 4.072   11.441  -8.960  1.00 15.00 ?  233 PRO B CB   4  
ATOM   3005  C CG   . PRO B 2 14 ? 4.089   9.961   -9.225  1.00 15.00 ?  233 PRO B CG   4  
ATOM   3006  C CD   . PRO B 2 14 ? 3.336   9.284   -8.103  1.00 15.00 ?  233 PRO B CD   4  
ATOM   3007  H HA   . PRO B 2 14 ? 3.336   12.467  -7.220  1.00 15.00 ?  233 PRO B HA   4  
ATOM   3008  H HB2  . PRO B 2 14 ? 3.784   11.994  -9.842  1.00 15.00 ?  233 PRO B HB2  4  
ATOM   3009  H HB3  . PRO B 2 14 ? 5.036   11.786  -8.614  1.00 15.00 ?  233 PRO B HB3  4  
ATOM   3010  H HG2  . PRO B 2 14 ? 3.604   9.756   -10.168 1.00 15.00 ?  233 PRO B HG2  4  
ATOM   3011  H HG3  . PRO B 2 14 ? 5.110   9.610   -9.251  1.00 15.00 ?  233 PRO B HG3  4  
ATOM   3012  H HD2  . PRO B 2 14 ? 2.419   8.850   -8.472  1.00 15.00 ?  233 PRO B HD2  4  
ATOM   3013  H HD3  . PRO B 2 14 ? 3.952   8.529   -7.638  1.00 15.00 ?  233 PRO B HD3  4  
HETATM 3014  N N    . NH2 B 2 15 ? 0.676   12.185  -7.597  1.00 15.00 ?  234 NH2 B N    4  
HETATM 3015  H HN1  . NH2 B 2 15 ? 0.884   12.137  -6.640  1.00 15.00 ?  234 NH2 B HN1  4  
HETATM 3016  H HN2  . NH2 B 2 15 ? -0.217  12.383  -7.950  1.00 15.00 ?  234 NH2 B HN2  4  
ATOM   3017  N N    . LEU A 1 1  ? -13.515 2.052   -1.645  1.00 15.00 ?  279 LEU A N    5  
ATOM   3018  C CA   . LEU A 1 1  ? -14.790 2.795   -1.693  1.00 15.00 ?  279 LEU A CA   5  
ATOM   3019  C C    . LEU A 1 1  ? -14.590 4.285   -1.427  1.00 15.00 ?  279 LEU A C    5  
ATOM   3020  O O    . LEU A 1 1  ? -15.517 5.074   -1.614  1.00 15.00 ?  279 LEU A O    5  
ATOM   3021  C CB   . LEU A 1 1  ? -15.788 2.219   -0.687  1.00 15.00 ?  279 LEU A CB   5  
ATOM   3022  C CG   . LEU A 1 1  ? -16.240 0.786   -0.967  1.00 15.00 ?  279 LEU A CG   5  
ATOM   3023  C CD1  . LEU A 1 1  ? -17.232 0.333   0.091   1.00 15.00 ?  279 LEU A CD1  5  
ATOM   3024  C CD2  . LEU A 1 1  ? -16.857 0.680   -2.355  1.00 15.00 ?  279 LEU A CD2  5  
ATOM   3025  H H1   . LEU A 1 1  ? -13.688 1.034   -1.787  1.00 15.00 ?  279 LEU A H1   5  
ATOM   3026  H H2   . LEU A 1 1  ? -13.048 2.185   -0.724  1.00 15.00 ?  279 LEU A H2   5  
ATOM   3027  H H3   . LEU A 1 1  ? -12.883 2.387   -2.400  1.00 15.00 ?  279 LEU A H3   5  
ATOM   3028  H HA   . LEU A 1 1  ? -15.199 2.683   -2.686  1.00 15.00 ?  279 LEU A HA   5  
ATOM   3029  H HB2  . LEU A 1 1  ? -15.336 2.247   0.293   1.00 15.00 ?  279 LEU A HB2  5  
ATOM   3030  H HB3  . LEU A 1 1  ? -16.662 2.852   -0.679  1.00 15.00 ?  279 LEU A HB3  5  
ATOM   3031  H HG   . LEU A 1 1  ? -15.384 0.129   -0.928  1.00 15.00 ?  279 LEU A HG   5  
ATOM   3032  H HD11 . LEU A 1 1  ? -18.091 0.987   0.080   1.00 15.00 ?  279 LEU A HD11 5  
ATOM   3033  H HD12 . LEU A 1 1  ? -16.764 0.371   1.064   1.00 15.00 ?  279 LEU A HD12 5  
ATOM   3034  H HD13 . LEU A 1 1  ? -17.547 -0.679  -0.119  1.00 15.00 ?  279 LEU A HD13 5  
ATOM   3035  H HD21 . LEU A 1 1  ? -16.123 0.955   -3.098  1.00 15.00 ?  279 LEU A HD21 5  
ATOM   3036  H HD22 . LEU A 1 1  ? -17.705 1.345   -2.423  1.00 15.00 ?  279 LEU A HD22 5  
ATOM   3037  H HD23 . LEU A 1 1  ? -17.182 -0.336  -2.528  1.00 15.00 ?  279 LEU A HD23 5  
ATOM   3038  N N    . GLY A 1 2  ? -13.402 4.687   -0.978  1.00 15.00 ?  280 GLY A N    5  
ATOM   3039  C CA   . GLY A 1 2  ? -13.172 6.103   -0.764  1.00 15.00 ?  280 GLY A CA   5  
ATOM   3040  C C    . GLY A 1 2  ? -12.104 6.442   0.270   1.00 15.00 ?  280 GLY A C    5  
ATOM   3041  O O    . GLY A 1 2  ? -11.130 7.114   -0.067  1.00 15.00 ?  280 GLY A O    5  
ATOM   3042  H H    . GLY A 1 2  ? -12.692 4.035   -0.791  1.00 15.00 ?  280 GLY A H    5  
ATOM   3043  H HA2  . GLY A 1 2  ? -12.881 6.545   -1.705  1.00 15.00 ?  280 GLY A HA2  5  
ATOM   3044  H HA3  . GLY A 1 2  ? -14.104 6.554   -0.452  1.00 15.00 ?  280 GLY A HA3  5  
ATOM   3045  N N    . PRO A 1 3  ? -12.232 5.983   1.530   1.00 15.00 ?  281 PRO A N    5  
ATOM   3046  C CA   . PRO A 1 3  ? -11.417 6.497   2.632   1.00 15.00 ?  281 PRO A CA   5  
ATOM   3047  C C    . PRO A 1 3  ? -10.097 5.752   2.850   1.00 15.00 ?  281 PRO A C    5  
ATOM   3048  O O    . PRO A 1 3  ? -10.030 4.524   2.770   1.00 15.00 ?  281 PRO A O    5  
ATOM   3049  C CB   . PRO A 1 3  ? -12.344 6.295   3.829   1.00 15.00 ?  281 PRO A CB   5  
ATOM   3050  C CG   . PRO A 1 3  ? -13.135 5.071   3.504   1.00 15.00 ?  281 PRO A CG   5  
ATOM   3051  C CD   . PRO A 1 3  ? -13.189 4.964   1.997   1.00 15.00 ?  281 PRO A CD   5  
ATOM   3052  H HA   . PRO A 1 3  ? -11.215 7.550   2.513   1.00 15.00 ?  281 PRO A HA   5  
ATOM   3053  H HB2  . PRO A 1 3  ? -11.755 6.160   4.724   1.00 15.00 ?  281 PRO A HB2  5  
ATOM   3054  H HB3  . PRO A 1 3  ? -12.985 7.159   3.940   1.00 15.00 ?  281 PRO A HB3  5  
ATOM   3055  H HG2  . PRO A 1 3  ? -12.647 4.203   3.920   1.00 15.00 ?  281 PRO A HG2  5  
ATOM   3056  H HG3  . PRO A 1 3  ? -14.134 5.165   3.906   1.00 15.00 ?  281 PRO A HG3  5  
ATOM   3057  H HD2  . PRO A 1 3  ? -12.883 3.979   1.680   1.00 15.00 ?  281 PRO A HD2  5  
ATOM   3058  H HD3  . PRO A 1 3  ? -14.186 5.181   1.640   1.00 15.00 ?  281 PRO A HD3  5  
ATOM   3059  N N    . LEU A 1 4  ? -9.056  6.524   3.140   1.00 15.00 ?  282 LEU A N    5  
ATOM   3060  C CA   . LEU A 1 4  ? -7.737  5.985   3.442   1.00 15.00 ?  282 LEU A CA   5  
ATOM   3061  C C    . LEU A 1 4  ? -7.513  6.001   4.957   1.00 15.00 ?  282 LEU A C    5  
ATOM   3062  O O    . LEU A 1 4  ? -7.528  7.066   5.578   1.00 15.00 ?  282 LEU A O    5  
ATOM   3063  C CB   . LEU A 1 4  ? -6.662  6.822   2.738   1.00 15.00 ?  282 LEU A CB   5  
ATOM   3064  C CG   . LEU A 1 4  ? -5.240  6.255   2.787   1.00 15.00 ?  282 LEU A CG   5  
ATOM   3065  C CD1  . LEU A 1 4  ? -5.122  5.023   1.904   1.00 15.00 ?  282 LEU A CD1  5  
ATOM   3066  C CD2  . LEU A 1 4  ? -4.230  7.310   2.366   1.00 15.00 ?  282 LEU A CD2  5  
ATOM   3067  H H    . LEU A 1 4  ? -9.183  7.498   3.158   1.00 15.00 ?  282 LEU A H    5  
ATOM   3068  H HA   . LEU A 1 4  ? -7.696  4.967   3.082   1.00 15.00 ?  282 LEU A HA   5  
ATOM   3069  H HB2  . LEU A 1 4  ? -6.944  6.931   1.701   1.00 15.00 ?  282 LEU A HB2  5  
ATOM   3070  H HB3  . LEU A 1 4  ? -6.649  7.801   3.193   1.00 15.00 ?  282 LEU A HB3  5  
ATOM   3071  H HG   . LEU A 1 4  ? -5.014  5.960   3.802   1.00 15.00 ?  282 LEU A HG   5  
ATOM   3072  H HD11 . LEU A 1 4  ? -5.565  5.229   0.939   1.00 15.00 ?  282 LEU A HD11 5  
ATOM   3073  H HD12 . LEU A 1 4  ? -5.632  4.192   2.369   1.00 15.00 ?  282 LEU A HD12 5  
ATOM   3074  H HD13 . LEU A 1 4  ? -4.078  4.778   1.771   1.00 15.00 ?  282 LEU A HD13 5  
ATOM   3075  H HD21 . LEU A 1 4  ? -3.237  6.887   2.399   1.00 15.00 ?  282 LEU A HD21 5  
ATOM   3076  H HD22 . LEU A 1 4  ? -4.286  8.153   3.038   1.00 15.00 ?  282 LEU A HD22 5  
ATOM   3077  H HD23 . LEU A 1 4  ? -4.449  7.635   1.360   1.00 15.00 ?  282 LEU A HD23 5  
ATOM   3078  N N    . PRO A 1 5  ? -7.334  4.820   5.571   1.00 15.00 ?  283 PRO A N    5  
ATOM   3079  C CA   . PRO A 1 5  ? -7.159  4.686   7.029   1.00 15.00 ?  283 PRO A CA   5  
ATOM   3080  C C    . PRO A 1 5  ? -5.865  5.341   7.545   1.00 15.00 ?  283 PRO A C    5  
ATOM   3081  O O    . PRO A 1 5  ? -4.904  5.502   6.790   1.00 15.00 ?  283 PRO A O    5  
ATOM   3082  C CB   . PRO A 1 5  ? -7.106  3.167   7.243   1.00 15.00 ?  283 PRO A CB   5  
ATOM   3083  C CG   . PRO A 1 5  ? -7.686  2.574   6.005   1.00 15.00 ?  283 PRO A CG   5  
ATOM   3084  C CD   . PRO A 1 5  ? -7.304  3.511   4.901   1.00 15.00 ?  283 PRO A CD   5  
ATOM   3085  H HA   . PRO A 1 5  ? -8.006  5.094   7.552   1.00 15.00 ?  283 PRO A HA   5  
ATOM   3086  H HB2  . PRO A 1 5  ? -6.079  2.860   7.383   1.00 15.00 ?  283 PRO A HB2  5  
ATOM   3087  H HB3  . PRO A 1 5  ? -7.686  2.904   8.115   1.00 15.00 ?  283 PRO A HB3  5  
ATOM   3088  H HG2  . PRO A 1 5  ? -7.264  1.595   5.833   1.00 15.00 ?  283 PRO A HG2  5  
ATOM   3089  H HG3  . PRO A 1 5  ? -8.760  2.513   6.093   1.00 15.00 ?  283 PRO A HG3  5  
ATOM   3090  H HD2  . PRO A 1 5  ? -6.313  3.282   4.535   1.00 15.00 ?  283 PRO A HD2  5  
ATOM   3091  H HD3  . PRO A 1 5  ? -8.027  3.470   4.098   1.00 15.00 ?  283 PRO A HD3  5  
ATOM   3092  N N    . PRO A 1 6  ? -5.805  5.701   8.848   1.00 15.00 ?  284 PRO A N    5  
ATOM   3093  C CA   . PRO A 1 6  ? -4.617  6.332   9.441   1.00 15.00 ?  284 PRO A CA   5  
ATOM   3094  C C    . PRO A 1 6  ? -3.425  5.379   9.507   1.00 15.00 ?  284 PRO A C    5  
ATOM   3095  O O    . PRO A 1 6  ? -3.551  4.241   9.960   1.00 15.00 ?  284 PRO A O    5  
ATOM   3096  C CB   . PRO A 1 6  ? -5.059  6.709   10.863  1.00 15.00 ?  284 PRO A CB   5  
ATOM   3097  C CG   . PRO A 1 6  ? -6.540  6.544   10.888  1.00 15.00 ?  284 PRO A CG   5  
ATOM   3098  C CD   . PRO A 1 6  ? -6.871  5.514   9.852   1.00 15.00 ?  284 PRO A CD   5  
ATOM   3099  H HA   . PRO A 1 6  ? -4.333  7.222   8.901   1.00 15.00 ?  284 PRO A HA   5  
ATOM   3100  H HB2  . PRO A 1 6  ? -4.581  6.052   11.574  1.00 15.00 ?  284 PRO A HB2  5  
ATOM   3101  H HB3  . PRO A 1 6  ? -4.775  7.730   11.067  1.00 15.00 ?  284 PRO A HB3  5  
ATOM   3102  H HG2  . PRO A 1 6  ? -6.856  6.206   11.864  1.00 15.00 ?  284 PRO A HG2  5  
ATOM   3103  H HG3  . PRO A 1 6  ? -7.015  7.483   10.646  1.00 15.00 ?  284 PRO A HG3  5  
ATOM   3104  H HD2  . PRO A 1 6  ? -6.835  4.522   10.280  1.00 15.00 ?  284 PRO A HD2  5  
ATOM   3105  H HD3  . PRO A 1 6  ? -7.842  5.713   9.433   1.00 15.00 ?  284 PRO A HD3  5  
ATOM   3106  N N    . GLY A 1 7  ? -2.266  5.855   9.071   1.00 15.00 ?  285 GLY A N    5  
ATOM   3107  C CA   . GLY A 1 7  ? -1.069  5.033   9.100   1.00 15.00 ?  285 GLY A CA   5  
ATOM   3108  C C    . GLY A 1 7  ? -0.841  4.309   7.792   1.00 15.00 ?  285 GLY A C    5  
ATOM   3109  O O    . GLY A 1 7  ? 0.137   3.571   7.640   1.00 15.00 ?  285 GLY A O    5  
ATOM   3110  H H    . GLY A 1 7  ? -2.218  6.775   8.731   1.00 15.00 ?  285 GLY A H    5  
ATOM   3111  H HA2  . GLY A 1 7  ? -0.218  5.665   9.304   1.00 15.00 ?  285 GLY A HA2  5  
ATOM   3112  H HA3  . GLY A 1 7  ? -1.163  4.305   9.891   1.00 15.00 ?  285 GLY A HA3  5  
ATOM   3113  N N    . TRP A 1 8  ? -1.736  4.535   6.842   1.00 15.00 ?  286 TRP A N    5  
ATOM   3114  C CA   . TRP A 1 8  ? -1.648  3.886   5.546   1.00 15.00 ?  286 TRP A CA   5  
ATOM   3115  C C    . TRP A 1 8  ? -0.832  4.709   4.582   1.00 15.00 ?  286 TRP A C    5  
ATOM   3116  O O    . TRP A 1 8  ? -1.284  5.744   4.088   1.00 15.00 ?  286 TRP A O    5  
ATOM   3117  C CB   . TRP A 1 8  ? -3.042  3.645   4.950   1.00 15.00 ?  286 TRP A CB   5  
ATOM   3118  C CG   . TRP A 1 8  ? -3.692  2.404   5.458   1.00 15.00 ?  286 TRP A CG   5  
ATOM   3119  C CD1  . TRP A 1 8  ? -3.852  2.049   6.766   1.00 15.00 ?  286 TRP A CD1  5  
ATOM   3120  C CD2  . TRP A 1 8  ? -4.256  1.340   4.676   1.00 15.00 ?  286 TRP A CD2  5  
ATOM   3121  N NE1  . TRP A 1 8  ? -4.463  0.828   6.851   1.00 15.00 ?  286 TRP A NE1  5  
ATOM   3122  C CE2  . TRP A 1 8  ? -4.719  0.368   5.589   1.00 15.00 ?  286 TRP A CE2  5  
ATOM   3123  C CE3  . TRP A 1 8  ? -4.416  1.099   3.297   1.00 15.00 ?  286 TRP A CE3  5  
ATOM   3124  C CZ2  . TRP A 1 8  ? -5.318  -0.818  5.181   1.00 15.00 ?  286 TRP A CZ2  5  
ATOM   3125  C CZ3  . TRP A 1 8  ? -5.004  -0.087  2.908   1.00 15.00 ?  286 TRP A CZ3  5  
ATOM   3126  C CH2  . TRP A 1 8  ? -5.445  -1.032  3.840   1.00 15.00 ?  286 TRP A CH2  5  
ATOM   3127  H H    . TRP A 1 8  ? -2.476  5.152   7.017   1.00 15.00 ?  286 TRP A H    5  
ATOM   3128  H HA   . TRP A 1 8  ? -1.150  2.933   5.688   1.00 15.00 ?  286 TRP A HA   5  
ATOM   3129  H HB2  . TRP A 1 8  ? -3.681  4.481   5.193   1.00 15.00 ?  286 TRP A HB2  5  
ATOM   3130  H HB3  . TRP A 1 8  ? -2.957  3.562   3.876   1.00 15.00 ?  286 TRP A HB3  5  
ATOM   3131  H HD1  . TRP A 1 8  ? -3.533  2.653   7.601   1.00 15.00 ?  286 TRP A HD1  5  
ATOM   3132  H HE1  . TRP A 1 8  ? -4.678  0.357   7.685   1.00 15.00 ?  286 TRP A HE1  5  
ATOM   3133  H HE3  . TRP A 1 8  ? -4.095  1.837   2.507   1.00 15.00 ?  286 TRP A HE3  5  
ATOM   3134  H HZ2  . TRP A 1 8  ? -5.663  -1.556  5.888   1.00 15.00 ?  286 TRP A HZ2  5  
ATOM   3135  H HZ3  . TRP A 1 8  ? -5.093  -0.310  1.856   1.00 15.00 ?  286 TRP A HZ3  5  
ATOM   3136  H HH2  . TRP A 1 8  ? -5.897  -1.943  3.479   1.00 15.00 ?  286 TRP A HH2  5  
ATOM   3137  N N    . GLU A 1 9  ? 0.379   4.260   4.328   1.00 15.00 ?  287 GLU A N    5  
ATOM   3138  C CA   . GLU A 1 9  ? 1.173   4.836   3.280   1.00 15.00 ?  287 GLU A CA   5  
ATOM   3139  C C    . GLU A 1 9  ? 0.881   4.077   2.002   1.00 15.00 ?  287 GLU A C    5  
ATOM   3140  O O    . GLU A 1 9  ? 1.067   2.863   1.922   1.00 15.00 ?  287 GLU A O    5  
ATOM   3141  C CB   . GLU A 1 9  ? 2.658   4.805   3.638   1.00 15.00 ?  287 GLU A CB   5  
ATOM   3142  C CG   . GLU A 1 9  ? 3.172   6.118   4.210   1.00 15.00 ?  287 GLU A CG   5  
ATOM   3143  C CD   . GLU A 1 9  ? 2.407   6.583   5.431   1.00 15.00 ?  287 GLU A CD   5  
ATOM   3144  O OE1  . GLU A 1 9  ? 2.513   5.926   6.490   1.00 15.00 ?  287 GLU A OE1  5  
ATOM   3145  O OE2  . GLU A 1 9  ? 1.723   7.625   5.342   1.00 15.00 -1 287 GLU A OE2  5  
ATOM   3146  H H    . GLU A 1 9  ? 0.742   3.506   4.849   1.00 15.00 ?  287 GLU A H    5  
ATOM   3147  H HA   . GLU A 1 9  ? 0.857   5.863   3.154   1.00 15.00 ?  287 GLU A HA   5  
ATOM   3148  H HB2  . GLU A 1 9  ? 2.823   4.031   4.374   1.00 15.00 ?  287 GLU A HB2  5  
ATOM   3149  H HB3  . GLU A 1 9  ? 3.233   4.573   2.756   1.00 15.00 ?  287 GLU A HB3  5  
ATOM   3150  H HG2  . GLU A 1 9  ? 4.208   5.989   4.485   1.00 15.00 ?  287 GLU A HG2  5  
ATOM   3151  H HG3  . GLU A 1 9  ? 3.102   6.879   3.445   1.00 15.00 ?  287 GLU A HG3  5  
ATOM   3152  N N    . VAL A 1 10 ? 0.389   4.787   1.017   1.00 15.00 ?  288 VAL A N    5  
ATOM   3153  C CA   . VAL A 1 10 ? -0.041  4.174   -0.217  1.00 15.00 ?  288 VAL A CA   5  
ATOM   3154  C C    . VAL A 1 10 ? 1.120   4.112   -1.197  1.00 15.00 ?  288 VAL A C    5  
ATOM   3155  O O    . VAL A 1 10 ? 1.551   5.130   -1.743  1.00 15.00 ?  288 VAL A O    5  
ATOM   3156  C CB   . VAL A 1 10 ? -1.251  4.943   -0.809  1.00 15.00 ?  288 VAL A CB   5  
ATOM   3157  C CG1  . VAL A 1 10 ? -1.072  6.447   -0.672  1.00 15.00 ?  288 VAL A CG1  5  
ATOM   3158  C CG2  . VAL A 1 10 ? -1.487  4.574   -2.263  1.00 15.00 ?  288 VAL A CG2  5  
ATOM   3159  H H    . VAL A 1 10 ? 0.306   5.757   1.122   1.00 15.00 ?  288 VAL A H    5  
ATOM   3160  H HA   . VAL A 1 10 ? -0.359  3.164   0.008   1.00 15.00 ?  288 VAL A HA   5  
ATOM   3161  H HB   . VAL A 1 10 ? -2.130  4.661   -0.247  1.00 15.00 ?  288 VAL A HB   5  
ATOM   3162  H HG11 . VAL A 1 10 ? -0.311  6.784   -1.360  1.00 15.00 ?  288 VAL A HG11 5  
ATOM   3163  H HG12 . VAL A 1 10 ? -0.772  6.683   0.338   1.00 15.00 ?  288 VAL A HG12 5  
ATOM   3164  H HG13 . VAL A 1 10 ? -2.008  6.939   -0.894  1.00 15.00 ?  288 VAL A HG13 5  
ATOM   3165  H HG21 . VAL A 1 10 ? -1.745  3.528   -2.333  1.00 15.00 ?  288 VAL A HG21 5  
ATOM   3166  H HG22 . VAL A 1 10 ? -0.587  4.761   -2.830  1.00 15.00 ?  288 VAL A HG22 5  
ATOM   3167  H HG23 . VAL A 1 10 ? -2.294  5.174   -2.659  1.00 15.00 ?  288 VAL A HG23 5  
ATOM   3168  N N    . ARG A 1 11 ? 1.661   2.913   -1.396  1.00 15.00 ?  289 ARG A N    5  
ATOM   3169  C CA   . ARG A 1 11 ? 2.808   2.763   -2.254  1.00 15.00 ?  289 ARG A CA   5  
ATOM   3170  C C    . ARG A 1 11 ? 2.310   2.252   -3.604  1.00 15.00 ?  289 ARG A C    5  
ATOM   3171  O O    . ARG A 1 11 ? 2.081   1.067   -3.792  1.00 15.00 ?  289 ARG A O    5  
ATOM   3172  C CB   . ARG A 1 11 ? 3.835   1.823   -1.585  1.00 15.00 ?  289 ARG A CB   5  
ATOM   3173  C CG   . ARG A 1 11 ? 5.295   2.303   -1.594  1.00 15.00 ?  289 ARG A CG   5  
ATOM   3174  C CD   . ARG A 1 11 ? 5.850   2.533   -2.994  1.00 15.00 ?  289 ARG A CD   5  
ATOM   3175  N NE   . ARG A 1 11 ? 5.350   3.777   -3.577  1.00 15.00 ?  289 ARG A NE   5  
ATOM   3176  C CZ   . ARG A 1 11 ? 4.940   3.888   -4.830  1.00 15.00 ?  289 ARG A CZ   5  
ATOM   3177  N NH1  . ARG A 1 11 ? 5.279   2.974   -5.716  1.00 15.00 1  289 ARG A NH1  5  
ATOM   3178  N NH2  . ARG A 1 11 ? 4.253   4.951   -5.218  1.00 15.00 ?  289 ARG A NH2  5  
ATOM   3179  H H    . ARG A 1 11 ? 1.256   2.099   -0.985  1.00 15.00 ?  289 ARG A H    5  
ATOM   3180  H HA   . ARG A 1 11 ? 3.250   3.740   -2.390  1.00 15.00 ?  289 ARG A HA   5  
ATOM   3181  H HB2  . ARG A 1 11 ? 3.547   1.702   -0.552  1.00 15.00 ?  289 ARG A HB2  5  
ATOM   3182  H HB3  . ARG A 1 11 ? 3.793   0.862   -2.054  1.00 15.00 ?  289 ARG A HB3  5  
ATOM   3183  H HG2  . ARG A 1 11 ? 5.357   3.232   -1.047  1.00 15.00 ?  289 ARG A HG2  5  
ATOM   3184  H HG3  . ARG A 1 11 ? 5.901   1.559   -1.099  1.00 15.00 ?  289 ARG A HG3  5  
ATOM   3185  H HD2  . ARG A 1 11 ? 6.928   2.579   -2.938  1.00 15.00 ?  289 ARG A HD2  5  
ATOM   3186  H HD3  . ARG A 1 11 ? 5.556   1.708   -3.626  1.00 15.00 ?  289 ARG A HD3  5  
ATOM   3187  H HE   . ARG A 1 11 ? 5.253   4.541   -2.979  1.00 15.00 ?  289 ARG A HE   5  
ATOM   3188  H HH11 . ARG A 1 11 ? 5.851   2.195   -5.446  1.00 15.00 ?  289 ARG A HH11 5  
ATOM   3189  H HH12 . ARG A 1 11 ? 4.972   3.057   -6.667  1.00 15.00 ?  289 ARG A HH12 5  
ATOM   3190  H HH21 . ARG A 1 11 ? 4.042   5.684   -4.569  1.00 15.00 ?  289 ARG A HH21 5  
ATOM   3191  H HH22 . ARG A 1 11 ? 3.940   5.030   -6.172  1.00 15.00 ?  289 ARG A HH22 5  
ATOM   3192  N N    . SER A 1 12 ? 2.046   3.178   -4.515  1.00 15.00 ?  290 SER A N    5  
ATOM   3193  C CA   . SER A 1 12 ? 1.420   2.839   -5.786  1.00 15.00 ?  290 SER A CA   5  
ATOM   3194  C C    . SER A 1 12 ? 2.438   2.884   -6.921  1.00 15.00 ?  290 SER A C    5  
ATOM   3195  O O    . SER A 1 12 ? 2.914   3.957   -7.295  1.00 15.00 ?  290 SER A O    5  
ATOM   3196  C CB   . SER A 1 12 ? 0.287   3.824   -6.053  1.00 15.00 ?  290 SER A CB   5  
ATOM   3197  O OG   . SER A 1 12 ? -0.415  3.515   -7.245  1.00 15.00 ?  290 SER A OG   5  
ATOM   3198  H H    . SER A 1 12 ? 2.281   4.124   -4.330  1.00 15.00 ?  290 SER A H    5  
ATOM   3199  H HA   . SER A 1 12 ? 1.017   1.841   -5.709  1.00 15.00 ?  290 SER A HA   5  
ATOM   3200  H HB2  . SER A 1 12 ? -0.406  3.806   -5.227  1.00 15.00 ?  290 SER A HB2  5  
ATOM   3201  H HB3  . SER A 1 12 ? 0.710   4.808   -6.136  1.00 15.00 ?  290 SER A HB3  5  
ATOM   3202  H HG   . SER A 1 12 ? -0.075  4.056   -7.965  1.00 15.00 ?  290 SER A HG   5  
ATOM   3203  N N    . THR A 1 13 ? 2.790   1.729   -7.461  1.00 15.00 ?  291 THR A N    5  
ATOM   3204  C CA   . THR A 1 13 ? 3.849   1.663   -8.452  1.00 15.00 ?  291 THR A CA   5  
ATOM   3205  C C    . THR A 1 13 ? 3.305   1.829   -9.871  1.00 15.00 ?  291 THR A C    5  
ATOM   3206  O O    . THR A 1 13 ? 2.213   1.337   -10.200 1.00 15.00 ?  291 THR A O    5  
ATOM   3207  C CB   . THR A 1 13 ? 4.648   0.349   -8.330  1.00 15.00 ?  291 THR A CB   5  
ATOM   3208  O OG1  . THR A 1 13 ? 3.761   -0.774  -8.414  1.00 15.00 ?  291 THR A OG1  5  
ATOM   3209  C CG2  . THR A 1 13 ? 5.402   0.307   -7.003  1.00 15.00 ?  291 THR A CG2  5  
ATOM   3210  H H    . THR A 1 13 ? 2.321   0.904   -7.199  1.00 15.00 ?  291 THR A H    5  
ATOM   3211  H HA   . THR A 1 13 ? 4.527   2.481   -8.252  1.00 15.00 ?  291 THR A HA   5  
ATOM   3212  H HB   . THR A 1 13 ? 5.362   0.299   -9.139  1.00 15.00 ?  291 THR A HB   5  
ATOM   3213  H HG1  . THR A 1 13 ? 4.183   -1.552  -8.022  1.00 15.00 ?  291 THR A HG1  5  
ATOM   3214  H HG21 . THR A 1 13 ? 4.701   0.160   -6.199  1.00 15.00 ?  291 THR A HG21 5  
ATOM   3215  H HG22 . THR A 1 13 ? 5.929   1.254   -6.847  1.00 15.00 ?  291 THR A HG22 5  
ATOM   3216  H HG23 . THR A 1 13 ? 6.116   -0.502  -7.016  1.00 15.00 ?  291 THR A HG23 5  
ATOM   3217  N N    . VAL A 1 14 ? 4.091   2.526   -10.701 1.00 15.00 ?  292 VAL A N    5  
ATOM   3218  C CA   . VAL A 1 14 ? 3.714   2.850   -12.082 1.00 15.00 ?  292 VAL A CA   5  
ATOM   3219  C C    . VAL A 1 14 ? 3.474   1.599   -12.919 1.00 15.00 ?  292 VAL A C    5  
ATOM   3220  O O    . VAL A 1 14 ? 2.911   1.672   -14.010 1.00 15.00 ?  292 VAL A O    5  
ATOM   3221  C CB   . VAL A 1 14 ? 4.782   3.725   -12.777 1.00 15.00 ?  292 VAL A CB   5  
ATOM   3222  C CG1  . VAL A 1 14 ? 4.947   5.051   -12.048 1.00 15.00 ?  292 VAL A CG1  5  
ATOM   3223  C CG2  . VAL A 1 14 ? 6.113   2.991   -12.875 1.00 15.00 ?  292 VAL A CG2  5  
ATOM   3224  H H    . VAL A 1 14 ? 4.961   2.845   -10.366 1.00 15.00 ?  292 VAL A H    5  
ATOM   3225  H HA   . VAL A 1 14 ? 2.796   3.418   -12.044 1.00 15.00 ?  292 VAL A HA   5  
ATOM   3226  H HB   . VAL A 1 14 ? 4.440   3.938   -13.780 1.00 15.00 ?  292 VAL A HB   5  
ATOM   3227  H HG11 . VAL A 1 14 ? 5.259   4.865   -11.030 1.00 15.00 ?  292 VAL A HG11 5  
ATOM   3228  H HG12 . VAL A 1 14 ? 4.006   5.580   -12.045 1.00 15.00 ?  292 VAL A HG12 5  
ATOM   3229  H HG13 . VAL A 1 14 ? 5.695   5.646   -12.549 1.00 15.00 ?  292 VAL A HG13 5  
ATOM   3230  H HG21 . VAL A 1 14 ? 5.981   2.079   -13.438 1.00 15.00 ?  292 VAL A HG21 5  
ATOM   3231  H HG22 . VAL A 1 14 ? 6.469   2.753   -11.883 1.00 15.00 ?  292 VAL A HG22 5  
ATOM   3232  H HG23 . VAL A 1 14 ? 6.834   3.620   -13.374 1.00 15.00 ?  292 VAL A HG23 5  
ATOM   3233  N N    . SER A 1 15 ? 3.920   0.456   -12.408 1.00 15.00 ?  293 SER A N    5  
ATOM   3234  C CA   . SER A 1 15 ? 3.664   -0.829  -13.042 1.00 15.00 ?  293 SER A CA   5  
ATOM   3235  C C    . SER A 1 15 ? 2.155   -1.087  -13.144 1.00 15.00 ?  293 SER A C    5  
ATOM   3236  O O    . SER A 1 15 ? 1.715   -1.978  -13.870 1.00 15.00 ?  293 SER A O    5  
ATOM   3237  C CB   . SER A 1 15 ? 4.356   -1.956  -12.269 1.00 15.00 ?  293 SER A CB   5  
ATOM   3238  O OG   . SER A 1 15 ? 4.231   -3.194  -12.948 1.00 15.00 ?  293 SER A OG   5  
ATOM   3239  H H    . SER A 1 15 ? 4.437   0.479   -11.577 1.00 15.00 ?  293 SER A H    5  
ATOM   3240  H HA   . SER A 1 15 ? 4.073   -0.788  -14.042 1.00 15.00 ?  293 SER A HA   5  
ATOM   3241  H HB2  . SER A 1 15 ? 5.404   -1.725  -12.161 1.00 15.00 ?  293 SER A HB2  5  
ATOM   3242  H HB3  . SER A 1 15 ? 3.904   -2.048  -11.292 1.00 15.00 ?  293 SER A HB3  5  
ATOM   3243  H HG   . SER A 1 15 ? 4.314   -3.044  -13.904 1.00 15.00 ?  293 SER A HG   5  
ATOM   3244  N N    . GLY A 1 16 ? 1.373   -0.305  -12.402 1.00 15.00 ?  294 GLY A N    5  
ATOM   3245  C CA   . GLY A 1 16 ? -0.068  -0.444  -12.436 1.00 15.00 ?  294 GLY A CA   5  
ATOM   3246  C C    . GLY A 1 16 ? -0.583  -1.413  -11.399 1.00 15.00 ?  294 GLY A C    5  
ATOM   3247  O O    . GLY A 1 16 ? -1.418  -2.269  -11.693 1.00 15.00 ?  294 GLY A O    5  
ATOM   3248  H H    . GLY A 1 16 ? 1.784   0.374   -11.825 1.00 15.00 ?  294 GLY A H    5  
ATOM   3249  H HA2  . GLY A 1 16 ? -0.514  0.524   -12.260 1.00 15.00 ?  294 GLY A HA2  5  
ATOM   3250  H HA3  . GLY A 1 16 ? -0.362  -0.790  -13.415 1.00 15.00 ?  294 GLY A HA3  5  
ATOM   3251  N N    . ARG A 1 17 ? -0.067  -1.294  -10.183 1.00 15.00 ?  295 ARG A N    5  
ATOM   3252  C CA   . ARG A 1 17 ? -0.557  -2.101  -9.069  1.00 15.00 ?  295 ARG A CA   5  
ATOM   3253  C C    . ARG A 1 17 ? -0.433  -1.333  -7.761  1.00 15.00 ?  295 ARG A C    5  
ATOM   3254  O O    . ARG A 1 17 ? 0.588   -0.698  -7.496  1.00 15.00 ?  295 ARG A O    5  
ATOM   3255  C CB   . ARG A 1 17 ? 0.184   -3.451  -8.978  1.00 15.00 ?  295 ARG A CB   5  
ATOM   3256  C CG   . ARG A 1 17 ? 1.697   -3.352  -9.112  1.00 15.00 ?  295 ARG A CG   5  
ATOM   3257  C CD   . ARG A 1 17 ? 2.191   -4.138  -10.316 1.00 15.00 ?  295 ARG A CD   5  
ATOM   3258  N NE   . ARG A 1 17 ? 2.762   -5.436  -9.960  1.00 15.00 ?  295 ARG A NE   5  
ATOM   3259  C CZ   . ARG A 1 17 ? 3.518   -6.172  -10.784 1.00 15.00 ?  295 ARG A CZ   5  
ATOM   3260  N NH1  . ARG A 1 17 ? 3.859   -5.711  -11.982 1.00 15.00 1  295 ARG A NH1  5  
ATOM   3261  N NH2  . ARG A 1 17 ? 3.946   -7.365  -10.399 1.00 15.00 ?  295 ARG A NH2  5  
ATOM   3262  H H    . ARG A 1 17 ? 0.654   -0.634  -10.023 1.00 15.00 ?  295 ARG A H    5  
ATOM   3263  H HA   . ARG A 1 17 ? -1.605  -2.293  -9.250  1.00 15.00 ?  295 ARG A HA   5  
ATOM   3264  H HB2  . ARG A 1 17 ? -0.038  -3.900  -8.023  1.00 15.00 ?  295 ARG A HB2  5  
ATOM   3265  H HB3  . ARG A 1 17 ? -0.183  -4.100  -9.760  1.00 15.00 ?  295 ARG A HB3  5  
ATOM   3266  H HG2  . ARG A 1 17 ? 1.972   -2.315  -9.234  1.00 15.00 ?  295 ARG A HG2  5  
ATOM   3267  H HG3  . ARG A 1 17 ? 2.158   -3.748  -8.218  1.00 15.00 ?  295 ARG A HG3  5  
ATOM   3268  H HD2  . ARG A 1 17 ? 1.352   -4.308  -10.971 1.00 15.00 ?  295 ARG A HD2  5  
ATOM   3269  H HD3  . ARG A 1 17 ? 2.938   -3.557  -10.828 1.00 15.00 ?  295 ARG A HD3  5  
ATOM   3270  H HE   . ARG A 1 17 ? 2.558   -5.794  -9.059  1.00 15.00 ?  295 ARG A HE   5  
ATOM   3271  H HH11 . ARG A 1 17 ? 3.562   -4.797  -12.280 1.00 15.00 ?  295 ARG A HH11 5  
ATOM   3272  H HH12 . ARG A 1 17 ? 4.410   -6.281  -12.604 1.00 15.00 ?  295 ARG A HH12 5  
ATOM   3273  H HH21 . ARG A 1 17 ? 3.698   -7.719  -9.490  1.00 15.00 ?  295 ARG A HH21 5  
ATOM   3274  H HH22 . ARG A 1 17 ? 4.512   -7.927  -11.013 1.00 15.00 ?  295 ARG A HH22 5  
ATOM   3275  N N    . ILE A 1 18 ? -1.480  -1.400  -6.948  1.00 15.00 ?  296 ILE A N    5  
ATOM   3276  C CA   . ILE A 1 18 ? -1.454  -0.794  -5.629  1.00 15.00 ?  296 ILE A CA   5  
ATOM   3277  C C    . ILE A 1 18 ? -0.932  -1.815  -4.636  1.00 15.00 ?  296 ILE A C    5  
ATOM   3278  O O    . ILE A 1 18 ? -1.255  -2.997  -4.732  1.00 15.00 ?  296 ILE A O    5  
ATOM   3279  C CB   . ILE A 1 18 ? -2.860  -0.301  -5.171  1.00 15.00 ?  296 ILE A CB   5  
ATOM   3280  C CG1  . ILE A 1 18 ? -2.767  0.436   -3.838  1.00 15.00 ?  296 ILE A CG1  5  
ATOM   3281  C CG2  . ILE A 1 18 ? -3.851  -1.445  -5.038  1.00 15.00 ?  296 ILE A CG2  5  
ATOM   3282  C CD1  . ILE A 1 18 ? -2.134  1.791   -3.954  1.00 15.00 ?  296 ILE A CD1  5  
ATOM   3283  H H    . ILE A 1 18 ? -2.284  -1.876  -7.238  1.00 15.00 ?  296 ILE A H    5  
ATOM   3284  H HA   . ILE A 1 18 ? -0.781  0.051   -5.658  1.00 15.00 ?  296 ILE A HA   5  
ATOM   3285  H HB   . ILE A 1 18 ? -3.236  0.379   -5.918  1.00 15.00 ?  296 ILE A HB   5  
ATOM   3286  H HG12 . ILE A 1 18 ? -3.760  0.567   -3.435  1.00 15.00 ?  296 ILE A HG12 5  
ATOM   3287  H HG13 . ILE A 1 18 ? -2.177  -0.151  -3.148  1.00 15.00 ?  296 ILE A HG13 5  
ATOM   3288  H HG21 . ILE A 1 18 ? -4.771  -1.065  -4.608  1.00 15.00 ?  296 ILE A HG21 5  
ATOM   3289  H HG22 . ILE A 1 18 ? -3.440  -2.202  -4.386  1.00 15.00 ?  296 ILE A HG22 5  
ATOM   3290  H HG23 . ILE A 1 18 ? -4.052  -1.868  -6.009  1.00 15.00 ?  296 ILE A HG23 5  
ATOM   3291  H HD11 . ILE A 1 18 ? -2.783  2.433   -4.530  1.00 15.00 ?  296 ILE A HD11 5  
ATOM   3292  H HD12 . ILE A 1 18 ? -1.179  1.697   -4.449  1.00 15.00 ?  296 ILE A HD12 5  
ATOM   3293  H HD13 . ILE A 1 18 ? -1.992  2.208   -2.969  1.00 15.00 ?  296 ILE A HD13 5  
ATOM   3294  N N    . TYR A 1 19 ? -0.108  -1.375  -3.705  1.00 15.00 ?  297 TYR A N    5  
ATOM   3295  C CA   . TYR A 1 19 ? 0.415   -2.279  -2.712  1.00 15.00 ?  297 TYR A CA   5  
ATOM   3296  C C    . TYR A 1 19 ? 0.662   -1.475  -1.462  1.00 15.00 ?  297 TYR A C    5  
ATOM   3297  O O    . TYR A 1 19 ? 1.294   -0.397  -1.476  1.00 15.00 ?  297 TYR A O    5  
ATOM   3298  C CB   . TYR A 1 19 ? 1.652   -3.082  -3.196  1.00 15.00 ?  297 TYR A CB   5  
ATOM   3299  C CG   . TYR A 1 19 ? 3.025   -2.485  -2.957  1.00 15.00 ?  297 TYR A CG   5  
ATOM   3300  C CD1  . TYR A 1 19 ? 3.475   -1.380  -3.660  1.00 15.00 ?  297 TYR A CD1  5  
ATOM   3301  C CD2  . TYR A 1 19 ? 3.889   -3.071  -2.033  1.00 15.00 ?  297 TYR A CD2  5  
ATOM   3302  C CE1  . TYR A 1 19 ? 4.740   -0.866  -3.445  1.00 15.00 ?  297 TYR A CE1  5  
ATOM   3303  C CE2  . TYR A 1 19 ? 5.154   -2.562  -1.812  1.00 15.00 ?  297 TYR A CE2  5  
ATOM   3304  C CZ   . TYR A 1 19 ? 5.574   -1.458  -2.521  1.00 15.00 ?  297 TYR A CZ   5  
ATOM   3305  O OH   . TYR A 1 19 ? 6.829   -0.937  -2.305  1.00 15.00 ?  297 TYR A OH   5  
ATOM   3306  H H    . TYR A 1 19 ? 0.070   -0.406  -3.622  1.00 15.00 ?  297 TYR A H    5  
ATOM   3307  H HA   . TYR A 1 19 ? -0.378  -2.981  -2.490  1.00 15.00 ?  297 TYR A HA   5  
ATOM   3308  H HB2  . TYR A 1 19 ? 1.641   -4.042  -2.708  1.00 15.00 ?  297 TYR A HB2  5  
ATOM   3309  H HB3  . TYR A 1 19 ? 1.550   -3.242  -4.262  1.00 15.00 ?  297 TYR A HB3  5  
ATOM   3310  H HD1  . TYR A 1 19 ? 2.820   -0.914  -4.380  1.00 15.00 ?  297 TYR A HD1  5  
ATOM   3311  H HD2  . TYR A 1 19 ? 3.557   -3.942  -1.484  1.00 15.00 ?  297 TYR A HD2  5  
ATOM   3312  H HE1  . TYR A 1 19 ? 5.070   -0.003  -4.002  1.00 15.00 ?  297 TYR A HE1  5  
ATOM   3313  H HE2  . TYR A 1 19 ? 5.810   -3.034  -1.087  1.00 15.00 ?  297 TYR A HE2  5  
ATOM   3314  H HH   . TYR A 1 19 ? 7.468   -1.653  -2.250  1.00 15.00 ?  297 TYR A HH   5  
ATOM   3315  N N    . PHE A 1 20 ? 0.076   -1.939  -0.399  1.00 15.00 ?  298 PHE A N    5  
ATOM   3316  C CA   . PHE A 1 20 ? 0.032   -1.166  0.782   1.00 15.00 ?  298 PHE A CA   5  
ATOM   3317  C C    . PHE A 1 20 ? 1.156   -1.403  1.710   1.00 15.00 ?  298 PHE A C    5  
ATOM   3318  O O    . PHE A 1 20 ? 1.517   -2.532  2.011   1.00 15.00 ?  298 PHE A O    5  
ATOM   3319  C CB   . PHE A 1 20 ? -1.271  -1.353  1.477   1.00 15.00 ?  298 PHE A CB   5  
ATOM   3320  C CG   . PHE A 1 20 ? -2.088  -0.192  1.170   1.00 15.00 ?  298 PHE A CG   5  
ATOM   3321  C CD1  . PHE A 1 20 ? -1.737  1.029   1.704   1.00 15.00 ?  298 PHE A CD1  5  
ATOM   3322  C CD2  . PHE A 1 20 ? -3.166  -0.288  0.324   1.00 15.00 ?  298 PHE A CD2  5  
ATOM   3323  C CE1  . PHE A 1 20 ? -2.459  2.139   1.412   1.00 15.00 ?  298 PHE A CE1  5  
ATOM   3324  C CE2  . PHE A 1 20 ? -3.894  0.826   0.028   1.00 15.00 ?  298 PHE A CE2  5  
ATOM   3325  C CZ   . PHE A 1 20 ? -3.539  2.030   0.578   1.00 15.00 ?  298 PHE A CZ   5  
ATOM   3326  H H    . PHE A 1 20 ? -0.387  -2.803  -0.431  1.00 15.00 ?  298 PHE A H    5  
ATOM   3327  H HA   . PHE A 1 20 ? 0.079   -0.137  0.466   1.00 15.00 ?  298 PHE A HA   5  
ATOM   3328  H HB2  . PHE A 1 20 ? -1.765  -2.246  1.114   1.00 15.00 ?  298 PHE A HB2  5  
ATOM   3329  H HB3  . PHE A 1 20 ? -1.127  -1.406  2.545   1.00 15.00 ?  298 PHE A HB3  5  
ATOM   3330  H HD1  . PHE A 1 20 ? -0.889  1.095   2.370   1.00 15.00 ?  298 PHE A HD1  5  
ATOM   3331  H HD2  . PHE A 1 20 ? -3.433  -1.244  -0.101  1.00 15.00 ?  298 PHE A HD2  5  
ATOM   3332  H HE1  . PHE A 1 20 ? -2.185  3.097   1.829   1.00 15.00 ?  298 PHE A HE1  5  
ATOM   3333  H HE2  . PHE A 1 20 ? -4.741  0.765   -0.631  1.00 15.00 ?  298 PHE A HE2  5  
ATOM   3334  H HZ   . PHE A 1 20 ? -4.116  2.866   0.384   1.00 15.00 ?  298 PHE A HZ   5  
ATOM   3335  N N    . VAL A 1 21 ? 1.639   -0.298  2.206   1.00 15.00 ?  299 VAL A N    5  
ATOM   3336  C CA   . VAL A 1 21 ? 2.734   -0.277  3.110   1.00 15.00 ?  299 VAL A CA   5  
ATOM   3337  C C    . VAL A 1 21 ? 2.344   0.587   4.308   1.00 15.00 ?  299 VAL A C    5  
ATOM   3338  O O    . VAL A 1 21 ? 2.520   1.806   4.334   1.00 15.00 ?  299 VAL A O    5  
ATOM   3339  C CB   . VAL A 1 21 ? 3.996   0.253   2.387   1.00 15.00 ?  299 VAL A CB   5  
ATOM   3340  C CG1  . VAL A 1 21 ? 4.434   -0.713  1.288   1.00 15.00 ?  299 VAL A CG1  5  
ATOM   3341  C CG2  . VAL A 1 21 ? 3.724   1.615   1.770   1.00 15.00 ?  299 VAL A CG2  5  
ATOM   3342  H H    . VAL A 1 21 ? 1.213   0.554   1.969   1.00 15.00 ?  299 VAL A H    5  
ATOM   3343  H HA   . VAL A 1 21 ? 2.921   -1.289  3.443   1.00 15.00 ?  299 VAL A HA   5  
ATOM   3344  H HB   . VAL A 1 21 ? 4.797   0.351   3.103   1.00 15.00 ?  299 VAL A HB   5  
ATOM   3345  H HG11 . VAL A 1 21 ? 3.691   -0.723  0.505   1.00 15.00 ?  299 VAL A HG11 5  
ATOM   3346  H HG12 . VAL A 1 21 ? 4.537   -1.708  1.693   1.00 15.00 ?  299 VAL A HG12 5  
ATOM   3347  H HG13 . VAL A 1 21 ? 5.380   -0.390  0.880   1.00 15.00 ?  299 VAL A HG13 5  
ATOM   3348  H HG21 . VAL A 1 21 ? 2.951   1.523   1.020   1.00 15.00 ?  299 VAL A HG21 5  
ATOM   3349  H HG22 . VAL A 1 21 ? 4.628   1.991   1.313   1.00 15.00 ?  299 VAL A HG22 5  
ATOM   3350  H HG23 . VAL A 1 21 ? 3.401   2.295   2.539   1.00 15.00 ?  299 VAL A HG23 5  
ATOM   3351  N N    . ASP A 1 22 ? 1.758   -0.055  5.291   1.00 15.00 ?  300 ASP A N    5  
ATOM   3352  C CA   . ASP A 1 22 ? 1.291   0.648   6.467   1.00 15.00 ?  300 ASP A CA   5  
ATOM   3353  C C    . ASP A 1 22 ? 2.381   0.622   7.522   1.00 15.00 ?  300 ASP A C    5  
ATOM   3354  O O    . ASP A 1 22 ? 2.853   -0.445  7.918   1.00 15.00 ?  300 ASP A O    5  
ATOM   3355  C CB   . ASP A 1 22 ? -0.039  0.040   6.959   1.00 15.00 ?  300 ASP A CB   5  
ATOM   3356  C CG   . ASP A 1 22 ? -0.064  -0.262  8.445   1.00 15.00 ?  300 ASP A CG   5  
ATOM   3357  O OD1  . ASP A 1 22 ? -0.055  0.685   9.254   1.00 15.00 -1 300 ASP A OD1  5  
ATOM   3358  O OD2  . ASP A 1 22 ? -0.089  -1.454  8.808   1.00 15.00 ?  300 ASP A OD2  5  
ATOM   3359  H H    . ASP A 1 22 ? 1.636   -1.028  5.230   1.00 15.00 ?  300 ASP A H    5  
ATOM   3360  H HA   . ASP A 1 22 ? 1.119   1.677   6.180   1.00 15.00 ?  300 ASP A HA   5  
ATOM   3361  H HB2  . ASP A 1 22 ? -0.835  0.739   6.750   1.00 15.00 ?  300 ASP A HB2  5  
ATOM   3362  H HB3  . ASP A 1 22 ? -0.231  -0.878  6.416   1.00 15.00 ?  300 ASP A HB3  5  
ATOM   3363  N N    . HIS A 1 23 ? 2.818   1.804   7.940   1.00 15.00 ?  301 HIS A N    5  
ATOM   3364  C CA   . HIS A 1 23 ? 3.928   1.900   8.875   1.00 15.00 ?  301 HIS A CA   5  
ATOM   3365  C C    . HIS A 1 23 ? 3.412   1.862   10.313  1.00 15.00 ?  301 HIS A C    5  
ATOM   3366  O O    . HIS A 1 23 ? 4.194   1.798   11.262  1.00 15.00 ?  301 HIS A O    5  
ATOM   3367  C CB   . HIS A 1 23 ? 4.748   3.187   8.686   1.00 15.00 ?  301 HIS A CB   5  
ATOM   3368  C CG   . HIS A 1 23 ? 5.123   3.566   7.278   1.00 15.00 ?  301 HIS A CG   5  
ATOM   3369  N ND1  . HIS A 1 23 ? 5.224   4.875   6.878   1.00 15.00 ?  301 HIS A ND1  5  
ATOM   3370  C CD2  . HIS A 1 23 ? 5.537   2.830   6.218   1.00 15.00 ?  301 HIS A CD2  5  
ATOM   3371  C CE1  . HIS A 1 23 ? 5.686   4.925   5.648   1.00 15.00 ?  301 HIS A CE1  5  
ATOM   3372  N NE2  . HIS A 1 23 ? 5.895   3.695   5.220   1.00 15.00 ?  301 HIS A NE2  5  
ATOM   3373  H H    . HIS A 1 23 ? 2.372   2.623   7.625   1.00 15.00 ?  301 HIS A H    5  
ATOM   3374  H HA   . HIS A 1 23 ? 4.570   1.046   8.716   1.00 15.00 ?  301 HIS A HA   5  
ATOM   3375  H HB2  . HIS A 1 23 ? 4.202   4.012   9.107   1.00 15.00 ?  301 HIS A HB2  5  
ATOM   3376  H HB3  . HIS A 1 23 ? 5.670   3.068   9.234   1.00 15.00 ?  301 HIS A HB3  5  
ATOM   3377  H HD1  . HIS A 1 23 ? 4.979   5.665   7.419   1.00 15.00 ?  301 HIS A HD1  5  
ATOM   3378  H HD2  . HIS A 1 23 ? 5.568   1.750   6.156   1.00 15.00 ?  301 HIS A HD2  5  
ATOM   3379  H HE1  . HIS A 1 23 ? 5.851   5.825   5.069   1.00 15.00 ?  301 HIS A HE1  5  
ATOM   3380  H HE2  . HIS A 1 23 ? 6.553   3.473   4.515   1.00 15.00 ?  301 HIS A HE2  5  
ATOM   3381  N N    . ASN A 1 24 ? 2.094   1.901   10.460  1.00 15.00 ?  302 ASN A N    5  
ATOM   3382  C CA   . ASN A 1 24 ? 1.461   1.970   11.772  1.00 15.00 ?  302 ASN A CA   5  
ATOM   3383  C C    . ASN A 1 24 ? 1.342   0.576   12.382  1.00 15.00 ?  302 ASN A C    5  
ATOM   3384  O O    . ASN A 1 24 ? 1.943   0.284   13.417  1.00 15.00 ?  302 ASN A O    5  
ATOM   3385  C CB   . ASN A 1 24 ? 0.078   2.623   11.643  1.00 15.00 ?  302 ASN A CB   5  
ATOM   3386  C CG   . ASN A 1 24 ? -0.649  2.772   12.967  1.00 15.00 ?  302 ASN A CG   5  
ATOM   3387  O OD1  . ASN A 1 24 ? -0.033  2.953   14.018  1.00 15.00 ?  302 ASN A OD1  5  
ATOM   3388  N ND2  . ASN A 1 24 ? -1.971  2.714   12.917  1.00 15.00 ?  302 ASN A ND2  5  
ATOM   3389  H H    . ASN A 1 24 ? 1.521   1.861   9.660   1.00 15.00 ?  302 ASN A H    5  
ATOM   3390  H HA   . ASN A 1 24 ? 2.083   2.579   12.411  1.00 15.00 ?  302 ASN A HA   5  
ATOM   3391  H HB2  . ASN A 1 24 ? 0.195   3.606   11.212  1.00 15.00 ?  302 ASN A HB2  5  
ATOM   3392  H HB3  . ASN A 1 24 ? -0.532  2.022   10.984  1.00 15.00 ?  302 ASN A HB3  5  
ATOM   3393  H HD21 . ASN A 1 24 ? -2.398  2.580   12.042  1.00 15.00 ?  302 ASN A HD21 5  
ATOM   3394  H HD22 . ASN A 1 24 ? -2.475  2.807   13.757  1.00 15.00 ?  302 ASN A HD22 5  
ATOM   3395  N N    . ASN A 1 25 ? 0.581   -0.288  11.727  1.00 15.00 ?  303 ASN A N    5  
ATOM   3396  C CA   . ASN A 1 25 ? 0.401   -1.656  12.203  1.00 15.00 ?  303 ASN A CA   5  
ATOM   3397  C C    . ASN A 1 25 ? 1.427   -2.592  11.569  1.00 15.00 ?  303 ASN A C    5  
ATOM   3398  O O    . ASN A 1 25 ? 1.638   -3.708  12.049  1.00 15.00 ?  303 ASN A O    5  
ATOM   3399  C CB   . ASN A 1 25 ? -1.029  -2.140  11.922  1.00 15.00 ?  303 ASN A CB   5  
ATOM   3400  C CG   . ASN A 1 25 ? -1.292  -3.553  12.422  1.00 15.00 ?  303 ASN A CG   5  
ATOM   3401  O OD1  . ASN A 1 25 ? -1.582  -3.762  13.602  1.00 15.00 ?  303 ASN A OD1  5  
ATOM   3402  N ND2  . ASN A 1 25 ? -1.227  -4.528  11.526  1.00 15.00 ?  303 ASN A ND2  5  
ATOM   3403  H H    . ASN A 1 25 ? 0.125   0.002   10.894  1.00 15.00 ?  303 ASN A H    5  
ATOM   3404  H HA   . ASN A 1 25 ? 0.560   -1.649  13.272  1.00 15.00 ?  303 ASN A HA   5  
ATOM   3405  H HB2  . ASN A 1 25 ? -1.730  -1.475  12.404  1.00 15.00 ?  303 ASN A HB2  5  
ATOM   3406  H HB3  . ASN A 1 25 ? -1.203  -2.120  10.855  1.00 15.00 ?  303 ASN A HB3  5  
ATOM   3407  H HD21 . ASN A 1 25 ? -1.014  -4.290  10.591  1.00 15.00 ?  303 ASN A HD21 5  
ATOM   3408  H HD22 . ASN A 1 25 ? -1.390  -5.447  11.827  1.00 15.00 ?  303 ASN A HD22 5  
ATOM   3409  N N    . ARG A 1 26 ? 2.076   -2.114  10.505  1.00 15.00 ?  304 ARG A N    5  
ATOM   3410  C CA   . ARG A 1 26 ? 3.000   -2.918  9.710   1.00 15.00 ?  304 ARG A CA   5  
ATOM   3411  C C    . ARG A 1 26 ? 2.229   -3.996  8.955   1.00 15.00 ?  304 ARG A C    5  
ATOM   3412  O O    . ARG A 1 26 ? 2.110   -5.141  9.403   1.00 15.00 ?  304 ARG A O    5  
ATOM   3413  C CB   . ARG A 1 26 ? 4.125   -3.526  10.565  1.00 15.00 ?  304 ARG A CB   5  
ATOM   3414  C CG   . ARG A 1 26 ? 5.032   -4.478  9.802   1.00 15.00 ?  304 ARG A CG   5  
ATOM   3415  C CD   . ARG A 1 26 ? 6.146   -5.016  10.680  1.00 15.00 ?  304 ARG A CD   5  
ATOM   3416  N NE   . ARG A 1 26 ? 6.885   -6.090  10.021  1.00 15.00 ?  304 ARG A NE   5  
ATOM   3417  C CZ   . ARG A 1 26 ? 7.896   -6.756  10.579  1.00 15.00 ?  304 ARG A CZ   5  
ATOM   3418  N NH1  . ARG A 1 26 ? 8.332   -6.424  11.790  1.00 15.00 1  304 ARG A NH1  5  
ATOM   3419  N NH2  . ARG A 1 26 ? 8.476   -7.749  9.915   1.00 15.00 ?  304 ARG A NH2  5  
ATOM   3420  H H    . ARG A 1 26 ? 1.906   -1.190  10.227  1.00 15.00 ?  304 ARG A H    5  
ATOM   3421  H HA   . ARG A 1 26 ? 3.444   -2.256  8.978   1.00 15.00 ?  304 ARG A HA   5  
ATOM   3422  H HB2  . ARG A 1 26 ? 4.732   -2.724  10.958  1.00 15.00 ?  304 ARG A HB2  5  
ATOM   3423  H HB3  . ARG A 1 26 ? 3.682   -4.068  11.388  1.00 15.00 ?  304 ARG A HB3  5  
ATOM   3424  H HG2  . ARG A 1 26 ? 4.443   -5.307  9.438   1.00 15.00 ?  304 ARG A HG2  5  
ATOM   3425  H HG3  . ARG A 1 26 ? 5.468   -3.950  8.965   1.00 15.00 ?  304 ARG A HG3  5  
ATOM   3426  H HD2  . ARG A 1 26 ? 6.829   -4.211  10.910  1.00 15.00 ?  304 ARG A HD2  5  
ATOM   3427  H HD3  . ARG A 1 26 ? 5.716   -5.394  11.595  1.00 15.00 ?  304 ARG A HD3  5  
ATOM   3428  H HE   . ARG A 1 26 ? 6.596   -6.345  9.114   1.00 15.00 ?  304 ARG A HE   5  
ATOM   3429  H HH11 . ARG A 1 26 ? 7.902   -5.673  12.292  1.00 15.00 ?  304 ARG A HH11 5  
ATOM   3430  H HH12 . ARG A 1 26 ? 9.090   -6.928  12.208  1.00 15.00 ?  304 ARG A HH12 5  
ATOM   3431  H HH21 . ARG A 1 26 ? 8.148   -7.997  8.993   1.00 15.00 ?  304 ARG A HH21 5  
ATOM   3432  H HH22 . ARG A 1 26 ? 9.232   -8.268  10.331  1.00 15.00 ?  304 ARG A HH22 5  
ATOM   3433  N N    . THR A 1 27 ? 1.647   -3.594  7.836   1.00 15.00 ?  305 THR A N    5  
ATOM   3434  C CA   . THR A 1 27 ? 0.821   -4.482  7.043   1.00 15.00 ?  305 THR A CA   5  
ATOM   3435  C C    . THR A 1 27 ? 0.980   -4.176  5.558   1.00 15.00 ?  305 THR A C    5  
ATOM   3436  O O    . THR A 1 27 ? 1.028   -3.009  5.159   1.00 15.00 ?  305 THR A O    5  
ATOM   3437  C CB   . THR A 1 27 ? -0.668  -4.328  7.425   1.00 15.00 ?  305 THR A CB   5  
ATOM   3438  O OG1  . THR A 1 27 ? -0.789  -3.983  8.813   1.00 15.00 ?  305 THR A OG1  5  
ATOM   3439  C CG2  . THR A 1 27 ? -1.434  -5.614  7.154   1.00 15.00 ?  305 THR A CG2  5  
ATOM   3440  H H    . THR A 1 27 ? 1.763   -2.663  7.546   1.00 15.00 ?  305 THR A H    5  
ATOM   3441  H HA   . THR A 1 27 ? 1.125   -5.500  7.239   1.00 15.00 ?  305 THR A HA   5  
ATOM   3442  H HB   . THR A 1 27 ? -1.096  -3.537  6.826   1.00 15.00 ?  305 THR A HB   5  
ATOM   3443  H HG1  . THR A 1 27 ? -0.529  -3.047  8.925   1.00 15.00 ?  305 THR A HG1  5  
ATOM   3444  H HG21 . THR A 1 27 ? -1.016  -6.414  7.746   1.00 15.00 ?  305 THR A HG21 5  
ATOM   3445  H HG22 . THR A 1 27 ? -1.358  -5.863  6.107   1.00 15.00 ?  305 THR A HG22 5  
ATOM   3446  H HG23 . THR A 1 27 ? -2.473  -5.475  7.417   1.00 15.00 ?  305 THR A HG23 5  
ATOM   3447  N N    . THR A 1 28 ? 1.077   -5.219  4.747   1.00 15.00 ?  306 THR A N    5  
ATOM   3448  C CA   . THR A 1 28 ? 1.113   -5.060  3.305   1.00 15.00 ?  306 THR A CA   5  
ATOM   3449  C C    . THR A 1 28 ? -0.160  -5.638  2.693   1.00 15.00 ?  306 THR A C    5  
ATOM   3450  O O    . THR A 1 28 ? -0.451  -6.821  2.859   1.00 15.00 ?  306 THR A O    5  
ATOM   3451  C CB   . THR A 1 28 ? 2.343   -5.750  2.689   1.00 15.00 ?  306 THR A CB   5  
ATOM   3452  O OG1  . THR A 1 28 ? 3.513   -5.458  3.464   1.00 15.00 ?  306 THR A OG1  5  
ATOM   3453  C CG2  . THR A 1 28 ? 2.556   -5.277  1.260   1.00 15.00 ?  306 THR A CG2  5  
ATOM   3454  H H    . THR A 1 28 ? 1.135   -6.118  5.128   1.00 15.00 ?  306 THR A H    5  
ATOM   3455  H HA   . THR A 1 28 ? 1.162   -4.004  3.083   1.00 15.00 ?  306 THR A HA   5  
ATOM   3456  H HB   . THR A 1 28 ? 2.177   -6.817  2.682   1.00 15.00 ?  306 THR A HB   5  
ATOM   3457  H HG1  . THR A 1 28 ? 4.298   -5.616  2.918   1.00 15.00 ?  306 THR A HG1  5  
ATOM   3458  H HG21 . THR A 1 28 ? 1.683   -5.510  0.669   1.00 15.00 ?  306 THR A HG21 5  
ATOM   3459  H HG22 . THR A 1 28 ? 3.419   -5.776  0.842   1.00 15.00 ?  306 THR A HG22 5  
ATOM   3460  H HG23 . THR A 1 28 ? 2.720   -4.210  1.256   1.00 15.00 ?  306 THR A HG23 5  
ATOM   3461  N N    . GLN A 1 29 ? -0.923  -4.802  2.001   1.00 15.00 ?  307 GLN A N    5  
ATOM   3462  C CA   . GLN A 1 29 ? -2.239  -5.207  1.491   1.00 15.00 ?  307 GLN A CA   5  
ATOM   3463  C C    . GLN A 1 29 ? -2.401  -4.851  0.013   1.00 15.00 ?  307 GLN A C    5  
ATOM   3464  O O    . GLN A 1 29 ? -2.030  -3.765  -0.408  1.00 15.00 ?  307 GLN A O    5  
ATOM   3465  C CB   . GLN A 1 29 ? -3.346  -4.521  2.304   1.00 15.00 ?  307 GLN A CB   5  
ATOM   3466  C CG   . GLN A 1 29 ? -3.361  -4.905  3.775   1.00 15.00 ?  307 GLN A CG   5  
ATOM   3467  C CD   . GLN A 1 29 ? -3.839  -6.326  4.010   1.00 15.00 ?  307 GLN A CD   5  
ATOM   3468  O OE1  . GLN A 1 29 ? -5.027  -6.566  4.205   1.00 15.00 ?  307 GLN A OE1  5  
ATOM   3469  N NE2  . GLN A 1 29 ? -2.919  -7.276  3.987   1.00 15.00 ?  307 GLN A NE2  5  
ATOM   3470  H H    . GLN A 1 29 ? -0.592  -3.889  1.821   1.00 15.00 ?  307 GLN A H    5  
ATOM   3471  H HA   . GLN A 1 29 ? -2.329  -6.277  1.607   1.00 15.00 ?  307 GLN A HA   5  
ATOM   3472  H HB2  . GLN A 1 29 ? -3.214  -3.451  2.236   1.00 15.00 ?  307 GLN A HB2  5  
ATOM   3473  H HB3  . GLN A 1 29 ? -4.303  -4.783  1.878   1.00 15.00 ?  307 GLN A HB3  5  
ATOM   3474  H HG2  . GLN A 1 29 ? -2.361  -4.808  4.170   1.00 15.00 ?  307 GLN A HG2  5  
ATOM   3475  H HG3  . GLN A 1 29 ? -4.020  -4.229  4.300   1.00 15.00 ?  307 GLN A HG3  5  
ATOM   3476  H HE21 . GLN A 1 29 ? -1.985  -7.020  3.817   1.00 15.00 ?  307 GLN A HE21 5  
ATOM   3477  H HE22 . GLN A 1 29 ? -3.205  -8.205  4.152   1.00 15.00 ?  307 GLN A HE22 5  
ATOM   3478  N N    . PHE A 1 30 ? -2.974  -5.760  -0.768  1.00 15.00 ?  308 PHE A N    5  
ATOM   3479  C CA   . PHE A 1 30 ? -3.239  -5.484  -2.182  1.00 15.00 ?  308 PHE A CA   5  
ATOM   3480  C C    . PHE A 1 30 ? -4.631  -4.898  -2.394  1.00 15.00 ?  308 PHE A C    5  
ATOM   3481  O O    . PHE A 1 30 ? -4.940  -4.385  -3.466  1.00 15.00 ?  308 PHE A O    5  
ATOM   3482  C CB   . PHE A 1 30 ? -3.055  -6.733  -3.045  1.00 15.00 ?  308 PHE A CB   5  
ATOM   3483  C CG   . PHE A 1 30 ? -1.643  -6.918  -3.507  1.00 15.00 ?  308 PHE A CG   5  
ATOM   3484  C CD1  . PHE A 1 30 ? -0.981  -5.881  -4.142  1.00 15.00 ?  308 PHE A CD1  5  
ATOM   3485  C CD2  . PHE A 1 30 ? -0.979  -8.112  -3.316  1.00 15.00 ?  308 PHE A CD2  5  
ATOM   3486  C CE1  . PHE A 1 30 ? 0.320   -6.027  -4.576  1.00 15.00 ?  308 PHE A CE1  5  
ATOM   3487  C CE2  . PHE A 1 30 ? 0.318   -8.263  -3.745  1.00 15.00 ?  308 PHE A CE2  5  
ATOM   3488  C CZ   . PHE A 1 30 ? 0.971   -7.222  -4.376  1.00 15.00 ?  308 PHE A CZ   5  
ATOM   3489  H H    . PHE A 1 30 ? -3.215  -6.633  -0.395  1.00 15.00 ?  308 PHE A H    5  
ATOM   3490  H HA   . PHE A 1 30 ? -2.518  -4.745  -2.497  1.00 15.00 ?  308 PHE A HA   5  
ATOM   3491  H HB2  . PHE A 1 30 ? -3.336  -7.605  -2.474  1.00 15.00 ?  308 PHE A HB2  5  
ATOM   3492  H HB3  . PHE A 1 30 ? -3.685  -6.660  -3.919  1.00 15.00 ?  308 PHE A HB3  5  
ATOM   3493  H HD1  . PHE A 1 30 ? -1.493  -4.945  -4.291  1.00 15.00 ?  308 PHE A HD1  5  
ATOM   3494  H HD2  . PHE A 1 30 ? -1.481  -8.934  -2.830  1.00 15.00 ?  308 PHE A HD2  5  
ATOM   3495  H HE1  . PHE A 1 30 ? 0.825   -5.208  -5.075  1.00 15.00 ?  308 PHE A HE1  5  
ATOM   3496  H HE2  . PHE A 1 30 ? 0.829   -9.202  -3.588  1.00 15.00 ?  308 PHE A HE2  5  
ATOM   3497  H HZ   . PHE A 1 30 ? 1.992   -7.346  -4.710  1.00 15.00 ?  308 PHE A HZ   5  
ATOM   3498  N N    . THR A 1 31 ? -5.476  -5.008  -1.384  1.00 15.00 ?  309 THR A N    5  
ATOM   3499  C CA   . THR A 1 31 ? -6.816  -4.456  -1.457  1.00 15.00 ?  309 THR A CA   5  
ATOM   3500  C C    . THR A 1 31 ? -6.807  -2.985  -1.038  1.00 15.00 ?  309 THR A C    5  
ATOM   3501  O O    . THR A 1 31 ? -6.540  -2.664  0.121   1.00 15.00 ?  309 THR A O    5  
ATOM   3502  C CB   . THR A 1 31 ? -7.776  -5.255  -0.557  1.00 15.00 ?  309 THR A CB   5  
ATOM   3503  O OG1  . THR A 1 31 ? -7.633  -6.657  -0.830  1.00 15.00 ?  309 THR A OG1  5  
ATOM   3504  C CG2  . THR A 1 31 ? -9.221  -4.836  -0.787  1.00 15.00 ?  309 THR A CG2  5  
ATOM   3505  H H    . THR A 1 31 ? -5.190  -5.461  -0.566  1.00 15.00 ?  309 THR A H    5  
ATOM   3506  H HA   . THR A 1 31 ? -7.159  -4.531  -2.479  1.00 15.00 ?  309 THR A HA   5  
ATOM   3507  H HB   . THR A 1 31 ? -7.521  -5.067  0.477   1.00 15.00 ?  309 THR A HB   5  
ATOM   3508  H HG1  . THR A 1 31 ? -7.079  -6.774  -1.610  1.00 15.00 ?  309 THR A HG1  5  
ATOM   3509  H HG21 . THR A 1 31 ? -9.326  -3.782  -0.578  1.00 15.00 ?  309 THR A HG21 5  
ATOM   3510  H HG22 . THR A 1 31 ? -9.866  -5.399  -0.132  1.00 15.00 ?  309 THR A HG22 5  
ATOM   3511  H HG23 . THR A 1 31 ? -9.491  -5.030  -1.815  1.00 15.00 ?  309 THR A HG23 5  
ATOM   3512  N N    . ASP A 1 32 ? -7.080  -2.097  -1.991  1.00 15.00 ?  310 ASP A N    5  
ATOM   3513  C CA   . ASP A 1 32 ? -7.048  -0.663  -1.729  1.00 15.00 ?  310 ASP A CA   5  
ATOM   3514  C C    . ASP A 1 32 ? -8.428  -0.128  -1.359  1.00 15.00 ?  310 ASP A C    5  
ATOM   3515  O O    . ASP A 1 32 ? -9.408  -0.352  -2.071  1.00 15.00 ?  310 ASP A O    5  
ATOM   3516  C CB   . ASP A 1 32 ? -6.476  0.096   -2.935  1.00 15.00 ?  310 ASP A CB   5  
ATOM   3517  C CG   . ASP A 1 32 ? -6.661  1.599   -2.825  1.00 15.00 ?  310 ASP A CG   5  
ATOM   3518  O OD1  . ASP A 1 32 ? -6.056  2.220   -1.932  1.00 15.00 ?  310 ASP A OD1  5  
ATOM   3519  O OD2  . ASP A 1 32 ? -7.414  2.167   -3.643  1.00 15.00 -1 310 ASP A OD2  5  
ATOM   3520  H H    . ASP A 1 32 ? -7.309  -2.413  -2.888  1.00 15.00 ?  310 ASP A H    5  
ATOM   3521  H HA   . ASP A 1 32 ? -6.397  -0.516  -0.887  1.00 15.00 ?  310 ASP A HA   5  
ATOM   3522  H HB2  . ASP A 1 32 ? -5.418  -0.109  -3.010  1.00 15.00 ?  310 ASP A HB2  5  
ATOM   3523  H HB3  . ASP A 1 32 ? -6.963  -0.242  -3.837  1.00 15.00 ?  310 ASP A HB3  5  
ATOM   3524  N N    . PRO A 1 33 ? -8.513  0.586   -0.225  1.00 15.00 ?  311 PRO A N    5  
ATOM   3525  C CA   . PRO A 1 33 ? -9.765  1.146   0.285   1.00 15.00 ?  311 PRO A CA   5  
ATOM   3526  C C    . PRO A 1 33 ? -10.230 2.385   -0.482  1.00 15.00 ?  311 PRO A C    5  
ATOM   3527  O O    . PRO A 1 33 ? -11.370 2.829   -0.324  1.00 15.00 ?  311 PRO A O    5  
ATOM   3528  C CB   . PRO A 1 33 ? -9.430  1.506   1.732   1.00 15.00 ?  311 PRO A CB   5  
ATOM   3529  C CG   . PRO A 1 33 ? -7.970  1.795   1.714   1.00 15.00 ?  311 PRO A CG   5  
ATOM   3530  C CD   . PRO A 1 33 ? -7.375  0.892   0.665   1.00 15.00 ?  311 PRO A CD   5  
ATOM   3531  H HA   . PRO A 1 33 ? -10.553 0.408   0.274   1.00 15.00 ?  311 PRO A HA   5  
ATOM   3532  H HB2  . PRO A 1 33 ? -10.003 2.371   2.033   1.00 15.00 ?  311 PRO A HB2  5  
ATOM   3533  H HB3  . PRO A 1 33 ? -9.658  0.672   2.379   1.00 15.00 ?  311 PRO A HB3  5  
ATOM   3534  H HG2  . PRO A 1 33 ? -7.806  2.830   1.455   1.00 15.00 ?  311 PRO A HG2  5  
ATOM   3535  H HG3  . PRO A 1 33 ? -7.541  1.579   2.681   1.00 15.00 ?  311 PRO A HG3  5  
ATOM   3536  H HD2  . PRO A 1 33 ? -6.594  1.407   0.124   1.00 15.00 ?  311 PRO A HD2  5  
ATOM   3537  H HD3  . PRO A 1 33 ? -6.989  -0.009  1.119   1.00 15.00 ?  311 PRO A HD3  5  
ATOM   3538  N N    . ARG A 1 34 ? -9.346  2.975   -1.277  1.00 15.00 ?  312 ARG A N    5  
ATOM   3539  C CA   . ARG A 1 34 ? -9.708  4.156   -2.048  1.00 15.00 ?  312 ARG A CA   5  
ATOM   3540  C C    . ARG A 1 34 ? -10.541 3.753   -3.260  1.00 15.00 ?  312 ARG A C    5  
ATOM   3541  O O    . ARG A 1 34 ? -11.462 4.465   -3.659  1.00 15.00 ?  312 ARG A O    5  
ATOM   3542  C CB   . ARG A 1 34 ? -8.470  4.930   -2.505  1.00 15.00 ?  312 ARG A CB   5  
ATOM   3543  C CG   . ARG A 1 34 ? -7.454  5.183   -1.404  1.00 15.00 ?  312 ARG A CG   5  
ATOM   3544  C CD   . ARG A 1 34 ? -6.319  6.063   -1.900  1.00 15.00 ?  312 ARG A CD   5  
ATOM   3545  N NE   . ARG A 1 34 ? -5.812  5.618   -3.197  1.00 15.00 ?  312 ARG A NE   5  
ATOM   3546  C CZ   . ARG A 1 34 ? -5.137  6.396   -4.043  1.00 15.00 ?  312 ARG A CZ   5  
ATOM   3547  N NH1  . ARG A 1 34 ? -4.797  7.631   -3.695  1.00 15.00 1  312 ARG A NH1  5  
ATOM   3548  N NH2  . ARG A 1 34 ? -4.796  5.930   -5.238  1.00 15.00 ?  312 ARG A NH2  5  
ATOM   3549  H H    . ARG A 1 34 ? -8.438  2.604   -1.354  1.00 15.00 ?  312 ARG A H    5  
ATOM   3550  H HA   . ARG A 1 34 ? -10.308 4.794   -1.413  1.00 15.00 ?  312 ARG A HA   5  
ATOM   3551  H HB2  . ARG A 1 34 ? -7.982  4.370   -3.289  1.00 15.00 ?  312 ARG A HB2  5  
ATOM   3552  H HB3  . ARG A 1 34 ? -8.782  5.885   -2.902  1.00 15.00 ?  312 ARG A HB3  5  
ATOM   3553  H HG2  . ARG A 1 34 ? -7.945  5.674   -0.577  1.00 15.00 ?  312 ARG A HG2  5  
ATOM   3554  H HG3  . ARG A 1 34 ? -7.049  4.237   -1.078  1.00 15.00 ?  312 ARG A HG3  5  
ATOM   3555  H HD2  . ARG A 1 34 ? -6.681  7.076   -1.993  1.00 15.00 ?  312 ARG A HD2  5  
ATOM   3556  H HD3  . ARG A 1 34 ? -5.516  6.032   -1.180  1.00 15.00 ?  312 ARG A HD3  5  
ATOM   3557  H HE   . ARG A 1 34 ? -6.015  4.689   -3.463  1.00 15.00 ?  312 ARG A HE   5  
ATOM   3558  H HH11 . ARG A 1 34 ? -5.044  7.990   -2.785  1.00 15.00 ?  312 ARG A HH11 5  
ATOM   3559  H HH12 . ARG A 1 34 ? -4.284  8.218   -4.337  1.00 15.00 ?  312 ARG A HH12 5  
ATOM   3560  H HH21 . ARG A 1 34 ? -5.045  4.988   -5.502  1.00 15.00 ?  312 ARG A HH21 5  
ATOM   3561  H HH22 . ARG A 1 34 ? -4.301  6.516   -5.895  1.00 15.00 ?  312 ARG A HH22 5  
ATOM   3562  N N    . LEU A 1 35 ? -10.195 2.614   -3.847  1.00 15.00 ?  313 LEU A N    5  
ATOM   3563  C CA   . LEU A 1 35 ? -10.932 2.075   -4.982  1.00 15.00 ?  313 LEU A CA   5  
ATOM   3564  C C    . LEU A 1 35 ? -12.131 1.265   -4.509  1.00 15.00 ?  313 LEU A C    5  
ATOM   3565  O O    . LEU A 1 35 ? -13.210 1.857   -4.315  1.00 15.00 ?  313 LEU A O    5  
ATOM   3566  C CB   . LEU A 1 35 ? -10.021 1.201   -5.847  1.00 15.00 ?  313 LEU A CB   5  
ATOM   3567  C CG   . LEU A 1 35 ? -8.867  1.935   -6.529  1.00 15.00 ?  313 LEU A CG   5  
ATOM   3568  C CD1  . LEU A 1 35 ? -7.990  0.952   -7.288  1.00 15.00 ?  313 LEU A CD1  5  
ATOM   3569  C CD2  . LEU A 1 35 ? -9.397  3.007   -7.467  1.00 15.00 ?  313 LEU A CD2  5  
ATOM   3570  H H    . LEU A 1 35 ? -9.403  2.128   -3.517  1.00 15.00 ?  313 LEU A H    5  
ATOM   3571  H HA   . LEU A 1 35 ? -11.286 2.907   -5.573  1.00 15.00 ?  313 LEU A HA   5  
ATOM   3572  H HB2  . LEU A 1 35 ? -9.607  0.423   -5.222  1.00 15.00 ?  313 LEU A HB2  5  
ATOM   3573  H HB3  . LEU A 1 35 ? -10.626 0.739   -6.613  1.00 15.00 ?  313 LEU A HB3  5  
ATOM   3574  H HG   . LEU A 1 35 ? -8.258  2.416   -5.778  1.00 15.00 ?  313 LEU A HG   5  
ATOM   3575  H HD11 . LEU A 1 35 ? -7.576  0.233   -6.598  1.00 15.00 ?  313 LEU A HD11 5  
ATOM   3576  H HD12 . LEU A 1 35 ? -7.188  1.486   -7.777  1.00 15.00 ?  313 LEU A HD12 5  
ATOM   3577  H HD13 . LEU A 1 35 ? -8.584  0.438   -8.029  1.00 15.00 ?  313 LEU A HD13 5  
ATOM   3578  H HD21 . LEU A 1 35 ? -8.569  3.508   -7.948  1.00 15.00 ?  313 LEU A HD21 5  
ATOM   3579  H HD22 . LEU A 1 35 ? -9.973  3.725   -6.902  1.00 15.00 ?  313 LEU A HD22 5  
ATOM   3580  H HD23 . LEU A 1 35 ? -10.027 2.550   -8.216  1.00 15.00 ?  313 LEU A HD23 5  
ATOM   3581  N N    . ASP B 2 2  ? -1.970  -8.990  -7.837  1.00 15.00 ?  221 ASP B N    5  
ATOM   3582  C CA   . ASP B 2 2  ? -0.530  -9.178  -8.127  1.00 15.00 ?  221 ASP B CA   5  
ATOM   3583  C C    . ASP B 2 2  ? 0.039   -10.285 -7.233  1.00 15.00 ?  221 ASP B C    5  
ATOM   3584  O O    . ASP B 2 2  ? -0.668  -10.817 -6.374  1.00 15.00 ?  221 ASP B O    5  
ATOM   3585  C CB   . ASP B 2 2  ? 0.223   -7.847  -7.930  1.00 15.00 ?  221 ASP B CB   5  
ATOM   3586  C CG   . ASP B 2 2  ? 1.686   -7.928  -8.312  1.00 15.00 ?  221 ASP B CG   5  
ATOM   3587  O OD1  . ASP B 2 2  ? 2.041   -8.792  -9.140  1.00 15.00 -1 221 ASP B OD1  5  
ATOM   3588  O OD2  . ASP B 2 2  ? 2.487   -7.126  -7.792  1.00 15.00 ?  221 ASP B OD2  5  
ATOM   3589  H H    . ASP B 2 2  ? -2.324  -8.134  -8.313  1.00 15.00 ?  221 ASP B H    5  
ATOM   3590  H HA   . ASP B 2 2  ? -0.435  -9.488  -9.159  1.00 15.00 ?  221 ASP B HA   5  
ATOM   3591  H HB2  . ASP B 2 2  ? -0.238  -7.083  -8.544  1.00 15.00 ?  221 ASP B HB2  5  
ATOM   3592  H HB3  . ASP B 2 2  ? 0.158   -7.553  -6.893  1.00 15.00 ?  221 ASP B HB3  5  
ATOM   3593  N N    . THR B 2 3  ? 1.300   -10.641 -7.458  1.00 15.00 ?  222 THR B N    5  
ATOM   3594  C CA   . THR B 2 3  ? 1.988   -11.673 -6.689  1.00 15.00 ?  222 THR B CA   5  
ATOM   3595  C C    . THR B 2 3  ? 2.058   -11.301 -5.212  1.00 15.00 ?  222 THR B C    5  
ATOM   3596  O O    . THR B 2 3  ? 1.957   -10.129 -4.886  1.00 15.00 ?  222 THR B O    5  
ATOM   3597  C CB   . THR B 2 3  ? 3.413   -11.869 -7.236  1.00 15.00 ?  222 THR B CB   5  
ATOM   3598  O OG1  . THR B 2 3  ? 4.102   -10.611 -7.249  1.00 15.00 ?  222 THR B OG1  5  
ATOM   3599  C CG2  . THR B 2 3  ? 3.378   -12.439 -8.644  1.00 15.00 ?  222 THR B CG2  5  
ATOM   3600  H H    . THR B 2 3  ? 1.798   -10.177 -8.175  1.00 15.00 ?  222 THR B H    5  
ATOM   3601  H HA   . THR B 2 3  ? 1.442   -12.598 -6.796  1.00 15.00 ?  222 THR B HA   5  
ATOM   3602  H HB   . THR B 2 3  ? 3.942   -12.560 -6.595  1.00 15.00 ?  222 THR B HB   5  
ATOM   3603  H HG1  . THR B 2 3  ? 3.602   -9.966  -6.729  1.00 15.00 ?  222 THR B HG1  5  
ATOM   3604  H HG21 . THR B 2 3  ? 2.864   -13.389 -8.636  1.00 15.00 ?  222 THR B HG21 5  
ATOM   3605  H HG22 . THR B 2 3  ? 4.389   -12.580 -9.001  1.00 15.00 ?  222 THR B HG22 5  
ATOM   3606  H HG23 . THR B 2 3  ? 2.858   -11.754 -9.297  1.00 15.00 ?  222 THR B HG23 5  
ATOM   3607  N N    . PRO B 2 4  ? 2.287   -12.283 -4.312  1.00 15.00 ?  223 PRO B N    5  
ATOM   3608  C CA   . PRO B 2 4  ? 2.215   -12.072 -2.858  1.00 15.00 ?  223 PRO B CA   5  
ATOM   3609  C C    . PRO B 2 4  ? 2.997   -10.836 -2.399  1.00 15.00 ?  223 PRO B C    5  
ATOM   3610  O O    . PRO B 2 4  ? 4.166   -10.667 -2.755  1.00 15.00 ?  223 PRO B O    5  
ATOM   3611  C CB   . PRO B 2 4  ? 2.836   -13.351 -2.268  1.00 15.00 ?  223 PRO B CB   5  
ATOM   3612  C CG   . PRO B 2 4  ? 3.418   -14.093 -3.426  1.00 15.00 ?  223 PRO B CG   5  
ATOM   3613  C CD   . PRO B 2 4  ? 2.630   -13.672 -4.629  1.00 15.00 ?  223 PRO B CD   5  
ATOM   3614  H HA   . PRO B 2 4  ? 1.191   -11.993 -2.539  1.00 15.00 ?  223 PRO B HA   5  
ATOM   3615  H HB2  . PRO B 2 4  ? 3.597   -13.084 -1.551  1.00 15.00 ?  223 PRO B HB2  5  
ATOM   3616  H HB3  . PRO B 2 4  ? 2.067   -13.931 -1.779  1.00 15.00 ?  223 PRO B HB3  5  
ATOM   3617  H HG2  . PRO B 2 4  ? 4.457   -13.825 -3.546  1.00 15.00 ?  223 PRO B HG2  5  
ATOM   3618  H HG3  . PRO B 2 4  ? 3.321   -15.156 -3.266  1.00 15.00 ?  223 PRO B HG3  5  
ATOM   3619  H HD2  . PRO B 2 4  ? 3.237   -13.731 -5.522  1.00 15.00 ?  223 PRO B HD2  5  
ATOM   3620  H HD3  . PRO B 2 4  ? 1.740   -14.276 -4.732  1.00 15.00 ?  223 PRO B HD3  5  
ATOM   3621  N N    . PRO B 2 5  ? 2.362   -9.960  -1.589  1.00 15.00 ?  224 PRO B N    5  
ATOM   3622  C CA   . PRO B 2 5  ? 2.919   -8.644  -1.254  1.00 15.00 ?  224 PRO B CA   5  
ATOM   3623  C C    . PRO B 2 5  ? 4.215   -8.711  -0.444  1.00 15.00 ?  224 PRO B C    5  
ATOM   3624  O O    . PRO B 2 5  ? 4.410   -9.614  0.374   1.00 15.00 ?  224 PRO B O    5  
ATOM   3625  C CB   . PRO B 2 5  ? 1.808   -7.973  -0.444  1.00 15.00 ?  224 PRO B CB   5  
ATOM   3626  C CG   . PRO B 2 5  ? 0.959   -9.077  0.071   1.00 15.00 ?  224 PRO B CG   5  
ATOM   3627  C CD   . PRO B 2 5  ? 1.060   -10.193 -0.927  1.00 15.00 ?  224 PRO B CD   5  
ATOM   3628  H HA   . PRO B 2 5  ? 3.102   -8.067  -2.148  1.00 15.00 ?  224 PRO B HA   5  
ATOM   3629  H HB2  . PRO B 2 5  ? 2.245   -7.408  0.366   1.00 15.00 ?  224 PRO B HB2  5  
ATOM   3630  H HB3  . PRO B 2 5  ? 1.246   -7.311  -1.085  1.00 15.00 ?  224 PRO B HB3  5  
ATOM   3631  H HG2  . PRO B 2 5  ? 1.321   -9.401  1.034   1.00 15.00 ?  224 PRO B HG2  5  
ATOM   3632  H HG3  . PRO B 2 5  ? -0.067  -8.737  0.146   1.00 15.00 ?  224 PRO B HG3  5  
ATOM   3633  H HD2  . PRO B 2 5  ? 1.048   -11.146 -0.419  1.00 15.00 ?  224 PRO B HD2  5  
ATOM   3634  H HD3  . PRO B 2 5  ? 0.246   -10.125 -1.636  1.00 15.00 ?  224 PRO B HD3  5  
ATOM   3635  N N    . PRO B 2 6  ? 5.104   -7.725  -0.660  1.00 15.00 ?  225 PRO B N    5  
ATOM   3636  C CA   . PRO B 2 6  ? 6.414   -7.656  -0.020  1.00 15.00 ?  225 PRO B CA   5  
ATOM   3637  C C    . PRO B 2 6  ? 6.397   -6.872  1.291   1.00 15.00 ?  225 PRO B C    5  
ATOM   3638  O O    . PRO B 2 6  ? 5.352   -6.386  1.720   1.00 15.00 ?  225 PRO B O    5  
ATOM   3639  C CB   . PRO B 2 6  ? 7.236   -6.908  -1.068  1.00 15.00 ?  225 PRO B CB   5  
ATOM   3640  C CG   . PRO B 2 6  ? 6.276   -6.001  -1.757  1.00 15.00 ?  225 PRO B CG   5  
ATOM   3641  C CD   . PRO B 2 6  ? 4.893   -6.575  -1.559  1.00 15.00 ?  225 PRO B CD   5  
ATOM   3642  H HA   . PRO B 2 6  ? 6.834   -8.637  0.143   1.00 15.00 ?  225 PRO B HA   5  
ATOM   3643  H HB2  . PRO B 2 6  ? 8.017   -6.344  -0.581  1.00 15.00 ?  225 PRO B HB2  5  
ATOM   3644  H HB3  . PRO B 2 6  ? 7.667   -7.610  -1.759  1.00 15.00 ?  225 PRO B HB3  5  
ATOM   3645  H HG2  . PRO B 2 6  ? 6.341   -5.017  -1.321  1.00 15.00 ?  225 PRO B HG2  5  
ATOM   3646  H HG3  . PRO B 2 6  ? 6.512   -5.955  -2.810  1.00 15.00 ?  225 PRO B HG3  5  
ATOM   3647  H HD2  . PRO B 2 6  ? 4.245   -5.843  -1.098  1.00 15.00 ?  225 PRO B HD2  5  
ATOM   3648  H HD3  . PRO B 2 6  ? 4.483   -6.898  -2.504  1.00 15.00 ?  225 PRO B HD3  5  
ATOM   3649  N N    . ALA B 2 7  ? 7.559   -6.766  1.930   1.00 15.00 ?  226 ALA B N    5  
ATOM   3650  C CA   . ALA B 2 7  ? 7.716   -5.922  3.111   1.00 15.00 ?  226 ALA B CA   5  
ATOM   3651  C C    . ALA B 2 7  ? 7.371   -4.475  2.774   1.00 15.00 ?  226 ALA B C    5  
ATOM   3652  O O    . ALA B 2 7  ? 7.482   -4.063  1.618   1.00 15.00 ?  226 ALA B O    5  
ATOM   3653  C CB   . ALA B 2 7  ? 9.137   -6.022  3.647   1.00 15.00 ?  226 ALA B CB   5  
ATOM   3654  H H    . ALA B 2 7  ? 8.334   -7.276  1.598   1.00 15.00 ?  226 ALA B H    5  
ATOM   3655  H HA   . ALA B 2 7  ? 7.037   -6.279  3.874   1.00 15.00 ?  226 ALA B HA   5  
ATOM   3656  H HB1  . ALA B 2 7  ? 9.362   -7.053  3.873   1.00 15.00 ?  226 ALA B HB1  5  
ATOM   3657  H HB2  . ALA B 2 7  ? 9.226   -5.429  4.544   1.00 15.00 ?  226 ALA B HB2  5  
ATOM   3658  H HB3  . ALA B 2 7  ? 9.828   -5.655  2.902   1.00 15.00 ?  226 ALA B HB3  5  
ATOM   3659  N N    . TYR B 2 8  ? 6.961   -3.701  3.769   1.00 15.00 ?  227 TYR B N    5  
ATOM   3660  C CA   . TYR B 2 8  ? 6.485   -2.350  3.507   1.00 15.00 ?  227 TYR B CA   5  
ATOM   3661  C C    . TYR B 2 8  ? 7.618   -1.330  3.562   1.00 15.00 ?  227 TYR B C    5  
ATOM   3662  O O    . TYR B 2 8  ? 8.550   -1.431  4.367   1.00 15.00 ?  227 TYR B O    5  
ATOM   3663  C CB   . TYR B 2 8  ? 5.383   -1.942  4.487   1.00 15.00 ?  227 TYR B CB   5  
ATOM   3664  C CG   . TYR B 2 8  ? 5.904   -1.543  5.856   1.00 15.00 ?  227 TYR B CG   5  
ATOM   3665  C CD1  . TYR B 2 8  ? 6.255   -2.499  6.801   1.00 15.00 ?  227 TYR B CD1  5  
ATOM   3666  C CD2  . TYR B 2 8  ? 6.066   -0.208  6.192   1.00 15.00 ?  227 TYR B CD2  5  
ATOM   3667  C CE1  . TYR B 2 8  ? 6.753   -2.128  8.037   1.00 15.00 ?  227 TYR B CE1  5  
ATOM   3668  C CE2  . TYR B 2 8  ? 6.558   0.169   7.418   1.00 15.00 ?  227 TYR B CE2  5  
ATOM   3669  C CZ   . TYR B 2 8  ? 6.903   -0.790  8.339   1.00 15.00 ?  227 TYR B CZ   5  
ATOM   3670  O OH   . TYR B 2 8  ? 7.397   -0.413  9.567   1.00 15.00 ?  227 TYR B OH   5  
ATOM   3671  H H    . TYR B 2 8  ? 6.972   -4.042  4.688   1.00 15.00 ?  227 TYR B H    5  
ATOM   3672  H HA   . TYR B 2 8  ? 6.073   -2.343  2.510   1.00 15.00 ?  227 TYR B HA   5  
ATOM   3673  H HB2  . TYR B 2 8  ? 4.845   -1.091  4.059   1.00 15.00 ?  227 TYR B HB2  5  
ATOM   3674  H HB3  . TYR B 2 8  ? 4.698   -2.768  4.614   1.00 15.00 ?  227 TYR B HB3  5  
ATOM   3675  H HD1  . TYR B 2 8  ? 6.135   -3.545  6.559   1.00 15.00 ?  227 TYR B HD1  5  
ATOM   3676  H HD2  . TYR B 2 8  ? 5.794   0.554   5.480   1.00 15.00 ?  227 TYR B HD2  5  
ATOM   3677  H HE1  . TYR B 2 8  ? 7.020   -2.885  8.761   1.00 15.00 ?  227 TYR B HE1  5  
ATOM   3678  H HE2  . TYR B 2 8  ? 6.675   1.225   7.641   1.00 15.00 ?  227 TYR B HE2  5  
ATOM   3679  H HH   . TYR B 2 8  ? 6.782   0.198   9.986   1.00 15.00 ?  227 TYR B HH   5  
ATOM   3680  N N    . LEU B 2 9  ? 7.500   -0.347  2.695   1.00 15.00 ?  228 LEU B N    5  
ATOM   3681  C CA   . LEU B 2 9  ? 8.434   0.760   2.592   1.00 15.00 ?  228 LEU B CA   5  
ATOM   3682  C C    . LEU B 2 9  ? 7.646   2.056   2.589   1.00 15.00 ?  228 LEU B C    5  
ATOM   3683  O O    . LEU B 2 9  ? 6.461   2.044   2.315   1.00 15.00 ?  228 LEU B O    5  
ATOM   3684  C CB   . LEU B 2 9  ? 9.289   0.675   1.313   1.00 15.00 ?  228 LEU B CB   5  
ATOM   3685  C CG   . LEU B 2 9  ? 10.149  -0.583  1.142   1.00 15.00 ?  228 LEU B CG   5  
ATOM   3686  C CD1  . LEU B 2 9  ? 9.333   -1.727  0.563   1.00 15.00 ?  228 LEU B CD1  5  
ATOM   3687  C CD2  . LEU B 2 9  ? 11.348  -0.281  0.256   1.00 15.00 ?  228 LEU B CD2  5  
ATOM   3688  H H    . LEU B 2 9  ? 6.734   -0.360  2.084   1.00 15.00 ?  228 LEU B H    5  
ATOM   3689  H HA   . LEU B 2 9  ? 9.066   0.744   3.467   1.00 15.00 ?  228 LEU B HA   5  
ATOM   3690  H HB2  . LEU B 2 9  ? 8.626   0.740   0.463   1.00 15.00 ?  228 LEU B HB2  5  
ATOM   3691  H HB3  . LEU B 2 9  ? 9.946   1.532   1.295   1.00 15.00 ?  228 LEU B HB3  5  
ATOM   3692  H HG   . LEU B 2 9  ? 10.518  -0.893  2.109   1.00 15.00 ?  228 LEU B HG   5  
ATOM   3693  H HD11 . LEU B 2 9  ? 8.951   -1.443  -0.407  1.00 15.00 ?  228 LEU B HD11 5  
ATOM   3694  H HD12 . LEU B 2 9  ? 8.508   -1.952  1.223   1.00 15.00 ?  228 LEU B HD12 5  
ATOM   3695  H HD13 . LEU B 2 9  ? 9.960   -2.600  0.461   1.00 15.00 ?  228 LEU B HD13 5  
ATOM   3696  H HD21 . LEU B 2 9  ? 11.005  0.055   -0.711  1.00 15.00 ?  228 LEU B HD21 5  
ATOM   3697  H HD22 . LEU B 2 9  ? 11.940  -1.176  0.136   1.00 15.00 ?  228 LEU B HD22 5  
ATOM   3698  H HD23 . LEU B 2 9  ? 11.948  0.491   0.713   1.00 15.00 ?  228 LEU B HD23 5  
ATOM   3699  N N    . PRO B 2 10 ? 8.261   3.197   2.880   1.00 15.00 ?  229 PRO B N    5  
ATOM   3700  C CA   . PRO B 2 10 ? 7.541   4.459   2.811   1.00 15.00 ?  229 PRO B CA   5  
ATOM   3701  C C    . PRO B 2 10 ? 7.623   5.014   1.394   1.00 15.00 ?  229 PRO B C    5  
ATOM   3702  O O    . PRO B 2 10 ? 8.653   4.901   0.731   1.00 15.00 ?  229 PRO B O    5  
ATOM   3703  C CB   . PRO B 2 10 ? 8.315   5.365   3.783   1.00 15.00 ?  229 PRO B CB   5  
ATOM   3704  C CG   . PRO B 2 10 ? 9.346   4.489   4.423   1.00 15.00 ?  229 PRO B CG   5  
ATOM   3705  C CD   . PRO B 2 10 ? 9.582   3.354   3.472   1.00 15.00 ?  229 PRO B CD   5  
ATOM   3706  H HA   . PRO B 2 10 ? 6.519   4.345   3.125   1.00 15.00 ?  229 PRO B HA   5  
ATOM   3707  H HB2  . PRO B 2 10 ? 8.773   6.173   3.232   1.00 15.00 ?  229 PRO B HB2  5  
ATOM   3708  H HB3  . PRO B 2 10 ? 7.633   5.768   4.516   1.00 15.00 ?  229 PRO B HB3  5  
ATOM   3709  H HG2  . PRO B 2 10 ? 10.248  5.042   4.575   1.00 15.00 ?  229 PRO B HG2  5  
ATOM   3710  H HG3  . PRO B 2 10 ? 8.973   4.114   5.364   1.00 15.00 ?  229 PRO B HG3  5  
ATOM   3711  H HD2  . PRO B 2 10 ? 10.316  3.618   2.735   1.00 15.00 ?  229 PRO B HD2  5  
ATOM   3712  H HD3  . PRO B 2 10 ? 9.872   2.465   4.007   1.00 15.00 ?  229 PRO B HD3  5  
ATOM   3713  N N    . PRO B 2 11 ? 6.539   5.655   0.918   1.00 15.00 ?  230 PRO B N    5  
ATOM   3714  C CA   . PRO B 2 11 ? 6.136   5.545   -0.477  1.00 15.00 ?  230 PRO B CA   5  
ATOM   3715  C C    . PRO B 2 11 ? 6.739   6.572   -1.421  1.00 15.00 ?  230 PRO B C    5  
ATOM   3716  O O    . PRO B 2 11 ? 6.820   7.759   -1.116  1.00 15.00 ?  230 PRO B O    5  
ATOM   3717  C CB   . PRO B 2 11 ? 4.630   5.755   -0.364  1.00 15.00 ?  230 PRO B CB   5  
ATOM   3718  C CG   . PRO B 2 11 ? 4.464   6.749   0.740   1.00 15.00 ?  230 PRO B CG   5  
ATOM   3719  C CD   . PRO B 2 11 ? 5.651   6.586   1.657   1.00 15.00 ?  230 PRO B CD   5  
ATOM   3720  H HA   . PRO B 2 11 ? 6.323   4.557   -0.863  1.00 15.00 ?  230 PRO B HA   5  
ATOM   3721  H HB2  . PRO B 2 11 ? 4.248   6.137   -1.294  1.00 15.00 ?  230 PRO B HB2  5  
ATOM   3722  H HB3  . PRO B 2 11 ? 4.149   4.819   -0.126  1.00 15.00 ?  230 PRO B HB3  5  
ATOM   3723  H HG2  . PRO B 2 11 ? 4.448   7.748   0.329   1.00 15.00 ?  230 PRO B HG2  5  
ATOM   3724  H HG3  . PRO B 2 11 ? 3.547   6.552   1.277   1.00 15.00 ?  230 PRO B HG3  5  
ATOM   3725  H HD2  . PRO B 2 11 ? 6.135   7.541   1.813   1.00 15.00 ?  230 PRO B HD2  5  
ATOM   3726  H HD3  . PRO B 2 11 ? 5.333   6.172   2.596   1.00 15.00 ?  230 PRO B HD3  5  
ATOM   3727  N N    . GLU B 2 12 ? 7.128   6.088   -2.595  1.00 15.00 ?  231 GLU B N    5  
ATOM   3728  C CA   . GLU B 2 12 ? 7.628   6.950   -3.649  1.00 15.00 ?  231 GLU B CA   5  
ATOM   3729  C C    . GLU B 2 12 ? 6.463   7.412   -4.529  1.00 15.00 ?  231 GLU B C    5  
ATOM   3730  O O    . GLU B 2 12 ? 6.037   6.702   -5.424  1.00 15.00 ?  231 GLU B O    5  
ATOM   3731  C CB   . GLU B 2 12 ? 8.641   6.142   -4.476  1.00 15.00 ?  231 GLU B CB   5  
ATOM   3732  C CG   . GLU B 2 12 ? 8.082   4.816   -5.025  1.00 15.00 ?  231 GLU B CG   5  
ATOM   3733  C CD   . GLU B 2 12 ? 9.167   3.819   -5.359  1.00 15.00 ?  231 GLU B CD   5  
ATOM   3734  O OE1  . GLU B 2 12 ? 9.544   3.033   -4.472  1.00 15.00 -1 231 GLU B OE1  5  
ATOM   3735  O OE2  . GLU B 2 12 ? 9.633   3.810   -6.517  1.00 15.00 ?  231 GLU B OE2  5  
ATOM   3736  H H    . GLU B 2 12 ? 7.087   5.119   -2.751  1.00 15.00 ?  231 GLU B H    5  
ATOM   3737  H HA   . GLU B 2 12 ? 8.120   7.800   -3.202  1.00 15.00 ?  231 GLU B HA   5  
ATOM   3738  H HB2  . GLU B 2 12 ? 8.964   6.744   -5.313  1.00 15.00 ?  231 GLU B HB2  5  
ATOM   3739  H HB3  . GLU B 2 12 ? 9.495   5.918   -3.855  1.00 15.00 ?  231 GLU B HB3  5  
ATOM   3740  H HG2  . GLU B 2 12 ? 7.403   4.367   -4.296  1.00 15.00 ?  231 GLU B HG2  5  
ATOM   3741  H HG3  . GLU B 2 12 ? 7.525   5.024   -5.929  1.00 15.00 ?  231 GLU B HG3  5  
ATOM   3742  N N    . ASP B 2 13 ? 5.960   8.609   -4.312  1.00 15.00 ?  232 ASP B N    5  
ATOM   3743  C CA   . ASP B 2 13 ? 4.716   8.996   -4.967  1.00 15.00 ?  232 ASP B CA   5  
ATOM   3744  C C    . ASP B 2 13 ? 4.663   10.501  -5.214  1.00 15.00 ?  232 ASP B C    5  
ATOM   3745  O O    . ASP B 2 13 ? 4.578   11.294  -4.273  1.00 15.00 ?  232 ASP B O    5  
ATOM   3746  C CB   . ASP B 2 13 ? 3.513   8.515   -4.131  1.00 15.00 ?  232 ASP B CB   5  
ATOM   3747  C CG   . ASP B 2 13 ? 2.179   8.979   -4.684  1.00 15.00 ?  232 ASP B CG   5  
ATOM   3748  O OD1  . ASP B 2 13 ? 1.720   8.405   -5.688  1.00 15.00 -1 232 ASP B OD1  5  
ATOM   3749  O OD2  . ASP B 2 13 ? 1.575   9.905   -4.095  1.00 15.00 ?  232 ASP B OD2  5  
ATOM   3750  H H    . ASP B 2 13 ? 6.425   9.249   -3.726  1.00 15.00 ?  232 ASP B H    5  
ATOM   3751  H HA   . ASP B 2 13 ? 4.690   8.497   -5.924  1.00 15.00 ?  232 ASP B HA   5  
ATOM   3752  H HB2  . ASP B 2 13 ? 3.504   7.423   -4.109  1.00 15.00 ?  232 ASP B HB2  5  
ATOM   3753  H HB3  . ASP B 2 13 ? 3.613   8.887   -3.123  1.00 15.00 ?  232 ASP B HB3  5  
ATOM   3754  N N    . PRO B 2 14 ? 4.755   10.913  -6.486  1.00 15.00 ?  233 PRO B N    5  
ATOM   3755  C CA   . PRO B 2 14 ? 4.704   12.313  -6.882  1.00 15.00 ?  233 PRO B CA   5  
ATOM   3756  C C    . PRO B 2 14 ? 3.275   12.783  -7.141  1.00 15.00 ?  233 PRO B C    5  
ATOM   3757  O O    . PRO B 2 14 ? 2.812   12.819  -8.282  1.00 15.00 ?  233 PRO B O    5  
ATOM   3758  C CB   . PRO B 2 14 ? 5.527   12.343  -8.182  1.00 15.00 ?  233 PRO B CB   5  
ATOM   3759  C CG   . PRO B 2 14 ? 5.758   10.909  -8.575  1.00 15.00 ?  233 PRO B CG   5  
ATOM   3760  C CD   . PRO B 2 14 ? 4.929   10.053  -7.655  1.00 15.00 ?  233 PRO B CD   5  
ATOM   3761  H HA   . PRO B 2 14 ? 5.167   12.950  -6.143  1.00 15.00 ?  233 PRO B HA   5  
ATOM   3762  H HB2  . PRO B 2 14 ? 4.973   12.870  -8.943  1.00 15.00 ?  233 PRO B HB2  5  
ATOM   3763  H HB3  . PRO B 2 14 ? 6.463   12.851  -8.000  1.00 15.00 ?  233 PRO B HB3  5  
ATOM   3764  H HG2  . PRO B 2 14 ? 5.447   10.759  -9.598  1.00 15.00 ?  233 PRO B HG2  5  
ATOM   3765  H HG3  . PRO B 2 14 ? 6.805   10.668  -8.465  1.00 15.00 ?  233 PRO B HG3  5  
ATOM   3766  H HD2  . PRO B 2 14 ? 3.977   9.820   -8.109  1.00 15.00 ?  233 PRO B HD2  5  
ATOM   3767  H HD3  . PRO B 2 14 ? 5.460   9.149   -7.395  1.00 15.00 ?  233 PRO B HD3  5  
HETATM 3768  N N    . NH2 B 2 15 ? 2.575   13.141  -6.077  1.00 15.00 ?  234 NH2 B N    5  
HETATM 3769  H HN1  . NH2 B 2 15 ? 3.007   13.085  -5.200  1.00 15.00 ?  234 NH2 B HN1  5  
HETATM 3770  H HN2  . NH2 B 2 15 ? 1.654   13.445  -6.211  1.00 15.00 ?  234 NH2 B HN2  5  
ATOM   3771  N N    . LEU A 1 1  ? -14.409 1.786   -1.286  1.00 15.00 ?  279 LEU A N    6  
ATOM   3772  C CA   . LEU A 1 1  ? -15.448 2.319   -0.382  1.00 15.00 ?  279 LEU A CA   6  
ATOM   3773  C C    . LEU A 1 1  ? -15.347 3.839   -0.305  1.00 15.00 ?  279 LEU A C    6  
ATOM   3774  O O    . LEU A 1 1  ? -16.288 4.546   -0.667  1.00 15.00 ?  279 LEU A O    6  
ATOM   3775  C CB   . LEU A 1 1  ? -15.298 1.703   1.018   1.00 15.00 ?  279 LEU A CB   6  
ATOM   3776  C CG   . LEU A 1 1  ? -16.577 1.641   1.876   1.00 15.00 ?  279 LEU A CG   6  
ATOM   3777  C CD1  . LEU A 1 1  ? -17.071 3.030   2.255   1.00 15.00 ?  279 LEU A CD1  6  
ATOM   3778  C CD2  . LEU A 1 1  ? -17.667 0.871   1.147   1.00 15.00 ?  279 LEU A CD2  6  
ATOM   3779  H H1   . LEU A 1 1  ? -14.493 2.230   -2.231  1.00 15.00 ?  279 LEU A H1   6  
ATOM   3780  H H2   . LEU A 1 1  ? -14.525 0.754   -1.394  1.00 15.00 ?  279 LEU A H2   6  
ATOM   3781  H H3   . LEU A 1 1  ? -13.462 1.983   -0.906  1.00 15.00 ?  279 LEU A H3   6  
ATOM   3782  H HA   . LEU A 1 1  ? -16.415 2.054   -0.784  1.00 15.00 ?  279 LEU A HA   6  
ATOM   3783  H HB2  . LEU A 1 1  ? -14.923 0.696   0.901   1.00 15.00 ?  279 LEU A HB2  6  
ATOM   3784  H HB3  . LEU A 1 1  ? -14.562 2.279   1.558   1.00 15.00 ?  279 LEU A HB3  6  
ATOM   3785  H HG   . LEU A 1 1  ? -16.356 1.111   2.791   1.00 15.00 ?  279 LEU A HG   6  
ATOM   3786  H HD11 . LEU A 1 1  ? -17.969 2.944   2.851   1.00 15.00 ?  279 LEU A HD11 6  
ATOM   3787  H HD12 . LEU A 1 1  ? -17.287 3.594   1.360   1.00 15.00 ?  279 LEU A HD12 6  
ATOM   3788  H HD13 . LEU A 1 1  ? -16.308 3.540   2.825   1.00 15.00 ?  279 LEU A HD13 6  
ATOM   3789  H HD21 . LEU A 1 1  ? -17.894 1.366   0.215   1.00 15.00 ?  279 LEU A HD21 6  
ATOM   3790  H HD22 . LEU A 1 1  ? -18.554 0.836   1.762   1.00 15.00 ?  279 LEU A HD22 6  
ATOM   3791  H HD23 . LEU A 1 1  ? -17.325 -0.134  0.949   1.00 15.00 ?  279 LEU A HD23 6  
ATOM   3792  N N    . GLY A 1 2  ? -14.210 4.345   0.163   1.00 15.00 ?  280 GLY A N    6  
ATOM   3793  C CA   . GLY A 1 2  ? -14.065 5.781   0.314   1.00 15.00 ?  280 GLY A CA   6  
ATOM   3794  C C    . GLY A 1 2  ? -12.919 6.199   1.229   1.00 15.00 ?  280 GLY A C    6  
ATOM   3795  O O    . GLY A 1 2  ? -12.037 6.941   0.796   1.00 15.00 ?  280 GLY A O    6  
ATOM   3796  H H    . GLY A 1 2  ? -13.466 3.749   0.399   1.00 15.00 ?  280 GLY A H    6  
ATOM   3797  H HA2  . GLY A 1 2  ? -13.900 6.215   -0.661  1.00 15.00 ?  280 GLY A HA2  6  
ATOM   3798  H HA3  . GLY A 1 2  ? -14.987 6.180   0.715   1.00 15.00 ?  280 GLY A HA3  6  
ATOM   3799  N N    . PRO A 1 3  ? -12.885 5.731   2.493   1.00 15.00 ?  281 PRO A N    6  
ATOM   3800  C CA   . PRO A 1 3  ? -11.937 6.237   3.487   1.00 15.00 ?  281 PRO A CA   6  
ATOM   3801  C C    . PRO A 1 3  ? -10.609 5.482   3.516   1.00 15.00 ?  281 PRO A C    6  
ATOM   3802  O O    . PRO A 1 3  ? -10.549 4.277   3.262   1.00 15.00 ?  281 PRO A O    6  
ATOM   3803  C CB   . PRO A 1 3  ? -12.700 6.007   4.788   1.00 15.00 ?  281 PRO A CB   6  
ATOM   3804  C CG   . PRO A 1 3  ? -13.467 4.751   4.553   1.00 15.00 ?  281 PRO A CG   6  
ATOM   3805  C CD   . PRO A 1 3  ? -13.776 4.706   3.076   1.00 15.00 ?  281 PRO A CD   6  
ATOM   3806  H HA   . PRO A 1 3  ? -11.751 7.292   3.359   1.00 15.00 ?  281 PRO A HA   6  
ATOM   3807  H HB2  . PRO A 1 3  ? -12.003 5.898   5.606   1.00 15.00 ?  281 PRO A HB2  6  
ATOM   3808  H HB3  . PRO A 1 3  ? -13.359 6.841   4.976   1.00 15.00 ?  281 PRO A HB3  6  
ATOM   3809  H HG2  . PRO A 1 3  ? -12.864 3.898   4.833   1.00 15.00 ?  281 PRO A HG2  6  
ATOM   3810  H HG3  . PRO A 1 3  ? -14.384 4.769   5.125   1.00 15.00 ?  281 PRO A HG3  6  
ATOM   3811  H HD2  . PRO A 1 3  ? -13.550 3.730   2.674   1.00 15.00 ?  281 PRO A HD2  6  
ATOM   3812  H HD3  . PRO A 1 3  ? -14.812 4.956   2.903   1.00 15.00 ?  281 PRO A HD3  6  
ATOM   3813  N N    . LEU A 1 4  ? -9.551  6.208   3.845   1.00 15.00 ?  282 LEU A N    6  
ATOM   3814  C CA   . LEU A 1 4  ? -8.225  5.628   3.991   1.00 15.00 ?  282 LEU A CA   6  
ATOM   3815  C C    . LEU A 1 4  ? -7.778  5.741   5.448   1.00 15.00 ?  282 LEU A C    6  
ATOM   3816  O O    . LEU A 1 4  ? -7.694  6.845   5.987   1.00 15.00 ?  282 LEU A O    6  
ATOM   3817  C CB   . LEU A 1 4  ? -7.224  6.341   3.074   1.00 15.00 ?  282 LEU A CB   6  
ATOM   3818  C CG   . LEU A 1 4  ? -5.822  5.725   3.029   1.00 15.00 ?  282 LEU A CG   6  
ATOM   3819  C CD1  . LEU A 1 4  ? -5.865  4.344   2.393   1.00 15.00 ?  282 LEU A CD1  6  
ATOM   3820  C CD2  . LEU A 1 4  ? -4.866  6.635   2.274   1.00 15.00 ?  282 LEU A CD2  6  
ATOM   3821  H H    . LEU A 1 4  ? -9.668  7.168   4.010   1.00 15.00 ?  282 LEU A H    6  
ATOM   3822  H HA   . LEU A 1 4  ? -8.284  4.584   3.717   1.00 15.00 ?  282 LEU A HA   6  
ATOM   3823  H HB2  . LEU A 1 4  ? -7.625  6.341   2.072   1.00 15.00 ?  282 LEU A HB2  6  
ATOM   3824  H HB3  . LEU A 1 4  ? -7.132  7.365   3.407   1.00 15.00 ?  282 LEU A HB3  6  
ATOM   3825  H HG   . LEU A 1 4  ? -5.453  5.614   4.038   1.00 15.00 ?  282 LEU A HG   6  
ATOM   3826  H HD11 . LEU A 1 4  ? -6.320  4.413   1.416   1.00 15.00 ?  282 LEU A HD11 6  
ATOM   3827  H HD12 . LEU A 1 4  ? -6.445  3.678   3.016   1.00 15.00 ?  282 LEU A HD12 6  
ATOM   3828  H HD13 . LEU A 1 4  ? -4.859  3.961   2.293   1.00 15.00 ?  282 LEU A HD13 6  
ATOM   3829  H HD21 . LEU A 1 4  ? -3.893  6.170   2.221   1.00 15.00 ?  282 LEU A HD21 6  
ATOM   3830  H HD22 . LEU A 1 4  ? -4.787  7.578   2.790   1.00 15.00 ?  282 LEU A HD22 6  
ATOM   3831  H HD23 . LEU A 1 4  ? -5.242  6.801   1.275   1.00 15.00 ?  282 LEU A HD23 6  
ATOM   3832  N N    . PRO A 1 5  ? -7.513  4.602   6.106   1.00 15.00 ?  283 PRO A N    6  
ATOM   3833  C CA   . PRO A 1 5  ? -7.088  4.567   7.515   1.00 15.00 ?  283 PRO A CA   6  
ATOM   3834  C C    . PRO A 1 5  ? -5.761  5.294   7.749   1.00 15.00 ?  283 PRO A C    6  
ATOM   3835  O O    . PRO A 1 5  ? -4.826  5.157   6.960   1.00 15.00 ?  283 PRO A O    6  
ATOM   3836  C CB   . PRO A 1 5  ? -6.929  3.068   7.807   1.00 15.00 ?  283 PRO A CB   6  
ATOM   3837  C CG   . PRO A 1 5  ? -7.716  2.378   6.750   1.00 15.00 ?  283 PRO A CG   6  
ATOM   3838  C CD   . PRO A 1 5  ? -7.616  3.252   5.535   1.00 15.00 ?  283 PRO A CD   6  
ATOM   3839  H HA   . PRO A 1 5  ? -7.845  4.981   8.161   1.00 15.00 ?  283 PRO A HA   6  
ATOM   3840  H HB2  . PRO A 1 5  ? -5.884  2.797   7.760   1.00 15.00 ?  283 PRO A HB2  6  
ATOM   3841  H HB3  . PRO A 1 5  ? -7.317  2.847   8.791   1.00 15.00 ?  283 PRO A HB3  6  
ATOM   3842  H HG2  . PRO A 1 5  ? -7.289  1.405   6.549   1.00 15.00 ?  283 PRO A HG2  6  
ATOM   3843  H HG3  . PRO A 1 5  ? -8.745  2.282   7.061   1.00 15.00 ?  283 PRO A HG3  6  
ATOM   3844  H HD2  . PRO A 1 5  ? -6.733  3.007   4.963   1.00 15.00 ?  283 PRO A HD2  6  
ATOM   3845  H HD3  . PRO A 1 5  ? -8.502  3.158   4.924   1.00 15.00 ?  283 PRO A HD3  6  
ATOM   3846  N N    . PRO A 1 6  ? -5.664  6.081   8.838   1.00 15.00 ?  284 PRO A N    6  
ATOM   3847  C CA   . PRO A 1 6  ? -4.421  6.768   9.218   1.00 15.00 ?  284 PRO A CA   6  
ATOM   3848  C C    . PRO A 1 6  ? -3.260  5.793   9.413   1.00 15.00 ?  284 PRO A C    6  
ATOM   3849  O O    . PRO A 1 6  ? -3.409  4.753   10.061  1.00 15.00 ?  284 PRO A O    6  
ATOM   3850  C CB   . PRO A 1 6  ? -4.768  7.437   10.551  1.00 15.00 ?  284 PRO A CB   6  
ATOM   3851  C CG   . PRO A 1 6  ? -6.252  7.550   10.557  1.00 15.00 ?  284 PRO A CG   6  
ATOM   3852  C CD   . PRO A 1 6  ? -6.763  6.374   9.779   1.00 15.00 ?  284 PRO A CD   6  
ATOM   3853  H HA   . PRO A 1 6  ? -4.143  7.519   8.493   1.00 15.00 ?  284 PRO A HA   6  
ATOM   3854  H HB2  . PRO A 1 6  ? -4.415  6.822   11.366  1.00 15.00 ?  284 PRO A HB2  6  
ATOM   3855  H HB3  . PRO A 1 6  ? -4.299  8.409   10.600  1.00 15.00 ?  284 PRO A HB3  6  
ATOM   3856  H HG2  . PRO A 1 6  ? -6.618  7.513   11.573  1.00 15.00 ?  284 PRO A HG2  6  
ATOM   3857  H HG3  . PRO A 1 6  ? -6.552  8.472   10.083  1.00 15.00 ?  284 PRO A HG3  6  
ATOM   3858  H HD2  . PRO A 1 6  ? -6.945  5.536   10.435  1.00 15.00 ?  284 PRO A HD2  6  
ATOM   3859  H HD3  . PRO A 1 6  ? -7.665  6.642   9.249   1.00 15.00 ?  284 PRO A HD3  6  
ATOM   3860  N N    . GLY A 1 7  ? -2.104  6.138   8.860   1.00 15.00 ?  285 GLY A N    6  
ATOM   3861  C CA   . GLY A 1 7  ? -0.938  5.286   8.981   1.00 15.00 ?  285 GLY A CA   6  
ATOM   3862  C C    . GLY A 1 7  ? -0.694  4.489   7.720   1.00 15.00 ?  285 GLY A C    6  
ATOM   3863  O O    . GLY A 1 7  ? 0.282   3.743   7.618   1.00 15.00 ?  285 GLY A O    6  
ATOM   3864  H H    . GLY A 1 7  ? -2.041  6.982   8.355   1.00 15.00 ?  285 GLY A H    6  
ATOM   3865  H HA2  . GLY A 1 7  ? -0.073  5.901   9.184   1.00 15.00 ?  285 GLY A HA2  6  
ATOM   3866  H HA3  . GLY A 1 7  ? -1.084  4.603   9.806   1.00 15.00 ?  285 GLY A HA3  6  
ATOM   3867  N N    . TRP A 1 8  ? -1.579  4.670   6.750   1.00 15.00 ?  286 TRP A N    6  
ATOM   3868  C CA   . TRP A 1 8  ? -1.494  3.955   5.490   1.00 15.00 ?  286 TRP A CA   6  
ATOM   3869  C C    . TRP A 1 8  ? -0.661  4.723   4.488   1.00 15.00 ?  286 TRP A C    6  
ATOM   3870  O O    . TRP A 1 8  ? -1.072  5.776   3.994   1.00 15.00 ?  286 TRP A O    6  
ATOM   3871  C CB   . TRP A 1 8  ? -2.893  3.705   4.908   1.00 15.00 ?  286 TRP A CB   6  
ATOM   3872  C CG   . TRP A 1 8  ? -3.565  2.498   5.479   1.00 15.00 ?  286 TRP A CG   6  
ATOM   3873  C CD1  . TRP A 1 8  ? -3.682  2.181   6.800   1.00 15.00 ?  286 TRP A CD1  6  
ATOM   3874  C CD2  . TRP A 1 8  ? -4.201  1.437   4.751   1.00 15.00 ?  286 TRP A CD2  6  
ATOM   3875  N NE1  . TRP A 1 8  ? -4.334  0.985   6.943   1.00 15.00 ?  286 TRP A NE1  6  
ATOM   3876  C CE2  . TRP A 1 8  ? -4.661  0.504   5.704   1.00 15.00 ?  286 TRP A CE2  6  
ATOM   3877  C CE3  . TRP A 1 8  ? -4.426  1.170   3.389   1.00 15.00 ?  286 TRP A CE3  6  
ATOM   3878  C CZ2  . TRP A 1 8  ? -5.321  -0.667  5.346   1.00 15.00 ?  286 TRP A CZ2  6  
ATOM   3879  C CZ3  . TRP A 1 8  ? -5.072  0.002   3.047   1.00 15.00 ?  286 TRP A CZ3  6  
ATOM   3880  C CH2  . TRP A 1 8  ? -5.510  -0.905  4.016   1.00 15.00 ?  286 TRP A CH2  6  
ATOM   3881  H H    . TRP A 1 8  ? -2.313  5.303   6.887   1.00 15.00 ?  286 TRP A H    6  
ATOM   3882  H HA   . TRP A 1 8  ? -1.014  3.004   5.680   1.00 15.00 ?  286 TRP A HA   6  
ATOM   3883  H HB2  . TRP A 1 8  ? -3.518  4.561   5.110   1.00 15.00 ?  286 TRP A HB2  6  
ATOM   3884  H HB3  . TRP A 1 8  ? -2.812  3.569   3.839   1.00 15.00 ?  286 TRP A HB3  6  
ATOM   3885  H HD1  . TRP A 1 8  ? -3.306  2.790   7.608   1.00 15.00 ?  286 TRP A HD1  6  
ATOM   3886  H HE1  . TRP A 1 8  ? -4.532  0.544   7.799   1.00 15.00 ?  286 TRP A HE1  6  
ATOM   3887  H HE3  . TRP A 1 8  ? -4.107  1.877   2.575   1.00 15.00 ?  286 TRP A HE3  6  
ATOM   3888  H HZ2  . TRP A 1 8  ? -5.665  -1.376  6.083   1.00 15.00 ?  286 TRP A HZ2  6  
ATOM   3889  H HZ3  . TRP A 1 8  ? -5.208  -0.237  2.003   1.00 15.00 ?  286 TRP A HZ3  6  
ATOM   3890  H HH2  . TRP A 1 8  ? -6.009  -1.806  3.692   1.00 15.00 ?  286 TRP A HH2  6  
ATOM   3891  N N    . GLU A 1 9  ? 0.523   4.204   4.216   1.00 15.00 ?  287 GLU A N    6  
ATOM   3892  C CA   . GLU A 1 9  ? 1.358   4.741   3.171   1.00 15.00 ?  287 GLU A CA   6  
ATOM   3893  C C    . GLU A 1 9  ? 1.072   3.978   1.892   1.00 15.00 ?  287 GLU A C    6  
ATOM   3894  O O    . GLU A 1 9  ? 1.177   2.752   1.857   1.00 15.00 ?  287 GLU A O    6  
ATOM   3895  C CB   . GLU A 1 9  ? 2.834   4.629   3.556   1.00 15.00 ?  287 GLU A CB   6  
ATOM   3896  C CG   . GLU A 1 9  ? 3.459   5.943   4.003   1.00 15.00 ?  287 GLU A CG   6  
ATOM   3897  C CD   . GLU A 1 9  ? 2.809   6.540   5.235   1.00 15.00 ?  287 GLU A CD   6  
ATOM   3898  O OE1  . GLU A 1 9  ? 2.865   5.910   6.309   1.00 15.00 -1 287 GLU A OE1  6  
ATOM   3899  O OE2  . GLU A 1 9  ? 2.266   7.660   5.136   1.00 15.00 ?  287 GLU A OE2  6  
ATOM   3900  H H    . GLU A 1 9  ? 0.841   3.422   4.725   1.00 15.00 ?  287 GLU A H    6  
ATOM   3901  H HA   . GLU A 1 9  ? 1.099   5.781   3.030   1.00 15.00 ?  287 GLU A HA   6  
ATOM   3902  H HB2  . GLU A 1 9  ? 2.927   3.922   4.367   1.00 15.00 ?  287 GLU A HB2  6  
ATOM   3903  H HB3  . GLU A 1 9  ? 3.394   4.261   2.708   1.00 15.00 ?  287 GLU A HB3  6  
ATOM   3904  H HG2  . GLU A 1 9  ? 4.502   5.769   4.222   1.00 15.00 ?  287 GLU A HG2  6  
ATOM   3905  H HG3  . GLU A 1 9  ? 3.381   6.652   3.193   1.00 15.00 ?  287 GLU A HG3  6  
ATOM   3906  N N    . VAL A 1 10 ? 0.684   4.683   0.849   1.00 15.00 ?  288 VAL A N    6  
ATOM   3907  C CA   . VAL A 1 10 ? 0.367   4.017   -0.396  1.00 15.00 ?  288 VAL A CA   6  
ATOM   3908  C C    . VAL A 1 10 ? 1.623   3.913   -1.252  1.00 15.00 ?  288 VAL A C    6  
ATOM   3909  O O    . VAL A 1 10 ? 2.163   4.909   -1.734  1.00 15.00 ?  288 VAL A O    6  
ATOM   3910  C CB   . VAL A 1 10 ? -0.786  4.721   -1.175  1.00 15.00 ?  288 VAL A CB   6  
ATOM   3911  C CG1  . VAL A 1 10 ? -2.015  4.870   -0.294  1.00 15.00 ?  288 VAL A CG1  6  
ATOM   3912  C CG2  . VAL A 1 10 ? -0.375  6.080   -1.717  1.00 15.00 ?  288 VAL A CG2  6  
ATOM   3913  H H    . VAL A 1 10 ? 0.606   5.657   0.917   1.00 15.00 ?  288 VAL A H    6  
ATOM   3914  H HA   . VAL A 1 10 ? 0.042   3.016   -0.150  1.00 15.00 ?  288 VAL A HA   6  
ATOM   3915  H HB   . VAL A 1 10 ? -1.053  4.094   -2.014  1.00 15.00 ?  288 VAL A HB   6  
ATOM   3916  H HG11 . VAL A 1 10 ? -1.775  5.491   0.558   1.00 15.00 ?  288 VAL A HG11 6  
ATOM   3917  H HG12 . VAL A 1 10 ? -2.335  3.898   0.049   1.00 15.00 ?  288 VAL A HG12 6  
ATOM   3918  H HG13 . VAL A 1 10 ? -2.811  5.332   -0.860  1.00 15.00 ?  288 VAL A HG13 6  
ATOM   3919  H HG21 . VAL A 1 10 ? 0.554   5.985   -2.257  1.00 15.00 ?  288 VAL A HG21 6  
ATOM   3920  H HG22 . VAL A 1 10 ? -0.250  6.774   -0.898  1.00 15.00 ?  288 VAL A HG22 6  
ATOM   3921  H HG23 . VAL A 1 10 ? -1.142  6.443   -2.384  1.00 15.00 ?  288 VAL A HG23 6  
ATOM   3922  N N    . ARG A 1 11 ? 2.138   2.707   -1.391  1.00 15.00 ?  289 ARG A N    6  
ATOM   3923  C CA   . ARG A 1 11 ? 3.320   2.520   -2.191  1.00 15.00 ?  289 ARG A CA   6  
ATOM   3924  C C    . ARG A 1 11 ? 2.883   2.085   -3.586  1.00 15.00 ?  289 ARG A C    6  
ATOM   3925  O O    . ARG A 1 11 ? 2.572   0.922   -3.831  1.00 15.00 ?  289 ARG A O    6  
ATOM   3926  C CB   . ARG A 1 11 ? 4.301   1.539   -1.506  1.00 15.00 ?  289 ARG A CB   6  
ATOM   3927  C CG   . ARG A 1 11 ? 5.767   1.733   -1.903  1.00 15.00 ?  289 ARG A CG   6  
ATOM   3928  C CD   . ARG A 1 11 ? 6.056   1.339   -3.345  1.00 15.00 ?  289 ARG A CD   6  
ATOM   3929  N NE   . ARG A 1 11 ? 7.426   1.683   -3.748  1.00 15.00 ?  289 ARG A NE   6  
ATOM   3930  C CZ   . ARG A 1 11 ? 8.480   0.865   -3.635  1.00 15.00 ?  289 ARG A CZ   6  
ATOM   3931  N NH1  . ARG A 1 11 ? 8.344   -0.340  -3.100  1.00 15.00 1  289 ARG A NH1  6  
ATOM   3932  N NH2  . ARG A 1 11 ? 9.675   1.253   -4.060  1.00 15.00 ?  289 ARG A NH2  6  
ATOM   3933  H H    . ARG A 1 11 ? 1.706   1.931   -0.965  1.00 15.00 ?  289 ARG A H    6  
ATOM   3934  H HA   . ARG A 1 11 ? 3.800   3.486   -2.277  1.00 15.00 ?  289 ARG A HA   6  
ATOM   3935  H HB2  . ARG A 1 11 ? 4.231   1.694   -0.440  1.00 15.00 ?  289 ARG A HB2  6  
ATOM   3936  H HB3  . ARG A 1 11 ? 4.014   0.519   -1.717  1.00 15.00 ?  289 ARG A HB3  6  
ATOM   3937  H HG2  . ARG A 1 11 ? 6.025   2.773   -1.774  1.00 15.00 ?  289 ARG A HG2  6  
ATOM   3938  H HG3  . ARG A 1 11 ? 6.381   1.130   -1.250  1.00 15.00 ?  289 ARG A HG3  6  
ATOM   3939  H HD2  . ARG A 1 11 ? 5.919   0.273   -3.448  1.00 15.00 ?  289 ARG A HD2  6  
ATOM   3940  H HD3  . ARG A 1 11 ? 5.361   1.855   -3.992  1.00 15.00 ?  289 ARG A HD3  6  
ATOM   3941  H HE   . ARG A 1 11 ? 7.566   2.573   -4.142  1.00 15.00 ?  289 ARG A HE   6  
ATOM   3942  H HH11 . ARG A 1 11 ? 7.447   -0.656  -2.766  1.00 15.00 ?  289 ARG A HH11 6  
ATOM   3943  H HH12 . ARG A 1 11 ? 9.140   -0.953  -3.026  1.00 15.00 ?  289 ARG A HH12 6  
ATOM   3944  H HH21 . ARG A 1 11 ? 9.799   2.170   -4.479  1.00 15.00 ?  289 ARG A HH21 6  
ATOM   3945  H HH22 . ARG A 1 11 ? 10.474  0.640   -3.961  1.00 15.00 ?  289 ARG A HH22 6  
ATOM   3946  N N    . SER A 1 12 ? 2.757   3.072   -4.459  1.00 15.00 ?  290 SER A N    6  
ATOM   3947  C CA   . SER A 1 12 ? 2.288   2.859   -5.812  1.00 15.00 ?  290 SER A CA   6  
ATOM   3948  C C    . SER A 1 12 ? 3.457   2.846   -6.786  1.00 15.00 ?  290 SER A C    6  
ATOM   3949  O O    . SER A 1 12 ? 4.163   3.839   -6.946  1.00 15.00 ?  290 SER A O    6  
ATOM   3950  C CB   . SER A 1 12 ? 1.284   3.956   -6.172  1.00 15.00 ?  290 SER A CB   6  
ATOM   3951  O OG   . SER A 1 12 ? 1.576   5.153   -5.466  1.00 15.00 ?  290 SER A OG   6  
ATOM   3952  H H    . SER A 1 12 ? 2.979   3.989   -4.180  1.00 15.00 ?  290 SER A H    6  
ATOM   3953  H HA   . SER A 1 12 ? 1.793   1.901   -5.849  1.00 15.00 ?  290 SER A HA   6  
ATOM   3954  H HB2  . SER A 1 12 ? 1.333   4.154   -7.232  1.00 15.00 ?  290 SER A HB2  6  
ATOM   3955  H HB3  . SER A 1 12 ? 0.289   3.630   -5.910  1.00 15.00 ?  290 SER A HB3  6  
ATOM   3956  H HG   . SER A 1 12 ? 1.580   5.904   -6.084  1.00 15.00 ?  290 SER A HG   6  
ATOM   3957  N N    . THR A 1 13 ? 3.671   1.710   -7.421  1.00 15.00 ?  291 THR A N    6  
ATOM   3958  C CA   . THR A 1 13 ? 4.776   1.570   -8.349  1.00 15.00 ?  291 THR A CA   6  
ATOM   3959  C C    . THR A 1 13 ? 4.314   1.799   -9.783  1.00 15.00 ?  291 THR A C    6  
ATOM   3960  O O    . THR A 1 13 ? 3.190   1.425   -10.152 1.00 15.00 ?  291 THR A O    6  
ATOM   3961  C CB   . THR A 1 13 ? 5.429   0.177   -8.237  1.00 15.00 ?  291 THR A CB   6  
ATOM   3962  O OG1  . THR A 1 13 ? 4.447   -0.844  -8.439  1.00 15.00 ?  291 THR A OG1  6  
ATOM   3963  C CG2  . THR A 1 13 ? 6.085   -0.014  -6.877  1.00 15.00 ?  291 THR A CG2  6  
ATOM   3964  H H    . THR A 1 13 ? 3.067   0.954   -7.267  1.00 15.00 ?  291 THR A H    6  
ATOM   3965  H HA   . THR A 1 13 ? 5.518   2.312   -8.097  1.00 15.00 ?  291 THR A HA   6  
ATOM   3966  H HB   . THR A 1 13 ? 6.190   0.090   -9.000  1.00 15.00 ?  291 THR A HB   6  
ATOM   3967  H HG1  . THR A 1 13 ? 3.583   -0.523  -8.160  1.00 15.00 ?  291 THR A HG1  6  
ATOM   3968  H HG21 . THR A 1 13 ? 6.846   0.740   -6.734  1.00 15.00 ?  291 THR A HG21 6  
ATOM   3969  H HG22 . THR A 1 13 ? 6.537   -0.995  -6.830  1.00 15.00 ?  291 THR A HG22 6  
ATOM   3970  H HG23 . THR A 1 13 ? 5.339   0.075   -6.102  1.00 15.00 ?  291 THR A HG23 6  
ATOM   3971  N N    . VAL A 1 14 ? 5.189   2.399   -10.590 1.00 15.00 ?  292 VAL A N    6  
ATOM   3972  C CA   . VAL A 1 14 ? 4.905   2.683   -11.998 1.00 15.00 ?  292 VAL A CA   6  
ATOM   3973  C C    . VAL A 1 14 ? 4.609   1.403   -12.781 1.00 15.00 ?  292 VAL A C    6  
ATOM   3974  O O    . VAL A 1 14 ? 4.097   1.452   -13.898 1.00 15.00 ?  292 VAL A O    6  
ATOM   3975  C CB   . VAL A 1 14 ? 6.063   3.445   -12.675 1.00 15.00 ?  292 VAL A CB   6  
ATOM   3976  C CG1  . VAL A 1 14 ? 6.254   4.806   -12.028 1.00 15.00 ?  292 VAL A CG1  6  
ATOM   3977  C CG2  . VAL A 1 14 ? 7.350   2.638   -12.618 1.00 15.00 ?  292 VAL A CG2  6  
ATOM   3978  H H    . VAL A 1 14 ? 6.061   2.671   -10.223 1.00 15.00 ?  292 VAL A H    6  
ATOM   3979  H HA   . VAL A 1 14 ? 4.026   3.314   -12.031 1.00 15.00 ?  292 VAL A HA   6  
ATOM   3980  H HB   . VAL A 1 14 ? 5.807   3.600   -13.713 1.00 15.00 ?  292 VAL A HB   6  
ATOM   3981  H HG11 . VAL A 1 14 ? 6.471   4.678   -10.976 1.00 15.00 ?  292 VAL A HG11 6  
ATOM   3982  H HG12 . VAL A 1 14 ? 5.353   5.388   -12.141 1.00 15.00 ?  292 VAL A HG12 6  
ATOM   3983  H HG13 . VAL A 1 14 ? 7.076   5.318   -12.505 1.00 15.00 ?  292 VAL A HG13 6  
ATOM   3984  H HG21 . VAL A 1 14 ? 7.205   1.694   -13.120 1.00 15.00 ?  292 VAL A HG21 6  
ATOM   3985  H HG22 . VAL A 1 14 ? 7.618   2.459   -11.587 1.00 15.00 ?  292 VAL A HG22 6  
ATOM   3986  H HG23 . VAL A 1 14 ? 8.142   3.188   -13.105 1.00 15.00 ?  292 VAL A HG23 6  
ATOM   3987  N N    . SER A 1 15 ? 4.952   0.265   -12.181 1.00 15.00 ?  293 SER A N    6  
ATOM   3988  C CA   . SER A 1 15 ? 4.634   -1.046  -12.735 1.00 15.00 ?  293 SER A CA   6  
ATOM   3989  C C    . SER A 1 15 ? 3.117   -1.205  -12.918 1.00 15.00 ?  293 SER A C    6  
ATOM   3990  O O    . SER A 1 15 ? 2.657   -2.130  -13.584 1.00 15.00 ?  293 SER A O    6  
ATOM   3991  C CB   . SER A 1 15 ? 5.179   -2.146  -11.814 1.00 15.00 ?  293 SER A CB   6  
ATOM   3992  O OG   . SER A 1 15 ? 5.094   -3.426  -12.414 1.00 15.00 ?  293 SER A OG   6  
ATOM   3993  H H    . SER A 1 15 ? 5.435   0.310   -11.333 1.00 15.00 ?  293 SER A H    6  
ATOM   3994  H HA   . SER A 1 15 ? 5.113   -1.127  -13.699 1.00 15.00 ?  293 SER A HA   6  
ATOM   3995  H HB2  . SER A 1 15 ? 6.215   -1.940  -11.590 1.00 15.00 ?  293 SER A HB2  6  
ATOM   3996  H HB3  . SER A 1 15 ? 4.610   -2.157  -10.895 1.00 15.00 ?  293 SER A HB3  6  
ATOM   3997  H HG   . SER A 1 15 ? 4.443   -3.407  -13.131 1.00 15.00 ?  293 SER A HG   6  
ATOM   3998  N N    . GLY A 1 16 ? 2.351   -0.312  -12.298 1.00 15.00 ?  294 GLY A N    6  
ATOM   3999  C CA   . GLY A 1 16 ? 0.912   -0.357  -12.417 1.00 15.00 ?  294 GLY A CA   6  
ATOM   4000  C C    . GLY A 1 16 ? 0.278   -1.205  -11.345 1.00 15.00 ?  294 GLY A C    6  
ATOM   4001  O O    . GLY A 1 16 ? -0.601  -2.020  -11.626 1.00 15.00 ?  294 GLY A O    6  
ATOM   4002  H H    . GLY A 1 16 ? 2.775   0.383   -11.752 1.00 15.00 ?  294 GLY A H    6  
ATOM   4003  H HA2  . GLY A 1 16 ? 0.525   0.649   -12.344 1.00 15.00 ?  294 GLY A HA2  6  
ATOM   4004  H HA3  . GLY A 1 16 ? 0.654   -0.761  -13.386 1.00 15.00 ?  294 GLY A HA3  6  
ATOM   4005  N N    . ARG A 1 17 ? 0.735   -1.025  -10.115 1.00 15.00 ?  295 ARG A N    6  
ATOM   4006  C CA   . ARG A 1 17 ? 0.164   -1.743  -8.985  1.00 15.00 ?  295 ARG A CA   6  
ATOM   4007  C C    . ARG A 1 17 ? 0.229   -0.885  -7.723  1.00 15.00 ?  295 ARG A C    6  
ATOM   4008  O O    . ARG A 1 17 ? 1.299   -0.386  -7.343  1.00 15.00 ?  295 ARG A O    6  
ATOM   4009  C CB   . ARG A 1 17 ? 0.889   -3.085  -8.767  1.00 15.00 ?  295 ARG A CB   6  
ATOM   4010  C CG   . ARG A 1 17 ? 2.325   -2.944  -8.287  1.00 15.00 ?  295 ARG A CG   6  
ATOM   4011  C CD   . ARG A 1 17 ? 2.961   -4.288  -7.983  1.00 15.00 ?  295 ARG A CD   6  
ATOM   4012  N NE   . ARG A 1 17 ? 4.317   -4.138  -7.452  1.00 15.00 ?  295 ARG A NE   6  
ATOM   4013  C CZ   . ARG A 1 17 ? 5.408   -4.635  -8.039  1.00 15.00 ?  295 ARG A CZ   6  
ATOM   4014  N NH1  . ARG A 1 17 ? 5.303   -5.314  -9.177  1.00 15.00 1  295 ARG A NH1  6  
ATOM   4015  N NH2  . ARG A 1 17 ? 6.604   -4.454  -7.487  1.00 15.00 ?  295 ARG A NH2  6  
ATOM   4016  H H    . ARG A 1 17 ? 1.462   -0.383  -9.960  1.00 15.00 ?  295 ARG A H    6  
ATOM   4017  H HA   . ARG A 1 17 ? -0.873  -1.941  -9.215  1.00 15.00 ?  295 ARG A HA   6  
ATOM   4018  H HB2  . ARG A 1 17 ? 0.343   -3.666  -8.036  1.00 15.00 ?  295 ARG A HB2  6  
ATOM   4019  H HB3  . ARG A 1 17 ? 0.900   -3.625  -9.702  1.00 15.00 ?  295 ARG A HB3  6  
ATOM   4020  H HG2  . ARG A 1 17 ? 2.902   -2.454  -9.056  1.00 15.00 ?  295 ARG A HG2  6  
ATOM   4021  H HG3  . ARG A 1 17 ? 2.335   -2.341  -7.389  1.00 15.00 ?  295 ARG A HG3  6  
ATOM   4022  H HD2  . ARG A 1 17 ? 2.354   -4.805  -7.255  1.00 15.00 ?  295 ARG A HD2  6  
ATOM   4023  H HD3  . ARG A 1 17 ? 3.003   -4.867  -8.894  1.00 15.00 ?  295 ARG A HD3  6  
ATOM   4024  H HE   . ARG A 1 17 ? 4.415   -3.641  -6.613  1.00 15.00 ?  295 ARG A HE   6  
ATOM   4025  H HH11 . ARG A 1 17 ? 4.394   -5.461  -9.603  1.00 15.00 ?  295 ARG A HH11 6  
ATOM   4026  H HH12 . ARG A 1 17 ? 6.121   -5.683  -9.623  1.00 15.00 ?  295 ARG A HH12 6  
ATOM   4027  H HH21 . ARG A 1 17 ? 6.694   -3.946  -6.627  1.00 15.00 ?  295 ARG A HH21 6  
ATOM   4028  H HH22 . ARG A 1 17 ? 7.433   -4.827  -7.931  1.00 15.00 ?  295 ARG A HH22 6  
ATOM   4029  N N    . ILE A 1 18 ? -0.922  -0.683  -7.100  1.00 15.00 ?  296 ILE A N    6  
ATOM   4030  C CA   . ILE A 1 18 ? -0.985  -0.039  -5.801  1.00 15.00 ?  296 ILE A CA   6  
ATOM   4031  C C    . ILE A 1 18 ? -0.937  -1.148  -4.746  1.00 15.00 ?  296 ILE A C    6  
ATOM   4032  O O    . ILE A 1 18 ? -1.609  -2.171  -4.883  1.00 15.00 ?  296 ILE A O    6  
ATOM   4033  C CB   . ILE A 1 18 ? -2.268  0.844   -5.682  1.00 15.00 ?  296 ILE A CB   6  
ATOM   4034  C CG1  . ILE A 1 18 ? -2.070  2.030   -4.713  1.00 15.00 ?  296 ILE A CG1  6  
ATOM   4035  C CG2  . ILE A 1 18 ? -3.485  0.023   -5.270  1.00 15.00 ?  296 ILE A CG2  6  
ATOM   4036  C CD1  . ILE A 1 18 ? -2.013  1.663   -3.244  1.00 15.00 ?  296 ILE A CD1  6  
ATOM   4037  H H    . ILE A 1 18 ? -1.752  -0.983  -7.522  1.00 15.00 ?  296 ILE A H    6  
ATOM   4038  H HA   . ILE A 1 18 ? -0.111  0.591   -5.692  1.00 15.00 ?  296 ILE A HA   6  
ATOM   4039  H HB   . ILE A 1 18 ? -2.472  1.242   -6.665  1.00 15.00 ?  296 ILE A HB   6  
ATOM   4040  H HG12 . ILE A 1 18 ? -1.145  2.530   -4.957  1.00 15.00 ?  296 ILE A HG12 6  
ATOM   4041  H HG13 . ILE A 1 18 ? -2.887  2.726   -4.848  1.00 15.00 ?  296 ILE A HG13 6  
ATOM   4042  H HG21 . ILE A 1 18 ? -4.345  0.669   -5.191  1.00 15.00 ?  296 ILE A HG21 6  
ATOM   4043  H HG22 . ILE A 1 18 ? -3.297  -0.446  -4.315  1.00 15.00 ?  296 ILE A HG22 6  
ATOM   4044  H HG23 . ILE A 1 18 ? -3.672  -0.738  -6.014  1.00 15.00 ?  296 ILE A HG23 6  
ATOM   4045  H HD11 . ILE A 1 18 ? -2.612  0.782   -3.067  1.00 15.00 ?  296 ILE A HD11 6  
ATOM   4046  H HD12 . ILE A 1 18 ? -2.402  2.484   -2.657  1.00 15.00 ?  296 ILE A HD12 6  
ATOM   4047  H HD13 . ILE A 1 18 ? -0.994  1.473   -2.957  1.00 15.00 ?  296 ILE A HD13 6  
ATOM   4048  N N    . TYR A 1 19 ? -0.097  -0.991  -3.739  1.00 15.00 ?  297 TYR A N    6  
ATOM   4049  C CA   . TYR A 1 19 ? 0.120   -2.066  -2.788  1.00 15.00 ?  297 TYR A CA   6  
ATOM   4050  C C    . TYR A 1 19 ? 0.469   -1.449  -1.463  1.00 15.00 ?  297 TYR A C    6  
ATOM   4051  O O    . TYR A 1 19 ? 1.264   -0.503  -1.386  1.00 15.00 ?  297 TYR A O    6  
ATOM   4052  C CB   . TYR A 1 19 ? 1.174   -3.093  -3.270  1.00 15.00 ?  297 TYR A CB   6  
ATOM   4053  C CG   . TYR A 1 19 ? 2.620   -2.790  -2.935  1.00 15.00 ?  297 TYR A CG   6  
ATOM   4054  C CD1  . TYR A 1 19 ? 3.347   -1.882  -3.683  1.00 15.00 ?  297 TYR A CD1  6  
ATOM   4055  C CD2  . TYR A 1 19 ? 3.264   -3.436  -1.878  1.00 15.00 ?  297 TYR A CD2  6  
ATOM   4056  C CE1  . TYR A 1 19 ? 4.667   -1.617  -3.388  1.00 15.00 ?  297 TYR A CE1  6  
ATOM   4057  C CE2  . TYR A 1 19 ? 4.582   -3.171  -1.582  1.00 15.00 ?  297 TYR A CE2  6  
ATOM   4058  C CZ   . TYR A 1 19 ? 5.277   -2.262  -2.336  1.00 15.00 ?  297 TYR A CZ   6  
ATOM   4059  O OH   . TYR A 1 19 ? 6.588   -1.994  -2.037  1.00 15.00 ?  297 TYR A OH   6  
ATOM   4060  H H    . TYR A 1 19 ? 0.295   -0.099  -3.557  1.00 15.00 ?  297 TYR A H    6  
ATOM   4061  H HA   . TYR A 1 19 ? -0.827  -2.575  -2.672  1.00 15.00 ?  297 TYR A HA   6  
ATOM   4062  H HB2  . TYR A 1 19 ? 0.944   -4.051  -2.835  1.00 15.00 ?  297 TYR A HB2  6  
ATOM   4063  H HB3  . TYR A 1 19 ? 1.101   -3.177  -4.346  1.00 15.00 ?  297 TYR A HB3  6  
ATOM   4064  H HD1  . TYR A 1 19 ? 2.865   -1.372  -4.505  1.00 15.00 ?  297 TYR A HD1  6  
ATOM   4065  H HD2  . TYR A 1 19 ? 2.724   -4.161  -1.290  1.00 15.00 ?  297 TYR A HD2  6  
ATOM   4066  H HE1  . TYR A 1 19 ? 5.219   -0.904  -3.985  1.00 15.00 ?  297 TYR A HE1  6  
ATOM   4067  H HE2  . TYR A 1 19 ? 5.064   -3.679  -0.757  1.00 15.00 ?  297 TYR A HE2  6  
ATOM   4068  H HH   . TYR A 1 19 ? 7.023   -2.806  -1.751  1.00 15.00 ?  297 TYR A HH   6  
ATOM   4069  N N    . PHE A 1 20 ? -0.136  -1.957  -0.428  1.00 15.00 ?  298 PHE A N    6  
ATOM   4070  C CA   . PHE A 1 20 ? -0.118  -1.266  0.813   1.00 15.00 ?  298 PHE A CA   6  
ATOM   4071  C C    . PHE A 1 20 ? 1.018   -1.595  1.717   1.00 15.00 ?  298 PHE A C    6  
ATOM   4072  O O    . PHE A 1 20 ? 1.367   -2.754  1.925   1.00 15.00 ?  298 PHE A O    6  
ATOM   4073  C CB   . PHE A 1 20 ? -1.422  -1.435  1.519   1.00 15.00 ?  298 PHE A CB   6  
ATOM   4074  C CG   . PHE A 1 20 ? -2.215  -0.251  1.224   1.00 15.00 ?  298 PHE A CG   6  
ATOM   4075  C CD1  . PHE A 1 20 ? -1.801  0.958   1.733   1.00 15.00 ?  298 PHE A CD1  6  
ATOM   4076  C CD2  . PHE A 1 20 ? -3.319  -0.312  0.408   1.00 15.00 ?  298 PHE A CD2  6  
ATOM   4077  C CE1  . PHE A 1 20 ? -2.477  2.092   1.448   1.00 15.00 ?  298 PHE A CE1  6  
ATOM   4078  C CE2  . PHE A 1 20 ? -4.011  0.830   0.121   1.00 15.00 ?  298 PHE A CE2  6  
ATOM   4079  C CZ   . PHE A 1 20 ? -3.582  2.027   0.648   1.00 15.00 ?  298 PHE A CZ   6  
ATOM   4080  H H    . PHE A 1 20 ? -0.653  -2.787  -0.516  1.00 15.00 ?  298 PHE A H    6  
ATOM   4081  H HA   . PHE A 1 20 ? -0.037  -0.222  0.557   1.00 15.00 ?  298 PHE A HA   6  
ATOM   4082  H HB2  . PHE A 1 20 ? -1.936  -2.315  1.156   1.00 15.00 ?  298 PHE A HB2  6  
ATOM   4083  H HB3  . PHE A 1 20 ? -1.268  -1.497  2.585   1.00 15.00 ?  298 PHE A HB3  6  
ATOM   4084  H HD1  . PHE A 1 20 ? -0.940  0.998   2.377   1.00 15.00 ?  298 PHE A HD1  6  
ATOM   4085  H HD2  . PHE A 1 20 ? -3.640  -1.262  0.004   1.00 15.00 ?  298 PHE A HD2  6  
ATOM   4086  H HE1  . PHE A 1 20 ? -2.147  3.039   1.849   1.00 15.00 ?  298 PHE A HE1  6  
ATOM   4087  H HE2  . PHE A 1 20 ? -4.885  0.796   -0.511  1.00 15.00 ?  298 PHE A HE2  6  
ATOM   4088  H HZ   . PHE A 1 20 ? -4.110  2.896   0.457   1.00 15.00 ?  298 PHE A HZ   6  
ATOM   4089  N N    . VAL A 1 21 ? 1.529   -0.520  2.287   1.00 15.00 ?  299 VAL A N    6  
ATOM   4090  C CA   . VAL A 1 21 ? 2.605   -0.549  3.228   1.00 15.00 ?  299 VAL A CA   6  
ATOM   4091  C C    . VAL A 1 21 ? 2.261   0.407   4.375   1.00 15.00 ?  299 VAL A C    6  
ATOM   4092  O O    . VAL A 1 21 ? 2.541   1.608   4.340   1.00 15.00 ?  299 VAL A O    6  
ATOM   4093  C CB   . VAL A 1 21 ? 3.926   -0.138  2.535   1.00 15.00 ?  299 VAL A CB   6  
ATOM   4094  C CG1  . VAL A 1 21 ? 4.368   -1.213  1.549   1.00 15.00 ?  299 VAL A CG1  6  
ATOM   4095  C CG2  . VAL A 1 21 ? 3.754   1.179   1.797   1.00 15.00 ?  299 VAL A CG2  6  
ATOM   4096  H H    . VAL A 1 21 ? 1.137   0.351   2.071   1.00 15.00 ?  299 VAL A H    6  
ATOM   4097  H HA   . VAL A 1 21 ? 2.705   -1.553  3.611   1.00 15.00 ?  299 VAL A HA   6  
ATOM   4098  H HB   . VAL A 1 21 ? 4.694   -0.017  3.286   1.00 15.00 ?  299 VAL A HB   6  
ATOM   4099  H HG11 . VAL A 1 21 ? 3.622   -1.320  0.776   1.00 15.00 ?  299 VAL A HG11 6  
ATOM   4100  H HG12 . VAL A 1 21 ? 4.485   -2.154  2.066   1.00 15.00 ?  299 VAL A HG12 6  
ATOM   4101  H HG13 . VAL A 1 21 ? 5.310   -0.927  1.103   1.00 15.00 ?  299 VAL A HG13 6  
ATOM   4102  H HG21 . VAL A 1 21 ? 4.686   1.453   1.326   1.00 15.00 ?  299 VAL A HG21 6  
ATOM   4103  H HG22 . VAL A 1 21 ? 3.464   1.949   2.498   1.00 15.00 ?  299 VAL A HG22 6  
ATOM   4104  H HG23 . VAL A 1 21 ? 2.989   1.072   1.043   1.00 15.00 ?  299 VAL A HG23 6  
ATOM   4105  N N    . ASP A 1 22 ? 1.599   -0.118  5.377   1.00 15.00 ?  300 ASP A N    6  
ATOM   4106  C CA   . ASP A 1 22 ? 1.195   0.694   6.508   1.00 15.00 ?  300 ASP A CA   6  
ATOM   4107  C C    . ASP A 1 22 ? 2.260   0.617   7.587   1.00 15.00 ?  300 ASP A C    6  
ATOM   4108  O O    . ASP A 1 22 ? 2.586   -0.466  8.078   1.00 15.00 ?  300 ASP A O    6  
ATOM   4109  C CB   . ASP A 1 22 ? -0.194  0.262   7.010   1.00 15.00 ?  300 ASP A CB   6  
ATOM   4110  C CG   . ASP A 1 22 ? -0.328  0.247   8.522   1.00 15.00 ?  300 ASP A CG   6  
ATOM   4111  O OD1  . ASP A 1 22 ? -0.288  1.325   9.152   1.00 15.00 ?  300 ASP A OD1  6  
ATOM   4112  O OD2  . ASP A 1 22 ? -0.492  -0.848  9.088   1.00 15.00 -1 300 ASP A OD2  6  
ATOM   4113  H H    . ASP A 1 22 ? 1.374   -1.076  5.360   1.00 15.00 ?  300 ASP A H    6  
ATOM   4114  H HA   . ASP A 1 22 ? 1.138   1.718   6.166   1.00 15.00 ?  300 ASP A HA   6  
ATOM   4115  H HB2  . ASP A 1 22 ? -0.930  0.949   6.622   1.00 15.00 ?  300 ASP A HB2  6  
ATOM   4116  H HB3  . ASP A 1 22 ? -0.414  -0.728  6.636   1.00 15.00 ?  300 ASP A HB3  6  
ATOM   4117  N N    . HIS A 1 23 ? 2.838   1.768   7.923   1.00 15.00 ?  301 HIS A N    6  
ATOM   4118  C CA   . HIS A 1 23 ? 3.943   1.804   8.871   1.00 15.00 ?  301 HIS A CA   6  
ATOM   4119  C C    . HIS A 1 23 ? 3.412   1.848   10.300  1.00 15.00 ?  301 HIS A C    6  
ATOM   4120  O O    . HIS A 1 23 ? 4.174   1.704   11.254  1.00 15.00 ?  301 HIS A O    6  
ATOM   4121  C CB   . HIS A 1 23 ? 4.859   3.025   8.681   1.00 15.00 ?  301 HIS A CB   6  
ATOM   4122  C CG   . HIS A 1 23 ? 5.275   3.374   7.278   1.00 15.00 ?  301 HIS A CG   6  
ATOM   4123  N ND1  . HIS A 1 23 ? 5.444   4.674   6.879   1.00 15.00 ?  301 HIS A ND1  6  
ATOM   4124  C CD2  . HIS A 1 23 ? 5.663   2.615   6.228   1.00 15.00 ?  301 HIS A CD2  6  
ATOM   4125  C CE1  . HIS A 1 23 ? 5.925   4.701   5.659   1.00 15.00 ?  301 HIS A CE1  6  
ATOM   4126  N NE2  . HIS A 1 23 ? 6.078   3.462   5.233   1.00 15.00 ?  301 HIS A NE2  6  
ATOM   4127  H H    . HIS A 1 23 ? 2.498   2.608   7.538   1.00 15.00 ?  301 HIS A H    6  
ATOM   4128  H HA   . HIS A 1 23 ? 4.524   0.904   8.741   1.00 15.00 ?  301 HIS A HA   6  
ATOM   4129  H HB2  . HIS A 1 23 ? 4.369   3.884   9.086   1.00 15.00 ?  301 HIS A HB2  6  
ATOM   4130  H HB3  . HIS A 1 23 ? 5.764   2.851   9.246   1.00 15.00 ?  301 HIS A HB3  6  
ATOM   4131  H HD1  . HIS A 1 23 ? 5.216   5.474   7.412   1.00 15.00 ?  301 HIS A HD1  6  
ATOM   4132  H HD2  . HIS A 1 23 ? 5.638   1.536   6.172   1.00 15.00 ?  301 HIS A HD2  6  
ATOM   4133  H HE1  . HIS A 1 23 ? 6.153   5.592   5.090   1.00 15.00 ?  301 HIS A HE1  6  
ATOM   4134  H HE2  . HIS A 1 23 ? 6.722   3.206   4.531   1.00 15.00 ?  301 HIS A HE2  6  
ATOM   4135  N N    . ASN A 1 24 ? 2.112   2.075   10.439  1.00 15.00 ?  302 ASN A N    6  
ATOM   4136  C CA   . ASN A 1 24 ? 1.510   2.284   11.750  1.00 15.00 ?  302 ASN A CA   6  
ATOM   4137  C C    . ASN A 1 24 ? 1.185   0.955   12.425  1.00 15.00 ?  302 ASN A C    6  
ATOM   4138  O O    . ASN A 1 24 ? 1.660   0.680   13.526  1.00 15.00 ?  302 ASN A O    6  
ATOM   4139  C CB   . ASN A 1 24 ? 0.255   3.153   11.618  1.00 15.00 ?  302 ASN A CB   6  
ATOM   4140  C CG   . ASN A 1 24 ? -0.420  3.434   12.948  1.00 15.00 ?  302 ASN A CG   6  
ATOM   4141  O OD1  . ASN A 1 24 ? -0.034  4.356   13.666  1.00 15.00 ?  302 ASN A OD1  6  
ATOM   4142  N ND2  . ASN A 1 24 ? -1.458  2.674   13.263  1.00 15.00 ?  302 ASN A ND2  6  
ATOM   4143  H H    . ASN A 1 24 ? 1.535   2.088   9.641   1.00 15.00 ?  302 ASN A H    6  
ATOM   4144  H HA   . ASN A 1 24 ? 2.231   2.808   12.360  1.00 15.00 ?  302 ASN A HA   6  
ATOM   4145  H HB2  . ASN A 1 24 ? 0.530   4.099   11.174  1.00 15.00 ?  302 ASN A HB2  6  
ATOM   4146  H HB3  . ASN A 1 24 ? -0.453  2.654   10.974  1.00 15.00 ?  302 ASN A HB3  6  
ATOM   4147  H HD21 . ASN A 1 24 ? -1.737  1.979   12.627  1.00 15.00 ?  302 ASN A HD21 6  
ATOM   4148  H HD22 . ASN A 1 24 ? -1.907  2.837   14.120  1.00 15.00 ?  302 ASN A HD22 6  
ATOM   4149  N N    . ASN A 1 25 ? 0.375   0.134   11.771  1.00 15.00 ?  303 ASN A N    6  
ATOM   4150  C CA   . ASN A 1 25 ? 0.050   -1.192  12.299  1.00 15.00 ?  303 ASN A CA   6  
ATOM   4151  C C    . ASN A 1 25 ? 0.969   -2.260  11.719  1.00 15.00 ?  303 ASN A C    6  
ATOM   4152  O O    . ASN A 1 25 ? 1.025   -3.383  12.231  1.00 15.00 ?  303 ASN A O    6  
ATOM   4153  C CB   . ASN A 1 25 ? -1.405  -1.567  12.000  1.00 15.00 ?  303 ASN A CB   6  
ATOM   4154  C CG   . ASN A 1 25 ? -2.410  -0.754  12.794  1.00 15.00 ?  303 ASN A CG   6  
ATOM   4155  O OD1  . ASN A 1 25 ? -2.147  -0.341  13.925  1.00 15.00 ?  303 ASN A OD1  6  
ATOM   4156  N ND2  . ASN A 1 25 ? -3.573  -0.530  12.207  1.00 15.00 ?  303 ASN A ND2  6  
ATOM   4157  H H    . ASN A 1 25 ? -0.028  0.429   10.917  1.00 15.00 ?  303 ASN A H    6  
ATOM   4158  H HA   . ASN A 1 25 ? 0.187   -1.163  13.369  1.00 15.00 ?  303 ASN A HA   6  
ATOM   4159  H HB2  . ASN A 1 25 ? -1.601  -1.410  10.949  1.00 15.00 ?  303 ASN A HB2  6  
ATOM   4160  H HB3  . ASN A 1 25 ? -1.553  -2.611  12.233  1.00 15.00 ?  303 ASN A HB3  6  
ATOM   4161  H HD21 . ASN A 1 25 ? -3.714  -0.897  11.302  1.00 15.00 ?  303 ASN A HD21 6  
ATOM   4162  H HD22 . ASN A 1 25 ? -4.251  -0.012  12.692  1.00 15.00 ?  303 ASN A HD22 6  
ATOM   4163  N N    . ARG A 1 26 ? 1.674   -1.901  10.645  1.00 15.00 ?  304 ARG A N    6  
ATOM   4164  C CA   . ARG A 1 26 ? 2.499   -2.829  9.879   1.00 15.00 ?  304 ARG A CA   6  
ATOM   4165  C C    . ARG A 1 26 ? 1.625   -3.860  9.173   1.00 15.00 ?  304 ARG A C    6  
ATOM   4166  O O    . ARG A 1 26 ? 1.291   -4.907  9.733   1.00 15.00 ?  304 ARG A O    6  
ATOM   4167  C CB   . ARG A 1 26 ? 3.565   -3.517  10.745  1.00 15.00 ?  304 ARG A CB   6  
ATOM   4168  C CG   . ARG A 1 26 ? 4.511   -4.401  9.945   1.00 15.00 ?  304 ARG A CG   6  
ATOM   4169  C CD   . ARG A 1 26 ? 5.585   -5.022  10.821  1.00 15.00 ?  304 ARG A CD   6  
ATOM   4170  N NE   . ARG A 1 26 ? 6.491   -5.873  10.049  1.00 15.00 ?  304 ARG A NE   6  
ATOM   4171  C CZ   . ARG A 1 26 ? 6.677   -7.173  10.280  1.00 15.00 ?  304 ARG A CZ   6  
ATOM   4172  N NH1  . ARG A 1 26 ? 6.035   -7.779  11.270  1.00 15.00 1  304 ARG A NH1  6  
ATOM   4173  N NH2  . ARG A 1 26 ? 7.516   -7.859  9.522   1.00 15.00 ?  304 ARG A NH2  6  
ATOM   4174  H H    . ARG A 1 26 ? 1.624   -0.973  10.343  1.00 15.00 ?  304 ARG A H    6  
ATOM   4175  H HA   . ARG A 1 26 ? 3.001   -2.247  9.119   1.00 15.00 ?  304 ARG A HA   6  
ATOM   4176  H HB2  . ARG A 1 26 ? 4.149   -2.760  11.246  1.00 15.00 ?  304 ARG A HB2  6  
ATOM   4177  H HB3  . ARG A 1 26 ? 3.072   -4.130  11.485  1.00 15.00 ?  304 ARG A HB3  6  
ATOM   4178  H HG2  . ARG A 1 26 ? 3.941   -5.192  9.480   1.00 15.00 ?  304 ARG A HG2  6  
ATOM   4179  H HG3  . ARG A 1 26 ? 4.985   -3.802  9.180   1.00 15.00 ?  304 ARG A HG3  6  
ATOM   4180  H HD2  . ARG A 1 26 ? 6.158   -4.230  11.281  1.00 15.00 ?  304 ARG A HD2  6  
ATOM   4181  H HD3  . ARG A 1 26 ? 5.113   -5.615  11.585  1.00 15.00 ?  304 ARG A HD3  6  
ATOM   4182  H HE   . ARG A 1 26 ? 6.987   -5.450  9.313   1.00 15.00 ?  304 ARG A HE   6  
ATOM   4183  H HH11 . ARG A 1 26 ? 5.406   -7.262  11.857  1.00 15.00 ?  304 ARG A HH11 6  
ATOM   4184  H HH12 . ARG A 1 26 ? 6.164   -8.763  11.428  1.00 15.00 ?  304 ARG A HH12 6  
ATOM   4185  H HH21 . ARG A 1 26 ? 8.012   -7.400  8.775   1.00 15.00 ?  304 ARG A HH21 6  
ATOM   4186  H HH22 . ARG A 1 26 ? 7.665   -8.847  9.686   1.00 15.00 ?  304 ARG A HH22 6  
ATOM   4187  N N    . THR A 1 27 ? 1.211   -3.525  7.962   1.00 15.00 ?  305 THR A N    6  
ATOM   4188  C CA   . THR A 1 27 ? 0.397   -4.420  7.157   1.00 15.00 ?  305 THR A CA   6  
ATOM   4189  C C    . THR A 1 27 ? 0.672   -4.183  5.675   1.00 15.00 ?  305 THR A C    6  
ATOM   4190  O O    . THR A 1 27 ? 1.031   -3.070  5.271   1.00 15.00 ?  305 THR A O    6  
ATOM   4191  C CB   . THR A 1 27 ? -1.112  -4.234  7.459   1.00 15.00 ?  305 THR A CB   6  
ATOM   4192  O OG1  . THR A 1 27 ? -1.865  -5.338  6.942   1.00 15.00 ?  305 THR A OG1  6  
ATOM   4193  C CG2  . THR A 1 27 ? -1.649  -2.941  6.864   1.00 15.00 ?  305 THR A CG2  6  
ATOM   4194  H H    . THR A 1 27 ? 1.450   -2.643  7.600   1.00 15.00 ?  305 THR A H    6  
ATOM   4195  H HA   . THR A 1 27 ? 0.673   -5.434  7.406   1.00 15.00 ?  305 THR A HA   6  
ATOM   4196  H HB   . THR A 1 27 ? -1.241  -4.196  8.531   1.00 15.00 ?  305 THR A HB   6  
ATOM   4197  H HG1  . THR A 1 27 ? -2.519  -5.611  7.605   1.00 15.00 ?  305 THR A HG1  6  
ATOM   4198  H HG21 . THR A 1 27 ? -2.700  -2.848  7.094   1.00 15.00 ?  305 THR A HG21 6  
ATOM   4199  H HG22 . THR A 1 27 ? -1.515  -2.955  5.791   1.00 15.00 ?  305 THR A HG22 6  
ATOM   4200  H HG23 . THR A 1 27 ? -1.112  -2.101  7.281   1.00 15.00 ?  305 THR A HG23 6  
ATOM   4201  N N    . THR A 1 28 ? 0.529   -5.233  4.875   1.00 15.00 ?  306 THR A N    6  
ATOM   4202  C CA   . THR A 1 28 ? 0.749   -5.139  3.444   1.00 15.00 ?  306 THR A CA   6  
ATOM   4203  C C    . THR A 1 28 ? -0.413  -5.773  2.682   1.00 15.00 ?  306 THR A C    6  
ATOM   4204  O O    . THR A 1 28 ? -0.679  -6.968  2.813   1.00 15.00 ?  306 THR A O    6  
ATOM   4205  C CB   . THR A 1 28 ? 2.087   -5.794  3.040   1.00 15.00 ?  306 THR A CB   6  
ATOM   4206  O OG1  . THR A 1 28 ? 2.206   -7.106  3.612   1.00 15.00 ?  306 THR A OG1  6  
ATOM   4207  C CG2  . THR A 1 28 ? 3.257   -4.937  3.495   1.00 15.00 ?  306 THR A CG2  6  
ATOM   4208  H H    . THR A 1 28 ? 0.264   -6.098  5.259   1.00 15.00 ?  306 THR A H    6  
ATOM   4209  H HA   . THR A 1 28 ? 0.798   -4.090  3.188   1.00 15.00 ?  306 THR A HA   6  
ATOM   4210  H HB   . THR A 1 28 ? 2.120   -5.875  1.963   1.00 15.00 ?  306 THR A HB   6  
ATOM   4211  H HG1  . THR A 1 28 ? 2.911   -7.582  3.155   1.00 15.00 ?  306 THR A HG1  6  
ATOM   4212  H HG21 . THR A 1 28 ? 4.184   -5.411  3.207   1.00 15.00 ?  306 THR A HG21 6  
ATOM   4213  H HG22 . THR A 1 28 ? 3.226   -4.827  4.569   1.00 15.00 ?  306 THR A HG22 6  
ATOM   4214  H HG23 . THR A 1 28 ? 3.190   -3.963  3.032   1.00 15.00 ?  306 THR A HG23 6  
ATOM   4215  N N    . GLN A 1 29 ? -1.114  -4.965  1.893   1.00 15.00 ?  307 GLN A N    6  
ATOM   4216  C CA   . GLN A 1 29 ? -2.361  -5.409  1.260   1.00 15.00 ?  307 GLN A CA   6  
ATOM   4217  C C    . GLN A 1 29 ? -2.502  -4.864  -0.162  1.00 15.00 ?  307 GLN A C    6  
ATOM   4218  O O    . GLN A 1 29 ? -2.329  -3.676  -0.387  1.00 15.00 ?  307 GLN A O    6  
ATOM   4219  C CB   . GLN A 1 29 ? -3.566  -4.932  2.087   1.00 15.00 ?  307 GLN A CB   6  
ATOM   4220  C CG   . GLN A 1 29 ? -3.580  -5.419  3.532   1.00 15.00 ?  307 GLN A CG   6  
ATOM   4221  C CD   . GLN A 1 29 ? -3.895  -6.899  3.664   1.00 15.00 ?  307 GLN A CD   6  
ATOM   4222  O OE1  . GLN A 1 29 ? -3.401  -7.571  4.571   1.00 15.00 ?  307 GLN A OE1  6  
ATOM   4223  N NE2  . GLN A 1 29 ? -4.744  -7.411  2.786   1.00 15.00 ?  307 GLN A NE2  6  
ATOM   4224  H H    . GLN A 1 29 ? -0.780  -4.049  1.726   1.00 15.00 ?  307 GLN A H    6  
ATOM   4225  H HA   . GLN A 1 29 ? -2.358  -6.489  1.228   1.00 15.00 ?  307 GLN A HA   6  
ATOM   4226  H HB2  . GLN A 1 29 ? -3.568  -3.851  2.100   1.00 15.00 ?  307 GLN A HB2  6  
ATOM   4227  H HB3  . GLN A 1 29 ? -4.471  -5.274  1.609   1.00 15.00 ?  307 GLN A HB3  6  
ATOM   4228  H HG2  . GLN A 1 29 ? -2.608  -5.238  3.967   1.00 15.00 ?  307 GLN A HG2  6  
ATOM   4229  H HG3  . GLN A 1 29 ? -4.325  -4.860  4.076   1.00 15.00 ?  307 GLN A HG3  6  
ATOM   4230  H HE21 . GLN A 1 29 ? -5.123  -6.819  2.103   1.00 15.00 ?  307 GLN A HE21 6  
ATOM   4231  H HE22 . GLN A 1 29 ? -4.967  -8.374  2.859   1.00 15.00 ?  307 GLN A HE22 6  
ATOM   4232  N N    . PHE A 1 30 ? -2.841  -5.729  -1.116  1.00 15.00 ?  308 PHE A N    6  
ATOM   4233  C CA   . PHE A 1 30 ? -3.202  -5.271  -2.465  1.00 15.00 ?  308 PHE A CA   6  
ATOM   4234  C C    . PHE A 1 30 ? -4.591  -4.630  -2.466  1.00 15.00 ?  308 PHE A C    6  
ATOM   4235  O O    . PHE A 1 30 ? -4.986  -3.972  -3.426  1.00 15.00 ?  308 PHE A O    6  
ATOM   4236  C CB   . PHE A 1 30 ? -3.169  -6.417  -3.488  1.00 15.00 ?  308 PHE A CB   6  
ATOM   4237  C CG   . PHE A 1 30 ? -1.842  -6.611  -4.174  1.00 15.00 ?  308 PHE A CG   6  
ATOM   4238  C CD1  . PHE A 1 30 ? -1.148  -5.521  -4.680  1.00 15.00 ?  308 PHE A CD1  6  
ATOM   4239  C CD2  . PHE A 1 30 ? -1.303  -7.879  -4.343  1.00 15.00 ?  308 PHE A CD2  6  
ATOM   4240  C CE1  . PHE A 1 30 ? 0.056   -5.691  -5.336  1.00 15.00 ?  308 PHE A CE1  6  
ATOM   4241  C CE2  . PHE A 1 30 ? -0.100  -8.049  -4.993  1.00 15.00 ?  308 PHE A CE2  6  
ATOM   4242  C CZ   . PHE A 1 30 ? 0.581   -6.957  -5.490  1.00 15.00 ?  308 PHE A CZ   6  
ATOM   4243  H H    . PHE A 1 30 ? -2.851  -6.686  -0.915  1.00 15.00 ?  308 PHE A H    6  
ATOM   4244  H HA   . PHE A 1 30 ? -2.481  -4.521  -2.756  1.00 15.00 ?  308 PHE A HA   6  
ATOM   4245  H HB2  . PHE A 1 30 ? -3.415  -7.340  -2.987  1.00 15.00 ?  308 PHE A HB2  6  
ATOM   4246  H HB3  . PHE A 1 30 ? -3.911  -6.223  -4.250  1.00 15.00 ?  308 PHE A HB3  6  
ATOM   4247  H HD1  . PHE A 1 30 ? -1.557  -4.530  -4.555  1.00 15.00 ?  308 PHE A HD1  6  
ATOM   4248  H HD2  . PHE A 1 30 ? -1.828  -8.741  -3.961  1.00 15.00 ?  308 PHE A HD2  6  
ATOM   4249  H HE1  . PHE A 1 30 ? 0.588   -4.836  -5.729  1.00 15.00 ?  308 PHE A HE1  6  
ATOM   4250  H HE2  . PHE A 1 30 ? 0.311   -9.041  -5.113  1.00 15.00 ?  308 PHE A HE2  6  
ATOM   4251  H HZ   . PHE A 1 30 ? 1.523   -7.094  -6.001  1.00 15.00 ?  308 PHE A HZ   6  
ATOM   4252  N N    . THR A 1 31 ? -5.334  -4.861  -1.394  1.00 15.00 ?  309 THR A N    6  
ATOM   4253  C CA   . THR A 1 31 ? -6.699  -4.375  -1.272  1.00 15.00 ?  309 THR A CA   6  
ATOM   4254  C C    . THR A 1 31 ? -6.743  -2.895  -0.876  1.00 15.00 ?  309 THR A C    6  
ATOM   4255  O O    . THR A 1 31 ? -6.406  -2.537  0.256   1.00 15.00 ?  309 THR A O    6  
ATOM   4256  C CB   . THR A 1 31 ? -7.459  -5.212  -0.231  1.00 15.00 ?  309 THR A CB   6  
ATOM   4257  O OG1  . THR A 1 31 ? -6.666  -5.329  0.960   1.00 15.00 ?  309 THR A OG1  6  
ATOM   4258  C CG2  . THR A 1 31 ? -7.773  -6.599  -0.775  1.00 15.00 ?  309 THR A CG2  6  
ATOM   4259  H H    . THR A 1 31 ? -4.952  -5.374  -0.656  1.00 15.00 ?  309 THR A H    6  
ATOM   4260  H HA   . THR A 1 31 ? -7.185  -4.498  -2.228  1.00 15.00 ?  309 THR A HA   6  
ATOM   4261  H HB   . THR A 1 31 ? -8.386  -4.713  0.008   1.00 15.00 ?  309 THR A HB   6  
ATOM   4262  H HG1  . THR A 1 31 ? -6.535  -4.449  1.337   1.00 15.00 ?  309 THR A HG1  6  
ATOM   4263  H HG21 . THR A 1 31 ? -8.316  -7.163  -0.031  1.00 15.00 ?  309 THR A HG21 6  
ATOM   4264  H HG22 . THR A 1 31 ? -6.851  -7.109  -1.010  1.00 15.00 ?  309 THR A HG22 6  
ATOM   4265  H HG23 . THR A 1 31 ? -8.374  -6.508  -1.668  1.00 15.00 ?  309 THR A HG23 6  
ATOM   4266  N N    . ASP A 1 32 ? -7.145  -2.048  -1.819  1.00 15.00 ?  310 ASP A N    6  
ATOM   4267  C CA   . ASP A 1 32 ? -7.271  -0.613  -1.566  1.00 15.00 ?  310 ASP A CA   6  
ATOM   4268  C C    . ASP A 1 32 ? -8.723  -0.268  -1.229  1.00 15.00 ?  310 ASP A C    6  
ATOM   4269  O O    . ASP A 1 32 ? -9.641  -0.626  -1.969  1.00 15.00 ?  310 ASP A O    6  
ATOM   4270  C CB   . ASP A 1 32 ? -6.806  0.186   -2.789  1.00 15.00 ?  310 ASP A CB   6  
ATOM   4271  C CG   . ASP A 1 32 ? -6.612  1.666   -2.496  1.00 15.00 ?  310 ASP A CG   6  
ATOM   4272  O OD1  . ASP A 1 32 ? -7.575  2.335   -2.066  1.00 15.00 -1 310 ASP A OD1  6  
ATOM   4273  O OD2  . ASP A 1 32 ? -5.486  2.166   -2.692  1.00 15.00 ?  310 ASP A OD2  6  
ATOM   4274  H H    . ASP A 1 32 ? -7.360  -2.395  -2.711  1.00 15.00 ?  310 ASP A H    6  
ATOM   4275  H HA   . ASP A 1 32 ? -6.649  -0.368  -0.720  1.00 15.00 ?  310 ASP A HA   6  
ATOM   4276  H HB2  . ASP A 1 32 ? -5.866  -0.215  -3.133  1.00 15.00 ?  310 ASP A HB2  6  
ATOM   4277  H HB3  . ASP A 1 32 ? -7.541  0.089   -3.574  1.00 15.00 ?  310 ASP A HB3  6  
ATOM   4278  N N    . PRO A 1 33 ? -8.948  0.424   -0.103  1.00 15.00 ?  311 PRO A N    6  
ATOM   4279  C CA   . PRO A 1 33 ? -10.287 0.769   0.374   1.00 15.00 ?  311 PRO A CA   6  
ATOM   4280  C C    . PRO A 1 33 ? -10.851 2.067   -0.216  1.00 15.00 ?  311 PRO A C    6  
ATOM   4281  O O    . PRO A 1 33 ? -12.048 2.347   -0.079  1.00 15.00 ?  311 PRO A O    6  
ATOM   4282  C CB   . PRO A 1 33 ? -10.074 0.918   1.877   1.00 15.00 ?  311 PRO A CB   6  
ATOM   4283  C CG   . PRO A 1 33 ? -8.684  1.445   2.004   1.00 15.00 ?  311 PRO A CG   6  
ATOM   4284  C CD   . PRO A 1 33 ? -7.904  0.901   0.828   1.00 15.00 ?  311 PRO A CD   6  
ATOM   4285  H HA   . PRO A 1 33 ? -10.984 -0.034  0.191   1.00 15.00 ?  311 PRO A HA   6  
ATOM   4286  H HB2  . PRO A 1 33 ? -10.801 1.611   2.281   1.00 15.00 ?  311 PRO A HB2  6  
ATOM   4287  H HB3  . PRO A 1 33 ? -10.175 -0.044  2.356   1.00 15.00 ?  311 PRO A HB3  6  
ATOM   4288  H HG2  . PRO A 1 33 ? -8.700  2.525   1.974   1.00 15.00 ?  311 PRO A HG2  6  
ATOM   4289  H HG3  . PRO A 1 33 ? -8.247  1.104   2.931   1.00 15.00 ?  311 PRO A HG3  6  
ATOM   4290  H HD2  . PRO A 1 33 ? -7.313  1.683   0.373   1.00 15.00 ?  311 PRO A HD2  6  
ATOM   4291  H HD3  . PRO A 1 33 ? -7.271  0.085   1.143   1.00 15.00 ?  311 PRO A HD3  6  
ATOM   4292  N N    . ARG A 1 34 ? -9.992  2.875   -0.830  1.00 15.00 ?  312 ARG A N    6  
ATOM   4293  C CA   . ARG A 1 34 ? -10.368 4.229   -1.238  1.00 15.00 ?  312 ARG A CA   6  
ATOM   4294  C C    . ARG A 1 34 ? -11.387 4.246   -2.373  1.00 15.00 ?  312 ARG A C    6  
ATOM   4295  O O    . ARG A 1 34 ? -12.254 5.121   -2.414  1.00 15.00 ?  312 ARG A O    6  
ATOM   4296  C CB   . ARG A 1 34 ? -9.133  5.033   -1.638  1.00 15.00 ?  312 ARG A CB   6  
ATOM   4297  C CG   . ARG A 1 34 ? -8.204  5.332   -0.476  1.00 15.00 ?  312 ARG A CG   6  
ATOM   4298  C CD   . ARG A 1 34 ? -6.903  5.957   -0.949  1.00 15.00 ?  312 ARG A CD   6  
ATOM   4299  N NE   . ARG A 1 34 ? -6.118  5.035   -1.770  1.00 15.00 ?  312 ARG A NE   6  
ATOM   4300  C CZ   . ARG A 1 34 ? -5.019  5.381   -2.438  1.00 15.00 ?  312 ARG A CZ   6  
ATOM   4301  N NH1  . ARG A 1 34 ? -4.587  6.638   -2.416  1.00 15.00 1  312 ARG A NH1  6  
ATOM   4302  N NH2  . ARG A 1 34 ? -4.356  4.465   -3.130  1.00 15.00 ?  312 ARG A NH2  6  
ATOM   4303  H H    . ARG A 1 34 ? -9.083  2.546   -1.037  1.00 15.00 ?  312 ARG A H    6  
ATOM   4304  H HA   . ARG A 1 34 ? -10.816 4.705   -0.378  1.00 15.00 ?  312 ARG A HA   6  
ATOM   4305  H HB2  . ARG A 1 34 ? -8.580  4.476   -2.379  1.00 15.00 ?  312 ARG A HB2  6  
ATOM   4306  H HB3  . ARG A 1 34 ? -9.452  5.971   -2.068  1.00 15.00 ?  312 ARG A HB3  6  
ATOM   4307  H HG2  . ARG A 1 34 ? -8.696  6.019   0.197   1.00 15.00 ?  312 ARG A HG2  6  
ATOM   4308  H HG3  . ARG A 1 34 ? -7.984  4.411   0.042   1.00 15.00 ?  312 ARG A HG3  6  
ATOM   4309  H HD2  . ARG A 1 34 ? -7.133  6.837   -1.533  1.00 15.00 ?  312 ARG A HD2  6  
ATOM   4310  H HD3  . ARG A 1 34 ? -6.319  6.243   -0.086  1.00 15.00 ?  312 ARG A HD3  6  
ATOM   4311  H HE   . ARG A 1 34 ? -6.429  4.094   -1.820  1.00 15.00 ?  312 ARG A HE   6  
ATOM   4312  H HH11 . ARG A 1 34 ? -5.091  7.337   -1.896  1.00 15.00 ?  312 ARG A HH11 6  
ATOM   4313  H HH12 . ARG A 1 34 ? -3.755  6.897   -2.911  1.00 15.00 ?  312 ARG A HH12 6  
ATOM   4314  H HH21 . ARG A 1 34 ? -4.689  3.503   -3.142  1.00 15.00 ?  312 ARG A HH21 6  
ATOM   4315  H HH22 . ARG A 1 34 ? -3.533  4.710   -3.642  1.00 15.00 ?  312 ARG A HH22 6  
ATOM   4316  N N    . LEU A 1 35 ? -11.279 3.306   -3.298  1.00 15.00 ?  313 LEU A N    6  
ATOM   4317  C CA   . LEU A 1 35 ? -12.197 3.259   -4.429  1.00 15.00 ?  313 LEU A CA   6  
ATOM   4318  C C    . LEU A 1 35 ? -13.421 2.414   -4.091  1.00 15.00 ?  313 LEU A C    6  
ATOM   4319  O O    . LEU A 1 35 ? -14.430 2.989   -3.631  1.00 15.00 ?  313 LEU A O    6  
ATOM   4320  C CB   . LEU A 1 35 ? -11.528 2.763   -5.740  1.00 15.00 ?  313 LEU A CB   6  
ATOM   4321  C CG   . LEU A 1 35 ? -10.224 1.936   -5.643  1.00 15.00 ?  313 LEU A CG   6  
ATOM   4322  C CD1  . LEU A 1 35 ? -9.057  2.793   -5.169  1.00 15.00 ?  313 LEU A CD1  6  
ATOM   4323  C CD2  . LEU A 1 35 ? -10.393 0.718   -4.747  1.00 15.00 ?  313 LEU A CD2  6  
ATOM   4324  H H    . LEU A 1 35 ? -10.577 2.628   -3.217  1.00 15.00 ?  313 LEU A H    6  
ATOM   4325  H HA   . LEU A 1 35 ? -12.537 4.274   -4.591  1.00 15.00 ?  313 LEU A HA   6  
ATOM   4326  H HB2  . LEU A 1 35 ? -12.253 2.159   -6.264  1.00 15.00 ?  313 LEU A HB2  6  
ATOM   4327  H HB3  . LEU A 1 35 ? -11.322 3.632   -6.348  1.00 15.00 ?  313 LEU A HB3  6  
ATOM   4328  H HG   . LEU A 1 35 ? -9.976  1.579   -6.634  1.00 15.00 ?  313 LEU A HG   6  
ATOM   4329  H HD11 . LEU A 1 35 ? -8.166  2.187   -5.105  1.00 15.00 ?  313 LEU A HD11 6  
ATOM   4330  H HD12 . LEU A 1 35 ? -9.285  3.202   -4.196  1.00 15.00 ?  313 LEU A HD12 6  
ATOM   4331  H HD13 . LEU A 1 35 ? -8.894  3.599   -5.870  1.00 15.00 ?  313 LEU A HD13 6  
ATOM   4332  H HD21 . LEU A 1 35 ? -11.171 0.082   -5.145  1.00 15.00 ?  313 LEU A HD21 6  
ATOM   4333  H HD22 . LEU A 1 35 ? -10.664 1.038   -3.753  1.00 15.00 ?  313 LEU A HD22 6  
ATOM   4334  H HD23 . LEU A 1 35 ? -9.464  0.168   -4.707  1.00 15.00 ?  313 LEU A HD23 6  
ATOM   4335  N N    . ASP B 2 2  ? 0.831   -9.609  -10.713 1.00 15.00 ?  221 ASP B N    6  
ATOM   4336  C CA   . ASP B 2 2  ? 1.774   -9.121  -9.687  1.00 15.00 ?  221 ASP B CA   6  
ATOM   4337  C C    . ASP B 2 2  ? 1.668   -9.967  -8.426  1.00 15.00 ?  221 ASP B C    6  
ATOM   4338  O O    . ASP B 2 2  ? 0.571   -10.253 -7.944  1.00 15.00 ?  221 ASP B O    6  
ATOM   4339  C CB   . ASP B 2 2  ? 1.516   -7.642  -9.385  1.00 15.00 ?  221 ASP B CB   6  
ATOM   4340  C CG   . ASP B 2 2  ? 2.001   -6.751  -10.513 1.00 15.00 ?  221 ASP B CG   6  
ATOM   4341  O OD1  . ASP B 2 2  ? 1.295   -6.640  -11.539 1.00 15.00 -1 221 ASP B OD1  6  
ATOM   4342  O OD2  . ASP B 2 2  ? 3.102   -6.175  -10.387 1.00 15.00 ?  221 ASP B OD2  6  
ATOM   4343  H H    . ASP B 2 2  ? -0.144  -9.532  -10.366 1.00 15.00 ?  221 ASP B H    6  
ATOM   4344  H HA   . ASP B 2 2  ? 2.775   -9.226  -10.082 1.00 15.00 ?  221 ASP B HA   6  
ATOM   4345  H HB2  . ASP B 2 2  ? 0.455   -7.479  -9.253  1.00 15.00 ?  221 ASP B HB2  6  
ATOM   4346  H HB3  . ASP B 2 2  ? 2.034   -7.363  -8.479  1.00 15.00 ?  221 ASP B HB3  6  
ATOM   4347  N N    . THR B 2 3  ? 2.824   -10.361 -7.910  1.00 15.00 ?  222 THR B N    6  
ATOM   4348  C CA   . THR B 2 3  ? 2.916   -11.260 -6.767  1.00 15.00 ?  222 THR B CA   6  
ATOM   4349  C C    . THR B 2 3  ? 2.406   -10.585 -5.491  1.00 15.00 ?  222 THR B C    6  
ATOM   4350  O O    . THR B 2 3  ? 2.476   -9.362  -5.370  1.00 15.00 ?  222 THR B O    6  
ATOM   4351  C CB   . THR B 2 3  ? 4.385   -11.734 -6.592  1.00 15.00 ?  222 THR B CB   6  
ATOM   4352  O OG1  . THR B 2 3  ? 4.494   -12.736 -5.576  1.00 15.00 ?  222 THR B OG1  6  
ATOM   4353  C CG2  . THR B 2 3  ? 5.302   -10.569 -6.245  1.00 15.00 ?  222 THR B CG2  6  
ATOM   4354  H H    . THR B 2 3  ? 3.658   -10.025 -8.312  1.00 15.00 ?  222 THR B H    6  
ATOM   4355  H HA   . THR B 2 3  ? 2.296   -12.119 -6.969  1.00 15.00 ?  222 THR B HA   6  
ATOM   4356  H HB   . THR B 2 3  ? 4.718   -12.155 -7.531  1.00 15.00 ?  222 THR B HB   6  
ATOM   4357  H HG1  . THR B 2 3  ? 4.647   -12.307 -4.727  1.00 15.00 ?  222 THR B HG1  6  
ATOM   4358  H HG21 . THR B 2 3  ? 4.967   -10.110 -5.327  1.00 15.00 ?  222 THR B HG21 6  
ATOM   4359  H HG22 . THR B 2 3  ? 5.278   -9.842  -7.041  1.00 15.00 ?  222 THR B HG22 6  
ATOM   4360  H HG23 . THR B 2 3  ? 6.311   -10.931 -6.119  1.00 15.00 ?  222 THR B HG23 6  
ATOM   4361  N N    . PRO B 2 4  ? 1.884   -11.386 -4.527  1.00 15.00 ?  223 PRO B N    6  
ATOM   4362  C CA   . PRO B 2 4  ? 1.302   -10.873 -3.275  1.00 15.00 ?  223 PRO B CA   6  
ATOM   4363  C C    . PRO B 2 4  ? 2.192   -9.850  -2.569  1.00 15.00 ?  223 PRO B C    6  
ATOM   4364  O O    . PRO B 2 4  ? 3.420   -9.886  -2.688  1.00 15.00 ?  223 PRO B O    6  
ATOM   4365  C CB   . PRO B 2 4  ? 1.175   -12.137 -2.421  1.00 15.00 ?  223 PRO B CB   6  
ATOM   4366  C CG   . PRO B 2 4  ? 0.952   -13.225 -3.406  1.00 15.00 ?  223 PRO B CG   6  
ATOM   4367  C CD   . PRO B 2 4  ? 1.768   -12.857 -4.613  1.00 15.00 ?  223 PRO B CD   6  
ATOM   4368  H HA   . PRO B 2 4  ? 0.322   -10.449 -3.437  1.00 15.00 ?  223 PRO B HA   6  
ATOM   4369  H HB2  . PRO B 2 4  ? 2.085   -12.288 -1.859  1.00 15.00 ?  223 PRO B HB2  6  
ATOM   4370  H HB3  . PRO B 2 4  ? 0.338   -12.038 -1.746  1.00 15.00 ?  223 PRO B HB3  6  
ATOM   4371  H HG2  . PRO B 2 4  ? 1.291   -14.166 -2.997  1.00 15.00 ?  223 PRO B HG2  6  
ATOM   4372  H HG3  . PRO B 2 4  ? -0.094  -13.279 -3.663  1.00 15.00 ?  223 PRO B HG3  6  
ATOM   4373  H HD2  . PRO B 2 4  ? 2.741   -13.322 -4.565  1.00 15.00 ?  223 PRO B HD2  6  
ATOM   4374  H HD3  . PRO B 2 4  ? 1.254   -13.149 -5.517  1.00 15.00 ?  223 PRO B HD3  6  
ATOM   4375  N N    . PRO B 2 5  ? 1.559   -8.957  -1.782  1.00 15.00 ?  224 PRO B N    6  
ATOM   4376  C CA   . PRO B 2 5  ? 2.191   -7.751  -1.239  1.00 15.00 ?  224 PRO B CA   6  
ATOM   4377  C C    . PRO B 2 5  ? 3.540   -7.992  -0.568  1.00 15.00 ?  224 PRO B C    6  
ATOM   4378  O O    . PRO B 2 5  ? 3.656   -8.764  0.386   1.00 15.00 ?  224 PRO B O    6  
ATOM   4379  C CB   . PRO B 2 5  ? 1.173   -7.229  -0.212  1.00 15.00 ?  224 PRO B CB   6  
ATOM   4380  C CG   . PRO B 2 5  ? 0.161   -8.313  -0.056  1.00 15.00 ?  224 PRO B CG   6  
ATOM   4381  C CD   . PRO B 2 5  ? 0.163   -9.066  -1.349  1.00 15.00 ?  224 PRO B CD   6  
ATOM   4382  H HA   . PRO B 2 5  ? 2.318   -7.008  -2.010  1.00 15.00 ?  224 PRO B HA   6  
ATOM   4383  H HB2  . PRO B 2 5  ? 1.676   -7.025  0.721   1.00 15.00 ?  224 PRO B HB2  6  
ATOM   4384  H HB3  . PRO B 2 5  ? 0.721   -6.321  -0.585  1.00 15.00 ?  224 PRO B HB3  6  
ATOM   4385  H HG2  . PRO B 2 5  ? 0.441   -8.964  0.759   1.00 15.00 ?  224 PRO B HG2  6  
ATOM   4386  H HG3  . PRO B 2 5  ? -0.813  -7.882  0.125   1.00 15.00 ?  224 PRO B HG3  6  
ATOM   4387  H HD2  . PRO B 2 5  ? -0.116  -10.099 -1.190  1.00 15.00 ?  224 PRO B HD2  6  
ATOM   4388  H HD3  . PRO B 2 5  ? -0.500  -8.600  -2.061  1.00 15.00 ?  224 PRO B HD3  6  
ATOM   4389  N N    . PRO B 2 6  ? 4.574   -7.331  -1.105  1.00 15.00 ?  225 PRO B N    6  
ATOM   4390  C CA   . PRO B 2 6  ? 5.923   -7.295  -0.522  1.00 15.00 ?  225 PRO B CA   6  
ATOM   4391  C C    . PRO B 2 6  ? 5.941   -6.775  0.917   1.00 15.00 ?  225 PRO B C    6  
ATOM   4392  O O    . PRO B 2 6  ? 4.913   -6.363  1.451   1.00 15.00 ?  225 PRO B O    6  
ATOM   4393  C CB   . PRO B 2 6  ? 6.655   -6.294  -1.421  1.00 15.00 ?  225 PRO B CB   6  
ATOM   4394  C CG   . PRO B 2 6  ? 5.942   -6.354  -2.719  1.00 15.00 ?  225 PRO B CG   6  
ATOM   4395  C CD   . PRO B 2 6  ? 4.504   -6.585  -2.375  1.00 15.00 ?  225 PRO B CD   6  
ATOM   4396  H HA   . PRO B 2 6  ? 6.410   -8.256  -0.573  1.00 15.00 ?  225 PRO B HA   6  
ATOM   4397  H HB2  . PRO B 2 6  ? 6.596   -5.308  -0.985  1.00 15.00 ?  225 PRO B HB2  6  
ATOM   4398  H HB3  . PRO B 2 6  ? 7.680   -6.582  -1.524  1.00 15.00 ?  225 PRO B HB3  6  
ATOM   4399  H HG2  . PRO B 2 6  ? 6.059   -5.420  -3.246  1.00 15.00 ?  225 PRO B HG2  6  
ATOM   4400  H HG3  . PRO B 2 6  ? 6.322   -7.172  -3.310  1.00 15.00 ?  225 PRO B HG3  6  
ATOM   4401  H HD2  . PRO B 2 6  ? 3.992   -5.644  -2.242  1.00 15.00 ?  225 PRO B HD2  6  
ATOM   4402  H HD3  . PRO B 2 6  ? 4.023   -7.174  -3.141  1.00 15.00 ?  225 PRO B HD3  6  
ATOM   4403  N N    . ALA B 2 7  ? 7.123   -6.784  1.531   1.00 15.00 ?  226 ALA B N    6  
ATOM   4404  C CA   . ALA B 2 7  ? 7.308   -6.158  2.835   1.00 15.00 ?  226 ALA B CA   6  
ATOM   4405  C C    . ALA B 2 7  ? 7.059   -4.660  2.717   1.00 15.00 ?  226 ALA B C    6  
ATOM   4406  O O    . ALA B 2 7  ? 7.131   -4.104  1.616   1.00 15.00 ?  226 ALA B O    6  
ATOM   4407  C CB   . ALA B 2 7  ? 8.705   -6.428  3.368   1.00 15.00 ?  226 ALA B CB   6  
ATOM   4408  H H    . ALA B 2 7  ? 7.883   -7.216  1.096   1.00 15.00 ?  226 ALA B H    6  
ATOM   4409  H HA   . ALA B 2 7  ? 6.589   -6.585  3.521   1.00 15.00 ?  226 ALA B HA   6  
ATOM   4410  H HB1  . ALA B 2 7  ? 9.436   -6.001  2.697   1.00 15.00 ?  226 ALA B HB1  6  
ATOM   4411  H HB2  . ALA B 2 7  ? 8.863   -7.494  3.441   1.00 15.00 ?  226 ALA B HB2  6  
ATOM   4412  H HB3  . ALA B 2 7  ? 8.810   -5.981  4.346   1.00 15.00 ?  226 ALA B HB3  6  
ATOM   4413  N N    . TYR B 2 8  ? 6.785   -3.990  3.827   1.00 15.00 ?  227 TYR B N    6  
ATOM   4414  C CA   . TYR B 2 8  ? 6.351   -2.611  3.736   1.00 15.00 ?  227 TYR B CA   6  
ATOM   4415  C C    . TYR B 2 8  ? 7.520   -1.631  3.768   1.00 15.00 ?  227 TYR B C    6  
ATOM   4416  O O    . TYR B 2 8  ? 8.440   -1.722  4.587   1.00 15.00 ?  227 TYR B O    6  
ATOM   4417  C CB   . TYR B 2 8  ? 5.312   -2.265  4.811   1.00 15.00 ?  227 TYR B CB   6  
ATOM   4418  C CG   . TYR B 2 8  ? 5.884   -1.799  6.136   1.00 15.00 ?  227 TYR B CG   6  
ATOM   4419  C CD1  . TYR B 2 8  ? 6.141   -0.455  6.352   1.00 15.00 ?  227 TYR B CD1  6  
ATOM   4420  C CD2  . TYR B 2 8  ? 6.161   -2.691  7.165   1.00 15.00 ?  227 TYR B CD2  6  
ATOM   4421  C CE1  . TYR B 2 8  ? 6.658   -0.003  7.543   1.00 15.00 ?  227 TYR B CE1  6  
ATOM   4422  C CE2  . TYR B 2 8  ? 6.678   -2.248  8.371   1.00 15.00 ?  227 TYR B CE2  6  
ATOM   4423  C CZ   . TYR B 2 8  ? 6.927   -0.900  8.554   1.00 15.00 ?  227 TYR B CZ   6  
ATOM   4424  O OH   . TYR B 2 8  ? 7.439   -0.450  9.749   1.00 15.00 ?  227 TYR B OH   6  
ATOM   4425  H H    . TYR B 2 8  ? 6.862   -4.428  4.702   1.00 15.00 ?  227 TYR B H    6  
ATOM   4426  H HA   . TYR B 2 8  ? 5.873   -2.509  2.771   1.00 15.00 ?  227 TYR B HA   6  
ATOM   4427  H HB2  . TYR B 2 8  ? 4.678   -1.470  4.421   1.00 15.00 ?  227 TYR B HB2  6  
ATOM   4428  H HB3  . TYR B 2 8  ? 4.702   -3.139  5.000   1.00 15.00 ?  227 TYR B HB3  6  
ATOM   4429  H HD1  . TYR B 2 8  ? 5.928   0.253   5.566   1.00 15.00 ?  227 TYR B HD1  6  
ATOM   4430  H HD2  . TYR B 2 8  ? 5.967   -3.742  7.018   1.00 15.00 ?  227 TYR B HD2  6  
ATOM   4431  H HE1  . TYR B 2 8  ? 6.848   1.062   7.672   1.00 15.00 ?  227 TYR B HE1  6  
ATOM   4432  H HE2  . TYR B 2 8  ? 6.884   -2.956  9.164   1.00 15.00 ?  227 TYR B HE2  6  
ATOM   4433  H HH   . TYR B 2 8  ? 6.961   0.339   10.025  1.00 15.00 ?  227 TYR B HH   6  
ATOM   4434  N N    . LEU B 2 9  ? 7.438   -0.690  2.851   1.00 15.00 ?  228 LEU B N    6  
ATOM   4435  C CA   . LEU B 2 9  ? 8.422   0.361   2.662   1.00 15.00 ?  228 LEU B CA   6  
ATOM   4436  C C    . LEU B 2 9  ? 7.693   1.693   2.603   1.00 15.00 ?  228 LEU B C    6  
ATOM   4437  O O    . LEU B 2 9  ? 6.498   1.717   2.363   1.00 15.00 ?  228 LEU B O    6  
ATOM   4438  C CB   . LEU B 2 9  ? 9.206   0.133   1.364   1.00 15.00 ?  228 LEU B CB   6  
ATOM   4439  C CG   . LEU B 2 9  ? 9.983   -1.183  1.281   1.00 15.00 ?  228 LEU B CG   6  
ATOM   4440  C CD1  . LEU B 2 9  ? 10.640  -1.323  -0.082  1.00 15.00 ?  228 LEU B CD1  6  
ATOM   4441  C CD2  . LEU B 2 9  ? 11.028  -1.261  2.380   1.00 15.00 ?  228 LEU B CD2  6  
ATOM   4442  H H    . LEU B 2 9  ? 6.659   -0.698  2.255   1.00 15.00 ?  228 LEU B H    6  
ATOM   4443  H HA   . LEU B 2 9  ? 9.089   0.357   3.510   1.00 15.00 ?  228 LEU B HA   6  
ATOM   4444  H HB2  . LEU B 2 9  ? 8.507   0.165   0.539   1.00 15.00 ?  228 LEU B HB2  6  
ATOM   4445  H HB3  . LEU B 2 9  ? 9.908   0.946   1.247   1.00 15.00 ?  228 LEU B HB3  6  
ATOM   4446  H HG   . LEU B 2 9  ? 9.297   -2.009  1.410   1.00 15.00 ?  228 LEU B HG   6  
ATOM   4447  H HD11 . LEU B 2 9  ? 11.330  -0.507  -0.236  1.00 15.00 ?  228 LEU B HD11 6  
ATOM   4448  H HD12 . LEU B 2 9  ? 9.882   -1.304  -0.850  1.00 15.00 ?  228 LEU B HD12 6  
ATOM   4449  H HD13 . LEU B 2 9  ? 11.175  -2.260  -0.128  1.00 15.00 ?  228 LEU B HD13 6  
ATOM   4450  H HD21 . LEU B 2 9  ? 10.542  -1.201  3.342   1.00 15.00 ?  228 LEU B HD21 6  
ATOM   4451  H HD22 . LEU B 2 9  ? 11.724  -0.442  2.277   1.00 15.00 ?  228 LEU B HD22 6  
ATOM   4452  H HD23 . LEU B 2 9  ? 11.561  -2.197  2.303   1.00 15.00 ?  228 LEU B HD23 6  
ATOM   4453  N N    . PRO B 2 10 ? 8.363   2.824   2.816   1.00 15.00 ?  229 PRO B N    6  
ATOM   4454  C CA   . PRO B 2 10 ? 7.696   4.116   2.713   1.00 15.00 ?  229 PRO B CA   6  
ATOM   4455  C C    . PRO B 2 10 ? 7.736   4.636   1.274   1.00 15.00 ?  229 PRO B C    6  
ATOM   4456  O O    . PRO B 2 10 ? 8.698   4.397   0.542   1.00 15.00 ?  229 PRO B O    6  
ATOM   4457  C CB   . PRO B 2 10 ? 8.537   5.023   3.628   1.00 15.00 ?  229 PRO B CB   6  
ATOM   4458  C CG   . PRO B 2 10 ? 9.540   4.124   4.279   1.00 15.00 ?  229 PRO B CG   6  
ATOM   4459  C CD   . PRO B 2 10 ? 9.708   2.950   3.361   1.00 15.00 ?  229 PRO B CD   6  
ATOM   4460  H HA   . PRO B 2 10 ? 6.681   4.058   3.069   1.00 15.00 ?  229 PRO B HA   6  
ATOM   4461  H HB2  . PRO B 2 10 ? 9.019   5.785   3.034   1.00 15.00 ?  229 PRO B HB2  6  
ATOM   4462  H HB3  . PRO B 2 10 ? 7.894   5.488   4.360   1.00 15.00 ?  229 PRO B HB3  6  
ATOM   4463  H HG2  . PRO B 2 10 ? 10.471  4.644   4.397   1.00 15.00 ?  229 PRO B HG2  6  
ATOM   4464  H HG3  . PRO B 2 10 ? 9.170   3.798   5.239   1.00 15.00 ?  229 PRO B HG3  6  
ATOM   4465  H HD2  . PRO B 2 10 ? 10.427  3.161   2.597   1.00 15.00 ?  229 PRO B HD2  6  
ATOM   4466  H HD3  . PRO B 2 10 ? 9.982   2.069   3.918   1.00 15.00 ?  229 PRO B HD3  6  
ATOM   4467  N N    . PRO B 2 11 ? 6.694   5.391   0.870   1.00 15.00 ?  230 PRO B N    6  
ATOM   4468  C CA   . PRO B 2 11 ? 6.186   5.358   -0.500  1.00 15.00 ?  230 PRO B CA   6  
ATOM   4469  C C    . PRO B 2 11 ? 6.810   6.342   -1.482  1.00 15.00 ?  230 PRO B C    6  
ATOM   4470  O O    . PRO B 2 11 ? 7.270   7.426   -1.122  1.00 15.00 ?  230 PRO B O    6  
ATOM   4471  C CB   . PRO B 2 11 ? 4.728   5.724   -0.269  1.00 15.00 ?  230 PRO B CB   6  
ATOM   4472  C CG   . PRO B 2 11 ? 4.774   6.749   0.811   1.00 15.00 ?  230 PRO B CG   6  
ATOM   4473  C CD   . PRO B 2 11 ? 5.956   6.394   1.681   1.00 15.00 ?  230 PRO B CD   6  
ATOM   4474  H HA   . PRO B 2 11 ? 6.232   4.364   -0.914  1.00 15.00 ?  230 PRO B HA   6  
ATOM   4475  H HB2  . PRO B 2 11 ? 4.304   6.123   -1.179  1.00 15.00 ?  230 PRO B HB2  6  
ATOM   4476  H HB3  . PRO B 2 11 ? 4.176   4.850   0.041   1.00 15.00 ?  230 PRO B HB3  6  
ATOM   4477  H HG2  . PRO B 2 11 ? 4.907   7.730   0.379   1.00 15.00 ?  230 PRO B HG2  6  
ATOM   4478  H HG3  . PRO B 2 11 ? 3.861   6.714   1.388   1.00 15.00 ?  230 PRO B HG3  6  
ATOM   4479  H HD2  . PRO B 2 11 ? 6.562   7.268   1.863   1.00 15.00 ?  230 PRO B HD2  6  
ATOM   4480  H HD3  . PRO B 2 11 ? 5.611   5.977   2.610   1.00 15.00 ?  230 PRO B HD3  6  
ATOM   4481  N N    . GLU B 2 12 ? 6.776   5.933   -2.741  1.00 15.00 ?  231 GLU B N    6  
ATOM   4482  C CA   . GLU B 2 12 ? 7.094   6.794   -3.862  1.00 15.00 ?  231 GLU B CA   6  
ATOM   4483  C C    . GLU B 2 12 ? 5.838   6.912   -4.737  1.00 15.00 ?  231 GLU B C    6  
ATOM   4484  O O    . GLU B 2 12 ? 5.225   5.894   -5.060  1.00 15.00 ?  231 GLU B O    6  
ATOM   4485  C CB   . GLU B 2 12 ? 8.253   6.199   -4.672  1.00 15.00 ?  231 GLU B CB   6  
ATOM   4486  C CG   . GLU B 2 12 ? 7.962   4.805   -5.209  1.00 15.00 ?  231 GLU B CG   6  
ATOM   4487  C CD   . GLU B 2 12 ? 9.103   4.231   -6.018  1.00 15.00 ?  231 GLU B CD   6  
ATOM   4488  O OE1  . GLU B 2 12 ? 9.190   4.524   -7.226  1.00 15.00 -1 231 GLU B OE1  6  
ATOM   4489  O OE2  . GLU B 2 12 ? 9.904   3.466   -5.449  1.00 15.00 ?  231 GLU B OE2  6  
ATOM   4490  H H    . GLU B 2 12 ? 6.511   5.009   -2.928  1.00 15.00 ?  231 GLU B H    6  
ATOM   4491  H HA   . GLU B 2 12 ? 7.377   7.762   -3.475  1.00 15.00 ?  231 GLU B HA   6  
ATOM   4492  H HB2  . GLU B 2 12 ? 8.465   6.849   -5.508  1.00 15.00 ?  231 GLU B HB2  6  
ATOM   4493  H HB3  . GLU B 2 12 ? 9.127   6.143   -4.040  1.00 15.00 ?  231 GLU B HB3  6  
ATOM   4494  H HG2  . GLU B 2 12 ? 7.769   4.146   -4.376  1.00 15.00 ?  231 GLU B HG2  6  
ATOM   4495  H HG3  . GLU B 2 12 ? 7.084   4.854   -5.837  1.00 15.00 ?  231 GLU B HG3  6  
ATOM   4496  N N    . ASP B 2 13 ? 5.425   8.123   -5.087  1.00 15.00 ?  232 ASP B N    6  
ATOM   4497  C CA   . ASP B 2 13 ? 4.242   8.303   -5.921  1.00 15.00 ?  232 ASP B CA   6  
ATOM   4498  C C    . ASP B 2 13 ? 4.382   9.563   -6.760  1.00 15.00 ?  232 ASP B C    6  
ATOM   4499  O O    . ASP B 2 13 ? 4.456   10.669  -6.222  1.00 15.00 ?  232 ASP B O    6  
ATOM   4500  C CB   . ASP B 2 13 ? 2.976   8.373   -5.059  1.00 15.00 ?  232 ASP B CB   6  
ATOM   4501  C CG   . ASP B 2 13 ? 1.714   8.515   -5.888  1.00 15.00 ?  232 ASP B CG   6  
ATOM   4502  O OD1  . ASP B 2 13 ? 1.427   7.618   -6.711  1.00 15.00 -1 232 ASP B OD1  6  
ATOM   4503  O OD2  . ASP B 2 13 ? 0.998   9.525   -5.719  1.00 15.00 ?  232 ASP B OD2  6  
ATOM   4504  H H    . ASP B 2 13 ? 5.922   8.919   -4.793  1.00 15.00 ?  232 ASP B H    6  
ATOM   4505  H HA   . ASP B 2 13 ? 4.171   7.451   -6.582  1.00 15.00 ?  232 ASP B HA   6  
ATOM   4506  H HB2  . ASP B 2 13 ? 2.897   7.472   -4.470  1.00 15.00 ?  232 ASP B HB2  6  
ATOM   4507  H HB3  . ASP B 2 13 ? 3.047   9.225   -4.398  1.00 15.00 ?  232 ASP B HB3  6  
ATOM   4508  N N    . PRO B 2 14 ? 4.459   9.407   -8.091  1.00 15.00 ?  233 PRO B N    6  
ATOM   4509  C CA   . PRO B 2 14 ? 4.621   10.530  -9.024  1.00 15.00 ?  233 PRO B CA   6  
ATOM   4510  C C    . PRO B 2 14 ? 3.477   11.539  -8.933  1.00 15.00 ?  233 PRO B C    6  
ATOM   4511  O O    . PRO B 2 14 ? 3.648   12.645  -8.418  1.00 15.00 ?  233 PRO B O    6  
ATOM   4512  C CB   . PRO B 2 14 ? 4.640   9.859   -10.404 1.00 15.00 ?  233 PRO B CB   6  
ATOM   4513  C CG   . PRO B 2 14 ? 4.986   8.433   -10.139 1.00 15.00 ?  233 PRO B CG   6  
ATOM   4514  C CD   . PRO B 2 14 ? 4.404   8.112   -8.793  1.00 15.00 ?  233 PRO B CD   6  
ATOM   4515  H HA   . PRO B 2 14 ? 5.559   11.044  -8.860  1.00 15.00 ?  233 PRO B HA   6  
ATOM   4516  H HB2  . PRO B 2 14 ? 3.667   9.950   -10.864 1.00 15.00 ?  233 PRO B HB2  6  
ATOM   4517  H HB3  . PRO B 2 14 ? 5.383   10.334  -11.027 1.00 15.00 ?  233 PRO B HB3  6  
ATOM   4518  H HG2  . PRO B 2 14 ? 4.548   7.800   -10.897 1.00 15.00 ?  233 PRO B HG2  6  
ATOM   4519  H HG3  . PRO B 2 14 ? 6.059   8.312   -10.121 1.00 15.00 ?  233 PRO B HG3  6  
ATOM   4520  H HD2  . PRO B 2 14 ? 3.385   7.767   -8.892  1.00 15.00 ?  233 PRO B HD2  6  
ATOM   4521  H HD3  . PRO B 2 14 ? 5.008   7.372   -8.286  1.00 15.00 ?  233 PRO B HD3  6  
HETATM 4522  N N    . NH2 B 2 15 ? 2.317   11.163  -9.445  1.00 15.00 ?  234 NH2 B N    6  
HETATM 4523  H HN1  . NH2 B 2 15 ? 2.254   10.268  -9.840  1.00 15.00 ?  234 NH2 B HN1  6  
HETATM 4524  H HN2  . NH2 B 2 15 ? 1.568   11.792  -9.407  1.00 15.00 ?  234 NH2 B HN2  6  
ATOM   4525  N N    . LEU A 1 1  ? -15.561 3.783   -3.279  1.00 15.00 ?  279 LEU A N    7  
ATOM   4526  C CA   . LEU A 1 1  ? -15.305 4.637   -2.096  1.00 15.00 ?  279 LEU A CA   7  
ATOM   4527  C C    . LEU A 1 1  ? -14.927 3.784   -0.894  1.00 15.00 ?  279 LEU A C    7  
ATOM   4528  O O    . LEU A 1 1  ? -15.465 2.691   -0.700  1.00 15.00 ?  279 LEU A O    7  
ATOM   4529  C CB   . LEU A 1 1  ? -16.529 5.508   -1.762  1.00 15.00 ?  279 LEU A CB   7  
ATOM   4530  C CG   . LEU A 1 1  ? -17.799 4.767   -1.314  1.00 15.00 ?  279 LEU A CG   7  
ATOM   4531  C CD1  . LEU A 1 1  ? -18.719 5.716   -0.562  1.00 15.00 ?  279 LEU A CD1  7  
ATOM   4532  C CD2  . LEU A 1 1  ? -18.537 4.178   -2.506  1.00 15.00 ?  279 LEU A CD2  7  
ATOM   4533  H H1   . LEU A 1 1  ? -14.689 3.268   -3.547  1.00 15.00 ?  279 LEU A H1   7  
ATOM   4534  H H2   . LEU A 1 1  ? -15.859 4.368   -4.084  1.00 15.00 ?  279 LEU A H2   7  
ATOM   4535  H H3   . LEU A 1 1  ? -16.307 3.086   -3.071  1.00 15.00 ?  279 LEU A H3   7  
ATOM   4536  H HA   . LEU A 1 1  ? -14.470 5.283   -2.330  1.00 15.00 ?  279 LEU A HA   7  
ATOM   4537  H HB2  . LEU A 1 1  ? -16.247 6.190   -0.974  1.00 15.00 ?  279 LEU A HB2  7  
ATOM   4538  H HB3  . LEU A 1 1  ? -16.773 6.088   -2.639  1.00 15.00 ?  279 LEU A HB3  7  
ATOM   4539  H HG   . LEU A 1 1  ? -17.526 3.962   -0.648  1.00 15.00 ?  279 LEU A HG   7  
ATOM   4540  H HD11 . LEU A 1 1  ? -19.002 6.532   -1.211  1.00 15.00 ?  279 LEU A HD11 7  
ATOM   4541  H HD12 . LEU A 1 1  ? -18.206 6.106   0.303   1.00 15.00 ?  279 LEU A HD12 7  
ATOM   4542  H HD13 . LEU A 1 1  ? -19.605 5.184   -0.247  1.00 15.00 ?  279 LEU A HD13 7  
ATOM   4543  H HD21 . LEU A 1 1  ? -18.826 4.971   -3.178  1.00 15.00 ?  279 LEU A HD21 7  
ATOM   4544  H HD22 . LEU A 1 1  ? -19.419 3.656   -2.162  1.00 15.00 ?  279 LEU A HD22 7  
ATOM   4545  H HD23 . LEU A 1 1  ? -17.888 3.486   -3.022  1.00 15.00 ?  279 LEU A HD23 7  
ATOM   4546  N N    . GLY A 1 2  ? -14.012 4.292   -0.083  1.00 15.00 ?  280 GLY A N    7  
ATOM   4547  C CA   . GLY A 1 2  ? -13.583 3.579   1.100   1.00 15.00 ?  280 GLY A CA   7  
ATOM   4548  C C    . GLY A 1 2  ? -12.801 4.465   2.051   1.00 15.00 ?  280 GLY A C    7  
ATOM   4549  O O    . GLY A 1 2  ? -12.449 5.592   1.703   1.00 15.00 ?  280 GLY A O    7  
ATOM   4550  H H    . GLY A 1 2  ? -13.616 5.173   -0.293  1.00 15.00 ?  280 GLY A H    7  
ATOM   4551  H HA2  . GLY A 1 2  ? -14.453 3.196   1.613   1.00 15.00 ?  280 GLY A HA2  7  
ATOM   4552  H HA3  . GLY A 1 2  ? -12.959 2.749   0.802   1.00 15.00 ?  280 GLY A HA3  7  
ATOM   4553  N N    . PRO A 1 3  ? -12.504 3.969   3.257   1.00 15.00 ?  281 PRO A N    7  
ATOM   4554  C CA   . PRO A 1 3  ? -11.804 4.735   4.288   1.00 15.00 ?  281 PRO A CA   7  
ATOM   4555  C C    . PRO A 1 3  ? -10.285 4.584   4.210   1.00 15.00 ?  281 PRO A C    7  
ATOM   4556  O O    . PRO A 1 3  ? -9.769  3.521   3.860   1.00 15.00 ?  281 PRO A O    7  
ATOM   4557  C CB   . PRO A 1 3  ? -12.326 4.080   5.563   1.00 15.00 ?  281 PRO A CB   7  
ATOM   4558  C CG   . PRO A 1 3  ? -12.488 2.642   5.193   1.00 15.00 ?  281 PRO A CG   7  
ATOM   4559  C CD   . PRO A 1 3  ? -12.860 2.617   3.732   1.00 15.00 ?  281 PRO A CD   7  
ATOM   4560  H HA   . PRO A 1 3  ? -12.073 5.778   4.274   1.00 15.00 ?  281 PRO A HA   7  
ATOM   4561  H HB2  . PRO A 1 3  ? -11.607 4.209   6.360   1.00 15.00 ?  281 PRO A HB2  7  
ATOM   4562  H HB3  . PRO A 1 3  ? -13.269 4.525   5.842   1.00 15.00 ?  281 PRO A HB3  7  
ATOM   4563  H HG2  . PRO A 1 3  ? -11.555 2.118   5.344   1.00 15.00 ?  281 PRO A HG2  7  
ATOM   4564  H HG3  . PRO A 1 3  ? -13.271 2.195   5.787   1.00 15.00 ?  281 PRO A HG3  7  
ATOM   4565  H HD2  . PRO A 1 3  ? -12.287 1.865   3.210   1.00 15.00 ?  281 PRO A HD2  7  
ATOM   4566  H HD3  . PRO A 1 3  ? -13.918 2.435   3.616   1.00 15.00 ?  281 PRO A HD3  7  
ATOM   4567  N N    . LEU A 1 4  ? -9.573  5.647   4.548   1.00 15.00 ?  282 LEU A N    7  
ATOM   4568  C CA   . LEU A 1 4  ? -8.120  5.605   4.571   1.00 15.00 ?  282 LEU A CA   7  
ATOM   4569  C C    . LEU A 1 4  ? -7.601  6.157   5.893   1.00 15.00 ?  282 LEU A C    7  
ATOM   4570  O O    . LEU A 1 4  ? -7.606  7.367   6.117   1.00 15.00 ?  282 LEU A O    7  
ATOM   4571  C CB   . LEU A 1 4  ? -7.524  6.397   3.403   1.00 15.00 ?  282 LEU A CB   7  
ATOM   4572  C CG   . LEU A 1 4  ? -6.016  6.222   3.205   1.00 15.00 ?  282 LEU A CG   7  
ATOM   4573  C CD1  . LEU A 1 4  ? -5.708  4.826   2.687   1.00 15.00 ?  282 LEU A CD1  7  
ATOM   4574  C CD2  . LEU A 1 4  ? -5.470  7.280   2.260   1.00 15.00 ?  282 LEU A CD2  7  
ATOM   4575  H H    . LEU A 1 4  ? -10.037 6.478   4.805   1.00 15.00 ?  282 LEU A H    7  
ATOM   4576  H HA   . LEU A 1 4  ? -7.820  4.571   4.485   1.00 15.00 ?  282 LEU A HA   7  
ATOM   4577  H HB2  . LEU A 1 4  ? -8.025  6.088   2.497   1.00 15.00 ?  282 LEU A HB2  7  
ATOM   4578  H HB3  . LEU A 1 4  ? -7.724  7.445   3.568   1.00 15.00 ?  282 LEU A HB3  7  
ATOM   4579  H HG   . LEU A 1 4  ? -5.519  6.337   4.158   1.00 15.00 ?  282 LEU A HG   7  
ATOM   4580  H HD11 . LEU A 1 4  ? -6.221  4.669   1.750   1.00 15.00 ?  282 LEU A HD11 7  
ATOM   4581  H HD12 . LEU A 1 4  ? -6.041  4.094   3.406   1.00 15.00 ?  282 LEU A HD12 7  
ATOM   4582  H HD13 . LEU A 1 4  ? -4.642  4.726   2.535   1.00 15.00 ?  282 LEU A HD13 7  
ATOM   4583  H HD21 . LEU A 1 4  ? -5.946  7.182   1.295   1.00 15.00 ?  282 LEU A HD21 7  
ATOM   4584  H HD22 . LEU A 1 4  ? -4.403  7.146   2.152   1.00 15.00 ?  282 LEU A HD22 7  
ATOM   4585  H HD23 . LEU A 1 4  ? -5.670  8.262   2.664   1.00 15.00 ?  282 LEU A HD23 7  
ATOM   4586  N N    . PRO A 1 5  ? -7.186  5.270   6.804   1.00 15.00 ?  283 PRO A N    7  
ATOM   4587  C CA   . PRO A 1 5  ? -6.672  5.659   8.119   1.00 15.00 ?  283 PRO A CA   7  
ATOM   4588  C C    . PRO A 1 5  ? -5.240  6.186   8.051   1.00 15.00 ?  283 PRO A C    7  
ATOM   4589  O O    . PRO A 1 5  ? -4.391  5.602   7.374   1.00 15.00 ?  283 PRO A O    7  
ATOM   4590  C CB   . PRO A 1 5  ? -6.715  4.351   8.928   1.00 15.00 ?  283 PRO A CB   7  
ATOM   4591  C CG   . PRO A 1 5  ? -7.384  3.339   8.051   1.00 15.00 ?  283 PRO A CG   7  
ATOM   4592  C CD   . PRO A 1 5  ? -7.199  3.816   6.641   1.00 15.00 ?  283 PRO A CD   7  
ATOM   4593  H HA   . PRO A 1 5  ? -7.305  6.398   8.588   1.00 15.00 ?  283 PRO A HA   7  
ATOM   4594  H HB2  . PRO A 1 5  ? -5.707  4.049   9.173   1.00 15.00 ?  283 PRO A HB2  7  
ATOM   4595  H HB3  . PRO A 1 5  ? -7.275  4.511   9.838   1.00 15.00 ?  283 PRO A HB3  7  
ATOM   4596  H HG2  . PRO A 1 5  ? -6.917  2.374   8.182   1.00 15.00 ?  283 PRO A HG2  7  
ATOM   4597  H HG3  . PRO A 1 5  ? -8.435  3.283   8.292   1.00 15.00 ?  283 PRO A HG3  7  
ATOM   4598  H HD2  . PRO A 1 5  ? -6.261  3.458   6.237   1.00 15.00 ?  283 PRO A HD2  7  
ATOM   4599  H HD3  . PRO A 1 5  ? -8.026  3.503   6.022   1.00 15.00 ?  283 PRO A HD3  7  
ATOM   4600  N N    . PRO A 1 6  ? -4.953  7.298   8.754   1.00 15.00 ?  284 PRO A N    7  
ATOM   4601  C CA   . PRO A 1 6  ? -3.600  7.856   8.840   1.00 15.00 ?  284 PRO A CA   7  
ATOM   4602  C C    . PRO A 1 6  ? -2.596  6.818   9.327   1.00 15.00 ?  284 PRO A C    7  
ATOM   4603  O O    . PRO A 1 6  ? -2.694  6.313   10.450  1.00 15.00 ?  284 PRO A O    7  
ATOM   4604  C CB   . PRO A 1 6  ? -3.739  8.997   9.850   1.00 15.00 ?  284 PRO A CB   7  
ATOM   4605  C CG   . PRO A 1 6  ? -5.176  9.376   9.792   1.00 15.00 ?  284 PRO A CG   7  
ATOM   4606  C CD   . PRO A 1 6  ? -5.926  8.107   9.507   1.00 15.00 ?  284 PRO A CD   7  
ATOM   4607  H HA   . PRO A 1 6  ? -3.272  8.249   7.888   1.00 15.00 ?  284 PRO A HA   7  
ATOM   4608  H HB2  . PRO A 1 6  ? -3.459  8.648   10.834  1.00 15.00 ?  284 PRO A HB2  7  
ATOM   4609  H HB3  . PRO A 1 6  ? -3.103  9.819   9.558   1.00 15.00 ?  284 PRO A HB3  7  
ATOM   4610  H HG2  . PRO A 1 6  ? -5.486  9.790   10.741  1.00 15.00 ?  284 PRO A HG2  7  
ATOM   4611  H HG3  . PRO A 1 6  ? -5.335  10.091  9.000   1.00 15.00 ?  284 PRO A HG3  7  
ATOM   4612  H HD2  . PRO A 1 6  ? -6.204  7.617   10.428  1.00 15.00 ?  284 PRO A HD2  7  
ATOM   4613  H HD3  . PRO A 1 6  ? -6.803  8.313   8.910   1.00 15.00 ?  284 PRO A HD3  7  
ATOM   4614  N N    . GLY A 1 7  ? -1.645  6.496   8.472   1.00 15.00 ?  285 GLY A N    7  
ATOM   4615  C CA   . GLY A 1 7  ? -0.735  5.404   8.739   1.00 15.00 ?  285 GLY A CA   7  
ATOM   4616  C C    . GLY A 1 7  ? -0.735  4.423   7.590   1.00 15.00 ?  285 GLY A C    7  
ATOM   4617  O O    . GLY A 1 7  ? 0.144   3.566   7.480   1.00 15.00 ?  285 GLY A O    7  
ATOM   4618  H H    . GLY A 1 7  ? -1.557  7.008   7.635   1.00 15.00 ?  285 GLY A H    7  
ATOM   4619  H HA2  . GLY A 1 7  ? 0.262   5.797   8.874   1.00 15.00 ?  285 GLY A HA2  7  
ATOM   4620  H HA3  . GLY A 1 7  ? -1.043  4.895   9.640   1.00 15.00 ?  285 GLY A HA3  7  
ATOM   4621  N N    . TRP A 1 8  ? -1.725  4.577   6.716   1.00 15.00 ?  286 TRP A N    7  
ATOM   4622  C CA   . TRP A 1 8  ? -1.807  3.791   5.501   1.00 15.00 ?  286 TRP A CA   7  
ATOM   4623  C C    . TRP A 1 8  ? -1.065  4.505   4.395   1.00 15.00 ?  286 TRP A C    7  
ATOM   4624  O O    . TRP A 1 8  ? -1.562  5.474   3.815   1.00 15.00 ?  286 TRP A O    7  
ATOM   4625  C CB   . TRP A 1 8  ? -3.270  3.573   5.071   1.00 15.00 ?  286 TRP A CB   7  
ATOM   4626  C CG   . TRP A 1 8  ? -3.869  2.309   5.598   1.00 15.00 ?  286 TRP A CG   7  
ATOM   4627  C CD1  . TRP A 1 8  ? -3.974  1.937   6.907   1.00 15.00 ?  286 TRP A CD1  7  
ATOM   4628  C CD2  . TRP A 1 8  ? -4.436  1.238   4.824   1.00 15.00 ?  286 TRP A CD2  7  
ATOM   4629  N NE1  . TRP A 1 8  ? -4.557  0.698   7.000   1.00 15.00 ?  286 TRP A NE1  7  
ATOM   4630  C CE2  . TRP A 1 8  ? -4.845  0.244   5.739   1.00 15.00 ?  286 TRP A CE2  7  
ATOM   4631  C CE3  . TRP A 1 8  ? -4.636  1.012   3.450   1.00 15.00 ?  286 TRP A CE3  7  
ATOM   4632  C CZ2  . TRP A 1 8  ? -5.430  -0.952  5.332   1.00 15.00 ?  286 TRP A CZ2  7  
ATOM   4633  C CZ3  . TRP A 1 8  ? -5.209  -0.184  3.058   1.00 15.00 ?  286 TRP A CZ3  7  
ATOM   4634  C CH2  . TRP A 1 8  ? -5.596  -1.152  3.991   1.00 15.00 ?  286 TRP A CH2  7  
ATOM   4635  H H    . TRP A 1 8  ? -2.426  5.237   6.904   1.00 15.00 ?  286 TRP A H    7  
ATOM   4636  H HA   . TRP A 1 8  ? -1.332  2.836   5.684   1.00 15.00 ?  286 TRP A HA   7  
ATOM   4637  H HB2  . TRP A 1 8  ? -3.870  4.399   5.423   1.00 15.00 ?  286 TRP A HB2  7  
ATOM   4638  H HB3  . TRP A 1 8  ? -3.315  3.538   3.992   1.00 15.00 ?  286 TRP A HB3  7  
ATOM   4639  H HD1  . TRP A 1 8  ? -3.638  2.539   7.738   1.00 15.00 ?  286 TRP A HD1  7  
ATOM   4640  H HE1  . TRP A 1 8  ? -4.732  0.212   7.835   1.00 15.00 ?  286 TRP A HE1  7  
ATOM   4641  H HE3  . TRP A 1 8  ? -4.351  1.766   2.667   1.00 15.00 ?  286 TRP A HE3  7  
ATOM   4642  H HZ2  . TRP A 1 8  ? -5.735  -1.710  6.039   1.00 15.00 ?  286 TRP A HZ2  7  
ATOM   4643  H HZ3  . TRP A 1 8  ? -5.329  -0.392  2.002   1.00 15.00 ?  286 TRP A HZ3  7  
ATOM   4644  H HH2  . TRP A 1 8  ? -6.033  -2.074  3.631   1.00 15.00 ?  286 TRP A HH2  7  
ATOM   4645  N N    . GLU A 1 9  ? 0.148   4.062   4.146   1.00 15.00 ?  287 GLU A N    7  
ATOM   4646  C CA   . GLU A 1 9  ? 0.955   4.637   3.103   1.00 15.00 ?  287 GLU A CA   7  
ATOM   4647  C C    . GLU A 1 9  ? 0.723   3.883   1.809   1.00 15.00 ?  287 GLU A C    7  
ATOM   4648  O O    . GLU A 1 9  ? 0.858   2.659   1.757   1.00 15.00 ?  287 GLU A O    7  
ATOM   4649  C CB   . GLU A 1 9  ? 2.430   4.609   3.513   1.00 15.00 ?  287 GLU A CB   7  
ATOM   4650  C CG   . GLU A 1 9  ? 2.970   5.971   3.921   1.00 15.00 ?  287 GLU A CG   7  
ATOM   4651  C CD   . GLU A 1 9  ? 2.199   6.607   5.060   1.00 15.00 ?  287 GLU A CD   7  
ATOM   4652  O OE1  . GLU A 1 9  ? 2.508   6.307   6.229   1.00 15.00 -1 287 GLU A OE1  7  
ATOM   4653  O OE2  . GLU A 1 9  ? 1.293   7.424   4.787   1.00 15.00 ?  287 GLU A OE2  7  
ATOM   4654  H H    . GLU A 1 9  ? 0.512   3.317   4.679   1.00 15.00 ?  287 GLU A H    7  
ATOM   4655  H HA   . GLU A 1 9  ? 0.645   5.664   2.970   1.00 15.00 ?  287 GLU A HA   7  
ATOM   4656  H HB2  . GLU A 1 9  ? 2.538   3.940   4.354   1.00 15.00 ?  287 GLU A HB2  7  
ATOM   4657  H HB3  . GLU A 1 9  ? 3.026   4.234   2.695   1.00 15.00 ?  287 GLU A HB3  7  
ATOM   4658  H HG2  . GLU A 1 9  ? 3.996   5.852   4.232   1.00 15.00 ?  287 GLU A HG2  7  
ATOM   4659  H HG3  . GLU A 1 9  ? 2.930   6.631   3.066   1.00 15.00 ?  287 GLU A HG3  7  
ATOM   4660  N N    . VAL A 1 10 ? 0.365   4.607   0.765   1.00 15.00 ?  288 VAL A N    7  
ATOM   4661  C CA   . VAL A 1 10 ? 0.096   3.983   -0.510  1.00 15.00 ?  288 VAL A CA   7  
ATOM   4662  C C    . VAL A 1 10 ? 1.377   3.910   -1.322  1.00 15.00 ?  288 VAL A C    7  
ATOM   4663  O O    . VAL A 1 10 ? 1.840   4.896   -1.891  1.00 15.00 ?  288 VAL A O    7  
ATOM   4664  C CB   . VAL A 1 10 ? -1.021  4.721   -1.308  1.00 15.00 ?  288 VAL A CB   7  
ATOM   4665  C CG1  . VAL A 1 10 ? -2.325  4.692   -0.540  1.00 15.00 ?  288 VAL A CG1  7  
ATOM   4666  C CG2  . VAL A 1 10 ? -0.649  6.163   -1.629  1.00 15.00 ?  288 VAL A CG2  7  
ATOM   4667  H H    . VAL A 1 10 ? 0.274   5.581   0.858   1.00 15.00 ?  288 VAL A H    7  
ATOM   4668  H HA   . VAL A 1 10 ? -0.241  2.975   -0.313  1.00 15.00 ?  288 VAL A HA   7  
ATOM   4669  H HB   . VAL A 1 10 ? -1.171  4.195   -2.239  1.00 15.00 ?  288 VAL A HB   7  
ATOM   4670  H HG11 . VAL A 1 10 ? -2.194  5.198   0.406   1.00 15.00 ?  288 VAL A HG11 7  
ATOM   4671  H HG12 . VAL A 1 10 ? -2.611  3.670   -0.365  1.00 15.00 ?  288 VAL A HG12 7  
ATOM   4672  H HG13 . VAL A 1 10 ? -3.094  5.191   -1.112  1.00 15.00 ?  288 VAL A HG13 7  
ATOM   4673  H HG21 . VAL A 1 10 ? 0.173   6.170   -2.332  1.00 15.00 ?  288 VAL A HG21 7  
ATOM   4674  H HG22 . VAL A 1 10 ? -0.352  6.671   -0.723  1.00 15.00 ?  288 VAL A HG22 7  
ATOM   4675  H HG23 . VAL A 1 10 ? -1.500  6.667   -2.063  1.00 15.00 ?  288 VAL A HG23 7  
ATOM   4676  N N    . ARG A 1 11 ? 1.998   2.746   -1.338  1.00 15.00 ?  289 ARG A N    7  
ATOM   4677  C CA   . ARG A 1 11 ? 3.212   2.612   -2.096  1.00 15.00 ?  289 ARG A CA   7  
ATOM   4678  C C    . ARG A 1 11 ? 2.830   2.142   -3.493  1.00 15.00 ?  289 ARG A C    7  
ATOM   4679  O O    . ARG A 1 11 ? 2.497   0.979   -3.716  1.00 15.00 ?  289 ARG A O    7  
ATOM   4680  C CB   . ARG A 1 11 ? 4.218   1.691   -1.373  1.00 15.00 ?  289 ARG A CB   7  
ATOM   4681  C CG   . ARG A 1 11 ? 5.679   1.894   -1.787  1.00 15.00 ?  289 ARG A CG   7  
ATOM   4682  C CD   . ARG A 1 11 ? 5.923   1.587   -3.261  1.00 15.00 ?  289 ARG A CD   7  
ATOM   4683  N NE   . ARG A 1 11 ? 7.309   1.832   -3.670  1.00 15.00 ?  289 ARG A NE   7  
ATOM   4684  C CZ   . ARG A 1 11 ? 8.266   0.899   -3.675  1.00 15.00 ?  289 ARG A CZ   7  
ATOM   4685  N NH1  . ARG A 1 11 ? 8.042   -0.299  -3.158  1.00 15.00 1  289 ARG A NH1  7  
ATOM   4686  N NH2  . ARG A 1 11 ? 9.462   1.176   -4.169  1.00 15.00 ?  289 ARG A NH2  7  
ATOM   4687  H H    . ARG A 1 11 ? 1.621   1.965   -0.864  1.00 15.00 ?  289 ARG A H    7  
ATOM   4688  H HA   . ARG A 1 11 ? 3.645   3.601   -2.183  1.00 15.00 ?  289 ARG A HA   7  
ATOM   4689  H HB2  . ARG A 1 11 ? 4.150   1.892   -0.312  1.00 15.00 ?  289 ARG A HB2  7  
ATOM   4690  H HB3  . ARG A 1 11 ? 3.954   0.656   -1.537  1.00 15.00 ?  289 ARG A HB3  7  
ATOM   4691  H HG2  . ARG A 1 11 ? 5.954   2.921   -1.599  1.00 15.00 ?  289 ARG A HG2  7  
ATOM   4692  H HG3  . ARG A 1 11 ? 6.300   1.241   -1.185  1.00 15.00 ?  289 ARG A HG3  7  
ATOM   4693  H HD2  . ARG A 1 11 ? 5.686   0.550   -3.441  1.00 15.00 ?  289 ARG A HD2  7  
ATOM   4694  H HD3  . ARG A 1 11 ? 5.270   2.211   -3.855  1.00 15.00 ?  289 ARG A HD3  7  
ATOM   4695  H HE   . ARG A 1 11 ? 7.528   2.729   -4.005  1.00 15.00 ?  289 ARG A HE   7  
ATOM   4696  H HH11 . ARG A 1 11 ? 7.151   -0.524  -2.750  1.00 15.00 ?  289 ARG A HH11 7  
ATOM   4697  H HH12 . ARG A 1 11 ? 8.772   -0.997  -3.172  1.00 15.00 ?  289 ARG A HH12 7  
ATOM   4698  H HH21 . ARG A 1 11 ? 9.661   2.096   -4.548  1.00 15.00 ?  289 ARG A HH21 7  
ATOM   4699  H HH22 . ARG A 1 11 ? 10.178  0.471   -4.177  1.00 15.00 ?  289 ARG A HH22 7  
ATOM   4700  N N    . SER A 1 12 ? 2.783   3.101   -4.401  1.00 15.00 ?  290 SER A N    7  
ATOM   4701  C CA   . SER A 1 12 ? 2.349   2.868   -5.761  1.00 15.00 ?  290 SER A CA   7  
ATOM   4702  C C    . SER A 1 12 ? 3.556   2.690   -6.669  1.00 15.00 ?  290 SER A C    7  
ATOM   4703  O O    . SER A 1 12 ? 4.576   3.357   -6.500  1.00 15.00 ?  290 SER A O    7  
ATOM   4704  C CB   . SER A 1 12 ? 1.496   4.052   -6.224  1.00 15.00 ?  290 SER A CB   7  
ATOM   4705  O OG   . SER A 1 12 ? 2.130   5.282   -5.910  1.00 15.00 ?  290 SER A OG   7  
ATOM   4706  H H    . SER A 1 12 ? 3.049   4.013   -4.147  1.00 15.00 ?  290 SER A H    7  
ATOM   4707  H HA   . SER A 1 12 ? 1.754   1.969   -5.778  1.00 15.00 ?  290 SER A HA   7  
ATOM   4708  H HB2  . SER A 1 12 ? 1.355   3.997   -7.292  1.00 15.00 ?  290 SER A HB2  7  
ATOM   4709  H HB3  . SER A 1 12 ? 0.535   4.019   -5.730  1.00 15.00 ?  290 SER A HB3  7  
ATOM   4710  H HG   . SER A 1 12 ? 1.475   6.000   -5.913  1.00 15.00 ?  290 SER A HG   7  
ATOM   4711  N N    . THR A 1 13 ? 3.446   1.790   -7.629  1.00 15.00 ?  291 THR A N    7  
ATOM   4712  C CA   . THR A 1 13 ? 4.533   1.563   -8.558  1.00 15.00 ?  291 THR A CA   7  
ATOM   4713  C C    . THR A 1 13 ? 4.036   1.625   -9.999  1.00 15.00 ?  291 THR A C    7  
ATOM   4714  O O    . THR A 1 13 ? 2.891   1.248   -10.289 1.00 15.00 ?  291 THR A O    7  
ATOM   4715  C CB   . THR A 1 13 ? 5.236   0.222   -8.275  1.00 15.00 ?  291 THR A CB   7  
ATOM   4716  O OG1  . THR A 1 13 ? 4.266   -0.828  -8.174  1.00 15.00 ?  291 THR A OG1  7  
ATOM   4717  C CG2  . THR A 1 13 ? 6.042   0.304   -6.982  1.00 15.00 ?  291 THR A CG2  7  
ATOM   4718  H H    . THR A 1 13 ? 2.618   1.274   -7.718  1.00 15.00 ?  291 THR A H    7  
ATOM   4719  H HA   . THR A 1 13 ? 5.253   2.355   -8.411  1.00 15.00 ?  291 THR A HA   7  
ATOM   4720  H HB   . THR A 1 13 ? 5.910   0.005   -9.089  1.00 15.00 ?  291 THR A HB   7  
ATOM   4721  H HG1  . THR A 1 13 ? 3.619   -0.604  -7.496  1.00 15.00 ?  291 THR A HG1  7  
ATOM   4722  H HG21 . THR A 1 13 ? 6.692   1.173   -7.009  1.00 15.00 ?  291 THR A HG21 7  
ATOM   4723  H HG22 . THR A 1 13 ? 6.639   -0.590  -6.873  1.00 15.00 ?  291 THR A HG22 7  
ATOM   4724  H HG23 . THR A 1 13 ? 5.368   0.389   -6.142  1.00 15.00 ?  291 THR A HG23 7  
ATOM   4725  N N    . VAL A 1 14 ? 4.913   2.090   -10.893 1.00 15.00 ?  292 VAL A N    7  
ATOM   4726  C CA   . VAL A 1 14 ? 4.559   2.396   -12.281 1.00 15.00 ?  292 VAL A CA   7  
ATOM   4727  C C    . VAL A 1 14 ? 4.062   1.175   -13.052 1.00 15.00 ?  292 VAL A C    7  
ATOM   4728  O O    . VAL A 1 14 ? 3.486   1.311   -14.130 1.00 15.00 ?  292 VAL A O    7  
ATOM   4729  C CB   . VAL A 1 14 ? 5.748   3.025   -13.037 1.00 15.00 ?  292 VAL A CB   7  
ATOM   4730  C CG1  . VAL A 1 14 ? 6.142   4.349   -12.401 1.00 15.00 ?  292 VAL A CG1  7  
ATOM   4731  C CG2  . VAL A 1 14 ? 6.934   2.074   -13.073 1.00 15.00 ?  292 VAL A CG2  7  
ATOM   4732  H H    . VAL A 1 14 ? 5.840   2.228   -10.607 1.00 15.00 ?  292 VAL A H    7  
ATOM   4733  H HA   . VAL A 1 14 ? 3.763   3.128   -12.257 1.00 15.00 ?  292 VAL A HA   7  
ATOM   4734  H HB   . VAL A 1 14 ? 5.438   3.219   -14.055 1.00 15.00 ?  292 VAL A HB   7  
ATOM   4735  H HG11 . VAL A 1 14 ? 5.299   5.024   -12.423 1.00 15.00 ?  292 VAL A HG11 7  
ATOM   4736  H HG12 . VAL A 1 14 ? 6.964   4.783   -12.951 1.00 15.00 ?  292 VAL A HG12 7  
ATOM   4737  H HG13 . VAL A 1 14 ? 6.443   4.181   -11.377 1.00 15.00 ?  292 VAL A HG13 7  
ATOM   4738  H HG21 . VAL A 1 14 ? 6.649   1.159   -13.573 1.00 15.00 ?  292 VAL A HG21 7  
ATOM   4739  H HG22 . VAL A 1 14 ? 7.246   1.849   -12.063 1.00 15.00 ?  292 VAL A HG22 7  
ATOM   4740  H HG23 . VAL A 1 14 ? 7.751   2.537   -13.607 1.00 15.00 ?  292 VAL A HG23 7  
ATOM   4741  N N    . SER A 1 15 ? 4.295   -0.010  -12.502 1.00 15.00 ?  293 SER A N    7  
ATOM   4742  C CA   . SER A 1 15 ? 3.770   -1.244  -13.075 1.00 15.00 ?  293 SER A CA   7  
ATOM   4743  C C    . SER A 1 15 ? 2.236   -1.237  -13.081 1.00 15.00 ?  293 SER A C    7  
ATOM   4744  O O    . SER A 1 15 ? 1.605   -2.056  -13.745 1.00 15.00 ?  293 SER A O    7  
ATOM   4745  C CB   . SER A 1 15 ? 4.292   -2.447  -12.291 1.00 15.00 ?  293 SER A CB   7  
ATOM   4746  O OG   . SER A 1 15 ? 5.707   -2.412  -12.200 1.00 15.00 ?  293 SER A OG   7  
ATOM   4747  H H    . SER A 1 15 ? 4.847   -0.060  -11.692 1.00 15.00 ?  293 SER A H    7  
ATOM   4748  H HA   . SER A 1 15 ? 4.120   -1.310  -14.094 1.00 15.00 ?  293 SER A HA   7  
ATOM   4749  H HB2  . SER A 1 15 ? 3.879   -2.433  -11.295 1.00 15.00 ?  293 SER A HB2  7  
ATOM   4750  H HB3  . SER A 1 15 ? 3.997   -3.356  -12.792 1.00 15.00 ?  293 SER A HB3  7  
ATOM   4751  H HG   . SER A 1 15 ? 6.072   -2.031  -13.017 1.00 15.00 ?  293 SER A HG   7  
ATOM   4752  N N    . GLY A 1 16 ? 1.650   -0.311  -12.327 1.00 15.00 ?  294 GLY A N    7  
ATOM   4753  C CA   . GLY A 1 16 ? 0.208   -0.224  -12.226 1.00 15.00 ?  294 GLY A CA   7  
ATOM   4754  C C    . GLY A 1 16 ? -0.328  -1.063  -11.093 1.00 15.00 ?  294 GLY A C    7  
ATOM   4755  O O    . GLY A 1 16 ? -1.435  -1.594  -11.165 1.00 15.00 ?  294 GLY A O    7  
ATOM   4756  H H    . GLY A 1 16 ? 2.209   0.328   -11.833 1.00 15.00 ?  294 GLY A H    7  
ATOM   4757  H HA2  . GLY A 1 16 ? -0.070  0.806   -12.065 1.00 15.00 ?  294 GLY A HA2  7  
ATOM   4758  H HA3  . GLY A 1 16 ? -0.230  -0.566  -13.153 1.00 15.00 ?  294 GLY A HA3  7  
ATOM   4759  N N    . ARG A 1 17 ? 0.457   -1.165  -10.032 1.00 15.00 ?  295 ARG A N    7  
ATOM   4760  C CA   . ARG A 1 17 ? 0.068   -1.946  -8.872  1.00 15.00 ?  295 ARG A CA   7  
ATOM   4761  C C    . ARG A 1 17 ? 0.258   -1.140  -7.593  1.00 15.00 ?  295 ARG A C    7  
ATOM   4762  O O    . ARG A 1 17 ? 1.375   -0.741  -7.251  1.00 15.00 ?  295 ARG A O    7  
ATOM   4763  C CB   . ARG A 1 17 ? 0.852   -3.271  -8.819  1.00 15.00 ?  295 ARG A CB   7  
ATOM   4764  C CG   . ARG A 1 17 ? 2.356   -3.113  -8.982  1.00 15.00 ?  295 ARG A CG   7  
ATOM   4765  C CD   . ARG A 1 17 ? 3.056   -4.449  -9.205  1.00 15.00 ?  295 ARG A CD   7  
ATOM   4766  N NE   . ARG A 1 17 ? 3.086   -5.289  -8.004  1.00 15.00 ?  295 ARG A NE   7  
ATOM   4767  C CZ   . ARG A 1 17 ? 4.063   -6.166  -7.741  1.00 15.00 ?  295 ARG A CZ   7  
ATOM   4768  N NH1  . ARG A 1 17 ? 5.098   -6.274  -8.566  1.00 15.00 1  295 ARG A NH1  7  
ATOM   4769  N NH2  . ARG A 1 17 ? 4.012   -6.930  -6.651  1.00 15.00 ?  295 ARG A NH2  7  
ATOM   4770  H H    . ARG A 1 17 ? 1.318   -0.688  -10.025 1.00 15.00 ?  295 ARG A H    7  
ATOM   4771  H HA   . ARG A 1 17 ? -0.983  -2.173  -8.975  1.00 15.00 ?  295 ARG A HA   7  
ATOM   4772  H HB2  . ARG A 1 17 ? 0.667   -3.747  -7.867  1.00 15.00 ?  295 ARG A HB2  7  
ATOM   4773  H HB3  . ARG A 1 17 ? 0.494   -3.918  -9.607  1.00 15.00 ?  295 ARG A HB3  7  
ATOM   4774  H HG2  . ARG A 1 17 ? 2.549   -2.477  -9.832  1.00 15.00 ?  295 ARG A HG2  7  
ATOM   4775  H HG3  . ARG A 1 17 ? 2.757   -2.654  -8.090  1.00 15.00 ?  295 ARG A HG3  7  
ATOM   4776  H HD2  . ARG A 1 17 ? 2.535   -4.984  -9.984  1.00 15.00 ?  295 ARG A HD2  7  
ATOM   4777  H HD3  . ARG A 1 17 ? 4.071   -4.258  -9.522  1.00 15.00 ?  295 ARG A HD3  7  
ATOM   4778  H HE   . ARG A 1 17 ? 2.337   -5.204  -7.375  1.00 15.00 ?  295 ARG A HE   7  
ATOM   4779  H HH11 . ARG A 1 17 ? 5.154   -5.700  -9.384  1.00 15.00 ?  295 ARG A HH11 7  
ATOM   4780  H HH12 . ARG A 1 17 ? 5.834   -6.941  -8.375  1.00 15.00 ?  295 ARG A HH12 7  
ATOM   4781  H HH21 . ARG A 1 17 ? 3.241   -6.861  -6.018  1.00 15.00 ?  295 ARG A HH21 7  
ATOM   4782  H HH22 . ARG A 1 17 ? 4.757   -7.578  -6.455  1.00 15.00 ?  295 ARG A HH22 7  
ATOM   4783  N N    . ILE A 1 18 ? -0.849  -0.862  -6.921  1.00 15.00 ?  296 ILE A N    7  
ATOM   4784  C CA   . ILE A 1 18 ? -0.811  -0.221  -5.618  1.00 15.00 ?  296 ILE A CA   7  
ATOM   4785  C C    . ILE A 1 18 ? -0.736  -1.320  -4.569  1.00 15.00 ?  296 ILE A C    7  
ATOM   4786  O O    . ILE A 1 18 ? -1.345  -2.375  -4.732  1.00 15.00 ?  296 ILE A O    7  
ATOM   4787  C CB   . ILE A 1 18 ? -2.050  0.701   -5.397  1.00 15.00 ?  296 ILE A CB   7  
ATOM   4788  C CG1  . ILE A 1 18 ? -1.835  1.671   -4.217  1.00 15.00 ?  296 ILE A CG1  7  
ATOM   4789  C CG2  . ILE A 1 18 ? -3.318  -0.122  -5.182  1.00 15.00 ?  296 ILE A CG2  7  
ATOM   4790  C CD1  . ILE A 1 18 ? -2.227  1.114   -2.861  1.00 15.00 ?  296 ILE A CD1  7  
ATOM   4791  H H    . ILE A 1 18 ? -1.716  -1.110  -7.302  1.00 15.00 ?  296 ILE A H    7  
ATOM   4792  H HA   . ILE A 1 18 ? 0.087   0.381   -5.564  1.00 15.00 ?  296 ILE A HA   7  
ATOM   4793  H HB   . ILE A 1 18 ? -2.190  1.279   -6.297  1.00 15.00 ?  296 ILE A HB   7  
ATOM   4794  H HG12 . ILE A 1 18 ? -0.792  1.947   -4.170  1.00 15.00 ?  296 ILE A HG12 7  
ATOM   4795  H HG13 . ILE A 1 18 ? -2.425  2.560   -4.391  1.00 15.00 ?  296 ILE A HG13 7  
ATOM   4796  H HG21 . ILE A 1 18 ? -4.164  0.541   -5.085  1.00 15.00 ?  296 ILE A HG21 7  
ATOM   4797  H HG22 . ILE A 1 18 ? -3.218  -0.709  -4.279  1.00 15.00 ?  296 ILE A HG22 7  
ATOM   4798  H HG23 . ILE A 1 18 ? -3.468  -0.781  -6.024  1.00 15.00 ?  296 ILE A HG23 7  
ATOM   4799  H HD11 . ILE A 1 18 ? -1.885  0.095   -2.776  1.00 15.00 ?  296 ILE A HD11 7  
ATOM   4800  H HD12 . ILE A 1 18 ? -3.302  1.144   -2.758  1.00 15.00 ?  296 ILE A HD12 7  
ATOM   4801  H HD13 . ILE A 1 18 ? -1.775  1.711   -2.082  1.00 15.00 ?  296 ILE A HD13 7  
ATOM   4802  N N    . TYR A 1 19 ? 0.028   -1.101  -3.520  1.00 15.00 ?  297 TYR A N    7  
ATOM   4803  C CA   . TYR A 1 19 ? 0.281   -2.164  -2.569  1.00 15.00 ?  297 TYR A CA   7  
ATOM   4804  C C    . TYR A 1 19 ? 0.501   -1.515  -1.235  1.00 15.00 ?  297 TYR A C    7  
ATOM   4805  O O    . TYR A 1 19 ? 1.231   -0.515  -1.115  1.00 15.00 ?  297 TYR A O    7  
ATOM   4806  C CB   . TYR A 1 19 ? 1.441   -3.110  -2.991  1.00 15.00 ?  297 TYR A CB   7  
ATOM   4807  C CG   . TYR A 1 19 ? 2.833   -2.730  -2.521  1.00 15.00 ?  297 TYR A CG   7  
ATOM   4808  C CD1  . TYR A 1 19 ? 3.526   -1.697  -3.125  1.00 15.00 ?  297 TYR A CD1  7  
ATOM   4809  C CD2  . TYR A 1 19 ? 3.460   -3.416  -1.477  1.00 15.00 ?  297 TYR A CD2  7  
ATOM   4810  C CE1  . TYR A 1 19 ? 4.790   -1.347  -2.703  1.00 15.00 ?  297 TYR A CE1  7  
ATOM   4811  C CE2  . TYR A 1 19 ? 4.724   -3.065  -1.053  1.00 15.00 ?  297 TYR A CE2  7  
ATOM   4812  C CZ   . TYR A 1 19 ? 5.381   -2.030  -1.666  1.00 15.00 ?  297 TYR A CZ   7  
ATOM   4813  O OH   . TYR A 1 19 ? 6.639   -1.673  -1.242  1.00 15.00 ?  297 TYR A OH   7  
ATOM   4814  H H    . TYR A 1 19 ? 0.307   -0.173  -3.296  1.00 15.00 ?  297 TYR A H    7  
ATOM   4815  H HA   . TYR A 1 19 ? -0.630  -2.745  -2.502  1.00 15.00 ?  297 TYR A HA   7  
ATOM   4816  H HB2  . TYR A 1 19 ? 1.236   -4.096  -2.606  1.00 15.00 ?  297 TYR A HB2  7  
ATOM   4817  H HB3  . TYR A 1 19 ? 1.464   -3.161  -4.070  1.00 15.00 ?  297 TYR A HB3  7  
ATOM   4818  H HD1  . TYR A 1 19 ? 3.059   -1.155  -3.933  1.00 15.00 ?  297 TYR A HD1  7  
ATOM   4819  H HD2  . TYR A 1 19 ? 2.959   -4.249  -1.003  1.00 15.00 ?  297 TYR A HD2  7  
ATOM   4820  H HE1  . TYR A 1 19 ? 5.314   -0.539  -3.191  1.00 15.00 ?  297 TYR A HE1  7  
ATOM   4821  H HE2  . TYR A 1 19 ? 5.187   -3.598  -0.236  1.00 15.00 ?  297 TYR A HE2  7  
ATOM   4822  H HH   . TYR A 1 19 ? 7.127   -2.463  -0.976  1.00 15.00 ?  297 TYR A HH   7  
ATOM   4823  N N    . PHE A 1 20 ? -0.164  -2.034  -0.250  1.00 15.00 ?  298 PHE A N    7  
ATOM   4824  C CA   . PHE A 1 20 ? -0.254  -1.346  0.978   1.00 15.00 ?  298 PHE A CA   7  
ATOM   4825  C C    . PHE A 1 20 ? 0.826   -1.660  1.948   1.00 15.00 ?  298 PHE A C    7  
ATOM   4826  O O    . PHE A 1 20 ? 1.123   -2.820  2.227   1.00 15.00 ?  298 PHE A O    7  
ATOM   4827  C CB   . PHE A 1 20 ? -1.596  -1.547  1.594   1.00 15.00 ?  298 PHE A CB   7  
ATOM   4828  C CG   . PHE A 1 20 ? -2.371  -0.346  1.310   1.00 15.00 ?  298 PHE A CG   7  
ATOM   4829  C CD1  . PHE A 1 20 ? -1.962  0.847   1.865   1.00 15.00 ?  298 PHE A CD1  7  
ATOM   4830  C CD2  . PHE A 1 20 ? -3.454  -0.375  0.463   1.00 15.00 ?  298 PHE A CD2  7  
ATOM   4831  C CE1  . PHE A 1 20 ? -2.626  1.995   1.595   1.00 15.00 ?  298 PHE A CE1  7  
ATOM   4832  C CE2  . PHE A 1 20 ? -4.129  0.782   0.191   1.00 15.00 ?  298 PHE A CE2  7  
ATOM   4833  C CZ   . PHE A 1 20 ? -3.709  1.956   0.762   1.00 15.00 ?  298 PHE A CZ   7  
ATOM   4834  H H    . PHE A 1 20 ? -0.658  -2.871  -0.374  1.00 15.00 ?  298 PHE A H    7  
ATOM   4835  H HA   . PHE A 1 20 ? -0.179  -0.303  0.727   1.00 15.00 ?  298 PHE A HA   7  
ATOM   4836  H HB2  . PHE A 1 20 ? -2.088  -2.406  1.155   1.00 15.00 ?  298 PHE A HB2  7  
ATOM   4837  H HB3  . PHE A 1 20 ? -1.509  -1.661  2.663   1.00 15.00 ?  298 PHE A HB3  7  
ATOM   4838  H HD1  . PHE A 1 20 ? -1.115  0.860   2.531   1.00 15.00 ?  298 PHE A HD1  7  
ATOM   4839  H HD2  . PHE A 1 20 ? -3.771  -1.309  0.023   1.00 15.00 ?  298 PHE A HD2  7  
ATOM   4840  H HE1  . PHE A 1 20 ? -2.304  2.929   2.032   1.00 15.00 ?  298 PHE A HE1  7  
ATOM   4841  H HE2  . PHE A 1 20 ? -4.982  0.775   -0.464  1.00 15.00 ?  298 PHE A HE2  7  
ATOM   4842  H HZ   . PHE A 1 20 ? -4.231  2.830   0.580   1.00 15.00 ?  298 PHE A HZ   7  
ATOM   4843  N N    . VAL A 1 21 ? 1.353   -0.576  2.481   1.00 15.00 ?  299 VAL A N    7  
ATOM   4844  C CA   . VAL A 1 21 ? 2.409   -0.592  3.433   1.00 15.00 ?  299 VAL A CA   7  
ATOM   4845  C C    . VAL A 1 21 ? 2.034   0.349   4.580   1.00 15.00 ?  299 VAL A C    7  
ATOM   4846  O O    . VAL A 1 21 ? 2.295   1.555   4.546   1.00 15.00 ?  299 VAL A O    7  
ATOM   4847  C CB   . VAL A 1 21 ? 3.727   -0.150  2.755   1.00 15.00 ?  299 VAL A CB   7  
ATOM   4848  C CG1  . VAL A 1 21 ? 4.198   -1.211  1.771   1.00 15.00 ?  299 VAL A CG1  7  
ATOM   4849  C CG2  . VAL A 1 21 ? 3.537   1.168   2.019   1.00 15.00 ?  299 VAL A CG2  7  
ATOM   4850  H H    . VAL A 1 21 ? 0.992   0.297   2.221   1.00 15.00 ?  299 VAL A H    7  
ATOM   4851  H HA   . VAL A 1 21 ? 2.524   -1.599  3.809   1.00 15.00 ?  299 VAL A HA   7  
ATOM   4852  H HB   . VAL A 1 21 ? 4.485   -0.017  3.513   1.00 15.00 ?  299 VAL A HB   7  
ATOM   4853  H HG11 . VAL A 1 21 ? 3.456   -1.340  0.998   1.00 15.00 ?  299 VAL A HG11 7  
ATOM   4854  H HG12 . VAL A 1 21 ? 4.342   -2.147  2.289   1.00 15.00 ?  299 VAL A HG12 7  
ATOM   4855  H HG13 . VAL A 1 21 ? 5.132   -0.901  1.326   1.00 15.00 ?  299 VAL A HG13 7  
ATOM   4856  H HG21 . VAL A 1 21 ? 4.468   1.464   1.561   1.00 15.00 ?  299 VAL A HG21 7  
ATOM   4857  H HG22 . VAL A 1 21 ? 3.221   1.929   2.717   1.00 15.00 ?  299 VAL A HG22 7  
ATOM   4858  H HG23 . VAL A 1 21 ? 2.784   1.046   1.255   1.00 15.00 ?  299 VAL A HG23 7  
ATOM   4859  N N    . ASP A 1 22 ? 1.368   -0.190  5.578   1.00 15.00 ?  300 ASP A N    7  
ATOM   4860  C CA   . ASP A 1 22 ? 0.994   0.607   6.729   1.00 15.00 ?  300 ASP A CA   7  
ATOM   4861  C C    . ASP A 1 22 ? 2.113   0.526   7.745   1.00 15.00 ?  300 ASP A C    7  
ATOM   4862  O O    . ASP A 1 22 ? 2.519   -0.568  8.155   1.00 15.00 ?  300 ASP A O    7  
ATOM   4863  C CB   . ASP A 1 22 ? -0.353  0.155   7.315   1.00 15.00 ?  300 ASP A CB   7  
ATOM   4864  C CG   . ASP A 1 22 ? -0.292  -0.140  8.799   1.00 15.00 ?  300 ASP A CG   7  
ATOM   4865  O OD1  . ASP A 1 22 ? -0.125  0.798   9.607   1.00 15.00 -1 300 ASP A OD1  7  
ATOM   4866  O OD2  . ASP A 1 22 ? -0.387  -1.321  9.160   1.00 15.00 ?  300 ASP A OD2  7  
ATOM   4867  H H    . ASP A 1 22 ? 1.125   -1.142  5.543   1.00 15.00 ?  300 ASP A H    7  
ATOM   4868  H HA   . ASP A 1 22 ? 0.907   1.633   6.399   1.00 15.00 ?  300 ASP A HA   7  
ATOM   4869  H HB2  . ASP A 1 22 ? -1.081  0.939   7.159   1.00 15.00 ?  300 ASP A HB2  7  
ATOM   4870  H HB3  . ASP A 1 22 ? -0.684  -0.736  6.798   1.00 15.00 ?  300 ASP A HB3  7  
ATOM   4871  N N    . HIS A 1 23 ? 2.612   1.695   8.124   1.00 15.00 ?  301 HIS A N    7  
ATOM   4872  C CA   . HIS A 1 23 ? 3.857   1.799   8.868   1.00 15.00 ?  301 HIS A CA   7  
ATOM   4873  C C    . HIS A 1 23 ? 3.682   1.488   10.350  1.00 15.00 ?  301 HIS A C    7  
ATOM   4874  O O    . HIS A 1 23 ? 4.643   1.105   11.015  1.00 15.00 ?  301 HIS A O    7  
ATOM   4875  C CB   . HIS A 1 23 ? 4.473   3.196   8.733   1.00 15.00 ?  301 HIS A CB   7  
ATOM   4876  C CG   . HIS A 1 23 ? 4.910   3.594   7.351   1.00 15.00 ?  301 HIS A CG   7  
ATOM   4877  N ND1  . HIS A 1 23 ? 5.008   4.906   6.957   1.00 15.00 ?  301 HIS A ND1  7  
ATOM   4878  C CD2  . HIS A 1 23 ? 5.362   2.864   6.303   1.00 15.00 ?  301 HIS A CD2  7  
ATOM   4879  C CE1  . HIS A 1 23 ? 5.508   4.965   5.740   1.00 15.00 ?  301 HIS A CE1  7  
ATOM   4880  N NE2  . HIS A 1 23 ? 5.742   3.734   5.316   1.00 15.00 ?  301 HIS A NE2  7  
ATOM   4881  H H    . HIS A 1 23 ? 2.112   2.514   7.908   1.00 15.00 ?  301 HIS A H    7  
ATOM   4882  H HA   . HIS A 1 23 ? 4.545   1.082   8.449   1.00 15.00 ?  301 HIS A HA   7  
ATOM   4883  H HB2  . HIS A 1 23 ? 3.758   3.927   9.070   1.00 15.00 ?  301 HIS A HB2  7  
ATOM   4884  H HB3  . HIS A 1 23 ? 5.344   3.243   9.370   1.00 15.00 ?  301 HIS A HB3  7  
ATOM   4885  H HD1  . HIS A 1 23 ? 4.726   5.694   7.489   1.00 15.00 ?  301 HIS A HD1  7  
ATOM   4886  H HD2  . HIS A 1 23 ? 5.398   1.785   6.241   1.00 15.00 ?  301 HIS A HD2  7  
ATOM   4887  H HE1  . HIS A 1 23 ? 5.681   5.868   5.168   1.00 15.00 ?  301 HIS A HE1  7  
ATOM   4888  H HE2  . HIS A 1 23 ? 6.405   3.516   4.615   1.00 15.00 ?  301 HIS A HE2  7  
ATOM   4889  N N    . ASN A 1 24 ? 2.476   1.661   10.876  1.00 15.00 ?  302 ASN A N    7  
ATOM   4890  C CA   . ASN A 1 24 ? 2.281   1.560   12.320  1.00 15.00 ?  302 ASN A CA   7  
ATOM   4891  C C    . ASN A 1 24 ? 1.753   0.197   12.744  1.00 15.00 ?  302 ASN A C    7  
ATOM   4892  O O    . ASN A 1 24 ? 2.052   -0.272  13.842  1.00 15.00 ?  302 ASN A O    7  
ATOM   4893  C CB   . ASN A 1 24 ? 1.367   2.675   12.851  1.00 15.00 ?  302 ASN A CB   7  
ATOM   4894  C CG   . ASN A 1 24 ? 0.089   2.840   12.052  1.00 15.00 ?  302 ASN A CG   7  
ATOM   4895  O OD1  . ASN A 1 24 ? 0.036   3.628   11.110  1.00 15.00 ?  302 ASN A OD1  7  
ATOM   4896  N ND2  . ASN A 1 24 ? -0.951  2.111   12.421  1.00 15.00 ?  302 ASN A ND2  7  
ATOM   4897  H H    . ASN A 1 24 ? 1.705   1.836   10.289  1.00 15.00 ?  302 ASN A H    7  
ATOM   4898  H HA   . ASN A 1 24 ? 3.255   1.687   12.773  1.00 15.00 ?  302 ASN A HA   7  
ATOM   4899  H HB2  . ASN A 1 24 ? 1.098   2.453   13.873  1.00 15.00 ?  302 ASN A HB2  7  
ATOM   4900  H HB3  . ASN A 1 24 ? 1.907   3.610   12.822  1.00 15.00 ?  302 ASN A HB3  7  
ATOM   4901  H HD21 . ASN A 1 24 ? -0.849  1.505   13.187  1.00 15.00 ?  302 ASN A HD21 7  
ATOM   4902  H HD22 . ASN A 1 24 ? -1.778  2.195   11.904  1.00 15.00 ?  302 ASN A HD22 7  
ATOM   4903  N N    . ASN A 1 25 ? 0.936   -0.424  11.914  1.00 15.00 ?  303 ASN A N    7  
ATOM   4904  C CA   . ASN A 1 25 ? 0.462   -1.770  12.219  1.00 15.00 ?  303 ASN A CA   7  
ATOM   4905  C C    . ASN A 1 25 ? 1.246   -2.832  11.447  1.00 15.00 ?  303 ASN A C    7  
ATOM   4906  O O    . ASN A 1 25 ? 1.165   -4.016  11.771  1.00 15.00 ?  303 ASN A O    7  
ATOM   4907  C CB   . ASN A 1 25 ? -1.035  -1.912  11.938  1.00 15.00 ?  303 ASN A CB   7  
ATOM   4908  C CG   . ASN A 1 25 ? -1.882  -0.915  12.705  1.00 15.00 ?  303 ASN A CG   7  
ATOM   4909  O OD1  . ASN A 1 25 ? -1.528  -0.480  13.803  1.00 15.00 ?  303 ASN A OD1  7  
ATOM   4910  N ND2  . ASN A 1 25 ? -3.013  -0.545  12.129  1.00 15.00 ?  303 ASN A ND2  7  
ATOM   4911  H H    . ASN A 1 25 ? 0.607   0.042   11.103  1.00 15.00 ?  303 ASN A H    7  
ATOM   4912  H HA   . ASN A 1 25 ? 0.629   -1.934  13.274  1.00 15.00 ?  303 ASN A HA   7  
ATOM   4913  H HB2  . ASN A 1 25 ? -1.211  -1.763  10.884  1.00 15.00 ?  303 ASN A HB2  7  
ATOM   4914  H HB3  . ASN A 1 25 ? -1.350  -2.909  12.212  1.00 15.00 ?  303 ASN A HB3  7  
ATOM   4915  H HD21 . ASN A 1 25 ? -3.231  -0.932  11.250  1.00 15.00 ?  303 ASN A HD21 7  
ATOM   4916  H HD22 . ASN A 1 25 ? -3.593  0.091   12.601  1.00 15.00 ?  303 ASN A HD22 7  
ATOM   4917  N N    . ARG A 1 26 ? 1.992   -2.405  10.420  1.00 15.00 ?  304 ARG A N    7  
ATOM   4918  C CA   . ARG A 1 26 ? 2.730   -3.321  9.544   1.00 15.00 ?  304 ARG A CA   7  
ATOM   4919  C C    . ARG A 1 26 ? 1.769   -4.161  8.704   1.00 15.00 ?  304 ARG A C    7  
ATOM   4920  O O    . ARG A 1 26 ? 1.844   -5.394  8.686   1.00 15.00 ?  304 ARG A O    7  
ATOM   4921  C CB   . ARG A 1 26 ? 3.686   -4.227  10.338  1.00 15.00 ?  304 ARG A CB   7  
ATOM   4922  C CG   . ARG A 1 26 ? 5.086   -3.652  10.508  1.00 15.00 ?  304 ARG A CG   7  
ATOM   4923  C CD   . ARG A 1 26 ? 5.090   -2.359  11.309  1.00 15.00 ?  304 ARG A CD   7  
ATOM   4924  N NE   . ARG A 1 26 ? 4.848   -2.585  12.733  1.00 15.00 ?  304 ARG A NE   7  
ATOM   4925  C CZ   . ARG A 1 26 ? 4.875   -1.620  13.651  1.00 15.00 ?  304 ARG A CZ   7  
ATOM   4926  N NH1  . ARG A 1 26 ? 5.071   -0.358  13.289  1.00 15.00 1  304 ARG A NH1  7  
ATOM   4927  N NH2  . ARG A 1 26 ? 4.694   -1.911  14.931  1.00 15.00 ?  304 ARG A NH2  7  
ATOM   4928  H H    . ARG A 1 26 ? 2.035   -1.448  10.234  1.00 15.00 ?  304 ARG A H    7  
ATOM   4929  H HA   . ARG A 1 26 ? 3.315   -2.711  8.872   1.00 15.00 ?  304 ARG A HA   7  
ATOM   4930  H HB2  . ARG A 1 26 ? 3.270   -4.397  11.319  1.00 15.00 ?  304 ARG A HB2  7  
ATOM   4931  H HB3  . ARG A 1 26 ? 3.770   -5.174  9.825   1.00 15.00 ?  304 ARG A HB3  7  
ATOM   4932  H HG2  . ARG A 1 26 ? 5.700   -4.378  11.021  1.00 15.00 ?  304 ARG A HG2  7  
ATOM   4933  H HG3  . ARG A 1 26 ? 5.502   -3.459  9.531   1.00 15.00 ?  304 ARG A HG3  7  
ATOM   4934  H HD2  . ARG A 1 26 ? 6.051   -1.882  11.191  1.00 15.00 ?  304 ARG A HD2  7  
ATOM   4935  H HD3  . ARG A 1 26 ? 4.318   -1.709  10.923  1.00 15.00 ?  304 ARG A HD3  7  
ATOM   4936  H HE   . ARG A 1 26 ? 4.669   -3.514  13.020  1.00 15.00 ?  304 ARG A HE   7  
ATOM   4937  H HH11 . ARG A 1 26 ? 5.202   -0.121  12.321  1.00 15.00 ?  304 ARG A HH11 7  
ATOM   4938  H HH12 . ARG A 1 26 ? 5.070   0.377   13.983  1.00 15.00 ?  304 ARG A HH12 7  
ATOM   4939  H HH21 . ARG A 1 26 ? 4.534   -2.862  15.218  1.00 15.00 ?  304 ARG A HH21 7  
ATOM   4940  H HH22 . ARG A 1 26 ? 4.717   -1.179  15.624  1.00 15.00 ?  304 ARG A HH22 7  
ATOM   4941  N N    . THR A 1 27 ? 0.874   -3.482  8.001   1.00 15.00 ?  305 THR A N    7  
ATOM   4942  C CA   . THR A 1 27 ? -0.133  -4.157  7.183   1.00 15.00 ?  305 THR A CA   7  
ATOM   4943  C C    . THR A 1 27 ? 0.217   -4.061  5.700   1.00 15.00 ?  305 THR A C    7  
ATOM   4944  O O    . THR A 1 27 ? 0.624   -3.001  5.220   1.00 15.00 ?  305 THR A O    7  
ATOM   4945  C CB   . THR A 1 27 ? -1.534  -3.557  7.419   1.00 15.00 ?  305 THR A CB   7  
ATOM   4946  O OG1  . THR A 1 27 ? -1.780  -3.433  8.826   1.00 15.00 ?  305 THR A OG1  7  
ATOM   4947  C CG2  . THR A 1 27 ? -2.618  -4.421  6.790   1.00 15.00 ?  305 THR A CG2  7  
ATOM   4948  H H    . THR A 1 27 ? 0.891   -2.491  8.034   1.00 15.00 ?  305 THR A H    7  
ATOM   4949  H HA   . THR A 1 27 ? -0.155  -5.199  7.471   1.00 15.00 ?  305 THR A HA   7  
ATOM   4950  H HB   . THR A 1 27 ? -1.569  -2.576  6.967   1.00 15.00 ?  305 THR A HB   7  
ATOM   4951  H HG1  . THR A 1 27 ? -1.250  -2.686  9.171   1.00 15.00 ?  305 THR A HG1  7  
ATOM   4952  H HG21 . THR A 1 27 ? -2.588  -5.409  7.225   1.00 15.00 ?  305 THR A HG21 7  
ATOM   4953  H HG22 . THR A 1 27 ? -2.452  -4.490  5.725   1.00 15.00 ?  305 THR A HG22 7  
ATOM   4954  H HG23 . THR A 1 27 ? -3.584  -3.977  6.977   1.00 15.00 ?  305 THR A HG23 7  
ATOM   4955  N N    . THR A 1 28 ? 0.062   -5.172  4.983   1.00 15.00 ?  306 THR A N    7  
ATOM   4956  C CA   . THR A 1 28 ? 0.391   -5.230  3.564   1.00 15.00 ?  306 THR A CA   7  
ATOM   4957  C C    . THR A 1 28 ? -0.762  -5.828  2.750   1.00 15.00 ?  306 THR A C    7  
ATOM   4958  O O    . THR A 1 28 ? -1.130  -6.985  2.952   1.00 15.00 ?  306 THR A O    7  
ATOM   4959  C CB   . THR A 1 28 ? 1.672   -6.061  3.343   1.00 15.00 ?  306 THR A CB   7  
ATOM   4960  O OG1  . THR A 1 28 ? 1.584   -7.303  4.065   1.00 15.00 ?  306 THR A OG1  7  
ATOM   4961  C CG2  . THR A 1 28 ? 2.901   -5.290  3.805   1.00 15.00 ?  306 THR A CG2  7  
ATOM   4962  H H    . THR A 1 28 ? -0.280  -5.983  5.422   1.00 15.00 ?  306 THR A H    7  
ATOM   4963  H HA   . THR A 1 28 ? 0.577   -4.223  3.220   1.00 15.00 ?  306 THR A HA   7  
ATOM   4964  H HB   . THR A 1 28 ? 1.771   -6.272  2.288   1.00 15.00 ?  306 THR A HB   7  
ATOM   4965  H HG1  . THR A 1 28 ? 0.697   -7.672  3.955   1.00 15.00 ?  306 THR A HG1  7  
ATOM   4966  H HG21 . THR A 1 28 ? 2.978   -4.368  3.248   1.00 15.00 ?  306 THR A HG21 7  
ATOM   4967  H HG22 . THR A 1 28 ? 3.785   -5.886  3.637   1.00 15.00 ?  306 THR A HG22 7  
ATOM   4968  H HG23 . THR A 1 28 ? 2.811   -5.067  4.858   1.00 15.00 ?  306 THR A HG23 7  
ATOM   4969  N N    . GLN A 1 29 ? -1.340  -5.039  1.839   1.00 15.00 ?  307 GLN A N    7  
ATOM   4970  C CA   . GLN A 1 29 ? -2.523  -5.490  1.070   1.00 15.00 ?  307 GLN A CA   7  
ATOM   4971  C C    . GLN A 1 29 ? -2.558  -4.890  -0.339  1.00 15.00 ?  307 GLN A C    7  
ATOM   4972  O O    . GLN A 1 29 ? -2.375  -3.696  -0.499  1.00 15.00 ?  307 GLN A O    7  
ATOM   4973  C CB   . GLN A 1 29 ? -3.825  -5.080  1.778   1.00 15.00 ?  307 GLN A CB   7  
ATOM   4974  C CG   . GLN A 1 29 ? -3.932  -5.509  3.231   1.00 15.00 ?  307 GLN A CG   7  
ATOM   4975  C CD   . GLN A 1 29 ? -5.322  -5.292  3.806   1.00 15.00 ?  307 GLN A CD   7  
ATOM   4976  O OE1  . GLN A 1 29 ? -5.750  -6.013  4.706   1.00 15.00 ?  307 GLN A OE1  7  
ATOM   4977  N NE2  . GLN A 1 29 ? -6.038  -4.301  3.294   1.00 15.00 ?  307 GLN A NE2  7  
ATOM   4978  H H    . GLN A 1 29 ? -0.956  -4.140  1.671   1.00 15.00 ?  307 GLN A H    7  
ATOM   4979  H HA   . GLN A 1 29 ? -2.485  -6.565  0.997   1.00 15.00 ?  307 GLN A HA   7  
ATOM   4980  H HB2  . GLN A 1 29 ? -3.907  -4.005  1.743   1.00 15.00 ?  307 GLN A HB2  7  
ATOM   4981  H HB3  . GLN A 1 29 ? -4.658  -5.508  1.238   1.00 15.00 ?  307 GLN A HB3  7  
ATOM   4982  H HG2  . GLN A 1 29 ? -3.687  -6.557  3.304   1.00 15.00 ?  307 GLN A HG2  7  
ATOM   4983  H HG3  . GLN A 1 29 ? -3.229  -4.932  3.813   1.00 15.00 ?  307 GLN A HG3  7  
ATOM   4984  H HE21 . GLN A 1 29 ? -5.643  -3.763  2.576   1.00 15.00 ?  307 GLN A HE21 7  
ATOM   4985  H HE22 . GLN A 1 29 ? -6.942  -4.146  3.654   1.00 15.00 ?  307 GLN A HE22 7  
ATOM   4986  N N    . PHE A 1 30 ? -2.845  -5.703  -1.356  1.00 15.00 ?  308 PHE A N    7  
ATOM   4987  C CA   . PHE A 1 30 ? -3.057  -5.173  -2.709  1.00 15.00 ?  308 PHE A CA   7  
ATOM   4988  C C    . PHE A 1 30 ? -4.404  -4.477  -2.845  1.00 15.00 ?  308 PHE A C    7  
ATOM   4989  O O    . PHE A 1 30 ? -4.591  -3.647  -3.734  1.00 15.00 ?  308 PHE A O    7  
ATOM   4990  C CB   . PHE A 1 30 ? -2.969  -6.261  -3.780  1.00 15.00 ?  308 PHE A CB   7  
ATOM   4991  C CG   . PHE A 1 30 ? -1.598  -6.477  -4.345  1.00 15.00 ?  308 PHE A CG   7  
ATOM   4992  C CD1  . PHE A 1 30 ? -0.891  -5.418  -4.890  1.00 15.00 ?  308 PHE A CD1  7  
ATOM   4993  C CD2  . PHE A 1 30 ? -1.036  -7.738  -4.375  1.00 15.00 ?  308 PHE A CD2  7  
ATOM   4994  C CE1  . PHE A 1 30 ? 0.356   -5.614  -5.450  1.00 15.00 ?  308 PHE A CE1  7  
ATOM   4995  C CE2  . PHE A 1 30 ? 0.208   -7.937  -4.926  1.00 15.00 ?  308 PHE A CE2  7  
ATOM   4996  C CZ   . PHE A 1 30 ? 0.905   -6.875  -5.465  1.00 15.00 ?  308 PHE A CZ   7  
ATOM   4997  H H    . PHE A 1 30 ? -2.920  -6.676  -1.200  1.00 15.00 ?  308 PHE A H    7  
ATOM   4998  H HA   . PHE A 1 30 ? -2.279  -4.447  -2.894  1.00 15.00 ?  308 PHE A HA   7  
ATOM   4999  H HB2  . PHE A 1 30 ? -3.298  -7.197  -3.354  1.00 15.00 ?  308 PHE A HB2  7  
ATOM   5000  H HB3  . PHE A 1 30 ? -3.626  -5.999  -4.595  1.00 15.00 ?  308 PHE A HB3  7  
ATOM   5001  H HD1  . PHE A 1 30 ? -1.319  -4.429  -4.866  1.00 15.00 ?  308 PHE A HD1  7  
ATOM   5002  H HD2  . PHE A 1 30 ? -1.581  -8.574  -3.962  1.00 15.00 ?  308 PHE A HD2  7  
ATOM   5003  H HE1  . PHE A 1 30 ? 0.897   -4.783  -5.879  1.00 15.00 ?  308 PHE A HE1  7  
ATOM   5004  H HE2  . PHE A 1 30 ? 0.640   -8.928  -4.938  1.00 15.00 ?  308 PHE A HE2  7  
ATOM   5005  H HZ   . PHE A 1 30 ? 1.876   -7.035  -5.909  1.00 15.00 ?  308 PHE A HZ   7  
ATOM   5006  N N    . THR A 1 31 ? -5.352  -4.840  -1.997  1.00 15.00 ?  309 THR A N    7  
ATOM   5007  C CA   . THR A 1 31 ? -6.678  -4.260  -2.079  1.00 15.00 ?  309 THR A CA   7  
ATOM   5008  C C    . THR A 1 31 ? -6.664  -2.818  -1.568  1.00 15.00 ?  309 THR A C    7  
ATOM   5009  O O    . THR A 1 31 ? -6.199  -2.539  -0.459  1.00 15.00 ?  309 THR A O    7  
ATOM   5010  C CB   . THR A 1 31 ? -7.725  -5.114  -1.321  1.00 15.00 ?  309 THR A CB   7  
ATOM   5011  O OG1  . THR A 1 31 ? -9.034  -4.564  -1.508  1.00 15.00 ?  309 THR A OG1  7  
ATOM   5012  C CG2  . THR A 1 31 ? -7.414  -5.210  0.167   1.00 15.00 ?  309 THR A CG2  7  
ATOM   5013  H H    . THR A 1 31 ? -5.155  -5.505  -1.310  1.00 15.00 ?  309 THR A H    7  
ATOM   5014  H HA   . THR A 1 31 ? -6.956  -4.245  -3.124  1.00 15.00 ?  309 THR A HA   7  
ATOM   5015  H HB   . THR A 1 31 ? -7.710  -6.112  -1.737  1.00 15.00 ?  309 THR A HB   7  
ATOM   5016  H HG1  . THR A 1 31 ? -9.559  -4.691  -0.703  1.00 15.00 ?  309 THR A HG1  7  
ATOM   5017  H HG21 . THR A 1 31 ? -6.445  -5.667  0.303   1.00 15.00 ?  309 THR A HG21 7  
ATOM   5018  H HG22 . THR A 1 31 ? -8.167  -5.813  0.654   1.00 15.00 ?  309 THR A HG22 7  
ATOM   5019  H HG23 . THR A 1 31 ? -7.411  -4.220  0.599   1.00 15.00 ?  309 THR A HG23 7  
ATOM   5020  N N    . ASP A 1 32 ? -7.149  -1.906  -2.398  1.00 15.00 ?  310 ASP A N    7  
ATOM   5021  C CA   . ASP A 1 32 ? -7.114  -0.485  -2.077  1.00 15.00 ?  310 ASP A CA   7  
ATOM   5022  C C    . ASP A 1 32 ? -8.523  0.077   -1.938  1.00 15.00 ?  310 ASP A C    7  
ATOM   5023  O O    . ASP A 1 32 ? -9.309  0.065   -2.888  1.00 15.00 ?  310 ASP A O    7  
ATOM   5024  C CB   . ASP A 1 32 ? -6.312  0.279   -3.143  1.00 15.00 ?  310 ASP A CB   7  
ATOM   5025  C CG   . ASP A 1 32 ? -6.336  1.790   -2.967  1.00 15.00 ?  310 ASP A CG   7  
ATOM   5026  O OD1  . ASP A 1 32 ? -6.541  2.266   -1.835  1.00 15.00 ?  310 ASP A OD1  7  
ATOM   5027  O OD2  . ASP A 1 32 ? -6.126  2.508   -3.971  1.00 15.00 -1 310 ASP A OD2  7  
ATOM   5028  H H    . ASP A 1 32 ? -7.542  -2.194  -3.245  1.00 15.00 ?  310 ASP A H    7  
ATOM   5029  H HA   . ASP A 1 32 ? -6.618  -0.387  -1.129  1.00 15.00 ?  310 ASP A HA   7  
ATOM   5030  H HB2  . ASP A 1 32 ? -5.284  -0.043  -3.099  1.00 15.00 ?  310 ASP A HB2  7  
ATOM   5031  H HB3  . ASP A 1 32 ? -6.707  0.043   -4.119  1.00 15.00 ?  310 ASP A HB3  7  
ATOM   5032  N N    . PRO A 1 33 ? -8.853  0.569   -0.732  1.00 15.00 ?  311 PRO A N    7  
ATOM   5033  C CA   . PRO A 1 33 ? -10.173 1.124   -0.417  1.00 15.00 ?  311 PRO A CA   7  
ATOM   5034  C C    . PRO A 1 33 ? -10.426 2.486   -1.068  1.00 15.00 ?  311 PRO A C    7  
ATOM   5035  O O    . PRO A 1 33 ? -11.559 2.961   -1.097  1.00 15.00 ?  311 PRO A O    7  
ATOM   5036  C CB   . PRO A 1 33 ? -10.139 1.258   1.109   1.00 15.00 ?  311 PRO A CB   7  
ATOM   5037  C CG   . PRO A 1 33 ? -8.700  1.456   1.428   1.00 15.00 ?  311 PRO A CG   7  
ATOM   5038  C CD   . PRO A 1 33 ? -7.948  0.613   0.436   1.00 15.00 ?  311 PRO A CD   7  
ATOM   5039  H HA   . PRO A 1 33 ? -10.961 0.443   -0.699  1.00 15.00 ?  311 PRO A HA   7  
ATOM   5040  H HB2  . PRO A 1 33 ? -10.736 2.105   1.420   1.00 15.00 ?  311 PRO A HB2  7  
ATOM   5041  H HB3  . PRO A 1 33 ? -10.521 0.355   1.562   1.00 15.00 ?  311 PRO A HB3  7  
ATOM   5042  H HG2  . PRO A 1 33 ? -8.437  2.499   1.312   1.00 15.00 ?  311 PRO A HG2  7  
ATOM   5043  H HG3  . PRO A 1 33 ? -8.498  1.124   2.435   1.00 15.00 ?  311 PRO A HG3  7  
ATOM   5044  H HD2  . PRO A 1 33 ? -7.007  1.080   0.180   1.00 15.00 ?  311 PRO A HD2  7  
ATOM   5045  H HD3  . PRO A 1 33 ? -7.782  -0.379  0.832   1.00 15.00 ?  311 PRO A HD3  7  
ATOM   5046  N N    . ARG A 1 34 ? -9.366  3.122   -1.558  1.00 15.00 ?  312 ARG A N    7  
ATOM   5047  C CA   . ARG A 1 34 ? -9.459  4.475   -2.115  1.00 15.00 ?  312 ARG A CA   7  
ATOM   5048  C C    . ARG A 1 34 ? -10.297 4.535   -3.393  1.00 15.00 ?  312 ARG A C    7  
ATOM   5049  O O    . ARG A 1 34 ? -10.668 5.621   -3.840  1.00 15.00 ?  312 ARG A O    7  
ATOM   5050  C CB   . ARG A 1 34 ? -8.064  5.035   -2.381  1.00 15.00 ?  312 ARG A CB   7  
ATOM   5051  C CG   . ARG A 1 34 ? -7.289  5.378   -1.117  1.00 15.00 ?  312 ARG A CG   7  
ATOM   5052  C CD   . ARG A 1 34 ? -7.696  6.732   -0.546  1.00 15.00 ?  312 ARG A CD   7  
ATOM   5053  N NE   . ARG A 1 34 ? -9.066  6.747   -0.019  1.00 15.00 ?  312 ARG A NE   7  
ATOM   5054  C CZ   . ARG A 1 34 ? -9.651  7.836   0.486   1.00 15.00 ?  312 ARG A CZ   7  
ATOM   5055  N NH1  . ARG A 1 34 ? -8.995  8.988   0.507   1.00 15.00 1  312 ARG A NH1  7  
ATOM   5056  N NH2  . ARG A 1 34 ? -10.888 7.772   0.966   1.00 15.00 ?  312 ARG A NH2  7  
ATOM   5057  H H    . ARG A 1 34 ? -8.489  2.668   -1.551  1.00 15.00 ?  312 ARG A H    7  
ATOM   5058  H HA   . ARG A 1 34 ? -9.936  5.094   -1.369  1.00 15.00 ?  312 ARG A HA   7  
ATOM   5059  H HB2  . ARG A 1 34 ? -7.497  4.304   -2.938  1.00 15.00 ?  312 ARG A HB2  7  
ATOM   5060  H HB3  . ARG A 1 34 ? -8.158  5.933   -2.974  1.00 15.00 ?  312 ARG A HB3  7  
ATOM   5061  H HG2  . ARG A 1 34 ? -7.483  4.618   -0.377  1.00 15.00 ?  312 ARG A HG2  7  
ATOM   5062  H HG3  . ARG A 1 34 ? -6.235  5.393   -1.346  1.00 15.00 ?  312 ARG A HG3  7  
ATOM   5063  H HD2  . ARG A 1 34 ? -7.018  6.987   0.253   1.00 15.00 ?  312 ARG A HD2  7  
ATOM   5064  H HD3  . ARG A 1 34 ? -7.615  7.473   -1.330  1.00 15.00 ?  312 ARG A HD3  7  
ATOM   5065  H HE   . ARG A 1 34 ? -9.567  5.904   -0.039  1.00 15.00 ?  312 ARG A HE   7  
ATOM   5066  H HH11 . ARG A 1 34 ? -8.062  9.048   0.143   1.00 15.00 ?  312 ARG A HH11 7  
ATOM   5067  H HH12 . ARG A 1 34 ? -9.428  9.815   0.898   1.00 15.00 ?  312 ARG A HH12 7  
ATOM   5068  H HH21 . ARG A 1 34 ? -11.395 6.903   0.955   1.00 15.00 ?  312 ARG A HH21 7  
ATOM   5069  H HH22 . ARG A 1 34 ? -11.331 8.599   1.336   1.00 15.00 ?  312 ARG A HH22 7  
ATOM   5070  N N    . LEU A 1 35 ? -10.566 3.385   -3.997  1.00 15.00 ?  313 LEU A N    7  
ATOM   5071  C CA   . LEU A 1 35 ? -11.379 3.342   -5.207  1.00 15.00 ?  313 LEU A CA   7  
ATOM   5072  C C    . LEU A 1 35 ? -12.859 3.466   -4.862  1.00 15.00 ?  313 LEU A C    7  
ATOM   5073  O O    . LEU A 1 35 ? -13.456 4.525   -5.155  1.00 15.00 ?  313 LEU A O    7  
ATOM   5074  C CB   . LEU A 1 35 ? -11.130 2.056   -6.004  1.00 15.00 ?  313 LEU A CB   7  
ATOM   5075  C CG   . LEU A 1 35 ? -9.816  2.008   -6.796  1.00 15.00 ?  313 LEU A CG   7  
ATOM   5076  C CD1  . LEU A 1 35 ? -8.620  1.828   -5.874  1.00 15.00 ?  313 LEU A CD1  7  
ATOM   5077  C CD2  . LEU A 1 35 ? -9.863  0.901   -7.835  1.00 15.00 ?  313 LEU A CD2  7  
ATOM   5078  H H    . LEU A 1 35 ? -10.223 2.551   -3.617  1.00 15.00 ?  313 LEU A H    7  
ATOM   5079  H HA   . LEU A 1 35 ? -11.098 4.188   -5.817  1.00 15.00 ?  313 LEU A HA   7  
ATOM   5080  H HB2  . LEU A 1 35 ? -11.138 1.225   -5.313  1.00 15.00 ?  313 LEU A HB2  7  
ATOM   5081  H HB3  . LEU A 1 35 ? -11.945 1.928   -6.700  1.00 15.00 ?  313 LEU A HB3  7  
ATOM   5082  H HG   . LEU A 1 35 ? -9.690  2.945   -7.316  1.00 15.00 ?  313 LEU A HG   7  
ATOM   5083  H HD11 . LEU A 1 35 ? -8.718  0.898   -5.331  1.00 15.00 ?  313 LEU A HD11 7  
ATOM   5084  H HD12 . LEU A 1 35 ? -8.578  2.650   -5.175  1.00 15.00 ?  313 LEU A HD12 7  
ATOM   5085  H HD13 . LEU A 1 35 ? -7.713  1.806   -6.461  1.00 15.00 ?  313 LEU A HD13 7  
ATOM   5086  H HD21 . LEU A 1 35 ? -8.929  0.877   -8.376  1.00 15.00 ?  313 LEU A HD21 7  
ATOM   5087  H HD22 . LEU A 1 35 ? -10.673 1.088   -8.524  1.00 15.00 ?  313 LEU A HD22 7  
ATOM   5088  H HD23 . LEU A 1 35 ? -10.019 -0.048  -7.344  1.00 15.00 ?  313 LEU A HD23 7  
ATOM   5089  N N    . ASP B 2 2  ? 1.135   -9.453  -10.539 1.00 15.00 ?  221 ASP B N    7  
ATOM   5090  C CA   . ASP B 2 2  ? 1.584   -8.965  -9.212  1.00 15.00 ?  221 ASP B CA   7  
ATOM   5091  C C    . ASP B 2 2  ? 1.745   -10.118 -8.232  1.00 15.00 ?  221 ASP B C    7  
ATOM   5092  O O    . ASP B 2 2  ? 0.850   -10.949 -8.075  1.00 15.00 ?  221 ASP B O    7  
ATOM   5093  C CB   . ASP B 2 2  ? 0.596   -7.937  -8.638  1.00 15.00 ?  221 ASP B CB   7  
ATOM   5094  C CG   . ASP B 2 2  ? -0.844  -8.417  -8.668  1.00 15.00 ?  221 ASP B CG   7  
ATOM   5095  O OD1  . ASP B 2 2  ? -1.530  -8.175  -9.682  1.00 15.00 ?  221 ASP B OD1  7  
ATOM   5096  O OD2  . ASP B 2 2  ? -1.295  -9.038  -7.688  1.00 15.00 -1 221 ASP B OD2  7  
ATOM   5097  H H    . ASP B 2 2  ? 0.195   -9.893  -10.459 1.00 15.00 ?  221 ASP B H    7  
ATOM   5098  H HA   . ASP B 2 2  ? 2.547   -8.492  -9.339  1.00 15.00 ?  221 ASP B HA   7  
ATOM   5099  H HB2  . ASP B 2 2  ? 0.861   -7.736  -7.610  1.00 15.00 ?  221 ASP B HB2  7  
ATOM   5100  H HB3  . ASP B 2 2  ? 0.666   -7.018  -9.200  1.00 15.00 ?  221 ASP B HB3  7  
ATOM   5101  N N    . THR B 2 3  ? 2.900   -10.166 -7.588  1.00 15.00 ?  222 THR B N    7  
ATOM   5102  C CA   . THR B 2 3  ? 3.157   -11.124 -6.530  1.00 15.00 ?  222 THR B CA   7  
ATOM   5103  C C    . THR B 2 3  ? 2.666   -10.565 -5.201  1.00 15.00 ?  222 THR B C    7  
ATOM   5104  O O    . THR B 2 3  ? 2.657   -9.348  -5.023  1.00 15.00 ?  222 THR B O    7  
ATOM   5105  C CB   . THR B 2 3  ? 4.661   -11.436 -6.445  1.00 15.00 ?  222 THR B CB   7  
ATOM   5106  O OG1  . THR B 2 3  ? 5.413   -10.219 -6.588  1.00 15.00 ?  222 THR B OG1  7  
ATOM   5107  C CG2  . THR B 2 3  ? 5.073   -12.427 -7.524  1.00 15.00 ?  222 THR B CG2  7  
ATOM   5108  H H    . THR B 2 3  ? 3.608   -9.534  -7.825  1.00 15.00 ?  222 THR B H    7  
ATOM   5109  H HA   . THR B 2 3  ? 2.619   -12.033 -6.754  1.00 15.00 ?  222 THR B HA   7  
ATOM   5110  H HB   . THR B 2 3  ? 4.870   -11.869 -5.477  1.00 15.00 ?  222 THR B HB   7  
ATOM   5111  H HG1  . THR B 2 3  ? 6.357   -10.431 -6.664  1.00 15.00 ?  222 THR B HG1  7  
ATOM   5112  H HG21 . THR B 2 3  ? 4.523   -13.347 -7.397  1.00 15.00 ?  222 THR B HG21 7  
ATOM   5113  H HG22 . THR B 2 3  ? 6.131   -12.627 -7.443  1.00 15.00 ?  222 THR B HG22 7  
ATOM   5114  H HG23 . THR B 2 3  ? 4.859   -12.010 -8.497  1.00 15.00 ?  222 THR B HG23 7  
ATOM   5115  N N    . PRO B 2 4  ? 2.275   -11.440 -4.251  1.00 15.00 ?  223 PRO B N    7  
ATOM   5116  C CA   . PRO B 2 4  ? 1.657   -11.026 -2.980  1.00 15.00 ?  223 PRO B CA   7  
ATOM   5117  C C    . PRO B 2 4  ? 2.434   -9.912  -2.281  1.00 15.00 ?  223 PRO B C    7  
ATOM   5118  O O    . PRO B 2 4  ? 3.665   -9.875  -2.335  1.00 15.00 ?  223 PRO B O    7  
ATOM   5119  C CB   . PRO B 2 4  ? 1.696   -12.307 -2.146  1.00 15.00 ?  223 PRO B CB   7  
ATOM   5120  C CG   . PRO B 2 4  ? 1.636   -13.403 -3.146  1.00 15.00 ?  223 PRO B CG   7  
ATOM   5121  C CD   . PRO B 2 4  ? 2.389   -12.908 -4.352  1.00 15.00 ?  223 PRO B CD   7  
ATOM   5122  H HA   . PRO B 2 4  ? 0.633   -10.716 -3.123  1.00 15.00 ?  223 PRO B HA   7  
ATOM   5123  H HB2  . PRO B 2 4  ? 2.613   -12.340 -1.575  1.00 15.00 ?  223 PRO B HB2  7  
ATOM   5124  H HB3  . PRO B 2 4  ? 0.847   -12.333 -1.480  1.00 15.00 ?  223 PRO B HB3  7  
ATOM   5125  H HG2  . PRO B 2 4  ? 2.107   -14.290 -2.748  1.00 15.00 ?  223 PRO B HG2  7  
ATOM   5126  H HG3  . PRO B 2 4  ? 0.607   -13.608 -3.405  1.00 15.00 ?  223 PRO B HG3  7  
ATOM   5127  H HD2  . PRO B 2 4  ? 3.421   -13.219 -4.305  1.00 15.00 ?  223 PRO B HD2  7  
ATOM   5128  H HD3  . PRO B 2 4  ? 1.925   -13.268 -5.258  1.00 15.00 ?  223 PRO B HD3  7  
ATOM   5129  N N    . PRO B 2 5  ? 1.711   -9.010  -1.586  1.00 15.00 ?  224 PRO B N    7  
ATOM   5130  C CA   . PRO B 2 5  ? 2.271   -7.762  -1.063  1.00 15.00 ?  224 PRO B CA   7  
ATOM   5131  C C    . PRO B 2 5  ? 3.535   -7.976  -0.240  1.00 15.00 ?  224 PRO B C    7  
ATOM   5132  O O    . PRO B 2 5  ? 3.530   -8.680  0.774   1.00 15.00 ?  224 PRO B O    7  
ATOM   5133  C CB   . PRO B 2 5  ? 1.150   -7.172  -0.196  1.00 15.00 ?  224 PRO B CB   7  
ATOM   5134  C CG   . PRO B 2 5  ? 0.155   -8.269  -0.025  1.00 15.00 ?  224 PRO B CG   7  
ATOM   5135  C CD   . PRO B 2 5  ? 0.294   -9.156  -1.225  1.00 15.00 ?  224 PRO B CD   7  
ATOM   5136  H HA   . PRO B 2 5  ? 2.494   -7.076  -1.867  1.00 15.00 ?  224 PRO B HA   7  
ATOM   5137  H HB2  . PRO B 2 5  ? 1.555   -6.858  0.755   1.00 15.00 ?  224 PRO B HB2  7  
ATOM   5138  H HB3  . PRO B 2 5  ? 0.712   -6.322  -0.702  1.00 15.00 ?  224 PRO B HB3  7  
ATOM   5139  H HG2  . PRO B 2 5  ? 0.370   -8.823  0.877   1.00 15.00 ?  224 PRO B HG2  7  
ATOM   5140  H HG3  . PRO B 2 5  ? -0.842  -7.854  0.019   1.00 15.00 ?  224 PRO B HG3  7  
ATOM   5141  H HD2  . PRO B 2 5  ? 0.066   -10.180 -0.966  1.00 15.00 ?  224 PRO B HD2  7  
ATOM   5142  H HD3  . PRO B 2 5  ? -0.343  -8.816  -2.023  1.00 15.00 ?  224 PRO B HD3  7  
ATOM   5143  N N    . PRO B 2 6  ? 4.636   -7.367  -0.694  1.00 15.00 ?  225 PRO B N    7  
ATOM   5144  C CA   . PRO B 2 6  ? 5.939   -7.465  -0.038  1.00 15.00 ?  225 PRO B CA   7  
ATOM   5145  C C    . PRO B 2 6  ? 6.008   -6.658  1.253   1.00 15.00 ?  225 PRO B C    7  
ATOM   5146  O O    . PRO B 2 6  ? 5.030   -6.021  1.644   1.00 15.00 ?  225 PRO B O    7  
ATOM   5147  C CB   . PRO B 2 6  ? 6.889   -6.892  -1.087  1.00 15.00 ?  225 PRO B CB   7  
ATOM   5148  C CG   . PRO B 2 6  ? 6.066   -5.940  -1.871  1.00 15.00 ?  225 PRO B CG   7  
ATOM   5149  C CD   . PRO B 2 6  ? 4.689   -6.534  -1.910  1.00 15.00 ?  225 PRO B CD   7  
ATOM   5150  H HA   . PRO B 2 6  ? 6.203   -8.493  0.167   1.00 15.00 ?  225 PRO B HA   7  
ATOM   5151  H HB2  . PRO B 2 6  ? 7.721   -6.400  -0.605  1.00 15.00 ?  225 PRO B HB2  7  
ATOM   5152  H HB3  . PRO B 2 6  ? 7.244   -7.683  -1.709  1.00 15.00 ?  225 PRO B HB3  7  
ATOM   5153  H HG2  . PRO B 2 6  ? 6.051   -4.979  -1.385  1.00 15.00 ?  225 PRO B HG2  7  
ATOM   5154  H HG3  . PRO B 2 6  ? 6.463   -5.850  -2.871  1.00 15.00 ?  225 PRO B HG3  7  
ATOM   5155  H HD2  . PRO B 2 6  ? 3.943   -5.754  -1.875  1.00 15.00 ?  225 PRO B HD2  7  
ATOM   5156  H HD3  . PRO B 2 6  ? 4.563   -7.139  -2.796  1.00 15.00 ?  225 PRO B HD3  7  
ATOM   5157  N N    . ALA B 2 7  ? 7.168   -6.696  1.909   1.00 15.00 ?  226 ALA B N    7  
ATOM   5158  C CA   . ALA B 2 7  ? 7.388   -5.947  3.143   1.00 15.00 ?  226 ALA B CA   7  
ATOM   5159  C C    . ALA B 2 7  ? 7.115   -4.463  2.929   1.00 15.00 ?  226 ALA B C    7  
ATOM   5160  O O    . ALA B 2 7  ? 7.177   -3.969  1.800   1.00 15.00 ?  226 ALA B O    7  
ATOM   5161  C CB   . ALA B 2 7  ? 8.807   -6.156  3.643   1.00 15.00 ?  226 ALA B CB   7  
ATOM   5162  H H    . ALA B 2 7  ? 7.899   -7.237  1.546   1.00 15.00 ?  226 ALA B H    7  
ATOM   5163  H HA   . ALA B 2 7  ? 6.706   -6.326  3.891   1.00 15.00 ?  226 ALA B HA   7  
ATOM   5164  H HB1  . ALA B 2 7  ? 8.943   -5.625  4.574   1.00 15.00 ?  226 ALA B HB1  7  
ATOM   5165  H HB2  . ALA B 2 7  ? 9.506   -5.780  2.909   1.00 15.00 ?  226 ALA B HB2  7  
ATOM   5166  H HB3  . ALA B 2 7  ? 8.983   -7.209  3.800   1.00 15.00 ?  226 ALA B HB3  7  
ATOM   5167  N N    . TYR B 2 8  ? 6.839   -3.747  4.005   1.00 15.00 ?  227 TYR B N    7  
ATOM   5168  C CA   . TYR B 2 8  ? 6.362   -2.385  3.874   1.00 15.00 ?  227 TYR B CA   7  
ATOM   5169  C C    . TYR B 2 8  ? 7.500   -1.370  3.848   1.00 15.00 ?  227 TYR B C    7  
ATOM   5170  O O    . TYR B 2 8  ? 8.441   -1.422  4.643   1.00 15.00 ?  227 TYR B O    7  
ATOM   5171  C CB   . TYR B 2 8  ? 5.364   -2.045  4.983   1.00 15.00 ?  227 TYR B CB   7  
ATOM   5172  C CG   . TYR B 2 8  ? 5.996   -1.517  6.253   1.00 15.00 ?  227 TYR B CG   7  
ATOM   5173  C CD1  . TYR B 2 8  ? 6.573   -2.366  7.189   1.00 15.00 ?  227 TYR B CD1  7  
ATOM   5174  C CD2  . TYR B 2 8  ? 6.028   -0.157  6.502   1.00 15.00 ?  227 TYR B CD2  7  
ATOM   5175  C CE1  . TYR B 2 8  ? 7.161   -1.863  8.338   1.00 15.00 ?  227 TYR B CE1  7  
ATOM   5176  C CE2  . TYR B 2 8  ? 6.608   0.352   7.640   1.00 15.00 ?  227 TYR B CE2  7  
ATOM   5177  C CZ   . TYR B 2 8  ? 7.175   -0.501  8.557   1.00 15.00 ?  227 TYR B CZ   7  
ATOM   5178  O OH   . TYR B 2 8  ? 7.756   0.009   9.696   1.00 15.00 ?  227 TYR B OH   7  
ATOM   5179  H H    . TYR B 2 8  ? 6.956   -4.137  4.894   1.00 15.00 ?  227 TYR B H    7  
ATOM   5180  H HA   . TYR B 2 8  ? 5.846   -2.327  2.928   1.00 15.00 ?  227 TYR B HA   7  
ATOM   5181  H HB2  . TYR B 2 8  ? 4.684   -1.286  4.603   1.00 15.00 ?  227 TYR B HB2  7  
ATOM   5182  H HB3  . TYR B 2 8  ? 4.800   -2.931  5.234   1.00 15.00 ?  227 TYR B HB3  7  
ATOM   5183  H HD1  . TYR B 2 8  ? 6.559   -3.432  7.013   1.00 15.00 ?  227 TYR B HD1  7  
ATOM   5184  H HD2  . TYR B 2 8  ? 5.581   0.518   5.788   1.00 15.00 ?  227 TYR B HD2  7  
ATOM   5185  H HE1  . TYR B 2 8  ? 7.605   -2.535  9.057   1.00 15.00 ?  227 TYR B HE1  7  
ATOM   5186  H HE2  . TYR B 2 8  ? 6.615   1.425   7.801   1.00 15.00 ?  227 TYR B HE2  7  
ATOM   5187  H HH   . TYR B 2 8  ? 8.638   -0.381  9.809   1.00 15.00 ?  227 TYR B HH   7  
ATOM   5188  N N    . LEU B 2 9  ? 7.376   -0.449  2.915   1.00 15.00 ?  228 LEU B N    7  
ATOM   5189  C CA   . LEU B 2 9  ? 8.294   0.664   2.745   1.00 15.00 ?  228 LEU B CA   7  
ATOM   5190  C C    . LEU B 2 9  ? 7.477   1.947   2.652   1.00 15.00 ?  228 LEU B C    7  
ATOM   5191  O O    . LEU B 2 9  ? 6.295   1.891   2.359   1.00 15.00 ?  228 LEU B O    7  
ATOM   5192  C CB   . LEU B 2 9  ? 9.163   0.500   1.483   1.00 15.00 ?  228 LEU B CB   7  
ATOM   5193  C CG   . LEU B 2 9  ? 10.275  -0.558  1.546   1.00 15.00 ?  228 LEU B CG   7  
ATOM   5194  C CD1  . LEU B 2 9  ? 11.049  -0.453  2.848   1.00 15.00 ?  228 LEU B CD1  7  
ATOM   5195  C CD2  . LEU B 2 9  ? 9.715   -1.959  1.356   1.00 15.00 ?  228 LEU B CD2  7  
ATOM   5196  H H    . LEU B 2 9  ? 6.617   -0.515  2.298   1.00 15.00 ?  228 LEU B H    7  
ATOM   5197  H HA   . LEU B 2 9  ? 8.921   0.712   3.623   1.00 15.00 ?  228 LEU B HA   7  
ATOM   5198  H HB2  . LEU B 2 9  ? 8.510   0.248   0.661   1.00 15.00 ?  228 LEU B HB2  7  
ATOM   5199  H HB3  . LEU B 2 9  ? 9.622   1.454   1.271   1.00 15.00 ?  228 LEU B HB3  7  
ATOM   5200  H HG   . LEU B 2 9  ? 10.971  -0.372  0.740   1.00 15.00 ?  228 LEU B HG   7  
ATOM   5201  H HD11 . LEU B 2 9  ? 11.821  -1.210  2.872   1.00 15.00 ?  228 LEU B HD11 7  
ATOM   5202  H HD12 . LEU B 2 9  ? 10.376  -0.600  3.680   1.00 15.00 ?  228 LEU B HD12 7  
ATOM   5203  H HD13 . LEU B 2 9  ? 11.502  0.524   2.920   1.00 15.00 ?  228 LEU B HD13 7  
ATOM   5204  H HD21 . LEU B 2 9  ? 10.520  -2.677  1.398   1.00 15.00 ?  228 LEU B HD21 7  
ATOM   5205  H HD22 . LEU B 2 9  ? 9.223   -2.025  0.397   1.00 15.00 ?  228 LEU B HD22 7  
ATOM   5206  H HD23 . LEU B 2 9  ? 9.005   -2.170  2.141   1.00 15.00 ?  228 LEU B HD23 7  
ATOM   5207  N N    . PRO B 2 10 ? 8.068   3.121   2.876   1.00 15.00 ?  229 PRO B N    7  
ATOM   5208  C CA   . PRO B 2 10 ? 7.319   4.364   2.768   1.00 15.00 ?  229 PRO B CA   7  
ATOM   5209  C C    . PRO B 2 10 ? 7.353   4.880   1.332   1.00 15.00 ?  229 PRO B C    7  
ATOM   5210  O O    . PRO B 2 10 ? 8.306   4.635   0.593   1.00 15.00 ?  229 PRO B O    7  
ATOM   5211  C CB   . PRO B 2 10 ? 8.091   5.325   3.690   1.00 15.00 ?  229 PRO B CB   7  
ATOM   5212  C CG   . PRO B 2 10 ? 9.181   4.515   4.317   1.00 15.00 ?  229 PRO B CG   7  
ATOM   5213  C CD   . PRO B 2 10 ? 9.399   3.333   3.421   1.00 15.00 ?  229 PRO B CD   7  
ATOM   5214  H HA   . PRO B 2 10 ? 6.307   4.246   3.106   1.00 15.00 ?  229 PRO B HA   7  
ATOM   5215  H HB2  . PRO B 2 10 ? 8.498   6.136   3.101   1.00 15.00 ?  229 PRO B HB2  7  
ATOM   5216  H HB3  . PRO B 2 10 ? 7.420   5.725   4.436   1.00 15.00 ?  229 PRO B HB3  7  
ATOM   5217  H HG2  . PRO B 2 10 ? 10.080  5.102   4.386   1.00 15.00 ?  229 PRO B HG2  7  
ATOM   5218  H HG3  . PRO B 2 10 ? 8.872   4.186   5.300   1.00 15.00 ?  229 PRO B HG3  7  
ATOM   5219  H HD2  . PRO B 2 10 ? 10.111  3.558   2.649   1.00 15.00 ?  229 PRO B HD2  7  
ATOM   5220  H HD3  . PRO B 2 10 ? 9.710   2.480   4.000   1.00 15.00 ?  229 PRO B HD3  7  
ATOM   5221  N N    . PRO B 2 11 ? 6.309   5.624   0.929   1.00 15.00 ?  230 PRO B N    7  
ATOM   5222  C CA   . PRO B 2 11 ? 5.828   5.600   -0.443  1.00 15.00 ?  230 PRO B CA   7  
ATOM   5223  C C    . PRO B 2 11 ? 6.462   6.607   -1.386  1.00 15.00 ?  230 PRO B C    7  
ATOM   5224  O O    . PRO B 2 11 ? 6.672   7.774   -1.048  1.00 15.00 ?  230 PRO B O    7  
ATOM   5225  C CB   . PRO B 2 11 ? 4.356   5.939   -0.243  1.00 15.00 ?  230 PRO B CB   7  
ATOM   5226  C CG   . PRO B 2 11 ? 4.349   6.922   0.878   1.00 15.00 ?  230 PRO B CG   7  
ATOM   5227  C CD   . PRO B 2 11 ? 5.545   6.598   1.742   1.00 15.00 ?  230 PRO B CD   7  
ATOM   5228  H HA   . PRO B 2 11 ? 5.903   4.614   -0.871  1.00 15.00 ?  230 PRO B HA   7  
ATOM   5229  H HB2  . PRO B 2 11 ? 3.958   6.368   -1.145  1.00 15.00 ?  230 PRO B HB2  7  
ATOM   5230  H HB3  . PRO B 2 11 ? 3.806   5.045   0.014   1.00 15.00 ?  230 PRO B HB3  7  
ATOM   5231  H HG2  . PRO B 2 11 ? 4.433   7.924   0.484   1.00 15.00 ?  230 PRO B HG2  7  
ATOM   5232  H HG3  . PRO B 2 11 ? 3.438   6.819   1.448   1.00 15.00 ?  230 PRO B HG3  7  
ATOM   5233  H HD2  . PRO B 2 11 ? 6.127   7.492   1.920   1.00 15.00 ?  230 PRO B HD2  7  
ATOM   5234  H HD3  . PRO B 2 11 ? 5.221   6.169   2.674   1.00 15.00 ?  230 PRO B HD3  7  
ATOM   5235  N N    . GLU B 2 12 ? 6.744   6.130   -2.587  1.00 15.00 ?  231 GLU B N    7  
ATOM   5236  C CA   . GLU B 2 12 ? 7.065   6.997   -3.696  1.00 15.00 ?  231 GLU B CA   7  
ATOM   5237  C C    . GLU B 2 12 ? 5.841   7.036   -4.624  1.00 15.00 ?  231 GLU B C    7  
ATOM   5238  O O    . GLU B 2 12 ? 5.418   5.995   -5.124  1.00 15.00 ?  231 GLU B O    7  
ATOM   5239  C CB   . GLU B 2 12 ? 8.322   6.505   -4.433  1.00 15.00 ?  231 GLU B CB   7  
ATOM   5240  C CG   . GLU B 2 12 ? 8.207   5.126   -5.081  1.00 15.00 ?  231 GLU B CG   7  
ATOM   5241  C CD   . GLU B 2 12 ? 9.544   4.632   -5.584  1.00 15.00 ?  231 GLU B CD   7  
ATOM   5242  O OE1  . GLU B 2 12 ? 10.239  5.392   -6.292  1.00 15.00 -1 231 GLU B OE1  7  
ATOM   5243  O OE2  . GLU B 2 12 ? 9.929   3.497   -5.242  1.00 15.00 ?  231 GLU B OE2  7  
ATOM   5244  H H    . GLU B 2 12 ? 6.720   5.164   -2.732  1.00 15.00 ?  231 GLU B H    7  
ATOM   5245  H HA   . GLU B 2 12 ? 7.255   7.980   -3.290  1.00 15.00 ?  231 GLU B HA   7  
ATOM   5246  H HB2  . GLU B 2 12 ? 8.563   7.215   -5.209  1.00 15.00 ?  231 GLU B HB2  7  
ATOM   5247  H HB3  . GLU B 2 12 ? 9.141   6.476   -3.728  1.00 15.00 ?  231 GLU B HB3  7  
ATOM   5248  H HG2  . GLU B 2 12 ? 7.825   4.418   -4.358  1.00 15.00 ?  231 GLU B HG2  7  
ATOM   5249  H HG3  . GLU B 2 12 ? 7.525   5.187   -5.917  1.00 15.00 ?  231 GLU B HG3  7  
ATOM   5250  N N    . ASP B 2 13 ? 5.243   8.206   -4.824  1.00 15.00 ?  232 ASP B N    7  
ATOM   5251  C CA   . ASP B 2 13 ? 3.979   8.286   -5.545  1.00 15.00 ?  232 ASP B CA   7  
ATOM   5252  C C    . ASP B 2 13 ? 3.980   9.465   -6.506  1.00 15.00 ?  232 ASP B C    7  
ATOM   5253  O O    . ASP B 2 13 ? 4.049   10.622  -6.089  1.00 15.00 ?  232 ASP B O    7  
ATOM   5254  C CB   . ASP B 2 13 ? 2.815   8.404   -4.553  1.00 15.00 ?  232 ASP B CB   7  
ATOM   5255  C CG   . ASP B 2 13 ? 1.484   8.679   -5.228  1.00 15.00 ?  232 ASP B CG   7  
ATOM   5256  O OD1  . ASP B 2 13 ? 0.859   7.728   -5.748  1.00 15.00 -1 232 ASP B OD1  7  
ATOM   5257  O OD2  . ASP B 2 13 ? 1.047   9.851   -5.220  1.00 15.00 ?  232 ASP B OD2  7  
ATOM   5258  H H    . ASP B 2 13 ? 5.662   9.038   -4.510  1.00 15.00 ?  232 ASP B H    7  
ATOM   5259  H HA   . ASP B 2 13 ? 3.863   7.375   -6.112  1.00 15.00 ?  232 ASP B HA   7  
ATOM   5260  H HB2  . ASP B 2 13 ? 2.730   7.481   -4.000  1.00 15.00 ?  232 ASP B HB2  7  
ATOM   5261  H HB3  . ASP B 2 13 ? 3.021   9.211   -3.864  1.00 15.00 ?  232 ASP B HB3  7  
ATOM   5262  N N    . PRO B 2 14 ? 3.933   9.181   -7.813  1.00 15.00 ?  233 PRO B N    7  
ATOM   5263  C CA   . PRO B 2 14 ? 3.920   10.203  -8.848  1.00 15.00 ?  233 PRO B CA   7  
ATOM   5264  C C    . PRO B 2 14 ? 2.524   10.778  -9.058  1.00 15.00 ?  233 PRO B C    7  
ATOM   5265  O O    . PRO B 2 14 ? 1.840   10.450  -10.030 1.00 15.00 ?  233 PRO B O    7  
ATOM   5266  C CB   . PRO B 2 14 ? 4.394   9.456   -10.109 1.00 15.00 ?  233 PRO B CB   7  
ATOM   5267  C CG   . PRO B 2 14 ? 4.598   8.026   -9.702  1.00 15.00 ?  233 PRO B CG   7  
ATOM   5268  C CD   . PRO B 2 14 ? 3.890   7.839   -8.390  1.00 15.00 ?  233 PRO B CD   7  
ATOM   5269  H HA   . PRO B 2 14 ? 4.607   11.004  -8.621  1.00 15.00 ?  233 PRO B HA   7  
ATOM   5270  H HB2  . PRO B 2 14 ? 3.641   9.539   -10.876 1.00 15.00 ?  233 PRO B HB2  7  
ATOM   5271  H HB3  . PRO B 2 14 ? 5.317   9.897   -10.461 1.00 15.00 ?  233 PRO B HB3  7  
ATOM   5272  H HG2  . PRO B 2 14 ? 4.174   7.370   -10.449 1.00 15.00 ?  233 PRO B HG2  7  
ATOM   5273  H HG3  . PRO B 2 14 ? 5.654   7.826   -9.590  1.00 15.00 ?  233 PRO B HG3  7  
ATOM   5274  H HD2  . PRO B 2 14 ? 2.872   7.519   -8.550  1.00 15.00 ?  233 PRO B HD2  7  
ATOM   5275  H HD3  . PRO B 2 14 ? 4.421   7.133   -7.769  1.00 15.00 ?  233 PRO B HD3  7  
HETATM 5276  N N    . NH2 B 2 15 ? 2.111   11.649  -8.153  1.00 15.00 ?  234 NH2 B N    7  
HETATM 5277  H HN1  . NH2 B 2 15 ? 2.713   11.858  -7.407  1.00 15.00 ?  234 NH2 B HN1  7  
HETATM 5278  H HN2  . NH2 B 2 15 ? 1.225   12.052  -8.266  1.00 15.00 ?  234 NH2 B HN2  7  
ATOM   5279  N N    . LEU A 1 1  ? -13.662 1.948   -1.593  1.00 15.00 ?  279 LEU A N    8  
ATOM   5280  C CA   . LEU A 1 1  ? -14.897 2.489   -0.986  1.00 15.00 ?  279 LEU A CA   8  
ATOM   5281  C C    . LEU A 1 1  ? -14.841 4.011   -0.895  1.00 15.00 ?  279 LEU A C    8  
ATOM   5282  O O    . LEU A 1 1  ? -15.878 4.666   -0.836  1.00 15.00 ?  279 LEU A O    8  
ATOM   5283  C CB   . LEU A 1 1  ? -15.144 1.903   0.414   1.00 15.00 ?  279 LEU A CB   8  
ATOM   5284  C CG   . LEU A 1 1  ? -15.526 0.417   0.462   1.00 15.00 ?  279 LEU A CG   8  
ATOM   5285  C CD1  . LEU A 1 1  ? -14.317 -0.471  0.217   1.00 15.00 ?  279 LEU A CD1  8  
ATOM   5286  C CD2  . LEU A 1 1  ? -16.164 0.080   1.799   1.00 15.00 ?  279 LEU A CD2  8  
ATOM   5287  H H1   . LEU A 1 1  ? -12.838 2.173   -1.001  1.00 15.00 ?  279 LEU A H1   8  
ATOM   5288  H H2   . LEU A 1 1  ? -13.517 2.369   -2.541  1.00 15.00 ?  279 LEU A H2   8  
ATOM   5289  H H3   . LEU A 1 1  ? -13.732 0.914   -1.700  1.00 15.00 ?  279 LEU A H3   8  
ATOM   5290  H HA   . LEU A 1 1  ? -15.725 2.218   -1.626  1.00 15.00 ?  279 LEU A HA   8  
ATOM   5291  H HB2  . LEU A 1 1  ? -14.244 2.038   0.997   1.00 15.00 ?  279 LEU A HB2  8  
ATOM   5292  H HB3  . LEU A 1 1  ? -15.937 2.467   0.879   1.00 15.00 ?  279 LEU A HB3  8  
ATOM   5293  H HG   . LEU A 1 1  ? -16.250 0.214   -0.313  1.00 15.00 ?  279 LEU A HG   8  
ATOM   5294  H HD11 . LEU A 1 1  ? -14.621 -1.507  0.243   1.00 15.00 ?  279 LEU A HD11 8  
ATOM   5295  H HD12 . LEU A 1 1  ? -13.578 -0.293  0.985   1.00 15.00 ?  279 LEU A HD12 8  
ATOM   5296  H HD13 . LEU A 1 1  ? -13.894 -0.244  -0.751  1.00 15.00 ?  279 LEU A HD13 8  
ATOM   5297  H HD21 . LEU A 1 1  ? -16.429 -0.968  1.815   1.00 15.00 ?  279 LEU A HD21 8  
ATOM   5298  H HD22 . LEU A 1 1  ? -17.052 0.679   1.935   1.00 15.00 ?  279 LEU A HD22 8  
ATOM   5299  H HD23 . LEU A 1 1  ? -15.464 0.287   2.594   1.00 15.00 ?  279 LEU A HD23 8  
ATOM   5300  N N    . GLY A 1 2  ? -13.637 4.579   -0.852  1.00 15.00 ?  280 GLY A N    8  
ATOM   5301  C CA   . GLY A 1 2  ? -13.524 6.023   -0.789  1.00 15.00 ?  280 GLY A CA   8  
ATOM   5302  C C    . GLY A 1 2  ? -12.460 6.526   0.181   1.00 15.00 ?  280 GLY A C    8  
ATOM   5303  O O    . GLY A 1 2  ? -11.498 7.158   -0.248  1.00 15.00 ?  280 GLY A O    8  
ATOM   5304  H H    . GLY A 1 2  ? -12.828 4.021   -0.861  1.00 15.00 ?  280 GLY A H    8  
ATOM   5305  H HA2  . GLY A 1 2  ? -13.287 6.391   -1.776  1.00 15.00 ?  280 GLY A HA2  8  
ATOM   5306  H HA3  . GLY A 1 2  ? -14.481 6.429   -0.492  1.00 15.00 ?  280 GLY A HA3  8  
ATOM   5307  N N    . PRO A 1 3  ? -12.585 6.240   1.494   1.00 15.00 ?  281 PRO A N    8  
ATOM   5308  C CA   . PRO A 1 3  ? -11.755 6.874   2.526   1.00 15.00 ?  281 PRO A CA   8  
ATOM   5309  C C    . PRO A 1 3  ? -10.455 6.126   2.825   1.00 15.00 ?  281 PRO A C    8  
ATOM   5310  O O    . PRO A 1 3  ? -10.375 4.901   2.706   1.00 15.00 ?  281 PRO A O    8  
ATOM   5311  C CB   . PRO A 1 3  ? -12.679 6.819   3.739   1.00 15.00 ?  281 PRO A CB   8  
ATOM   5312  C CG   . PRO A 1 3  ? -13.422 5.535   3.577   1.00 15.00 ?  281 PRO A CG   8  
ATOM   5313  C CD   . PRO A 1 3  ? -13.562 5.305   2.092   1.00 15.00 ?  281 PRO A CD   8  
ATOM   5314  H HA   . PRO A 1 3  ? -11.536 7.902   2.287   1.00 15.00 ?  281 PRO A HA   8  
ATOM   5315  H HB2  . PRO A 1 3  ? -12.091 6.827   4.647   1.00 15.00 ?  281 PRO A HB2  8  
ATOM   5316  H HB3  . PRO A 1 3  ? -13.347 7.666   3.727   1.00 15.00 ?  281 PRO A HB3  8  
ATOM   5317  H HG2  . PRO A 1 3  ? -12.860 4.728   4.027   1.00 15.00 ?  281 PRO A HG2  8  
ATOM   5318  H HG3  . PRO A 1 3  ? -14.396 5.616   4.037   1.00 15.00 ?  281 PRO A HG3  8  
ATOM   5319  H HD2  . PRO A 1 3  ? -13.315 4.283   1.845   1.00 15.00 ?  281 PRO A HD2  8  
ATOM   5320  H HD3  . PRO A 1 3  ? -14.564 5.539   1.768   1.00 15.00 ?  281 PRO A HD3  8  
ATOM   5321  N N    . LEU A 1 4  ? -9.439  6.887   3.225   1.00 15.00 ?  282 LEU A N    8  
ATOM   5322  C CA   . LEU A 1 4  ? -8.141  6.328   3.581   1.00 15.00 ?  282 LEU A CA   8  
ATOM   5323  C C    . LEU A 1 4  ? -7.848  6.598   5.057   1.00 15.00 ?  282 LEU A C    8  
ATOM   5324  O O    . LEU A 1 4  ? -7.757  7.753   5.475   1.00 15.00 ?  282 LEU A O    8  
ATOM   5325  C CB   . LEU A 1 4  ? -7.043  6.947   2.712   1.00 15.00 ?  282 LEU A CB   8  
ATOM   5326  C CG   . LEU A 1 4  ? -5.653  6.312   2.840   1.00 15.00 ?  282 LEU A CG   8  
ATOM   5327  C CD1  . LEU A 1 4  ? -5.628  4.932   2.202   1.00 15.00 ?  282 LEU A CD1  8  
ATOM   5328  C CD2  . LEU A 1 4  ? -4.602  7.210   2.211   1.00 15.00 ?  282 LEU A CD2  8  
ATOM   5329  H H    . LEU A 1 4  ? -9.569  7.856   3.300   1.00 15.00 ?  282 LEU A H    8  
ATOM   5330  H HA   . LEU A 1 4  ? -8.172  5.262   3.413   1.00 15.00 ?  282 LEU A HA   8  
ATOM   5331  H HB2  . LEU A 1 4  ? -7.351  6.873   1.679   1.00 15.00 ?  282 LEU A HB2  8  
ATOM   5332  H HB3  . LEU A 1 4  ? -6.958  7.993   2.967   1.00 15.00 ?  282 LEU A HB3  8  
ATOM   5333  H HG   . LEU A 1 4  ? -5.414  6.199   3.888   1.00 15.00 ?  282 LEU A HG   8  
ATOM   5334  H HD11 . LEU A 1 4  ? -6.102  4.977   1.232   1.00 15.00 ?  282 LEU A HD11 8  
ATOM   5335  H HD12 . LEU A 1 4  ? -6.158  4.232   2.831   1.00 15.00 ?  282 LEU A HD12 8  
ATOM   5336  H HD13 . LEU A 1 4  ? -4.602  4.613   2.083   1.00 15.00 ?  282 LEU A HD13 8  
ATOM   5337  H HD21 . LEU A 1 4  ? -3.650  6.703   2.208   1.00 15.00 ?  282 LEU A HD21 8  
ATOM   5338  H HD22 . LEU A 1 4  ? -4.520  8.119   2.786   1.00 15.00 ?  282 LEU A HD22 8  
ATOM   5339  H HD23 . LEU A 1 4  ? -4.889  7.446   1.197   1.00 15.00 ?  282 LEU A HD23 8  
ATOM   5340  N N    . PRO A 1 5  ? -7.724  5.539   5.867   1.00 15.00 ?  283 PRO A N    8  
ATOM   5341  C CA   . PRO A 1 5  ? -7.443  5.660   7.301   1.00 15.00 ?  283 PRO A CA   8  
ATOM   5342  C C    . PRO A 1 5  ? -6.023  6.155   7.581   1.00 15.00 ?  283 PRO A C    8  
ATOM   5343  O O    . PRO A 1 5  ? -5.067  5.725   6.929   1.00 15.00 ?  283 PRO A O    8  
ATOM   5344  C CB   . PRO A 1 5  ? -7.617  4.228   7.831   1.00 15.00 ?  283 PRO A CB   8  
ATOM   5345  C CG   . PRO A 1 5  ? -8.292  3.474   6.733   1.00 15.00 ?  283 PRO A CG   8  
ATOM   5346  C CD   . PRO A 1 5  ? -7.859  4.135   5.460   1.00 15.00 ?  283 PRO A CD   8  
ATOM   5347  H HA   . PRO A 1 5  ? -8.153  6.316   7.787   1.00 15.00 ?  283 PRO A HA   8  
ATOM   5348  H HB2  . PRO A 1 5  ? -6.647  3.809   8.056   1.00 15.00 ?  283 PRO A HB2  8  
ATOM   5349  H HB3  . PRO A 1 5  ? -8.221  4.246   8.725   1.00 15.00 ?  283 PRO A HB3  8  
ATOM   5350  H HG2  . PRO A 1 5  ? -7.976  2.442   6.745   1.00 15.00 ?  283 PRO A HG2  8  
ATOM   5351  H HG3  . PRO A 1 5  ? -9.364  3.543   6.846   1.00 15.00 ?  283 PRO A HG3  8  
ATOM   5352  H HD2  . PRO A 1 5  ? -6.913  3.732   5.125   1.00 15.00 ?  283 PRO A HD2  8  
ATOM   5353  H HD3  . PRO A 1 5  ? -8.614  4.024   4.697   1.00 15.00 ?  283 PRO A HD3  8  
ATOM   5354  N N    . PRO A 1 6  ? -5.868  7.059   8.565   1.00 15.00 ?  284 PRO A N    8  
ATOM   5355  C CA   . PRO A 1 6  ? -4.553  7.564   8.981   1.00 15.00 ?  284 PRO A CA   8  
ATOM   5356  C C    . PRO A 1 6  ? -3.639  6.437   9.456   1.00 15.00 ?  284 PRO A C    8  
ATOM   5357  O O    . PRO A 1 6  ? -4.027  5.617   10.289  1.00 15.00 ?  284 PRO A O    8  
ATOM   5358  C CB   . PRO A 1 6  ? -4.873  8.518   10.138  1.00 15.00 ?  284 PRO A CB   8  
ATOM   5359  C CG   . PRO A 1 6  ? -6.251  8.160   10.576  1.00 15.00 ?  284 PRO A CG   8  
ATOM   5360  C CD   . PRO A 1 6  ? -6.958  7.656   9.352   1.00 15.00 ?  284 PRO A CD   8  
ATOM   5361  H HA   . PRO A 1 6  ? -4.067  8.108   8.183   1.00 15.00 ?  284 PRO A HA   8  
ATOM   5362  H HB2  . PRO A 1 6  ? -4.157  8.374   10.932  1.00 15.00 ?  284 PRO A HB2  8  
ATOM   5363  H HB3  . PRO A 1 6  ? -4.826  9.539   9.787   1.00 15.00 ?  284 PRO A HB3  8  
ATOM   5364  H HG2  . PRO A 1 6  ? -6.208  7.385   11.328  1.00 15.00 ?  284 PRO A HG2  8  
ATOM   5365  H HG3  . PRO A 1 6  ? -6.753  9.033   10.965  1.00 15.00 ?  284 PRO A HG3  8  
ATOM   5366  H HD2  . PRO A 1 6  ? -7.695  6.912   9.619   1.00 15.00 ?  284 PRO A HD2  8  
ATOM   5367  H HD3  . PRO A 1 6  ? -7.419  8.474   8.818   1.00 15.00 ?  284 PRO A HD3  8  
ATOM   5368  N N    . GLY A 1 7  ? -2.424  6.411   8.926   1.00 15.00 ?  285 GLY A N    8  
ATOM   5369  C CA   . GLY A 1 7  ? -1.507  5.329   9.223   1.00 15.00 ?  285 GLY A CA   8  
ATOM   5370  C C    . GLY A 1 7  ? -1.243  4.493   7.994   1.00 15.00 ?  285 GLY A C    8  
ATOM   5371  O O    . GLY A 1 7  ? -0.303  3.699   7.950   1.00 15.00 ?  285 GLY A O    8  
ATOM   5372  H H    . GLY A 1 7  ? -2.142  7.137   8.328   1.00 15.00 ?  285 GLY A H    8  
ATOM   5373  H HA2  . GLY A 1 7  ? -0.573  5.742   9.579   1.00 15.00 ?  285 GLY A HA2  8  
ATOM   5374  H HA3  . GLY A 1 7  ? -1.933  4.702   9.990   1.00 15.00 ?  285 GLY A HA3  8  
ATOM   5375  N N    . TRP A 1 8  ? -2.082  4.688   6.988   1.00 15.00 ?  286 TRP A N    8  
ATOM   5376  C CA   . TRP A 1 8  ? -1.954  3.978   5.730   1.00 15.00 ?  286 TRP A CA   8  
ATOM   5377  C C    . TRP A 1 8  ? -1.076  4.738   4.767   1.00 15.00 ?  286 TRP A C    8  
ATOM   5378  O O    . TRP A 1 8  ? -1.478  5.764   4.218   1.00 15.00 ?  286 TRP A O    8  
ATOM   5379  C CB   . TRP A 1 8  ? -3.331  3.761   5.084   1.00 15.00 ?  286 TRP A CB   8  
ATOM   5380  C CG   . TRP A 1 8  ? -4.065  2.581   5.623   1.00 15.00 ?  286 TRP A CG   8  
ATOM   5381  C CD1  . TRP A 1 8  ? -4.348  2.318   6.932   1.00 15.00 ?  286 TRP A CD1  8  
ATOM   5382  C CD2  . TRP A 1 8  ? -4.599  1.492   4.863   1.00 15.00 ?  286 TRP A CD2  8  
ATOM   5383  N NE1  . TRP A 1 8  ? -5.001  1.117   7.039   1.00 15.00 ?  286 TRP A NE1  8  
ATOM   5384  C CE2  . TRP A 1 8  ? -5.167  0.588   5.787   1.00 15.00 ?  286 TRP A CE2  8  
ATOM   5385  C CE3  . TRP A 1 8  ? -4.651  1.176   3.494   1.00 15.00 ?  286 TRP A CE3  8  
ATOM   5386  C CZ2  . TRP A 1 8  ? -5.764  -0.605  5.395   1.00 15.00 ?  286 TRP A CZ2  8  
ATOM   5387  C CZ3  . TRP A 1 8  ? -5.240  -0.013  3.118   1.00 15.00 ?  286 TRP A CZ3  8  
ATOM   5388  C CH2  . TRP A 1 8  ? -5.784  -0.893  4.060   1.00 15.00 ?  286 TRP A CH2  8  
ATOM   5389  H H    . TRP A 1 8  ? -2.813  5.330   7.098   1.00 15.00 ?  286 TRP A H    8  
ATOM   5390  H HA   . TRP A 1 8  ? -1.489  3.016   5.931   1.00 15.00 ?  286 TRP A HA   8  
ATOM   5391  H HB2  . TRP A 1 8  ? -3.941  4.639   5.249   1.00 15.00 ?  286 TRP A HB2  8  
ATOM   5392  H HB3  . TRP A 1 8  ? -3.201  3.617   4.021   1.00 15.00 ?  286 TRP A HB3  8  
ATOM   5393  H HD1  . TRP A 1 8  ? -4.078  2.964   7.755   1.00 15.00 ?  286 TRP A HD1  8  
ATOM   5394  H HE1  . TRP A 1 8  ? -5.299  0.705   7.877   1.00 15.00 ?  286 TRP A HE1  8  
ATOM   5395  H HE3  . TRP A 1 8  ? -4.251  1.866   2.700   1.00 15.00 ?  286 TRP A HE3  8  
ATOM   5396  H HZ2  . TRP A 1 8  ? -6.188  -1.294  6.109   1.00 15.00 ?  286 TRP A HZ2  8  
ATOM   5397  H HZ3  . TRP A 1 8  ? -5.243  -0.293  2.074   1.00 15.00 ?  286 TRP A HZ3  8  
ATOM   5398  H HH2  . TRP A 1 8  ? -6.233  -1.811  3.711   1.00 15.00 ?  286 TRP A HH2  8  
ATOM   5399  N N    . GLU A 1 9  ? 0.128   4.240   4.576   1.00 15.00 ?  287 GLU A N    8  
ATOM   5400  C CA   . GLU A 1 9  ? 0.992   4.768   3.554   1.00 15.00 ?  287 GLU A CA   8  
ATOM   5401  C C    . GLU A 1 9  ? 0.750   3.996   2.271   1.00 15.00 ?  287 GLU A C    8  
ATOM   5402  O O    . GLU A 1 9  ? 0.997   2.795   2.191   1.00 15.00 ?  287 GLU A O    8  
ATOM   5403  C CB   . GLU A 1 9  ? 2.454   4.703   3.995   1.00 15.00 ?  287 GLU A CB   8  
ATOM   5404  C CG   . GLU A 1 9  ? 2.941   5.981   4.655   1.00 15.00 ?  287 GLU A CG   8  
ATOM   5405  C CD   . GLU A 1 9  ? 2.159   6.353   5.896   1.00 15.00 ?  287 GLU A CD   8  
ATOM   5406  O OE1  . GLU A 1 9  ? 2.258   5.629   6.901   1.00 15.00 -1 287 GLU A OE1  8  
ATOM   5407  O OE2  . GLU A 1 9  ? 1.455   7.385   5.870   1.00 15.00 ?  287 GLU A OE2  8  
ATOM   5408  H H    . GLU A 1 9  ? 0.441   3.489   5.132   1.00 15.00 ?  287 GLU A H    8  
ATOM   5409  H HA   . GLU A 1 9  ? 0.717   5.800   3.395   1.00 15.00 ?  287 GLU A HA   8  
ATOM   5410  H HB2  . GLU A 1 9  ? 2.566   3.895   4.704   1.00 15.00 ?  287 GLU A HB2  8  
ATOM   5411  H HB3  . GLU A 1 9  ? 3.079   4.504   3.139   1.00 15.00 ?  287 GLU A HB3  8  
ATOM   5412  H HG2  . GLU A 1 9  ? 3.976   5.854   4.931   1.00 15.00 ?  287 GLU A HG2  8  
ATOM   5413  H HG3  . GLU A 1 9  ? 2.860   6.789   3.942   1.00 15.00 ?  287 GLU A HG3  8  
ATOM   5414  N N    . VAL A 1 10 ? 0.214   4.683   1.284   1.00 15.00 ?  288 VAL A N    8  
ATOM   5415  C CA   . VAL A 1 10 ? -0.136  4.049   0.032   1.00 15.00 ?  288 VAL A CA   8  
ATOM   5416  C C    . VAL A 1 10 ? 1.039   4.113   -0.934  1.00 15.00 ?  288 VAL A C    8  
ATOM   5417  O O    . VAL A 1 10 ? 1.352   5.164   -1.498  1.00 15.00 ?  288 VAL A O    8  
ATOM   5418  C CB   . VAL A 1 10 ? -1.412  4.683   -0.581  1.00 15.00 ?  288 VAL A CB   8  
ATOM   5419  C CG1  . VAL A 1 10 ? -1.409  6.196   -0.426  1.00 15.00 ?  288 VAL A CG1  8  
ATOM   5420  C CG2  . VAL A 1 10 ? -1.567  4.303   -2.044  1.00 15.00 ?  288 VAL A CG2  8  
ATOM   5421  H H    . VAL A 1 10 ? 0.061   5.647   1.398   1.00 15.00 ?  288 VAL A H    8  
ATOM   5422  H HA   . VAL A 1 10 ? -0.347  3.011   0.242   1.00 15.00 ?  288 VAL A HA   8  
ATOM   5423  H HB   . VAL A 1 10 ? -2.265  4.297   -0.042  1.00 15.00 ?  288 VAL A HB   8  
ATOM   5424  H HG11 . VAL A 1 10 ? -0.705  6.629   -1.122  1.00 15.00 ?  288 VAL A HG11 8  
ATOM   5425  H HG12 . VAL A 1 10 ? -1.120  6.453   0.583   1.00 15.00 ?  288 VAL A HG12 8  
ATOM   5426  H HG13 . VAL A 1 10 ? -2.400  6.578   -0.625  1.00 15.00 ?  288 VAL A HG13 8  
ATOM   5427  H HG21 . VAL A 1 10 ? -0.711  4.654   -2.600  1.00 15.00 ?  288 VAL A HG21 8  
ATOM   5428  H HG22 . VAL A 1 10 ? -2.463  4.756   -2.440  1.00 15.00 ?  288 VAL A HG22 8  
ATOM   5429  H HG23 . VAL A 1 10 ? -1.637  3.228   -2.132  1.00 15.00 ?  288 VAL A HG23 8  
ATOM   5430  N N    . ARG A 1 11 ? 1.708   2.981   -1.096  1.00 15.00 ?  289 ARG A N    8  
ATOM   5431  C CA   . ARG A 1 11 ? 2.892   2.932   -1.925  1.00 15.00 ?  289 ARG A CA   8  
ATOM   5432  C C    . ARG A 1 11 ? 2.492   2.435   -3.313  1.00 15.00 ?  289 ARG A C    8  
ATOM   5433  O O    . ARG A 1 11 ? 2.319   1.240   -3.538  1.00 15.00 ?  289 ARG A O    8  
ATOM   5434  C CB   . ARG A 1 11 ? 3.966   2.047   -1.249  1.00 15.00 ?  289 ARG A CB   8  
ATOM   5435  C CG   . ARG A 1 11 ? 5.403   2.282   -1.723  1.00 15.00 ?  289 ARG A CG   8  
ATOM   5436  C CD   . ARG A 1 11 ? 5.595   1.917   -3.190  1.00 15.00 ?  289 ARG A CD   8  
ATOM   5437  N NE   . ARG A 1 11 ? 6.918   2.275   -3.714  1.00 15.00 ?  289 ARG A NE   8  
ATOM   5438  C CZ   . ARG A 1 11 ? 7.944   1.420   -3.809  1.00 15.00 ?  289 ARG A CZ   8  
ATOM   5439  N NH1  . ARG A 1 11 ? 7.887   0.226   -3.237  1.00 15.00 1  289 ARG A NH1  8  
ATOM   5440  N NH2  . ARG A 1 11 ? 9.047   1.773   -4.454  1.00 15.00 ?  289 ARG A NH2  8  
ATOM   5441  H H    . ARG A 1 11 ? 1.384   2.153   -0.668  1.00 15.00 ?  289 ARG A H    8  
ATOM   5442  H HA   . ARG A 1 11 ? 3.270   3.940   -2.016  1.00 15.00 ?  289 ARG A HA   8  
ATOM   5443  H HB2  . ARG A 1 11 ? 3.939   2.241   -0.186  1.00 15.00 ?  289 ARG A HB2  8  
ATOM   5444  H HB3  . ARG A 1 11 ? 3.721   1.005   -1.409  1.00 15.00 ?  289 ARG A HB3  8  
ATOM   5445  H HG2  . ARG A 1 11 ? 5.650   3.324   -1.586  1.00 15.00 ?  289 ARG A HG2  8  
ATOM   5446  H HG3  . ARG A 1 11 ? 6.065   1.669   -1.115  1.00 15.00 ?  289 ARG A HG3  8  
ATOM   5447  H HD2  . ARG A 1 11 ? 5.461   0.851   -3.295  1.00 15.00 ?  289 ARG A HD2  8  
ATOM   5448  H HD3  . ARG A 1 11 ? 4.840   2.427   -3.771  1.00 15.00 ?  289 ARG A HD3  8  
ATOM   5449  H HE   . ARG A 1 11 ? 7.023   3.181   -4.080  1.00 15.00 ?  289 ARG A HE   8  
ATOM   5450  H HH11 . ARG A 1 11 ? 7.071   -0.055  -2.720  1.00 15.00 ?  289 ARG A HH11 8  
ATOM   5451  H HH12 . ARG A 1 11 ? 8.660   -0.405  -3.318  1.00 15.00 ?  289 ARG A HH12 8  
ATOM   5452  H HH21 . ARG A 1 11 ? 9.123   2.688   -4.881  1.00 15.00 ?  289 ARG A HH21 8  
ATOM   5453  H HH22 . ARG A 1 11 ? 9.814   1.123   -4.536  1.00 15.00 ?  289 ARG A HH22 8  
ATOM   5454  N N    . SER A 1 12 ? 2.271   3.373   -4.223  1.00 15.00 ?  290 SER A N    8  
ATOM   5455  C CA   . SER A 1 12 ? 1.818   3.047   -5.564  1.00 15.00 ?  290 SER A CA   8  
ATOM   5456  C C    . SER A 1 12 ? 2.980   3.066   -6.546  1.00 15.00 ?  290 SER A C    8  
ATOM   5457  O O    . SER A 1 12 ? 3.671   4.073   -6.689  1.00 15.00 ?  290 SER A O    8  
ATOM   5458  C CB   . SER A 1 12 ? 0.732   4.038   -5.977  1.00 15.00 ?  290 SER A CB   8  
ATOM   5459  O OG   . SER A 1 12 ? 0.914   5.283   -5.320  1.00 15.00 ?  290 SER A OG   8  
ATOM   5460  H H    . SER A 1 12 ? 2.411   4.320   -3.989  1.00 15.00 ?  290 SER A H    8  
ATOM   5461  H HA   . SER A 1 12 ? 1.397   2.052   -5.540  1.00 15.00 ?  290 SER A HA   8  
ATOM   5462  H HB2  . SER A 1 12 ? 0.777   4.195   -7.045  1.00 15.00 ?  290 SER A HB2  8  
ATOM   5463  H HB3  . SER A 1 12 ? -0.237  3.640   -5.710  1.00 15.00 ?  290 SER A HB3  8  
ATOM   5464  H HG   . SER A 1 12 ? 0.952   5.997   -5.985  1.00 15.00 ?  290 SER A HG   8  
ATOM   5465  N N    . THR A 1 13 ? 3.197   1.951   -7.221  1.00 15.00 ?  291 THR A N    8  
ATOM   5466  C CA   . THR A 1 13 ? 4.339   1.826   -8.106  1.00 15.00 ?  291 THR A CA   8  
ATOM   5467  C C    . THR A 1 13 ? 3.931   1.962   -9.571  1.00 15.00 ?  291 THR A C    8  
ATOM   5468  O O    . THR A 1 13 ? 2.813   1.593   -9.955  1.00 15.00 ?  291 THR A O    8  
ATOM   5469  C CB   . THR A 1 13 ? 5.069   0.490   -7.885  1.00 15.00 ?  291 THR A CB   8  
ATOM   5470  O OG1  . THR A 1 13 ? 4.143   -0.599  -7.992  1.00 15.00 ?  291 THR A OG1  8  
ATOM   5471  C CG2  . THR A 1 13 ? 5.733   0.465   -6.514  1.00 15.00 ?  291 THR A CG2  8  
ATOM   5472  H H    . THR A 1 13 ? 2.567   1.202   -7.135  1.00 15.00 ?  291 THR A H    8  
ATOM   5473  H HA   . THR A 1 13 ? 5.025   2.625   -7.866  1.00 15.00 ?  291 THR A HA   8  
ATOM   5474  H HB   . THR A 1 13 ? 5.832   0.384   -8.642  1.00 15.00 ?  291 THR A HB   8  
ATOM   5475  H HG1  . THR A 1 13 ? 3.566   -0.605  -7.220  1.00 15.00 ?  291 THR A HG1  8  
ATOM   5476  H HG21 . THR A 1 13 ? 4.971   0.437   -5.748  1.00 15.00 ?  291 THR A HG21 8  
ATOM   5477  H HG22 . THR A 1 13 ? 6.337   1.357   -6.384  1.00 15.00 ?  291 THR A HG22 8  
ATOM   5478  H HG23 . THR A 1 13 ? 6.359   -0.410  -6.431  1.00 15.00 ?  291 THR A HG23 8  
ATOM   5479  N N    . VAL A 1 14 ? 4.863   2.474   -10.378 1.00 15.00 ?  292 VAL A N    8  
ATOM   5480  C CA   . VAL A 1 14 ? 4.623   2.774   -11.791 1.00 15.00 ?  292 VAL A CA   8  
ATOM   5481  C C    . VAL A 1 14 ? 4.249   1.518   -12.589 1.00 15.00 ?  292 VAL A C    8  
ATOM   5482  O O    . VAL A 1 14 ? 3.742   1.605   -13.707 1.00 15.00 ?  292 VAL A O    8  
ATOM   5483  C CB   . VAL A 1 14 ? 5.861   3.455   -12.423 1.00 15.00 ?  292 VAL A CB   8  
ATOM   5484  C CG1  . VAL A 1 14 ? 7.043   2.495   -12.501 1.00 15.00 ?  292 VAL A CG1  8  
ATOM   5485  C CG2  . VAL A 1 14 ? 5.534   4.029   -13.794 1.00 15.00 ?  292 VAL A CG2  8  
ATOM   5486  H H    . VAL A 1 14 ? 5.749   2.666   -10.007 1.00 15.00 ?  292 VAL A H    8  
ATOM   5487  H HA   . VAL A 1 14 ? 3.799   3.470   -11.843 1.00 15.00 ?  292 VAL A HA   8  
ATOM   5488  H HB   . VAL A 1 14 ? 6.149   4.277   -11.780 1.00 15.00 ?  292 VAL A HB   8  
ATOM   5489  H HG11 . VAL A 1 14 ? 7.891   3.004   -12.933 1.00 15.00 ?  292 VAL A HG11 8  
ATOM   5490  H HG12 . VAL A 1 14 ? 6.778   1.649   -13.116 1.00 15.00 ?  292 VAL A HG12 8  
ATOM   5491  H HG13 . VAL A 1 14 ? 7.297   2.155   -11.507 1.00 15.00 ?  292 VAL A HG13 8  
ATOM   5492  H HG21 . VAL A 1 14 ? 5.188   3.237   -14.442 1.00 15.00 ?  292 VAL A HG21 8  
ATOM   5493  H HG22 . VAL A 1 14 ? 6.420   4.479   -14.218 1.00 15.00 ?  292 VAL A HG22 8  
ATOM   5494  H HG23 . VAL A 1 14 ? 4.762   4.777   -13.697 1.00 15.00 ?  292 VAL A HG23 8  
ATOM   5495  N N    . SER A 1 15 ? 4.492   0.354   -11.999 1.00 15.00 ?  293 SER A N    8  
ATOM   5496  C CA   . SER A 1 15 ? 4.111   -0.916  -12.603 1.00 15.00 ?  293 SER A CA   8  
ATOM   5497  C C    . SER A 1 15 ? 2.594   -0.997  -12.806 1.00 15.00 ?  293 SER A C    8  
ATOM   5498  O O    . SER A 1 15 ? 2.096   -1.879  -13.509 1.00 15.00 ?  293 SER A O    8  
ATOM   5499  C CB   . SER A 1 15 ? 4.580   -2.070  -11.720 1.00 15.00 ?  293 SER A CB   8  
ATOM   5500  O OG   . SER A 1 15 ? 5.880   -1.824  -11.208 1.00 15.00 ?  293 SER A OG   8  
ATOM   5501  H H    . SER A 1 15 ? 4.956   0.347   -11.136 1.00 15.00 ?  293 SER A H    8  
ATOM   5502  H HA   . SER A 1 15 ? 4.598   -0.988  -13.563 1.00 15.00 ?  293 SER A HA   8  
ATOM   5503  H HB2  . SER A 1 15 ? 3.896   -2.190  -10.892 1.00 15.00 ?  293 SER A HB2  8  
ATOM   5504  H HB3  . SER A 1 15 ? 4.603   -2.978  -12.304 1.00 15.00 ?  293 SER A HB3  8  
ATOM   5505  H HG   . SER A 1 15 ? 6.524   -2.378  -11.683 1.00 15.00 ?  293 SER A HG   8  
ATOM   5506  N N    . GLY A 1 16 ? 1.868   -0.091  -12.157 1.00 15.00 ?  294 GLY A N    8  
ATOM   5507  C CA   . GLY A 1 16 ? 0.423   -0.082  -12.251 1.00 15.00 ?  294 GLY A CA   8  
ATOM   5508  C C    . GLY A 1 16 ? -0.201  -0.934  -11.173 1.00 15.00 ?  294 GLY A C    8  
ATOM   5509  O O    . GLY A 1 16 ? -1.213  -1.601  -11.396 1.00 15.00 ?  294 GLY A O    8  
ATOM   5510  H H    . GLY A 1 16 ? 2.323   0.579   -11.603 1.00 15.00 ?  294 GLY A H    8  
ATOM   5511  H HA2  . GLY A 1 16 ? 0.071   0.935   -12.149 1.00 15.00 ?  294 GLY A HA2  8  
ATOM   5512  H HA3  . GLY A 1 16 ? 0.128   -0.464  -13.217 1.00 15.00 ?  294 GLY A HA3  8  
ATOM   5513  N N    . ARG A 1 17 ? 0.411   -0.911  -9.997  1.00 15.00 ?  295 ARG A N    8  
ATOM   5514  C CA   . ARG A 1 17 ? -0.041  -1.733  -8.887  1.00 15.00 ?  295 ARG A CA   8  
ATOM   5515  C C    . ARG A 1 17 ? 0.086   -0.979  -7.570  1.00 15.00 ?  295 ARG A C    8  
ATOM   5516  O O    . ARG A 1 17 ? 1.166   -0.501  -7.205  1.00 15.00 ?  295 ARG A O    8  
ATOM   5517  C CB   . ARG A 1 17 ? 0.751   -3.048  -8.839  1.00 15.00 ?  295 ARG A CB   8  
ATOM   5518  C CG   . ARG A 1 17 ? 2.255   -2.855  -8.918  1.00 15.00 ?  295 ARG A CG   8  
ATOM   5519  C CD   . ARG A 1 17 ? 3.005   -4.175  -8.870  1.00 15.00 ?  295 ARG A CD   8  
ATOM   5520  N NE   . ARG A 1 17 ? 4.440   -3.984  -9.087  1.00 15.00 ?  295 ARG A NE   8  
ATOM   5521  C CZ   . ARG A 1 17 ? 5.344   -4.965  -9.060  1.00 15.00 ?  295 ARG A CZ   8  
ATOM   5522  N NH1  . ARG A 1 17 ? 4.980   -6.211  -8.777  1.00 15.00 1  295 ARG A NH1  8  
ATOM   5523  N NH2  . ARG A 1 17 ? 6.619   -4.693  -9.319  1.00 15.00 ?  295 ARG A NH2  8  
ATOM   5524  H H    . ARG A 1 17 ? 1.181   -0.311  -9.867  1.00 15.00 ?  295 ARG A H    8  
ATOM   5525  H HA   . ARG A 1 17 ? -1.084  -1.962  -9.051  1.00 15.00 ?  295 ARG A HA   8  
ATOM   5526  H HB2  . ARG A 1 17 ? 0.524   -3.559  -7.915  1.00 15.00 ?  295 ARG A HB2  8  
ATOM   5527  H HB3  . ARG A 1 17 ? 0.446   -3.668  -9.669  1.00 15.00 ?  295 ARG A HB3  8  
ATOM   5528  H HG2  . ARG A 1 17 ? 2.492   -2.353  -9.844  1.00 15.00 ?  295 ARG A HG2  8  
ATOM   5529  H HG3  . ARG A 1 17 ? 2.571   -2.241  -8.087  1.00 15.00 ?  295 ARG A HG3  8  
ATOM   5530  H HD2  . ARG A 1 17 ? 2.851   -4.628  -7.900  1.00 15.00 ?  295 ARG A HD2  8  
ATOM   5531  H HD3  . ARG A 1 17 ? 2.614   -4.826  -9.638  1.00 15.00 ?  295 ARG A HD3  8  
ATOM   5532  H HE   . ARG A 1 17 ? 4.746   -3.069  -9.280  1.00 15.00 ?  295 ARG A HE   8  
ATOM   5533  H HH11 . ARG A 1 17 ? 4.013   -6.430  -8.577  1.00 15.00 ?  295 ARG A HH11 8  
ATOM   5534  H HH12 . ARG A 1 17 ? 5.661   -6.944  -8.763  1.00 15.00 ?  295 ARG A HH12 8  
ATOM   5535  H HH21 . ARG A 1 17 ? 6.903   -3.756  -9.537  1.00 15.00 ?  295 ARG A HH21 8  
ATOM   5536  H HH22 . ARG A 1 17 ? 7.309   -5.426  -9.297  1.00 15.00 ?  295 ARG A HH22 8  
ATOM   5537  N N    . ILE A 1 18 ? -1.032  -0.860  -6.874  1.00 15.00 ?  296 ILE A N    8  
ATOM   5538  C CA   . ILE A 1 18 ? -1.053  -0.253  -5.558  1.00 15.00 ?  296 ILE A CA   8  
ATOM   5539  C C    . ILE A 1 18 ? -0.824  -1.336  -4.512  1.00 15.00 ?  296 ILE A C    8  
ATOM   5540  O O    . ILE A 1 18 ? -1.327  -2.453  -4.653  1.00 15.00 ?  296 ILE A O    8  
ATOM   5541  C CB   . ILE A 1 18 ? -2.391  0.482   -5.294  1.00 15.00 ?  296 ILE A CB   8  
ATOM   5542  C CG1  . ILE A 1 18 ? -2.286  1.358   -4.047  1.00 15.00 ?  296 ILE A CG1  8  
ATOM   5543  C CG2  . ILE A 1 18 ? -3.547  -0.505  -5.148  1.00 15.00 ?  296 ILE A CG2  8  
ATOM   5544  C CD1  . ILE A 1 18 ? -3.532  2.171   -3.781  1.00 15.00 ?  296 ILE A CD1  8  
ATOM   5545  H H    . ILE A 1 18 ? -1.868  -1.193  -7.257  1.00 15.00 ?  296 ILE A H    8  
ATOM   5546  H HA   . ILE A 1 18 ? -0.246  0.464   -5.505  1.00 15.00 ?  296 ILE A HA   8  
ATOM   5547  H HB   . ILE A 1 18 ? -2.599  1.110   -6.146  1.00 15.00 ?  296 ILE A HB   8  
ATOM   5548  H HG12 . ILE A 1 18 ? -2.112  0.730   -3.186  1.00 15.00 ?  296 ILE A HG12 8  
ATOM   5549  H HG13 . ILE A 1 18 ? -1.460  2.043   -4.162  1.00 15.00 ?  296 ILE A HG13 8  
ATOM   5550  H HG21 . ILE A 1 18 ? -4.467  0.039   -4.991  1.00 15.00 ?  296 ILE A HG21 8  
ATOM   5551  H HG22 . ILE A 1 18 ? -3.364  -1.150  -4.299  1.00 15.00 ?  296 ILE A HG22 8  
ATOM   5552  H HG23 . ILE A 1 18 ? -3.629  -1.102  -6.044  1.00 15.00 ?  296 ILE A HG23 8  
ATOM   5553  H HD11 . ILE A 1 18 ? -3.734  2.809   -4.627  1.00 15.00 ?  296 ILE A HD11 8  
ATOM   5554  H HD12 . ILE A 1 18 ? -3.384  2.778   -2.899  1.00 15.00 ?  296 ILE A HD12 8  
ATOM   5555  H HD13 . ILE A 1 18 ? -4.368  1.507   -3.625  1.00 15.00 ?  296 ILE A HD13 8  
ATOM   5556  N N    . TYR A 1 19 ? -0.042  -1.037  -3.493  1.00 15.00 ?  297 TYR A N    8  
ATOM   5557  C CA   . TYR A 1 19 ? 0.277   -2.048  -2.505  1.00 15.00 ?  297 TYR A CA   8  
ATOM   5558  C C    . TYR A 1 19 ? 0.512   -1.351  -1.192  1.00 15.00 ?  297 TYR A C    8  
ATOM   5559  O O    . TYR A 1 19 ? 1.192   -0.316  -1.122  1.00 15.00 ?  297 TYR A O    8  
ATOM   5560  C CB   . TYR A 1 19 ? 1.451   -2.964  -2.930  1.00 15.00 ?  297 TYR A CB   8  
ATOM   5561  C CG   . TYR A 1 19 ? 2.850   -2.544  -2.533  1.00 15.00 ?  297 TYR A CG   8  
ATOM   5562  C CD1  . TYR A 1 19 ? 3.462   -1.440  -3.095  1.00 15.00 ?  297 TYR A CD1  8  
ATOM   5563  C CD2  . TYR A 1 19 ? 3.571   -3.292  -1.603  1.00 15.00 ?  297 TYR A CD2  8  
ATOM   5564  C CE1  . TYR A 1 19 ? 4.747   -1.087  -2.740  1.00 15.00 ?  297 TYR A CE1  8  
ATOM   5565  C CE2  . TYR A 1 19 ? 4.854   -2.940  -1.244  1.00 15.00 ?  297 TYR A CE2  8  
ATOM   5566  C CZ   . TYR A 1 19 ? 5.437   -1.838  -1.814  1.00 15.00 ?  297 TYR A CZ   8  
ATOM   5567  O OH   . TYR A 1 19 ? 6.714   -1.480  -1.452  1.00 15.00 ?  297 TYR A OH   8  
ATOM   5568  H H    . TYR A 1 19 ? 0.214   -0.095  -3.325  1.00 15.00 ?  297 TYR A H    8  
ATOM   5569  H HA   . TYR A 1 19 ? -0.610  -2.660  -2.396  1.00 15.00 ?  297 TYR A HA   8  
ATOM   5570  H HB2  . TYR A 1 19 ? 1.288   -3.943  -2.508  1.00 15.00 ?  297 TYR A HB2  8  
ATOM   5571  H HB3  . TYR A 1 19 ? 1.436   -3.051  -4.007  1.00 15.00 ?  297 TYR A HB3  8  
ATOM   5572  H HD1  . TYR A 1 19 ? 2.920   -0.848  -3.818  1.00 15.00 ?  297 TYR A HD1  8  
ATOM   5573  H HD2  . TYR A 1 19 ? 3.118   -4.165  -1.160  1.00 15.00 ?  297 TYR A HD2  8  
ATOM   5574  H HE1  . TYR A 1 19 ? 5.209   -0.220  -3.189  1.00 15.00 ?  297 TYR A HE1  8  
ATOM   5575  H HE2  . TYR A 1 19 ? 5.395   -3.536  -0.525  1.00 15.00 ?  297 TYR A HE2  8  
ATOM   5576  H HH   . TYR A 1 19 ? 7.205   -2.269  -1.190  1.00 15.00 ?  297 TYR A HH   8  
ATOM   5577  N N    . PHE A 1 20 ? -0.084  -1.876  -0.160  1.00 15.00 ?  298 PHE A N    8  
ATOM   5578  C CA   . PHE A 1 20 ? -0.148  -1.157  1.061   1.00 15.00 ?  298 PHE A CA   8  
ATOM   5579  C C    . PHE A 1 20 ? 0.948   -1.446  2.025   1.00 15.00 ?  298 PHE A C    8  
ATOM   5580  O O    . PHE A 1 20 ? 1.305   -2.590  2.275   1.00 15.00 ?  298 PHE A O    8  
ATOM   5581  C CB   . PHE A 1 20 ? -1.482  -1.345  1.707   1.00 15.00 ?  298 PHE A CB   8  
ATOM   5582  C CG   . PHE A 1 20 ? -2.282  -0.167  1.398   1.00 15.00 ?  298 PHE A CG   8  
ATOM   5583  C CD1  . PHE A 1 20 ? -1.901  1.046   1.929   1.00 15.00 ?  298 PHE A CD1  8  
ATOM   5584  C CD2  . PHE A 1 20 ? -3.363  -0.241  0.555   1.00 15.00 ?  298 PHE A CD2  8  
ATOM   5585  C CE1  . PHE A 1 20 ? -2.596  2.173   1.638   1.00 15.00 ?  298 PHE A CE1  8  
ATOM   5586  C CE2  . PHE A 1 20 ? -4.069  0.890   0.259   1.00 15.00 ?  298 PHE A CE2  8  
ATOM   5587  C CZ   . PHE A 1 20 ? -3.678  2.092   0.806   1.00 15.00 ?  298 PHE A CZ   8  
ATOM   5588  H H    . PHE A 1 20 ? -0.529  -2.747  -0.237  1.00 15.00 ?  298 PHE A H    8  
ATOM   5589  H HA   . PHE A 1 20 ? -0.072  -0.116  0.795   1.00 15.00 ?  298 PHE A HA   8  
ATOM   5590  H HB2  . PHE A 1 20 ? -1.984  -2.236  1.319   1.00 15.00 ?  298 PHE A HB2  8  
ATOM   5591  H HB3  . PHE A 1 20 ? -1.368  -1.414  2.778   1.00 15.00 ?  298 PHE A HB3  8  
ATOM   5592  H HD1  . PHE A 1 20 ? -1.051  1.095   2.592   1.00 15.00 ?  298 PHE A HD1  8  
ATOM   5593  H HD2  . PHE A 1 20 ? -3.656  -1.192  0.135   1.00 15.00 ?  298 PHE A HD2  8  
ATOM   5594  H HE1  . PHE A 1 20 ? -2.296  3.122   2.055   1.00 15.00 ?  298 PHE A HE1  8  
ATOM   5595  H HE2  . PHE A 1 20 ? -4.925  0.842   -0.397  1.00 15.00 ?  298 PHE A HE2  8  
ATOM   5596  H HZ   . PHE A 1 20 ? -4.225  2.949   0.611   1.00 15.00 ?  298 PHE A HZ   8  
ATOM   5597  N N    . VAL A 1 21 ? 1.426   -0.363  2.596   1.00 15.00 ?  299 VAL A N    8  
ATOM   5598  C CA   . VAL A 1 21 ? 2.442   -0.398  3.600   1.00 15.00 ?  299 VAL A CA   8  
ATOM   5599  C C    . VAL A 1 21 ? 1.973   0.405   4.815   1.00 15.00 ?  299 VAL A C    8  
ATOM   5600  O O    . VAL A 1 21 ? 2.111   1.629   4.890   1.00 15.00 ?  299 VAL A O    8  
ATOM   5601  C CB   . VAL A 1 21 ? 3.789   0.141   3.050   1.00 15.00 ?  299 VAL A CB   8  
ATOM   5602  C CG1  . VAL A 1 21 ? 4.266   -0.700  1.874   1.00 15.00 ?  299 VAL A CG1  8  
ATOM   5603  C CG2  . VAL A 1 21 ? 3.657   1.586   2.602   1.00 15.00 ?  299 VAL A CG2  8  
ATOM   5604  H H    . VAL A 1 21 ? 1.062   0.511   2.333   1.00 15.00 ?  299 VAL A H    8  
ATOM   5605  H HA   . VAL A 1 21 ? 2.581   -1.430  3.897   1.00 15.00 ?  299 VAL A HA   8  
ATOM   5606  H HB   . VAL A 1 21 ? 4.532   0.090   3.835   1.00 15.00 ?  299 VAL A HB   8  
ATOM   5607  H HG11 . VAL A 1 21 ? 5.346   -0.697  1.836   1.00 15.00 ?  299 VAL A HG11 8  
ATOM   5608  H HG12 . VAL A 1 21 ? 3.885   -0.270  0.969   1.00 15.00 ?  299 VAL A HG12 8  
ATOM   5609  H HG13 . VAL A 1 21 ? 3.905   -1.714  1.968   1.00 15.00 ?  299 VAL A HG13 8  
ATOM   5610  H HG21 . VAL A 1 21 ? 2.908   1.654   1.826   1.00 15.00 ?  299 VAL A HG21 8  
ATOM   5611  H HG22 . VAL A 1 21 ? 4.605   1.934   2.219   1.00 15.00 ?  299 VAL A HG22 8  
ATOM   5612  H HG23 . VAL A 1 21 ? 3.361   2.196   3.442   1.00 15.00 ?  299 VAL A HG23 8  
ATOM   5613  N N    . ASP A 1 22 ? 1.346   -0.270  5.750   1.00 15.00 ?  300 ASP A N    8  
ATOM   5614  C CA   . ASP A 1 22 ? 0.997   0.378   6.992   1.00 15.00 ?  300 ASP A CA   8  
ATOM   5615  C C    . ASP A 1 22 ? 2.163   0.183   7.938   1.00 15.00 ?  300 ASP A C    8  
ATOM   5616  O O    . ASP A 1 22 ? 2.602   -0.949  8.182   1.00 15.00 ?  300 ASP A O    8  
ATOM   5617  C CB   . ASP A 1 22 ? -0.320  -0.159  7.570   1.00 15.00 ?  300 ASP A CB   8  
ATOM   5618  C CG   . ASP A 1 22 ? -0.170  -0.666  8.992   1.00 15.00 ?  300 ASP A CG   8  
ATOM   5619  O OD1  . ASP A 1 22 ? -0.070  0.163   9.924   1.00 15.00 -1 300 ASP A OD1  8  
ATOM   5620  O OD2  . ASP A 1 22 ? -0.122  -1.890  9.178   1.00 15.00 ?  300 ASP A OD2  8  
ATOM   5621  H H    . ASP A 1 22 ? 1.126   -1.217  5.610   1.00 15.00 ?  300 ASP A H    8  
ATOM   5622  H HA   . ASP A 1 22 ? 0.892   1.437   6.790   1.00 15.00 ?  300 ASP A HA   8  
ATOM   5623  H HB2  . ASP A 1 22 ? -1.044  0.642   7.575   1.00 15.00 ?  300 ASP A HB2  8  
ATOM   5624  H HB3  . ASP A 1 22 ? -0.690  -0.965  6.944   1.00 15.00 ?  300 ASP A HB3  8  
ATOM   5625  N N    . HIS A 1 23 ? 2.692   1.296   8.425   1.00 15.00 ?  301 HIS A N    8  
ATOM   5626  C CA   . HIS A 1 23 ? 3.974   1.287   9.103   1.00 15.00 ?  301 HIS A CA   8  
ATOM   5627  C C    . HIS A 1 23 ? 3.837   0.974   10.590  1.00 15.00 ?  301 HIS A C    8  
ATOM   5628  O O    . HIS A 1 23 ? 4.817   0.601   11.233  1.00 15.00 ?  301 HIS A O    8  
ATOM   5629  C CB   . HIS A 1 23 ? 4.702   2.631   8.956   1.00 15.00 ?  301 HIS A CB   8  
ATOM   5630  C CG   . HIS A 1 23 ? 4.953   3.117   7.551   1.00 15.00 ?  301 HIS A CG   8  
ATOM   5631  N ND1  . HIS A 1 23 ? 5.088   4.451   7.258   1.00 15.00 ?  301 HIS A ND1  8  
ATOM   5632  C CD2  . HIS A 1 23 ? 5.228   2.461   6.399   1.00 15.00 ?  301 HIS A CD2  8  
ATOM   5633  C CE1  . HIS A 1 23 ? 5.445   4.592   6.001   1.00 15.00 ?  301 HIS A CE1  8  
ATOM   5634  N NE2  . HIS A 1 23 ? 5.555   3.398   5.446   1.00 15.00 ?  301 HIS A NE2  8  
ATOM   5635  H H    . HIS A 1 23 ? 2.199   2.142   8.336   1.00 15.00 ?  301 HIS A H    8  
ATOM   5636  H HA   . HIS A 1 23 ? 4.578   0.518   8.646   1.00 15.00 ?  301 HIS A HA   8  
ATOM   5637  H HB2  . HIS A 1 23 ? 4.132   3.393   9.461   1.00 15.00 ?  301 HIS A HB2  8  
ATOM   5638  H HB3  . HIS A 1 23 ? 5.666   2.542   9.435   1.00 15.00 ?  301 HIS A HB3  8  
ATOM   5639  H HD1  . HIS A 1 23 ? 4.941   5.195   7.888   1.00 15.00 ?  301 HIS A HD1  8  
ATOM   5640  H HD2  . HIS A 1 23 ? 5.157   1.396   6.238   1.00 15.00 ?  301 HIS A HD2  8  
ATOM   5641  H HE1  . HIS A 1 23 ? 5.595   5.536   5.487   1.00 15.00 ?  301 HIS A HE1  8  
ATOM   5642  H HE2  . HIS A 1 23 ? 6.179   3.215   4.702   1.00 15.00 ?  301 HIS A HE2  8  
ATOM   5643  N N    . ASN A 1 24 ? 2.642   1.137   11.149  1.00 15.00 ?  302 ASN A N    8  
ATOM   5644  C CA   . ASN A 1 24 ? 2.484   1.007   12.596  1.00 15.00 ?  302 ASN A CA   8  
ATOM   5645  C C    . ASN A 1 24 ? 1.955   -0.366  12.994  1.00 15.00 ?  302 ASN A C    8  
ATOM   5646  O O    . ASN A 1 24 ? 2.317   -0.891  14.049  1.00 15.00 ?  302 ASN A O    8  
ATOM   5647  C CB   . ASN A 1 24 ? 1.602   2.124   13.176  1.00 15.00 ?  302 ASN A CB   8  
ATOM   5648  C CG   . ASN A 1 24 ? 0.195   2.142   12.611  1.00 15.00 ?  302 ASN A CG   8  
ATOM   5649  O OD1  . ASN A 1 24 ? -0.067  2.789   11.599  1.00 15.00 ?  302 ASN A OD1  8  
ATOM   5650  N ND2  . ASN A 1 24 ? -0.723  1.457   13.275  1.00 15.00 ?  302 ASN A ND2  8  
ATOM   5651  H H    . ASN A 1 24 ? 1.858   1.330   10.585  1.00 15.00 ?  302 ASN A H    8  
ATOM   5652  H HA   . ASN A 1 24 ? 3.472   1.109   13.023  1.00 15.00 ?  302 ASN A HA   8  
ATOM   5653  H HB2  . ASN A 1 24 ? 1.533   1.995   14.244  1.00 15.00 ?  302 ASN A HB2  8  
ATOM   5654  H HB3  . ASN A 1 24 ? 2.064   3.078   12.965  1.00 15.00 ?  302 ASN A HB3  8  
ATOM   5655  H HD21 . ASN A 1 24 ? -0.451  0.983   14.092  1.00 15.00 ?  302 ASN A HD21 8  
ATOM   5656  H HD22 . ASN A 1 24 ? -1.634  1.441   12.917  1.00 15.00 ?  302 ASN A HD22 8  
ATOM   5657  N N    . ASN A 1 25 ? 1.074   -0.939  12.186  1.00 15.00 ?  303 ASN A N    8  
ATOM   5658  C CA   . ASN A 1 25 ? 0.626   -2.309  12.424  1.00 15.00 ?  303 ASN A CA   8  
ATOM   5659  C C    . ASN A 1 25 ? 1.477   -3.298  11.632  1.00 15.00 ?  303 ASN A C    8  
ATOM   5660  O O    . ASN A 1 25 ? 1.452   -4.503  11.897  1.00 15.00 ?  303 ASN A O    8  
ATOM   5661  C CB   . ASN A 1 25 ? -0.856  -2.482  12.076  1.00 15.00 ?  303 ASN A CB   8  
ATOM   5662  C CG   . ASN A 1 25 ? -1.776  -1.726  13.016  1.00 15.00 ?  303 ASN A CG   8  
ATOM   5663  O OD1  . ASN A 1 25 ? -1.490  -1.577  14.205  1.00 15.00 ?  303 ASN A OD1  8  
ATOM   5664  N ND2  . ASN A 1 25 ? -2.884  -1.228  12.489  1.00 15.00 ?  303 ASN A ND2  8  
ATOM   5665  H H    . ASN A 1 25 ? 0.685   -0.421  11.431  1.00 15.00 ?  303 ASN A H    8  
ATOM   5666  H HA   . ASN A 1 25 ? 0.762   -2.514  13.476  1.00 15.00 ?  303 ASN A HA   8  
ATOM   5667  H HB2  . ASN A 1 25 ? -1.028  -2.125  11.071  1.00 15.00 ?  303 ASN A HB2  8  
ATOM   5668  H HB3  . ASN A 1 25 ? -1.108  -3.533  12.126  1.00 15.00 ?  303 ASN A HB3  8  
ATOM   5669  H HD21 . ASN A 1 25 ? -3.049  -1.377  11.533  1.00 15.00 ?  303 ASN A HD21 8  
ATOM   5670  H HD22 . ASN A 1 25 ? -3.493  -0.724  13.076  1.00 15.00 ?  303 ASN A HD22 8  
ATOM   5671  N N    . ARG A 1 26 ? 2.227   -2.770  10.663  1.00 15.00 ?  304 ARG A N    8  
ATOM   5672  C CA   . ARG A 1 26 ? 3.113   -3.558  9.816   1.00 15.00 ?  304 ARG A CA   8  
ATOM   5673  C C    . ARG A 1 26 ? 2.342   -4.631  9.057   1.00 15.00 ?  304 ARG A C    8  
ATOM   5674  O O    . ARG A 1 26 ? 2.293   -5.798  9.457   1.00 15.00 ?  304 ARG A O    8  
ATOM   5675  C CB   . ARG A 1 26 ? 4.257   -4.178  10.624  1.00 15.00 ?  304 ARG A CB   8  
ATOM   5676  C CG   . ARG A 1 26 ? 5.257   -4.954  9.779   1.00 15.00 ?  304 ARG A CG   8  
ATOM   5677  C CD   . ARG A 1 26 ? 6.353   -5.554  10.641  1.00 15.00 ?  304 ARG A CD   8  
ATOM   5678  N NE   . ARG A 1 26 ? 5.807   -6.434  11.671  1.00 15.00 ?  304 ARG A NE   8  
ATOM   5679  C CZ   . ARG A 1 26 ? 6.075   -6.317  12.972  1.00 15.00 ?  304 ARG A CZ   8  
ATOM   5680  N NH1  . ARG A 1 26 ? 6.924   -5.393  13.399  1.00 15.00 1  304 ARG A NH1  8  
ATOM   5681  N NH2  . ARG A 1 26 ? 5.505   -7.137  13.846  1.00 15.00 ?  304 ARG A NH2  8  
ATOM   5682  H H    . ARG A 1 26 ? 2.165   -1.812  10.495  1.00 15.00 ?  304 ARG A H    8  
ATOM   5683  H HA   . ARG A 1 26 ? 3.539   -2.880  9.091   1.00 15.00 ?  304 ARG A HA   8  
ATOM   5684  H HB2  . ARG A 1 26 ? 4.790   -3.389  11.134  1.00 15.00 ?  304 ARG A HB2  8  
ATOM   5685  H HB3  . ARG A 1 26 ? 3.840   -4.852  11.360  1.00 15.00 ?  304 ARG A HB3  8  
ATOM   5686  H HG2  . ARG A 1 26 ? 4.738   -5.750  9.265   1.00 15.00 ?  304 ARG A HG2  8  
ATOM   5687  H HG3  . ARG A 1 26 ? 5.702   -4.285  9.057   1.00 15.00 ?  304 ARG A HG3  8  
ATOM   5688  H HD2  . ARG A 1 26 ? 7.020   -6.122  10.009  1.00 15.00 ?  304 ARG A HD2  8  
ATOM   5689  H HD3  . ARG A 1 26 ? 6.899   -4.753  11.114  1.00 15.00 ?  304 ARG A HD3  8  
ATOM   5690  H HE   . ARG A 1 26 ? 5.192   -7.150  11.374  1.00 15.00 ?  304 ARG A HE   8  
ATOM   5691  H HH11 . ARG A 1 26 ? 7.381   -4.777  12.745  1.00 15.00 ?  304 ARG A HH11 8  
ATOM   5692  H HH12 . ARG A 1 26 ? 7.109   -5.296  14.385  1.00 15.00 ?  304 ARG A HH12 8  
ATOM   5693  H HH21 . ARG A 1 26 ? 4.871   -7.851  13.533  1.00 15.00 ?  304 ARG A HH21 8  
ATOM   5694  H HH22 . ARG A 1 26 ? 5.705   -7.047  14.824  1.00 15.00 ?  304 ARG A HH22 8  
ATOM   5695  N N    . THR A 1 27 ? 1.686   -4.214  7.991   1.00 15.00 ?  305 THR A N    8  
ATOM   5696  C CA   . THR A 1 27 ? 0.997   -5.152  7.122   1.00 15.00 ?  305 THR A CA   8  
ATOM   5697  C C    . THR A 1 27 ? 0.969   -4.632  5.690   1.00 15.00 ?  305 THR A C    8  
ATOM   5698  O O    . THR A 1 27 ? 0.975   -3.417  5.456   1.00 15.00 ?  305 THR A O    8  
ATOM   5699  C CB   . THR A 1 27 ? -0.436  -5.468  7.629   1.00 15.00 ?  305 THR A CB   8  
ATOM   5700  O OG1  . THR A 1 27 ? -1.104  -6.351  6.721   1.00 15.00 ?  305 THR A OG1  8  
ATOM   5701  C CG2  . THR A 1 27 ? -1.266  -4.208  7.804   1.00 15.00 ?  305 THR A CG2  8  
ATOM   5702  H H    . THR A 1 27 ? 1.651   -3.246  7.793   1.00 15.00 ?  305 THR A H    8  
ATOM   5703  H HA   . THR A 1 27 ? 1.564   -6.073  7.133   1.00 15.00 ?  305 THR A HA   8  
ATOM   5704  H HB   . THR A 1 27 ? -0.354  -5.959  8.589   1.00 15.00 ?  305 THR A HB   8  
ATOM   5705  H HG1  . THR A 1 27 ? -1.673  -5.830  6.132   1.00 15.00 ?  305 THR A HG1  8  
ATOM   5706  H HG21 . THR A 1 27 ? -0.792  -3.560  8.527   1.00 15.00 ?  305 THR A HG21 8  
ATOM   5707  H HG22 . THR A 1 27 ? -2.253  -4.473  8.155   1.00 15.00 ?  305 THR A HG22 8  
ATOM   5708  H HG23 . THR A 1 27 ? -1.346  -3.695  6.858   1.00 15.00 ?  305 THR A HG23 8  
ATOM   5709  N N    . THR A 1 28 ? 0.960   -5.556  4.739   1.00 15.00 ?  306 THR A N    8  
ATOM   5710  C CA   . THR A 1 28 ? 0.994   -5.218  3.328   1.00 15.00 ?  306 THR A CA   8  
ATOM   5711  C C    . THR A 1 28 ? -0.238  -5.759  2.611   1.00 15.00 ?  306 THR A C    8  
ATOM   5712  O O    . THR A 1 28 ? -0.428  -6.969  2.514   1.00 15.00 ?  306 THR A O    8  
ATOM   5713  C CB   . THR A 1 28 ? 2.271   -5.771  2.668   1.00 15.00 ?  306 THR A CB   8  
ATOM   5714  O OG1  . THR A 1 28 ? 2.546   -7.087  3.166   1.00 15.00 ?  306 THR A OG1  8  
ATOM   5715  C CG2  . THR A 1 28 ? 3.458   -4.865  2.941   1.00 15.00 ?  306 THR A CG2  8  
ATOM   5716  H H    . THR A 1 28 ? 0.921   -6.506  4.997   1.00 15.00 ?  306 THR A H    8  
ATOM   5717  H HA   . THR A 1 28 ? 1.008   -4.141  3.241   1.00 15.00 ?  306 THR A HA   8  
ATOM   5718  H HB   . THR A 1 28 ? 2.114   -5.824  1.600   1.00 15.00 ?  306 THR A HB   8  
ATOM   5719  H HG1  . THR A 1 28 ? 1.714   -7.519  3.408   1.00 15.00 ?  306 THR A HG1  8  
ATOM   5720  H HG21 . THR A 1 28 ? 3.616   -4.792  4.006   1.00 15.00 ?  306 THR A HG21 8  
ATOM   5721  H HG22 . THR A 1 28 ? 3.262   -3.883  2.536   1.00 15.00 ?  306 THR A HG22 8  
ATOM   5722  H HG23 . THR A 1 28 ? 4.340   -5.278  2.472   1.00 15.00 ?  306 THR A HG23 8  
ATOM   5723  N N    . GLN A 1 29 ? -1.076  -4.858  2.111   1.00 15.00 ?  307 GLN A N    8  
ATOM   5724  C CA   . GLN A 1 29 ? -2.351  -5.255  1.514   1.00 15.00 ?  307 GLN A CA   8  
ATOM   5725  C C    . GLN A 1 29 ? -2.488  -4.787  0.072   1.00 15.00 ?  307 GLN A C    8  
ATOM   5726  O O    . GLN A 1 29 ? -2.255  -3.625  -0.235  1.00 15.00 ?  307 GLN A O    8  
ATOM   5727  C CB   . GLN A 1 29 ? -3.556  -4.723  2.314   1.00 15.00 ?  307 GLN A CB   8  
ATOM   5728  C CG   . GLN A 1 29 ? -3.310  -3.494  3.179   1.00 15.00 ?  307 GLN A CG   8  
ATOM   5729  C CD   . GLN A 1 29 ? -2.506  -3.781  4.426   1.00 15.00 ?  307 GLN A CD   8  
ATOM   5730  O OE1  . GLN A 1 29 ? -2.547  -4.882  4.970   1.00 15.00 ?  307 GLN A OE1  8  
ATOM   5731  N NE2  . GLN A 1 29 ? -1.771  -2.784  4.891   1.00 15.00 ?  307 GLN A NE2  8  
ATOM   5732  H H    . GLN A 1 29 ? -0.824  -3.910  2.130   1.00 15.00 ?  307 GLN A H    8  
ATOM   5733  H HA   . GLN A 1 29 ? -2.387  -6.334  1.523   1.00 15.00 ?  307 GLN A HA   8  
ATOM   5734  H HB2  . GLN A 1 29 ? -4.316  -4.449  1.605   1.00 15.00 ?  307 GLN A HB2  8  
ATOM   5735  H HB3  . GLN A 1 29 ? -3.931  -5.514  2.947   1.00 15.00 ?  307 GLN A HB3  8  
ATOM   5736  H HG2  . GLN A 1 29 ? -2.780  -2.761  2.593   1.00 15.00 ?  307 GLN A HG2  8  
ATOM   5737  H HG3  . GLN A 1 29 ? -4.267  -3.086  3.473   1.00 15.00 ?  307 GLN A HG3  8  
ATOM   5738  H HE21 . GLN A 1 29 ? -1.790  -1.929  4.414   1.00 15.00 ?  307 GLN A HE21 8  
ATOM   5739  H HE22 . GLN A 1 29 ? -1.229  -2.943  5.696   1.00 15.00 ?  307 GLN A HE22 8  
ATOM   5740  N N    . PHE A 1 30 ? -2.900  -5.693  -0.803  1.00 15.00 ?  308 PHE A N    8  
ATOM   5741  C CA   . PHE A 1 30 ? -3.240  -5.321  -2.171  1.00 15.00 ?  308 PHE A CA   8  
ATOM   5742  C C    . PHE A 1 30 ? -4.668  -4.791  -2.239  1.00 15.00 ?  308 PHE A C    8  
ATOM   5743  O O    . PHE A 1 30 ? -5.073  -4.194  -3.236  1.00 15.00 ?  308 PHE A O    8  
ATOM   5744  C CB   . PHE A 1 30 ? -3.072  -6.502  -3.132  1.00 15.00 ?  308 PHE A CB   8  
ATOM   5745  C CG   . PHE A 1 30 ? -1.657  -6.698  -3.600  1.00 15.00 ?  308 PHE A CG   8  
ATOM   5746  C CD1  . PHE A 1 30 ? -0.921  -5.621  -4.068  1.00 15.00 ?  308 PHE A CD1  8  
ATOM   5747  C CD2  . PHE A 1 30 ? -1.067  -7.949  -3.585  1.00 15.00 ?  308 PHE A CD2  8  
ATOM   5748  C CE1  . PHE A 1 30 ? 0.376   -5.787  -4.510  1.00 15.00 ?  308 PHE A CE1  8  
ATOM   5749  C CE2  . PHE A 1 30 ? 0.227   -8.118  -4.024  1.00 15.00 ?  308 PHE A CE2  8  
ATOM   5750  C CZ   . PHE A 1 30 ? 0.950   -7.037  -4.486  1.00 15.00 ?  308 PHE A CZ   8  
ATOM   5751  H H    . PHE A 1 30 ? -2.971  -6.637  -0.524  1.00 15.00 ?  308 PHE A H    8  
ATOM   5752  H HA   . PHE A 1 30 ? -2.567  -4.533  -2.469  1.00 15.00 ?  308 PHE A HA   8  
ATOM   5753  H HB2  . PHE A 1 30 ? -3.385  -7.408  -2.637  1.00 15.00 ?  308 PHE A HB2  8  
ATOM   5754  H HB3  . PHE A 1 30 ? -3.693  -6.340  -4.002  1.00 15.00 ?  308 PHE A HB3  8  
ATOM   5755  H HD1  . PHE A 1 30 ? -1.369  -4.642  -4.081  1.00 15.00 ?  308 PHE A HD1  8  
ATOM   5756  H HD2  . PHE A 1 30 ? -1.626  -8.802  -3.230  1.00 15.00 ?  308 PHE A HD2  8  
ATOM   5757  H HE1  . PHE A 1 30 ? 0.939   -4.940  -4.873  1.00 15.00 ?  308 PHE A HE1  8  
ATOM   5758  H HE2  . PHE A 1 30 ? 0.679   -9.100  -4.004  1.00 15.00 ?  308 PHE A HE2  8  
ATOM   5759  H HZ   . PHE A 1 30 ? 1.962   -7.173  -4.831  1.00 15.00 ?  308 PHE A HZ   8  
ATOM   5760  N N    . THR A 1 31 ? -5.428  -5.037  -1.180  1.00 15.00 ?  309 THR A N    8  
ATOM   5761  C CA   . THR A 1 31 ? -6.795  -4.551  -1.090  1.00 15.00 ?  309 THR A CA   8  
ATOM   5762  C C    . THR A 1 31 ? -6.812  -3.073  -0.703  1.00 15.00 ?  309 THR A C    8  
ATOM   5763  O O    . THR A 1 31 ? -6.539  -2.715  0.448   1.00 15.00 ?  309 THR A O    8  
ATOM   5764  C CB   . THR A 1 31 ? -7.600  -5.366  -0.061  1.00 15.00 ?  309 THR A CB   8  
ATOM   5765  O OG1  . THR A 1 31 ? -7.391  -6.768  -0.288  1.00 15.00 ?  309 THR A OG1  8  
ATOM   5766  C CG2  . THR A 1 31 ? -9.086  -5.049  -0.155  1.00 15.00 ?  309 THR A CG2  8  
ATOM   5767  H H    . THR A 1 31 ? -5.061  -5.562  -0.442  1.00 15.00 ?  309 THR A H    8  
ATOM   5768  H HA   . THR A 1 31 ? -7.260  -4.668  -2.058  1.00 15.00 ?  309 THR A HA   8  
ATOM   5769  H HB   . THR A 1 31 ? -7.253  -5.112  0.932   1.00 15.00 ?  309 THR A HB   8  
ATOM   5770  H HG1  . THR A 1 31 ? -7.439  -6.947  -1.234  1.00 15.00 ?  309 THR A HG1  8  
ATOM   5771  H HG21 . THR A 1 31 ? -9.628  -5.647  0.563   1.00 15.00 ?  309 THR A HG21 8  
ATOM   5772  H HG22 . THR A 1 31 ? -9.441  -5.274  -1.150  1.00 15.00 ?  309 THR A HG22 8  
ATOM   5773  H HG23 . THR A 1 31 ? -9.244  -4.001  0.055   1.00 15.00 ?  309 THR A HG23 8  
ATOM   5774  N N    . ASP A 1 32 ? -7.120  -2.228  -1.672  1.00 15.00 ?  310 ASP A N    8  
ATOM   5775  C CA   . ASP A 1 32 ? -7.128  -0.785  -1.465  1.00 15.00 ?  310 ASP A CA   8  
ATOM   5776  C C    . ASP A 1 32 ? -8.537  -0.269  -1.170  1.00 15.00 ?  310 ASP A C    8  
ATOM   5777  O O    . ASP A 1 32 ? -9.504  -0.658  -1.829  1.00 15.00 ?  310 ASP A O    8  
ATOM   5778  C CB   . ASP A 1 32 ? -6.568  -0.070  -2.694  1.00 15.00 ?  310 ASP A CB   8  
ATOM   5779  C CG   . ASP A 1 32 ? -6.777  1.421   -2.617  1.00 15.00 ?  310 ASP A CG   8  
ATOM   5780  O OD1  . ASP A 1 32 ? -6.022  2.099   -1.898  1.00 15.00 ?  310 ASP A OD1  8  
ATOM   5781  O OD2  . ASP A 1 32 ? -7.720  1.913   -3.257  1.00 15.00 -1 310 ASP A OD2  8  
ATOM   5782  H H    . ASP A 1 32 ? -7.352  -2.583  -2.561  1.00 15.00 ?  310 ASP A H    8  
ATOM   5783  H HA   . ASP A 1 32 ? -6.496  -0.572  -0.617  1.00 15.00 ?  310 ASP A HA   8  
ATOM   5784  H HB2  . ASP A 1 32 ? -5.510  -0.263  -2.773  1.00 15.00 ?  310 ASP A HB2  8  
ATOM   5785  H HB3  . ASP A 1 32 ? -7.064  -0.437  -3.576  1.00 15.00 ?  310 ASP A HB3  8  
ATOM   5786  N N    . PRO A 1 33 ? -8.658  0.622   -0.173  1.00 15.00 ?  311 PRO A N    8  
ATOM   5787  C CA   . PRO A 1 33 ? -9.924  1.253   0.195   1.00 15.00 ?  311 PRO A CA   8  
ATOM   5788  C C    . PRO A 1 33 ? -10.261 2.485   -0.653  1.00 15.00 ?  311 PRO A C    8  
ATOM   5789  O O    . PRO A 1 33 ? -11.393 2.974   -0.614  1.00 15.00 ?  311 PRO A O    8  
ATOM   5790  C CB   . PRO A 1 33 ? -9.685  1.660   1.645   1.00 15.00 ?  311 PRO A CB   8  
ATOM   5791  C CG   . PRO A 1 33 ? -8.231  1.986   1.698   1.00 15.00 ?  311 PRO A CG   8  
ATOM   5792  C CD   . PRO A 1 33 ? -7.555  1.075   0.702   1.00 15.00 ?  311 PRO A CD   8  
ATOM   5793  H HA   . PRO A 1 33 ? -10.743 0.552   0.147   1.00 15.00 ?  311 PRO A HA   8  
ATOM   5794  H HB2  . PRO A 1 33 ? -10.297 2.517   1.890   1.00 15.00 ?  311 PRO A HB2  8  
ATOM   5795  H HB3  . PRO A 1 33 ? -9.930  0.835   2.298   1.00 15.00 ?  311 PRO A HB3  8  
ATOM   5796  H HG2  . PRO A 1 33 ? -8.077  3.021   1.422   1.00 15.00 ?  311 PRO A HG2  8  
ATOM   5797  H HG3  . PRO A 1 33 ? -7.850  1.801   2.692   1.00 15.00 ?  311 PRO A HG3  8  
ATOM   5798  H HD2  . PRO A 1 33 ? -6.816  1.622   0.135   1.00 15.00 ?  311 PRO A HD2  8  
ATOM   5799  H HD3  . PRO A 1 33 ? -7.098  0.237   1.208   1.00 15.00 ?  311 PRO A HD3  8  
ATOM   5800  N N    . ARG A 1 34 ? -9.275  3.006   -1.381  1.00 15.00 ?  312 ARG A N    8  
ATOM   5801  C CA   . ARG A 1 34 ? -9.438  4.251   -2.130  1.00 15.00 ?  312 ARG A CA   8  
ATOM   5802  C C    . ARG A 1 34 ? -10.397 4.085   -3.307  1.00 15.00 ?  312 ARG A C    8  
ATOM   5803  O O    . ARG A 1 34 ? -11.282 4.919   -3.497  1.00 15.00 ?  312 ARG A O    8  
ATOM   5804  C CB   . ARG A 1 34 ? -8.086  4.776   -2.629  1.00 15.00 ?  312 ARG A CB   8  
ATOM   5805  C CG   . ARG A 1 34 ? -7.111  5.111   -1.511  1.00 15.00 ?  312 ARG A CG   8  
ATOM   5806  C CD   . ARG A 1 34 ? -7.557  6.332   -0.724  1.00 15.00 ?  312 ARG A CD   8  
ATOM   5807  N NE   . ARG A 1 34 ? -7.518  7.552   -1.528  1.00 15.00 ?  312 ARG A NE   8  
ATOM   5808  C CZ   . ARG A 1 34 ? -8.238  8.642   -1.262  1.00 15.00 ?  312 ARG A CZ   8  
ATOM   5809  N NH1  . ARG A 1 34 ? -9.090  8.647   -0.243  1.00 15.00 1  312 ARG A NH1  8  
ATOM   5810  N NH2  . ARG A 1 34 ? -8.117  9.721   -2.025  1.00 15.00 ?  312 ARG A NH2  8  
ATOM   5811  H H    . ARG A 1 34 ? -8.418  2.523   -1.442  1.00 15.00 ?  312 ARG A H    8  
ATOM   5812  H HA   . ARG A 1 34 ? -9.858  4.979   -1.453  1.00 15.00 ?  312 ARG A HA   8  
ATOM   5813  H HB2  . ARG A 1 34 ? -7.632  4.026   -3.259  1.00 15.00 ?  312 ARG A HB2  8  
ATOM   5814  H HB3  . ARG A 1 34 ? -8.253  5.670   -3.210  1.00 15.00 ?  312 ARG A HB3  8  
ATOM   5815  H HG2  . ARG A 1 34 ? -7.047  4.269   -0.839  1.00 15.00 ?  312 ARG A HG2  8  
ATOM   5816  H HG3  . ARG A 1 34 ? -6.140  5.304   -1.939  1.00 15.00 ?  312 ARG A HG3  8  
ATOM   5817  H HD2  . ARG A 1 34 ? -8.568  6.173   -0.382  1.00 15.00 ?  312 ARG A HD2  8  
ATOM   5818  H HD3  . ARG A 1 34 ? -6.905  6.452   0.128   1.00 15.00 ?  312 ARG A HD3  8  
ATOM   5819  H HE   . ARG A 1 34 ? -6.903  7.564   -2.305  1.00 15.00 ?  312 ARG A HE   8  
ATOM   5820  H HH11 . ARG A 1 34 ? -9.195  7.834   0.328   1.00 15.00 ?  312 ARG A HH11 8  
ATOM   5821  H HH12 . ARG A 1 34 ? -9.638  9.467   -0.043  1.00 15.00 ?  312 ARG A HH12 8  
ATOM   5822  H HH21 . ARG A 1 34 ? -7.483  9.720   -2.808  1.00 15.00 ?  312 ARG A HH21 8  
ATOM   5823  H HH22 . ARG A 1 34 ? -8.656  10.548  -1.825  1.00 15.00 ?  312 ARG A HH22 8  
ATOM   5824  N N    . LEU A 1 35 ? -10.218 3.040   -4.116  1.00 15.00 ?  313 LEU A N    8  
ATOM   5825  C CA   . LEU A 1 35 ? -11.149 2.799   -5.222  1.00 15.00 ?  313 LEU A CA   8  
ATOM   5826  C C    . LEU A 1 35 ? -12.367 2.003   -4.761  1.00 15.00 ?  313 LEU A C    8  
ATOM   5827  O O    . LEU A 1 35 ? -13.210 2.584   -4.046  1.00 15.00 ?  313 LEU A O    8  
ATOM   5828  C CB   . LEU A 1 35 ? -10.497 2.141   -6.471  1.00 15.00 ?  313 LEU A CB   8  
ATOM   5829  C CG   . LEU A 1 35 ? -9.362  1.105   -6.292  1.00 15.00 ?  313 LEU A CG   8  
ATOM   5830  C CD1  . LEU A 1 35 ? -8.019  1.795   -6.123  1.00 15.00 ?  313 LEU A CD1  8  
ATOM   5831  C CD2  . LEU A 1 35 ? -9.623  0.158   -5.127  1.00 15.00 ?  313 LEU A CD2  8  
ATOM   5832  H H    . LEU A 1 35 ? -9.455  2.428   -3.964  1.00 15.00 ?  313 LEU A H    8  
ATOM   5833  H HA   . LEU A 1 35 ? -11.509 3.774   -5.521  1.00 15.00 ?  313 LEU A HA   8  
ATOM   5834  H HB2  . LEU A 1 35 ? -11.284 1.654   -7.024  1.00 15.00 ?  313 LEU A HB2  8  
ATOM   5835  H HB3  . LEU A 1 35 ? -10.112 2.941   -7.090  1.00 15.00 ?  313 LEU A HB3  8  
ATOM   5836  H HG   . LEU A 1 35 ? -9.305  0.507   -7.191  1.00 15.00 ?  313 LEU A HG   8  
ATOM   5837  H HD11 . LEU A 1 35 ? -7.952  2.218   -5.130  1.00 15.00 ?  313 LEU A HD11 8  
ATOM   5838  H HD12 . LEU A 1 35 ? -7.923  2.582   -6.859  1.00 15.00 ?  313 LEU A HD12 8  
ATOM   5839  H HD13 . LEU A 1 35 ? -7.227  1.075   -6.262  1.00 15.00 ?  313 LEU A HD13 8  
ATOM   5840  H HD21 . LEU A 1 35 ? -8.808  -0.546  -5.045  1.00 15.00 ?  313 LEU A HD21 8  
ATOM   5841  H HD22 . LEU A 1 35 ? -10.546 -0.377  -5.299  1.00 15.00 ?  313 LEU A HD22 8  
ATOM   5842  H HD23 . LEU A 1 35 ? -9.702  0.727   -4.213  1.00 15.00 ?  313 LEU A HD23 8  
ATOM   5843  N N    . ASP B 2 2  ? -1.771  -8.610  -8.060  1.00 15.00 ?  221 ASP B N    8  
ATOM   5844  C CA   . ASP B 2 2  ? -0.355  -8.802  -8.444  1.00 15.00 ?  221 ASP B CA   8  
ATOM   5845  C C    . ASP B 2 2  ? 0.239   -9.945  -7.622  1.00 15.00 ?  221 ASP B C    8  
ATOM   5846  O O    . ASP B 2 2  ? -0.464  -10.550 -6.810  1.00 15.00 ?  221 ASP B O    8  
ATOM   5847  C CB   . ASP B 2 2  ? 0.426   -7.497  -8.221  1.00 15.00 ?  221 ASP B CB   8  
ATOM   5848  C CG   . ASP B 2 2  ? 1.807   -7.516  -8.847  1.00 15.00 ?  221 ASP B CG   8  
ATOM   5849  O OD1  . ASP B 2 2  ? 1.912   -7.383  -10.080 1.00 15.00 -1 221 ASP B OD1  8  
ATOM   5850  O OD2  . ASP B 2 2  ? 2.798   -7.672  -8.110  1.00 15.00 ?  221 ASP B OD2  8  
ATOM   5851  H H    . ASP B 2 2  ? -1.845  -8.467  -7.036  1.00 15.00 ?  221 ASP B H    8  
ATOM   5852  H HA   . ASP B 2 2  ? -0.318  -9.069  -9.490  1.00 15.00 ?  221 ASP B HA   8  
ATOM   5853  H HB2  . ASP B 2 2  ? -0.130  -6.678  -8.651  1.00 15.00 ?  221 ASP B HB2  8  
ATOM   5854  H HB3  . ASP B 2 2  ? 0.535   -7.333  -7.160  1.00 15.00 ?  221 ASP B HB3  8  
ATOM   5855  N N    . THR B 2 3  ? 1.511   -10.252 -7.839  1.00 15.00 ?  222 THR B N    8  
ATOM   5856  C CA   . THR B 2 3  ? 2.197   -11.292 -7.084  1.00 15.00 ?  222 THR B CA   8  
ATOM   5857  C C    . THR B 2 3  ? 2.304   -10.904 -5.612  1.00 15.00 ?  222 THR B C    8  
ATOM   5858  O O    . THR B 2 3  ? 2.131   -9.738  -5.285  1.00 15.00 ?  222 THR B O    8  
ATOM   5859  C CB   . THR B 2 3  ? 3.600   -11.535 -7.668  1.00 15.00 ?  222 THR B CB   8  
ATOM   5860  O OG1  . THR B 2 3  ? 4.231   -10.276 -7.949  1.00 15.00 ?  222 THR B OG1  8  
ATOM   5861  C CG2  . THR B 2 3  ? 3.524   -12.366 -8.939  1.00 15.00 ?  222 THR B CG2  8  
ATOM   5862  H H    . THR B 2 3  ? 2.014   -9.753  -8.517  1.00 15.00 ?  222 THR B H    8  
ATOM   5863  H HA   . THR B 2 3  ? 1.621   -12.202 -7.164  1.00 15.00 ?  222 THR B HA   8  
ATOM   5864  H HB   . THR B 2 3  ? 4.191   -12.071 -6.938  1.00 15.00 ?  222 THR B HB   8  
ATOM   5865  H HG1  . THR B 2 3  ? 3.864   -9.596  -7.365  1.00 15.00 ?  222 THR B HG1  8  
ATOM   5866  H HG21 . THR B 2 3  ? 4.520   -12.531 -9.320  1.00 15.00 ?  222 THR B HG21 8  
ATOM   5867  H HG22 . THR B 2 3  ? 2.939   -11.840 -9.679  1.00 15.00 ?  222 THR B HG22 8  
ATOM   5868  H HG23 . THR B 2 3  ? 3.058   -13.316 -8.723  1.00 15.00 ?  222 THR B HG23 8  
ATOM   5869  N N    . PRO B 2 4  ? 2.620   -11.862 -4.712  1.00 15.00 ?  223 PRO B N    8  
ATOM   5870  C CA   . PRO B 2 4  ? 2.597   -11.634 -3.258  1.00 15.00 ?  223 PRO B CA   8  
ATOM   5871  C C    . PRO B 2 4  ? 3.337   -10.357 -2.849  1.00 15.00 ?  223 PRO B C    8  
ATOM   5872  O O    . PRO B 2 4  ? 4.462   -10.111 -3.294  1.00 15.00 ?  223 PRO B O    8  
ATOM   5873  C CB   . PRO B 2 4  ? 3.309   -12.869 -2.679  1.00 15.00 ?  223 PRO B CB   8  
ATOM   5874  C CG   . PRO B 2 4  ? 3.869   -13.607 -3.852  1.00 15.00 ?  223 PRO B CG   8  
ATOM   5875  C CD   . PRO B 2 4  ? 3.011   -13.241 -5.025  1.00 15.00 ?  223 PRO B CD   8  
ATOM   5876  H HA   . PRO B 2 4  ? 1.586   -11.596 -2.892  1.00 15.00 ?  223 PRO B HA   8  
ATOM   5877  H HB2  . PRO B 2 4  ? 4.090   -12.549 -2.006  1.00 15.00 ?  223 PRO B HB2  8  
ATOM   5878  H HB3  . PRO B 2 4  ? 2.594   -13.474 -2.140  1.00 15.00 ?  223 PRO B HB3  8  
ATOM   5879  H HG2  . PRO B 2 4  ? 4.891   -13.302 -4.025  1.00 15.00 ?  223 PRO B HG2  8  
ATOM   5880  H HG3  . PRO B 2 4  ? 3.823   -14.672 -3.671  1.00 15.00 ?  223 PRO B HG3  8  
ATOM   5881  H HD2  . PRO B 2 4  ? 3.581   -13.285 -5.942  1.00 15.00 ?  223 PRO B HD2  8  
ATOM   5882  H HD3  . PRO B 2 4  ? 2.147   -13.885 -5.081  1.00 15.00 ?  223 PRO B HD3  8  
ATOM   5883  N N    . PRO B 2 5  ? 2.715   -9.538  -1.972  1.00 15.00 ?  224 PRO B N    8  
ATOM   5884  C CA   . PRO B 2 5  ? 3.193   -8.184  -1.677  1.00 15.00 ?  224 PRO B CA   8  
ATOM   5885  C C    . PRO B 2 5  ? 4.594   -8.149  -1.078  1.00 15.00 ?  224 PRO B C    8  
ATOM   5886  O O    . PRO B 2 5  ? 4.952   -8.977  -0.237  1.00 15.00 ?  224 PRO B O    8  
ATOM   5887  C CB   . PRO B 2 5  ? 2.170   -7.633  -0.678  1.00 15.00 ?  224 PRO B CB   8  
ATOM   5888  C CG   . PRO B 2 5  ? 1.465   -8.819  -0.124  1.00 15.00 ?  224 PRO B CG   8  
ATOM   5889  C CD   . PRO B 2 5  ? 1.513   -9.881  -1.186  1.00 15.00 ?  224 PRO B CD   8  
ATOM   5890  H HA   . PRO B 2 5  ? 3.182   -7.572  -2.567  1.00 15.00 ?  224 PRO B HA   8  
ATOM   5891  H HB2  . PRO B 2 5  ? 2.684   -7.087  0.100   1.00 15.00 ?  224 PRO B HB2  8  
ATOM   5892  H HB3  . PRO B 2 5  ? 1.484   -6.974  -1.191  1.00 15.00 ?  224 PRO B HB3  8  
ATOM   5893  H HG2  . PRO B 2 5  ? 1.966   -9.161  0.769   1.00 15.00 ?  224 PRO B HG2  8  
ATOM   5894  H HG3  . PRO B 2 5  ? 0.438   -8.559  0.096   1.00 15.00 ?  224 PRO B HG3  8  
ATOM   5895  H HD2  . PRO B 2 5  ? 1.613   -10.854 -0.729  1.00 15.00 ?  224 PRO B HD2  8  
ATOM   5896  H HD3  . PRO B 2 5  ? 0.623   -9.837  -1.798  1.00 15.00 ?  224 PRO B HD3  8  
ATOM   5897  N N    . PRO B 2 6  ? 5.398   -7.173  -1.524  1.00 15.00 ?  225 PRO B N    8  
ATOM   5898  C CA   . PRO B 2 6  ? 6.745   -6.924  -0.997  1.00 15.00 ?  225 PRO B CA   8  
ATOM   5899  C C    . PRO B 2 6  ? 6.729   -6.526  0.477   1.00 15.00 ?  225 PRO B C    8  
ATOM   5900  O O    . PRO B 2 6  ? 5.666   -6.405  1.088   1.00 15.00 ?  225 PRO B O    8  
ATOM   5901  C CB   . PRO B 2 6  ? 7.242   -5.735  -1.827  1.00 15.00 ?  225 PRO B CB   8  
ATOM   5902  C CG   . PRO B 2 6  ? 6.369   -5.686  -3.030  1.00 15.00 ?  225 PRO B CG   8  
ATOM   5903  C CD   . PRO B 2 6  ? 5.046   -6.238  -2.604  1.00 15.00 ?  225 PRO B CD   8  
ATOM   5904  H HA   . PRO B 2 6  ? 7.398   -7.772  -1.141  1.00 15.00 ?  225 PRO B HA   8  
ATOM   5905  H HB2  . PRO B 2 6  ? 7.153   -4.830  -1.245  1.00 15.00 ?  225 PRO B HB2  8  
ATOM   5906  H HB3  . PRO B 2 6  ? 8.271   -5.889  -2.097  1.00 15.00 ?  225 PRO B HB3  8  
ATOM   5907  H HG2  . PRO B 2 6  ? 6.260   -4.666  -3.363  1.00 15.00 ?  225 PRO B HG2  8  
ATOM   5908  H HG3  . PRO B 2 6  ? 6.791   -6.291  -3.813  1.00 15.00 ?  225 PRO B HG3  8  
ATOM   5909  H HD2  . PRO B 2 6  ? 4.408   -5.447  -2.239  1.00 15.00 ?  225 PRO B HD2  8  
ATOM   5910  H HD3  . PRO B 2 6  ? 4.576   -6.758  -3.422  1.00 15.00 ?  225 PRO B HD3  8  
ATOM   5911  N N    . ALA B 2 7  ? 7.911   -6.301  1.041   1.00 15.00 ?  226 ALA B N    8  
ATOM   5912  C CA   . ALA B 2 7  ? 8.015   -5.749  2.383   1.00 15.00 ?  226 ALA B CA   8  
ATOM   5913  C C    . ALA B 2 7  ? 7.521   -4.308  2.367   1.00 15.00 ?  226 ALA B C    8  
ATOM   5914  O O    . ALA B 2 7  ? 7.459   -3.681  1.305   1.00 15.00 ?  226 ALA B O    8  
ATOM   5915  C CB   . ALA B 2 7  ? 9.449   -5.824  2.882   1.00 15.00 ?  226 ALA B CB   8  
ATOM   5916  H H    . ALA B 2 7  ? 8.733   -6.503  0.539   1.00 15.00 ?  226 ALA B H    8  
ATOM   5917  H HA   . ALA B 2 7  ? 7.388   -6.334  3.041   1.00 15.00 ?  226 ALA B HA   8  
ATOM   5918  H HB1  . ALA B 2 7  ? 9.777   -6.852  2.877   1.00 15.00 ?  226 ALA B HB1  8  
ATOM   5919  H HB2  . ALA B 2 7  ? 9.504   -5.433  3.886   1.00 15.00 ?  226 ALA B HB2  8  
ATOM   5920  H HB3  . ALA B 2 7  ? 10.086  -5.240  2.233   1.00 15.00 ?  226 ALA B HB3  8  
ATOM   5921  N N    . TYR B 2 8  ? 7.179   -3.768  3.524   1.00 15.00 ?  227 TYR B N    8  
ATOM   5922  C CA   . TYR B 2 8  ? 6.566   -2.454  3.556   1.00 15.00 ?  227 TYR B CA   8  
ATOM   5923  C C    . TYR B 2 8  ? 7.620   -1.358  3.662   1.00 15.00 ?  227 TYR B C    8  
ATOM   5924  O O    . TYR B 2 8  ? 8.487   -1.368  4.539   1.00 15.00 ?  227 TYR B O    8  
ATOM   5925  C CB   . TYR B 2 8  ? 5.539   -2.338  4.694   1.00 15.00 ?  227 TYR B CB   8  
ATOM   5926  C CG   . TYR B 2 8  ? 6.117   -1.892  6.014   1.00 15.00 ?  227 TYR B CG   8  
ATOM   5927  C CD1  . TYR B 2 8  ? 6.612   -2.797  6.942   1.00 15.00 ?  227 TYR B CD1  8  
ATOM   5928  C CD2  . TYR B 2 8  ? 6.179   -0.541  6.313   1.00 15.00 ?  227 TYR B CD2  8  
ATOM   5929  C CE1  . TYR B 2 8  ? 7.156   -2.358  8.136   1.00 15.00 ?  227 TYR B CE1  8  
ATOM   5930  C CE2  . TYR B 2 8  ? 6.717   -0.095  7.496   1.00 15.00 ?  227 TYR B CE2  8  
ATOM   5931  C CZ   . TYR B 2 8  ? 7.207   -1.006  8.408   1.00 15.00 ?  227 TYR B CZ   8  
ATOM   5932  O OH   . TYR B 2 8  ? 7.748   -0.568  9.597   1.00 15.00 ?  227 TYR B OH   8  
ATOM   5933  H H    . TYR B 2 8  ? 7.345   -4.250  4.359   1.00 15.00 ?  227 TYR B H    8  
ATOM   5934  H HA   . TYR B 2 8  ? 6.048   -2.324  2.616   1.00 15.00 ?  227 TYR B HA   8  
ATOM   5935  H HB2  . TYR B 2 8  ? 4.787   -1.614  4.412   1.00 15.00 ?  227 TYR B HB2  8  
ATOM   5936  H HB3  . TYR B 2 8  ? 5.066   -3.292  4.835   1.00 15.00 ?  227 TYR B HB3  8  
ATOM   5937  H HD1  . TYR B 2 8  ? 6.571   -3.853  6.722   1.00 15.00 ?  227 TYR B HD1  8  
ATOM   5938  H HD2  . TYR B 2 8  ? 5.789   0.173   5.594   1.00 15.00 ?  227 TYR B HD2  8  
ATOM   5939  H HE1  . TYR B 2 8  ? 7.539   -3.074  8.848   1.00 15.00 ?  227 TYR B HE1  8  
ATOM   5940  H HE2  . TYR B 2 8  ? 6.756   0.970   7.694   1.00 15.00 ?  227 TYR B HE2  8  
ATOM   5941  H HH   . TYR B 2 8  ? 7.164   0.089   9.995   1.00 15.00 ?  227 TYR B HH   8  
ATOM   5942  N N    . LEU B 2 9  ? 7.549   -0.441  2.726   1.00 15.00 ?  228 LEU B N    8  
ATOM   5943  C CA   . LEU B 2 9  ? 8.375   0.750   2.717   1.00 15.00 ?  228 LEU B CA   8  
ATOM   5944  C C    . LEU B 2 9  ? 7.471   1.952   2.506   1.00 15.00 ?  228 LEU B C    8  
ATOM   5945  O O    . LEU B 2 9  ? 6.392   1.798   1.963   1.00 15.00 ?  228 LEU B O    8  
ATOM   5946  C CB   . LEU B 2 9  ? 9.441   0.665   1.616   1.00 15.00 ?  228 LEU B CB   8  
ATOM   5947  C CG   . LEU B 2 9  ? 10.499  -0.426  1.811   1.00 15.00 ?  228 LEU B CG   8  
ATOM   5948  C CD1  . LEU B 2 9  ? 11.445  -0.465  0.619   1.00 15.00 ?  228 LEU B CD1  8  
ATOM   5949  C CD2  . LEU B 2 9  ? 11.272  -0.192  3.102   1.00 15.00 ?  228 LEU B CD2  8  
ATOM   5950  H H    . LEU B 2 9  ? 6.899   -0.563  2.003   1.00 15.00 ?  228 LEU B H    8  
ATOM   5951  H HA   . LEU B 2 9  ? 8.843   0.834   3.687   1.00 15.00 ?  228 LEU B HA   8  
ATOM   5952  H HB2  . LEU B 2 9  ? 8.942   0.489   0.674   1.00 15.00 ?  228 LEU B HB2  8  
ATOM   5953  H HB3  . LEU B 2 9  ? 9.946   1.618   1.563   1.00 15.00 ?  228 LEU B HB3  8  
ATOM   5954  H HG   . LEU B 2 9  ? 10.011  -1.387  1.882   1.00 15.00 ?  228 LEU B HG   8  
ATOM   5955  H HD11 . LEU B 2 9  ? 10.886  -0.693  -0.276  1.00 15.00 ?  228 LEU B HD11 8  
ATOM   5956  H HD12 . LEU B 2 9  ? 12.194  -1.227  0.780   1.00 15.00 ?  228 LEU B HD12 8  
ATOM   5957  H HD13 . LEU B 2 9  ? 11.925  0.496   0.509   1.00 15.00 ?  228 LEU B HD13 8  
ATOM   5958  H HD21 . LEU B 2 9  ? 12.021  -0.961  3.219   1.00 15.00 ?  228 LEU B HD21 8  
ATOM   5959  H HD22 . LEU B 2 9  ? 10.590  -0.223  3.939   1.00 15.00 ?  228 LEU B HD22 8  
ATOM   5960  H HD23 . LEU B 2 9  ? 11.752  0.774   3.064   1.00 15.00 ?  228 LEU B HD23 8  
ATOM   5961  N N    . PRO B 2 10 ? 7.906   3.173   2.833   1.00 15.00 ?  229 PRO B N    8  
ATOM   5962  C CA   . PRO B 2 10 ? 7.017   4.331   2.802   1.00 15.00 ?  229 PRO B CA   8  
ATOM   5963  C C    . PRO B 2 10 ? 6.990   4.971   1.424   1.00 15.00 ?  229 PRO B C    8  
ATOM   5964  O O    . PRO B 2 10 ? 7.900   4.791   0.614   1.00 15.00 ?  229 PRO B O    8  
ATOM   5965  C CB   . PRO B 2 10 ? 7.668   5.305   3.802   1.00 15.00 ?  229 PRO B CB   8  
ATOM   5966  C CG   . PRO B 2 10 ? 8.816   4.572   4.409   1.00 15.00 ?  229 PRO B CG   8  
ATOM   5967  C CD   . PRO B 2 10 ? 9.188   3.491   3.443   1.00 15.00 ?  229 PRO B CD   8  
ATOM   5968  H HA   . PRO B 2 10 ? 6.015   4.086   3.119   1.00 15.00 ?  229 PRO B HA   8  
ATOM   5969  H HB2  . PRO B 2 10 ? 8.003   6.188   3.278   1.00 15.00 ?  229 PRO B HB2  8  
ATOM   5970  H HB3  . PRO B 2 10 ? 6.943   5.587   4.551   1.00 15.00 ?  229 PRO B HB3  8  
ATOM   5971  H HG2  . PRO B 2 10 ? 9.640   5.244   4.554   1.00 15.00 ?  229 PRO B HG2  8  
ATOM   5972  H HG3  . PRO B 2 10 ? 8.515   4.141   5.352   1.00 15.00 ?  229 PRO B HG3  8  
ATOM   5973  H HD2  . PRO B 2 10 ? 9.895   3.847   2.717   1.00 15.00 ?  229 PRO B HD2  8  
ATOM   5974  H HD3  . PRO B 2 10 ? 9.574   2.641   3.975   1.00 15.00 ?  229 PRO B HD3  8  
ATOM   5975  N N    . PRO B 2 11 ? 5.935   5.752   1.160   1.00 15.00 ?  230 PRO B N    8  
ATOM   5976  C CA   . PRO B 2 11 ? 5.322   5.818   -0.157  1.00 15.00 ?  230 PRO B CA   8  
ATOM   5977  C C    . PRO B 2 11 ? 5.886   6.860   -1.112  1.00 15.00 ?  230 PRO B C    8  
ATOM   5978  O O    . PRO B 2 11 ? 6.063   8.033   -0.775  1.00 15.00 ?  230 PRO B O    8  
ATOM   5979  C CB   . PRO B 2 11 ? 3.881   6.158   0.205   1.00 15.00 ?  230 PRO B CB   8  
ATOM   5980  C CG   . PRO B 2 11 ? 3.975   7.017   1.420   1.00 15.00 ?  230 PRO B CG   8  
ATOM   5981  C CD   . PRO B 2 11 ? 5.257   6.645   2.118   1.00 15.00 ?  230 PRO B CD   8  
ATOM   5982  H HA   . PRO B 2 11 ? 5.338   4.855   -0.642  1.00 15.00 ?  230 PRO B HA   8  
ATOM   5983  H HB2  . PRO B 2 11 ? 3.423   6.688   -0.608  1.00 15.00 ?  230 PRO B HB2  8  
ATOM   5984  H HB3  . PRO B 2 11 ? 3.332   5.251   0.406   1.00 15.00 ?  230 PRO B HB3  8  
ATOM   5985  H HG2  . PRO B 2 11 ? 4.000   8.058   1.131   1.00 15.00 ?  230 PRO B HG2  8  
ATOM   5986  H HG3  . PRO B 2 11 ? 3.133   6.828   2.066   1.00 15.00 ?  230 PRO B HG3  8  
ATOM   5987  H HD2  . PRO B 2 11 ? 5.852   7.528   2.305   1.00 15.00 ?  230 PRO B HD2  8  
ATOM   5988  H HD3  . PRO B 2 11 ? 5.045   6.132   3.043   1.00 15.00 ?  230 PRO B HD3  8  
ATOM   5989  N N    . GLU B 2 12 ? 6.156   6.379   -2.317  1.00 15.00 ?  231 GLU B N    8  
ATOM   5990  C CA   . GLU B 2 12 ? 6.493   7.210   -3.453  1.00 15.00 ?  231 GLU B CA   8  
ATOM   5991  C C    . GLU B 2 12 ? 5.385   7.047   -4.494  1.00 15.00 ?  231 GLU B C    8  
ATOM   5992  O O    . GLU B 2 12 ? 4.872   5.940   -4.673  1.00 15.00 ?  231 GLU B O    8  
ATOM   5993  C CB   . GLU B 2 12 ? 7.843   6.777   -4.039  1.00 15.00 ?  231 GLU B CB   8  
ATOM   5994  C CG   . GLU B 2 12 ? 7.839   5.374   -4.638  1.00 15.00 ?  231 GLU B CG   8  
ATOM   5995  C CD   . GLU B 2 12 ? 9.219   4.909   -5.052  1.00 15.00 ?  231 GLU B CD   8  
ATOM   5996  O OE1  . GLU B 2 12 ? 10.216  5.428   -4.519  1.00 15.00 ?  231 GLU B OE1  8  
ATOM   5997  O OE2  . GLU B 2 12 ? 9.310   3.989   -5.888  1.00 15.00 -1 231 GLU B OE2  8  
ATOM   5998  H H    . GLU B 2 12 ? 6.117   5.411   -2.449  1.00 15.00 ?  231 GLU B H    8  
ATOM   5999  H HA   . GLU B 2 12 ? 6.546   8.238   -3.125  1.00 15.00 ?  231 GLU B HA   8  
ATOM   6000  H HB2  . GLU B 2 12 ? 8.123   7.473   -4.816  1.00 15.00 ?  231 GLU B HB2  8  
ATOM   6001  H HB3  . GLU B 2 12 ? 8.586   6.808   -3.257  1.00 15.00 ?  231 GLU B HB3  8  
ATOM   6002  H HG2  . GLU B 2 12 ? 7.443   4.675   -3.914  1.00 15.00 ?  231 GLU B HG2  8  
ATOM   6003  H HG3  . GLU B 2 12 ? 7.203   5.376   -5.513  1.00 15.00 ?  231 GLU B HG3  8  
ATOM   6004  N N    . ASP B 2 13 ? 5.002   8.123   -5.163  1.00 15.00 ?  232 ASP B N    8  
ATOM   6005  C CA   . ASP B 2 13 ? 3.946   8.047   -6.166  1.00 15.00 ?  232 ASP B CA   8  
ATOM   6006  C C    . ASP B 2 13 ? 4.281   8.934   -7.358  1.00 15.00 ?  232 ASP B C    8  
ATOM   6007  O O    . ASP B 2 13 ? 4.462   10.146  -7.215  1.00 15.00 ?  232 ASP B O    8  
ATOM   6008  C CB   . ASP B 2 13 ? 2.598   8.450   -5.557  1.00 15.00 ?  232 ASP B CB   8  
ATOM   6009  C CG   . ASP B 2 13 ? 1.471   8.470   -6.576  1.00 15.00 ?  232 ASP B CG   8  
ATOM   6010  O OD1  . ASP B 2 13 ? 1.258   9.516   -7.219  1.00 15.00 -1 232 ASP B OD1  8  
ATOM   6011  O OD2  . ASP B 2 13 ? 0.782   7.437   -6.731  1.00 15.00 ?  232 ASP B OD2  8  
ATOM   6012  H H    . ASP B 2 13 ? 5.435   8.989   -4.985  1.00 15.00 ?  232 ASP B H    8  
ATOM   6013  H HA   . ASP B 2 13 ? 3.885   7.024   -6.504  1.00 15.00 ?  232 ASP B HA   8  
ATOM   6014  H HB2  . ASP B 2 13 ? 2.339   7.738   -4.781  1.00 15.00 ?  232 ASP B HB2  8  
ATOM   6015  H HB3  . ASP B 2 13 ? 2.687   9.435   -5.123  1.00 15.00 ?  232 ASP B HB3  8  
ATOM   6016  N N    . PRO B 2 14 ? 4.400   8.331   -8.550  1.00 15.00 ?  233 PRO B N    8  
ATOM   6017  C CA   . PRO B 2 14 ? 4.678   9.050   -9.781  1.00 15.00 ?  233 PRO B CA   8  
ATOM   6018  C C    . PRO B 2 14 ? 3.401   9.442   -10.520 1.00 15.00 ?  233 PRO B C    8  
ATOM   6019  O O    . PRO B 2 14 ? 3.133   8.968   -11.625 1.00 15.00 ?  233 PRO B O    8  
ATOM   6020  C CB   . PRO B 2 14 ? 5.480   8.025   -10.582 1.00 15.00 ?  233 PRO B CB   8  
ATOM   6021  C CG   . PRO B 2 14 ? 5.012   6.681   -10.103 1.00 15.00 ?  233 PRO B CG   8  
ATOM   6022  C CD   . PRO B 2 14 ? 4.288   6.888   -8.790  1.00 15.00 ?  233 PRO B CD   8  
ATOM   6023  H HA   . PRO B 2 14 ? 5.280   9.929   -9.604  1.00 15.00 ?  233 PRO B HA   8  
ATOM   6024  H HB2  . PRO B 2 14 ? 5.282   8.156   -11.635 1.00 15.00 ?  233 PRO B HB2  8  
ATOM   6025  H HB3  . PRO B 2 14 ? 6.535   8.161   -10.391 1.00 15.00 ?  233 PRO B HB3  8  
ATOM   6026  H HG2  . PRO B 2 14 ? 4.340   6.252   -10.831 1.00 15.00 ?  233 PRO B HG2  8  
ATOM   6027  H HG3  . PRO B 2 14 ? 5.863   6.032   -9.958  1.00 15.00 ?  233 PRO B HG3  8  
ATOM   6028  H HD2  . PRO B 2 14 ? 3.253   6.596   -8.881  1.00 15.00 ?  233 PRO B HD2  8  
ATOM   6029  H HD3  . PRO B 2 14 ? 4.770   6.328   -8.002  1.00 15.00 ?  233 PRO B HD3  8  
HETATM 6030  N N    . NH2 B 2 15 ? 2.621   10.319  -9.913  1.00 15.00 ?  234 NH2 B N    8  
HETATM 6031  H HN1  . NH2 B 2 15 ? 2.897   10.652  -9.032  1.00 15.00 ?  234 NH2 B HN1  8  
HETATM 6032  H HN2  . NH2 B 2 15 ? 1.799   10.598  -10.363 1.00 15.00 ?  234 NH2 B HN2  8  
ATOM   6033  N N    . LEU A 1 1  ? -12.319 5.887   -5.056  1.00 15.00 ?  279 LEU A N    9  
ATOM   6034  C CA   . LEU A 1 1  ? -12.371 6.807   -3.896  1.00 15.00 ?  279 LEU A CA   9  
ATOM   6035  C C    . LEU A 1 1  ? -12.936 6.091   -2.675  1.00 15.00 ?  279 LEU A C    9  
ATOM   6036  O O    . LEU A 1 1  ? -13.773 5.197   -2.803  1.00 15.00 ?  279 LEU A O    9  
ATOM   6037  C CB   . LEU A 1 1  ? -13.179 8.094   -4.233  1.00 15.00 ?  279 LEU A CB   9  
ATOM   6038  C CG   . LEU A 1 1  ? -14.704 7.985   -4.503  1.00 15.00 ?  279 LEU A CG   9  
ATOM   6039  C CD1  . LEU A 1 1  ? -15.044 6.897   -5.511  1.00 15.00 ?  279 LEU A CD1  9  
ATOM   6040  C CD2  . LEU A 1 1  ? -15.494 7.798   -3.213  1.00 15.00 ?  279 LEU A CD2  9  
ATOM   6041  H H1   . LEU A 1 1  ? -11.940 6.378   -5.888  1.00 15.00 ?  279 LEU A H1   9  
ATOM   6042  H H2   . LEU A 1 1  ? -13.271 5.532   -5.278  1.00 15.00 ?  279 LEU A H2   9  
ATOM   6043  H H3   . LEU A 1 1  ? -11.704 5.070   -4.840  1.00 15.00 ?  279 LEU A H3   9  
ATOM   6044  H HA   . LEU A 1 1  ? -11.352 7.093   -3.668  1.00 15.00 ?  279 LEU A HA   9  
ATOM   6045  H HB2  . LEU A 1 1  ? -13.051 8.780   -3.411  1.00 15.00 ?  279 LEU A HB2  9  
ATOM   6046  H HB3  . LEU A 1 1  ? -12.724 8.540   -5.106  1.00 15.00 ?  279 LEU A HB3  9  
ATOM   6047  H HG   . LEU A 1 1  ? -15.028 8.920   -4.939  1.00 15.00 ?  279 LEU A HG   9  
ATOM   6048  H HD11 . LEU A 1 1  ? -16.112 6.873   -5.670  1.00 15.00 ?  279 LEU A HD11 9  
ATOM   6049  H HD12 . LEU A 1 1  ? -14.714 5.940   -5.133  1.00 15.00 ?  279 LEU A HD12 9  
ATOM   6050  H HD13 . LEU A 1 1  ? -14.545 7.106   -6.447  1.00 15.00 ?  279 LEU A HD13 9  
ATOM   6051  H HD21 . LEU A 1 1  ? -16.545 7.707   -3.447  1.00 15.00 ?  279 LEU A HD21 9  
ATOM   6052  H HD22 . LEU A 1 1  ? -15.339 8.653   -2.570  1.00 15.00 ?  279 LEU A HD22 9  
ATOM   6053  H HD23 . LEU A 1 1  ? -15.159 6.903   -2.710  1.00 15.00 ?  279 LEU A HD23 9  
ATOM   6054  N N    . GLY A 1 2  ? -12.480 6.485   -1.493  1.00 15.00 ?  280 GLY A N    9  
ATOM   6055  C CA   . GLY A 1 2  ? -12.961 5.870   -0.277  1.00 15.00 ?  280 GLY A CA   9  
ATOM   6056  C C    . GLY A 1 2  ? -12.231 6.373   0.949   1.00 15.00 ?  280 GLY A C    9  
ATOM   6057  O O    . GLY A 1 2  ? -11.443 7.317   0.853   1.00 15.00 ?  280 GLY A O    9  
ATOM   6058  H H    . GLY A 1 2  ? -11.806 7.197   -1.446  1.00 15.00 ?  280 GLY A H    9  
ATOM   6059  H HA2  . GLY A 1 2  ? -14.015 6.085   -0.168  1.00 15.00 ?  280 GLY A HA2  9  
ATOM   6060  H HA3  . GLY A 1 2  ? -12.828 4.801   -0.347  1.00 15.00 ?  280 GLY A HA3  9  
ATOM   6061  N N    . PRO A 1 3  ? -12.460 5.751   2.111   1.00 15.00 ?  281 PRO A N    9  
ATOM   6062  C CA   . PRO A 1 3  ? -11.871 6.180   3.371   1.00 15.00 ?  281 PRO A CA   9  
ATOM   6063  C C    . PRO A 1 3  ? -10.524 5.515   3.643   1.00 15.00 ?  281 PRO A C    9  
ATOM   6064  O O    . PRO A 1 3  ? -10.356 4.310   3.447   1.00 15.00 ?  281 PRO A O    9  
ATOM   6065  C CB   . PRO A 1 3  ? -12.914 5.723   4.388   1.00 15.00 ?  281 PRO A CB   9  
ATOM   6066  C CG   . PRO A 1 3  ? -13.536 4.500   3.792   1.00 15.00 ?  281 PRO A CG   9  
ATOM   6067  C CD   . PRO A 1 3  ? -13.340 4.583   2.295   1.00 15.00 ?  281 PRO A CD   9  
ATOM   6068  H HA   . PRO A 1 3  ? -11.762 7.253   3.418   1.00 15.00 ?  281 PRO A HA   9  
ATOM   6069  H HB2  . PRO A 1 3  ? -12.430 5.502   5.329   1.00 15.00 ?  281 PRO A HB2  9  
ATOM   6070  H HB3  . PRO A 1 3  ? -13.646 6.504   4.532   1.00 15.00 ?  281 PRO A HB3  9  
ATOM   6071  H HG2  . PRO A 1 3  ? -13.049 3.618   4.180   1.00 15.00 ?  281 PRO A HG2  9  
ATOM   6072  H HG3  . PRO A 1 3  ? -14.590 4.477   4.028   1.00 15.00 ?  281 PRO A HG3  9  
ATOM   6073  H HD2  . PRO A 1 3  ? -12.866 3.685   1.929   1.00 15.00 ?  281 PRO A HD2  9  
ATOM   6074  H HD3  . PRO A 1 3  ? -14.288 4.736   1.801   1.00 15.00 ?  281 PRO A HD3  9  
ATOM   6075  N N    . LEU A 1 4  ? -9.565  6.306   4.093   1.00 15.00 ?  282 LEU A N    9  
ATOM   6076  C CA   . LEU A 1 4  ? -8.234  5.796   4.375   1.00 15.00 ?  282 LEU A CA   9  
ATOM   6077  C C    . LEU A 1 4  ? -7.972  5.807   5.876   1.00 15.00 ?  282 LEU A C    9  
ATOM   6078  O O    . LEU A 1 4  ? -7.995  6.863   6.510   1.00 15.00 ?  282 LEU A O    9  
ATOM   6079  C CB   . LEU A 1 4  ? -7.182  6.636   3.648   1.00 15.00 ?  282 LEU A CB   9  
ATOM   6080  C CG   . LEU A 1 4  ? -5.762  6.058   3.630   1.00 15.00 ?  282 LEU A CG   9  
ATOM   6081  C CD1  . LEU A 1 4  ? -5.720  4.756   2.844   1.00 15.00 ?  282 LEU A CD1  9  
ATOM   6082  C CD2  . LEU A 1 4  ? -4.792  7.064   3.039   1.00 15.00 ?  282 LEU A CD2  9  
ATOM   6083  H H    . LEU A 1 4  ? -9.761  7.260   4.253   1.00 15.00 ?  282 LEU A H    9  
ATOM   6084  H HA   . LEU A 1 4  ? -8.184  4.779   4.017   1.00 15.00 ?  282 LEU A HA   9  
ATOM   6085  H HB2  . LEU A 1 4  ? -7.505  6.765   2.626   1.00 15.00 ?  282 LEU A HB2  9  
ATOM   6086  H HB3  . LEU A 1 4  ? -7.142  7.606   4.117   1.00 15.00 ?  282 LEU A HB3  9  
ATOM   6087  H HG   . LEU A 1 4  ? -5.450  5.846   4.643   1.00 15.00 ?  282 LEU A HG   9  
ATOM   6088  H HD11 . LEU A 1 4  ? -6.313  4.862   1.947   1.00 15.00 ?  282 LEU A HD11 9  
ATOM   6089  H HD12 . LEU A 1 4  ? -6.119  3.955   3.449   1.00 15.00 ?  282 LEU A HD12 9  
ATOM   6090  H HD13 . LEU A 1 4  ? -4.697  4.533   2.571   1.00 15.00 ?  282 LEU A HD13 9  
ATOM   6091  H HD21 . LEU A 1 4  ? -3.827  6.600   2.903   1.00 15.00 ?  282 LEU A HD21 9  
ATOM   6092  H HD22 . LEU A 1 4  ? -4.695  7.902   3.712   1.00 15.00 ?  282 LEU A HD22 9  
ATOM   6093  H HD23 . LEU A 1 4  ? -5.169  7.407   2.084   1.00 15.00 ?  282 LEU A HD23 9  
ATOM   6094  N N    . PRO A 1 5  ? -7.755  4.625   6.465   1.00 15.00 ?  283 PRO A N    9  
ATOM   6095  C CA   . PRO A 1 5  ? -7.474  4.485   7.898   1.00 15.00 ?  283 PRO A CA   9  
ATOM   6096  C C    . PRO A 1 5  ? -6.124  5.090   8.282   1.00 15.00 ?  283 PRO A C    9  
ATOM   6097  O O    . PRO A 1 5  ? -5.138  4.939   7.557   1.00 15.00 ?  283 PRO A O    9  
ATOM   6098  C CB   . PRO A 1 5  ? -7.464  2.964   8.122   1.00 15.00 ?  283 PRO A CB   9  
ATOM   6099  C CG   . PRO A 1 5  ? -8.110  2.384   6.910   1.00 15.00 ?  283 PRO A CG   9  
ATOM   6100  C CD   . PRO A 1 5  ? -7.781  3.321   5.789   1.00 15.00 ?  283 PRO A CD   9  
ATOM   6101  H HA   . PRO A 1 5  ? -8.252  4.936   8.497   1.00 15.00 ?  283 PRO A HA   9  
ATOM   6102  H HB2  . PRO A 1 5  ? -6.446  2.621   8.227   1.00 15.00 ?  283 PRO A HB2  9  
ATOM   6103  H HB3  . PRO A 1 5  ? -8.022  2.727   9.016   1.00 15.00 ?  283 PRO A HB3  9  
ATOM   6104  H HG2  . PRO A 1 5  ? -7.706  1.402   6.712   1.00 15.00 ?  283 PRO A HG2  9  
ATOM   6105  H HG3  . PRO A 1 5  ? -9.179  2.330   7.052   1.00 15.00 ?  283 PRO A HG3  9  
ATOM   6106  H HD2  . PRO A 1 5  ? -6.817  3.083   5.363   1.00 15.00 ?  283 PRO A HD2  9  
ATOM   6107  H HD3  . PRO A 1 5  ? -8.552  3.293   5.033   1.00 15.00 ?  283 PRO A HD3  9  
ATOM   6108  N N    . PRO A 1 6  ? -6.065  5.783   9.430   1.00 15.00 ?  284 PRO A N    9  
ATOM   6109  C CA   . PRO A 1 6  ? -4.826  6.390   9.925   1.00 15.00 ?  284 PRO A CA   9  
ATOM   6110  C C    . PRO A 1 6  ? -3.726  5.353   10.132  1.00 15.00 ?  284 PRO A C    9  
ATOM   6111  O O    . PRO A 1 6  ? -3.890  4.405   10.901  1.00 15.00 ?  284 PRO A O    9  
ATOM   6112  C CB   . PRO A 1 6  ? -5.232  7.019   11.265  1.00 15.00 ?  284 PRO A CB   9  
ATOM   6113  C CG   . PRO A 1 6  ? -6.519  6.364   11.633  1.00 15.00 ?  284 PRO A CG   9  
ATOM   6114  C CD   . PRO A 1 6  ? -7.196  6.026   10.338  1.00 15.00 ?  284 PRO A CD   9  
ATOM   6115  H HA   . PRO A 1 6  ? -4.471  7.160   9.256   1.00 15.00 ?  284 PRO A HA   9  
ATOM   6116  H HB2  . PRO A 1 6  ? -4.465  6.823   12.000  1.00 15.00 ?  284 PRO A HB2  9  
ATOM   6117  H HB3  . PRO A 1 6  ? -5.353  8.086   11.144  1.00 15.00 ?  284 PRO A HB3  9  
ATOM   6118  H HG2  . PRO A 1 6  ? -6.325  5.465   12.201  1.00 15.00 ?  284 PRO A HG2  9  
ATOM   6119  H HG3  . PRO A 1 6  ? -7.129  7.047   12.208  1.00 15.00 ?  284 PRO A HG3  9  
ATOM   6120  H HD2  . PRO A 1 6  ? -7.804  5.139   10.447  1.00 15.00 ?  284 PRO A HD2  9  
ATOM   6121  H HD3  . PRO A 1 6  ? -7.794  6.857   9.995   1.00 15.00 ?  284 PRO A HD3  9  
ATOM   6122  N N    . GLY A 1 7  ? -2.610  5.538   9.440   1.00 15.00 ?  285 GLY A N    9  
ATOM   6123  C CA   . GLY A 1 7  ? -1.528  4.575   9.498   1.00 15.00 ?  285 GLY A CA   9  
ATOM   6124  C C    . GLY A 1 7  ? -1.287  3.926   8.154   1.00 15.00 ?  285 GLY A C    9  
ATOM   6125  O O    . GLY A 1 7  ? -0.269  3.266   7.943   1.00 15.00 ?  285 GLY A O    9  
ATOM   6126  H H    . GLY A 1 7  ? -2.514  6.340   8.885   1.00 15.00 ?  285 GLY A H    9  
ATOM   6127  H HA2  . GLY A 1 7  ? -0.628  5.079   9.814   1.00 15.00 ?  285 GLY A HA2  9  
ATOM   6128  H HA3  . GLY A 1 7  ? -1.776  3.809   10.218  1.00 15.00 ?  285 GLY A HA3  9  
ATOM   6129  N N    . TRP A 1 8  ? -2.224  4.138   7.238   1.00 15.00 ?  286 TRP A N    9  
ATOM   6130  C CA   . TRP A 1 8  ? -2.149  3.544   5.911   1.00 15.00 ?  286 TRP A CA   9  
ATOM   6131  C C    . TRP A 1 8  ? -1.410  4.442   4.944   1.00 15.00 ?  286 TRP A C    9  
ATOM   6132  O O    . TRP A 1 8  ? -1.903  5.505   4.556   1.00 15.00 ?  286 TRP A O    9  
ATOM   6133  C CB   . TRP A 1 8  ? -3.553  3.267   5.356   1.00 15.00 ?  286 TRP A CB   9  
ATOM   6134  C CG   . TRP A 1 8  ? -4.157  1.994   5.846   1.00 15.00 ?  286 TRP A CG   9  
ATOM   6135  C CD1  . TRP A 1 8  ? -4.323  1.610   7.146   1.00 15.00 ?  286 TRP A CD1  9  
ATOM   6136  C CD2  . TRP A 1 8  ? -4.667  0.921   5.039   1.00 15.00 ?  286 TRP A CD2  9  
ATOM   6137  N NE1  . TRP A 1 8  ? -4.891  0.362   7.199   1.00 15.00 ?  286 TRP A NE1  9  
ATOM   6138  C CE2  . TRP A 1 8  ? -5.107  -0.084  5.924   1.00 15.00 ?  286 TRP A CE2  9  
ATOM   6139  C CE3  . TRP A 1 8  ? -4.793  0.703   3.654   1.00 15.00 ?  286 TRP A CE3  9  
ATOM   6140  C CZ2  . TRP A 1 8  ? -5.653  -1.285  5.477   1.00 15.00 ?  286 TRP A CZ2  9  
ATOM   6141  C CZ3  . TRP A 1 8  ? -5.327  -0.494  3.226   1.00 15.00 ?  286 TRP A CZ3  9  
ATOM   6142  C CH2  . TRP A 1 8  ? -5.748  -1.474  4.130   1.00 15.00 ?  286 TRP A CH2  9  
ATOM   6143  H H    . TRP A 1 8  ? -2.992  4.706   7.464   1.00 15.00 ?  286 TRP A H    9  
ATOM   6144  H HA   . TRP A 1 8  ? -1.603  2.610   5.995   1.00 15.00 ?  286 TRP A HA   9  
ATOM   6145  H HB2  . TRP A 1 8  ? -4.210  4.078   5.635   1.00 15.00 ?  286 TRP A HB2  9  
ATOM   6146  H HB3  . TRP A 1 8  ? -3.497  3.217   4.277   1.00 15.00 ?  286 TRP A HB3  9  
ATOM   6147  H HD1  . TRP A 1 8  ? -4.038  2.210   7.998   1.00 15.00 ?  286 TRP A HD1  9  
ATOM   6148  H HE1  . TRP A 1 8  ? -5.103  -0.134  8.020   1.00 15.00 ?  286 TRP A HE1  9  
ATOM   6149  H HE3  . TRP A 1 8  ? -4.483  1.468   2.892   1.00 15.00 ?  286 TRP A HE3  9  
ATOM   6150  H HZ2  . TRP A 1 8  ? -5.983  -2.053  6.160   1.00 15.00 ?  286 TRP A HZ2  9  
ATOM   6151  H HZ3  . TRP A 1 8  ? -5.387  -0.694  2.166   1.00 15.00 ?  286 TRP A HZ3  9  
ATOM   6152  H HH2  . TRP A 1 8  ? -6.159  -2.394  3.741   1.00 15.00 ?  286 TRP A HH2  9  
ATOM   6153  N N    . GLU A 1 9  ? -0.222  4.010   4.567   1.00 15.00 ?  287 GLU A N    9  
ATOM   6154  C CA   . GLU A 1 9  ? 0.507   4.644   3.495   1.00 15.00 ?  287 GLU A CA   9  
ATOM   6155  C C    . GLU A 1 9  ? 0.296   3.847   2.220   1.00 15.00 ?  287 GLU A C    9  
ATOM   6156  O O    . GLU A 1 9  ? 0.618   2.662   2.152   1.00 15.00 ?  287 GLU A O    9  
ATOM   6157  C CB   . GLU A 1 9  ? 1.992   4.748   3.842   1.00 15.00 ?  287 GLU A CB   9  
ATOM   6158  C CG   . GLU A 1 9  ? 2.417   6.138   4.295   1.00 15.00 ?  287 GLU A CG   9  
ATOM   6159  C CD   . GLU A 1 9  ? 1.527   6.715   5.377   1.00 15.00 ?  287 GLU A CD   9  
ATOM   6160  O OE1  . GLU A 1 9  ? 1.694   6.344   6.556   1.00 15.00 ?  287 GLU A OE1  9  
ATOM   6161  O OE2  . GLU A 1 9  ? 0.668   7.562   5.049   1.00 15.00 -1 287 GLU A OE2  9  
ATOM   6162  H H    . GLU A 1 9  ? 0.176   3.235   5.022   1.00 15.00 ?  287 GLU A H    9  
ATOM   6163  H HA   . GLU A 1 9  ? 0.102   5.636   3.359   1.00 15.00 ?  287 GLU A HA   9  
ATOM   6164  H HB2  . GLU A 1 9  ? 2.216   4.050   4.635   1.00 15.00 ?  287 GLU A HB2  9  
ATOM   6165  H HB3  . GLU A 1 9  ? 2.573   4.486   2.970   1.00 15.00 ?  287 GLU A HB3  9  
ATOM   6166  H HG2  . GLU A 1 9  ? 3.426   6.083   4.678   1.00 15.00 ?  287 GLU A HG2  9  
ATOM   6167  H HG3  . GLU A 1 9  ? 2.397   6.799   3.442   1.00 15.00 ?  287 GLU A HG3  9  
ATOM   6168  N N    . VAL A 1 10 ? -0.277  4.490   1.224   1.00 15.00 ?  288 VAL A N    9  
ATOM   6169  C CA   . VAL A 1 10 ? -0.582  3.827   -0.029  1.00 15.00 ?  288 VAL A CA   9  
ATOM   6170  C C    . VAL A 1 10 ? 0.598   3.948   -0.990  1.00 15.00 ?  288 VAL A C    9  
ATOM   6171  O O    . VAL A 1 10 ? 0.857   5.011   -1.554  1.00 15.00 ?  288 VAL A O    9  
ATOM   6172  C CB   . VAL A 1 10 ? -1.889  4.393   -0.650  1.00 15.00 ?  288 VAL A CB   9  
ATOM   6173  C CG1  . VAL A 1 10 ? -1.957  5.907   -0.502  1.00 15.00 ?  288 VAL A CG1  9  
ATOM   6174  C CG2  . VAL A 1 10 ? -2.028  3.996   -2.113  1.00 15.00 ?  288 VAL A CG2  9  
ATOM   6175  H H    . VAL A 1 10 ? -0.500  5.440   1.332   1.00 15.00 ?  288 VAL A H    9  
ATOM   6176  H HA   . VAL A 1 10 ? -0.740  2.780   0.188   1.00 15.00 ?  288 VAL A HA   9  
ATOM   6177  H HB   . VAL A 1 10 ? -2.724  3.970   -0.109  1.00 15.00 ?  288 VAL A HB   9  
ATOM   6178  H HG11 . VAL A 1 10 ? -1.332  6.373   -1.249  1.00 15.00 ?  288 VAL A HG11 9  
ATOM   6179  H HG12 . VAL A 1 10 ? -1.609  6.186   0.481   1.00 15.00 ?  288 VAL A HG12 9  
ATOM   6180  H HG13 . VAL A 1 10 ? -2.980  6.232   -0.627  1.00 15.00 ?  288 VAL A HG13 9  
ATOM   6181  H HG21 . VAL A 1 10 ? -2.942  4.409   -2.512  1.00 15.00 ?  288 VAL A HG21 9  
ATOM   6182  H HG22 . VAL A 1 10 ? -2.053  2.920   -2.191  1.00 15.00 ?  288 VAL A HG22 9  
ATOM   6183  H HG23 . VAL A 1 10 ? -1.186  4.378   -2.671  1.00 15.00 ?  288 VAL A HG23 9  
ATOM   6184  N N    . ARG A 1 11 ? 1.341   2.853   -1.143  1.00 15.00 ?  289 ARG A N    9  
ATOM   6185  C CA   . ARG A 1 11 ? 2.551   2.872   -1.944  1.00 15.00 ?  289 ARG A CA   9  
ATOM   6186  C C    . ARG A 1 11 ? 2.241   2.327   -3.336  1.00 15.00 ?  289 ARG A C    9  
ATOM   6187  O O    . ARG A 1 11 ? 2.050   1.129   -3.524  1.00 15.00 ?  289 ARG A O    9  
ATOM   6188  C CB   . ARG A 1 11 ? 3.669   2.074   -1.233  1.00 15.00 ?  289 ARG A CB   9  
ATOM   6189  C CG   . ARG A 1 11 ? 5.099   2.457   -1.630  1.00 15.00 ?  289 ARG A CG   9  
ATOM   6190  C CD   . ARG A 1 11 ? 5.445   2.054   -3.056  1.00 15.00 ?  289 ARG A CD   9  
ATOM   6191  N NE   . ARG A 1 11 ? 6.808   2.442   -3.443  1.00 15.00 ?  289 ARG A NE   9  
ATOM   6192  C CZ   . ARG A 1 11 ? 7.789   1.570   -3.705  1.00 15.00 ?  289 ARG A CZ   9  
ATOM   6193  N NH1  . ARG A 1 11 ? 7.629   0.279   -3.461  1.00 15.00 1  289 ARG A NH1  9  
ATOM   6194  N NH2  . ARG A 1 11 ? 8.950   1.996   -4.179  1.00 15.00 ?  289 ARG A NH2  9  
ATOM   6195  H H    . ARG A 1 11 ? 1.054   2.005   -0.726  1.00 15.00 ?  289 ARG A H    9  
ATOM   6196  H HA   . ARG A 1 11 ? 2.862   3.903   -2.041  1.00 15.00 ?  289 ARG A HA   9  
ATOM   6197  H HB2  . ARG A 1 11 ? 3.574   2.238   -0.170  1.00 15.00 ?  289 ARG A HB2  9  
ATOM   6198  H HB3  . ARG A 1 11 ? 3.533   1.019   -1.428  1.00 15.00 ?  289 ARG A HB3  9  
ATOM   6199  H HG2  . ARG A 1 11 ? 5.210   3.526   -1.538  1.00 15.00 ?  289 ARG A HG2  9  
ATOM   6200  H HG3  . ARG A 1 11 ? 5.786   1.966   -0.952  1.00 15.00 ?  289 ARG A HG3  9  
ATOM   6201  H HD2  . ARG A 1 11 ? 5.352   0.983   -3.143  1.00 15.00 ?  289 ARG A HD2  9  
ATOM   6202  H HD3  . ARG A 1 11 ? 4.745   2.529   -3.727  1.00 15.00 ?  289 ARG A HD3  9  
ATOM   6203  H HE   . ARG A 1 11 ? 6.985   3.399   -3.562  1.00 15.00 ?  289 ARG A HE   9  
ATOM   6204  H HH11 . ARG A 1 11 ? 6.772   -0.061  -3.063  1.00 15.00 ?  289 ARG A HH11 9  
ATOM   6205  H HH12 . ARG A 1 11 ? 8.366   -0.375  -3.685  1.00 15.00 ?  289 ARG A HH12 9  
ATOM   6206  H HH21 . ARG A 1 11 ? 9.105   2.986   -4.347  1.00 15.00 ?  289 ARG A HH21 9  
ATOM   6207  H HH22 . ARG A 1 11 ? 9.683   1.342   -4.374  1.00 15.00 ?  289 ARG A HH22 9  
ATOM   6208  N N    . SER A 1 12 ? 2.124   3.231   -4.292  1.00 15.00 ?  290 SER A N    9  
ATOM   6209  C CA   . SER A 1 12 ? 1.806   2.871   -5.664  1.00 15.00 ?  290 SER A CA   9  
ATOM   6210  C C    . SER A 1 12 ? 3.083   2.634   -6.464  1.00 15.00 ?  290 SER A C    9  
ATOM   6211  O O    . SER A 1 12 ? 4.070   3.349   -6.296  1.00 15.00 ?  290 SER A O    9  
ATOM   6212  C CB   . SER A 1 12 ? 0.976   3.993   -6.284  1.00 15.00 ?  290 SER A CB   9  
ATOM   6213  O OG   . SER A 1 12 ? 1.498   5.258   -5.918  1.00 15.00 ?  290 SER A OG   9  
ATOM   6214  H H    . SER A 1 12 ? 2.248   4.180   -4.075  1.00 15.00 ?  290 SER A H    9  
ATOM   6215  H HA   . SER A 1 12 ? 1.222   1.963   -5.649  1.00 15.00 ?  290 SER A HA   9  
ATOM   6216  H HB2  . SER A 1 12 ? 0.993   3.904   -7.360  1.00 15.00 ?  290 SER A HB2  9  
ATOM   6217  H HB3  . SER A 1 12 ? -0.041  3.920   -5.930  1.00 15.00 ?  290 SER A HB3  9  
ATOM   6218  H HG   . SER A 1 12 ? 0.982   5.962   -6.345  1.00 15.00 ?  290 SER A HG   9  
ATOM   6219  N N    . THR A 1 13 ? 3.066   1.629   -7.333  1.00 15.00 ?  291 THR A N    9  
ATOM   6220  C CA   . THR A 1 13 ? 4.250   1.295   -8.107  1.00 15.00 ?  291 THR A CA   9  
ATOM   6221  C C    . THR A 1 13 ? 3.933   1.144   -9.599  1.00 15.00 ?  291 THR A C    9  
ATOM   6222  O O    . THR A 1 13 ? 2.828   0.722   -9.977  1.00 15.00 ?  291 THR A O    9  
ATOM   6223  C CB   . THR A 1 13 ? 4.925   0.022   -7.560  1.00 15.00 ?  291 THR A CB   9  
ATOM   6224  O OG1  . THR A 1 13 ? 3.978   -1.055  -7.466  1.00 15.00 ?  291 THR A OG1  9  
ATOM   6225  C CG2  . THR A 1 13 ? 5.523   0.287   -6.187  1.00 15.00 ?  291 THR A CG2  9  
ATOM   6226  H H    . THR A 1 13 ? 2.244   1.109   -7.457  1.00 15.00 ?  291 THR A H    9  
ATOM   6227  H HA   . THR A 1 13 ? 4.948   2.112   -7.992  1.00 15.00 ?  291 THR A HA   9  
ATOM   6228  H HB   . THR A 1 13 ? 5.720   -0.264  -8.231  1.00 15.00 ?  291 THR A HB   9  
ATOM   6229  H HG1  . THR A 1 13 ? 3.087   -0.696  -7.377  1.00 15.00 ?  291 THR A HG1  9  
ATOM   6230  H HG21 . THR A 1 13 ? 4.724   0.403   -5.467  1.00 15.00 ?  291 THR A HG21 9  
ATOM   6231  H HG22 . THR A 1 13 ? 6.112   1.199   -6.216  1.00 15.00 ?  291 THR A HG22 9  
ATOM   6232  H HG23 . THR A 1 13 ? 6.151   -0.545  -5.901  1.00 15.00 ?  291 THR A HG23 9  
ATOM   6233  N N    . VAL A 1 14 ? 4.930   1.475   -10.432 1.00 15.00 ?  292 VAL A N    9  
ATOM   6234  C CA   . VAL A 1 14 ? 4.761   1.597   -11.886 1.00 15.00 ?  292 VAL A CA   9  
ATOM   6235  C C    . VAL A 1 14 ? 4.436   0.257   -12.558 1.00 15.00 ?  292 VAL A C    9  
ATOM   6236  O O    . VAL A 1 14 ? 3.990   0.221   -13.706 1.00 15.00 ?  292 VAL A O    9  
ATOM   6237  C CB   . VAL A 1 14 ? 6.028   2.217   -12.531 1.00 15.00 ?  292 VAL A CB   9  
ATOM   6238  C CG1  . VAL A 1 14 ? 7.210   1.257   -12.461 1.00 15.00 ?  292 VAL A CG1  9  
ATOM   6239  C CG2  . VAL A 1 14 ? 5.754   2.656   -13.967 1.00 15.00 ?  292 VAL A CG2  9  
ATOM   6240  H H    . VAL A 1 14 ? 5.818   1.642   -10.052 1.00 15.00 ?  292 VAL A H    9  
ATOM   6241  H HA   . VAL A 1 14 ? 3.937   2.275   -12.062 1.00 15.00 ?  292 VAL A HA   9  
ATOM   6242  H HB   . VAL A 1 14 ? 6.288   3.096   -11.963 1.00 15.00 ?  292 VAL A HB   9  
ATOM   6243  H HG11 . VAL A 1 14 ? 7.430   1.036   -11.426 1.00 15.00 ?  292 VAL A HG11 9  
ATOM   6244  H HG12 . VAL A 1 14 ? 8.074   1.712   -12.923 1.00 15.00 ?  292 VAL A HG12 9  
ATOM   6245  H HG13 . VAL A 1 14 ? 6.965   0.342   -12.980 1.00 15.00 ?  292 VAL A HG13 9  
ATOM   6246  H HG21 . VAL A 1 14 ? 4.957   3.386   -13.973 1.00 15.00 ?  292 VAL A HG21 9  
ATOM   6247  H HG22 . VAL A 1 14 ? 5.464   1.800   -14.559 1.00 15.00 ?  292 VAL A HG22 9  
ATOM   6248  H HG23 . VAL A 1 14 ? 6.647   3.097   -14.385 1.00 15.00 ?  292 VAL A HG23 9  
ATOM   6249  N N    . SER A 1 15 ? 4.650   -0.839  -11.842 1.00 15.00 ?  293 SER A N    9  
ATOM   6250  C CA   . SER A 1 15 ? 4.287   -2.161  -12.340 1.00 15.00 ?  293 SER A CA   9  
ATOM   6251  C C    . SER A 1 15 ? 2.780   -2.247  -12.604 1.00 15.00 ?  293 SER A C    9  
ATOM   6252  O O    . SER A 1 15 ? 2.309   -3.155  -13.289 1.00 15.00 ?  293 SER A O    9  
ATOM   6253  C CB   . SER A 1 15 ? 4.741   -3.255  -11.373 1.00 15.00 ?  293 SER A CB   9  
ATOM   6254  O OG   . SER A 1 15 ? 4.255   -3.024  -10.063 1.00 15.00 ?  293 SER A OG   9  
ATOM   6255  H H    . SER A 1 15 ? 5.073   -0.761  -10.957 1.00 15.00 ?  293 SER A H    9  
ATOM   6256  H HA   . SER A 1 15 ? 4.800   -2.298  -13.282 1.00 15.00 ?  293 SER A HA   9  
ATOM   6257  H HB2  . SER A 1 15 ? 4.366   -4.209  -11.714 1.00 15.00 ?  293 SER A HB2  9  
ATOM   6258  H HB3  . SER A 1 15 ? 5.819   -3.281  -11.344 1.00 15.00 ?  293 SER A HB3  9  
ATOM   6259  H HG   . SER A 1 15 ? 3.757   -3.802  -9.774  1.00 15.00 ?  293 SER A HG   9  
ATOM   6260  N N    . GLY A 1 16 ? 2.039   -1.282  -12.070 1.00 15.00 ?  294 GLY A N    9  
ATOM   6261  C CA   . GLY A 1 16 ? 0.600   -1.264  -12.221 1.00 15.00 ?  294 GLY A CA   9  
ATOM   6262  C C    . GLY A 1 16 ? -0.088  -1.997  -11.097 1.00 15.00 ?  294 GLY A C    9  
ATOM   6263  O O    . GLY A 1 16 ? -0.996  -2.801  -11.320 1.00 15.00 ?  294 GLY A O    9  
ATOM   6264  H H    . GLY A 1 16 ? 2.482   -0.571  -11.557 1.00 15.00 ?  294 GLY A H    9  
ATOM   6265  H HA2  . GLY A 1 16 ? 0.260   -0.239  -12.235 1.00 15.00 ?  294 GLY A HA2  9  
ATOM   6266  H HA3  . GLY A 1 16 ? 0.338   -1.734  -13.158 1.00 15.00 ?  294 GLY A HA3  9  
ATOM   6267  N N    . ARG A 1 17 ? 0.362   -1.729  -9.876  1.00 15.00 ?  295 ARG A N    9  
ATOM   6268  C CA   . ARG A 1 17 ? -0.257  -2.318  -8.702  1.00 15.00 ?  295 ARG A CA   9  
ATOM   6269  C C    . ARG A 1 17 ? -0.155  -1.378  -7.507  1.00 15.00 ?  295 ARG A C    9  
ATOM   6270  O O    . ARG A 1 17 ? 0.900   -0.785  -7.247  1.00 15.00 ?  295 ARG A O    9  
ATOM   6271  C CB   . ARG A 1 17 ? 0.381   -3.672  -8.364  1.00 15.00 ?  295 ARG A CB   9  
ATOM   6272  C CG   . ARG A 1 17 ? 1.828   -3.582  -7.910  1.00 15.00 ?  295 ARG A CG   9  
ATOM   6273  C CD   . ARG A 1 17 ? 2.361   -4.937  -7.476  1.00 15.00 ?  295 ARG A CD   9  
ATOM   6274  N NE   . ARG A 1 17 ? 3.733   -4.857  -6.980  1.00 15.00 ?  295 ARG A NE   9  
ATOM   6275  C CZ   . ARG A 1 17 ? 4.458   -5.910  -6.603  1.00 15.00 ?  295 ARG A CZ   9  
ATOM   6276  N NH1  . ARG A 1 17 ? 3.979   -7.142  -6.726  1.00 15.00 1  295 ARG A NH1  9  
ATOM   6277  N NH2  . ARG A 1 17 ? 5.682   -5.729  -6.128  1.00 15.00 ?  295 ARG A NH2  9  
ATOM   6278  H H    . ARG A 1 17 ? 1.128   -1.118  -9.764  1.00 15.00 ?  295 ARG A H    9  
ATOM   6279  H HA   . ARG A 1 17 ? -1.302  -2.474  -8.928  1.00 15.00 ?  295 ARG A HA   9  
ATOM   6280  H HB2  . ARG A 1 17 ? -0.191  -4.136  -7.573  1.00 15.00 ?  295 ARG A HB2  9  
ATOM   6281  H HB3  . ARG A 1 17 ? 0.340   -4.302  -9.241  1.00 15.00 ?  295 ARG A HB3  9  
ATOM   6282  H HG2  . ARG A 1 17 ? 2.428   -3.214  -8.728  1.00 15.00 ?  295 ARG A HG2  9  
ATOM   6283  H HG3  . ARG A 1 17 ? 1.891   -2.895  -7.077  1.00 15.00 ?  295 ARG A HG3  9  
ATOM   6284  H HD2  . ARG A 1 17 ? 1.724   -5.327  -6.694  1.00 15.00 ?  295 ARG A HD2  9  
ATOM   6285  H HD3  . ARG A 1 17 ? 2.334   -5.605  -8.324  1.00 15.00 ?  295 ARG A HD3  9  
ATOM   6286  H HE   . ARG A 1 17 ? 4.135   -3.960  -6.910  1.00 15.00 ?  295 ARG A HE   9  
ATOM   6287  H HH11 . ARG A 1 17 ? 3.056   -7.294  -7.115  1.00 15.00 ?  295 ARG A HH11 9  
ATOM   6288  H HH12 . ARG A 1 17 ? 4.527   -7.929  -6.429  1.00 15.00 ?  295 ARG A HH12 9  
ATOM   6289  H HH21 . ARG A 1 17 ? 6.057   -4.797  -6.053  1.00 15.00 ?  295 ARG A HH21 9  
ATOM   6290  H HH22 . ARG A 1 17 ? 6.236   -6.514  -5.840  1.00 15.00 ?  295 ARG A HH22 9  
ATOM   6291  N N    . ILE A 1 18 ? -1.262  -1.233  -6.802  1.00 15.00 ?  296 ILE A N    9  
ATOM   6292  C CA   . ILE A 1 18 ? -1.274  -0.542  -5.528  1.00 15.00 ?  296 ILE A CA   9  
ATOM   6293  C C    . ILE A 1 18 ? -1.022  -1.578  -4.439  1.00 15.00 ?  296 ILE A C    9  
ATOM   6294  O O    . ILE A 1 18 ? -1.526  -2.700  -4.524  1.00 15.00 ?  296 ILE A O    9  
ATOM   6295  C CB   . ILE A 1 18 ? -2.620  0.208   -5.314  1.00 15.00 ?  296 ILE A CB   9  
ATOM   6296  C CG1  . ILE A 1 18 ? -2.533  1.214   -4.153  1.00 15.00 ?  296 ILE A CG1  9  
ATOM   6297  C CG2  . ILE A 1 18 ? -3.769  -0.771  -5.091  1.00 15.00 ?  296 ILE A CG2  9  
ATOM   6298  C CD1  . ILE A 1 18 ? -2.741  0.615   -2.776  1.00 15.00 ?  296 ILE A CD1  9  
ATOM   6299  H H    . ILE A 1 18 ? -2.098  -1.608  -7.147  1.00 15.00 ?  296 ILE A H    9  
ATOM   6300  H HA   . ILE A 1 18 ? -0.467  0.177   -5.526  1.00 15.00 ?  296 ILE A HA   9  
ATOM   6301  H HB   . ILE A 1 18 ? -2.834  0.752   -6.222  1.00 15.00 ?  296 ILE A HB   9  
ATOM   6302  H HG12 . ILE A 1 18 ? -1.557  1.675   -4.164  1.00 15.00 ?  296 ILE A HG12 9  
ATOM   6303  H HG13 . ILE A 1 18 ? -3.284  1.978   -4.298  1.00 15.00 ?  296 ILE A HG13 9  
ATOM   6304  H HG21 . ILE A 1 18 ? -3.849  -1.433  -5.941  1.00 15.00 ?  296 ILE A HG21 9  
ATOM   6305  H HG22 . ILE A 1 18 ? -4.690  -0.222  -4.973  1.00 15.00 ?  296 ILE A HG22 9  
ATOM   6306  H HG23 . ILE A 1 18 ? -3.581  -1.352  -4.198  1.00 15.00 ?  296 ILE A HG23 9  
ATOM   6307  H HD11 . ILE A 1 18 ? -3.708  0.143   -2.734  1.00 15.00 ?  296 ILE A HD11 9  
ATOM   6308  H HD12 . ILE A 1 18 ? -2.694  1.397   -2.036  1.00 15.00 ?  296 ILE A HD12 9  
ATOM   6309  H HD13 . ILE A 1 18 ? -1.975  -0.118  -2.578  1.00 15.00 ?  296 ILE A HD13 9  
ATOM   6310  N N    . TYR A 1 19 ? -0.223  -1.239  -3.442  1.00 15.00 ?  297 TYR A N    9  
ATOM   6311  C CA   . TYR A 1 19 ? 0.166   -2.238  -2.464  1.00 15.00 ?  297 TYR A CA   9  
ATOM   6312  C C    . TYR A 1 19 ? 0.406   -1.535  -1.153  1.00 15.00 ?  297 TYR A C    9  
ATOM   6313  O O    . TYR A 1 19 ? 1.058   -0.482  -1.095  1.00 15.00 ?  297 TYR A O    9  
ATOM   6314  C CB   . TYR A 1 19 ? 1.380   -3.081  -2.923  1.00 15.00 ?  297 TYR A CB   9  
ATOM   6315  C CG   . TYR A 1 19 ? 2.759   -2.578  -2.547  1.00 15.00 ?  297 TYR A CG   9  
ATOM   6316  C CD1  . TYR A 1 19 ? 3.318   -1.468  -3.153  1.00 15.00 ?  297 TYR A CD1  9  
ATOM   6317  C CD2  . TYR A 1 19 ? 3.514   -3.245  -1.585  1.00 15.00 ?  297 TYR A CD2  9  
ATOM   6318  C CE1  . TYR A 1 19 ? 4.581   -1.033  -2.808  1.00 15.00 ?  297 TYR A CE1  9  
ATOM   6319  C CE2  . TYR A 1 19 ? 4.775   -2.814  -1.238  1.00 15.00 ?  297 TYR A CE2  9  
ATOM   6320  C CZ   . TYR A 1 19 ? 5.304   -1.709  -1.851  1.00 15.00 ?  297 TYR A CZ   9  
ATOM   6321  O OH   . TYR A 1 19 ? 6.558   -1.269  -1.501  1.00 15.00 ?  297 TYR A OH   9  
ATOM   6322  H H    . TYR A 1 19 ? 0.000   -0.287  -3.283  1.00 15.00 ?  297 TYR A H    9  
ATOM   6323  H HA   . TYR A 1 19 ? -0.682  -2.896  -2.337  1.00 15.00 ?  297 TYR A HA   9  
ATOM   6324  H HB2  . TYR A 1 19 ? 1.281   -4.074  -2.518  1.00 15.00 ?  297 TYR A HB2  9  
ATOM   6325  H HB3  . TYR A 1 19 ? 1.347   -3.146  -4.000  1.00 15.00 ?  297 TYR A HB3  9  
ATOM   6326  H HD1  . TYR A 1 19 ? 2.751   -0.937  -3.903  1.00 15.00 ?  297 TYR A HD1  9  
ATOM   6327  H HD2  . TYR A 1 19 ? 3.104   -4.122  -1.106  1.00 15.00 ?  297 TYR A HD2  9  
ATOM   6328  H HE1  . TYR A 1 19 ? 5.001   -0.164  -3.292  1.00 15.00 ?  297 TYR A HE1  9  
ATOM   6329  H HE2  . TYR A 1 19 ? 5.343   -3.350  -0.494  1.00 15.00 ?  297 TYR A HE2  9  
ATOM   6330  H HH   . TYR A 1 19 ? 7.119   -2.025  -1.299  1.00 15.00 ?  297 TYR A HH   9  
ATOM   6331  N N    . PHE A 1 20 ? -0.158  -2.080  -0.113  1.00 15.00 ?  298 PHE A N    9  
ATOM   6332  C CA   . PHE A 1 20 ? -0.213  -1.373  1.117   1.00 15.00 ?  298 PHE A CA   9  
ATOM   6333  C C    . PHE A 1 20 ? 0.941   -1.587  2.028   1.00 15.00 ?  298 PHE A C    9  
ATOM   6334  O O    . PHE A 1 20 ? 1.407   -2.702  2.243   1.00 15.00 ?  298 PHE A O    9  
ATOM   6335  C CB   . PHE A 1 20 ? -1.505  -1.637  1.817   1.00 15.00 ?  298 PHE A CB   9  
ATOM   6336  C CG   . PHE A 1 20 ? -2.363  -0.492  1.554   1.00 15.00 ?  298 PHE A CG   9  
ATOM   6337  C CD1  . PHE A 1 20 ? -2.056  0.707   2.147   1.00 15.00 ?  298 PHE A CD1  9  
ATOM   6338  C CD2  . PHE A 1 20 ? -3.410  -0.572  0.669   1.00 15.00 ?  298 PHE A CD2  9  
ATOM   6339  C CE1  . PHE A 1 20 ? -2.790  1.818   1.881   1.00 15.00 ?  298 PHE A CE1  9  
ATOM   6340  C CE2  . PHE A 1 20 ? -4.152  0.538   0.395   1.00 15.00 ?  298 PHE A CE2  9  
ATOM   6341  C CZ   . PHE A 1 20 ? -3.836  1.729   1.005   1.00 15.00 ?  298 PHE A CZ   9  
ATOM   6342  H H    . PHE A 1 20 ? -0.596  -2.954  -0.189  1.00 15.00 ?  298 PHE A H    9  
ATOM   6343  H HA   . PHE A 1 20 ? -0.216  -0.331  0.845   1.00 15.00 ?  298 PHE A HA   9  
ATOM   6344  H HB2  . PHE A 1 20 ? -1.970  -2.532  1.424   1.00 15.00 ?  298 PHE A HB2  9  
ATOM   6345  H HB3  . PHE A 1 20 ? -1.352  -1.722  2.882   1.00 15.00 ?  298 PHE A HB3  9  
ATOM   6346  H HD1  . PHE A 1 20 ? -1.235  0.756   2.840   1.00 15.00 ?  298 PHE A HD1  9  
ATOM   6347  H HD2  . PHE A 1 20 ? -3.649  -1.517  0.205   1.00 15.00 ?  298 PHE A HD2  9  
ATOM   6348  H HE1  . PHE A 1 20 ? -2.551  2.760   2.352   1.00 15.00 ?  298 PHE A HE1  9  
ATOM   6349  H HE2  . PHE A 1 20 ? -4.971  0.488   -0.301  1.00 15.00 ?  298 PHE A HE2  9  
ATOM   6350  H HZ   . PHE A 1 20 ? -4.414  2.571   0.819   1.00 15.00 ?  298 PHE A HZ   9  
ATOM   6351  N N    . VAL A 1 21 ? 1.343   -0.469  2.595   1.00 15.00 ?  299 VAL A N    9  
ATOM   6352  C CA   . VAL A 1 21 ? 2.407   -0.407  3.540   1.00 15.00 ?  299 VAL A CA   9  
ATOM   6353  C C    . VAL A 1 21 ? 1.962   0.441   4.732   1.00 15.00 ?  299 VAL A C    9  
ATOM   6354  O O    . VAL A 1 21 ? 2.112   1.665   4.757   1.00 15.00 ?  299 VAL A O    9  
ATOM   6355  C CB   . VAL A 1 21 ? 3.678   0.184   2.887   1.00 15.00 ?  299 VAL A CB   9  
ATOM   6356  C CG1  . VAL A 1 21 ? 4.194   -0.732  1.789   1.00 15.00 ?  299 VAL A CG1  9  
ATOM   6357  C CG2  . VAL A 1 21 ? 3.388   1.556   2.297   1.00 15.00 ?  299 VAL A CG2  9  
ATOM   6358  H H    . VAL A 1 21 ? 0.882   0.368   2.365   1.00 15.00 ?  299 VAL A H    9  
ATOM   6359  H HA   . VAL A 1 21 ? 2.623   -1.411  3.874   1.00 15.00 ?  299 VAL A HA   9  
ATOM   6360  H HB   . VAL A 1 21 ? 4.443   0.288   3.642   1.00 15.00 ?  299 VAL A HB   9  
ATOM   6361  H HG11 . VAL A 1 21 ? 5.272   -0.673  1.741   1.00 15.00 ?  299 VAL A HG11 9  
ATOM   6362  H HG12 . VAL A 1 21 ? 3.785   -0.413  0.852   1.00 15.00 ?  299 VAL A HG12 9  
ATOM   6363  H HG13 . VAL A 1 21 ? 3.893   -1.750  1.986   1.00 15.00 ?  299 VAL A HG13 9  
ATOM   6364  H HG21 . VAL A 1 21 ? 2.618   1.468   1.544   1.00 15.00 ?  299 VAL A HG21 9  
ATOM   6365  H HG22 . VAL A 1 21 ? 4.287   1.952   1.849   1.00 15.00 ?  299 VAL A HG22 9  
ATOM   6366  H HG23 . VAL A 1 21 ? 3.053   2.221   3.079   1.00 15.00 ?  299 VAL A HG23 9  
ATOM   6367  N N    . ASP A 1 22 ? 1.378   -0.194  5.720   1.00 15.00 ?  300 ASP A N    9  
ATOM   6368  C CA   . ASP A 1 22 ? 1.004   0.533   6.909   1.00 15.00 ?  300 ASP A CA   9  
ATOM   6369  C C    . ASP A 1 22 ? 2.195   0.466   7.843   1.00 15.00 ?  300 ASP A C    9  
ATOM   6370  O O    . ASP A 1 22 ? 2.700   -0.617  8.152   1.00 15.00 ?  300 ASP A O    9  
ATOM   6371  C CB   . ASP A 1 22 ? -0.281  -0.024  7.549   1.00 15.00 ?  300 ASP A CB   9  
ATOM   6372  C CG   . ASP A 1 22 ? -0.064  -0.560  8.950   1.00 15.00 ?  300 ASP A CG   9  
ATOM   6373  O OD1  . ASP A 1 22 ? 0.008   0.251   9.904   1.00 15.00 ?  300 ASP A OD1  9  
ATOM   6374  O OD2  . ASP A 1 22 ? 0.042   -1.787  9.104   1.00 15.00 -1 300 ASP A OD2  9  
ATOM   6375  H H    . ASP A 1 22 ? 1.201   -1.159  5.652   1.00 15.00 ?  300 ASP A H    9  
ATOM   6376  H HA   . ASP A 1 22 ? 0.845   1.565   6.627   1.00 15.00 ?  300 ASP A HA   9  
ATOM   6377  H HB2  . ASP A 1 22 ? -1.012  0.769   7.604   1.00 15.00 ?  300 ASP A HB2  9  
ATOM   6378  H HB3  . ASP A 1 22 ? -0.676  -0.821  6.925   1.00 15.00 ?  300 ASP A HB3  9  
ATOM   6379  N N    . HIS A 1 23 ? 2.683   1.635   8.224   1.00 15.00 ?  301 HIS A N    9  
ATOM   6380  C CA   . HIS A 1 23 ? 4.004   1.737   8.822   1.00 15.00 ?  301 HIS A CA   9  
ATOM   6381  C C    . HIS A 1 23 ? 3.993   1.484   10.328  1.00 15.00 ?  301 HIS A C    9  
ATOM   6382  O O    . HIS A 1 23 ? 5.037   1.192   10.905  1.00 15.00 ?  301 HIS A O    9  
ATOM   6383  C CB   . HIS A 1 23 ? 4.634   3.112   8.558   1.00 15.00 ?  301 HIS A CB   9  
ATOM   6384  C CG   . HIS A 1 23 ? 4.833   3.495   7.113   1.00 15.00 ?  301 HIS A CG   9  
ATOM   6385  N ND1  . HIS A 1 23 ? 4.838   4.804   6.695   1.00 15.00 ?  301 HIS A ND1  9  
ATOM   6386  C CD2  . HIS A 1 23 ? 5.151   2.764   6.017   1.00 15.00 ?  301 HIS A CD2  9  
ATOM   6387  C CE1  . HIS A 1 23 ? 5.161   4.859   5.423   1.00 15.00 ?  301 HIS A CE1  9  
ATOM   6388  N NE2  . HIS A 1 23 ? 5.370   3.634   4.978   1.00 15.00 ?  301 HIS A NE2  9  
ATOM   6389  H H    . HIS A 1 23 ? 2.138   2.445   8.107   1.00 15.00 ?  301 HIS A H    9  
ATOM   6390  H HA   . HIS A 1 23 ? 4.625   0.986   8.359   1.00 15.00 ?  301 HIS A HA   9  
ATOM   6391  H HB2  . HIS A 1 23 ? 4.022   3.867   9.011   1.00 15.00 ?  301 HIS A HB2  9  
ATOM   6392  H HB3  . HIS A 1 23 ? 5.605   3.129   9.029   1.00 15.00 ?  301 HIS A HB3  9  
ATOM   6393  H HD1  . HIS A 1 23 ? 4.624   5.593   7.257   1.00 15.00 ?  301 HIS A HD1  9  
ATOM   6394  H HD2  . HIS A 1 23 ? 5.179   1.686   5.955   1.00 15.00 ?  301 HIS A HD2  9  
ATOM   6395  H HE1  . HIS A 1 23 ? 5.232   5.761   4.827   1.00 15.00 ?  301 HIS A HE1  9  
ATOM   6396  H HE2  . HIS A 1 23 ? 5.975   3.434   4.221   1.00 15.00 ?  301 HIS A HE2  9  
ATOM   6397  N N    . ASN A 1 24 ? 2.845   1.616   10.979  1.00 15.00 ?  302 ASN A N    9  
ATOM   6398  C CA   . ASN A 1 24 ? 2.822   1.512   12.435  1.00 15.00 ?  302 ASN A CA   9  
ATOM   6399  C C    . ASN A 1 24 ? 2.354   0.137   12.898  1.00 15.00 ?  302 ASN A C    9  
ATOM   6400  O O    . ASN A 1 24 ? 2.786   -0.346  13.944  1.00 15.00 ?  302 ASN A O    9  
ATOM   6401  C CB   . ASN A 1 24 ? 1.983   2.630   13.074  1.00 15.00 ?  302 ASN A CB   9  
ATOM   6402  C CG   . ASN A 1 24 ? 0.491   2.475   12.859  1.00 15.00 ?  302 ASN A CG   9  
ATOM   6403  O OD1  . ASN A 1 24 ? -0.052  2.924   11.853  1.00 15.00 ?  302 ASN A OD1  9  
ATOM   6404  N ND2  . ASN A 1 24 ? -0.185  1.865   13.822  1.00 15.00 ?  302 ASN A ND2  9  
ATOM   6405  H H    . ASN A 1 24 ? 2.010   1.763   10.483  1.00 15.00 ?  302 ASN A H    9  
ATOM   6406  H HA   . ASN A 1 24 ? 3.845   1.635   12.766  1.00 15.00 ?  302 ASN A HA   9  
ATOM   6407  H HB2  . ASN A 1 24 ? 2.169   2.641   14.138  1.00 15.00 ?  302 ASN A HB2  9  
ATOM   6408  H HB3  . ASN A 1 24 ? 2.290   3.577   12.654  1.00 15.00 ?  302 ASN A HB3  9  
ATOM   6409  H HD21 . ASN A 1 24 ? 0.310   1.552   14.610  1.00 15.00 ?  302 ASN A HD21 9  
ATOM   6410  H HD22 . ASN A 1 24 ? -1.149  1.753   13.708  1.00 15.00 ?  302 ASN A HD22 9  
ATOM   6411  N N    . ASN A 1 25 ? 1.450   -0.483  12.152  1.00 15.00 ?  303 ASN A N    9  
ATOM   6412  C CA   . ASN A 1 25 ? 1.075   -1.866  12.439  1.00 15.00 ?  303 ASN A CA   9  
ATOM   6413  C C    . ASN A 1 25 ? 1.985   -2.823  11.672  1.00 15.00 ?  303 ASN A C    9  
ATOM   6414  O O    . ASN A 1 25 ? 2.202   -3.959  12.099  1.00 15.00 ?  303 ASN A O    9  
ATOM   6415  C CB   . ASN A 1 25 ? -0.388  -2.151  12.072  1.00 15.00 ?  303 ASN A CB   9  
ATOM   6416  C CG   . ASN A 1 25 ? -1.370  -1.192  12.715  1.00 15.00 ?  303 ASN A CG   9  
ATOM   6417  O OD1  . ASN A 1 25 ? -1.853  -1.424  13.825  1.00 15.00 ?  303 ASN A OD1  9  
ATOM   6418  N ND2  . ASN A 1 25 ? -1.679  -0.111  12.017  1.00 15.00 ?  303 ASN A ND2  9  
ATOM   6419  H H    . ASN A 1 25 ? 1.000   0.004   11.418  1.00 15.00 ?  303 ASN A H    9  
ATOM   6420  H HA   . ASN A 1 25 ? 1.213   -2.031  13.499  1.00 15.00 ?  303 ASN A HA   9  
ATOM   6421  H HB2  . ASN A 1 25 ? -0.500  -2.083  11.000  1.00 15.00 ?  303 ASN A HB2  9  
ATOM   6422  H HB3  . ASN A 1 25 ? -0.637  -3.154  12.388  1.00 15.00 ?  303 ASN A HB3  9  
ATOM   6423  H HD21 . ASN A 1 25 ? -1.251  0.008   11.129  1.00 15.00 ?  303 ASN A HD21 9  
ATOM   6424  H HD22 . ASN A 1 25 ? -2.317  0.523   12.398  1.00 15.00 ?  303 ASN A HD22 9  
ATOM   6425  N N    . ARG A 1 26 ? 2.498   -2.343  10.536  1.00 15.00 ?  304 ARG A N    9  
ATOM   6426  C CA   . ARG A 1 26 ? 3.326   -3.128  9.632   1.00 15.00 ?  304 ARG A CA   9  
ATOM   6427  C C    . ARG A 1 26 ? 2.506   -4.233  8.980   1.00 15.00 ?  304 ARG A C    9  
ATOM   6428  O O    . ARG A 1 26 ? 2.457   -5.368  9.461   1.00 15.00 ?  304 ARG A O    9  
ATOM   6429  C CB   . ARG A 1 26 ? 4.571   -3.689  10.331  1.00 15.00 ?  304 ARG A CB   9  
ATOM   6430  C CG   . ARG A 1 26 ? 5.452   -4.534  9.424   1.00 15.00 ?  304 ARG A CG   9  
ATOM   6431  C CD   . ARG A 1 26 ? 6.751   -4.917  10.110  1.00 15.00 ?  304 ARG A CD   9  
ATOM   6432  N NE   . ARG A 1 26 ? 6.528   -5.603  11.383  1.00 15.00 ?  304 ARG A NE   9  
ATOM   6433  C CZ   . ARG A 1 26 ? 7.252   -6.636  11.809  1.00 15.00 ?  304 ARG A CZ   9  
ATOM   6434  N NH1  . ARG A 1 26 ? 8.207   -7.144  11.040  1.00 15.00 1  304 ARG A NH1  9  
ATOM   6435  N NH2  . ARG A 1 26 ? 7.019   -7.168  13.006  1.00 15.00 ?  304 ARG A NH2  9  
ATOM   6436  H H    . ARG A 1 26 ? 2.285   -1.428  10.277  1.00 15.00 ?  304 ARG A H    9  
ATOM   6437  H HA   . ARG A 1 26 ? 3.653   -2.458  8.848   1.00 15.00 ?  304 ARG A HA   9  
ATOM   6438  H HB2  . ARG A 1 26 ? 5.161   -2.865  10.705  1.00 15.00 ?  304 ARG A HB2  9  
ATOM   6439  H HB3  . ARG A 1 26 ? 4.256   -4.302  11.163  1.00 15.00 ?  304 ARG A HB3  9  
ATOM   6440  H HG2  . ARG A 1 26 ? 4.918   -5.434  9.158   1.00 15.00 ?  304 ARG A HG2  9  
ATOM   6441  H HG3  . ARG A 1 26 ? 5.677   -3.968  8.531   1.00 15.00 ?  304 ARG A HG3  9  
ATOM   6442  H HD2  . ARG A 1 26 ? 7.308   -5.571  9.454   1.00 15.00 ?  304 ARG A HD2  9  
ATOM   6443  H HD3  . ARG A 1 26 ? 7.326   -4.020  10.291  1.00 15.00 ?  304 ARG A HD3  9  
ATOM   6444  H HE   . ARG A 1 26 ? 5.802   -5.259  11.963  1.00 15.00 ?  304 ARG A HE   9  
ATOM   6445  H HH11 . ARG A 1 26 ? 8.387   -6.755  10.126  1.00 15.00 ?  304 ARG A HH11 9  
ATOM   6446  H HH12 . ARG A 1 26 ? 8.750   -7.924  11.364  1.00 15.00 ?  304 ARG A HH12 9  
ATOM   6447  H HH21 . ARG A 1 26 ? 6.295   -6.794  13.593  1.00 15.00 ?  304 ARG A HH21 9  
ATOM   6448  H HH22 . ARG A 1 26 ? 7.564   -7.948  13.325  1.00 15.00 ?  304 ARG A HH22 9  
ATOM   6449  N N    . THR A 1 27 ? 1.807   -3.866  7.919   1.00 15.00 ?  305 THR A N    9  
ATOM   6450  C CA   . THR A 1 27 ? 1.024   -4.828  7.163   1.00 15.00 ?  305 THR A CA   9  
ATOM   6451  C C    . THR A 1 27 ? 1.075   -4.501  5.671   1.00 15.00 ?  305 THR A C    9  
ATOM   6452  O O    . THR A 1 27 ? 1.237   -3.340  5.279   1.00 15.00 ?  305 THR A O    9  
ATOM   6453  C CB   . THR A 1 27 ? -0.450  -4.884  7.646   1.00 15.00 ?  305 THR A CB   9  
ATOM   6454  O OG1  . THR A 1 27 ? -1.064  -6.104  7.206   1.00 15.00 ?  305 THR A OG1  9  
ATOM   6455  C CG2  . THR A 1 27 ? -1.260  -3.705  7.123   1.00 15.00 ?  305 THR A CG2  9  
ATOM   6456  H H    . THR A 1 27 ? 1.802   -2.915  7.654   1.00 15.00 ?  305 THR A H    9  
ATOM   6457  H HA   . THR A 1 27 ? 1.466   -5.801  7.316   1.00 15.00 ?  305 THR A HA   9  
ATOM   6458  H HB   . THR A 1 27 ? -0.458  -4.857  8.726   1.00 15.00 ?  305 THR A HB   9  
ATOM   6459  H HG1  . THR A 1 27 ? -1.453  -6.556  7.967   1.00 15.00 ?  305 THR A HG1  9  
ATOM   6460  H HG21 . THR A 1 27 ? -1.254  -3.716  6.042   1.00 15.00 ?  305 THR A HG21 9  
ATOM   6461  H HG22 . THR A 1 27 ? -0.822  -2.783  7.475   1.00 15.00 ?  305 THR A HG22 9  
ATOM   6462  H HG23 . THR A 1 27 ? -2.276  -3.780  7.478   1.00 15.00 ?  305 THR A HG23 9  
ATOM   6463  N N    . THR A 1 28 ? 0.967   -5.536  4.849   1.00 15.00 ?  306 THR A N    9  
ATOM   6464  C CA   . THR A 1 28 ? 1.010   -5.382  3.407   1.00 15.00 ?  306 THR A CA   9  
ATOM   6465  C C    . THR A 1 28 ? -0.284  -5.885  2.766   1.00 15.00 ?  306 THR A C    9  
ATOM   6466  O O    . THR A 1 28 ? -0.567  -7.084  2.762   1.00 15.00 ?  306 THR A O    9  
ATOM   6467  C CB   . THR A 1 28 ? 2.226   -6.121  2.818   1.00 15.00 ?  306 THR A CB   9  
ATOM   6468  O OG1  . THR A 1 28 ? 2.382   -7.396  3.461   1.00 15.00 ?  306 THR A OG1  9  
ATOM   6469  C CG2  . THR A 1 28 ? 3.496   -5.301  3.001   1.00 15.00 ?  306 THR A CG2  9  
ATOM   6470  H H    . THR A 1 28 ? 0.850   -6.434  5.227   1.00 15.00 ?  306 THR A H    9  
ATOM   6471  H HA   . THR A 1 28 ? 1.117   -4.329  3.191   1.00 15.00 ?  306 THR A HA   9  
ATOM   6472  H HB   . THR A 1 28 ? 2.060   -6.273  1.761   1.00 15.00 ?  306 THR A HB   9  
ATOM   6473  H HG1  . THR A 1 28 ? 1.729   -8.019  3.113   1.00 15.00 ?  306 THR A HG1  9  
ATOM   6474  H HG21 . THR A 1 28 ? 3.670   -5.131  4.054   1.00 15.00 ?  306 THR A HG21 9  
ATOM   6475  H HG22 . THR A 1 28 ? 3.390   -4.353  2.495   1.00 15.00 ?  306 THR A HG22 9  
ATOM   6476  H HG23 . THR A 1 28 ? 4.334   -5.838  2.581   1.00 15.00 ?  306 THR A HG23 9  
ATOM   6477  N N    . GLN A 1 29 ? -1.063  -4.957  2.220   1.00 15.00 ?  307 GLN A N    9  
ATOM   6478  C CA   . GLN A 1 29 ? -2.414  -5.265  1.737   1.00 15.00 ?  307 GLN A CA   9  
ATOM   6479  C C    . GLN A 1 29 ? -2.584  -4.935  0.255   1.00 15.00 ?  307 GLN A C    9  
ATOM   6480  O O    . GLN A 1 29 ? -2.328  -3.819  -0.167  1.00 15.00 ?  307 GLN A O    9  
ATOM   6481  C CB   . GLN A 1 29 ? -3.444  -4.473  2.554   1.00 15.00 ?  307 GLN A CB   9  
ATOM   6482  C CG   . GLN A 1 29 ? -3.572  -4.931  3.997   1.00 15.00 ?  307 GLN A CG   9  
ATOM   6483  C CD   . GLN A 1 29 ? -4.187  -6.313  4.130   1.00 15.00 ?  307 GLN A CD   9  
ATOM   6484  O OE1  . GLN A 1 29 ? -4.035  -7.170  3.258   1.00 15.00 ?  307 GLN A OE1  9  
ATOM   6485  N NE2  . GLN A 1 29 ? -4.899  -6.536  5.222   1.00 15.00 ?  307 GLN A NE2  9  
ATOM   6486  H H    . GLN A 1 29 ? -0.717  -4.039  2.134   1.00 15.00 ?  307 GLN A H    9  
ATOM   6487  H HA   . GLN A 1 29 ? -2.590  -6.319  1.882   1.00 15.00 ?  307 GLN A HA   9  
ATOM   6488  H HB2  . GLN A 1 29 ? -3.155  -3.426  2.557   1.00 15.00 ?  307 GLN A HB2  9  
ATOM   6489  H HB3  . GLN A 1 29 ? -4.412  -4.567  2.080   1.00 15.00 ?  307 GLN A HB3  9  
ATOM   6490  H HG2  . GLN A 1 29 ? -2.586  -4.951  4.441   1.00 15.00 ?  307 GLN A HG2  9  
ATOM   6491  H HG3  . GLN A 1 29 ? -4.189  -4.225  4.530   1.00 15.00 ?  307 GLN A HG3  9  
ATOM   6492  H HE21 . GLN A 1 29 ? -4.990  -5.809  5.876   1.00 15.00 ?  307 GLN A HE21 9  
ATOM   6493  H HE22 . GLN A 1 29 ? -5.310  -7.422  5.337   1.00 15.00 ?  307 GLN A HE22 9  
ATOM   6494  N N    . PHE A 1 30 ? -3.035  -5.898  -0.536  1.00 15.00 ?  308 PHE A N    9  
ATOM   6495  C CA   . PHE A 1 30 ? -3.327  -5.633  -1.946  1.00 15.00 ?  308 PHE A CA   9  
ATOM   6496  C C    . PHE A 1 30 ? -4.732  -5.066  -2.129  1.00 15.00 ?  308 PHE A C    9  
ATOM   6497  O O    . PHE A 1 30 ? -5.066  -4.551  -3.197  1.00 15.00 ?  308 PHE A O    9  
ATOM   6498  C CB   . PHE A 1 30 ? -3.137  -6.885  -2.810  1.00 15.00 ?  308 PHE A CB   9  
ATOM   6499  C CG   . PHE A 1 30 ? -1.740  -7.023  -3.352  1.00 15.00 ?  308 PHE A CG   9  
ATOM   6500  C CD1  . PHE A 1 30 ? -1.035  -5.897  -3.754  1.00 15.00 ?  308 PHE A CD1  9  
ATOM   6501  C CD2  . PHE A 1 30 ? -1.132  -8.266  -3.482  1.00 15.00 ?  308 PHE A CD2  9  
ATOM   6502  C CE1  . PHE A 1 30 ? 0.244   -6.006  -4.266  1.00 15.00 ?  308 PHE A CE1  9  
ATOM   6503  C CE2  . PHE A 1 30 ? 0.142   -8.373  -3.990  1.00 15.00 ?  308 PHE A CE2  9  
ATOM   6504  C CZ   . PHE A 1 30 ? 0.831   -7.245  -4.383  1.00 15.00 ?  308 PHE A CZ   9  
ATOM   6505  H H    . PHE A 1 30 ? -3.171  -6.797  -0.173  1.00 15.00 ?  308 PHE A H    9  
ATOM   6506  H HA   . PHE A 1 30 ? -2.620  -4.884  -2.277  1.00 15.00 ?  308 PHE A HA   9  
ATOM   6507  H HB2  . PHE A 1 30 ? -3.352  -7.763  -2.217  1.00 15.00 ?  308 PHE A HB2  9  
ATOM   6508  H HB3  . PHE A 1 30 ? -3.817  -6.846  -3.647  1.00 15.00 ?  308 PHE A HB3  9  
ATOM   6509  H HD1  . PHE A 1 30 ? -1.493  -4.926  -3.658  1.00 15.00 ?  308 PHE A HD1  9  
ATOM   6510  H HD2  . PHE A 1 30 ? -1.661  -9.159  -3.185  1.00 15.00 ?  308 PHE A HD2  9  
ATOM   6511  H HE1  . PHE A 1 30 ? 0.784   -5.120  -4.577  1.00 15.00 ?  308 PHE A HE1  9  
ATOM   6512  H HE2  . PHE A 1 30 ? 0.605   -9.345  -4.082  1.00 15.00 ?  308 PHE A HE2  9  
ATOM   6513  H HZ   . PHE A 1 30 ? 1.829   -7.335  -4.785  1.00 15.00 ?  308 PHE A HZ   9  
ATOM   6514  N N    . THR A 1 31 ? -5.557  -5.181  -1.098  1.00 15.00 ?  309 THR A N    9  
ATOM   6515  C CA   . THR A 1 31 ? -6.905  -4.630  -1.132  1.00 15.00 ?  309 THR A CA   9  
ATOM   6516  C C    . THR A 1 31 ? -6.881  -3.136  -0.805  1.00 15.00 ?  309 THR A C    9  
ATOM   6517  O O    . THR A 1 31 ? -6.470  -2.736  0.286   1.00 15.00 ?  309 THR A O    9  
ATOM   6518  C CB   . THR A 1 31 ? -7.821  -5.371  -0.142  1.00 15.00 ?  309 THR A CB   9  
ATOM   6519  O OG1  . THR A 1 31 ? -7.748  -6.784  -0.390  1.00 15.00 ?  309 THR A OG1  9  
ATOM   6520  C CG2  . THR A 1 31 ? -9.265  -4.903  -0.271  1.00 15.00 ?  309 THR A CG2  9  
ATOM   6521  H H    . THR A 1 31 ? -5.252  -5.641  -0.291  1.00 15.00 ?  309 THR A H    9  
ATOM   6522  H HA   . THR A 1 31 ? -7.298  -4.768  -2.130  1.00 15.00 ?  309 THR A HA   9  
ATOM   6523  H HB   . THR A 1 31 ? -7.479  -5.170  0.865   1.00 15.00 ?  309 THR A HB   9  
ATOM   6524  H HG1  . THR A 1 31 ? -7.509  -6.933  -1.321  1.00 15.00 ?  309 THR A HG1  9  
ATOM   6525  H HG21 . THR A 1 31 ? -9.320  -3.843  -0.067  1.00 15.00 ?  309 THR A HG21 9  
ATOM   6526  H HG22 . THR A 1 31 ? -9.882  -5.438  0.436   1.00 15.00 ?  309 THR A HG22 9  
ATOM   6527  H HG23 . THR A 1 31 ? -9.615  -5.095  -1.274  1.00 15.00 ?  309 THR A HG23 9  
ATOM   6528  N N    . ASP A 1 32 ? -7.314  -2.320  -1.758  1.00 15.00 ?  310 ASP A N    9  
ATOM   6529  C CA   . ASP A 1 32 ? -7.251  -0.867  -1.614  1.00 15.00 ?  310 ASP A CA   9  
ATOM   6530  C C    . ASP A 1 32 ? -8.640  -0.262  -1.499  1.00 15.00 ?  310 ASP A C    9  
ATOM   6531  O O    . ASP A 1 32 ? -9.545  -0.621  -2.249  1.00 15.00 ?  310 ASP A O    9  
ATOM   6532  C CB   . ASP A 1 32 ? -6.520  -0.259  -2.815  1.00 15.00 ?  310 ASP A CB   9  
ATOM   6533  C CG   . ASP A 1 32 ? -6.416  1.259   -2.754  1.00 15.00 ?  310 ASP A CG   9  
ATOM   6534  O OD1  . ASP A 1 32 ? -6.192  1.808   -1.659  1.00 15.00 -1 310 ASP A OD1  9  
ATOM   6535  O OD2  . ASP A 1 32 ? -6.574  1.910   -3.807  1.00 15.00 ?  310 ASP A OD2  9  
ATOM   6536  H H    . ASP A 1 32 ? -7.689  -2.699  -2.580  1.00 15.00 ?  310 ASP A H    9  
ATOM   6537  H HA   . ASP A 1 32 ? -6.703  -0.649  -0.715  1.00 15.00 ?  310 ASP A HA   9  
ATOM   6538  H HB2  . ASP A 1 32 ? -5.526  -0.667  -2.866  1.00 15.00 ?  310 ASP A HB2  9  
ATOM   6539  H HB3  . ASP A 1 32 ? -7.053  -0.523  -3.713  1.00 15.00 ?  310 ASP A HB3  9  
ATOM   6540  N N    . PRO A 1 33 ? -8.837  0.638   -0.528  1.00 15.00 ?  311 PRO A N    9  
ATOM   6541  C CA   . PRO A 1 33 ? -10.060 1.422   -0.411  1.00 15.00 ?  311 PRO A CA   9  
ATOM   6542  C C    . PRO A 1 33 ? -10.011 2.751   -1.182  1.00 15.00 ?  311 PRO A C    9  
ATOM   6543  O O    . PRO A 1 33 ? -11.040 3.407   -1.362  1.00 15.00 ?  311 PRO A O    9  
ATOM   6544  C CB   . PRO A 1 33 ? -10.146 1.676   1.089   1.00 15.00 ?  311 PRO A CB   9  
ATOM   6545  C CG   . PRO A 1 33 ? -8.723  1.765   1.537   1.00 15.00 ?  311 PRO A CG   9  
ATOM   6546  C CD   . PRO A 1 33 ? -7.905  0.923   0.583   1.00 15.00 ?  311 PRO A CD   9  
ATOM   6547  H HA   . PRO A 1 33 ? -10.922 0.857   -0.728  1.00 15.00 ?  311 PRO A HA   9  
ATOM   6548  H HB2  . PRO A 1 33 ? -10.679 2.598   1.270   1.00 15.00 ?  311 PRO A HB2  9  
ATOM   6549  H HB3  . PRO A 1 33 ? -10.660 0.856   1.568   1.00 15.00 ?  311 PRO A HB3  9  
ATOM   6550  H HG2  . PRO A 1 33 ? -8.394  2.793   1.497   1.00 15.00 ?  311 PRO A HG2  9  
ATOM   6551  H HG3  . PRO A 1 33 ? -8.633  1.383   2.543   1.00 15.00 ?  311 PRO A HG3  9  
ATOM   6552  H HD2  . PRO A 1 33 ? -7.049  1.481   0.233   1.00 15.00 ?  311 PRO A HD2  9  
ATOM   6553  H HD3  . PRO A 1 33 ? -7.588  0.010   1.065   1.00 15.00 ?  311 PRO A HD3  9  
ATOM   6554  N N    . ARG A 1 34 ? -8.812  3.169   -1.594  1.00 15.00 ?  312 ARG A N    9  
ATOM   6555  C CA   . ARG A 1 34 ? -8.615  4.503   -2.167  1.00 15.00 ?  312 ARG A CA   9  
ATOM   6556  C C    . ARG A 1 34 ? -8.983  4.581   -3.647  1.00 15.00 ?  312 ARG A C    9  
ATOM   6557  O O    . ARG A 1 34 ? -9.497  5.606   -4.103  1.00 15.00 ?  312 ARG A O    9  
ATOM   6558  C CB   . ARG A 1 34 ? -7.165  4.959   -1.990  1.00 15.00 ?  312 ARG A CB   9  
ATOM   6559  C CG   . ARG A 1 34 ? -6.755  5.150   -0.544  1.00 15.00 ?  312 ARG A CG   9  
ATOM   6560  C CD   . ARG A 1 34 ? -7.542  6.271   0.116   1.00 15.00 ?  312 ARG A CD   9  
ATOM   6561  N NE   . ARG A 1 34 ? -7.305  7.564   -0.525  1.00 15.00 ?  312 ARG A NE   9  
ATOM   6562  C CZ   . ARG A 1 34 ? -7.865  8.707   -0.132  1.00 15.00 ?  312 ARG A CZ   9  
ATOM   6563  N NH1  . ARG A 1 34 ? -8.750  8.716   0.856   1.00 15.00 1  312 ARG A NH1  9  
ATOM   6564  N NH2  . ARG A 1 34 ? -7.559  9.846   -0.742  1.00 15.00 ?  312 ARG A NH2  9  
ATOM   6565  H H    . ARG A 1 34 ? -8.039  2.558   -1.523  1.00 15.00 ?  312 ARG A H    9  
ATOM   6566  H HA   . ARG A 1 34 ? -9.252  5.183   -1.623  1.00 15.00 ?  312 ARG A HA   9  
ATOM   6567  H HB2  . ARG A 1 34 ? -6.511  4.221   -2.430  1.00 15.00 ?  312 ARG A HB2  9  
ATOM   6568  H HB3  . ARG A 1 34 ? -7.030  5.900   -2.506  1.00 15.00 ?  312 ARG A HB3  9  
ATOM   6569  H HG2  . ARG A 1 34 ? -6.935  4.233   -0.006  1.00 15.00 ?  312 ARG A HG2  9  
ATOM   6570  H HG3  . ARG A 1 34 ? -5.703  5.393   -0.509  1.00 15.00 ?  312 ARG A HG3  9  
ATOM   6571  H HD2  . ARG A 1 34 ? -8.593  6.040   0.056   1.00 15.00 ?  312 ARG A HD2  9  
ATOM   6572  H HD3  . ARG A 1 34 ? -7.248  6.335   1.153   1.00 15.00 ?  312 ARG A HD3  9  
ATOM   6573  H HE   . ARG A 1 34 ? -6.672  7.582   -1.290  1.00 15.00 ?  312 ARG A HE   9  
ATOM   6574  H HH11 . ARG A 1 34 ? -9.009  7.863   1.313   1.00 15.00 ?  312 ARG A HH11 9  
ATOM   6575  H HH12 . ARG A 1 34 ? -9.167  9.585   1.150   1.00 15.00 ?  312 ARG A HH12 9  
ATOM   6576  H HH21 . ARG A 1 34 ? -6.907  9.854   -1.505  1.00 15.00 ?  312 ARG A HH21 9  
ATOM   6577  H HH22 . ARG A 1 34 ? -7.980  10.708  -0.438  1.00 15.00 ?  312 ARG A HH22 9  
ATOM   6578  N N    . LEU A 1 35 ? -8.677  3.531   -4.397  1.00 15.00 ?  313 LEU A N    9  
ATOM   6579  C CA   . LEU A 1 35 ? -8.882  3.522   -5.846  1.00 15.00 ?  313 LEU A CA   9  
ATOM   6580  C C    . LEU A 1 35 ? -10.326 3.863   -6.222  1.00 15.00 ?  313 LEU A C    9  
ATOM   6581  O O    . LEU A 1 35 ? -11.262 3.392   -5.543  1.00 15.00 ?  313 LEU A O    9  
ATOM   6582  C CB   . LEU A 1 35 ? -8.447  2.177   -6.461  1.00 15.00 ?  313 LEU A CB   9  
ATOM   6583  C CG   . LEU A 1 35 ? -9.409  0.985   -6.314  1.00 15.00 ?  313 LEU A CG   9  
ATOM   6584  C CD1  . LEU A 1 35 ? -8.776  -0.266  -6.902  1.00 15.00 ?  313 LEU A CD1  9  
ATOM   6585  C CD2  . LEU A 1 35 ? -9.783  0.737   -4.864  1.00 15.00 ?  313 LEU A CD2  9  
ATOM   6586  H H    . LEU A 1 35 ? -8.273  2.741   -3.968  1.00 15.00 ?  313 LEU A H    9  
ATOM   6587  H HA   . LEU A 1 35 ? -8.245  4.296   -6.253  1.00 15.00 ?  313 LEU A HA   9  
ATOM   6588  H HB2  . LEU A 1 35 ? -8.278  2.335   -7.516  1.00 15.00 ?  313 LEU A HB2  9  
ATOM   6589  H HB3  . LEU A 1 35 ? -7.506  1.898   -6.011  1.00 15.00 ?  313 LEU A HB3  9  
ATOM   6590  H HG   . LEU A 1 35 ? -10.315 1.191   -6.867  1.00 15.00 ?  313 LEU A HG   9  
ATOM   6591  H HD11 . LEU A 1 35 ? -7.876  -0.506  -6.347  1.00 15.00 ?  313 LEU A HD11 9  
ATOM   6592  H HD12 . LEU A 1 35 ? -8.527  -0.093  -7.937  1.00 15.00 ?  313 LEU A HD12 9  
ATOM   6593  H HD13 . LEU A 1 35 ? -9.473  -1.088  -6.831  1.00 15.00 ?  313 LEU A HD13 9  
ATOM   6594  H HD21 . LEU A 1 35 ? -10.277 1.611   -4.464  1.00 15.00 ?  313 LEU A HD21 9  
ATOM   6595  H HD22 . LEU A 1 35 ? -8.889  0.537   -4.292  1.00 15.00 ?  313 LEU A HD22 9  
ATOM   6596  H HD23 . LEU A 1 35 ? -10.448 -0.112  -4.802  1.00 15.00 ?  313 LEU A HD23 9  
ATOM   6597  N N    . ASP B 2 2  ? -2.330  -9.789  -7.935  1.00 15.00 ?  221 ASP B N    9  
ATOM   6598  C CA   . ASP B 2 2  ? -0.899  -9.589  -8.257  1.00 15.00 ?  221 ASP B CA   9  
ATOM   6599  C C    . ASP B 2 2  ? -0.057  -10.563 -7.444  1.00 15.00 ?  221 ASP B C    9  
ATOM   6600  O O    . ASP B 2 2  ? -0.574  -11.236 -6.553  1.00 15.00 ?  221 ASP B O    9  
ATOM   6601  C CB   . ASP B 2 2  ? -0.485  -8.146  -7.941  1.00 15.00 ?  221 ASP B CB   9  
ATOM   6602  C CG   . ASP B 2 2  ? 0.795   -7.735  -8.641  1.00 15.00 ?  221 ASP B CG   9  
ATOM   6603  O OD1  . ASP B 2 2  ? 1.888   -8.020  -8.113  1.00 15.00 ?  221 ASP B OD1  9  
ATOM   6604  O OD2  . ASP B 2 2  ? 0.709   -7.117  -9.724  1.00 15.00 -1 221 ASP B OD2  9  
ATOM   6605  H H    . ASP B 2 2  ? -2.626  -10.756 -8.198  1.00 15.00 ?  221 ASP B H    9  
ATOM   6606  H HA   . ASP B 2 2  ? -0.750  -9.785  -9.308  1.00 15.00 ?  221 ASP B HA   9  
ATOM   6607  H HB2  . ASP B 2 2  ? -1.272  -7.474  -8.252  1.00 15.00 ?  221 ASP B HB2  9  
ATOM   6608  H HB3  . ASP B 2 2  ? -0.336  -8.048  -6.874  1.00 15.00 ?  221 ASP B HB3  9  
ATOM   6609  N N    . THR B 2 3  ? 1.230   -10.629 -7.745  1.00 15.00 ?  222 THR B N    9  
ATOM   6610  C CA   . THR B 2 3  ? 2.150   -11.498 -7.026  1.00 15.00 ?  222 THR B CA   9  
ATOM   6611  C C    . THR B 2 3  ? 2.311   -11.037 -5.582  1.00 15.00 ?  222 THR B C    9  
ATOM   6612  O O    . THR B 2 3  ? 2.082   -9.871  -5.297  1.00 15.00 ?  222 THR B O    9  
ATOM   6613  C CB   . THR B 2 3  ? 3.523   -11.511 -7.720  1.00 15.00 ?  222 THR B CB   9  
ATOM   6614  O OG1  . THR B 2 3  ? 3.907   -10.167 -8.042  1.00 15.00 ?  222 THR B OG1  9  
ATOM   6615  C CG2  . THR B 2 3  ? 3.486   -12.355 -8.985  1.00 15.00 ?  222 THR B CG2  9  
ATOM   6616  H H    . THR B 2 3  ? 1.581   -10.060 -8.465  1.00 15.00 ?  222 THR B H    9  
ATOM   6617  H HA   . THR B 2 3  ? 1.741   -12.493 -7.029  1.00 15.00 ?  222 THR B HA   9  
ATOM   6618  H HB   . THR B 2 3  ? 4.251   -11.935 -7.041  1.00 15.00 ?  222 THR B HB   9  
ATOM   6619  H HG1  . THR B 2 3  ? 3.197   -9.559  -7.784  1.00 15.00 ?  222 THR B HG1  9  
ATOM   6620  H HG21 . THR B 2 3  ? 3.229   -13.372 -8.732  1.00 15.00 ?  222 THR B HG21 9  
ATOM   6621  H HG22 . THR B 2 3  ? 4.455   -12.335 -9.460  1.00 15.00 ?  222 THR B HG22 9  
ATOM   6622  H HG23 . THR B 2 3  ? 2.744   -11.956 -9.663  1.00 15.00 ?  222 THR B HG23 9  
ATOM   6623  N N    . PRO B 2 4  ? 2.752   -11.932 -4.675  1.00 15.00 ?  223 PRO B N    9  
ATOM   6624  C CA   . PRO B 2 4  ? 2.780   -11.657 -3.229  1.00 15.00 ?  223 PRO B CA   9  
ATOM   6625  C C    . PRO B 2 4  ? 3.423   -10.310 -2.886  1.00 15.00 ?  223 PRO B C    9  
ATOM   6626  O O    . PRO B 2 4  ? 4.448   -9.931  -3.465  1.00 15.00 ?  223 PRO B O    9  
ATOM   6627  C CB   . PRO B 2 4  ? 3.625   -12.805 -2.676  1.00 15.00 ?  223 PRO B CB   9  
ATOM   6628  C CG   . PRO B 2 4  ? 3.409   -13.924 -3.632  1.00 15.00 ?  223 PRO B CG   9  
ATOM   6629  C CD   . PRO B 2 4  ? 3.251   -13.287 -4.983  1.00 15.00 ?  223 PRO B CD   9  
ATOM   6630  H HA   . PRO B 2 4  ? 1.789   -11.703 -2.806  1.00 15.00 ?  223 PRO B HA   9  
ATOM   6631  H HB2  . PRO B 2 4  ? 4.663   -12.507 -2.644  1.00 15.00 ?  223 PRO B HB2  9  
ATOM   6632  H HB3  . PRO B 2 4  ? 3.286   -13.063 -1.685  1.00 15.00 ?  223 PRO B HB3  9  
ATOM   6633  H HG2  . PRO B 2 4  ? 4.266   -14.581 -3.626  1.00 15.00 ?  223 PRO B HG2  9  
ATOM   6634  H HG3  . PRO B 2 4  ? 2.515   -14.468 -3.367  1.00 15.00 ?  223 PRO B HG3  9  
ATOM   6635  H HD2  . PRO B 2 4  ? 4.203   -13.238 -5.490  1.00 15.00 ?  223 PRO B HD2  9  
ATOM   6636  H HD3  . PRO B 2 4  ? 2.534   -13.836 -5.576  1.00 15.00 ?  223 PRO B HD3  9  
ATOM   6637  N N    . PRO B 2 5  ? 2.828   -9.576  -1.921  1.00 15.00 ?  224 PRO B N    9  
ATOM   6638  C CA   . PRO B 2 5  ? 3.242   -8.209  -1.601  1.00 15.00 ?  224 PRO B CA   9  
ATOM   6639  C C    . PRO B 2 5  ? 4.656   -8.130  -1.036  1.00 15.00 ?  224 PRO B C    9  
ATOM   6640  O O    . PRO B 2 5  ? 5.065   -8.957  -0.219  1.00 15.00 ?  224 PRO B O    9  
ATOM   6641  C CB   . PRO B 2 5  ? 2.222   -7.751  -0.553  1.00 15.00 ?  224 PRO B CB   9  
ATOM   6642  C CG   . PRO B 2 5  ? 1.676   -9.002  0.037   1.00 15.00 ?  224 PRO B CG   9  
ATOM   6643  C CD   . PRO B 2 5  ? 1.723   -10.035 -1.052  1.00 15.00 ?  224 PRO B CD   9  
ATOM   6644  H HA   . PRO B 2 5  ? 3.174   -7.568  -2.469  1.00 15.00 ?  224 PRO B HA   9  
ATOM   6645  H HB2  . PRO B 2 5  ? 2.719   -7.149  0.193   1.00 15.00 ?  224 PRO B HB2  9  
ATOM   6646  H HB3  . PRO B 2 5  ? 1.448   -7.173  -1.033  1.00 15.00 ?  224 PRO B HB3  9  
ATOM   6647  H HG2  . PRO B 2 5  ? 2.283   -9.310  0.876   1.00 15.00 ?  224 PRO B HG2  9  
ATOM   6648  H HG3  . PRO B 2 5  ? 0.658   -8.841  0.352   1.00 15.00 ?  224 PRO B HG3  9  
ATOM   6649  H HD2  . PRO B 2 5  ? 1.939   -11.006 -0.633  1.00 15.00 ?  224 PRO B HD2  9  
ATOM   6650  H HD3  . PRO B 2 5  ? 0.786   -10.051 -1.590  1.00 15.00 ?  224 PRO B HD3  9  
ATOM   6651  N N    . PRO B 2 6  ? 5.410   -7.113  -1.473  1.00 15.00 ?  225 PRO B N    9  
ATOM   6652  C CA   . PRO B 2 6  ? 6.764   -6.843  -0.981  1.00 15.00 ?  225 PRO B CA   9  
ATOM   6653  C C    . PRO B 2 6  ? 6.764   -6.428  0.484   1.00 15.00 ?  225 PRO B C    9  
ATOM   6654  O O    . PRO B 2 6  ? 5.707   -6.315  1.103   1.00 15.00 ?  225 PRO B O    9  
ATOM   6655  C CB   . PRO B 2 6  ? 7.236   -5.656  -1.833  1.00 15.00 ?  225 PRO B CB   9  
ATOM   6656  C CG   . PRO B 2 6  ? 6.279   -5.556  -2.968  1.00 15.00 ?  225 PRO B CG   9  
ATOM   6657  C CD   . PRO B 2 6  ? 4.990   -6.144  -2.490  1.00 15.00 ?  225 PRO B CD   9  
ATOM   6658  H HA   . PRO B 2 6  ? 7.423   -7.685  -1.125  1.00 15.00 ?  225 PRO B HA   9  
ATOM   6659  H HB2  . PRO B 2 6  ? 7.224   -4.758  -1.234  1.00 15.00 ?  225 PRO B HB2  9  
ATOM   6660  H HB3  . PRO B 2 6  ? 8.234   -5.839  -2.183  1.00 15.00 ?  225 PRO B HB3  9  
ATOM   6661  H HG2  . PRO B 2 6  ? 6.138   -4.520  -3.237  1.00 15.00 ?  225 PRO B HG2  9  
ATOM   6662  H HG3  . PRO B 2 6  ? 6.654   -6.112  -3.808  1.00 15.00 ?  225 PRO B HG3  9  
ATOM   6663  H HD2  . PRO B 2 6  ? 4.365   -5.378  -2.056  1.00 15.00 ?  225 PRO B HD2  9  
ATOM   6664  H HD3  . PRO B 2 6  ? 4.477   -6.637  -3.301  1.00 15.00 ?  225 PRO B HD3  9  
ATOM   6665  N N    . ALA B 2 7  ? 7.950   -6.183  1.030   1.00 15.00 ?  226 ALA B N    9  
ATOM   6666  C CA   . ALA B 2 7  ? 8.061   -5.583  2.351   1.00 15.00 ?  226 ALA B CA   9  
ATOM   6667  C C    . ALA B 2 7  ? 7.502   -4.167  2.301   1.00 15.00 ?  226 ALA B C    9  
ATOM   6668  O O    . ALA B 2 7  ? 7.338   -3.601  1.215   1.00 15.00 ?  226 ALA B O    9  
ATOM   6669  C CB   . ALA B 2 7  ? 9.508   -5.576  2.820   1.00 15.00 ?  226 ALA B CB   9  
ATOM   6670  H H    . ALA B 2 7  ? 8.761   -6.406  0.534   1.00 15.00 ?  226 ALA B H    9  
ATOM   6671  H HA   . ALA B 2 7  ? 7.475   -6.173  3.043   1.00 15.00 ?  226 ALA B HA   9  
ATOM   6672  H HB1  . ALA B 2 7  ? 9.885   -6.588  2.839   1.00 15.00 ?  226 ALA B HB1  9  
ATOM   6673  H HB2  . ALA B 2 7  ? 9.564   -5.153  3.812   1.00 15.00 ?  226 ALA B HB2  9  
ATOM   6674  H HB3  . ALA B 2 7  ? 10.103  -4.983  2.141   1.00 15.00 ?  226 ALA B HB3  9  
ATOM   6675  N N    . TYR B 2 8  ? 7.224   -3.579  3.449   1.00 15.00 ?  227 TYR B N    9  
ATOM   6676  C CA   . TYR B 2 8  ? 6.557   -2.291  3.459   1.00 15.00 ?  227 TYR B CA   9  
ATOM   6677  C C    . TYR B 2 8  ? 7.574   -1.148  3.429   1.00 15.00 ?  227 TYR B C    9  
ATOM   6678  O O    . TYR B 2 8  ? 8.505   -1.087  4.235   1.00 15.00 ?  227 TYR B O    9  
ATOM   6679  C CB   . TYR B 2 8  ? 5.612   -2.164  4.667   1.00 15.00 ?  227 TYR B CB   9  
ATOM   6680  C CG   . TYR B 2 8  ? 6.257   -1.587  5.902   1.00 15.00 ?  227 TYR B CG   9  
ATOM   6681  C CD1  . TYR B 2 8  ? 6.933   -2.388  6.813   1.00 15.00 ?  227 TYR B CD1  9  
ATOM   6682  C CD2  . TYR B 2 8  ? 6.204   -0.223  6.137   1.00 15.00 ?  227 TYR B CD2  9  
ATOM   6683  C CE1  . TYR B 2 8  ? 7.542   -1.838  7.924   1.00 15.00 ?  227 TYR B CE1  9  
ATOM   6684  C CE2  . TYR B 2 8  ? 6.806   0.334   7.244   1.00 15.00 ?  227 TYR B CE2  9  
ATOM   6685  C CZ   . TYR B 2 8  ? 7.477   -0.477  8.136   1.00 15.00 ?  227 TYR B CZ   9  
ATOM   6686  O OH   . TYR B 2 8  ? 8.091   0.073   9.237   1.00 15.00 ?  227 TYR B OH   9  
ATOM   6687  H H    . TYR B 2 8  ? 7.467   -4.010  4.293   1.00 15.00 ?  227 TYR B H    9  
ATOM   6688  H HA   . TYR B 2 8  ? 5.964   -2.235  2.556   1.00 15.00 ?  227 TYR B HA   9  
ATOM   6689  H HB2  . TYR B 2 8  ? 4.789   -1.514  4.397   1.00 15.00 ?  227 TYR B HB2  9  
ATOM   6690  H HB3  . TYR B 2 8  ? 5.227   -3.139  4.915   1.00 15.00 ?  227 TYR B HB3  9  
ATOM   6691  H HD1  . TYR B 2 8  ? 6.981   -3.453  6.642   1.00 15.00 ?  227 TYR B HD1  9  
ATOM   6692  H HD2  . TYR B 2 8  ? 5.673   0.410   5.432   1.00 15.00 ?  227 TYR B HD2  9  
ATOM   6693  H HE1  . TYR B 2 8  ? 8.064   -2.475  8.624   1.00 15.00 ?  227 TYR B HE1  9  
ATOM   6694  H HE2  . TYR B 2 8  ? 6.753   1.408   7.403   1.00 15.00 ?  227 TYR B HE2  9  
ATOM   6695  H HH   . TYR B 2 8  ? 8.972   -0.315  9.335   1.00 15.00 ?  227 TYR B HH   9  
ATOM   6696  N N    . LEU B 2 9  ? 7.398   -0.279  2.452   1.00 15.00 ?  228 LEU B N    9  
ATOM   6697  C CA   . LEU B 2 9  ? 8.181   0.939   2.310   1.00 15.00 ?  228 LEU B CA   9  
ATOM   6698  C C    . LEU B 2 9  ? 7.221   2.101   2.115   1.00 15.00 ?  228 LEU B C    9  
ATOM   6699  O O    . LEU B 2 9  ? 6.101   1.886   1.691   1.00 15.00 ?  228 LEU B O    9  
ATOM   6700  C CB   . LEU B 2 9  ? 9.150   0.855   1.115   1.00 15.00 ?  228 LEU B CB   9  
ATOM   6701  C CG   . LEU B 2 9  ? 10.365  -0.069  1.279   1.00 15.00 ?  228 LEU B CG   9  
ATOM   6702  C CD1  . LEU B 2 9  ? 9.976   -1.525  1.092   1.00 15.00 ?  228 LEU B CD1  9  
ATOM   6703  C CD2  . LEU B 2 9  ? 11.455  0.320   0.295   1.00 15.00 ?  228 LEU B CD2  9  
ATOM   6704  H H    . LEU B 2 9  ? 6.697   -0.458  1.790   1.00 15.00 ?  228 LEU B H    9  
ATOM   6705  H HA   . LEU B 2 9  ? 8.730   1.087   3.228   1.00 15.00 ?  228 LEU B HA   9  
ATOM   6706  H HB2  . LEU B 2 9  ? 8.589   0.517   0.258   1.00 15.00 ?  228 LEU B HB2  9  
ATOM   6707  H HB3  . LEU B 2 9  ? 9.513   1.851   0.909   1.00 15.00 ?  228 LEU B HB3  9  
ATOM   6708  H HG   . LEU B 2 9  ? 10.762  0.043   2.277   1.00 15.00 ?  228 LEU B HG   9  
ATOM   6709  H HD11 . LEU B 2 9  ? 9.581   -1.667  0.098   1.00 15.00 ?  228 LEU B HD11 9  
ATOM   6710  H HD12 . LEU B 2 9  ? 9.225   -1.792  1.820   1.00 15.00 ?  228 LEU B HD12 9  
ATOM   6711  H HD13 . LEU B 2 9  ? 10.846  -2.152  1.226   1.00 15.00 ?  228 LEU B HD13 9  
ATOM   6712  H HD21 . LEU B 2 9  ? 11.748  1.346   0.471   1.00 15.00 ?  228 LEU B HD21 9  
ATOM   6713  H HD22 . LEU B 2 9  ? 11.084  0.219   -0.714  1.00 15.00 ?  228 LEU B HD22 9  
ATOM   6714  H HD23 . LEU B 2 9  ? 12.310  -0.326  0.431   1.00 15.00 ?  228 LEU B HD23 9  
ATOM   6715  N N    . PRO B 2 10 ? 7.635   3.352   2.344   1.00 15.00 ?  229 PRO B N    9  
ATOM   6716  C CA   . PRO B 2 10 ? 6.715   4.484   2.265   1.00 15.00 ?  229 PRO B CA   9  
ATOM   6717  C C    . PRO B 2 10 ? 6.620   5.043   0.847   1.00 15.00 ?  229 PRO B C    9  
ATOM   6718  O O    . PRO B 2 10 ? 7.509   4.835   0.019   1.00 15.00 ?  229 PRO B O    9  
ATOM   6719  C CB   . PRO B 2 10 ? 7.369   5.532   3.188   1.00 15.00 ?  229 PRO B CB   9  
ATOM   6720  C CG   . PRO B 2 10 ? 8.552   4.862   3.807   1.00 15.00 ?  229 PRO B CG   9  
ATOM   6721  C CD   . PRO B 2 10 ? 8.930   3.744   2.886   1.00 15.00 ?  229 PRO B CD   9  
ATOM   6722  H HA   . PRO B 2 10 ? 5.736   4.225   2.633   1.00 15.00 ?  229 PRO B HA   9  
ATOM   6723  H HB2  . PRO B 2 10 ? 7.669   6.387   2.603   1.00 15.00 ?  229 PRO B HB2  9  
ATOM   6724  H HB3  . PRO B 2 10 ? 6.658   5.841   3.939   1.00 15.00 ?  229 PRO B HB3  9  
ATOM   6725  H HG2  . PRO B 2 10 ? 9.362   5.561   3.898   1.00 15.00 ?  229 PRO B HG2  9  
ATOM   6726  H HG3  . PRO B 2 10 ? 8.284   4.472   4.777   1.00 15.00 ?  229 PRO B HG3  9  
ATOM   6727  H HD2  . PRO B 2 10 ? 9.595   4.085   2.118   1.00 15.00 ?  229 PRO B HD2  9  
ATOM   6728  H HD3  . PRO B 2 10 ? 9.369   2.937   3.445   1.00 15.00 ?  229 PRO B HD3  9  
ATOM   6729  N N    . PRO B 2 11 ? 5.536   5.788   0.556   1.00 15.00 ?  230 PRO B N    9  
ATOM   6730  C CA   . PRO B 2 11 ? 4.966   5.844   -0.783  1.00 15.00 ?  230 PRO B CA   9  
ATOM   6731  C C    . PRO B 2 11 ? 5.524   6.929   -1.692  1.00 15.00 ?  230 PRO B C    9  
ATOM   6732  O O    . PRO B 2 11 ? 5.832   8.044   -1.268  1.00 15.00 ?  230 PRO B O    9  
ATOM   6733  C CB   . PRO B 2 11 ? 3.500   6.130   -0.474  1.00 15.00 ?  230 PRO B CB   9  
ATOM   6734  C CG   . PRO B 2 11 ? 3.514   6.976   0.756   1.00 15.00 ?  230 PRO B CG   9  
ATOM   6735  C CD   . PRO B 2 11 ? 4.788   6.656   1.494   1.00 15.00 ?  230 PRO B CD   9  
ATOM   6736  H HA   . PRO B 2 11 ? 5.037   4.891   -1.281  1.00 15.00 ?  230 PRO B HA   9  
ATOM   6737  H HB2  . PRO B 2 11 ? 3.052   6.653   -1.300  1.00 15.00 ?  230 PRO B HB2  9  
ATOM   6738  H HB3  . PRO B 2 11 ? 2.977   5.199   -0.304  1.00 15.00 ?  230 PRO B HB3  9  
ATOM   6739  H HG2  . PRO B 2 11 ? 3.495   8.019   0.480   1.00 15.00 ?  230 PRO B HG2  9  
ATOM   6740  H HG3  . PRO B 2 11 ? 2.657   6.738   1.369   1.00 15.00 ?  230 PRO B HG3  9  
ATOM   6741  H HD2  . PRO B 2 11 ? 5.340   7.562   1.701   1.00 15.00 ?  230 PRO B HD2  9  
ATOM   6742  H HD3  . PRO B 2 11 ? 4.563   6.138   2.411   1.00 15.00 ?  230 PRO B HD3  9  
ATOM   6743  N N    . GLU B 2 12 ? 5.620   6.571   -2.965  1.00 15.00 ?  231 GLU B N    9  
ATOM   6744  C CA   . GLU B 2 12 ? 6.031   7.487   -4.009  1.00 15.00 ?  231 GLU B CA   9  
ATOM   6745  C C    . GLU B 2 12 ? 4.900   7.633   -5.040  1.00 15.00 ?  231 GLU B C    9  
ATOM   6746  O O    . GLU B 2 12 ? 4.705   6.755   -5.878  1.00 15.00 ?  231 GLU B O    9  
ATOM   6747  C CB   . GLU B 2 12 ? 7.317   6.982   -4.678  1.00 15.00 ?  231 GLU B CB   9  
ATOM   6748  C CG   . GLU B 2 12 ? 7.277   5.519   -5.113  1.00 15.00 ?  231 GLU B CG   9  
ATOM   6749  C CD   . GLU B 2 12 ? 8.606   5.052   -5.658  1.00 15.00 ?  231 GLU B CD   9  
ATOM   6750  O OE1  . GLU B 2 12 ? 8.879   5.281   -6.853  1.00 15.00 ?  231 GLU B OE1  9  
ATOM   6751  O OE2  . GLU B 2 12 ? 9.385   4.456   -4.887  1.00 15.00 -1 231 GLU B OE2  9  
ATOM   6752  H H    . GLU B 2 12 ? 5.396   5.652   -3.215  1.00 15.00 ?  231 GLU B H    9  
ATOM   6753  H HA   . GLU B 2 12 ? 6.233   8.442   -3.549  1.00 15.00 ?  231 GLU B HA   9  
ATOM   6754  H HB2  . GLU B 2 12 ? 7.510   7.585   -5.553  1.00 15.00 ?  231 GLU B HB2  9  
ATOM   6755  H HB3  . GLU B 2 12 ? 8.136   7.105   -3.986  1.00 15.00 ?  231 GLU B HB3  9  
ATOM   6756  H HG2  . GLU B 2 12 ? 7.018   4.903   -4.263  1.00 15.00 ?  231 GLU B HG2  9  
ATOM   6757  H HG3  . GLU B 2 12 ? 6.526   5.397   -5.882  1.00 15.00 ?  231 GLU B HG3  9  
ATOM   6758  N N    . ASP B 2 13 ? 4.121   8.710   -4.955  1.00 15.00 ?  232 ASP B N    9  
ATOM   6759  C CA   . ASP B 2 13 ? 2.982   8.884   -5.847  1.00 15.00 ?  232 ASP B CA   9  
ATOM   6760  C C    . ASP B 2 13 ? 2.840   10.346  -6.245  1.00 15.00 ?  232 ASP B C    9  
ATOM   6761  O O    . ASP B 2 13 ? 2.690   11.219  -5.386  1.00 15.00 ?  232 ASP B O    9  
ATOM   6762  C CB   . ASP B 2 13 ? 1.693   8.399   -5.171  1.00 15.00 ?  232 ASP B CB   9  
ATOM   6763  C CG   . ASP B 2 13 ? 0.486   8.473   -6.090  1.00 15.00 ?  232 ASP B CG   9  
ATOM   6764  O OD1  . ASP B 2 13 ? 0.213   7.483   -6.809  1.00 15.00 -1 232 ASP B OD1  9  
ATOM   6765  O OD2  . ASP B 2 13 ? -0.195  9.519   -6.104  1.00 15.00 ?  232 ASP B OD2  9  
ATOM   6766  H H    . ASP B 2 13 ? 4.311   9.405   -4.293  1.00 15.00 ?  232 ASP B H    9  
ATOM   6767  H HA   . ASP B 2 13 ? 3.159   8.294   -6.734  1.00 15.00 ?  232 ASP B HA   9  
ATOM   6768  H HB2  . ASP B 2 13 ? 1.822   7.373   -4.861  1.00 15.00 ?  232 ASP B HB2  9  
ATOM   6769  H HB3  . ASP B 2 13 ? 1.500   9.011   -4.302  1.00 15.00 ?  232 ASP B HB3  9  
ATOM   6770  N N    . PRO B 2 14 ? 2.917   10.639  -7.551  1.00 15.00 ?  233 PRO B N    9  
ATOM   6771  C CA   . PRO B 2 14 ? 2.778   11.995  -8.074  1.00 15.00 ?  233 PRO B CA   9  
ATOM   6772  C C    . PRO B 2 14 ? 1.316   12.424  -8.160  1.00 15.00 ?  233 PRO B C    9  
ATOM   6773  O O    . PRO B 2 14 ? 0.657   12.224  -9.179  1.00 15.00 ?  233 PRO B O    9  
ATOM   6774  C CB   . PRO B 2 14 ? 3.400   11.911  -9.483  1.00 15.00 ?  233 PRO B CB   9  
ATOM   6775  C CG   . PRO B 2 14 ? 3.917   10.512  -9.623  1.00 15.00 ?  233 PRO B CG   9  
ATOM   6776  C CD   . PRO B 2 14 ? 3.157   9.680   -8.629  1.00 15.00 ?  233 PRO B CD   9  
ATOM   6777  H HA   . PRO B 2 14 ? 3.328   12.710  -7.476  1.00 15.00 ?  233 PRO B HA   9  
ATOM   6778  H HB2  . PRO B 2 14 ? 2.645   12.125  -10.223 1.00 15.00 ?  233 PRO B HB2  9  
ATOM   6779  H HB3  . PRO B 2 14 ? 4.200   12.632  -9.565  1.00 15.00 ?  233 PRO B HB3  9  
ATOM   6780  H HG2  . PRO B 2 14 ? 3.738   10.153  -10.626 1.00 15.00 ?  233 PRO B HG2  9  
ATOM   6781  H HG3  . PRO B 2 14 ? 4.975   10.488  -9.398  1.00 15.00 ?  233 PRO B HG3  9  
ATOM   6782  H HD2  . PRO B 2 14 ? 2.227   9.330   -9.056  1.00 15.00 ?  233 PRO B HD2  9  
ATOM   6783  H HD3  . PRO B 2 14 ? 3.758   8.851   -8.287  1.00 15.00 ?  233 PRO B HD3  9  
HETATM 6784  N N    . NH2 B 2 15 ? 0.810   13.008  -7.086  1.00 15.00 ?  234 NH2 B N    9  
HETATM 6785  H HN1  . NH2 B 2 15 ? 1.394   13.134  -6.309  1.00 15.00 ?  234 NH2 B HN1  9  
HETATM 6786  H HN2  . NH2 B 2 15 ? -0.127  13.288  -7.112  1.00 15.00 ?  234 NH2 B HN2  9  
ATOM   6787  N N    . LEU A 1 1  ? -14.007 1.553   -1.629  1.00 15.00 ?  279 LEU A N    10 
ATOM   6788  C CA   . LEU A 1 1  ? -15.214 1.701   -0.788  1.00 15.00 ?  279 LEU A CA   10 
ATOM   6789  C C    . LEU A 1 1  ? -15.430 3.165   -0.426  1.00 15.00 ?  279 LEU A C    10 
ATOM   6790  O O    . LEU A 1 1  ? -16.464 3.743   -0.764  1.00 15.00 ?  279 LEU A O    10 
ATOM   6791  C CB   . LEU A 1 1  ? -15.085 0.833   0.476   1.00 15.00 ?  279 LEU A CB   10 
ATOM   6792  C CG   . LEU A 1 1  ? -16.371 0.638   1.293   1.00 15.00 ?  279 LEU A CG   10 
ATOM   6793  C CD1  . LEU A 1 1  ? -16.282 -0.637  2.115   1.00 15.00 ?  279 LEU A CD1  10 
ATOM   6794  C CD2  . LEU A 1 1  ? -16.626 1.823   2.212   1.00 15.00 ?  279 LEU A CD2  10 
ATOM   6795  H H1   . LEU A 1 1  ? -13.900 0.559   -1.926  1.00 15.00 ?  279 LEU A H1   10 
ATOM   6796  H H2   . LEU A 1 1  ? -13.161 1.839   -1.100  1.00 15.00 ?  279 LEU A H2   10 
ATOM   6797  H H3   . LEU A 1 1  ? -14.091 2.148   -2.481  1.00 15.00 ?  279 LEU A H3   10 
ATOM   6798  H HA   . LEU A 1 1  ? -16.064 1.360   -1.361  1.00 15.00 ?  279 LEU A HA   10 
ATOM   6799  H HB2  . LEU A 1 1  ? -14.725 -0.141  0.178   1.00 15.00 ?  279 LEU A HB2  10 
ATOM   6800  H HB3  . LEU A 1 1  ? -14.344 1.286   1.119   1.00 15.00 ?  279 LEU A HB3  10 
ATOM   6801  H HG   . LEU A 1 1  ? -17.210 0.546   0.618   1.00 15.00 ?  279 LEU A HG   10 
ATOM   6802  H HD11 . LEU A 1 1  ? -16.165 -1.483  1.454   1.00 15.00 ?  279 LEU A HD11 10 
ATOM   6803  H HD12 . LEU A 1 1  ? -17.186 -0.756  2.693   1.00 15.00 ?  279 LEU A HD12 10 
ATOM   6804  H HD13 . LEU A 1 1  ? -15.434 -0.580  2.780   1.00 15.00 ?  279 LEU A HD13 10 
ATOM   6805  H HD21 . LEU A 1 1  ? -17.543 1.662   2.760   1.00 15.00 ?  279 LEU A HD21 10 
ATOM   6806  H HD22 . LEU A 1 1  ? -16.714 2.724   1.623   1.00 15.00 ?  279 LEU A HD22 10 
ATOM   6807  H HD23 . LEU A 1 1  ? -15.805 1.925   2.907   1.00 15.00 ?  279 LEU A HD23 10 
ATOM   6808  N N    . GLY A 1 2  ? -14.465 3.774   0.257   1.00 15.00 ?  280 GLY A N    10 
ATOM   6809  C CA   . GLY A 1 2  ? -14.620 5.164   0.636   1.00 15.00 ?  280 GLY A CA   10 
ATOM   6810  C C    . GLY A 1 2  ? -13.474 5.704   1.480   1.00 15.00 ?  280 GLY A C    10 
ATOM   6811  O O    . GLY A 1 2  ? -12.680 6.509   0.994   1.00 15.00 ?  280 GLY A O    10 
ATOM   6812  H H    . GLY A 1 2  ? -13.652 3.280   0.509   1.00 15.00 ?  280 GLY A H    10 
ATOM   6813  H HA2  . GLY A 1 2  ? -14.695 5.759   -0.261  1.00 15.00 ?  280 GLY A HA2  10 
ATOM   6814  H HA3  . GLY A 1 2  ? -15.538 5.267   1.196   1.00 15.00 ?  280 GLY A HA3  10 
ATOM   6815  N N    . PRO A 1 3  ? -13.348 5.272   2.746   1.00 15.00 ?  281 PRO A N    10 
ATOM   6816  C CA   . PRO A 1 3  ? -12.414 5.872   3.697   1.00 15.00 ?  281 PRO A CA   10 
ATOM   6817  C C    . PRO A 1 3  ? -11.028 5.229   3.691   1.00 15.00 ?  281 PRO A C    10 
ATOM   6818  O O    . PRO A 1 3  ? -10.879 4.027   3.456   1.00 15.00 ?  281 PRO A O    10 
ATOM   6819  C CB   . PRO A 1 3  ? -13.117 5.617   5.029   1.00 15.00 ?  281 PRO A CB   10 
ATOM   6820  C CG   . PRO A 1 3  ? -13.831 4.318   4.843   1.00 15.00 ?  281 PRO A CG   10 
ATOM   6821  C CD   . PRO A 1 3  ? -14.114 4.176   3.365   1.00 15.00 ?  281 PRO A CD   10 
ATOM   6822  H HA   . PRO A 1 3  ? -12.317 6.935   3.540   1.00 15.00 ?  281 PRO A HA   10 
ATOM   6823  H HB2  . PRO A 1 3  ? -12.384 5.558   5.819   1.00 15.00 ?  281 PRO A HB2  10 
ATOM   6824  H HB3  . PRO A 1 3  ? -13.810 6.421   5.232   1.00 15.00 ?  281 PRO A HB3  10 
ATOM   6825  H HG2  . PRO A 1 3  ? -13.204 3.505   5.180   1.00 15.00 ?  281 PRO A HG2  10 
ATOM   6826  H HG3  . PRO A 1 3  ? -14.757 4.330   5.399   1.00 15.00 ?  281 PRO A HG3  10 
ATOM   6827  H HD2  . PRO A 1 3  ? -13.764 3.217   3.008   1.00 15.00 ?  281 PRO A HD2  10 
ATOM   6828  H HD3  . PRO A 1 3  ? -15.171 4.287   3.172   1.00 15.00 ?  281 PRO A HD3  10 
ATOM   6829  N N    . LEU A 1 4  ? -10.021 6.045   3.976   1.00 15.00 ?  282 LEU A N    10 
ATOM   6830  C CA   . LEU A 1 4  ? -8.644  5.586   4.057   1.00 15.00 ?  282 LEU A CA   10 
ATOM   6831  C C    . LEU A 1 4  ? -8.196  5.581   5.518   1.00 15.00 ?  282 LEU A C    10 
ATOM   6832  O O    . LEU A 1 4  ? -8.177  6.630   6.166   1.00 15.00 ?  282 LEU A O    10 
ATOM   6833  C CB   . LEU A 1 4  ? -7.734  6.504   3.233   1.00 15.00 ?  282 LEU A CB   10 
ATOM   6834  C CG   . LEU A 1 4  ? -6.306  6.000   3.024   1.00 15.00 ?  282 LEU A CG   10 
ATOM   6835  C CD1  . LEU A 1 4  ? -6.301  4.793   2.099   1.00 15.00 ?  282 LEU A CD1  10 
ATOM   6836  C CD2  . LEU A 1 4  ? -5.428  7.108   2.467   1.00 15.00 ?  282 LEU A CD2  10 
ATOM   6837  H H    . LEU A 1 4  ? -10.216 6.990   4.152   1.00 15.00 ?  282 LEU A H    10 
ATOM   6838  H HA   . LEU A 1 4  ? -8.594  4.582   3.664   1.00 15.00 ?  282 LEU A HA   10 
ATOM   6839  H HB2  . LEU A 1 4  ? -8.188  6.643   2.261   1.00 15.00 ?  282 LEU A HB2  10 
ATOM   6840  H HB3  . LEU A 1 4  ? -7.683  7.463   3.724   1.00 15.00 ?  282 LEU A HB3  10 
ATOM   6841  H HG   . LEU A 1 4  ? -5.897  5.692   3.975   1.00 15.00 ?  282 LEU A HG   10 
ATOM   6842  H HD11 . LEU A 1 4  ? -6.765  5.061   1.158   1.00 15.00 ?  282 LEU A HD11 10 
ATOM   6843  H HD12 . LEU A 1 4  ? -6.853  3.987   2.555   1.00 15.00 ?  282 LEU A HD12 10 
ATOM   6844  H HD13 . LEU A 1 4  ? -5.282  4.479   1.921   1.00 15.00 ?  282 LEU A HD13 10 
ATOM   6845  H HD21 . LEU A 1 4  ? -4.432  6.728   2.294   1.00 15.00 ?  282 LEU A HD21 10 
ATOM   6846  H HD22 . LEU A 1 4  ? -5.383  7.921   3.176   1.00 15.00 ?  282 LEU A HD22 10 
ATOM   6847  H HD23 . LEU A 1 4  ? -5.845  7.466   1.537   1.00 15.00 ?  282 LEU A HD23 10 
ATOM   6848  N N    . PRO A 1 5  ? -7.856  4.402   6.064   1.00 15.00 ?  283 PRO A N    10 
ATOM   6849  C CA   . PRO A 1 5  ? -7.428  4.270   7.462   1.00 15.00 ?  283 PRO A CA   10 
ATOM   6850  C C    . PRO A 1 5  ? -6.145  5.045   7.754   1.00 15.00 ?  283 PRO A C    10 
ATOM   6851  O O    . PRO A 1 5  ? -5.187  4.994   6.982   1.00 15.00 ?  283 PRO A O    10 
ATOM   6852  C CB   . PRO A 1 5  ? -7.192  2.764   7.635   1.00 15.00 ?  283 PRO A CB   10 
ATOM   6853  C CG   . PRO A 1 5  ? -7.898  2.116   6.495   1.00 15.00 ?  283 PRO A CG   10 
ATOM   6854  C CD   . PRO A 1 5  ? -7.863  3.108   5.369   1.00 15.00 ?  283 PRO A CD   10 
ATOM   6855  H HA   . PRO A 1 5  ? -8.203  4.595   8.140   1.00 15.00 ?  283 PRO A HA   10 
ATOM   6856  H HB2  . PRO A 1 5  ? -6.132  2.560   7.610   1.00 15.00 ?  283 PRO A HB2  10 
ATOM   6857  H HB3  . PRO A 1 5  ? -7.600  2.442   8.583   1.00 15.00 ?  283 PRO A HB3  10 
ATOM   6858  H HG2  . PRO A 1 5  ? -7.383  1.211   6.213   1.00 15.00 ?  283 PRO A HG2  10 
ATOM   6859  H HG3  . PRO A 1 5  ? -8.917  1.898   6.770   1.00 15.00 ?  283 PRO A HG3  10 
ATOM   6860  H HD2  . PRO A 1 5  ? -6.967  2.981   4.780   1.00 15.00 ?  283 PRO A HD2  10 
ATOM   6861  H HD3  . PRO A 1 5  ? -8.742  3.007   4.749   1.00 15.00 ?  283 PRO A HD3  10 
ATOM   6862  N N    . PRO A 1 6  ? -6.112  5.767   8.883   1.00 15.00 ?  284 PRO A N    10 
ATOM   6863  C CA   . PRO A 1 6  ? -4.934  6.530   9.304   1.00 15.00 ?  284 PRO A CA   10 
ATOM   6864  C C    . PRO A 1 6  ? -3.735  5.626   9.580   1.00 15.00 ?  284 PRO A C    10 
ATOM   6865  O O    . PRO A 1 6  ? -3.818  4.687   10.374  1.00 15.00 ?  284 PRO A O    10 
ATOM   6866  C CB   . PRO A 1 6  ? -5.389  7.223   10.591  1.00 15.00 ?  284 PRO A CB   10 
ATOM   6867  C CG   . PRO A 1 6  ? -6.554  6.432   11.071  1.00 15.00 ?  284 PRO A CG   10 
ATOM   6868  C CD   . PRO A 1 6  ? -7.224  5.893   9.841   1.00 15.00 ?  284 PRO A CD   10 
ATOM   6869  H HA   . PRO A 1 6  ? -4.660  7.271   8.567   1.00 15.00 ?  284 PRO A HA   10 
ATOM   6870  H HB2  . PRO A 1 6  ? -4.584  7.215   11.312  1.00 15.00 ?  284 PRO A HB2  10 
ATOM   6871  H HB3  . PRO A 1 6  ? -5.670  8.241   10.371  1.00 15.00 ?  284 PRO A HB3  10 
ATOM   6872  H HG2  . PRO A 1 6  ? -6.213  5.620   11.698  1.00 15.00 ?  284 PRO A HG2  10 
ATOM   6873  H HG3  . PRO A 1 6  ? -7.232  7.070   11.619  1.00 15.00 ?  284 PRO A HG3  10 
ATOM   6874  H HD2  . PRO A 1 6  ? -7.672  4.930   10.044  1.00 15.00 ?  284 PRO A HD2  10 
ATOM   6875  H HD3  . PRO A 1 6  ? -7.966  6.589   9.478   1.00 15.00 ?  284 PRO A HD3  10 
ATOM   6876  N N    . GLY A 1 7  ? -2.624  5.911   8.917   1.00 15.00 ?  285 GLY A N    10 
ATOM   6877  C CA   . GLY A 1 7  ? -1.442  5.089   9.065   1.00 15.00 ?  285 GLY A CA   10 
ATOM   6878  C C    . GLY A 1 7  ? -1.103  4.367   7.781   1.00 15.00 ?  285 GLY A C    10 
ATOM   6879  O O    . GLY A 1 7  ? -0.073  3.694   7.684   1.00 15.00 ?  285 GLY A O    10 
ATOM   6880  H H    . GLY A 1 7  ? -2.606  6.689   8.313   1.00 15.00 ?  285 GLY A H    10 
ATOM   6881  H HA2  . GLY A 1 7  ? -0.608  5.716   9.348   1.00 15.00 ?  285 GLY A HA2  10 
ATOM   6882  H HA3  . GLY A 1 7  ? -1.615  4.359   9.843   1.00 15.00 ?  285 GLY A HA3  10 
ATOM   6883  N N    . TRP A 1 8  ? -1.952  4.545   6.780   1.00 15.00 ?  286 TRP A N    10 
ATOM   6884  C CA   . TRP A 1 8  ? -1.779  3.887   5.498   1.00 15.00 ?  286 TRP A CA   10 
ATOM   6885  C C    . TRP A 1 8  ? -0.940  4.737   4.574   1.00 15.00 ?  286 TRP A C    10 
ATOM   6886  O O    . TRP A 1 8  ? -1.359  5.814   4.147   1.00 15.00 ?  286 TRP A O    10 
ATOM   6887  C CB   . TRP A 1 8  ? -3.143  3.618   4.835   1.00 15.00 ?  286 TRP A CB   10 
ATOM   6888  C CG   . TRP A 1 8  ? -3.791  2.357   5.293   1.00 15.00 ?  286 TRP A CG   10 
ATOM   6889  C CD1  . TRP A 1 8  ? -3.880  1.917   6.579   1.00 15.00 ?  286 TRP A CD1  10 
ATOM   6890  C CD2  . TRP A 1 8  ? -4.431  1.362   4.477   1.00 15.00 ?  286 TRP A CD2  10 
ATOM   6891  N NE1  . TRP A 1 8  ? -4.513  0.704   6.622   1.00 15.00 ?  286 TRP A NE1  10 
ATOM   6892  C CE2  . TRP A 1 8  ? -4.857  0.335   5.349   1.00 15.00 ?  286 TRP A CE2  10 
ATOM   6893  C CE3  . TRP A 1 8  ? -4.679  1.218   3.094   1.00 15.00 ?  286 TRP A CE3  10 
ATOM   6894  C CZ2  . TRP A 1 8  ? -5.509  -0.808  4.900   1.00 15.00 ?  286 TRP A CZ2  10 
ATOM   6895  C CZ3  . TRP A 1 8  ? -5.319  0.072   2.664   1.00 15.00 ?  286 TRP A CZ3  10 
ATOM   6896  C CH2  . TRP A 1 8  ? -5.721  -0.928  3.557   1.00 15.00 ?  286 TRP A CH2  10 
ATOM   6897  H H    . TRP A 1 8  ? -2.723  5.135   6.910   1.00 15.00 ?  286 TRP A H    10 
ATOM   6898  H HA   . TRP A 1 8  ? -1.265  2.946   5.669   1.00 15.00 ?  286 TRP A HA   10 
ATOM   6899  H HB2  . TRP A 1 8  ? -3.811  4.435   5.062   1.00 15.00 ?  286 TRP A HB2  10 
ATOM   6900  H HB3  . TRP A 1 8  ? -3.010  3.556   3.766   1.00 15.00 ?  286 TRP A HB3  10 
ATOM   6901  H HD1  . TRP A 1 8  ? -3.496  2.455   7.432   1.00 15.00 ?  286 TRP A HD1  10 
ATOM   6902  H HE1  . TRP A 1 8  ? -4.685  0.181   7.434   1.00 15.00 ?  286 TRP A HE1  10 
ATOM   6903  H HE3  . TRP A 1 8  ? -4.383  2.000   2.331   1.00 15.00 ?  286 TRP A HE3  10 
ATOM   6904  H HZ2  . TRP A 1 8  ? -5.825  -1.589  5.577   1.00 15.00 ?  286 TRP A HZ2  10 
ATOM   6905  H HZ3  . TRP A 1 8  ? -5.476  -0.075  1.604   1.00 15.00 ?  286 TRP A HZ3  10 
ATOM   6906  H HH2  . TRP A 1 8  ? -6.216  -1.805  3.163   1.00 15.00 ?  286 TRP A HH2  10 
ATOM   6907  N N    . GLU A 1 9  ? 0.255   4.260   4.284   1.00 15.00 ?  287 GLU A N    10 
ATOM   6908  C CA   . GLU A 1 9  ? 1.097   4.900   3.308   1.00 15.00 ?  287 GLU A CA   10 
ATOM   6909  C C    . GLU A 1 9  ? 0.912   4.160   1.999   1.00 15.00 ?  287 GLU A C    10 
ATOM   6910  O O    . GLU A 1 9  ? 1.097   2.942   1.940   1.00 15.00 ?  287 GLU A O    10 
ATOM   6911  C CB   . GLU A 1 9  ? 2.553   4.856   3.767   1.00 15.00 ?  287 GLU A CB   10 
ATOM   6912  C CG   . GLU A 1 9  ? 3.333   6.134   3.506   1.00 15.00 ?  287 GLU A CG   10 
ATOM   6913  C CD   . GLU A 1 9  ? 2.769   7.329   4.247   1.00 15.00 ?  287 GLU A CD   10 
ATOM   6914  O OE1  . GLU A 1 9  ? 1.686   7.822   3.872   1.00 15.00 ?  287 GLU A OE1  10 
ATOM   6915  O OE2  . GLU A 1 9  ? 3.422   7.789   5.208   1.00 15.00 -1 287 GLU A OE2  10 
ATOM   6916  H H    . GLU A 1 9  ? 0.575   3.438   4.727   1.00 15.00 ?  287 GLU A H    10 
ATOM   6917  H HA   . GLU A 1 9  ? 0.777   5.927   3.192   1.00 15.00 ?  287 GLU A HA   10 
ATOM   6918  H HB2  . GLU A 1 9  ? 2.574   4.663   4.828   1.00 15.00 ?  287 GLU A HB2  10 
ATOM   6919  H HB3  . GLU A 1 9  ? 3.053   4.051   3.258   1.00 15.00 ?  287 GLU A HB3  10 
ATOM   6920  H HG2  . GLU A 1 9  ? 4.350   5.981   3.837   1.00 15.00 ?  287 GLU A HG2  10 
ATOM   6921  H HG3  . GLU A 1 9  ? 3.334   6.346   2.445   1.00 15.00 ?  287 GLU A HG3  10 
ATOM   6922  N N    . VAL A 1 10 ? 0.505   4.864   0.962   1.00 15.00 ?  288 VAL A N    10 
ATOM   6923  C CA   . VAL A 1 10 ? 0.242   4.208   -0.299  1.00 15.00 ?  288 VAL A CA   10 
ATOM   6924  C C    . VAL A 1 10 ? 1.522   4.191   -1.128  1.00 15.00 ?  288 VAL A C    10 
ATOM   6925  O O    . VAL A 1 10 ? 2.062   5.226   -1.518  1.00 15.00 ?  288 VAL A O    10 
ATOM   6926  C CB   . VAL A 1 10 ? -0.956  4.853   -1.073  1.00 15.00 ?  288 VAL A CB   10 
ATOM   6927  C CG1  . VAL A 1 10 ? -2.067  5.256   -0.114  1.00 15.00 ?  288 VAL A CG1  10 
ATOM   6928  C CG2  . VAL A 1 10 ? -0.547  6.044   -1.928  1.00 15.00 ?  288 VAL A CG2  10 
ATOM   6929  H H    . VAL A 1 10 ? 0.385   5.832   1.045   1.00 15.00 ?  288 VAL A H    10 
ATOM   6930  H HA   . VAL A 1 10 ? -0.023  3.183   -0.074  1.00 15.00 ?  288 VAL A HA   10 
ATOM   6931  H HB   . VAL A 1 10 ? -1.358  4.097   -1.733  1.00 15.00 ?  288 VAL A HB   10 
ATOM   6932  H HG11 . VAL A 1 10 ? -2.885  5.688   -0.674  1.00 15.00 ?  288 VAL A HG11 10 
ATOM   6933  H HG12 . VAL A 1 10 ? -1.689  5.985   0.588   1.00 15.00 ?  288 VAL A HG12 10 
ATOM   6934  H HG13 . VAL A 1 10 ? -2.418  4.386   0.421   1.00 15.00 ?  288 VAL A HG13 10 
ATOM   6935  H HG21 . VAL A 1 10 ? 0.039   5.692   -2.764  1.00 15.00 ?  288 VAL A HG21 10 
ATOM   6936  H HG22 . VAL A 1 10 ? 0.043   6.729   -1.335  1.00 15.00 ?  288 VAL A HG22 10 
ATOM   6937  H HG23 . VAL A 1 10 ? -1.430  6.548   -2.289  1.00 15.00 ?  288 VAL A HG23 10 
ATOM   6938  N N    . ARG A 1 11 ? 2.058   3.004   -1.328  1.00 15.00 ?  289 ARG A N    10 
ATOM   6939  C CA   . ARG A 1 11 ? 3.294   2.877   -2.057  1.00 15.00 ?  289 ARG A CA   10 
ATOM   6940  C C    . ARG A 1 11 ? 2.961   2.419   -3.475  1.00 15.00 ?  289 ARG A C    10 
ATOM   6941  O O    . ARG A 1 11 ? 2.691   1.248   -3.723  1.00 15.00 ?  289 ARG A O    10 
ATOM   6942  C CB   . ARG A 1 11 ? 4.257   1.937   -1.291  1.00 15.00 ?  289 ARG A CB   10 
ATOM   6943  C CG   . ARG A 1 11 ? 5.743   2.172   -1.561  1.00 15.00 ?  289 ARG A CG   10 
ATOM   6944  C CD   . ARG A 1 11 ? 6.172   1.788   -2.969  1.00 15.00 ?  289 ARG A CD   10 
ATOM   6945  N NE   . ARG A 1 11 ? 7.607   2.013   -3.174  1.00 15.00 ?  289 ARG A NE   10 
ATOM   6946  C CZ   . ARG A 1 11 ? 8.477   1.055   -3.515  1.00 15.00 ?  289 ARG A CZ   10 
ATOM   6947  N NH1  . ARG A 1 11 ? 8.079   -0.202  -3.634  1.00 15.00 1  289 ARG A NH1  10 
ATOM   6948  N NH2  . ARG A 1 11 ? 9.756   1.349   -3.714  1.00 15.00 ?  289 ARG A NH2  10 
ATOM   6949  H H    . ARG A 1 11 ? 1.610   2.198   -0.983  1.00 15.00 ?  289 ARG A H    10 
ATOM   6950  H HA   . ARG A 1 11 ? 3.739   3.862   -2.115  1.00 15.00 ?  289 ARG A HA   10 
ATOM   6951  H HB2  . ARG A 1 11 ? 4.098   2.103   -0.234  1.00 15.00 ?  289 ARG A HB2  10 
ATOM   6952  H HB3  . ARG A 1 11 ? 4.023   0.902   -1.506  1.00 15.00 ?  289 ARG A HB3  10 
ATOM   6953  H HG2  . ARG A 1 11 ? 5.956   3.220   -1.416  1.00 15.00 ?  289 ARG A HG2  10 
ATOM   6954  H HG3  . ARG A 1 11 ? 6.318   1.593   -0.851  1.00 15.00 ?  289 ARG A HG3  10 
ATOM   6955  H HD2  . ARG A 1 11 ? 5.950   0.743   -3.129  1.00 15.00 ?  289 ARG A HD2  10 
ATOM   6956  H HD3  . ARG A 1 11 ? 5.618   2.386   -3.677  1.00 15.00 ?  289 ARG A HD3  10 
ATOM   6957  H HE   . ARG A 1 11 ? 7.938   2.930   -3.064  1.00 15.00 ?  289 ARG A HE   10 
ATOM   6958  H HH11 . ARG A 1 11 ? 7.126   -0.451  -3.459  1.00 15.00 ?  289 ARG A HH11 10 
ATOM   6959  H HH12 . ARG A 1 11 ? 8.741   -0.914  -3.911  1.00 15.00 ?  289 ARG A HH12 10 
ATOM   6960  H HH21 . ARG A 1 11 ? 10.088  2.297   -3.614  1.00 15.00 ?  289 ARG A HH21 10 
ATOM   6961  H HH22 . ARG A 1 11 ? 10.401  0.624   -3.976  1.00 15.00 ?  289 ARG A HH22 10 
ATOM   6962  N N    . SER A 1 12 ? 2.875   3.387   -4.378  1.00 15.00 ?  290 SER A N    10 
ATOM   6963  C CA   . SER A 1 12 ? 2.453   3.134   -5.746  1.00 15.00 ?  290 SER A CA   10 
ATOM   6964  C C    . SER A 1 12 ? 3.654   3.061   -6.678  1.00 15.00 ?  290 SER A C    10 
ATOM   6965  O O    . SER A 1 12 ? 4.477   3.971   -6.718  1.00 15.00 ?  290 SER A O    10 
ATOM   6966  C CB   . SER A 1 12 ? 1.485   4.232   -6.195  1.00 15.00 ?  290 SER A CB   10 
ATOM   6967  O OG   . SER A 1 12 ? 1.926   5.513   -5.768  1.00 15.00 ?  290 SER A OG   10 
ATOM   6968  H H    . SER A 1 12 ? 3.099   4.308   -4.120  1.00 15.00 ?  290 SER A H    10 
ATOM   6969  H HA   . SER A 1 12 ? 1.941   2.186   -5.765  1.00 15.00 ?  290 SER A HA   10 
ATOM   6970  H HB2  . SER A 1 12 ? 1.419   4.230   -7.274  1.00 15.00 ?  290 SER A HB2  10 
ATOM   6971  H HB3  . SER A 1 12 ? 0.508   4.042   -5.774  1.00 15.00 ?  290 SER A HB3  10 
ATOM   6972  H HG   . SER A 1 12 ? 2.466   5.919   -6.468  1.00 15.00 ?  290 SER A HG   10 
ATOM   6973  N N    . THR A 1 13 ? 3.748   1.981   -7.431  1.00 15.00 ?  291 THR A N    10 
ATOM   6974  C CA   . THR A 1 13 ? 4.879   1.784   -8.315  1.00 15.00 ?  291 THR A CA   10 
ATOM   6975  C C    . THR A 1 13 ? 4.485   2.019   -9.773  1.00 15.00 ?  291 THR A C    10 
ATOM   6976  O O    . THR A 1 13 ? 3.344   1.737   -10.172 1.00 15.00 ?  291 THR A O    10 
ATOM   6977  C CB   . THR A 1 13 ? 5.465   0.372   -8.146  1.00 15.00 ?  291 THR A CB   10 
ATOM   6978  O OG1  . THR A 1 13 ? 4.432   -0.609  -8.323  1.00 15.00 ?  291 THR A OG1  10 
ATOM   6979  C CG2  . THR A 1 13 ? 6.089   0.209   -6.764  1.00 15.00 ?  291 THR A CG2  10 
ATOM   6980  H H    . THR A 1 13 ? 3.036   1.306   -7.400  1.00 15.00 ?  291 THR A H    10 
ATOM   6981  H HA   . THR A 1 13 ? 5.641   2.502   -8.043  1.00 15.00 ?  291 THR A HA   10 
ATOM   6982  H HB   . THR A 1 13 ? 6.230   0.219   -8.893  1.00 15.00 ?  291 THR A HB   10 
ATOM   6983  H HG1  . THR A 1 13 ? 3.936   -0.699  -7.502  1.00 15.00 ?  291 THR A HG1  10 
ATOM   6984  H HG21 . THR A 1 13 ? 5.315   0.269   -6.012  1.00 15.00 ?  291 THR A HG21 10 
ATOM   6985  H HG22 . THR A 1 13 ? 6.813   0.995   -6.595  1.00 15.00 ?  291 THR A HG22 10 
ATOM   6986  H HG23 . THR A 1 13 ? 6.578   -0.753  -6.701  1.00 15.00 ?  291 THR A HG23 10 
ATOM   6987  N N    . VAL A 1 14 ? 5.444   2.520   -10.559 1.00 15.00 ?  292 VAL A N    10 
ATOM   6988  C CA   . VAL A 1 14 ? 5.225   2.851   -11.971 1.00 15.00 ?  292 VAL A CA   10 
ATOM   6989  C C    . VAL A 1 14 ? 4.821   1.608   -12.774 1.00 15.00 ?  292 VAL A C    10 
ATOM   6990  O O    . VAL A 1 14 ? 4.321   1.705   -13.898 1.00 15.00 ?  292 VAL A O    10 
ATOM   6991  C CB   . VAL A 1 14 ? 6.490   3.503   -12.591 1.00 15.00 ?  292 VAL A CB   10 
ATOM   6992  C CG1  . VAL A 1 14 ? 7.643   2.513   -12.662 1.00 15.00 ?  292 VAL A CG1  10 
ATOM   6993  C CG2  . VAL A 1 14 ? 6.189   4.087   -13.965 1.00 15.00 ?  292 VAL A CG2  10 
ATOM   6994  H H    . VAL A 1 14 ? 6.334   2.674   -10.173 1.00 15.00 ?  292 VAL A H    10 
ATOM   6995  H HA   . VAL A 1 14 ? 4.419   3.570   -12.018 1.00 15.00 ?  292 VAL A HA   10 
ATOM   6996  H HB   . VAL A 1 14 ? 6.793   4.316   -11.945 1.00 15.00 ?  292 VAL A HB   10 
ATOM   6997  H HG11 . VAL A 1 14 ? 7.878   2.162   -11.667 1.00 15.00 ?  292 VAL A HG11 10 
ATOM   6998  H HG12 . VAL A 1 14 ? 8.511   3.001   -13.085 1.00 15.00 ?  292 VAL A HG12 10 
ATOM   6999  H HG13 . VAL A 1 14 ? 7.362   1.675   -13.283 1.00 15.00 ?  292 VAL A HG13 10 
ATOM   7000  H HG21 . VAL A 1 14 ? 7.087   4.524   -14.374 1.00 15.00 ?  292 VAL A HG21 10 
ATOM   7001  H HG22 . VAL A 1 14 ? 5.428   4.848   -13.873 1.00 15.00 ?  292 VAL A HG22 10 
ATOM   7002  H HG23 . VAL A 1 14 ? 5.840   3.304   -14.620 1.00 15.00 ?  292 VAL A HG23 10 
ATOM   7003  N N    . SER A 1 15 ? 5.033   0.444   -12.173 1.00 15.00 ?  293 SER A N    10 
ATOM   7004  C CA   . SER A 1 15 ? 4.580   -0.825  -12.722 1.00 15.00 ?  293 SER A CA   10 
ATOM   7005  C C    . SER A 1 15 ? 3.058   -0.834  -12.925 1.00 15.00 ?  293 SER A C    10 
ATOM   7006  O O    . SER A 1 15 ? 2.512   -1.722  -13.579 1.00 15.00 ?  293 SER A O    10 
ATOM   7007  C CB   . SER A 1 15 ? 5.004   -1.958  -11.791 1.00 15.00 ?  293 SER A CB   10 
ATOM   7008  O OG   . SER A 1 15 ? 6.402   -1.919  -11.567 1.00 15.00 ?  293 SER A OG   10 
ATOM   7009  H H    . SER A 1 15 ? 5.528   0.433   -11.327 1.00 15.00 ?  293 SER A H    10 
ATOM   7010  H HA   . SER A 1 15 ? 5.058   -0.961  -13.679 1.00 15.00 ?  293 SER A HA   10 
ATOM   7011  H HB2  . SER A 1 15 ? 4.496   -1.856  -10.843 1.00 15.00 ?  293 SER A HB2  10 
ATOM   7012  H HB3  . SER A 1 15 ? 4.749   -2.908  -12.238 1.00 15.00 ?  293 SER A HB3  10 
ATOM   7013  H HG   . SER A 1 15 ? 6.855   -2.343  -12.315 1.00 15.00 ?  293 SER A HG   10 
ATOM   7014  N N    . GLY A 1 16 ? 2.377   0.134   -12.315 1.00 15.00 ?  294 GLY A N    10 
ATOM   7015  C CA   . GLY A 1 16 ? 0.945   0.263   -12.481 1.00 15.00 ?  294 GLY A CA   10 
ATOM   7016  C C    . GLY A 1 16 ? 0.185   -0.520  -11.442 1.00 15.00 ?  294 GLY A C    10 
ATOM   7017  O O    . GLY A 1 16 ? -0.830  -1.149  -11.741 1.00 15.00 ?  294 GLY A O    10 
ATOM   7018  H H    . GLY A 1 16 ? 2.859   0.773   -11.744 1.00 15.00 ?  294 GLY A H    10 
ATOM   7019  H HA2  . GLY A 1 16 ? 0.677   1.305   -12.403 1.00 15.00 ?  294 GLY A HA2  10 
ATOM   7020  H HA3  . GLY A 1 16 ? 0.672   -0.097  -13.462 1.00 15.00 ?  294 GLY A HA3  10 
ATOM   7021  N N    . ARG A 1 17 ? 0.678   -0.484  -10.213 1.00 15.00 ?  295 ARG A N    10 
ATOM   7022  C CA   . ARG A 1 17 ? 0.030   -1.189  -9.120  1.00 15.00 ?  295 ARG A CA   10 
ATOM   7023  C C    . ARG A 1 17 ? 0.268   -0.473  -7.797  1.00 15.00 ?  295 ARG A C    10 
ATOM   7024  O O    . ARG A 1 17 ? 1.411   -0.195  -7.417  1.00 15.00 ?  295 ARG A O    10 
ATOM   7025  C CB   . ARG A 1 17 ? 0.518   -2.650  -9.049  1.00 15.00 ?  295 ARG A CB   10 
ATOM   7026  C CG   . ARG A 1 17 ? 2.032   -2.807  -9.037  1.00 15.00 ?  295 ARG A CG   10 
ATOM   7027  C CD   . ARG A 1 17 ? 2.465   -4.094  -9.728  1.00 15.00 ?  295 ARG A CD   10 
ATOM   7028  N NE   . ARG A 1 17 ? 2.426   -3.971  -11.188 1.00 15.00 ?  295 ARG A NE   10 
ATOM   7029  C CZ   . ARG A 1 17 ? 3.022   -4.825  -12.024 1.00 15.00 ?  295 ARG A CZ   10 
ATOM   7030  N NH1  . ARG A 1 17 ? 3.528   -5.962  -11.569 1.00 15.00 1  295 ARG A NH1  10 
ATOM   7031  N NH2  . ARG A 1 17 ? 3.071   -4.560  -13.324 1.00 15.00 ?  295 ARG A NH2  10 
ATOM   7032  H H    . ARG A 1 17 ? 1.495   0.042   -10.035 1.00 15.00 ?  295 ARG A H    10 
ATOM   7033  H HA   . ARG A 1 17 ? -1.030  -1.189  -9.320  1.00 15.00 ?  295 ARG A HA   10 
ATOM   7034  H HB2  . ARG A 1 17 ? 0.134   -3.093  -8.142  1.00 15.00 ?  295 ARG A HB2  10 
ATOM   7035  H HB3  . ARG A 1 17 ? 0.125   -3.197  -9.893  1.00 15.00 ?  295 ARG A HB3  10 
ATOM   7036  H HG2  . ARG A 1 17 ? 2.476   -1.968  -9.553  1.00 15.00 ?  295 ARG A HG2  10 
ATOM   7037  H HG3  . ARG A 1 17 ? 2.375   -2.825  -8.013  1.00 15.00 ?  295 ARG A HG3  10 
ATOM   7038  H HD2  . ARG A 1 17 ? 3.473   -4.332  -9.421  1.00 15.00 ?  295 ARG A HD2  10 
ATOM   7039  H HD3  . ARG A 1 17 ? 1.801   -4.892  -9.427  1.00 15.00 ?  295 ARG A HD3  10 
ATOM   7040  H HE   . ARG A 1 17 ? 1.977   -3.177  -11.560 1.00 15.00 ?  295 ARG A HE   10 
ATOM   7041  H HH11 . ARG A 1 17 ? 3.456   -6.197  -10.590 1.00 15.00 ?  295 ARG A HH11 10 
ATOM   7042  H HH12 . ARG A 1 17 ? 3.998   -6.599  -12.197 1.00 15.00 ?  295 ARG A HH12 10 
ATOM   7043  H HH21 . ARG A 1 17 ? 2.659   -3.718  -13.688 1.00 15.00 ?  295 ARG A HH21 10 
ATOM   7044  H HH22 . ARG A 1 17 ? 3.534   -5.196  -13.955 1.00 15.00 ?  295 ARG A HH22 10 
ATOM   7045  N N    . ILE A 1 18 ? -0.820  -0.166  -7.102  1.00 15.00 ?  296 ILE A N    10 
ATOM   7046  C CA   . ILE A 1 18 ? -0.734  0.377   -5.758  1.00 15.00 ?  296 ILE A CA   10 
ATOM   7047  C C    . ILE A 1 18 ? -0.733  -0.788  -4.783  1.00 15.00 ?  296 ILE A C    10 
ATOM   7048  O O    . ILE A 1 18 ? -1.403  -1.797  -5.007  1.00 15.00 ?  296 ILE A O    10 
ATOM   7049  C CB   . ILE A 1 18 ? -1.911  1.346   -5.441  1.00 15.00 ?  296 ILE A CB   10 
ATOM   7050  C CG1  . ILE A 1 18 ? -1.705  2.054   -4.089  1.00 15.00 ?  296 ILE A CG1  10 
ATOM   7051  C CG2  . ILE A 1 18 ? -3.246  0.608   -5.451  1.00 15.00 ?  296 ILE A CG2  10 
ATOM   7052  C CD1  . ILE A 1 18 ? -2.840  2.981   -3.710  1.00 15.00 ?  296 ILE A CD1  10 
ATOM   7053  H H    . ILE A 1 18 ? -1.704  -0.300  -7.509  1.00 15.00 ?  296 ILE A H    10 
ATOM   7054  H HA   . ILE A 1 18 ? 0.198   0.918   -5.669  1.00 15.00 ?  296 ILE A HA   10 
ATOM   7055  H HB   . ILE A 1 18 ? -1.944  2.093   -6.222  1.00 15.00 ?  296 ILE A HB   10 
ATOM   7056  H HG12 . ILE A 1 18 ? -1.610  1.316   -3.310  1.00 15.00 ?  296 ILE A HG12 10 
ATOM   7057  H HG13 . ILE A 1 18 ? -0.803  2.640   -4.126  1.00 15.00 ?  296 ILE A HG13 10 
ATOM   7058  H HG21 . ILE A 1 18 ? -4.043  1.309   -5.253  1.00 15.00 ?  296 ILE A HG21 10 
ATOM   7059  H HG22 . ILE A 1 18 ? -3.242  -0.156  -4.687  1.00 15.00 ?  296 ILE A HG22 10 
ATOM   7060  H HG23 . ILE A 1 18 ? -3.399  0.153   -6.418  1.00 15.00 ?  296 ILE A HG23 10 
ATOM   7061  H HD11 . ILE A 1 18 ? -3.759  2.417   -3.641  1.00 15.00 ?  296 ILE A HD11 10 
ATOM   7062  H HD12 . ILE A 1 18 ? -2.943  3.750   -4.461  1.00 15.00 ?  296 ILE A HD12 10 
ATOM   7063  H HD13 . ILE A 1 18 ? -2.628  3.439   -2.755  1.00 15.00 ?  296 ILE A HD13 10 
ATOM   7064  N N    . TYR A 1 19 ? 0.043   -0.671  -3.729  1.00 15.00 ?  297 TYR A N    10 
ATOM   7065  C CA   . TYR A 1 19 ? 0.230   -1.778  -2.820  1.00 15.00 ?  297 TYR A CA   10 
ATOM   7066  C C    . TYR A 1 19 ? 0.492   -1.199  -1.463  1.00 15.00 ?  297 TYR A C    10 
ATOM   7067  O O    . TYR A 1 19 ? 1.290   -0.266  -1.308  1.00 15.00 ?  297 TYR A O    10 
ATOM   7068  C CB   . TYR A 1 19 ? 1.337   -2.751  -3.294  1.00 15.00 ?  297 TYR A CB   10 
ATOM   7069  C CG   . TYR A 1 19 ? 2.754   -2.456  -2.837  1.00 15.00 ?  297 TYR A CG   10 
ATOM   7070  C CD1  . TYR A 1 19 ? 3.518   -1.487  -3.464  1.00 15.00 ?  297 TYR A CD1  10 
ATOM   7071  C CD2  . TYR A 1 19 ? 3.336   -3.173  -1.790  1.00 15.00 ?  297 TYR A CD2  10 
ATOM   7072  C CE1  . TYR A 1 19 ? 4.813   -1.230  -3.063  1.00 15.00 ?  297 TYR A CE1  10 
ATOM   7073  C CE2  . TYR A 1 19 ? 4.631   -2.917  -1.385  1.00 15.00 ?  297 TYR A CE2  10 
ATOM   7074  C CZ   . TYR A 1 19 ? 5.363   -1.945  -2.025  1.00 15.00 ?  297 TYR A CZ   10 
ATOM   7075  O OH   . TYR A 1 19 ? 6.651   -1.678  -1.622  1.00 15.00 ?  297 TYR A OH   10 
ATOM   7076  H H    . TYR A 1 19 ? 0.416   0.212   -3.494  1.00 15.00 ?  297 TYR A H    10 
ATOM   7077  H HA   . TYR A 1 19 ? -0.709  -2.314  -2.776  1.00 15.00 ?  297 TYR A HA   10 
ATOM   7078  H HB2  . TYR A 1 19 ? 1.093   -3.743  -2.947  1.00 15.00 ?  297 TYR A HB2  10 
ATOM   7079  H HB3  . TYR A 1 19 ? 1.339   -2.756  -4.375  1.00 15.00 ?  297 TYR A HB3  10 
ATOM   7080  H HD1  . TYR A 1 19 ? 3.086   -0.923  -4.276  1.00 15.00 ?  297 TYR A HD1  10 
ATOM   7081  H HD2  . TYR A 1 19 ? 2.765   -3.942  -1.293  1.00 15.00 ?  297 TYR A HD2  10 
ATOM   7082  H HE1  . TYR A 1 19 ? 5.391   -0.469  -3.566  1.00 15.00 ?  297 TYR A HE1  10 
ATOM   7083  H HE2  . TYR A 1 19 ? 5.064   -3.482  -0.571  1.00 15.00 ?  297 TYR A HE2  10 
ATOM   7084  H HH   . TYR A 1 19 ? 7.077   -2.497  -1.344  1.00 15.00 ?  297 TYR A HH   10 
ATOM   7085  N N    . PHE A 1 20 ? -0.195  -1.716  -0.485  1.00 15.00 ?  298 PHE A N    10 
ATOM   7086  C CA   . PHE A 1 20 ? -0.246  -1.050  0.769   1.00 15.00 ?  298 PHE A CA   10 
ATOM   7087  C C    . PHE A 1 20 ? 0.821   -1.433  1.721   1.00 15.00 ?  298 PHE A C    10 
ATOM   7088  O O    . PHE A 1 20 ? 1.201   -2.589  1.845   1.00 15.00 ?  298 PHE A O    10 
ATOM   7089  C CB   . PHE A 1 20 ? -1.588  -1.212  1.390   1.00 15.00 ?  298 PHE A CB   10 
ATOM   7090  C CG   . PHE A 1 20 ? -2.371  -0.026  1.054   1.00 15.00 ?  298 PHE A CG   10 
ATOM   7091  C CD1  . PHE A 1 20 ? -2.018  1.183   1.611   1.00 15.00 ?  298 PHE A CD1  10 
ATOM   7092  C CD2  . PHE A 1 20 ? -3.418  -0.093  0.162   1.00 15.00 ?  298 PHE A CD2  10 
ATOM   7093  C CE1  . PHE A 1 20 ? -2.701  2.308   1.305   1.00 15.00 ?  298 PHE A CE1  10 
ATOM   7094  C CE2  . PHE A 1 20 ? -4.114  1.042   -0.149  1.00 15.00 ?  298 PHE A CE2  10 
ATOM   7095  C CZ   . PHE A 1 20 ? -3.747  2.236   0.433   1.00 15.00 ?  298 PHE A CZ   10 
ATOM   7096  H H    . PHE A 1 20 ? -0.722  -2.534  -0.623  1.00 15.00 ?  298 PHE A H    10 
ATOM   7097  H HA   . PHE A 1 20 ? -0.123  -0.001  0.551   1.00 15.00 ?  298 PHE A HA   10 
ATOM   7098  H HB2  . PHE A 1 20 ? -2.081  -2.090  0.995   1.00 15.00 ?  298 PHE A HB2  10 
ATOM   7099  H HB3  . PHE A 1 20 ? -1.501  -1.278  2.463   1.00 15.00 ?  298 PHE A HB3  10 
ATOM   7100  H HD1  . PHE A 1 20 ? -1.209  1.230   2.313   1.00 15.00 ?  298 PHE A HD1  10 
ATOM   7101  H HD2  . PHE A 1 20 ? -3.688  -1.039  -0.283  1.00 15.00 ?  298 PHE A HD2  10 
ATOM   7102  H HE1  . PHE A 1 20 ? -2.420  3.256   1.744   1.00 15.00 ?  298 PHE A HE1  10 
ATOM   7103  H HE2  . PHE A 1 20 ? -4.944  1.003   -0.838  1.00 15.00 ?  298 PHE A HE2  10 
ATOM   7104  H HZ   . PHE A 1 20 ? -4.286  3.096   0.236   1.00 15.00 ?  298 PHE A HZ   10 
ATOM   7105  N N    . VAL A 1 21 ? 1.262   -0.406  2.402   1.00 15.00 ?  299 VAL A N    10 
ATOM   7106  C CA   . VAL A 1 21 ? 2.324   -0.477  3.347   1.00 15.00 ?  299 VAL A CA   10 
ATOM   7107  C C    . VAL A 1 21 ? 2.026   0.498   4.488   1.00 15.00 ?  299 VAL A C    10 
ATOM   7108  O O    . VAL A 1 21 ? 2.360   1.687   4.435   1.00 15.00 ?  299 VAL A O    10 
ATOM   7109  C CB   . VAL A 1 21 ? 3.661   -0.137  2.654   1.00 15.00 ?  299 VAL A CB   10 
ATOM   7110  C CG1  . VAL A 1 21 ? 4.093   -1.269  1.736   1.00 15.00 ?  299 VAL A CG1  10 
ATOM   7111  C CG2  . VAL A 1 21 ? 3.509   1.132   1.839   1.00 15.00 ?  299 VAL A CG2  10 
ATOM   7112  H H    . VAL A 1 21 ? 0.840   0.466   2.252   1.00 15.00 ?  299 VAL A H    10 
ATOM   7113  H HA   . VAL A 1 21 ? 2.376   -1.483  3.735   1.00 15.00 ?  299 VAL A HA   10 
ATOM   7114  H HB   . VAL A 1 21 ? 4.423   0.020   3.407   1.00 15.00 ?  299 VAL A HB   10 
ATOM   7115  H HG11 . VAL A 1 21 ? 4.050   -2.206  2.272   1.00 15.00 ?  299 VAL A HG11 10 
ATOM   7116  H HG12 . VAL A 1 21 ? 5.105   -1.095  1.400   1.00 15.00 ?  299 VAL A HG12 10 
ATOM   7117  H HG13 . VAL A 1 21 ? 3.432   -1.312  0.881   1.00 15.00 ?  299 VAL A HG13 10 
ATOM   7118  H HG21 . VAL A 1 21 ? 2.799   0.964   1.043   1.00 15.00 ?  299 VAL A HG21 10 
ATOM   7119  H HG22 . VAL A 1 21 ? 4.465   1.408   1.418   1.00 15.00 ?  299 VAL A HG22 10 
ATOM   7120  H HG23 . VAL A 1 21 ? 3.154   1.924   2.477   1.00 15.00 ?  299 VAL A HG23 10 
ATOM   7121  N N    . ASP A 1 22 ? 1.342   0.016   5.503   1.00 15.00 ?  300 ASP A N    10 
ATOM   7122  C CA   . ASP A 1 22 ? 1.033   0.862   6.636   1.00 15.00 ?  300 ASP A CA   10 
ATOM   7123  C C    . ASP A 1 22 ? 2.157   0.750   7.639   1.00 15.00 ?  300 ASP A C    10 
ATOM   7124  O O    . ASP A 1 22 ? 2.519   -0.343  8.076   1.00 15.00 ?  300 ASP A O    10 
ATOM   7125  C CB   . ASP A 1 22 ? -0.323  0.516   7.269   1.00 15.00 ?  300 ASP A CB   10 
ATOM   7126  C CG   . ASP A 1 22 ? -0.488  -0.949  7.603   1.00 15.00 ?  300 ASP A CG   10 
ATOM   7127  O OD1  . ASP A 1 22 ? -0.082  -1.371  8.706   1.00 15.00 -1 300 ASP A OD1  10 
ATOM   7128  O OD2  . ASP A 1 22 ? -1.043  -1.685  6.763   1.00 15.00 ?  300 ASP A OD2  10 
ATOM   7129  H H    . ASP A 1 22 ? 1.037   -0.921  5.490   1.00 15.00 ?  300 ASP A H    10 
ATOM   7130  H HA   . ASP A 1 22 ? 1.001   1.881   6.278   1.00 15.00 ?  300 ASP A HA   10 
ATOM   7131  H HB2  . ASP A 1 22 ? -0.437  1.081   8.182   1.00 15.00 ?  300 ASP A HB2  10 
ATOM   7132  H HB3  . ASP A 1 22 ? -1.111  0.796   6.581   1.00 15.00 ?  300 ASP A HB3  10 
ATOM   7133  N N    . HIS A 1 23 ? 2.734   1.895   7.968   1.00 15.00 ?  301 HIS A N    10 
ATOM   7134  C CA   . HIS A 1 23 ? 3.953   1.934   8.758   1.00 15.00 ?  301 HIS A CA   10 
ATOM   7135  C C    . HIS A 1 23 ? 3.650   1.773   10.240  1.00 15.00 ?  301 HIS A C    10 
ATOM   7136  O O    . HIS A 1 23 ? 4.545   1.485   11.031  1.00 15.00 ?  301 HIS A O    10 
ATOM   7137  C CB   . HIS A 1 23 ? 4.710   3.254   8.554   1.00 15.00 ?  301 HIS A CB   10 
ATOM   7138  C CG   . HIS A 1 23 ? 5.102   3.588   7.137   1.00 15.00 ?  301 HIS A CG   10 
ATOM   7139  N ND1  . HIS A 1 23 ? 5.238   4.886   6.705   1.00 15.00 ?  301 HIS A ND1  10 
ATOM   7140  C CD2  . HIS A 1 23 ? 5.472   2.813   6.085   1.00 15.00 ?  301 HIS A CD2  10 
ATOM   7141  C CE1  . HIS A 1 23 ? 5.676   4.893   5.467   1.00 15.00 ?  301 HIS A CE1  10 
ATOM   7142  N NE2  . HIS A 1 23 ? 5.837   3.648   5.061   1.00 15.00 ?  301 HIS A NE2  10 
ATOM   7143  H H    . HIS A 1 23 ? 2.317   2.737   7.681   1.00 15.00 ?  301 HIS A H    10 
ATOM   7144  H HA   . HIS A 1 23 ? 4.581   1.116   8.440   1.00 15.00 ?  301 HIS A HA   10 
ATOM   7145  H HB2  . HIS A 1 23 ? 4.097   4.059   8.911   1.00 15.00 ?  301 HIS A HB2  10 
ATOM   7146  H HB3  . HIS A 1 23 ? 5.615   3.222   9.144   1.00 15.00 ?  301 HIS A HB3  10 
ATOM   7147  H HD1  . HIS A 1 23 ? 5.032   5.697   7.237   1.00 15.00 ?  301 HIS A HD1  10 
ATOM   7148  H HD2  . HIS A 1 23 ? 5.459   1.732   6.042   1.00 15.00 ?  301 HIS A HD2  10 
ATOM   7149  H HE1  . HIS A 1 23 ? 5.867   5.777   4.870   1.00 15.00 ?  301 HIS A HE1  10 
ATOM   7150  H HE2  . HIS A 1 23 ? 6.445   3.388   4.327   1.00 15.00 ?  301 HIS A HE2  10 
ATOM   7151  N N    . ASN A 1 24 ? 2.394   1.971   10.615  1.00 15.00 ?  302 ASN A N    10 
ATOM   7152  C CA   . ASN A 1 24 ? 2.019   1.983   12.024  1.00 15.00 ?  302 ASN A CA   10 
ATOM   7153  C C    . ASN A 1 24 ? 1.693   0.583   12.531  1.00 15.00 ?  302 ASN A C    10 
ATOM   7154  O O    . ASN A 1 24 ? 2.144   0.188   13.604  1.00 15.00 ?  302 ASN A O    10 
ATOM   7155  C CB   . ASN A 1 24 ? 0.845   2.946   12.278  1.00 15.00 ?  302 ASN A CB   10 
ATOM   7156  C CG   . ASN A 1 24 ? -0.410  2.604   11.490  1.00 15.00 ?  302 ASN A CG   10 
ATOM   7157  O OD1  . ASN A 1 24 ? -0.344  2.014   10.411  1.00 15.00 ?  302 ASN A OD1  10 
ATOM   7158  N ND2  . ASN A 1 24 ? -1.560  2.997   12.015  1.00 15.00 ?  302 ASN A ND2  10 
ATOM   7159  H H    . ASN A 1 24 ? 1.700   2.097   9.930   1.00 15.00 ?  302 ASN A H    10 
ATOM   7160  H HA   . ASN A 1 24 ? 2.876   2.344   12.573  1.00 15.00 ?  302 ASN A HA   10 
ATOM   7161  H HB2  . ASN A 1 24 ? 0.597   2.925   13.327  1.00 15.00 ?  302 ASN A HB2  10 
ATOM   7162  H HB3  . ASN A 1 24 ? 1.151   3.947   12.009  1.00 15.00 ?  302 ASN A HB3  10 
ATOM   7163  H HD21 . ASN A 1 24 ? -1.539  3.485   12.872  1.00 15.00 ?  302 ASN A HD21 10 
ATOM   7164  H HD22 . ASN A 1 24 ? -2.387  2.786   11.531  1.00 15.00 ?  302 ASN A HD22 10 
ATOM   7165  N N    . ASN A 1 25 ? 0.902   -0.163  11.776  1.00 15.00 ?  303 ASN A N    10 
ATOM   7166  C CA   . ASN A 1 25 ? 0.590   -1.540  12.143  1.00 15.00 ?  303 ASN A CA   10 
ATOM   7167  C C    . ASN A 1 25 ? 1.519   -2.526  11.440  1.00 15.00 ?  303 ASN A C    10 
ATOM   7168  O O    . ASN A 1 25 ? 1.592   -3.697  11.821  1.00 15.00 ?  303 ASN A O    10 
ATOM   7169  C CB   . ASN A 1 25 ? -0.869  -1.875  11.820  1.00 15.00 ?  303 ASN A CB   10 
ATOM   7170  C CG   . ASN A 1 25 ? -1.846  -1.227  12.783  1.00 15.00 ?  303 ASN A CG   10 
ATOM   7171  O OD1  . ASN A 1 25 ? -2.308  -0.110  12.567  1.00 15.00 ?  303 ASN A OD1  10 
ATOM   7172  N ND2  . ASN A 1 25 ? -2.173  -1.930  13.854  1.00 15.00 ?  303 ASN A ND2  10 
ATOM   7173  H H    . ASN A 1 25 ? 0.488   0.230   10.971  1.00 15.00 ?  303 ASN A H    10 
ATOM   7174  H HA   . ASN A 1 25 ? 0.737   -1.630  13.210  1.00 15.00 ?  303 ASN A HA   10 
ATOM   7175  H HB2  . ASN A 1 25 ? -1.096  -1.529  10.822  1.00 15.00 ?  303 ASN A HB2  10 
ATOM   7176  H HB3  . ASN A 1 25 ? -1.004  -2.946  11.864  1.00 15.00 ?  303 ASN A HB3  10 
ATOM   7177  H HD21 . ASN A 1 25 ? -1.770  -2.826  13.967  1.00 15.00 ?  303 ASN A HD21 10 
ATOM   7178  H HD22 . ASN A 1 25 ? -2.807  -1.537  14.493  1.00 15.00 ?  303 ASN A HD22 10 
ATOM   7179  N N    . ARG A 1 26 ? 2.216   -2.040  10.414  1.00 15.00 ?  304 ARG A N    10 
ATOM   7180  C CA   . ARG A 1 26 ? 3.100   -2.861  9.597   1.00 15.00 ?  304 ARG A CA   10 
ATOM   7181  C C    . ARG A 1 26 ? 2.310   -3.968  8.910   1.00 15.00 ?  304 ARG A C    10 
ATOM   7182  O O    . ARG A 1 26 ? 2.289   -5.117  9.354   1.00 15.00 ?  304 ARG A O    10 
ATOM   7183  C CB   . ARG A 1 26 ? 4.268   -3.425  10.420  1.00 15.00 ?  304 ARG A CB   10 
ATOM   7184  C CG   . ARG A 1 26 ? 5.149   -4.407  9.662   1.00 15.00 ?  304 ARG A CG   10 
ATOM   7185  C CD   . ARG A 1 26 ? 6.427   -4.715  10.424  1.00 15.00 ?  304 ARG A CD   10 
ATOM   7186  N NE   . ARG A 1 26 ? 6.178   -5.066  11.822  1.00 15.00 ?  304 ARG A NE   10 
ATOM   7187  C CZ   . ARG A 1 26 ? 7.136   -5.130  12.741  1.00 15.00 ?  304 ARG A CZ   10 
ATOM   7188  N NH1  . ARG A 1 26 ? 8.401   -4.923  12.393  1.00 15.00 1  304 ARG A NH1  10 
ATOM   7189  N NH2  . ARG A 1 26 ? 6.834   -5.416  14.001  1.00 15.00 ?  304 ARG A NH2  10 
ATOM   7190  H H    . ARG A 1 26 ? 2.111   -1.097  10.178  1.00 15.00 ?  304 ARG A H    10 
ATOM   7191  H HA   . ARG A 1 26 ? 3.505   -2.216  8.831   1.00 15.00 ?  304 ARG A HA   10 
ATOM   7192  H HB2  . ARG A 1 26 ? 4.889   -2.605  10.751  1.00 15.00 ?  304 ARG A HB2  10 
ATOM   7193  H HB3  . ARG A 1 26 ? 3.868   -3.931  11.285  1.00 15.00 ?  304 ARG A HB3  10 
ATOM   7194  H HG2  . ARG A 1 26 ? 4.600   -5.325  9.511   1.00 15.00 ?  304 ARG A HG2  10 
ATOM   7195  H HG3  . ARG A 1 26 ? 5.406   -3.979  8.704   1.00 15.00 ?  304 ARG A HG3  10 
ATOM   7196  H HD2  . ARG A 1 26 ? 6.926   -5.543  9.943   1.00 15.00 ?  304 ARG A HD2  10 
ATOM   7197  H HD3  . ARG A 1 26 ? 7.065   -3.846  10.391  1.00 15.00 ?  304 ARG A HD3  10 
ATOM   7198  H HE   . ARG A 1 26 ? 5.244   -5.249  12.089  1.00 15.00 ?  304 ARG A HE   10 
ATOM   7199  H HH11 . ARG A 1 26 ? 8.633   -4.726  11.434  1.00 15.00 ?  304 ARG A HH11 10 
ATOM   7200  H HH12 . ARG A 1 26 ? 9.132   -4.957  13.085  1.00 15.00 ?  304 ARG A HH12 10 
ATOM   7201  H HH21 . ARG A 1 26 ? 5.878   -5.589  14.268  1.00 15.00 ?  304 ARG A HH21 10 
ATOM   7202  H HH22 . ARG A 1 26 ? 7.557   -5.458  14.697  1.00 15.00 ?  304 ARG A HH22 10 
ATOM   7203  N N    . THR A 1 27 ? 1.603   -3.588  7.862   1.00 15.00 ?  305 THR A N    10 
ATOM   7204  C CA   . THR A 1 27 ? 0.803   -4.528  7.095   1.00 15.00 ?  305 THR A CA   10 
ATOM   7205  C C    . THR A 1 27 ? 0.892   -4.194  5.609   1.00 15.00 ?  305 THR A C    10 
ATOM   7206  O O    . THR A 1 27 ? 1.105   -3.036  5.240   1.00 15.00 ?  305 THR A O    10 
ATOM   7207  C CB   . THR A 1 27 ? -0.675  -4.490  7.532   1.00 15.00 ?  305 THR A CB   10 
ATOM   7208  O OG1  . THR A 1 27 ? -0.779  -4.032  8.890   1.00 15.00 ?  305 THR A OG1  10 
ATOM   7209  C CG2  . THR A 1 27 ? -1.313  -5.866  7.412   1.00 15.00 ?  305 THR A CG2  10 
ATOM   7210  H H    . THR A 1 27 ? 1.598   -2.633  7.608   1.00 15.00 ?  305 THR A H    10 
ATOM   7211  H HA   . THR A 1 27 ? 1.190   -5.522  7.262   1.00 15.00 ?  305 THR A HA   10 
ATOM   7212  H HB   . THR A 1 27 ? -1.208  -3.805  6.887   1.00 15.00 ?  305 THR A HB   10 
ATOM   7213  H HG1  . THR A 1 27 ? -0.454  -3.111  8.936   1.00 15.00 ?  305 THR A HG1  10 
ATOM   7214  H HG21 . THR A 1 27 ? -1.275  -6.193  6.382   1.00 15.00 ?  305 THR A HG21 10 
ATOM   7215  H HG22 . THR A 1 27 ? -2.341  -5.816  7.735   1.00 15.00 ?  305 THR A HG22 10 
ATOM   7216  H HG23 . THR A 1 27 ? -0.775  -6.567  8.033   1.00 15.00 ?  305 THR A HG23 10 
ATOM   7217  N N    . THR A 1 28 ? 0.771   -5.206  4.762   1.00 15.00 ?  306 THR A N    10 
ATOM   7218  C CA   . THR A 1 28 ? 0.773   -4.989  3.326   1.00 15.00 ?  306 THR A CA   10 
ATOM   7219  C C    . THR A 1 28 ? -0.427  -5.661  2.667   1.00 15.00 ?  306 THR A C    10 
ATOM   7220  O O    . THR A 1 28 ? -0.678  -6.850  2.870   1.00 15.00 ?  306 THR A O    10 
ATOM   7221  C CB   . THR A 1 28 ? 2.088   -5.474  2.685   1.00 15.00 ?  306 THR A CB   10 
ATOM   7222  O OG1  . THR A 1 28 ? 2.386   -6.814  3.094   1.00 15.00 ?  306 THR A OG1  10 
ATOM   7223  C CG2  . THR A 1 28 ? 3.238   -4.559  3.075   1.00 15.00 ?  306 THR A CG2  10 
ATOM   7224  H H    . THR A 1 28 ? 0.686   -6.118  5.107   1.00 15.00 ?  306 THR A H    10 
ATOM   7225  H HA   . THR A 1 28 ? 0.697   -3.923  3.162   1.00 15.00 ?  306 THR A HA   10 
ATOM   7226  H HB   . THR A 1 28 ? 1.979   -5.447  1.610   1.00 15.00 ?  306 THR A HB   10 
ATOM   7227  H HG1  . THR A 1 28 ? 3.266   -7.054  2.768   1.00 15.00 ?  306 THR A HG1  10 
ATOM   7228  H HG21 . THR A 1 28 ? 3.031   -3.555  2.736   1.00 15.00 ?  306 THR A HG21 10 
ATOM   7229  H HG22 . THR A 1 28 ? 4.150   -4.913  2.617   1.00 15.00 ?  306 THR A HG22 10 
ATOM   7230  H HG23 . THR A 1 28 ? 3.350   -4.562  4.149   1.00 15.00 ?  306 THR A HG23 10 
ATOM   7231  N N    . GLN A 1 29 ? -1.177  -4.883  1.894   1.00 15.00 ?  307 GLN A N    10 
ATOM   7232  C CA   . GLN A 1 29 ? -2.419  -5.353  1.280   1.00 15.00 ?  307 GLN A CA   10 
ATOM   7233  C C    . GLN A 1 29 ? -2.584  -4.768  -0.121  1.00 15.00 ?  307 GLN A C    10 
ATOM   7234  O O    . GLN A 1 29 ? -2.221  -3.626  -0.360  1.00 15.00 ?  307 GLN A O    10 
ATOM   7235  C CB   . GLN A 1 29 ? -3.615  -4.934  2.146   1.00 15.00 ?  307 GLN A CB   10 
ATOM   7236  C CG   . GLN A 1 29 ? -3.691  -5.635  3.495   1.00 15.00 ?  307 GLN A CG   10 
ATOM   7237  C CD   . GLN A 1 29 ? -4.139  -7.076  3.373   1.00 15.00 ?  307 GLN A CD   10 
ATOM   7238  O OE1  . GLN A 1 29 ? -5.331  -7.369  3.438   1.00 15.00 ?  307 GLN A OE1  10 
ATOM   7239  N NE2  . GLN A 1 29 ? -3.194  -7.984  3.195   1.00 15.00 ?  307 GLN A NE2  10 
ATOM   7240  H H    . GLN A 1 29 ? -0.886  -3.960  1.727   1.00 15.00 ?  307 GLN A H    10 
ATOM   7241  H HA   . GLN A 1 29 ? -2.382  -6.429  1.218   1.00 15.00 ?  307 GLN A HA   10 
ATOM   7242  H HB2  . GLN A 1 29 ? -3.559  -3.872  2.323   1.00 15.00 ?  307 GLN A HB2  10 
ATOM   7243  H HB3  . GLN A 1 29 ? -4.526  -5.150  1.605   1.00 15.00 ?  307 GLN A HB3  10 
ATOM   7244  H HG2  . GLN A 1 29 ? -2.713  -5.616  3.952   1.00 15.00 ?  307 GLN A HG2  10 
ATOM   7245  H HG3  . GLN A 1 29 ? -4.393  -5.106  4.123   1.00 15.00 ?  307 GLN A HG3  10 
ATOM   7246  H HE21 . GLN A 1 29 ? -2.255  -7.682  3.150   1.00 15.00 ?  307 GLN A HE21 10 
ATOM   7247  H HE22 . GLN A 1 29 ? -3.468  -8.927  3.107   1.00 15.00 ?  307 GLN A HE22 10 
ATOM   7248  N N    . PHE A 1 30 ? -3.144  -5.544  -1.041  1.00 15.00 ?  308 PHE A N    10 
ATOM   7249  C CA   . PHE A 1 30 ? -3.443  -5.040  -2.383  1.00 15.00 ?  308 PHE A CA   10 
ATOM   7250  C C    . PHE A 1 30 ? -4.827  -4.401  -2.426  1.00 15.00 ?  308 PHE A C    10 
ATOM   7251  O O    . PHE A 1 30 ? -5.181  -3.711  -3.383  1.00 15.00 ?  308 PHE A O    10 
ATOM   7252  C CB   . PHE A 1 30 ? -3.333  -6.146  -3.435  1.00 15.00 ?  308 PHE A CB   10 
ATOM   7253  C CG   . PHE A 1 30 ? -1.922  -6.391  -3.892  1.00 15.00 ?  308 PHE A CG   10 
ATOM   7254  C CD1  . PHE A 1 30 ? -1.136  -5.329  -4.310  1.00 15.00 ?  308 PHE A CD1  10 
ATOM   7255  C CD2  . PHE A 1 30 ? -1.379  -7.669  -3.911  1.00 15.00 ?  308 PHE A CD2  10 
ATOM   7256  C CE1  . PHE A 1 30 ? 0.161   -5.532  -4.738  1.00 15.00 ?  308 PHE A CE1  10 
ATOM   7257  C CE2  . PHE A 1 30 ? -0.084  -7.871  -4.337  1.00 15.00 ?  308 PHE A CE2  10 
ATOM   7258  C CZ   . PHE A 1 30 ? 0.687   -6.802  -4.749  1.00 15.00 ?  308 PHE A CZ   10 
ATOM   7259  H H    . PHE A 1 30 ? -3.360  -6.472  -0.820  1.00 15.00 ?  308 PHE A H    10 
ATOM   7260  H HA   . PHE A 1 30 ? -2.713  -4.277  -2.608  1.00 15.00 ?  308 PHE A HA   10 
ATOM   7261  H HB2  . PHE A 1 30 ? -3.716  -7.066  -3.023  1.00 15.00 ?  308 PHE A HB2  10 
ATOM   7262  H HB3  . PHE A 1 30 ? -3.921  -5.871  -4.298  1.00 15.00 ?  308 PHE A HB3  10 
ATOM   7263  H HD1  . PHE A 1 30 ? -1.547  -4.332  -4.298  1.00 15.00 ?  308 PHE A HD1  10 
ATOM   7264  H HD2  . PHE A 1 30 ? -1.973  -8.514  -3.594  1.00 15.00 ?  308 PHE A HD2  10 
ATOM   7265  H HE1  . PHE A 1 30 ? 0.763   -4.694  -5.062  1.00 15.00 ?  308 PHE A HE1  10 
ATOM   7266  H HE2  . PHE A 1 30 ? 0.331   -8.867  -4.347  1.00 15.00 ?  308 PHE A HE2  10 
ATOM   7267  H HZ   . PHE A 1 30 ? 1.701   -6.963  -5.084  1.00 15.00 ?  308 PHE A HZ   10 
ATOM   7268  N N    . THR A 1 31 ? -5.613  -4.673  -1.401  1.00 15.00 ?  309 THR A N    10 
ATOM   7269  C CA   . THR A 1 31 ? -6.959  -4.141  -1.295  1.00 15.00 ?  309 THR A CA   10 
ATOM   7270  C C    . THR A 1 31 ? -6.940  -2.666  -0.891  1.00 15.00 ?  309 THR A C    10 
ATOM   7271  O O    . THR A 1 31 ? -6.543  -2.326  0.225   1.00 15.00 ?  309 THR A O    10 
ATOM   7272  C CB   . THR A 1 31 ? -7.760  -4.944  -0.256  1.00 15.00 ?  309 THR A CB   10 
ATOM   7273  O OG1  . THR A 1 31 ? -7.556  -6.345  -0.480  1.00 15.00 ?  309 THR A OG1  10 
ATOM   7274  C CG2  . THR A 1 31 ? -9.245  -4.621  -0.334  1.00 15.00 ?  309 THR A CG2  10 
ATOM   7275  H H    . THR A 1 31 ? -5.281  -5.256  -0.692  1.00 15.00 ?  309 THR A H    10 
ATOM   7276  H HA   . THR A 1 31 ? -7.441  -4.243  -2.255  1.00 15.00 ?  309 THR A HA   10 
ATOM   7277  H HB   . THR A 1 31 ? -7.399  -4.688  0.731   1.00 15.00 ?  309 THR A HB   10 
ATOM   7278  H HG1  . THR A 1 31 ? -8.090  -6.854  0.144   1.00 15.00 ?  309 THR A HG1  10 
ATOM   7279  H HG21 . THR A 1 31 ? -9.612  -4.857  -1.322  1.00 15.00 ?  309 THR A HG21 10 
ATOM   7280  H HG22 . THR A 1 31 ? -9.396  -3.569  -0.136  1.00 15.00 ?  309 THR A HG22 10 
ATOM   7281  H HG23 . THR A 1 31 ? -9.780  -5.205  0.399   1.00 15.00 ?  309 THR A HG23 10 
ATOM   7282  N N    . ASP A 1 32 ? -7.358  -1.798  -1.806  1.00 15.00 ?  310 ASP A N    10 
ATOM   7283  C CA   . ASP A 1 32 ? -7.454  -0.371  -1.516  1.00 15.00 ?  310 ASP A CA   10 
ATOM   7284  C C    . ASP A 1 32 ? -8.850  -0.050  -0.988  1.00 15.00 ?  310 ASP A C    10 
ATOM   7285  O O    . ASP A 1 32 ? -9.852  -0.418  -1.598  1.00 15.00 ?  310 ASP A O    10 
ATOM   7286  C CB   . ASP A 1 32 ? -7.152  0.463   -2.771  1.00 15.00 ?  310 ASP A CB   10 
ATOM   7287  C CG   . ASP A 1 32 ? -7.093  1.952   -2.472  1.00 15.00 ?  310 ASP A CG   10 
ATOM   7288  O OD1  . ASP A 1 32 ? -8.161  2.578   -2.310  1.00 15.00 -1 310 ASP A OD1  10 
ATOM   7289  O OD2  . ASP A 1 32 ? -5.979  2.505   -2.395  1.00 15.00 ?  310 ASP A OD2  10 
ATOM   7290  H H    . ASP A 1 32 ? -7.617  -2.123  -2.695  1.00 15.00 ?  310 ASP A H    10 
ATOM   7291  H HA   . ASP A 1 32 ? -6.731  -0.138  -0.750  1.00 15.00 ?  310 ASP A HA   10 
ATOM   7292  H HB2  . ASP A 1 32 ? -6.196  0.160   -3.176  1.00 15.00 ?  310 ASP A HB2  10 
ATOM   7293  H HB3  . ASP A 1 32 ? -7.923  0.291   -3.513  1.00 15.00 ?  310 ASP A HB3  10 
ATOM   7294  N N    . PRO A 1 33 ? -8.941  0.641   0.158   1.00 15.00 ?  311 PRO A N    10 
ATOM   7295  C CA   . PRO A 1 33 ? -10.217 0.908   0.813   1.00 15.00 ?  311 PRO A CA   10 
ATOM   7296  C C    . PRO A 1 33 ? -10.993 2.062   0.179   1.00 15.00 ?  311 PRO A C    10 
ATOM   7297  O O    . PRO A 1 33 ? -12.184 2.238   0.443   1.00 15.00 ?  311 PRO A O    10 
ATOM   7298  C CB   . PRO A 1 33 ? -9.807  1.254   2.239   1.00 15.00 ?  311 PRO A CB   10 
ATOM   7299  C CG   . PRO A 1 33 ? -8.454  1.861   2.102   1.00 15.00 ?  311 PRO A CG   10 
ATOM   7300  C CD   . PRO A 1 33 ? -7.808  1.216   0.901   1.00 15.00 ?  311 PRO A CD   10 
ATOM   7301  H HA   . PRO A 1 33 ? -10.840 0.026   0.826   1.00 15.00 ?  311 PRO A HA   10 
ATOM   7302  H HB2  . PRO A 1 33 ? -10.517 1.953   2.662   1.00 15.00 ?  311 PRO A HB2  10 
ATOM   7303  H HB3  . PRO A 1 33 ? -9.778  0.356   2.836   1.00 15.00 ?  311 PRO A HB3  10 
ATOM   7304  H HG2  . PRO A 1 33 ? -8.544  2.927   1.950   1.00 15.00 ?  311 PRO A HG2  10 
ATOM   7305  H HG3  . PRO A 1 33 ? -7.874  1.658   2.991   1.00 15.00 ?  311 PRO A HG3  10 
ATOM   7306  H HD2  . PRO A 1 33 ? -7.296  1.958   0.308   1.00 15.00 ?  311 PRO A HD2  10 
ATOM   7307  H HD3  . PRO A 1 33 ? -7.121  0.443   1.214   1.00 15.00 ?  311 PRO A HD3  10 
ATOM   7308  N N    . ARG A 1 34 ? -10.326 2.854   -0.646  1.00 15.00 ?  312 ARG A N    10 
ATOM   7309  C CA   . ARG A 1 34 ? -10.983 3.967   -1.319  1.00 15.00 ?  312 ARG A CA   10 
ATOM   7310  C C    . ARG A 1 34 ? -11.440 3.513   -2.693  1.00 15.00 ?  312 ARG A C    10 
ATOM   7311  O O    . ARG A 1 34 ? -12.577 3.753   -3.101  1.00 15.00 ?  312 ARG A O    10 
ATOM   7312  C CB   . ARG A 1 34 ? -10.042 5.170   -1.465  1.00 15.00 ?  312 ARG A CB   10 
ATOM   7313  C CG   . ARG A 1 34 ? -9.372  5.601   -0.171  1.00 15.00 ?  312 ARG A CG   10 
ATOM   7314  C CD   . ARG A 1 34 ? -8.567  6.882   -0.361  1.00 15.00 ?  312 ARG A CD   10 
ATOM   7315  N NE   . ARG A 1 34 ? -7.621  6.788   -1.476  1.00 15.00 ?  312 ARG A NE   10 
ATOM   7316  C CZ   . ARG A 1 34 ? -6.969  7.828   -2.002  1.00 15.00 ?  312 ARG A CZ   10 
ATOM   7317  N NH1  . ARG A 1 34 ? -7.154  9.059   -1.526  1.00 15.00 1  312 ARG A NH1  10 
ATOM   7318  N NH2  . ARG A 1 34 ? -6.136  7.636   -3.015  1.00 15.00 ?  312 ARG A NH2  10 
ATOM   7319  H H    . ARG A 1 34 ? -9.374  2.670   -0.834  1.00 15.00 ?  312 ARG A H    10 
ATOM   7320  H HA   . ARG A 1 34 ? -11.846 4.254   -0.736  1.00 15.00 ?  312 ARG A HA   10 
ATOM   7321  H HB2  . ARG A 1 34 ? -9.269  4.920   -2.176  1.00 15.00 ?  312 ARG A HB2  10 
ATOM   7322  H HB3  . ARG A 1 34 ? -10.610 6.006   -1.845  1.00 15.00 ?  312 ARG A HB3  10 
ATOM   7323  H HG2  . ARG A 1 34 ? -10.133 5.775   0.575   1.00 15.00 ?  312 ARG A HG2  10 
ATOM   7324  H HG3  . ARG A 1 34 ? -8.711  4.815   0.162   1.00 15.00 ?  312 ARG A HG3  10 
ATOM   7325  H HD2  . ARG A 1 34 ? -9.250  7.694   -0.552  1.00 15.00 ?  312 ARG A HD2  10 
ATOM   7326  H HD3  . ARG A 1 34 ? -8.017  7.083   0.547   1.00 15.00 ?  312 ARG A HD3  10 
ATOM   7327  H HE   . ARG A 1 34 ? -7.464  5.891   -1.862  1.00 15.00 ?  312 ARG A HE   10 
ATOM   7328  H HH11 . ARG A 1 34 ? -7.793  9.219   -0.763  1.00 15.00 ?  312 ARG A HH11 10 
ATOM   7329  H HH12 . ARG A 1 34 ? -6.655  9.835   -1.922  1.00 15.00 ?  312 ARG A HH12 10 
ATOM   7330  H HH21 . ARG A 1 34 ? -5.997  6.706   -3.380  1.00 15.00 ?  312 ARG A HH21 10 
ATOM   7331  H HH22 . ARG A 1 34 ? -5.646  8.416   -3.430  1.00 15.00 ?  312 ARG A HH22 10 
ATOM   7332  N N    . LEU A 1 35 ? -10.538 2.839   -3.382  1.00 15.00 ?  313 LEU A N    10 
ATOM   7333  C CA   . LEU A 1 35 ? -10.772 2.366   -4.732  1.00 15.00 ?  313 LEU A CA   10 
ATOM   7334  C C    . LEU A 1 35 ? -11.416 0.980   -4.681  1.00 15.00 ?  313 LEU A C    10 
ATOM   7335  O O    . LEU A 1 35 ? -10.689 -0.034  -4.691  1.00 15.00 ?  313 LEU A O    10 
ATOM   7336  C CB   . LEU A 1 35 ? -9.426  2.369   -5.483  1.00 15.00 ?  313 LEU A CB   10 
ATOM   7337  C CG   . LEU A 1 35 ? -9.452  2.087   -6.991  1.00 15.00 ?  313 LEU A CG   10 
ATOM   7338  C CD1  . LEU A 1 35 ? -9.350  0.596   -7.260  1.00 15.00 ?  313 LEU A CD1  10 
ATOM   7339  C CD2  . LEU A 1 35 ? -10.708 2.667   -7.631  1.00 15.00 ?  313 LEU A CD2  10 
ATOM   7340  H H    . LEU A 1 35 ? -9.664  2.643   -2.958  1.00 15.00 ?  313 LEU A H    10 
ATOM   7341  H HA   . LEU A 1 35 ? -11.451 3.053   -5.214  1.00 15.00 ?  313 LEU A HA   10 
ATOM   7342  H HB2  . LEU A 1 35 ? -8.970  3.337   -5.339  1.00 15.00 ?  313 LEU A HB2  10 
ATOM   7343  H HB3  . LEU A 1 35 ? -8.790  1.629   -5.019  1.00 15.00 ?  313 LEU A HB3  10 
ATOM   7344  H HG   . LEU A 1 35 ? -8.596  2.562   -7.448  1.00 15.00 ?  313 LEU A HG   10 
ATOM   7345  H HD11 . LEU A 1 35 ? -8.549  0.179   -6.660  1.00 15.00 ?  313 LEU A HD11 10 
ATOM   7346  H HD12 . LEU A 1 35 ? -9.139  0.432   -8.307  1.00 15.00 ?  313 LEU A HD12 10 
ATOM   7347  H HD13 . LEU A 1 35 ? -10.281 0.117   -6.999  1.00 15.00 ?  313 LEU A HD13 10 
ATOM   7348  H HD21 . LEU A 1 35 ? -10.721 3.738   -7.490  1.00 15.00 ?  313 LEU A HD21 10 
ATOM   7349  H HD22 . LEU A 1 35 ? -11.581 2.233   -7.168  1.00 15.00 ?  313 LEU A HD22 10 
ATOM   7350  H HD23 . LEU A 1 35 ? -10.712 2.443   -8.689  1.00 15.00 ?  313 LEU A HD23 10 
ATOM   7351  N N    . ASP B 2 2  ? -1.452  -8.568  -8.682  1.00 15.00 ?  221 ASP B N    10 
ATOM   7352  C CA   . ASP B 2 2  ? 0.021   -8.718  -8.647  1.00 15.00 ?  221 ASP B CA   10 
ATOM   7353  C C    . ASP B 2 2  ? 0.405   -9.764  -7.602  1.00 15.00 ?  221 ASP B C    10 
ATOM   7354  O O    . ASP B 2 2  ? -0.410  -10.120 -6.748  1.00 15.00 ?  221 ASP B O    10 
ATOM   7355  C CB   . ASP B 2 2  ? 0.691   -7.356  -8.364  1.00 15.00 ?  221 ASP B CB   10 
ATOM   7356  C CG   . ASP B 2 2  ? 2.209   -7.436  -8.317  1.00 15.00 ?  221 ASP B CG   10 
ATOM   7357  O OD1  . ASP B 2 2  ? 2.846   -7.311  -9.381  1.00 15.00 -1 221 ASP B OD1  10 
ATOM   7358  O OD2  . ASP B 2 2  ? 2.773   -7.626  -7.221  1.00 15.00 ?  221 ASP B OD2  10 
ATOM   7359  H H    . ASP B 2 2  ? -1.822  -8.429  -7.716  1.00 15.00 ?  221 ASP B H    10 
ATOM   7360  H HA   . ASP B 2 2  ? 0.340   -9.072  -9.617  1.00 15.00 ?  221 ASP B HA   10 
ATOM   7361  H HB2  . ASP B 2 2  ? 0.420   -6.668  -9.151  1.00 15.00 ?  221 ASP B HB2  10 
ATOM   7362  H HB3  . ASP B 2 2  ? 0.336   -6.967  -7.422  1.00 15.00 ?  221 ASP B HB3  10 
ATOM   7363  N N    . THR B 2 3  ? 1.635   -10.264 -7.688  1.00 15.00 ?  222 THR B N    10 
ATOM   7364  C CA   . THR B 2 3  ? 2.150   -11.275 -6.766  1.00 15.00 ?  222 THR B CA   10 
ATOM   7365  C C    . THR B 2 3  ? 1.975   -10.861 -5.306  1.00 15.00 ?  222 THR B C    10 
ATOM   7366  O O    . THR B 2 3  ? 1.912   -9.676  -5.015  1.00 15.00 ?  222 THR B O    10 
ATOM   7367  C CB   . THR B 2 3  ? 3.640   -11.524 -7.052  1.00 15.00 ?  222 THR B CB   10 
ATOM   7368  O OG1  . THR B 2 3  ? 4.317   -10.265 -7.159  1.00 15.00 ?  222 THR B OG1  10 
ATOM   7369  C CG2  . THR B 2 3  ? 3.824   -12.316 -8.337  1.00 15.00 ?  222 THR B CG2  10 
ATOM   7370  H H    . THR B 2 3  ? 2.227   -9.934  -8.393  1.00 15.00 ?  222 THR B H    10 
ATOM   7371  H HA   . THR B 2 3  ? 1.607   -12.190 -6.932  1.00 15.00 ?  222 THR B HA   10 
ATOM   7372  H HB   . THR B 2 3  ? 4.063   -12.085 -6.232  1.00 15.00 ?  222 THR B HB   10 
ATOM   7373  H HG1  . THR B 2 3  ? 3.679   -9.548  -7.029  1.00 15.00 ?  222 THR B HG1  10 
ATOM   7374  H HG21 . THR B 2 3  ? 3.343   -13.277 -8.236  1.00 15.00 ?  222 THR B HG21 10 
ATOM   7375  H HG22 . THR B 2 3  ? 4.877   -12.459 -8.526  1.00 15.00 ?  222 THR B HG22 10 
ATOM   7376  H HG23 . THR B 2 3  ? 3.381   -11.777 -9.160  1.00 15.00 ?  222 THR B HG23 10 
ATOM   7377  N N    . PRO B 2 4  ? 1.949   -11.836 -4.373  1.00 15.00 ?  223 PRO B N    10 
ATOM   7378  C CA   . PRO B 2 4  ? 1.613   -11.583 -2.962  1.00 15.00 ?  223 PRO B CA   10 
ATOM   7379  C C    . PRO B 2 4  ? 2.386   -10.402 -2.368  1.00 15.00 ?  223 PRO B C    10 
ATOM   7380  O O    . PRO B 2 4  ? 3.593   -10.271 -2.581  1.00 15.00 ?  223 PRO B O    10 
ATOM   7381  C CB   . PRO B 2 4  ? 2.020   -12.883 -2.270  1.00 15.00 ?  223 PRO B CB   10 
ATOM   7382  C CG   . PRO B 2 4  ? 1.874   -13.926 -3.324  1.00 15.00 ?  223 PRO B CG   10 
ATOM   7383  C CD   . PRO B 2 4  ? 2.235   -13.260 -4.624  1.00 15.00 ?  223 PRO B CD   10 
ATOM   7384  H HA   . PRO B 2 4  ? 0.554   -11.424 -2.839  1.00 15.00 ?  223 PRO B HA   10 
ATOM   7385  H HB2  . PRO B 2 4  ? 3.041   -12.804 -1.925  1.00 15.00 ?  223 PRO B HB2  10 
ATOM   7386  H HB3  . PRO B 2 4  ? 1.363   -13.071 -1.436  1.00 15.00 ?  223 PRO B HB3  10 
ATOM   7387  H HG2  . PRO B 2 4  ? 2.546   -14.747 -3.123  1.00 15.00 ?  223 PRO B HG2  10 
ATOM   7388  H HG3  . PRO B 2 4  ? 0.853   -14.272 -3.353  1.00 15.00 ?  223 PRO B HG3  10 
ATOM   7389  H HD2  . PRO B 2 4  ? 3.279   -13.410 -4.848  1.00 15.00 ?  223 PRO B HD2  10 
ATOM   7390  H HD3  . PRO B 2 4  ? 1.617   -13.639 -5.424  1.00 15.00 ?  223 PRO B HD3  10 
ATOM   7391  N N    . PRO B 2 5  ? 1.691   -9.548  -1.586  1.00 15.00 ?  224 PRO B N    10 
ATOM   7392  C CA   . PRO B 2 5  ? 2.219   -8.251  -1.150  1.00 15.00 ?  224 PRO B CA   10 
ATOM   7393  C C    . PRO B 2 5  ? 3.578   -8.338  -0.455  1.00 15.00 ?  224 PRO B C    10 
ATOM   7394  O O    . PRO B 2 5  ? 3.780   -9.129  0.471   1.00 15.00 ?  224 PRO B O    10 
ATOM   7395  C CB   . PRO B 2 5  ? 1.164   -7.699  -0.188  1.00 15.00 ?  224 PRO B CB   10 
ATOM   7396  C CG   . PRO B 2 5  ? 0.189   -8.800  0.057   1.00 15.00 ?  224 PRO B CG   10 
ATOM   7397  C CD   . PRO B 2 5  ? 0.339   -9.795  -1.057  1.00 15.00 ?  224 PRO B CD   10 
ATOM   7398  H HA   . PRO B 2 5  ? 2.309   -7.580  -1.992  1.00 15.00 ?  224 PRO B HA   10 
ATOM   7399  H HB2  . PRO B 2 5  ? 1.647   -7.395  0.731   1.00 15.00 ?  224 PRO B HB2  10 
ATOM   7400  H HB3  . PRO B 2 5  ? 0.683   -6.844  -0.638  1.00 15.00 ?  224 PRO B HB3  10 
ATOM   7401  H HG2  . PRO B 2 5  ? 0.403   -9.271  1.005   1.00 15.00 ?  224 PRO B HG2  10 
ATOM   7402  H HG3  . PRO B 2 5  ? -0.817  -8.396  0.061   1.00 15.00 ?  224 PRO B HG3  10 
ATOM   7403  H HD2  . PRO B 2 5  ? 0.258   -10.799 -0.663  1.00 15.00 ?  224 PRO B HD2  10 
ATOM   7404  H HD3  . PRO B 2 5  ? -0.412  -9.624  -1.815  1.00 15.00 ?  224 PRO B HD3  10 
ATOM   7405  N N    . PRO B 2 6  ? 4.514   -7.496  -0.917  1.00 15.00 ?  225 PRO B N    10 
ATOM   7406  C CA   . PRO B 2 6  ? 5.879   -7.389  -0.372  1.00 15.00 ?  225 PRO B CA   10 
ATOM   7407  C C    . PRO B 2 6  ? 5.908   -6.882  1.067   1.00 15.00 ?  225 PRO B C    10 
ATOM   7408  O O    . PRO B 2 6  ? 4.864   -6.638  1.671   1.00 15.00 ?  225 PRO B O    10 
ATOM   7409  C CB   . PRO B 2 6  ? 6.550   -6.351  -1.283  1.00 15.00 ?  225 PRO B CB   10 
ATOM   7410  C CG   . PRO B 2 6  ? 5.693   -6.266  -2.495  1.00 15.00 ?  225 PRO B CG   10 
ATOM   7411  C CD   . PRO B 2 6  ? 4.303   -6.569  -2.036  1.00 15.00 ?  225 PRO B CD   10 
ATOM   7412  H HA   . PRO B 2 6  ? 6.410   -8.327  -0.437  1.00 15.00 ?  225 PRO B HA   10 
ATOM   7413  H HB2  . PRO B 2 6  ? 6.599   -5.402  -0.770  1.00 15.00 ?  225 PRO B HB2  10 
ATOM   7414  H HB3  . PRO B 2 6  ? 7.544   -6.678  -1.530  1.00 15.00 ?  225 PRO B HB3  10 
ATOM   7415  H HG2  . PRO B 2 6  ? 5.741   -5.271  -2.911  1.00 15.00 ?  225 PRO B HG2  10 
ATOM   7416  H HG3  . PRO B 2 6  ? 6.014   -6.994  -3.223  1.00 15.00 ?  225 PRO B HG3  10 
ATOM   7417  H HD2  . PRO B 2 6  ? 3.809   -5.668  -1.704  1.00 15.00 ?  225 PRO B HD2  10 
ATOM   7418  H HD3  . PRO B 2 6  ? 3.739   -7.041  -2.826  1.00 15.00 ?  225 PRO B HD3  10 
ATOM   7419  N N    . ALA B 2 7  ? 7.111   -6.755  1.620   1.00 15.00 ?  226 ALA B N    10 
ATOM   7420  C CA   . ALA B 2 7  ? 7.294   -6.073  2.896   1.00 15.00 ?  226 ALA B CA   10 
ATOM   7421  C C    . ALA B 2 7  ? 6.946   -4.594  2.735   1.00 15.00 ?  226 ALA B C    10 
ATOM   7422  O O    . ALA B 2 7  ? 6.819   -4.107  1.610   1.00 15.00 ?  226 ALA B O    10 
ATOM   7423  C CB   . ALA B 2 7  ? 8.722   -6.241  3.394   1.00 15.00 ?  226 ALA B CB   10 
ATOM   7424  H H    . ALA B 2 7  ? 7.894   -7.125  1.155   1.00 15.00 ?  226 ALA B H    10 
ATOM   7425  H HA   . ALA B 2 7  ? 6.622   -6.519  3.616   1.00 15.00 ?  226 ALA B HA   10 
ATOM   7426  H HB1  . ALA B 2 7  ? 8.833   -5.741  4.346   1.00 15.00 ?  226 ALA B HB1  10 
ATOM   7427  H HB2  . ALA B 2 7  ? 9.406   -5.808  2.679   1.00 15.00 ?  226 ALA B HB2  10 
ATOM   7428  H HB3  . ALA B 2 7  ? 8.941   -7.291  3.511   1.00 15.00 ?  226 ALA B HB3  10 
ATOM   7429  N N    . TYR B 2 8  ? 6.798   -3.869  3.836   1.00 15.00 ?  227 TYR B N    10 
ATOM   7430  C CA   . TYR B 2 8  ? 6.308   -2.503  3.737   1.00 15.00 ?  227 TYR B CA   10 
ATOM   7431  C C    . TYR B 2 8  ? 7.434   -1.482  3.638   1.00 15.00 ?  227 TYR B C    10 
ATOM   7432  O O    . TYR B 2 8  ? 8.432   -1.537  4.364   1.00 15.00 ?  227 TYR B O    10 
ATOM   7433  C CB   . TYR B 2 8  ? 5.366   -2.145  4.890   1.00 15.00 ?  227 TYR B CB   10 
ATOM   7434  C CG   . TYR B 2 8  ? 6.061   -1.612  6.123   1.00 15.00 ?  227 TYR B CG   10 
ATOM   7435  C CD1  . TYR B 2 8  ? 6.685   -2.458  7.032   1.00 15.00 ?  227 TYR B CD1  10 
ATOM   7436  C CD2  . TYR B 2 8  ? 6.100   -0.251  6.366   1.00 15.00 ?  227 TYR B CD2  10 
ATOM   7437  C CE1  . TYR B 2 8  ? 7.327   -1.951  8.147   1.00 15.00 ?  227 TYR B CE1  10 
ATOM   7438  C CE2  . TYR B 2 8  ? 6.736   0.264   7.475   1.00 15.00 ?  227 TYR B CE2  10 
ATOM   7439  C CZ   . TYR B 2 8  ? 7.349   -0.589  8.363   1.00 15.00 ?  227 TYR B CZ   10 
ATOM   7440  O OH   . TYR B 2 8  ? 7.990   -0.080  9.470   1.00 15.00 ?  227 TYR B OH   10 
ATOM   7441  H H    . TYR B 2 8  ? 7.022   -4.249  4.708   1.00 15.00 ?  227 TYR B H    10 
ATOM   7442  H HA   . TYR B 2 8  ? 5.744   -2.449  2.820   1.00 15.00 ?  227 TYR B HA   10 
ATOM   7443  H HB2  . TYR B 2 8  ? 4.684   -1.377  4.533   1.00 15.00 ?  227 TYR B HB2  10 
ATOM   7444  H HB3  . TYR B 2 8  ? 4.798   -3.021  5.173   1.00 15.00 ?  227 TYR B HB3  10 
ATOM   7445  H HD1  . TYR B 2 8  ? 6.665   -3.522  6.857   1.00 15.00 ?  227 TYR B HD1  10 
ATOM   7446  H HD2  . TYR B 2 8  ? 5.616   0.417   5.670   1.00 15.00 ?  227 TYR B HD2  10 
ATOM   7447  H HE1  . TYR B 2 8  ? 7.807   -2.622  8.844   1.00 15.00 ?  227 TYR B HE1  10 
ATOM   7448  H HE2  . TYR B 2 8  ? 6.749   1.337   7.635   1.00 15.00 ?  227 TYR B HE2  10 
ATOM   7449  H HH   . TYR B 2 8  ? 7.441   0.601   9.876   1.00 15.00 ?  227 TYR B HH   10 
ATOM   7450  N N    . LEU B 2 9  ? 7.232   -0.546  2.729   1.00 15.00 ?  228 LEU B N    10 
ATOM   7451  C CA   . LEU B 2 9  ? 8.153   0.551   2.478   1.00 15.00 ?  228 LEU B CA   10 
ATOM   7452  C C    . LEU B 2 9  ? 7.384   1.871   2.471   1.00 15.00 ?  228 LEU B C    10 
ATOM   7453  O O    . LEU B 2 9  ? 6.179   1.872   2.316   1.00 15.00 ?  228 LEU B O    10 
ATOM   7454  C CB   . LEU B 2 9  ? 8.890   0.381   1.136   1.00 15.00 ?  228 LEU B CB   10 
ATOM   7455  C CG   . LEU B 2 9  ? 9.917   -0.754  1.051   1.00 15.00 ?  228 LEU B CG   10 
ATOM   7456  C CD1  . LEU B 2 9  ? 9.238   -2.102  0.878   1.00 15.00 ?  228 LEU B CD1  10 
ATOM   7457  C CD2  . LEU B 2 9  ? 10.877  -0.502  -0.099  1.00 15.00 ?  228 LEU B CD2  10 
ATOM   7458  H H    . LEU B 2 9  ? 6.412   -0.593  2.192   1.00 15.00 ?  228 LEU B H    10 
ATOM   7459  H HA   . LEU B 2 9  ? 8.860   0.570   3.289   1.00 15.00 ?  228 LEU B HA   10 
ATOM   7460  H HB2  . LEU B 2 9  ? 8.151   0.215   0.367   1.00 15.00 ?  228 LEU B HB2  10 
ATOM   7461  H HB3  . LEU B 2 9  ? 9.401   1.309   0.918   1.00 15.00 ?  228 LEU B HB3  10 
ATOM   7462  H HG   . LEU B 2 9  ? 10.491  -0.784  1.966   1.00 15.00 ?  228 LEU B HG   10 
ATOM   7463  H HD11 . LEU B 2 9  ? 8.575   -2.281  1.710   1.00 15.00 ?  228 LEU B HD11 10 
ATOM   7464  H HD12 . LEU B 2 9  ? 9.988   -2.879  0.840   1.00 15.00 ?  228 LEU B HD12 10 
ATOM   7465  H HD13 . LEU B 2 9  ? 8.670   -2.103  -0.041  1.00 15.00 ?  228 LEU B HD13 10 
ATOM   7466  H HD21 . LEU B 2 9  ? 10.323  -0.448  -1.024  1.00 15.00 ?  228 LEU B HD21 10 
ATOM   7467  H HD22 . LEU B 2 9  ? 11.592  -1.309  -0.154  1.00 15.00 ?  228 LEU B HD22 10 
ATOM   7468  H HD23 . LEU B 2 9  ? 11.398  0.430   0.064   1.00 15.00 ?  228 LEU B HD23 10 
ATOM   7469  N N    . PRO B 2 10 ? 8.053   3.013   2.643   1.00 15.00 ?  229 PRO B N    10 
ATOM   7470  C CA   . PRO B 2 10 ? 7.393   4.311   2.512   1.00 15.00 ?  229 PRO B CA   10 
ATOM   7471  C C    . PRO B 2 10 ? 7.434   4.780   1.060   1.00 15.00 ?  229 PRO B C    10 
ATOM   7472  O O    . PRO B 2 10 ? 8.272   4.326   0.279   1.00 15.00 ?  229 PRO B O    10 
ATOM   7473  C CB   . PRO B 2 10 ? 8.257   5.235   3.392   1.00 15.00 ?  229 PRO B CB   10 
ATOM   7474  C CG   . PRO B 2 10 ? 9.251   4.339   4.055   1.00 15.00 ?  229 PRO B CG   10 
ATOM   7475  C CD   . PRO B 2 10 ? 9.413   3.162   3.143   1.00 15.00 ?  229 PRO B CD   10 
ATOM   7476  H HA   . PRO B 2 10 ? 6.378   4.281   2.875   1.00 15.00 ?  229 PRO B HA   10 
ATOM   7477  H HB2  . PRO B 2 10 ? 8.747   5.972   2.771   1.00 15.00 ?  229 PRO B HB2  10 
ATOM   7478  H HB3  . PRO B 2 10 ? 7.631   5.732   4.119   1.00 15.00 ?  229 PRO B HB3  10 
ATOM   7479  H HG2  . PRO B 2 10 ? 10.184  4.855   4.176   1.00 15.00 ?  229 PRO B HG2  10 
ATOM   7480  H HG3  . PRO B 2 10 ? 8.871   4.018   5.014   1.00 15.00 ?  229 PRO B HG3  10 
ATOM   7481  H HD2  . PRO B 2 10 ? 10.106  3.380   2.350   1.00 15.00 ?  229 PRO B HD2  10 
ATOM   7482  H HD3  . PRO B 2 10 ? 9.717   2.293   3.698   1.00 15.00 ?  229 PRO B HD3  10 
ATOM   7483  N N    . PRO B 2 11 ? 6.553   5.715   0.674   1.00 15.00 ?  230 PRO B N    10 
ATOM   7484  C CA   . PRO B 2 11 ? 6.097   5.805   -0.708  1.00 15.00 ?  230 PRO B CA   10 
ATOM   7485  C C    . PRO B 2 11 ? 6.934   6.683   -1.625  1.00 15.00 ?  230 PRO B C    10 
ATOM   7486  O O    . PRO B 2 11 ? 7.300   7.816   -1.304  1.00 15.00 ?  230 PRO B O    10 
ATOM   7487  C CB   . PRO B 2 11 ? 4.714   6.419   -0.532  1.00 15.00 ?  230 PRO B CB   10 
ATOM   7488  C CG   . PRO B 2 11 ? 4.857   7.340   0.631   1.00 15.00 ?  230 PRO B CG   10 
ATOM   7489  C CD   . PRO B 2 11 ? 5.903   6.732   1.529   1.00 15.00 ?  230 PRO B CD   10 
ATOM   7490  H HA   . PRO B 2 11 ? 5.992   4.827   -1.153  1.00 15.00 ?  230 PRO B HA   10 
ATOM   7491  H HB2  . PRO B 2 11 ? 4.439   6.954   -1.425  1.00 15.00 ?  230 PRO B HB2  10 
ATOM   7492  H HB3  . PRO B 2 11 ? 3.993   5.642   -0.332  1.00 15.00 ?  230 PRO B HB3  10 
ATOM   7493  H HG2  . PRO B 2 11 ? 5.177   8.314   0.291   1.00 15.00 ?  230 PRO B HG2  10 
ATOM   7494  H HG3  . PRO B 2 11 ? 3.916   7.417   1.156   1.00 15.00 ?  230 PRO B HG3  10 
ATOM   7495  H HD2  . PRO B 2 11 ? 6.605   7.481   1.845   1.00 15.00 ?  230 PRO B HD2  10 
ATOM   7496  H HD3  . PRO B 2 11 ? 5.434   6.273   2.384   1.00 15.00 ?  230 PRO B HD3  10 
ATOM   7497  N N    . GLU B 2 12 ? 7.226   6.110   -2.779  1.00 15.00 ?  231 GLU B N    10 
ATOM   7498  C CA   . GLU B 2 12 ? 7.838   6.815   -3.883  1.00 15.00 ?  231 GLU B CA   10 
ATOM   7499  C C    . GLU B 2 12 ? 6.821   6.847   -5.026  1.00 15.00 ?  231 GLU B C    10 
ATOM   7500  O O    . GLU B 2 12 ? 6.261   5.809   -5.372  1.00 15.00 ?  231 GLU B O    10 
ATOM   7501  C CB   . GLU B 2 12 ? 9.116   6.093   -4.325  1.00 15.00 ?  231 GLU B CB   10 
ATOM   7502  C CG   . GLU B 2 12 ? 8.876   4.684   -4.852  1.00 15.00 ?  231 GLU B CG   10 
ATOM   7503  C CD   . GLU B 2 12 ? 10.157  3.970   -5.204  1.00 15.00 ?  231 GLU B CD   10 
ATOM   7504  O OE1  . GLU B 2 12 ? 10.987  3.765   -4.293  1.00 15.00 ?  231 GLU B OE1  10 
ATOM   7505  O OE2  . GLU B 2 12 ? 10.328  3.591   -6.380  1.00 15.00 -1 231 GLU B OE2  10 
ATOM   7506  H H    . GLU B 2 12 ? 7.005   5.166   -2.901  1.00 15.00 ?  231 GLU B H    10 
ATOM   7507  H HA   . GLU B 2 12 ? 8.074   7.817   -3.558  1.00 15.00 ?  231 GLU B HA   10 
ATOM   7508  H HB2  . GLU B 2 12 ? 9.589   6.670   -5.107  1.00 15.00 ?  231 GLU B HB2  10 
ATOM   7509  H HB3  . GLU B 2 12 ? 9.788   6.029   -3.482  1.00 15.00 ?  231 GLU B HB3  10 
ATOM   7510  H HG2  . GLU B 2 12 ? 8.353   4.106   -4.103  1.00 15.00 ?  231 GLU B HG2  10 
ATOM   7511  H HG3  . GLU B 2 12 ? 8.265   4.750   -5.739  1.00 15.00 ?  231 GLU B HG3  10 
ATOM   7512  N N    . ASP B 2 13 ? 6.543   8.013   -5.585  1.00 15.00 ?  232 ASP B N    10 
ATOM   7513  C CA   . ASP B 2 13 ? 5.539   8.100   -6.632  1.00 15.00 ?  232 ASP B CA   10 
ATOM   7514  C C    . ASP B 2 13 ? 5.865   9.231   -7.591  1.00 15.00 ?  232 ASP B C    10 
ATOM   7515  O O    . ASP B 2 13 ? 5.983   10.386  -7.176  1.00 15.00 ?  232 ASP B O    10 
ATOM   7516  C CB   . ASP B 2 13 ? 4.150   8.288   -6.014  1.00 15.00 ?  232 ASP B CB   10 
ATOM   7517  C CG   . ASP B 2 13 ? 3.039   8.274   -7.045  1.00 15.00 ?  232 ASP B CG   10 
ATOM   7518  O OD1  . ASP B 2 13 ? 2.859   7.240   -7.724  1.00 15.00 ?  232 ASP B OD1  10 
ATOM   7519  O OD2  . ASP B 2 13 ? 2.305   9.279   -7.142  1.00 15.00 -1 232 ASP B OD2  10 
ATOM   7520  H H    . ASP B 2 13 ? 7.025   8.823   -5.315  1.00 15.00 ?  232 ASP B H    10 
ATOM   7521  H HA   . ASP B 2 13 ? 5.554   7.171   -7.181  1.00 15.00 ?  232 ASP B HA   10 
ATOM   7522  H HB2  . ASP B 2 13 ? 3.970   7.488   -5.310  1.00 15.00 ?  232 ASP B HB2  10 
ATOM   7523  H HB3  . ASP B 2 13 ? 4.122   9.234   -5.493  1.00 15.00 ?  232 ASP B HB3  10 
ATOM   7524  N N    . PRO B 2 14 ? 6.060   8.900   -8.875  1.00 15.00 ?  233 PRO B N    10 
ATOM   7525  C CA   . PRO B 2 14 ? 6.342   9.888   -9.919  1.00 15.00 ?  233 PRO B CA   10 
ATOM   7526  C C    . PRO B 2 14 ? 5.277   10.977  -9.975  1.00 15.00 ?  233 PRO B C    10 
ATOM   7527  O O    . PRO B 2 14 ? 5.578   12.168  -9.887  1.00 15.00 ?  233 PRO B O    10 
ATOM   7528  C CB   . PRO B 2 14 ? 6.337   9.062   -11.209 1.00 15.00 ?  233 PRO B CB   10 
ATOM   7529  C CG   . PRO B 2 14 ? 6.644   7.673   -10.772 1.00 15.00 ?  233 PRO B CG   10 
ATOM   7530  C CD   . PRO B 2 14 ? 6.029   7.525   -9.410  1.00 15.00 ?  233 PRO B CD   10 
ATOM   7531  H HA   . PRO B 2 14 ? 7.310   10.341  -9.781  1.00 15.00 ?  233 PRO B HA   10 
ATOM   7532  H HB2  . PRO B 2 14 ? 5.363   9.124   -11.674 1.00 15.00 ?  233 PRO B HB2  10 
ATOM   7533  H HB3  . PRO B 2 14 ? 7.090   9.440   -11.884 1.00 15.00 ?  233 PRO B HB3  10 
ATOM   7534  H HG2  . PRO B 2 14 ? 6.206   6.965   -11.462 1.00 15.00 ?  233 PRO B HG2  10 
ATOM   7535  H HG3  . PRO B 2 14 ? 7.713   7.532   -10.719 1.00 15.00 ?  233 PRO B HG3  10 
ATOM   7536  H HD2  . PRO B 2 14 ? 5.014   7.162   -9.489  1.00 15.00 ?  233 PRO B HD2  10 
ATOM   7537  H HD3  . PRO B 2 14 ? 6.621   6.861   -8.797  1.00 15.00 ?  233 PRO B HD3  10 
HETATM 7538  N N    . NH2 B 2 15 ? 4.031   10.564  -10.133 1.00 15.00 ?  234 NH2 B N    10 
HETATM 7539  H HN1  . NH2 B 2 15 ? 3.869   9.599   -10.194 1.00 15.00 ?  234 NH2 B HN1  10 
HETATM 7540  H HN2  . NH2 B 2 15 ? 3.322   11.236  -10.181 1.00 15.00 ?  234 NH2 B HN2  10 
ATOM   7541  N N    . LEU A 1 1  ? -13.190 1.991   -2.593  1.00 15.00 ?  279 LEU A N    11 
ATOM   7542  C CA   . LEU A 1 1  ? -14.500 2.487   -2.121  1.00 15.00 ?  279 LEU A CA   11 
ATOM   7543  C C    . LEU A 1 1  ? -14.573 2.382   -0.607  1.00 15.00 ?  279 LEU A C    11 
ATOM   7544  O O    . LEU A 1 1  ? -14.634 1.281   -0.056  1.00 15.00 ?  279 LEU A O    11 
ATOM   7545  C CB   . LEU A 1 1  ? -15.639 1.686   -2.757  1.00 15.00 ?  279 LEU A CB   11 
ATOM   7546  C CG   . LEU A 1 1  ? -15.750 1.808   -4.276  1.00 15.00 ?  279 LEU A CG   11 
ATOM   7547  C CD1  . LEU A 1 1  ? -16.807 0.857   -4.807  1.00 15.00 ?  279 LEU A CD1  11 
ATOM   7548  C CD2  . LEU A 1 1  ? -16.080 3.238   -4.674  1.00 15.00 ?  279 LEU A CD2  11 
ATOM   7549  H H1   . LEU A 1 1  ? -13.122 2.068   -3.634  1.00 15.00 ?  279 LEU A H1   11 
ATOM   7550  H H2   . LEU A 1 1  ? -13.067 0.997   -2.324  1.00 15.00 ?  279 LEU A H2   11 
ATOM   7551  H H3   . LEU A 1 1  ? -12.425 2.549   -2.164  1.00 15.00 ?  279 LEU A H3   11 
ATOM   7552  H HA   . LEU A 1 1  ? -14.593 3.526   -2.403  1.00 15.00 ?  279 LEU A HA   11 
ATOM   7553  H HB2  . LEU A 1 1  ? -15.499 0.644   -2.509  1.00 15.00 ?  279 LEU A HB2  11 
ATOM   7554  H HB3  . LEU A 1 1  ? -16.570 2.020   -2.322  1.00 15.00 ?  279 LEU A HB3  11 
ATOM   7555  H HG   . LEU A 1 1  ? -14.803 1.544   -4.724  1.00 15.00 ?  279 LEU A HG   11 
ATOM   7556  H HD11 . LEU A 1 1  ? -17.763 1.098   -4.366  1.00 15.00 ?  279 LEU A HD11 11 
ATOM   7557  H HD12 . LEU A 1 1  ? -16.539 -0.157  -4.552  1.00 15.00 ?  279 LEU A HD12 11 
ATOM   7558  H HD13 . LEU A 1 1  ? -16.870 0.953   -5.881  1.00 15.00 ?  279 LEU A HD13 11 
ATOM   7559  H HD21 . LEU A 1 1  ? -16.152 3.304   -5.750  1.00 15.00 ?  279 LEU A HD21 11 
ATOM   7560  H HD22 . LEU A 1 1  ? -15.302 3.901   -4.325  1.00 15.00 ?  279 LEU A HD22 11 
ATOM   7561  H HD23 . LEU A 1 1  ? -17.023 3.527   -4.233  1.00 15.00 ?  279 LEU A HD23 11 
ATOM   7562  N N    . GLY A 1 2  ? -14.537 3.524   0.062   1.00 15.00 ?  280 GLY A N    11 
ATOM   7563  C CA   . GLY A 1 2  ? -14.525 3.534   1.506   1.00 15.00 ?  280 GLY A CA   11 
ATOM   7564  C C    . GLY A 1 2  ? -13.519 4.522   2.070   1.00 15.00 ?  280 GLY A C    11 
ATOM   7565  O O    . GLY A 1 2  ? -13.128 5.473   1.392   1.00 15.00 ?  280 GLY A O    11 
ATOM   7566  H H    . GLY A 1 2  ? -14.525 4.373   -0.432  1.00 15.00 ?  280 GLY A H    11 
ATOM   7567  H HA2  . GLY A 1 2  ? -15.510 3.797   1.861   1.00 15.00 ?  280 GLY A HA2  11 
ATOM   7568  H HA3  . GLY A 1 2  ? -14.278 2.545   1.860   1.00 15.00 ?  280 GLY A HA3  11 
ATOM   7569  N N    . PRO A 1 3  ? -13.092 4.319   3.322   1.00 15.00 ?  281 PRO A N    11 
ATOM   7570  C CA   . PRO A 1 3  ? -12.175 5.219   4.029   1.00 15.00 ?  281 PRO A CA   11 
ATOM   7571  C C    . PRO A 1 3  ? -10.702 4.821   3.907   1.00 15.00 ?  281 PRO A C    11 
ATOM   7572  O O    . PRO A 1 3  ? -10.371 3.638   3.830   1.00 15.00 ?  281 PRO A O    11 
ATOM   7573  C CB   . PRO A 1 3  ? -12.631 5.015   5.465   1.00 15.00 ?  281 PRO A CB   11 
ATOM   7574  C CG   . PRO A 1 3  ? -12.920 3.554   5.528   1.00 15.00 ?  281 PRO A CG   11 
ATOM   7575  C CD   . PRO A 1 3  ? -13.497 3.190   4.183   1.00 15.00 ?  281 PRO A CD   11 
ATOM   7576  H HA   . PRO A 1 3  ? -12.309 6.250   3.744   1.00 15.00 ?  281 PRO A HA   11 
ATOM   7577  H HB2  . PRO A 1 3  ? -11.841 5.300   6.145   1.00 15.00 ?  281 PRO A HB2  11 
ATOM   7578  H HB3  . PRO A 1 3  ? -13.516 5.603   5.657   1.00 15.00 ?  281 PRO A HB3  11 
ATOM   7579  H HG2  . PRO A 1 3  ? -12.001 3.006   5.694   1.00 15.00 ?  281 PRO A HG2  11 
ATOM   7580  H HG3  . PRO A 1 3  ? -13.632 3.348   6.314   1.00 15.00 ?  281 PRO A HG3  11 
ATOM   7581  H HD2  . PRO A 1 3  ? -13.073 2.263   3.829   1.00 15.00 ?  281 PRO A HD2  11 
ATOM   7582  H HD3  . PRO A 1 3  ? -14.574 3.117   4.242   1.00 15.00 ?  281 PRO A HD3  11 
ATOM   7583  N N    . LEU A 1 4  ? -9.817  5.807   3.923   1.00 15.00 ?  282 LEU A N    11 
ATOM   7584  C CA   . LEU A 1 4  ? -8.395  5.535   4.064   1.00 15.00 ?  282 LEU A CA   11 
ATOM   7585  C C    . LEU A 1 4  ? -7.967  5.833   5.497   1.00 15.00 ?  282 LEU A C    11 
ATOM   7586  O O    . LEU A 1 4  ? -8.015  6.984   5.937   1.00 15.00 ?  282 LEU A O    11 
ATOM   7587  C CB   . LEU A 1 4  ? -7.556  6.366   3.090   1.00 15.00 ?  282 LEU A CB   11 
ATOM   7588  C CG   . LEU A 1 4  ? -6.052  6.072   3.136   1.00 15.00 ?  282 LEU A CG   11 
ATOM   7589  C CD1  . LEU A 1 4  ? -5.759  4.690   2.572   1.00 15.00 ?  282 LEU A CD1  11 
ATOM   7590  C CD2  . LEU A 1 4  ? -5.268  7.135   2.386   1.00 15.00 ?  282 LEU A CD2  11 
ATOM   7591  H H    . LEU A 1 4  ? -10.125 6.734   3.844   1.00 15.00 ?  282 LEU A H    11 
ATOM   7592  H HA   . LEU A 1 4  ? -8.237  4.484   3.865   1.00 15.00 ?  282 LEU A HA   11 
ATOM   7593  H HB2  . LEU A 1 4  ? -7.912  6.176   2.086   1.00 15.00 ?  282 LEU A HB2  11 
ATOM   7594  H HB3  . LEU A 1 4  ? -7.704  7.411   3.316   1.00 15.00 ?  282 LEU A HB3  11 
ATOM   7595  H HG   . LEU A 1 4  ? -5.726  6.083   4.166   1.00 15.00 ?  282 LEU A HG   11 
ATOM   7596  H HD11 . LEU A 1 4  ? -6.094  4.640   1.548   1.00 15.00 ?  282 LEU A HD11 11 
ATOM   7597  H HD12 . LEU A 1 4  ? -6.280  3.946   3.156   1.00 15.00 ?  282 LEU A HD12 11 
ATOM   7598  H HD13 . LEU A 1 4  ? -4.697  4.501   2.614   1.00 15.00 ?  282 LEU A HD13 11 
ATOM   7599  H HD21 . LEU A 1 4  ? -5.589  7.161   1.355   1.00 15.00 ?  282 LEU A HD21 11 
ATOM   7600  H HD22 . LEU A 1 4  ? -4.214  6.902   2.429   1.00 15.00 ?  282 LEU A HD22 11 
ATOM   7601  H HD23 . LEU A 1 4  ? -5.443  8.098   2.841   1.00 15.00 ?  282 LEU A HD23 11 
ATOM   7602  N N    . PRO A 1 5  ? -7.582  4.797   6.253   1.00 15.00 ?  283 PRO A N    11 
ATOM   7603  C CA   . PRO A 1 5  ? -7.161  4.942   7.650   1.00 15.00 ?  283 PRO A CA   11 
ATOM   7604  C C    . PRO A 1 5  ? -5.826  5.675   7.784   1.00 15.00 ?  283 PRO A C    11 
ATOM   7605  O O    . PRO A 1 5  ? -4.890  5.420   7.026   1.00 15.00 ?  283 PRO A O    11 
ATOM   7606  C CB   . PRO A 1 5  ? -7.021  3.492   8.142   1.00 15.00 ?  283 PRO A CB   11 
ATOM   7607  C CG   . PRO A 1 5  ? -7.687  2.650   7.106   1.00 15.00 ?  283 PRO A CG   11 
ATOM   7608  C CD   . PRO A 1 5  ? -7.538  3.397   5.815   1.00 15.00 ?  283 PRO A CD   11 
ATOM   7609  H HA   . PRO A 1 5  ? -7.910  5.453   8.237   1.00 15.00 ?  283 PRO A HA   11 
ATOM   7610  H HB2  . PRO A 1 5  ? -5.975  3.243   8.237   1.00 15.00 ?  283 PRO A HB2  11 
ATOM   7611  H HB3  . PRO A 1 5  ? -7.507  3.389   9.102   1.00 15.00 ?  283 PRO A HB3  11 
ATOM   7612  H HG2  . PRO A 1 5  ? -7.198  1.690   7.043   1.00 15.00 ?  283 PRO A HG2  11 
ATOM   7613  H HG3  . PRO A 1 5  ? -8.733  2.527   7.349   1.00 15.00 ?  283 PRO A HG3  11 
ATOM   7614  H HD2  . PRO A 1 5  ? -6.591  3.165   5.348   1.00 15.00 ?  283 PRO A HD2  11 
ATOM   7615  H HD3  . PRO A 1 5  ? -8.358  3.174   5.149   1.00 15.00 ?  283 PRO A HD3  11 
ATOM   7616  N N    . PRO A 1 6  ? -5.730  6.600   8.753   1.00 15.00 ?  284 PRO A N    11 
ATOM   7617  C CA   . PRO A 1 6  ? -4.484  7.312   9.051   1.00 15.00 ?  284 PRO A CA   11 
ATOM   7618  C C    . PRO A 1 6  ? -3.364  6.350   9.442   1.00 15.00 ?  284 PRO A C    11 
ATOM   7619  O O    . PRO A 1 6  ? -3.541  5.499   10.317  1.00 15.00 ?  284 PRO A O    11 
ATOM   7620  C CB   . PRO A 1 6  ? -4.849  8.223   10.231  1.00 15.00 ?  284 PRO A CB   11 
ATOM   7621  C CG   . PRO A 1 6  ? -6.115  7.665   10.785  1.00 15.00 ?  284 PRO A CG   11 
ATOM   7622  C CD   . PRO A 1 6  ? -6.831  7.029   9.630   1.00 15.00 ?  284 PRO A CD   11 
ATOM   7623  H HA   . PRO A 1 6  ? -4.161  7.912   8.213   1.00 15.00 ?  284 PRO A HA   11 
ATOM   7624  H HB2  . PRO A 1 6  ? -4.055  8.201   10.963  1.00 15.00 ?  284 PRO A HB2  11 
ATOM   7625  H HB3  . PRO A 1 6  ? -4.987  9.233   9.875   1.00 15.00 ?  284 PRO A HB3  11 
ATOM   7626  H HG2  . PRO A 1 6  ? -5.891  6.925   11.540  1.00 15.00 ?  284 PRO A HG2  11 
ATOM   7627  H HG3  . PRO A 1 6  ? -6.713  8.460   11.205  1.00 15.00 ?  284 PRO A HG3  11 
ATOM   7628  H HD2  . PRO A 1 6  ? -7.411  6.182   9.965   1.00 15.00 ?  284 PRO A HD2  11 
ATOM   7629  H HD3  . PRO A 1 6  ? -7.463  7.749   9.133   1.00 15.00 ?  284 PRO A HD3  11 
ATOM   7630  N N    . GLY A 1 7  ? -2.220  6.491   8.793   1.00 15.00 ?  285 GLY A N    11 
ATOM   7631  C CA   . GLY A 1 7  ? -1.117  5.578   9.025   1.00 15.00 ?  285 GLY A CA   11 
ATOM   7632  C C    . GLY A 1 7  ? -0.871  4.693   7.824   1.00 15.00 ?  285 GLY A C    11 
ATOM   7633  O O    . GLY A 1 7  ? 0.109   3.946   7.770   1.00 15.00 ?  285 GLY A O    11 
ATOM   7634  H H    . GLY A 1 7  ? -2.122  7.224   8.147   1.00 15.00 ?  285 GLY A H    11 
ATOM   7635  H HA2  . GLY A 1 7  ? -0.224  6.149   9.233   1.00 15.00 ?  285 GLY A HA2  11 
ATOM   7636  H HA3  . GLY A 1 7  ? -1.347  4.958   9.878   1.00 15.00 ?  285 GLY A HA3  11 
ATOM   7637  N N    . TRP A 1 8  ? -1.756  4.806   6.843   1.00 15.00 ?  286 TRP A N    11 
ATOM   7638  C CA   . TRP A 1 8  ? -1.653  4.030   5.619   1.00 15.00 ?  286 TRP A CA   11 
ATOM   7639  C C    . TRP A 1 8  ? -0.829  4.769   4.589   1.00 15.00 ?  286 TRP A C    11 
ATOM   7640  O O    . TRP A 1 8  ? -1.245  5.809   4.069   1.00 15.00 ?  286 TRP A O    11 
ATOM   7641  C CB   . TRP A 1 8  ? -3.048  3.743   5.038   1.00 15.00 ?  286 TRP A CB   11 
ATOM   7642  C CG   . TRP A 1 8  ? -3.674  2.496   5.571   1.00 15.00 ?  286 TRP A CG   11 
ATOM   7643  C CD1  . TRP A 1 8  ? -3.793  2.140   6.883   1.00 15.00 ?  286 TRP A CD1  11 
ATOM   7644  C CD2  . TRP A 1 8  ? -4.259  1.431   4.806   1.00 15.00 ?  286 TRP A CD2  11 
ATOM   7645  N NE1  . TRP A 1 8  ? -4.398  0.914   6.985   1.00 15.00 ?  286 TRP A NE1  11 
ATOM   7646  C CE2  . TRP A 1 8  ? -4.691  0.454   5.730   1.00 15.00 ?  286 TRP A CE2  11 
ATOM   7647  C CE3  . TRP A 1 8  ? -4.457  1.193   3.434   1.00 15.00 ?  286 TRP A CE3  11 
ATOM   7648  C CZ2  . TRP A 1 8  ? -5.299  -0.734  5.334   1.00 15.00 ?  286 TRP A CZ2  11 
ATOM   7649  C CZ3  . TRP A 1 8  ? -5.055  0.006   3.056   1.00 15.00 ?  286 TRP A CZ3  11 
ATOM   7650  C CH2  . TRP A 1 8  ? -5.464  -0.944  3.995   1.00 15.00 ?  286 TRP A CH2  11 
ATOM   7651  H H    . TRP A 1 8  ? -2.507  5.426   6.950   1.00 15.00 ?  286 TRP A H    11 
ATOM   7652  H HA   . TRP A 1 8  ? -1.159  3.094   5.854   1.00 15.00 ?  286 TRP A HA   11 
ATOM   7653  H HB2  . TRP A 1 8  ? -3.704  4.568   5.271   1.00 15.00 ?  286 TRP A HB2  11 
ATOM   7654  H HB3  . TRP A 1 8  ? -2.970  3.645   3.965   1.00 15.00 ?  286 TRP A HB3  11 
ATOM   7655  H HD1  . TRP A 1 8  ? -3.449  2.744   7.710   1.00 15.00 ?  286 TRP A HD1  11 
ATOM   7656  H HE1  . TRP A 1 8  ? -4.585  0.440   7.824   1.00 15.00 ?  286 TRP A HE1  11 
ATOM   7657  H HE3  . TRP A 1 8  ? -4.156  1.933   2.642   1.00 15.00 ?  286 TRP A HE3  11 
ATOM   7658  H HZ2  . TRP A 1 8  ? -5.621  -1.476  6.049   1.00 15.00 ?  286 TRP A HZ2  11 
ATOM   7659  H HZ3  . TRP A 1 8  ? -5.174  -0.213  2.006   1.00 15.00 ?  286 TRP A HZ3  11 
ATOM   7660  H HH2  . TRP A 1 8  ? -5.923  -1.857  3.641   1.00 15.00 ?  286 TRP A HH2  11 
ATOM   7661  N N    . GLU A 1 9  ? 0.348   4.243   4.308   1.00 15.00 ?  287 GLU A N    11 
ATOM   7662  C CA   . GLU A 1 9  ? 1.180   4.789   3.269   1.00 15.00 ?  287 GLU A CA   11 
ATOM   7663  C C    . GLU A 1 9  ? 0.926   4.017   1.988   1.00 15.00 ?  287 GLU A C    11 
ATOM   7664  O O    . GLU A 1 9  ? 1.105   2.800   1.944   1.00 15.00 ?  287 GLU A O    11 
ATOM   7665  C CB   . GLU A 1 9  ? 2.651   4.710   3.681   1.00 15.00 ?  287 GLU A CB   11 
ATOM   7666  C CG   . GLU A 1 9  ? 3.243   6.045   4.100   1.00 15.00 ?  287 GLU A CG   11 
ATOM   7667  C CD   . GLU A 1 9  ? 2.522   6.687   5.267   1.00 15.00 ?  287 GLU A CD   11 
ATOM   7668  O OE1  . GLU A 1 9  ? 2.791   6.305   6.425   1.00 15.00 -1 287 GLU A OE1  11 
ATOM   7669  O OE2  . GLU A 1 9  ? 1.701   7.598   5.029   1.00 15.00 ?  287 GLU A OE2  11 
ATOM   7670  H H    . GLU A 1 9  ? 0.663   3.448   4.805   1.00 15.00 ?  287 GLU A H    11 
ATOM   7671  H HA   . GLU A 1 9  ? 0.903   5.823   3.121   1.00 15.00 ?  287 GLU A HA   11 
ATOM   7672  H HB2  . GLU A 1 9  ? 2.738   4.030   4.517   1.00 15.00 ?  287 GLU A HB2  11 
ATOM   7673  H HB3  . GLU A 1 9  ? 3.232   4.324   2.859   1.00 15.00 ?  287 GLU A HB3  11 
ATOM   7674  H HG2  . GLU A 1 9  ? 4.273   5.890   4.383   1.00 15.00 ?  287 GLU A HG2  11 
ATOM   7675  H HG3  . GLU A 1 9  ? 3.205   6.718   3.259   1.00 15.00 ?  287 GLU A HG3  11 
ATOM   7676  N N    . VAL A 1 10 ? 0.480   4.703   0.950   1.00 15.00 ?  288 VAL A N    11 
ATOM   7677  C CA   . VAL A 1 10 ? 0.202   4.025   -0.297  1.00 15.00 ?  288 VAL A CA   11 
ATOM   7678  C C    . VAL A 1 10 ? 1.469   4.026   -1.148  1.00 15.00 ?  288 VAL A C    11 
ATOM   7679  O O    . VAL A 1 10 ? 1.974   5.070   -1.558  1.00 15.00 ?  288 VAL A O    11 
ATOM   7680  C CB   . VAL A 1 10 ? -1.020  4.637   -1.059  1.00 15.00 ?  288 VAL A CB   11 
ATOM   7681  C CG1  . VAL A 1 10 ? -2.104  5.061   -0.084  1.00 15.00 ?  288 VAL A CG1  11 
ATOM   7682  C CG2  . VAL A 1 10 ? -0.650  5.804   -1.963  1.00 15.00 ?  288 VAL A CG2  11 
ATOM   7683  H H    . VAL A 1 10 ? 0.336   5.670   1.026   1.00 15.00 ?  288 VAL A H    11 
ATOM   7684  H HA   . VAL A 1 10 ? -0.037  2.997   -0.054  1.00 15.00 ?  288 VAL A HA   11 
ATOM   7685  H HB   . VAL A 1 10 ? -1.438  3.857   -1.683  1.00 15.00 ?  288 VAL A HB   11 
ATOM   7686  H HG11 . VAL A 1 10 ? -2.432  4.204   0.483   1.00 15.00 ?  288 VAL A HG11 11 
ATOM   7687  H HG12 . VAL A 1 10 ? -2.938  5.474   -0.630  1.00 15.00 ?  288 VAL A HG12 11 
ATOM   7688  H HG13 . VAL A 1 10 ? -1.709  5.807   0.589   1.00 15.00 ?  288 VAL A HG13 11 
ATOM   7689  H HG21 . VAL A 1 10 ? -0.072  5.434   -2.798  1.00 15.00 ?  288 VAL A HG21 11 
ATOM   7690  H HG22 . VAL A 1 10 ? -0.063  6.520   -1.406  1.00 15.00 ?  288 VAL A HG22 11 
ATOM   7691  H HG23 . VAL A 1 10 ? -1.549  6.279   -2.327  1.00 15.00 ?  288 VAL A HG23 11 
ATOM   7692  N N    . ARG A 1 11 ? 2.043   2.853   -1.338  1.00 15.00 ?  289 ARG A N    11 
ATOM   7693  C CA   . ARG A 1 11 ? 3.264   2.756   -2.102  1.00 15.00 ?  289 ARG A CA   11 
ATOM   7694  C C    . ARG A 1 11 ? 2.906   2.305   -3.504  1.00 15.00 ?  289 ARG A C    11 
ATOM   7695  O O    . ARG A 1 11 ? 2.545   1.154   -3.735  1.00 15.00 ?  289 ARG A O    11 
ATOM   7696  C CB   . ARG A 1 11 ? 4.258   1.815   -1.404  1.00 15.00 ?  289 ARG A CB   11 
ATOM   7697  C CG   . ARG A 1 11 ? 5.723   2.064   -1.742  1.00 15.00 ?  289 ARG A CG   11 
ATOM   7698  C CD   . ARG A 1 11 ? 6.110   1.540   -3.117  1.00 15.00 ?  289 ARG A CD   11 
ATOM   7699  N NE   . ARG A 1 11 ? 7.552   1.618   -3.328  1.00 15.00 ?  289 ARG A NE   11 
ATOM   7700  C CZ   . ARG A 1 11 ? 8.315   0.624   -3.793  1.00 15.00 ?  289 ARG A CZ   11 
ATOM   7701  N NH1  . ARG A 1 11 ? 7.789   -0.562  -4.061  1.00 15.00 1  289 ARG A NH1  11 
ATOM   7702  N NH2  . ARG A 1 11 ? 9.616   0.823   -3.977  1.00 15.00 ?  289 ARG A NH2  11 
ATOM   7703  H H    . ARG A 1 11 ? 1.631   2.036   -0.972  1.00 15.00 ?  289 ARG A H    11 
ATOM   7704  H HA   . ARG A 1 11 ? 3.693   3.747   -2.159  1.00 15.00 ?  289 ARG A HA   11 
ATOM   7705  H HB2  . ARG A 1 11 ? 4.143   1.929   -0.337  1.00 15.00 ?  289 ARG A HB2  11 
ATOM   7706  H HB3  . ARG A 1 11 ? 4.021   0.800   -1.665  1.00 15.00 ?  289 ARG A HB3  11 
ATOM   7707  H HG2  . ARG A 1 11 ? 5.909   3.127   -1.717  1.00 15.00 ?  289 ARG A HG2  11 
ATOM   7708  H HG3  . ARG A 1 11 ? 6.338   1.578   -0.998  1.00 15.00 ?  289 ARG A HG3  11 
ATOM   7709  H HD2  . ARG A 1 11 ? 5.795   0.512   -3.199  1.00 15.00 ?  289 ARG A HD2  11 
ATOM   7710  H HD3  . ARG A 1 11 ? 5.611   2.133   -3.869  1.00 15.00 ?  289 ARG A HD3  11 
ATOM   7711  H HE   . ARG A 1 11 ? 7.988   2.483   -3.109  1.00 15.00 ?  289 ARG A HE   11 
ATOM   7712  H HH11 . ARG A 1 11 ? 6.814   -0.723  -3.921  1.00 15.00 ?  289 ARG A HH11 11 
ATOM   7713  H HH12 . ARG A 1 11 ? 8.378   -1.316  -4.393  1.00 15.00 ?  289 ARG A HH12 11 
ATOM   7714  H HH21 . ARG A 1 11 ? 10.026  1.725   -3.771  1.00 15.00 ?  289 ARG A HH21 11 
ATOM   7715  H HH22 . ARG A 1 11 ? 10.199  0.080   -4.318  1.00 15.00 ?  289 ARG A HH22 11 
ATOM   7716  N N    . SER A 1 12 ? 2.931   3.251   -4.418  1.00 15.00 ?  290 SER A N    11 
ATOM   7717  C CA   . SER A 1 12 ? 2.489   3.021   -5.776  1.00 15.00 ?  290 SER A CA   11 
ATOM   7718  C C    . SER A 1 12 ? 3.686   2.804   -6.683  1.00 15.00 ?  290 SER A C    11 
ATOM   7719  O O    . SER A 1 12 ? 4.706   3.480   -6.551  1.00 15.00 ?  290 SER A O    11 
ATOM   7720  C CB   . SER A 1 12 ? 1.671   4.225   -6.238  1.00 15.00 ?  290 SER A CB   11 
ATOM   7721  O OG   . SER A 1 12 ? 1.267   4.099   -7.592  1.00 15.00 ?  290 SER A OG   11 
ATOM   7722  H H    . SER A 1 12 ? 3.267   4.140   -4.175  1.00 15.00 ?  290 SER A H    11 
ATOM   7723  H HA   . SER A 1 12 ? 1.866   2.139   -5.787  1.00 15.00 ?  290 SER A HA   11 
ATOM   7724  H HB2  . SER A 1 12 ? 0.790   4.314   -5.622  1.00 15.00 ?  290 SER A HB2  11 
ATOM   7725  H HB3  . SER A 1 12 ? 2.273   5.113   -6.132  1.00 15.00 ?  290 SER A HB3  11 
ATOM   7726  H HG   . SER A 1 12 ? 1.415   4.945   -8.047  1.00 15.00 ?  290 SER A HG   11 
ATOM   7727  N N    . THR A 1 13 ? 3.565   1.866   -7.603  1.00 15.00 ?  291 THR A N    11 
ATOM   7728  C CA   . THR A 1 13 ? 4.647   1.580   -8.518  1.00 15.00 ?  291 THR A CA   11 
ATOM   7729  C C    . THR A 1 13 ? 4.173   1.683   -9.965  1.00 15.00 ?  291 THR A C    11 
ATOM   7730  O O    . THR A 1 13 ? 3.020   1.357   -10.279 1.00 15.00 ?  291 THR A O    11 
ATOM   7731  C CB   . THR A 1 13 ? 5.262   0.193   -8.246  1.00 15.00 ?  291 THR A CB   11 
ATOM   7732  O OG1  . THR A 1 13 ? 4.245   -0.815  -8.285  1.00 15.00 ?  291 THR A OG1  11 
ATOM   7733  C CG2  . THR A 1 13 ? 5.951   0.166   -6.888  1.00 15.00 ?  291 THR A CG2  11 
ATOM   7734  H H    . THR A 1 13 ? 2.721   1.370   -7.681  1.00 15.00 ?  291 THR A H    11 
ATOM   7735  H HA   . THR A 1 13 ? 5.415   2.323   -8.356  1.00 15.00 ?  291 THR A HA   11 
ATOM   7736  H HB   . THR A 1 13 ? 5.997   -0.016  -9.011  1.00 15.00 ?  291 THR A HB   11 
ATOM   7737  H HG1  . THR A 1 13 ? 3.483   -0.524  -7.770  1.00 15.00 ?  291 THR A HG1  11 
ATOM   7738  H HG21 . THR A 1 13 ? 5.208   0.270   -6.109  1.00 15.00 ?  291 THR A HG21 11 
ATOM   7739  H HG22 . THR A 1 13 ? 6.661   0.986   -6.821  1.00 15.00 ?  291 THR A HG22 11 
ATOM   7740  H HG23 . THR A 1 13 ? 6.470   -0.773  -6.764  1.00 15.00 ?  291 THR A HG23 11 
ATOM   7741  N N    . VAL A 1 14 ? 5.089   2.118   -10.833 1.00 15.00 ?  292 VAL A N    11 
ATOM   7742  C CA   . VAL A 1 14 ? 4.793   2.405   -12.238 1.00 15.00 ?  292 VAL A CA   11 
ATOM   7743  C C    . VAL A 1 14 ? 4.273   1.167   -12.977 1.00 15.00 ?  292 VAL A C    11 
ATOM   7744  O O    . VAL A 1 14 ? 3.712   1.274   -14.069 1.00 15.00 ?  292 VAL A O    11 
ATOM   7745  C CB   . VAL A 1 14 ? 6.052   2.958   -12.951 1.00 15.00 ?  292 VAL A CB   11 
ATOM   7746  C CG1  . VAL A 1 14 ? 7.132   1.892   -13.061 1.00 15.00 ?  292 VAL A CG1  11 
ATOM   7747  C CG2  . VAL A 1 14 ? 5.709   3.524   -14.324 1.00 15.00 ?  292 VAL A CG2  11 
ATOM   7748  H H    . VAL A 1 14 ? 6.003   2.259   -10.514 1.00 15.00 ?  292 VAL A H    11 
ATOM   7749  H HA   . VAL A 1 14 ? 4.030   3.169   -12.263 1.00 15.00 ?  292 VAL A HA   11 
ATOM   7750  H HB   . VAL A 1 14 ? 6.447   3.764   -12.349 1.00 15.00 ?  292 VAL A HB   11 
ATOM   7751  H HG11 . VAL A 1 14 ? 7.997   2.305   -13.560 1.00 15.00 ?  292 VAL A HG11 11 
ATOM   7752  H HG12 . VAL A 1 14 ? 6.755   1.054   -13.628 1.00 15.00 ?  292 VAL A HG12 11 
ATOM   7753  H HG13 . VAL A 1 14 ? 7.411   1.559   -12.071 1.00 15.00 ?  292 VAL A HG13 11 
ATOM   7754  H HG21 . VAL A 1 14 ? 5.280   2.745   -14.937 1.00 15.00 ?  292 VAL A HG21 11 
ATOM   7755  H HG22 . VAL A 1 14 ? 6.608   3.897   -14.792 1.00 15.00 ?  292 VAL A HG22 11 
ATOM   7756  H HG23 . VAL A 1 14 ? 4.998   4.329   -14.213 1.00 15.00 ?  292 VAL A HG23 11 
ATOM   7757  N N    . SER A 1 15 ? 4.451   -0.001  -12.370 1.00 15.00 ?  293 SER A N    11 
ATOM   7758  C CA   . SER A 1 15 ? 3.960   -1.254  -12.927 1.00 15.00 ?  293 SER A CA   11 
ATOM   7759  C C    . SER A 1 15 ? 2.432   -1.232  -13.072 1.00 15.00 ?  293 SER A C    11 
ATOM   7760  O O    . SER A 1 15 ? 1.848   -2.078  -13.749 1.00 15.00 ?  293 SER A O    11 
ATOM   7761  C CB   . SER A 1 15 ? 4.377   -2.409  -12.019 1.00 15.00 ?  293 SER A CB   11 
ATOM   7762  O OG   . SER A 1 15 ? 5.625   -2.133  -11.399 1.00 15.00 ?  293 SER A OG   11 
ATOM   7763  H H    . SER A 1 15 ? 4.937   -0.025  -11.520 1.00 15.00 ?  293 SER A H    11 
ATOM   7764  H HA   . SER A 1 15 ? 4.405   -1.389  -13.899 1.00 15.00 ?  293 SER A HA   11 
ATOM   7765  H HB2  . SER A 1 15 ? 3.631   -2.555  -11.252 1.00 15.00 ?  293 SER A HB2  11 
ATOM   7766  H HB3  . SER A 1 15 ? 4.473   -3.311  -12.605 1.00 15.00 ?  293 SER A HB3  11 
ATOM   7767  H HG   . SER A 1 15 ? 6.331   -2.624  -11.854 1.00 15.00 ?  293 SER A HG   11 
ATOM   7768  N N    . GLY A 1 16 ? 1.795   -0.270  -12.414 1.00 15.00 ?  294 GLY A N    11 
ATOM   7769  C CA   . GLY A 1 16 ? 0.353   -0.174  -12.444 1.00 15.00 ?  294 GLY A CA   11 
ATOM   7770  C C    . GLY A 1 16 ? -0.274  -0.964  -11.321 1.00 15.00 ?  294 GLY A C    11 
ATOM   7771  O O    . GLY A 1 16 ? -1.258  -1.680  -11.518 1.00 15.00 ?  294 GLY A O    11 
ATOM   7772  H H    . GLY A 1 16 ? 2.317   0.384   -11.898 1.00 15.00 ?  294 GLY A H    11 
ATOM   7773  H HA2  . GLY A 1 16 ? 0.068   0.864   -12.351 1.00 15.00 ?  294 GLY A HA2  11 
ATOM   7774  H HA3  . GLY A 1 16 ? -0.007  -0.557  -13.386 1.00 15.00 ?  294 GLY A HA3  11 
ATOM   7775  N N    . ARG A 1 17 ? 0.307   -0.836  -10.137 1.00 15.00 ?  295 ARG A N    11 
ATOM   7776  C CA   . ARG A 1 17 ? -0.170  -1.566  -8.971  1.00 15.00 ?  295 ARG A CA   11 
ATOM   7777  C C    . ARG A 1 17 ? 0.065   -0.760  -7.698  1.00 15.00 ?  295 ARG A C    11 
ATOM   7778  O O    . ARG A 1 17 ? 1.196   -0.357  -7.398  1.00 15.00 ?  295 ARG A O    11 
ATOM   7779  C CB   . ARG A 1 17 ? 0.526   -2.935  -8.861  1.00 15.00 ?  295 ARG A CB   11 
ATOM   7780  C CG   . ARG A 1 17 ? 2.038   -2.845  -8.952  1.00 15.00 ?  295 ARG A CG   11 
ATOM   7781  C CD   . ARG A 1 17 ? 2.713   -4.200  -8.841  1.00 15.00 ?  295 ARG A CD   11 
ATOM   7782  N NE   . ARG A 1 17 ? 4.170   -4.054  -8.801  1.00 15.00 ?  295 ARG A NE   11 
ATOM   7783  C CZ   . ARG A 1 17 ? 5.008   -4.953  -8.281  1.00 15.00 ?  295 ARG A CZ   11 
ATOM   7784  N NH1  . ARG A 1 17 ? 4.555   -6.104  -7.802  1.00 15.00 1  295 ARG A NH1  11 
ATOM   7785  N NH2  . ARG A 1 17 ? 6.313   -4.696  -8.259  1.00 15.00 ?  295 ARG A NH2  11 
ATOM   7786  H H    . ARG A 1 17 ? 1.071   -0.214  -10.038 1.00 15.00 ?  295 ARG A H    11 
ATOM   7787  H HA   . ARG A 1 17 ? -1.232  -1.722  -9.091  1.00 15.00 ?  295 ARG A HA   11 
ATOM   7788  H HB2  . ARG A 1 17 ? 0.272   -3.374  -7.908  1.00 15.00 ?  295 ARG A HB2  11 
ATOM   7789  H HB3  . ARG A 1 17 ? 0.172   -3.582  -9.650  1.00 15.00 ?  295 ARG A HB3  11 
ATOM   7790  H HG2  . ARG A 1 17 ? 2.303   -2.405  -9.901  1.00 15.00 ?  295 ARG A HG2  11 
ATOM   7791  H HG3  . ARG A 1 17 ? 2.396   -2.211  -8.153  1.00 15.00 ?  295 ARG A HG3  11 
ATOM   7792  H HD2  . ARG A 1 17 ? 2.375   -4.689  -7.937  1.00 15.00 ?  295 ARG A HD2  11 
ATOM   7793  H HD3  . ARG A 1 17 ? 2.441   -4.797  -9.699  1.00 15.00 ?  295 ARG A HD3  11 
ATOM   7794  H HE   . ARG A 1 17 ? 4.542   -3.224  -9.175  1.00 15.00 ?  295 ARG A HE   11 
ATOM   7795  H HH11 . ARG A 1 17 ? 3.561   -6.320  -7.832  1.00 15.00 ?  295 ARG A HH11 11 
ATOM   7796  H HH12 . ARG A 1 17 ? 5.192   -6.776  -7.400  1.00 15.00 ?  295 ARG A HH12 11 
ATOM   7797  H HH21 . ARG A 1 17 ? 6.664   -3.839  -8.635  1.00 15.00 ?  295 ARG A HH21 11 
ATOM   7798  H HH22 . ARG A 1 17 ? 6.956   -5.364  -7.859  1.00 15.00 ?  295 ARG A HH22 11 
ATOM   7799  N N    . ILE A 1 18 ? -1.009  -0.510  -6.966  1.00 15.00 ?  296 ILE A N    11 
ATOM   7800  C CA   . ILE A 1 18 ? -0.904  0.063   -5.637  1.00 15.00 ?  296 ILE A CA   11 
ATOM   7801  C C    . ILE A 1 18 ? -0.789  -1.087  -4.646  1.00 15.00 ?  296 ILE A C    11 
ATOM   7802  O O    . ILE A 1 18 ? -1.417  -2.132  -4.827  1.00 15.00 ?  296 ILE A O    11 
ATOM   7803  C CB   . ILE A 1 18 ? -2.118  0.968   -5.287  1.00 15.00 ?  296 ILE A CB   11 
ATOM   7804  C CG1  . ILE A 1 18 ? -1.874  1.735   -3.974  1.00 15.00 ?  296 ILE A CG1  11 
ATOM   7805  C CG2  . ILE A 1 18 ? -3.401  0.147   -5.195  1.00 15.00 ?  296 ILE A CG2  11 
ATOM   7806  C CD1  . ILE A 1 18 ? -3.028  2.629   -3.567  1.00 15.00 ?  296 ILE A CD1  11 
ATOM   7807  H H    . ILE A 1 18 ? -1.894  -0.731  -7.322  1.00 15.00 ?  296 ILE A H    11 
ATOM   7808  H HA   . ILE A 1 18 ? 0.000   0.657   -5.597  1.00 15.00 ?  296 ILE A HA   11 
ATOM   7809  H HB   . ILE A 1 18 ? -2.241  1.681   -6.089  1.00 15.00 ?  296 ILE A HB   11 
ATOM   7810  H HG12 . ILE A 1 18 ? -1.704  1.034   -3.176  1.00 15.00 ?  296 ILE A HG12 11 
ATOM   7811  H HG13 . ILE A 1 18 ? -1.001  2.359   -4.084  1.00 15.00 ?  296 ILE A HG13 11 
ATOM   7812  H HG21 . ILE A 1 18 ? -4.230  0.798   -4.959  1.00 15.00 ?  296 ILE A HG21 11 
ATOM   7813  H HG22 . ILE A 1 18 ? -3.297  -0.596  -4.418  1.00 15.00 ?  296 ILE A HG22 11 
ATOM   7814  H HG23 . ILE A 1 18 ? -3.583  -0.343  -6.140  1.00 15.00 ?  296 ILE A HG23 11 
ATOM   7815  H HD11 . ILE A 1 18 ? -3.916  2.029   -3.437  1.00 15.00 ?  296 ILE A HD11 11 
ATOM   7816  H HD12 . ILE A 1 18 ? -3.200  3.367   -4.336  1.00 15.00 ?  296 ILE A HD12 11 
ATOM   7817  H HD13 . ILE A 1 18 ? -2.788  3.124   -2.638  1.00 15.00 ?  296 ILE A HD13 11 
ATOM   7818  N N    . TYR A 1 19 ? 0.022   -0.920  -3.623  1.00 15.00 ?  297 TYR A N    11 
ATOM   7819  C CA   . TYR A 1 19 ? 0.283   -2.013  -2.709  1.00 15.00 ?  297 TYR A CA   11 
ATOM   7820  C C    . TYR A 1 19 ? 0.571   -1.402  -1.372  1.00 15.00 ?  297 TYR A C    11 
ATOM   7821  O O    . TYR A 1 19 ? 1.346   -0.443  -1.259  1.00 15.00 ?  297 TYR A O    11 
ATOM   7822  C CB   . TYR A 1 19 ? 1.410   -2.960  -3.197  1.00 15.00 ?  297 TYR A CB   11 
ATOM   7823  C CG   . TYR A 1 19 ? 2.829   -2.635  -2.771  1.00 15.00 ?  297 TYR A CG   11 
ATOM   7824  C CD1  . TYR A 1 19 ? 3.509   -1.561  -3.312  1.00 15.00 ?  297 TYR A CD1  11 
ATOM   7825  C CD2  . TYR A 1 19 ? 3.501   -3.432  -1.838  1.00 15.00 ?  297 TYR A CD2  11 
ATOM   7826  C CE1  . TYR A 1 19 ? 4.804   -1.281  -2.937  1.00 15.00 ?  297 TYR A CE1  11 
ATOM   7827  C CE2  . TYR A 1 19 ? 4.795   -3.152  -1.461  1.00 15.00 ?  297 TYR A CE2  11 
ATOM   7828  C CZ   . TYR A 1 19 ? 5.441   -2.074  -2.011  1.00 15.00 ?  297 TYR A CZ   11 
ATOM   7829  O OH   . TYR A 1 19 ? 6.736   -1.791  -1.641  1.00 15.00 ?  297 TYR A OH   11 
ATOM   7830  H H    . TYR A 1 19 ? 0.356   -0.015  -3.403  1.00 15.00 ?  297 TYR A H    11 
ATOM   7831  H HA   . TYR A 1 19 ? -0.635  -2.580  -2.624  1.00 15.00 ?  297 TYR A HA   11 
ATOM   7832  H HB2  . TYR A 1 19 ? 1.196   -3.956  -2.845  1.00 15.00 ?  297 TYR A HB2  11 
ATOM   7833  H HB3  . TYR A 1 19 ? 1.393   -2.968  -4.278  1.00 15.00 ?  297 TYR A HB3  11 
ATOM   7834  H HD1  . TYR A 1 19 ? 3.008   -0.932  -4.034  1.00 15.00 ?  297 TYR A HD1  11 
ATOM   7835  H HD2  . TYR A 1 19 ? 3.002   -4.285  -1.409  1.00 15.00 ?  297 TYR A HD2  11 
ATOM   7836  H HE1  . TYR A 1 19 ? 5.317   -0.438  -3.373  1.00 15.00 ?  297 TYR A HE1  11 
ATOM   7837  H HE2  . TYR A 1 19 ? 5.295   -3.776  -0.735  1.00 15.00 ?  297 TYR A HE2  11 
ATOM   7838  H HH   . TYR A 1 19 ? 6.799   -0.877  -1.353  1.00 15.00 ?  297 TYR A HH   11 
ATOM   7839  N N    . PHE A 1 20 ? -0.077  -1.912  -0.367  1.00 15.00 ?  298 PHE A N    11 
ATOM   7840  C CA   . PHE A 1 20 ? -0.116  -1.208  0.860   1.00 15.00 ?  298 PHE A CA   11 
ATOM   7841  C C    . PHE A 1 20 ? 0.986   -1.529  1.800   1.00 15.00 ?  298 PHE A C    11 
ATOM   7842  O O    . PHE A 1 20 ? 1.314   -2.686  2.043   1.00 15.00 ?  298 PHE A O    11 
ATOM   7843  C CB   . PHE A 1 20 ? -1.437  -1.380  1.523   1.00 15.00 ?  298 PHE A CB   11 
ATOM   7844  C CG   . PHE A 1 20 ? -2.216  -0.181  1.249   1.00 15.00 ?  298 PHE A CG   11 
ATOM   7845  C CD1  . PHE A 1 20 ? -1.796  1.012   1.793   1.00 15.00 ?  298 PHE A CD1  11 
ATOM   7846  C CD2  . PHE A 1 20 ? -3.314  -0.213  0.423   1.00 15.00 ?  298 PHE A CD2  11 
ATOM   7847  C CE1  . PHE A 1 20 ? -2.466  2.158   1.532   1.00 15.00 ?  298 PHE A CE1  11 
ATOM   7848  C CE2  . PHE A 1 20 ? -3.996  0.939   0.159   1.00 15.00 ?  298 PHE A CE2  11 
ATOM   7849  C CZ   . PHE A 1 20 ? -3.565  2.119   0.720   1.00 15.00 ?  298 PHE A CZ   11 
ATOM   7850  H H    . PHE A 1 20 ? -0.585  -2.744  -0.472  1.00 15.00 ?  298 PHE A H    11 
ATOM   7851  H HA   . PHE A 1 20 ? -0.031  -0.167  0.598   1.00 15.00 ?  298 PHE A HA   11 
ATOM   7852  H HB2  . PHE A 1 20 ? -1.952  -2.242  1.118   1.00 15.00 ?  298 PHE A HB2  11 
ATOM   7853  H HB3  . PHE A 1 20 ? -1.314  -1.479  2.590   1.00 15.00 ?  298 PHE A HB3  11 
ATOM   7854  H HD1  . PHE A 1 20 ? -0.937  1.029   2.444   1.00 15.00 ?  298 PHE A HD1  11 
ATOM   7855  H HD2  . PHE A 1 20 ? -3.636  -1.150  -0.010  1.00 15.00 ?  298 PHE A HD2  11 
ATOM   7856  H HE1  . PHE A 1 20 ? -2.138  3.093   1.960   1.00 15.00 ?  298 PHE A HE1  11 
ATOM   7857  H HE2  . PHE A 1 20 ? -4.864  0.926   -0.480  1.00 15.00 ?  298 PHE A HE2  11 
ATOM   7858  H HZ   . PHE A 1 20 ? -4.091  2.994   0.545   1.00 15.00 ?  298 PHE A HZ   11 
ATOM   7859  N N    . VAL A 1 21 ? 1.509   -0.451  2.344   1.00 15.00 ?  299 VAL A N    11 
ATOM   7860  C CA   . VAL A 1 21 ? 2.558   -0.480  3.300   1.00 15.00 ?  299 VAL A CA   11 
ATOM   7861  C C    . VAL A 1 21 ? 2.168   0.445   4.460   1.00 15.00 ?  299 VAL A C    11 
ATOM   7862  O O    . VAL A 1 21 ? 2.405   1.659   4.447   1.00 15.00 ?  299 VAL A O    11 
ATOM   7863  C CB   . VAL A 1 21 ? 3.883   -0.041  2.628   1.00 15.00 ?  299 VAL A CB   11 
ATOM   7864  C CG1  . VAL A 1 21 ? 4.313   -1.059  1.577   1.00 15.00 ?  299 VAL A CG1  11 
ATOM   7865  C CG2  . VAL A 1 21 ? 3.724   1.316   1.965   1.00 15.00 ?  299 VAL A CG2  11 
ATOM   7866  H H    . VAL A 1 21 ? 1.152   0.426   2.091   1.00 15.00 ?  299 VAL A H    11 
ATOM   7867  H HA   . VAL A 1 21 ? 2.665   -1.492  3.664   1.00 15.00 ?  299 VAL A HA   11 
ATOM   7868  H HB   . VAL A 1 21 ? 4.652   0.029   3.383   1.00 15.00 ?  299 VAL A HB   11 
ATOM   7869  H HG11 . VAL A 1 21 ? 3.586   -1.079  0.780   1.00 15.00 ?  299 VAL A HG11 11 
ATOM   7870  H HG12 . VAL A 1 21 ? 4.379   -2.039  2.023   1.00 15.00 ?  299 VAL A HG12 11 
ATOM   7871  H HG13 . VAL A 1 21 ? 5.276   -0.778  1.177   1.00 15.00 ?  299 VAL A HG13 11 
ATOM   7872  H HG21 . VAL A 1 21 ? 2.965   1.257   1.200   1.00 15.00 ?  299 VAL A HG21 11 
ATOM   7873  H HG22 . VAL A 1 21 ? 4.664   1.610   1.520   1.00 15.00 ?  299 VAL A HG22 11 
ATOM   7874  H HG23 . VAL A 1 21 ? 3.433   2.043   2.706   1.00 15.00 ?  299 VAL A HG23 11 
ATOM   7875  N N    . ASP A 1 22 ? 1.496   -0.116  5.439   1.00 15.00 ?  300 ASP A N    11 
ATOM   7876  C CA   . ASP A 1 22 ? 1.110   0.657   6.601   1.00 15.00 ?  300 ASP A CA   11 
ATOM   7877  C C    . ASP A 1 22 ? 2.216   0.563   7.634   1.00 15.00 ?  300 ASP A C    11 
ATOM   7878  O O    . ASP A 1 22 ? 2.627   -0.534  8.023   1.00 15.00 ?  300 ASP A O    11 
ATOM   7879  C CB   . ASP A 1 22 ? -0.244  0.186   7.160   1.00 15.00 ?  300 ASP A CB   11 
ATOM   7880  C CG   . ASP A 1 22 ? -0.259  0.099   8.677   1.00 15.00 ?  300 ASP A CG   11 
ATOM   7881  O OD1  . ASP A 1 22 ? -0.219  1.153   9.344   1.00 15.00 -1 300 ASP A OD1  11 
ATOM   7882  O OD2  . ASP A 1 22 ? -0.284  -1.025  9.206   1.00 15.00 ?  300 ASP A OD2  11 
ATOM   7883  H H    . ASP A 1 22 ? 1.253   -1.067  5.383   1.00 15.00 ?  300 ASP A H    11 
ATOM   7884  H HA   . ASP A 1 22 ? 1.021   1.689   6.291   1.00 15.00 ?  300 ASP A HA   11 
ATOM   7885  H HB2  . ASP A 1 22 ? -1.004  0.891   6.859   1.00 15.00 ?  300 ASP A HB2  11 
ATOM   7886  H HB3  . ASP A 1 22 ? -0.485  -0.786  6.750   1.00 15.00 ?  300 ASP A HB3  11 
ATOM   7887  N N    . HIS A 1 23 ? 2.721   1.718   8.044   1.00 15.00 ?  301 HIS A N    11 
ATOM   7888  C CA   . HIS A 1 23 ? 3.875   1.763   8.928   1.00 15.00 ?  301 HIS A CA   11 
ATOM   7889  C C    . HIS A 1 23 ? 3.444   1.670   10.385  1.00 15.00 ?  301 HIS A C    11 
ATOM   7890  O O    . HIS A 1 23 ? 4.271   1.440   11.267  1.00 15.00 ?  301 HIS A O    11 
ATOM   7891  C CB   . HIS A 1 23 ? 4.686   3.057   8.757   1.00 15.00 ?  301 HIS A CB   11 
ATOM   7892  C CG   . HIS A 1 23 ? 5.076   3.434   7.355   1.00 15.00 ?  301 HIS A CG   11 
ATOM   7893  N ND1  . HIS A 1 23 ? 5.181   4.744   6.956   1.00 15.00 ?  301 HIS A ND1  11 
ATOM   7894  C CD2  . HIS A 1 23 ? 5.490   2.693   6.300   1.00 15.00 ?  301 HIS A CD2  11 
ATOM   7895  C CE1  . HIS A 1 23 ? 5.651   4.789   5.731   1.00 15.00 ?  301 HIS A CE1  11 
ATOM   7896  N NE2  . HIS A 1 23 ? 5.856   3.559   5.303   1.00 15.00 ?  301 HIS A NE2  11 
ATOM   7897  H H    . HIS A 1 23 ? 2.294   2.556   7.760   1.00 15.00 ?  301 HIS A H    11 
ATOM   7898  H HA   . HIS A 1 23 ? 4.506   0.920   8.695   1.00 15.00 ?  301 HIS A HA   11 
ATOM   7899  H HB2  . HIS A 1 23 ? 4.121   3.874   9.160   1.00 15.00 ?  301 HIS A HB2  11 
ATOM   7900  H HB3  . HIS A 1 23 ? 5.599   2.957   9.326   1.00 15.00 ?  301 HIS A HB3  11 
ATOM   7901  H HD1  . HIS A 1 23 ? 4.918   5.529   7.482   1.00 15.00 ?  301 HIS A HD1  11 
ATOM   7902  H HD2  . HIS A 1 23 ? 5.502   1.617   6.237   1.00 15.00 ?  301 HIS A HD2  11 
ATOM   7903  H HE1  . HIS A 1 23 ? 5.834   5.690   5.159   1.00 15.00 ?  301 HIS A HE1  11 
ATOM   7904  H HE2  . HIS A 1 23 ? 6.500   3.334   4.591   1.00 15.00 ?  301 HIS A HE2  11 
ATOM   7905  N N    . ASN A 1 24 ? 2.154   1.861   10.635  1.00 15.00 ?  302 ASN A N    11 
ATOM   7906  C CA   . ASN A 1 24 ? 1.657   1.955   12.001  1.00 15.00 ?  302 ASN A CA   11 
ATOM   7907  C C    . ASN A 1 24 ? 1.424   0.572   12.590  1.00 15.00 ?  302 ASN A C    11 
ATOM   7908  O O    . ASN A 1 24 ? 2.031   0.206   13.598  1.00 15.00 ?  302 ASN A O    11 
ATOM   7909  C CB   . ASN A 1 24 ? 0.357   2.766   12.051  1.00 15.00 ?  302 ASN A CB   11 
ATOM   7910  C CG   . ASN A 1 24 ? -0.095  3.055   13.473  1.00 15.00 ?  302 ASN A CG   11 
ATOM   7911  O OD1  . ASN A 1 24 ? -1.290  3.047   13.772  1.00 15.00 ?  302 ASN A OD1  11 
ATOM   7912  N ND2  . ASN A 1 24 ? 0.851   3.345   14.356  1.00 15.00 ?  302 ASN A ND2  11 
ATOM   7913  H H    . ASN A 1 24 ? 1.514   1.911   9.885   1.00 15.00 ?  302 ASN A H    11 
ATOM   7914  H HA   . ASN A 1 24 ? 2.407   2.461   12.590  1.00 15.00 ?  302 ASN A HA   11 
ATOM   7915  H HB2  . ASN A 1 24 ? 0.507   3.707   11.543  1.00 15.00 ?  302 ASN A HB2  11 
ATOM   7916  H HB3  . ASN A 1 24 ? -0.423  2.212   11.552  1.00 15.00 ?  302 ASN A HB3  11 
ATOM   7917  H HD21 . ASN A 1 24 ? 1.789   3.360   14.049  1.00 15.00 ?  302 ASN A HD21 11 
ATOM   7918  H HD22 . ASN A 1 24 ? 0.580   3.532   15.283  1.00 15.00 ?  302 ASN A HD22 11 
ATOM   7919  N N    . ASN A 1 25 ? 0.541   -0.190  11.967  1.00 15.00 ?  303 ASN A N    11 
ATOM   7920  C CA   . ASN A 1 25 ? 0.232   -1.538  12.435  1.00 15.00 ?  303 ASN A CA   11 
ATOM   7921  C C    . ASN A 1 25 ? 1.151   -2.562  11.771  1.00 15.00 ?  303 ASN A C    11 
ATOM   7922  O O    . ASN A 1 25 ? 1.249   -3.709  12.217  1.00 15.00 ?  303 ASN A O    11 
ATOM   7923  C CB   . ASN A 1 25 ? -1.235  -1.871  12.142  1.00 15.00 ?  303 ASN A CB   11 
ATOM   7924  C CG   . ASN A 1 25 ? -1.698  -3.166  12.782  1.00 15.00 ?  303 ASN A CG   11 
ATOM   7925  O OD1  . ASN A 1 25 ? -2.538  -3.877  12.227  1.00 15.00 ?  303 ASN A OD1  11 
ATOM   7926  N ND2  . ASN A 1 25 ? -1.188  -3.470  13.967  1.00 15.00 ?  303 ASN A ND2  11 
ATOM   7927  H H    . ASN A 1 25 ? 0.072   0.165   11.170  1.00 15.00 ?  303 ASN A H    11 
ATOM   7928  H HA   . ASN A 1 25 ? 0.393   -1.564  13.502  1.00 15.00 ?  303 ASN A HA   11 
ATOM   7929  H HB2  . ASN A 1 25 ? -1.856  -1.070  12.513  1.00 15.00 ?  303 ASN A HB2  11 
ATOM   7930  H HB3  . ASN A 1 25 ? -1.368  -1.953  11.072  1.00 15.00 ?  303 ASN A HB3  11 
ATOM   7931  H HD21 . ASN A 1 25 ? -0.542  -2.852  14.365  1.00 15.00 ?  303 ASN A HD21 11 
ATOM   7932  H HD22 . ASN A 1 25 ? -1.483  -4.304  14.398  1.00 15.00 ?  303 ASN A HD22 11 
ATOM   7933  N N    . ARG A 1 26 ? 1.818   -2.124  10.702  1.00 15.00 ?  304 ARG A N    11 
ATOM   7934  C CA   . ARG A 1 26 ? 2.698   -2.967  9.905   1.00 15.00 ?  304 ARG A CA   11 
ATOM   7935  C C    . ARG A 1 26 ? 1.892   -4.037  9.180   1.00 15.00 ?  304 ARG A C    11 
ATOM   7936  O O    . ARG A 1 26 ? 1.762   -5.172  9.646   1.00 15.00 ?  304 ARG A O    11 
ATOM   7937  C CB   . ARG A 1 26 ? 3.817   -3.583  10.756  1.00 15.00 ?  304 ARG A CB   11 
ATOM   7938  C CG   . ARG A 1 26 ? 4.804   -4.423  9.961   1.00 15.00 ?  304 ARG A CG   11 
ATOM   7939  C CD   . ARG A 1 26 ? 6.004   -4.817  10.807  1.00 15.00 ?  304 ARG A CD   11 
ATOM   7940  N NE   . ARG A 1 26 ? 5.616   -5.583  11.989  1.00 15.00 ?  304 ARG A NE   11 
ATOM   7941  C CZ   . ARG A 1 26 ? 6.176   -5.437  13.189  1.00 15.00 ?  304 ARG A CZ   11 
ATOM   7942  N NH1  . ARG A 1 26 ? 7.173   -4.573  13.363  1.00 15.00 1  304 ARG A NH1  11 
ATOM   7943  N NH2  . ARG A 1 26 ? 5.748   -6.157  14.215  1.00 15.00 ?  304 ARG A NH2  11 
ATOM   7944  H H    . ARG A 1 26 ? 1.687   -1.197  10.420  1.00 15.00 ?  304 ARG A H    11 
ATOM   7945  H HA   . ARG A 1 26 ? 3.150   -2.330  9.158   1.00 15.00 ?  304 ARG A HA   11 
ATOM   7946  H HB2  . ARG A 1 26 ? 4.364   -2.788  11.240  1.00 15.00 ?  304 ARG A HB2  11 
ATOM   7947  H HB3  . ARG A 1 26 ? 3.371   -4.213  11.512  1.00 15.00 ?  304 ARG A HB3  11 
ATOM   7948  H HG2  . ARG A 1 26 ? 4.307   -5.318  9.618   1.00 15.00 ?  304 ARG A HG2  11 
ATOM   7949  H HG3  . ARG A 1 26 ? 5.146   -3.850  9.111   1.00 15.00 ?  304 ARG A HG3  11 
ATOM   7950  H HD2  . ARG A 1 26 ? 6.671   -5.418  10.206  1.00 15.00 ?  304 ARG A HD2  11 
ATOM   7951  H HD3  . ARG A 1 26 ? 6.515   -3.920  11.123  1.00 15.00 ?  304 ARG A HD3  11 
ATOM   7952  H HE   . ARG A 1 26 ? 4.891   -6.242  11.878  1.00 15.00 ?  304 ARG A HE   11 
ATOM   7953  H HH11 . ARG A 1 26 ? 7.507   -4.018  12.589  1.00 15.00 ?  304 ARG A HH11 11 
ATOM   7954  H HH12 . ARG A 1 26 ? 7.601   -4.478  14.263  1.00 15.00 ?  304 ARG A HH12 11 
ATOM   7955  H HH21 . ARG A 1 26 ? 4.997   -6.819  14.096  1.00 15.00 ?  304 ARG A HH21 11 
ATOM   7956  H HH22 . ARG A 1 26 ? 6.158   -6.032  15.130  1.00 15.00 ?  304 ARG A HH22 11 
ATOM   7957  N N    . THR A 1 27 ? 1.300   -3.644  8.064   1.00 15.00 ?  305 THR A N    11 
ATOM   7958  C CA   . THR A 1 27 ? 0.487   -4.550  7.275   1.00 15.00 ?  305 THR A CA   11 
ATOM   7959  C C    . THR A 1 27 ? 0.538   -4.172  5.797   1.00 15.00 ?  305 THR A C    11 
ATOM   7960  O O    . THR A 1 27 ? 0.746   -3.004  5.449   1.00 15.00 ?  305 THR A O    11 
ATOM   7961  C CB   . THR A 1 27 ? -0.983  -4.578  7.765   1.00 15.00 ?  305 THR A CB   11 
ATOM   7962  O OG1  . THR A 1 27 ? -1.694  -5.648  7.130   1.00 15.00 ?  305 THR A OG1  11 
ATOM   7963  C CG2  . THR A 1 27 ? -1.695  -3.263  7.478   1.00 15.00 ?  305 THR A CG2  11 
ATOM   7964  H H    . THR A 1 27 ? 1.403   -2.709  7.770   1.00 15.00 ?  305 THR A H    11 
ATOM   7965  H HA   . THR A 1 27 ? 0.898   -5.544  7.390   1.00 15.00 ?  305 THR A HA   11 
ATOM   7966  H HB   . THR A 1 27 ? -0.984  -4.743  8.832   1.00 15.00 ?  305 THR A HB   11 
ATOM   7967  H HG1  . THR A 1 27 ? -1.581  -6.461  7.646   1.00 15.00 ?  305 THR A HG1  11 
ATOM   7968  H HG21 . THR A 1 27 ? -1.182  -2.457  7.984   1.00 15.00 ?  305 THR A HG21 11 
ATOM   7969  H HG22 . THR A 1 27 ? -2.713  -3.321  7.834   1.00 15.00 ?  305 THR A HG22 11 
ATOM   7970  H HG23 . THR A 1 27 ? -1.695  -3.078  6.415   1.00 15.00 ?  305 THR A HG23 11 
ATOM   7971  N N    . THR A 1 28 ? 0.393   -5.169  4.936   1.00 15.00 ?  306 THR A N    11 
ATOM   7972  C CA   . THR A 1 28 ? 0.378   -4.945  3.503   1.00 15.00 ?  306 THR A CA   11 
ATOM   7973  C C    . THR A 1 28 ? -0.980  -5.330  2.921   1.00 15.00 ?  306 THR A C    11 
ATOM   7974  O O    . THR A 1 28 ? -1.628  -6.264  3.393   1.00 15.00 ?  306 THR A O    11 
ATOM   7975  C CB   . THR A 1 28 ? 1.498   -5.728  2.788   1.00 15.00 ?  306 THR A CB   11 
ATOM   7976  O OG1  . THR A 1 28 ? 1.390   -5.547  1.375   1.00 15.00 ?  306 THR A OG1  11 
ATOM   7977  C CG2  . THR A 1 28 ? 1.453   -7.207  3.141   1.00 15.00 ?  306 THR A CG2  11 
ATOM   7978  H H    . THR A 1 28 ? 0.272   -6.079  5.277   1.00 15.00 ?  306 THR A H    11 
ATOM   7979  H HA   . THR A 1 28 ? 0.542   -3.890  3.335   1.00 15.00 ?  306 THR A HA   11 
ATOM   7980  H HB   . THR A 1 28 ? 2.445   -5.337  3.106   1.00 15.00 ?  306 THR A HB   11 
ATOM   7981  H HG1  . THR A 1 28 ? 1.839   -4.729  1.126   1.00 15.00 ?  306 THR A HG1  11 
ATOM   7982  H HG21 . THR A 1 28 ? 2.234   -7.729  2.607   1.00 15.00 ?  306 THR A HG21 11 
ATOM   7983  H HG22 . THR A 1 28 ? 0.492   -7.616  2.866   1.00 15.00 ?  306 THR A HG22 11 
ATOM   7984  H HG23 . THR A 1 28 ? 1.605   -7.326  4.206   1.00 15.00 ?  306 THR A HG23 11 
ATOM   7985  N N    . GLN A 1 29 ? -1.418  -4.602  1.901   1.00 15.00 ?  307 GLN A N    11 
ATOM   7986  C CA   . GLN A 1 29 ? -2.749  -4.826  1.338   1.00 15.00 ?  307 GLN A CA   11 
ATOM   7987  C C    . GLN A 1 29 ? -2.794  -4.484  -0.158  1.00 15.00 ?  307 GLN A C    11 
ATOM   7988  O O    . GLN A 1 29 ? -2.440  -3.383  -0.553  1.00 15.00 ?  307 GLN A O    11 
ATOM   7989  C CB   . GLN A 1 29 ? -3.765  -3.968  2.104   1.00 15.00 ?  307 GLN A CB   11 
ATOM   7990  C CG   . GLN A 1 29 ? -5.195  -4.472  2.018   1.00 15.00 ?  307 GLN A CG   11 
ATOM   7991  C CD   . GLN A 1 29 ? -5.501  -5.593  3.000   1.00 15.00 ?  307 GLN A CD   11 
ATOM   7992  O OE1  . GLN A 1 29 ? -6.648  -5.769  3.408   1.00 15.00 ?  307 GLN A OE1  11 
ATOM   7993  N NE2  . GLN A 1 29 ? -4.488  -6.342  3.414   1.00 15.00 ?  307 GLN A NE2  11 
ATOM   7994  H H    . GLN A 1 29 ? -0.833  -3.901  1.524   1.00 15.00 ?  307 GLN A H    11 
ATOM   7995  H HA   . GLN A 1 29 ? -2.997  -5.868  1.469   1.00 15.00 ?  307 GLN A HA   11 
ATOM   7996  H HB2  . GLN A 1 29 ? -3.480  -3.940  3.145   1.00 15.00 ?  307 GLN A HB2  11 
ATOM   7997  H HB3  . GLN A 1 29 ? -3.737  -2.963  1.707   1.00 15.00 ?  307 GLN A HB3  11 
ATOM   7998  H HG2  . GLN A 1 29 ? -5.862  -3.649  2.222   1.00 15.00 ?  307 GLN A HG2  11 
ATOM   7999  H HG3  . GLN A 1 29 ? -5.373  -4.832  1.018   1.00 15.00 ?  307 GLN A HG3  11 
ATOM   8000  H HE21 . GLN A 1 29 ? -3.588  -6.140  3.076   1.00 15.00 ?  307 GLN A HE21 11 
ATOM   8001  H HE22 . GLN A 1 29 ? -4.678  -7.067  4.046   1.00 15.00 ?  307 GLN A HE22 11 
ATOM   8002  N N    . PHE A 1 30 ? -3.237  -5.425  -0.989  1.00 15.00 ?  308 PHE A N    11 
ATOM   8003  C CA   . PHE A 1 30 ? -3.357  -5.168  -2.431  1.00 15.00 ?  308 PHE A CA   11 
ATOM   8004  C C    . PHE A 1 30 ? -4.706  -4.558  -2.799  1.00 15.00 ?  308 PHE A C    11 
ATOM   8005  O O    . PHE A 1 30 ? -4.888  -4.059  -3.911  1.00 15.00 ?  308 PHE A O    11 
ATOM   8006  C CB   . PHE A 1 30 ? -3.126  -6.437  -3.252  1.00 15.00 ?  308 PHE A CB   11 
ATOM   8007  C CG   . PHE A 1 30 ? -1.691  -6.653  -3.640  1.00 15.00 ?  308 PHE A CG   11 
ATOM   8008  C CD1  . PHE A 1 30 ? -0.930  -5.602  -4.130  1.00 15.00 ?  308 PHE A CD1  11 
ATOM   8009  C CD2  . PHE A 1 30 ? -1.110  -7.905  -3.541  1.00 15.00 ?  308 PHE A CD2  11 
ATOM   8010  C CE1  . PHE A 1 30 ? 0.386   -5.795  -4.509  1.00 15.00 ?  308 PHE A CE1  11 
ATOM   8011  C CE2  . PHE A 1 30 ? 0.201   -8.099  -3.915  1.00 15.00 ?  308 PHE A CE2  11 
ATOM   8012  C CZ   . PHE A 1 30 ? 0.950   -7.046  -4.399  1.00 15.00 ?  308 PHE A CZ   11 
ATOM   8013  H H    . PHE A 1 30 ? -3.482  -6.303  -0.637  1.00 15.00 ?  308 PHE A H    11 
ATOM   8014  H HA   . PHE A 1 30 ? -2.588  -4.453  -2.688  1.00 15.00 ?  308 PHE A HA   11 
ATOM   8015  H HB2  . PHE A 1 30 ? -3.445  -7.292  -2.675  1.00 15.00 ?  308 PHE A HB2  11 
ATOM   8016  H HB3  . PHE A 1 30 ? -3.711  -6.381  -4.157  1.00 15.00 ?  308 PHE A HB3  11 
ATOM   8017  H HD1  . PHE A 1 30 ? -1.372  -4.622  -4.210  1.00 15.00 ?  308 PHE A HD1  11 
ATOM   8018  H HD2  . PHE A 1 30 ? -1.689  -8.735  -3.167  1.00 15.00 ?  308 PHE A HD2  11 
ATOM   8019  H HE1  . PHE A 1 30 ? 0.972   -4.968  -4.891  1.00 15.00 ?  308 PHE A HE1  11 
ATOM   8020  H HE2  . PHE A 1 30 ? 0.646   -9.079  -3.830  1.00 15.00 ?  308 PHE A HE2  11 
ATOM   8021  H HZ   . PHE A 1 30 ? 1.978   -7.202  -4.695  1.00 15.00 ?  308 PHE A HZ   11 
ATOM   8022  N N    . THR A 1 31 ? -5.659  -4.628  -1.887  1.00 15.00 ?  309 THR A N    11 
ATOM   8023  C CA   . THR A 1 31 ? -6.955  -4.014  -2.114  1.00 15.00 ?  309 THR A CA   11 
ATOM   8024  C C    . THR A 1 31 ? -7.000  -2.635  -1.455  1.00 15.00 ?  309 THR A C    11 
ATOM   8025  O O    . THR A 1 31 ? -6.822  -2.503  -0.242  1.00 15.00 ?  309 THR A O    11 
ATOM   8026  C CB   . THR A 1 31 ? -8.114  -4.915  -1.616  1.00 15.00 ?  309 THR A CB   11 
ATOM   8027  O OG1  . THR A 1 31 ? -9.373  -4.258  -1.801  1.00 15.00 ?  309 THR A OG1  11 
ATOM   8028  C CG2  . THR A 1 31 ? -7.945  -5.299  -0.152  1.00 15.00 ?  309 THR A CG2  11 
ATOM   8029  H H    . THR A 1 31 ? -5.489  -5.090  -1.046  1.00 15.00 ?  309 THR A H    11 
ATOM   8030  H HA   . THR A 1 31 ? -7.065  -3.883  -3.183  1.00 15.00 ?  309 THR A HA   11 
ATOM   8031  H HB   . THR A 1 31 ? -8.111  -5.820  -2.206  1.00 15.00 ?  309 THR A HB   11 
ATOM   8032  H HG1  . THR A 1 31 ? -9.720  -4.467  -2.672  1.00 15.00 ?  309 THR A HG1  11 
ATOM   8033  H HG21 . THR A 1 31 ? -7.017  -5.836  -0.026  1.00 15.00 ?  309 THR A HG21 11 
ATOM   8034  H HG22 . THR A 1 31 ? -8.769  -5.928  0.152   1.00 15.00 ?  309 THR A HG22 11 
ATOM   8035  H HG23 . THR A 1 31 ? -7.930  -4.406  0.456   1.00 15.00 ?  309 THR A HG23 11 
ATOM   8036  N N    . ASP A 1 32 ? -7.193  -1.610  -2.274  1.00 15.00 ?  310 ASP A N    11 
ATOM   8037  C CA   . ASP A 1 32 ? -7.199  -0.234  -1.796  1.00 15.00 ?  310 ASP A CA   11 
ATOM   8038  C C    . ASP A 1 32 ? -8.614  0.232   -1.473  1.00 15.00 ?  310 ASP A C    11 
ATOM   8039  O O    . ASP A 1 32 ? -9.532  0.083   -2.283  1.00 15.00 ?  310 ASP A O    11 
ATOM   8040  C CB   . ASP A 1 32 ? -6.563  0.694   -2.835  1.00 15.00 ?  310 ASP A CB   11 
ATOM   8041  C CG   . ASP A 1 32 ? -6.773  2.159   -2.506  1.00 15.00 ?  310 ASP A CG   11 
ATOM   8042  O OD1  . ASP A 1 32 ? -6.158  2.657   -1.542  1.00 15.00 -1 310 ASP A OD1  11 
ATOM   8043  O OD2  . ASP A 1 32 ? -7.578  2.809   -3.200  1.00 15.00 ?  310 ASP A OD2  11 
ATOM   8044  H H    . ASP A 1 32 ? -7.342  -1.781  -3.226  1.00 15.00 ?  310 ASP A H    11 
ATOM   8045  H HA   . ASP A 1 32 ? -6.612  -0.201  -0.893  1.00 15.00 ?  310 ASP A HA   11 
ATOM   8046  H HB2  . ASP A 1 32 ? -5.501  0.503   -2.878  1.00 15.00 ?  310 ASP A HB2  11 
ATOM   8047  H HB3  . ASP A 1 32 ? -7.001  0.494   -3.803  1.00 15.00 ?  310 ASP A HB3  11 
ATOM   8048  N N    . PRO A 1 33 ? -8.800  0.810   -0.278  1.00 15.00 ?  311 PRO A N    11 
ATOM   8049  C CA   . PRO A 1 33 ? -10.100 1.297   0.174   1.00 15.00 ?  311 PRO A CA   11 
ATOM   8050  C C    . PRO A 1 33 ? -10.526 2.604   -0.505  1.00 15.00 ?  311 PRO A C    11 
ATOM   8051  O O    . PRO A 1 33 ? -11.686 2.994   -0.421  1.00 15.00 ?  311 PRO A O    11 
ATOM   8052  C CB   . PRO A 1 33 ? -9.896  1.496   1.679   1.00 15.00 ?  311 PRO A CB   11 
ATOM   8053  C CG   . PRO A 1 33 ? -8.445  1.798   1.820   1.00 15.00 ?  311 PRO A CG   11 
ATOM   8054  C CD   . PRO A 1 33 ? -7.747  1.023   0.734   1.00 15.00 ?  311 PRO A CD   11 
ATOM   8055  H HA   . PRO A 1 33 ? -10.868 0.555   0.016   1.00 15.00 ?  311 PRO A HA   11 
ATOM   8056  H HB2  . PRO A 1 33 ? -10.512 2.314   2.032   1.00 15.00 ?  311 PRO A HB2  11 
ATOM   8057  H HB3  . PRO A 1 33 ? -10.161 0.589   2.201   1.00 15.00 ?  311 PRO A HB3  11 
ATOM   8058  H HG2  . PRO A 1 33 ? -8.276  2.857   1.693   1.00 15.00 ?  311 PRO A HG2  11 
ATOM   8059  H HG3  . PRO A 1 33 ? -8.097  1.477   2.791   1.00 15.00 ?  311 PRO A HG3  11 
ATOM   8060  H HD2  . PRO A 1 33 ? -6.932  1.601   0.323   1.00 15.00 ?  311 PRO A HD2  11 
ATOM   8061  H HD3  . PRO A 1 33 ? -7.385  0.081   1.117   1.00 15.00 ?  311 PRO A HD3  11 
ATOM   8062  N N    . ARG A 1 34 ? -9.598  3.287   -1.163  1.00 15.00 ?  312 ARG A N    11 
ATOM   8063  C CA   . ARG A 1 34 ? -9.915  4.567   -1.795  1.00 15.00 ?  312 ARG A CA   11 
ATOM   8064  C C    . ARG A 1 34 ? -10.623 4.364   -3.132  1.00 15.00 ?  312 ARG A C    11 
ATOM   8065  O O    . ARG A 1 34 ? -11.683 4.943   -3.369  1.00 15.00 ?  312 ARG A O    11 
ATOM   8066  C CB   . ARG A 1 34 ? -8.654  5.405   -2.021  1.00 15.00 ?  312 ARG A CB   11 
ATOM   8067  C CG   . ARG A 1 34 ? -7.877  5.710   -0.757  1.00 15.00 ?  312 ARG A CG   11 
ATOM   8068  C CD   . ARG A 1 34 ? -6.726  6.662   -1.040  1.00 15.00 ?  312 ARG A CD   11 
ATOM   8069  N NE   . ARG A 1 34 ? -7.196  7.938   -1.586  1.00 15.00 ?  312 ARG A NE   11 
ATOM   8070  C CZ   . ARG A 1 34 ? -7.076  9.108   -0.956  1.00 15.00 ?  312 ARG A CZ   11 
ATOM   8071  N NH1  . ARG A 1 34 ? -6.439  9.174   0.200   1.00 15.00 1  312 ARG A NH1  11 
ATOM   8072  N NH2  . ARG A 1 34 ? -7.566  10.215  -1.494  1.00 15.00 ?  312 ARG A NH2  11 
ATOM   8073  H H    . ARG A 1 34 ? -8.687  2.919   -1.245  1.00 15.00 ?  312 ARG A H    11 
ATOM   8074  H HA   . ARG A 1 34 ? -10.576 5.105   -1.133  1.00 15.00 ?  312 ARG A HA   11 
ATOM   8075  H HB2  . ARG A 1 34 ? -8.002  4.873   -2.696  1.00 15.00 ?  312 ARG A HB2  11 
ATOM   8076  H HB3  . ARG A 1 34 ? -8.939  6.341   -2.476  1.00 15.00 ?  312 ARG A HB3  11 
ATOM   8077  H HG2  . ARG A 1 34 ? -8.540  6.166   -0.038  1.00 15.00 ?  312 ARG A HG2  11 
ATOM   8078  H HG3  . ARG A 1 34 ? -7.481  4.789   -0.356  1.00 15.00 ?  312 ARG A HG3  11 
ATOM   8079  H HD2  . ARG A 1 34 ? -6.195  6.849   -0.119  1.00 15.00 ?  312 ARG A HD2  11 
ATOM   8080  H HD3  . ARG A 1 34 ? -6.058  6.199   -1.753  1.00 15.00 ?  312 ARG A HD3  11 
ATOM   8081  H HE   . ARG A 1 34 ? -7.635  7.914   -2.472  1.00 15.00 ?  312 ARG A HE   11 
ATOM   8082  H HH11 . ARG A 1 34 ? -6.047  8.351   0.607   1.00 15.00 ?  312 ARG A HH11 11 
ATOM   8083  H HH12 . ARG A 1 34 ? -6.334  10.063  0.672   1.00 15.00 ?  312 ARG A HH12 11 
ATOM   8084  H HH21 . ARG A 1 34 ? -8.027  10.187  -2.390  1.00 15.00 ?  312 ARG A HH21 11 
ATOM   8085  H HH22 . ARG A 1 34 ? -7.491  11.093  -1.000  1.00 15.00 ?  312 ARG A HH22 11 
ATOM   8086  N N    . LEU A 1 35 ? -10.019 3.550   -3.993  1.00 15.00 ?  313 LEU A N    11 
ATOM   8087  C CA   . LEU A 1 35 ? -10.517 3.308   -5.350  1.00 15.00 ?  313 LEU A CA   11 
ATOM   8088  C C    . LEU A 1 35 ? -11.988 2.903   -5.358  1.00 15.00 ?  313 LEU A C    11 
ATOM   8089  O O    . LEU A 1 35 ? -12.837 3.755   -5.686  1.00 15.00 ?  313 LEU A O    11 
ATOM   8090  C CB   . LEU A 1 35 ? -9.677  2.224   -6.030  1.00 15.00 ?  313 LEU A CB   11 
ATOM   8091  C CG   . LEU A 1 35 ? -8.194  2.564   -6.196  1.00 15.00 ?  313 LEU A CG   11 
ATOM   8092  C CD1  . LEU A 1 35 ? -7.427  1.361   -6.715  1.00 15.00 ?  313 LEU A CD1  11 
ATOM   8093  C CD2  . LEU A 1 35 ? -8.020  3.752   -7.129  1.00 15.00 ?  313 LEU A CD2  11 
ATOM   8094  H H    . LEU A 1 35 ? -9.187  3.094   -3.705  1.00 15.00 ?  313 LEU A H    11 
ATOM   8095  H HA   . LEU A 1 35 ? -10.410 4.228   -5.907  1.00 15.00 ?  313 LEU A HA   11 
ATOM   8096  H HB2  . LEU A 1 35 ? -9.755  1.319   -5.446  1.00 15.00 ?  313 LEU A HB2  11 
ATOM   8097  H HB3  . LEU A 1 35 ? -10.092 2.039   -7.009  1.00 15.00 ?  313 LEU A HB3  11 
ATOM   8098  H HG   . LEU A 1 35 ? -7.783  2.831   -5.233  1.00 15.00 ?  313 LEU A HG   11 
ATOM   8099  H HD11 . LEU A 1 35 ? -7.520  0.544   -6.015  1.00 15.00 ?  313 LEU A HD11 11 
ATOM   8100  H HD12 . LEU A 1 35 ? -6.384  1.620   -6.829  1.00 15.00 ?  313 LEU A HD12 11 
ATOM   8101  H HD13 . LEU A 1 35 ? -7.830  1.063   -7.672  1.00 15.00 ?  313 LEU A HD13 11 
ATOM   8102  H HD21 . LEU A 1 35 ? -6.968  3.979   -7.232  1.00 15.00 ?  313 LEU A HD21 11 
ATOM   8103  H HD22 . LEU A 1 35 ? -8.535  4.609   -6.722  1.00 15.00 ?  313 LEU A HD22 11 
ATOM   8104  H HD23 . LEU A 1 35 ? -8.432  3.513   -8.099  1.00 15.00 ?  313 LEU A HD23 11 
ATOM   8105  N N    . ASP B 2 2  ? -2.192  -9.100  -7.951  1.00 15.00 ?  221 ASP B N    11 
ATOM   8106  C CA   . ASP B 2 2  ? -0.751  -9.176  -8.278  1.00 15.00 ?  221 ASP B CA   11 
ATOM   8107  C C    . ASP B 2 2  ? -0.043  -10.138 -7.320  1.00 15.00 ?  221 ASP B C    11 
ATOM   8108  O O    . ASP B 2 2  ? -0.630  -10.565 -6.322  1.00 15.00 ?  221 ASP B O    11 
ATOM   8109  C CB   . ASP B 2 2  ? -0.125  -7.770  -8.226  1.00 15.00 ?  221 ASP B CB   11 
ATOM   8110  C CG   . ASP B 2 2  ? 1.339   -7.765  -8.601  1.00 15.00 ?  221 ASP B CG   11 
ATOM   8111  O OD1  . ASP B 2 2  ? 1.703   -8.450  -9.584  1.00 15.00 ?  221 ASP B OD1  11 
ATOM   8112  O OD2  . ASP B 2 2  ? 2.125   -7.076  -7.930  1.00 15.00 -1 221 ASP B OD2  11 
ATOM   8113  H H    . ASP B 2 2  ? -2.696  -8.543  -8.674  1.00 15.00 ?  221 ASP B H    11 
ATOM   8114  H HA   . ASP B 2 2  ? -0.658  -9.565  -9.283  1.00 15.00 ?  221 ASP B HA   11 
ATOM   8115  H HB2  . ASP B 2 2  ? -0.649  -7.125  -8.916  1.00 15.00 ?  221 ASP B HB2  11 
ATOM   8116  H HB3  . ASP B 2 2  ? -0.224  -7.368  -7.228  1.00 15.00 ?  221 ASP B HB3  11 
ATOM   8117  N N    . THR B 2 3  ? 1.201   -10.486 -7.644  1.00 15.00 ?  222 THR B N    11 
ATOM   8118  C CA   . THR B 2 3  ? 2.002   -11.424 -6.857  1.00 15.00 ?  222 THR B CA   11 
ATOM   8119  C C    . THR B 2 3  ? 2.092   -10.977 -5.396  1.00 15.00 ?  222 THR B C    11 
ATOM   8120  O O    . THR B 2 3  ? 2.120   -9.782  -5.128  1.00 15.00 ?  222 THR B O    11 
ATOM   8121  C CB   . THR B 2 3  ? 3.420   -11.560 -7.477  1.00 15.00 ?  222 THR B CB   11 
ATOM   8122  O OG1  . THR B 2 3  ? 4.295   -12.303 -6.622  1.00 15.00 ?  222 THR B OG1  11 
ATOM   8123  C CG2  . THR B 2 3  ? 4.027   -10.193 -7.763  1.00 15.00 ?  222 THR B CG2  11 
ATOM   8124  H H    . THR B 2 3  ? 1.610   -10.075 -8.438  1.00 15.00 ?  222 THR B H    11 
ATOM   8125  H HA   . THR B 2 3  ? 1.517   -12.387 -6.894  1.00 15.00 ?  222 THR B HA   11 
ATOM   8126  H HB   . THR B 2 3  ? 3.327   -12.087 -8.416  1.00 15.00 ?  222 THR B HB   11 
ATOM   8127  H HG1  . THR B 2 3  ? 4.912   -11.695 -6.191  1.00 15.00 ?  222 THR B HG1  11 
ATOM   8128  H HG21 . THR B 2 3  ? 5.003   -10.319 -8.208  1.00 15.00 ?  222 THR B HG21 11 
ATOM   8129  H HG22 . THR B 2 3  ? 4.122   -9.642  -6.838  1.00 15.00 ?  222 THR B HG22 11 
ATOM   8130  H HG23 . THR B 2 3  ? 3.388   -9.649  -8.442  1.00 15.00 ?  222 THR B HG23 11 
ATOM   8131  N N    . PRO B 2 4  ? 2.171   -11.932 -4.436  1.00 15.00 ?  223 PRO B N    11 
ATOM   8132  C CA   . PRO B 2 4  ? 2.090   -11.630 -2.998  1.00 15.00 ?  223 PRO B CA   11 
ATOM   8133  C C    . PRO B 2 4  ? 3.007   -10.480 -2.592  1.00 15.00 ?  223 PRO B C    11 
ATOM   8134  O O    . PRO B 2 4  ? 4.193   -10.461 -2.936  1.00 15.00 ?  223 PRO B O    11 
ATOM   8135  C CB   . PRO B 2 4  ? 2.548   -12.933 -2.344  1.00 15.00 ?  223 PRO B CB   11 
ATOM   8136  C CG   . PRO B 2 4  ? 2.164   -13.993 -3.316  1.00 15.00 ?  223 PRO B CG   11 
ATOM   8137  C CD   . PRO B 2 4  ? 2.316   -13.381 -4.683  1.00 15.00 ?  223 PRO B CD   11 
ATOM   8138  H HA   . PRO B 2 4  ? 1.078   -11.407 -2.697  1.00 15.00 ?  223 PRO B HA   11 
ATOM   8139  H HB2  . PRO B 2 4  ? 3.616   -12.905 -2.188  1.00 15.00 ?  223 PRO B HB2  11 
ATOM   8140  H HB3  . PRO B 2 4  ? 2.042   -13.063 -1.399  1.00 15.00 ?  223 PRO B HB3  11 
ATOM   8141  H HG2  . PRO B 2 4  ? 2.821   -14.843 -3.211  1.00 15.00 ?  223 PRO B HG2  11 
ATOM   8142  H HG3  . PRO B 2 4  ? 1.138   -14.288 -3.151  1.00 15.00 ?  223 PRO B HG3  11 
ATOM   8143  H HD2  . PRO B 2 4  ? 3.292   -13.605 -5.089  1.00 15.00 ?  223 PRO B HD2  11 
ATOM   8144  H HD3  . PRO B 2 4  ? 1.541   -13.736 -5.344  1.00 15.00 ?  223 PRO B HD3  11 
ATOM   8145  N N    . PRO B 2 5  ? 2.462   -9.525  -1.820  1.00 15.00 ?  224 PRO B N    11 
ATOM   8146  C CA   . PRO B 2 5  ? 3.075   -8.208  -1.626  1.00 15.00 ?  224 PRO B CA   11 
ATOM   8147  C C    . PRO B 2 5  ? 4.426   -8.242  -0.933  1.00 15.00 ?  224 PRO B C    11 
ATOM   8148  O O    . PRO B 2 5  ? 4.651   -9.021  -0.002  1.00 15.00 ?  224 PRO B O    11 
ATOM   8149  C CB   . PRO B 2 5  ? 2.065   -7.474  -0.750  1.00 15.00 ?  224 PRO B CB   11 
ATOM   8150  C CG   . PRO B 2 5  ? 1.345   -8.552  -0.034  1.00 15.00 ?  224 PRO B CG   11 
ATOM   8151  C CD   . PRO B 2 5  ? 1.215   -9.659  -1.038  1.00 15.00 ?  224 PRO B CD   11 
ATOM   8152  H HA   . PRO B 2 5  ? 3.174   -7.683  -2.564  1.00 15.00 ?  224 PRO B HA   11 
ATOM   8153  H HB2  . PRO B 2 5  ? 2.586   -6.821  -0.063  1.00 15.00 ?  224 PRO B HB2  11 
ATOM   8154  H HB3  . PRO B 2 5  ? 1.396   -6.896  -1.371  1.00 15.00 ?  224 PRO B HB3  11 
ATOM   8155  H HG2  . PRO B 2 5  ? 1.927   -8.879  0.816   1.00 15.00 ?  224 PRO B HG2  11 
ATOM   8156  H HG3  . PRO B 2 5  ? 0.377   -8.199  0.284   1.00 15.00 ?  224 PRO B HG3  11 
ATOM   8157  H HD2  . PRO B 2 5  ? 1.165   -10.618 -0.543  1.00 15.00 ?  224 PRO B HD2  11 
ATOM   8158  H HD3  . PRO B 2 5  ? 0.348   -9.506  -1.663  1.00 15.00 ?  224 PRO B HD3  11 
ATOM   8159  N N    . PRO B 2 6  ? 5.331   -7.379  -1.405  1.00 15.00 ?  225 PRO B N    11 
ATOM   8160  C CA   . PRO B 2 6  ? 6.623   -7.108  -0.760  1.00 15.00 ?  225 PRO B CA   11 
ATOM   8161  C C    . PRO B 2 6  ? 6.472   -6.656  0.692   1.00 15.00 ?  225 PRO B C    11 
ATOM   8162  O O    . PRO B 2 6  ? 5.363   -6.390  1.162   1.00 15.00 ?  225 PRO B O    11 
ATOM   8163  C CB   . PRO B 2 6  ? 7.175   -5.946  -1.591  1.00 15.00 ?  225 PRO B CB   11 
ATOM   8164  C CG   . PRO B 2 6  ? 6.551   -6.106  -2.926  1.00 15.00 ?  225 PRO B CG   11 
ATOM   8165  C CD   . PRO B 2 6  ? 5.167   -6.604  -2.651  1.00 15.00 ?  225 PRO B CD   11 
ATOM   8166  H HA   . PRO B 2 6  ? 7.291   -7.952  -0.817  1.00 15.00 ?  225 PRO B HA   11 
ATOM   8167  H HB2  . PRO B 2 6  ? 6.894   -5.009  -1.134  1.00 15.00 ?  225 PRO B HB2  11 
ATOM   8168  H HB3  . PRO B 2 6  ? 8.242   -6.011  -1.646  1.00 15.00 ?  225 PRO B HB3  11 
ATOM   8169  H HG2  . PRO B 2 6  ? 6.516   -5.153  -3.435  1.00 15.00 ?  225 PRO B HG2  11 
ATOM   8170  H HG3  . PRO B 2 6  ? 7.101   -6.827  -3.509  1.00 15.00 ?  225 PRO B HG3  11 
ATOM   8171  H HD2  . PRO B 2 6  ? 4.489   -5.776  -2.504  1.00 15.00 ?  225 PRO B HD2  11 
ATOM   8172  H HD3  . PRO B 2 6  ? 4.825   -7.237  -3.456  1.00 15.00 ?  225 PRO B HD3  11 
ATOM   8173  N N    . ALA B 2 7  ? 7.597   -6.555  1.395   1.00 15.00 ?  226 ALA B N    11 
ATOM   8174  C CA   . ALA B 2 7  ? 7.611   -5.955  2.722   1.00 15.00 ?  226 ALA B CA   11 
ATOM   8175  C C    . ALA B 2 7  ? 7.224   -4.484  2.614   1.00 15.00 ?  226 ALA B C    11 
ATOM   8176  O O    . ALA B 2 7  ? 7.215   -3.924  1.517   1.00 15.00 ?  226 ALA B O    11 
ATOM   8177  C CB   . ALA B 2 7  ? 8.984   -6.106  3.360   1.00 15.00 ?  226 ALA B CB   11 
ATOM   8178  H H    . ALA B 2 7  ? 8.433   -6.883  1.008   1.00 15.00 ?  226 ALA B H    11 
ATOM   8179  H HA   . ALA B 2 7  ? 6.885   -6.472  3.334   1.00 15.00 ?  226 ALA B HA   11 
ATOM   8180  H HB1  . ALA B 2 7  ? 9.720   -5.597  2.757   1.00 15.00 ?  226 ALA B HB1  11 
ATOM   8181  H HB2  . ALA B 2 7  ? 9.236   -7.155  3.429   1.00 15.00 ?  226 ALA B HB2  11 
ATOM   8182  H HB3  . ALA B 2 7  ? 8.968   -5.675  4.350   1.00 15.00 ?  226 ALA B HB3  11 
ATOM   8183  N N    . TYR B 2 8  ? 6.910   -3.844  3.729   1.00 15.00 ?  227 TYR B N    11 
ATOM   8184  C CA   . TYR B 2 8  ? 6.419   -2.480  3.658   1.00 15.00 ?  227 TYR B CA   11 
ATOM   8185  C C    . TYR B 2 8  ? 7.561   -1.467  3.729   1.00 15.00 ?  227 TYR B C    11 
ATOM   8186  O O    . TYR B 2 8  ? 8.479   -1.574  4.546   1.00 15.00 ?  227 TYR B O    11 
ATOM   8187  C CB   . TYR B 2 8  ? 5.368   -2.203  4.740   1.00 15.00 ?  227 TYR B CB   11 
ATOM   8188  C CG   . TYR B 2 8  ? 5.931   -1.775  6.075   1.00 15.00 ?  227 TYR B CG   11 
ATOM   8189  C CD1  . TYR B 2 8  ? 6.356   -2.707  7.009   1.00 15.00 ?  227 TYR B CD1  11 
ATOM   8190  C CD2  . TYR B 2 8  ? 6.038   -0.431  6.395   1.00 15.00 ?  227 TYR B CD2  11 
ATOM   8191  C CE1  . TYR B 2 8  ? 6.873   -2.308  8.223   1.00 15.00 ?  227 TYR B CE1  11 
ATOM   8192  C CE2  . TYR B 2 8  ? 6.551   -0.020  7.601   1.00 15.00 ?  227 TYR B CE2  11 
ATOM   8193  C CZ   . TYR B 2 8  ? 6.971   -0.962  8.519   1.00 15.00 ?  227 TYR B CZ   11 
ATOM   8194  O OH   . TYR B 2 8  ? 7.486   -0.563  9.733   1.00 15.00 ?  227 TYR B OH   11 
ATOM   8195  H H    . TYR B 2 8  ? 7.010   -4.287  4.595   1.00 15.00 ?  227 TYR B H    11 
ATOM   8196  H HA   . TYR B 2 8  ? 5.944   -2.370  2.694   1.00 15.00 ?  227 TYR B HA   11 
ATOM   8197  H HB2  . TYR B 2 8  ? 4.717   -1.410  4.386   1.00 15.00 ?  227 TYR B HB2  11 
ATOM   8198  H HB3  . TYR B 2 8  ? 4.782   -3.098  4.897   1.00 15.00 ?  227 TYR B HB3  11 
ATOM   8199  H HD1  . TYR B 2 8  ? 6.281   -3.759  6.775   1.00 15.00 ?  227 TYR B HD1  11 
ATOM   8200  H HD2  . TYR B 2 8  ? 5.706   0.308   5.681   1.00 15.00 ?  227 TYR B HD2  11 
ATOM   8201  H HE1  . TYR B 2 8  ? 7.198   -3.049  8.938   1.00 15.00 ?  227 TYR B HE1  11 
ATOM   8202  H HE2  . TYR B 2 8  ? 6.625   1.043   7.815   1.00 15.00 ?  227 TYR B HE2  11 
ATOM   8203  H HH   . TYR B 2 8  ? 6.901   0.097   10.128  1.00 15.00 ?  227 TYR B HH   11 
ATOM   8204  N N    . LEU B 2 9  ? 7.475   -0.494  2.843   1.00 15.00 ?  228 LEU B N    11 
ATOM   8205  C CA   . LEU B 2 9  ? 8.425   0.602   2.748   1.00 15.00 ?  228 LEU B CA   11 
ATOM   8206  C C    . LEU B 2 9  ? 7.649   1.908   2.711   1.00 15.00 ?  228 LEU B C    11 
ATOM   8207  O O    . LEU B 2 9  ? 6.471   1.901   2.399   1.00 15.00 ?  228 LEU B O    11 
ATOM   8208  C CB   . LEU B 2 9  ? 9.303   0.493   1.486   1.00 15.00 ?  228 LEU B CB   11 
ATOM   8209  C CG   . LEU B 2 9  ? 10.286  -0.682  1.433   1.00 15.00 ?  228 LEU B CG   11 
ATOM   8210  C CD1  . LEU B 2 9  ? 9.591   -1.964  1.001   1.00 15.00 ?  228 LEU B CD1  11 
ATOM   8211  C CD2  . LEU B 2 9  ? 11.438  -0.364  0.492   1.00 15.00 ?  228 LEU B CD2  11 
ATOM   8212  H H    . LEU B 2 9  ? 6.724   -0.507  2.214   1.00 15.00 ?  228 LEU B H    11 
ATOM   8213  H HA   . LEU B 2 9  ? 9.042   0.584   3.631   1.00 15.00 ?  228 LEU B HA   11 
ATOM   8214  H HB2  . LEU B 2 9  ? 8.648   0.418   0.631   1.00 15.00 ?  228 LEU B HB2  11 
ATOM   8215  H HB3  . LEU B 2 9  ? 9.871   1.407   1.396   1.00 15.00 ?  228 LEU B HB3  11 
ATOM   8216  H HG   . LEU B 2 9  ? 10.696  -0.844  2.418   1.00 15.00 ?  228 LEU B HG   11 
ATOM   8217  H HD11 . LEU B 2 9  ? 10.308  -2.770  0.967   1.00 15.00 ?  228 LEU B HD11 11 
ATOM   8218  H HD12 . LEU B 2 9  ? 9.157   -1.826  0.022   1.00 15.00 ?  228 LEU B HD12 11 
ATOM   8219  H HD13 . LEU B 2 9  ? 8.812   -2.206  1.709   1.00 15.00 ?  228 LEU B HD13 11 
ATOM   8220  H HD21 . LEU B 2 9  ? 11.052  -0.171  -0.497  1.00 15.00 ?  228 LEU B HD21 11 
ATOM   8221  H HD22 . LEU B 2 9  ? 12.117  -1.203  0.458   1.00 15.00 ?  228 LEU B HD22 11 
ATOM   8222  H HD23 . LEU B 2 9  ? 11.964  0.510   0.851   1.00 15.00 ?  228 LEU B HD23 11 
ATOM   8223  N N    . PRO B 2 10 ? 8.272   3.049   3.005   1.00 15.00 ?  229 PRO B N    11 
ATOM   8224  C CA   . PRO B 2 10 ? 7.577   4.328   2.897   1.00 15.00 ?  229 PRO B CA   11 
ATOM   8225  C C    . PRO B 2 10 ? 7.709   4.882   1.479   1.00 15.00 ?  229 PRO B C    11 
ATOM   8226  O O    . PRO B 2 10 ? 8.739   4.713   0.829   1.00 15.00 ?  229 PRO B O    11 
ATOM   8227  C CB   . PRO B 2 10 ? 8.336   5.228   3.890   1.00 15.00 ?  229 PRO B CB   11 
ATOM   8228  C CG   . PRO B 2 10 ? 9.302   4.328   4.591   1.00 15.00 ?  229 PRO B CG   11 
ATOM   8229  C CD   . PRO B 2 10 ? 9.568   3.191   3.653   1.00 15.00 ?  229 PRO B CD   11 
ATOM   8230  H HA   . PRO B 2 10 ? 6.544   4.235   3.180   1.00 15.00 ?  229 PRO B HA   11 
ATOM   8231  H HB2  . PRO B 2 10 ? 8.851   6.007   3.346   1.00 15.00 ?  229 PRO B HB2  11 
ATOM   8232  H HB3  . PRO B 2 10 ? 7.636   5.670   4.582   1.00 15.00 ?  229 PRO B HB3  11 
ATOM   8233  H HG2  . PRO B 2 10 ? 10.209  4.861   4.801   1.00 15.00 ?  229 PRO B HG2  11 
ATOM   8234  H HG3  . PRO B 2 10 ? 8.862   3.963   5.508   1.00 15.00 ?  229 PRO B HG3  11 
ATOM   8235  H HD2  . PRO B 2 10 ? 10.336  3.443   2.950   1.00 15.00 ?  229 PRO B HD2  11 
ATOM   8236  H HD3  . PRO B 2 10 ? 9.826   2.300   4.202   1.00 15.00 ?  229 PRO B HD3  11 
ATOM   8237  N N    . PRO B 2 11 ? 6.661   5.578   0.997   1.00 15.00 ?  230 PRO B N    11 
ATOM   8238  C CA   . PRO B 2 11 ? 6.261   5.510   -0.403  1.00 15.00 ?  230 PRO B CA   11 
ATOM   8239  C C    . PRO B 2 11 ? 6.898   6.521   -1.347  1.00 15.00 ?  230 PRO B C    11 
ATOM   8240  O O    . PRO B 2 11 ? 7.073   7.697   -1.023  1.00 15.00 ?  230 PRO B O    11 
ATOM   8241  C CB   . PRO B 2 11 ? 4.765   5.782   -0.292  1.00 15.00 ?  230 PRO B CB   11 
ATOM   8242  C CG   . PRO B 2 11 ? 4.638   6.769   0.821   1.00 15.00 ?  230 PRO B CG   11 
ATOM   8243  C CD   . PRO B 2 11 ? 5.815   6.544   1.739   1.00 15.00 ?  230 PRO B CD   11 
ATOM   8244  H HA   . PRO B 2 11 ? 6.402   4.519   -0.803  1.00 15.00 ?  230 PRO B HA   11 
ATOM   8245  H HB2  . PRO B 2 11 ? 4.402   6.189   -1.223  1.00 15.00 ?  230 PRO B HB2  11 
ATOM   8246  H HB3  . PRO B 2 11 ? 4.245   4.864   -0.066  1.00 15.00 ?  230 PRO B HB3  11 
ATOM   8247  H HG2  . PRO B 2 11 ? 4.661   7.773   0.424   1.00 15.00 ?  230 PRO B HG2  11 
ATOM   8248  H HG3  . PRO B 2 11 ? 3.713   6.599   1.353   1.00 15.00 ?  230 PRO B HG3  11 
ATOM   8249  H HD2  . PRO B 2 11 ? 6.344   7.473   1.900   1.00 15.00 ?  230 PRO B HD2  11 
ATOM   8250  H HD3  . PRO B 2 11 ? 5.477   6.142   2.676   1.00 15.00 ?  230 PRO B HD3  11 
ATOM   8251  N N    . GLU B 2 12 ? 7.224   6.019   -2.529  1.00 15.00 ?  231 GLU B N    11 
ATOM   8252  C CA   . GLU B 2 12 ? 7.519   6.846   -3.685  1.00 15.00 ?  231 GLU B CA   11 
ATOM   8253  C C    . GLU B 2 12 ? 6.242   6.986   -4.521  1.00 15.00 ?  231 GLU B C    11 
ATOM   8254  O O    . GLU B 2 12 ? 5.582   5.984   -4.802  1.00 15.00 ?  231 GLU B O    11 
ATOM   8255  C CB   . GLU B 2 12 ? 8.631   6.215   -4.541  1.00 15.00 ?  231 GLU B CB   11 
ATOM   8256  C CG   . GLU B 2 12 ? 8.510   4.703   -4.694  1.00 15.00 ?  231 GLU B CG   11 
ATOM   8257  C CD   . GLU B 2 12 ? 9.299   3.958   -3.641  1.00 15.00 ?  231 GLU B CD   11 
ATOM   8258  O OE1  . GLU B 2 12 ? 8.772   3.777   -2.529  1.00 15.00 -1 231 GLU B OE1  11 
ATOM   8259  O OE2  . GLU B 2 12 ? 10.435  3.526   -3.925  1.00 15.00 ?  231 GLU B OE2  11 
ATOM   8260  H H    . GLU B 2 12 ? 7.275   5.040   -2.623  1.00 15.00 ?  231 GLU B H    11 
ATOM   8261  H HA   . GLU B 2 12 ? 7.841   7.813   -3.329  1.00 15.00 ?  231 GLU B HA   11 
ATOM   8262  H HB2  . GLU B 2 12 ? 8.605   6.658   -5.525  1.00 15.00 ?  231 GLU B HB2  11 
ATOM   8263  H HB3  . GLU B 2 12 ? 9.585   6.433   -4.084  1.00 15.00 ?  231 GLU B HB3  11 
ATOM   8264  H HG2  . GLU B 2 12 ? 7.470   4.430   -4.593  1.00 15.00 ?  231 GLU B HG2  11 
ATOM   8265  H HG3  . GLU B 2 12 ? 8.862   4.405   -5.674  1.00 15.00 ?  231 GLU B HG3  11 
ATOM   8266  N N    . ASP B 2 13 ? 5.875   8.204   -4.912  1.00 15.00 ?  232 ASP B N    11 
ATOM   8267  C CA   . ASP B 2 13 ? 4.673   8.404   -5.715  1.00 15.00 ?  232 ASP B CA   11 
ATOM   8268  C C    . ASP B 2 13 ? 4.823   9.618   -6.621  1.00 15.00 ?  232 ASP B C    11 
ATOM   8269  O O    . ASP B 2 13 ? 4.899   10.755  -6.148  1.00 15.00 ?  232 ASP B O    11 
ATOM   8270  C CB   . ASP B 2 13 ? 3.439   8.561   -4.818  1.00 15.00 ?  232 ASP B CB   11 
ATOM   8271  C CG   . ASP B 2 13 ? 2.180   8.875   -5.609  1.00 15.00 ?  232 ASP B CG   11 
ATOM   8272  O OD1  . ASP B 2 13 ? 1.706   7.995   -6.358  1.00 15.00 ?  232 ASP B OD1  11 
ATOM   8273  O OD2  . ASP B 2 13 ? 1.656   10.002  -5.479  1.00 15.00 -1 232 ASP B OD2  11 
ATOM   8274  H H    . ASP B 2 13 ? 6.416   8.983   -4.668  1.00 15.00 ?  232 ASP B H    11 
ATOM   8275  H HA   . ASP B 2 13 ? 4.544   7.529   -6.333  1.00 15.00 ?  232 ASP B HA   11 
ATOM   8276  H HB2  . ASP B 2 13 ? 3.279   7.640   -4.275  1.00 15.00 ?  232 ASP B HB2  11 
ATOM   8277  H HB3  . ASP B 2 13 ? 3.611   9.364   -4.115  1.00 15.00 ?  232 ASP B HB3  11 
ATOM   8278  N N    . PRO B 2 14 ? 4.914   9.387   -7.938  1.00 15.00 ?  233 PRO B N    11 
ATOM   8279  C CA   . PRO B 2 14 ? 5.014   10.453  -8.930  1.00 15.00 ?  233 PRO B CA   11 
ATOM   8280  C C    . PRO B 2 14 ? 3.658   11.094  -9.216  1.00 15.00 ?  233 PRO B C    11 
ATOM   8281  O O    . PRO B 2 14 ? 2.974   10.735  -10.174 1.00 15.00 ?  233 PRO B O    11 
ATOM   8282  C CB   . PRO B 2 14 ? 5.545   9.737   -10.186 1.00 15.00 ?  233 PRO B CB   11 
ATOM   8283  C CG   . PRO B 2 14 ? 5.802   8.319   -9.779  1.00 15.00 ?  233 PRO B CG   11 
ATOM   8284  C CD   . PRO B 2 14 ? 4.949   8.068   -8.570  1.00 15.00 ?  233 PRO B CD   11 
ATOM   8285  H HA   . PRO B 2 14 ? 5.714   11.216  -8.622  1.00 15.00 ?  233 PRO B HA   11 
ATOM   8286  H HB2  . PRO B 2 14 ? 4.804   9.791   -10.969 1.00 15.00 ?  233 PRO B HB2  11 
ATOM   8287  H HB3  . PRO B 2 14 ? 6.454   10.219  -10.516 1.00 15.00 ?  233 PRO B HB3  11 
ATOM   8288  H HG2  . PRO B 2 14 ? 5.520   7.651   -10.580 1.00 15.00 ?  233 PRO B HG2  11 
ATOM   8289  H HG3  . PRO B 2 14 ? 6.845   8.193   -9.534  1.00 15.00 ?  233 PRO B HG3  11 
ATOM   8290  H HD2  . PRO B 2 14 ? 3.958   7.749   -8.861  1.00 15.00 ?  233 PRO B HD2  11 
ATOM   8291  H HD3  . PRO B 2 14 ? 5.412   7.339   -7.922  1.00 15.00 ?  233 PRO B HD3  11 
HETATM 8292  N N    . NH2 B 2 15 ? 3.272   12.044  -8.378  1.00 15.00 ?  234 NH2 B N    11 
HETATM 8293  H HN1  . NH2 B 2 15 ? 3.868   12.278  -7.638  1.00 15.00 ?  234 NH2 B HN1  11 
HETATM 8294  H HN2  . NH2 B 2 15 ? 2.406   12.472  -8.534  1.00 15.00 ?  234 NH2 B HN2  11 
ATOM   8295  N N    . LEU A 1 1  ? -14.769 3.952   -2.616  1.00 15.00 ?  279 LEU A N    12 
ATOM   8296  C CA   . LEU A 1 1  ? -15.727 4.685   -1.754  1.00 15.00 ?  279 LEU A CA   12 
ATOM   8297  C C    . LEU A 1 1  ? -15.435 4.469   -0.270  1.00 15.00 ?  279 LEU A C    12 
ATOM   8298  O O    . LEU A 1 1  ? -16.145 4.999   0.587   1.00 15.00 ?  279 LEU A O    12 
ATOM   8299  C CB   . LEU A 1 1  ? -17.170 4.261   -2.084  1.00 15.00 ?  279 LEU A CB   12 
ATOM   8300  C CG   . LEU A 1 1  ? -17.449 2.747   -2.126  1.00 15.00 ?  279 LEU A CG   12 
ATOM   8301  C CD1  . LEU A 1 1  ? -17.495 2.142   -0.728  1.00 15.00 ?  279 LEU A CD1  12 
ATOM   8302  C CD2  . LEU A 1 1  ? -18.752 2.473   -2.860  1.00 15.00 ?  279 LEU A CD2  12 
ATOM   8303  H H1   . LEU A 1 1  ? -15.021 4.083   -3.618  1.00 15.00 ?  279 LEU A H1   12 
ATOM   8304  H H2   . LEU A 1 1  ? -14.790 2.931   -2.401  1.00 15.00 ?  279 LEU A H2   12 
ATOM   8305  H H3   . LEU A 1 1  ? -13.802 4.311   -2.468  1.00 15.00 ?  279 LEU A H3   12 
ATOM   8306  H HA   . LEU A 1 1  ? -15.622 5.738   -1.968  1.00 15.00 ?  279 LEU A HA   12 
ATOM   8307  H HB2  . LEU A 1 1  ? -17.823 4.700   -1.345  1.00 15.00 ?  279 LEU A HB2  12 
ATOM   8308  H HB3  . LEU A 1 1  ? -17.427 4.675   -3.048  1.00 15.00 ?  279 LEU A HB3  12 
ATOM   8309  H HG   . LEU A 1 1  ? -16.654 2.259   -2.671  1.00 15.00 ?  279 LEU A HG   12 
ATOM   8310  H HD11 . LEU A 1 1  ? -17.688 1.082   -0.800  1.00 15.00 ?  279 LEU A HD11 12 
ATOM   8311  H HD12 . LEU A 1 1  ? -18.282 2.614   -0.159  1.00 15.00 ?  279 LEU A HD12 12 
ATOM   8312  H HD13 . LEU A 1 1  ? -16.548 2.303   -0.235  1.00 15.00 ?  279 LEU A HD13 12 
ATOM   8313  H HD21 . LEU A 1 1  ? -18.936 1.409   -2.883  1.00 15.00 ?  279 LEU A HD21 12 
ATOM   8314  H HD22 . LEU A 1 1  ? -18.683 2.849   -3.870  1.00 15.00 ?  279 LEU A HD22 12 
ATOM   8315  H HD23 . LEU A 1 1  ? -19.564 2.967   -2.348  1.00 15.00 ?  279 LEU A HD23 12 
ATOM   8316  N N    . GLY A 1 2  ? -14.395 3.705   0.036   1.00 15.00 ?  280 GLY A N    12 
ATOM   8317  C CA   . GLY A 1 2  ? -14.109 3.370   1.415   1.00 15.00 ?  280 GLY A CA   12 
ATOM   8318  C C    . GLY A 1 2  ? -13.169 4.353   2.085   1.00 15.00 ?  280 GLY A C    12 
ATOM   8319  O O    . GLY A 1 2  ? -12.723 5.321   1.466   1.00 15.00 ?  280 GLY A O    12 
ATOM   8320  H H    . GLY A 1 2  ? -13.805 3.373   -0.673  1.00 15.00 ?  280 GLY A H    12 
ATOM   8321  H HA2  . GLY A 1 2  ? -15.037 3.350   1.966   1.00 15.00 ?  280 GLY A HA2  12 
ATOM   8322  H HA3  . GLY A 1 2  ? -13.664 2.386   1.448   1.00 15.00 ?  280 GLY A HA3  12 
ATOM   8323  N N    . PRO A 1 3  ? -12.848 4.112   3.360   1.00 15.00 ?  281 PRO A N    12 
ATOM   8324  C CA   . PRO A 1 3  ? -12.013 5.005   4.169   1.00 15.00 ?  281 PRO A CA   12 
ATOM   8325  C C    . PRO A 1 3  ? -10.518 4.687   4.088   1.00 15.00 ?  281 PRO A C    12 
ATOM   8326  O O    . PRO A 1 3  ? -10.121 3.527   3.971   1.00 15.00 ?  281 PRO A O    12 
ATOM   8327  C CB   . PRO A 1 3  ? -12.524 4.696   5.570   1.00 15.00 ?  281 PRO A CB   12 
ATOM   8328  C CG   . PRO A 1 3  ? -12.792 3.229   5.527   1.00 15.00 ?  281 PRO A CG   12 
ATOM   8329  C CD   . PRO A 1 3  ? -13.307 2.945   4.142   1.00 15.00 ?  281 PRO A CD   12 
ATOM   8330  H HA   . PRO A 1 3  ? -12.185 6.045   3.938   1.00 15.00 ?  281 PRO A HA   12 
ATOM   8331  H HB2  . PRO A 1 3  ? -11.765 4.944   6.298   1.00 15.00 ?  281 PRO A HB2  12 
ATOM   8332  H HB3  . PRO A 1 3  ? -13.425 5.257   5.765   1.00 15.00 ?  281 PRO A HB3  12 
ATOM   8333  H HG2  . PRO A 1 3  ? -11.874 2.682   5.696   1.00 15.00 ?  281 PRO A HG2  12 
ATOM   8334  H HG3  . PRO A 1 3  ? -13.534 2.965   6.267   1.00 15.00 ?  281 PRO A HG3  12 
ATOM   8335  H HD2  . PRO A 1 3  ? -12.876 2.031   3.759   1.00 15.00 ?  281 PRO A HD2  12 
ATOM   8336  H HD3  . PRO A 1 3  ? -14.385 2.883   4.145   1.00 15.00 ?  281 PRO A HD3  12 
ATOM   8337  N N    . LEU A 1 4  ? -9.693  5.722   4.180   1.00 15.00 ?  282 LEU A N    12 
ATOM   8338  C CA   . LEU A 1 4  ? -8.252  5.539   4.281   1.00 15.00 ?  282 LEU A CA   12 
ATOM   8339  C C    . LEU A 1 4  ? -7.803  5.796   5.719   1.00 15.00 ?  282 LEU A C    12 
ATOM   8340  O O    . LEU A 1 4  ? -7.829  6.934   6.186   1.00 15.00 ?  282 LEU A O    12 
ATOM   8341  C CB   . LEU A 1 4  ? -7.513  6.478   3.323   1.00 15.00 ?  282 LEU A CB   12 
ATOM   8342  C CG   . LEU A 1 4  ? -5.990  6.317   3.302   1.00 15.00 ?  282 LEU A CG   12 
ATOM   8343  C CD1  . LEU A 1 4  ? -5.606  4.937   2.789   1.00 15.00 ?  282 LEU A CD1  12 
ATOM   8344  C CD2  . LEU A 1 4  ? -5.351  7.403   2.452   1.00 15.00 ?  282 LEU A CD2  12 
ATOM   8345  H H    . LEU A 1 4  ? -10.060 6.629   4.182   1.00 15.00 ?  282 LEU A H    12 
ATOM   8346  H HA   . LEU A 1 4  ? -8.026  4.515   4.021   1.00 15.00 ?  282 LEU A HA   12 
ATOM   8347  H HB2  . LEU A 1 4  ? -7.888  6.305   2.324   1.00 15.00 ?  282 LEU A HB2  12 
ATOM   8348  H HB3  . LEU A 1 4  ? -7.741  7.496   3.603   1.00 15.00 ?  282 LEU A HB3  12 
ATOM   8349  H HG   . LEU A 1 4  ? -5.612  6.413   4.310   1.00 15.00 ?  282 LEU A HG   12 
ATOM   8350  H HD11 . LEU A 1 4  ? -5.994  4.805   1.790   1.00 15.00 ?  282 LEU A HD11 12 
ATOM   8351  H HD12 . LEU A 1 4  ? -6.023  4.183   3.439   1.00 15.00 ?  282 LEU A HD12 12 
ATOM   8352  H HD13 . LEU A 1 4  ? -4.530  4.846   2.773   1.00 15.00 ?  282 LEU A HD13 12 
ATOM   8353  H HD21 . LEU A 1 4  ? -5.727  7.336   1.441   1.00 15.00 ?  282 LEU A HD21 12 
ATOM   8354  H HD22 . LEU A 1 4  ? -4.279  7.271   2.447   1.00 15.00 ?  282 LEU A HD22 12 
ATOM   8355  H HD23 . LEU A 1 4  ? -5.594  8.372   2.862   1.00 15.00 ?  282 LEU A HD23 12 
ATOM   8356  N N    . PRO A 1 5  ? -7.429  4.736   6.446   1.00 15.00 ?  283 PRO A N    12 
ATOM   8357  C CA   . PRO A 1 5  ? -7.018  4.834   7.852   1.00 15.00 ?  283 PRO A CA   12 
ATOM   8358  C C    . PRO A 1 5  ? -5.668  5.531   8.025   1.00 15.00 ?  283 PRO A C    12 
ATOM   8359  O O    . PRO A 1 5  ? -4.741  5.307   7.247   1.00 15.00 ?  283 PRO A O    12 
ATOM   8360  C CB   . PRO A 1 5  ? -6.915  3.369   8.308   1.00 15.00 ?  283 PRO A CB   12 
ATOM   8361  C CG   . PRO A 1 5  ? -7.558  2.563   7.229   1.00 15.00 ?  283 PRO A CG   12 
ATOM   8362  C CD   . PRO A 1 5  ? -7.384  3.351   5.966   1.00 15.00 ?  283 PRO A CD   12 
ATOM   8363  H HA   . PRO A 1 5  ? -7.762  5.345   8.446   1.00 15.00 ?  283 PRO A HA   12 
ATOM   8364  H HB2  . PRO A 1 5  ? -5.875  3.102   8.428   1.00 15.00 ?  283 PRO A HB2  12 
ATOM   8365  H HB3  . PRO A 1 5  ? -7.430  3.247   9.249   1.00 15.00 ?  283 PRO A HB3  12 
ATOM   8366  H HG2  . PRO A 1 5  ? -7.069  1.604   7.144   1.00 15.00 ?  283 PRO A HG2  12 
ATOM   8367  H HG3  . PRO A 1 5  ? -8.608  2.432   7.446   1.00 15.00 ?  283 PRO A HG3  12 
ATOM   8368  H HD2  . PRO A 1 5  ? -6.431  3.128   5.508   1.00 15.00 ?  283 PRO A HD2  12 
ATOM   8369  H HD3  . PRO A 1 5  ? -8.193  3.153   5.280   1.00 15.00 ?  283 PRO A HD3  12 
ATOM   8370  N N    . PRO A 1 6  ? -5.540  6.380   9.059   1.00 15.00 ?  284 PRO A N    12 
ATOM   8371  C CA   . PRO A 1 6  ? -4.276  7.049   9.374   1.00 15.00 ?  284 PRO A CA   12 
ATOM   8372  C C    . PRO A 1 6  ? -3.184  6.041   9.726   1.00 15.00 ?  284 PRO A C    12 
ATOM   8373  O O    . PRO A 1 6  ? -3.346  5.221   10.634  1.00 15.00 ?  284 PRO A O    12 
ATOM   8374  C CB   . PRO A 1 6  ? -4.615  7.930   10.583  1.00 15.00 ?  284 PRO A CB   12 
ATOM   8375  C CG   . PRO A 1 6  ? -5.864  7.351   11.155  1.00 15.00 ?  284 PRO A CG   12 
ATOM   8376  C CD   . PRO A 1 6  ? -6.611  6.749   9.998   1.00 15.00 ?  284 PRO A CD   12 
ATOM   8377  H HA   . PRO A 1 6  ? -3.941  7.667   8.554   1.00 15.00 ?  284 PRO A HA   12 
ATOM   8378  H HB2  . PRO A 1 6  ? -3.803  7.895   11.295  1.00 15.00 ?  284 PRO A HB2  12 
ATOM   8379  H HB3  . PRO A 1 6  ? -4.767  8.947   10.256  1.00 15.00 ?  284 PRO A HB3  12 
ATOM   8380  H HG2  . PRO A 1 6  ? -5.617  6.588   11.878  1.00 15.00 ?  284 PRO A HG2  12 
ATOM   8381  H HG3  . PRO A 1 6  ? -6.452  8.130   11.615  1.00 15.00 ?  284 PRO A HG3  12 
ATOM   8382  H HD2  . PRO A 1 6  ? -7.163  5.877   10.318  1.00 15.00 ?  284 PRO A HD2  12 
ATOM   8383  H HD3  . PRO A 1 6  ? -7.276  7.477   9.558   1.00 15.00 ?  284 PRO A HD3  12 
ATOM   8384  N N    . GLY A 1 7  ? -2.079  6.101   8.997   1.00 15.00 ?  285 GLY A N    12 
ATOM   8385  C CA   . GLY A 1 7  ? -1.028  5.115   9.159   1.00 15.00 ?  285 GLY A CA   12 
ATOM   8386  C C    . GLY A 1 7  ? -0.860  4.296   7.901   1.00 15.00 ?  285 GLY A C    12 
ATOM   8387  O O    . GLY A 1 7  ? 0.093   3.524   7.764   1.00 15.00 ?  285 GLY A O    12 
ATOM   8388  H H    . GLY A 1 7  ? -1.974  6.818   8.337   1.00 15.00 ?  285 GLY A H    12 
ATOM   8389  H HA2  . GLY A 1 7  ? -0.100  5.620   9.383   1.00 15.00 ?  285 GLY A HA2  12 
ATOM   8390  H HA3  . GLY A 1 7  ? -1.282  4.458   9.976   1.00 15.00 ?  285 GLY A HA3  12 
ATOM   8391  N N    . TRP A 1 8  ? -1.789  4.487   6.975   1.00 15.00 ?  286 TRP A N    12 
ATOM   8392  C CA   . TRP A 1 8  ? -1.751  3.810   5.693   1.00 15.00 ?  286 TRP A CA   12 
ATOM   8393  C C    . TRP A 1 8  ? -0.977  4.627   4.686   1.00 15.00 ?  286 TRP A C    12 
ATOM   8394  O O    . TRP A 1 8  ? -1.447  5.666   4.216   1.00 15.00 ?  286 TRP A O    12 
ATOM   8395  C CB   . TRP A 1 8  ? -3.170  3.567   5.159   1.00 15.00 ?  286 TRP A CB   12 
ATOM   8396  C CG   . TRP A 1 8  ? -3.744  2.253   5.565   1.00 15.00 ?  286 TRP A CG   12 
ATOM   8397  C CD1  . TRP A 1 8  ? -3.826  1.758   6.833   1.00 15.00 ?  286 TRP A CD1  12 
ATOM   8398  C CD2  . TRP A 1 8  ? -4.312  1.257   4.702   1.00 15.00 ?  286 TRP A CD2  12 
ATOM   8399  N NE1  . TRP A 1 8  ? -4.387  0.508   6.817   1.00 15.00 ?  286 TRP A NE1  12 
ATOM   8400  C CE2  . TRP A 1 8  ? -4.690  0.174   5.525   1.00 15.00 ?  286 TRP A CE2  12 
ATOM   8401  C CE3  . TRP A 1 8  ? -4.532  1.155   3.314   1.00 15.00 ?  286 TRP A CE3  12 
ATOM   8402  C CZ2  . TRP A 1 8  ? -5.269  -0.982  5.017   1.00 15.00 ?  286 TRP A CZ2  12 
ATOM   8403  C CZ3  . TRP A 1 8  ? -5.099  -0.004  2.824   1.00 15.00 ?  286 TRP A CZ3  12 
ATOM   8404  C CH2  . TRP A 1 8  ? -5.457  -1.057  3.668   1.00 15.00 ?  286 TRP A CH2  12 
ATOM   8405  H H    . TRP A 1 8  ? -2.528  5.103   7.164   1.00 15.00 ?  286 TRP A H    12 
ATOM   8406  H HA   . TRP A 1 8  ? -1.250  2.861   5.831   1.00 15.00 ?  286 TRP A HA   12 
ATOM   8407  H HB2  . TRP A 1 8  ? -3.823  4.343   5.527   1.00 15.00 ?  286 TRP A HB2  12 
ATOM   8408  H HB3  . TRP A 1 8  ? -3.150  3.605   4.079   1.00 15.00 ?  286 TRP A HB3  12 
ATOM   8409  H HD1  . TRP A 1 8  ? -3.485  2.282   7.713   1.00 15.00 ?  286 TRP A HD1  12 
ATOM   8410  H HE1  . TRP A 1 8  ? -4.540  -0.057  7.602   1.00 15.00 ?  286 TRP A HE1  12 
ATOM   8411  H HE3  . TRP A 1 8  ? -4.260  1.977   2.596   1.00 15.00 ?  286 TRP A HE3  12 
ATOM   8412  H HZ2  . TRP A 1 8  ? -5.553  -1.807  5.654   1.00 15.00 ?  286 TRP A HZ2  12 
ATOM   8413  H HZ3  . TRP A 1 8  ? -5.241  -0.115  1.760   1.00 15.00 ?  286 TRP A HZ3  12 
ATOM   8414  H HH2  . TRP A 1 8  ? -5.890  -1.950  3.226   1.00 15.00 ?  286 TRP A HH2  12 
ATOM   8415  N N    . GLU A 1 9  ? 0.222   4.175   4.385   1.00 15.00 ?  287 GLU A N    12 
ATOM   8416  C CA   . GLU A 1 9  ? 1.009   4.779   3.343   1.00 15.00 ?  287 GLU A CA   12 
ATOM   8417  C C    . GLU A 1 9  ? 0.766   4.010   2.060   1.00 15.00 ?  287 GLU A C    12 
ATOM   8418  O O    . GLU A 1 9  ? 1.001   2.804   1.995   1.00 15.00 ?  287 GLU A O    12 
ATOM   8419  C CB   . GLU A 1 9  ? 2.490   4.780   3.736   1.00 15.00 ?  287 GLU A CB   12 
ATOM   8420  C CG   . GLU A 1 9  ? 2.960   6.098   4.341   1.00 15.00 ?  287 GLU A CG   12 
ATOM   8421  C CD   . GLU A 1 9  ? 2.139   6.527   5.545   1.00 15.00 ?  287 GLU A CD   12 
ATOM   8422  O OE1  . GLU A 1 9  ? 2.369   5.985   6.647   1.00 15.00 -1 287 GLU A OE1  12 
ATOM   8423  O OE2  . GLU A 1 9  ? 1.272   7.410   5.399   1.00 15.00 ?  287 GLU A OE2  12 
ATOM   8424  H H    . GLU A 1 9  ? 0.586   3.398   4.868   1.00 15.00 ?  287 GLU A H    12 
ATOM   8425  H HA   . GLU A 1 9  ? 0.671   5.798   3.213   1.00 15.00 ?  287 GLU A HA   12 
ATOM   8426  H HB2  . GLU A 1 9  ? 2.651   4.003   4.469   1.00 15.00 ?  287 GLU A HB2  12 
ATOM   8427  H HB3  . GLU A 1 9  ? 3.095   4.567   2.870   1.00 15.00 ?  287 GLU A HB3  12 
ATOM   8428  H HG2  . GLU A 1 9  ? 3.987   5.983   4.653   1.00 15.00 ?  287 GLU A HG2  12 
ATOM   8429  H HG3  . GLU A 1 9  ? 2.902   6.869   3.585   1.00 15.00 ?  287 GLU A HG3  12 
ATOM   8430  N N    . VAL A 1 10 ? 0.260   4.687   1.047   1.00 15.00 ?  288 VAL A N    12 
ATOM   8431  C CA   . VAL A 1 10 ? -0.063  4.015   -0.193  1.00 15.00 ?  288 VAL A CA   12 
ATOM   8432  C C    . VAL A 1 10 ? 1.166   4.046   -1.093  1.00 15.00 ?  288 VAL A C    12 
ATOM   8433  O O    . VAL A 1 10 ? 1.648   5.107   -1.490  1.00 15.00 ?  288 VAL A O    12 
ATOM   8434  C CB   . VAL A 1 10 ? -1.335  4.622   -0.886  1.00 15.00 ?  288 VAL A CB   12 
ATOM   8435  C CG1  . VAL A 1 10 ? -2.221  5.326   0.131   1.00 15.00 ?  288 VAL A CG1  12 
ATOM   8436  C CG2  . VAL A 1 10 ? -1.015  5.567   -2.041  1.00 15.00 ?  288 VAL A CG2  12 
ATOM   8437  H H    . VAL A 1 10 ? 0.105   5.650   1.134   1.00 15.00 ?  288 VAL A H    12 
ATOM   8438  H HA   . VAL A 1 10 ? -0.275  2.982   0.050   1.00 15.00 ?  288 VAL A HA   12 
ATOM   8439  H HB   . VAL A 1 10 ? -1.906  3.796   -1.289  1.00 15.00 ?  288 VAL A HB   12 
ATOM   8440  H HG11 . VAL A 1 10 ? -3.081  5.746   -0.369  1.00 15.00 ?  288 VAL A HG11 12 
ATOM   8441  H HG12 . VAL A 1 10 ? -1.662  6.116   0.611   1.00 15.00 ?  288 VAL A HG12 12 
ATOM   8442  H HG13 . VAL A 1 10 ? -2.550  4.615   0.875   1.00 15.00 ?  288 VAL A HG13 12 
ATOM   8443  H HG21 . VAL A 1 10 ? -0.577  5.004   -2.853  1.00 15.00 ?  288 VAL A HG21 12 
ATOM   8444  H HG22 . VAL A 1 10 ? -0.318  6.321   -1.707  1.00 15.00 ?  288 VAL A HG22 12 
ATOM   8445  H HG23 . VAL A 1 10 ? -1.924  6.041   -2.380  1.00 15.00 ?  288 VAL A HG23 12 
ATOM   8446  N N    . ARG A 1 11 ? 1.736   2.881   -1.335  1.00 15.00 ?  289 ARG A N    12 
ATOM   8447  C CA   . ARG A 1 11 ? 2.948   2.803   -2.117  1.00 15.00 ?  289 ARG A CA   12 
ATOM   8448  C C    . ARG A 1 11 ? 2.581   2.355   -3.531  1.00 15.00 ?  289 ARG A C    12 
ATOM   8449  O O    . ARG A 1 11 ? 2.270   1.190   -3.773  1.00 15.00 ?  289 ARG A O    12 
ATOM   8450  C CB   . ARG A 1 11 ? 3.971   1.885   -1.402  1.00 15.00 ?  289 ARG A CB   12 
ATOM   8451  C CG   . ARG A 1 11 ? 5.438   2.194   -1.707  1.00 15.00 ?  289 ARG A CG   12 
ATOM   8452  C CD   . ARG A 1 11 ? 5.847   1.859   -3.133  1.00 15.00 ?  289 ARG A CD   12 
ATOM   8453  N NE   . ARG A 1 11 ? 7.244   2.222   -3.389  1.00 15.00 ?  289 ARG A NE   12 
ATOM   8454  C CZ   . ARG A 1 11 ? 8.151   1.413   -3.940  1.00 15.00 ?  289 ARG A CZ   12 
ATOM   8455  N NH1  . ARG A 1 11 ? 7.850   0.153   -4.222  1.00 15.00 1  289 ARG A NH1  12 
ATOM   8456  N NH2  . ARG A 1 11 ? 9.374   1.867   -4.180  1.00 15.00 ?  289 ARG A NH2  12 
ATOM   8457  H H    . ARG A 1 11 ? 1.331   2.052   -0.989  1.00 15.00 ?  289 ARG A H    12 
ATOM   8458  H HA   . ARG A 1 11 ? 3.358   3.803   -2.176  1.00 15.00 ?  289 ARG A HA   12 
ATOM   8459  H HB2  . ARG A 1 11 ? 3.833   2.014   -0.338  1.00 15.00 ?  289 ARG A HB2  12 
ATOM   8460  H HB3  . ARG A 1 11 ? 3.776   0.848   -1.638  1.00 15.00 ?  289 ARG A HB3  12 
ATOM   8461  H HG2  . ARG A 1 11 ? 5.608   3.246   -1.543  1.00 15.00 ?  289 ARG A HG2  12 
ATOM   8462  H HG3  . ARG A 1 11 ? 6.055   1.625   -1.026  1.00 15.00 ?  289 ARG A HG3  12 
ATOM   8463  H HD2  . ARG A 1 11 ? 5.725   0.798   -3.291  1.00 15.00 ?  289 ARG A HD2  12 
ATOM   8464  H HD3  . ARG A 1 11 ? 5.212   2.402   -3.816  1.00 15.00 ?  289 ARG A HD3  12 
ATOM   8465  H HE   . ARG A 1 11 ? 7.523   3.137   -3.142  1.00 15.00 ?  289 ARG A HE   12 
ATOM   8466  H HH11 . ARG A 1 11 ? 6.936   -0.205  -4.016  1.00 15.00 ?  289 ARG A HH11 12 
ATOM   8467  H HH12 . ARG A 1 11 ? 8.533   -0.447  -4.640  1.00 15.00 ?  289 ARG A HH12 12 
ATOM   8468  H HH21 . ARG A 1 11 ? 9.618   2.817   -3.949  1.00 15.00 ?  289 ARG A HH21 12 
ATOM   8469  H HH22 . ARG A 1 11 ? 10.069  1.269   -4.593  1.00 15.00 ?  289 ARG A HH22 12 
ATOM   8470  N N    . SER A 1 12 ? 2.526   3.327   -4.440  1.00 15.00 ?  290 SER A N    12 
ATOM   8471  C CA   . SER A 1 12 ? 2.063   3.090   -5.795  1.00 15.00 ?  290 SER A CA   12 
ATOM   8472  C C    . SER A 1 12 ? 3.239   2.960   -6.749  1.00 15.00 ?  290 SER A C    12 
ATOM   8473  O O    . SER A 1 12 ? 4.140   3.794   -6.756  1.00 15.00 ?  290 SER A O    12 
ATOM   8474  C CB   . SER A 1 12 ? 1.143   4.238   -6.221  1.00 15.00 ?  290 SER A CB   12 
ATOM   8475  O OG   . SER A 1 12 ? 1.666   5.491   -5.803  1.00 15.00 ?  290 SER A OG   12 
ATOM   8476  H H    . SER A 1 12 ? 2.816   4.237   -4.197  1.00 15.00 ?  290 SER A H    12 
ATOM   8477  H HA   . SER A 1 12 ? 1.502   2.168   -5.802  1.00 15.00 ?  290 SER A HA   12 
ATOM   8478  H HB2  . SER A 1 12 ? 1.050   4.242   -7.297  1.00 15.00 ?  290 SER A HB2  12 
ATOM   8479  H HB3  . SER A 1 12 ? 0.170   4.099   -5.774  1.00 15.00 ?  290 SER A HB3  12 
ATOM   8480  H HG   . SER A 1 12 ? 1.920   6.011   -6.582  1.00 15.00 ?  290 SER A HG   12 
ATOM   8481  N N    . THR A 1 13 ? 3.223   1.923   -7.566  1.00 15.00 ?  291 THR A N    12 
ATOM   8482  C CA   . THR A 1 13 ? 4.336   1.662   -8.456  1.00 15.00 ?  291 THR A CA   12 
ATOM   8483  C C    . THR A 1 13 ? 3.899   1.656   -9.915  1.00 15.00 ?  291 THR A C    12 
ATOM   8484  O O    . THR A 1 13 ? 2.801   1.189   -10.247 1.00 15.00 ?  291 THR A O    12 
ATOM   8485  C CB   . THR A 1 13 ? 5.032   0.337   -8.100  1.00 15.00 ?  291 THR A CB   12 
ATOM   8486  O OG1  . THR A 1 13 ? 4.062   -0.712  -7.976  1.00 15.00 ?  291 THR A OG1  12 
ATOM   8487  C CG2  . THR A 1 13 ? 5.803   0.472   -6.797  1.00 15.00 ?  291 THR A CG2  12 
ATOM   8488  H H    . THR A 1 13 ? 2.441   1.332   -7.584  1.00 15.00 ?  291 THR A H    12 
ATOM   8489  H HA   . THR A 1 13 ? 5.053   2.460   -8.319  1.00 15.00 ?  291 THR A HA   12 
ATOM   8490  H HB   . THR A 1 13 ? 5.726   0.086   -8.888  1.00 15.00 ?  291 THR A HB   12 
ATOM   8491  H HG1  . THR A 1 13 ? 3.274   -0.370  -7.540  1.00 15.00 ?  291 THR A HG1  12 
ATOM   8492  H HG21 . THR A 1 13 ? 6.540   1.259   -6.891  1.00 15.00 ?  291 THR A HG21 12 
ATOM   8493  H HG22 . THR A 1 13 ? 6.295   -0.460  -6.570  1.00 15.00 ?  291 THR A HG22 12 
ATOM   8494  H HG23 . THR A 1 13 ? 5.117   0.720   -6.000  1.00 15.00 ?  291 THR A HG23 12 
ATOM   8495  N N    . VAL A 1 14 ? 4.781   2.167   -10.773 1.00 15.00 ?  292 VAL A N    12 
ATOM   8496  C CA   . VAL A 1 14 ? 4.513   2.321   -12.205 1.00 15.00 ?  292 VAL A CA   12 
ATOM   8497  C C    . VAL A 1 14 ? 4.214   0.990   -12.892 1.00 15.00 ?  292 VAL A C    12 
ATOM   8498  O O    . VAL A 1 14 ? 3.722   0.965   -14.020 1.00 15.00 ?  292 VAL A O    12 
ATOM   8499  C CB   . VAL A 1 14 ? 5.687   3.016   -12.924 1.00 15.00 ?  292 VAL A CB   12 
ATOM   8500  C CG1  . VAL A 1 14 ? 5.802   4.468   -12.479 1.00 15.00 ?  292 VAL A CG1  12 
ATOM   8501  C CG2  . VAL A 1 14 ? 6.990   2.274   -12.667 1.00 15.00 ?  292 VAL A CG2  12 
ATOM   8502  H H    . VAL A 1 14 ? 5.652   2.459   -10.429 1.00 15.00 ?  292 VAL A H    12 
ATOM   8503  H HA   . VAL A 1 14 ? 3.644   2.957   -12.303 1.00 15.00 ?  292 VAL A HA   12 
ATOM   8504  H HB   . VAL A 1 14 ? 5.492   3.003   -13.985 1.00 15.00 ?  292 VAL A HB   12 
ATOM   8505  H HG11 . VAL A 1 14 ? 4.884   4.988   -12.710 1.00 15.00 ?  292 VAL A HG11 12 
ATOM   8506  H HG12 . VAL A 1 14 ? 6.623   4.939   -12.996 1.00 15.00 ?  292 VAL A HG12 12 
ATOM   8507  H HG13 . VAL A 1 14 ? 5.977   4.505   -11.414 1.00 15.00 ?  292 VAL A HG13 12 
ATOM   8508  H HG21 . VAL A 1 14 ? 7.191   2.255   -11.606 1.00 15.00 ?  292 VAL A HG21 12 
ATOM   8509  H HG22 . VAL A 1 14 ? 7.797   2.775   -13.179 1.00 15.00 ?  292 VAL A HG22 12 
ATOM   8510  H HG23 . VAL A 1 14 ? 6.904   1.261   -13.035 1.00 15.00 ?  292 VAL A HG23 12 
ATOM   8511  N N    . SER A 1 15 ? 4.532   -0.110  -12.215 1.00 15.00 ?  293 SER A N    12 
ATOM   8512  C CA   . SER A 1 15 ? 4.195   -1.447  -12.692 1.00 15.00 ?  293 SER A CA   12 
ATOM   8513  C C    . SER A 1 15 ? 2.682   -1.598  -12.891 1.00 15.00 ?  293 SER A C    12 
ATOM   8514  O O    . SER A 1 15 ? 2.219   -2.551  -13.518 1.00 15.00 ?  293 SER A O    12 
ATOM   8515  C CB   . SER A 1 15 ? 4.697   -2.496  -11.700 1.00 15.00 ?  293 SER A CB   12 
ATOM   8516  O OG   . SER A 1 15 ? 6.069   -2.291  -11.395 1.00 15.00 ?  293 SER A OG   12 
ATOM   8517  H H    . SER A 1 15 ? 5.012   -0.023  -11.368 1.00 15.00 ?  293 SER A H    12 
ATOM   8518  H HA   . SER A 1 15 ? 4.689   -1.596  -13.641 1.00 15.00 ?  293 SER A HA   12 
ATOM   8519  H HB2  . SER A 1 15 ? 4.125   -2.428  -10.787 1.00 15.00 ?  293 SER A HB2  12 
ATOM   8520  H HB3  . SER A 1 15 ? 4.579   -3.480  -12.127 1.00 15.00 ?  293 SER A HB3  12 
ATOM   8521  H HG   . SER A 1 15 ? 6.605   -2.904  -11.925 1.00 15.00 ?  293 SER A HG   12 
ATOM   8522  N N    . GLY A 1 16 ? 1.920   -0.666  -12.328 1.00 15.00 ?  294 GLY A N    12 
ATOM   8523  C CA   . GLY A 1 16 ? 0.480   -0.716  -12.451 1.00 15.00 ?  294 GLY A CA   12 
ATOM   8524  C C    . GLY A 1 16 ? -0.147  -1.499  -11.325 1.00 15.00 ?  294 GLY A C    12 
ATOM   8525  O O    . GLY A 1 16 ? -1.022  -2.338  -11.551 1.00 15.00 ?  294 GLY A O    12 
ATOM   8526  H H    . GLY A 1 16 ? 2.344   0.061   -11.822 1.00 15.00 ?  294 GLY A H    12 
ATOM   8527  H HA2  . GLY A 1 16 ? 0.092   0.292   -12.438 1.00 15.00 ?  294 GLY A HA2  12 
ATOM   8528  H HA3  . GLY A 1 16 ? 0.220   -1.180  -13.390 1.00 15.00 ?  294 GLY A HA3  12 
ATOM   8529  N N    . ARG A 1 17 ? 0.310   -1.243  -10.112 1.00 15.00 ?  295 ARG A N    12 
ATOM   8530  C CA   . ARG A 1 17 ? -0.203  -1.947  -8.947  1.00 15.00 ?  295 ARG A CA   12 
ATOM   8531  C C    . ARG A 1 17 ? -0.131  -1.061  -7.705  1.00 15.00 ?  295 ARG A C    12 
ATOM   8532  O O    . ARG A 1 17 ? 0.922   -0.494  -7.387  1.00 15.00 ?  295 ARG A O    12 
ATOM   8533  C CB   . ARG A 1 17 ? 0.577   -3.257  -8.720  1.00 15.00 ?  295 ARG A CB   12 
ATOM   8534  C CG   . ARG A 1 17 ? 2.065   -3.052  -8.485  1.00 15.00 ?  295 ARG A CG   12 
ATOM   8535  C CD   . ARG A 1 17 ? 2.778   -4.373  -8.271  1.00 15.00 ?  295 ARG A CD   12 
ATOM   8536  N NE   . ARG A 1 17 ? 4.198   -4.201  -7.969  1.00 15.00 ?  295 ARG A NE   12 
ATOM   8537  C CZ   . ARG A 1 17 ? 5.076   -5.207  -7.966  1.00 15.00 ?  295 ARG A CZ   12 
ATOM   8538  N NH1  . ARG A 1 17 ? 4.708   -6.410  -8.386  1.00 15.00 1  295 ARG A NH1  12 
ATOM   8539  N NH2  . ARG A 1 17 ? 6.332   -5.001  -7.593  1.00 15.00 ?  295 ARG A NH2  12 
ATOM   8540  H H    . ARG A 1 17 ? 1.005   -0.552  -9.992  1.00 15.00 ?  295 ARG A H    12 
ATOM   8541  H HA   . ARG A 1 17 ? -1.237  -2.185  -9.140  1.00 15.00 ?  295 ARG A HA   12 
ATOM   8542  H HB2  . ARG A 1 17 ? 0.166   -3.768  -7.860  1.00 15.00 ?  295 ARG A HB2  12 
ATOM   8543  H HB3  . ARG A 1 17 ? 0.458   -3.891  -9.587  1.00 15.00 ?  295 ARG A HB3  12 
ATOM   8544  H HG2  . ARG A 1 17 ? 2.492   -2.559  -9.346  1.00 15.00 ?  295 ARG A HG2  12 
ATOM   8545  H HG3  . ARG A 1 17 ? 2.201   -2.434  -7.609  1.00 15.00 ?  295 ARG A HG3  12 
ATOM   8546  H HD2  . ARG A 1 17 ? 2.309   -4.889  -7.448  1.00 15.00 ?  295 ARG A HD2  12 
ATOM   8547  H HD3  . ARG A 1 17 ? 2.681   -4.968  -9.168  1.00 15.00 ?  295 ARG A HD3  12 
ATOM   8548  H HE   . ARG A 1 17 ? 4.505   -3.298  -7.727  1.00 15.00 ?  295 ARG A HE   12 
ATOM   8549  H HH11 . ARG A 1 17 ? 3.768   -6.570  -8.714  1.00 15.00 ?  295 ARG A HH11 12 
ATOM   8550  H HH12 . ARG A 1 17 ? 5.372   -7.173  -8.383  1.00 15.00 ?  295 ARG A HH12 12 
ATOM   8551  H HH21 . ARG A 1 17 ? 6.637   -4.083  -7.316  1.00 15.00 ?  295 ARG A HH21 12 
ATOM   8552  H HH22 . ARG A 1 17 ? 6.983   -5.766  -7.574  1.00 15.00 ?  295 ARG A HH22 12 
ATOM   8553  N N    . ILE A 1 18 ? -1.257  -0.940  -7.014  1.00 15.00 ?  296 ILE A N    12 
ATOM   8554  C CA   . ILE A 1 18 ? -1.280  -0.283  -5.718  1.00 15.00 ?  296 ILE A CA   12 
ATOM   8555  C C    . ILE A 1 18 ? -1.020  -1.349  -4.665  1.00 15.00 ?  296 ILE A C    12 
ATOM   8556  O O    . ILE A 1 18 ? -1.571  -2.448  -4.744  1.00 15.00 ?  296 ILE A O    12 
ATOM   8557  C CB   . ILE A 1 18 ? -2.632  0.440   -5.437  1.00 15.00 ?  296 ILE A CB   12 
ATOM   8558  C CG1  . ILE A 1 18 ? -2.580  1.231   -4.129  1.00 15.00 ?  296 ILE A CG1  12 
ATOM   8559  C CG2  . ILE A 1 18 ? -3.796  -0.535  -5.386  1.00 15.00 ?  296 ILE A CG2  12 
ATOM   8560  C CD1  . ILE A 1 18 ? -1.744  2.483   -4.200  1.00 15.00 ?  296 ILE A CD1  12 
ATOM   8561  H H    . ILE A 1 18 ? -2.088  -1.310  -7.379  1.00 15.00 ?  296 ILE A H    12 
ATOM   8562  H HA   . ILE A 1 18 ? -0.479  0.443   -5.692  1.00 15.00 ?  296 ILE A HA   12 
ATOM   8563  H HB   . ILE A 1 18 ? -2.815  1.128   -6.248  1.00 15.00 ?  296 ILE A HB   12 
ATOM   8564  H HG12 . ILE A 1 18 ? -3.581  1.524   -3.852  1.00 15.00 ?  296 ILE A HG12 12 
ATOM   8565  H HG13 . ILE A 1 18 ? -2.168  0.602   -3.353  1.00 15.00 ?  296 ILE A HG13 12 
ATOM   8566  H HG21 . ILE A 1 18 ? -4.703  0.004   -5.154  1.00 15.00 ?  296 ILE A HG21 12 
ATOM   8567  H HG22 . ILE A 1 18 ? -3.611  -1.273  -4.619  1.00 15.00 ?  296 ILE A HG22 12 
ATOM   8568  H HG23 . ILE A 1 18 ? -3.900  -1.025  -6.343  1.00 15.00 ?  296 ILE A HG23 12 
ATOM   8569  H HD11 . ILE A 1 18 ? -2.006  3.126   -3.374  1.00 15.00 ?  296 ILE A HD11 12 
ATOM   8570  H HD12 . ILE A 1 18 ? -1.937  2.994   -5.133  1.00 15.00 ?  296 ILE A HD12 12 
ATOM   8571  H HD13 . ILE A 1 18 ? -0.698  2.224   -4.139  1.00 15.00 ?  296 ILE A HD13 12 
ATOM   8572  N N    . TYR A 1 19 ? -0.159  -1.062  -3.711  1.00 15.00 ?  297 TYR A N    12 
ATOM   8573  C CA   . TYR A 1 19 ? 0.226   -2.078  -2.757  1.00 15.00 ?  297 TYR A CA   12 
ATOM   8574  C C    . TYR A 1 19 ? 0.563   -1.389  -1.470  1.00 15.00 ?  297 TYR A C    12 
ATOM   8575  O O    . TYR A 1 19 ? 1.327   -0.418  -1.436  1.00 15.00 ?  297 TYR A O    12 
ATOM   8576  C CB   . TYR A 1 19 ? 1.364   -2.990  -3.273  1.00 15.00 ?  297 TYR A CB   12 
ATOM   8577  C CG   . TYR A 1 19 ? 2.784   -2.557  -2.971  1.00 15.00 ?  297 TYR A CG   12 
ATOM   8578  C CD1  . TYR A 1 19 ? 3.401   -1.557  -3.705  1.00 15.00 ?  297 TYR A CD1  12 
ATOM   8579  C CD2  . TYR A 1 19 ? 3.519   -3.176  -1.959  1.00 15.00 ?  297 TYR A CD2  12 
ATOM   8580  C CE1  . TYR A 1 19 ? 4.701   -1.181  -3.439  1.00 15.00 ?  297 TYR A CE1  12 
ATOM   8581  C CE2  . TYR A 1 19 ? 4.817   -2.799  -1.689  1.00 15.00 ?  297 TYR A CE2  12 
ATOM   8582  C CZ   . TYR A 1 19 ? 5.403   -1.803  -2.430  1.00 15.00 ?  297 TYR A CZ   12 
ATOM   8583  O OH   . TYR A 1 19 ? 6.696   -1.423  -2.163  1.00 15.00 ?  297 TYR A OH   12 
ATOM   8584  H H    . TYR A 1 19 ? 0.140   -0.124  -3.574  1.00 15.00 ?  297 TYR A H    12 
ATOM   8585  H HA   . TYR A 1 19 ? -0.651  -2.688  -2.583  1.00 15.00 ?  297 TYR A HA   12 
ATOM   8586  H HB2  . TYR A 1 19 ? 1.237   -3.971  -2.840  1.00 15.00 ?  297 TYR A HB2  12 
ATOM   8587  H HB3  . TYR A 1 19 ? 1.270   -3.074  -4.346  1.00 15.00 ?  297 TYR A HB3  12 
ATOM   8588  H HD1  . TYR A 1 19 ? 2.848   -1.064  -4.491  1.00 15.00 ?  297 TYR A HD1  12 
ATOM   8589  H HD2  . TYR A 1 19 ? 3.065   -3.968  -1.382  1.00 15.00 ?  297 TYR A HD2  12 
ATOM   8590  H HE1  . TYR A 1 19 ? 5.164   -0.399  -4.020  1.00 15.00 ?  297 TYR A HE1  12 
ATOM   8591  H HE2  . TYR A 1 19 ? 5.368   -3.288  -0.898  1.00 15.00 ?  297 TYR A HE2  12 
ATOM   8592  H HH   . TYR A 1 19 ? 7.205   -2.193  -1.897  1.00 15.00 ?  297 TYR A HH   12 
ATOM   8593  N N    . PHE A 1 20 ? -0.042  -1.856  -0.421  1.00 15.00 ?  298 PHE A N    12 
ATOM   8594  C CA   . PHE A 1 20 ? -0.028  -1.120  0.785   1.00 15.00 ?  298 PHE A CA   12 
ATOM   8595  C C    . PHE A 1 20 ? 1.106   -1.426  1.671   1.00 15.00 ?  298 PHE A C    12 
ATOM   8596  O O    . PHE A 1 20 ? 1.537   -2.562  1.803   1.00 15.00 ?  298 PHE A O    12 
ATOM   8597  C CB   . PHE A 1 20 ? -1.313  -1.268  1.531   1.00 15.00 ?  298 PHE A CB   12 
ATOM   8598  C CG   . PHE A 1 20 ? -2.101  -0.074  1.260   1.00 15.00 ?  298 PHE A CG   12 
ATOM   8599  C CD1  . PHE A 1 20 ? -1.769  1.101   1.898   1.00 15.00 ?  298 PHE A CD1  12 
ATOM   8600  C CD2  . PHE A 1 20 ? -3.118  -0.091  0.335   1.00 15.00 ?  298 PHE A CD2  12 
ATOM   8601  C CE1  . PHE A 1 20 ? -2.454  2.244   1.630   1.00 15.00 ?  298 PHE A CE1  12 
ATOM   8602  C CE2  . PHE A 1 20 ? -3.809  1.056   0.069   1.00 15.00 ?  298 PHE A CE2  12 
ATOM   8603  C CZ   . PHE A 1 20 ? -3.473  2.213   0.719   1.00 15.00 ?  298 PHE A CZ   12 
ATOM   8604  H H    . PHE A 1 20 ? -0.557  -2.688  -0.478  1.00 15.00 ?  298 PHE A H    12 
ATOM   8605  H HA   . PHE A 1 20 ? 0.055   -0.083  0.498   1.00 15.00 ?  298 PHE A HA   12 
ATOM   8606  H HB2  . PHE A 1 20 ? -1.856  -2.150  1.198   1.00 15.00 ?  298 PHE A HB2  12 
ATOM   8607  H HB3  . PHE A 1 20 ? -1.123  -1.324  2.591   1.00 15.00 ?  298 PHE A HB3  12 
ATOM   8608  H HD1  . PHE A 1 20 ? -0.973  1.108   2.626   1.00 15.00 ?  298 PHE A HD1  12 
ATOM   8609  H HD2  . PHE A 1 20 ? -3.372  -1.011  -0.169  1.00 15.00 ?  298 PHE A HD2  12 
ATOM   8610  H HE1  . PHE A 1 20 ? -2.196  3.165   2.131   1.00 15.00 ?  298 PHE A HE1  12 
ATOM   8611  H HE2  . PHE A 1 20 ? -4.608  1.057   -0.645  1.00 15.00 ?  298 PHE A HE2  12 
ATOM   8612  H HZ   . PHE A 1 20 ? -4.016  3.078   0.535   1.00 15.00 ?  298 PHE A HZ   12 
ATOM   8613  N N    . VAL A 1 21 ? 1.534   -0.365  2.298   1.00 15.00 ?  299 VAL A N    12 
ATOM   8614  C CA   . VAL A 1 21 ? 2.596   -0.386  3.239   1.00 15.00 ?  299 VAL A CA   12 
ATOM   8615  C C    . VAL A 1 21 ? 2.186   0.490   4.419   1.00 15.00 ?  299 VAL A C    12 
ATOM   8616  O O    . VAL A 1 21 ? 2.399   1.705   4.445   1.00 15.00 ?  299 VAL A O    12 
ATOM   8617  C CB   . VAL A 1 21 ? 3.893   0.125   2.575   1.00 15.00 ?  299 VAL A CB   12 
ATOM   8618  C CG1  . VAL A 1 21 ? 4.402   -0.879  1.546   1.00 15.00 ?  299 VAL A CG1  12 
ATOM   8619  C CG2  . VAL A 1 21 ? 3.642   1.459   1.893   1.00 15.00 ?  299 VAL A CG2  12 
ATOM   8620  H H    . VAL A 1 21 ? 1.085   0.492   2.124   1.00 15.00 ?  299 VAL A H    12 
ATOM   8621  H HA   . VAL A 1 21 ? 2.744   -1.402  3.573   1.00 15.00 ?  299 VAL A HA   12 
ATOM   8622  H HB   . VAL A 1 21 ? 4.649   0.261   3.334   1.00 15.00 ?  299 VAL A HB   12 
ATOM   8623  H HG11 . VAL A 1 21 ? 3.676   -0.978  0.752   1.00 15.00 ?  299 VAL A HG11 12 
ATOM   8624  H HG12 . VAL A 1 21 ? 4.550   -1.839  2.017   1.00 15.00 ?  299 VAL A HG12 12 
ATOM   8625  H HG13 . VAL A 1 21 ? 5.339   -0.530  1.136   1.00 15.00 ?  299 VAL A HG13 12 
ATOM   8626  H HG21 . VAL A 1 21 ? 2.876   1.340   1.139   1.00 15.00 ?  299 VAL A HG21 12 
ATOM   8627  H HG22 . VAL A 1 21 ? 4.553   1.804   1.427   1.00 15.00 ?  299 VAL A HG22 12 
ATOM   8628  H HG23 . VAL A 1 21 ? 3.314   2.183   2.625   1.00 15.00 ?  299 VAL A HG23 12 
ATOM   8629  N N    . ASP A 1 22 ? 1.539   -0.123  5.381   1.00 15.00 ?  300 ASP A N    12 
ATOM   8630  C CA   . ASP A 1 22 ? 1.102   0.602   6.548   1.00 15.00 ?  300 ASP A CA   12 
ATOM   8631  C C    . ASP A 1 22 ? 2.176   0.500   7.610   1.00 15.00 ?  300 ASP A C    12 
ATOM   8632  O O    . ASP A 1 22 ? 2.556   -0.601  8.031   1.00 15.00 ?  300 ASP A O    12 
ATOM   8633  C CB   . ASP A 1 22 ? -0.258  0.087   7.031   1.00 15.00 ?  300 ASP A CB   12 
ATOM   8634  C CG   . ASP A 1 22 ? -0.266  -0.284  8.495   1.00 15.00 ?  300 ASP A CG   12 
ATOM   8635  O OD1  . ASP A 1 22 ? -0.290  0.627   9.352   1.00 15.00 ?  300 ASP A OD1  12 
ATOM   8636  O OD2  . ASP A 1 22 ? -0.232  -1.492  8.788   1.00 15.00 -1 300 ASP A OD2  12 
ATOM   8637  H H    . ASP A 1 22 ? 1.349   -1.086  5.306   1.00 15.00 ?  300 ASP A H    12 
ATOM   8638  H HA   . ASP A 1 22 ? 1.002   1.642   6.266   1.00 15.00 ?  300 ASP A HA   12 
ATOM   8639  H HB2  . ASP A 1 22 ? -0.999  0.857   6.874   1.00 15.00 ?  300 ASP A HB2  12 
ATOM   8640  H HB3  . ASP A 1 22 ? -0.530  -0.786  6.453   1.00 15.00 ?  300 ASP A HB3  12 
ATOM   8641  N N    . HIS A 1 23 ? 2.690   1.657   8.007   1.00 15.00 ?  301 HIS A N    12 
ATOM   8642  C CA   . HIS A 1 23 ? 3.850   1.716   8.879   1.00 15.00 ?  301 HIS A CA   12 
ATOM   8643  C C    . HIS A 1 23 ? 3.451   1.511   10.338  1.00 15.00 ?  301 HIS A C    12 
ATOM   8644  O O    . HIS A 1 23 ? 4.297   1.230   11.185  1.00 15.00 ?  301 HIS A O    12 
ATOM   8645  C CB   . HIS A 1 23 ? 4.586   3.062   8.758   1.00 15.00 ?  301 HIS A CB   12 
ATOM   8646  C CG   . HIS A 1 23 ? 4.998   3.489   7.373   1.00 15.00 ?  301 HIS A CG   12 
ATOM   8647  N ND1  . HIS A 1 23 ? 5.089   4.811   7.009   1.00 15.00 ?  301 HIS A ND1  12 
ATOM   8648  C CD2  . HIS A 1 23 ? 5.432   2.787   6.300   1.00 15.00 ?  301 HIS A CD2  12 
ATOM   8649  C CE1  . HIS A 1 23 ? 5.561   4.900   5.784   1.00 15.00 ?  301 HIS A CE1  12 
ATOM   8650  N NE2  . HIS A 1 23 ? 5.789   3.682   5.327   1.00 15.00 ?  301 HIS A NE2  12 
ATOM   8651  H H    . HIS A 1 23 ? 2.262   2.493   7.715   1.00 15.00 ?  301 HIS A H    12 
ATOM   8652  H HA   . HIS A 1 23 ? 4.523   0.923   8.587   1.00 15.00 ?  301 HIS A HA   12 
ATOM   8653  H HB2  . HIS A 1 23 ? 3.956   3.836   9.153   1.00 15.00 ?  301 HIS A HB2  12 
ATOM   8654  H HB3  . HIS A 1 23 ? 5.483   3.009   9.357   1.00 15.00 ?  301 HIS A HB3  12 
ATOM   8655  H HD1  . HIS A 1 23 ? 4.826   5.584   7.573   1.00 15.00 ?  301 HIS A HD1  12 
ATOM   8656  H HD2  . HIS A 1 23 ? 5.473   1.710   6.213   1.00 15.00 ?  301 HIS A HD2  12 
ATOM   8657  H HE1  . HIS A 1 23 ? 5.712   5.817   5.226   1.00 15.00 ?  301 HIS A HE1  12 
ATOM   8658  H HE2  . HIS A 1 23 ? 6.438   3.481   4.609   1.00 15.00 ?  301 HIS A HE2  12 
ATOM   8659  N N    . ASN A 1 24 ? 2.162   1.660   10.633  1.00 15.00 ?  302 ASN A N    12 
ATOM   8660  C CA   . ASN A 1 24 ? 1.695   1.639   12.019  1.00 15.00 ?  302 ASN A CA   12 
ATOM   8661  C C    . ASN A 1 24 ? 1.309   0.233   12.456  1.00 15.00 ?  302 ASN A C    12 
ATOM   8662  O O    . ASN A 1 24 ? 1.810   -0.273  13.462  1.00 15.00 ?  302 ASN A O    12 
ATOM   8663  C CB   . ASN A 1 24 ? 0.505   2.591   12.212  1.00 15.00 ?  302 ASN A CB   12 
ATOM   8664  C CG   . ASN A 1 24 ? 0.912   4.055   12.303  1.00 15.00 ?  302 ASN A CG   12 
ATOM   8665  O OD1  . ASN A 1 24 ? 0.253   4.853   12.969  1.00 15.00 ?  302 ASN A OD1  12 
ATOM   8666  N ND2  . ASN A 1 24 ? 1.996   4.424   11.639  1.00 15.00 ?  302 ASN A ND2  12 
ATOM   8667  H H    . ASN A 1 24 ? 1.506   1.754   9.904   1.00 15.00 ?  302 ASN A H    12 
ATOM   8668  H HA   . ASN A 1 24 ? 2.510   1.978   12.641  1.00 15.00 ?  302 ASN A HA   12 
ATOM   8669  H HB2  . ASN A 1 24 ? -0.173  2.480   11.379  1.00 15.00 ?  302 ASN A HB2  12 
ATOM   8670  H HB3  . ASN A 1 24 ? -0.012  2.323   13.123  1.00 15.00 ?  302 ASN A HB3  12 
ATOM   8671  H HD21 . ASN A 1 24 ? 2.480   3.741   11.130  1.00 15.00 ?  302 ASN A HD21 12 
ATOM   8672  H HD22 . ASN A 1 24 ? 2.274   5.361   11.689  1.00 15.00 ?  302 ASN A HD22 12 
ATOM   8673  N N    . ASN A 1 25 ? 0.419   -0.395  11.704  1.00 15.00 ?  303 ASN A N    12 
ATOM   8674  C CA   . ASN A 1 25 ? -0.045  -1.738  12.027  1.00 15.00 ?  303 ASN A CA   12 
ATOM   8675  C C    . ASN A 1 25 ? 0.902   -2.778  11.430  1.00 15.00 ?  303 ASN A C    12 
ATOM   8676  O O    . ASN A 1 25 ? 0.851   -3.959  11.783  1.00 15.00 ?  303 ASN A O    12 
ATOM   8677  C CB   . ASN A 1 25 ? -1.487  -1.938  11.529  1.00 15.00 ?  303 ASN A CB   12 
ATOM   8678  C CG   . ASN A 1 25 ? -2.057  -3.304  11.870  1.00 15.00 ?  303 ASN A CG   12 
ATOM   8679  O OD1  . ASN A 1 25 ? -2.582  -3.517  12.963  1.00 15.00 ?  303 ASN A OD1  12 
ATOM   8680  N ND2  . ASN A 1 25 ? -1.991  -4.226  10.926  1.00 15.00 ?  303 ASN A ND2  12 
ATOM   8681  H H    . ASN A 1 25 ? 0.064   0.055   10.893  1.00 15.00 ?  303 ASN A H    12 
ATOM   8682  H HA   . ASN A 1 25 ? -0.031  -1.838  13.103  1.00 15.00 ?  303 ASN A HA   12 
ATOM   8683  H HB2  . ASN A 1 25 ? -2.120  -1.188  11.977  1.00 15.00 ?  303 ASN A HB2  12 
ATOM   8684  H HB3  . ASN A 1 25 ? -1.505  -1.821  10.456  1.00 15.00 ?  303 ASN A HB3  12 
ATOM   8685  H HD21 . ASN A 1 25 ? -1.584  -3.978  10.061  1.00 15.00 ?  303 ASN A HD21 12 
ATOM   8686  H HD22 . ASN A 1 25 ? -2.347  -5.123  11.121  1.00 15.00 ?  303 ASN A HD22 12 
ATOM   8687  N N    . ARG A 1 26 ? 1.748   -2.317  10.505  1.00 15.00 ?  304 ARG A N    12 
ATOM   8688  C CA   . ARG A 1 26 ? 2.790   -3.139  9.891   1.00 15.00 ?  304 ARG A CA   12 
ATOM   8689  C C    . ARG A 1 26 ? 2.168   -4.169  8.951   1.00 15.00 ?  304 ARG A C    12 
ATOM   8690  O O    . ARG A 1 26 ? 2.435   -5.369  9.059   1.00 15.00 ?  304 ARG A O    12 
ATOM   8691  C CB   . ARG A 1 26 ? 3.623   -3.842  10.969  1.00 15.00 ?  304 ARG A CB   12 
ATOM   8692  C CG   . ARG A 1 26 ? 4.991   -4.304  10.500  1.00 15.00 ?  304 ARG A CG   12 
ATOM   8693  C CD   . ARG A 1 26 ? 6.076   -3.347  10.960  1.00 15.00 ?  304 ARG A CD   12 
ATOM   8694  N NE   . ARG A 1 26 ? 7.410   -3.930  10.851  1.00 15.00 ?  304 ARG A NE   12 
ATOM   8695  C CZ   . ARG A 1 26 ? 8.424   -3.606  11.648  1.00 15.00 ?  304 ARG A CZ   12 
ATOM   8696  N NH1  . ARG A 1 26 ? 8.276   -2.654  12.564  1.00 15.00 1  304 ARG A NH1  12 
ATOM   8697  N NH2  . ARG A 1 26 ? 9.589   -4.222  11.518  1.00 15.00 ?  304 ARG A NH2  12 
ATOM   8698  H H    . ARG A 1 26 ? 1.646   -1.389  10.204  1.00 15.00 ?  304 ARG A H    12 
ATOM   8699  H HA   . ARG A 1 26 ? 3.432   -2.486  9.318   1.00 15.00 ?  304 ARG A HA   12 
ATOM   8700  H HB2  . ARG A 1 26 ? 3.763   -3.162  11.796  1.00 15.00 ?  304 ARG A HB2  12 
ATOM   8701  H HB3  . ARG A 1 26 ? 3.078   -4.706  11.319  1.00 15.00 ?  304 ARG A HB3  12 
ATOM   8702  H HG2  . ARG A 1 26 ? 5.192   -5.284  10.899  1.00 15.00 ?  304 ARG A HG2  12 
ATOM   8703  H HG3  . ARG A 1 26 ? 4.995   -4.346  9.419   1.00 15.00 ?  304 ARG A HG3  12 
ATOM   8704  H HD2  . ARG A 1 26 ? 6.033   -2.456  10.351  1.00 15.00 ?  304 ARG A HD2  12 
ATOM   8705  H HD3  . ARG A 1 26 ? 5.890   -3.085  11.992  1.00 15.00 ?  304 ARG A HD3  12 
ATOM   8706  H HE   . ARG A 1 26 ? 7.553   -4.618  10.157  1.00 15.00 ?  304 ARG A HE   12 
ATOM   8707  H HH11 . ARG A 1 26 ? 7.399   -2.172  12.655  1.00 15.00 ?  304 ARG A HH11 12 
ATOM   8708  H HH12 . ARG A 1 26 ? 9.035   -2.419  13.177  1.00 15.00 ?  304 ARG A HH12 12 
ATOM   8709  H HH21 . ARG A 1 26 ? 9.709   -4.930  10.813  1.00 15.00 ?  304 ARG A HH21 12 
ATOM   8710  H HH22 . ARG A 1 26 ? 10.356  -3.992  12.132  1.00 15.00 ?  304 ARG A HH22 12 
ATOM   8711  N N    . THR A 1 27 ? 1.346   -3.705  8.022   1.00 15.00 ?  305 THR A N    12 
ATOM   8712  C CA   . THR A 1 27 ? 0.659   -4.619  7.109   1.00 15.00 ?  305 THR A CA   12 
ATOM   8713  C C    . THR A 1 27 ? 0.664   -4.130  5.663   1.00 15.00 ?  305 THR A C    12 
ATOM   8714  O O    . THR A 1 27 ? 0.712   -2.928  5.394   1.00 15.00 ?  305 THR A O    12 
ATOM   8715  C CB   . THR A 1 27 ? -0.791  -4.907  7.554   1.00 15.00 ?  305 THR A CB   12 
ATOM   8716  O OG1  . THR A 1 27 ? -1.331  -3.807  8.300   1.00 15.00 ?  305 THR A OG1  12 
ATOM   8717  C CG2  . THR A 1 27 ? -0.853  -6.176  8.389   1.00 15.00 ?  305 THR A CG2  12 
ATOM   8718  H H    . THR A 1 27 ? 1.203   -2.725  7.943   1.00 15.00 ?  305 THR A H    12 
ATOM   8719  H HA   . THR A 1 27 ? 1.197   -5.554  7.142   1.00 15.00 ?  305 THR A HA   12 
ATOM   8720  H HB   . THR A 1 27 ? -1.394  -5.054  6.669   1.00 15.00 ?  305 THR A HB   12 
ATOM   8721  H HG1  . THR A 1 27 ? -0.723  -3.046  8.259   1.00 15.00 ?  305 THR A HG1  12 
ATOM   8722  H HG21 . THR A 1 27 ? -1.875  -6.357  8.694   1.00 15.00 ?  305 THR A HG21 12 
ATOM   8723  H HG22 . THR A 1 27 ? -0.231  -6.063  9.265   1.00 15.00 ?  305 THR A HG22 12 
ATOM   8724  H HG23 . THR A 1 27 ? -0.499  -7.011  7.802   1.00 15.00 ?  305 THR A HG23 12 
ATOM   8725  N N    . THR A 1 28 ? 0.646   -5.087  4.739   1.00 15.00 ?  306 THR A N    12 
ATOM   8726  C CA   . THR A 1 28 ? 0.650   -4.795  3.315   1.00 15.00 ?  306 THR A CA   12 
ATOM   8727  C C    . THR A 1 28 ? -0.653  -5.277  2.659   1.00 15.00 ?  306 THR A C    12 
ATOM   8728  O O    . THR A 1 28 ? -1.204  -6.309  3.050   1.00 15.00 ?  306 THR A O    12 
ATOM   8729  C CB   . THR A 1 28 ? 1.877   -5.444  2.637   1.00 15.00 ?  306 THR A CB   12 
ATOM   8730  O OG1  . THR A 1 28 ? 1.949   -6.843  2.957   1.00 15.00 ?  306 THR A OG1  12 
ATOM   8731  C CG2  . THR A 1 28 ? 3.160   -4.763  3.091   1.00 15.00 ?  306 THR A CG2  12 
ATOM   8732  H H    . THR A 1 28 ? 0.625   -6.025  5.025   1.00 15.00 ?  306 THR A H    12 
ATOM   8733  H HA   . THR A 1 28 ? 0.724   -3.724  3.197   1.00 15.00 ?  306 THR A HA   12 
ATOM   8734  H HB   . THR A 1 28 ? 1.785   -5.330  1.566   1.00 15.00 ?  306 THR A HB   12 
ATOM   8735  H HG1  . THR A 1 28 ? 2.817   -7.182  2.703   1.00 15.00 ?  306 THR A HG1  12 
ATOM   8736  H HG21 . THR A 1 28 ? 3.258   -4.856  4.163   1.00 15.00 ?  306 THR A HG21 12 
ATOM   8737  H HG22 . THR A 1 28 ? 3.127   -3.716  2.824   1.00 15.00 ?  306 THR A HG22 12 
ATOM   8738  H HG23 . THR A 1 28 ? 4.006   -5.229  2.610   1.00 15.00 ?  306 THR A HG23 12 
ATOM   8739  N N    . GLN A 1 29 ? -1.152  -4.524  1.673   1.00 15.00 ?  307 GLN A N    12 
ATOM   8740  C CA   . GLN A 1 29 ? -2.484  -4.803  1.101   1.00 15.00 ?  307 GLN A CA   12 
ATOM   8741  C C    . GLN A 1 29 ? -2.586  -4.395  -0.379  1.00 15.00 ?  307 GLN A C    12 
ATOM   8742  O O    . GLN A 1 29 ? -2.436  -3.231  -0.712  1.00 15.00 ?  307 GLN A O    12 
ATOM   8743  C CB   . GLN A 1 29 ? -3.543  -4.054  1.919   1.00 15.00 ?  307 GLN A CB   12 
ATOM   8744  C CG   . GLN A 1 29 ? -4.976  -4.317  1.480   1.00 15.00 ?  307 GLN A CG   12 
ATOM   8745  C CD   . GLN A 1 29 ? -6.002  -3.946  2.533   1.00 15.00 ?  307 GLN A CD   12 
ATOM   8746  O OE1  . GLN A 1 29 ? -5.771  -4.103  3.732   1.00 15.00 ?  307 GLN A OE1  12 
ATOM   8747  N NE2  . GLN A 1 29 ? -7.133  -3.417  2.093   1.00 15.00 ?  307 GLN A NE2  12 
ATOM   8748  H H    . GLN A 1 29 ? -0.621  -3.767  1.331   1.00 15.00 ?  307 GLN A H    12 
ATOM   8749  H HA   . GLN A 1 29 ? -2.665  -5.863  1.184   1.00 15.00 ?  307 GLN A HA   12 
ATOM   8750  H HB2  . GLN A 1 29 ? -3.442  -4.330  2.953   1.00 15.00 ?  307 GLN A HB2  12 
ATOM   8751  H HB3  . GLN A 1 29 ? -3.355  -2.994  1.827   1.00 15.00 ?  307 GLN A HB3  12 
ATOM   8752  H HG2  . GLN A 1 29 ? -5.177  -3.744  0.589   1.00 15.00 ?  307 GLN A HG2  12 
ATOM   8753  H HG3  . GLN A 1 29 ? -5.080  -5.361  1.262   1.00 15.00 ?  307 GLN A HG3  12 
ATOM   8754  H HE21 . GLN A 1 29 ? -7.241  -3.293  1.124   1.00 15.00 ?  307 GLN A HE21 12 
ATOM   8755  H HE22 . GLN A 1 29 ? -7.813  -3.163  2.752   1.00 15.00 ?  307 GLN A HE22 12 
ATOM   8756  N N    . PHE A 1 30 ? -2.876  -5.353  -1.260  1.00 15.00 ?  308 PHE A N    12 
ATOM   8757  C CA   . PHE A 1 30 ? -2.978  -5.067  -2.699  1.00 15.00 ?  308 PHE A CA   12 
ATOM   8758  C C    . PHE A 1 30 ? -4.257  -4.324  -3.095  1.00 15.00 ?  308 PHE A C    12 
ATOM   8759  O O    . PHE A 1 30 ? -4.349  -3.813  -4.210  1.00 15.00 ?  308 PHE A O    12 
ATOM   8760  C CB   . PHE A 1 30 ? -2.849  -6.336  -3.547  1.00 15.00 ?  308 PHE A CB   12 
ATOM   8761  C CG   . PHE A 1 30 ? -1.439  -6.654  -3.953  1.00 15.00 ?  308 PHE A CG   12 
ATOM   8762  C CD1  . PHE A 1 30 ? -0.599  -5.639  -4.386  1.00 15.00 ?  308 PHE A CD1  12 
ATOM   8763  C CD2  . PHE A 1 30 ? -0.958  -7.952  -3.939  1.00 15.00 ?  308 PHE A CD2  12 
ATOM   8764  C CE1  . PHE A 1 30 ? 0.692   -5.911  -4.792  1.00 15.00 ?  308 PHE A CE1  12 
ATOM   8765  C CE2  . PHE A 1 30 ? 0.331   -8.225  -4.338  1.00 15.00 ?  308 PHE A CE2  12 
ATOM   8766  C CZ   . PHE A 1 30 ? 1.156   -7.205  -4.767  1.00 15.00 ?  308 PHE A CZ   12 
ATOM   8767  H H    . PHE A 1 30 ? -3.026  -6.272  -0.939  1.00 15.00 ?  308 PHE A H    12 
ATOM   8768  H HA   . PHE A 1 30 ? -2.144  -4.425  -2.942  1.00 15.00 ?  308 PHE A HA   12 
ATOM   8769  H HB2  . PHE A 1 30 ? -3.228  -7.176  -2.982  1.00 15.00 ?  308 PHE A HB2  12 
ATOM   8770  H HB3  . PHE A 1 30 ? -3.438  -6.220  -4.445  1.00 15.00 ?  308 PHE A HB3  12 
ATOM   8771  H HD1  . PHE A 1 30 ? -0.962  -4.623  -4.401  1.00 15.00 ?  308 PHE A HD1  12 
ATOM   8772  H HD2  . PHE A 1 30 ? -1.597  -8.758  -3.609  1.00 15.00 ?  308 PHE A HD2  12 
ATOM   8773  H HE1  . PHE A 1 30 ? 1.336   -5.107  -5.127  1.00 15.00 ?  308 PHE A HE1  12 
ATOM   8774  H HE2  . PHE A 1 30 ? 0.697   -9.241  -4.319  1.00 15.00 ?  308 PHE A HE2  12 
ATOM   8775  H HZ   . PHE A 1 30 ? 2.164   -7.424  -5.087  1.00 15.00 ?  308 PHE A HZ   12 
ATOM   8776  N N    . THR A 1 31 ? -5.249  -4.279  -2.226  1.00 15.00 ?  309 THR A N    12 
ATOM   8777  C CA   . THR A 1 31 ? -6.475  -3.563  -2.553  1.00 15.00 ?  309 THR A CA   12 
ATOM   8778  C C    . THR A 1 31 ? -6.557  -2.244  -1.785  1.00 15.00 ?  309 THR A C    12 
ATOM   8779  O O    . THR A 1 31 ? -6.376  -2.206  -0.564  1.00 15.00 ?  309 THR A O    12 
ATOM   8780  C CB   . THR A 1 31 ? -7.737  -4.425  -2.293  1.00 15.00 ?  309 THR A CB   12 
ATOM   8781  O OG1  . THR A 1 31 ? -8.916  -3.708  -2.680  1.00 15.00 ?  309 THR A OG1  12 
ATOM   8782  C CG2  . THR A 1 31 ? -7.850  -4.834  -0.832  1.00 15.00 ?  309 THR A CG2  12 
ATOM   8783  H H    . THR A 1 31 ? -5.160  -4.723  -1.359  1.00 15.00 ?  309 THR A H    12 
ATOM   8784  H HA   . THR A 1 31 ? -6.440  -3.337  -3.610  1.00 15.00 ?  309 THR A HA   12 
ATOM   8785  H HB   . THR A 1 31 ? -7.665  -5.321  -2.894  1.00 15.00 ?  309 THR A HB   12 
ATOM   8786  H HG1  . THR A 1 31 ? -9.217  -4.022  -3.539  1.00 15.00 ?  309 THR A HG1  12 
ATOM   8787  H HG21 . THR A 1 31 ? -8.743  -5.425  -0.693  1.00 15.00 ?  309 THR A HG21 12 
ATOM   8788  H HG22 . THR A 1 31 ? -7.905  -3.950  -0.215  1.00 15.00 ?  309 THR A HG22 12 
ATOM   8789  H HG23 . THR A 1 31 ? -6.984  -5.416  -0.552  1.00 15.00 ?  309 THR A HG23 12 
ATOM   8790  N N    . ASP A 1 32 ? -6.798  -1.157  -2.513  1.00 15.00 ?  310 ASP A N    12 
ATOM   8791  C CA   . ASP A 1 32 ? -6.933  0.158   -1.897  1.00 15.00 ?  310 ASP A CA   12 
ATOM   8792  C C    . ASP A 1 32 ? -8.402  0.472   -1.662  1.00 15.00 ?  310 ASP A C    12 
ATOM   8793  O O    . ASP A 1 32 ? -9.224  0.397   -2.576  1.00 15.00 ?  310 ASP A O    12 
ATOM   8794  C CB   . ASP A 1 32 ? -6.247  1.245   -2.753  1.00 15.00 ?  310 ASP A CB   12 
ATOM   8795  C CG   . ASP A 1 32 ? -6.463  2.659   -2.227  1.00 15.00 ?  310 ASP A CG   12 
ATOM   8796  O OD1  . ASP A 1 32 ? -7.600  3.159   -2.309  1.00 15.00 ?  310 ASP A OD1  12 
ATOM   8797  O OD2  . ASP A 1 32 ? -5.489  3.286   -1.754  1.00 15.00 -1 310 ASP A OD2  12 
ATOM   8798  H H    . ASP A 1 32 ? -6.897  -1.243  -3.484  1.00 15.00 ?  310 ASP A H    12 
ATOM   8799  H HA   . ASP A 1 32 ? -6.455  0.106   -0.938  1.00 15.00 ?  310 ASP A HA   12 
ATOM   8800  H HB2  . ASP A 1 32 ? -5.186  1.058   -2.768  1.00 15.00 ?  310 ASP A HB2  12 
ATOM   8801  H HB3  . ASP A 1 32 ? -6.621  1.198   -3.762  1.00 15.00 ?  310 ASP A HB3  12 
ATOM   8802  N N    . PRO A 1 33 ? -8.738  0.839   -0.418  1.00 15.00 ?  311 PRO A N    12 
ATOM   8803  C CA   . PRO A 1 33 ? -10.123 1.017   0.021   1.00 15.00 ?  311 PRO A CA   12 
ATOM   8804  C C    . PRO A 1 33 ? -10.775 2.290   -0.522  1.00 15.00 ?  311 PRO A C    12 
ATOM   8805  O O    . PRO A 1 33 ? -11.995 2.436   -0.470  1.00 15.00 ?  311 PRO A O    12 
ATOM   8806  C CB   . PRO A 1 33 ? -9.990  1.080   1.546   1.00 15.00 ?  311 PRO A CB   12 
ATOM   8807  C CG   . PRO A 1 33 ? -8.643  1.668   1.768   1.00 15.00 ?  311 PRO A CG   12 
ATOM   8808  C CD   . PRO A 1 33 ? -7.778  1.120   0.668   1.00 15.00 ?  311 PRO A CD   12 
ATOM   8809  H HA   . PRO A 1 33 ? -10.730 0.167   -0.250  1.00 15.00 ?  311 PRO A HA   12 
ATOM   8810  H HB2  . PRO A 1 33 ? -10.773 1.699   1.968   1.00 15.00 ?  311 PRO A HB2  12 
ATOM   8811  H HB3  . PRO A 1 33 ? -10.047 0.083   1.952   1.00 15.00 ?  311 PRO A HB3  12 
ATOM   8812  H HG2  . PRO A 1 33 ? -8.695  2.745   1.705   1.00 15.00 ?  311 PRO A HG2  12 
ATOM   8813  H HG3  . PRO A 1 33 ? -8.261  1.364   2.732   1.00 15.00 ?  311 PRO A HG3  12 
ATOM   8814  H HD2  . PRO A 1 33 ? -7.051  1.858   0.359   1.00 15.00 ?  311 PRO A HD2  12 
ATOM   8815  H HD3  . PRO A 1 33 ? -7.285  0.215   0.990   1.00 15.00 ?  311 PRO A HD3  12 
ATOM   8816  N N    . ARG A 1 34 ? -9.971  3.205   -1.038  1.00 15.00 ?  312 ARG A N    12 
ATOM   8817  C CA   . ARG A 1 34 ? -10.474 4.498   -1.480  1.00 15.00 ?  312 ARG A CA   12 
ATOM   8818  C C    . ARG A 1 34 ? -11.180 4.375   -2.819  1.00 15.00 ?  312 ARG A C    12 
ATOM   8819  O O    . ARG A 1 34 ? -12.240 4.973   -3.028  1.00 15.00 ?  312 ARG A O    12 
ATOM   8820  C CB   . ARG A 1 34 ? -9.332  5.505   -1.586  1.00 15.00 ?  312 ARG A CB   12 
ATOM   8821  C CG   . ARG A 1 34 ? -8.587  5.714   -0.281  1.00 15.00 ?  312 ARG A CG   12 
ATOM   8822  C CD   . ARG A 1 34 ? -7.108  5.951   -0.530  1.00 15.00 ?  312 ARG A CD   12 
ATOM   8823  N NE   . ARG A 1 34 ? -6.875  7.062   -1.448  1.00 15.00 ?  312 ARG A NE   12 
ATOM   8824  C CZ   . ARG A 1 34 ? -5.967  7.041   -2.421  1.00 15.00 ?  312 ARG A CZ   12 
ATOM   8825  N NH1  . ARG A 1 34 ? -5.269  5.935   -2.663  1.00 15.00 1  312 ARG A NH1  12 
ATOM   8826  N NH2  . ARG A 1 34 ? -5.786  8.118   -3.173  1.00 15.00 ?  312 ARG A NH2  12 
ATOM   8827  H H    . ARG A 1 34 ? -9.011  2.996   -1.156  1.00 15.00 ?  312 ARG A H    12 
ATOM   8828  H HA   . ARG A 1 34 ? -11.182 4.846   -0.743  1.00 15.00 ?  312 ARG A HA   12 
ATOM   8829  H HB2  . ARG A 1 34 ? -8.628  5.156   -2.327  1.00 15.00 ?  312 ARG A HB2  12 
ATOM   8830  H HB3  . ARG A 1 34 ? -9.734  6.456   -1.903  1.00 15.00 ?  312 ARG A HB3  12 
ATOM   8831  H HG2  . ARG A 1 34 ? -8.999  6.575   0.227   1.00 15.00 ?  312 ARG A HG2  12 
ATOM   8832  H HG3  . ARG A 1 34 ? -8.704  4.837   0.336   1.00 15.00 ?  312 ARG A HG3  12 
ATOM   8833  H HD2  . ARG A 1 34 ? -6.631  6.170   0.413   1.00 15.00 ?  312 ARG A HD2  12 
ATOM   8834  H HD3  . ARG A 1 34 ? -6.680  5.052   -0.949  1.00 15.00 ?  312 ARG A HD3  12 
ATOM   8835  H HE   . ARG A 1 34 ? -7.420  7.879   -1.321  1.00 15.00 ?  312 ARG A HE   12 
ATOM   8836  H HH11 . ARG A 1 34 ? -5.424  5.099   -2.111  1.00 15.00 ?  312 ARG A HH11 12 
ATOM   8837  H HH12 . ARG A 1 34 ? -4.589  5.921   -3.395  1.00 15.00 ?  312 ARG A HH12 12 
ATOM   8838  H HH21 . ARG A 1 34 ? -6.333  8.943   -3.011  1.00 15.00 ?  312 ARG A HH21 12 
ATOM   8839  H HH22 . ARG A 1 34 ? -5.092  8.113   -3.910  1.00 15.00 ?  312 ARG A HH22 12 
ATOM   8840  N N    . LEU A 1 35 ? -10.591 3.603   -3.724  1.00 15.00 ?  313 LEU A N    12 
ATOM   8841  C CA   . LEU A 1 35 ? -11.168 3.403   -5.047  1.00 15.00 ?  313 LEU A CA   12 
ATOM   8842  C C    . LEU A 1 35 ? -12.505 2.684   -4.944  1.00 15.00 ?  313 LEU A C    12 
ATOM   8843  O O    . LEU A 1 35 ? -12.516 1.471   -4.659  1.00 15.00 ?  313 LEU A O    12 
ATOM   8844  C CB   . LEU A 1 35 ? -10.224 2.623   -5.973  1.00 15.00 ?  313 LEU A CB   12 
ATOM   8845  C CG   . LEU A 1 35 ? -8.975  3.380   -6.435  1.00 15.00 ?  313 LEU A CG   12 
ATOM   8846  C CD1  . LEU A 1 35 ? -7.833  3.213   -5.446  1.00 15.00 ?  313 LEU A CD1  12 
ATOM   8847  C CD2  . LEU A 1 35 ? -8.553  2.912   -7.820  1.00 15.00 ?  313 LEU A CD2  12 
ATOM   8848  H H    . LEU A 1 35 ? -9.749  3.151   -3.492  1.00 15.00 ?  313 LEU A H    12 
ATOM   8849  H HA   . LEU A 1 35 ? -11.342 4.380   -5.476  1.00 15.00 ?  313 LEU A HA   12 
ATOM   8850  H HB2  . LEU A 1 35 ? -9.907  1.730   -5.454  1.00 15.00 ?  313 LEU A HB2  12 
ATOM   8851  H HB3  . LEU A 1 35 ? -10.782 2.327   -6.850  1.00 15.00 ?  313 LEU A HB3  12 
ATOM   8852  H HG   . LEU A 1 35 ? -9.205  4.434   -6.498  1.00 15.00 ?  313 LEU A HG   12 
ATOM   8853  H HD11 . LEU A 1 35 ? -8.159  3.508   -4.460  1.00 15.00 ?  313 LEU A HD11 12 
ATOM   8854  H HD12 . LEU A 1 35 ? -7.002  3.831   -5.750  1.00 15.00 ?  313 LEU A HD12 12 
ATOM   8855  H HD13 . LEU A 1 35 ? -7.523  2.179   -5.428  1.00 15.00 ?  313 LEU A HD13 12 
ATOM   8856  H HD21 . LEU A 1 35 ? -9.361  3.080   -8.518  1.00 15.00 ?  313 LEU A HD21 12 
ATOM   8857  H HD22 . LEU A 1 35 ? -8.318  1.859   -7.789  1.00 15.00 ?  313 LEU A HD22 12 
ATOM   8858  H HD23 . LEU A 1 35 ? -7.683  3.466   -8.137  1.00 15.00 ?  313 LEU A HD23 12 
ATOM   8859  N N    . ASP B 2 2  ? -0.316  -9.941  -9.551  1.00 15.00 ?  221 ASP B N    12 
ATOM   8860  C CA   . ASP B 2 2  ? 0.938   -9.534  -8.879  1.00 15.00 ?  221 ASP B CA   12 
ATOM   8861  C C    . ASP B 2 2  ? 1.168   -10.380 -7.636  1.00 15.00 ?  221 ASP B C    12 
ATOM   8862  O O    . ASP B 2 2  ? 0.266   -10.549 -6.814  1.00 15.00 ?  221 ASP B O    12 
ATOM   8863  C CB   . ASP B 2 2  ? 0.911   -8.038  -8.531  1.00 15.00 ?  221 ASP B CB   12 
ATOM   8864  C CG   . ASP B 2 2  ? 1.268   -7.183  -9.723  1.00 15.00 ?  221 ASP B CG   12 
ATOM   8865  O OD1  . ASP B 2 2  ? 2.467   -6.901  -9.910  1.00 15.00 ?  221 ASP B OD1  12 
ATOM   8866  O OD2  . ASP B 2 2  ? 0.360   -6.802  -10.487 1.00 15.00 -1 221 ASP B OD2  12 
ATOM   8867  H H    . ASP B 2 2  ? -0.263  -10.946 -9.823  1.00 15.00 ?  221 ASP B H    12 
ATOM   8868  H HA   . ASP B 2 2  ? 1.753   -9.717  -9.566  1.00 15.00 ?  221 ASP B HA   12 
ATOM   8869  H HB2  . ASP B 2 2  ? -0.078  -7.759  -8.197  1.00 15.00 ?  221 ASP B HB2  12 
ATOM   8870  H HB3  . ASP B 2 2  ? 1.622   -7.839  -7.745  1.00 15.00 ?  221 ASP B HB3  12 
ATOM   8871  N N    . THR B 2 3  ? 2.382   -10.910 -7.514  1.00 15.00 ?  222 THR B N    12 
ATOM   8872  C CA   . THR B 2 3  ? 2.742   -11.805 -6.420  1.00 15.00 ?  222 THR B CA   12 
ATOM   8873  C C    . THR B 2 3  ? 2.512   -11.160 -5.058  1.00 15.00 ?  222 THR B C    12 
ATOM   8874  O O    . THR B 2 3  ? 2.532   -9.938  -4.943  1.00 15.00 ?  222 THR B O    12 
ATOM   8875  C CB   . THR B 2 3  ? 4.214   -12.252 -6.537  1.00 15.00 ?  222 THR B CB   12 
ATOM   8876  O OG1  . THR B 2 3  ? 5.061   -11.109 -6.717  1.00 15.00 ?  222 THR B OG1  12 
ATOM   8877  C CG2  . THR B 2 3  ? 4.397   -13.214 -7.700  1.00 15.00 ?  222 THR B CG2  12 
ATOM   8878  H H    . THR B 2 3  ? 3.064   -10.691 -8.188  1.00 15.00 ?  222 THR B H    12 
ATOM   8879  H HA   . THR B 2 3  ? 2.113   -12.679 -6.489  1.00 15.00 ?  222 THR B HA   12 
ATOM   8880  H HB   . THR B 2 3  ? 4.494   -12.757 -5.624  1.00 15.00 ?  222 THR B HB   12 
ATOM   8881  H HG1  . THR B 2 3  ? 5.004   -10.810 -7.638  1.00 15.00 ?  222 THR B HG1  12 
ATOM   8882  H HG21 . THR B 2 3  ? 5.431   -13.525 -7.750  1.00 15.00 ?  222 THR B HG21 12 
ATOM   8883  H HG22 . THR B 2 3  ? 4.124   -12.724 -8.624  1.00 15.00 ?  222 THR B HG22 12 
ATOM   8884  H HG23 . THR B 2 3  ? 3.769   -14.080 -7.554  1.00 15.00 ?  222 THR B HG23 12 
ATOM   8885  N N    . PRO B 2 4  ? 2.347   -11.989 -4.004  1.00 15.00 ?  223 PRO B N    12 
ATOM   8886  C CA   . PRO B 2 4  ? 1.930   -11.536 -2.672  1.00 15.00 ?  223 PRO B CA   12 
ATOM   8887  C C    . PRO B 2 4  ? 2.736   -10.338 -2.176  1.00 15.00 ?  223 PRO B C    12 
ATOM   8888  O O    . PRO B 2 4  ? 3.949   -10.259 -2.397  1.00 15.00 ?  223 PRO B O    12 
ATOM   8889  C CB   . PRO B 2 4  ? 2.183   -12.758 -1.770  1.00 15.00 ?  223 PRO B CB   12 
ATOM   8890  C CG   . PRO B 2 4  ? 2.925   -13.742 -2.614  1.00 15.00 ?  223 PRO B CG   12 
ATOM   8891  C CD   . PRO B 2 4  ? 2.544   -13.442 -4.030  1.00 15.00 ?  223 PRO B CD   12 
ATOM   8892  H HA   . PRO B 2 4  ? 0.879   -11.289 -2.658  1.00 15.00 ?  223 PRO B HA   12 
ATOM   8893  H HB2  . PRO B 2 4  ? 2.768   -12.458 -0.913  1.00 15.00 ?  223 PRO B HB2  12 
ATOM   8894  H HB3  . PRO B 2 4  ? 1.237   -13.161 -1.440  1.00 15.00 ?  223 PRO B HB3  12 
ATOM   8895  H HG2  . PRO B 2 4  ? 3.988   -13.615 -2.476  1.00 15.00 ?  223 PRO B HG2  12 
ATOM   8896  H HG3  . PRO B 2 4  ? 2.629   -14.747 -2.351  1.00 15.00 ?  223 PRO B HG3  12 
ATOM   8897  H HD2  . PRO B 2 4  ? 3.342   -13.716 -4.705  1.00 15.00 ?  223 PRO B HD2  12 
ATOM   8898  H HD3  . PRO B 2 4  ? 1.630   -13.952 -4.293  1.00 15.00 ?  223 PRO B HD3  12 
ATOM   8899  N N    . PRO B 2 5  ? 2.064   -9.413  -1.461  1.00 15.00 ?  224 PRO B N    12 
ATOM   8900  C CA   . PRO B 2 5  ? 2.612   -8.094  -1.130  1.00 15.00 ?  224 PRO B CA   12 
ATOM   8901  C C    . PRO B 2 5  ? 3.976   -8.149  -0.450  1.00 15.00 ?  224 PRO B C    12 
ATOM   8902  O O    . PRO B 2 5  ? 4.187   -8.903  0.505   1.00 15.00 ?  224 PRO B O    12 
ATOM   8903  C CB   . PRO B 2 5  ? 1.566   -7.474  -0.193  1.00 15.00 ?  224 PRO B CB   12 
ATOM   8904  C CG   . PRO B 2 5  ? 0.675   -8.594  0.221   1.00 15.00 ?  224 PRO B CG   12 
ATOM   8905  C CD   . PRO B 2 5  ? 0.719   -9.599  -0.892  1.00 15.00 ?  224 PRO B CD   12 
ATOM   8906  H HA   . PRO B 2 5  ? 2.695   -7.481  -2.016  1.00 15.00 ?  224 PRO B HA   12 
ATOM   8907  H HB2  . PRO B 2 5  ? 2.064   -7.034  0.659   1.00 15.00 ?  224 PRO B HB2  12 
ATOM   8908  H HB3  . PRO B 2 5  ? 1.016   -6.711  -0.724  1.00 15.00 ?  224 PRO B HB3  12 
ATOM   8909  H HG2  . PRO B 2 5  ? 1.040   -9.035  1.137   1.00 15.00 ?  224 PRO B HG2  12 
ATOM   8910  H HG3  . PRO B 2 5  ? -0.333  -8.229  0.355   1.00 15.00 ?  224 PRO B HG3  12 
ATOM   8911  H HD2  . PRO B 2 5  ? 0.600   -10.597 -0.496  1.00 15.00 ?  224 PRO B HD2  12 
ATOM   8912  H HD3  . PRO B 2 5  ? -0.044  -9.387  -1.626  1.00 15.00 ?  224 PRO B HD3  12 
ATOM   8913  N N    . PRO B 2 6  ? 4.917   -7.339  -0.959  1.00 15.00 ?  225 PRO B N    12 
ATOM   8914  C CA   . PRO B 2 6  ? 6.281   -7.220  -0.418  1.00 15.00 ?  225 PRO B CA   12 
ATOM   8915  C C    . PRO B 2 6  ? 6.307   -6.673  1.007   1.00 15.00 ?  225 PRO B C    12 
ATOM   8916  O O    . PRO B 2 6  ? 5.264   -6.378  1.590   1.00 15.00 ?  225 PRO B O    12 
ATOM   8917  C CB   . PRO B 2 6  ? 6.949   -6.205  -1.356  1.00 15.00 ?  225 PRO B CB   12 
ATOM   8918  C CG   . PRO B 2 6  ? 6.115   -6.193  -2.587  1.00 15.00 ?  225 PRO B CG   12 
ATOM   8919  C CD   . PRO B 2 6  ? 4.719   -6.474  -2.131  1.00 15.00 ?  225 PRO B CD   12 
ATOM   8920  H HA   . PRO B 2 6  ? 6.813   -8.159  -0.459  1.00 15.00 ?  225 PRO B HA   12 
ATOM   8921  H HB2  . PRO B 2 6  ? 6.964   -5.234  -0.885  1.00 15.00 ?  225 PRO B HB2  12 
ATOM   8922  H HB3  . PRO B 2 6  ? 7.953   -6.518  -1.570  1.00 15.00 ?  225 PRO B HB3  12 
ATOM   8923  H HG2  . PRO B 2 6  ? 6.168   -5.223  -3.059  1.00 15.00 ?  225 PRO B HG2  12 
ATOM   8924  H HG3  . PRO B 2 6  ? 6.449   -6.962  -3.265  1.00 15.00 ?  225 PRO B HG3  12 
ATOM   8925  H HD2  . PRO B 2 6  ? 4.219   -5.556  -1.854  1.00 15.00 ?  225 PRO B HD2  12 
ATOM   8926  H HD3  . PRO B 2 6  ? 4.168   -6.989  -2.901  1.00 15.00 ?  225 PRO B HD3  12 
ATOM   8927  N N    . ALA B 2 7  ? 7.511   -6.538  1.560   1.00 15.00 ?  226 ALA B N    12 
ATOM   8928  C CA   . ALA B 2 7  ? 7.693   -5.850  2.831   1.00 15.00 ?  226 ALA B CA   12 
ATOM   8929  C C    . ALA B 2 7  ? 7.301   -4.387  2.669   1.00 15.00 ?  226 ALA B C    12 
ATOM   8930  O O    . ALA B 2 7  ? 7.265   -3.874  1.548   1.00 15.00 ?  226 ALA B O    12 
ATOM   8931  C CB   . ALA B 2 7  ? 9.134   -5.968  3.302   1.00 15.00 ?  226 ALA B CB   12 
ATOM   8932  H H    . ALA B 2 7  ? 8.292   -6.909  1.101   1.00 15.00 ?  226 ALA B H    12 
ATOM   8933  H HA   . ALA B 2 7  ? 7.050   -6.314  3.565   1.00 15.00 ?  226 ALA B HA   12 
ATOM   8934  H HB1  . ALA B 2 7  ? 9.791   -5.510  2.577   1.00 15.00 ?  226 ALA B HB1  12 
ATOM   8935  H HB2  . ALA B 2 7  ? 9.392   -7.011  3.413   1.00 15.00 ?  226 ALA B HB2  12 
ATOM   8936  H HB3  . ALA B 2 7  ? 9.246   -5.469  4.254   1.00 15.00 ?  226 ALA B HB3  12 
ATOM   8937  N N    . TYR B 2 8  ? 7.012   -3.707  3.766   1.00 15.00 ?  227 TYR B N    12 
ATOM   8938  C CA   . TYR B 2 8  ? 6.489   -2.358  3.666   1.00 15.00 ?  227 TYR B CA   12 
ATOM   8939  C C    . TYR B 2 8  ? 7.607   -1.313  3.680   1.00 15.00 ?  227 TYR B C    12 
ATOM   8940  O O    . TYR B 2 8  ? 8.542   -1.361  4.486   1.00 15.00 ?  227 TYR B O    12 
ATOM   8941  C CB   . TYR B 2 8  ? 5.467   -2.070  4.769   1.00 15.00 ?  227 TYR B CB   12 
ATOM   8942  C CG   . TYR B 2 8  ? 6.079   -1.580  6.062   1.00 15.00 ?  227 TYR B CG   12 
ATOM   8943  C CD1  . TYR B 2 8  ? 6.636   -2.457  6.982   1.00 15.00 ?  227 TYR B CD1  12 
ATOM   8944  C CD2  . TYR B 2 8  ? 6.122   -0.227  6.343   1.00 15.00 ?  227 TYR B CD2  12 
ATOM   8945  C CE1  . TYR B 2 8  ? 7.219   -1.990  8.145   1.00 15.00 ?  227 TYR B CE1  12 
ATOM   8946  C CE2  . TYR B 2 8  ? 6.696   0.250   7.497   1.00 15.00 ?  227 TYR B CE2  12 
ATOM   8947  C CZ   . TYR B 2 8  ? 7.246   -0.633  8.400   1.00 15.00 ?  227 TYR B CZ   12 
ATOM   8948  O OH   . TYR B 2 8  ? 7.834   -0.163  9.552   1.00 15.00 ?  227 TYR B OH   12 
ATOM   8949  H H    . TYR B 2 8  ? 7.156   -4.112  4.645   1.00 15.00 ?  227 TYR B H    12 
ATOM   8950  H HA   . TYR B 2 8  ? 5.984   -2.287  2.714   1.00 15.00 ?  227 TYR B HA   12 
ATOM   8951  H HB2  . TYR B 2 8  ? 4.781   -1.307  4.407   1.00 15.00 ?  227 TYR B HB2  12 
ATOM   8952  H HB3  . TYR B 2 8  ? 4.914   -2.974  4.981   1.00 15.00 ?  227 TYR B HB3  12 
ATOM   8953  H HD1  . TYR B 2 8  ? 6.612   -3.518  6.781   1.00 15.00 ?  227 TYR B HD1  12 
ATOM   8954  H HD2  . TYR B 2 8  ? 5.690   0.468   5.640   1.00 15.00 ?  227 TYR B HD2  12 
ATOM   8955  H HE1  . TYR B 2 8  ? 7.648   -2.685  8.850   1.00 15.00 ?  227 TYR B HE1  12 
ATOM   8956  H HE2  . TYR B 2 8  ? 6.712   1.321   7.681   1.00 15.00 ?  227 TYR B HE2  12 
ATOM   8957  H HH   . TYR B 2 8  ? 7.417   0.677   9.811   1.00 15.00 ?  227 TYR B HH   12 
ATOM   8958  N N    . LEU B 2 9  ? 7.481   -0.375  2.768   1.00 15.00 ?  228 LEU B N    12 
ATOM   8959  C CA   . LEU B 2 9  ? 8.378   0.762   2.637   1.00 15.00 ?  228 LEU B CA   12 
ATOM   8960  C C    . LEU B 2 9  ? 7.535   2.023   2.558   1.00 15.00 ?  228 LEU B C    12 
ATOM   8961  O O    . LEU B 2 9  ? 6.366   1.942   2.244   1.00 15.00 ?  228 LEU B O    12 
ATOM   8962  C CB   . LEU B 2 9  ? 9.270   0.647   1.386   1.00 15.00 ?  228 LEU B CB   12 
ATOM   8963  C CG   . LEU B 2 9  ? 10.327  -0.467  1.399   1.00 15.00 ?  228 LEU B CG   12 
ATOM   8964  C CD1  . LEU B 2 9  ? 9.715   -1.813  1.049   1.00 15.00 ?  228 LEU B CD1  12 
ATOM   8965  C CD2  . LEU B 2 9  ? 11.458  -0.133  0.438   1.00 15.00 ?  228 LEU B CD2  12 
ATOM   8966  H H    . LEU B 2 9  ? 6.732   -0.441  2.137   1.00 15.00 ?  228 LEU B H    12 
ATOM   8967  H HA   . LEU B 2 9  ? 8.989   0.807   3.527   1.00 15.00 ?  228 LEU B HA   12 
ATOM   8968  H HB2  . LEU B 2 9  ? 8.626   0.486   0.533   1.00 15.00 ?  228 LEU B HB2  12 
ATOM   8969  H HB3  . LEU B 2 9  ? 9.779   1.590   1.252   1.00 15.00 ?  228 LEU B HB3  12 
ATOM   8970  H HG   . LEU B 2 9  ? 10.746  -0.541  2.392   1.00 15.00 ?  228 LEU B HG   12 
ATOM   8971  H HD11 . LEU B 2 9  ? 9.277   -1.764  0.063   1.00 15.00 ?  228 LEU B HD11 12 
ATOM   8972  H HD12 . LEU B 2 9  ? 8.951   -2.060  1.770   1.00 15.00 ?  228 LEU B HD12 12 
ATOM   8973  H HD13 . LEU B 2 9  ? 10.483  -2.571  1.063   1.00 15.00 ?  228 LEU B HD13 12 
ATOM   8974  H HD21 . LEU B 2 9  ? 11.062  -0.033  -0.562  1.00 15.00 ?  228 LEU B HD21 12 
ATOM   8975  H HD22 . LEU B 2 9  ? 12.192  -0.925  0.457   1.00 15.00 ?  228 LEU B HD22 12 
ATOM   8976  H HD23 . LEU B 2 9  ? 11.921  0.796   0.736   1.00 15.00 ?  228 LEU B HD23 12 
ATOM   8977  N N    . PRO B 2 10 ? 8.086   3.207   2.812   1.00 15.00 ?  229 PRO B N    12 
ATOM   8978  C CA   . PRO B 2 10 ? 7.293   4.427   2.753   1.00 15.00 ?  229 PRO B CA   12 
ATOM   8979  C C    . PRO B 2 10 ? 7.285   4.984   1.334   1.00 15.00 ?  229 PRO B C    12 
ATOM   8980  O O    . PRO B 2 10 ? 8.230   4.780   0.575   1.00 15.00 ?  229 PRO B O    12 
ATOM   8981  C CB   . PRO B 2 10 ? 8.049   5.389   3.687   1.00 15.00 ?  229 PRO B CB   12 
ATOM   8982  C CG   . PRO B 2 10 ? 9.169   4.597   4.283   1.00 15.00 ?  229 PRO B CG   12 
ATOM   8983  C CD   . PRO B 2 10 ? 9.417   3.445   3.353   1.00 15.00 ?  229 PRO B CD   12 
ATOM   8984  H HA   . PRO B 2 10 ? 6.289   4.265   3.106   1.00 15.00 ?  229 PRO B HA   12 
ATOM   8985  H HB2  . PRO B 2 10 ? 8.423   6.224   3.114   1.00 15.00 ?  229 PRO B HB2  12 
ATOM   8986  H HB3  . PRO B 2 10 ? 7.375   5.750   4.450   1.00 15.00 ?  229 PRO B HB3  12 
ATOM   8987  H HG2  . PRO B 2 10 ? 10.047  5.210   4.361   1.00 15.00 ?  229 PRO B HG2  12 
ATOM   8988  H HG3  . PRO B 2 10 ? 8.879   4.232   5.257   1.00 15.00 ?  229 PRO B HG3  12 
ATOM   8989  H HD2  . PRO B 2 10 ? 10.112  3.715   2.583   1.00 15.00 ?  229 PRO B HD2  12 
ATOM   8990  H HD3  . PRO B 2 10 ? 9.761   2.586   3.904   1.00 15.00 ?  229 PRO B HD3  12 
ATOM   8991  N N    . PRO B 2 11 ? 6.223   5.726   0.970   1.00 15.00 ?  230 PRO B N    12 
ATOM   8992  C CA   . PRO B 2 11 ? 5.700   5.712   -0.394  1.00 15.00 ?  230 PRO B CA   12 
ATOM   8993  C C    . PRO B 2 11 ? 6.306   6.730   -1.353  1.00 15.00 ?  230 PRO B C    12 
ATOM   8994  O O    . PRO B 2 11 ? 6.592   7.876   -0.996  1.00 15.00 ?  230 PRO B O    12 
ATOM   8995  C CB   . PRO B 2 11 ? 4.233   6.043   -0.144  1.00 15.00 ?  230 PRO B CB   12 
ATOM   8996  C CG   . PRO B 2 11 ? 4.249   7.006   0.992   1.00 15.00 ?  230 PRO B CG   12 
ATOM   8997  C CD   . PRO B 2 11 ? 5.440   6.641   1.840   1.00 15.00 ?  230 PRO B CD   12 
ATOM   8998  H HA   . PRO B 2 11 ? 5.767   4.728   -0.830  1.00 15.00 ?  230 PRO B HA   12 
ATOM   8999  H HB2  . PRO B 2 11 ? 3.806   6.485   -1.025  1.00 15.00 ?  230 PRO B HB2  12 
ATOM   9000  H HB3  . PRO B 2 11 ? 3.695   5.142   0.111   1.00 15.00 ?  230 PRO B HB3  12 
ATOM   9001  H HG2  . PRO B 2 11 ? 4.354   8.014   0.617   1.00 15.00 ?  230 PRO B HG2  12 
ATOM   9002  H HG3  . PRO B 2 11 ? 3.339   6.912   1.565   1.00 15.00 ?  230 PRO B HG3  12 
ATOM   9003  H HD2  . PRO B 2 11 ? 6.007   7.525   2.086   1.00 15.00 ?  230 PRO B HD2  12 
ATOM   9004  H HD3  . PRO B 2 11 ? 5.113   6.146   2.737   1.00 15.00 ?  230 PRO B HD3  12 
ATOM   9005  N N    . GLU B 2 12 ? 6.472   6.273   -2.592  1.00 15.00 ?  231 GLU B N    12 
ATOM   9006  C CA   . GLU B 2 12 ? 6.944   7.103   -3.682  1.00 15.00 ?  231 GLU B CA   12 
ATOM   9007  C C    . GLU B 2 12 ? 5.893   7.124   -4.801  1.00 15.00 ?  231 GLU B C    12 
ATOM   9008  O O    . GLU B 2 12 ? 5.381   6.070   -5.181  1.00 15.00 ?  231 GLU B O    12 
ATOM   9009  C CB   . GLU B 2 12 ? 8.269   6.561   -4.241  1.00 15.00 ?  231 GLU B CB   12 
ATOM   9010  C CG   . GLU B 2 12 ? 8.158   5.199   -4.924  1.00 15.00 ?  231 GLU B CG   12 
ATOM   9011  C CD   . GLU B 2 12 ? 9.475   4.724   -5.504  1.00 15.00 ?  231 GLU B CD   12 
ATOM   9012  O OE1  . GLU B 2 12 ? 10.396  4.411   -4.719  1.00 15.00 ?  231 GLU B OE1  12 
ATOM   9013  O OE2  . GLU B 2 12 ? 9.591   4.637   -6.744  1.00 15.00 -1 231 GLU B OE2  12 
ATOM   9014  H H    . GLU B 2 12 ? 6.259   5.338   -2.780  1.00 15.00 ?  231 GLU B H    12 
ATOM   9015  H HA   . GLU B 2 12 ? 7.101   8.099   -3.295  1.00 15.00 ?  231 GLU B HA   12 
ATOM   9016  H HB2  . GLU B 2 12 ? 8.654   7.267   -4.962  1.00 15.00 ?  231 GLU B HB2  12 
ATOM   9017  H HB3  . GLU B 2 12 ? 8.977   6.473   -3.430  1.00 15.00 ?  231 GLU B HB3  12 
ATOM   9018  H HG2  . GLU B 2 12 ? 7.816   4.469   -4.206  1.00 15.00 ?  231 GLU B HG2  12 
ATOM   9019  H HG3  . GLU B 2 12 ? 7.438   5.272   -5.726  1.00 15.00 ?  231 GLU B HG3  12 
ATOM   9020  N N    . ASP B 2 13 ? 5.548   8.300   -5.310  1.00 15.00 ?  232 ASP B N    12 
ATOM   9021  C CA   . ASP B 2 13 ? 4.728   8.387   -6.508  1.00 15.00 ?  232 ASP B CA   12 
ATOM   9022  C C    . ASP B 2 13 ? 5.081   9.655   -7.266  1.00 15.00 ?  232 ASP B C    12 
ATOM   9023  O O    . ASP B 2 13 ? 4.730   10.759  -6.845  1.00 15.00 ?  232 ASP B O    12 
ATOM   9024  C CB   . ASP B 2 13 ? 3.233   8.346   -6.176  1.00 15.00 ?  232 ASP B CB   12 
ATOM   9025  C CG   . ASP B 2 13 ? 2.369   8.316   -7.426  1.00 15.00 ?  232 ASP B CG   12 
ATOM   9026  O OD1  . ASP B 2 13 ? 2.226   7.228   -8.027  1.00 15.00 -1 232 ASP B OD1  12 
ATOM   9027  O OD2  . ASP B 2 13 ? 1.830   9.376   -7.819  1.00 15.00 ?  232 ASP B OD2  12 
ATOM   9028  H H    . ASP B 2 13 ? 5.836   9.131   -4.876  1.00 15.00 ?  232 ASP B H    12 
ATOM   9029  H HA   . ASP B 2 13 ? 4.972   7.537   -7.131  1.00 15.00 ?  232 ASP B HA   12 
ATOM   9030  H HB2  . ASP B 2 13 ? 3.023   7.456   -5.592  1.00 15.00 ?  232 ASP B HB2  12 
ATOM   9031  H HB3  . ASP B 2 13 ? 2.973   9.222   -5.600  1.00 15.00 ?  232 ASP B HB3  12 
ATOM   9032  N N    . PRO B 2 14 ? 5.845   9.510   -8.360  1.00 15.00 ?  233 PRO B N    12 
ATOM   9033  C CA   . PRO B 2 14 ? 6.303   10.645  -9.167  1.00 15.00 ?  233 PRO B CA   12 
ATOM   9034  C C    . PRO B 2 14 ? 5.159   11.342  -9.894  1.00 15.00 ?  233 PRO B C    12 
ATOM   9035  O O    . PRO B 2 14 ? 4.767   10.948  -10.992 1.00 15.00 ?  233 PRO B O    12 
ATOM   9036  C CB   . PRO B 2 14 ? 7.276   10.009  -10.165 1.00 15.00 ?  233 PRO B CB   12 
ATOM   9037  C CG   . PRO B 2 14 ? 6.878   8.575   -10.239 1.00 15.00 ?  233 PRO B CG   12 
ATOM   9038  C CD   . PRO B 2 14 ? 6.331   8.221   -8.887  1.00 15.00 ?  233 PRO B CD   12 
ATOM   9039  H HA   . PRO B 2 14 ? 6.830   11.367  -8.561  1.00 15.00 ?  233 PRO B HA   12 
ATOM   9040  H HB2  . PRO B 2 14 ? 7.178   10.496  -11.124 1.00 15.00 ?  233 PRO B HB2  12 
ATOM   9041  H HB3  . PRO B 2 14 ? 8.287   10.118  -9.803  1.00 15.00 ?  233 PRO B HB3  12 
ATOM   9042  H HG2  . PRO B 2 14 ? 6.120   8.443   -10.995 1.00 15.00 ?  233 PRO B HG2  12 
ATOM   9043  H HG3  . PRO B 2 14 ? 7.742   7.966   -10.464 1.00 15.00 ?  233 PRO B HG3  12 
ATOM   9044  H HD2  . PRO B 2 14 ? 5.522   7.513   -8.983  1.00 15.00 ?  233 PRO B HD2  12 
ATOM   9045  H HD3  . PRO B 2 14 ? 7.112   7.820   -8.257  1.00 15.00 ?  233 PRO B HD3  12 
HETATM 9046  N N    . NH2 B 2 15 ? 4.613   12.374  -9.272  1.00 15.00 ?  234 NH2 B N    12 
HETATM 9047  H HN1  . NH2 B 2 15 ? 4.977   12.632  -8.398  1.00 15.00 ?  234 NH2 B HN1  12 
HETATM 9048  H HN2  . NH2 B 2 15 ? 3.870   12.839  -9.709  1.00 15.00 ?  234 NH2 B HN2  12 
ATOM   9049  N N    . LEU A 1 1  ? -13.546 2.285   -2.221  1.00 15.00 ?  279 LEU A N    13 
ATOM   9050  C CA   . LEU A 1 1  ? -13.500 3.702   -2.646  1.00 15.00 ?  279 LEU A CA   13 
ATOM   9051  C C    . LEU A 1 1  ? -14.048 4.602   -1.543  1.00 15.00 ?  279 LEU A C    13 
ATOM   9052  O O    . LEU A 1 1  ? -15.159 4.390   -1.056  1.00 15.00 ?  279 LEU A O    13 
ATOM   9053  C CB   . LEU A 1 1  ? -14.290 3.921   -3.952  1.00 15.00 ?  279 LEU A CB   13 
ATOM   9054  C CG   . LEU A 1 1  ? -15.805 3.675   -3.889  1.00 15.00 ?  279 LEU A CG   13 
ATOM   9055  C CD1  . LEU A 1 1  ? -16.498 4.364   -5.054  1.00 15.00 ?  279 LEU A CD1  13 
ATOM   9056  C CD2  . LEU A 1 1  ? -16.117 2.188   -3.916  1.00 15.00 ?  279 LEU A CD2  13 
ATOM   9057  H H1   . LEU A 1 1  ? -12.880 2.130   -1.437  1.00 15.00 ?  279 LEU A H1   13 
ATOM   9058  H H2   . LEU A 1 1  ? -13.292 1.657   -3.013  1.00 15.00 ?  279 LEU A H2   13 
ATOM   9059  H H3   . LEU A 1 1  ? -14.507 2.042   -1.892  1.00 15.00 ?  279 LEU A H3   13 
ATOM   9060  H HA   . LEU A 1 1  ? -12.464 3.963   -2.817  1.00 15.00 ?  279 LEU A HA   13 
ATOM   9061  H HB2  . LEU A 1 1  ? -14.132 4.940   -4.269  1.00 15.00 ?  279 LEU A HB2  13 
ATOM   9062  H HB3  . LEU A 1 1  ? -13.878 3.267   -4.706  1.00 15.00 ?  279 LEU A HB3  13 
ATOM   9063  H HG   . LEU A 1 1  ? -16.196 4.087   -2.969  1.00 15.00 ?  279 LEU A HG   13 
ATOM   9064  H HD11 . LEU A 1 1  ? -16.309 5.426   -5.007  1.00 15.00 ?  279 LEU A HD11 13 
ATOM   9065  H HD12 . LEU A 1 1  ? -17.562 4.185   -4.997  1.00 15.00 ?  279 LEU A HD12 13 
ATOM   9066  H HD13 . LEU A 1 1  ? -16.116 3.970   -5.985  1.00 15.00 ?  279 LEU A HD13 13 
ATOM   9067  H HD21 . LEU A 1 1  ? -15.656 1.707   -3.066  1.00 15.00 ?  279 LEU A HD21 13 
ATOM   9068  H HD22 . LEU A 1 1  ? -15.731 1.757   -4.828  1.00 15.00 ?  279 LEU A HD22 13 
ATOM   9069  H HD23 . LEU A 1 1  ? -17.186 2.045   -3.875  1.00 15.00 ?  279 LEU A HD23 13 
ATOM   9070  N N    . GLY A 1 2  ? -13.265 5.597   -1.140  1.00 15.00 ?  280 GLY A N    13 
ATOM   9071  C CA   . GLY A 1 2  ? -13.732 6.535   -0.139  1.00 15.00 ?  280 GLY A CA   13 
ATOM   9072  C C    . GLY A 1 2  ? -12.683 6.873   0.907   1.00 15.00 ?  280 GLY A C    13 
ATOM   9073  O O    . GLY A 1 2  ? -11.828 7.726   0.677   1.00 15.00 ?  280 GLY A O    13 
ATOM   9074  H H    . GLY A 1 2  ? -12.370 5.699   -1.526  1.00 15.00 ?  280 GLY A H    13 
ATOM   9075  H HA2  . GLY A 1 2  ? -14.031 7.447   -0.634  1.00 15.00 ?  280 GLY A HA2  13 
ATOM   9076  H HA3  . GLY A 1 2  ? -14.592 6.113   0.357   1.00 15.00 ?  280 GLY A HA3  13 
ATOM   9077  N N    . PRO A 1 3  ? -12.717 6.200   2.065   1.00 15.00 ?  281 PRO A N    13 
ATOM   9078  C CA   . PRO A 1 3  ? -11.878 6.544   3.208   1.00 15.00 ?  281 PRO A CA   13 
ATOM   9079  C C    . PRO A 1 3  ? -10.523 5.833   3.221   1.00 15.00 ?  281 PRO A C    13 
ATOM   9080  O O    . PRO A 1 3  ? -10.406 4.670   2.828   1.00 15.00 ?  281 PRO A O    13 
ATOM   9081  C CB   . PRO A 1 3  ? -12.732 6.071   4.378   1.00 15.00 ?  281 PRO A CB   13 
ATOM   9082  C CG   . PRO A 1 3  ? -13.481 4.884   3.859   1.00 15.00 ?  281 PRO A CG   13 
ATOM   9083  C CD   . PRO A 1 3  ? -13.592 5.050   2.361   1.00 15.00 ?  281 PRO A CD   13 
ATOM   9084  H HA   . PRO A 1 3  ? -11.725 7.610   3.285   1.00 15.00 ?  281 PRO A HA   13 
ATOM   9085  H HB2  . PRO A 1 3  ? -12.093 5.801   5.207   1.00 15.00 ?  281 PRO A HB2  13 
ATOM   9086  H HB3  . PRO A 1 3  ? -13.406 6.859   4.678   1.00 15.00 ?  281 PRO A HB3  13 
ATOM   9087  H HG2  . PRO A 1 3  ? -12.938 3.981   4.090   1.00 15.00 ?  281 PRO A HG2  13 
ATOM   9088  H HG3  . PRO A 1 3  ? -14.465 4.851   4.301   1.00 15.00 ?  281 PRO A HG3  13 
ATOM   9089  H HD2  . PRO A 1 3  ? -13.242 4.161   1.856   1.00 15.00 ?  281 PRO A HD2  13 
ATOM   9090  H HD3  . PRO A 1 3  ? -14.613 5.264   2.081   1.00 15.00 ?  281 PRO A HD3  13 
ATOM   9091  N N    . LEU A 1 4  ? -9.505  6.543   3.689   1.00 15.00 ?  282 LEU A N    13 
ATOM   9092  C CA   . LEU A 1 4  ? -8.180  5.965   3.882   1.00 15.00 ?  282 LEU A CA   13 
ATOM   9093  C C    . LEU A 1 4  ? -7.851  5.942   5.371   1.00 15.00 ?  282 LEU A C    13 
ATOM   9094  O O    . LEU A 1 4  ? -7.817  6.992   6.015   1.00 15.00 ?  282 LEU A O    13 
ATOM   9095  C CB   . LEU A 1 4  ? -7.126  6.786   3.133   1.00 15.00 ?  282 LEU A CB   13 
ATOM   9096  C CG   . LEU A 1 4  ? -5.710  6.198   3.119   1.00 15.00 ?  282 LEU A CG   13 
ATOM   9097  C CD1  . LEU A 1 4  ? -5.642  4.985   2.206   1.00 15.00 ?  282 LEU A CD1  13 
ATOM   9098  C CD2  . LEU A 1 4  ? -4.700  7.246   2.684   1.00 15.00 ?  282 LEU A CD2  13 
ATOM   9099  H H    . LEU A 1 4  ? -9.649  7.489   3.914   1.00 15.00 ?  282 LEU A H    13 
ATOM   9100  H HA   . LEU A 1 4  ? -8.190  4.956   3.501   1.00 15.00 ?  282 LEU A HA   13 
ATOM   9101  H HB2  . LEU A 1 4  ? -7.453  6.892   2.110   1.00 15.00 ?  282 LEU A HB2  13 
ATOM   9102  H HB3  . LEU A 1 4  ? -7.080  7.767   3.582   1.00 15.00 ?  282 LEU A HB3  13 
ATOM   9103  H HG   . LEU A 1 4  ? -5.452  5.878   4.118   1.00 15.00 ?  282 LEU A HG   13 
ATOM   9104  H HD11 . LEU A 1 4  ? -6.128  5.213   1.268   1.00 15.00 ?  282 LEU A HD11 13 
ATOM   9105  H HD12 . LEU A 1 4  ? -6.137  4.147   2.677   1.00 15.00 ?  282 LEU A HD12 13 
ATOM   9106  H HD13 . LEU A 1 4  ? -4.607  4.733   2.017   1.00 15.00 ?  282 LEU A HD13 13 
ATOM   9107  H HD21 . LEU A 1 4  ? -3.712  6.810   2.676   1.00 15.00 ?  282 LEU A HD21 13 
ATOM   9108  H HD22 . LEU A 1 4  ? -4.721  8.077   3.372   1.00 15.00 ?  282 LEU A HD22 13 
ATOM   9109  H HD23 . LEU A 1 4  ? -4.947  7.594   1.690   1.00 15.00 ?  282 LEU A HD23 13 
ATOM   9110  N N    . PRO A 1 5  ? -7.629  4.752   5.942   1.00 15.00 ?  283 PRO A N    13 
ATOM   9111  C CA   . PRO A 1 5  ? -7.310  4.611   7.366   1.00 15.00 ?  283 PRO A CA   13 
ATOM   9112  C C    . PRO A 1 5  ? -6.003  5.308   7.735   1.00 15.00 ?  283 PRO A C    13 
ATOM   9113  O O    . PRO A 1 5  ? -5.001  5.176   7.031   1.00 15.00 ?  283 PRO A O    13 
ATOM   9114  C CB   . PRO A 1 5  ? -7.188  3.093   7.560   1.00 15.00 ?  283 PRO A CB   13 
ATOM   9115  C CG   . PRO A 1 5  ? -7.914  2.504   6.401   1.00 15.00 ?  283 PRO A CG   13 
ATOM   9116  C CD   . PRO A 1 5  ? -7.674  3.447   5.264   1.00 15.00 ?  283 PRO A CD   13 
ATOM   9117  H HA   . PRO A 1 5  ? -8.108  4.992   7.988   1.00 15.00 ?  283 PRO A HA   13 
ATOM   9118  H HB2  . PRO A 1 5  ? -6.144  2.812   7.559   1.00 15.00 ?  283 PRO A HB2  13 
ATOM   9119  H HB3  . PRO A 1 5  ? -7.644  2.809   8.497   1.00 15.00 ?  283 PRO A HB3  13 
ATOM   9120  H HG2  . PRO A 1 5  ? -7.516  1.526   6.173   1.00 15.00 ?  283 PRO A HG2  13 
ATOM   9121  H HG3  . PRO A 1 5  ? -8.969  2.441   6.621   1.00 15.00 ?  283 PRO A HG3  13 
ATOM   9122  H HD2  . PRO A 1 5  ? -6.732  3.224   4.781   1.00 15.00 ?  283 PRO A HD2  13 
ATOM   9123  H HD3  . PRO A 1 5  ? -8.489  3.407   4.555   1.00 15.00 ?  283 PRO A HD3  13 
ATOM   9124  N N    . PRO A 1 6  ? -6.003  6.063   8.843   1.00 15.00 ?  284 PRO A N    13 
ATOM   9125  C CA   . PRO A 1 6  ? -4.817  6.784   9.314   1.00 15.00 ?  284 PRO A CA   13 
ATOM   9126  C C    . PRO A 1 6  ? -3.636  5.849   9.565   1.00 15.00 ?  284 PRO A C    13 
ATOM   9127  O O    . PRO A 1 6  ? -3.754  4.859   10.291  1.00 15.00 ?  284 PRO A O    13 
ATOM   9128  C CB   . PRO A 1 6  ? -5.277  7.436   10.625  1.00 15.00 ?  284 PRO A CB   13 
ATOM   9129  C CG   . PRO A 1 6  ? -6.516  6.705   11.014  1.00 15.00 ?  284 PRO A CG   13 
ATOM   9130  C CD   . PRO A 1 6  ? -7.156  6.270   9.731   1.00 15.00 ?  284 PRO A CD   13 
ATOM   9131  H HA   . PRO A 1 6  ? -4.520  7.551   8.612   1.00 15.00 ?  284 PRO A HA   13 
ATOM   9132  H HB2  . PRO A 1 6  ? -4.504  7.327   11.371  1.00 15.00 ?  284 PRO A HB2  13 
ATOM   9133  H HB3  . PRO A 1 6  ? -5.476  8.485   10.458  1.00 15.00 ?  284 PRO A HB3  13 
ATOM   9134  H HG2  . PRO A 1 6  ? -6.263  5.846   11.618  1.00 15.00 ?  284 PRO A HG2  13 
ATOM   9135  H HG3  . PRO A 1 6  ? -7.176  7.365   11.557  1.00 15.00 ?  284 PRO A HG3  13 
ATOM   9136  H HD2  . PRO A 1 6  ? -7.706  5.351   9.874   1.00 15.00 ?  284 PRO A HD2  13 
ATOM   9137  H HD3  . PRO A 1 6  ? -7.802  7.045   9.348   1.00 15.00 ?  284 PRO A HD3  13 
ATOM   9138  N N    . GLY A 1 7  ? -2.502  6.163   8.957   1.00 15.00 ?  285 GLY A N    13 
ATOM   9139  C CA   . GLY A 1 7  ? -1.321  5.341   9.121   1.00 15.00 ?  285 GLY A CA   13 
ATOM   9140  C C    . GLY A 1 7  ? -1.048  4.475   7.909   1.00 15.00 ?  285 GLY A C    13 
ATOM   9141  O O    . GLY A 1 7  ? -0.089  3.701   7.890   1.00 15.00 ?  285 GLY A O    13 
ATOM   9142  H H    . GLY A 1 7  ? -2.463  6.967   8.397   1.00 15.00 ?  285 GLY A H    13 
ATOM   9143  H HA2  . GLY A 1 7  ? -0.470  5.986   9.289   1.00 15.00 ?  285 GLY A HA2  13 
ATOM   9144  H HA3  . GLY A 1 7  ? -1.454  4.705   9.983   1.00 15.00 ?  285 GLY A HA3  13 
ATOM   9145  N N    . TRP A 1 8  ? -1.901  4.603   6.906   1.00 15.00 ?  286 TRP A N    13 
ATOM   9146  C CA   . TRP A 1 8  ? -1.755  3.853   5.669   1.00 15.00 ?  286 TRP A CA   13 
ATOM   9147  C C    . TRP A 1 8  ? -0.912  4.611   4.669   1.00 15.00 ?  286 TRP A C    13 
ATOM   9148  O O    . TRP A 1 8  ? -1.353  5.611   4.101   1.00 15.00 ?  286 TRP A O    13 
ATOM   9149  C CB   . TRP A 1 8  ? -3.130  3.568   5.048   1.00 15.00 ?  286 TRP A CB   13 
ATOM   9150  C CG   . TRP A 1 8  ? -3.779  2.330   5.566   1.00 15.00 ?  286 TRP A CG   13 
ATOM   9151  C CD1  . TRP A 1 8  ? -3.966  1.987   6.872   1.00 15.00 ?  286 TRP A CD1  13 
ATOM   9152  C CD2  . TRP A 1 8  ? -4.318  1.261   4.783   1.00 15.00 ?  286 TRP A CD2  13 
ATOM   9153  N NE1  . TRP A 1 8  ? -4.581  0.765   6.952   1.00 15.00 ?  286 TRP A NE1  13 
ATOM   9154  C CE2  . TRP A 1 8  ? -4.800  0.293   5.687   1.00 15.00 ?  286 TRP A CE2  13 
ATOM   9155  C CE3  . TRP A 1 8  ? -4.439  1.019   3.405   1.00 15.00 ?  286 TRP A CE3  13 
ATOM   9156  C CZ2  . TRP A 1 8  ? -5.383  -0.898  5.264   1.00 15.00 ?  286 TRP A CZ2  13 
ATOM   9157  C CZ3  . TRP A 1 8  ? -5.009  -0.169  2.997   1.00 15.00 ?  286 TRP A CZ3  13 
ATOM   9158  C CH2  . TRP A 1 8  ? -5.472  -1.115  3.918   1.00 15.00 ?  286 TRP A CH2  13 
ATOM   9159  H H    . TRP A 1 8  ? -2.655  5.221   6.999   1.00 15.00 ?  286 TRP A H    13 
ATOM   9160  H HA   . TRP A 1 8  ? -1.259  2.916   5.898   1.00 15.00 ?  286 TRP A HA   13 
ATOM   9161  H HB2  . TRP A 1 8  ? -3.788  4.398   5.255   1.00 15.00 ?  286 TRP A HB2  13 
ATOM   9162  H HB3  . TRP A 1 8  ? -3.017  3.464   3.979   1.00 15.00 ?  286 TRP A HB3  13 
ATOM   9163  H HD1  . TRP A 1 8  ? -3.669  2.599   7.711   1.00 15.00 ?  286 TRP A HD1  13 
ATOM   9164  H HE1  . TRP A 1 8  ? -4.816  0.301   7.782   1.00 15.00 ?  286 TRP A HE1  13 
ATOM   9165  H HE3  . TRP A 1 8  ? -4.096  1.761   2.632   1.00 15.00 ?  286 TRP A HE3  13 
ATOM   9166  H HZ2  . TRP A 1 8  ? -5.743  -1.639  5.963   1.00 15.00 ?  286 TRP A HZ2  13 
ATOM   9167  H HZ3  . TRP A 1 8  ? -5.065  -0.391  1.939   1.00 15.00 ?  286 TRP A HZ3  13 
ATOM   9168  H HH2  . TRP A 1 8  ? -5.910  -2.030  3.545   1.00 15.00 ?  286 TRP A HH2  13 
ATOM   9169  N N    . GLU A 1 9  ? 0.302   4.141   4.461   1.00 15.00 ?  287 GLU A N    13 
ATOM   9170  C CA   . GLU A 1 9  ? 1.131   4.684   3.415   1.00 15.00 ?  287 GLU A CA   13 
ATOM   9171  C C    . GLU A 1 9  ? 0.878   3.902   2.140   1.00 15.00 ?  287 GLU A C    13 
ATOM   9172  O O    . GLU A 1 9  ? 1.154   2.706   2.058   1.00 15.00 ?  287 GLU A O    13 
ATOM   9173  C CB   . GLU A 1 9  ? 2.608   4.649   3.824   1.00 15.00 ?  287 GLU A CB   13 
ATOM   9174  C CG   . GLU A 1 9  ? 3.074   5.913   4.531   1.00 15.00 ?  287 GLU A CG   13 
ATOM   9175  C CD   . GLU A 1 9  ? 2.305   6.196   5.803   1.00 15.00 ?  287 GLU A CD   13 
ATOM   9176  O OE1  . GLU A 1 9  ? 2.646   5.604   6.848   1.00 15.00 ?  287 GLU A OE1  13 
ATOM   9177  O OE2  . GLU A 1 9  ? 1.370   7.020   5.766   1.00 15.00 -1 287 GLU A OE2  13 
ATOM   9178  H H    . GLU A 1 9  ? 0.644   3.402   5.015   1.00 15.00 ?  287 GLU A H    13 
ATOM   9179  H HA   . GLU A 1 9  ? 0.831   5.711   3.257   1.00 15.00 ?  287 GLU A HA   13 
ATOM   9180  H HB2  . GLU A 1 9  ? 2.760   3.816   4.493   1.00 15.00 ?  287 GLU A HB2  13 
ATOM   9181  H HB3  . GLU A 1 9  ? 3.220   4.504   2.948   1.00 15.00 ?  287 GLU A HB3  13 
ATOM   9182  H HG2  . GLU A 1 9  ? 4.118   5.798   4.784   1.00 15.00 ?  287 GLU A HG2  13 
ATOM   9183  H HG3  . GLU A 1 9  ? 2.961   6.753   3.860   1.00 15.00 ?  287 GLU A HG3  13 
ATOM   9184  N N    . VAL A 1 10 ? 0.307   4.573   1.160   1.00 15.00 ?  288 VAL A N    13 
ATOM   9185  C CA   . VAL A 1 10 ? -0.055  3.927   -0.086  1.00 15.00 ?  288 VAL A CA   13 
ATOM   9186  C C    . VAL A 1 10 ? 1.104   4.007   -1.073  1.00 15.00 ?  288 VAL A C    13 
ATOM   9187  O O    . VAL A 1 10 ? 1.368   5.051   -1.675  1.00 15.00 ?  288 VAL A O    13 
ATOM   9188  C CB   . VAL A 1 10 ? -1.353  4.540   -0.679  1.00 15.00 ?  288 VAL A CB   13 
ATOM   9189  C CG1  . VAL A 1 10 ? -1.333  6.060   -0.611  1.00 15.00 ?  288 VAL A CG1  13 
ATOM   9190  C CG2  . VAL A 1 10 ? -1.575  4.073   -2.110  1.00 15.00 ?  288 VAL A CG2  13 
ATOM   9191  H H    . VAL A 1 10 ? 0.125   5.528   1.277   1.00 15.00 ?  288 VAL A H    13 
ATOM   9192  H HA   . VAL A 1 10 ? -0.246  2.886   0.132   1.00 15.00 ?  288 VAL A HA   13 
ATOM   9193  H HB   . VAL A 1 10 ? -2.186  4.193   -0.083  1.00 15.00 ?  288 VAL A HB   13 
ATOM   9194  H HG11 . VAL A 1 10 ? -0.646  6.445   -1.349  1.00 15.00 ?  288 VAL A HG11 13 
ATOM   9195  H HG12 . VAL A 1 10 ? -1.011  6.369   0.373   1.00 15.00 ?  288 VAL A HG12 13 
ATOM   9196  H HG13 . VAL A 1 10 ? -2.326  6.442   -0.800  1.00 15.00 ?  288 VAL A HG13 13 
ATOM   9197  H HG21 . VAL A 1 10 ? -0.739  4.382   -2.722  1.00 15.00 ?  288 VAL A HG21 13 
ATOM   9198  H HG22 . VAL A 1 10 ? -2.483  4.512   -2.496  1.00 15.00 ?  288 VAL A HG22 13 
ATOM   9199  H HG23 . VAL A 1 10 ? -1.658  2.997   -2.130  1.00 15.00 ?  288 VAL A HG23 13 
ATOM   9200  N N    . ARG A 1 11 ? 1.824   2.901   -1.206  1.00 15.00 ?  289 ARG A N    13 
ATOM   9201  C CA   . ARG A 1 11 ? 3.003   2.872   -2.044  1.00 15.00 ?  289 ARG A CA   13 
ATOM   9202  C C    . ARG A 1 11 ? 2.593   2.447   -3.445  1.00 15.00 ?  289 ARG A C    13 
ATOM   9203  O O    . ARG A 1 11 ? 2.290   1.282   -3.700  1.00 15.00 ?  289 ARG A O    13 
ATOM   9204  C CB   . ARG A 1 11 ? 4.068   1.938   -1.440  1.00 15.00 ?  289 ARG A CB   13 
ATOM   9205  C CG   . ARG A 1 11 ? 5.505   2.212   -1.890  1.00 15.00 ?  289 ARG A CG   13 
ATOM   9206  C CD   . ARG A 1 11 ? 5.742   1.852   -3.353  1.00 15.00 ?  289 ARG A CD   13 
ATOM   9207  N NE   . ARG A 1 11 ? 7.085   2.213   -3.816  1.00 15.00 ?  289 ARG A NE   13 
ATOM   9208  C CZ   . ARG A 1 11 ? 8.113   1.363   -3.911  1.00 15.00 ?  289 ARG A CZ   13 
ATOM   9209  N NH1  . ARG A 1 11 ? 7.998   0.106   -3.501  1.00 15.00 1  289 ARG A NH1  13 
ATOM   9210  N NH2  . ARG A 1 11 ? 9.263   1.779   -4.424  1.00 15.00 ?  289 ARG A NH2  13 
ATOM   9211  H H    . ARG A 1 11 ? 1.535   2.074   -0.753  1.00 15.00 ?  289 ARG A H    13 
ATOM   9212  H HA   . ARG A 1 11 ? 3.398   3.878   -2.090  1.00 15.00 ?  289 ARG A HA   13 
ATOM   9213  H HB2  . ARG A 1 11 ? 4.036   2.036   -0.365  1.00 15.00 ?  289 ARG A HB2  13 
ATOM   9214  H HB3  . ARG A 1 11 ? 3.820   0.921   -1.698  1.00 15.00 ?  289 ARG A HB3  13 
ATOM   9215  H HG2  . ARG A 1 11 ? 5.719   3.261   -1.753  1.00 15.00 ?  289 ARG A HG2  13 
ATOM   9216  H HG3  . ARG A 1 11 ? 6.175   1.624   -1.270  1.00 15.00 ?  289 ARG A HG3  13 
ATOM   9217  H HD2  . ARG A 1 11 ? 5.610   0.786   -3.472  1.00 15.00 ?  289 ARG A HD2  13 
ATOM   9218  H HD3  . ARG A 1 11 ? 5.012   2.372   -3.956  1.00 15.00 ?  289 ARG A HD3  13 
ATOM   9219  H HE   . ARG A 1 11 ? 7.219   3.142   -4.110  1.00 15.00 ?  289 ARG A HE   13 
ATOM   9220  H HH11 . ARG A 1 11 ? 7.136   -0.225  -3.112  1.00 15.00 ?  289 ARG A HH11 13 
ATOM   9221  H HH12 . ARG A 1 11 ? 8.781   -0.527  -3.578  1.00 15.00 ?  289 ARG A HH12 13 
ATOM   9222  H HH21 . ARG A 1 11 ? 9.359   2.736   -4.749  1.00 15.00 ?  289 ARG A HH21 13 
ATOM   9223  H HH22 . ARG A 1 11 ? 10.044  1.155   -4.491  1.00 15.00 ?  289 ARG A HH22 13 
ATOM   9224  N N    . SER A 1 12 ? 2.521   3.420   -4.328  1.00 15.00 ?  290 SER A N    13 
ATOM   9225  C CA   . SER A 1 12 ? 2.125   3.188   -5.698  1.00 15.00 ?  290 SER A CA   13 
ATOM   9226  C C    . SER A 1 12 ? 3.353   2.883   -6.544  1.00 15.00 ?  290 SER A C    13 
ATOM   9227  O O    . SER A 1 12 ? 4.404   3.497   -6.364  1.00 15.00 ?  290 SER A O    13 
ATOM   9228  C CB   . SER A 1 12 ? 1.410   4.432   -6.209  1.00 15.00 ?  290 SER A CB   13 
ATOM   9229  O OG   . SER A 1 12 ? 0.979   4.281   -7.551  1.00 15.00 ?  290 SER A OG   13 
ATOM   9230  H H    . SER A 1 12 ? 2.739   4.339   -4.049  1.00 15.00 ?  290 SER A H    13 
ATOM   9231  H HA   . SER A 1 12 ? 1.450   2.348   -5.723  1.00 15.00 ?  290 SER A HA   13 
ATOM   9232  H HB2  . SER A 1 12 ? 0.547   4.627   -5.588  1.00 15.00 ?  290 SER A HB2  13 
ATOM   9233  H HB3  . SER A 1 12 ? 2.088   5.266   -6.147  1.00 15.00 ?  290 SER A HB3  13 
ATOM   9234  H HG   . SER A 1 12 ? 0.469   5.060   -7.810  1.00 15.00 ?  290 SER A HG   13 
ATOM   9235  N N    . THR A 1 13 ? 3.228   1.932   -7.456  1.00 15.00 ?  291 THR A N    13 
ATOM   9236  C CA   . THR A 1 13 ? 4.339   1.579   -8.319  1.00 15.00 ?  291 THR A CA   13 
ATOM   9237  C C    . THR A 1 13 ? 3.938   1.660   -9.789  1.00 15.00 ?  291 THR A C    13 
ATOM   9238  O O    . THR A 1 13 ? 2.833   1.245   -10.172 1.00 15.00 ?  291 THR A O    13 
ATOM   9239  C CB   . THR A 1 13 ? 4.887   0.175   -7.993  1.00 15.00 ?  291 THR A CB   13 
ATOM   9240  O OG1  . THR A 1 13 ? 3.853   -0.808  -8.137  1.00 15.00 ?  291 THR A OG1  13 
ATOM   9241  C CG2  . THR A 1 13 ? 5.436   0.125   -6.574  1.00 15.00 ?  291 THR A CG2  13 
ATOM   9242  H H    . THR A 1 13 ? 2.370   1.469   -7.558  1.00 15.00 ?  291 THR A H    13 
ATOM   9243  H HA   . THR A 1 13 ? 5.129   2.295   -8.140  1.00 15.00 ?  291 THR A HA   13 
ATOM   9244  H HB   . THR A 1 13 ? 5.688   -0.052  -8.681  1.00 15.00 ?  291 THR A HB   13 
ATOM   9245  H HG1  . THR A 1 13 ? 3.085   -0.550  -7.609  1.00 15.00 ?  291 THR A HG1  13 
ATOM   9246  H HG21 . THR A 1 13 ? 4.620   0.199   -5.869  1.00 15.00 ?  291 THR A HG21 13 
ATOM   9247  H HG22 . THR A 1 13 ? 6.117   0.954   -6.423  1.00 15.00 ?  291 THR A HG22 13 
ATOM   9248  H HG23 . THR A 1 13 ? 5.960   -0.808  -6.421  1.00 15.00 ?  291 THR A HG23 13 
ATOM   9249  N N    . VAL A 1 14 ? 4.859   2.180   -10.602 1.00 15.00 ?  292 VAL A N    13 
ATOM   9250  C CA   . VAL A 1 14 ? 4.635   2.423   -12.030 1.00 15.00 ?  292 VAL A CA   13 
ATOM   9251  C C    . VAL A 1 14 ? 4.292   1.130   -12.780 1.00 15.00 ?  292 VAL A C    13 
ATOM   9252  O O    . VAL A 1 14 ? 3.796   1.163   -13.907 1.00 15.00 ?  292 VAL A O    13 
ATOM   9253  C CB   . VAL A 1 14 ? 5.871   3.099   -12.673 1.00 15.00 ?  292 VAL A CB   13 
ATOM   9254  C CG1  . VAL A 1 14 ? 7.067   2.158   -12.685 1.00 15.00 ?  292 VAL A CG1  13 
ATOM   9255  C CG2  . VAL A 1 14 ? 5.560   3.597   -14.078 1.00 15.00 ?  292 VAL A CG2  13 
ATOM   9256  H H    . VAL A 1 14 ? 5.738   2.423   -10.219 1.00 15.00 ?  292 VAL A H    13 
ATOM   9257  H HA   . VAL A 1 14 ? 3.798   3.102   -12.116 1.00 15.00 ?  292 VAL A HA   13 
ATOM   9258  H HB   . VAL A 1 14 ? 6.131   3.957   -12.066 1.00 15.00 ?  292 VAL A HB   13 
ATOM   9259  H HG11 . VAL A 1 14 ? 7.911   2.655   -13.138 1.00 15.00 ?  292 VAL A HG11 13 
ATOM   9260  H HG12 . VAL A 1 14 ? 6.821   1.273   -13.255 1.00 15.00 ?  292 VAL A HG12 13 
ATOM   9261  H HG13 . VAL A 1 14 ? 7.315   1.877   -11.672 1.00 15.00 ?  292 VAL A HG13 13 
ATOM   9262  H HG21 . VAL A 1 14 ? 6.446   4.046   -14.504 1.00 15.00 ?  292 VAL A HG21 13 
ATOM   9263  H HG22 . VAL A 1 14 ? 4.769   4.334   -14.034 1.00 15.00 ?  292 VAL A HG22 13 
ATOM   9264  H HG23 . VAL A 1 14 ? 5.246   2.768   -14.694 1.00 15.00 ?  292 VAL A HG23 13 
ATOM   9265  N N    . SER A 1 15 ? 4.552   -0.004  -12.141 1.00 15.00 ?  293 SER A N    13 
ATOM   9266  C CA   . SER A 1 15 ? 4.188   -1.306  -12.687 1.00 15.00 ?  293 SER A CA   13 
ATOM   9267  C C    . SER A 1 15 ? 2.675   -1.417  -12.883 1.00 15.00 ?  293 SER A C    13 
ATOM   9268  O O    . SER A 1 15 ? 2.188   -2.336  -13.542 1.00 15.00 ?  293 SER A O    13 
ATOM   9269  C CB   . SER A 1 15 ? 4.681   -2.411  -11.754 1.00 15.00 ?  293 SER A CB   13 
ATOM   9270  O OG   . SER A 1 15 ? 6.059   -2.245  -11.465 1.00 15.00 ?  293 SER A OG   13 
ATOM   9271  H H    . SER A 1 15 ? 5.004   0.035   -11.274 1.00 15.00 ?  293 SER A H    13 
ATOM   9272  H HA   . SER A 1 15 ? 4.673   -1.412  -13.645 1.00 15.00 ?  293 SER A HA   13 
ATOM   9273  H HB2  . SER A 1 15 ? 4.124   -2.377  -10.829 1.00 15.00 ?  293 SER A HB2  13 
ATOM   9274  H HB3  . SER A 1 15 ? 4.538   -3.371  -12.229 1.00 15.00 ?  293 SER A HB3  13 
ATOM   9275  H HG   . SER A 1 15 ? 6.521   -1.957  -12.273 1.00 15.00 ?  293 SER A HG   13 
ATOM   9276  N N    . GLY A 1 16 ? 1.934   -0.498  -12.271 1.00 15.00 ?  294 GLY A N    13 
ATOM   9277  C CA   . GLY A 1 16 ? 0.494   -0.508  -12.382 1.00 15.00 ?  294 GLY A CA   13 
ATOM   9278  C C    . GLY A 1 16 ? -0.136  -1.333  -11.287 1.00 15.00 ?  294 GLY A C    13 
ATOM   9279  O O    . GLY A 1 16 ? -1.143  -2.007  -11.503 1.00 15.00 ?  294 GLY A O    13 
ATOM   9280  H H    . GLY A 1 16 ? 2.377   0.199   -11.740 1.00 15.00 ?  294 GLY A H    13 
ATOM   9281  H HA2  . GLY A 1 16 ? 0.128   0.507   -12.313 1.00 15.00 ?  294 GLY A HA2  13 
ATOM   9282  H HA3  . GLY A 1 16 ? 0.212   -0.920  -13.340 1.00 15.00 ?  294 GLY A HA3  13 
ATOM   9283  N N    . ARG A 1 17 ? 0.463   -1.283  -10.106 1.00 15.00 ?  295 ARG A N    13 
ATOM   9284  C CA   . ARG A 1 17 ? -0.046  -2.033  -8.967  1.00 15.00 ?  295 ARG A CA   13 
ATOM   9285  C C    . ARG A 1 17 ? 0.092   -1.218  -7.687  1.00 15.00 ?  295 ARG A C    13 
ATOM   9286  O O    . ARG A 1 17 ? 1.173   -0.718  -7.360  1.00 15.00 ?  295 ARG A O    13 
ATOM   9287  C CB   . ARG A 1 17 ? 0.674   -3.386  -8.831  1.00 15.00 ?  295 ARG A CB   13 
ATOM   9288  C CG   . ARG A 1 17 ? 2.189   -3.283  -8.765  1.00 15.00 ?  295 ARG A CG   13 
ATOM   9289  C CD   . ARG A 1 17 ? 2.818   -4.657  -8.660  1.00 15.00 ?  295 ARG A CD   13 
ATOM   9290  N NE   . ARG A 1 17 ? 4.278   -4.614  -8.626  1.00 15.00 ?  295 ARG A NE   13 
ATOM   9291  C CZ   . ARG A 1 17 ? 5.045   -5.678  -8.863  1.00 15.00 ?  295 ARG A CZ   13 
ATOM   9292  N NH1  . ARG A 1 17 ? 4.486   -6.819  -9.255  1.00 15.00 1  295 ARG A NH1  13 
ATOM   9293  N NH2  . ARG A 1 17 ? 6.366   -5.596  -8.745  1.00 15.00 ?  295 ARG A NH2  13 
ATOM   9294  H H    . ARG A 1 17 ? 1.260   -0.711  -9.992  1.00 15.00 ?  295 ARG A H    13 
ATOM   9295  H HA   . ARG A 1 17 ? -1.095  -2.217  -9.143  1.00 15.00 ?  295 ARG A HA   13 
ATOM   9296  H HB2  . ARG A 1 17 ? 0.331   -3.880  -7.930  1.00 15.00 ?  295 ARG A HB2  13 
ATOM   9297  H HB3  . ARG A 1 17 ? 0.417   -4.007  -9.678  1.00 15.00 ?  295 ARG A HB3  13 
ATOM   9298  H HG2  . ARG A 1 17 ? 2.547   -2.798  -9.660  1.00 15.00 ?  295 ARG A HG2  13 
ATOM   9299  H HG3  . ARG A 1 17 ? 2.465   -2.700  -7.899  1.00 15.00 ?  295 ARG A HG3  13 
ATOM   9300  H HD2  . ARG A 1 17 ? 2.463   -5.133  -7.759  1.00 15.00 ?  295 ARG A HD2  13 
ATOM   9301  H HD3  . ARG A 1 17 ? 2.509   -5.241  -9.515  1.00 15.00 ?  295 ARG A HD3  13 
ATOM   9302  H HE   . ARG A 1 17 ? 4.702   -3.759  -8.389  1.00 15.00 ?  295 ARG A HE   13 
ATOM   9303  H HH11 . ARG A 1 17 ? 3.483   -6.879  -9.380  1.00 15.00 ?  295 ARG A HH11 13 
ATOM   9304  H HH12 . ARG A 1 17 ? 5.054   -7.633  -9.417  1.00 15.00 ?  295 ARG A HH12 13 
ATOM   9305  H HH21 . ARG A 1 17 ? 6.800   -4.733  -8.477  1.00 15.00 ?  295 ARG A HH21 13 
ATOM   9306  H HH22 . ARG A 1 17 ? 6.940   -6.406  -8.926  1.00 15.00 ?  295 ARG A HH22 13 
ATOM   9307  N N    . ILE A 1 18 ? -1.021  -1.066  -6.989  1.00 15.00 ?  296 ILE A N    13 
ATOM   9308  C CA   . ILE A 1 18 ? -1.034  -0.402  -5.699  1.00 15.00 ?  296 ILE A CA   13 
ATOM   9309  C C    . ILE A 1 18 ? -0.809  -1.455  -4.621  1.00 15.00 ?  296 ILE A C    13 
ATOM   9310  O O    . ILE A 1 18 ? -1.347  -2.559  -4.711  1.00 15.00 ?  296 ILE A O    13 
ATOM   9311  C CB   . ILE A 1 18 ? -2.372  0.366   -5.480  1.00 15.00 ?  296 ILE A CB   13 
ATOM   9312  C CG1  . ILE A 1 18 ? -2.295  1.311   -4.271  1.00 15.00 ?  296 ILE A CG1  13 
ATOM   9313  C CG2  . ILE A 1 18 ? -3.546  -0.597  -5.326  1.00 15.00 ?  296 ILE A CG2  13 
ATOM   9314  C CD1  . ILE A 1 18 ? -2.507  0.641   -2.930  1.00 15.00 ?  296 ILE A CD1  13 
ATOM   9315  H H    . ILE A 1 18 ? -1.858  -1.427  -7.343  1.00 15.00 ?  296 ILE A H    13 
ATOM   9316  H HA   . ILE A 1 18 ? -0.219  0.308   -5.676  1.00 15.00 ?  296 ILE A HA   13 
ATOM   9317  H HB   . ILE A 1 18 ? -2.553  0.957   -6.366  1.00 15.00 ?  296 ILE A HB   13 
ATOM   9318  H HG12 . ILE A 1 18 ? -1.321  1.776   -4.251  1.00 15.00 ?  296 ILE A HG12 13 
ATOM   9319  H HG13 . ILE A 1 18 ? -3.049  2.078   -4.380  1.00 15.00 ?  296 ILE A HG13 13 
ATOM   9320  H HG21 . ILE A 1 18 ? -3.612  -1.228  -6.198  1.00 15.00 ?  296 ILE A HG21 13 
ATOM   9321  H HG22 . ILE A 1 18 ? -4.461  -0.032  -5.219  1.00 15.00 ?  296 ILE A HG22 13 
ATOM   9322  H HG23 . ILE A 1 18 ? -3.397  -1.208  -4.446  1.00 15.00 ?  296 ILE A HG23 13 
ATOM   9323  H HD11 . ILE A 1 18 ? -3.412  0.053   -2.960  1.00 15.00 ?  296 ILE A HD11 13 
ATOM   9324  H HD12 . ILE A 1 18 ? -2.602  1.397   -2.165  1.00 15.00 ?  296 ILE A HD12 13 
ATOM   9325  H HD13 . ILE A 1 18 ? -1.667  0.002   -2.705  1.00 15.00 ?  296 ILE A HD13 13 
ATOM   9326  N N    . TYR A 1 19 ? 0.011   -1.143  -3.627  1.00 15.00 ?  297 TYR A N    13 
ATOM   9327  C CA   . TYR A 1 19 ? 0.339   -2.137  -2.627  1.00 15.00 ?  297 TYR A CA   13 
ATOM   9328  C C    . TYR A 1 19 ? 0.623   -1.409  -1.337  1.00 15.00 ?  297 TYR A C    13 
ATOM   9329  O O    . TYR A 1 19 ? 1.289   -0.363  -1.316  1.00 15.00 ?  297 TYR A O    13 
ATOM   9330  C CB   . TYR A 1 19 ? 1.491   -3.076  -3.058  1.00 15.00 ?  297 TYR A CB   13 
ATOM   9331  C CG   . TYR A 1 19 ? 2.897   -2.649  -2.695  1.00 15.00 ?  297 TYR A CG   13 
ATOM   9332  C CD1  . TYR A 1 19 ? 3.458   -1.485  -3.190  1.00 15.00 ?  297 TYR A CD1  13 
ATOM   9333  C CD2  . TYR A 1 19 ? 3.672   -3.442  -1.851  1.00 15.00 ?  297 TYR A CD2  13 
ATOM   9334  C CE1  . TYR A 1 19 ? 4.744   -1.120  -2.849  1.00 15.00 ?  297 TYR A CE1  13 
ATOM   9335  C CE2  . TYR A 1 19 ? 4.957   -3.081  -1.509  1.00 15.00 ?  297 TYR A CE2  13 
ATOM   9336  C CZ   . TYR A 1 19 ? 5.487   -1.919  -2.008  1.00 15.00 ?  297 TYR A CZ   13 
ATOM   9337  O OH   . TYR A 1 19 ? 6.768   -1.549  -1.667  1.00 15.00 ?  297 TYR A OH   13 
ATOM   9338  H H    . TYR A 1 19 ? 0.280   -0.200  -3.480  1.00 15.00 ?  297 TYR A H    13 
ATOM   9339  H HA   . TYR A 1 19 ? -0.552  -2.734  -2.477  1.00 15.00 ?  297 TYR A HA   13 
ATOM   9340  H HB2  . TYR A 1 19 ? 1.329   -4.043  -2.609  1.00 15.00 ?  297 TYR A HB2  13 
ATOM   9341  H HB3  . TYR A 1 19 ? 1.452   -3.187  -4.134  1.00 15.00 ?  297 TYR A HB3  13 
ATOM   9342  H HD1  . TYR A 1 19 ? 2.876   -0.855  -3.845  1.00 15.00 ?  297 TYR A HD1  13 
ATOM   9343  H HD2  . TYR A 1 19 ? 3.257   -4.360  -1.461  1.00 15.00 ?  297 TYR A HD2  13 
ATOM   9344  H HE1  . TYR A 1 19 ? 5.167   -0.208  -3.245  1.00 15.00 ?  297 TYR A HE1  13 
ATOM   9345  H HE2  . TYR A 1 19 ? 5.539   -3.712  -0.854  1.00 15.00 ?  297 TYR A HE2  13 
ATOM   9346  H HH   . TYR A 1 19 ? 6.735   -0.807  -1.057  1.00 15.00 ?  297 TYR A HH   13 
ATOM   9347  N N    . PHE A 1 20 ? 0.096   -1.931  -0.273  1.00 15.00 ?  298 PHE A N    13 
ATOM   9348  C CA   . PHE A 1 20 ? 0.061   -1.196  0.939   1.00 15.00 ?  298 PHE A CA   13 
ATOM   9349  C C    . PHE A 1 20 ? 1.184   -1.460  1.871   1.00 15.00 ?  298 PHE A C    13 
ATOM   9350  O O    . PHE A 1 20 ? 1.565   -2.596  2.126   1.00 15.00 ?  298 PHE A O    13 
ATOM   9351  C CB   . PHE A 1 20 ? -1.246  -1.386  1.625   1.00 15.00 ?  298 PHE A CB   13 
ATOM   9352  C CG   . PHE A 1 20 ? -2.043  -0.200  1.353   1.00 15.00 ?  298 PHE A CG   13 
ATOM   9353  C CD1  . PHE A 1 20 ? -1.682  0.993   1.940   1.00 15.00 ?  298 PHE A CD1  13 
ATOM   9354  C CD2  . PHE A 1 20 ? -3.097  -0.243  0.474   1.00 15.00 ?  298 PHE A CD2  13 
ATOM   9355  C CE1  . PHE A 1 20 ? -2.370  2.130   1.663   1.00 15.00 ?  298 PHE A CE1  13 
ATOM   9356  C CE2  . PHE A 1 20 ? -3.795  0.895   0.197   1.00 15.00 ?  298 PHE A CE2  13 
ATOM   9357  C CZ   . PHE A 1 20 ? -3.425  2.075   0.795   1.00 15.00 ?  298 PHE A CZ   13 
ATOM   9358  H H    . PHE A 1 20 ? -0.316  -2.822  -0.315  1.00 15.00 ?  298 PHE A H    13 
ATOM   9359  H HA   . PHE A 1 20 ? 0.118   -0.159  0.651   1.00 15.00 ?  298 PHE A HA   13 
ATOM   9360  H HB2  . PHE A 1 20 ? -1.753  -2.258  1.233   1.00 15.00 ?  298 PHE A HB2  13 
ATOM   9361  H HB3  . PHE A 1 20 ? -1.104  -1.473  2.690   1.00 15.00 ?  298 PHE A HB3  13 
ATOM   9362  H HD1  . PHE A 1 20 ? -0.858  1.019   2.634   1.00 15.00 ?  298 PHE A HD1  13 
ATOM   9363  H HD2  . PHE A 1 20 ? -3.374  -1.179  0.012   1.00 15.00 ?  298 PHE A HD2  13 
ATOM   9364  H HE1  . PHE A 1 20 ? -2.089  3.065   2.123   1.00 15.00 ?  298 PHE A HE1  13 
ATOM   9365  H HE2  . PHE A 1 20 ? -4.627  0.871   -0.487  1.00 15.00 ?  298 PHE A HE2  13 
ATOM   9366  H HZ   . PHE A 1 20 ? -3.964  2.937   0.605   1.00 15.00 ?  298 PHE A HZ   13 
ATOM   9367  N N    . VAL A 1 21 ? 1.649   -0.364  2.418   1.00 15.00 ?  299 VAL A N    13 
ATOM   9368  C CA   . VAL A 1 21 ? 2.705   -0.372  3.372   1.00 15.00 ?  299 VAL A CA   13 
ATOM   9369  C C    . VAL A 1 21 ? 2.270   0.472   4.577   1.00 15.00 ?  299 VAL A C    13 
ATOM   9370  O O    . VAL A 1 21 ? 2.448   1.691   4.639   1.00 15.00 ?  299 VAL A O    13 
ATOM   9371  C CB   . VAL A 1 21 ? 4.014   0.153   2.722   1.00 15.00 ?  299 VAL A CB   13 
ATOM   9372  C CG1  . VAL A 1 21 ? 4.387   -0.707  1.513   1.00 15.00 ?  299 VAL A CG1  13 
ATOM   9373  C CG2  . VAL A 1 21 ? 3.870   1.600   2.279   1.00 15.00 ?  299 VAL A CG2  13 
ATOM   9374  H H    . VAL A 1 21 ? 1.236   0.496   2.183   1.00 15.00 ?  299 VAL A H    13 
ATOM   9375  H HA   . VAL A 1 21 ? 2.862   -1.393  3.692   1.00 15.00 ?  299 VAL A HA   13 
ATOM   9376  H HB   . VAL A 1 21 ? 4.812   0.089   3.447   1.00 15.00 ?  299 VAL A HB   13 
ATOM   9377  H HG11 . VAL A 1 21 ? 4.385   -1.751  1.788   1.00 15.00 ?  299 VAL A HG11 13 
ATOM   9378  H HG12 . VAL A 1 21 ? 5.371   -0.429  1.165   1.00 15.00 ?  299 VAL A HG12 13 
ATOM   9379  H HG13 . VAL A 1 21 ? 3.669   -0.541  0.722   1.00 15.00 ?  299 VAL A HG13 13 
ATOM   9380  H HG21 . VAL A 1 21 ? 3.632   2.212   3.136   1.00 15.00 ?  299 VAL A HG21 13 
ATOM   9381  H HG22 . VAL A 1 21 ? 3.077   1.678   1.550   1.00 15.00 ?  299 VAL A HG22 13 
ATOM   9382  H HG23 . VAL A 1 21 ? 4.798   1.938   1.841   1.00 15.00 ?  299 VAL A HG23 13 
ATOM   9383  N N    . ASP A 1 22 ? 1.639   -0.180  5.523   1.00 15.00 ?  300 ASP A N    13 
ATOM   9384  C CA   . ASP A 1 22 ? 1.205   0.504   6.720   1.00 15.00 ?  300 ASP A CA   13 
ATOM   9385  C C    . ASP A 1 22 ? 2.314   0.411   7.749   1.00 15.00 ?  300 ASP A C    13 
ATOM   9386  O O    . ASP A 1 22 ? 2.675   -0.675  8.195   1.00 15.00 ?  300 ASP A O    13 
ATOM   9387  C CB   . ASP A 1 22 ? -0.137  -0.069  7.218   1.00 15.00 ?  300 ASP A CB   13 
ATOM   9388  C CG   . ASP A 1 22 ? -0.158  -0.385  8.703   1.00 15.00 ?  300 ASP A CG   13 
ATOM   9389  O OD1  . ASP A 1 22 ? -0.123  0.563   9.523   1.00 15.00 ?  300 ASP A OD1  13 
ATOM   9390  O OD2  . ASP A 1 22 ? -0.221  -1.580  9.055   1.00 15.00 -1 300 ASP A OD2  13 
ATOM   9391  H H    . ASP A 1 22 ? 1.468   -1.142  5.421   1.00 15.00 ?  300 ASP A H    13 
ATOM   9392  H HA   . ASP A 1 22 ? 1.067   1.545   6.464   1.00 15.00 ?  300 ASP A HA   13 
ATOM   9393  H HB2  . ASP A 1 22 ? -0.912  0.657   7.024   1.00 15.00 ?  300 ASP A HB2  13 
ATOM   9394  H HB3  . ASP A 1 22 ? -0.363  -0.973  6.666   1.00 15.00 ?  300 ASP A HB3  13 
ATOM   9395  N N    . HIS A 1 23 ? 2.904   1.553   8.075   1.00 15.00 ?  301 HIS A N    13 
ATOM   9396  C CA   . HIS A 1 23 ? 4.090   1.567   8.919   1.00 15.00 ?  301 HIS A CA   13 
ATOM   9397  C C    . HIS A 1 23 ? 3.704   1.539   10.394  1.00 15.00 ?  301 HIS A C    13 
ATOM   9398  O O    . HIS A 1 23 ? 4.554   1.353   11.263  1.00 15.00 ?  301 HIS A O    13 
ATOM   9399  C CB   . HIS A 1 23 ? 4.963   2.809   8.677   1.00 15.00 ?  301 HIS A CB   13 
ATOM   9400  C CG   . HIS A 1 23 ? 5.243   3.178   7.246   1.00 15.00 ?  301 HIS A CG   13 
ATOM   9401  N ND1  . HIS A 1 23 ? 5.413   4.479   6.850   1.00 15.00 ?  301 HIS A ND1  13 
ATOM   9402  C CD2  . HIS A 1 23 ? 5.490   2.429   6.147   1.00 15.00 ?  301 HIS A CD2  13 
ATOM   9403  C CE1  . HIS A 1 23 ? 5.757   4.513   5.585   1.00 15.00 ?  301 HIS A CE1  13 
ATOM   9404  N NE2  . HIS A 1 23 ? 5.824   3.278   5.125   1.00 15.00 ?  301 HIS A NE2  13 
ATOM   9405  H H    . HIS A 1 23 ? 2.530   2.400   7.745   1.00 15.00 ?  301 HIS A H    13 
ATOM   9406  H HA   . HIS A 1 23 ? 4.667   0.683   8.693   1.00 15.00 ?  301 HIS A HA   13 
ATOM   9407  H HB2  . HIS A 1 23 ? 4.492   3.656   9.137   1.00 15.00 ?  301 HIS A HB2  13 
ATOM   9408  H HB3  . HIS A 1 23 ? 5.917   2.645   9.156   1.00 15.00 ?  301 HIS A HB3  13 
ATOM   9409  H HD1  . HIS A 1 23 ? 5.289   5.277   7.422   1.00 15.00 ?  301 HIS A HD1  13 
ATOM   9410  H HD2  . HIS A 1 23 ? 5.403   1.354   6.069   1.00 15.00 ?  301 HIS A HD2  13 
ATOM   9411  H HE1  . HIS A 1 23 ? 5.932   5.409   5.002   1.00 15.00 ?  301 HIS A HE1  13 
ATOM   9412  H HE2  . HIS A 1 23 ? 6.408   3.016   4.372   1.00 15.00 ?  301 HIS A HE2  13 
ATOM   9413  N N    . ASN A 1 24 ? 2.422   1.723   10.677  1.00 15.00 ?  302 ASN A N    13 
ATOM   9414  C CA   . ASN A 1 24 ? 1.973   1.900   12.054  1.00 15.00 ?  302 ASN A CA   13 
ATOM   9415  C C    . ASN A 1 24 ? 1.553   0.579   12.681  1.00 15.00 ?  302 ASN A C    13 
ATOM   9416  O O    . ASN A 1 24 ? 1.984   0.250   13.788  1.00 15.00 ?  302 ASN A O    13 
ATOM   9417  C CB   . ASN A 1 24 ? 0.834   2.917   12.122  1.00 15.00 ?  302 ASN A CB   13 
ATOM   9418  C CG   . ASN A 1 24 ? 1.302   4.324   11.797  1.00 15.00 ?  302 ASN A CG   13 
ATOM   9419  O OD1  . ASN A 1 24 ? 1.697   5.081   12.683  1.00 15.00 ?  302 ASN A OD1  13 
ATOM   9420  N ND2  . ASN A 1 24 ? 1.272   4.684   10.522  1.00 15.00 ?  302 ASN A ND2  13 
ATOM   9421  H H    . ASN A 1 24 ? 1.761   1.719   9.951   1.00 15.00 ?  302 ASN A H    13 
ATOM   9422  H HA   . ASN A 1 24 ? 2.811   2.286   12.615  1.00 15.00 ?  302 ASN A HA   13 
ATOM   9423  H HB2  . ASN A 1 24 ? 0.068   2.640   11.415  1.00 15.00 ?  302 ASN A HB2  13 
ATOM   9424  H HB3  . ASN A 1 24 ? 0.417   2.915   13.119  1.00 15.00 ?  302 ASN A HB3  13 
ATOM   9425  H HD21 . ASN A 1 24 ? 0.956   4.030   9.860   1.00 15.00 ?  302 ASN A HD21 13 
ATOM   9426  H HD22 . ASN A 1 24 ? 1.552   5.599   10.288  1.00 15.00 ?  302 ASN A HD22 13 
ATOM   9427  N N    . ASN A 1 25 ? 0.688   -0.157  11.997  1.00 15.00 ?  303 ASN A N    13 
ATOM   9428  C CA   . ASN A 1 25 ? 0.314   -1.496  12.439  1.00 15.00 ?  303 ASN A CA   13 
ATOM   9429  C C    . ASN A 1 25 ? 1.259   -2.529  11.811  1.00 15.00 ?  303 ASN A C    13 
ATOM   9430  O O    . ASN A 1 25 ? 1.310   -3.686  12.236  1.00 15.00 ?  303 ASN A O    13 
ATOM   9431  C CB   . ASN A 1 25 ? -1.145  -1.797  12.060  1.00 15.00 ?  303 ASN A CB   13 
ATOM   9432  C CG   . ASN A 1 25 ? -1.814  -2.836  12.953  1.00 15.00 ?  303 ASN A CG   13 
ATOM   9433  O OD1  . ASN A 1 25 ? -3.033  -2.814  13.137  1.00 15.00 ?  303 ASN A OD1  13 
ATOM   9434  N ND2  . ASN A 1 25 ? -1.038  -3.749  13.511  1.00 15.00 ?  303 ASN A ND2  13 
ATOM   9435  H H    . ASN A 1 25 ? 0.265   0.221   11.183  1.00 15.00 ?  303 ASN A H    13 
ATOM   9436  H HA   . ASN A 1 25 ? 0.418   -1.534  13.515  1.00 15.00 ?  303 ASN A HA   13 
ATOM   9437  H HB2  . ASN A 1 25 ? -1.718  -0.884  12.122  1.00 15.00 ?  303 ASN A HB2  13 
ATOM   9438  H HB3  . ASN A 1 25 ? -1.172  -2.158  11.041  1.00 15.00 ?  303 ASN A HB3  13 
ATOM   9439  H HD21 . ASN A 1 25 ? -0.074  -3.713  13.327  1.00 15.00 ?  303 ASN A HD21 13 
ATOM   9440  H HD22 . ASN A 1 25 ? -1.456  -4.430  14.083  1.00 15.00 ?  303 ASN A HD22 13 
ATOM   9441  N N    . ARG A 1 26 ? 1.995   -2.088  10.787  1.00 15.00 ?  304 ARG A N    13 
ATOM   9442  C CA   . ARG A 1 26 ? 2.959   -2.914  10.068  1.00 15.00 ?  304 ARG A CA   13 
ATOM   9443  C C    . ARG A 1 26 ? 2.260   -4.056  9.337   1.00 15.00 ?  304 ARG A C    13 
ATOM   9444  O O    . ARG A 1 26 ? 2.219   -5.195  9.815   1.00 15.00 ?  304 ARG A O    13 
ATOM   9445  C CB   . ARG A 1 26 ? 4.051   -3.438  11.006  1.00 15.00 ?  304 ARG A CB   13 
ATOM   9446  C CG   . ARG A 1 26 ? 5.229   -4.072  10.287  1.00 15.00 ?  304 ARG A CG   13 
ATOM   9447  C CD   . ARG A 1 26 ? 6.367   -4.358  11.248  1.00 15.00 ?  304 ARG A CD   13 
ATOM   9448  N NE   . ARG A 1 26 ? 7.553   -4.861  10.562  1.00 15.00 ?  304 ARG A NE   13 
ATOM   9449  C CZ   . ARG A 1 26 ? 8.797   -4.698  11.011  1.00 15.00 ?  304 ARG A CZ   13 
ATOM   9450  N NH1  . ARG A 1 26 ? 9.016   -4.072  12.163  1.00 15.00 1  304 ARG A NH1  13 
ATOM   9451  N NH2  . ARG A 1 26 ? 9.821   -5.172  10.315  1.00 15.00 ?  304 ARG A NH2  13 
ATOM   9452  H H    . ARG A 1 26 ? 1.870   -1.169  10.489  1.00 15.00 ?  304 ARG A H    13 
ATOM   9453  H HA   . ARG A 1 26 ? 3.424   -2.282  9.324   1.00 15.00 ?  304 ARG A HA   13 
ATOM   9454  H HB2  . ARG A 1 26 ? 4.419   -2.617  11.600  1.00 15.00 ?  304 ARG A HB2  13 
ATOM   9455  H HB3  . ARG A 1 26 ? 3.618   -4.181  11.661  1.00 15.00 ?  304 ARG A HB3  13 
ATOM   9456  H HG2  . ARG A 1 26 ? 4.907   -4.999  9.838   1.00 15.00 ?  304 ARG A HG2  13 
ATOM   9457  H HG3  . ARG A 1 26 ? 5.578   -3.397  9.519   1.00 15.00 ?  304 ARG A HG3  13 
ATOM   9458  H HD2  . ARG A 1 26 ? 6.623   -3.446  11.767  1.00 15.00 ?  304 ARG A HD2  13 
ATOM   9459  H HD3  . ARG A 1 26 ? 6.038   -5.094  11.959  1.00 15.00 ?  304 ARG A HD3  13 
ATOM   9460  H HE   . ARG A 1 26 ? 7.411   -5.345  9.719   1.00 15.00 ?  304 ARG A HE   13 
ATOM   9461  H HH11 . ARG A 1 26 ? 8.243   -3.718  12.705  1.00 15.00 ?  304 ARG A HH11 13 
ATOM   9462  H HH12 . ARG A 1 26 ? 9.957   -3.941  12.499  1.00 15.00 ?  304 ARG A HH12 13 
ATOM   9463  H HH21 . ARG A 1 26 ? 9.666   -5.657  9.449   1.00 15.00 ?  304 ARG A HH21 13 
ATOM   9464  H HH22 . ARG A 1 26 ? 10.759  -5.052  10.651  1.00 15.00 ?  304 ARG A HH22 13 
ATOM   9465  N N    . THR A 1 27 ? 1.659   -3.723  8.201   1.00 15.00 ?  305 THR A N    13 
ATOM   9466  C CA   . THR A 1 27 ? 0.934   -4.694  7.396   1.00 15.00 ?  305 THR A CA   13 
ATOM   9467  C C    . THR A 1 27 ? 1.031   -4.346  5.908   1.00 15.00 ?  305 THR A C    13 
ATOM   9468  O O    . THR A 1 27 ? 1.145   -3.172  5.544   1.00 15.00 ?  305 THR A O    13 
ATOM   9469  C CB   . THR A 1 27 ? -0.559  -4.746  7.788   1.00 15.00 ?  305 THR A CB   13 
ATOM   9470  O OG1  . THR A 1 27 ? -0.724  -4.388  9.168   1.00 15.00 ?  305 THR A OG1  13 
ATOM   9471  C CG2  . THR A 1 27 ? -1.127  -6.139  7.555   1.00 15.00 ?  305 THR A CG2  13 
ATOM   9472  H H    . THR A 1 27 ? 1.695   -2.789  7.899   1.00 15.00 ?  305 THR A H    13 
ATOM   9473  H HA   . THR A 1 27 ? 1.368   -5.668  7.563   1.00 15.00 ?  305 THR A HA   13 
ATOM   9474  H HB   . THR A 1 27 ? -1.103  -4.043  7.175   1.00 15.00 ?  305 THR A HB   13 
ATOM   9475  H HG1  . THR A 1 27 ? -0.499  -3.446  9.275   1.00 15.00 ?  305 THR A HG1  13 
ATOM   9476  H HG21 . THR A 1 27 ? -2.170  -6.154  7.841   1.00 15.00 ?  305 THR A HG21 13 
ATOM   9477  H HG22 . THR A 1 27 ? -0.581  -6.855  8.151   1.00 15.00 ?  305 THR A HG22 13 
ATOM   9478  H HG23 . THR A 1 27 ? -1.037  -6.396  6.510   1.00 15.00 ?  305 THR A HG23 13 
ATOM   9479  N N    . THR A 1 28 ? 0.986   -5.368  5.064   1.00 15.00 ?  306 THR A N    13 
ATOM   9480  C CA   . THR A 1 28 ? 0.997   -5.177  3.622   1.00 15.00 ?  306 THR A CA   13 
ATOM   9481  C C    . THR A 1 28 ? -0.318  -5.677  3.014   1.00 15.00 ?  306 THR A C    13 
ATOM   9482  O O    . THR A 1 28 ? -0.796  -6.758  3.359   1.00 15.00 ?  306 THR A O    13 
ATOM   9483  C CB   . THR A 1 28 ? 2.186   -5.920  2.984   1.00 15.00 ?  306 THR A CB   13 
ATOM   9484  O OG1  . THR A 1 28 ? 3.386   -5.645  3.722   1.00 15.00 ?  306 THR A OG1  13 
ATOM   9485  C CG2  . THR A 1 28 ? 2.380   -5.503  1.534   1.00 15.00 ?  306 THR A CG2  13 
ATOM   9486  H H    . THR A 1 28 ? 0.956   -6.287  5.422   1.00 15.00 ?  306 THR A H    13 
ATOM   9487  H HA   . THR A 1 28 ? 1.102   -4.121  3.423   1.00 15.00 ?  306 THR A HA   13 
ATOM   9488  H HB   . THR A 1 28 ? 1.989   -6.982  3.017   1.00 15.00 ?  306 THR A HB   13 
ATOM   9489  H HG1  . THR A 1 28 ? 3.920   -6.449  3.772   1.00 15.00 ?  306 THR A HG1  13 
ATOM   9490  H HG21 . THR A 1 28 ? 2.566   -4.441  1.484   1.00 15.00 ?  306 THR A HG21 13 
ATOM   9491  H HG22 . THR A 1 28 ? 1.489   -5.739  0.969   1.00 15.00 ?  306 THR A HG22 13 
ATOM   9492  H HG23 . THR A 1 28 ? 3.221   -6.036  1.118   1.00 15.00 ?  306 THR A HG23 13 
ATOM   9493  N N    . GLN A 1 29 ? -0.905  -4.885  2.118   1.00 15.00 ?  307 GLN A N    13 
ATOM   9494  C CA   . GLN A 1 29 ? -2.228  -5.195  1.558   1.00 15.00 ?  307 GLN A CA   13 
ATOM   9495  C C    . GLN A 1 29 ? -2.251  -4.998  0.044   1.00 15.00 ?  307 GLN A C    13 
ATOM   9496  O O    . GLN A 1 29 ? -1.564  -4.138  -0.477  1.00 15.00 ?  307 GLN A O    13 
ATOM   9497  C CB   . GLN A 1 29 ? -3.284  -4.280  2.186   1.00 15.00 ?  307 GLN A CB   13 
ATOM   9498  C CG   . GLN A 1 29 ? -3.423  -4.422  3.692   1.00 15.00 ?  307 GLN A CG   13 
ATOM   9499  C CD   . GLN A 1 29 ? -3.968  -5.773  4.104   1.00 15.00 ?  307 GLN A CD   13 
ATOM   9500  O OE1  . GLN A 1 29 ? -4.731  -6.397  3.371   1.00 15.00 ?  307 GLN A OE1  13 
ATOM   9501  N NE2  . GLN A 1 29 ? -3.586  -6.231  5.283   1.00 15.00 ?  307 GLN A NE2  13 
ATOM   9502  H H    . GLN A 1 29 ? -0.436  -4.072  1.819   1.00 15.00 ?  307 GLN A H    13 
ATOM   9503  H HA   . GLN A 1 29 ? -2.463  -6.223  1.788   1.00 15.00 ?  307 GLN A HA   13 
ATOM   9504  H HB2  . GLN A 1 29 ? -3.026  -3.254  1.969   1.00 15.00 ?  307 GLN A HB2  13 
ATOM   9505  H HB3  . GLN A 1 29 ? -4.243  -4.498  1.737   1.00 15.00 ?  307 GLN A HB3  13 
ATOM   9506  H HG2  . GLN A 1 29 ? -2.451  -4.293  4.143   1.00 15.00 ?  307 GLN A HG2  13 
ATOM   9507  H HG3  . GLN A 1 29 ? -4.091  -3.653  4.054   1.00 15.00 ?  307 GLN A HG3  13 
ATOM   9508  H HE21 . GLN A 1 29 ? -2.977  -5.682  5.817   1.00 15.00 ?  307 GLN A HE21 13 
ATOM   9509  H HE22 . GLN A 1 29 ? -3.931  -7.105  5.575   1.00 15.00 ?  307 GLN A HE22 13 
ATOM   9510  N N    . PHE A 1 30 ? -3.041  -5.787  -0.664  1.00 15.00 ?  308 PHE A N    13 
ATOM   9511  C CA   . PHE A 1 30 ? -3.282  -5.529  -2.081  1.00 15.00 ?  308 PHE A CA   13 
ATOM   9512  C C    . PHE A 1 30 ? -4.623  -4.833  -2.295  1.00 15.00 ?  308 PHE A C    13 
ATOM   9513  O O    . PHE A 1 30 ? -4.897  -4.311  -3.374  1.00 15.00 ?  308 PHE A O    13 
ATOM   9514  C CB   . PHE A 1 30 ? -3.191  -6.805  -2.921  1.00 15.00 ?  308 PHE A CB   13 
ATOM   9515  C CG   . PHE A 1 30 ? -1.802  -7.077  -3.437  1.00 15.00 ?  308 PHE A CG   13 
ATOM   9516  C CD1  . PHE A 1 30 ? -1.009  -6.034  -3.898  1.00 15.00 ?  308 PHE A CD1  13 
ATOM   9517  C CD2  . PHE A 1 30 ? -1.295  -8.366  -3.478  1.00 15.00 ?  308 PHE A CD2  13 
ATOM   9518  C CE1  . PHE A 1 30 ? 0.262   -6.271  -4.385  1.00 15.00 ?  308 PHE A CE1  13 
ATOM   9519  C CE2  . PHE A 1 30 ? -0.026  -8.606  -3.962  1.00 15.00 ?  308 PHE A CE2  13 
ATOM   9520  C CZ   . PHE A 1 30 ? 0.753   -7.559  -4.415  1.00 15.00 ?  308 PHE A CZ   13 
ATOM   9521  H H    . PHE A 1 30 ? -3.473  -6.558  -0.232  1.00 15.00 ?  308 PHE A H    13 
ATOM   9522  H HA   . PHE A 1 30 ? -2.505  -4.853  -2.410  1.00 15.00 ?  308 PHE A HA   13 
ATOM   9523  H HB2  . PHE A 1 30 ? -3.493  -7.647  -2.317  1.00 15.00 ?  308 PHE A HB2  13 
ATOM   9524  H HB3  . PHE A 1 30 ? -3.852  -6.717  -3.769  1.00 15.00 ?  308 PHE A HB3  13 
ATOM   9525  H HD1  . PHE A 1 30 ? -1.394  -5.026  -3.869  1.00 15.00 ?  308 PHE A HD1  13 
ATOM   9526  H HD2  . PHE A 1 30 ? -1.901  -9.189  -3.129  1.00 15.00 ?  308 PHE A HD2  13 
ATOM   9527  H HE1  . PHE A 1 30 ? 0.872   -5.451  -4.743  1.00 15.00 ?  308 PHE A HE1  13 
ATOM   9528  H HE2  . PHE A 1 30 ? 0.360   -9.615  -3.986  1.00 15.00 ?  308 PHE A HE2  13 
ATOM   9529  H HZ   . PHE A 1 30 ? 1.747   -7.750  -4.794  1.00 15.00 ?  308 PHE A HZ   13 
ATOM   9530  N N    . THR A 1 31 ? -5.470  -4.852  -1.274  1.00 15.00 ?  309 THR A N    13 
ATOM   9531  C CA   . THR A 1 31 ? -6.766  -4.190  -1.351  1.00 15.00 ?  309 THR A CA   13 
ATOM   9532  C C    . THR A 1 31 ? -6.669  -2.726  -0.913  1.00 15.00 ?  309 THR A C    13 
ATOM   9533  O O    . THR A 1 31 ? -6.225  -2.420  0.198   1.00 15.00 ?  309 THR A O    13 
ATOM   9534  C CB   . THR A 1 31 ? -7.835  -4.926  -0.506  1.00 15.00 ?  309 THR A CB   13 
ATOM   9535  O OG1  . THR A 1 31 ? -9.046  -4.158  -0.456  1.00 15.00 ?  309 THR A OG1  13 
ATOM   9536  C CG2  . THR A 1 31 ? -7.337  -5.197  0.910   1.00 15.00 ?  309 THR A CG2  13 
ATOM   9537  H H    . THR A 1 31 ? -5.219  -5.322  -0.450  1.00 15.00 ?  309 THR A H    13 
ATOM   9538  H HA   . THR A 1 31 ? -7.081  -4.218  -2.384  1.00 15.00 ?  309 THR A HA   13 
ATOM   9539  H HB   . THR A 1 31 ? -8.045  -5.873  -0.979  1.00 15.00 ?  309 THR A HB   13 
ATOM   9540  H HG1  . THR A 1 31 ? -9.044  -3.609  0.344   1.00 15.00 ?  309 THR A HG1  13 
ATOM   9541  H HG21 . THR A 1 31 ? -8.107  -5.706  1.472   1.00 15.00 ?  309 THR A HG21 13 
ATOM   9542  H HG22 . THR A 1 31 ? -7.098  -4.262  1.394   1.00 15.00 ?  309 THR A HG22 13 
ATOM   9543  H HG23 . THR A 1 31 ? -6.454  -5.818  0.867   1.00 15.00 ?  309 THR A HG23 13 
ATOM   9544  N N    . ASP A 1 32 ? -7.087  -1.825  -1.794  1.00 15.00 ?  310 ASP A N    13 
ATOM   9545  C CA   . ASP A 1 32 ? -7.071  -0.394  -1.502  1.00 15.00 ?  310 ASP A CA   13 
ATOM   9546  C C    . ASP A 1 32 ? -8.478  0.089   -1.149  1.00 15.00 ?  310 ASP A C    13 
ATOM   9547  O O    . ASP A 1 32 ? -9.444  -0.240  -1.838  1.00 15.00 ?  310 ASP A O    13 
ATOM   9548  C CB   . ASP A 1 32 ? -6.532  0.383   -2.708  1.00 15.00 ?  310 ASP A CB   13 
ATOM   9549  C CG   . ASP A 1 32 ? -6.278  1.848   -2.396  1.00 15.00 ?  310 ASP A CG   13 
ATOM   9550  O OD1  . ASP A 1 32 ? -7.250  2.617   -2.306  1.00 15.00 ?  310 ASP A OD1  13 
ATOM   9551  O OD2  . ASP A 1 32 ? -5.106  2.236   -2.244  1.00 15.00 -1 310 ASP A OD2  13 
ATOM   9552  H H    . ASP A 1 32 ? -7.413  -2.127  -2.666  1.00 15.00 ?  310 ASP A H    13 
ATOM   9553  H HA   . ASP A 1 32 ? -6.424  -0.234  -0.656  1.00 15.00 ?  310 ASP A HA   13 
ATOM   9554  H HB2  . ASP A 1 32 ? -5.602  -0.062  -3.031  1.00 15.00 ?  310 ASP A HB2  13 
ATOM   9555  H HB3  . ASP A 1 32 ? -7.249  0.325   -3.516  1.00 15.00 ?  310 ASP A HB3  13 
ATOM   9556  N N    . PRO A 1 33 ? -8.616  0.864   -0.061  1.00 15.00 ?  311 PRO A N    13 
ATOM   9557  C CA   . PRO A 1 33 ? -9.914  1.365   0.391   1.00 15.00 ?  311 PRO A CA   13 
ATOM   9558  C C    . PRO A 1 33 ? -10.366 2.641   -0.333  1.00 15.00 ?  311 PRO A C    13 
ATOM   9559  O O    . PRO A 1 33 ? -11.538 3.018   -0.262  1.00 15.00 ?  311 PRO A O    13 
ATOM   9560  C CB   . PRO A 1 33 ? -9.670  1.639   1.873   1.00 15.00 ?  311 PRO A CB   13 
ATOM   9561  C CG   . PRO A 1 33 ? -8.226  2.010   1.958   1.00 15.00 ?  311 PRO A CG   13 
ATOM   9562  C CD   . PRO A 1 33 ? -7.522  1.290   0.831   1.00 15.00 ?  311 PRO A CD   13 
ATOM   9563  H HA   . PRO A 1 33 ? -10.680 0.612   0.288   1.00 15.00 ?  311 PRO A HA   13 
ATOM   9564  H HB2  . PRO A 1 33 ? -10.308 2.447   2.203   1.00 15.00 ?  311 PRO A HB2  13 
ATOM   9565  H HB3  . PRO A 1 33 ? -9.881  0.749   2.446   1.00 15.00 ?  311 PRO A HB3  13 
ATOM   9566  H HG2  . PRO A 1 33 ? -8.118  3.078   1.841   1.00 15.00 ?  311 PRO A HG2  13 
ATOM   9567  H HG3  . PRO A 1 33 ? -7.823  1.696   2.909   1.00 15.00 ?  311 PRO A HG3  13 
ATOM   9568  H HD2  . PRO A 1 33 ? -6.849  1.962   0.319   1.00 15.00 ?  311 PRO A HD2  13 
ATOM   9569  H HD3  . PRO A 1 33 ? -6.983  0.434   1.210   1.00 15.00 ?  311 PRO A HD3  13 
ATOM   9570  N N    . ARG A 1 34 ? -9.444  3.300   -1.025  1.00 15.00 ?  312 ARG A N    13 
ATOM   9571  C CA   . ARG A 1 34 ? -9.752  4.531   -1.747  1.00 15.00 ?  312 ARG A CA   13 
ATOM   9572  C C    . ARG A 1 34 ? -10.062 4.232   -3.204  1.00 15.00 ?  312 ARG A C    13 
ATOM   9573  O O    . ARG A 1 34 ? -10.934 4.856   -3.807  1.00 15.00 ?  312 ARG A O    13 
ATOM   9574  C CB   . ARG A 1 34 ? -8.585  5.519   -1.672  1.00 15.00 ?  312 ARG A CB   13 
ATOM   9575  C CG   . ARG A 1 34 ? -8.573  6.376   -0.422  1.00 15.00 ?  312 ARG A CG   13 
ATOM   9576  C CD   . ARG A 1 34 ? -7.302  7.209   -0.338  1.00 15.00 ?  312 ARG A CD   13 
ATOM   9577  N NE   . ARG A 1 34 ? -6.985  7.875   -1.604  1.00 15.00 ?  312 ARG A NE   13 
ATOM   9578  C CZ   . ARG A 1 34 ? -5.786  8.380   -1.898  1.00 15.00 ?  312 ARG A CZ   13 
ATOM   9579  N NH1  . ARG A 1 34 ? -4.806  8.329   -1.005  1.00 15.00 1  312 ARG A NH1  13 
ATOM   9580  N NH2  . ARG A 1 34 ? -5.570  8.942   -3.083  1.00 15.00 ?  312 ARG A NH2  13 
ATOM   9581  H H    . ARG A 1 34 ? -8.529  2.931   -1.080  1.00 15.00 ?  312 ARG A H    13 
ATOM   9582  H HA   . ARG A 1 34 ? -10.622 4.978   -1.288  1.00 15.00 ?  312 ARG A HA   13 
ATOM   9583  H HB2  . ARG A 1 34 ? -7.659  4.964   -1.705  1.00 15.00 ?  312 ARG A HB2  13 
ATOM   9584  H HB3  . ARG A 1 34 ? -8.630  6.174   -2.530  1.00 15.00 ?  312 ARG A HB3  13 
ATOM   9585  H HG2  . ARG A 1 34 ? -9.427  7.037   -0.440  1.00 15.00 ?  312 ARG A HG2  13 
ATOM   9586  H HG3  . ARG A 1 34 ? -8.631  5.732   0.444   1.00 15.00 ?  312 ARG A HG3  13 
ATOM   9587  H HD2  . ARG A 1 34 ? -7.433  7.962   0.424   1.00 15.00 ?  312 ARG A HD2  13 
ATOM   9588  H HD3  . ARG A 1 34 ? -6.480  6.562   -0.065  1.00 15.00 ?  312 ARG A HD3  13 
ATOM   9589  H HE   . ARG A 1 34 ? -7.710  7.941   -2.273  1.00 15.00 ?  312 ARG A HE   13 
ATOM   9590  H HH11 . ARG A 1 34 ? -4.964  7.909   -0.113  1.00 15.00 ?  312 ARG A HH11 13 
ATOM   9591  H HH12 . ARG A 1 34 ? -3.904  8.723   -1.218  1.00 15.00 ?  312 ARG A HH12 13 
ATOM   9592  H HH21 . ARG A 1 34 ? -6.309  8.993   -3.758  1.00 15.00 ?  312 ARG A HH21 13 
ATOM   9593  H HH22 . ARG A 1 34 ? -4.657  9.309   -3.312  1.00 15.00 ?  312 ARG A HH22 13 
ATOM   9594  N N    . LEU A 1 35 ? -9.323  3.295   -3.761  1.00 15.00 ?  313 LEU A N    13 
ATOM   9595  C CA   . LEU A 1 35 ? -9.499  2.881   -5.137  1.00 15.00 ?  313 LEU A CA   13 
ATOM   9596  C C    . LEU A 1 35 ? -10.621 1.850   -5.217  1.00 15.00 ?  313 LEU A C    13 
ATOM   9597  O O    . LEU A 1 35 ? -11.757 2.242   -5.565  1.00 15.00 ?  313 LEU A O    13 
ATOM   9598  C CB   . LEU A 1 35 ? -8.159  2.334   -5.673  1.00 15.00 ?  313 LEU A CB   13 
ATOM   9599  C CG   . LEU A 1 35 ? -8.113  1.883   -7.142  1.00 15.00 ?  313 LEU A CG   13 
ATOM   9600  C CD1  . LEU A 1 35 ? -8.441  0.403   -7.260  1.00 15.00 ?  313 LEU A CD1  13 
ATOM   9601  C CD2  . LEU A 1 35 ? -9.054  2.714   -8.006  1.00 15.00 ?  313 LEU A CD2  13 
ATOM   9602  H H    . LEU A 1 35 ? -8.616  2.864   -3.219  1.00 15.00 ?  313 LEU A H    13 
ATOM   9603  H HA   . LEU A 1 35 ? -9.783  3.749   -5.712  1.00 15.00 ?  313 LEU A HA   13 
ATOM   9604  H HB2  . LEU A 1 35 ? -7.415  3.104   -5.544  1.00 15.00 ?  313 LEU A HB2  13 
ATOM   9605  H HB3  . LEU A 1 35 ? -7.878  1.490   -5.060  1.00 15.00 ?  313 LEU A HB3  13 
ATOM   9606  H HG   . LEU A 1 35 ? -7.109  2.025   -7.516  1.00 15.00 ?  313 LEU A HG   13 
ATOM   9607  H HD11 . LEU A 1 35 ? -7.760  -0.164  -6.638  1.00 15.00 ?  313 LEU A HD11 13 
ATOM   9608  H HD12 . LEU A 1 35 ? -8.338  0.091   -8.288  1.00 15.00 ?  313 LEU A HD12 13 
ATOM   9609  H HD13 . LEU A 1 35 ? -9.456  0.232   -6.930  1.00 15.00 ?  313 LEU A HD13 13 
ATOM   9610  H HD21 . LEU A 1 35 ? -8.767  3.754   -7.953  1.00 15.00 ?  313 LEU A HD21 13 
ATOM   9611  H HD22 . LEU A 1 35 ? -10.067 2.601   -7.647  1.00 15.00 ?  313 LEU A HD22 13 
ATOM   9612  H HD23 . LEU A 1 35 ? -8.994  2.377   -9.030  1.00 15.00 ?  313 LEU A HD23 13 
ATOM   9613  N N    . ASP B 2 2  ? -0.973  -9.717  -9.756  1.00 15.00 ?  221 ASP B N    13 
ATOM   9614  C CA   . ASP B 2 2  ? 0.298   -9.525  -9.023  1.00 15.00 ?  221 ASP B CA   13 
ATOM   9615  C C    . ASP B 2 2  ? 0.437   -10.541 -7.898  1.00 15.00 ?  221 ASP B C    13 
ATOM   9616  O O    . ASP B 2 2  ? -0.487  -10.750 -7.107  1.00 15.00 ?  221 ASP B O    13 
ATOM   9617  C CB   . ASP B 2 2  ? 0.410   -8.089  -8.494  1.00 15.00 ?  221 ASP B CB   13 
ATOM   9618  C CG   . ASP B 2 2  ? 0.666   -7.118  -9.618  1.00 15.00 ?  221 ASP B CG   13 
ATOM   9619  O OD1  . ASP B 2 2  ? 1.826   -7.035  -10.075 1.00 15.00 ?  221 ASP B OD1  13 
ATOM   9620  O OD2  . ASP B 2 2  ? -0.289  -6.448  -10.060 1.00 15.00 -1 221 ASP B OD2  13 
ATOM   9621  H H    . ASP B 2 2  ? -1.775  -9.742  -9.089  1.00 15.00 ?  221 ASP B H    13 
ATOM   9622  H HA   . ASP B 2 2  ? 1.103   -9.694  -9.723  1.00 15.00 ?  221 ASP B HA   13 
ATOM   9623  H HB2  . ASP B 2 2  ? -0.508  -7.804  -8.001  1.00 15.00 ?  221 ASP B HB2  13 
ATOM   9624  H HB3  . ASP B 2 2  ? 1.227   -8.020  -7.793  1.00 15.00 ?  221 ASP B HB3  13 
ATOM   9625  N N    . THR B 2 3  ? 1.608   -11.165 -7.840  1.00 15.00 ?  222 THR B N    13 
ATOM   9626  C CA   . THR B 2 3  ? 1.901   -12.218 -6.879  1.00 15.00 ?  222 THR B CA   13 
ATOM   9627  C C    . THR B 2 3  ? 1.993   -11.671 -5.445  1.00 15.00 ?  222 THR B C    13 
ATOM   9628  O O    . THR B 2 3  ? 1.910   -10.460 -5.252  1.00 15.00 ?  222 THR B O    13 
ATOM   9629  C CB   . THR B 2 3  ? 3.206   -12.928 -7.291  1.00 15.00 ?  222 THR B CB   13 
ATOM   9630  O OG1  . THR B 2 3  ? 4.136   -11.974 -7.828  1.00 15.00 ?  222 THR B OG1  13 
ATOM   9631  C CG2  . THR B 2 3  ? 2.926   -14.006 -8.326  1.00 15.00 ?  222 THR B CG2  13 
ATOM   9632  H H    . THR B 2 3  ? 2.312   -10.902 -8.465  1.00 15.00 ?  222 THR B H    13 
ATOM   9633  H HA   . THR B 2 3  ? 1.095   -12.936 -6.920  1.00 15.00 ?  222 THR B HA   13 
ATOM   9634  H HB   . THR B 2 3  ? 3.639   -13.392 -6.416  1.00 15.00 ?  222 THR B HB   13 
ATOM   9635  H HG1  . THR B 2 3  ? 4.941   -12.438 -8.106  1.00 15.00 ?  222 THR B HG1  13 
ATOM   9636  H HG21 . THR B 2 3  ? 2.255   -14.741 -7.908  1.00 15.00 ?  222 THR B HG21 13 
ATOM   9637  H HG22 . THR B 2 3  ? 3.852   -14.484 -8.609  1.00 15.00 ?  222 THR B HG22 13 
ATOM   9638  H HG23 . THR B 2 3  ? 2.471   -13.558 -9.198  1.00 15.00 ?  222 THR B HG23 13 
ATOM   9639  N N    . PRO B 2 4  ? 2.178   -12.551 -4.424  1.00 15.00 ?  223 PRO B N    13 
ATOM   9640  C CA   . PRO B 2 4  ? 2.118   -12.163 -3.004  1.00 15.00 ?  223 PRO B CA   13 
ATOM   9641  C C    . PRO B 2 4  ? 2.953   -10.922 -2.677  1.00 15.00 ?  223 PRO B C    13 
ATOM   9642  O O    . PRO B 2 4  ? 4.079   -10.769 -3.160  1.00 15.00 ?  223 PRO B O    13 
ATOM   9643  C CB   . PRO B 2 4  ? 2.679   -13.390 -2.259  1.00 15.00 ?  223 PRO B CB   13 
ATOM   9644  C CG   . PRO B 2 4  ? 3.185   -14.319 -3.314  1.00 15.00 ?  223 PRO B CG   13 
ATOM   9645  C CD   . PRO B 2 4  ? 2.415   -13.995 -4.557  1.00 15.00 ?  223 PRO B CD   13 
ATOM   9646  H HA   . PRO B 2 4  ? 1.099   -11.998 -2.698  1.00 15.00 ?  223 PRO B HA   13 
ATOM   9647  H HB2  . PRO B 2 4  ? 3.474   -13.077 -1.600  1.00 15.00 ?  223 PRO B HB2  13 
ATOM   9648  H HB3  . PRO B 2 4  ? 1.890   -13.848 -1.682  1.00 15.00 ?  223 PRO B HB3  13 
ATOM   9649  H HG2  . PRO B 2 4  ? 4.241   -14.154 -3.472  1.00 15.00 ?  223 PRO B HG2  13 
ATOM   9650  H HG3  . PRO B 2 4  ? 3.006   -15.342 -3.017  1.00 15.00 ?  223 PRO B HG3  13 
ATOM   9651  H HD2  . PRO B 2 4  ? 3.005   -14.212 -5.436  1.00 15.00 ?  223 PRO B HD2  13 
ATOM   9652  H HD3  . PRO B 2 4  ? 1.483   -14.541 -4.580  1.00 15.00 ?  223 PRO B HD3  13 
ATOM   9653  N N    . PRO B 2 5  ? 2.408   -10.040 -1.816  1.00 15.00 ?  224 PRO B N    13 
ATOM   9654  C CA   . PRO B 2 5  ? 2.966   -8.703  -1.566  1.00 15.00 ?  224 PRO B CA   13 
ATOM   9655  C C    . PRO B 2 5  ? 4.360   -8.715  -0.939  1.00 15.00 ?  224 PRO B C    13 
ATOM   9656  O O    . PRO B 2 5  ? 4.680   -9.560  -0.099  1.00 15.00 ?  224 PRO B O    13 
ATOM   9657  C CB   . PRO B 2 5  ? 1.958   -8.072  -0.603  1.00 15.00 ?  224 PRO B CB   13 
ATOM   9658  C CG   . PRO B 2 5  ? 1.280   -9.219  0.052   1.00 15.00 ?  224 PRO B CG   13 
ATOM   9659  C CD   . PRO B 2 5  ? 1.205   -10.287 -0.995  1.00 15.00 ?  224 PRO B CD   13 
ATOM   9660  H HA   . PRO B 2 5  ? 2.998   -8.122  -2.476  1.00 15.00 ?  224 PRO B HA   13 
ATOM   9661  H HB2  . PRO B 2 5  ? 2.481   -7.459  0.118   1.00 15.00 ?  224 PRO B HB2  13 
ATOM   9662  H HB3  . PRO B 2 5  ? 1.258   -7.465  -1.157  1.00 15.00 ?  224 PRO B HB3  13 
ATOM   9663  H HG2  . PRO B 2 5  ? 1.862   -9.557  0.897   1.00 15.00 ?  224 PRO B HG2  13 
ATOM   9664  H HG3  . PRO B 2 5  ? 0.288   -8.931  0.367   1.00 15.00 ?  224 PRO B HG3  13 
ATOM   9665  H HD2  . PRO B 2 5  ? 1.240   -11.264 -0.535  1.00 15.00 ?  224 PRO B HD2  13 
ATOM   9666  H HD3  . PRO B 2 5  ? 0.306   -10.172 -1.582  1.00 15.00 ?  224 PRO B HD3  13 
ATOM   9667  N N    . PRO B 2 6  ? 5.195   -7.747  -1.346  1.00 15.00 ?  225 PRO B N    13 
ATOM   9668  C CA   . PRO B 2 6  ? 6.536   -7.541  -0.790  1.00 15.00 ?  225 PRO B CA   13 
ATOM   9669  C C    . PRO B 2 6  ? 6.481   -6.981  0.629   1.00 15.00 ?  225 PRO B C    13 
ATOM   9670  O O    . PRO B 2 6  ? 5.398   -6.761  1.174   1.00 15.00 ?  225 PRO B O    13 
ATOM   9671  C CB   . PRO B 2 6  ? 7.168   -6.500  -1.730  1.00 15.00 ?  225 PRO B CB   13 
ATOM   9672  C CG   . PRO B 2 6  ? 6.250   -6.393  -2.900  1.00 15.00 ?  225 PRO B CG   13 
ATOM   9673  C CD   . PRO B 2 6  ? 4.892   -6.767  -2.396  1.00 15.00 ?  225 PRO B CD   13 
ATOM   9674  H HA   . PRO B 2 6  ? 7.121   -8.449  -0.801  1.00 15.00 ?  225 PRO B HA   13 
ATOM   9675  H HB2  . PRO B 2 6  ? 7.253   -5.555  -1.214  1.00 15.00 ?  225 PRO B HB2  13 
ATOM   9676  H HB3  . PRO B 2 6  ? 8.145   -6.834  -2.030  1.00 15.00 ?  225 PRO B HB3  13 
ATOM   9677  H HG2  . PRO B 2 6  ? 6.246   -5.379  -3.271  1.00 15.00 ?  225 PRO B HG2  13 
ATOM   9678  H HG3  . PRO B 2 6  ? 6.563   -7.075  -3.673  1.00 15.00 ?  225 PRO B HG3  13 
ATOM   9679  H HD2  . PRO B 2 6  ? 4.387   -5.904  -1.986  1.00 15.00 ?  225 PRO B HD2  13 
ATOM   9680  H HD3  . PRO B 2 6  ? 4.305   -7.216  -3.183  1.00 15.00 ?  225 PRO B HD3  13 
ATOM   9681  N N    . ALA B 2 7  ? 7.646   -6.758  1.223   1.00 15.00 ?  226 ALA B N    13 
ATOM   9682  C CA   . ALA B 2 7  ? 7.729   -6.093  2.516   1.00 15.00 ?  226 ALA B CA   13 
ATOM   9683  C C    . ALA B 2 7  ? 7.303   -4.636  2.374   1.00 15.00 ?  226 ALA B C    13 
ATOM   9684  O O    . ALA B 2 7  ? 7.250   -4.105  1.263   1.00 15.00 ?  226 ALA B O    13 
ATOM   9685  C CB   . ALA B 2 7  ? 9.141   -6.186  3.075   1.00 15.00 ?  226 ALA B CB   13 
ATOM   9686  H H    . ALA B 2 7  ? 8.478   -7.050  0.777   1.00 15.00 ?  226 ALA B H    13 
ATOM   9687  H HA   . ALA B 2 7  ? 7.056   -6.594  3.197   1.00 15.00 ?  226 ALA B HA   13 
ATOM   9688  H HB1  . ALA B 2 7  ? 9.174   -5.725  4.050   1.00 15.00 ?  226 ALA B HB1  13 
ATOM   9689  H HB2  . ALA B 2 7  ? 9.824   -5.675  2.413   1.00 15.00 ?  226 ALA B HB2  13 
ATOM   9690  H HB3  . ALA B 2 7  ? 9.428   -7.224  3.159   1.00 15.00 ?  226 ALA B HB3  13 
ATOM   9691  N N    . TYR B 2 8  ? 7.004   -3.979  3.485   1.00 15.00 ?  227 TYR B N    13 
ATOM   9692  C CA   . TYR B 2 8  ? 6.497   -2.622  3.417   1.00 15.00 ?  227 TYR B CA   13 
ATOM   9693  C C    . TYR B 2 8  ? 7.631   -1.600  3.455   1.00 15.00 ?  227 TYR B C    13 
ATOM   9694  O O    . TYR B 2 8  ? 8.502   -1.623  4.330   1.00 15.00 ?  227 TYR B O    13 
ATOM   9695  C CB   . TYR B 2 8  ? 5.478   -2.341  4.534   1.00 15.00 ?  227 TYR B CB   13 
ATOM   9696  C CG   . TYR B 2 8  ? 6.085   -1.908  5.851   1.00 15.00 ?  227 TYR B CG   13 
ATOM   9697  C CD1  . TYR B 2 8  ? 6.500   -2.825  6.808   1.00 15.00 ?  227 TYR B CD1  13 
ATOM   9698  C CD2  . TYR B 2 8  ? 6.254   -0.561  6.122   1.00 15.00 ?  227 TYR B CD2  13 
ATOM   9699  C CE1  . TYR B 2 8  ? 7.070   -2.399  7.996   1.00 15.00 ?  227 TYR B CE1  13 
ATOM   9700  C CE2  . TYR B 2 8  ? 6.816   -0.126  7.297   1.00 15.00 ?  227 TYR B CE2  13 
ATOM   9701  C CZ   . TYR B 2 8  ? 7.227   -1.048  8.235   1.00 15.00 ?  227 TYR B CZ   13 
ATOM   9702  O OH   . TYR B 2 8  ? 7.799   -0.625  9.410   1.00 15.00 ?  227 TYR B OH   13 
ATOM   9703  H H    . TYR B 2 8  ? 7.128   -4.410  4.354   1.00 15.00 ?  227 TYR B H    13 
ATOM   9704  H HA   . TYR B 2 8  ? 5.993   -2.521  2.468   1.00 15.00 ?  227 TYR B HA   13 
ATOM   9705  H HB2  . TYR B 2 8  ? 4.820   -1.548  4.204   1.00 15.00 ?  227 TYR B HB2  13 
ATOM   9706  H HB3  . TYR B 2 8  ? 4.896   -3.230  4.707   1.00 15.00 ?  227 TYR B HB3  13 
ATOM   9707  H HD1  . TYR B 2 8  ? 6.376   -3.880  6.614   1.00 15.00 ?  227 TYR B HD1  13 
ATOM   9708  H HD2  . TYR B 2 8  ? 5.930   0.163   5.392   1.00 15.00 ?  227 TYR B HD2  13 
ATOM   9709  H HE1  . TYR B 2 8  ? 7.387   -3.124  8.736   1.00 15.00 ?  227 TYR B HE1  13 
ATOM   9710  H HE2  . TYR B 2 8  ? 6.934   0.946   7.464   1.00 15.00 ?  227 TYR B HE2  13 
ATOM   9711  H HH   . TYR B 2 8  ? 8.643   -1.095  9.536   1.00 15.00 ?  227 TYR B HH   13 
ATOM   9712  N N    . LEU B 2 9  ? 7.616   -0.722  2.473   1.00 15.00 ?  228 LEU B N    13 
ATOM   9713  C CA   . LEU B 2 9  ? 8.500   0.431   2.429   1.00 15.00 ?  228 LEU B CA   13 
ATOM   9714  C C    . LEU B 2 9  ? 7.643   1.655   2.153   1.00 15.00 ?  228 LEU B C    13 
ATOM   9715  O O    . LEU B 2 9  ? 6.580   1.517   1.575   1.00 15.00 ?  228 LEU B O    13 
ATOM   9716  C CB   . LEU B 2 9  ? 9.576   0.278   1.335   1.00 15.00 ?  228 LEU B CB   13 
ATOM   9717  C CG   . LEU B 2 9  ? 10.574  -0.876  1.508   1.00 15.00 ?  228 LEU B CG   13 
ATOM   9718  C CD1  . LEU B 2 9  ? 9.975   -2.198  1.046   1.00 15.00 ?  228 LEU B CD1  13 
ATOM   9719  C CD2  . LEU B 2 9  ? 11.853  -0.582  0.743   1.00 15.00 ?  228 LEU B CD2  13 
ATOM   9720  H H    . LEU B 2 9  ? 6.975   -0.850  1.744   1.00 15.00 ?  228 LEU B H    13 
ATOM   9721  H HA   . LEU B 2 9  ? 8.961   0.537   3.402   1.00 15.00 ?  228 LEU B HA   13 
ATOM   9722  H HB2  . LEU B 2 9  ? 9.073   0.143   0.388   1.00 15.00 ?  228 LEU B HB2  13 
ATOM   9723  H HB3  . LEU B 2 9  ? 10.136  1.200   1.290   1.00 15.00 ?  228 LEU B HB3  13 
ATOM   9724  H HG   . LEU B 2 9  ? 10.824  -0.971  2.553   1.00 15.00 ?  228 LEU B HG   13 
ATOM   9725  H HD11 . LEU B 2 9  ? 9.093   -2.419  1.630   1.00 15.00 ?  228 LEU B HD11 13 
ATOM   9726  H HD12 . LEU B 2 9  ? 10.700  -2.987  1.177   1.00 15.00 ?  228 LEU B HD12 13 
ATOM   9727  H HD13 . LEU B 2 9  ? 9.708   -2.127  0.002   1.00 15.00 ?  228 LEU B HD13 13 
ATOM   9728  H HD21 . LEU B 2 9  ? 11.628  -0.464  -0.306  1.00 15.00 ?  228 LEU B HD21 13 
ATOM   9729  H HD22 . LEU B 2 9  ? 12.546  -1.401  0.873   1.00 15.00 ?  228 LEU B HD22 13 
ATOM   9730  H HD23 . LEU B 2 9  ? 12.297  0.328   1.119   1.00 15.00 ?  228 LEU B HD23 13 
ATOM   9731  N N    . PRO B 2 10 ? 8.109   2.875   2.444   1.00 15.00 ?  229 PRO B N    13 
ATOM   9732  C CA   . PRO B 2 10 ? 7.232   4.045   2.402   1.00 15.00 ?  229 PRO B CA   13 
ATOM   9733  C C    . PRO B 2 10 ? 7.167   4.677   1.015   1.00 15.00 ?  229 PRO B C    13 
ATOM   9734  O O    . PRO B 2 10 ? 8.083   4.540   0.204   1.00 15.00 ?  229 PRO B O    13 
ATOM   9735  C CB   . PRO B 2 10 ? 7.916   5.031   3.367   1.00 15.00 ?  229 PRO B CB   13 
ATOM   9736  C CG   . PRO B 2 10 ? 9.062   4.296   3.983   1.00 15.00 ?  229 PRO B CG   13 
ATOM   9737  C CD   . PRO B 2 10 ? 9.401   3.176   3.047   1.00 15.00 ?  229 PRO B CD   13 
ATOM   9738  H HA   . PRO B 2 10 ? 6.244   3.807   2.753   1.00 15.00 ?  229 PRO B HA   13 
ATOM   9739  H HB2  . PRO B 2 10 ? 8.259   5.893   2.814   1.00 15.00 ?  229 PRO B HB2  13 
ATOM   9740  H HB3  . PRO B 2 10 ? 7.205   5.347   4.118   1.00 15.00 ?  229 PRO B HB3  13 
ATOM   9741  H HG2  . PRO B 2 10 ? 9.903   4.958   4.091   1.00 15.00 ?  229 PRO B HG2  13 
ATOM   9742  H HG3  . PRO B 2 10 ? 8.769   3.903   4.945   1.00 15.00 ?  229 PRO B HG3  13 
ATOM   9743  H HD2  . PRO B 2 10 ? 10.114  3.489   2.316   1.00 15.00 ?  229 PRO B HD2  13 
ATOM   9744  H HD3  . PRO B 2 10 ? 9.767   2.327   3.602   1.00 15.00 ?  229 PRO B HD3  13 
ATOM   9745  N N    . PRO B 2 11 ? 6.077   5.425   0.754   1.00 15.00 ?  230 PRO B N    13 
ATOM   9746  C CA   . PRO B 2 11 ? 5.482   5.503   -0.576  1.00 15.00 ?  230 PRO B CA   13 
ATOM   9747  C C    . PRO B 2 11 ? 6.011   6.594   -1.495  1.00 15.00 ?  230 PRO B C    13 
ATOM   9748  O O    . PRO B 2 11 ? 6.382   7.690   -1.069  1.00 15.00 ?  230 PRO B O    13 
ATOM   9749  C CB   . PRO B 2 11 ? 4.028   5.790   -0.225  1.00 15.00 ?  230 PRO B CB   13 
ATOM   9750  C CG   . PRO B 2 11 ? 4.097   6.680   0.966   1.00 15.00 ?  230 PRO B CG   13 
ATOM   9751  C CD   . PRO B 2 11 ? 5.333   6.274   1.723   1.00 15.00 ?  230 PRO B CD   13 
ATOM   9752  H HA   . PRO B 2 11 ? 5.535   4.555   -1.086  1.00 15.00 ?  230 PRO B HA   13 
ATOM   9753  H HB2  . PRO B 2 11 ? 3.545   6.280   -1.053  1.00 15.00 ?  230 PRO B HB2  13 
ATOM   9754  H HB3  . PRO B 2 11 ? 3.520   4.865   0.002   1.00 15.00 ?  230 PRO B HB3  13 
ATOM   9755  H HG2  . PRO B 2 11 ? 4.172   7.711   0.651   1.00 15.00 ?  230 PRO B HG2  13 
ATOM   9756  H HG3  . PRO B 2 11 ? 3.219   6.538   1.579   1.00 15.00 ?  230 PRO B HG3  13 
ATOM   9757  H HD2  . PRO B 2 11 ? 5.906   7.146   1.997   1.00 15.00 ?  230 PRO B HD2  13 
ATOM   9758  H HD3  . PRO B 2 11 ? 5.059   5.716   2.601   1.00 15.00 ?  230 PRO B HD3  13 
ATOM   9759  N N    . GLU B 2 12 ? 6.027   6.251   -2.776  1.00 15.00 ?  231 GLU B N    13 
ATOM   9760  C CA   . GLU B 2 12 ? 6.266   7.192   -3.850  1.00 15.00 ?  231 GLU B CA   13 
ATOM   9761  C C    . GLU B 2 12 ? 4.944   7.410   -4.602  1.00 15.00 ?  231 GLU B C    13 
ATOM   9762  O O    . GLU B 2 12 ? 4.339   6.444   -5.064  1.00 15.00 ?  231 GLU B O    13 
ATOM   9763  C CB   . GLU B 2 12 ? 7.348   6.649   -4.795  1.00 15.00 ?  231 GLU B CB   13 
ATOM   9764  C CG   . GLU B 2 12 ? 7.118   5.210   -5.251  1.00 15.00 ?  231 GLU B CG   13 
ATOM   9765  C CD   . GLU B 2 12 ? 8.256   4.678   -6.097  1.00 15.00 ?  231 GLU B CD   13 
ATOM   9766  O OE1  . GLU B 2 12 ? 9.234   4.166   -5.516  1.00 15.00 -1 231 GLU B OE1  13 
ATOM   9767  O OE2  . GLU B 2 12 ? 8.178   4.763   -7.339  1.00 15.00 ?  231 GLU B OE2  13 
ATOM   9768  H H    . GLU B 2 12 ? 5.855   5.319   -3.011  1.00 15.00 ?  231 GLU B H    13 
ATOM   9769  H HA   . GLU B 2 12 ? 6.606   8.118   -3.409  1.00 15.00 ?  231 GLU B HA   13 
ATOM   9770  H HB2  . GLU B 2 12 ? 7.387   7.277   -5.673  1.00 15.00 ?  231 GLU B HB2  13 
ATOM   9771  H HB3  . GLU B 2 12 ? 8.302   6.696   -4.291  1.00 15.00 ?  231 GLU B HB3  13 
ATOM   9772  H HG2  . GLU B 2 12 ? 7.018   4.579   -4.380  1.00 15.00 ?  231 GLU B HG2  13 
ATOM   9773  H HG3  . GLU B 2 12 ? 6.207   5.166   -5.831  1.00 15.00 ?  231 GLU B HG3  13 
ATOM   9774  N N    . ASP B 2 13 ? 4.469   8.651   -4.697  1.00 15.00 ?  232 ASP B N    13 
ATOM   9775  C CA   . ASP B 2 13 ? 3.173   8.915   -5.314  1.00 15.00 ?  232 ASP B CA   13 
ATOM   9776  C C    . ASP B 2 13 ? 3.159   10.292  -5.963  1.00 15.00 ?  232 ASP B C    13 
ATOM   9777  O O    . ASP B 2 13 ? 3.526   11.287  -5.331  1.00 15.00 ?  232 ASP B O    13 
ATOM   9778  C CB   . ASP B 2 13 ? 2.054   8.795   -4.270  1.00 15.00 ?  232 ASP B CB   13 
ATOM   9779  C CG   . ASP B 2 13 ? 0.693   9.199   -4.812  1.00 15.00 ?  232 ASP B CG   13 
ATOM   9780  O OD1  . ASP B 2 13 ? 0.173   8.506   -5.713  1.00 15.00 -1 232 ASP B OD1  13 
ATOM   9781  O OD2  . ASP B 2 13 ? 0.138   10.216  -4.341  1.00 15.00 ?  232 ASP B OD2  13 
ATOM   9782  H H    . ASP B 2 13 ? 4.996   9.409   -4.369  1.00 15.00 ?  232 ASP B H    13 
ATOM   9783  H HA   . ASP B 2 13 ? 3.017   8.170   -6.080  1.00 15.00 ?  232 ASP B HA   13 
ATOM   9784  H HB2  . ASP B 2 13 ? 1.996   7.766   -3.937  1.00 15.00 ?  232 ASP B HB2  13 
ATOM   9785  H HB3  . ASP B 2 13 ? 2.289   9.427   -3.427  1.00 15.00 ?  232 ASP B HB3  13 
ATOM   9786  N N    . PRO B 2 14 ? 2.755   10.357  -7.244  1.00 15.00 ?  233 PRO B N    13 
ATOM   9787  C CA   . PRO B 2 14 ? 2.659   11.613  -7.998  1.00 15.00 ?  233 PRO B CA   13 
ATOM   9788  C C    . PRO B 2 14 ? 1.730   12.621  -7.330  1.00 15.00 ?  233 PRO B C    13 
ATOM   9789  O O    . PRO B 2 14 ? 2.180   13.617  -6.763  1.00 15.00 ?  233 PRO B O    13 
ATOM   9790  C CB   . PRO B 2 14 ? 2.093   11.182  -9.355  1.00 15.00 ?  233 PRO B CB   13 
ATOM   9791  C CG   . PRO B 2 14 ? 2.414   9.733   -9.466  1.00 15.00 ?  233 PRO B CG   13 
ATOM   9792  C CD   . PRO B 2 14 ? 2.371   9.195   -8.065  1.00 15.00 ?  233 PRO B CD   13 
ATOM   9793  H HA   . PRO B 2 14 ? 3.631   12.062  -8.135  1.00 15.00 ?  233 PRO B HA   13 
ATOM   9794  H HB2  . PRO B 2 14 ? 1.026   11.352  -9.371  1.00 15.00 ?  233 PRO B HB2  13 
ATOM   9795  H HB3  . PRO B 2 14 ? 2.564   11.751  -10.143 1.00 15.00 ?  233 PRO B HB3  13 
ATOM   9796  H HG2  . PRO B 2 14 ? 1.676   9.240   -10.082 1.00 15.00 ?  233 PRO B HG2  13 
ATOM   9797  H HG3  . PRO B 2 14 ? 3.401   9.607   -9.887  1.00 15.00 ?  233 PRO B HG3  13 
ATOM   9798  H HD2  . PRO B 2 14 ? 1.373   8.863   -7.820  1.00 15.00 ?  233 PRO B HD2  13 
ATOM   9799  H HD3  . PRO B 2 14 ? 3.079   8.388   -7.950  1.00 15.00 ?  233 PRO B HD3  13 
HETATM 9800  N N    . NH2 B 2 15 ? 0.431   12.367  -7.407  1.00 15.00 ?  234 NH2 B N    13 
HETATM 9801  H HN1  . NH2 B 2 15 ? 0.145   11.553  -7.876  1.00 15.00 ?  234 NH2 B HN1  13 
HETATM 9802  H HN2  . NH2 B 2 15 ? -0.191  13.001  -6.991  1.00 15.00 ?  234 NH2 B HN2  13 
ATOM   9803  N N    . LEU A 1 1  ? -16.554 5.354   -3.268  1.00 15.00 ?  279 LEU A N    14 
ATOM   9804  C CA   . LEU A 1 1  ? -16.362 5.485   -1.807  1.00 15.00 ?  279 LEU A CA   14 
ATOM   9805  C C    . LEU A 1 1  ? -15.011 4.910   -1.411  1.00 15.00 ?  279 LEU A C    14 
ATOM   9806  O O    . LEU A 1 1  ? -14.660 3.800   -1.811  1.00 15.00 ?  279 LEU A O    14 
ATOM   9807  C CB   . LEU A 1 1  ? -17.490 4.776   -1.029  1.00 15.00 ?  279 LEU A CB   14 
ATOM   9808  C CG   . LEU A 1 1  ? -17.560 3.245   -1.155  1.00 15.00 ?  279 LEU A CG   14 
ATOM   9809  C CD1  . LEU A 1 1  ? -18.414 2.664   -0.038  1.00 15.00 ?  279 LEU A CD1  14 
ATOM   9810  C CD2  . LEU A 1 1  ? -18.125 2.826   -2.505  1.00 15.00 ?  279 LEU A CD2  14 
ATOM   9811  H H1   . LEU A 1 1  ? -15.805 5.879   -3.773  1.00 15.00 ?  279 LEU A H1   14 
ATOM   9812  H H2   . LEU A 1 1  ? -17.480 5.739   -3.548  1.00 15.00 ?  279 LEU A H2   14 
ATOM   9813  H H3   . LEU A 1 1  ? -16.504 4.354   -3.549  1.00 15.00 ?  279 LEU A H3   14 
ATOM   9814  H HA   . LEU A 1 1  ? -16.374 6.537   -1.562  1.00 15.00 ?  279 LEU A HA   14 
ATOM   9815  H HB2  . LEU A 1 1  ? -17.375 5.019   0.016   1.00 15.00 ?  279 LEU A HB2  14 
ATOM   9816  H HB3  . LEU A 1 1  ? -18.432 5.181   -1.368  1.00 15.00 ?  279 LEU A HB3  14 
ATOM   9817  H HG   . LEU A 1 1  ? -16.564 2.834   -1.064  1.00 15.00 ?  279 LEU A HG   14 
ATOM   9818  H HD11 . LEU A 1 1  ? -19.415 3.063   -0.105  1.00 15.00 ?  279 LEU A HD11 14 
ATOM   9819  H HD12 . LEU A 1 1  ? -17.985 2.927   0.916   1.00 15.00 ?  279 LEU A HD12 14 
ATOM   9820  H HD13 . LEU A 1 1  ? -18.448 1.588   -0.134  1.00 15.00 ?  279 LEU A HD13 14 
ATOM   9821  H HD21 . LEU A 1 1  ? -17.486 3.199   -3.293  1.00 15.00 ?  279 LEU A HD21 14 
ATOM   9822  H HD22 . LEU A 1 1  ? -19.118 3.235   -2.623  1.00 15.00 ?  279 LEU A HD22 14 
ATOM   9823  H HD23 . LEU A 1 1  ? -18.170 1.748   -2.559  1.00 15.00 ?  279 LEU A HD23 14 
ATOM   9824  N N    . GLY A 1 2  ? -14.255 5.663   -0.626  1.00 15.00 ?  280 GLY A N    14 
ATOM   9825  C CA   . GLY A 1 2  ? -12.942 5.209   -0.223  1.00 15.00 ?  280 GLY A CA   14 
ATOM   9826  C C    . GLY A 1 2  ? -12.407 5.936   0.993   1.00 15.00 ?  280 GLY A C    14 
ATOM   9827  O O    . GLY A 1 2  ? -11.858 7.032   0.872   1.00 15.00 ?  280 GLY A O    14 
ATOM   9828  H H    . GLY A 1 2  ? -14.592 6.536   -0.315  1.00 15.00 ?  280 GLY A H    14 
ATOM   9829  H HA2  . GLY A 1 2  ? -12.994 4.153   -0.002  1.00 15.00 ?  280 GLY A HA2  14 
ATOM   9830  H HA3  . GLY A 1 2  ? -12.258 5.357   -1.046  1.00 15.00 ?  280 GLY A HA3  14 
ATOM   9831  N N    . PRO A 1 3  ? -12.557 5.350   2.187   1.00 15.00 ?  281 PRO A N    14 
ATOM   9832  C CA   . PRO A 1 3  ? -12.021 5.911   3.414   1.00 15.00 ?  281 PRO A CA   14 
ATOM   9833  C C    . PRO A 1 3  ? -10.609 5.403   3.714   1.00 15.00 ?  281 PRO A C    14 
ATOM   9834  O O    . PRO A 1 3  ? -10.400 4.212   3.949   1.00 15.00 ?  281 PRO A O    14 
ATOM   9835  C CB   . PRO A 1 3  ? -13.012 5.419   4.469   1.00 15.00 ?  281 PRO A CB   14 
ATOM   9836  C CG   . PRO A 1 3  ? -13.588 4.146   3.923   1.00 15.00 ?  281 PRO A CG   14 
ATOM   9837  C CD   . PRO A 1 3  ? -13.281 4.096   2.443   1.00 15.00 ?  281 PRO A CD   14 
ATOM   9838  H HA   . PRO A 1 3  ? -12.021 6.990   3.390   1.00 15.00 ?  281 PRO A HA   14 
ATOM   9839  H HB2  . PRO A 1 3  ? -12.490 5.247   5.399   1.00 15.00 ?  281 PRO A HB2  14 
ATOM   9840  H HB3  . PRO A 1 3  ? -13.780 6.165   4.618   1.00 15.00 ?  281 PRO A HB3  14 
ATOM   9841  H HG2  . PRO A 1 3  ? -13.135 3.302   4.420   1.00 15.00 ?  281 PRO A HG2  14 
ATOM   9842  H HG3  . PRO A 1 3  ? -14.657 4.136   4.080   1.00 15.00 ?  281 PRO A HG3  14 
ATOM   9843  H HD2  . PRO A 1 3  ? -12.661 3.242   2.217   1.00 15.00 ?  281 PRO A HD2  14 
ATOM   9844  H HD3  . PRO A 1 3  ? -14.196 4.060   1.871   1.00 15.00 ?  281 PRO A HD3  14 
ATOM   9845  N N    . LEU A 1 4  ? -9.637  6.303   3.680   1.00 15.00 ?  282 LEU A N    14 
ATOM   9846  C CA   . LEU A 1 4  ? -8.256  5.933   3.956   1.00 15.00 ?  282 LEU A CA   14 
ATOM   9847  C C    . LEU A 1 4  ? -7.897  6.266   5.399   1.00 15.00 ?  282 LEU A C    14 
ATOM   9848  O O    . LEU A 1 4  ? -7.911  7.431   5.798   1.00 15.00 ?  282 LEU A O    14 
ATOM   9849  C CB   . LEU A 1 4  ? -7.298  6.653   3.004   1.00 15.00 ?  282 LEU A CB   14 
ATOM   9850  C CG   . LEU A 1 4  ? -5.840  6.188   3.079   1.00 15.00 ?  282 LEU A CG   14 
ATOM   9851  C CD1  . LEU A 1 4  ? -5.711  4.759   2.577   1.00 15.00 ?  282 LEU A CD1  14 
ATOM   9852  C CD2  . LEU A 1 4  ? -4.936  7.120   2.286   1.00 15.00 ?  282 LEU A CD2  14 
ATOM   9853  H H    . LEU A 1 4  ? -9.852  7.234   3.465   1.00 15.00 ?  282 LEU A H    14 
ATOM   9854  H HA   . LEU A 1 4  ? -8.163  4.869   3.811   1.00 15.00 ?  282 LEU A HA   14 
ATOM   9855  H HB2  . LEU A 1 4  ? -7.649  6.505   1.993   1.00 15.00 ?  282 LEU A HB2  14 
ATOM   9856  H HB3  . LEU A 1 4  ? -7.328  7.708   3.228   1.00 15.00 ?  282 LEU A HB3  14 
ATOM   9857  H HG   . LEU A 1 4  ? -5.518  6.207   4.110   1.00 15.00 ?  282 LEU A HG   14 
ATOM   9858  H HD11 . LEU A 1 4  ? -6.047  4.706   1.551   1.00 15.00 ?  282 LEU A HD11 14 
ATOM   9859  H HD12 . LEU A 1 4  ? -6.315  4.104   3.189   1.00 15.00 ?  282 LEU A HD12 14 
ATOM   9860  H HD13 . LEU A 1 4  ? -4.677  4.449   2.634   1.00 15.00 ?  282 LEU A HD13 14 
ATOM   9861  H HD21 . LEU A 1 4  ? -3.926  6.736   2.299   1.00 15.00 ?  282 LEU A HD21 14 
ATOM   9862  H HD22 . LEU A 1 4  ? -4.952  8.103   2.731   1.00 15.00 ?  282 LEU A HD22 14 
ATOM   9863  H HD23 . LEU A 1 4  ? -5.286  7.181   1.266   1.00 15.00 ?  282 LEU A HD23 14 
ATOM   9864  N N    . PRO A 1 5  ? -7.591  5.243   6.203   1.00 15.00 ?  283 PRO A N    14 
ATOM   9865  C CA   . PRO A 1 5  ? -7.206  5.423   7.605   1.00 15.00 ?  283 PRO A CA   14 
ATOM   9866  C C    . PRO A 1 5  ? -5.841  6.095   7.743   1.00 15.00 ?  283 PRO A C    14 
ATOM   9867  O O    . PRO A 1 5  ? -4.883  5.713   7.066   1.00 15.00 ?  283 PRO A O    14 
ATOM   9868  C CB   . PRO A 1 5  ? -7.150  3.988   8.157   1.00 15.00 ?  283 PRO A CB   14 
ATOM   9869  C CG   . PRO A 1 5  ? -7.822  3.137   7.131   1.00 15.00 ?  283 PRO A CG   14 
ATOM   9870  C CD   . PRO A 1 5  ? -7.598  3.826   5.821   1.00 15.00 ?  283 PRO A CD   14 
ATOM   9871  H HA   . PRO A 1 5  ? -7.946  5.993   8.146   1.00 15.00 ?  283 PRO A HA   14 
ATOM   9872  H HB2  . PRO A 1 5  ? -6.119  3.697   8.294   1.00 15.00 ?  283 PRO A HB2  14 
ATOM   9873  H HB3  . PRO A 1 5  ? -7.669  3.945   9.104   1.00 15.00 ?  283 PRO A HB3  14 
ATOM   9874  H HG2  . PRO A 1 5  ? -7.378  2.153   7.120   1.00 15.00 ?  283 PRO A HG2  14 
ATOM   9875  H HG3  . PRO A 1 5  ? -8.878  3.071   7.345   1.00 15.00 ?  283 PRO A HG3  14 
ATOM   9876  H HD2  . PRO A 1 5  ? -6.648  3.532   5.395   1.00 15.00 ?  283 PRO A HD2  14 
ATOM   9877  H HD3  . PRO A 1 5  ? -8.405  3.614   5.136   1.00 15.00 ?  283 PRO A HD3  14 
ATOM   9878  N N    . PRO A 1 6  ? -5.733  7.105   8.622   1.00 15.00 ?  284 PRO A N    14 
ATOM   9879  C CA   . PRO A 1 6  ? -4.466  7.792   8.887   1.00 15.00 ?  284 PRO A CA   14 
ATOM   9880  C C    . PRO A 1 6  ? -3.393  6.824   9.375   1.00 15.00 ?  284 PRO A C    14 
ATOM   9881  O O    . PRO A 1 6  ? -3.579  6.124   10.370  1.00 15.00 ?  284 PRO A O    14 
ATOM   9882  C CB   . PRO A 1 6  ? -4.817  8.811   9.982   1.00 15.00 ?  284 PRO A CB   14 
ATOM   9883  C CG   . PRO A 1 6  ? -6.114  8.347   10.551  1.00 15.00 ?  284 PRO A CG   14 
ATOM   9884  C CD   . PRO A 1 6  ? -6.832  7.659   9.426   1.00 15.00 ?  284 PRO A CD   14 
ATOM   9885  H HA   . PRO A 1 6  ? -4.105  8.309   8.010   1.00 15.00 ?  284 PRO A HA   14 
ATOM   9886  H HB2  . PRO A 1 6  ? -4.039  8.818   10.732  1.00 15.00 ?  284 PRO A HB2  14 
ATOM   9887  H HB3  . PRO A 1 6  ? -4.909  9.793   9.546   1.00 15.00 ?  284 PRO A HB3  14 
ATOM   9888  H HG2  . PRO A 1 6  ? -5.935  7.655   11.361  1.00 15.00 ?  284 PRO A HG2  14 
ATOM   9889  H HG3  . PRO A 1 6  ? -6.688  9.194   10.900  1.00 15.00 ?  284 PRO A HG3  14 
ATOM   9890  H HD2  . PRO A 1 6  ? -7.468  6.873   9.805   1.00 15.00 ?  284 PRO A HD2  14 
ATOM   9891  H HD3  . PRO A 1 6  ? -7.409  8.372   8.854   1.00 15.00 ?  284 PRO A HD3  14 
ATOM   9892  N N    . GLY A 1 7  ? -2.276  6.786   8.667   1.00 15.00 ?  285 GLY A N    14 
ATOM   9893  C CA   . GLY A 1 7  ? -1.224  5.842   8.990   1.00 15.00 ?  285 GLY A CA   14 
ATOM   9894  C C    . GLY A 1 7  ? -0.955  4.886   7.849   1.00 15.00 ?  285 GLY A C    14 
ATOM   9895  O O    . GLY A 1 7  ? -0.032  4.072   7.910   1.00 15.00 ?  285 GLY A O    14 
ATOM   9896  H H    . GLY A 1 7  ? -2.157  7.415   7.919   1.00 15.00 ?  285 GLY A H    14 
ATOM   9897  H HA2  . GLY A 1 7  ? -0.321  6.390   9.213   1.00 15.00 ?  285 GLY A HA2  14 
ATOM   9898  H HA3  . GLY A 1 7  ? -1.516  5.274   9.861   1.00 15.00 ?  285 GLY A HA3  14 
ATOM   9899  N N    . TRP A 1 8  ? -1.779  4.979   6.816   1.00 15.00 ?  286 TRP A N    14 
ATOM   9900  C CA   . TRP A 1 8  ? -1.617  4.169   5.619   1.00 15.00 ?  286 TRP A CA   14 
ATOM   9901  C C    . TRP A 1 8  ? -0.737  4.874   4.608   1.00 15.00 ?  286 TRP A C    14 
ATOM   9902  O O    . TRP A 1 8  ? -1.107  5.918   4.065   1.00 15.00 ?  286 TRP A O    14 
ATOM   9903  C CB   . TRP A 1 8  ? -2.987  3.876   4.982   1.00 15.00 ?  286 TRP A CB   14 
ATOM   9904  C CG   . TRP A 1 8  ? -3.715  2.725   5.602   1.00 15.00 ?  286 TRP A CG   14 
ATOM   9905  C CD1  . TRP A 1 8  ? -3.889  2.483   6.935   1.00 15.00 ?  286 TRP A CD1  14 
ATOM   9906  C CD2  . TRP A 1 8  ? -4.358  1.647   4.908   1.00 15.00 ?  286 TRP A CD2  14 
ATOM   9907  N NE1  . TRP A 1 8  ? -4.582  1.314   7.114   1.00 15.00 ?  286 TRP A NE1  14 
ATOM   9908  C CE2  . TRP A 1 8  ? -4.879  0.779   5.888   1.00 15.00 ?  286 TRP A CE2  14 
ATOM   9909  C CE3  . TRP A 1 8  ? -4.542  1.321   3.552   1.00 15.00 ?  286 TRP A CE3  14 
ATOM   9910  C CZ2  . TRP A 1 8  ? -5.560  -0.392  5.561   1.00 15.00 ?  286 TRP A CZ2  14 
ATOM   9911  C CZ3  . TRP A 1 8  ? -5.208  0.155   3.239   1.00 15.00 ?  286 TRP A CZ3  14 
ATOM   9912  C CH2  . TRP A 1 8  ? -5.706  -0.691  4.235   1.00 15.00 ?  286 TRP A CH2  14 
ATOM   9913  H H    . TRP A 1 8  ? -2.525  5.611   6.861   1.00 15.00 ?  286 TRP A H    14 
ATOM   9914  H HA   . TRP A 1 8  ? -1.133  3.234   5.902   1.00 15.00 ?  286 TRP A HA   14 
ATOM   9915  H HB2  . TRP A 1 8  ? -3.613  4.751   5.074   1.00 15.00 ?  286 TRP A HB2  14 
ATOM   9916  H HB3  . TRP A 1 8  ? -2.845  3.653   3.935   1.00 15.00 ?  286 TRP A HB3  14 
ATOM   9917  H HD1  . TRP A 1 8  ? -3.521  3.125   7.721   1.00 15.00 ?  286 TRP A HD1  14 
ATOM   9918  H HE1  . TRP A 1 8  ? -4.824  0.922   7.981   1.00 15.00 ?  286 TRP A HE1  14 
ATOM   9919  H HE3  . TRP A 1 8  ? -4.175  1.982   2.722   1.00 15.00 ?  286 TRP A HE3  14 
ATOM   9920  H HZ2  . TRP A 1 8  ? -5.951  -1.057  6.318   1.00 15.00 ?  286 TRP A HZ2  14 
ATOM   9921  H HZ3  . TRP A 1 8  ? -5.311  -0.133  2.199   1.00 15.00 ?  286 TRP A HZ3  14 
ATOM   9922  H HH2  . TRP A 1 8  ? -6.221  -1.594  3.936   1.00 15.00 ?  286 TRP A HH2  14 
ATOM   9923  N N    . GLU A 1 9  ? 0.430   4.307   4.371   1.00 15.00 ?  287 GLU A N    14 
ATOM   9924  C CA   . GLU A 1 9  ? 1.297   4.781   3.321   1.00 15.00 ?  287 GLU A CA   14 
ATOM   9925  C C    . GLU A 1 9  ? 0.990   3.991   2.060   1.00 15.00 ?  287 GLU A C    14 
ATOM   9926  O O    . GLU A 1 9  ? 1.070   2.764   2.060   1.00 15.00 ?  287 GLU A O    14 
ATOM   9927  C CB   . GLU A 1 9  ? 2.764   4.612   3.740   1.00 15.00 ?  287 GLU A CB   14 
ATOM   9928  C CG   . GLU A 1 9  ? 3.302   5.753   4.595   1.00 15.00 ?  287 GLU A CG   14 
ATOM   9929  C CD   . GLU A 1 9  ? 2.592   5.896   5.931   1.00 15.00 ?  287 GLU A CD   14 
ATOM   9930  O OE1  . GLU A 1 9  ? 2.857   5.073   6.836   1.00 15.00 -1 287 GLU A OE1  14 
ATOM   9931  O OE2  . GLU A 1 9  ? 1.784   6.837   6.085   1.00 15.00 ?  287 GLU A OE2  14 
ATOM   9932  H H    . GLU A 1 9  ? 0.715   3.536   4.914   1.00 15.00 ?  287 GLU A H    14 
ATOM   9933  H HA   . GLU A 1 9  ? 1.088   5.826   3.150   1.00 15.00 ?  287 GLU A HA   14 
ATOM   9934  H HB2  . GLU A 1 9  ? 2.851   3.700   4.314   1.00 15.00 ?  287 GLU A HB2  14 
ATOM   9935  H HB3  . GLU A 1 9  ? 3.383   4.525   2.860   1.00 15.00 ?  287 GLU A HB3  14 
ATOM   9936  H HG2  . GLU A 1 9  ? 4.348   5.565   4.790   1.00 15.00 ?  287 GLU A HG2  14 
ATOM   9937  H HG3  . GLU A 1 9  ? 3.207   6.678   4.043   1.00 15.00 ?  287 GLU A HG3  14 
ATOM   9938  N N    . VAL A 1 10 ? 0.585   4.666   0.998   1.00 15.00 ?  288 VAL A N    14 
ATOM   9939  C CA   . VAL A 1 10 ? 0.266   3.952   -0.224  1.00 15.00 ?  288 VAL A CA   14 
ATOM   9940  C C    . VAL A 1 10 ? 1.516   3.838   -1.092  1.00 15.00 ?  288 VAL A C    14 
ATOM   9941  O O    . VAL A 1 10 ? 2.020   4.813   -1.647  1.00 15.00 ?  288 VAL A O    14 
ATOM   9942  C CB   . VAL A 1 10 ? -0.935  4.571   -1.007  1.00 15.00 ?  288 VAL A CB   14 
ATOM   9943  C CG1  . VAL A 1 10 ? -2.046  4.971   -0.052  1.00 15.00 ?  288 VAL A CG1  14 
ATOM   9944  C CG2  . VAL A 1 10 ? -0.554  5.758   -1.875  1.00 15.00 ?  288 VAL A CG2  14 
ATOM   9945  H H    . VAL A 1 10 ? 0.508   5.649   1.035   1.00 15.00 ?  288 VAL A H    14 
ATOM   9946  H HA   . VAL A 1 10 ? -0.017  2.950   0.070   1.00 15.00 ?  288 VAL A HA   14 
ATOM   9947  H HB   . VAL A 1 10 ? -1.330  3.801   -1.657  1.00 15.00 ?  288 VAL A HB   14 
ATOM   9948  H HG11 . VAL A 1 10 ? -2.381  4.102   0.495   1.00 15.00 ?  288 VAL A HG11 14 
ATOM   9949  H HG12 . VAL A 1 10 ? -2.870  5.387   -0.611  1.00 15.00 ?  288 VAL A HG12 14 
ATOM   9950  H HG13 . VAL A 1 10 ? -1.673  5.710   0.642   1.00 15.00 ?  288 VAL A HG13 14 
ATOM   9951  H HG21 . VAL A 1 10 ? -1.317  5.905   -2.623  1.00 15.00 ?  288 VAL A HG21 14 
ATOM   9952  H HG22 . VAL A 1 10 ? 0.393   5.564   -2.356  1.00 15.00 ?  288 VAL A HG22 14 
ATOM   9953  H HG23 . VAL A 1 10 ? -0.472  6.643   -1.261  1.00 15.00 ?  288 VAL A HG23 14 
ATOM   9954  N N    . ARG A 1 11 ? 2.069   2.645   -1.161  1.00 15.00 ?  289 ARG A N    14 
ATOM   9955  C CA   . ARG A 1 11 ? 3.280   2.453   -1.924  1.00 15.00 ?  289 ARG A CA   14 
ATOM   9956  C C    . ARG A 1 11 ? 2.900   1.988   -3.324  1.00 15.00 ?  289 ARG A C    14 
ATOM   9957  O O    . ARG A 1 11 ? 2.630   0.818   -3.553  1.00 15.00 ?  289 ARG A O    14 
ATOM   9958  C CB   . ARG A 1 11 ? 4.223   1.475   -1.194  1.00 15.00 ?  289 ARG A CB   14 
ATOM   9959  C CG   . ARG A 1 11 ? 5.709   1.725   -1.449  1.00 15.00 ?  289 ARG A CG   14 
ATOM   9960  C CD   . ARG A 1 11 ? 6.120   1.388   -2.872  1.00 15.00 ?  289 ARG A CD   14 
ATOM   9961  N NE   . ARG A 1 11 ? 7.514   1.749   -3.140  1.00 15.00 ?  289 ARG A NE   14 
ATOM   9962  C CZ   . ARG A 1 11 ? 8.505   0.866   -3.299  1.00 15.00 ?  289 ARG A CZ   14 
ATOM   9963  N NH1  . ARG A 1 11 ? 8.295   -0.429  -3.089  1.00 15.00 1  289 ARG A NH1  14 
ATOM   9964  N NH2  . ARG A 1 11 ? 9.719   1.286   -3.629  1.00 15.00 ?  289 ARG A NH2  14 
ATOM   9965  H H    . ARG A 1 11 ? 1.649   1.878   -0.710  1.00 15.00 ?  289 ARG A H    14 
ATOM   9966  H HA   . ARG A 1 11 ? 3.766   3.414   -2.006  1.00 15.00 ?  289 ARG A HA   14 
ATOM   9967  H HB2  . ARG A 1 11 ? 4.053   1.569   -0.131  1.00 15.00 ?  289 ARG A HB2  14 
ATOM   9968  H HB3  . ARG A 1 11 ? 3.991   0.460   -1.486  1.00 15.00 ?  289 ARG A HB3  14 
ATOM   9969  H HG2  . ARG A 1 11 ? 5.922   2.768   -1.265  1.00 15.00 ?  289 ARG A HG2  14 
ATOM   9970  H HG3  . ARG A 1 11 ? 6.286   1.117   -0.766  1.00 15.00 ?  289 ARG A HG3  14 
ATOM   9971  H HD2  . ARG A 1 11 ? 5.997   0.326   -3.025  1.00 15.00 ?  289 ARG A HD2  14 
ATOM   9972  H HD3  . ARG A 1 11 ? 5.481   1.926   -3.556  1.00 15.00 ?  289 ARG A HD3  14 
ATOM   9973  H HE   . ARG A 1 11 ? 7.720   2.705   -3.239  1.00 15.00 ?  289 ARG A HE   14 
ATOM   9974  H HH11 . ARG A 1 11 ? 7.389   -0.757  -2.805  1.00 15.00 ?  289 ARG A HH11 14 
ATOM   9975  H HH12 . ARG A 1 11 ? 9.045   -1.091  -3.217  1.00 15.00 ?  289 ARG A HH12 14 
ATOM   9976  H HH21 . ARG A 1 11 ? 9.896   2.278   -3.759  1.00 15.00 ?  289 ARG A HH21 14 
ATOM   9977  H HH22 . ARG A 1 11 ? 10.463  0.630   -3.761  1.00 15.00 ?  289 ARG A HH22 14 
ATOM   9978  N N    . SER A 1 12 ? 2.779   2.939   -4.235  1.00 15.00 ?  290 SER A N    14 
ATOM   9979  C CA   . SER A 1 12 ? 2.363   2.648   -5.594  1.00 15.00 ?  290 SER A CA   14 
ATOM   9980  C C    . SER A 1 12 ? 3.558   2.650   -6.539  1.00 15.00 ?  290 SER A C    14 
ATOM   9981  O O    . SER A 1 12 ? 4.179   3.682   -6.778  1.00 15.00 ?  290 SER A O    14 
ATOM   9982  C CB   . SER A 1 12 ? 1.320   3.674   -6.029  1.00 15.00 ?  290 SER A CB   14 
ATOM   9983  O OG   . SER A 1 12 ? 1.565   4.921   -5.402  1.00 15.00 ?  290 SER A OG   14 
ATOM   9984  H H    . SER A 1 12 ? 2.962   3.871   -3.986  1.00 15.00 ?  290 SER A H    14 
ATOM   9985  H HA   . SER A 1 12 ? 1.913   1.666   -5.602  1.00 15.00 ?  290 SER A HA   14 
ATOM   9986  H HB2  . SER A 1 12 ? 1.366   3.805   -7.099  1.00 15.00 ?  290 SER A HB2  14 
ATOM   9987  H HB3  . SER A 1 12 ? 0.334   3.331   -5.749  1.00 15.00 ?  290 SER A HB3  14 
ATOM   9988  H HG   . SER A 1 12 ? 1.248   5.642   -5.969  1.00 15.00 ?  290 SER A HG   14 
ATOM   9989  N N    . THR A 1 13 ? 3.887   1.484   -7.057  1.00 15.00 ?  291 THR A N    14 
ATOM   9990  C CA   . THR A 1 13 ? 5.040   1.346   -7.924  1.00 15.00 ?  291 THR A CA   14 
ATOM   9991  C C    . THR A 1 13 ? 4.652   1.556   -9.384  1.00 15.00 ?  291 THR A C    14 
ATOM   9992  O O    . THR A 1 13 ? 3.513   1.280   -9.781  1.00 15.00 ?  291 THR A O    14 
ATOM   9993  C CB   . THR A 1 13 ? 5.728   -0.015  -7.730  1.00 15.00 ?  291 THR A CB   14 
ATOM   9994  O OG1  . THR A 1 13 ? 4.798   -1.084  -7.950  1.00 15.00 ?  291 THR A OG1  14 
ATOM   9995  C CG2  . THR A 1 13 ? 6.299   -0.111  -6.323  1.00 15.00 ?  291 THR A CG2  14 
ATOM   9996  H H    . THR A 1 13 ? 3.338   0.696   -6.861  1.00 15.00 ?  291 THR A H    14 
ATOM   9997  H HA   . THR A 1 13 ? 5.745   2.117   -7.646  1.00 15.00 ?  291 THR A HA   14 
ATOM   9998  H HB   . THR A 1 13 ? 6.540   -0.098  -8.439  1.00 15.00 ?  291 THR A HB   14 
ATOM   9999  H HG1  . THR A 1 13 ? 4.752   -1.277  -8.898  1.00 15.00 ?  291 THR A HG1  14 
ATOM   10000 H HG21 . THR A 1 13 ? 6.908   0.763   -6.118  1.00 15.00 ?  291 THR A HG21 14 
ATOM   10001 H HG22 . THR A 1 13 ? 6.907   -1.000  -6.240  1.00 15.00 ?  291 THR A HG22 14 
ATOM   10002 H HG23 . THR A 1 13 ? 5.488   -0.159  -5.609  1.00 15.00 ?  291 THR A HG23 14 
ATOM   10003 N N    . VAL A 1 14 ? 5.608   2.058   -10.167 1.00 15.00 ?  292 VAL A N    14 
ATOM   10004 C CA   . VAL A 1 14 ? 5.371   2.480   -11.548 1.00 15.00 ?  292 VAL A CA   14 
ATOM   10005 C C    . VAL A 1 14 ? 4.859   1.330   -12.428 1.00 15.00 ?  292 VAL A C    14 
ATOM   10006 O O    . VAL A 1 14 ? 4.337   1.556   -13.520 1.00 15.00 ?  292 VAL A O    14 
ATOM   10007 C CB   . VAL A 1 14 ? 6.662   3.068   -12.163 1.00 15.00 ?  292 VAL A CB   14 
ATOM   10008 C CG1  . VAL A 1 14 ? 6.379   3.742   -13.498 1.00 15.00 ?  292 VAL A CG1  14 
ATOM   10009 C CG2  . VAL A 1 14 ? 7.312   4.051   -11.199 1.00 15.00 ?  292 VAL A CG2  14 
ATOM   10010 H H    . VAL A 1 14 ? 6.514   2.144   -9.802  1.00 15.00 ?  292 VAL A H    14 
ATOM   10011 H HA   . VAL A 1 14 ? 4.625   3.261   -11.528 1.00 15.00 ?  292 VAL A HA   14 
ATOM   10012 H HB   . VAL A 1 14 ? 7.356   2.258   -12.336 1.00 15.00 ?  292 VAL A HB   14 
ATOM   10013 H HG11 . VAL A 1 14 ? 5.664   4.541   -13.354 1.00 15.00 ?  292 VAL A HG11 14 
ATOM   10014 H HG12 . VAL A 1 14 ? 5.974   3.018   -14.190 1.00 15.00 ?  292 VAL A HG12 14 
ATOM   10015 H HG13 . VAL A 1 14 ? 7.295   4.149   -13.897 1.00 15.00 ?  292 VAL A HG13 14 
ATOM   10016 H HG21 . VAL A 1 14 ? 6.623   4.856   -10.989 1.00 15.00 ?  292 VAL A HG21 14 
ATOM   10017 H HG22 . VAL A 1 14 ? 8.211   4.452   -11.644 1.00 15.00 ?  292 VAL A HG22 14 
ATOM   10018 H HG23 . VAL A 1 14 ? 7.561   3.540   -10.280 1.00 15.00 ?  292 VAL A HG23 14 
ATOM   10019 N N    . SER A 1 15 ? 4.995   0.099   -11.940 1.00 15.00 ?  293 SER A N    14 
ATOM   10020 C CA   . SER A 1 15 ? 4.438   -1.070  -12.615 1.00 15.00 ?  293 SER A CA   14 
ATOM   10021 C C    . SER A 1 15 ? 2.912   -0.968  -12.739 1.00 15.00 ?  293 SER A C    14 
ATOM   10022 O O    . SER A 1 15 ? 2.287   -1.716  -13.491 1.00 15.00 ?  293 SER A O    14 
ATOM   10023 C CB   . SER A 1 15 ? 4.840   -2.352  -11.883 1.00 15.00 ?  293 SER A CB   14 
ATOM   10024 O OG   . SER A 1 15 ? 4.560   -2.271  -10.493 1.00 15.00 ?  293 SER A OG   14 
ATOM   10025 H H    . SER A 1 15 ? 5.493   -0.029  -11.103 1.00 15.00 ?  293 SER A H    14 
ATOM   10026 H HA   . SER A 1 15 ? 4.859   -1.097  -13.610 1.00 15.00 ?  293 SER A HA   14 
ATOM   10027 H HB2  . SER A 1 15 ? 4.292   -3.187  -12.298 1.00 15.00 ?  293 SER A HB2  14 
ATOM   10028 H HB3  . SER A 1 15 ? 5.899   -2.519  -12.013 1.00 15.00 ?  293 SER A HB3  14 
ATOM   10029 H HG   . SER A 1 15 ? 4.432   -3.164  -10.148 1.00 15.00 ?  293 SER A HG   14 
ATOM   10030 N N    . GLY A 1 16 ? 2.322   -0.043  -11.986 1.00 15.00 ?  294 GLY A N    14 
ATOM   10031 C CA   . GLY A 1 16 ? 0.888   0.155   -12.030 1.00 15.00 ?  294 GLY A CA   14 
ATOM   10032 C C    . GLY A 1 16 ? 0.159   -0.697  -11.017 1.00 15.00 ?  294 GLY A C    14 
ATOM   10033 O O    . GLY A 1 16 ? -0.849  -1.329  -11.329 1.00 15.00 ?  294 GLY A O    14 
ATOM   10034 H H    . GLY A 1 16 ? 2.871   0.508   -11.388 1.00 15.00 ?  294 GLY A H    14 
ATOM   10035 H HA2  . GLY A 1 16 ? 0.671   1.195   -11.832 1.00 15.00 ?  294 GLY A HA2  14 
ATOM   10036 H HA3  . GLY A 1 16 ? 0.530   -0.095  -13.017 1.00 15.00 ?  294 GLY A HA3  14 
ATOM   10037 N N    . ARG A 1 17 ? 0.684   -0.721  -9.803  1.00 15.00 ?  295 ARG A N    14 
ATOM   10038 C CA   . ARG A 1 17 ? 0.062   -1.456  -8.713  1.00 15.00 ?  295 ARG A CA   14 
ATOM   10039 C C    . ARG A 1 17 ? 0.171   -0.658  -7.419  1.00 15.00 ?  295 ARG A C    14 
ATOM   10040 O O    . ARG A 1 17 ? 1.247   -0.163  -7.073  1.00 15.00 ?  295 ARG A O    14 
ATOM   10041 C CB   . ARG A 1 17 ? 0.734   -2.826  -8.532  1.00 15.00 ?  295 ARG A CB   14 
ATOM   10042 C CG   . ARG A 1 17 ? 2.202   -2.720  -8.157  1.00 15.00 ?  295 ARG A CG   14 
ATOM   10043 C CD   . ARG A 1 17 ? 2.848   -4.072  -7.912  1.00 15.00 ?  295 ARG A CD   14 
ATOM   10044 N NE   . ARG A 1 17 ? 4.243   -3.909  -7.491  1.00 15.00 ?  295 ARG A NE   14 
ATOM   10045 C CZ   . ARG A 1 17 ? 5.110   -4.907  -7.316  1.00 15.00 ?  295 ARG A CZ   14 
ATOM   10046 N NH1  . ARG A 1 17 ? 4.741   -6.170  -7.480  1.00 15.00 1  295 ARG A NH1  14 
ATOM   10047 N NH2  . ARG A 1 17 ? 6.365   -4.638  -6.975  1.00 15.00 ?  295 ARG A NH2  14 
ATOM   10048 H H    . ARG A 1 17 ? 1.515   -0.220  -9.630  1.00 15.00 ?  295 ARG A H    14 
ATOM   10049 H HA   . ARG A 1 17 ? -0.980  -1.598  -8.954  1.00 15.00 ?  295 ARG A HA   14 
ATOM   10050 H HB2  . ARG A 1 17 ? 0.221   -3.367  -7.750  1.00 15.00 ?  295 ARG A HB2  14 
ATOM   10051 H HB3  . ARG A 1 17 ? 0.658   -3.383  -9.454  1.00 15.00 ?  295 ARG A HB3  14 
ATOM   10052 H HG2  . ARG A 1 17 ? 2.730   -2.227  -8.959  1.00 15.00 ?  295 ARG A HG2  14 
ATOM   10053 H HG3  . ARG A 1 17 ? 2.285   -2.126  -7.257  1.00 15.00 ?  295 ARG A HG3  14 
ATOM   10054 H HD2  . ARG A 1 17 ? 2.296   -4.595  -7.144  1.00 15.00 ?  295 ARG A HD2  14 
ATOM   10055 H HD3  . ARG A 1 17 ? 2.822   -4.645  -8.829  1.00 15.00 ?  295 ARG A HD3  14 
ATOM   10056 H HE   . ARG A 1 17 ? 4.556   -2.985  -7.345  1.00 15.00 ?  295 ARG A HE   14 
ATOM   10057 H HH11 . ARG A 1 17 ? 3.791   -6.402  -7.744  1.00 15.00 ?  295 ARG A HH11 14 
ATOM   10058 H HH12 . ARG A 1 17 ? 5.414   -6.910  -7.347  1.00 15.00 ?  295 ARG A HH12 14 
ATOM   10059 H HH21 . ARG A 1 17 ? 6.666   -3.690  -6.851  1.00 15.00 ?  295 ARG A HH21 14 
ATOM   10060 H HH22 . ARG A 1 17 ? 7.025   -5.389  -6.848  1.00 15.00 ?  295 ARG A HH22 14 
ATOM   10061 N N    . ILE A 1 18 ? -0.937  -0.516  -6.713  1.00 15.00 ?  296 ILE A N    14 
ATOM   10062 C CA   . ILE A 1 18 ? -0.899  0.046   -5.377  1.00 15.00 ?  296 ILE A CA   14 
ATOM   10063 C C    . ILE A 1 18 ? -0.889  -1.111  -4.384  1.00 15.00 ?  296 ILE A C    14 
ATOM   10064 O O    . ILE A 1 18 ? -1.588  -2.107  -4.576  1.00 15.00 ?  296 ILE A O    14 
ATOM   10065 C CB   . ILE A 1 18 ? -2.086  1.016   -5.107  1.00 15.00 ?  296 ILE A CB   14 
ATOM   10066 C CG1  . ILE A 1 18 ? -1.834  1.864   -3.848  1.00 15.00 ?  296 ILE A CG1  14 
ATOM   10067 C CG2  . ILE A 1 18 ? -3.402  0.256   -4.981  1.00 15.00 ?  296 ILE A CG2  14 
ATOM   10068 C CD1  . ILE A 1 18 ? -2.830  2.987   -3.671  1.00 15.00 ?  296 ILE A CD1  14 
ATOM   10069 H H    . ILE A 1 18 ? -1.793  -0.808  -7.090  1.00 15.00 ?  296 ILE A H    14 
ATOM   10070 H HA   . ILE A 1 18 ? 0.027   0.598   -5.277  1.00 15.00 ?  296 ILE A HA   14 
ATOM   10071 H HB   . ILE A 1 18 ? -2.171  1.676   -5.957  1.00 15.00 ?  296 ILE A HB   14 
ATOM   10072 H HG12 . ILE A 1 18 ? -1.893  1.238   -2.975  1.00 15.00 ?  296 ILE A HG12 14 
ATOM   10073 H HG13 . ILE A 1 18 ? -0.851  2.302   -3.901  1.00 15.00 ?  296 ILE A HG13 14 
ATOM   10074 H HG21 . ILE A 1 18 ? -3.592  -0.289  -5.894  1.00 15.00 ?  296 ILE A HG21 14 
ATOM   10075 H HG22 . ILE A 1 18 ? -4.207  0.954   -4.804  1.00 15.00 ?  296 ILE A HG22 14 
ATOM   10076 H HG23 . ILE A 1 18 ? -3.339  -0.437  -4.154  1.00 15.00 ?  296 ILE A HG23 14 
ATOM   10077 H HD11 . ILE A 1 18 ? -3.827  2.578   -3.601  1.00 15.00 ?  296 ILE A HD11 14 
ATOM   10078 H HD12 . ILE A 1 18 ? -2.774  3.655   -4.518  1.00 15.00 ?  296 ILE A HD12 14 
ATOM   10079 H HD13 . ILE A 1 18 ? -2.601  3.532   -2.768  1.00 15.00 ?  296 ILE A HD13 14 
ATOM   10080 N N    . TYR A 1 19 ? -0.063  -1.007  -3.365  1.00 15.00 ?  297 TYR A N    14 
ATOM   10081 C CA   . TYR A 1 19 ? 0.117   -2.100  -2.427  1.00 15.00 ?  297 TYR A CA   14 
ATOM   10082 C C    . TYR A 1 19 ? 0.461   -1.500  -1.094  1.00 15.00 ?  297 TYR A C    14 
ATOM   10083 O O    . TYR A 1 19 ? 1.292   -0.587  -1.003  1.00 15.00 ?  297 TYR A O    14 
ATOM   10084 C CB   . TYR A 1 19 ? 1.163   -3.131  -2.915  1.00 15.00 ?  297 TYR A CB   14 
ATOM   10085 C CG   . TYR A 1 19 ? 2.620   -2.852  -2.591  1.00 15.00 ?  297 TYR A CG   14 
ATOM   10086 C CD1  . TYR A 1 19 ? 3.326   -1.872  -3.267  1.00 15.00 ?  297 TYR A CD1  14 
ATOM   10087 C CD2  . TYR A 1 19 ? 3.297   -3.592  -1.622  1.00 15.00 ?  297 TYR A CD2  14 
ATOM   10088 C CE1  . TYR A 1 19 ? 4.656   -1.630  -2.987  1.00 15.00 ?  297 TYR A CE1  14 
ATOM   10089 C CE2  . TYR A 1 19 ? 4.626   -3.354  -1.341  1.00 15.00 ?  297 TYR A CE2  14 
ATOM   10090 C CZ   . TYR A 1 19 ? 5.299   -2.371  -2.025  1.00 15.00 ?  297 TYR A CZ   14 
ATOM   10091 O OH   . TYR A 1 19 ? 6.622   -2.125  -1.742  1.00 15.00 ?  297 TYR A OH   14 
ATOM   10092 H H    . TYR A 1 19 ? 0.370   -0.143  -3.180  1.00 15.00 ?  297 TYR A H    14 
ATOM   10093 H HA   . TYR A 1 19 ? -0.842  -2.596  -2.330  1.00 15.00 ?  297 TYR A HA   14 
ATOM   10094 H HB2  . TYR A 1 19 ? 0.924   -4.092  -2.487  1.00 15.00 ?  297 TYR A HB2  14 
ATOM   10095 H HB3  . TYR A 1 19 ? 1.081   -3.207  -3.989  1.00 15.00 ?  297 TYR A HB3  14 
ATOM   10096 H HD1  . TYR A 1 19 ? 2.821   -1.287  -4.021  1.00 15.00 ?  297 TYR A HD1  14 
ATOM   10097 H HD2  . TYR A 1 19 ? 2.774   -4.369  -1.090  1.00 15.00 ?  297 TYR A HD2  14 
ATOM   10098 H HE1  . TYR A 1 19 ? 5.187   -0.859  -3.525  1.00 15.00 ?  297 TYR A HE1  14 
ATOM   10099 H HE2  . TYR A 1 19 ? 5.134   -3.943  -0.595  1.00 15.00 ?  297 TYR A HE2  14 
ATOM   10100 H HH   . TYR A 1 19 ? 7.052   -2.945  -1.477  1.00 15.00 ?  297 TYR A HH   14 
ATOM   10101 N N    . PHE A 1 20 ? -0.183  -1.981  -0.066  1.00 15.00 ?  298 PHE A N    14 
ATOM   10102 C CA   . PHE A 1 20 ? -0.194  -1.259  1.156   1.00 15.00 ?  298 PHE A CA   14 
ATOM   10103 C C    . PHE A 1 20 ? 0.915   -1.576  2.102   1.00 15.00 ?  298 PHE A C    14 
ATOM   10104 O O    . PHE A 1 20 ? 1.280   -2.727  2.331   1.00 15.00 ?  298 PHE A O    14 
ATOM   10105 C CB   . PHE A 1 20 ? -1.528  -1.390  1.823   1.00 15.00 ?  298 PHE A CB   14 
ATOM   10106 C CG   . PHE A 1 20 ? -2.292  -0.192  1.481   1.00 15.00 ?  298 PHE A CG   14 
ATOM   10107 C CD1  . PHE A 1 20 ? -1.879  1.018   1.992   1.00 15.00 ?  298 PHE A CD1  14 
ATOM   10108 C CD2  . PHE A 1 20 ? -3.366  -0.242  0.620   1.00 15.00 ?  298 PHE A CD2  14 
ATOM   10109 C CE1  . PHE A 1 20 ? -2.527  2.163   1.667   1.00 15.00 ?  298 PHE A CE1  14 
ATOM   10110 C CE2  . PHE A 1 20 ? -4.027  0.912   0.290   1.00 15.00 ?  298 PHE A CE2  14 
ATOM   10111 C CZ   . PHE A 1 20 ? -3.600  2.109   0.822   1.00 15.00 ?  298 PHE A CZ   14 
ATOM   10112 H H    . PHE A 1 20 ? -0.720  -2.799  -0.151  1.00 15.00 ?  298 PHE A H    14 
ATOM   10113 H HA   . PHE A 1 20 ? -0.090  -0.224  0.875   1.00 15.00 ?  298 PHE A HA   14 
ATOM   10114 H HB2  . PHE A 1 20 ? -2.051  -2.271  1.460   1.00 15.00 ?  298 PHE A HB2  14 
ATOM   10115 H HB3  . PHE A 1 20 ? -1.409  -1.434  2.893   1.00 15.00 ?  298 PHE A HB3  14 
ATOM   10116 H HD1  . PHE A 1 20 ? -1.047  1.051   2.669   1.00 15.00 ?  298 PHE A HD1  14 
ATOM   10117 H HD2  . PHE A 1 20 ? -3.685  -1.191  0.212   1.00 15.00 ?  298 PHE A HD2  14 
ATOM   10118 H HE1  . PHE A 1 20 ? -2.198  3.109   2.070   1.00 15.00 ?  298 PHE A HE1  14 
ATOM   10119 H HE2  . PHE A 1 20 ? -4.872  0.887   -0.377  1.00 15.00 ?  298 PHE A HE2  14 
ATOM   10120 H HZ   . PHE A 1 20 ? -4.111  2.990   0.602   1.00 15.00 ?  298 PHE A HZ   14 
ATOM   10121 N N    . VAL A 1 21 ? 1.415   -0.493  2.661   1.00 15.00 ?  299 VAL A N    14 
ATOM   10122 C CA   . VAL A 1 21 ? 2.480   -0.505  3.607   1.00 15.00 ?  299 VAL A CA   14 
ATOM   10123 C C    . VAL A 1 21 ? 2.111   0.420   4.769   1.00 15.00 ?  299 VAL A C    14 
ATOM   10124 O O    . VAL A 1 21 ? 2.354   1.631   4.752   1.00 15.00 ?  299 VAL A O    14 
ATOM   10125 C CB   . VAL A 1 21 ? 3.792   -0.048  2.937   1.00 15.00 ?  299 VAL A CB   14 
ATOM   10126 C CG1  . VAL A 1 21 ? 4.228   -1.043  1.874   1.00 15.00 ?  299 VAL A CG1  14 
ATOM   10127 C CG2  . VAL A 1 21 ? 3.606   1.314   2.292   1.00 15.00 ?  299 VAL A CG2  14 
ATOM   10128 H H    . VAL A 1 21 ? 1.030   0.374   2.421   1.00 15.00 ?  299 VAL A H    14 
ATOM   10129 H HA   . VAL A 1 21 ? 2.605   -1.513  3.973   1.00 15.00 ?  299 VAL A HA   14 
ATOM   10130 H HB   . VAL A 1 21 ? 4.564   0.026   3.688   1.00 15.00 ?  299 VAL A HB   14 
ATOM   10131 H HG11 . VAL A 1 21 ? 5.306   -1.062  1.816   1.00 15.00 ?  299 VAL A HG11 14 
ATOM   10132 H HG12 . VAL A 1 21 ? 3.833   -0.734  0.927   1.00 15.00 ?  299 VAL A HG12 14 
ATOM   10133 H HG13 . VAL A 1 21 ? 3.857   -2.028  2.113   1.00 15.00 ?  299 VAL A HG13 14 
ATOM   10134 H HG21 . VAL A 1 21 ? 2.835   1.254   1.537   1.00 15.00 ?  299 VAL A HG21 14 
ATOM   10135 H HG22 . VAL A 1 21 ? 4.532   1.626   1.837   1.00 15.00 ?  299 VAL A HG22 14 
ATOM   10136 H HG23 . VAL A 1 21 ? 3.316   2.032   3.046   1.00 15.00 ?  299 VAL A HG23 14 
ATOM   10137 N N    . ASP A 1 22 ? 1.466   -0.134  5.761   1.00 15.00 ?  300 ASP A N    14 
ATOM   10138 C CA   . ASP A 1 22 ? 1.153   0.640   6.940   1.00 15.00 ?  300 ASP A CA   14 
ATOM   10139 C C    . ASP A 1 22 ? 2.314   0.485   7.902   1.00 15.00 ?  300 ASP A C    14 
ATOM   10140 O O    . ASP A 1 22 ? 2.649   -0.623  8.317   1.00 15.00 ?  300 ASP A O    14 
ATOM   10141 C CB   . ASP A 1 22 ? -0.197  0.206   7.545   1.00 15.00 ?  300 ASP A CB   14 
ATOM   10142 C CG   . ASP A 1 22 ? -0.103  -0.286  8.977   1.00 15.00 ?  300 ASP A CG   14 
ATOM   10143 O OD1  . ASP A 1 22 ? 0.097   0.548   9.890   1.00 15.00 -1 300 ASP A OD1  14 
ATOM   10144 O OD2  . ASP A 1 22 ? -0.218  -1.510  9.194   1.00 15.00 ?  300 ASP A OD2  14 
ATOM   10145 H H    . ASP A 1 22 ? 1.198   -1.077  5.706   1.00 15.00 ?  300 ASP A H    14 
ATOM   10146 H HA   . ASP A 1 22 ? 1.091   1.677   6.641   1.00 15.00 ?  300 ASP A HA   14 
ATOM   10147 H HB2  . ASP A 1 22 ? -0.871  1.049   7.528   1.00 15.00 ?  300 ASP A HB2  14 
ATOM   10148 H HB3  . ASP A 1 22 ? -0.615  -0.587  6.937   1.00 15.00 ?  300 ASP A HB3  14 
ATOM   10149 N N    . HIS A 1 23 ? 2.985   1.593   8.192   1.00 15.00 ?  301 HIS A N    14 
ATOM   10150 C CA   . HIS A 1 23 ? 4.208   1.534   8.980   1.00 15.00 ?  301 HIS A CA   14 
ATOM   10151 C C    . HIS A 1 23 ? 3.889   1.483   10.473  1.00 15.00 ?  301 HIS A C    14 
ATOM   10152 O O    . HIS A 1 23 ? 4.788   1.367   11.301  1.00 15.00 ?  301 HIS A O    14 
ATOM   10153 C CB   . HIS A 1 23 ? 5.126   2.741   8.727   1.00 15.00 ?  301 HIS A CB   14 
ATOM   10154 C CG   . HIS A 1 23 ? 5.397   3.128   7.296   1.00 15.00 ?  301 HIS A CG   14 
ATOM   10155 N ND1  . HIS A 1 23 ? 5.643   4.431   6.946   1.00 15.00 ?  301 HIS A ND1  14 
ATOM   10156 C CD2  . HIS A 1 23 ? 5.597   2.403   6.162   1.00 15.00 ?  301 HIS A CD2  14 
ATOM   10157 C CE1  . HIS A 1 23 ? 5.988   4.491   5.683   1.00 15.00 ?  301 HIS A CE1  14 
ATOM   10158 N NE2  . HIS A 1 23 ? 5.981   3.275   5.174   1.00 15.00 ?  301 HIS A NE2  14 
ATOM   10159 H H    . HIS A 1 23 ? 2.646   2.462   7.878   1.00 15.00 ?  301 HIS A H    14 
ATOM   10160 H HA   . HIS A 1 23 ? 4.735   0.631   8.707   1.00 15.00 ?  301 HIS A HA   14 
ATOM   10161 H HB2  . HIS A 1 23 ? 4.704   3.602   9.211   1.00 15.00 ?  301 HIS A HB2  14 
ATOM   10162 H HB3  . HIS A 1 23 ? 6.082   2.528   9.180   1.00 15.00 ?  301 HIS A HB3  14 
ATOM   10163 H HD1  . HIS A 1 23 ? 5.554   5.208   7.538   1.00 15.00 ?  301 HIS A HD1  14 
ATOM   10164 H HD2  . HIS A 1 23 ? 5.449   1.337   6.038   1.00 15.00 ?  301 HIS A HD2  14 
ATOM   10165 H HE1  . HIS A 1 23 ? 6.219   5.395   5.138   1.00 15.00 ?  301 HIS A HE1  14 
ATOM   10166 H HE2  . HIS A 1 23 ? 6.537   3.014   4.397   1.00 15.00 ?  301 HIS A HE2  14 
ATOM   10167 N N    . ASN A 1 24 ? 2.609   1.568   10.813  1.00 15.00 ?  302 ASN A N    14 
ATOM   10168 C CA   . ASN A 1 24 ? 2.191   1.656   12.207  1.00 15.00 ?  302 ASN A CA   14 
ATOM   10169 C C    . ASN A 1 24 ? 1.923   0.274   12.782  1.00 15.00 ?  302 ASN A C    14 
ATOM   10170 O O    . ASN A 1 24 ? 2.617   -0.175  13.699  1.00 15.00 ?  302 ASN A O    14 
ATOM   10171 C CB   . ASN A 1 24 ? 0.941   2.531   12.342  1.00 15.00 ?  302 ASN A CB   14 
ATOM   10172 C CG   . ASN A 1 24 ? 1.210   3.985   12.012  1.00 15.00 ?  302 ASN A CG   14 
ATOM   10173 O OD1  . ASN A 1 24 ? 1.561   4.776   12.886  1.00 15.00 ?  302 ASN A OD1  14 
ATOM   10174 N ND2  . ASN A 1 24 ? 1.046   4.350   10.749  1.00 15.00 ?  302 ASN A ND2  14 
ATOM   10175 H H    . ASN A 1 24 ? 1.921   1.543   10.110  1.00 15.00 ?  302 ASN A H    14 
ATOM   10176 H HA   . ASN A 1 24 ? 2.997   2.110   12.765  1.00 15.00 ?  302 ASN A HA   14 
ATOM   10177 H HB2  . ASN A 1 24 ? 0.179   2.165   11.668  1.00 15.00 ?  302 ASN A HB2  14 
ATOM   10178 H HB3  . ASN A 1 24 ? 0.575   2.470   13.357  1.00 15.00 ?  302 ASN A HB3  14 
ATOM   10179 H HD21 . ASN A 1 24 ? 0.756   3.670   10.101  1.00 15.00 ?  302 ASN A HD21 14 
ATOM   10180 H HD22 . ASN A 1 24 ? 1.221   5.284   10.511  1.00 15.00 ?  302 ASN A HD22 14 
ATOM   10181 N N    . ASN A 1 25 ? 0.915   -0.395  12.246  1.00 15.00 ?  303 ASN A N    14 
ATOM   10182 C CA   . ASN A 1 25 ? 0.590   -1.755  12.655  1.00 15.00 ?  303 ASN A CA   14 
ATOM   10183 C C    . ASN A 1 25 ? 1.446   -2.746  11.865  1.00 15.00 ?  303 ASN A C    14 
ATOM   10184 O O    . ASN A 1 25 ? 1.566   -3.917  12.231  1.00 15.00 ?  303 ASN A O    14 
ATOM   10185 C CB   . ASN A 1 25 ? -0.905  -2.027  12.439  1.00 15.00 ?  303 ASN A CB   14 
ATOM   10186 C CG   . ASN A 1 25 ? -1.354  -3.378  12.969  1.00 15.00 ?  303 ASN A CG   14 
ATOM   10187 O OD1  . ASN A 1 25 ? -1.726  -3.509  14.136  1.00 15.00 ?  303 ASN A OD1  14 
ATOM   10188 N ND2  . ASN A 1 25 ? -1.348  -4.385  12.110  1.00 15.00 ?  303 ASN A ND2  14 
ATOM   10189 H H    . ASN A 1 25 ? 0.368   0.043   11.544  1.00 15.00 ?  303 ASN A H    14 
ATOM   10190 H HA   . ASN A 1 25 ? 0.822   -1.852  13.705  1.00 15.00 ?  303 ASN A HA   14 
ATOM   10191 H HB2  . ASN A 1 25 ? -1.477  -1.261  12.941  1.00 15.00 ?  303 ASN A HB2  14 
ATOM   10192 H HB3  . ASN A 1 25 ? -1.119  -1.990  11.380  1.00 15.00 ?  303 ASN A HB3  14 
ATOM   10193 H HD21 . ASN A 1 25 ? -1.057  -4.206  11.190  1.00 15.00 ?  303 ASN A HD21 14 
ATOM   10194 H HD22 . ASN A 1 25 ? -1.633  -5.272  12.428  1.00 15.00 ?  303 ASN A HD22 14 
ATOM   10195 N N    . ARG A 1 26 ? 2.026   -2.246  10.775  1.00 15.00 ?  304 ARG A N    14 
ATOM   10196 C CA   . ARG A 1 26 ? 2.917   -3.006  9.908   1.00 15.00 ?  304 ARG A CA   14 
ATOM   10197 C C    . ARG A 1 26 ? 2.166   -4.121  9.185   1.00 15.00 ?  304 ARG A C    14 
ATOM   10198 O O    . ARG A 1 26 ? 2.113   -5.263  9.649   1.00 15.00 ?  304 ARG A O    14 
ATOM   10199 C CB   . ARG A 1 26 ? 4.120   -3.549  10.683  1.00 15.00 ?  304 ARG A CB   14 
ATOM   10200 C CG   . ARG A 1 26 ? 5.408   -3.515  9.881   1.00 15.00 ?  304 ARG A CG   14 
ATOM   10201 C CD   . ARG A 1 26 ? 6.630   -3.746  10.757  1.00 15.00 ?  304 ARG A CD   14 
ATOM   10202 N NE   . ARG A 1 26 ? 6.481   -3.157  12.087  1.00 15.00 ?  304 ARG A NE   14 
ATOM   10203 C CZ   . ARG A 1 26 ? 7.490   -2.964  12.935  1.00 15.00 ?  304 ARG A CZ   14 
ATOM   10204 N NH1  . ARG A 1 26 ? 8.725   -3.321  12.607  1.00 15.00 1  304 ARG A NH1  14 
ATOM   10205 N NH2  . ARG A 1 26 ? 7.256   -2.410  14.116  1.00 15.00 ?  304 ARG A NH2  14 
ATOM   10206 H H    . ARG A 1 26 ? 1.829   -1.320  10.529  1.00 15.00 ?  304 ARG A H    14 
ATOM   10207 H HA   . ARG A 1 26 ? 3.283   -2.318  9.157   1.00 15.00 ?  304 ARG A HA   14 
ATOM   10208 H HB2  . ARG A 1 26 ? 4.258   -2.958  11.576  1.00 15.00 ?  304 ARG A HB2  14 
ATOM   10209 H HB3  . ARG A 1 26 ? 3.921   -4.573  10.963  1.00 15.00 ?  304 ARG A HB3  14 
ATOM   10210 H HG2  . ARG A 1 26 ? 5.368   -4.293  9.134   1.00 15.00 ?  304 ARG A HG2  14 
ATOM   10211 H HG3  . ARG A 1 26 ? 5.498   -2.555  9.394   1.00 15.00 ?  304 ARG A HG3  14 
ATOM   10212 H HD2  . ARG A 1 26 ? 6.805   -4.800  10.846  1.00 15.00 ?  304 ARG A HD2  14 
ATOM   10213 H HD3  . ARG A 1 26 ? 7.480   -3.291  10.283  1.00 15.00 ?  304 ARG A HD3  14 
ATOM   10214 H HE   . ARG A 1 26 ? 5.574   -2.887  12.366  1.00 15.00 ?  304 ARG A HE   14 
ATOM   10215 H HH11 . ARG A 1 26 ? 8.914   -3.740  11.710  1.00 15.00 ?  304 ARG A HH11 14 
ATOM   10216 H HH12 . ARG A 1 26 ? 9.478   -3.189  13.261  1.00 15.00 ?  304 ARG A HH12 14 
ATOM   10217 H HH21 . ARG A 1 26 ? 6.316   -2.138  14.364  1.00 15.00 ?  304 ARG A HH21 14 
ATOM   10218 H HH22 . ARG A 1 26 ? 8.005   -2.261  14.764  1.00 15.00 ?  304 ARG A HH22 14 
ATOM   10219 N N    . THR A 1 27 ? 1.538   -3.760  8.071   1.00 15.00 ?  305 THR A N    14 
ATOM   10220 C CA   . THR A 1 27 ? 0.789   -4.710  7.258   1.00 15.00 ?  305 THR A CA   14 
ATOM   10221 C C    . THR A 1 27 ? 1.003   -4.448  5.768   1.00 15.00 ?  305 THR A C    14 
ATOM   10222 O O    . THR A 1 27 ? 1.251   -3.310  5.359   1.00 15.00 ?  305 THR A O    14 
ATOM   10223 C CB   . THR A 1 27 ? -0.726  -4.652  7.557   1.00 15.00 ?  305 THR A CB   14 
ATOM   10224 O OG1  . THR A 1 27 ? -1.198  -3.300  7.481   1.00 15.00 ?  305 THR A OG1  14 
ATOM   10225 C CG2  . THR A 1 27 ? -1.044  -5.231  8.927   1.00 15.00 ?  305 THR A CG2  14 
ATOM   10226 H H    . THR A 1 27 ? 1.569   -2.819  7.791   1.00 15.00 ?  305 THR A H    14 
ATOM   10227 H HA   . THR A 1 27 ? 1.144   -5.703  7.494   1.00 15.00 ?  305 THR A HA   14 
ATOM   10228 H HB   . THR A 1 27 ? -1.242  -5.240  6.810   1.00 15.00 ?  305 THR A HB   14 
ATOM   10229 H HG1  . THR A 1 27 ? -0.769  -2.762  8.172   1.00 15.00 ?  305 THR A HG1  14 
ATOM   10230 H HG21 . THR A 1 27 ? -2.110  -5.190  9.097   1.00 15.00 ?  305 THR A HG21 14 
ATOM   10231 H HG22 . THR A 1 27 ? -0.535  -4.658  9.686   1.00 15.00 ?  305 THR A HG22 14 
ATOM   10232 H HG23 . THR A 1 27 ? -0.713  -6.259  8.968   1.00 15.00 ?  305 THR A HG23 14 
ATOM   10233 N N    . THR A 1 28 ? 0.928   -5.508  4.971   1.00 15.00 ?  306 THR A N    14 
ATOM   10234 C CA   . THR A 1 28 ? 1.011   -5.400  3.522   1.00 15.00 ?  306 THR A CA   14 
ATOM   10235 C C    . THR A 1 28 ? -0.233  -6.007  2.871   1.00 15.00 ?  306 THR A C    14 
ATOM   10236 O O    . THR A 1 28 ? -0.550  -7.177  3.091   1.00 15.00 ?  306 THR A O    14 
ATOM   10237 C CB   . THR A 1 28 ? 2.283   -6.090  2.982   1.00 15.00 ?  306 THR A CB   14 
ATOM   10238 O OG1  . THR A 1 28 ? 2.407   -7.409  3.534   1.00 15.00 ?  306 THR A OG1  14 
ATOM   10239 C CG2  . THR A 1 28 ? 3.523   -5.278  3.320   1.00 15.00 ?  306 THR A CG2  14 
ATOM   10240 H H    . THR A 1 28 ? 0.816   -6.398  5.372   1.00 15.00 ?  306 THR A H    14 
ATOM   10241 H HA   . THR A 1 28 ? 1.060   -4.351  3.271   1.00 15.00 ?  306 THR A HA   14 
ATOM   10242 H HB   . THR A 1 28 ? 2.203   -6.163  1.907   1.00 15.00 ?  306 THR A HB   14 
ATOM   10243 H HG1  . THR A 1 28 ? 3.260   -7.778  3.281   1.00 15.00 ?  306 THR A HG1  14 
ATOM   10244 H HG21 . THR A 1 28 ? 4.396   -5.773  2.926   1.00 15.00 ?  306 THR A HG21 14 
ATOM   10245 H HG22 . THR A 1 28 ? 3.613   -5.189  4.392   1.00 15.00 ?  306 THR A HG22 14 
ATOM   10246 H HG23 . THR A 1 28 ? 3.440   -4.293  2.884   1.00 15.00 ?  306 THR A HG23 14 
ATOM   10247 N N    . GLN A 1 29 ? -0.948  -5.204  2.089   1.00 15.00 ?  307 GLN A N    14 
ATOM   10248 C CA   . GLN A 1 29 ? -2.224  -5.628  1.511   1.00 15.00 ?  307 GLN A CA   14 
ATOM   10249 C C    . GLN A 1 29 ? -2.431  -5.037  0.116   1.00 15.00 ?  307 GLN A C    14 
ATOM   10250 O O    . GLN A 1 29 ? -2.250  -3.845  -0.082  1.00 15.00 ?  307 GLN A O    14 
ATOM   10251 C CB   . GLN A 1 29 ? -3.385  -5.203  2.425   1.00 15.00 ?  307 GLN A CB   14 
ATOM   10252 C CG   . GLN A 1 29 ? -2.996  -4.249  3.552   1.00 15.00 ?  307 GLN A CG   14 
ATOM   10253 C CD   . GLN A 1 29 ? -4.132  -4.011  4.533   1.00 15.00 ?  307 GLN A CD   14 
ATOM   10254 O OE1  . GLN A 1 29 ? -5.306  -4.083  4.172   1.00 15.00 ?  307 GLN A OE1  14 
ATOM   10255 N NE2  . GLN A 1 29 ? -3.792  -3.714  5.780   1.00 15.00 ?  307 GLN A NE2  14 
ATOM   10256 H H    . GLN A 1 29 ? -0.612  -4.303  1.896   1.00 15.00 ?  307 GLN A H    14 
ATOM   10257 H HA   . GLN A 1 29 ? -2.213  -6.704  1.435   1.00 15.00 ?  307 GLN A HA   14 
ATOM   10258 H HB2  . GLN A 1 29 ? -4.124  -4.701  1.818   1.00 15.00 ?  307 GLN A HB2  14 
ATOM   10259 H HB3  . GLN A 1 29 ? -3.829  -6.085  2.862   1.00 15.00 ?  307 GLN A HB3  14 
ATOM   10260 H HG2  . GLN A 1 29 ? -2.158  -4.668  4.089   1.00 15.00 ?  307 GLN A HG2  14 
ATOM   10261 H HG3  . GLN A 1 29 ? -2.708  -3.301  3.121   1.00 15.00 ?  307 GLN A HG3  14 
ATOM   10262 H HE21 . GLN A 1 29 ? -2.836  -3.660  6.006   1.00 15.00 ?  307 GLN A HE21 14 
ATOM   10263 H HE22 . GLN A 1 29 ? -4.511  -3.561  6.431   1.00 15.00 ?  307 GLN A HE22 14 
ATOM   10264 N N    . PHE A 1 30 ? -2.833  -5.871  -0.843  1.00 15.00 ?  308 PHE A N    14 
ATOM   10265 C CA   . PHE A 1 30 ? -3.136  -5.393  -2.196  1.00 15.00 ?  308 PHE A CA   14 
ATOM   10266 C C    . PHE A 1 30 ? -4.482  -4.680  -2.272  1.00 15.00 ?  308 PHE A C    14 
ATOM   10267 O O    . PHE A 1 30 ? -4.784  -4.023  -3.267  1.00 15.00 ?  308 PHE A O    14 
ATOM   10268 C CB   . PHE A 1 30 ? -3.103  -6.530  -3.225  1.00 15.00 ?  308 PHE A CB   14 
ATOM   10269 C CG   . PHE A 1 30 ? -1.756  -6.739  -3.856  1.00 15.00 ?  308 PHE A CG   14 
ATOM   10270 C CD1  . PHE A 1 30 ? -1.002  -5.647  -4.257  1.00 15.00 ?  308 PHE A CD1  14 
ATOM   10271 C CD2  . PHE A 1 30 ? -1.251  -8.011  -4.076  1.00 15.00 ?  308 PHE A CD2  14 
ATOM   10272 C CE1  . PHE A 1 30 ? 0.227   -5.819  -4.860  1.00 15.00 ?  308 PHE A CE1  14 
ATOM   10273 C CE2  . PHE A 1 30 ? -0.025  -8.183  -4.674  1.00 15.00 ?  308 PHE A CE2  14 
ATOM   10274 C CZ   . PHE A 1 30 ? 0.715   -7.086  -5.066  1.00 15.00 ?  308 PHE A CZ   14 
ATOM   10275 H H    . PHE A 1 30 ? -2.928  -6.831  -0.640  1.00 15.00 ?  308 PHE A H    14 
ATOM   10276 H HA   . PHE A 1 30 ? -2.369  -4.681  -2.457  1.00 15.00 ?  308 PHE A HA   14 
ATOM   10277 H HB2  . PHE A 1 30 ? -3.388  -7.452  -2.740  1.00 15.00 ?  308 PHE A HB2  14 
ATOM   10278 H HB3  . PHE A 1 30 ? -3.810  -6.312  -4.013  1.00 15.00 ?  308 PHE A HB3  14 
ATOM   10279 H HD1  . PHE A 1 30 ? -1.383  -4.652  -4.090  1.00 15.00 ?  308 PHE A HD1  14 
ATOM   10280 H HD2  . PHE A 1 30 ? -1.822  -8.875  -3.779  1.00 15.00 ?  308 PHE A HD2  14 
ATOM   10281 H HE1  . PHE A 1 30 ? 0.806   -4.961  -5.172  1.00 15.00 ?  308 PHE A HE1  14 
ATOM   10282 H HE2  . PHE A 1 30 ? 0.360   -9.180  -4.835  1.00 15.00 ?  308 PHE A HE2  14 
ATOM   10283 H HZ   . PHE A 1 30 ? 1.677   -7.226  -5.536  1.00 15.00 ?  308 PHE A HZ   14 
ATOM   10284 N N    . THR A 1 31 ? -5.306  -4.840  -1.250  1.00 15.00 ?  309 THR A N    14 
ATOM   10285 C CA   . THR A 1 31 ? -6.623  -4.228  -1.255  1.00 15.00 ?  309 THR A CA   14 
ATOM   10286 C C    . THR A 1 31 ? -6.534  -2.735  -0.920  1.00 15.00 ?  309 THR A C    14 
ATOM   10287 O O    . THR A 1 31 ? -5.827  -2.332  0.005   1.00 15.00 ?  309 THR A O    14 
ATOM   10288 C CB   . THR A 1 31 ? -7.588  -4.942  -0.278  1.00 15.00 ?  309 THR A CB   14 
ATOM   10289 O OG1  . THR A 1 31 ? -8.928  -4.467  -0.467  1.00 15.00 ?  309 THR A OG1  14 
ATOM   10290 C CG2  . THR A 1 31 ? -7.173  -4.730  1.173   1.00 15.00 ?  309 THR A CG2  14 
ATOM   10291 H H    . THR A 1 31 ? -5.021  -5.370  -0.479  1.00 15.00 ?  309 THR A H    14 
ATOM   10292 H HA   . THR A 1 31 ? -7.024  -4.331  -2.254  1.00 15.00 ?  309 THR A HA   14 
ATOM   10293 H HB   . THR A 1 31 ? -7.564  -6.003  -0.488  1.00 15.00 ?  309 THR A HB   14 
ATOM   10294 H HG1  . THR A 1 31 ? -9.083  -3.696  0.102   1.00 15.00 ?  309 THR A HG1  14 
ATOM   10295 H HG21 . THR A 1 31 ? -7.858  -5.255  1.823   1.00 15.00 ?  309 THR A HG21 14 
ATOM   10296 H HG22 . THR A 1 31 ? -7.194  -3.677  1.403   1.00 15.00 ?  309 THR A HG22 14 
ATOM   10297 H HG23 . THR A 1 31 ? -6.173  -5.111  1.321   1.00 15.00 ?  309 THR A HG23 14 
ATOM   10298 N N    . ASP A 1 32 ? -7.237  -1.921  -1.696  1.00 15.00 ?  310 ASP A N    14 
ATOM   10299 C CA   . ASP A 1 32 ? -7.275  -0.482  -1.465  1.00 15.00 ?  310 ASP A CA   14 
ATOM   10300 C C    . ASP A 1 32 ? -8.697  -0.058  -1.118  1.00 15.00 ?  310 ASP A C    14 
ATOM   10301 O O    . ASP A 1 32 ? -9.642  -0.415  -1.818  1.00 15.00 ?  310 ASP A O    14 
ATOM   10302 C CB   . ASP A 1 32 ? -6.773  0.274   -2.703  1.00 15.00 ?  310 ASP A CB   14 
ATOM   10303 C CG   . ASP A 1 32 ? -6.757  1.780   -2.511  1.00 15.00 ?  310 ASP A CG   14 
ATOM   10304 O OD1  . ASP A 1 32 ? -7.838  2.394   -2.471  1.00 15.00 -1 310 ASP A OD1  14 
ATOM   10305 O OD2  . ASP A 1 32 ? -5.661  2.364   -2.399  1.00 15.00 ?  310 ASP A OD2  14 
ATOM   10306 H H    . ASP A 1 32 ? -7.747  -2.294  -2.442  1.00 15.00 ?  310 ASP A H    14 
ATOM   10307 H HA   . ASP A 1 32 ? -6.632  -0.265  -0.627  1.00 15.00 ?  310 ASP A HA   14 
ATOM   10308 H HB2  . ASP A 1 32 ? -5.769  -0.049  -2.928  1.00 15.00 ?  310 ASP A HB2  14 
ATOM   10309 H HB3  . ASP A 1 32 ? -7.416  0.044   -3.546  1.00 15.00 ?  310 ASP A HB3  14 
ATOM   10310 N N    . PRO A 1 33 ? -8.865  0.711   -0.032  1.00 15.00 ?  311 PRO A N    14 
ATOM   10311 C CA   . PRO A 1 33 ? -10.187 1.111   0.469   1.00 15.00 ?  311 PRO A CA   14 
ATOM   10312 C C    . PRO A 1 33 ? -10.948 2.061   -0.460  1.00 15.00 ?  311 PRO A C    14 
ATOM   10313 O O    . PRO A 1 33 ? -12.150 2.266   -0.288  1.00 15.00 ?  311 PRO A O    14 
ATOM   10314 C CB   . PRO A 1 33 ? -9.876  1.807   1.796   1.00 15.00 ?  311 PRO A CB   14 
ATOM   10315 C CG   . PRO A 1 33 ? -8.461  2.259   1.672   1.00 15.00 ?  311 PRO A CG   14 
ATOM   10316 C CD   . PRO A 1 33 ? -7.775  1.242   0.806   1.00 15.00 ?  311 PRO A CD   14 
ATOM   10317 H HA   . PRO A 1 33 ? -10.805 0.246   0.661   1.00 15.00 ?  311 PRO A HA   14 
ATOM   10318 H HB2  . PRO A 1 33 ? -10.548 2.642   1.932   1.00 15.00 ?  311 PRO A HB2  14 
ATOM   10319 H HB3  . PRO A 1 33 ? -9.997  1.106   2.608   1.00 15.00 ?  311 PRO A HB3  14 
ATOM   10320 H HG2  . PRO A 1 33 ? -8.424  3.232   1.206   1.00 15.00 ?  311 PRO A HG2  14 
ATOM   10321 H HG3  . PRO A 1 33 ? -7.998  2.291   2.647   1.00 15.00 ?  311 PRO A HG3  14 
ATOM   10322 H HD2  . PRO A 1 33 ? -7.018  1.715   0.199   1.00 15.00 ?  311 PRO A HD2  14 
ATOM   10323 H HD3  . PRO A 1 33 ? -7.339  0.462   1.415   1.00 15.00 ?  311 PRO A HD3  14 
ATOM   10324 N N    . ARG A 1 34 ? -10.256 2.655   -1.425  1.00 15.00 ?  312 ARG A N    14 
ATOM   10325 C CA   . ARG A 1 34 ? -10.888 3.597   -2.346  1.00 15.00 ?  312 ARG A CA   14 
ATOM   10326 C C    . ARG A 1 34 ? -11.305 2.891   -3.628  1.00 15.00 ?  312 ARG A C    14 
ATOM   10327 O O    . ARG A 1 34 ? -12.063 3.434   -4.435  1.00 15.00 ?  312 ARG A O    14 
ATOM   10328 C CB   . ARG A 1 34 ? -9.960  4.769   -2.700  1.00 15.00 ?  312 ARG A CB   14 
ATOM   10329 C CG   . ARG A 1 34 ? -9.683  5.741   -1.561  1.00 15.00 ?  312 ARG A CG   14 
ATOM   10330 C CD   . ARG A 1 34 ? -8.693  5.175   -0.553  1.00 15.00 ?  312 ARG A CD   14 
ATOM   10331 N NE   . ARG A 1 34 ? -7.448  4.745   -1.188  1.00 15.00 ?  312 ARG A NE   14 
ATOM   10332 C CZ   . ARG A 1 34 ? -6.376  5.520   -1.347  1.00 15.00 ?  312 ARG A CZ   14 
ATOM   10333 N NH1  . ARG A 1 34 ? -6.401  6.793   -0.965  1.00 15.00 1  312 ARG A NH1  14 
ATOM   10334 N NH2  . ARG A 1 34 ? -5.278  5.019   -1.896  1.00 15.00 ?  312 ARG A NH2  14 
ATOM   10335 H H    . ARG A 1 34 ? -9.299  2.438   -1.540  1.00 15.00 ?  312 ARG A H    14 
ATOM   10336 H HA   . ARG A 1 34 ? -11.773 3.985   -1.862  1.00 15.00 ?  312 ARG A HA   14 
ATOM   10337 H HB2  . ARG A 1 34 ? -9.013  4.370   -3.029  1.00 15.00 ?  312 ARG A HB2  14 
ATOM   10338 H HB3  . ARG A 1 34 ? -10.402 5.324   -3.513  1.00 15.00 ?  312 ARG A HB3  14 
ATOM   10339 H HG2  . ARG A 1 34 ? -9.277  6.653   -1.973  1.00 15.00 ?  312 ARG A HG2  14 
ATOM   10340 H HG3  . ARG A 1 34 ? -10.612 5.957   -1.055  1.00 15.00 ?  312 ARG A HG3  14 
ATOM   10341 H HD2  . ARG A 1 34 ? -8.469  5.934   0.179   1.00 15.00 ?  312 ARG A HD2  14 
ATOM   10342 H HD3  . ARG A 1 34 ? -9.147  4.326   -0.063  1.00 15.00 ?  312 ARG A HD3  14 
ATOM   10343 H HE   . ARG A 1 34 ? -7.408  3.807   -1.515  1.00 15.00 ?  312 ARG A HE   14 
ATOM   10344 H HH11 . ARG A 1 34 ? -7.232  7.183   -0.549  1.00 15.00 ?  312 ARG A HH11 14 
ATOM   10345 H HH12 . ARG A 1 34 ? -5.592  7.381   -1.105  1.00 15.00 ?  312 ARG A HH12 14 
ATOM   10346 H HH21 . ARG A 1 34 ? -5.257  4.049   -2.191  1.00 15.00 ?  312 ARG A HH21 14 
ATOM   10347 H HH22 . ARG A 1 34 ? -4.473  5.599   -2.035  1.00 15.00 ?  312 ARG A HH22 14 
ATOM   10348 N N    . LEU A 1 35 ? -10.778 1.697   -3.827  1.00 15.00 ?  313 LEU A N    14 
ATOM   10349 C CA   . LEU A 1 35 ? -11.051 0.939   -5.033  1.00 15.00 ?  313 LEU A CA   14 
ATOM   10350 C C    . LEU A 1 35 ? -12.132 -0.099  -4.773  1.00 15.00 ?  313 LEU A C    14 
ATOM   10351 O O    . LEU A 1 35 ? -11.811 -1.303  -4.726  1.00 15.00 ?  313 LEU A O    14 
ATOM   10352 C CB   . LEU A 1 35 ? -9.764  0.268   -5.523  1.00 15.00 ?  313 LEU A CB   14 
ATOM   10353 C CG   . LEU A 1 35 ? -8.638  1.231   -5.903  1.00 15.00 ?  313 LEU A CG   14 
ATOM   10354 C CD1  . LEU A 1 35 ? -7.341  0.471   -6.131  1.00 15.00 ?  313 LEU A CD1  14 
ATOM   10355 C CD2  . LEU A 1 35 ? -9.014  2.033   -7.142  1.00 15.00 ?  313 LEU A CD2  14 
ATOM   10356 H H    . LEU A 1 35 ? -10.197 1.309   -3.139  1.00 15.00 ?  313 LEU A H    14 
ATOM   10357 H HA   . LEU A 1 35 ? -11.398 1.628   -5.788  1.00 15.00 ?  313 LEU A HA   14 
ATOM   10358 H HB2  . LEU A 1 35 ? -9.404  -0.385  -4.740  1.00 15.00 ?  313 LEU A HB2  14 
ATOM   10359 H HB3  . LEU A 1 35 ? -10.002 -0.332  -6.389  1.00 15.00 ?  313 LEU A HB3  14 
ATOM   10360 H HG   . LEU A 1 35 ? -8.477  1.924   -5.091  1.00 15.00 ?  313 LEU A HG   14 
ATOM   10361 H HD11 . LEU A 1 35 ? -7.538  -0.410  -6.720  1.00 15.00 ?  313 LEU A HD11 14 
ATOM   10362 H HD12 . LEU A 1 35 ? -6.924  0.180   -5.178  1.00 15.00 ?  313 LEU A HD12 14 
ATOM   10363 H HD13 . LEU A 1 35 ? -6.639  1.105   -6.654  1.00 15.00 ?  313 LEU A HD13 14 
ATOM   10364 H HD21 . LEU A 1 35 ? -9.205  1.359   -7.965  1.00 15.00 ?  313 LEU A HD21 14 
ATOM   10365 H HD22 . LEU A 1 35 ? -8.202  2.697   -7.401  1.00 15.00 ?  313 LEU A HD22 14 
ATOM   10366 H HD23 . LEU A 1 35 ? -9.902  2.611   -6.936  1.00 15.00 ?  313 LEU A HD23 14 
ATOM   10367 N N    . ASP B 2 2  ? -1.383  -9.084  -9.522  1.00 15.00 ?  221 ASP B N    14 
ATOM   10368 C CA   . ASP B 2 2  ? 0.065   -8.854  -9.346  1.00 15.00 ?  221 ASP B CA   14 
ATOM   10369 C C    . ASP B 2 2  ? 0.636   -9.934  -8.433  1.00 15.00 ?  221 ASP B C    14 
ATOM   10370 O O    . ASP B 2 2  ? -0.096  -10.820 -7.989  1.00 15.00 ?  221 ASP B O    14 
ATOM   10371 C CB   . ASP B 2 2  ? 0.330   -7.459  -8.766  1.00 15.00 ?  221 ASP B CB   14 
ATOM   10372 C CG   . ASP B 2 2  ? 1.673   -6.912  -9.194  1.00 15.00 ?  221 ASP B CG   14 
ATOM   10373 O OD1  . ASP B 2 2  ? 2.696   -7.319  -8.617  1.00 15.00 -1 221 ASP B OD1  14 
ATOM   10374 O OD2  . ASP B 2 2  ? 1.711   -6.064  -10.112 1.00 15.00 ?  221 ASP B OD2  14 
ATOM   10375 H H    . ASP B 2 2  ? -1.857  -9.113  -8.594  1.00 15.00 ?  221 ASP B H    14 
ATOM   10376 H HA   . ASP B 2 2  ? 0.539   -8.933  -10.313 1.00 15.00 ?  221 ASP B HA   14 
ATOM   10377 H HB2  . ASP B 2 2  ? -0.436  -6.778  -9.102  1.00 15.00 ?  221 ASP B HB2  14 
ATOM   10378 H HB3  . ASP B 2 2  ? 0.311   -7.510  -7.688  1.00 15.00 ?  221 ASP B HB3  14 
ATOM   10379 N N    . THR B 2 3  ? 1.929   -9.874  -8.164  1.00 15.00 ?  222 THR B N    14 
ATOM   10380 C CA   . THR B 2 3  ? 2.585   -10.884 -7.348  1.00 15.00 ?  222 THR B CA   14 
ATOM   10381 C C    . THR B 2 3  ? 2.461   -10.510 -5.869  1.00 15.00 ?  222 THR B C    14 
ATOM   10382 O O    . THR B 2 3  ? 2.463   -9.328  -5.540  1.00 15.00 ?  222 THR B O    14 
ATOM   10383 C CB   . THR B 2 3  ? 4.072   -11.046 -7.769  1.00 15.00 ?  222 THR B CB   14 
ATOM   10384 O OG1  . THR B 2 3  ? 4.618   -12.268 -7.256  1.00 15.00 ?  222 THR B OG1  14 
ATOM   10385 C CG2  . THR B 2 3  ? 4.918   -9.871  -7.294  1.00 15.00 ?  222 THR B CG2  14 
ATOM   10386 H H    . THR B 2 3  ? 2.456   -9.110  -8.499  1.00 15.00 ?  222 THR B H    14 
ATOM   10387 H HA   . THR B 2 3  ? 2.071   -11.819 -7.505  1.00 15.00 ?  222 THR B HA   14 
ATOM   10388 H HB   . THR B 2 3  ? 4.116   -11.078 -8.849  1.00 15.00 ?  222 THR B HB   14 
ATOM   10389 H HG1  . THR B 2 3  ? 5.585   -12.212 -7.250  1.00 15.00 ?  222 THR B HG1  14 
ATOM   10390 H HG21 . THR B 2 3  ? 4.532   -8.956  -7.720  1.00 15.00 ?  222 THR B HG21 14 
ATOM   10391 H HG22 . THR B 2 3  ? 5.941   -10.013 -7.610  1.00 15.00 ?  222 THR B HG22 14 
ATOM   10392 H HG23 . THR B 2 3  ? 4.879   -9.812  -6.216  1.00 15.00 ?  222 THR B HG23 14 
ATOM   10393 N N    . PRO B 2 4  ? 2.375   -11.514 -4.964  1.00 15.00 ?  223 PRO B N    14 
ATOM   10394 C CA   . PRO B 2 4  ? 2.016   -11.305 -3.551  1.00 15.00 ?  223 PRO B CA   14 
ATOM   10395 C C    . PRO B 2 4  ? 2.807   -10.178 -2.887  1.00 15.00 ?  223 PRO B C    14 
ATOM   10396 O O    . PRO B 2 4  ? 4.005   -10.011 -3.139  1.00 15.00 ?  223 PRO B O    14 
ATOM   10397 C CB   . PRO B 2 4  ? 2.352   -12.652 -2.886  1.00 15.00 ?  223 PRO B CB   14 
ATOM   10398 C CG   . PRO B 2 4  ? 3.079   -13.446 -3.920  1.00 15.00 ?  223 PRO B CG   14 
ATOM   10399 C CD   . PRO B 2 4  ? 2.600   -12.935 -5.243  1.00 15.00 ?  223 PRO B CD   14 
ATOM   10400 H HA   . PRO B 2 4  ? 0.960   -11.106 -3.449  1.00 15.00 ?  223 PRO B HA   14 
ATOM   10401 H HB2  . PRO B 2 4  ? 2.969   -12.479 -2.018  1.00 15.00 ?  223 PRO B HB2  14 
ATOM   10402 H HB3  . PRO B 2 4  ? 1.436   -13.142 -2.590  1.00 15.00 ?  223 PRO B HB3  14 
ATOM   10403 H HG2  . PRO B 2 4  ? 4.142   -13.291 -3.821  1.00 15.00 ?  223 PRO B HG2  14 
ATOM   10404 H HG3  . PRO B 2 4  ? 2.841   -14.494 -3.814  1.00 15.00 ?  223 PRO B HG3  14 
ATOM   10405 H HD2  . PRO B 2 4  ? 3.357   -13.070 -6.002  1.00 15.00 ?  223 PRO B HD2  14 
ATOM   10406 H HD3  . PRO B 2 4  ? 1.679   -13.424 -5.528  1.00 15.00 ?  223 PRO B HD3  14 
ATOM   10407 N N    . PRO B 2 5  ? 2.137   -9.424  -1.988  1.00 15.00 ?  224 PRO B N    14 
ATOM   10408 C CA   . PRO B 2 5  ? 2.636   -8.149  -1.464  1.00 15.00 ?  224 PRO B CA   14 
ATOM   10409 C C    . PRO B 2 5  ? 4.075   -8.208  -0.964  1.00 15.00 ?  224 PRO B C    14 
ATOM   10410 O O    . PRO B 2 5  ? 4.420   -9.018  -0.099  1.00 15.00 ?  224 PRO B O    14 
ATOM   10411 C CB   . PRO B 2 5  ? 1.683   -7.805  -0.311  1.00 15.00 ?  224 PRO B CB   14 
ATOM   10412 C CG   . PRO B 2 5  ? 0.840   -9.015  -0.095  1.00 15.00 ?  224 PRO B CG   14 
ATOM   10413 C CD   . PRO B 2 5  ? 0.845   -9.781  -1.385  1.00 15.00 ?  224 PRO B CD   14 
ATOM   10414 H HA   . PRO B 2 5  ? 2.567   -7.376  -2.217  1.00 15.00 ?  224 PRO B HA   14 
ATOM   10415 H HB2  . PRO B 2 5  ? 2.260   -7.568  0.571   1.00 15.00 ?  224 PRO B HB2  14 
ATOM   10416 H HB3  . PRO B 2 5  ? 1.080   -6.951  -0.587  1.00 15.00 ?  224 PRO B HB3  14 
ATOM   10417 H HG2  . PRO B 2 5  ? 1.259   -9.617  0.697   1.00 15.00 ?  224 PRO B HG2  14 
ATOM   10418 H HG3  . PRO B 2 5  ? -0.167  -8.714  0.155   1.00 15.00 ?  224 PRO B HG3  14 
ATOM   10419 H HD2  . PRO B 2 5  ? 0.790   -10.842 -1.187  1.00 15.00 ?  224 PRO B HD2  14 
ATOM   10420 H HD3  . PRO B 2 5  ? 0.025   -9.470  -2.016  1.00 15.00 ?  224 PRO B HD3  14 
ATOM   10421 N N    . PRO B 2 6  ? 4.927   -7.351  -1.545  1.00 15.00 ?  225 PRO B N    14 
ATOM   10422 C CA   . PRO B 2 6  ? 6.320   -7.163  -1.115  1.00 15.00 ?  225 PRO B CA   14 
ATOM   10423 C C    . PRO B 2 6  ? 6.439   -6.726  0.344   1.00 15.00 ?  225 PRO B C    14 
ATOM   10424 O O    . PRO B 2 6  ? 5.436   -6.549  1.038   1.00 15.00 ?  225 PRO B O    14 
ATOM   10425 C CB   . PRO B 2 6  ? 6.816   -6.026  -2.015  1.00 15.00 ?  225 PRO B CB   14 
ATOM   10426 C CG   . PRO B 2 6  ? 5.928   -6.052  -3.205  1.00 15.00 ?  225 PRO B CG   14 
ATOM   10427 C CD   . PRO B 2 6  ? 4.592   -6.514  -2.711  1.00 15.00 ?  225 PRO B CD   14 
ATOM   10428 H HA   . PRO B 2 6  ? 6.916   -8.048  -1.283  1.00 15.00 ?  225 PRO B HA   14 
ATOM   10429 H HB2  . PRO B 2 6  ? 6.735   -5.086  -1.488  1.00 15.00 ?  225 PRO B HB2  14 
ATOM   10430 H HB3  . PRO B 2 6  ? 7.838   -6.201  -2.286  1.00 15.00 ?  225 PRO B HB3  14 
ATOM   10431 H HG2  . PRO B 2 6  ? 5.850   -5.060  -3.629  1.00 15.00 ?  225 PRO B HG2  14 
ATOM   10432 H HG3  . PRO B 2 6  ? 6.315   -6.740  -3.934  1.00 15.00 ?  225 PRO B HG3  14 
ATOM   10433 H HD2  . PRO B 2 6  ? 3.986   -5.670  -2.417  1.00 15.00 ?  225 PRO B HD2  14 
ATOM   10434 H HD3  . PRO B 2 6  ? 4.089   -7.095  -3.471  1.00 15.00 ?  225 PRO B HD3  14 
ATOM   10435 N N    . ALA B 2 7  ? 7.677   -6.539  0.794   1.00 15.00 ?  226 ALA B N    14 
ATOM   10436 C CA   . ALA B 2 7  ? 7.935   -5.953  2.101   1.00 15.00 ?  226 ALA B CA   14 
ATOM   10437 C C    . ALA B 2 7  ? 7.383   -4.534  2.143   1.00 15.00 ?  226 ALA B C    14 
ATOM   10438 O O    . ALA B 2 7  ? 7.152   -3.925  1.093   1.00 15.00 ?  226 ALA B O    14 
ATOM   10439 C CB   . ALA B 2 7  ? 9.427   -5.953  2.393   1.00 15.00 ?  226 ALA B CB   14 
ATOM   10440 H H    . ALA B 2 7  ? 8.433   -6.799  0.230   1.00 15.00 ?  226 ALA B H    14 
ATOM   10441 H HA   . ALA B 2 7  ? 7.436   -6.552  2.848   1.00 15.00 ?  226 ALA B HA   14 
ATOM   10442 H HB1  . ALA B 2 7  ? 9.937   -5.348  1.658   1.00 15.00 ?  226 ALA B HB1  14 
ATOM   10443 H HB2  . ALA B 2 7  ? 9.804   -6.965  2.350   1.00 15.00 ?  226 ALA B HB2  14 
ATOM   10444 H HB3  . ALA B 2 7  ? 9.602   -5.545  3.378   1.00 15.00 ?  226 ALA B HB3  14 
ATOM   10445 N N    . TYR B 2 8  ? 7.185   -3.990  3.334   1.00 15.00 ?  227 TYR B N    14 
ATOM   10446 C CA   . TYR B 2 8  ? 6.554   -2.691  3.429   1.00 15.00 ?  227 TYR B CA   14 
ATOM   10447 C C    . TYR B 2 8  ? 7.616   -1.590  3.390   1.00 15.00 ?  227 TYR B C    14 
ATOM   10448 O O    . TYR B 2 8  ? 8.581   -1.593  4.158   1.00 15.00 ?  227 TYR B O    14 
ATOM   10449 C CB   . TYR B 2 8  ? 5.684   -2.562  4.693   1.00 15.00 ?  227 TYR B CB   14 
ATOM   10450 C CG   . TYR B 2 8  ? 6.413   -2.030  5.898   1.00 15.00 ?  227 TYR B CG   14 
ATOM   10451 C CD1  . TYR B 2 8  ? 7.109   -2.855  6.768   1.00 15.00 ?  227 TYR B CD1  14 
ATOM   10452 C CD2  . TYR B 2 8  ? 6.417   -0.666  6.137   1.00 15.00 ?  227 TYR B CD2  14 
ATOM   10453 C CE1  . TYR B 2 8  ? 7.794   -2.330  7.847   1.00 15.00 ?  227 TYR B CE1  14 
ATOM   10454 C CE2  . TYR B 2 8  ? 7.091   -0.129  7.209   1.00 15.00 ?  227 TYR B CE2  14 
ATOM   10455 C CZ   . TYR B 2 8  ? 7.781   -0.966  8.067   1.00 15.00 ?  227 TYR B CZ   14 
ATOM   10456 O OH   . TYR B 2 8  ? 8.461   -0.437  9.139   1.00 15.00 ?  227 TYR B OH   14 
ATOM   10457 H H    . TYR B 2 8  ? 7.467   -4.460  4.142   1.00 15.00 ?  227 TYR B H    14 
ATOM   10458 H HA   . TYR B 2 8  ? 5.920   -2.579  2.561   1.00 15.00 ?  227 TYR B HA   14 
ATOM   10459 H HB2  . TYR B 2 8  ? 4.868   -1.888  4.482   1.00 15.00 ?  227 TYR B HB2  14 
ATOM   10460 H HB3  . TYR B 2 8  ? 5.285   -3.535  4.944   1.00 15.00 ?  227 TYR B HB3  14 
ATOM   10461 H HD1  . TYR B 2 8  ? 7.112   -3.919  6.597   1.00 15.00 ?  227 TYR B HD1  14 
ATOM   10462 H HD2  . TYR B 2 8  ? 5.871   -0.015  5.459   1.00 15.00 ?  227 TYR B HD2  14 
ATOM   10463 H HE1  . TYR B 2 8  ? 8.331   -2.991  8.515   1.00 15.00 ?  227 TYR B HE1  14 
ATOM   10464 H HE2  . TYR B 2 8  ? 7.074   0.946   7.366   1.00 15.00 ?  227 TYR B HE2  14 
ATOM   10465 H HH   . TYR B 2 8  ? 9.306   -0.903  9.242   1.00 15.00 ?  227 TYR B HH   14 
ATOM   10466 N N    . LEU B 2 9  ? 7.444   -0.676  2.459   1.00 15.00 ?  228 LEU B N    14 
ATOM   10467 C CA   . LEU B 2 9  ? 8.315   0.478   2.313   1.00 15.00 ?  228 LEU B CA   14 
ATOM   10468 C C    . LEU B 2 9  ? 7.465   1.732   2.221   1.00 15.00 ?  228 LEU B C    14 
ATOM   10469 O O    . LEU B 2 9  ? 6.310   1.646   1.867   1.00 15.00 ?  228 LEU B O    14 
ATOM   10470 C CB   . LEU B 2 9  ? 9.222   0.364   1.073   1.00 15.00 ?  228 LEU B CB   14 
ATOM   10471 C CG   . LEU B 2 9  ? 10.390  -0.633  1.149   1.00 15.00 ?  228 LEU B CG   14 
ATOM   10472 C CD1  . LEU B 2 9  ? 11.161  -0.479  2.454   1.00 15.00 ?  228 LEU B CD1  14 
ATOM   10473 C CD2  . LEU B 2 9  ? 9.906   -2.065  0.965   1.00 15.00 ?  228 LEU B CD2  14 
ATOM   10474 H H    . LEU B 2 9  ? 6.692   -0.775  1.836   1.00 15.00 ?  228 LEU B H    14 
ATOM   10475 H HA   . LEU B 2 9  ? 8.911   0.543   3.212   1.00 15.00 ?  228 LEU B HA   14 
ATOM   10476 H HB2  . LEU B 2 9  ? 8.601   0.084   0.236   1.00 15.00 ?  228 LEU B HB2  14 
ATOM   10477 H HB3  . LEU B 2 9  ? 9.634   1.344   0.872   1.00 15.00 ?  228 LEU B HB3  14 
ATOM   10478 H HG   . LEU B 2 9  ? 11.079  -0.416  0.344   1.00 15.00 ?  228 LEU B HG   14 
ATOM   10479 H HD11 . LEU B 2 9  ? 11.579  0.515   2.508   1.00 15.00 ?  228 LEU B HD11 14 
ATOM   10480 H HD12 . LEU B 2 9  ? 11.958  -1.206  2.492   1.00 15.00 ?  228 LEU B HD12 14 
ATOM   10481 H HD13 . LEU B 2 9  ? 10.493  -0.634  3.288   1.00 15.00 ?  228 LEU B HD13 14 
ATOM   10482 H HD21 . LEU B 2 9  ? 9.418   -2.158  0.006   1.00 15.00 ?  228 LEU B HD21 14 
ATOM   10483 H HD22 . LEU B 2 9  ? 9.209   -2.315  1.750   1.00 15.00 ?  228 LEU B HD22 14 
ATOM   10484 H HD23 . LEU B 2 9  ? 10.750  -2.736  1.006   1.00 15.00 ?  228 LEU B HD23 14 
ATOM   10485 N N    . PRO B 2 10 ? 8.019   2.921   2.464   1.00 15.00 ?  229 PRO B N    14 
ATOM   10486 C CA   . PRO B 2 10 ? 7.217   4.141   2.514   1.00 15.00 ?  229 PRO B CA   14 
ATOM   10487 C C    . PRO B 2 10 ? 7.071   4.752   1.130   1.00 15.00 ?  229 PRO B C    14 
ATOM   10488 O O    . PRO B 2 10 ? 7.870   4.482   0.234   1.00 15.00 ?  229 PRO B O    14 
ATOM   10489 C CB   . PRO B 2 10 ? 8.067   5.080   3.396   1.00 15.00 ?  229 PRO B CB   14 
ATOM   10490 C CG   . PRO B 2 10 ? 9.202   4.250   3.897   1.00 15.00 ?  229 PRO B CG   14 
ATOM   10491 C CD   . PRO B 2 10 ? 9.393   3.165   2.885   1.00 15.00 ?  229 PRO B CD   14 
ATOM   10492 H HA   . PRO B 2 10 ? 6.250   3.974   2.961   1.00 15.00 ?  229 PRO B HA   14 
ATOM   10493 H HB2  . PRO B 2 10 ? 8.422   5.908   2.802   1.00 15.00 ?  229 PRO B HB2  14 
ATOM   10494 H HB3  . PRO B 2 10 ? 7.465   5.451   4.212   1.00 15.00 ?  229 PRO B HB3  14 
ATOM   10495 H HG2  . PRO B 2 10 ? 10.085  4.850   3.973   1.00 15.00 ?  229 PRO B HG2  14 
ATOM   10496 H HG3  . PRO B 2 10 ? 8.952   3.825   4.858   1.00 15.00 ?  229 PRO B HG3  14 
ATOM   10497 H HD2  . PRO B 2 10 ? 10.005  3.503   2.069   1.00 15.00 ?  229 PRO B HD2  14 
ATOM   10498 H HD3  . PRO B 2 10 ? 9.812   2.289   3.348   1.00 15.00 ?  229 PRO B HD3  14 
ATOM   10499 N N    . PRO B 2 11 ? 6.057   5.610   0.944   1.00 15.00 ?  230 PRO B N    14 
ATOM   10500 C CA   . PRO B 2 11 ? 5.368   5.712   -0.334  1.00 15.00 ?  230 PRO B CA   14 
ATOM   10501 C C    . PRO B 2 11 ? 5.955   6.703   -1.325  1.00 15.00 ?  230 PRO B C    14 
ATOM   10502 O O    . PRO B 2 11 ? 6.219   7.867   -1.016  1.00 15.00 ?  230 PRO B O    14 
ATOM   10503 C CB   . PRO B 2 11 ? 3.985   6.186   0.108   1.00 15.00 ?  230 PRO B CB   14 
ATOM   10504 C CG   . PRO B 2 11 ? 4.240   7.062   1.285   1.00 15.00 ?  230 PRO B CG   14 
ATOM   10505 C CD   . PRO B 2 11 ? 5.466   6.512   1.962   1.00 15.00 ?  230 PRO B CD   14 
ATOM   10506 H HA   . PRO B 2 11 ? 5.270   4.748   -0.809  1.00 15.00 ?  230 PRO B HA   14 
ATOM   10507 H HB2  . PRO B 2 11 ? 3.515   6.731   -0.693  1.00 15.00 ?  230 PRO B HB2  14 
ATOM   10508 H HB3  . PRO B 2 11 ? 3.379   5.334   0.376   1.00 15.00 ?  230 PRO B HB3  14 
ATOM   10509 H HG2  . PRO B 2 11 ? 4.418   8.076   0.956   1.00 15.00 ?  230 PRO B HG2  14 
ATOM   10510 H HG3  . PRO B 2 11 ? 3.397   7.028   1.959   1.00 15.00 ?  230 PRO B HG3  14 
ATOM   10511 H HD2  . PRO B 2 11 ? 6.143   7.310   2.219   1.00 15.00 ?  230 PRO B HD2  14 
ATOM   10512 H HD3  . PRO B 2 11 ? 5.184   5.964   2.846   1.00 15.00 ?  230 PRO B HD3  14 
ATOM   10513 N N    . GLU B 2 12 ? 6.165   6.186   -2.527  1.00 15.00 ?  231 GLU B N    14 
ATOM   10514 C CA   . GLU B 2 12 ? 6.563   6.979   -3.668  1.00 15.00 ?  231 GLU B CA   14 
ATOM   10515 C C    . GLU B 2 12 ? 5.435   6.940   -4.711  1.00 15.00 ?  231 GLU B C    14 
ATOM   10516 O O    . GLU B 2 12 ? 5.273   5.948   -5.416  1.00 15.00 ?  231 GLU B O    14 
ATOM   10517 C CB   . GLU B 2 12 ? 7.882   6.437   -4.248  1.00 15.00 ?  231 GLU B CB   14 
ATOM   10518 C CG   . GLU B 2 12 ? 7.845   4.967   -4.668  1.00 15.00 ?  231 GLU B CG   14 
ATOM   10519 C CD   . GLU B 2 12 ? 9.224   4.407   -4.928  1.00 15.00 ?  231 GLU B CD   14 
ATOM   10520 O OE1  . GLU B 2 12 ? 9.848   3.902   -3.974  1.00 15.00 ?  231 GLU B OE1  14 
ATOM   10521 O OE2  . GLU B 2 12 ? 9.694   4.468   -6.080  1.00 15.00 -1 231 GLU B OE2  14 
ATOM   10522 H H    . GLU B 2 12 ? 6.039   5.224   -2.649  1.00 15.00 ?  231 GLU B H    14 
ATOM   10523 H HA   . GLU B 2 12 ? 6.717   7.994   -3.331  1.00 15.00 ?  231 GLU B HA   14 
ATOM   10524 H HB2  . GLU B 2 12 ? 8.146   7.025   -5.114  1.00 15.00 ?  231 GLU B HB2  14 
ATOM   10525 H HB3  . GLU B 2 12 ? 8.657   6.553   -3.502  1.00 15.00 ?  231 GLU B HB3  14 
ATOM   10526 H HG2  . GLU B 2 12 ? 7.376   4.381   -3.891  1.00 15.00 ?  231 GLU B HG2  14 
ATOM   10527 H HG3  . GLU B 2 12 ? 7.265   4.884   -5.577  1.00 15.00 ?  231 GLU B HG3  14 
ATOM   10528 N N    . ASP B 2 13 ? 4.609   7.980   -4.773  1.00 15.00 ?  232 ASP B N    14 
ATOM   10529 C CA   . ASP B 2 13 ? 3.466   7.966   -5.676  1.00 15.00 ?  232 ASP B CA   14 
ATOM   10530 C C    . ASP B 2 13 ? 3.575   9.080   -6.705  1.00 15.00 ?  232 ASP B C    14 
ATOM   10531 O O    . ASP B 2 13 ? 3.568   10.263  -6.357  1.00 15.00 ?  232 ASP B O    14 
ATOM   10532 C CB   . ASP B 2 13 ? 2.156   8.095   -4.891  1.00 15.00 ?  232 ASP B CB   14 
ATOM   10533 C CG   . ASP B 2 13 ? 0.935   8.145   -5.794  1.00 15.00 ?  232 ASP B CG   14 
ATOM   10534 O OD1  . ASP B 2 13 ? 0.674   7.156   -6.516  1.00 15.00 -1 232 ASP B OD1  14 
ATOM   10535 O OD2  . ASP B 2 13 ? 0.229   9.173   -5.785  1.00 15.00 ?  232 ASP B OD2  14 
ATOM   10536 H H    . ASP B 2 13 ? 4.761   8.766   -4.212  1.00 15.00 ?  232 ASP B H    14 
ATOM   10537 H HA   . ASP B 2 13 ? 3.469   7.018   -6.193  1.00 15.00 ?  232 ASP B HA   14 
ATOM   10538 H HB2  . ASP B 2 13 ? 2.053   7.244   -4.232  1.00 15.00 ?  232 ASP B HB2  14 
ATOM   10539 H HB3  . ASP B 2 13 ? 2.184   9.000   -4.303  1.00 15.00 ?  232 ASP B HB3  14 
ATOM   10540 N N    . PRO B 2 14 ? 3.708   8.710   -7.986  1.00 15.00 ?  233 PRO B N    14 
ATOM   10541 C CA   . PRO B 2 14 ? 3.782   9.663   -9.085  1.00 15.00 ?  233 PRO B CA   14 
ATOM   10542 C C    . PRO B 2 14 ? 2.405   10.213  -9.439  1.00 15.00 ?  233 PRO B C    14 
ATOM   10543 O O    . PRO B 2 14 ? 1.740   9.719   -10.350 1.00 15.00 ?  233 PRO B O    14 
ATOM   10544 C CB   . PRO B 2 14 ? 4.354   8.839   -10.254 1.00 15.00 ?  233 PRO B CB   14 
ATOM   10545 C CG   . PRO B 2 14 ? 4.647   7.478   -9.704  1.00 15.00 ?  233 PRO B CG   14 
ATOM   10546 C CD   . PRO B 2 14 ? 3.809   7.330   -8.467  1.00 15.00 ?  233 PRO B CD   14 
ATOM   10547 H HA   . PRO B 2 14 ? 4.446   10.481  -8.855  1.00 15.00 ?  233 PRO B HA   14 
ATOM   10548 H HB2  . PRO B 2 14 ? 3.624   8.790   -11.047 1.00 15.00 ?  233 PRO B HB2  14 
ATOM   10549 H HB3  . PRO B 2 14 ? 5.253   9.314   -10.621 1.00 15.00 ?  233 PRO B HB3  14 
ATOM   10550 H HG2  . PRO B 2 14 ? 4.377   6.724   -10.428 1.00 15.00 ?  233 PRO B HG2  14 
ATOM   10551 H HG3  . PRO B 2 14 ? 5.695   7.402   -9.457  1.00 15.00 ?  233 PRO B HG3  14 
ATOM   10552 H HD2  . PRO B 2 14 ? 2.835   6.931   -8.714  1.00 15.00 ?  233 PRO B HD2  14 
ATOM   10553 H HD3  . PRO B 2 14 ? 4.306   6.701   -7.743  1.00 15.00 ?  233 PRO B HD3  14 
HETATM 10554 N N    . NH2 B 2 15 ? 1.977   11.228  -8.708  1.00 15.00 ?  234 NH2 B N    14 
HETATM 10555 H HN1  . NH2 B 2 15 ? 2.565   11.566  -7.999  1.00 15.00 ?  234 NH2 B HN1  14 
HETATM 10556 H HN2  . NH2 B 2 15 ? 1.087   11.597  -8.900  1.00 15.00 ?  234 NH2 B HN2  14 
ATOM   10557 N N    . LEU A 1 1  ? -16.011 5.064   -2.721  1.00 15.00 ?  279 LEU A N    15 
ATOM   10558 C CA   . LEU A 1 1  ? -15.848 5.897   -1.507  1.00 15.00 ?  279 LEU A CA   15 
ATOM   10559 C C    . LEU A 1 1  ? -14.725 5.327   -0.658  1.00 15.00 ?  279 LEU A C    15 
ATOM   10560 O O    . LEU A 1 1  ? -14.841 4.219   -0.136  1.00 15.00 ?  279 LEU A O    15 
ATOM   10561 C CB   . LEU A 1 1  ? -17.148 5.939   -0.686  1.00 15.00 ?  279 LEU A CB   15 
ATOM   10562 C CG   . LEU A 1 1  ? -18.379 6.531   -1.391  1.00 15.00 ?  279 LEU A CG   15 
ATOM   10563 C CD1  . LEU A 1 1  ? -18.030 7.838   -2.083  1.00 15.00 ?  279 LEU A CD1  15 
ATOM   10564 C CD2  . LEU A 1 1  ? -18.983 5.537   -2.375  1.00 15.00 ?  279 LEU A CD2  15 
ATOM   10565 H H1   . LEU A 1 1  ? -16.228 4.079   -2.451  1.00 15.00 ?  279 LEU A H1   15 
ATOM   10566 H H2   . LEU A 1 1  ? -15.129 5.068   -3.278  1.00 15.00 ?  279 LEU A H2   15 
ATOM   10567 H H3   . LEU A 1 1  ? -16.780 5.428   -3.311  1.00 15.00 ?  279 LEU A H3   15 
ATOM   10568 H HA   . LEU A 1 1  ? -15.583 6.900   -1.813  1.00 15.00 ?  279 LEU A HA   15 
ATOM   10569 H HB2  . LEU A 1 1  ? -17.388 4.930   -0.388  1.00 15.00 ?  279 LEU A HB2  15 
ATOM   10570 H HB3  . LEU A 1 1  ? -16.961 6.521   0.205   1.00 15.00 ?  279 LEU A HB3  15 
ATOM   10571 H HG   . LEU A 1 1  ? -19.130 6.751   -0.644  1.00 15.00 ?  279 LEU A HG   15 
ATOM   10572 H HD11 . LEU A 1 1  ? -17.262 7.661   -2.820  1.00 15.00 ?  279 LEU A HD11 15 
ATOM   10573 H HD12 . LEU A 1 1  ? -17.673 8.547   -1.352  1.00 15.00 ?  279 LEU A HD12 15 
ATOM   10574 H HD13 . LEU A 1 1  ? -18.911 8.235   -2.569  1.00 15.00 ?  279 LEU A HD13 15 
ATOM   10575 H HD21 . LEU A 1 1  ? -19.292 4.648   -1.845  1.00 15.00 ?  279 LEU A HD21 15 
ATOM   10576 H HD22 . LEU A 1 1  ? -18.246 5.274   -3.118  1.00 15.00 ?  279 LEU A HD22 15 
ATOM   10577 H HD23 . LEU A 1 1  ? -19.839 5.984   -2.858  1.00 15.00 ?  279 LEU A HD23 15 
ATOM   10578 N N    . GLY A 1 2  ? -13.640 6.072   -0.522  1.00 15.00 ?  280 GLY A N    15 
ATOM   10579 C CA   . GLY A 1 2  ? -12.472 5.533   0.133   1.00 15.00 ?  280 GLY A CA   15 
ATOM   10580 C C    . GLY A 1 2  ? -12.133 6.205   1.445   1.00 15.00 ?  280 GLY A C    15 
ATOM   10581 O O    . GLY A 1 2  ? -11.642 7.335   1.460   1.00 15.00 ?  280 GLY A O    15 
ATOM   10582 H H    . GLY A 1 2  ? -13.630 6.996   -0.871  1.00 15.00 ?  280 GLY A H    15 
ATOM   10583 H HA2  . GLY A 1 2  ? -12.638 4.482   0.320   1.00 15.00 ?  280 GLY A HA2  15 
ATOM   10584 H HA3  . GLY A 1 2  ? -11.628 5.633   -0.534  1.00 15.00 ?  280 GLY A HA3  15 
ATOM   10585 N N    . PRO A 1 3  ? -12.396 5.532   2.572   1.00 15.00 ?  281 PRO A N    15 
ATOM   10586 C CA   . PRO A 1 3  ? -11.924 5.957   3.875   1.00 15.00 ?  281 PRO A CA   15 
ATOM   10587 C C    . PRO A 1 3  ? -10.559 5.344   4.180   1.00 15.00 ?  281 PRO A C    15 
ATOM   10588 O O    . PRO A 1 3  ? -10.428 4.123   4.292   1.00 15.00 ?  281 PRO A O    15 
ATOM   10589 C CB   . PRO A 1 3  ? -12.996 5.422   4.826   1.00 15.00 ?  281 PRO A CB   15 
ATOM   10590 C CG   . PRO A 1 3  ? -13.656 4.280   4.107   1.00 15.00 ?  281 PRO A CG   15 
ATOM   10591 C CD   . PRO A 1 3  ? -13.190 4.300   2.669   1.00 15.00 ?  281 PRO A CD   15 
ATOM   10592 H HA   . PRO A 1 3  ? -11.866 7.034   3.948   1.00 15.00 ?  281 PRO A HA   15 
ATOM   10593 H HB2  . PRO A 1 3  ? -12.528 5.090   5.742   1.00 15.00 ?  281 PRO A HB2  15 
ATOM   10594 H HB3  . PRO A 1 3  ? -13.703 6.208   5.047   1.00 15.00 ?  281 PRO A HB3  15 
ATOM   10595 H HG2  . PRO A 1 3  ? -13.372 3.348   4.569   1.00 15.00 ?  281 PRO A HG2  15 
ATOM   10596 H HG3  . PRO A 1 3  ? -14.729 4.400   4.148   1.00 15.00 ?  281 PRO A HG3  15 
ATOM   10597 H HD2  . PRO A 1 3  ? -12.580 3.434   2.460   1.00 15.00 ?  281 PRO A HD2  15 
ATOM   10598 H HD3  . PRO A 1 3  ? -14.037 4.334   2.000   1.00 15.00 ?  281 PRO A HD3  15 
ATOM   10599 N N    . LEU A 1 4  ? -9.538  6.180   4.272   1.00 15.00 ?  282 LEU A N    15 
ATOM   10600 C CA   . LEU A 1 4  ? -8.183  5.690   4.463   1.00 15.00 ?  282 LEU A CA   15 
ATOM   10601 C C    . LEU A 1 4  ? -7.783  5.757   5.932   1.00 15.00 ?  282 LEU A C    15 
ATOM   10602 O O    . LEU A 1 4  ? -7.709  6.841   6.515   1.00 15.00 ?  282 LEU A O    15 
ATOM   10603 C CB   . LEU A 1 4  ? -7.196  6.495   3.614   1.00 15.00 ?  282 LEU A CB   15 
ATOM   10604 C CG   . LEU A 1 4  ? -5.792  5.898   3.524   1.00 15.00 ?  282 LEU A CG   15 
ATOM   10605 C CD1  . LEU A 1 4  ? -5.815  4.604   2.727   1.00 15.00 ?  282 LEU A CD1  15 
ATOM   10606 C CD2  . LEU A 1 4  ? -4.822  6.891   2.905   1.00 15.00 ?  282 LEU A CD2  15 
ATOM   10607 H H    . LEU A 1 4  ? -9.699  7.150   4.219   1.00 15.00 ?  282 LEU A H    15 
ATOM   10608 H HA   . LEU A 1 4  ? -8.157  4.658   4.143   1.00 15.00 ?  282 LEU A HA   15 
ATOM   10609 H HB2  . LEU A 1 4  ? -7.598  6.575   2.614   1.00 15.00 ?  282 LEU A HB2  15 
ATOM   10610 H HB3  . LEU A 1 4  ? -7.116  7.487   4.033   1.00 15.00 ?  282 LEU A HB3  15 
ATOM   10611 H HG   . LEU A 1 4  ? -5.442  5.667   4.520   1.00 15.00 ?  282 LEU A HG   15 
ATOM   10612 H HD11 . LEU A 1 4  ? -6.182  4.800   1.731   1.00 15.00 ?  282 LEU A HD11 15 
ATOM   10613 H HD12 . LEU A 1 4  ? -6.463  3.892   3.216   1.00 15.00 ?  282 LEU A HD12 15 
ATOM   10614 H HD13 . LEU A 1 4  ? -4.816  4.199   2.669   1.00 15.00 ?  282 LEU A HD13 15 
ATOM   10615 H HD21 . LEU A 1 4  ? -4.815  7.800   3.487   1.00 15.00 ?  282 LEU A HD21 15 
ATOM   10616 H HD22 . LEU A 1 4  ? -5.131  7.114   1.897   1.00 15.00 ?  282 LEU A HD22 15 
ATOM   10617 H HD23 . LEU A 1 4  ? -3.830  6.465   2.890   1.00 15.00 ?  282 LEU A HD23 15 
ATOM   10618 N N    . PRO A 1 5  ? -7.539  4.596   6.553   1.00 15.00 ?  283 PRO A N    15 
ATOM   10619 C CA   . PRO A 1 5  ? -7.097  4.516   7.949   1.00 15.00 ?  283 PRO A CA   15 
ATOM   10620 C C    . PRO A 1 5  ? -5.738  5.185   8.159   1.00 15.00 ?  283 PRO A C    15 
ATOM   10621 O O    . PRO A 1 5  ? -4.841  5.064   7.321   1.00 15.00 ?  283 PRO A O    15 
ATOM   10622 C CB   . PRO A 1 5  ? -6.992  3.007   8.212   1.00 15.00 ?  283 PRO A CB   15 
ATOM   10623 C CG   . PRO A 1 5  ? -7.818  2.372   7.149   1.00 15.00 ?  283 PRO A CG   15 
ATOM   10624 C CD   . PRO A 1 5  ? -7.688  3.264   5.951   1.00 15.00 ?  283 PRO A CD   15 
ATOM   10625 H HA   . PRO A 1 5  ? -7.821  4.953   8.620   1.00 15.00 ?  283 PRO A HA   15 
ATOM   10626 H HB2  . PRO A 1 5  ? -5.959  2.698   8.147   1.00 15.00 ?  283 PRO A HB2  15 
ATOM   10627 H HB3  . PRO A 1 5  ? -7.378  2.783   9.196   1.00 15.00 ?  283 PRO A HB3  15 
ATOM   10628 H HG2  . PRO A 1 5  ? -7.439  1.385   6.928   1.00 15.00 ?  283 PRO A HG2  15 
ATOM   10629 H HG3  . PRO A 1 5  ? -8.848  2.319   7.468   1.00 15.00 ?  283 PRO A HG3  15 
ATOM   10630 H HD2  . PRO A 1 5  ? -6.813  2.999   5.374   1.00 15.00 ?  283 PRO A HD2  15 
ATOM   10631 H HD3  . PRO A 1 5  ? -8.578  3.212   5.341   1.00 15.00 ?  283 PRO A HD3  15 
ATOM   10632 N N    . PRO A 1 6  ? -5.571  5.898   9.282   1.00 15.00 ?  284 PRO A N    15 
ATOM   10633 C CA   . PRO A 1 6  ? -4.307  6.550   9.627   1.00 15.00 ?  284 PRO A CA   15 
ATOM   10634 C C    . PRO A 1 6  ? -3.166  5.545   9.750   1.00 15.00 ?  284 PRO A C    15 
ATOM   10635 O O    . PRO A 1 6  ? -3.235  4.603   10.541  1.00 15.00 ?  284 PRO A O    15 
ATOM   10636 C CB   . PRO A 1 6  ? -4.589  7.209   10.983  1.00 15.00 ?  284 PRO A CB   15 
ATOM   10637 C CG   . PRO A 1 6  ? -5.796  6.515   11.510  1.00 15.00 ?  284 PRO A CG   15 
ATOM   10638 C CD   . PRO A 1 6  ? -6.600  6.121   10.306  1.00 15.00 ?  284 PRO A CD   15 
ATOM   10639 H HA   . PRO A 1 6  ? -4.040  7.305   8.902   1.00 15.00 ?  284 PRO A HA   15 
ATOM   10640 H HB2  . PRO A 1 6  ? -3.738  7.073   11.634  1.00 15.00 ?  284 PRO A HB2  15 
ATOM   10641 H HB3  . PRO A 1 6  ? -4.772  8.263   10.840  1.00 15.00 ?  284 PRO A HB3  15 
ATOM   10642 H HG2  . PRO A 1 6  ? -5.502  5.638   12.068  1.00 15.00 ?  284 PRO A HG2  15 
ATOM   10643 H HG3  . PRO A 1 6  ? -6.362  7.187   12.137  1.00 15.00 ?  284 PRO A HG3  15 
ATOM   10644 H HD2  . PRO A 1 6  ? -7.157  5.215   10.500  1.00 15.00 ?  284 PRO A HD2  15 
ATOM   10645 H HD3  . PRO A 1 6  ? -7.265  6.922   10.017  1.00 15.00 ?  284 PRO A HD3  15 
ATOM   10646 N N    . GLY A 1 7  ? -2.128  5.744   8.957   1.00 15.00 ?  285 GLY A N    15 
ATOM   10647 C CA   . GLY A 1 7  ? -1.016  4.821   8.955   1.00 15.00 ?  285 GLY A CA   15 
ATOM   10648 C C    . GLY A 1 7  ? -0.843  4.151   7.611   1.00 15.00 ?  285 GLY A C    15 
ATOM   10649 O O    . GLY A 1 7  ? 0.113   3.402   7.402   1.00 15.00 ?  285 GLY A O    15 
ATOM   10650 H H    . GLY A 1 7  ? -2.114  6.527   8.366   1.00 15.00 ?  285 GLY A H    15 
ATOM   10651 H HA2  . GLY A 1 7  ? -0.111  5.360   9.197   1.00 15.00 ?  285 GLY A HA2  15 
ATOM   10652 H HA3  . GLY A 1 7  ? -1.186  4.063   9.704   1.00 15.00 ?  285 GLY A HA3  15 
ATOM   10653 N N    . TRP A 1 8  ? -1.750  4.444   6.684   1.00 15.00 ?  286 TRP A N    15 
ATOM   10654 C CA   . TRP A 1 8  ? -1.701  3.843   5.361   1.00 15.00 ?  286 TRP A CA   15 
ATOM   10655 C C    . TRP A 1 8  ? -0.865  4.674   4.419   1.00 15.00 ?  286 TRP A C    15 
ATOM   10656 O O    . TRP A 1 8  ? -1.291  5.731   3.945   1.00 15.00 ?  286 TRP A O    15 
ATOM   10657 C CB   . TRP A 1 8  ? -3.108  3.659   4.763   1.00 15.00 ?  286 TRP A CB   15 
ATOM   10658 C CG   . TRP A 1 8  ? -3.796  2.423   5.243   1.00 15.00 ?  286 TRP A CG   15 
ATOM   10659 C CD1  . TRP A 1 8  ? -3.979  2.056   6.542   1.00 15.00 ?  286 TRP A CD1  15 
ATOM   10660 C CD2  . TRP A 1 8  ? -4.376  1.374   4.439   1.00 15.00 ?  286 TRP A CD2  15 
ATOM   10661 N NE1  . TRP A 1 8  ? -4.616  0.847   6.609   1.00 15.00 ?  286 TRP A NE1  15 
ATOM   10662 C CE2  . TRP A 1 8  ? -4.868  0.403   5.340   1.00 15.00 ?  286 TRP A CE2  15 
ATOM   10663 C CE3  . TRP A 1 8  ? -4.529  1.143   3.052   1.00 15.00 ?  286 TRP A CE3  15 
ATOM   10664 C CZ2  . TRP A 1 8  ? -5.488  -0.770  4.914   1.00 15.00 ?  286 TRP A CZ2  15 
ATOM   10665 C CZ3  . TRP A 1 8  ? -5.136  -0.030  2.650   1.00 15.00 ?  286 TRP A CZ3  15 
ATOM   10666 C CH2  . TRP A 1 8  ? -5.603  -0.973  3.570   1.00 15.00 ?  286 TRP A CH2  15 
ATOM   10667 H H    . TRP A 1 8  ? -2.471  5.072   6.898   1.00 15.00 ?  286 TRP A H    15 
ATOM   10668 H HA   . TRP A 1 8  ? -1.230  2.872   5.464   1.00 15.00 ?  286 TRP A HA   15 
ATOM   10669 H HB2  . TRP A 1 8  ? -3.721  4.510   5.024   1.00 15.00 ?  286 TRP A HB2  15 
ATOM   10670 H HB3  . TRP A 1 8  ? -3.027  3.600   3.686   1.00 15.00 ?  286 TRP A HB3  15 
ATOM   10671 H HD1  . TRP A 1 8  ? -3.656  2.644   7.389   1.00 15.00 ?  286 TRP A HD1  15 
ATOM   10672 H HE1  . TRP A 1 8  ? -4.849  0.372   7.442   1.00 15.00 ?  286 TRP A HE1  15 
ATOM   10673 H HE3  . TRP A 1 8  ? -4.191  1.878   2.263   1.00 15.00 ?  286 TRP A HE3  15 
ATOM   10674 H HZ2  . TRP A 1 8  ? -5.854  -1.509  5.611   1.00 15.00 ?  286 TRP A HZ2  15 
ATOM   10675 H HZ3  . TRP A 1 8  ? -5.212  -0.246  1.594   1.00 15.00 ?  286 TRP A HZ3  15 
ATOM   10676 H HH2  . TRP A 1 8  ? -6.070  -1.872  3.197   1.00 15.00 ?  286 TRP A HH2  15 
ATOM   10677 N N    . GLU A 1 9  ? 0.341   4.207   4.181   1.00 15.00 ?  287 GLU A N    15 
ATOM   10678 C CA   . GLU A 1 9  ? 1.179   4.779   3.163   1.00 15.00 ?  287 GLU A CA   15 
ATOM   10679 C C    . GLU A 1 9  ? 0.908   4.046   1.866   1.00 15.00 ?  287 GLU A C    15 
ATOM   10680 O O    . GLU A 1 9  ? 1.075   2.830   1.791   1.00 15.00 ?  287 GLU A O    15 
ATOM   10681 C CB   . GLU A 1 9  ? 2.651   4.666   3.568   1.00 15.00 ?  287 GLU A CB   15 
ATOM   10682 C CG   . GLU A 1 9  ? 3.195   5.895   4.280   1.00 15.00 ?  287 GLU A CG   15 
ATOM   10683 C CD   . GLU A 1 9  ? 2.389   6.303   5.495   1.00 15.00 ?  287 GLU A CD   15 
ATOM   10684 O OE1  . GLU A 1 9  ? 2.544   5.674   6.561   1.00 15.00 ?  287 GLU A OE1  15 
ATOM   10685 O OE2  . GLU A 1 9  ? 1.625   7.285   5.398   1.00 15.00 -1 287 GLU A OE2  15 
ATOM   10686 H H    . GLU A 1 9  ? 0.677   3.439   4.701   1.00 15.00 ?  287 GLU A H    15 
ATOM   10687 H HA   . GLU A 1 9  ? 0.913   5.821   3.048   1.00 15.00 ?  287 GLU A HA   15 
ATOM   10688 H HB2  . GLU A 1 9  ? 2.759   3.822   4.233   1.00 15.00 ?  287 GLU A HB2  15 
ATOM   10689 H HB3  . GLU A 1 9  ? 3.248   4.492   2.685   1.00 15.00 ?  287 GLU A HB3  15 
ATOM   10690 H HG2  . GLU A 1 9  ? 4.203   5.684   4.598   1.00 15.00 ?  287 GLU A HG2  15 
ATOM   10691 H HG3  . GLU A 1 9  ? 3.208   6.721   3.581   1.00 15.00 ?  287 GLU A HG3  15 
ATOM   10692 N N    . VAL A 1 10 ? 0.450   4.757   0.855   1.00 15.00 ?  288 VAL A N    15 
ATOM   10693 C CA   . VAL A 1 10 ? 0.165   4.111   -0.404  1.00 15.00 ?  288 VAL A CA   15 
ATOM   10694 C C    . VAL A 1 10 ? 1.427   4.149   -1.255  1.00 15.00 ?  288 VAL A C    15 
ATOM   10695 O O    . VAL A 1 10 ? 1.954   5.208   -1.590  1.00 15.00 ?  288 VAL A O    15 
ATOM   10696 C CB   . VAL A 1 10 ? -1.070  4.728   -1.142  1.00 15.00 ?  288 VAL A CB   15 
ATOM   10697 C CG1  . VAL A 1 10 ? -2.114  5.204   -0.142  1.00 15.00 ?  288 VAL A CG1  15 
ATOM   10698 C CG2  . VAL A 1 10 ? -0.700  5.851   -2.099  1.00 15.00 ?  288 VAL A CG2  15 
ATOM   10699 H H    . VAL A 1 10 ? 0.311   5.721   0.957   1.00 15.00 ?  288 VAL A H    15 
ATOM   10700 H HA   . VAL A 1 10 ? -0.059  3.075   -0.187  1.00 15.00 ?  288 VAL A HA   15 
ATOM   10701 H HB   . VAL A 1 10 ? -1.523  3.937   -1.724  1.00 15.00 ?  288 VAL A HB   15 
ATOM   10702 H HG11 . VAL A 1 10 ? -2.958  5.618   -0.674  1.00 15.00 ?  288 VAL A HG11 15 
ATOM   10703 H HG12 . VAL A 1 10 ? -1.681  5.961   0.495   1.00 15.00 ?  288 VAL A HG12 15 
ATOM   10704 H HG13 . VAL A 1 10 ? -2.441  4.370   0.460   1.00 15.00 ?  288 VAL A HG13 15 
ATOM   10705 H HG21 . VAL A 1 10 ? -0.153  5.436   -2.934  1.00 15.00 ?  288 VAL A HG21 15 
ATOM   10706 H HG22 . VAL A 1 10 ? -0.085  6.574   -1.584  1.00 15.00 ?  288 VAL A HG22 15 
ATOM   10707 H HG23 . VAL A 1 10 ? -1.598  6.330   -2.458  1.00 15.00 ?  288 VAL A HG23 15 
ATOM   10708 N N    . ARG A 1 11 ? 1.977   2.982   -1.519  1.00 15.00 ?  289 ARG A N    15 
ATOM   10709 C CA   . ARG A 1 11 ? 3.206   2.914   -2.266  1.00 15.00 ?  289 ARG A CA   15 
ATOM   10710 C C    . ARG A 1 11 ? 2.884   2.439   -3.678  1.00 15.00 ?  289 ARG A C    15 
ATOM   10711 O O    . ARG A 1 11 ? 2.661   1.255   -3.920  1.00 15.00 ?  289 ARG A O    15 
ATOM   10712 C CB   . ARG A 1 11 ? 4.226   2.022   -1.516  1.00 15.00 ?  289 ARG A CB   15 
ATOM   10713 C CG   . ARG A 1 11 ? 5.693   2.280   -1.865  1.00 15.00 ?  289 ARG A CG   15 
ATOM   10714 C CD   . ARG A 1 11 ? 6.045   1.869   -3.285  1.00 15.00 ?  289 ARG A CD   15 
ATOM   10715 N NE   . ARG A 1 11 ? 7.446   2.149   -3.613  1.00 15.00 ?  289 ARG A NE   15 
ATOM   10716 C CZ   . ARG A 1 11 ? 8.347   1.218   -3.938  1.00 15.00 ?  289 ARG A CZ   15 
ATOM   10717 N NH1  . ARG A 1 11 ? 8.046   -0.072  -3.862  1.00 15.00 1  289 ARG A NH1  15 
ATOM   10718 N NH2  . ARG A 1 11 ? 9.562   1.584   -4.318  1.00 15.00 ?  289 ARG A NH2  15 
ATOM   10719 H H    . ARG A 1 11 ? 1.547   2.151   -1.212  1.00 15.00 ?  289 ARG A H    15 
ATOM   10720 H HA   . ARG A 1 11 ? 3.600   3.920   -2.328  1.00 15.00 ?  289 ARG A HA   15 
ATOM   10721 H HB2  . ARG A 1 11 ? 4.112   2.211   -0.458  1.00 15.00 ?  289 ARG A HB2  15 
ATOM   10722 H HB3  . ARG A 1 11 ? 4.007   0.977   -1.694  1.00 15.00 ?  289 ARG A HB3  15 
ATOM   10723 H HG2  . ARG A 1 11 ? 5.896   3.332   -1.751  1.00 15.00 ?  289 ARG A HG2  15 
ATOM   10724 H HG3  . ARG A 1 11 ? 6.311   1.720   -1.175  1.00 15.00 ?  289 ARG A HG3  15 
ATOM   10725 H HD2  . ARG A 1 11 ? 5.865   0.810   -3.395  1.00 15.00 ?  289 ARG A HD2  15 
ATOM   10726 H HD3  . ARG A 1 11 ? 5.410   2.412   -3.969  1.00 15.00 ?  289 ARG A HD3  15 
ATOM   10727 H HE   . ARG A 1 11 ? 7.721   3.095   -3.632  1.00 15.00 ?  289 ARG A HE   15 
ATOM   10728 H HH11 . ARG A 1 11 ? 7.141   -0.364  -3.557  1.00 15.00 ?  289 ARG A HH11 15 
ATOM   10729 H HH12 . ARG A 1 11 ? 8.733   -0.768  -4.124  1.00 15.00 ?  289 ARG A HH12 15 
ATOM   10730 H HH21 . ARG A 1 11 ? 9.801   2.570   -4.365  1.00 15.00 ?  289 ARG A HH21 15 
ATOM   10731 H HH22 . ARG A 1 11 ? 10.244  0.896   -4.568  1.00 15.00 ?  289 ARG A HH22 15 
ATOM   10732 N N    . SER A 1 12 ? 2.757   3.398   -4.585  1.00 15.00 ?  290 SER A N    15 
ATOM   10733 C CA   . SER A 1 12 ? 2.392   3.110   -5.958  1.00 15.00 ?  290 SER A CA   15 
ATOM   10734 C C    . SER A 1 12 ? 3.644   2.919   -6.800  1.00 15.00 ?  290 SER A C    15 
ATOM   10735 O O    . SER A 1 12 ? 4.575   3.720   -6.742  1.00 15.00 ?  290 SER A O    15 
ATOM   10736 C CB   . SER A 1 12 ? 1.525   4.243   -6.516  1.00 15.00 ?  290 SER A CB   15 
ATOM   10737 O OG   . SER A 1 12 ? 2.132   5.504   -6.304  1.00 15.00 ?  290 SER A OG   15 
ATOM   10738 H H    . SER A 1 12 ? 2.924   4.336   -4.327  1.00 15.00 ?  290 SER A H    15 
ATOM   10739 H HA   . SER A 1 12 ? 1.823   2.192   -5.966  1.00 15.00 ?  290 SER A HA   15 
ATOM   10740 H HB2  . SER A 1 12 ? 1.387   4.099   -7.577  1.00 15.00 ?  290 SER A HB2  15 
ATOM   10741 H HB3  . SER A 1 12 ? 0.563   4.232   -6.024  1.00 15.00 ?  290 SER A HB3  15 
ATOM   10742 H HG   . SER A 1 12 ? 1.456   6.161   -6.062  1.00 15.00 ?  290 SER A HG   15 
ATOM   10743 N N    . THR A 1 13 ? 3.673   1.853   -7.576  1.00 15.00 ?  291 THR A N    15 
ATOM   10744 C CA   . THR A 1 13 ? 4.855   1.531   -8.347  1.00 15.00 ?  291 THR A CA   15 
ATOM   10745 C C    . THR A 1 13 ? 4.554   1.533   -9.843  1.00 15.00 ?  291 THR A C    15 
ATOM   10746 O O    . THR A 1 13 ? 3.435   1.205   -10.265 1.00 15.00 ?  291 THR A O    15 
ATOM   10747 C CB   . THR A 1 13 ? 5.436   0.174   -7.908  1.00 15.00 ?  291 THR A CB   15 
ATOM   10748 O OG1  . THR A 1 13 ? 4.446   -0.855  -8.044  1.00 15.00 ?  291 THR A OG1  15 
ATOM   10749 C CG2  . THR A 1 13 ? 5.894   0.234   -6.459  1.00 15.00 ?  291 THR A CG2  15 
ATOM   10750 H H    . THR A 1 13 ? 2.882   1.278   -7.641  1.00 15.00 ?  291 THR A H    15 
ATOM   10751 H HA   . THR A 1 13 ? 5.594   2.294   -8.144  1.00 15.00 ?  291 THR A HA   15 
ATOM   10752 H HB   . THR A 1 13 ? 6.285   -0.063  -8.531  1.00 15.00 ?  291 THR A HB   15 
ATOM   10753 H HG1  . THR A 1 13 ? 3.660   -0.610  -7.539  1.00 15.00 ?  291 THR A HG1  15 
ATOM   10754 H HG21 . THR A 1 13 ? 5.029   0.285   -5.812  1.00 15.00 ?  291 THR A HG21 15 
ATOM   10755 H HG22 . THR A 1 13 ? 6.504   1.118   -6.308  1.00 15.00 ?  291 THR A HG22 15 
ATOM   10756 H HG23 . THR A 1 13 ? 6.469   -0.648  -6.223  1.00 15.00 ?  291 THR A HG23 15 
ATOM   10757 N N    . VAL A 1 14 ? 5.566   1.889   -10.636 1.00 15.00 ?  292 VAL A N    15 
ATOM   10758 C CA   . VAL A 1 14 ? 5.425   2.050   -12.086 1.00 15.00 ?  292 VAL A CA   15 
ATOM   10759 C C    . VAL A 1 14 ? 5.049   0.725   -12.753 1.00 15.00 ?  292 VAL A C    15 
ATOM   10760 O O    . VAL A 1 14 ? 4.611   0.691   -13.906 1.00 15.00 ?  292 VAL A O    15 
ATOM   10761 C CB   . VAL A 1 14 ? 6.728   2.604   -12.711 1.00 15.00 ?  292 VAL A CB   15 
ATOM   10762 C CG1  . VAL A 1 14 ? 6.515   3.010   -14.162 1.00 15.00 ?  292 VAL A CG1  15 
ATOM   10763 C CG2  . VAL A 1 14 ? 7.247   3.782   -11.899 1.00 15.00 ?  292 VAL A CG2  15 
ATOM   10764 H H    . VAL A 1 14 ? 6.449   2.040   -10.231 1.00 15.00 ?  292 VAL A H    15 
ATOM   10765 H HA   . VAL A 1 14 ? 4.634   2.765   -12.264 1.00 15.00 ?  292 VAL A HA   15 
ATOM   10766 H HB   . VAL A 1 14 ? 7.474   1.823   -12.686 1.00 15.00 ?  292 VAL A HB   15 
ATOM   10767 H HG11 . VAL A 1 14 ? 7.440   3.392   -14.568 1.00 15.00 ?  292 VAL A HG11 15 
ATOM   10768 H HG12 . VAL A 1 14 ? 5.755   3.778   -14.214 1.00 15.00 ?  292 VAL A HG12 15 
ATOM   10769 H HG13 . VAL A 1 14 ? 6.199   2.152   -14.734 1.00 15.00 ?  292 VAL A HG13 15 
ATOM   10770 H HG21 . VAL A 1 14 ? 8.161   4.150   -12.341 1.00 15.00 ?  292 VAL A HG21 15 
ATOM   10771 H HG22 . VAL A 1 14 ? 7.439   3.464   -10.886 1.00 15.00 ?  292 VAL A HG22 15 
ATOM   10772 H HG23 . VAL A 1 14 ? 6.506   4.570   -11.894 1.00 15.00 ?  292 VAL A HG23 15 
ATOM   10773 N N    . SER A 1 15 ? 5.216   -0.365  -12.009 1.00 15.00 ?  293 SER A N    15 
ATOM   10774 C CA   . SER A 1 15 ? 4.776   -1.689  -12.445 1.00 15.00 ?  293 SER A CA   15 
ATOM   10775 C C    . SER A 1 15 ? 3.276   -1.706  -12.770 1.00 15.00 ?  293 SER A C    15 
ATOM   10776 O O    . SER A 1 15 ? 2.778   -2.651  -13.385 1.00 15.00 ?  293 SER A O    15 
ATOM   10777 C CB   . SER A 1 15 ? 5.097   -2.729  -11.366 1.00 15.00 ?  293 SER A CB   15 
ATOM   10778 O OG   . SER A 1 15 ? 4.631   -4.017  -11.732 1.00 15.00 ?  293 SER A OG   15 
ATOM   10779 H H    . SER A 1 15 ? 5.664   -0.278  -11.138 1.00 15.00 ?  293 SER A H    15 
ATOM   10780 H HA   . SER A 1 15 ? 5.325   -1.936  -13.340 1.00 15.00 ?  293 SER A HA   15 
ATOM   10781 H HB2  . SER A 1 15 ? 6.167   -2.776  -11.222 1.00 15.00 ?  293 SER A HB2  15 
ATOM   10782 H HB3  . SER A 1 15 ? 4.624   -2.439  -10.438 1.00 15.00 ?  293 SER A HB3  15 
ATOM   10783 H HG   . SER A 1 15 ? 4.007   -3.932  -12.465 1.00 15.00 ?  293 SER A HG   15 
ATOM   10784 N N    . GLY A 1 16 ? 2.563   -0.668  -12.337 1.00 15.00 ?  294 GLY A N    15 
ATOM   10785 C CA   . GLY A 1 16 ? 1.137   -0.588  -12.578 1.00 15.00 ?  294 GLY A CA   15 
ATOM   10786 C C    . GLY A 1 16 ? 0.351   -1.231  -11.460 1.00 15.00 ?  294 GLY A C    15 
ATOM   10787 O O    . GLY A 1 16 ? -0.723  -1.791  -11.675 1.00 15.00 ?  294 GLY A O    15 
ATOM   10788 H H    . GLY A 1 16 ? 3.014   0.054   -11.848 1.00 15.00 ?  294 GLY A H    15 
ATOM   10789 H HA2  . GLY A 1 16 ? 0.852   0.449   -12.662 1.00 15.00 ?  294 GLY A HA2  15 
ATOM   10790 H HA3  . GLY A 1 16 ? 0.906   -1.093  -13.505 1.00 15.00 ?  294 GLY A HA3  15 
ATOM   10791 N N    . ARG A 1 17 ? 0.891   -1.136  -10.255 1.00 15.00 ?  295 ARG A N    15 
ATOM   10792 C CA   . ARG A 1 17 ? 0.278   -1.759  -9.096  1.00 15.00 ?  295 ARG A CA   15 
ATOM   10793 C C    . ARG A 1 17 ? 0.396   -0.850  -7.875  1.00 15.00 ?  295 ARG A C    15 
ATOM   10794 O O    . ARG A 1 17 ? 1.483   -0.356  -7.556  1.00 15.00 ?  295 ARG A O    15 
ATOM   10795 C CB   . ARG A 1 17 ? 0.949   -3.115  -8.806  1.00 15.00 ?  295 ARG A CB   15 
ATOM   10796 C CG   . ARG A 1 17 ? 2.453   -3.009  -8.605  1.00 15.00 ?  295 ARG A CG   15 
ATOM   10797 C CD   . ARG A 1 17 ? 3.102   -4.341  -8.264  1.00 15.00 ?  295 ARG A CD   15 
ATOM   10798 N NE   . ARG A 1 17 ? 4.524   -4.170  -7.946  1.00 15.00 ?  295 ARG A NE   15 
ATOM   10799 C CZ   . ARG A 1 17 ? 5.365   -5.171  -7.663  1.00 15.00 ?  295 ARG A CZ   15 
ATOM   10800 N NH1  . ARG A 1 17 ? 4.944   -6.427  -7.656  1.00 15.00 1  295 ARG A NH1  15 
ATOM   10801 N NH2  . ARG A 1 17 ? 6.639   -4.908  -7.384  1.00 15.00 ?  295 ARG A NH2  15 
ATOM   10802 H H    . ARG A 1 17 ? 1.724   -0.623  -10.141 1.00 15.00 ?  295 ARG A H    15 
ATOM   10803 H HA   . ARG A 1 17 ? -0.765  -1.919  -9.313  1.00 15.00 ?  295 ARG A HA   15 
ATOM   10804 H HB2  . ARG A 1 17 ? 0.516   -3.533  -7.910  1.00 15.00 ?  295 ARG A HB2  15 
ATOM   10805 H HB3  . ARG A 1 17 ? 0.761   -3.785  -9.633  1.00 15.00 ?  295 ARG A HB3  15 
ATOM   10806 H HG2  . ARG A 1 17 ? 2.896   -2.634  -9.514  1.00 15.00 ?  295 ARG A HG2  15 
ATOM   10807 H HG3  . ARG A 1 17 ? 2.644   -2.312  -7.802  1.00 15.00 ?  295 ARG A HG3  15 
ATOM   10808 H HD2  . ARG A 1 17 ? 2.596   -4.772  -7.413  1.00 15.00 ?  295 ARG A HD2  15 
ATOM   10809 H HD3  . ARG A 1 17 ? 3.010   -5.004  -9.112  1.00 15.00 ?  295 ARG A HD3  15 
ATOM   10810 H HE   . ARG A 1 17 ? 4.869   -3.250  -7.944  1.00 15.00 ?  295 ARG A HE   15 
ATOM   10811 H HH11 . ARG A 1 17 ? 3.975   -6.648  -7.868  1.00 15.00 ?  295 ARG A HH11 15 
ATOM   10812 H HH12 . ARG A 1 17 ? 5.580   -7.170  -7.444  1.00 15.00 ?  295 ARG A HH12 15 
ATOM   10813 H HH21 . ARG A 1 17 ? 6.972   -3.965  -7.386  1.00 15.00 ?  295 ARG A HH21 15 
ATOM   10814 H HH22 . ARG A 1 17 ? 7.279   -5.663  -7.174  1.00 15.00 ?  295 ARG A HH22 15 
ATOM   10815 N N    . ILE A 1 18 ? -0.724  -0.615  -7.211  1.00 15.00 ?  296 ILE A N    15 
ATOM   10816 C CA   . ILE A 1 18 ? -0.696  0.002   -5.899  1.00 15.00 ?  296 ILE A CA   15 
ATOM   10817 C C    . ILE A 1 18 ? -0.597  -1.119  -4.880  1.00 15.00 ?  296 ILE A C    15 
ATOM   10818 O O    . ILE A 1 18 ? -1.198  -2.179  -5.054  1.00 15.00 ?  296 ILE A O    15 
ATOM   10819 C CB   . ILE A 1 18 ? -1.945  0.885   -5.616  1.00 15.00 ?  296 ILE A CB   15 
ATOM   10820 C CG1  . ILE A 1 18 ? -1.766  1.678   -4.306  1.00 15.00 ?  296 ILE A CG1  15 
ATOM   10821 C CG2  . ILE A 1 18 ? -3.214  0.037   -5.553  1.00 15.00 ?  296 ILE A CG2  15 
ATOM   10822 C CD1  . ILE A 1 18 ? -2.947  2.555   -3.958  1.00 15.00 ?  296 ILE A CD1  15 
ATOM   10823 H H    . ILE A 1 18 ? -1.583  -0.869  -7.605  1.00 15.00 ?  296 ILE A H    15 
ATOM   10824 H HA   . ILE A 1 18 ? 0.192   0.619   -5.835  1.00 15.00 ?  296 ILE A HA   15 
ATOM   10825 H HB   . ILE A 1 18 ? -2.053  1.581   -6.435  1.00 15.00 ?  296 ILE A HB   15 
ATOM   10826 H HG12 . ILE A 1 18 ? -1.615  0.993   -3.490  1.00 15.00 ?  296 ILE A HG12 15 
ATOM   10827 H HG13 . ILE A 1 18 ? -0.902  2.316   -4.388  1.00 15.00 ?  296 ILE A HG13 15 
ATOM   10828 H HG21 . ILE A 1 18 ? -4.066  0.678   -5.374  1.00 15.00 ?  296 ILE A HG21 15 
ATOM   10829 H HG22 . ILE A 1 18 ? -3.128  -0.678  -4.746  1.00 15.00 ?  296 ILE A HG22 15 
ATOM   10830 H HG23 . ILE A 1 18 ? -3.345  -0.486  -6.487  1.00 15.00 ?  296 ILE A HG23 15 
ATOM   10831 H HD11 . ILE A 1 18 ? -3.831  1.943   -3.850  1.00 15.00 ?  296 ILE A HD11 15 
ATOM   10832 H HD12 . ILE A 1 18 ? -3.102  3.277   -4.745  1.00 15.00 ?  296 ILE A HD12 15 
ATOM   10833 H HD13 . ILE A 1 18 ? -2.752  3.069   -3.029  1.00 15.00 ?  296 ILE A HD13 15 
ATOM   10834 N N    . TYR A 1 19 ? 0.182   -0.912  -3.844  1.00 15.00 ?  297 TYR A N    15 
ATOM   10835 C CA   . TYR A 1 19 ? 0.438   -1.973  -2.898  1.00 15.00 ?  297 TYR A CA   15 
ATOM   10836 C C    . TYR A 1 19 ? 0.681   -1.332  -1.564  1.00 15.00 ?  297 TYR A C    15 
ATOM   10837 O O    . TYR A 1 19 ? 1.422   -0.345  -1.451  1.00 15.00 ?  297 TYR A O    15 
ATOM   10838 C CB   . TYR A 1 19 ? 1.593   -2.903  -3.341  1.00 15.00 ?  297 TYR A CB   15 
ATOM   10839 C CG   . TYR A 1 19 ? 2.985   -2.518  -2.888  1.00 15.00 ?  297 TYR A CG   15 
ATOM   10840 C CD1  . TYR A 1 19 ? 3.643   -1.441  -3.449  1.00 15.00 ?  297 TYR A CD1  15 
ATOM   10841 C CD2  . TYR A 1 19 ? 3.649   -3.255  -1.908  1.00 15.00 ?  297 TYR A CD2  15 
ATOM   10842 C CE1  . TYR A 1 19 ? 4.915   -1.098  -3.048  1.00 15.00 ?  297 TYR A CE1  15 
ATOM   10843 C CE2  . TYR A 1 19 ? 4.922   -2.914  -1.501  1.00 15.00 ?  297 TYR A CE2  15 
ATOM   10844 C CZ   . TYR A 1 19 ? 5.550   -1.832  -2.073  1.00 15.00 ?  297 TYR A CZ   15 
ATOM   10845 O OH   . TYR A 1 19 ? 6.820   -1.486  -1.676  1.00 15.00 ?  297 TYR A OH   15 
ATOM   10846 H H    . TYR A 1 19 ? 0.507   0.000   -3.649  1.00 15.00 ?  297 TYR A H    15 
ATOM   10847 H HA   . TYR A 1 19 ? -0.470  -2.559  -2.827  1.00 15.00 ?  297 TYR A HA   15 
ATOM   10848 H HB2  . TYR A 1 19 ? 1.400   -3.894  -2.963  1.00 15.00 ?  297 TYR A HB2  15 
ATOM   10849 H HB3  . TYR A 1 19 ? 1.602   -2.943  -4.422  1.00 15.00 ?  297 TYR A HB3  15 
ATOM   10850 H HD1  . TYR A 1 19 ? 3.145   -0.858  -4.210  1.00 15.00 ?  297 TYR A HD1  15 
ATOM   10851 H HD2  . TYR A 1 19 ? 3.158   -4.110  -1.465  1.00 15.00 ?  297 TYR A HD2  15 
ATOM   10852 H HE1  . TYR A 1 19 ? 5.412   -0.252  -3.500  1.00 15.00 ?  297 TYR A HE1  15 
ATOM   10853 H HE2  . TYR A 1 19 ? 5.419   -3.493  -0.736  1.00 15.00 ?  297 TYR A HE2  15 
ATOM   10854 H HH   . TYR A 1 19 ? 6.807   -0.612  -1.276  1.00 15.00 ?  297 TYR A HH   15 
ATOM   10855 N N    . PHE A 1 20 ? 0.028   -1.852  -0.568  1.00 15.00 ?  298 PHE A N    15 
ATOM   10856 C CA   . PHE A 1 20 ? -0.056  -1.160  0.664   1.00 15.00 ?  298 PHE A CA   15 
ATOM   10857 C C    . PHE A 1 20 ? 1.034   -1.462  1.623   1.00 15.00 ?  298 PHE A C    15 
ATOM   10858 O O    . PHE A 1 20 ? 1.402   -2.604  1.858   1.00 15.00 ?  298 PHE A O    15 
ATOM   10859 C CB   . PHE A 1 20 ? -1.389  -1.392  1.283   1.00 15.00 ?  298 PHE A CB   15 
ATOM   10860 C CG   . PHE A 1 20 ? -2.234  -0.261  0.933   1.00 15.00 ?  298 PHE A CG   15 
ATOM   10861 C CD1  . PHE A 1 20 ? -1.882  0.974   1.414   1.00 15.00 ?  298 PHE A CD1  15 
ATOM   10862 C CD2  . PHE A 1 20 ? -3.326  -0.394  0.106   1.00 15.00 ?  298 PHE A CD2  15 
ATOM   10863 C CE1  . PHE A 1 20 ? -2.603  2.071   1.095   1.00 15.00 ?  298 PHE A CE1  15 
ATOM   10864 C CE2  . PHE A 1 20 ? -4.067  0.710   -0.219  1.00 15.00 ?  298 PHE A CE2  15 
ATOM   10865 C CZ   . PHE A 1 20 ? -3.695  1.939   0.284   1.00 15.00 ?  298 PHE A CZ   15 
ATOM   10866 H H    . PHE A 1 20 ? -0.467  -2.692  -0.683  1.00 15.00 ?  298 PHE A H    15 
ATOM   10867 H HA   . PHE A 1 20 ? 0.004   -0.112  0.419   1.00 15.00 ?  298 PHE A HA   15 
ATOM   10868 H HB2  . PHE A 1 20 ? -1.829  -2.302  0.894   1.00 15.00 ?  298 PHE A HB2  15 
ATOM   10869 H HB3  . PHE A 1 20 ? -1.302  -1.444  2.357   1.00 15.00 ?  298 PHE A HB3  15 
ATOM   10870 H HD1  . PHE A 1 20 ? -1.025  1.060   2.056   1.00 15.00 ?  298 PHE A HD1  15 
ATOM   10871 H HD2  . PHE A 1 20 ? -3.602  -1.369  -0.271  1.00 15.00 ?  298 PHE A HD2  15 
ATOM   10872 H HE1  . PHE A 1 20 ? -2.323  3.040   1.482   1.00 15.00 ?  298 PHE A HE1  15 
ATOM   10873 H HE2  . PHE A 1 20 ? -4.927  0.623   -0.867  1.00 15.00 ?  298 PHE A HE2  15 
ATOM   10874 H HZ   . PHE A 1 20 ? -4.263  2.777   0.074   1.00 15.00 ?  298 PHE A HZ   15 
ATOM   10875 N N    . VAL A 1 21 ? 1.501   -0.393  2.204   1.00 15.00 ?  299 VAL A N    15 
ATOM   10876 C CA   . VAL A 1 21 ? 2.557   -0.425  3.150   1.00 15.00 ?  299 VAL A CA   15 
ATOM   10877 C C    . VAL A 1 21 ? 2.182   0.492   4.309   1.00 15.00 ?  299 VAL A C    15 
ATOM   10878 O O    . VAL A 1 21 ? 2.444   1.696   4.301   1.00 15.00 ?  299 VAL A O    15 
ATOM   10879 C CB   . VAL A 1 21 ? 3.869   0.015   2.467   1.00 15.00 ?  299 VAL A CB   15 
ATOM   10880 C CG1  . VAL A 1 21 ? 4.347   -1.053  1.491   1.00 15.00 ?  299 VAL A CG1  15 
ATOM   10881 C CG2  . VAL A 1 21 ? 3.652   1.314   1.709   1.00 15.00 ?  299 VAL A CG2  15 
ATOM   10882 H H    . VAL A 1 21 ? 1.097   0.477   1.993   1.00 15.00 ?  299 VAL A H    15 
ATOM   10883 H HA   . VAL A 1 21 ? 2.667   -1.439  3.511   1.00 15.00 ?  299 VAL A HA   15 
ATOM   10884 H HB   . VAL A 1 21 ? 4.628   0.172   3.223   1.00 15.00 ?  299 VAL A HB   15 
ATOM   10885 H HG11 . VAL A 1 21 ? 3.635   -1.145  0.684   1.00 15.00 ?  299 VAL A HG11 15 
ATOM   10886 H HG12 . VAL A 1 21 ? 4.435   -2.000  2.001   1.00 15.00 ?  299 VAL A HG12 15 
ATOM   10887 H HG13 . VAL A 1 21 ? 5.309   -0.770  1.091   1.00 15.00 ?  299 VAL A HG13 15 
ATOM   10888 H HG21 . VAL A 1 21 ? 2.893   1.168   0.956   1.00 15.00 ?  299 VAL A HG21 15 
ATOM   10889 H HG22 . VAL A 1 21 ? 4.576   1.613   1.236   1.00 15.00 ?  299 VAL A HG22 15 
ATOM   10890 H HG23 . VAL A 1 21 ? 3.333   2.084   2.397   1.00 15.00 ?  299 VAL A HG23 15 
ATOM   10891 N N    . ASP A 1 22 ? 1.510   -0.072  5.285   1.00 15.00 ?  300 ASP A N    15 
ATOM   10892 C CA   . ASP A 1 22 ? 1.106   0.694   6.443   1.00 15.00 ?  300 ASP A CA   15 
ATOM   10893 C C    . ASP A 1 22 ? 2.195   0.587   7.492   1.00 15.00 ?  300 ASP A C    15 
ATOM   10894 O O    . ASP A 1 22 ? 2.587   -0.515  7.883   1.00 15.00 ?  300 ASP A O    15 
ATOM   10895 C CB   . ASP A 1 22 ? -0.267  0.221   6.963   1.00 15.00 ?  300 ASP A CB   15 
ATOM   10896 C CG   . ASP A 1 22 ? -0.276  -0.121  8.443   1.00 15.00 ?  300 ASP A CG   15 
ATOM   10897 O OD1  . ASP A 1 22 ? -0.286  0.807   9.283   1.00 15.00 -1 300 ASP A OD1  15 
ATOM   10898 O OD2  . ASP A 1 22 ? -0.265  -1.319  8.774   1.00 15.00 ?  300 ASP A OD2  15 
ATOM   10899 H H    . ASP A 1 22 ? 1.284   -1.026  5.231   1.00 15.00 ?  300 ASP A H    15 
ATOM   10900 H HA   . ASP A 1 22 ? 1.028   1.728   6.137   1.00 15.00 ?  300 ASP A HA   15 
ATOM   10901 H HB2  . ASP A 1 22 ? -0.986  1.010   6.800   1.00 15.00 ?  300 ASP A HB2  15 
ATOM   10902 H HB3  . ASP A 1 22 ? -0.578  -0.653  6.403   1.00 15.00 ?  300 ASP A HB3  15 
ATOM   10903 N N    . HIS A 1 23 ? 2.723   1.733   7.905   1.00 15.00 ?  301 HIS A N    15 
ATOM   10904 C CA   . HIS A 1 23 ? 3.852   1.745   8.823   1.00 15.00 ?  301 HIS A CA   15 
ATOM   10905 C C    . HIS A 1 23 ? 3.370   1.579   10.261  1.00 15.00 ?  301 HIS A C    15 
ATOM   10906 O O    . HIS A 1 23 ? 4.151   1.235   11.148  1.00 15.00 ?  301 HIS A O    15 
ATOM   10907 C CB   . HIS A 1 23 ? 4.668   3.044   8.752   1.00 15.00 ?  301 HIS A CB   15 
ATOM   10908 C CG   . HIS A 1 23 ? 5.120   3.515   7.397   1.00 15.00 ?  301 HIS A CG   15 
ATOM   10909 N ND1  . HIS A 1 23 ? 5.324   4.848   7.134   1.00 15.00 ?  301 HIS A ND1  15 
ATOM   10910 C CD2  . HIS A 1 23 ? 5.517   2.858   6.275   1.00 15.00 ?  301 HIS A CD2  15 
ATOM   10911 C CE1  . HIS A 1 23 ? 5.824   4.991   5.932   1.00 15.00 ?  301 HIS A CE1  15 
ATOM   10912 N NE2  . HIS A 1 23 ? 5.959   3.798   5.384   1.00 15.00 ?  301 HIS A NE2  15 
ATOM   10913 H H    . HIS A 1 23 ? 2.332   2.582   7.596   1.00 15.00 ?  301 HIS A H    15 
ATOM   10914 H HA   . HIS A 1 23 ? 4.491   0.912   8.572   1.00 15.00 ?  301 HIS A HA   15 
ATOM   10915 H HB2  . HIS A 1 23 ? 4.087   3.836   9.181   1.00 15.00 ?  301 HIS A HB2  15 
ATOM   10916 H HB3  . HIS A 1 23 ? 5.556   2.909   9.352   1.00 15.00 ?  301 HIS A HB3  15 
ATOM   10917 H HD1  . HIS A 1 23 ? 5.109   5.599   7.748   1.00 15.00 ?  301 HIS A HD1  15 
ATOM   10918 H HD2  . HIS A 1 23 ? 5.489   1.787   6.104   1.00 15.00 ?  301 HIS A HD2  15 
ATOM   10919 H HE1  . HIS A 1 23 ? 6.081   5.929   5.462   1.00 15.00 ?  301 HIS A HE1  15 
ATOM   10920 H HE2  . HIS A 1 23 ? 6.573   3.603   4.638   1.00 15.00 ?  301 HIS A HE2  15 
ATOM   10921 N N    . ASN A 1 24 ? 2.091   1.844   10.490  1.00 15.00 ?  302 ASN A N    15 
ATOM   10922 C CA   . ASN A 1 24 ? 1.552   1.866   11.844  1.00 15.00 ?  302 ASN A CA   15 
ATOM   10923 C C    . ASN A 1 24 ? 1.332   0.452   12.354  1.00 15.00 ?  302 ASN A C    15 
ATOM   10924 O O    . ASN A 1 24 ? 1.964   0.023   13.319  1.00 15.00 ?  302 ASN A O    15 
ATOM   10925 C CB   . ASN A 1 24 ? 0.238   2.656   11.891  1.00 15.00 ?  302 ASN A CB   15 
ATOM   10926 C CG   . ASN A 1 24 ? -0.350  2.719   13.290  1.00 15.00 ?  302 ASN A CG   15 
ATOM   10927 O OD1  . ASN A 1 24 ? -0.013  3.604   14.076  1.00 15.00 ?  302 ASN A OD1  15 
ATOM   10928 N ND2  . ASN A 1 24 ? -1.239  1.789   13.606  1.00 15.00 ?  302 ASN A ND2  15 
ATOM   10929 H H    . ASN A 1 24 ? 1.486   2.000   9.731   1.00 15.00 ?  302 ASN A H    15 
ATOM   10930 H HA   . ASN A 1 24 ? 2.276   2.353   12.478  1.00 15.00 ?  302 ASN A HA   15 
ATOM   10931 H HB2  . ASN A 1 24 ? 0.419   3.665   11.552  1.00 15.00 ?  302 ASN A HB2  15 
ATOM   10932 H HB3  . ASN A 1 24 ? -0.483  2.184   11.239  1.00 15.00 ?  302 ASN A HB3  15 
ATOM   10933 H HD21 . ASN A 1 24 ? -1.470  1.120   12.928  1.00 15.00 ?  302 ASN A HD21 15 
ATOM   10934 H HD22 . ASN A 1 24 ? -1.626  1.805   14.511  1.00 15.00 ?  302 ASN A HD22 15 
ATOM   10935 N N    . ASN A 1 25 ? 0.449   -0.268  11.689  1.00 15.00 ?  303 ASN A N    15 
ATOM   10936 C CA   . ASN A 1 25 ? 0.133   -1.638  12.065  1.00 15.00 ?  303 ASN A CA   15 
ATOM   10937 C C    . ASN A 1 25 ? 1.117   -2.606  11.414  1.00 15.00 ?  303 ASN A C    15 
ATOM   10938 O O    . ASN A 1 25 ? 1.243   -3.759  11.830  1.00 15.00 ?  303 ASN A O    15 
ATOM   10939 C CB   . ASN A 1 25 ? -1.314  -1.957  11.666  1.00 15.00 ?  303 ASN A CB   15 
ATOM   10940 C CG   . ASN A 1 25 ? -1.686  -3.419  11.836  1.00 15.00 ?  303 ASN A CG   15 
ATOM   10941 O OD1  . ASN A 1 25 ? -2.071  -3.853  12.923  1.00 15.00 ?  303 ASN A OD1  15 
ATOM   10942 N ND2  . ASN A 1 25 ? -1.600  -4.178  10.754  1.00 15.00 ?  303 ASN A ND2  15 
ATOM   10943 H H    . ASN A 1 25 ? -0.007  0.133   10.905  1.00 15.00 ?  303 ASN A H    15 
ATOM   10944 H HA   . ASN A 1 25 ? 0.228   -1.717  13.138  1.00 15.00 ?  303 ASN A HA   15 
ATOM   10945 H HB2  . ASN A 1 25 ? -1.982  -1.369  12.277  1.00 15.00 ?  303 ASN A HB2  15 
ATOM   10946 H HB3  . ASN A 1 25 ? -1.457  -1.688  10.629  1.00 15.00 ?  303 ASN A HB3  15 
ATOM   10947 H HD21 . ASN A 1 25 ? -1.303  -3.759  9.918   1.00 15.00 ?  303 ASN A HD21 15 
ATOM   10948 H HD22 . ASN A 1 25 ? -1.847  -5.128  10.829  1.00 15.00 ?  303 ASN A HD22 15 
ATOM   10949 N N    . ARG A 1 26 ? 1.809   -2.109  10.395  1.00 15.00 ?  304 ARG A N    15 
ATOM   10950 C CA   . ARG A 1 26 ? 2.788   -2.876  9.639   1.00 15.00 ?  304 ARG A CA   15 
ATOM   10951 C C    . ARG A 1 26 ? 2.118   -4.025  8.896   1.00 15.00 ?  304 ARG A C    15 
ATOM   10952 O O    . ARG A 1 26 ? 2.063   -5.157  9.379   1.00 15.00 ?  304 ARG A O    15 
ATOM   10953 C CB   . ARG A 1 26 ? 3.924   -3.390  10.531  1.00 15.00 ?  304 ARG A CB   15 
ATOM   10954 C CG   . ARG A 1 26 ? 5.006   -4.125  9.758   1.00 15.00 ?  304 ARG A CG   15 
ATOM   10955 C CD   . ARG A 1 26 ? 6.166   -4.530  10.649  1.00 15.00 ?  304 ARG A CD   15 
ATOM   10956 N NE   . ARG A 1 26 ? 7.221   -5.192  9.889   1.00 15.00 ?  304 ARG A NE   15 
ATOM   10957 C CZ   . ARG A 1 26 ? 8.496   -5.233  10.260  1.00 15.00 ?  304 ARG A CZ   15 
ATOM   10958 N NH1  . ARG A 1 26 ? 8.875   -4.705  11.418  1.00 15.00 1  304 ARG A NH1  15 
ATOM   10959 N NH2  . ARG A 1 26 ? 9.386   -5.828  9.479   1.00 15.00 ?  304 ARG A NH2  15 
ATOM   10960 H H    . ARG A 1 26 ? 1.630   -1.188  10.117  1.00 15.00 ?  304 ARG A H    15 
ATOM   10961 H HA   . ARG A 1 26 ? 3.210   -2.207  8.902   1.00 15.00 ?  304 ARG A HA   15 
ATOM   10962 H HB2  . ARG A 1 26 ? 4.377   -2.552  11.038  1.00 15.00 ?  304 ARG A HB2  15 
ATOM   10963 H HB3  . ARG A 1 26 ? 3.514   -4.068  11.265  1.00 15.00 ?  304 ARG A HB3  15 
ATOM   10964 H HG2  . ARG A 1 26 ? 4.579   -5.012  9.317   1.00 15.00 ?  304 ARG A HG2  15 
ATOM   10965 H HG3  . ARG A 1 26 ? 5.376   -3.476  8.975   1.00 15.00 ?  304 ARG A HG3  15 
ATOM   10966 H HD2  . ARG A 1 26 ? 6.572   -3.646  11.115  1.00 15.00 ?  304 ARG A HD2  15 
ATOM   10967 H HD3  . ARG A 1 26 ? 5.804   -5.204  11.409  1.00 15.00 ?  304 ARG A HD3  15 
ATOM   10968 H HE   . ARG A 1 26 ? 6.961   -5.631  9.040   1.00 15.00 ?  304 ARG A HE   15 
ATOM   10969 H HH11 . ARG A 1 26 ? 8.199   -4.278  12.022  1.00 15.00 ?  304 ARG A HH11 15 
ATOM   10970 H HH12 . ARG A 1 26 ? 9.843   -4.737  11.699  1.00 15.00 ?  304 ARG A HH12 15 
ATOM   10971 H HH21 . ARG A 1 26 ? 9.097   -6.246  8.616   1.00 15.00 ?  304 ARG A HH21 15 
ATOM   10972 H HH22 . ARG A 1 26 ? 10.356  -5.865  9.750   1.00 15.00 ?  304 ARG A HH22 15 
ATOM   10973 N N    . THR A 1 27 ? 1.566   -3.712  7.738   1.00 15.00 ?  305 THR A N    15 
ATOM   10974 C CA   . THR A 1 27 ? 0.909   -4.712  6.916   1.00 15.00 ?  305 THR A CA   15 
ATOM   10975 C C    . THR A 1 27 ? 1.021   -4.347  5.439   1.00 15.00 ?  305 THR A C    15 
ATOM   10976 O O    . THR A 1 27 ? 1.110   -3.167  5.085   1.00 15.00 ?  305 THR A O    15 
ATOM   10977 C CB   . THR A 1 27 ? -0.583  -4.880  7.308   1.00 15.00 ?  305 THR A CB   15 
ATOM   10978 O OG1  . THR A 1 27 ? -1.165  -5.986  6.604   1.00 15.00 ?  305 THR A OG1  15 
ATOM   10979 C CG2  . THR A 1 27 ? -1.380  -3.620  7.010   1.00 15.00 ?  305 THR A CG2  15 
ATOM   10980 H H    . THR A 1 27 ? 1.590   -2.775  7.432   1.00 15.00 ?  305 THR A H    15 
ATOM   10981 H HA   . THR A 1 27 ? 1.410   -5.655  7.081   1.00 15.00 ?  305 THR A HA   15 
ATOM   10982 H HB   . THR A 1 27 ? -0.637  -5.076  8.371   1.00 15.00 ?  305 THR A HB   15 
ATOM   10983 H HG1  . THR A 1 27 ? -2.127  -5.894  6.604   1.00 15.00 ?  305 THR A HG1  15 
ATOM   10984 H HG21 . THR A 1 27 ? -0.971  -2.792  7.571   1.00 15.00 ?  305 THR A HG21 15 
ATOM   10985 H HG22 . THR A 1 27 ? -2.412  -3.772  7.292   1.00 15.00 ?  305 THR A HG22 15 
ATOM   10986 H HG23 . THR A 1 27 ? -1.325  -3.401  5.953   1.00 15.00 ?  305 THR A HG23 15 
ATOM   10987 N N    . THR A 1 28 ? 1.046   -5.364  4.589   1.00 15.00 ?  306 THR A N    15 
ATOM   10988 C CA   . THR A 1 28 ? 1.086   -5.154  3.154   1.00 15.00 ?  306 THR A CA   15 
ATOM   10989 C C    . THR A 1 28 ? -0.224  -5.619  2.525   1.00 15.00 ?  306 THR A C    15 
ATOM   10990 O O    . THR A 1 28 ? -0.551  -6.806  2.548   1.00 15.00 ?  306 THR A O    15 
ATOM   10991 C CB   . THR A 1 28 ? 2.266   -5.898  2.509   1.00 15.00 ?  306 THR A CB   15 
ATOM   10992 O OG1  . THR A 1 28 ? 3.420   -5.823  3.357   1.00 15.00 ?  306 THR A OG1  15 
ATOM   10993 C CG2  . THR A 1 28 ? 2.602   -5.291  1.157   1.00 15.00 ?  306 THR A CG2  15 
ATOM   10994 H H    . THR A 1 28 ? 1.036   -6.281  4.935   1.00 15.00 ?  306 THR A H    15 
ATOM   10995 H HA   . THR A 1 28 ? 1.206   -4.094  2.974   1.00 15.00 ?  306 THR A HA   15 
ATOM   10996 H HB   . THR A 1 28 ? 1.993   -6.934  2.367   1.00 15.00 ?  306 THR A HB   15 
ATOM   10997 H HG1  . THR A 1 28 ? 4.212   -6.026  2.832   1.00 15.00 ?  306 THR A HG1  15 
ATOM   10998 H HG21 . THR A 1 28 ? 3.427   -5.831  0.715   1.00 15.00 ?  306 THR A HG21 15 
ATOM   10999 H HG22 . THR A 1 28 ? 2.881   -4.254  1.290   1.00 15.00 ?  306 THR A HG22 15 
ATOM   11000 H HG23 . THR A 1 28 ? 1.741   -5.354  0.509   1.00 15.00 ?  306 THR A HG23 15 
ATOM   11001 N N    . GLN A 1 29 ? -0.977  -4.682  1.972   1.00 15.00 ?  307 GLN A N    15 
ATOM   11002 C CA   . GLN A 1 29 ? -2.321  -4.966  1.490   1.00 15.00 ?  307 GLN A CA   15 
ATOM   11003 C C    . GLN A 1 29 ? -2.432  -4.751  -0.016  1.00 15.00 ?  307 GLN A C    15 
ATOM   11004 O O    . GLN A 1 29 ? -2.035  -3.719  -0.530  1.00 15.00 ?  307 GLN A O    15 
ATOM   11005 C CB   . GLN A 1 29 ? -3.325  -4.061  2.214   1.00 15.00 ?  307 GLN A CB   15 
ATOM   11006 C CG   . GLN A 1 29 ? -3.243  -4.118  3.737   1.00 15.00 ?  307 GLN A CG   15 
ATOM   11007 C CD   . GLN A 1 29 ? -3.711  -5.437  4.347   1.00 15.00 ?  307 GLN A CD   15 
ATOM   11008 O OE1  . GLN A 1 29 ? -4.230  -5.457  5.462   1.00 15.00 ?  307 GLN A OE1  15 
ATOM   11009 N NE2  . GLN A 1 29 ? -3.520  -6.543  3.645   1.00 15.00 ?  307 GLN A NE2  15 
ATOM   11010 H H    . GLN A 1 29 ? -0.617  -3.774  1.880   1.00 15.00 ?  307 GLN A H    15 
ATOM   11011 H HA   . GLN A 1 29 ? -2.549  -5.996  1.717   1.00 15.00 ?  307 GLN A HA   15 
ATOM   11012 H HB2  . GLN A 1 29 ? -3.145  -3.034  1.909   1.00 15.00 ?  307 GLN A HB2  15 
ATOM   11013 H HB3  . GLN A 1 29 ? -4.325  -4.343  1.918   1.00 15.00 ?  307 GLN A HB3  15 
ATOM   11014 H HG2  . GLN A 1 29 ? -2.216  -3.958  4.029   1.00 15.00 ?  307 GLN A HG2  15 
ATOM   11015 H HG3  . GLN A 1 29 ? -3.852  -3.320  4.140   1.00 15.00 ?  307 GLN A HG3  15 
ATOM   11016 H HE21 . GLN A 1 29 ? -3.088  -6.471  2.769   1.00 15.00 ?  307 GLN A HE21 15 
ATOM   11017 H HE22 . GLN A 1 29 ? -3.816  -7.395  4.034   1.00 15.00 ?  307 GLN A HE22 15 
ATOM   11018 N N    . PHE A 1 30 ? -2.985  -5.720  -0.719  1.00 15.00 ?  308 PHE A N    15 
ATOM   11019 C CA   . PHE A 1 30 ? -3.261  -5.553  -2.139  1.00 15.00 ?  308 PHE A CA   15 
ATOM   11020 C C    . PHE A 1 30 ? -4.676  -5.029  -2.348  1.00 15.00 ?  308 PHE A C    15 
ATOM   11021 O O    . PHE A 1 30 ? -5.037  -4.599  -3.443  1.00 15.00 ?  308 PHE A O    15 
ATOM   11022 C CB   . PHE A 1 30 ? -3.020  -6.844  -2.930  1.00 15.00 ?  308 PHE A CB   15 
ATOM   11023 C CG   . PHE A 1 30 ? -1.610  -6.960  -3.447  1.00 15.00 ?  308 PHE A CG   15 
ATOM   11024 C CD1  . PHE A 1 30 ? -0.853  -5.819  -3.673  1.00 15.00 ?  308 PHE A CD1  15 
ATOM   11025 C CD2  . PHE A 1 30 ? -1.047  -8.194  -3.731  1.00 15.00 ?  308 PHE A CD2  15 
ATOM   11026 C CE1  . PHE A 1 30 ? 0.434   -5.906  -4.169  1.00 15.00 ?  308 PHE A CE1  15 
ATOM   11027 C CE2  . PHE A 1 30 ? 0.237   -8.282  -4.220  1.00 15.00 ?  308 PHE A CE2  15 
ATOM   11028 C CZ   . PHE A 1 30 ? 0.979   -7.139  -4.439  1.00 15.00 ?  308 PHE A CZ   15 
ATOM   11029 H H    . PHE A 1 30 ? -3.236  -6.561  -0.272  1.00 15.00 ?  308 PHE A H    15 
ATOM   11030 H HA   . PHE A 1 30 ? -2.576  -4.801  -2.503  1.00 15.00 ?  308 PHE A HA   15 
ATOM   11031 H HB2  . PHE A 1 30 ? -3.214  -7.694  -2.293  1.00 15.00 ?  308 PHE A HB2  15 
ATOM   11032 H HB3  . PHE A 1 30 ? -3.690  -6.872  -3.778  1.00 15.00 ?  308 PHE A HB3  15 
ATOM   11033 H HD1  . PHE A 1 30 ? -1.279  -4.852  -3.453  1.00 15.00 ?  308 PHE A HD1  15 
ATOM   11034 H HD2  . PHE A 1 30 ? -1.618  -9.098  -3.569  1.00 15.00 ?  308 PHE A HD2  15 
ATOM   11035 H HE1  . PHE A 1 30 ? 1.014   -5.007  -4.345  1.00 15.00 ?  308 PHE A HE1  15 
ATOM   11036 H HE2  . PHE A 1 30 ? 0.667   -9.250  -4.432  1.00 15.00 ?  308 PHE A HE2  15 
ATOM   11037 H HZ   . PHE A 1 30 ? 1.985   -7.213  -4.828  1.00 15.00 ?  308 PHE A HZ   15 
ATOM   11038 N N    . THR A 1 31 ? -5.480  -5.108  -1.299  1.00 15.00 ?  309 THR A N    15 
ATOM   11039 C CA   . THR A 1 31 ? -6.827  -4.562  -1.320  1.00 15.00 ?  309 THR A CA   15 
ATOM   11040 C C    . THR A 1 31 ? -6.809  -3.055  -1.016  1.00 15.00 ?  309 THR A C    15 
ATOM   11041 O O    . THR A 1 31 ? -6.332  -2.621  0.038   1.00 15.00 ?  309 THR A O    15 
ATOM   11042 C CB   . THR A 1 31 ? -7.746  -5.310  -0.317  1.00 15.00 ?  309 THR A CB   15 
ATOM   11043 O OG1  . THR A 1 31 ? -9.053  -4.720  -0.285  1.00 15.00 ?  309 THR A OG1  15 
ATOM   11044 C CG2  . THR A 1 31 ? -7.150  -5.317  1.086   1.00 15.00 ?  309 THR A CG2  15 
ATOM   11045 H H    . THR A 1 31 ? -5.157  -5.546  -0.484  1.00 15.00 ?  309 THR A H    15 
ATOM   11046 H HA   . THR A 1 31 ? -7.223  -4.708  -2.314  1.00 15.00 ?  309 THR A HA   15 
ATOM   11047 H HB   . THR A 1 31 ? -7.840  -6.334  -0.648  1.00 15.00 ?  309 THR A HB   15 
ATOM   11048 H HG1  . THR A 1 31 ? -9.533  -5.045  0.494   1.00 15.00 ?  309 THR A HG1  15 
ATOM   11049 H HG21 . THR A 1 31 ? -7.812  -5.847  1.756   1.00 15.00 ?  309 THR A HG21 15 
ATOM   11050 H HG22 . THR A 1 31 ? -7.031  -4.300  1.431   1.00 15.00 ?  309 THR A HG22 15 
ATOM   11051 H HG23 . THR A 1 31 ? -6.188  -5.806  1.067   1.00 15.00 ?  309 THR A HG23 15 
ATOM   11052 N N    . ASP A 1 32 ? -7.293  -2.260  -1.966  1.00 15.00 ?  310 ASP A N    15 
ATOM   11053 C CA   . ASP A 1 32 ? -7.401  -0.814  -1.779  1.00 15.00 ?  310 ASP A CA   15 
ATOM   11054 C C    . ASP A 1 32 ? -8.825  -0.464  -1.343  1.00 15.00 ?  310 ASP A C    15 
ATOM   11055 O O    . ASP A 1 32 ? -9.793  -0.945  -1.933  1.00 15.00 ?  310 ASP A O    15 
ATOM   11056 C CB   . ASP A 1 32 ? -7.048  -0.070  -3.080  1.00 15.00 ?  310 ASP A CB   15 
ATOM   11057 C CG   . ASP A 1 32 ? -7.030  1.439   -2.914  1.00 15.00 ?  310 ASP A CG   15 
ATOM   11058 O OD1  . ASP A 1 32 ? -8.107  2.053   -2.971  1.00 15.00 -1 310 ASP A OD1  15 
ATOM   11059 O OD2  . ASP A 1 32 ? -5.940  2.019   -2.738  1.00 15.00 ?  310 ASP A OD2  15 
ATOM   11060 H H    . ASP A 1 32 ? -7.593  -2.656  -2.811  1.00 15.00 ?  310 ASP A H    15 
ATOM   11061 H HA   . ASP A 1 32 ? -6.711  -0.522  -1.001  1.00 15.00 ?  310 ASP A HA   15 
ATOM   11062 H HB2  . ASP A 1 32 ? -6.078  -0.382  -3.425  1.00 15.00 ?  310 ASP A HB2  15 
ATOM   11063 H HB3  . ASP A 1 32 ? -7.780  -0.314  -3.829  1.00 15.00 ?  310 ASP A HB3  15 
ATOM   11064 N N    . PRO A 1 33 ? -8.974  0.356   -0.294  1.00 15.00 ?  311 PRO A N    15 
ATOM   11065 C CA   . PRO A 1 33 ? -10.277 0.773   0.217   1.00 15.00 ?  311 PRO A CA   15 
ATOM   11066 C C    . PRO A 1 33 ? -10.832 2.025   -0.475  1.00 15.00 ?  311 PRO A C    15 
ATOM   11067 O O    . PRO A 1 33 ? -12.004 2.364   -0.317  1.00 15.00 ?  311 PRO A O    15 
ATOM   11068 C CB   . PRO A 1 33 ? -9.988  1.049   1.693   1.00 15.00 ?  311 PRO A CB   15 
ATOM   11069 C CG   . PRO A 1 33 ? -8.557  1.484   1.738   1.00 15.00 ?  311 PRO A CG   15 
ATOM   11070 C CD   . PRO A 1 33 ? -7.873  0.923   0.507   1.00 15.00 ?  311 PRO A CD   15 
ATOM   11071 H HA   . PRO A 1 33 ? -11.002 -0.023  0.138   1.00 15.00 ?  311 PRO A HA   15 
ATOM   11072 H HB2  . PRO A 1 33 ? -10.651 1.826   2.054   1.00 15.00 ?  311 PRO A HB2  15 
ATOM   11073 H HB3  . PRO A 1 33 ? -10.142 0.146   2.263   1.00 15.00 ?  311 PRO A HB3  15 
ATOM   11074 H HG2  . PRO A 1 33 ? -8.505  2.560   1.734   1.00 15.00 ?  311 PRO A HG2  15 
ATOM   11075 H HG3  . PRO A 1 33 ? -8.091  1.096   2.630   1.00 15.00 ?  311 PRO A HG3  15 
ATOM   11076 H HD2  . PRO A 1 33 ? -7.375  1.713   -0.035  1.00 15.00 ?  311 PRO A HD2  15 
ATOM   11077 H HD3  . PRO A 1 33 ? -7.167  0.155   0.787   1.00 15.00 ?  311 PRO A HD3  15 
ATOM   11078 N N    . ARG A 1 34 ? -9.971  2.722   -1.204  1.00 15.00 ?  312 ARG A N    15 
ATOM   11079 C CA   . ARG A 1 34 ? -10.271 4.060   -1.709  1.00 15.00 ?  312 ARG A CA   15 
ATOM   11080 C C    . ARG A 1 34 ? -11.197 4.050   -2.928  1.00 15.00 ?  312 ARG A C    15 
ATOM   11081 O O    . ARG A 1 34 ? -11.718 5.099   -3.311  1.00 15.00 ?  312 ARG A O    15 
ATOM   11082 C CB   . ARG A 1 34 ? -8.971  4.785   -2.056  1.00 15.00 ?  312 ARG A CB   15 
ATOM   11083 C CG   . ARG A 1 34 ? -8.029  4.939   -0.875  1.00 15.00 ?  312 ARG A CG   15 
ATOM   11084 C CD   . ARG A 1 34 ? -6.572  4.894   -1.311  1.00 15.00 ?  312 ARG A CD   15 
ATOM   11085 N NE   . ARG A 1 34 ? -6.241  5.945   -2.271  1.00 15.00 ?  312 ARG A NE   15 
ATOM   11086 C CZ   . ARG A 1 34 ? -5.750  5.709   -3.490  1.00 15.00 ?  312 ARG A CZ   15 
ATOM   11087 N NH1  . ARG A 1 34 ? -5.590  4.460   -3.919  1.00 15.00 1  312 ARG A NH1  15 
ATOM   11088 N NH2  . ARG A 1 34 ? -5.427  6.725   -4.279  1.00 15.00 ?  312 ARG A NH2  15 
ATOM   11089 H H    . ARG A 1 34 ? -9.107  2.309   -1.446  1.00 15.00 ?  312 ARG A H    15 
ATOM   11090 H HA   . ARG A 1 34 ? -10.761 4.601   -0.915  1.00 15.00 ?  312 ARG A HA   15 
ATOM   11091 H HB2  . ARG A 1 34 ? -8.460  4.233   -2.831  1.00 15.00 ?  312 ARG A HB2  15 
ATOM   11092 H HB3  . ARG A 1 34 ? -9.212  5.770   -2.428  1.00 15.00 ?  312 ARG A HB3  15 
ATOM   11093 H HG2  . ARG A 1 34 ? -8.220  5.888   -0.396  1.00 15.00 ?  312 ARG A HG2  15 
ATOM   11094 H HG3  . ARG A 1 34 ? -8.211  4.139   -0.176  1.00 15.00 ?  312 ARG A HG3  15 
ATOM   11095 H HD2  . ARG A 1 34 ? -5.946  5.014   -0.437  1.00 15.00 ?  312 ARG A HD2  15 
ATOM   11096 H HD3  . ARG A 1 34 ? -6.375  3.933   -1.761  1.00 15.00 ?  312 ARG A HD3  15 
ATOM   11097 H HE   . ARG A 1 34 ? -6.376  6.881   -1.981  1.00 15.00 ?  312 ARG A HE   15 
ATOM   11098 H HH11 . ARG A 1 34 ? -5.838  3.674   -3.325  1.00 15.00 ?  312 ARG A HH11 15 
ATOM   11099 H HH12 . ARG A 1 34 ? -5.224  4.285   -4.835  1.00 15.00 ?  312 ARG A HH12 15 
ATOM   11100 H HH21 . ARG A 1 34 ? -5.551  7.668   -3.963  1.00 15.00 ?  312 ARG A HH21 15 
ATOM   11101 H HH22 . ARG A 1 34 ? -5.044  6.556   -5.199  1.00 15.00 ?  312 ARG A HH22 15 
ATOM   11102 N N    . LEU A 1 35 ? -11.373 2.897   -3.564  1.00 15.00 ?  313 LEU A N    15 
ATOM   11103 C CA   . LEU A 1 35 ? -12.208 2.829   -4.766  1.00 15.00 ?  313 LEU A CA   15 
ATOM   11104 C C    . LEU A 1 35 ? -13.685 2.947   -4.389  1.00 15.00 ?  313 LEU A C    15 
ATOM   11105 O O    . LEU A 1 35 ? -14.256 1.956   -3.890  1.00 15.00 ?  313 LEU A O    15 
ATOM   11106 C CB   . LEU A 1 35 ? -11.996 1.528   -5.564  1.00 15.00 ?  313 LEU A CB   15 
ATOM   11107 C CG   . LEU A 1 35 ? -10.547 1.077   -5.820  1.00 15.00 ?  313 LEU A CG   15 
ATOM   11108 C CD1  . LEU A 1 35 ? -9.603  2.249   -6.046  1.00 15.00 ?  313 LEU A CD1  15 
ATOM   11109 C CD2  . LEU A 1 35 ? -10.059 0.207   -4.686  1.00 15.00 ?  313 LEU A CD2  15 
ATOM   11110 H H    . LEU A 1 35 ? -10.941 2.087   -3.224  1.00 15.00 ?  313 LEU A H    15 
ATOM   11111 H HA   . LEU A 1 35 ? -11.946 3.670   -5.391  1.00 15.00 ?  313 LEU A HA   15 
ATOM   11112 H HB2  . LEU A 1 35 ? -12.499 0.731   -5.037  1.00 15.00 ?  313 LEU A HB2  15 
ATOM   11113 H HB3  . LEU A 1 35 ? -12.478 1.649   -6.523  1.00 15.00 ?  313 LEU A HB3  15 
ATOM   11114 H HG   . LEU A 1 35 ? -10.531 0.476   -6.718  1.00 15.00 ?  313 LEU A HG   15 
ATOM   11115 H HD11 . LEU A 1 35 ? -8.579  1.909   -5.925  1.00 15.00 ?  313 LEU A HD11 15 
ATOM   11116 H HD12 . LEU A 1 35 ? -9.813  3.028   -5.326  1.00 15.00 ?  313 LEU A HD12 15 
ATOM   11117 H HD13 . LEU A 1 35 ? -9.738  2.635   -7.045  1.00 15.00 ?  313 LEU A HD13 15 
ATOM   11118 H HD21 . LEU A 1 35 ? -10.691 -0.666  -4.604  1.00 15.00 ?  313 LEU A HD21 15 
ATOM   11119 H HD22 . LEU A 1 35 ? -10.095 0.766   -3.763  1.00 15.00 ?  313 LEU A HD22 15 
ATOM   11120 H HD23 . LEU A 1 35 ? -9.042  -0.102  -4.881  1.00 15.00 ?  313 LEU A HD23 15 
ATOM   11121 N N    . ASP B 2 2  ? -1.544  -9.344  -8.626  1.00 15.00 ?  221 ASP B N    15 
ATOM   11122 C CA   . ASP B 2 2  ? -0.072  -9.186  -8.724  1.00 15.00 ?  221 ASP B CA   15 
ATOM   11123 C C    . ASP B 2 2  ? 0.613   -10.184 -7.790  1.00 15.00 ?  221 ASP B C    15 
ATOM   11124 O O    . ASP B 2 2  ? -0.058  -10.941 -7.091  1.00 15.00 ?  221 ASP B O    15 
ATOM   11125 C CB   . ASP B 2 2  ? 0.336   -7.745  -8.380  1.00 15.00 ?  221 ASP B CB   15 
ATOM   11126 C CG   . ASP B 2 2  ? 1.723   -7.401  -8.881  1.00 15.00 ?  221 ASP B CG   15 
ATOM   11127 O OD1  . ASP B 2 2  ? 2.696   -7.619  -8.141  1.00 15.00 ?  221 ASP B OD1  15 
ATOM   11128 O OD2  . ASP B 2 2  ? 1.845   -6.912  -10.022 1.00 15.00 -1 221 ASP B OD2  15 
ATOM   11129 H H    . ASP B 2 2  ? -1.865  -9.139  -7.654  1.00 15.00 ?  221 ASP B H    15 
ATOM   11130 H HA   . ASP B 2 2  ? 0.223   -9.405  -9.741  1.00 15.00 ?  221 ASP B HA   15 
ATOM   11131 H HB2  . ASP B 2 2  ? -0.367  -7.061  -8.831  1.00 15.00 ?  221 ASP B HB2  15 
ATOM   11132 H HB3  . ASP B 2 2  ? 0.316   -7.613  -7.306  1.00 15.00 ?  221 ASP B HB3  15 
ATOM   11133 N N    . THR B 2 3  ? 1.939   -10.182 -7.770  1.00 15.00 ?  222 THR B N    15 
ATOM   11134 C CA   . THR B 2 3  ? 2.698   -11.157 -7.003  1.00 15.00 ?  222 THR B CA   15 
ATOM   11135 C C    . THR B 2 3  ? 2.570   -10.869 -5.506  1.00 15.00 ?  222 THR B C    15 
ATOM   11136 O O    . THR B 2 3  ? 2.502   -9.711  -5.107  1.00 15.00 ?  222 THR B O    15 
ATOM   11137 C CB   . THR B 2 3  ? 4.188   -11.167 -7.451  1.00 15.00 ?  222 THR B CB   15 
ATOM   11138 O OG1  . THR B 2 3  ? 4.898   -12.263 -6.862  1.00 15.00 ?  222 THR B OG1  15 
ATOM   11139 C CG2  . THR B 2 3  ? 4.886   -9.863  -7.092  1.00 15.00 ?  222 THR B CG2  15 
ATOM   11140 H H    . THR B 2 3  ? 2.424   -9.476  -8.259  1.00 15.00 ?  222 THR B H    15 
ATOM   11141 H HA   . THR B 2 3  ? 2.271   -12.127 -7.197  1.00 15.00 ?  222 THR B HA   15 
ATOM   11142 H HB   . THR B 2 3  ? 4.215   -11.278 -8.525  1.00 15.00 ?  222 THR B HB   15 
ATOM   11143 H HG1  . THR B 2 3  ? 5.312   -11.971 -6.041  1.00 15.00 ?  222 THR B HG1  15 
ATOM   11144 H HG21 . THR B 2 3  ? 4.399   -9.043  -7.599  1.00 15.00 ?  222 THR B HG21 15 
ATOM   11145 H HG22 . THR B 2 3  ? 5.921   -9.913  -7.398  1.00 15.00 ?  222 THR B HG22 15 
ATOM   11146 H HG23 . THR B 2 3  ? 4.832   -9.708  -6.024  1.00 15.00 ?  222 THR B HG23 15 
ATOM   11147 N N    . PRO B 2 4  ? 2.549   -11.926 -4.664  1.00 15.00 ?  223 PRO B N    15 
ATOM   11148 C CA   . PRO B 2 4  ? 2.223   -11.812 -3.231  1.00 15.00 ?  223 PRO B CA   15 
ATOM   11149 C C    . PRO B 2 4  ? 2.988   -10.693 -2.518  1.00 15.00 ?  223 PRO B C    15 
ATOM   11150 O O    . PRO B 2 4  ? 4.184   -10.495 -2.752  1.00 15.00 ?  223 PRO B O    15 
ATOM   11151 C CB   . PRO B 2 4  ? 2.633   -13.176 -2.678  1.00 15.00 ?  223 PRO B CB   15 
ATOM   11152 C CG   . PRO B 2 4  ? 2.449   -14.110 -3.818  1.00 15.00 ?  223 PRO B CG   15 
ATOM   11153 C CD   . PRO B 2 4  ? 2.801   -13.329 -5.052  1.00 15.00 ?  223 PRO B CD   15 
ATOM   11154 H HA   . PRO B 2 4  ? 1.164   -11.670 -3.089  1.00 15.00 ?  223 PRO B HA   15 
ATOM   11155 H HB2  . PRO B 2 4  ? 3.664   -13.141 -2.356  1.00 15.00 ?  223 PRO B HB2  15 
ATOM   11156 H HB3  . PRO B 2 4  ? 1.997   -13.438 -1.846  1.00 15.00 ?  223 PRO B HB3  15 
ATOM   11157 H HG2  . PRO B 2 4  ? 3.110   -14.958 -3.706  1.00 15.00 ?  223 PRO B HG2  15 
ATOM   11158 H HG3  . PRO B 2 4  ? 1.421   -14.437 -3.862  1.00 15.00 ?  223 PRO B HG3  15 
ATOM   11159 H HD2  . PRO B 2 4  ? 3.840   -13.477 -5.307  1.00 15.00 ?  223 PRO B HD2  15 
ATOM   11160 H HD3  . PRO B 2 4  ? 2.165   -13.621 -5.876  1.00 15.00 ?  223 PRO B HD3  15 
ATOM   11161 N N    . PRO B 2 5  ? 2.294   -9.987  -1.598  1.00 15.00 ?  224 PRO B N    15 
ATOM   11162 C CA   . PRO B 2 5  ? 2.757   -8.716  -1.025  1.00 15.00 ?  224 PRO B CA   15 
ATOM   11163 C C    . PRO B 2 5  ? 4.169   -8.752  -0.437  1.00 15.00 ?  224 PRO B C    15 
ATOM   11164 O O    . PRO B 2 5  ? 4.526   -9.646  0.339   1.00 15.00 ?  224 PRO B O    15 
ATOM   11165 C CB   . PRO B 2 5  ? 1.735   -8.395  0.071   1.00 15.00 ?  224 PRO B CB   15 
ATOM   11166 C CG   . PRO B 2 5  ? 0.887   -9.609  0.233   1.00 15.00 ?  224 PRO B CG   15 
ATOM   11167 C CD   . PRO B 2 5  ? 0.992   -10.394 -1.040  1.00 15.00 ?  224 PRO B CD   15 
ATO