data_2LD1
# 
_entry.id   2LD1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LD1         
RCSB  RCSB102247   
BMRB  15001        
WWPDB D_1000102247 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          15001 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'NMR chemical shift assignments for ATRX ADD domain' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LD1 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-13 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Neuhaus, D.' 1 
'Yang, J.'    2 
# 
_citation.id                        primary 
_citation.title                     
;Structural consequences of disease-causing mutations in the ATRX-DNMT3-DNMT3L (ADD) domain of the chromatin-associated protein ATRX.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            104 
_citation.page_first                11939 
_citation.page_last                 11944 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17609377 
_citation.pdbx_database_id_DOI      10.1073/pnas.0704057104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Argentaro, A.'   1 
primary 'Yang, J.C.'      2 
primary 'Chapman, L.'     3 
primary 'Kowalczyk, M.S.' 4 
primary 'Gibbons, R.J.'   5 
primary 'Higgs, D.R.'     6 
primary 'Neuhaus, D.'     7 
primary 'Rhodes, D.'      8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcriptional regulator ATRX' 16274.603 1 3.6.4.12 ? 'ADD DOMAIN, RESIDUES 159-296' ? 
2 non-polymer syn 'ZINC ION'                       65.409    3 ?        ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ATP-dependent helicase ATRX, X-linked helicase II, X-linked nuclear protein, XNP, Znf-HX' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDF
CHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDF
CHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   ASP n 
1 6   LYS n 
1 7   ARG n 
1 8   GLY n 
1 9   ASP n 
1 10  GLY n 
1 11  LEU n 
1 12  HIS n 
1 13  GLY n 
1 14  ILE n 
1 15  VAL n 
1 16  SER n 
1 17  CYS n 
1 18  THR n 
1 19  ALA n 
1 20  CYS n 
1 21  GLY n 
1 22  GLN n 
1 23  GLN n 
1 24  VAL n 
1 25  ASN n 
1 26  HIS n 
1 27  PHE n 
1 28  GLN n 
1 29  LYS n 
1 30  ASP n 
1 31  SER n 
1 32  ILE n 
1 33  TYR n 
1 34  ARG n 
1 35  HIS n 
1 36  PRO n 
1 37  SER n 
1 38  LEU n 
1 39  GLN n 
1 40  VAL n 
1 41  LEU n 
1 42  ILE n 
1 43  CYS n 
1 44  LYS n 
1 45  ASN n 
1 46  CYS n 
1 47  PHE n 
1 48  LYS n 
1 49  TYR n 
1 50  TYR n 
1 51  MET n 
1 52  SER n 
1 53  ASP n 
1 54  ASP n 
1 55  ILE n 
1 56  SER n 
1 57  ARG n 
1 58  ASP n 
1 59  SER n 
1 60  ASP n 
1 61  GLY n 
1 62  MET n 
1 63  ASP n 
1 64  GLU n 
1 65  GLN n 
1 66  CYS n 
1 67  ARG n 
1 68  TRP n 
1 69  CYS n 
1 70  ALA n 
1 71  GLU n 
1 72  GLY n 
1 73  GLY n 
1 74  ASN n 
1 75  LEU n 
1 76  ILE n 
1 77  CYS n 
1 78  CYS n 
1 79  ASP n 
1 80  PHE n 
1 81  CYS n 
1 82  HIS n 
1 83  ASN n 
1 84  ALA n 
1 85  PHE n 
1 86  CYS n 
1 87  LYS n 
1 88  LYS n 
1 89  CYS n 
1 90  ILE n 
1 91  LEU n 
1 92  ARG n 
1 93  ASN n 
1 94  LEU n 
1 95  GLY n 
1 96  ARG n 
1 97  LYS n 
1 98  GLU n 
1 99  LEU n 
1 100 SER n 
1 101 THR n 
1 102 ILE n 
1 103 MET n 
1 104 ASP n 
1 105 GLU n 
1 106 ASN n 
1 107 ASN n 
1 108 GLN n 
1 109 TRP n 
1 110 TYR n 
1 111 CYS n 
1 112 TYR n 
1 113 ILE n 
1 114 CYS n 
1 115 HIS n 
1 116 PRO n 
1 117 GLU n 
1 118 PRO n 
1 119 LEU n 
1 120 LEU n 
1 121 ASP n 
1 122 LEU n 
1 123 VAL n 
1 124 THR n 
1 125 ALA n 
1 126 CYS n 
1 127 ASN n 
1 128 SER n 
1 129 VAL n 
1 130 PHE n 
1 131 GLU n 
1 132 ASN n 
1 133 LEU n 
1 134 GLU n 
1 135 GLN n 
1 136 LEU n 
1 137 LEU n 
1 138 GLN n 
1 139 GLN n 
1 140 ASN n 
1 141 LYS n 
1 142 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ATRX, RAD54L, XH2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3 ROSETTA PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET30a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATRX_HUMAN 
_struct_ref.pdbx_db_accession          P46100 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KRGEDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNA
FCKKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKK
;
_struct_ref.pdbx_align_begin           159 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LD1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 142 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P46100 
_struct_ref_seq.db_align_beg                  159 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  296 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       160 
_struct_ref_seq.pdbx_auth_seq_align_end       296 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LD1 GLY A 1 ? UNP P46100 ?   ?   'EXPRESSION TAG' 155 1 
1 2LD1 ALA A 2 ? UNP P46100 ?   ?   'EXPRESSION TAG' 156 2 
1 2LD1 MET A 3 ? UNP P46100 ?   ?   'EXPRESSION TAG' 157 3 
1 2LD1 ALA A 4 ? UNP P46100 ?   ?   'EXPRESSION TAG' 158 4 
1 2LD1 ASP A 5 ? UNP P46100 ?   ?   'EXPRESSION TAG' 159 5 
1 2LD1 ?   A ? ? UNP P46100 GLU 162 DELETION         ?   6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-1H NOESY'  
1 3  1 '3D 1H-15N NOESY' 
1 4  1 '3D HNHB'         
1 5  2 '2D 1H-15N HSQC'  
1 6  2 '2D 1H-13C HSQC'  
1 7  2 '3D HNCACB'       
1 8  2 '3D HN(COCA)CB'   
1 9  2 '3D HNCA'         
1 10 2 '3D HN(CO)CA'     
1 11 2 '3D HNHAHB'       
1 12 2 '3D HN(CO)HAHB'   
1 13 2 '3D HCCH-TOCSY'   
1 14 2 '3D HCCH-COSY'    
1 15 2 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.5 
_pdbx_nmr_exptl_sample_conditions.pH                  6.7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.6-0.8 mM [U-15N] ADD_domain_163-296, 20 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 100 uM zinc chloride, 0.5 M sodium chloride, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.3-0.4 mM [U-13C; U-15N] ADD_domain_163-296, 20 mM [U-2H] TRIS, 1 mM [U-2H] DTT, 100 uM zinc chloride, 0.5 M sodium chloride, 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
500 Bruker DRX    2 'Bruker DRX'    
# 
_pdbx_nmr_refine.entry_id           2LD1 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             34 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LD1 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.33 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LD1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin' collection           xwinnmr 3.5 1 
'Bruker Biospin' processing           xwinnmr 3.5 2 
Goddard          'data analysis'      SPARKY  ?   3 
Goddard          'peak picking'       SPARKY  ?   4 
Brunger          'structure solution' X-PLOR  3.8 5 
Brunger          refinement           X-PLOR  3.8 6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LD1 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LD1 
_struct.title                     'Structures and chemical shift assignments for the ADD domain of the ATRX protein' 
_struct.pdbx_descriptor           'Transcriptional regulator ATRX (E.C.3.6.4.12)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LD1 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'HYDROLASE, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 43  ? ASP A 53  ? CYS A 197 ASP A 207 1 ? 11 
HELX_P HELX_P2 2 LYS A 87  ? GLY A 95  ? LYS A 241 GLY A 249 1 ? 9  
HELX_P HELX_P3 3 ARG A 96  ? MET A 103 ? ARG A 250 MET A 257 1 ? 8  
HELX_P HELX_P4 4 LEU A 119 ? GLN A 139 ? LEU A 273 GLN A 293 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 66  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 220 A ZN 2 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc2  metalc ? ? A CYS 78  SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 232 A ZN 3 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc3  metalc ? ? A CYS 111 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 265 A ZN 3 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc4  metalc ? ? A CYS 86  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 240 A ZN 2 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc5  metalc ? ? A CYS 46  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 200 A ZN 1 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc6  metalc ? ? A CYS 81  SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 235 A ZN 3 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc7  metalc ? ? A CYS 20  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 174 A ZN 1 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc8  metalc ? ? A CYS 17  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 171 A ZN 1 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc9  metalc ? ? A CYS 114 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 268 A ZN 3 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc10 metalc ? ? A CYS 43  SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 197 A ZN 1 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc11 metalc ? ? A CYS 89  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 243 A ZN 2 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc12 metalc ? ? A CYS 69  SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 223 A ZN 2 1_555 ? ? ? ? ? ? ? 2.309 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 16 ? CYS A 17 ? SER A 170 CYS A 171 
A 2 GLN A 22 ? GLN A 23 ? GLN A 176 GLN A 177 
B 1 TYR A 33 ? ARG A 34 ? TYR A 187 ARG A 188 
B 2 LEU A 41 ? ILE A 42 ? LEU A 195 ILE A 196 
C 1 LEU A 75 ? CYS A 77 ? LEU A 229 CYS A 231 
C 2 ALA A 84 ? CYS A 86 ? ALA A 238 CYS A 240 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 17 ? N CYS A 171 O GLN A 22 ? O GLN A 176 
B 1 2 N TYR A 33 ? N TYR A 187 O ILE A 42 ? O ILE A 196 
C 1 2 N ILE A 76 ? N ILE A 230 O PHE A 85 ? O PHE A 239 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 3' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 17  ? CYS A 171 . ? 1_555 ? 
2  AC1 4 CYS A 20  ? CYS A 174 . ? 1_555 ? 
3  AC1 4 CYS A 43  ? CYS A 197 . ? 1_555 ? 
4  AC1 4 CYS A 46  ? CYS A 200 . ? 1_555 ? 
5  AC2 4 CYS A 66  ? CYS A 220 . ? 1_555 ? 
6  AC2 4 CYS A 69  ? CYS A 223 . ? 1_555 ? 
7  AC2 4 CYS A 86  ? CYS A 240 . ? 1_555 ? 
8  AC2 4 CYS A 89  ? CYS A 243 . ? 1_555 ? 
9  AC3 4 CYS A 78  ? CYS A 232 . ? 1_555 ? 
10 AC3 4 CYS A 81  ? CYS A 235 . ? 1_555 ? 
11 AC3 4 CYS A 111 ? CYS A 265 . ? 1_555 ? 
12 AC3 4 CYS A 114 ? CYS A 268 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2LD1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? 15.450  20.334  -38.438 1.00 0.00 ? 155 GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1   ? 15.818  19.498  -37.260 1.00 0.00 ? 155 GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1   ? 14.729  19.616  -36.184 1.00 0.00 ? 155 GLY A C    1  
ATOM   4     O  O    . GLY A 1 1   ? 13.554  19.503  -36.477 1.00 0.00 ? 155 GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1   ? 14.438  20.215  -38.644 1.00 0.00 ? 155 GLY A H1   1  
ATOM   6     H  H2   . GLY A 1 1   ? 16.010  20.037  -39.262 1.00 0.00 ? 155 GLY A H2   1  
ATOM   7     H  H3   . GLY A 1 1   ? 15.643  21.333  -38.228 1.00 0.00 ? 155 GLY A H3   1  
ATOM   8     H  HA2  . GLY A 1 1   ? 15.913  18.466  -37.568 1.00 0.00 ? 155 GLY A HA2  1  
ATOM   9     H  HA3  . GLY A 1 1   ? 16.758  19.840  -36.855 1.00 0.00 ? 155 GLY A HA3  1  
ATOM   10    N  N    . ALA A 1 2   ? 15.105  19.843  -34.941 1.00 0.00 ? 156 ALA A N    1  
ATOM   11    C  CA   . ALA A 1 2   ? 14.082  19.966  -33.860 1.00 0.00 ? 156 ALA A CA   1  
ATOM   12    C  C    . ALA A 1 2   ? 14.444  21.123  -32.915 1.00 0.00 ? 156 ALA A C    1  
ATOM   13    O  O    . ALA A 1 2   ? 15.586  21.539  -32.852 1.00 0.00 ? 156 ALA A O    1  
ATOM   14    C  CB   . ALA A 1 2   ? 14.131  18.632  -33.116 1.00 0.00 ? 156 ALA A CB   1  
ATOM   15    H  H    . ALA A 1 2   ? 16.058  19.933  -34.718 1.00 0.00 ? 156 ALA A H    1  
ATOM   16    H  HA   . ALA A 1 2   ? 13.102  20.117  -34.284 1.00 0.00 ? 156 ALA A HA   1  
ATOM   17    H  HB1  . ALA A 1 2   ? 13.429  17.944  -33.563 1.00 0.00 ? 156 ALA A HB1  1  
ATOM   18    H  HB2  . ALA A 1 2   ? 13.871  18.788  -32.079 1.00 0.00 ? 156 ALA A HB2  1  
ATOM   19    H  HB3  . ALA A 1 2   ? 15.127  18.221  -33.179 1.00 0.00 ? 156 ALA A HB3  1  
ATOM   20    N  N    . MET A 1 3   ? 13.484  21.648  -32.180 1.00 0.00 ? 157 MET A N    1  
ATOM   21    C  CA   . MET A 1 3   ? 13.787  22.774  -31.246 1.00 0.00 ? 157 MET A CA   1  
ATOM   22    C  C    . MET A 1 3   ? 13.026  22.587  -29.924 1.00 0.00 ? 157 MET A C    1  
ATOM   23    O  O    . MET A 1 3   ? 11.948  23.124  -29.747 1.00 0.00 ? 157 MET A O    1  
ATOM   24    C  CB   . MET A 1 3   ? 13.302  24.030  -31.971 1.00 0.00 ? 157 MET A CB   1  
ATOM   25    C  CG   . MET A 1 3   ? 14.006  25.259  -31.391 1.00 0.00 ? 157 MET A CG   1  
ATOM   26    S  SD   . MET A 1 3   ? 13.091  26.751  -31.852 1.00 0.00 ? 157 MET A SD   1  
ATOM   27    C  CE   . MET A 1 3   ? 14.453  27.925  -31.648 1.00 0.00 ? 157 MET A CE   1  
ATOM   28    H  H    . MET A 1 3   ? 12.566  21.303  -32.239 1.00 0.00 ? 157 MET A H    1  
ATOM   29    H  HA   . MET A 1 3   ? 14.848  22.839  -31.065 1.00 0.00 ? 157 MET A HA   1  
ATOM   30    H  HB2  . MET A 1 3   ? 13.528  23.948  -33.024 1.00 0.00 ? 157 MET A HB2  1  
ATOM   31    H  HB3  . MET A 1 3   ? 12.235  24.133  -31.838 1.00 0.00 ? 157 MET A HB3  1  
ATOM   32    H  HG2  . MET A 1 3   ? 14.043  25.178  -30.315 1.00 0.00 ? 157 MET A HG2  1  
ATOM   33    H  HG3  . MET A 1 3   ? 15.010  25.317  -31.783 1.00 0.00 ? 157 MET A HG3  1  
ATOM   34    H  HE1  . MET A 1 3   ? 15.379  27.381  -31.520 1.00 0.00 ? 157 MET A HE1  1  
ATOM   35    H  HE2  . MET A 1 3   ? 14.275  28.537  -30.779 1.00 0.00 ? 157 MET A HE2  1  
ATOM   36    H  HE3  . MET A 1 3   ? 14.518  28.556  -32.523 1.00 0.00 ? 157 MET A HE3  1  
ATOM   37    N  N    . ALA A 1 4   ? 13.573  21.830  -28.994 1.00 0.00 ? 158 ALA A N    1  
ATOM   38    C  CA   . ALA A 1 4   ? 12.871  21.617  -27.693 1.00 0.00 ? 158 ALA A CA   1  
ATOM   39    C  C    . ALA A 1 4   ? 13.878  21.655  -26.532 1.00 0.00 ? 158 ALA A C    1  
ATOM   40    O  O    . ALA A 1 4   ? 14.938  21.063  -26.611 1.00 0.00 ? 158 ALA A O    1  
ATOM   41    C  CB   . ALA A 1 4   ? 12.237  20.231  -27.807 1.00 0.00 ? 158 ALA A CB   1  
ATOM   42    H  H    . ALA A 1 4   ? 14.444  21.401  -29.149 1.00 0.00 ? 158 ALA A H    1  
ATOM   43    H  HA   . ALA A 1 4   ? 12.105  22.363  -27.552 1.00 0.00 ? 158 ALA A HA   1  
ATOM   44    H  HB1  . ALA A 1 4   ? 12.877  19.590  -28.395 1.00 0.00 ? 158 ALA A HB1  1  
ATOM   45    H  HB2  . ALA A 1 4   ? 11.273  20.315  -28.287 1.00 0.00 ? 158 ALA A HB2  1  
ATOM   46    H  HB3  . ALA A 1 4   ? 12.112  19.810  -26.821 1.00 0.00 ? 158 ALA A HB3  1  
ATOM   47    N  N    . ASP A 1 5   ? 13.558  22.344  -25.455 1.00 0.00 ? 159 ASP A N    1  
ATOM   48    C  CA   . ASP A 1 5   ? 14.504  22.410  -24.300 1.00 0.00 ? 159 ASP A CA   1  
ATOM   49    C  C    . ASP A 1 5   ? 13.870  21.765  -23.058 1.00 0.00 ? 159 ASP A C    1  
ATOM   50    O  O    . ASP A 1 5   ? 14.421  20.841  -22.489 1.00 0.00 ? 159 ASP A O    1  
ATOM   51    C  CB   . ASP A 1 5   ? 14.742  23.902  -24.068 1.00 0.00 ? 159 ASP A CB   1  
ATOM   52    C  CG   . ASP A 1 5   ? 15.765  24.088  -22.946 1.00 0.00 ? 159 ASP A CG   1  
ATOM   53    O  OD1  . ASP A 1 5   ? 16.906  23.702  -23.141 1.00 0.00 ? 159 ASP A OD1  1  
ATOM   54    O  OD2  . ASP A 1 5   ? 15.391  24.614  -21.910 1.00 0.00 ? 159 ASP A OD2  1  
ATOM   55    H  H    . ASP A 1 5   ? 12.698  22.817  -25.403 1.00 0.00 ? 159 ASP A H    1  
ATOM   56    H  HA   . ASP A 1 5   ? 15.434  21.922  -24.546 1.00 0.00 ? 159 ASP A HA   1  
ATOM   57    H  HB2  . ASP A 1 5   ? 15.116  24.353  -24.976 1.00 0.00 ? 159 ASP A HB2  1  
ATOM   58    H  HB3  . ASP A 1 5   ? 13.813  24.376  -23.787 1.00 0.00 ? 159 ASP A HB3  1  
ATOM   59    N  N    . LYS A 1 6   ? 12.719  22.242  -22.629 1.00 0.00 ? 160 LYS A N    1  
ATOM   60    C  CA   . LYS A 1 6   ? 12.064  21.648  -21.425 1.00 0.00 ? 160 LYS A CA   1  
ATOM   61    C  C    . LYS A 1 6   ? 10.550  21.514  -21.656 1.00 0.00 ? 160 LYS A C    1  
ATOM   62    O  O    . LYS A 1 6   ? 9.826   22.491  -21.607 1.00 0.00 ? 160 LYS A O    1  
ATOM   63    C  CB   . LYS A 1 6   ? 12.348  22.636  -20.293 1.00 0.00 ? 160 LYS A CB   1  
ATOM   64    C  CG   . LYS A 1 6   ? 12.050  21.972  -18.948 1.00 0.00 ? 160 LYS A CG   1  
ATOM   65    C  CD   . LYS A 1 6   ? 12.790  22.717  -17.835 1.00 0.00 ? 160 LYS A CD   1  
ATOM   66    C  CE   . LYS A 1 6   ? 12.653  21.942  -16.522 1.00 0.00 ? 160 LYS A CE   1  
ATOM   67    N  NZ   . LYS A 1 6   ? 13.271  22.821  -15.492 1.00 0.00 ? 160 LYS A NZ   1  
ATOM   68    H  H    . LYS A 1 6   ? 12.284  22.989  -23.097 1.00 0.00 ? 160 LYS A H    1  
ATOM   69    H  HA   . LYS A 1 6   ? 12.497  20.688  -21.195 1.00 0.00 ? 160 LYS A HA   1  
ATOM   70    H  HB2  . LYS A 1 6   ? 13.387  22.932  -20.327 1.00 0.00 ? 160 LYS A HB2  1  
ATOM   71    H  HB3  . LYS A 1 6   ? 11.721  23.507  -20.409 1.00 0.00 ? 160 LYS A HB3  1  
ATOM   72    H  HG2  . LYS A 1 6   ? 10.986  22.004  -18.759 1.00 0.00 ? 160 LYS A HG2  1  
ATOM   73    H  HG3  . LYS A 1 6   ? 12.380  20.944  -18.972 1.00 0.00 ? 160 LYS A HG3  1  
ATOM   74    H  HD2  . LYS A 1 6   ? 13.835  22.805  -18.095 1.00 0.00 ? 160 LYS A HD2  1  
ATOM   75    H  HD3  . LYS A 1 6   ? 12.363  23.701  -17.715 1.00 0.00 ? 160 LYS A HD3  1  
ATOM   76    H  HE2  . LYS A 1 6   ? 11.610  21.768  -16.297 1.00 0.00 ? 160 LYS A HE2  1  
ATOM   77    H  HE3  . LYS A 1 6   ? 13.188  21.007  -16.580 1.00 0.00 ? 160 LYS A HE3  1  
ATOM   78    H  HZ1  . LYS A 1 6   ? 12.665  23.650  -15.334 1.00 0.00 ? 160 LYS A HZ1  1  
ATOM   79    H  HZ2  . LYS A 1 6   ? 14.209  23.133  -15.820 1.00 0.00 ? 160 LYS A HZ2  1  
ATOM   80    H  HZ3  . LYS A 1 6   ? 13.373  22.295  -14.601 1.00 0.00 ? 160 LYS A HZ3  1  
ATOM   81    N  N    . ARG A 1 7   ? 10.064  20.315  -21.906 1.00 0.00 ? 161 ARG A N    1  
ATOM   82    C  CA   . ARG A 1 7   ? 8.599   20.134  -22.136 1.00 0.00 ? 161 ARG A CA   1  
ATOM   83    C  C    . ARG A 1 7   ? 8.120   18.818  -21.503 1.00 0.00 ? 161 ARG A C    1  
ATOM   84    O  O    . ARG A 1 7   ? 7.989   17.815  -22.180 1.00 0.00 ? 161 ARG A O    1  
ATOM   85    C  CB   . ARG A 1 7   ? 8.440   20.087  -23.656 1.00 0.00 ? 161 ARG A CB   1  
ATOM   86    C  CG   . ARG A 1 7   ? 6.956   19.975  -24.013 1.00 0.00 ? 161 ARG A CG   1  
ATOM   87    C  CD   . ARG A 1 7   ? 6.690   20.707  -25.330 1.00 0.00 ? 161 ARG A CD   1  
ATOM   88    N  NE   . ARG A 1 7   ? 5.711   19.845  -26.060 1.00 0.00 ? 161 ARG A NE   1  
ATOM   89    C  CZ   . ARG A 1 7   ? 4.445   19.766  -25.678 1.00 0.00 ? 161 ARG A CZ   1  
ATOM   90    N  NH1  . ARG A 1 7   ? 3.999   20.440  -24.642 1.00 0.00 ? 161 ARG A NH1  1  
ATOM   91    N  NH2  . ARG A 1 7   ? 3.616   19.002  -26.341 1.00 0.00 ? 161 ARG A NH2  1  
ATOM   92    H  H    . ARG A 1 7   ? 10.659  19.533  -21.942 1.00 0.00 ? 161 ARG A H    1  
ATOM   93    H  HA   . ARG A 1 7   ? 8.048   20.969  -21.733 1.00 0.00 ? 161 ARG A HA   1  
ATOM   94    H  HB2  . ARG A 1 7   ? 8.848   20.989  -24.089 1.00 0.00 ? 161 ARG A HB2  1  
ATOM   95    H  HB3  . ARG A 1 7   ? 8.968   19.230  -24.047 1.00 0.00 ? 161 ARG A HB3  1  
ATOM   96    H  HG2  . ARG A 1 7   ? 6.690   18.933  -24.119 1.00 0.00 ? 161 ARG A HG2  1  
ATOM   97    H  HG3  . ARG A 1 7   ? 6.363   20.420  -23.229 1.00 0.00 ? 161 ARG A HG3  1  
ATOM   98    H  HD2  . ARG A 1 7   ? 6.266   21.683  -25.137 1.00 0.00 ? 161 ARG A HD2  1  
ATOM   99    H  HD3  . ARG A 1 7   ? 7.601   20.797  -25.902 1.00 0.00 ? 161 ARG A HD3  1  
ATOM   100   H  HE   . ARG A 1 7   ? 6.016   19.329  -26.838 1.00 0.00 ? 161 ARG A HE   1  
ATOM   101   H  HH11 . ARG A 1 7   ? 4.612   21.030  -24.118 1.00 0.00 ? 161 ARG A HH11 1  
ATOM   102   H  HH12 . ARG A 1 7   ? 3.038   20.362  -24.375 1.00 0.00 ? 161 ARG A HH12 1  
ATOM   103   H  HH21 . ARG A 1 7   ? 3.940   18.482  -27.132 1.00 0.00 ? 161 ARG A HH21 1  
ATOM   104   H  HH22 . ARG A 1 7   ? 2.659   18.938  -26.058 1.00 0.00 ? 161 ARG A HH22 1  
ATOM   105   N  N    . GLY A 1 8   ? 7.859   18.808  -20.211 1.00 0.00 ? 162 GLY A N    1  
ATOM   106   C  CA   . GLY A 1 8   ? 7.391   17.553  -19.551 1.00 0.00 ? 162 GLY A CA   1  
ATOM   107   C  C    . GLY A 1 8   ? 5.963   17.750  -19.024 1.00 0.00 ? 162 GLY A C    1  
ATOM   108   O  O    . GLY A 1 8   ? 5.638   17.314  -17.935 1.00 0.00 ? 162 GLY A O    1  
ATOM   109   H  H    . GLY A 1 8   ? 7.969   19.625  -19.674 1.00 0.00 ? 162 GLY A H    1  
ATOM   110   H  HA2  . GLY A 1 8   ? 7.404   16.744  -20.268 1.00 0.00 ? 162 GLY A HA2  1  
ATOM   111   H  HA3  . GLY A 1 8   ? 8.046   17.314  -18.727 1.00 0.00 ? 162 GLY A HA3  1  
ATOM   112   N  N    . ASP A 1 9   ? 5.103   18.402  -19.782 1.00 0.00 ? 163 ASP A N    1  
ATOM   113   C  CA   . ASP A 1 9   ? 3.702   18.617  -19.310 1.00 0.00 ? 163 ASP A CA   1  
ATOM   114   C  C    . ASP A 1 9   ? 2.722   18.519  -20.491 1.00 0.00 ? 163 ASP A C    1  
ATOM   115   O  O    . ASP A 1 9   ? 2.267   19.523  -21.006 1.00 0.00 ? 163 ASP A O    1  
ATOM   116   C  CB   . ASP A 1 9   ? 3.695   20.028  -18.721 1.00 0.00 ? 163 ASP A CB   1  
ATOM   117   C  CG   . ASP A 1 9   ? 2.539   20.161  -17.728 1.00 0.00 ? 163 ASP A CG   1  
ATOM   118   O  OD1  . ASP A 1 9   ? 1.458   19.688  -18.040 1.00 0.00 ? 163 ASP A OD1  1  
ATOM   119   O  OD2  . ASP A 1 9   ? 2.753   20.734  -16.673 1.00 0.00 ? 163 ASP A OD2  1  
ATOM   120   H  H    . ASP A 1 9   ? 5.377   18.749  -20.660 1.00 0.00 ? 163 ASP A H    1  
ATOM   121   H  HA   . ASP A 1 9   ? 3.447   17.898  -18.548 1.00 0.00 ? 163 ASP A HA   1  
ATOM   122   H  HB2  . ASP A 1 9   ? 4.631   20.209  -18.212 1.00 0.00 ? 163 ASP A HB2  1  
ATOM   123   H  HB3  . ASP A 1 9   ? 3.571   20.749  -19.514 1.00 0.00 ? 163 ASP A HB3  1  
ATOM   124   N  N    . GLY A 1 10  ? 2.392   17.319  -20.927 1.00 0.00 ? 164 GLY A N    1  
ATOM   125   C  CA   . GLY A 1 10  ? 1.444   17.172  -22.070 1.00 0.00 ? 164 GLY A CA   1  
ATOM   126   C  C    . GLY A 1 10  ? 0.158   16.489  -21.586 1.00 0.00 ? 164 GLY A C    1  
ATOM   127   O  O    . GLY A 1 10  ? -0.094  15.342  -21.902 1.00 0.00 ? 164 GLY A O    1  
ATOM   128   H  H    . GLY A 1 10  ? 2.767   16.515  -20.503 1.00 0.00 ? 164 GLY A H    1  
ATOM   129   H  HA2  . GLY A 1 10  ? 1.208   18.149  -22.469 1.00 0.00 ? 164 GLY A HA2  1  
ATOM   130   H  HA3  . GLY A 1 10  ? 1.899   16.568  -22.841 1.00 0.00 ? 164 GLY A HA3  1  
ATOM   131   N  N    . LEU A 1 11  ? -0.665  17.180  -20.816 1.00 0.00 ? 165 LEU A N    1  
ATOM   132   C  CA   . LEU A 1 11  ? -1.938  16.565  -20.312 1.00 0.00 ? 165 LEU A CA   1  
ATOM   133   C  C    . LEU A 1 11  ? -1.654  15.224  -19.611 1.00 0.00 ? 165 LEU A C    1  
ATOM   134   O  O    . LEU A 1 11  ? -1.748  14.173  -20.219 1.00 0.00 ? 165 LEU A O    1  
ATOM   135   C  CB   . LEU A 1 11  ? -2.806  16.348  -21.555 1.00 0.00 ? 165 LEU A CB   1  
ATOM   136   C  CG   . LEU A 1 11  ? -4.274  16.233  -21.140 1.00 0.00 ? 165 LEU A CG   1  
ATOM   137   C  CD1  . LEU A 1 11  ? -4.879  17.631  -21.006 1.00 0.00 ? 165 LEU A CD1  1  
ATOM   138   C  CD2  . LEU A 1 11  ? -5.042  15.446  -22.205 1.00 0.00 ? 165 LEU A CD2  1  
ATOM   139   H  H    . LEU A 1 11  ? -0.449  18.106  -20.568 1.00 0.00 ? 165 LEU A H    1  
ATOM   140   H  HA   . LEU A 1 11  ? -2.434  17.241  -19.633 1.00 0.00 ? 165 LEU A HA   1  
ATOM   141   H  HB2  . LEU A 1 11  ? -2.686  17.186  -22.227 1.00 0.00 ? 165 LEU A HB2  1  
ATOM   142   H  HB3  . LEU A 1 11  ? -2.503  15.440  -22.053 1.00 0.00 ? 165 LEU A HB3  1  
ATOM   143   H  HG   . LEU A 1 11  ? -4.340  15.719  -20.192 1.00 0.00 ? 165 LEU A HG   1  
ATOM   144   H  HD11 . LEU A 1 11  ? -4.444  18.284  -21.748 1.00 0.00 ? 165 LEU A HD11 1  
ATOM   145   H  HD12 . LEU A 1 11  ? -4.672  18.020  -20.020 1.00 0.00 ? 165 LEU A HD12 1  
ATOM   146   H  HD13 . LEU A 1 11  ? -5.947  17.577  -21.155 1.00 0.00 ? 165 LEU A HD13 1  
ATOM   147   H  HD21 . LEU A 1 11  ? -6.103  15.587  -22.060 1.00 0.00 ? 165 LEU A HD21 1  
ATOM   148   H  HD22 . LEU A 1 11  ? -4.803  14.397  -22.119 1.00 0.00 ? 165 LEU A HD22 1  
ATOM   149   H  HD23 . LEU A 1 11  ? -4.762  15.801  -23.186 1.00 0.00 ? 165 LEU A HD23 1  
ATOM   150   N  N    . HIS A 1 12  ? -1.305  15.248  -18.340 1.00 0.00 ? 166 HIS A N    1  
ATOM   151   C  CA   . HIS A 1 12  ? -1.018  13.972  -17.618 1.00 0.00 ? 166 HIS A CA   1  
ATOM   152   C  C    . HIS A 1 12  ? -2.031  13.765  -16.481 1.00 0.00 ? 166 HIS A C    1  
ATOM   153   O  O    . HIS A 1 12  ? -2.949  14.548  -16.317 1.00 0.00 ? 166 HIS A O    1  
ATOM   154   C  CB   . HIS A 1 12  ? 0.393   14.145  -17.054 1.00 0.00 ? 166 HIS A CB   1  
ATOM   155   C  CG   . HIS A 1 12  ? 1.112   12.824  -17.084 1.00 0.00 ? 166 HIS A CG   1  
ATOM   156   N  ND1  . HIS A 1 12  ? 1.242   12.080  -18.246 1.00 0.00 ? 166 HIS A ND1  1  
ATOM   157   C  CD2  . HIS A 1 12  ? 1.745   12.101  -16.103 1.00 0.00 ? 166 HIS A CD2  1  
ATOM   158   C  CE1  . HIS A 1 12  ? 1.929   10.964  -17.938 1.00 0.00 ? 166 HIS A CE1  1  
ATOM   159   N  NE2  . HIS A 1 12  ? 2.260   10.927  -16.645 1.00 0.00 ? 166 HIS A NE2  1  
ATOM   160   H  H    . HIS A 1 12  ? -1.232  16.103  -17.861 1.00 0.00 ? 166 HIS A H    1  
ATOM   161   H  HA   . HIS A 1 12  ? -1.043  13.138  -18.302 1.00 0.00 ? 166 HIS A HA   1  
ATOM   162   H  HB2  . HIS A 1 12  ? 0.934   14.863  -17.652 1.00 0.00 ? 166 HIS A HB2  1  
ATOM   163   H  HB3  . HIS A 1 12  ? 0.333   14.498  -16.035 1.00 0.00 ? 166 HIS A HB3  1  
ATOM   164   H  HD1  . HIS A 1 12  ? 0.897   12.322  -19.131 1.00 0.00 ? 166 HIS A HD1  1  
ATOM   165   H  HD2  . HIS A 1 12  ? 1.830   12.398  -15.068 1.00 0.00 ? 166 HIS A HD2  1  
ATOM   166   H  HE1  . HIS A 1 12  ? 2.181   10.193  -18.651 1.00 0.00 ? 166 HIS A HE1  1  
ATOM   167   N  N    . GLY A 1 13  ? -1.876  12.720  -15.693 1.00 0.00 ? 167 GLY A N    1  
ATOM   168   C  CA   . GLY A 1 13  ? -2.835  12.477  -14.574 1.00 0.00 ? 167 GLY A CA   1  
ATOM   169   C  C    . GLY A 1 13  ? -3.413  11.059  -14.692 1.00 0.00 ? 167 GLY A C    1  
ATOM   170   O  O    . GLY A 1 13  ? -4.366  10.836  -15.415 1.00 0.00 ? 167 GLY A O    1  
ATOM   171   H  H    . GLY A 1 13  ? -1.132  12.095  -15.835 1.00 0.00 ? 167 GLY A H    1  
ATOM   172   H  HA2  . GLY A 1 13  ? -2.318  12.580  -13.630 1.00 0.00 ? 167 GLY A HA2  1  
ATOM   173   H  HA3  . GLY A 1 13  ? -3.638  13.195  -14.626 1.00 0.00 ? 167 GLY A HA3  1  
ATOM   174   N  N    . ILE A 1 14  ? -2.848  10.097  -13.990 1.00 0.00 ? 168 ILE A N    1  
ATOM   175   C  CA   . ILE A 1 14  ? -3.375  8.701   -14.072 1.00 0.00 ? 168 ILE A CA   1  
ATOM   176   C  C    . ILE A 1 14  ? -3.562  8.124   -12.660 1.00 0.00 ? 168 ILE A C    1  
ATOM   177   O  O    . ILE A 1 14  ? -2.865  8.500   -11.736 1.00 0.00 ? 168 ILE A O    1  
ATOM   178   C  CB   . ILE A 1 14  ? -2.310  7.913   -14.843 1.00 0.00 ? 168 ILE A CB   1  
ATOM   179   C  CG1  . ILE A 1 14  ? -2.124  8.526   -16.234 1.00 0.00 ? 168 ILE A CG1  1  
ATOM   180   C  CG2  . ILE A 1 14  ? -2.752  6.453   -14.991 1.00 0.00 ? 168 ILE A CG2  1  
ATOM   181   C  CD1  . ILE A 1 14  ? -0.937  7.860   -16.932 1.00 0.00 ? 168 ILE A CD1  1  
ATOM   182   H  H    . ILE A 1 14  ? -2.079  10.290  -13.409 1.00 0.00 ? 168 ILE A H    1  
ATOM   183   H  HA   . ILE A 1 14  ? -4.310  8.681   -14.609 1.00 0.00 ? 168 ILE A HA   1  
ATOM   184   H  HB   . ILE A 1 14  ? -1.375  7.951   -14.303 1.00 0.00 ? 168 ILE A HB   1  
ATOM   185   H  HG12 . ILE A 1 14  ? -3.020  8.372   -16.818 1.00 0.00 ? 168 ILE A HG12 1  
ATOM   186   H  HG13 . ILE A 1 14  ? -1.934  9.585   -16.138 1.00 0.00 ? 168 ILE A HG13 1  
ATOM   187   H  HG21 . ILE A 1 14  ? -2.375  6.056   -15.922 1.00 0.00 ? 168 ILE A HG21 1  
ATOM   188   H  HG22 . ILE A 1 14  ? -3.831  6.402   -14.989 1.00 0.00 ? 168 ILE A HG22 1  
ATOM   189   H  HG23 . ILE A 1 14  ? -2.363  5.872   -14.168 1.00 0.00 ? 168 ILE A HG23 1  
ATOM   190   H  HD11 . ILE A 1 14  ? -0.612  8.477   -17.757 1.00 0.00 ? 168 ILE A HD11 1  
ATOM   191   H  HD12 . ILE A 1 14  ? -1.236  6.891   -17.303 1.00 0.00 ? 168 ILE A HD12 1  
ATOM   192   H  HD13 . ILE A 1 14  ? -0.126  7.741   -16.229 1.00 0.00 ? 168 ILE A HD13 1  
ATOM   193   N  N    . VAL A 1 15  ? -4.489  7.206   -12.488 1.00 0.00 ? 169 VAL A N    1  
ATOM   194   C  CA   . VAL A 1 15  ? -4.704  6.602   -11.132 1.00 0.00 ? 169 VAL A CA   1  
ATOM   195   C  C    . VAL A 1 15  ? -4.032  5.224   -11.074 1.00 0.00 ? 169 VAL A C    1  
ATOM   196   O  O    . VAL A 1 15  ? -4.214  4.410   -11.959 1.00 0.00 ? 169 VAL A O    1  
ATOM   197   C  CB   . VAL A 1 15  ? -6.225  6.469   -10.967 1.00 0.00 ? 169 VAL A CB   1  
ATOM   198   C  CG1  . VAL A 1 15  ? -6.545  5.881   -9.590  1.00 0.00 ? 169 VAL A CG1  1  
ATOM   199   C  CG2  . VAL A 1 15  ? -6.877  7.849   -11.098 1.00 0.00 ? 169 VAL A CG2  1  
ATOM   200   H  H    . VAL A 1 15  ? -5.037  6.907   -13.252 1.00 0.00 ? 169 VAL A H    1  
ATOM   201   H  HA   . VAL A 1 15  ? -4.304  7.248   -10.366 1.00 0.00 ? 169 VAL A HA   1  
ATOM   202   H  HB   . VAL A 1 15  ? -6.611  5.813   -11.734 1.00 0.00 ? 169 VAL A HB   1  
ATOM   203   H  HG11 . VAL A 1 15  ? -6.785  6.679   -8.903  1.00 0.00 ? 169 VAL A HG11 1  
ATOM   204   H  HG12 . VAL A 1 15  ? -5.689  5.336   -9.221  1.00 0.00 ? 169 VAL A HG12 1  
ATOM   205   H  HG13 . VAL A 1 15  ? -7.389  5.212   -9.672  1.00 0.00 ? 169 VAL A HG13 1  
ATOM   206   H  HG21 . VAL A 1 15  ? -7.222  7.989   -12.113 1.00 0.00 ? 169 VAL A HG21 1  
ATOM   207   H  HG22 . VAL A 1 15  ? -6.155  8.614   -10.856 1.00 0.00 ? 169 VAL A HG22 1  
ATOM   208   H  HG23 . VAL A 1 15  ? -7.716  7.918   -10.421 1.00 0.00 ? 169 VAL A HG23 1  
ATOM   209   N  N    . SER A 1 16  ? -3.251  4.951   -10.047 1.00 0.00 ? 170 SER A N    1  
ATOM   210   C  CA   . SER A 1 16  ? -2.574  3.623   -9.962  1.00 0.00 ? 170 SER A CA   1  
ATOM   211   C  C    . SER A 1 16  ? -2.615  3.075   -8.531  1.00 0.00 ? 170 SER A C    1  
ATOM   212   O  O    . SER A 1 16  ? -2.669  3.824   -7.574  1.00 0.00 ? 170 SER A O    1  
ATOM   213   C  CB   . SER A 1 16  ? -1.132  3.887   -10.393 1.00 0.00 ? 170 SER A CB   1  
ATOM   214   O  OG   . SER A 1 16  ? -0.272  2.954   -9.751  1.00 0.00 ? 170 SER A OG   1  
ATOM   215   H  H    . SER A 1 16  ? -3.106  5.617   -9.339  1.00 0.00 ? 170 SER A H    1  
ATOM   216   H  HA   . SER A 1 16  ? -3.035  2.925   -10.637 1.00 0.00 ? 170 SER A HA   1  
ATOM   217   H  HB2  . SER A 1 16  ? -1.046  3.771   -11.461 1.00 0.00 ? 170 SER A HB2  1  
ATOM   218   H  HB3  . SER A 1 16  ? -0.854  4.896   -10.119 1.00 0.00 ? 170 SER A HB3  1  
ATOM   219   H  HG   . SER A 1 16  ? 0.625   3.123   -10.050 1.00 0.00 ? 170 SER A HG   1  
ATOM   220   N  N    . CYS A 1 17  ? -2.578  1.766   -8.379  1.00 0.00 ? 171 CYS A N    1  
ATOM   221   C  CA   . CYS A 1 17  ? -2.603  1.172   -7.003  1.00 0.00 ? 171 CYS A CA   1  
ATOM   222   C  C    . CYS A 1 17  ? -1.174  0.817   -6.564  1.00 0.00 ? 171 CYS A C    1  
ATOM   223   O  O    . CYS A 1 17  ? -0.394  0.307   -7.349  1.00 0.00 ? 171 CYS A O    1  
ATOM   224   C  CB   . CYS A 1 17  ? -3.456  -0.096  -7.103  1.00 0.00 ? 171 CYS A CB   1  
ATOM   225   S  SG   . CYS A 1 17  ? -3.736  -0.762  -5.445  1.00 0.00 ? 171 CYS A SG   1  
ATOM   226   H  H    . CYS A 1 17  ? -2.523  1.178   -9.171  1.00 0.00 ? 171 CYS A H    1  
ATOM   227   H  HA   . CYS A 1 17  ? -3.049  1.862   -6.304  1.00 0.00 ? 171 CYS A HA   1  
ATOM   228   H  HB2  . CYS A 1 17  ? -4.404  0.141   -7.563  1.00 0.00 ? 171 CYS A HB2  1  
ATOM   229   H  HB3  . CYS A 1 17  ? -2.938  -0.829  -7.701  1.00 0.00 ? 171 CYS A HB3  1  
ATOM   230   N  N    . THR A 1 18  ? -0.825  1.081   -5.319  1.00 0.00 ? 172 THR A N    1  
ATOM   231   C  CA   . THR A 1 18  ? 0.568   0.752   -4.849  1.00 0.00 ? 172 THR A CA   1  
ATOM   232   C  C    . THR A 1 18  ? 0.684   -0.740  -4.483  1.00 0.00 ? 172 THR A C    1  
ATOM   233   O  O    . THR A 1 18  ? 1.699   -1.362  -4.737  1.00 0.00 ? 172 THR A O    1  
ATOM   234   C  CB   . THR A 1 18  ? 0.850   1.648   -3.619  1.00 0.00 ? 172 THR A CB   1  
ATOM   235   O  OG1  . THR A 1 18  ? 2.229   1.561   -3.295  1.00 0.00 ? 172 THR A OG1  1  
ATOM   236   C  CG2  . THR A 1 18  ? 0.016   1.206   -2.401  1.00 0.00 ? 172 THR A CG2  1  
ATOM   237   H  H    . THR A 1 18  ? -1.475  1.493   -4.703  1.00 0.00 ? 172 THR A H    1  
ATOM   238   H  HA   . THR A 1 18  ? 1.276   0.986   -5.629  1.00 0.00 ? 172 THR A HA   1  
ATOM   239   H  HB   . THR A 1 18  ? 0.606   2.672   -3.862  1.00 0.00 ? 172 THR A HB   1  
ATOM   240   H  HG1  . THR A 1 18  ? 2.719   2.071   -3.944  1.00 0.00 ? 172 THR A HG1  1  
ATOM   241   H  HG21 . THR A 1 18  ? 0.107   1.942   -1.616  1.00 0.00 ? 172 THR A HG21 1  
ATOM   242   H  HG22 . THR A 1 18  ? 0.379   0.254   -2.043  1.00 0.00 ? 172 THR A HG22 1  
ATOM   243   H  HG23 . THR A 1 18  ? -1.020  1.110   -2.682  1.00 0.00 ? 172 THR A HG23 1  
ATOM   244   N  N    . ALA A 1 19  ? -0.341  -1.319  -3.891  1.00 0.00 ? 173 ALA A N    1  
ATOM   245   C  CA   . ALA A 1 19  ? -0.259  -2.777  -3.521  1.00 0.00 ? 173 ALA A CA   1  
ATOM   246   C  C    . ALA A 1 19  ? -0.320  -3.662  -4.783  1.00 0.00 ? 173 ALA A C    1  
ATOM   247   O  O    . ALA A 1 19  ? 0.250   -4.737  -4.809  1.00 0.00 ? 173 ALA A O    1  
ATOM   248   C  CB   . ALA A 1 19  ? -1.452  -3.061  -2.595  1.00 0.00 ? 173 ALA A CB   1  
ATOM   249   H  H    . ALA A 1 19  ? -1.157  -0.801  -3.697  1.00 0.00 ? 173 ALA A H    1  
ATOM   250   H  HA   . ALA A 1 19  ? 0.660   -2.965  -2.993  1.00 0.00 ? 173 ALA A HA   1  
ATOM   251   H  HB1  . ALA A 1 19  ? -1.190  -2.789  -1.581  1.00 0.00 ? 173 ALA A HB1  1  
ATOM   252   H  HB2  . ALA A 1 19  ? -1.699  -4.112  -2.634  1.00 0.00 ? 173 ALA A HB2  1  
ATOM   253   H  HB3  . ALA A 1 19  ? -2.303  -2.476  -2.914  1.00 0.00 ? 173 ALA A HB3  1  
ATOM   254   N  N    . CYS A 1 20  ? -0.991  -3.224  -5.832  1.00 0.00 ? 174 CYS A N    1  
ATOM   255   C  CA   . CYS A 1 20  ? -1.059  -4.053  -7.079  1.00 0.00 ? 174 CYS A CA   1  
ATOM   256   C  C    . CYS A 1 20  ? 0.029   -3.620  -8.076  1.00 0.00 ? 174 CYS A C    1  
ATOM   257   O  O    . CYS A 1 20  ? 0.578   -4.439  -8.788  1.00 0.00 ? 174 CYS A O    1  
ATOM   258   C  CB   . CYS A 1 20  ? -2.449  -3.802  -7.677  1.00 0.00 ? 174 CYS A CB   1  
ATOM   259   S  SG   . CYS A 1 20  ? -3.722  -4.431  -6.557  1.00 0.00 ? 174 CYS A SG   1  
ATOM   260   H  H    . CYS A 1 20  ? -1.440  -2.354  -5.805  1.00 0.00 ? 174 CYS A H    1  
ATOM   261   H  HA   . CYS A 1 20  ? -0.947  -5.093  -6.841  1.00 0.00 ? 174 CYS A HA   1  
ATOM   262   H  HB2  . CYS A 1 20  ? -2.591  -2.744  -7.821  1.00 0.00 ? 174 CYS A HB2  1  
ATOM   263   H  HB3  . CYS A 1 20  ? -2.525  -4.303  -8.625  1.00 0.00 ? 174 CYS A HB3  1  
ATOM   264   N  N    . GLY A 1 21  ? 0.336   -2.340  -8.146  1.00 0.00 ? 175 GLY A N    1  
ATOM   265   C  CA   . GLY A 1 21  ? 1.372   -1.871  -9.110  1.00 0.00 ? 175 GLY A CA   1  
ATOM   266   C  C    . GLY A 1 21  ? 0.732   -1.735  -10.498 1.00 0.00 ? 175 GLY A C    1  
ATOM   267   O  O    . GLY A 1 21  ? 1.335   -2.081  -11.497 1.00 0.00 ? 175 GLY A O    1  
ATOM   268   H  H    . GLY A 1 21  ? -0.120  -1.687  -7.578  1.00 0.00 ? 175 GLY A H    1  
ATOM   269   H  HA2  . GLY A 1 21  ? 1.756   -0.912  -8.789  1.00 0.00 ? 175 GLY A HA2  1  
ATOM   270   H  HA3  . GLY A 1 21  ? 2.177   -2.588  -9.156  1.00 0.00 ? 175 GLY A HA3  1  
ATOM   271   N  N    . GLN A 1 22  ? -0.490  -1.240  -10.574 1.00 0.00 ? 176 GLN A N    1  
ATOM   272   C  CA   . GLN A 1 22  ? -1.156  -1.101  -11.910 1.00 0.00 ? 176 GLN A CA   1  
ATOM   273   C  C    . GLN A 1 22  ? -2.340  -0.121  -11.841 1.00 0.00 ? 176 GLN A C    1  
ATOM   274   O  O    . GLN A 1 22  ? -2.895  0.116   -10.785 1.00 0.00 ? 176 GLN A O    1  
ATOM   275   C  CB   . GLN A 1 22  ? -1.652  -2.509  -12.250 1.00 0.00 ? 176 GLN A CB   1  
ATOM   276   C  CG   . GLN A 1 22  ? -0.679  -3.179  -13.223 1.00 0.00 ? 176 GLN A CG   1  
ATOM   277   C  CD   . GLN A 1 22  ? -1.398  -4.312  -13.967 1.00 0.00 ? 176 GLN A CD   1  
ATOM   278   O  OE1  . GLN A 1 22  ? -0.990  -5.454  -13.888 1.00 0.00 ? 176 GLN A OE1  1  
ATOM   279   N  NE2  . GLN A 1 22  ? -2.457  -4.049  -14.693 1.00 0.00 ? 176 GLN A NE2  1  
ATOM   280   H  H    . GLN A 1 22  ? -0.971  -0.969  -9.755  1.00 0.00 ? 176 GLN A H    1  
ATOM   281   H  HA   . GLN A 1 22  ? -0.448  -0.772  -12.653 1.00 0.00 ? 176 GLN A HA   1  
ATOM   282   H  HB2  . GLN A 1 22  ? -1.718  -3.094  -11.345 1.00 0.00 ? 176 GLN A HB2  1  
ATOM   283   H  HB3  . GLN A 1 22  ? -2.628  -2.445  -12.708 1.00 0.00 ? 176 GLN A HB3  1  
ATOM   284   H  HG2  . GLN A 1 22  ? -0.321  -2.449  -13.934 1.00 0.00 ? 176 GLN A HG2  1  
ATOM   285   H  HG3  . GLN A 1 22  ? 0.156   -3.586  -12.673 1.00 0.00 ? 176 GLN A HG3  1  
ATOM   286   H  HE21 . GLN A 1 22  ? -2.795  -3.129  -14.765 1.00 0.00 ? 176 GLN A HE21 1  
ATOM   287   H  HE22 . GLN A 1 22  ? -2.915  -4.774  -15.167 1.00 0.00 ? 176 GLN A HE22 1  
ATOM   288   N  N    . GLN A 1 23  ? -2.728  0.451   -12.963 1.00 0.00 ? 177 GLN A N    1  
ATOM   289   C  CA   . GLN A 1 23  ? -3.885  1.421   -12.951 1.00 0.00 ? 177 GLN A CA   1  
ATOM   290   C  C    . GLN A 1 23  ? -5.145  0.745   -12.390 1.00 0.00 ? 177 GLN A C    1  
ATOM   291   O  O    . GLN A 1 23  ? -5.283  -0.463  -12.449 1.00 0.00 ? 177 GLN A O    1  
ATOM   292   C  CB   . GLN A 1 23  ? -4.121  1.851   -14.409 1.00 0.00 ? 177 GLN A CB   1  
ATOM   293   C  CG   . GLN A 1 23  ? -4.672  3.278   -14.440 1.00 0.00 ? 177 GLN A CG   1  
ATOM   294   C  CD   . GLN A 1 23  ? -5.123  3.623   -15.864 1.00 0.00 ? 177 GLN A CD   1  
ATOM   295   O  OE1  . GLN A 1 23  ? -4.354  3.504   -16.798 1.00 0.00 ? 177 GLN A OE1  1  
ATOM   296   N  NE2  . GLN A 1 23  ? -6.345  4.048   -16.079 1.00 0.00 ? 177 GLN A NE2  1  
ATOM   297   H  H    . GLN A 1 23  ? -2.258  0.242   -13.806 1.00 0.00 ? 177 GLN A H    1  
ATOM   298   H  HA   . GLN A 1 23  ? -3.640  2.282   -12.354 1.00 0.00 ? 177 GLN A HA   1  
ATOM   299   H  HB2  . GLN A 1 23  ? -3.188  1.815   -14.952 1.00 0.00 ? 177 GLN A HB2  1  
ATOM   300   H  HB3  . GLN A 1 23  ? -4.833  1.183   -14.871 1.00 0.00 ? 177 GLN A HB3  1  
ATOM   301   H  HG2  . GLN A 1 23  ? -5.513  3.354   -13.766 1.00 0.00 ? 177 GLN A HG2  1  
ATOM   302   H  HG3  . GLN A 1 23  ? -3.900  3.968   -14.133 1.00 0.00 ? 177 GLN A HG3  1  
ATOM   303   H  HE21 . GLN A 1 23  ? -6.975  4.147   -15.332 1.00 0.00 ? 177 GLN A HE21 1  
ATOM   304   H  HE22 . GLN A 1 23  ? -6.631  4.267   -16.990 1.00 0.00 ? 177 GLN A HE22 1  
ATOM   305   N  N    . VAL A 1 24  ? -6.069  1.515   -11.850 1.00 0.00 ? 178 VAL A N    1  
ATOM   306   C  CA   . VAL A 1 24  ? -7.323  0.899   -11.293 1.00 0.00 ? 178 VAL A CA   1  
ATOM   307   C  C    . VAL A 1 24  ? -8.382  0.789   -12.402 1.00 0.00 ? 178 VAL A C    1  
ATOM   308   O  O    . VAL A 1 24  ? -8.285  1.452   -13.415 1.00 0.00 ? 178 VAL A O    1  
ATOM   309   C  CB   . VAL A 1 24  ? -7.807  1.833   -10.170 1.00 0.00 ? 178 VAL A CB   1  
ATOM   310   C  CG1  . VAL A 1 24  ? -9.049  1.236   -9.506  1.00 0.00 ? 178 VAL A CG1  1  
ATOM   311   C  CG2  . VAL A 1 24  ? -6.701  1.989   -9.123  1.00 0.00 ? 178 VAL A CG2  1  
ATOM   312   H  H    . VAL A 1 24  ? -5.939  2.492   -11.819 1.00 0.00 ? 178 VAL A H    1  
ATOM   313   H  HA   . VAL A 1 24  ? -7.108  -0.078  -10.889 1.00 0.00 ? 178 VAL A HA   1  
ATOM   314   H  HB   . VAL A 1 24  ? -8.053  2.801   -10.584 1.00 0.00 ? 178 VAL A HB   1  
ATOM   315   H  HG11 . VAL A 1 24  ? -9.909  1.399   -10.138 1.00 0.00 ? 178 VAL A HG11 1  
ATOM   316   H  HG12 . VAL A 1 24  ? -9.210  1.712   -8.549  1.00 0.00 ? 178 VAL A HG12 1  
ATOM   317   H  HG13 . VAL A 1 24  ? -8.905  0.176   -9.361  1.00 0.00 ? 178 VAL A HG13 1  
ATOM   318   H  HG21 . VAL A 1 24  ? -5.978  2.714   -9.469  1.00 0.00 ? 178 VAL A HG21 1  
ATOM   319   H  HG22 . VAL A 1 24  ? -6.212  1.038   -8.972  1.00 0.00 ? 178 VAL A HG22 1  
ATOM   320   H  HG23 . VAL A 1 24  ? -7.131  2.325   -8.192  1.00 0.00 ? 178 VAL A HG23 1  
ATOM   321   N  N    . ASN A 1 25  ? -9.388  -0.051  -12.229 1.00 0.00 ? 179 ASN A N    1  
ATOM   322   C  CA   . ASN A 1 25  ? -10.444 -0.198  -13.303 1.00 0.00 ? 179 ASN A CA   1  
ATOM   323   C  C    . ASN A 1 25  ? -11.017 1.175   -13.702 1.00 0.00 ? 179 ASN A C    1  
ATOM   324   O  O    . ASN A 1 25  ? -11.945 1.663   -13.088 1.00 0.00 ? 179 ASN A O    1  
ATOM   325   C  CB   . ASN A 1 25  ? -11.557 -1.073  -12.706 1.00 0.00 ? 179 ASN A CB   1  
ATOM   326   C  CG   . ASN A 1 25  ? -12.432 -1.630  -13.837 1.00 0.00 ? 179 ASN A CG   1  
ATOM   327   O  OD1  . ASN A 1 25  ? -11.924 -2.204  -14.780 1.00 0.00 ? 179 ASN A OD1  1  
ATOM   328   N  ND2  . ASN A 1 25  ? -13.734 -1.488  -13.787 1.00 0.00 ? 179 ASN A ND2  1  
ATOM   329   H  H    . ASN A 1 25  ? -9.440  -0.590  -11.403 1.00 0.00 ? 179 ASN A H    1  
ATOM   330   H  HA   . ASN A 1 25  ? -10.023 -0.687  -14.168 1.00 0.00 ? 179 ASN A HA   1  
ATOM   331   H  HB2  . ASN A 1 25  ? -11.116 -1.891  -12.155 1.00 0.00 ? 179 ASN A HB2  1  
ATOM   332   H  HB3  . ASN A 1 25  ? -12.166 -0.478  -12.043 1.00 0.00 ? 179 ASN A HB3  1  
ATOM   333   H  HD21 . ASN A 1 25  ? -14.156 -1.026  -13.030 1.00 0.00 ? 179 ASN A HD21 1  
ATOM   334   H  HD22 . ASN A 1 25  ? -14.291 -1.846  -14.510 1.00 0.00 ? 179 ASN A HD22 1  
ATOM   335   N  N    . HIS A 1 26  ? -10.474 1.801   -14.732 1.00 0.00 ? 180 HIS A N    1  
ATOM   336   C  CA   . HIS A 1 26  ? -10.991 3.139   -15.174 1.00 0.00 ? 180 HIS A CA   1  
ATOM   337   C  C    . HIS A 1 26  ? -11.084 4.115   -13.986 1.00 0.00 ? 180 HIS A C    1  
ATOM   338   O  O    . HIS A 1 26  ? -10.677 3.796   -12.884 1.00 0.00 ? 180 HIS A O    1  
ATOM   339   C  CB   . HIS A 1 26  ? -12.385 2.861   -15.746 1.00 0.00 ? 180 HIS A CB   1  
ATOM   340   C  CG   . HIS A 1 26  ? -12.295 2.696   -17.240 1.00 0.00 ? 180 HIS A CG   1  
ATOM   341   N  ND1  . HIS A 1 26  ? -11.686 1.598   -17.827 1.00 0.00 ? 180 HIS A ND1  1  
ATOM   342   C  CD2  . HIS A 1 26  ? -12.732 3.482   -18.278 1.00 0.00 ? 180 HIS A CD2  1  
ATOM   343   C  CE1  . HIS A 1 26  ? -11.773 1.752   -19.161 1.00 0.00 ? 180 HIS A CE1  1  
ATOM   344   N  NE2  . HIS A 1 26  ? -12.401 2.884   -19.490 1.00 0.00 ? 180 HIS A NE2  1  
ATOM   345   H  H    . HIS A 1 26  ? -9.727  1.391   -15.221 1.00 0.00 ? 180 HIS A H    1  
ATOM   346   H  HA   . HIS A 1 26  ? -10.355 3.549   -15.942 1.00 0.00 ? 180 HIS A HA   1  
ATOM   347   H  HB2  . HIS A 1 26  ? -12.780 1.957   -15.308 1.00 0.00 ? 180 HIS A HB2  1  
ATOM   348   H  HB3  . HIS A 1 26  ? -13.040 3.688   -15.515 1.00 0.00 ? 180 HIS A HB3  1  
ATOM   349   H  HD1  . HIS A 1 26  ? -11.269 0.847   -17.356 1.00 0.00 ? 180 HIS A HD1  1  
ATOM   350   H  HD2  . HIS A 1 26  ? -13.254 4.421   -18.170 1.00 0.00 ? 180 HIS A HD2  1  
ATOM   351   H  HE1  . HIS A 1 26  ? -11.381 1.046   -19.879 1.00 0.00 ? 180 HIS A HE1  1  
ATOM   352   N  N    . PHE A 1 27  ? -11.620 5.300   -14.199 1.00 0.00 ? 181 PHE A N    1  
ATOM   353   C  CA   . PHE A 1 27  ? -11.739 6.282   -13.079 1.00 0.00 ? 181 PHE A CA   1  
ATOM   354   C  C    . PHE A 1 27  ? -13.224 6.527   -12.760 1.00 0.00 ? 181 PHE A C    1  
ATOM   355   O  O    . PHE A 1 27  ? -13.890 7.284   -13.441 1.00 0.00 ? 181 PHE A O    1  
ATOM   356   C  CB   . PHE A 1 27  ? -11.069 7.562   -13.596 1.00 0.00 ? 181 PHE A CB   1  
ATOM   357   C  CG   . PHE A 1 27  ? -11.171 8.669   -12.564 1.00 0.00 ? 181 PHE A CG   1  
ATOM   358   C  CD1  . PHE A 1 27  ? -10.833 8.427   -11.224 1.00 0.00 ? 181 PHE A CD1  1  
ATOM   359   C  CD2  . PHE A 1 27  ? -11.602 9.942   -12.955 1.00 0.00 ? 181 PHE A CD2  1  
ATOM   360   C  CE1  . PHE A 1 27  ? -10.927 9.457   -10.282 1.00 0.00 ? 181 PHE A CE1  1  
ATOM   361   C  CE2  . PHE A 1 27  ? -11.696 10.971  -12.011 1.00 0.00 ? 181 PHE A CE2  1  
ATOM   362   C  CZ   . PHE A 1 27  ? -11.359 10.729  -10.675 1.00 0.00 ? 181 PHE A CZ   1  
ATOM   363   H  H    . PHE A 1 27  ? -11.949 5.544   -15.093 1.00 0.00 ? 181 PHE A H    1  
ATOM   364   H  HA   . PHE A 1 27  ? -11.221 5.921   -12.204 1.00 0.00 ? 181 PHE A HA   1  
ATOM   365   H  HB2  . PHE A 1 27  ? -10.027 7.361   -13.800 1.00 0.00 ? 181 PHE A HB2  1  
ATOM   366   H  HB3  . PHE A 1 27  ? -11.556 7.877   -14.507 1.00 0.00 ? 181 PHE A HB3  1  
ATOM   367   H  HD1  . PHE A 1 27  ? -10.501 7.446   -10.917 1.00 0.00 ? 181 PHE A HD1  1  
ATOM   368   H  HD2  . PHE A 1 27  ? -11.863 10.131  -13.986 1.00 0.00 ? 181 PHE A HD2  1  
ATOM   369   H  HE1  . PHE A 1 27  ? -10.667 9.271   -9.250  1.00 0.00 ? 181 PHE A HE1  1  
ATOM   370   H  HE2  . PHE A 1 27  ? -12.029 11.953  -12.314 1.00 0.00 ? 181 PHE A HE2  1  
ATOM   371   H  HZ   . PHE A 1 27  ? -11.431 11.523  -9.949  1.00 0.00 ? 181 PHE A HZ   1  
ATOM   372   N  N    . GLN A 1 28  ? -13.748 5.891   -11.732 1.00 0.00 ? 182 GLN A N    1  
ATOM   373   C  CA   . GLN A 1 28  ? -15.188 6.094   -11.381 1.00 0.00 ? 182 GLN A CA   1  
ATOM   374   C  C    . GLN A 1 28  ? -15.307 6.885   -10.068 1.00 0.00 ? 182 GLN A C    1  
ATOM   375   O  O    . GLN A 1 28  ? -14.439 6.815   -9.219  1.00 0.00 ? 182 GLN A O    1  
ATOM   376   C  CB   . GLN A 1 28  ? -15.765 4.684   -11.221 1.00 0.00 ? 182 GLN A CB   1  
ATOM   377   C  CG   . GLN A 1 28  ? -17.271 4.763   -10.953 1.00 0.00 ? 182 GLN A CG   1  
ATOM   378   C  CD   . GLN A 1 28  ? -17.995 3.663   -11.741 1.00 0.00 ? 182 GLN A CD   1  
ATOM   379   O  OE1  . GLN A 1 28  ? -17.678 2.499   -11.602 1.00 0.00 ? 182 GLN A OE1  1  
ATOM   380   N  NE2  . GLN A 1 28  ? -18.962 3.980   -12.568 1.00 0.00 ? 182 GLN A NE2  1  
ATOM   381   H  H    . GLN A 1 28  ? -13.197 5.283   -11.191 1.00 0.00 ? 182 GLN A H    1  
ATOM   382   H  HA   . GLN A 1 28  ? -15.699 6.611   -12.178 1.00 0.00 ? 182 GLN A HA   1  
ATOM   383   H  HB2  . GLN A 1 28  ? -15.586 4.120   -12.125 1.00 0.00 ? 182 GLN A HB2  1  
ATOM   384   H  HB3  . GLN A 1 28  ? -15.282 4.192   -10.393 1.00 0.00 ? 182 GLN A HB3  1  
ATOM   385   H  HG2  . GLN A 1 28  ? -17.452 4.627   -9.897  1.00 0.00 ? 182 GLN A HG2  1  
ATOM   386   H  HG3  . GLN A 1 28  ? -17.644 5.728   -11.261 1.00 0.00 ? 182 GLN A HG3  1  
ATOM   387   H  HE21 . GLN A 1 28  ? -19.227 4.918   -12.687 1.00 0.00 ? 182 GLN A HE21 1  
ATOM   388   H  HE22 . GLN A 1 28  ? -19.423 3.276   -13.069 1.00 0.00 ? 182 GLN A HE22 1  
ATOM   389   N  N    . LYS A 1 29  ? -16.367 7.651   -9.899  1.00 0.00 ? 183 LYS A N    1  
ATOM   390   C  CA   . LYS A 1 29  ? -16.520 8.462   -8.633  1.00 0.00 ? 183 LYS A CA   1  
ATOM   391   C  C    . LYS A 1 29  ? -16.348 7.595   -7.367  1.00 0.00 ? 183 LYS A C    1  
ATOM   392   O  O    . LYS A 1 29  ? -15.942 8.093   -6.333  1.00 0.00 ? 183 LYS A O    1  
ATOM   393   C  CB   . LYS A 1 29  ? -17.934 9.070   -8.664  1.00 0.00 ? 183 LYS A CB   1  
ATOM   394   C  CG   . LYS A 1 29  ? -18.983 7.956   -8.718  1.00 0.00 ? 183 LYS A CG   1  
ATOM   395   C  CD   . LYS A 1 29  ? -20.200 8.439   -9.509  1.00 0.00 ? 183 LYS A CD   1  
ATOM   396   C  CE   . LYS A 1 29  ? -20.999 9.431   -8.662  1.00 0.00 ? 183 LYS A CE   1  
ATOM   397   N  NZ   . LYS A 1 29  ? -22.427 9.133   -8.965  1.00 0.00 ? 183 LYS A NZ   1  
ATOM   398   H  H    . LYS A 1 29  ? -17.051 7.704   -10.609 1.00 0.00 ? 183 LYS A H    1  
ATOM   399   H  HA   . LYS A 1 29  ? -15.794 9.254   -8.626  1.00 0.00 ? 183 LYS A HA   1  
ATOM   400   H  HB2  . LYS A 1 29  ? -18.087 9.665   -7.775  1.00 0.00 ? 183 LYS A HB2  1  
ATOM   401   H  HB3  . LYS A 1 29  ? -18.034 9.698   -9.537  1.00 0.00 ? 183 LYS A HB3  1  
ATOM   402   H  HG2  . LYS A 1 29  ? -18.562 7.085   -9.199  1.00 0.00 ? 183 LYS A HG2  1  
ATOM   403   H  HG3  . LYS A 1 29  ? -19.289 7.700   -7.714  1.00 0.00 ? 183 LYS A HG3  1  
ATOM   404   H  HD2  . LYS A 1 29  ? -19.869 8.923   -10.417 1.00 0.00 ? 183 LYS A HD2  1  
ATOM   405   H  HD3  . LYS A 1 29  ? -20.826 7.595   -9.758  1.00 0.00 ? 183 LYS A HD3  1  
ATOM   406   H  HE2  . LYS A 1 29  ? -20.794 9.277   -7.612  1.00 0.00 ? 183 LYS A HE2  1  
ATOM   407   H  HE3  . LYS A 1 29  ? -20.764 10.445  -8.948  1.00 0.00 ? 183 LYS A HE3  1  
ATOM   408   H  HZ1  . LYS A 1 29  ? -22.666 8.185   -8.613  1.00 0.00 ? 183 LYS A HZ1  1  
ATOM   409   H  HZ2  . LYS A 1 29  ? -22.577 9.170   -9.995  1.00 0.00 ? 183 LYS A HZ2  1  
ATOM   410   H  HZ3  . LYS A 1 29  ? -23.034 9.837   -8.500  1.00 0.00 ? 183 LYS A HZ3  1  
ATOM   411   N  N    . ASP A 1 30  ? -16.664 6.317   -7.420  1.00 0.00 ? 184 ASP A N    1  
ATOM   412   C  CA   . ASP A 1 30  ? -16.523 5.467   -6.197  1.00 0.00 ? 184 ASP A CA   1  
ATOM   413   C  C    . ASP A 1 30  ? -15.728 4.183   -6.487  1.00 0.00 ? 184 ASP A C    1  
ATOM   414   O  O    . ASP A 1 30  ? -16.012 3.144   -5.921  1.00 0.00 ? 184 ASP A O    1  
ATOM   415   C  CB   . ASP A 1 30  ? -17.956 5.125   -5.790  1.00 0.00 ? 184 ASP A CB   1  
ATOM   416   C  CG   . ASP A 1 30  ? -18.055 5.068   -4.265  1.00 0.00 ? 184 ASP A CG   1  
ATOM   417   O  OD1  . ASP A 1 30  ? -17.580 4.098   -3.697  1.00 0.00 ? 184 ASP A OD1  1  
ATOM   418   O  OD2  . ASP A 1 30  ? -18.603 5.995   -3.691  1.00 0.00 ? 184 ASP A OD2  1  
ATOM   419   H  H    . ASP A 1 30  ? -17.001 5.924   -8.246  1.00 0.00 ? 184 ASP A H    1  
ATOM   420   H  HA   . ASP A 1 30  ? -16.046 6.028   -5.409  1.00 0.00 ? 184 ASP A HA   1  
ATOM   421   H  HB2  . ASP A 1 30  ? -18.628 5.883   -6.168  1.00 0.00 ? 184 ASP A HB2  1  
ATOM   422   H  HB3  . ASP A 1 30  ? -18.228 4.165   -6.203  1.00 0.00 ? 184 ASP A HB3  1  
ATOM   423   N  N    . SER A 1 31  ? -14.723 4.240   -7.339  1.00 0.00 ? 185 SER A N    1  
ATOM   424   C  CA   . SER A 1 31  ? -13.918 3.001   -7.614  1.00 0.00 ? 185 SER A CA   1  
ATOM   425   C  C    . SER A 1 31  ? -12.677 2.983   -6.707  1.00 0.00 ? 185 SER A C    1  
ATOM   426   O  O    . SER A 1 31  ? -12.583 2.170   -5.813  1.00 0.00 ? 185 SER A O    1  
ATOM   427   C  CB   . SER A 1 31  ? -13.510 3.063   -9.090  1.00 0.00 ? 185 SER A CB   1  
ATOM   428   O  OG   . SER A 1 31  ? -14.427 2.300   -9.863  1.00 0.00 ? 185 SER A OG   1  
ATOM   429   H  H    . SER A 1 31  ? -14.491 5.091   -7.777  1.00 0.00 ? 185 SER A H    1  
ATOM   430   H  HA   . SER A 1 31  ? -14.519 2.122   -7.436  1.00 0.00 ? 185 SER A HA   1  
ATOM   431   H  HB2  . SER A 1 31  ? -13.527 4.084   -9.428  1.00 0.00 ? 185 SER A HB2  1  
ATOM   432   H  HB3  . SER A 1 31  ? -12.510 2.666   -9.203  1.00 0.00 ? 185 SER A HB3  1  
ATOM   433   H  HG   . SER A 1 31  ? -14.182 1.375   -9.786  1.00 0.00 ? 185 SER A HG   1  
ATOM   434   N  N    . ILE A 1 32  ? -11.720 3.868   -6.926  1.00 0.00 ? 186 ILE A N    1  
ATOM   435   C  CA   . ILE A 1 32  ? -10.480 3.883   -6.052  1.00 0.00 ? 186 ILE A CA   1  
ATOM   436   C  C    . ILE A 1 32  ? -10.844 3.873   -4.557  1.00 0.00 ? 186 ILE A C    1  
ATOM   437   O  O    . ILE A 1 32  ? -11.943 4.228   -4.175  1.00 0.00 ? 186 ILE A O    1  
ATOM   438   C  CB   . ILE A 1 32  ? -9.708  5.175   -6.379  1.00 0.00 ? 186 ILE A CB   1  
ATOM   439   C  CG1  . ILE A 1 32  ? -10.611 6.397   -6.161  1.00 0.00 ? 186 ILE A CG1  1  
ATOM   440   C  CG2  . ILE A 1 32  ? -9.228  5.140   -7.829  1.00 0.00 ? 186 ILE A CG2  1  
ATOM   441   C  CD1  . ILE A 1 32  ? -9.788  7.674   -6.326  1.00 0.00 ? 186 ILE A CD1  1  
ATOM   442   H  H    . ILE A 1 32  ? -11.815 4.512   -7.663  1.00 0.00 ? 186 ILE A H    1  
ATOM   443   H  HA   . ILE A 1 32  ? -9.860  3.027   -6.273  1.00 0.00 ? 186 ILE A HA   1  
ATOM   444   H  HB   . ILE A 1 32  ? -8.849  5.246   -5.726  1.00 0.00 ? 186 ILE A HB   1  
ATOM   445   H  HG12 . ILE A 1 32  ? -11.411 6.396   -6.884  1.00 0.00 ? 186 ILE A HG12 1  
ATOM   446   H  HG13 . ILE A 1 32  ? -11.025 6.366   -5.166  1.00 0.00 ? 186 ILE A HG13 1  
ATOM   447   H  HG21 . ILE A 1 32  ? -8.888  4.142   -8.070  1.00 0.00 ? 186 ILE A HG21 1  
ATOM   448   H  HG22 . ILE A 1 32  ? -8.414  5.840   -7.951  1.00 0.00 ? 186 ILE A HG22 1  
ATOM   449   H  HG23 . ILE A 1 32  ? -10.039 5.415   -8.485  1.00 0.00 ? 186 ILE A HG23 1  
ATOM   450   H  HD11 . ILE A 1 32  ? -10.248 8.473   -5.764  1.00 0.00 ? 186 ILE A HD11 1  
ATOM   451   H  HD12 . ILE A 1 32  ? -9.750  7.945   -7.371  1.00 0.00 ? 186 ILE A HD12 1  
ATOM   452   H  HD13 . ILE A 1 32  ? -8.786  7.507   -5.961  1.00 0.00 ? 186 ILE A HD13 1  
ATOM   453   N  N    . TYR A 1 33  ? -9.919  3.468   -3.712  1.00 0.00 ? 187 TYR A N    1  
ATOM   454   C  CA   . TYR A 1 33  ? -10.196 3.432   -2.244  1.00 0.00 ? 187 TYR A CA   1  
ATOM   455   C  C    . TYR A 1 33  ? -8.969  3.900   -1.460  1.00 0.00 ? 187 TYR A C    1  
ATOM   456   O  O    . TYR A 1 33  ? -7.898  4.070   -2.012  1.00 0.00 ? 187 TYR A O    1  
ATOM   457   C  CB   . TYR A 1 33  ? -10.485 1.966   -1.928  1.00 0.00 ? 187 TYR A CB   1  
ATOM   458   C  CG   . TYR A 1 33  ? -11.965 1.707   -2.031  1.00 0.00 ? 187 TYR A CG   1  
ATOM   459   C  CD1  . TYR A 1 33  ? -12.797 1.925   -0.927  1.00 0.00 ? 187 TYR A CD1  1  
ATOM   460   C  CD2  . TYR A 1 33  ? -12.503 1.240   -3.231  1.00 0.00 ? 187 TYR A CD2  1  
ATOM   461   C  CE1  . TYR A 1 33  ? -14.171 1.676   -1.027  1.00 0.00 ? 187 TYR A CE1  1  
ATOM   462   C  CE2  . TYR A 1 33  ? -13.874 0.989   -3.335  1.00 0.00 ? 187 TYR A CE2  1  
ATOM   463   C  CZ   . TYR A 1 33  ? -14.710 1.207   -2.232  1.00 0.00 ? 187 TYR A CZ   1  
ATOM   464   O  OH   . TYR A 1 33  ? -16.064 0.960   -2.333  1.00 0.00 ? 187 TYR A OH   1  
ATOM   465   H  H    . TYR A 1 33  ? -9.037  3.185   -4.043  1.00 0.00 ? 187 TYR A H    1  
ATOM   466   H  HA   . TYR A 1 33  ? -11.049 4.040   -1.993  1.00 0.00 ? 187 TYR A HA   1  
ATOM   467   H  HB2  . TYR A 1 33  ? -9.959  1.337   -2.631  1.00 0.00 ? 187 TYR A HB2  1  
ATOM   468   H  HB3  . TYR A 1 33  ? -10.150 1.743   -0.925  1.00 0.00 ? 187 TYR A HB3  1  
ATOM   469   H  HD1  . TYR A 1 33  ? -12.380 2.287   0.001   1.00 0.00 ? 187 TYR A HD1  1  
ATOM   470   H  HD2  . TYR A 1 33  ? -11.857 1.071   -4.081  1.00 0.00 ? 187 TYR A HD2  1  
ATOM   471   H  HE1  . TYR A 1 33  ? -14.814 1.843   -0.176  1.00 0.00 ? 187 TYR A HE1  1  
ATOM   472   H  HE2  . TYR A 1 33  ? -14.287 0.626   -4.264  1.00 0.00 ? 187 TYR A HE2  1  
ATOM   473   H  HH   . TYR A 1 33  ? -16.257 0.160   -1.838  1.00 0.00 ? 187 TYR A HH   1  
ATOM   474   N  N    . ARG A 1 34  ? -9.118  4.101   -0.172  1.00 0.00 ? 188 ARG A N    1  
ATOM   475   C  CA   . ARG A 1 34  ? -7.959  4.549   0.656   1.00 0.00 ? 188 ARG A CA   1  
ATOM   476   C  C    . ARG A 1 34  ? -7.564  3.440   1.639   1.00 0.00 ? 188 ARG A C    1  
ATOM   477   O  O    . ARG A 1 34  ? -8.420  2.783   2.204   1.00 0.00 ? 188 ARG A O    1  
ATOM   478   C  CB   . ARG A 1 34  ? -8.456  5.782   1.415   1.00 0.00 ? 188 ARG A CB   1  
ATOM   479   C  CG   . ARG A 1 34  ? -8.564  6.968   0.455   1.00 0.00 ? 188 ARG A CG   1  
ATOM   480   C  CD   . ARG A 1 34  ? -8.368  8.271   1.232   1.00 0.00 ? 188 ARG A CD   1  
ATOM   481   N  NE   . ARG A 1 34  ? -9.580  8.387   2.100   1.00 0.00 ? 188 ARG A NE   1  
ATOM   482   C  CZ   . ARG A 1 34  ? -10.763 8.697   1.591   1.00 0.00 ? 188 ARG A CZ   1  
ATOM   483   N  NH1  . ARG A 1 34  ? -10.919 8.918   0.305   1.00 0.00 ? 188 ARG A NH1  1  
ATOM   484   N  NH2  . ARG A 1 34  ? -11.803 8.787   2.380   1.00 0.00 ? 188 ARG A NH2  1  
ATOM   485   H  H    . ARG A 1 34  ? -9.994  3.949   0.254   1.00 0.00 ? 188 ARG A H    1  
ATOM   486   H  HA   . ARG A 1 34  ? -7.123  4.813   0.027   1.00 0.00 ? 188 ARG A HA   1  
ATOM   487   H  HB2  . ARG A 1 34  ? -9.428  5.573   1.840   1.00 0.00 ? 188 ARG A HB2  1  
ATOM   488   H  HB3  . ARG A 1 34  ? -7.762  6.023   2.205   1.00 0.00 ? 188 ARG A HB3  1  
ATOM   489   H  HG2  . ARG A 1 34  ? -7.803  6.884   -0.308  1.00 0.00 ? 188 ARG A HG2  1  
ATOM   490   H  HG3  . ARG A 1 34  ? -9.540  6.970   -0.006  1.00 0.00 ? 188 ARG A HG3  1  
ATOM   491   H  HD2  . ARG A 1 34  ? -7.473  8.216   1.837   1.00 0.00 ? 188 ARG A HD2  1  
ATOM   492   H  HD3  . ARG A 1 34  ? -8.317  9.110   0.556   1.00 0.00 ? 188 ARG A HD3  1  
ATOM   493   H  HE   . ARG A 1 34  ? -9.494  8.229   3.065   1.00 0.00 ? 188 ARG A HE   1  
ATOM   494   H  HH11 . ARG A 1 34  ? -10.141 8.857   -0.318  1.00 0.00 ? 188 ARG A HH11 1  
ATOM   495   H  HH12 . ARG A 1 34  ? -11.824 9.151   -0.052  1.00 0.00 ? 188 ARG A HH12 1  
ATOM   496   H  HH21 . ARG A 1 34  ? -11.701 8.622   3.361   1.00 0.00 ? 188 ARG A HH21 1  
ATOM   497   H  HH22 . ARG A 1 34  ? -12.698 9.020   2.002   1.00 0.00 ? 188 ARG A HH22 1  
ATOM   498   N  N    . HIS A 1 35  ? -6.282  3.228   1.864   1.00 0.00 ? 189 HIS A N    1  
ATOM   499   C  CA   . HIS A 1 35  ? -5.874  2.158   2.836   1.00 0.00 ? 189 HIS A CA   1  
ATOM   500   C  C    . HIS A 1 35  ? -6.247  2.628   4.252   1.00 0.00 ? 189 HIS A C    1  
ATOM   501   O  O    . HIS A 1 35  ? -5.950  3.750   4.614   1.00 0.00 ? 189 HIS A O    1  
ATOM   502   C  CB   . HIS A 1 35  ? -4.353  1.990   2.692   1.00 0.00 ? 189 HIS A CB   1  
ATOM   503   C  CG   . HIS A 1 35  ? -3.967  0.568   3.008   1.00 0.00 ? 189 HIS A CG   1  
ATOM   504   N  ND1  . HIS A 1 35  ? -3.585  0.171   4.276   1.00 0.00 ? 189 HIS A ND1  1  
ATOM   505   C  CD2  . HIS A 1 35  ? -3.925  -0.567  2.236   1.00 0.00 ? 189 HIS A CD2  1  
ATOM   506   C  CE1  . HIS A 1 35  ? -3.343  -1.148  4.240   1.00 0.00 ? 189 HIS A CE1  1  
ATOM   507   N  NE2  . HIS A 1 35  ? -3.533  -1.652  3.018   1.00 0.00 ? 189 HIS A NE2  1  
ATOM   508   H  H    . HIS A 1 35  ? -5.603  3.779   1.412   1.00 0.00 ? 189 HIS A H    1  
ATOM   509   H  HA   . HIS A 1 35  ? -6.374  1.233   2.596   1.00 0.00 ? 189 HIS A HA   1  
ATOM   510   H  HB2  . HIS A 1 35  ? -4.062  2.225   1.678   1.00 0.00 ? 189 HIS A HB2  1  
ATOM   511   H  HB3  . HIS A 1 35  ? -3.857  2.663   3.371   1.00 0.00 ? 189 HIS A HB3  1  
ATOM   512   H  HD1  . HIS A 1 35  ? -3.477  0.747   5.047   1.00 0.00 ? 189 HIS A HD1  1  
ATOM   513   H  HD2  . HIS A 1 35  ? -4.143  -0.608  1.182   1.00 0.00 ? 189 HIS A HD2  1  
ATOM   514   H  HE1  . HIS A 1 35  ? -3.048  -1.730  5.101   1.00 0.00 ? 189 HIS A HE1  1  
ATOM   515   N  N    . PRO A 1 36  ? -6.916  1.782   5.006   1.00 0.00 ? 190 PRO A N    1  
ATOM   516   C  CA   . PRO A 1 36  ? -7.348  2.181   6.371   1.00 0.00 ? 190 PRO A CA   1  
ATOM   517   C  C    . PRO A 1 36  ? -6.152  2.285   7.333   1.00 0.00 ? 190 PRO A C    1  
ATOM   518   O  O    . PRO A 1 36  ? -6.132  3.140   8.199   1.00 0.00 ? 190 PRO A O    1  
ATOM   519   C  CB   . PRO A 1 36  ? -8.294  1.058   6.789   1.00 0.00 ? 190 PRO A CB   1  
ATOM   520   C  CG   . PRO A 1 36  ? -7.871  -0.126  5.983   1.00 0.00 ? 190 PRO A CG   1  
ATOM   521   C  CD   . PRO A 1 36  ? -7.327  0.403   4.684   1.00 0.00 ? 190 PRO A CD   1  
ATOM   522   H  HA   . PRO A 1 36  ? -7.885  3.114   6.337   1.00 0.00 ? 190 PRO A HA   1  
ATOM   523   H  HB2  . PRO A 1 36  ? -8.192  0.854   7.846   1.00 0.00 ? 190 PRO A HB2  1  
ATOM   524   H  HB3  . PRO A 1 36  ? -9.314  1.319   6.549   1.00 0.00 ? 190 PRO A HB3  1  
ATOM   525   H  HG2  . PRO A 1 36  ? -7.105  -0.677  6.511   1.00 0.00 ? 190 PRO A HG2  1  
ATOM   526   H  HG3  . PRO A 1 36  ? -8.719  -0.764  5.789   1.00 0.00 ? 190 PRO A HG3  1  
ATOM   527   H  HD2  . PRO A 1 36  ? -6.478  -0.185  4.364   1.00 0.00 ? 190 PRO A HD2  1  
ATOM   528   H  HD3  . PRO A 1 36  ? -8.094  0.411   3.926   1.00 0.00 ? 190 PRO A HD3  1  
ATOM   529   N  N    . SER A 1 37  ? -5.163  1.423   7.208   1.00 0.00 ? 191 SER A N    1  
ATOM   530   C  CA   . SER A 1 37  ? -3.992  1.494   8.149   1.00 0.00 ? 191 SER A CA   1  
ATOM   531   C  C    . SER A 1 37  ? -2.720  2.082   7.493   1.00 0.00 ? 191 SER A C    1  
ATOM   532   O  O    . SER A 1 37  ? -1.641  1.919   8.031   1.00 0.00 ? 191 SER A O    1  
ATOM   533   C  CB   . SER A 1 37  ? -3.734  0.044   8.570   1.00 0.00 ? 191 SER A CB   1  
ATOM   534   O  OG   . SER A 1 37  ? -4.881  -0.462  9.239   1.00 0.00 ? 191 SER A OG   1  
ATOM   535   H  H    . SER A 1 37  ? -5.197  0.726   6.514   1.00 0.00 ? 191 SER A H    1  
ATOM   536   H  HA   . SER A 1 37  ? -4.256  2.074   9.019   1.00 0.00 ? 191 SER A HA   1  
ATOM   537   H  HB2  . SER A 1 37  ? -3.539  -0.557  7.695   1.00 0.00 ? 191 SER A HB2  1  
ATOM   538   H  HB3  . SER A 1 37  ? -2.875  0.009   9.227   1.00 0.00 ? 191 SER A HB3  1  
ATOM   539   H  HG   . SER A 1 37  ? -4.830  -0.194  10.159  1.00 0.00 ? 191 SER A HG   1  
ATOM   540   N  N    . LEU A 1 38  ? -2.807  2.747   6.351   1.00 0.00 ? 192 LEU A N    1  
ATOM   541   C  CA   . LEU A 1 38  ? -1.548  3.297   5.727   1.00 0.00 ? 192 LEU A CA   1  
ATOM   542   C  C    . LEU A 1 38  ? -1.695  4.723   5.138   1.00 0.00 ? 192 LEU A C    1  
ATOM   543   O  O    . LEU A 1 38  ? -0.761  5.208   4.527   1.00 0.00 ? 192 LEU A O    1  
ATOM   544   C  CB   . LEU A 1 38  ? -1.213  2.333   4.581   1.00 0.00 ? 192 LEU A CB   1  
ATOM   545   C  CG   . LEU A 1 38  ? -0.665  1.000   5.103   1.00 0.00 ? 192 LEU A CG   1  
ATOM   546   C  CD1  . LEU A 1 38  ? -0.273  0.136   3.901   1.00 0.00 ? 192 LEU A CD1  1  
ATOM   547   C  CD2  . LEU A 1 38  ? 0.576   1.239   5.972   1.00 0.00 ? 192 LEU A CD2  1  
ATOM   548   H  H    . LEU A 1 38  ? -3.671  2.866   5.908   1.00 0.00 ? 192 LEU A H    1  
ATOM   549   H  HA   . LEU A 1 38  ? -0.747  3.281   6.446   1.00 0.00 ? 192 LEU A HA   1  
ATOM   550   H  HB2  . LEU A 1 38  ? -2.104  2.143   4.007   1.00 0.00 ? 192 LEU A HB2  1  
ATOM   551   H  HB3  . LEU A 1 38  ? -0.473  2.792   3.941   1.00 0.00 ? 192 LEU A HB3  1  
ATOM   552   H  HG   . LEU A 1 38  ? -1.426  0.495   5.681   1.00 0.00 ? 192 LEU A HG   1  
ATOM   553   H  HD11 . LEU A 1 38  ? 0.274   0.745   3.191   1.00 0.00 ? 192 LEU A HD11 1  
ATOM   554   H  HD12 . LEU A 1 38  ? -1.165  -0.256  3.427   1.00 0.00 ? 192 LEU A HD12 1  
ATOM   555   H  HD13 . LEU A 1 38  ? 0.351   -0.683  4.230   1.00 0.00 ? 192 LEU A HD13 1  
ATOM   556   H  HD21 . LEU A 1 38  ? 1.197   0.356   5.961   1.00 0.00 ? 192 LEU A HD21 1  
ATOM   557   H  HD22 . LEU A 1 38  ? 0.271   1.448   6.987   1.00 0.00 ? 192 LEU A HD22 1  
ATOM   558   H  HD23 . LEU A 1 38  ? 1.132   2.078   5.583   1.00 0.00 ? 192 LEU A HD23 1  
ATOM   559   N  N    . GLN A 1 39  ? -2.821  5.409   5.289   1.00 0.00 ? 193 GLN A N    1  
ATOM   560   C  CA   . GLN A 1 39  ? -2.952  6.789   4.700   1.00 0.00 ? 193 GLN A CA   1  
ATOM   561   C  C    . GLN A 1 39  ? -2.517  6.796   3.219   1.00 0.00 ? 193 GLN A C    1  
ATOM   562   O  O    . GLN A 1 39  ? -1.844  7.707   2.774   1.00 0.00 ? 193 GLN A O    1  
ATOM   563   C  CB   . GLN A 1 39  ? -2.018  7.671   5.534   1.00 0.00 ? 193 GLN A CB   1  
ATOM   564   C  CG   . GLN A 1 39  ? -2.728  8.094   6.822   1.00 0.00 ? 193 GLN A CG   1  
ATOM   565   C  CD   . GLN A 1 39  ? -2.358  7.126   7.953   1.00 0.00 ? 193 GLN A CD   1  
ATOM   566   O  OE1  . GLN A 1 39  ? -2.047  5.979   7.701   1.00 0.00 ? 193 GLN A OE1  1  
ATOM   567   N  NE2  . GLN A 1 39  ? -2.378  7.536   9.198   1.00 0.00 ? 193 GLN A NE2  1  
ATOM   568   H  H    . GLN A 1 39  ? -3.573  5.032   5.778   1.00 0.00 ? 193 GLN A H    1  
ATOM   569   H  HA   . GLN A 1 39  ? -3.969  7.138   4.792   1.00 0.00 ? 193 GLN A HA   1  
ATOM   570   H  HB2  . GLN A 1 39  ? -1.123  7.116   5.780   1.00 0.00 ? 193 GLN A HB2  1  
ATOM   571   H  HB3  . GLN A 1 39  ? -1.750  8.550   4.967   1.00 0.00 ? 193 GLN A HB3  1  
ATOM   572   H  HG2  . GLN A 1 39  ? -2.420  9.095   7.089   1.00 0.00 ? 193 GLN A HG2  1  
ATOM   573   H  HG3  . GLN A 1 39  ? -3.796  8.074   6.668   1.00 0.00 ? 193 GLN A HG3  1  
ATOM   574   H  HE21 . GLN A 1 39  ? -2.629  8.461   9.413   1.00 0.00 ? 193 GLN A HE21 1  
ATOM   575   H  HE22 . GLN A 1 39  ? -2.142  6.916   9.918   1.00 0.00 ? 193 GLN A HE22 1  
ATOM   576   N  N    . VAL A 1 40  ? -2.879  5.781   2.459   1.00 0.00 ? 194 VAL A N    1  
ATOM   577   C  CA   . VAL A 1 40  ? -2.463  5.733   1.024   1.00 0.00 ? 194 VAL A CA   1  
ATOM   578   C  C    . VAL A 1 40  ? -3.642  5.308   0.130   1.00 0.00 ? 194 VAL A C    1  
ATOM   579   O  O    . VAL A 1 40  ? -4.639  4.811   0.612   1.00 0.00 ? 194 VAL A O    1  
ATOM   580   C  CB   . VAL A 1 40  ? -1.317  4.708   0.992   1.00 0.00 ? 194 VAL A CB   1  
ATOM   581   C  CG1  . VAL A 1 40  ? -1.837  3.303   1.315   1.00 0.00 ? 194 VAL A CG1  1  
ATOM   582   C  CG2  . VAL A 1 40  ? -0.672  4.707   -0.392  1.00 0.00 ? 194 VAL A CG2  1  
ATOM   583   H  H    . VAL A 1 40  ? -3.411  5.045   2.834   1.00 0.00 ? 194 VAL A H    1  
ATOM   584   H  HA   . VAL A 1 40  ? -2.096  6.695   0.704   1.00 0.00 ? 194 VAL A HA   1  
ATOM   585   H  HB   . VAL A 1 40  ? -0.576  4.987   1.728   1.00 0.00 ? 194 VAL A HB   1  
ATOM   586   H  HG11 . VAL A 1 40  ? -2.593  3.025   0.597   1.00 0.00 ? 194 VAL A HG11 1  
ATOM   587   H  HG12 . VAL A 1 40  ? -2.260  3.295   2.308   1.00 0.00 ? 194 VAL A HG12 1  
ATOM   588   H  HG13 . VAL A 1 40  ? -1.019  2.599   1.269   1.00 0.00 ? 194 VAL A HG13 1  
ATOM   589   H  HG21 . VAL A 1 40  ? 0.218   4.095   -0.373  1.00 0.00 ? 194 VAL A HG21 1  
ATOM   590   H  HG22 . VAL A 1 40  ? -0.406  5.719   -0.663  1.00 0.00 ? 194 VAL A HG22 1  
ATOM   591   H  HG23 . VAL A 1 40  ? -1.368  4.309   -1.115  1.00 0.00 ? 194 VAL A HG23 1  
ATOM   592   N  N    . LEU A 1 41  ? -3.542  5.519   -1.166  1.00 0.00 ? 195 LEU A N    1  
ATOM   593   C  CA   . LEU A 1 41  ? -4.679  5.138   -2.078  1.00 0.00 ? 195 LEU A CA   1  
ATOM   594   C  C    . LEU A 1 41  ? -4.485  3.732   -2.672  1.00 0.00 ? 195 LEU A C    1  
ATOM   595   O  O    . LEU A 1 41  ? -3.384  3.334   -2.998  1.00 0.00 ? 195 LEU A O    1  
ATOM   596   C  CB   . LEU A 1 41  ? -4.686  6.177   -3.204  1.00 0.00 ? 195 LEU A CB   1  
ATOM   597   C  CG   . LEU A 1 41  ? -6.057  6.178   -3.883  1.00 0.00 ? 195 LEU A CG   1  
ATOM   598   C  CD1  . LEU A 1 41  ? -6.393  7.591   -4.360  1.00 0.00 ? 195 LEU A CD1  1  
ATOM   599   C  CD2  . LEU A 1 41  ? -6.032  5.228   -5.083  1.00 0.00 ? 195 LEU A CD2  1  
ATOM   600   H  H    . LEU A 1 41  ? -2.729  5.939   -1.533  1.00 0.00 ? 195 LEU A H    1  
ATOM   601   H  HA   . LEU A 1 41  ? -5.612  5.185   -1.540  1.00 0.00 ? 195 LEU A HA   1  
ATOM   602   H  HB2  . LEU A 1 41  ? -4.481  7.153   -2.795  1.00 0.00 ? 195 LEU A HB2  1  
ATOM   603   H  HB3  . LEU A 1 41  ? -3.928  5.925   -3.931  1.00 0.00 ? 195 LEU A HB3  1  
ATOM   604   H  HG   . LEU A 1 41  ? -6.807  5.850   -3.178  1.00 0.00 ? 195 LEU A HG   1  
ATOM   605   H  HD11 . LEU A 1 41  ? -7.460  7.681   -4.495  1.00 0.00 ? 195 LEU A HD11 1  
ATOM   606   H  HD12 . LEU A 1 41  ? -5.895  7.781   -5.299  1.00 0.00 ? 195 LEU A HD12 1  
ATOM   607   H  HD13 . LEU A 1 41  ? -6.061  8.309   -3.625  1.00 0.00 ? 195 LEU A HD13 1  
ATOM   608   H  HD21 . LEU A 1 41  ? -6.995  4.750   -5.184  1.00 0.00 ? 195 LEU A HD21 1  
ATOM   609   H  HD22 . LEU A 1 41  ? -5.272  4.475   -4.932  1.00 0.00 ? 195 LEU A HD22 1  
ATOM   610   H  HD23 . LEU A 1 41  ? -5.811  5.786   -5.981  1.00 0.00 ? 195 LEU A HD23 1  
ATOM   611   N  N    . ILE A 1 42  ? -5.562  2.987   -2.838  1.00 0.00 ? 196 ILE A N    1  
ATOM   612   C  CA   . ILE A 1 42  ? -5.464  1.617   -3.433  1.00 0.00 ? 196 ILE A CA   1  
ATOM   613   C  C    . ILE A 1 42  ? -6.613  1.431   -4.444  1.00 0.00 ? 196 ILE A C    1  
ATOM   614   O  O    . ILE A 1 42  ? -7.242  2.396   -4.838  1.00 0.00 ? 196 ILE A O    1  
ATOM   615   C  CB   . ILE A 1 42  ? -5.584  0.635   -2.250  1.00 0.00 ? 196 ILE A CB   1  
ATOM   616   C  CG1  . ILE A 1 42  ? -6.860  0.931   -1.448  1.00 0.00 ? 196 ILE A CG1  1  
ATOM   617   C  CG2  . ILE A 1 42  ? -4.353  0.761   -1.339  1.00 0.00 ? 196 ILE A CG2  1  
ATOM   618   C  CD1  . ILE A 1 42  ? -7.042  -0.136  -0.367  1.00 0.00 ? 196 ILE A CD1  1  
ATOM   619   H  H    . ILE A 1 42  ? -6.448  3.336   -2.586  1.00 0.00 ? 196 ILE A H    1  
ATOM   620   H  HA   . ILE A 1 42  ? -4.512  1.489   -3.926  1.00 0.00 ? 196 ILE A HA   1  
ATOM   621   H  HB   . ILE A 1 42  ? -5.628  -0.375  -2.628  1.00 0.00 ? 196 ILE A HB   1  
ATOM   622   H  HG12 . ILE A 1 42  ? -6.775  1.903   -0.985  1.00 0.00 ? 196 ILE A HG12 1  
ATOM   623   H  HG13 . ILE A 1 42  ? -7.712  0.920   -2.110  1.00 0.00 ? 196 ILE A HG13 1  
ATOM   624   H  HG21 . ILE A 1 42  ? -3.735  1.581   -1.670  1.00 0.00 ? 196 ILE A HG21 1  
ATOM   625   H  HG22 . ILE A 1 42  ? -3.782  -0.156  -1.382  1.00 0.00 ? 196 ILE A HG22 1  
ATOM   626   H  HG23 . ILE A 1 42  ? -4.669  0.938   -0.320  1.00 0.00 ? 196 ILE A HG23 1  
ATOM   627   H  HD11 . ILE A 1 42  ? -6.079  -0.398  0.047   1.00 0.00 ? 196 ILE A HD11 1  
ATOM   628   H  HD12 . ILE A 1 42  ? -7.498  -1.014  -0.801  1.00 0.00 ? 196 ILE A HD12 1  
ATOM   629   H  HD13 . ILE A 1 42  ? -7.677  0.249   0.416   1.00 0.00 ? 196 ILE A HD13 1  
ATOM   630   N  N    . CYS A 1 43  ? -6.897  0.218   -4.873  1.00 0.00 ? 197 CYS A N    1  
ATOM   631   C  CA   . CYS A 1 43  ? -8.005  0.017   -5.858  1.00 0.00 ? 197 CYS A CA   1  
ATOM   632   C  C    . CYS A 1 43  ? -9.182  -0.731  -5.196  1.00 0.00 ? 197 CYS A C    1  
ATOM   633   O  O    . CYS A 1 43  ? -9.026  -1.328  -4.148  1.00 0.00 ? 197 CYS A O    1  
ATOM   634   C  CB   . CYS A 1 43  ? -7.382  -0.782  -7.024  1.00 0.00 ? 197 CYS A CB   1  
ATOM   635   S  SG   . CYS A 1 43  ? -6.960  -2.482  -6.530  1.00 0.00 ? 197 CYS A SG   1  
ATOM   636   H  H    . CYS A 1 43  ? -6.390  -0.552  -4.554  1.00 0.00 ? 197 CYS A H    1  
ATOM   637   H  HA   . CYS A 1 43  ? -8.345  0.978   -6.222  1.00 0.00 ? 197 CYS A HA   1  
ATOM   638   H  HB2  . CYS A 1 43  ? -8.085  -0.820  -7.840  1.00 0.00 ? 197 CYS A HB2  1  
ATOM   639   H  HB3  . CYS A 1 43  ? -6.486  -0.276  -7.355  1.00 0.00 ? 197 CYS A HB3  1  
ATOM   640   N  N    . LYS A 1 44  ? -10.363 -0.690  -5.789  1.00 0.00 ? 198 LYS A N    1  
ATOM   641   C  CA   . LYS A 1 44  ? -11.551 -1.394  -5.165  1.00 0.00 ? 198 LYS A CA   1  
ATOM   642   C  C    . LYS A 1 44  ? -11.209 -2.848  -4.809  1.00 0.00 ? 198 LYS A C    1  
ATOM   643   O  O    . LYS A 1 44  ? -11.544 -3.315  -3.736  1.00 0.00 ? 198 LYS A O    1  
ATOM   644   C  CB   . LYS A 1 44  ? -12.684 -1.342  -6.202  1.00 0.00 ? 198 LYS A CB   1  
ATOM   645   C  CG   . LYS A 1 44  ? -13.947 -1.982  -5.620  1.00 0.00 ? 198 LYS A CG   1  
ATOM   646   C  CD   . LYS A 1 44  ? -15.184 -1.357  -6.268  1.00 0.00 ? 198 LYS A CD   1  
ATOM   647   C  CE   . LYS A 1 44  ? -16.320 -1.290  -5.244  1.00 0.00 ? 198 LYS A CE   1  
ATOM   648   N  NZ   . LYS A 1 44  ? -17.266 -0.275  -5.785  1.00 0.00 ? 198 LYS A NZ   1  
ATOM   649   H  H    . LYS A 1 44  ? -10.469 -0.186  -6.631  1.00 0.00 ? 198 LYS A H    1  
ATOM   650   H  HA   . LYS A 1 44  ? -11.856 -0.877  -4.279  1.00 0.00 ? 198 LYS A HA   1  
ATOM   651   H  HB2  . LYS A 1 44  ? -12.887 -0.310  -6.452  1.00 0.00 ? 198 LYS A HB2  1  
ATOM   652   H  HB3  . LYS A 1 44  ? -12.385 -1.878  -7.090  1.00 0.00 ? 198 LYS A HB3  1  
ATOM   653   H  HG2  . LYS A 1 44  ? -13.935 -3.045  -5.816  1.00 0.00 ? 198 LYS A HG2  1  
ATOM   654   H  HG3  . LYS A 1 44  ? -13.977 -1.813  -4.554  1.00 0.00 ? 198 LYS A HG3  1  
ATOM   655   H  HD2  . LYS A 1 44  ? -14.946 -0.359  -6.608  1.00 0.00 ? 198 LYS A HD2  1  
ATOM   656   H  HD3  . LYS A 1 44  ? -15.494 -1.960  -7.108  1.00 0.00 ? 198 LYS A HD3  1  
ATOM   657   H  HE2  . LYS A 1 44  ? -16.804 -2.254  -5.160  1.00 0.00 ? 198 LYS A HE2  1  
ATOM   658   H  HE3  . LYS A 1 44  ? -15.944 -0.971  -4.285  1.00 0.00 ? 198 LYS A HE3  1  
ATOM   659   H  HZ1  . LYS A 1 44  ? -18.138 -0.279  -5.220  1.00 0.00 ? 198 LYS A HZ1  1  
ATOM   660   H  HZ2  . LYS A 1 44  ? -17.492 -0.505  -6.775  1.00 0.00 ? 198 LYS A HZ2  1  
ATOM   661   H  HZ3  . LYS A 1 44  ? -16.829 0.666   -5.738  1.00 0.00 ? 198 LYS A HZ3  1  
ATOM   662   N  N    . ASN A 1 45  ? -10.542 -3.564  -5.684  1.00 0.00 ? 199 ASN A N    1  
ATOM   663   C  CA   . ASN A 1 45  ? -10.185 -4.990  -5.351  1.00 0.00 ? 199 ASN A CA   1  
ATOM   664   C  C    . ASN A 1 45  ? -9.325  -5.050  -4.074  1.00 0.00 ? 199 ASN A C    1  
ATOM   665   O  O    . ASN A 1 45  ? -9.357  -6.033  -3.361  1.00 0.00 ? 199 ASN A O    1  
ATOM   666   C  CB   . ASN A 1 45  ? -9.402  -5.548  -6.550  1.00 0.00 ? 199 ASN A CB   1  
ATOM   667   C  CG   . ASN A 1 45  ? -10.378 -5.901  -7.679  1.00 0.00 ? 199 ASN A CG   1  
ATOM   668   O  OD1  . ASN A 1 45  ? -11.164 -6.818  -7.547  1.00 0.00 ? 199 ASN A OD1  1  
ATOM   669   N  ND2  . ASN A 1 45  ? -10.367 -5.210  -8.793  1.00 0.00 ? 199 ASN A ND2  1  
ATOM   670   H  H    . ASN A 1 45  ? -10.273 -3.164  -6.544  1.00 0.00 ? 199 ASN A H    1  
ATOM   671   H  HA   . ASN A 1 45  ? -11.085 -5.562  -5.201  1.00 0.00 ? 199 ASN A HA   1  
ATOM   672   H  HB2  . ASN A 1 45  ? -8.699  -4.805  -6.898  1.00 0.00 ? 199 ASN A HB2  1  
ATOM   673   H  HB3  . ASN A 1 45  ? -8.867  -6.437  -6.249  1.00 0.00 ? 199 ASN A HB3  1  
ATOM   674   H  HD21 . ASN A 1 45  ? -9.736  -4.466  -8.911  1.00 0.00 ? 199 ASN A HD21 1  
ATOM   675   H  HD22 . ASN A 1 45  ? -10.992 -5.436  -9.513  1.00 0.00 ? 199 ASN A HD22 1  
ATOM   676   N  N    . CYS A 1 46  ? -8.573  -4.010  -3.763  1.00 0.00 ? 200 CYS A N    1  
ATOM   677   C  CA   . CYS A 1 46  ? -7.745  -4.043  -2.508  1.00 0.00 ? 200 CYS A CA   1  
ATOM   678   C  C    . CYS A 1 46  ? -8.659  -3.789  -1.308  1.00 0.00 ? 200 CYS A C    1  
ATOM   679   O  O    . CYS A 1 46  ? -8.656  -4.538  -0.354  1.00 0.00 ? 200 CYS A O    1  
ATOM   680   C  CB   . CYS A 1 46  ? -6.703  -2.915  -2.623  1.00 0.00 ? 200 CYS A CB   1  
ATOM   681   S  SG   . CYS A 1 46  ? -5.192  -3.555  -3.382  1.00 0.00 ? 200 CYS A SG   1  
ATOM   682   H  H    . CYS A 1 46  ? -8.570  -3.215  -4.335  1.00 0.00 ? 200 CYS A H    1  
ATOM   683   H  HA   . CYS A 1 46  ? -7.253  -4.996  -2.408  1.00 0.00 ? 200 CYS A HA   1  
ATOM   684   H  HB2  . CYS A 1 46  ? -7.100  -2.115  -3.230  1.00 0.00 ? 200 CYS A HB2  1  
ATOM   685   H  HB3  . CYS A 1 46  ? -6.477  -2.536  -1.637  1.00 0.00 ? 200 CYS A HB3  1  
ATOM   686   N  N    . PHE A 1 47  ? -9.451  -2.741  -1.355  1.00 0.00 ? 201 PHE A N    1  
ATOM   687   C  CA   . PHE A 1 47  ? -10.375 -2.453  -0.202  1.00 0.00 ? 201 PHE A CA   1  
ATOM   688   C  C    . PHE A 1 47  ? -11.364 -3.612  -0.014  1.00 0.00 ? 201 PHE A C    1  
ATOM   689   O  O    . PHE A 1 47  ? -11.702 -3.955  1.104   1.00 0.00 ? 201 PHE A O    1  
ATOM   690   C  CB   . PHE A 1 47  ? -11.127 -1.156  -0.549  1.00 0.00 ? 201 PHE A CB   1  
ATOM   691   C  CG   . PHE A 1 47  ? -11.508 -0.424  0.717   1.00 0.00 ? 201 PHE A CG   1  
ATOM   692   C  CD1  . PHE A 1 47  ? -10.575 0.399   1.362   1.00 0.00 ? 201 PHE A CD1  1  
ATOM   693   C  CD2  . PHE A 1 47  ? -12.798 -0.564  1.242   1.00 0.00 ? 201 PHE A CD2  1  
ATOM   694   C  CE1  . PHE A 1 47  ? -10.933 1.081   2.532   1.00 0.00 ? 201 PHE A CE1  1  
ATOM   695   C  CE2  . PHE A 1 47  ? -13.155 0.117   2.412   1.00 0.00 ? 201 PHE A CE2  1  
ATOM   696   C  CZ   . PHE A 1 47  ? -12.223 0.939   3.057   1.00 0.00 ? 201 PHE A CZ   1  
ATOM   697   H  H    . PHE A 1 47  ? -9.439  -2.153  -2.147  1.00 0.00 ? 201 PHE A H    1  
ATOM   698   H  HA   . PHE A 1 47  ? -9.801  -2.318  0.701   1.00 0.00 ? 201 PHE A HA   1  
ATOM   699   H  HB2  . PHE A 1 47  ? -10.491 -0.523  -1.151  1.00 0.00 ? 201 PHE A HB2  1  
ATOM   700   H  HB3  . PHE A 1 47  ? -12.021 -1.398  -1.106  1.00 0.00 ? 201 PHE A HB3  1  
ATOM   701   H  HD1  . PHE A 1 47  ? -9.580  0.509   0.957   1.00 0.00 ? 201 PHE A HD1  1  
ATOM   702   H  HD2  . PHE A 1 47  ? -13.517 -1.198  0.745   1.00 0.00 ? 201 PHE A HD2  1  
ATOM   703   H  HE1  . PHE A 1 47  ? -10.213 1.716   3.031   1.00 0.00 ? 201 PHE A HE1  1  
ATOM   704   H  HE2  . PHE A 1 47  ? -14.151 0.009   2.815   1.00 0.00 ? 201 PHE A HE2  1  
ATOM   705   H  HZ   . PHE A 1 47  ? -12.500 1.464   3.959   1.00 0.00 ? 201 PHE A HZ   1  
ATOM   706   N  N    . LYS A 1 48  ? -11.821 -4.237  -1.085  1.00 0.00 ? 202 LYS A N    1  
ATOM   707   C  CA   . LYS A 1 48  ? -12.773 -5.388  -0.910  1.00 0.00 ? 202 LYS A CA   1  
ATOM   708   C  C    . LYS A 1 48  ? -11.985 -6.644  -0.521  1.00 0.00 ? 202 LYS A C    1  
ATOM   709   O  O    . LYS A 1 48  ? -12.433 -7.424  0.296   1.00 0.00 ? 202 LYS A O    1  
ATOM   710   C  CB   . LYS A 1 48  ? -13.485 -5.588  -2.257  1.00 0.00 ? 202 LYS A CB   1  
ATOM   711   C  CG   . LYS A 1 48  ? -14.272 -4.324  -2.610  1.00 0.00 ? 202 LYS A CG   1  
ATOM   712   C  CD   . LYS A 1 48  ? -15.527 -4.243  -1.737  1.00 0.00 ? 202 LYS A CD   1  
ATOM   713   C  CE   . LYS A 1 48  ? -15.238 -3.384  -0.504  1.00 0.00 ? 202 LYS A CE   1  
ATOM   714   N  NZ   . LYS A 1 48  ? -16.471 -2.572  -0.304  1.00 0.00 ? 202 LYS A NZ   1  
ATOM   715   H  H    . LYS A 1 48  ? -11.527 -3.964  -1.990  1.00 0.00 ? 202 LYS A H    1  
ATOM   716   H  HA   . LYS A 1 48  ? -13.493 -5.158  -0.140  1.00 0.00 ? 202 LYS A HA   1  
ATOM   717   H  HB2  . LYS A 1 48  ? -12.751 -5.782  -3.026  1.00 0.00 ? 202 LYS A HB2  1  
ATOM   718   H  HB3  . LYS A 1 48  ? -14.163 -6.424  -2.185  1.00 0.00 ? 202 LYS A HB3  1  
ATOM   719   H  HG2  . LYS A 1 48  ? -13.655 -3.455  -2.436  1.00 0.00 ? 202 LYS A HG2  1  
ATOM   720   H  HG3  . LYS A 1 48  ? -14.561 -4.359  -3.650  1.00 0.00 ? 202 LYS A HG3  1  
ATOM   721   H  HD2  . LYS A 1 48  ? -16.332 -3.799  -2.305  1.00 0.00 ? 202 LYS A HD2  1  
ATOM   722   H  HD3  . LYS A 1 48  ? -15.813 -5.235  -1.423  1.00 0.00 ? 202 LYS A HD3  1  
ATOM   723   H  HE2  . LYS A 1 48  ? -15.055 -4.013  0.357   1.00 0.00 ? 202 LYS A HE2  1  
ATOM   724   H  HE3  . LYS A 1 48  ? -14.394 -2.736  -0.685  1.00 0.00 ? 202 LYS A HE3  1  
ATOM   725   H  HZ1  . LYS A 1 48  ? -17.243 -3.188  0.020   1.00 0.00 ? 202 LYS A HZ1  1  
ATOM   726   H  HZ2  . LYS A 1 48  ? -16.738 -2.122  -1.203  1.00 0.00 ? 202 LYS A HZ2  1  
ATOM   727   H  HZ3  . LYS A 1 48  ? -16.292 -1.840  0.412   1.00 0.00 ? 202 LYS A HZ3  1  
ATOM   728   N  N    . TYR A 1 49  ? -10.806 -6.841  -1.078  1.00 0.00 ? 203 TYR A N    1  
ATOM   729   C  CA   . TYR A 1 49  ? -10.000 -8.052  -0.698  1.00 0.00 ? 203 TYR A CA   1  
ATOM   730   C  C    . TYR A 1 49  ? -9.415  -7.865  0.713   1.00 0.00 ? 203 TYR A C    1  
ATOM   731   O  O    . TYR A 1 49  ? -9.318  -8.815  1.468   1.00 0.00 ? 203 TYR A O    1  
ATOM   732   C  CB   . TYR A 1 49  ? -8.878  -8.174  -1.743  1.00 0.00 ? 203 TYR A CB   1  
ATOM   733   C  CG   . TYR A 1 49  ? -8.029  -9.393  -1.466  1.00 0.00 ? 203 TYR A CG   1  
ATOM   734   C  CD1  . TYR A 1 49  ? -8.630  -10.638 -1.234  1.00 0.00 ? 203 TYR A CD1  1  
ATOM   735   C  CD2  . TYR A 1 49  ? -6.636  -9.275  -1.454  1.00 0.00 ? 203 TYR A CD2  1  
ATOM   736   C  CE1  . TYR A 1 49  ? -7.834  -11.763 -0.989  1.00 0.00 ? 203 TYR A CE1  1  
ATOM   737   C  CE2  . TYR A 1 49  ? -5.841  -10.400 -1.209  1.00 0.00 ? 203 TYR A CE2  1  
ATOM   738   C  CZ   . TYR A 1 49  ? -6.440  -11.645 -0.977  1.00 0.00 ? 203 TYR A CZ   1  
ATOM   739   O  OH   . TYR A 1 49  ? -5.655  -12.754 -0.737  1.00 0.00 ? 203 TYR A OH   1  
ATOM   740   H  H    . TYR A 1 49  ? -10.449 -6.190  -1.728  1.00 0.00 ? 203 TYR A H    1  
ATOM   741   H  HA   . TYR A 1 49  ? -10.625 -8.933  -0.722  1.00 0.00 ? 203 TYR A HA   1  
ATOM   742   H  HB2  . TYR A 1 49  ? -9.315  -8.261  -2.726  1.00 0.00 ? 203 TYR A HB2  1  
ATOM   743   H  HB3  . TYR A 1 49  ? -8.258  -7.291  -1.705  1.00 0.00 ? 203 TYR A HB3  1  
ATOM   744   H  HD1  . TYR A 1 49  ? -9.706  -10.729 -1.243  1.00 0.00 ? 203 TYR A HD1  1  
ATOM   745   H  HD2  . TYR A 1 49  ? -6.174  -8.313  -1.632  1.00 0.00 ? 203 TYR A HD2  1  
ATOM   746   H  HE1  . TYR A 1 49  ? -8.296  -12.723 -0.810  1.00 0.00 ? 203 TYR A HE1  1  
ATOM   747   H  HE2  . TYR A 1 49  ? -4.766  -10.309 -1.202  1.00 0.00 ? 203 TYR A HE2  1  
ATOM   748   H  HH   . TYR A 1 49  ? -5.485  -13.185 -1.578  1.00 0.00 ? 203 TYR A HH   1  
ATOM   749   N  N    . TYR A 1 50  ? -9.045  -6.651  1.095   1.00 0.00 ? 204 TYR A N    1  
ATOM   750   C  CA   . TYR A 1 50  ? -8.498  -6.454  2.484   1.00 0.00 ? 204 TYR A CA   1  
ATOM   751   C  C    . TYR A 1 50  ? -9.613  -6.717  3.511   1.00 0.00 ? 204 TYR A C    1  
ATOM   752   O  O    . TYR A 1 50  ? -9.363  -7.257  4.573   1.00 0.00 ? 204 TYR A O    1  
ATOM   753   C  CB   . TYR A 1 50  ? -8.014  -4.996  2.580   1.00 0.00 ? 204 TYR A CB   1  
ATOM   754   C  CG   . TYR A 1 50  ? -6.877  -4.901  3.570   1.00 0.00 ? 204 TYR A CG   1  
ATOM   755   C  CD1  . TYR A 1 50  ? -5.759  -5.733  3.434   1.00 0.00 ? 204 TYR A CD1  1  
ATOM   756   C  CD2  . TYR A 1 50  ? -6.939  -3.978  4.621   1.00 0.00 ? 204 TYR A CD2  1  
ATOM   757   C  CE1  . TYR A 1 50  ? -4.704  -5.643  4.349   1.00 0.00 ? 204 TYR A CE1  1  
ATOM   758   C  CE2  . TYR A 1 50  ? -5.883  -3.887  5.535   1.00 0.00 ? 204 TYR A CE2  1  
ATOM   759   C  CZ   . TYR A 1 50  ? -4.765  -4.720  5.400   1.00 0.00 ? 204 TYR A CZ   1  
ATOM   760   O  OH   . TYR A 1 50  ? -3.725  -4.630  6.301   1.00 0.00 ? 204 TYR A OH   1  
ATOM   761   H  H    . TYR A 1 50  ? -9.147  -5.880  0.483   1.00 0.00 ? 204 TYR A H    1  
ATOM   762   H  HA   . TYR A 1 50  ? -7.674  -7.129  2.653   1.00 0.00 ? 204 TYR A HA   1  
ATOM   763   H  HB2  . TYR A 1 50  ? -7.670  -4.667  1.613   1.00 0.00 ? 204 TYR A HB2  1  
ATOM   764   H  HB3  . TYR A 1 50  ? -8.828  -4.367  2.907   1.00 0.00 ? 204 TYR A HB3  1  
ATOM   765   H  HD1  . TYR A 1 50  ? -5.711  -6.445  2.624   1.00 0.00 ? 204 TYR A HD1  1  
ATOM   766   H  HD2  . TYR A 1 50  ? -7.801  -3.336  4.725   1.00 0.00 ? 204 TYR A HD2  1  
ATOM   767   H  HE1  . TYR A 1 50  ? -3.843  -6.287  4.243   1.00 0.00 ? 204 TYR A HE1  1  
ATOM   768   H  HE2  . TYR A 1 50  ? -5.931  -3.174  6.345   1.00 0.00 ? 204 TYR A HE2  1  
ATOM   769   H  HH   . TYR A 1 50  ? -3.286  -3.786  6.164   1.00 0.00 ? 204 TYR A HH   1  
ATOM   770   N  N    . MET A 1 51  ? -10.847 -6.360  3.199   1.00 0.00 ? 205 MET A N    1  
ATOM   771   C  CA   . MET A 1 51  ? -11.967 -6.621  4.165   1.00 0.00 ? 205 MET A CA   1  
ATOM   772   C  C    . MET A 1 51  ? -12.539 -8.026  3.916   1.00 0.00 ? 205 MET A C    1  
ATOM   773   O  O    . MET A 1 51  ? -12.835 -8.752  4.847   1.00 0.00 ? 205 MET A O    1  
ATOM   774   C  CB   . MET A 1 51  ? -13.030 -5.542  3.897   1.00 0.00 ? 205 MET A CB   1  
ATOM   775   C  CG   . MET A 1 51  ? -14.231 -5.756  4.822   1.00 0.00 ? 205 MET A CG   1  
ATOM   776   S  SD   . MET A 1 51  ? -15.314 -4.307  4.751   1.00 0.00 ? 205 MET A SD   1  
ATOM   777   C  CE   . MET A 1 51  ? -16.588 -5.029  3.688   1.00 0.00 ? 205 MET A CE   1  
ATOM   778   H  H    . MET A 1 51  ? -11.037 -5.939  2.327   1.00 0.00 ? 205 MET A H    1  
ATOM   779   H  HA   . MET A 1 51  ? -11.609 -6.542  5.176   1.00 0.00 ? 205 MET A HA   1  
ATOM   780   H  HB2  . MET A 1 51  ? -12.605 -4.566  4.079   1.00 0.00 ? 205 MET A HB2  1  
ATOM   781   H  HB3  . MET A 1 51  ? -13.355 -5.606  2.869   1.00 0.00 ? 205 MET A HB3  1  
ATOM   782   H  HG2  . MET A 1 51  ? -14.777 -6.631  4.502   1.00 0.00 ? 205 MET A HG2  1  
ATOM   783   H  HG3  . MET A 1 51  ? -13.884 -5.898  5.835   1.00 0.00 ? 205 MET A HG3  1  
ATOM   784   H  HE1  . MET A 1 51  ? -16.188 -5.173  2.694   1.00 0.00 ? 205 MET A HE1  1  
ATOM   785   H  HE2  . MET A 1 51  ? -17.437 -4.365  3.639   1.00 0.00 ? 205 MET A HE2  1  
ATOM   786   H  HE3  . MET A 1 51  ? -16.901 -5.980  4.097   1.00 0.00 ? 205 MET A HE3  1  
ATOM   787   N  N    . SER A 1 52  ? -12.689 -8.422  2.667   1.00 0.00 ? 206 SER A N    1  
ATOM   788   C  CA   . SER A 1 52  ? -13.238 -9.799  2.373   1.00 0.00 ? 206 SER A CA   1  
ATOM   789   C  C    . SER A 1 52  ? -12.394 -10.868 3.087   1.00 0.00 ? 206 SER A C    1  
ATOM   790   O  O    . SER A 1 52  ? -12.920 -11.838 3.599   1.00 0.00 ? 206 SER A O    1  
ATOM   791   C  CB   . SER A 1 52  ? -13.156 -9.999  0.852   1.00 0.00 ? 206 SER A CB   1  
ATOM   792   O  OG   . SER A 1 52  ? -14.189 -9.252  0.224   1.00 0.00 ? 206 SER A OG   1  
ATOM   793   H  H    . SER A 1 52  ? -12.438 -7.818  1.931   1.00 0.00 ? 206 SER A H    1  
ATOM   794   H  HA   . SER A 1 52  ? -14.259 -9.863  2.694   1.00 0.00 ? 206 SER A HA   1  
ATOM   795   H  HB2  . SER A 1 52  ? -12.201 -9.654  0.493   1.00 0.00 ? 206 SER A HB2  1  
ATOM   796   H  HB3  . SER A 1 52  ? -13.266 -11.051 0.622   1.00 0.00 ? 206 SER A HB3  1  
ATOM   797   H  HG   . SER A 1 52  ? -14.368 -9.653  -0.630  1.00 0.00 ? 206 SER A HG   1  
ATOM   798   N  N    . ASP A 1 53  ? -11.090 -10.693 3.129   1.00 0.00 ? 207 ASP A N    1  
ATOM   799   C  CA   . ASP A 1 53  ? -10.221 -11.695 3.815   1.00 0.00 ? 207 ASP A CA   1  
ATOM   800   C  C    . ASP A 1 53  ? -9.553  -11.058 5.042   1.00 0.00 ? 207 ASP A C    1  
ATOM   801   O  O    . ASP A 1 53  ? -9.188  -9.897  5.017   1.00 0.00 ? 207 ASP A O    1  
ATOM   802   C  CB   . ASP A 1 53  ? -9.170  -12.091 2.776   1.00 0.00 ? 207 ASP A CB   1  
ATOM   803   C  CG   . ASP A 1 53  ? -9.660  -13.310 1.992   1.00 0.00 ? 207 ASP A CG   1  
ATOM   804   O  OD1  . ASP A 1 53  ? -10.504 -13.135 1.129   1.00 0.00 ? 207 ASP A OD1  1  
ATOM   805   O  OD2  . ASP A 1 53  ? -9.183  -14.398 2.269   1.00 0.00 ? 207 ASP A OD2  1  
ATOM   806   H  H    . ASP A 1 53  ? -10.683 -9.901  2.714   1.00 0.00 ? 207 ASP A H    1  
ATOM   807   H  HA   . ASP A 1 53  ? -10.798 -12.559 4.105   1.00 0.00 ? 207 ASP A HA   1  
ATOM   808   H  HB2  . ASP A 1 53  ? -9.007  -11.267 2.096   1.00 0.00 ? 207 ASP A HB2  1  
ATOM   809   H  HB3  . ASP A 1 53  ? -8.244  -12.335 3.275   1.00 0.00 ? 207 ASP A HB3  1  
ATOM   810   N  N    . ASP A 1 54  ? -9.388  -11.802 6.116   1.00 0.00 ? 208 ASP A N    1  
ATOM   811   C  CA   . ASP A 1 54  ? -8.741  -11.225 7.335   1.00 0.00 ? 208 ASP A CA   1  
ATOM   812   C  C    . ASP A 1 54  ? -7.364  -11.862 7.553   1.00 0.00 ? 208 ASP A C    1  
ATOM   813   O  O    . ASP A 1 54  ? -7.116  -12.973 7.122   1.00 0.00 ? 208 ASP A O    1  
ATOM   814   C  CB   . ASP A 1 54  ? -9.680  -11.566 8.495   1.00 0.00 ? 208 ASP A CB   1  
ATOM   815   C  CG   . ASP A 1 54  ? -10.600 -10.377 8.777   1.00 0.00 ? 208 ASP A CG   1  
ATOM   816   O  OD1  . ASP A 1 54  ? -10.190 -9.499  9.519   1.00 0.00 ? 208 ASP A OD1  1  
ATOM   817   O  OD2  . ASP A 1 54  ? -11.698 -10.363 8.246   1.00 0.00 ? 208 ASP A OD2  1  
ATOM   818   H  H    . ASP A 1 54  ? -9.686  -12.740 6.121   1.00 0.00 ? 208 ASP A H    1  
ATOM   819   H  HA   . ASP A 1 54  ? -8.644  -10.155 7.242   1.00 0.00 ? 208 ASP A HA   1  
ATOM   820   H  HB2  . ASP A 1 54  ? -10.276 -12.429 8.233   1.00 0.00 ? 208 ASP A HB2  1  
ATOM   821   H  HB3  . ASP A 1 54  ? -9.098  -11.785 9.377   1.00 0.00 ? 208 ASP A HB3  1  
ATOM   822   N  N    . ILE A 1 55  ? -6.464  -11.170 8.221   1.00 0.00 ? 209 ILE A N    1  
ATOM   823   C  CA   . ILE A 1 55  ? -5.105  -11.754 8.461   1.00 0.00 ? 209 ILE A CA   1  
ATOM   824   C  C    . ILE A 1 55  ? -5.016  -12.312 9.889   1.00 0.00 ? 209 ILE A C    1  
ATOM   825   O  O    . ILE A 1 55  ? -5.023  -11.570 10.853  1.00 0.00 ? 209 ILE A O    1  
ATOM   826   C  CB   . ILE A 1 55  ? -4.109  -10.599 8.248   1.00 0.00 ? 209 ILE A CB   1  
ATOM   827   C  CG1  . ILE A 1 55  ? -4.180  -10.125 6.787   1.00 0.00 ? 209 ILE A CG1  1  
ATOM   828   C  CG2  . ILE A 1 55  ? -2.682  -11.065 8.564   1.00 0.00 ? 209 ILE A CG2  1  
ATOM   829   C  CD1  . ILE A 1 55  ? -3.835  -11.280 5.832   1.00 0.00 ? 209 ILE A CD1  1  
ATOM   830   H  H    . ILE A 1 55  ? -6.684  -10.274 8.566   1.00 0.00 ? 209 ILE A H    1  
ATOM   831   H  HA   . ILE A 1 55  ? -4.911  -12.539 7.747   1.00 0.00 ? 209 ILE A HA   1  
ATOM   832   H  HB   . ILE A 1 55  ? -4.369  -9.780  8.903   1.00 0.00 ? 209 ILE A HB   1  
ATOM   833   H  HG12 . ILE A 1 55  ? -5.179  -9.772  6.574   1.00 0.00 ? 209 ILE A HG12 1  
ATOM   834   H  HG13 . ILE A 1 55  ? -3.477  -9.319  6.639   1.00 0.00 ? 209 ILE A HG13 1  
ATOM   835   H  HG21 . ILE A 1 55  ? -1.976  -10.457 8.019   1.00 0.00 ? 209 ILE A HG21 1  
ATOM   836   H  HG22 . ILE A 1 55  ? -2.568  -12.099 8.271   1.00 0.00 ? 209 ILE A HG22 1  
ATOM   837   H  HG23 . ILE A 1 55  ? -2.498  -10.969 9.624   1.00 0.00 ? 209 ILE A HG23 1  
ATOM   838   H  HD11 . ILE A 1 55  ? -4.707  -11.537 5.249   1.00 0.00 ? 209 ILE A HD11 1  
ATOM   839   H  HD12 . ILE A 1 55  ? -3.518  -12.142 6.404   1.00 0.00 ? 209 ILE A HD12 1  
ATOM   840   H  HD13 . ILE A 1 55  ? -3.037  -10.974 5.171   1.00 0.00 ? 209 ILE A HD13 1  
ATOM   841   N  N    . SER A 1 56  ? -4.935  -13.620 10.030  1.00 0.00 ? 210 SER A N    1  
ATOM   842   C  CA   . SER A 1 56  ? -4.846  -14.227 11.402  1.00 0.00 ? 210 SER A CA   1  
ATOM   843   C  C    . SER A 1 56  ? -4.587  -15.743 11.315  1.00 0.00 ? 210 SER A C    1  
ATOM   844   O  O    . SER A 1 56  ? -5.283  -16.453 10.615  1.00 0.00 ? 210 SER A O    1  
ATOM   845   C  CB   . SER A 1 56  ? -6.208  -13.963 12.050  1.00 0.00 ? 210 SER A CB   1  
ATOM   846   O  OG   . SER A 1 56  ? -6.022  -13.661 13.426  1.00 0.00 ? 210 SER A OG   1  
ATOM   847   H  H    . SER A 1 56  ? -4.930  -14.202 9.234   1.00 0.00 ? 210 SER A H    1  
ATOM   848   H  HA   . SER A 1 56  ? -4.069  -13.747 11.975  1.00 0.00 ? 210 SER A HA   1  
ATOM   849   H  HB2  . SER A 1 56  ? -6.683  -13.127 11.565  1.00 0.00 ? 210 SER A HB2  1  
ATOM   850   H  HB3  . SER A 1 56  ? -6.832  -14.840 11.943  1.00 0.00 ? 210 SER A HB3  1  
ATOM   851   H  HG   . SER A 1 56  ? -5.857  -14.485 13.891  1.00 0.00 ? 210 SER A HG   1  
ATOM   852   N  N    . ARG A 1 57  ? -3.593  -16.250 12.022  1.00 0.00 ? 211 ARG A N    1  
ATOM   853   C  CA   . ARG A 1 57  ? -3.296  -17.721 11.979  1.00 0.00 ? 211 ARG A CA   1  
ATOM   854   C  C    . ARG A 1 57  ? -3.148  -18.209 10.524  1.00 0.00 ? 211 ARG A C    1  
ATOM   855   O  O    . ARG A 1 57  ? -3.835  -19.121 10.102  1.00 0.00 ? 211 ARG A O    1  
ATOM   856   C  CB   . ARG A 1 57  ? -4.497  -18.396 12.653  1.00 0.00 ? 211 ARG A CB   1  
ATOM   857   C  CG   . ARG A 1 57  ? -4.180  -18.658 14.129  1.00 0.00 ? 211 ARG A CG   1  
ATOM   858   C  CD   . ARG A 1 57  ? -5.440  -18.441 14.978  1.00 0.00 ? 211 ARG A CD   1  
ATOM   859   N  NE   . ARG A 1 57  ? -5.669  -19.743 15.680  1.00 0.00 ? 211 ARG A NE   1  
ATOM   860   C  CZ   . ARG A 1 57  ? -6.204  -20.779 15.052  1.00 0.00 ? 211 ARG A CZ   1  
ATOM   861   N  NH1  . ARG A 1 57  ? -6.552  -20.710 13.787  1.00 0.00 ? 211 ARG A NH1  1  
ATOM   862   N  NH2  . ARG A 1 57  ? -6.391  -21.900 15.700  1.00 0.00 ? 211 ARG A NH2  1  
ATOM   863   H  H    . ARG A 1 57  ? -3.039  -15.665 12.586  1.00 0.00 ? 211 ARG A H    1  
ATOM   864   H  HA   . ARG A 1 57  ? -2.399  -17.935 12.536  1.00 0.00 ? 211 ARG A HA   1  
ATOM   865   H  HB2  . ARG A 1 57  ? -5.361  -17.751 12.579  1.00 0.00 ? 211 ARG A HB2  1  
ATOM   866   H  HB3  . ARG A 1 57  ? -4.705  -19.334 12.161  1.00 0.00 ? 211 ARG A HB3  1  
ATOM   867   H  HG2  . ARG A 1 57  ? -3.835  -19.675 14.245  1.00 0.00 ? 211 ARG A HG2  1  
ATOM   868   H  HG3  . ARG A 1 57  ? -3.408  -17.978 14.457  1.00 0.00 ? 211 ARG A HG3  1  
ATOM   869   H  HD2  . ARG A 1 57  ? -5.274  -17.650 15.697  1.00 0.00 ? 211 ARG A HD2  1  
ATOM   870   H  HD3  . ARG A 1 57  ? -6.287  -18.206 14.351  1.00 0.00 ? 211 ARG A HD3  1  
ATOM   871   H  HE   . ARG A 1 57  ? -5.416  -19.826 16.625  1.00 0.00 ? 211 ARG A HE   1  
ATOM   872   H  HH11 . ARG A 1 57  ? -6.418  -19.867 13.269  1.00 0.00 ? 211 ARG A HH11 1  
ATOM   873   H  HH12 . ARG A 1 57  ? -6.954  -21.509 13.339  1.00 0.00 ? 211 ARG A HH12 1  
ATOM   874   H  HH21 . ARG A 1 57  ? -6.131  -21.971 16.663  1.00 0.00 ? 211 ARG A HH21 1  
ATOM   875   H  HH22 . ARG A 1 57  ? -6.795  -22.686 15.232  1.00 0.00 ? 211 ARG A HH22 1  
ATOM   876   N  N    . ASP A 1 58  ? -2.258  -17.615 9.754   1.00 0.00 ? 212 ASP A N    1  
ATOM   877   C  CA   . ASP A 1 58  ? -2.082  -18.058 8.338   1.00 0.00 ? 212 ASP A CA   1  
ATOM   878   C  C    . ASP A 1 58  ? -0.647  -18.561 8.109   1.00 0.00 ? 212 ASP A C    1  
ATOM   879   O  O    . ASP A 1 58  ? 0.245   -18.251 8.872   1.00 0.00 ? 212 ASP A O    1  
ATOM   880   C  CB   . ASP A 1 58  ? -2.355  -16.810 7.495   1.00 0.00 ? 212 ASP A CB   1  
ATOM   881   C  CG   . ASP A 1 58  ? -3.796  -16.844 6.982   1.00 0.00 ? 212 ASP A CG   1  
ATOM   882   O  OD1  . ASP A 1 58  ? -4.161  -17.829 6.362   1.00 0.00 ? 212 ASP A OD1  1  
ATOM   883   O  OD2  . ASP A 1 58  ? -4.511  -15.883 7.219   1.00 0.00 ? 212 ASP A OD2  1  
ATOM   884   H  H    . ASP A 1 58  ? -1.707  -16.879 10.104  1.00 0.00 ? 212 ASP A H    1  
ATOM   885   H  HA   . ASP A 1 58  ? -2.794  -18.831 8.095   1.00 0.00 ? 212 ASP A HA   1  
ATOM   886   H  HB2  . ASP A 1 58  ? -2.208  -15.928 8.102   1.00 0.00 ? 212 ASP A HB2  1  
ATOM   887   H  HB3  . ASP A 1 58  ? -1.676  -16.787 6.656   1.00 0.00 ? 212 ASP A HB3  1  
ATOM   888   N  N    . SER A 1 59  ? -0.418  -19.333 7.057   1.00 0.00 ? 213 SER A N    1  
ATOM   889   C  CA   . SER A 1 59  ? 0.956   -19.868 6.758   1.00 0.00 ? 213 SER A CA   1  
ATOM   890   C  C    . SER A 1 59  ? 1.470   -20.768 7.902   1.00 0.00 ? 213 SER A C    1  
ATOM   891   O  O    . SER A 1 59  ? 1.520   -21.976 7.756   1.00 0.00 ? 213 SER A O    1  
ATOM   892   C  CB   . SER A 1 59  ? 1.869   -18.647 6.561   1.00 0.00 ? 213 SER A CB   1  
ATOM   893   O  OG   . SER A 1 59  ? 1.977   -18.364 5.172   1.00 0.00 ? 213 SER A OG   1  
ATOM   894   H  H    . SER A 1 59  ? -1.158  -19.565 6.453   1.00 0.00 ? 213 SER A H    1  
ATOM   895   H  HA   . SER A 1 59  ? 0.926   -20.438 5.842   1.00 0.00 ? 213 SER A HA   1  
ATOM   896   H  HB2  . SER A 1 59  ? 1.454   -17.791 7.063   1.00 0.00 ? 213 SER A HB2  1  
ATOM   897   H  HB3  . SER A 1 59  ? 2.847   -18.862 6.971   1.00 0.00 ? 213 SER A HB3  1  
ATOM   898   H  HG   . SER A 1 59  ? 2.646   -18.946 4.802   1.00 0.00 ? 213 SER A HG   1  
ATOM   899   N  N    . ASP A 1 60  ? 1.853   -20.206 9.031   1.00 0.00 ? 214 ASP A N    1  
ATOM   900   C  CA   . ASP A 1 60  ? 2.358   -21.052 10.158  1.00 0.00 ? 214 ASP A CA   1  
ATOM   901   C  C    . ASP A 1 60  ? 1.398   -20.970 11.355  1.00 0.00 ? 214 ASP A C    1  
ATOM   902   O  O    . ASP A 1 60  ? 1.827   -20.852 12.487  1.00 0.00 ? 214 ASP A O    1  
ATOM   903   C  CB   . ASP A 1 60  ? 3.716   -20.451 10.524  1.00 0.00 ? 214 ASP A CB   1  
ATOM   904   C  CG   . ASP A 1 60  ? 4.514   -21.452 11.362  1.00 0.00 ? 214 ASP A CG   1  
ATOM   905   O  OD1  . ASP A 1 60  ? 4.199   -21.600 12.531  1.00 0.00 ? 214 ASP A OD1  1  
ATOM   906   O  OD2  . ASP A 1 60  ? 5.429   -22.051 10.821  1.00 0.00 ? 214 ASP A OD2  1  
ATOM   907   H  H    . ASP A 1 60  ? 1.808   -19.231 9.141   1.00 0.00 ? 214 ASP A H    1  
ATOM   908   H  HA   . ASP A 1 60  ? 2.479   -22.075 9.839   1.00 0.00 ? 214 ASP A HA   1  
ATOM   909   H  HB2  . ASP A 1 60  ? 4.262   -20.221 9.621   1.00 0.00 ? 214 ASP A HB2  1  
ATOM   910   H  HB3  . ASP A 1 60  ? 3.565   -19.547 11.094  1.00 0.00 ? 214 ASP A HB3  1  
ATOM   911   N  N    . GLY A 1 61  ? 0.103   -21.023 11.119  1.00 0.00 ? 215 GLY A N    1  
ATOM   912   C  CA   . GLY A 1 61  ? -0.873  -20.939 12.250  1.00 0.00 ? 215 GLY A CA   1  
ATOM   913   C  C    . GLY A 1 61  ? -0.649  -19.647 13.064  1.00 0.00 ? 215 GLY A C    1  
ATOM   914   O  O    . GLY A 1 61  ? -0.930  -19.611 14.248  1.00 0.00 ? 215 GLY A O    1  
ATOM   915   H  H    . GLY A 1 61  ? -0.231  -21.113 10.199  1.00 0.00 ? 215 GLY A H    1  
ATOM   916   H  HA2  . GLY A 1 61  ? -1.878  -20.943 11.853  1.00 0.00 ? 215 GLY A HA2  1  
ATOM   917   H  HA3  . GLY A 1 61  ? -0.742  -21.792 12.898  1.00 0.00 ? 215 GLY A HA3  1  
ATOM   918   N  N    . MET A 1 62  ? -0.151  -18.587 12.452  1.00 0.00 ? 216 MET A N    1  
ATOM   919   C  CA   . MET A 1 62  ? 0.075   -17.319 13.214  1.00 0.00 ? 216 MET A CA   1  
ATOM   920   C  C    . MET A 1 62  ? -0.118  -16.104 12.289  1.00 0.00 ? 216 MET A C    1  
ATOM   921   O  O    . MET A 1 62  ? -0.566  -16.248 11.167  1.00 0.00 ? 216 MET A O    1  
ATOM   922   C  CB   . MET A 1 62  ? 1.526   -17.405 13.698  1.00 0.00 ? 216 MET A CB   1  
ATOM   923   C  CG   . MET A 1 62  ? 1.553   -17.807 15.176  1.00 0.00 ? 216 MET A CG   1  
ATOM   924   S  SD   . MET A 1 62  ? 3.005   -17.082 15.976  1.00 0.00 ? 216 MET A SD   1  
ATOM   925   C  CE   . MET A 1 62  ? 2.178   -15.630 16.671  1.00 0.00 ? 216 MET A CE   1  
ATOM   926   H  H    . MET A 1 62  ? 0.073   -18.620 11.496  1.00 0.00 ? 216 MET A H    1  
ATOM   927   H  HA   . MET A 1 62  ? -0.596  -17.261 14.057  1.00 0.00 ? 216 MET A HA   1  
ATOM   928   H  HB2  . MET A 1 62  ? 2.055   -18.144 13.115  1.00 0.00 ? 216 MET A HB2  1  
ATOM   929   H  HB3  . MET A 1 62  ? 2.003   -16.445 13.579  1.00 0.00 ? 216 MET A HB3  1  
ATOM   930   H  HG2  . MET A 1 62  ? 0.658   -17.448 15.663  1.00 0.00 ? 216 MET A HG2  1  
ATOM   931   H  HG3  . MET A 1 62  ? 1.598   -18.883 15.255  1.00 0.00 ? 216 MET A HG3  1  
ATOM   932   H  HE1  . MET A 1 62  ? 2.115   -15.734 17.746  1.00 0.00 ? 216 MET A HE1  1  
ATOM   933   H  HE2  . MET A 1 62  ? 1.184   -15.550 16.261  1.00 0.00 ? 216 MET A HE2  1  
ATOM   934   H  HE3  . MET A 1 62  ? 2.741   -14.742 16.422  1.00 0.00 ? 216 MET A HE3  1  
ATOM   935   N  N    . ASP A 1 63  ? 0.221   -14.913 12.740  1.00 0.00 ? 217 ASP A N    1  
ATOM   936   C  CA   . ASP A 1 63  ? 0.052   -13.710 11.853  1.00 0.00 ? 217 ASP A CA   1  
ATOM   937   C  C    . ASP A 1 63  ? 1.308   -13.525 10.988  1.00 0.00 ? 217 ASP A C    1  
ATOM   938   O  O    . ASP A 1 63  ? 2.346   -13.123 11.479  1.00 0.00 ? 217 ASP A O    1  
ATOM   939   C  CB   . ASP A 1 63  ? -0.140  -12.505 12.785  1.00 0.00 ? 217 ASP A CB   1  
ATOM   940   C  CG   . ASP A 1 63  ? -0.692  -11.324 11.985  1.00 0.00 ? 217 ASP A CG   1  
ATOM   941   O  OD1  . ASP A 1 63  ? 0.033   -10.810 11.149  1.00 0.00 ? 217 ASP A OD1  1  
ATOM   942   O  OD2  . ASP A 1 63  ? -1.831  -10.954 12.221  1.00 0.00 ? 217 ASP A OD2  1  
ATOM   943   H  H    . ASP A 1 63  ? 0.591   -14.813 13.648  1.00 0.00 ? 217 ASP A H    1  
ATOM   944   H  HA   . ASP A 1 63  ? -0.817  -13.831 11.225  1.00 0.00 ? 217 ASP A HA   1  
ATOM   945   H  HB2  . ASP A 1 63  ? -0.834  -12.765 13.571  1.00 0.00 ? 217 ASP A HB2  1  
ATOM   946   H  HB3  . ASP A 1 63  ? 0.809   -12.230 13.219  1.00 0.00 ? 217 ASP A HB3  1  
ATOM   947   N  N    . GLU A 1 64  ? 1.228   -13.822 9.705   1.00 0.00 ? 218 GLU A N    1  
ATOM   948   C  CA   . GLU A 1 64  ? 2.428   -13.665 8.827   1.00 0.00 ? 218 GLU A CA   1  
ATOM   949   C  C    . GLU A 1 64  ? 2.007   -13.363 7.378   1.00 0.00 ? 218 GLU A C    1  
ATOM   950   O  O    . GLU A 1 64  ? 2.377   -14.073 6.462   1.00 0.00 ? 218 GLU A O    1  
ATOM   951   C  CB   . GLU A 1 64  ? 3.153   -15.009 8.910   1.00 0.00 ? 218 GLU A CB   1  
ATOM   952   C  CG   . GLU A 1 64  ? 4.665   -14.778 8.864   1.00 0.00 ? 218 GLU A CG   1  
ATOM   953   C  CD   . GLU A 1 64  ? 5.377   -16.106 8.602   1.00 0.00 ? 218 GLU A CD   1  
ATOM   954   O  OE1  . GLU A 1 64  ? 4.889   -16.865 7.781   1.00 0.00 ? 218 GLU A OE1  1  
ATOM   955   O  OE2  . GLU A 1 64  ? 6.398   -16.342 9.226   1.00 0.00 ? 218 GLU A OE2  1  
ATOM   956   H  H    . GLU A 1 64  ? 0.384   -14.151 9.321   1.00 0.00 ? 218 GLU A H    1  
ATOM   957   H  HA   . GLU A 1 64  ? 3.067   -12.881 9.202   1.00 0.00 ? 218 GLU A HA   1  
ATOM   958   H  HB2  . GLU A 1 64  ? 2.891   -15.502 9.836   1.00 0.00 ? 218 GLU A HB2  1  
ATOM   959   H  HB3  . GLU A 1 64  ? 2.860   -15.629 8.077   1.00 0.00 ? 218 GLU A HB3  1  
ATOM   960   H  HG2  . GLU A 1 64  ? 4.898   -14.081 8.073   1.00 0.00 ? 218 GLU A HG2  1  
ATOM   961   H  HG3  . GLU A 1 64  ? 4.997   -14.375 9.809   1.00 0.00 ? 218 GLU A HG3  1  
ATOM   962   N  N    . GLN A 1 65  ? 1.239   -12.314 7.162   1.00 0.00 ? 219 GLN A N    1  
ATOM   963   C  CA   . GLN A 1 65  ? 0.808   -11.974 5.771   1.00 0.00 ? 219 GLN A CA   1  
ATOM   964   C  C    . GLN A 1 65  ? 1.232   -10.536 5.425   1.00 0.00 ? 219 GLN A C    1  
ATOM   965   O  O    . GLN A 1 65  ? 1.892   -9.882  6.208   1.00 0.00 ? 219 GLN A O    1  
ATOM   966   C  CB   . GLN A 1 65  ? -0.717  -12.098 5.783   1.00 0.00 ? 219 GLN A CB   1  
ATOM   967   C  CG   . GLN A 1 65  ? -1.116  -13.573 5.642   1.00 0.00 ? 219 GLN A CG   1  
ATOM   968   C  CD   . GLN A 1 65  ? -2.307  -13.698 4.682   1.00 0.00 ? 219 GLN A CD   1  
ATOM   969   O  OE1  . GLN A 1 65  ? -2.181  -13.417 3.507   1.00 0.00 ? 219 GLN A OE1  1  
ATOM   970   N  NE2  . GLN A 1 65  ? -3.468  -14.110 5.131   1.00 0.00 ? 219 GLN A NE2  1  
ATOM   971   H  H    . GLN A 1 65  ? 0.948   -11.748 7.911   1.00 0.00 ? 219 GLN A H    1  
ATOM   972   H  HA   . GLN A 1 65  ? 1.230   -12.671 5.065   1.00 0.00 ? 219 GLN A HA   1  
ATOM   973   H  HB2  . GLN A 1 65  ? -1.101  -11.708 6.715   1.00 0.00 ? 219 GLN A HB2  1  
ATOM   974   H  HB3  . GLN A 1 65  ? -1.129  -11.534 4.959   1.00 0.00 ? 219 GLN A HB3  1  
ATOM   975   H  HG2  . GLN A 1 65  ? -0.281  -14.139 5.253   1.00 0.00 ? 219 GLN A HG2  1  
ATOM   976   H  HG3  . GLN A 1 65  ? -1.395  -13.963 6.609   1.00 0.00 ? 219 GLN A HG3  1  
ATOM   977   H  HE21 . GLN A 1 65  ? -3.582  -14.339 6.079   1.00 0.00 ? 219 GLN A HE21 1  
ATOM   978   H  HE22 . GLN A 1 65  ? -4.227  -14.190 4.517   1.00 0.00 ? 219 GLN A HE22 1  
ATOM   979   N  N    . CYS A 1 66  ? 0.860   -10.036 4.262   1.00 0.00 ? 220 CYS A N    1  
ATOM   980   C  CA   . CYS A 1 66  ? 1.256   -8.628  3.890   1.00 0.00 ? 220 CYS A CA   1  
ATOM   981   C  C    . CYS A 1 66  ? 0.294   -7.614  4.528   1.00 0.00 ? 220 CYS A C    1  
ATOM   982   O  O    . CYS A 1 66  ? -0.854  -7.923  4.786   1.00 0.00 ? 220 CYS A O    1  
ATOM   983   C  CB   . CYS A 1 66  ? 1.151   -8.544  2.361   1.00 0.00 ? 220 CYS A CB   1  
ATOM   984   S  SG   . CYS A 1 66  ? 1.727   -6.923  1.796   1.00 0.00 ? 220 CYS A SG   1  
ATOM   985   H  H    . CYS A 1 66  ? 0.320   -10.583 3.639   1.00 0.00 ? 220 CYS A H    1  
ATOM   986   H  HA   . CYS A 1 66  ? 2.274   -8.428  4.196   1.00 0.00 ? 220 CYS A HA   1  
ATOM   987   H  HB2  . CYS A 1 66  ? 1.756   -9.317  1.915   1.00 0.00 ? 220 CYS A HB2  1  
ATOM   988   H  HB3  . CYS A 1 66  ? 0.122   -8.679  2.067   1.00 0.00 ? 220 CYS A HB3  1  
ATOM   989   N  N    . ARG A 1 67  ? 0.743   -6.396  4.759   1.00 0.00 ? 221 ARG A N    1  
ATOM   990   C  CA   . ARG A 1 67  ? -0.166  -5.364  5.351   1.00 0.00 ? 221 ARG A CA   1  
ATOM   991   C  C    . ARG A 1 67  ? -0.592  -4.362  4.260   1.00 0.00 ? 221 ARG A C    1  
ATOM   992   O  O    . ARG A 1 67  ? -0.718  -3.179  4.516   1.00 0.00 ? 221 ARG A O    1  
ATOM   993   C  CB   . ARG A 1 67  ? 0.654   -4.664  6.440   1.00 0.00 ? 221 ARG A CB   1  
ATOM   994   C  CG   . ARG A 1 67  ? 0.309   -5.262  7.805   1.00 0.00 ? 221 ARG A CG   1  
ATOM   995   C  CD   . ARG A 1 67  ? -1.118  -4.848  8.200   1.00 0.00 ? 221 ARG A CD   1  
ATOM   996   N  NE   . ARG A 1 67  ? -1.639  -5.925  9.119   1.00 0.00 ? 221 ARG A NE   1  
ATOM   997   C  CZ   . ARG A 1 67  ? -2.596  -5.670  10.000  1.00 0.00 ? 221 ARG A CZ   1  
ATOM   998   N  NH1  . ARG A 1 67  ? -3.157  -4.485  10.085  1.00 0.00 ? 221 ARG A NH1  1  
ATOM   999   N  NH2  . ARG A 1 67  ? -3.010  -6.621  10.797  1.00 0.00 ? 221 ARG A NH2  1  
ATOM   1000  H  H    . ARG A 1 67  ? 1.668   -6.155  4.526   1.00 0.00 ? 221 ARG A H    1  
ATOM   1001  H  HA   . ARG A 1 67  ? -1.034  -5.835  5.785   1.00 0.00 ? 221 ARG A HA   1  
ATOM   1002  H  HB2  . ARG A 1 67  ? 1.707   -4.802  6.241   1.00 0.00 ? 221 ARG A HB2  1  
ATOM   1003  H  HB3  . ARG A 1 67  ? 0.423   -3.609  6.442   1.00 0.00 ? 221 ARG A HB3  1  
ATOM   1004  H  HG2  . ARG A 1 67  ? 0.372   -6.340  7.750   1.00 0.00 ? 221 ARG A HG2  1  
ATOM   1005  H  HG3  . ARG A 1 67  ? 1.005   -4.898  8.545   1.00 0.00 ? 221 ARG A HG3  1  
ATOM   1006  H  HD2  . ARG A 1 67  ? -1.092  -3.898  8.713   1.00 0.00 ? 221 ARG A HD2  1  
ATOM   1007  H  HD3  . ARG A 1 67  ? -1.742  -4.781  7.323   1.00 0.00 ? 221 ARG A HD3  1  
ATOM   1008  H  HE   . ARG A 1 67  ? -1.265  -6.836  9.069   1.00 0.00 ? 221 ARG A HE   1  
ATOM   1009  H  HH11 . ARG A 1 67  ? -2.874  -3.743  9.481   1.00 0.00 ? 221 ARG A HH11 1  
ATOM   1010  H  HH12 . ARG A 1 67  ? -3.876  -4.324  10.761  1.00 0.00 ? 221 ARG A HH12 1  
ATOM   1011  H  HH21 . ARG A 1 67  ? -2.604  -7.534  10.739  1.00 0.00 ? 221 ARG A HH21 1  
ATOM   1012  H  HH22 . ARG A 1 67  ? -3.732  -6.437  11.464  1.00 0.00 ? 221 ARG A HH22 1  
ATOM   1013  N  N    . TRP A 1 68  ? -0.814  -4.826  3.043   1.00 0.00 ? 222 TRP A N    1  
ATOM   1014  C  CA   . TRP A 1 68  ? -1.231  -3.899  1.942   1.00 0.00 ? 222 TRP A CA   1  
ATOM   1015  C  C    . TRP A 1 68  ? -2.077  -4.662  0.906   1.00 0.00 ? 222 TRP A C    1  
ATOM   1016  O  O    . TRP A 1 68  ? -3.223  -4.332  0.665   1.00 0.00 ? 222 TRP A O    1  
ATOM   1017  C  CB   . TRP A 1 68  ? 0.079   -3.424  1.298   1.00 0.00 ? 222 TRP A CB   1  
ATOM   1018  C  CG   . TRP A 1 68  ? 0.012   -1.953  1.027   1.00 0.00 ? 222 TRP A CG   1  
ATOM   1019  C  CD1  . TRP A 1 68  ? -1.082  -1.281  0.590   1.00 0.00 ? 222 TRP A CD1  1  
ATOM   1020  C  CD2  . TRP A 1 68  ? 1.069   -0.964  1.161   1.00 0.00 ? 222 TRP A CD2  1  
ATOM   1021  N  NE1  . TRP A 1 68  ? -0.766  0.058   0.474   1.00 0.00 ? 222 TRP A NE1  1  
ATOM   1022  C  CE2  . TRP A 1 68  ? 0.549   0.302   0.811   1.00 0.00 ? 222 TRP A CE2  1  
ATOM   1023  C  CE3  . TRP A 1 68  ? 2.416   -1.042  1.556   1.00 0.00 ? 222 TRP A CE3  1  
ATOM   1024  C  CZ2  . TRP A 1 68  ? 1.334   1.449   0.857   1.00 0.00 ? 222 TRP A CZ2  1  
ATOM   1025  C  CZ3  . TRP A 1 68  ? 3.212   0.112   1.596   1.00 0.00 ? 222 TRP A CZ3  1  
ATOM   1026  C  CH2  . TRP A 1 68  ? 2.671   1.357   1.250   1.00 0.00 ? 222 TRP A CH2  1  
ATOM   1027  H  H    . TRP A 1 68  ? -0.709  -5.785  2.852   1.00 0.00 ? 222 TRP A H    1  
ATOM   1028  H  HA   . TRP A 1 68  ? -1.779  -3.056  2.340   1.00 0.00 ? 222 TRP A HA   1  
ATOM   1029  H  HB2  . TRP A 1 68  ? 0.901   -3.626  1.968   1.00 0.00 ? 222 TRP A HB2  1  
ATOM   1030  H  HB3  . TRP A 1 68  ? 0.238   -3.951  0.369   1.00 0.00 ? 222 TRP A HB3  1  
ATOM   1031  H  HD1  . TRP A 1 68  ? -2.046  -1.719  0.380   1.00 0.00 ? 222 TRP A HD1  1  
ATOM   1032  H  HE1  . TRP A 1 68  ? -1.384  0.761   0.185   1.00 0.00 ? 222 TRP A HE1  1  
ATOM   1033  H  HE3  . TRP A 1 68  ? 2.841   -1.997  1.824   1.00 0.00 ? 222 TRP A HE3  1  
ATOM   1034  H  HZ2  . TRP A 1 68  ? 0.909   2.403   0.600   1.00 0.00 ? 222 TRP A HZ2  1  
ATOM   1035  H  HZ3  . TRP A 1 68  ? 4.246   0.041   1.898   1.00 0.00 ? 222 TRP A HZ3  1  
ATOM   1036  H  HH2  . TRP A 1 68  ? 3.288   2.242   1.281   1.00 0.00 ? 222 TRP A HH2  1  
ATOM   1037  N  N    . CYS A 1 69  ? -1.514  -5.689  0.302   1.00 0.00 ? 223 CYS A N    1  
ATOM   1038  C  CA   . CYS A 1 69  ? -2.283  -6.483  -0.710  1.00 0.00 ? 223 CYS A CA   1  
ATOM   1039  C  C    . CYS A 1 69  ? -2.897  -7.762  -0.085  1.00 0.00 ? 223 CYS A C    1  
ATOM   1040  O  O    . CYS A 1 69  ? -3.742  -8.390  -0.692  1.00 0.00 ? 223 CYS A O    1  
ATOM   1041  C  CB   . CYS A 1 69  ? -1.282  -6.821  -1.843  1.00 0.00 ? 223 CYS A CB   1  
ATOM   1042  S  SG   . CYS A 1 69  ? -0.015  -8.002  -1.286  1.00 0.00 ? 223 CYS A SG   1  
ATOM   1043  H  H    . CYS A 1 69  ? -0.593  -5.940  0.521   1.00 0.00 ? 223 CYS A H    1  
ATOM   1044  H  HA   . CYS A 1 69  ? -3.075  -5.871  -1.114  1.00 0.00 ? 223 CYS A HA   1  
ATOM   1045  H  HB2  . CYS A 1 69  ? -1.821  -7.251  -2.673  1.00 0.00 ? 223 CYS A HB2  1  
ATOM   1046  H  HB3  . CYS A 1 69  ? -0.801  -5.910  -2.170  1.00 0.00 ? 223 CYS A HB3  1  
ATOM   1047  N  N    . ALA A 1 70  ? -2.492  -8.162  1.117   1.00 0.00 ? 224 ALA A N    1  
ATOM   1048  C  CA   . ALA A 1 70  ? -3.069  -9.395  1.752   1.00 0.00 ? 224 ALA A CA   1  
ATOM   1049  C  C    . ALA A 1 70  ? -2.759  -10.621 0.883   1.00 0.00 ? 224 ALA A C    1  
ATOM   1050  O  O    . ALA A 1 70  ? -3.654  -11.317 0.443   1.00 0.00 ? 224 ALA A O    1  
ATOM   1051  C  CB   . ALA A 1 70  ? -4.586  -9.160  1.857   1.00 0.00 ? 224 ALA A CB   1  
ATOM   1052  H  H    . ALA A 1 70  ? -1.807  -7.664  1.603   1.00 0.00 ? 224 ALA A H    1  
ATOM   1053  H  HA   . ALA A 1 70  ? -2.652  -9.529  2.738   1.00 0.00 ? 224 ALA A HA   1  
ATOM   1054  H  HB1  . ALA A 1 70  ? -4.773  -8.157  2.215   1.00 0.00 ? 224 ALA A HB1  1  
ATOM   1055  H  HB2  . ALA A 1 70  ? -5.012  -9.872  2.548   1.00 0.00 ? 224 ALA A HB2  1  
ATOM   1056  H  HB3  . ALA A 1 70  ? -5.040  -9.286  0.885   1.00 0.00 ? 224 ALA A HB3  1  
ATOM   1057  N  N    . GLU A 1 71  ? -1.494  -10.891 0.633   1.00 0.00 ? 225 GLU A N    1  
ATOM   1058  C  CA   . GLU A 1 71  ? -1.134  -12.071 -0.210  1.00 0.00 ? 225 GLU A CA   1  
ATOM   1059  C  C    . GLU A 1 71  ? -0.286  -13.070 0.593   1.00 0.00 ? 225 GLU A C    1  
ATOM   1060  O  O    . GLU A 1 71  ? -0.727  -14.167 0.881   1.00 0.00 ? 225 GLU A O    1  
ATOM   1061  C  CB   . GLU A 1 71  ? -0.336  -11.493 -1.381  1.00 0.00 ? 225 GLU A CB   1  
ATOM   1062  C  CG   . GLU A 1 71  ? -1.278  -10.727 -2.313  1.00 0.00 ? 225 GLU A CG   1  
ATOM   1063  C  CD   . GLU A 1 71  ? -1.997  -11.713 -3.235  1.00 0.00 ? 225 GLU A CD   1  
ATOM   1064  O  OE1  . GLU A 1 71  ? -1.341  -12.272 -4.099  1.00 0.00 ? 225 GLU A OE1  1  
ATOM   1065  O  OE2  . GLU A 1 71  ? -3.192  -11.892 -3.063  1.00 0.00 ? 225 GLU A OE2  1  
ATOM   1066  H  H    . GLU A 1 71  ? -0.781  -10.317 1.000   1.00 0.00 ? 225 GLU A H    1  
ATOM   1067  H  HA   . GLU A 1 71  ? -2.022  -12.551 -0.576  1.00 0.00 ? 225 GLU A HA   1  
ATOM   1068  H  HB2  . GLU A 1 71  ? 0.422   -10.821 -1.003  1.00 0.00 ? 225 GLU A HB2  1  
ATOM   1069  H  HB3  . GLU A 1 71  ? 0.134   -12.296 -1.928  1.00 0.00 ? 225 GLU A HB3  1  
ATOM   1070  H  HG2  . GLU A 1 71  ? -2.006  -10.186 -1.725  1.00 0.00 ? 225 GLU A HG2  1  
ATOM   1071  H  HG3  . GLU A 1 71  ? -0.708  -10.030 -2.909  1.00 0.00 ? 225 GLU A HG3  1  
ATOM   1072  N  N    . GLY A 1 72  ? 0.924   -12.705 0.960   1.00 0.00 ? 226 GLY A N    1  
ATOM   1073  C  CA   . GLY A 1 72  ? 1.785   -13.642 1.744   1.00 0.00 ? 226 GLY A CA   1  
ATOM   1074  C  C    . GLY A 1 72  ? 2.953   -14.129 0.872   1.00 0.00 ? 226 GLY A C    1  
ATOM   1075  O  O    . GLY A 1 72  ? 3.231   -13.561 -0.168  1.00 0.00 ? 226 GLY A O    1  
ATOM   1076  H  H    . GLY A 1 72  ? 1.265   -11.817 0.723   1.00 0.00 ? 226 GLY A H    1  
ATOM   1077  H  HA2  . GLY A 1 72  ? 2.174   -13.129 2.613   1.00 0.00 ? 226 GLY A HA2  1  
ATOM   1078  H  HA3  . GLY A 1 72  ? 1.199   -14.491 2.060   1.00 0.00 ? 226 GLY A HA3  1  
ATOM   1079  N  N    . GLY A 1 73  ? 3.641   -15.177 1.283   1.00 0.00 ? 227 GLY A N    1  
ATOM   1080  C  CA   . GLY A 1 73  ? 4.786   -15.689 0.471   1.00 0.00 ? 227 GLY A CA   1  
ATOM   1081  C  C    . GLY A 1 73  ? 5.952   -14.693 0.546   1.00 0.00 ? 227 GLY A C    1  
ATOM   1082  O  O    . GLY A 1 73  ? 5.852   -13.584 0.058   1.00 0.00 ? 227 GLY A O    1  
ATOM   1083  H  H    . GLY A 1 73  ? 3.407   -15.627 2.125   1.00 0.00 ? 227 GLY A H    1  
ATOM   1084  H  HA2  . GLY A 1 73  ? 5.102   -16.647 0.860   1.00 0.00 ? 227 GLY A HA2  1  
ATOM   1085  H  HA3  . GLY A 1 73  ? 4.478   -15.801 -0.557  1.00 0.00 ? 227 GLY A HA3  1  
ATOM   1086  N  N    . ASN A 1 74  ? 7.064   -15.071 1.157   1.00 0.00 ? 228 ASN A N    1  
ATOM   1087  C  CA   . ASN A 1 74  ? 8.233   -14.133 1.261   1.00 0.00 ? 228 ASN A CA   1  
ATOM   1088  C  C    . ASN A 1 74  ? 7.788   -12.784 1.848   1.00 0.00 ? 228 ASN A C    1  
ATOM   1089  O  O    . ASN A 1 74  ? 7.461   -11.868 1.115   1.00 0.00 ? 228 ASN A O    1  
ATOM   1090  C  CB   . ASN A 1 74  ? 8.737   -13.953 -0.174  1.00 0.00 ? 228 ASN A CB   1  
ATOM   1091  C  CG   . ASN A 1 74  ? 10.203  -13.500 -0.149  1.00 0.00 ? 228 ASN A CG   1  
ATOM   1092  O  OD1  . ASN A 1 74  ? 10.480  -12.318 -0.104  1.00 0.00 ? 228 ASN A OD1  1  
ATOM   1093  N  ND2  . ASN A 1 74  ? 11.163  -14.392 -0.175  1.00 0.00 ? 228 ASN A ND2  1  
ATOM   1094  H  H    . ASN A 1 74  ? 7.131   -15.970 1.550   1.00 0.00 ? 228 ASN A H    1  
ATOM   1095  H  HA   . ASN A 1 74  ? 9.009   -14.567 1.869   1.00 0.00 ? 228 ASN A HA   1  
ATOM   1096  H  HB2  . ASN A 1 74  ? 8.658   -14.891 -0.704  1.00 0.00 ? 228 ASN A HB2  1  
ATOM   1097  H  HB3  . ASN A 1 74  ? 8.141   -13.205 -0.674  1.00 0.00 ? 228 ASN A HB3  1  
ATOM   1098  H  HD21 . ASN A 1 74  ? 10.952  -15.350 -0.210  1.00 0.00 ? 228 ASN A HD21 1  
ATOM   1099  H  HD22 . ASN A 1 74  ? 12.099  -14.101 -0.158  1.00 0.00 ? 228 ASN A HD22 1  
ATOM   1100  N  N    . LEU A 1 75  ? 7.760   -12.651 3.160   1.00 0.00 ? 229 LEU A N    1  
ATOM   1101  C  CA   . LEU A 1 75  ? 7.320   -11.355 3.761   1.00 0.00 ? 229 LEU A CA   1  
ATOM   1102  C  C    . LEU A 1 75  ? 8.406   -10.780 4.686   1.00 0.00 ? 229 LEU A C    1  
ATOM   1103  O  O    . LEU A 1 75  ? 9.390   -11.433 4.976   1.00 0.00 ? 229 LEU A O    1  
ATOM   1104  C  CB   . LEU A 1 75  ? 6.062   -11.681 4.579   1.00 0.00 ? 229 LEU A CB   1  
ATOM   1105  C  CG   . LEU A 1 75  ? 5.005   -12.369 3.704   1.00 0.00 ? 229 LEU A CG   1  
ATOM   1106  C  CD1  . LEU A 1 75  ? 3.773   -12.699 4.556   1.00 0.00 ? 229 LEU A CD1  1  
ATOM   1107  C  CD2  . LEU A 1 75  ? 4.593   -11.438 2.560   1.00 0.00 ? 229 LEU A CD2  1  
ATOM   1108  H  H    . LEU A 1 75  ? 8.018   -13.397 3.745   1.00 0.00 ? 229 LEU A H    1  
ATOM   1109  H  HA   . LEU A 1 75  ? 7.081   -10.652 2.983   1.00 0.00 ? 229 LEU A HA   1  
ATOM   1110  H  HB2  . LEU A 1 75  ? 6.328   -12.336 5.395   1.00 0.00 ? 229 LEU A HB2  1  
ATOM   1111  H  HB3  . LEU A 1 75  ? 5.650   -10.766 4.979   1.00 0.00 ? 229 LEU A HB3  1  
ATOM   1112  H  HG   . LEU A 1 75  ? 5.416   -13.282 3.298   1.00 0.00 ? 229 LEU A HG   1  
ATOM   1113  H  HD11 . LEU A 1 75  ? 3.399   -13.674 4.282   1.00 0.00 ? 229 LEU A HD11 1  
ATOM   1114  H  HD12 . LEU A 1 75  ? 3.004   -11.958 4.386   1.00 0.00 ? 229 LEU A HD12 1  
ATOM   1115  H  HD13 . LEU A 1 75  ? 4.045   -12.699 5.602   1.00 0.00 ? 229 LEU A HD13 1  
ATOM   1116  H  HD21 . LEU A 1 75  ? 3.624   -11.736 2.186   1.00 0.00 ? 229 LEU A HD21 1  
ATOM   1117  H  HD22 . LEU A 1 75  ? 5.321   -11.501 1.764   1.00 0.00 ? 229 LEU A HD22 1  
ATOM   1118  H  HD23 . LEU A 1 75  ? 4.543   -10.423 2.922   1.00 0.00 ? 229 LEU A HD23 1  
ATOM   1119  N  N    . ILE A 1 76  ? 8.225   -9.563  5.162   1.00 0.00 ? 230 ILE A N    1  
ATOM   1120  C  CA   . ILE A 1 76  ? 9.233   -8.952  6.079   1.00 0.00 ? 230 ILE A CA   1  
ATOM   1121  C  C    . ILE A 1 76  ? 8.565   -8.610  7.416   1.00 0.00 ? 230 ILE A C    1  
ATOM   1122  O  O    . ILE A 1 76  ? 7.935   -7.577  7.545   1.00 0.00 ? 230 ILE A O    1  
ATOM   1123  C  CB   . ILE A 1 76  ? 9.700   -7.675  5.371   1.00 0.00 ? 230 ILE A CB   1  
ATOM   1124  C  CG1  . ILE A 1 76  ? 10.424  -8.052  4.076   1.00 0.00 ? 230 ILE A CG1  1  
ATOM   1125  C  CG2  . ILE A 1 76  ? 10.657  -6.881  6.276   1.00 0.00 ? 230 ILE A CG2  1  
ATOM   1126  C  CD1  . ILE A 1 76  ? 10.778  -6.784  3.298   1.00 0.00 ? 230 ILE A CD1  1  
ATOM   1127  H  H    . ILE A 1 76  ? 7.419   -9.052  4.926   1.00 0.00 ? 230 ILE A H    1  
ATOM   1128  H  HA   . ILE A 1 76  ? 10.065  -9.621  6.230   1.00 0.00 ? 230 ILE A HA   1  
ATOM   1129  H  HB   . ILE A 1 76  ? 8.841   -7.063  5.136   1.00 0.00 ? 230 ILE A HB   1  
ATOM   1130  H  HG12 . ILE A 1 76  ? 11.328  -8.593  4.315   1.00 0.00 ? 230 ILE A HG12 1  
ATOM   1131  H  HG13 . ILE A 1 76  ? 9.781   -8.674  3.473   1.00 0.00 ? 230 ILE A HG13 1  
ATOM   1132  H  HG21 . ILE A 1 76  ? 10.149  -6.613  7.193   1.00 0.00 ? 230 ILE A HG21 1  
ATOM   1133  H  HG22 . ILE A 1 76  ? 10.973  -5.982  5.767   1.00 0.00 ? 230 ILE A HG22 1  
ATOM   1134  H  HG23 . ILE A 1 76  ? 11.521  -7.486  6.507   1.00 0.00 ? 230 ILE A HG23 1  
ATOM   1135  H  HD11 . ILE A 1 76  ? 10.550  -6.928  2.252   1.00 0.00 ? 230 ILE A HD11 1  
ATOM   1136  H  HD12 . ILE A 1 76  ? 11.832  -6.576  3.412   1.00 0.00 ? 230 ILE A HD12 1  
ATOM   1137  H  HD13 . ILE A 1 76  ? 10.203  -5.951  3.680   1.00 0.00 ? 230 ILE A HD13 1  
ATOM   1138  N  N    . CYS A 1 77  ? 8.696   -9.459  8.414   1.00 0.00 ? 231 CYS A N    1  
ATOM   1139  C  CA   . CYS A 1 77  ? 8.054   -9.145  9.741   1.00 0.00 ? 231 CYS A CA   1  
ATOM   1140  C  C    . CYS A 1 77  ? 8.580   -7.802  10.268  1.00 0.00 ? 231 CYS A C    1  
ATOM   1141  O  O    . CYS A 1 77  ? 9.686   -7.402  9.957   1.00 0.00 ? 231 CYS A O    1  
ATOM   1142  C  CB   . CYS A 1 77  ? 8.437   -10.281 10.701  1.00 0.00 ? 231 CYS A CB   1  
ATOM   1143  S  SG   . CYS A 1 77  ? 7.388   -11.721 10.381  1.00 0.00 ? 231 CYS A SG   1  
ATOM   1144  H  H    . CYS A 1 77  ? 9.215   -10.289 8.290   1.00 0.00 ? 231 CYS A H    1  
ATOM   1145  H  HA   . CYS A 1 77  ? 6.979   -9.099  9.631   1.00 0.00 ? 231 CYS A HA   1  
ATOM   1146  H  HB2  . CYS A 1 77  ? 9.473   -10.548 10.546  1.00 0.00 ? 231 CYS A HB2  1  
ATOM   1147  H  HB3  . CYS A 1 77  ? 8.298   -9.953  11.721  1.00 0.00 ? 231 CYS A HB3  1  
ATOM   1148  H  HG   . CYS A 1 77  ? 7.344   -11.852 9.431   1.00 0.00 ? 231 CYS A HG   1  
ATOM   1149  N  N    . CYS A 1 78  ? 7.794   -7.099  11.052  1.00 0.00 ? 232 CYS A N    1  
ATOM   1150  C  CA   . CYS A 1 78  ? 8.256   -5.777  11.580  1.00 0.00 ? 232 CYS A CA   1  
ATOM   1151  C  C    . CYS A 1 78  ? 8.625   -5.887  13.066  1.00 0.00 ? 232 CYS A C    1  
ATOM   1152  O  O    . CYS A 1 78  ? 8.089   -6.712  13.783  1.00 0.00 ? 232 CYS A O    1  
ATOM   1153  C  CB   . CYS A 1 78  ? 7.065   -4.827  11.390  1.00 0.00 ? 232 CYS A CB   1  
ATOM   1154  S  SG   . CYS A 1 78  ? 7.504   -3.164  11.961  1.00 0.00 ? 232 CYS A SG   1  
ATOM   1155  H  H    . CYS A 1 78  ? 6.898   -7.436  11.287  1.00 0.00 ? 232 CYS A H    1  
ATOM   1156  H  HA   . CYS A 1 78  ? 9.100   -5.422  11.011  1.00 0.00 ? 232 CYS A HA   1  
ATOM   1157  H  HB2  . CYS A 1 78  ? 6.801   -4.789  10.344  1.00 0.00 ? 232 CYS A HB2  1  
ATOM   1158  H  HB3  . CYS A 1 78  ? 6.223   -5.191  11.959  1.00 0.00 ? 232 CYS A HB3  1  
ATOM   1159  N  N    . ASP A 1 79  ? 9.524   -5.047  13.538  1.00 0.00 ? 233 ASP A N    1  
ATOM   1160  C  CA   . ASP A 1 79  ? 9.904   -5.095  14.983  1.00 0.00 ? 233 ASP A CA   1  
ATOM   1161  C  C    . ASP A 1 79  ? 9.306   -3.881  15.711  1.00 0.00 ? 233 ASP A C    1  
ATOM   1162  O  O    . ASP A 1 79  ? 9.946   -3.287  16.559  1.00 0.00 ? 233 ASP A O    1  
ATOM   1163  C  CB   . ASP A 1 79  ? 11.435  -5.042  15.009  1.00 0.00 ? 233 ASP A CB   1  
ATOM   1164  C  CG   . ASP A 1 79  ? 11.934  -5.388  16.413  1.00 0.00 ? 233 ASP A CG   1  
ATOM   1165  O  OD1  . ASP A 1 79  ? 11.454  -6.362  16.968  1.00 0.00 ? 233 ASP A OD1  1  
ATOM   1166  O  OD2  . ASP A 1 79  ? 12.788  -4.671  16.910  1.00 0.00 ? 233 ASP A OD2  1  
ATOM   1167  H  H    . ASP A 1 79  ? 9.936   -4.373  12.945  1.00 0.00 ? 233 ASP A H    1  
ATOM   1168  H  HA   . ASP A 1 79  ? 9.557   -6.013  15.433  1.00 0.00 ? 233 ASP A HA   1  
ATOM   1169  H  HB2  . ASP A 1 79  ? 11.832  -5.755  14.300  1.00 0.00 ? 233 ASP A HB2  1  
ATOM   1170  H  HB3  . ASP A 1 79  ? 11.766  -4.049  14.746  1.00 0.00 ? 233 ASP A HB3  1  
ATOM   1171  N  N    . PHE A 1 80  ? 8.084   -3.502  15.385  1.00 0.00 ? 234 PHE A N    1  
ATOM   1172  C  CA   . PHE A 1 80  ? 7.458   -2.323  16.058  1.00 0.00 ? 234 PHE A CA   1  
ATOM   1173  C  C    . PHE A 1 80  ? 5.930   -2.494  16.133  1.00 0.00 ? 234 PHE A C    1  
ATOM   1174  O  O    . PHE A 1 80  ? 5.361   -2.522  17.208  1.00 0.00 ? 234 PHE A O    1  
ATOM   1175  C  CB   . PHE A 1 80  ? 7.815   -1.128  15.172  1.00 0.00 ? 234 PHE A CB   1  
ATOM   1176  C  CG   . PHE A 1 80  ? 9.212   -0.641  15.487  1.00 0.00 ? 234 PHE A CG   1  
ATOM   1177  C  CD1  . PHE A 1 80  ? 9.598   -0.399  16.813  1.00 0.00 ? 234 PHE A CD1  1  
ATOM   1178  C  CD2  . PHE A 1 80  ? 10.122  -0.423  14.445  1.00 0.00 ? 234 PHE A CD2  1  
ATOM   1179  C  CE1  . PHE A 1 80  ? 10.891  0.059   17.093  1.00 0.00 ? 234 PHE A CE1  1  
ATOM   1180  C  CE2  . PHE A 1 80  ? 11.413  0.033   14.726  1.00 0.00 ? 234 PHE A CE2  1  
ATOM   1181  C  CZ   . PHE A 1 80  ? 11.798  0.276   16.050  1.00 0.00 ? 234 PHE A CZ   1  
ATOM   1182  H  H    . PHE A 1 80  ? 7.579   -3.989  14.695  1.00 0.00 ? 234 PHE A H    1  
ATOM   1183  H  HA   . PHE A 1 80  ? 7.872   -2.188  17.045  1.00 0.00 ? 234 PHE A HA   1  
ATOM   1184  H  HB2  . PHE A 1 80  ? 7.766   -1.426  14.136  1.00 0.00 ? 234 PHE A HB2  1  
ATOM   1185  H  HB3  . PHE A 1 80  ? 7.109   -0.329  15.348  1.00 0.00 ? 234 PHE A HB3  1  
ATOM   1186  H  HD1  . PHE A 1 80  ? 8.898   -0.566  17.618  1.00 0.00 ? 234 PHE A HD1  1  
ATOM   1187  H  HD2  . PHE A 1 80  ? 9.828   -0.610  13.423  1.00 0.00 ? 234 PHE A HD2  1  
ATOM   1188  H  HE1  . PHE A 1 80  ? 11.188  0.246   18.115  1.00 0.00 ? 234 PHE A HE1  1  
ATOM   1189  H  HE2  . PHE A 1 80  ? 12.111  0.203   13.920  1.00 0.00 ? 234 PHE A HE2  1  
ATOM   1190  H  HZ   . PHE A 1 80  ? 12.796  0.629   16.266  1.00 0.00 ? 234 PHE A HZ   1  
ATOM   1191  N  N    . CYS A 1 81  ? 5.259   -2.605  15.001  1.00 0.00 ? 235 CYS A N    1  
ATOM   1192  C  CA   . CYS A 1 81  ? 3.762   -2.771  15.037  1.00 0.00 ? 235 CYS A CA   1  
ATOM   1193  C  C    . CYS A 1 81  ? 3.337   -4.257  14.942  1.00 0.00 ? 235 CYS A C    1  
ATOM   1194  O  O    . CYS A 1 81  ? 2.198   -4.544  14.627  1.00 0.00 ? 235 CYS A O    1  
ATOM   1195  C  CB   . CYS A 1 81  ? 3.211   -1.962  13.841  1.00 0.00 ? 235 CYS A CB   1  
ATOM   1196  S  SG   . CYS A 1 81  ? 3.716   -2.703  12.258  1.00 0.00 ? 235 CYS A SG   1  
ATOM   1197  H  H    . CYS A 1 81  ? 5.736   -2.580  14.140  1.00 0.00 ? 235 CYS A H    1  
ATOM   1198  H  HA   . CYS A 1 81  ? 3.379   -2.349  15.952  1.00 0.00 ? 235 CYS A HA   1  
ATOM   1199  H  HB2  . CYS A 1 81  ? 2.133   -1.944  13.893  1.00 0.00 ? 235 CYS A HB2  1  
ATOM   1200  H  HB3  . CYS A 1 81  ? 3.584   -0.950  13.897  1.00 0.00 ? 235 CYS A HB3  1  
ATOM   1201  N  N    . HIS A 1 82  ? 4.221   -5.205  15.218  1.00 0.00 ? 236 HIS A N    1  
ATOM   1202  C  CA   . HIS A 1 82  ? 3.833   -6.655  15.145  1.00 0.00 ? 236 HIS A CA   1  
ATOM   1203  C  C    . HIS A 1 82  ? 3.122   -6.981  13.814  1.00 0.00 ? 236 HIS A C    1  
ATOM   1204  O  O    . HIS A 1 82  ? 1.947   -7.297  13.798  1.00 0.00 ? 236 HIS A O    1  
ATOM   1205  C  CB   . HIS A 1 82  ? 2.884   -6.869  16.327  1.00 0.00 ? 236 HIS A CB   1  
ATOM   1206  C  CG   . HIS A 1 82  ? 3.011   -8.284  16.821  1.00 0.00 ? 236 HIS A CG   1  
ATOM   1207  N  ND1  . HIS A 1 82  ? 4.222   -8.817  17.233  1.00 0.00 ? 236 HIS A ND1  1  
ATOM   1208  C  CD2  . HIS A 1 82  ? 2.087   -9.288  16.975  1.00 0.00 ? 236 HIS A CD2  1  
ATOM   1209  C  CE1  . HIS A 1 82  ? 3.998   -10.089 17.610  1.00 0.00 ? 236 HIS A CE1  1  
ATOM   1210  N  NE2  . HIS A 1 82  ? 2.713   -10.428 17.473  1.00 0.00 ? 236 HIS A NE2  1  
ATOM   1211  H  H    . HIS A 1 82  ? 5.134   -4.972  15.482  1.00 0.00 ? 236 HIS A H    1  
ATOM   1212  H  HA   . HIS A 1 82  ? 4.705   -7.279  15.263  1.00 0.00 ? 236 HIS A HA   1  
ATOM   1213  H  HB2  . HIS A 1 82  ? 3.139   -6.185  17.123  1.00 0.00 ? 236 HIS A HB2  1  
ATOM   1214  H  HB3  . HIS A 1 82  ? 1.867   -6.689  16.010  1.00 0.00 ? 236 HIS A HB3  1  
ATOM   1215  H  HD1  . HIS A 1 82  ? 5.084   -8.352  17.247  1.00 0.00 ? 236 HIS A HD1  1  
ATOM   1216  H  HD2  . HIS A 1 82  ? 1.035   -9.207  16.744  1.00 0.00 ? 236 HIS A HD2  1  
ATOM   1217  H  HE1  . HIS A 1 82  ? 4.763   -10.756 17.978  1.00 0.00 ? 236 HIS A HE1  1  
ATOM   1218  N  N    . ASN A 1 83  ? 3.821   -6.905  12.699  1.00 0.00 ? 237 ASN A N    1  
ATOM   1219  C  CA   . ASN A 1 83  ? 3.167   -7.212  11.385  1.00 0.00 ? 237 ASN A CA   1  
ATOM   1220  C  C    . ASN A 1 83  ? 4.222   -7.608  10.335  1.00 0.00 ? 237 ASN A C    1  
ATOM   1221  O  O    . ASN A 1 83  ? 5.362   -7.861  10.671  1.00 0.00 ? 237 ASN A O    1  
ATOM   1222  C  CB   . ASN A 1 83  ? 2.460   -5.912  10.980  1.00 0.00 ? 237 ASN A CB   1  
ATOM   1223  C  CG   . ASN A 1 83  ? 0.938   -6.101  11.059  1.00 0.00 ? 237 ASN A CG   1  
ATOM   1224  O  OD1  . ASN A 1 83  ? 0.388   -6.944  10.379  1.00 0.00 ? 237 ASN A OD1  1  
ATOM   1225  N  ND2  . ASN A 1 83  ? 0.228   -5.351  11.866  1.00 0.00 ? 237 ASN A ND2  1  
ATOM   1226  H  H    . ASN A 1 83  ? 4.770   -6.645  12.725  1.00 0.00 ? 237 ASN A H    1  
ATOM   1227  H  HA   . ASN A 1 83  ? 2.445   -8.005  11.503  1.00 0.00 ? 237 ASN A HA   1  
ATOM   1228  H  HB2  . ASN A 1 83  ? 2.757   -5.118  11.648  1.00 0.00 ? 237 ASN A HB2  1  
ATOM   1229  H  HB3  . ASN A 1 83  ? 2.734   -5.650  9.969   1.00 0.00 ? 237 ASN A HB3  1  
ATOM   1230  H  HD21 . ASN A 1 83  ? 0.662   -4.666  12.420  1.00 0.00 ? 237 ASN A HD21 1  
ATOM   1231  H  HD22 . ASN A 1 83  ? -0.743  -5.474  11.916  1.00 0.00 ? 237 ASN A HD22 1  
ATOM   1232  N  N    . ALA A 1 84  ? 3.855   -7.668  9.070   1.00 0.00 ? 238 ALA A N    1  
ATOM   1233  C  CA   . ALA A 1 84  ? 4.854   -8.052  8.021   1.00 0.00 ? 238 ALA A CA   1  
ATOM   1234  C  C    . ALA A 1 84  ? 4.345   -7.683  6.613   1.00 0.00 ? 238 ALA A C    1  
ATOM   1235  O  O    . ALA A 1 84  ? 3.163   -7.765  6.340   1.00 0.00 ? 238 ALA A O    1  
ATOM   1236  C  CB   . ALA A 1 84  ? 4.997   -9.569  8.154   1.00 0.00 ? 238 ALA A CB   1  
ATOM   1237  H  H    . ALA A 1 84  ? 2.927   -7.465  8.813   1.00 0.00 ? 238 ALA A H    1  
ATOM   1238  H  HA   . ALA A 1 84  ? 5.805   -7.580  8.216   1.00 0.00 ? 238 ALA A HA   1  
ATOM   1239  H  HB1  . ALA A 1 84  ? 4.794   -9.860  9.175   1.00 0.00 ? 238 ALA A HB1  1  
ATOM   1240  H  HB2  . ALA A 1 84  ? 6.003   -9.860  7.890   1.00 0.00 ? 238 ALA A HB2  1  
ATOM   1241  H  HB3  . ALA A 1 84  ? 4.295   -10.057 7.494   1.00 0.00 ? 238 ALA A HB3  1  
ATOM   1242  N  N    . PHE A 1 85  ? 5.226   -7.289  5.714   1.00 0.00 ? 239 PHE A N    1  
ATOM   1243  C  CA   . PHE A 1 85  ? 4.779   -6.937  4.328   1.00 0.00 ? 239 PHE A CA   1  
ATOM   1244  C  C    . PHE A 1 85  ? 5.321   -7.983  3.344   1.00 0.00 ? 239 PHE A C    1  
ATOM   1245  O  O    . PHE A 1 85  ? 5.979   -8.918  3.752   1.00 0.00 ? 239 PHE A O    1  
ATOM   1246  C  CB   . PHE A 1 85  ? 5.378   -5.557  4.041   1.00 0.00 ? 239 PHE A CB   1  
ATOM   1247  C  CG   . PHE A 1 85  ? 4.469   -4.488  4.600   1.00 0.00 ? 239 PHE A CG   1  
ATOM   1248  C  CD1  . PHE A 1 85  ? 3.374   -4.034  3.851   1.00 0.00 ? 239 PHE A CD1  1  
ATOM   1249  C  CD2  . PHE A 1 85  ? 4.718   -3.954  5.868   1.00 0.00 ? 239 PHE A CD2  1  
ATOM   1250  C  CE1  . PHE A 1 85  ? 2.530   -3.044  4.374   1.00 0.00 ? 239 PHE A CE1  1  
ATOM   1251  C  CE2  . PHE A 1 85  ? 3.873   -2.966  6.391   1.00 0.00 ? 239 PHE A CE2  1  
ATOM   1252  C  CZ   . PHE A 1 85  ? 2.779   -2.510  5.644   1.00 0.00 ? 239 PHE A CZ   1  
ATOM   1253  H  H    . PHE A 1 85  ? 6.180   -7.236  5.946   1.00 0.00 ? 239 PHE A H    1  
ATOM   1254  H  HA   . PHE A 1 85  ? 3.702   -6.893  4.279   1.00 0.00 ? 239 PHE A HA   1  
ATOM   1255  H  HB2  . PHE A 1 85  ? 6.350   -5.483  4.506   1.00 0.00 ? 239 PHE A HB2  1  
ATOM   1256  H  HB3  . PHE A 1 85  ? 5.478   -5.423  2.974   1.00 0.00 ? 239 PHE A HB3  1  
ATOM   1257  H  HD1  . PHE A 1 85  ? 3.182   -4.446  2.872   1.00 0.00 ? 239 PHE A HD1  1  
ATOM   1258  H  HD2  . PHE A 1 85  ? 5.564   -4.304  6.443   1.00 0.00 ? 239 PHE A HD2  1  
ATOM   1259  H  HE1  . PHE A 1 85  ? 1.686   -2.692  3.797   1.00 0.00 ? 239 PHE A HE1  1  
ATOM   1260  H  HE2  . PHE A 1 85  ? 4.066   -2.554  7.369   1.00 0.00 ? 239 PHE A HE2  1  
ATOM   1261  H  HZ   . PHE A 1 85  ? 2.127   -1.748  6.048   1.00 0.00 ? 239 PHE A HZ   1  
ATOM   1262  N  N    . CYS A 1 86  ? 5.057   -7.846  2.057   1.00 0.00 ? 240 CYS A N    1  
ATOM   1263  C  CA   . CYS A 1 86  ? 5.575   -8.857  1.084   1.00 0.00 ? 240 CYS A CA   1  
ATOM   1264  C  C    . CYS A 1 86  ? 6.593   -8.217  0.113   1.00 0.00 ? 240 CYS A C    1  
ATOM   1265  O  O    . CYS A 1 86  ? 6.680   -7.009  0.006   1.00 0.00 ? 240 CYS A O    1  
ATOM   1266  C  CB   . CYS A 1 86  ? 4.325   -9.431  0.367   1.00 0.00 ? 240 CYS A CB   1  
ATOM   1267  S  SG   . CYS A 1 86  ? 3.728   -8.354  -0.972  1.00 0.00 ? 240 CYS A SG   1  
ATOM   1268  H  H    . CYS A 1 86  ? 4.528   -7.088  1.738   1.00 0.00 ? 240 CYS A H    1  
ATOM   1269  H  HA   . CYS A 1 86  ? 6.062   -9.651  1.627   1.00 0.00 ? 240 CYS A HA   1  
ATOM   1270  H  HB2  . CYS A 1 86  ? 4.575   -10.394 -0.051  1.00 0.00 ? 240 CYS A HB2  1  
ATOM   1271  H  HB3  . CYS A 1 86  ? 3.538   -9.562  1.094   1.00 0.00 ? 240 CYS A HB3  1  
ATOM   1272  N  N    . LYS A 1 87  ? 7.371   -9.023  -0.582  1.00 0.00 ? 241 LYS A N    1  
ATOM   1273  C  CA   . LYS A 1 87  ? 8.394   -8.450  -1.535  1.00 0.00 ? 241 LYS A CA   1  
ATOM   1274  C  C    . LYS A 1 87  ? 7.713   -7.740  -2.722  1.00 0.00 ? 241 LYS A C    1  
ATOM   1275  O  O    . LYS A 1 87  ? 8.215   -6.748  -3.216  1.00 0.00 ? 241 LYS A O    1  
ATOM   1276  C  CB   . LYS A 1 87  ? 9.228   -9.640  -2.042  1.00 0.00 ? 241 LYS A CB   1  
ATOM   1277  C  CG   . LYS A 1 87  ? 10.571  -9.139  -2.586  1.00 0.00 ? 241 LYS A CG   1  
ATOM   1278  C  CD   . LYS A 1 87  ? 10.925  -9.899  -3.867  1.00 0.00 ? 241 LYS A CD   1  
ATOM   1279  C  CE   . LYS A 1 87  ? 11.345  -11.328 -3.514  1.00 0.00 ? 241 LYS A CE   1  
ATOM   1280  N  NZ   . LYS A 1 87  ? 11.900  -11.889 -4.778  1.00 0.00 ? 241 LYS A NZ   1  
ATOM   1281  H  H    . LYS A 1 87  ? 7.287   -10.001 -0.470  1.00 0.00 ? 241 LYS A H    1  
ATOM   1282  H  HA   . LYS A 1 87  ? 9.034   -7.758  -1.012  1.00 0.00 ? 241 LYS A HA   1  
ATOM   1283  H  HB2  . LYS A 1 87  ? 9.404   -10.329 -1.227  1.00 0.00 ? 241 LYS A HB2  1  
ATOM   1284  H  HB3  . LYS A 1 87  ? 8.687   -10.147 -2.828  1.00 0.00 ? 241 LYS A HB3  1  
ATOM   1285  H  HG2  . LYS A 1 87  ? 10.502  -8.082  -2.802  1.00 0.00 ? 241 LYS A HG2  1  
ATOM   1286  H  HG3  . LYS A 1 87  ? 11.341  -9.306  -1.849  1.00 0.00 ? 241 LYS A HG3  1  
ATOM   1287  H  HD2  . LYS A 1 87  ? 10.063  -9.927  -4.519  1.00 0.00 ? 241 LYS A HD2  1  
ATOM   1288  H  HD3  . LYS A 1 87  ? 11.740  -9.400  -4.369  1.00 0.00 ? 241 LYS A HD3  1  
ATOM   1289  H  HE2  . LYS A 1 87  ? 12.101  -11.316 -2.741  1.00 0.00 ? 241 LYS A HE2  1  
ATOM   1290  H  HE3  . LYS A 1 87  ? 10.490  -11.905 -3.198  1.00 0.00 ? 241 LYS A HE3  1  
ATOM   1291  H  HZ1  . LYS A 1 87  ? 12.161  -12.884 -4.630  1.00 0.00 ? 241 LYS A HZ1  1  
ATOM   1292  H  HZ2  . LYS A 1 87  ? 12.743  -11.346 -5.057  1.00 0.00 ? 241 LYS A HZ2  1  
ATOM   1293  H  HZ3  . LYS A 1 87  ? 11.184  -11.829 -5.528  1.00 0.00 ? 241 LYS A HZ3  1  
ATOM   1294  N  N    . LYS A 1 88  ? 6.587   -8.238  -3.195  1.00 0.00 ? 242 LYS A N    1  
ATOM   1295  C  CA   . LYS A 1 88  ? 5.907   -7.569  -4.369  1.00 0.00 ? 242 LYS A CA   1  
ATOM   1296  C  C    . LYS A 1 88  ? 5.458   -6.129  -4.036  1.00 0.00 ? 242 LYS A C    1  
ATOM   1297  O  O    . LYS A 1 88  ? 5.265   -5.327  -4.933  1.00 0.00 ? 242 LYS A O    1  
ATOM   1298  C  CB   . LYS A 1 88  ? 4.680   -8.428  -4.713  1.00 0.00 ? 242 LYS A CB   1  
ATOM   1299  C  CG   . LYS A 1 88  ? 5.123   -9.656  -5.511  1.00 0.00 ? 242 LYS A CG   1  
ATOM   1300  C  CD   . LYS A 1 88  ? 4.227   -10.845 -5.159  1.00 0.00 ? 242 LYS A CD   1  
ATOM   1301  C  CE   . LYS A 1 88  ? 2.957   -10.797 -6.012  1.00 0.00 ? 242 LYS A CE   1  
ATOM   1302  N  NZ   . LYS A 1 88  ? 1.993   -11.693 -5.315  1.00 0.00 ? 242 LYS A NZ   1  
ATOM   1303  H  H    . LYS A 1 88  ? 6.199   -9.047  -2.788  1.00 0.00 ? 242 LYS A H    1  
ATOM   1304  H  HA   . LYS A 1 88  ? 6.576   -7.551  -5.213  1.00 0.00 ? 242 LYS A HA   1  
ATOM   1305  H  HB2  . LYS A 1 88  ? 4.197   -8.747  -3.800  1.00 0.00 ? 242 LYS A HB2  1  
ATOM   1306  H  HB3  . LYS A 1 88  ? 3.987   -7.848  -5.303  1.00 0.00 ? 242 LYS A HB3  1  
ATOM   1307  H  HG2  . LYS A 1 88  ? 5.045   -9.445  -6.568  1.00 0.00 ? 242 LYS A HG2  1  
ATOM   1308  H  HG3  . LYS A 1 88  ? 6.147   -9.894  -5.266  1.00 0.00 ? 242 LYS A HG3  1  
ATOM   1309  H  HD2  . LYS A 1 88  ? 4.758   -11.765 -5.353  1.00 0.00 ? 242 LYS A HD2  1  
ATOM   1310  H  HD3  . LYS A 1 88  ? 3.958   -10.796 -4.115  1.00 0.00 ? 242 LYS A HD3  1  
ATOM   1311  H  HE2  . LYS A 1 88  ? 2.573   -9.787  -6.056  1.00 0.00 ? 242 LYS A HE2  1  
ATOM   1312  H  HE3  . LYS A 1 88  ? 3.156   -11.169 -7.005  1.00 0.00 ? 242 LYS A HE3  1  
ATOM   1313  H  HZ1  . LYS A 1 88  ? 2.445   -12.610 -5.127  1.00 0.00 ? 242 LYS A HZ1  1  
ATOM   1314  H  HZ2  . LYS A 1 88  ? 1.155   -11.835 -5.917  1.00 0.00 ? 242 LYS A HZ2  1  
ATOM   1315  H  HZ3  . LYS A 1 88  ? 1.705   -11.260 -4.416  1.00 0.00 ? 242 LYS A HZ3  1  
ATOM   1316  N  N    . CYS A 1 89  ? 5.289   -5.781  -2.774  1.00 0.00 ? 243 CYS A N    1  
ATOM   1317  C  CA   . CYS A 1 89  ? 4.849   -4.381  -2.443  1.00 0.00 ? 243 CYS A CA   1  
ATOM   1318  C  C    . CYS A 1 89  ? 6.073   -3.466  -2.320  1.00 0.00 ? 243 CYS A C    1  
ATOM   1319  O  O    . CYS A 1 89  ? 6.054   -2.343  -2.791  1.00 0.00 ? 243 CYS A O    1  
ATOM   1320  C  CB   . CYS A 1 89  ? 4.088   -4.465  -1.107  1.00 0.00 ? 243 CYS A CB   1  
ATOM   1321  S  SG   . CYS A 1 89  ? 2.367   -4.956  -1.409  1.00 0.00 ? 243 CYS A SG   1  
ATOM   1322  H  H    . CYS A 1 89  ? 5.455   -6.426  -2.056  1.00 0.00 ? 243 CYS A H    1  
ATOM   1323  H  HA   . CYS A 1 89  ? 4.194   -4.011  -3.217  1.00 0.00 ? 243 CYS A HA   1  
ATOM   1324  H  HB2  . CYS A 1 89  ? 4.563   -5.196  -0.469  1.00 0.00 ? 243 CYS A HB2  1  
ATOM   1325  H  HB3  . CYS A 1 89  ? 4.107   -3.500  -0.622  1.00 0.00 ? 243 CYS A HB3  1  
ATOM   1326  N  N    . ILE A 1 90  ? 7.149   -3.935  -1.718  1.00 0.00 ? 244 ILE A N    1  
ATOM   1327  C  CA   . ILE A 1 90  ? 8.371   -3.063  -1.615  1.00 0.00 ? 244 ILE A CA   1  
ATOM   1328  C  C    . ILE A 1 90  ? 9.015   -2.942  -3.005  1.00 0.00 ? 244 ILE A C    1  
ATOM   1329  O  O    . ILE A 1 90  ? 9.475   -1.880  -3.380  1.00 0.00 ? 244 ILE A O    1  
ATOM   1330  C  CB   . ILE A 1 90  ? 9.321   -3.740  -0.616  1.00 0.00 ? 244 ILE A CB   1  
ATOM   1331  C  CG1  . ILE A 1 90  ? 8.640   -3.788  0.753   1.00 0.00 ? 244 ILE A CG1  1  
ATOM   1332  C  CG2  . ILE A 1 90  ? 10.621  -2.936  -0.508  1.00 0.00 ? 244 ILE A CG2  1  
ATOM   1333  C  CD1  . ILE A 1 90  ? 9.511   -4.570  1.734   1.00 0.00 ? 244 ILE A CD1  1  
ATOM   1334  H  H    . ILE A 1 90  ? 7.156   -4.855  -1.362  1.00 0.00 ? 244 ILE A H    1  
ATOM   1335  H  HA   . ILE A 1 90  ? 8.094   -2.085  -1.252  1.00 0.00 ? 244 ILE A HA   1  
ATOM   1336  H  HB   . ILE A 1 90  ? 9.541   -4.744  -0.948  1.00 0.00 ? 244 ILE A HB   1  
ATOM   1337  H  HG12 . ILE A 1 90  ? 8.500   -2.780  1.118   1.00 0.00 ? 244 ILE A HG12 1  
ATOM   1338  H  HG13 . ILE A 1 90  ? 7.680   -4.272  0.660   1.00 0.00 ? 244 ILE A HG13 1  
ATOM   1339  H  HG21 . ILE A 1 90  ? 10.387  -1.888  -0.392  1.00 0.00 ? 244 ILE A HG21 1  
ATOM   1340  H  HG22 . ILE A 1 90  ? 11.208  -3.077  -1.404  1.00 0.00 ? 244 ILE A HG22 1  
ATOM   1341  H  HG23 . ILE A 1 90  ? 11.185  -3.276  0.348   1.00 0.00 ? 244 ILE A HG23 1  
ATOM   1342  H  HD11 . ILE A 1 90  ? 8.880   -5.095  2.437   1.00 0.00 ? 244 ILE A HD11 1  
ATOM   1343  H  HD12 . ILE A 1 90  ? 10.154  -3.887  2.269   1.00 0.00 ? 244 ILE A HD12 1  
ATOM   1344  H  HD13 . ILE A 1 90  ? 10.114  -5.282  1.192   1.00 0.00 ? 244 ILE A HD13 1  
ATOM   1345  N  N    . LEU A 1 91  ? 9.029   -4.007  -3.789  1.00 0.00 ? 245 LEU A N    1  
ATOM   1346  C  CA   . LEU A 1 91  ? 9.624   -3.905  -5.170  1.00 0.00 ? 245 LEU A CA   1  
ATOM   1347  C  C    . LEU A 1 91  ? 8.890   -2.806  -5.965  1.00 0.00 ? 245 LEU A C    1  
ATOM   1348  O  O    . LEU A 1 91  ? 9.505   -2.063  -6.707  1.00 0.00 ? 245 LEU A O    1  
ATOM   1349  C  CB   . LEU A 1 91  ? 9.430   -5.279  -5.843  1.00 0.00 ? 245 LEU A CB   1  
ATOM   1350  C  CG   . LEU A 1 91  ? 9.959   -5.241  -7.282  1.00 0.00 ? 245 LEU A CG   1  
ATOM   1351  C  CD1  . LEU A 1 91  ? 11.475  -5.045  -7.269  1.00 0.00 ? 245 LEU A CD1  1  
ATOM   1352  C  CD2  . LEU A 1 91  ? 9.623   -6.560  -7.981  1.00 0.00 ? 245 LEU A CD2  1  
ATOM   1353  H  H    . LEU A 1 91  ? 8.638   -4.855  -3.478  1.00 0.00 ? 245 LEU A H    1  
ATOM   1354  H  HA   . LEU A 1 91  ? 10.673  -3.672  -5.100  1.00 0.00 ? 245 LEU A HA   1  
ATOM   1355  H  HB2  . LEU A 1 91  ? 9.969   -6.030  -5.283  1.00 0.00 ? 245 LEU A HB2  1  
ATOM   1356  H  HB3  . LEU A 1 91  ? 8.379   -5.526  -5.855  1.00 0.00 ? 245 LEU A HB3  1  
ATOM   1357  H  HG   . LEU A 1 91  ? 9.495   -4.422  -7.813  1.00 0.00 ? 245 LEU A HG   1  
ATOM   1358  H  HD11 . LEU A 1 91  ? 11.719  -4.153  -6.713  1.00 0.00 ? 245 LEU A HD11 1  
ATOM   1359  H  HD12 . LEU A 1 91  ? 11.833  -4.946  -8.283  1.00 0.00 ? 245 LEU A HD12 1  
ATOM   1360  H  HD13 . LEU A 1 91  ? 11.944  -5.899  -6.804  1.00 0.00 ? 245 LEU A HD13 1  
ATOM   1361  H  HD21 . LEU A 1 91  ? 9.948   -6.515  -9.010  1.00 0.00 ? 245 LEU A HD21 1  
ATOM   1362  H  HD22 . LEU A 1 91  ? 8.556   -6.725  -7.948  1.00 0.00 ? 245 LEU A HD22 1  
ATOM   1363  H  HD23 . LEU A 1 91  ? 10.128  -7.372  -7.480  1.00 0.00 ? 245 LEU A HD23 1  
ATOM   1364  N  N    . ARG A 1 92  ? 7.582   -2.684  -5.805  1.00 0.00 ? 246 ARG A N    1  
ATOM   1365  C  CA   . ARG A 1 92  ? 6.842   -1.607  -6.554  1.00 0.00 ? 246 ARG A CA   1  
ATOM   1366  C  C    . ARG A 1 92  ? 6.968   -0.239  -5.843  1.00 0.00 ? 246 ARG A C    1  
ATOM   1367  O  O    . ARG A 1 92  ? 6.707   0.786   -6.444  1.00 0.00 ? 246 ARG A O    1  
ATOM   1368  C  CB   . ARG A 1 92  ? 5.369   -2.043  -6.605  1.00 0.00 ? 246 ARG A CB   1  
ATOM   1369  C  CG   . ARG A 1 92  ? 5.149   -2.959  -7.811  1.00 0.00 ? 246 ARG A CG   1  
ATOM   1370  C  CD   . ARG A 1 92  ? 5.103   -2.119  -9.091  1.00 0.00 ? 246 ARG A CD   1  
ATOM   1371  N  NE   . ARG A 1 92  ? 5.901   -2.895  -10.089 1.00 0.00 ? 246 ARG A NE   1  
ATOM   1372  C  CZ   . ARG A 1 92  ? 5.431   -4.009  -10.629 1.00 0.00 ? 246 ARG A CZ   1  
ATOM   1373  N  NH1  . ARG A 1 92  ? 4.244   -4.476  -10.314 1.00 0.00 ? 246 ARG A NH1  1  
ATOM   1374  N  NH2  . ARG A 1 92  ? 6.158   -4.663  -11.497 1.00 0.00 ? 246 ARG A NH2  1  
ATOM   1375  H  H    . ARG A 1 92  ? 7.096   -3.288  -5.186  1.00 0.00 ? 246 ARG A H    1  
ATOM   1376  H  HA   . ARG A 1 92  ? 7.228   -1.531  -7.558  1.00 0.00 ? 246 ARG A HA   1  
ATOM   1377  H  HB2  . ARG A 1 92  ? 5.118   -2.574  -5.698  1.00 0.00 ? 246 ARG A HB2  1  
ATOM   1378  H  HB3  . ARG A 1 92  ? 4.739   -1.172  -6.698  1.00 0.00 ? 246 ARG A HB3  1  
ATOM   1379  H  HG2  . ARG A 1 92  ? 5.960   -3.670  -7.874  1.00 0.00 ? 246 ARG A HG2  1  
ATOM   1380  H  HG3  . ARG A 1 92  ? 4.214   -3.487  -7.696  1.00 0.00 ? 246 ARG A HG3  1  
ATOM   1381  H  HD2  . ARG A 1 92  ? 4.082   -2.006  -9.428  1.00 0.00 ? 246 ARG A HD2  1  
ATOM   1382  H  HD3  . ARG A 1 92  ? 5.556   -1.154  -8.926  1.00 0.00 ? 246 ARG A HD3  1  
ATOM   1383  H  HE   . ARG A 1 92  ? 6.791   -2.569  -10.347 1.00 0.00 ? 246 ARG A HE   1  
ATOM   1384  H  HH11 . ARG A 1 92  ? 3.668   -3.994  -9.654  1.00 0.00 ? 246 ARG A HH11 1  
ATOM   1385  H  HH12 . ARG A 1 92  ? 3.914   -5.320  -10.737 1.00 0.00 ? 246 ARG A HH12 1  
ATOM   1386  H  HH21 . ARG A 1 92  ? 7.064   -4.321  -11.750 1.00 0.00 ? 246 ARG A HH21 1  
ATOM   1387  H  HH22 . ARG A 1 92  ? 5.809   -5.505  -11.908 1.00 0.00 ? 246 ARG A HH22 1  
ATOM   1388  N  N    . ASN A 1 93  ? 7.362   -0.200  -4.578  1.00 0.00 ? 247 ASN A N    1  
ATOM   1389  C  CA   . ASN A 1 93  ? 7.488   1.121   -3.876  1.00 0.00 ? 247 ASN A CA   1  
ATOM   1390  C  C    . ASN A 1 93  ? 8.949   1.599   -3.878  1.00 0.00 ? 247 ASN A C    1  
ATOM   1391  O  O    . ASN A 1 93  ? 9.215   2.766   -4.095  1.00 0.00 ? 247 ASN A O    1  
ATOM   1392  C  CB   . ASN A 1 93  ? 7.001   0.882   -2.439  1.00 0.00 ? 247 ASN A CB   1  
ATOM   1393  C  CG   . ASN A 1 93  ? 7.051   2.197   -1.648  1.00 0.00 ? 247 ASN A CG   1  
ATOM   1394  O  OD1  . ASN A 1 93  ? 7.665   2.260   -0.601  1.00 0.00 ? 247 ASN A OD1  1  
ATOM   1395  N  ND2  . ASN A 1 93  ? 6.430   3.258   -2.102  1.00 0.00 ? 247 ASN A ND2  1  
ATOM   1396  H  H    . ASN A 1 93  ? 7.571   -1.025  -4.096  1.00 0.00 ? 247 ASN A H    1  
ATOM   1397  H  HA   . ASN A 1 93  ? 6.863   1.853   -4.355  1.00 0.00 ? 247 ASN A HA   1  
ATOM   1398  H  HB2  . ASN A 1 93  ? 5.986   0.512   -2.460  1.00 0.00 ? 247 ASN A HB2  1  
ATOM   1399  H  HB3  . ASN A 1 93  ? 7.639   0.153   -1.961  1.00 0.00 ? 247 ASN A HB3  1  
ATOM   1400  H  HD21 . ASN A 1 93  ? 5.931   3.219   -2.946  1.00 0.00 ? 247 ASN A HD21 1  
ATOM   1401  H  HD22 . ASN A 1 93  ? 6.465   4.096   -1.595  1.00 0.00 ? 247 ASN A HD22 1  
ATOM   1402  N  N    . LEU A 1 94  ? 9.897   0.717   -3.634  1.00 0.00 ? 248 LEU A N    1  
ATOM   1403  C  CA   . LEU A 1 94  ? 11.332  1.160   -3.623  1.00 0.00 ? 248 LEU A CA   1  
ATOM   1404  C  C    . LEU A 1 94  ? 12.301  0.074   -4.144  1.00 0.00 ? 248 LEU A C    1  
ATOM   1405  O  O    . LEU A 1 94  ? 13.472  0.094   -3.811  1.00 0.00 ? 248 LEU A O    1  
ATOM   1406  C  CB   . LEU A 1 94  ? 11.636  1.502   -2.156  1.00 0.00 ? 248 LEU A CB   1  
ATOM   1407  C  CG   . LEU A 1 94  ? 11.501  0.258   -1.269  1.00 0.00 ? 248 LEU A CG   1  
ATOM   1408  C  CD1  . LEU A 1 94  ? 12.832  -0.493  -1.228  1.00 0.00 ? 248 LEU A CD1  1  
ATOM   1409  C  CD2  . LEU A 1 94  ? 11.122  0.689   0.150   1.00 0.00 ? 248 LEU A CD2  1  
ATOM   1410  H  H    . LEU A 1 94  ? 9.667   -0.218  -3.456  1.00 0.00 ? 248 LEU A H    1  
ATOM   1411  H  HA   . LEU A 1 94  ? 11.437  2.052   -4.219  1.00 0.00 ? 248 LEU A HA   1  
ATOM   1412  H  HB2  . LEU A 1 94  ? 12.644  1.884   -2.082  1.00 0.00 ? 248 LEU A HB2  1  
ATOM   1413  H  HB3  . LEU A 1 94  ? 10.944  2.257   -1.816  1.00 0.00 ? 248 LEU A HB3  1  
ATOM   1414  H  HG   . LEU A 1 94  ? 10.738  -0.391  -1.663  1.00 0.00 ? 248 LEU A HG   1  
ATOM   1415  H  HD11 . LEU A 1 94  ? 12.882  -1.180  -2.060  1.00 0.00 ? 248 LEU A HD11 1  
ATOM   1416  H  HD12 . LEU A 1 94  ? 12.907  -1.044  -0.302  1.00 0.00 ? 248 LEU A HD12 1  
ATOM   1417  H  HD13 . LEU A 1 94  ? 13.646  0.213   -1.295  1.00 0.00 ? 248 LEU A HD13 1  
ATOM   1418  H  HD21 . LEU A 1 94  ? 11.542  -0.006  0.862   1.00 0.00 ? 248 LEU A HD21 1  
ATOM   1419  H  HD22 . LEU A 1 94  ? 10.046  0.698   0.247   1.00 0.00 ? 248 LEU A HD22 1  
ATOM   1420  H  HD23 . LEU A 1 94  ? 11.509  1.679   0.341   1.00 0.00 ? 248 LEU A HD23 1  
ATOM   1421  N  N    . GLY A 1 95  ? 11.855  -0.851  -4.974  1.00 0.00 ? 249 GLY A N    1  
ATOM   1422  C  CA   . GLY A 1 95  ? 12.793  -1.889  -5.506  1.00 0.00 ? 249 GLY A CA   1  
ATOM   1423  C  C    . GLY A 1 95  ? 12.996  -3.009  -4.476  1.00 0.00 ? 249 GLY A C    1  
ATOM   1424  O  O    . GLY A 1 95  ? 12.455  -2.965  -3.387  1.00 0.00 ? 249 GLY A O    1  
ATOM   1425  H  H    . GLY A 1 95  ? 10.918  -0.857  -5.264  1.00 0.00 ? 249 GLY A H    1  
ATOM   1426  H  HA2  . GLY A 1 95  ? 12.385  -2.306  -6.414  1.00 0.00 ? 249 GLY A HA2  1  
ATOM   1427  H  HA3  . GLY A 1 95  ? 13.748  -1.432  -5.722  1.00 0.00 ? 249 GLY A HA3  1  
ATOM   1428  N  N    . ARG A 1 96  ? 13.775  -4.019  -4.815  1.00 0.00 ? 250 ARG A N    1  
ATOM   1429  C  CA   . ARG A 1 96  ? 14.011  -5.147  -3.850  1.00 0.00 ? 250 ARG A CA   1  
ATOM   1430  C  C    . ARG A 1 96  ? 15.375  -5.022  -3.138  1.00 0.00 ? 250 ARG A C    1  
ATOM   1431  O  O    . ARG A 1 96  ? 15.535  -5.521  -2.040  1.00 0.00 ? 250 ARG A O    1  
ATOM   1432  C  CB   . ARG A 1 96  ? 13.979  -6.424  -4.696  1.00 0.00 ? 250 ARG A CB   1  
ATOM   1433  C  CG   . ARG A 1 96  ? 14.078  -7.648  -3.782  1.00 0.00 ? 250 ARG A CG   1  
ATOM   1434  C  CD   . ARG A 1 96  ? 15.549  -8.076  -3.652  1.00 0.00 ? 250 ARG A CD   1  
ATOM   1435  N  NE   . ARG A 1 96  ? 15.748  -9.217  -4.617  1.00 0.00 ? 250 ARG A NE   1  
ATOM   1436  C  CZ   . ARG A 1 96  ? 16.700  -10.120 -4.424  1.00 0.00 ? 250 ARG A CZ   1  
ATOM   1437  N  NH1  . ARG A 1 96  ? 17.534  -10.038 -3.411  1.00 0.00 ? 250 ARG A NH1  1  
ATOM   1438  N  NH2  . ARG A 1 96  ? 16.831  -11.109 -5.270  1.00 0.00 ? 250 ARG A NH2  1  
ATOM   1439  H  H    . ARG A 1 96  ? 14.201  -4.036  -5.705  1.00 0.00 ? 250 ARG A H    1  
ATOM   1440  H  HA   . ARG A 1 96  ? 13.221  -5.178  -3.122  1.00 0.00 ? 250 ARG A HA   1  
ATOM   1441  H  HB2  . ARG A 1 96  ? 13.054  -6.464  -5.253  1.00 0.00 ? 250 ARG A HB2  1  
ATOM   1442  H  HB3  . ARG A 1 96  ? 14.814  -6.420  -5.381  1.00 0.00 ? 250 ARG A HB3  1  
ATOM   1443  H  HG2  . ARG A 1 96  ? 13.686  -7.400  -2.806  1.00 0.00 ? 250 ARG A HG2  1  
ATOM   1444  H  HG3  . ARG A 1 96  ? 13.506  -8.460  -4.204  1.00 0.00 ? 250 ARG A HG3  1  
ATOM   1445  H  HD2  . ARG A 1 96  ? 16.200  -7.250  -3.907  1.00 0.00 ? 250 ARG A HD2  1  
ATOM   1446  H  HD3  . ARG A 1 96  ? 15.745  -8.407  -2.645  1.00 0.00 ? 250 ARG A HD3  1  
ATOM   1447  H  HE   . ARG A 1 96  ? 15.164  -9.298  -5.407  1.00 0.00 ? 250 ARG A HE   1  
ATOM   1448  H  HH11 . ARG A 1 96  ? 17.470  -9.286  -2.759  1.00 0.00 ? 250 ARG A HH11 1  
ATOM   1449  H  HH12 . ARG A 1 96  ? 18.239  -10.737 -3.293  1.00 0.00 ? 250 ARG A HH12 1  
ATOM   1450  H  HH21 . ARG A 1 96  ? 16.216  -11.181 -6.055  1.00 0.00 ? 250 ARG A HH21 1  
ATOM   1451  H  HH22 . ARG A 1 96  ? 17.547  -11.794 -5.131  1.00 0.00 ? 250 ARG A HH22 1  
ATOM   1452  N  N    . LYS A 1 97  ? 16.365  -4.383  -3.743  1.00 0.00 ? 251 LYS A N    1  
ATOM   1453  C  CA   . LYS A 1 97  ? 17.718  -4.264  -3.065  1.00 0.00 ? 251 LYS A CA   1  
ATOM   1454  C  C    . LYS A 1 97  ? 17.561  -3.754  -1.623  1.00 0.00 ? 251 LYS A C    1  
ATOM   1455  O  O    . LYS A 1 97  ? 17.956  -4.424  -0.687  1.00 0.00 ? 251 LYS A O    1  
ATOM   1456  C  CB   . LYS A 1 97  ? 18.543  -3.265  -3.892  1.00 0.00 ? 251 LYS A CB   1  
ATOM   1457  C  CG   . LYS A 1 97  ? 19.349  -4.023  -4.949  1.00 0.00 ? 251 LYS A CG   1  
ATOM   1458  C  CD   . LYS A 1 97  ? 19.988  -3.025  -5.917  1.00 0.00 ? 251 LYS A CD   1  
ATOM   1459  C  CE   . LYS A 1 97  ? 18.988  -2.670  -7.019  1.00 0.00 ? 251 LYS A CE   1  
ATOM   1460  N  NZ   . LYS A 1 97  ? 19.235  -1.230  -7.312  1.00 0.00 ? 251 LYS A NZ   1  
ATOM   1461  H  H    . LYS A 1 97  ? 16.226  -3.999  -4.637  1.00 0.00 ? 251 LYS A H    1  
ATOM   1462  H  HA   . LYS A 1 97  ? 18.208  -5.225  -3.056  1.00 0.00 ? 251 LYS A HA   1  
ATOM   1463  H  HB2  . LYS A 1 97  ? 17.878  -2.565  -4.377  1.00 0.00 ? 251 LYS A HB2  1  
ATOM   1464  H  HB3  . LYS A 1 97  ? 19.218  -2.730  -3.242  1.00 0.00 ? 251 LYS A HB3  1  
ATOM   1465  H  HG2  . LYS A 1 97  ? 20.122  -4.602  -4.465  1.00 0.00 ? 251 LYS A HG2  1  
ATOM   1466  H  HG3  . LYS A 1 97  ? 18.693  -4.683  -5.497  1.00 0.00 ? 251 LYS A HG3  1  
ATOM   1467  H  HD2  . LYS A 1 97  ? 20.266  -2.129  -5.379  1.00 0.00 ? 251 LYS A HD2  1  
ATOM   1468  H  HD3  . LYS A 1 97  ? 20.868  -3.466  -6.360  1.00 0.00 ? 251 LYS A HD3  1  
ATOM   1469  H  HE2  . LYS A 1 97  ? 19.170  -3.272  -7.899  1.00 0.00 ? 251 LYS A HE2  1  
ATOM   1470  H  HE3  . LYS A 1 97  ? 17.977  -2.808  -6.669  1.00 0.00 ? 251 LYS A HE3  1  
ATOM   1471  H  HZ1  . LYS A 1 97  ? 20.241  -1.089  -7.533  1.00 0.00 ? 251 LYS A HZ1  1  
ATOM   1472  H  HZ2  . LYS A 1 97  ? 18.977  -0.659  -6.482  1.00 0.00 ? 251 LYS A HZ2  1  
ATOM   1473  H  HZ3  . LYS A 1 97  ? 18.659  -0.938  -8.127  1.00 0.00 ? 251 LYS A HZ3  1  
ATOM   1474  N  N    . GLU A 1 98  ? 16.969  -2.591  -1.427  1.00 0.00 ? 252 GLU A N    1  
ATOM   1475  C  CA   . GLU A 1 98  ? 16.778  -2.083  -0.017  1.00 0.00 ? 252 GLU A CA   1  
ATOM   1476  C  C    . GLU A 1 98  ? 16.062  -3.152  0.837   1.00 0.00 ? 252 GLU A C    1  
ATOM   1477  O  O    . GLU A 1 98  ? 16.284  -3.247  2.029   1.00 0.00 ? 252 GLU A O    1  
ATOM   1478  C  CB   . GLU A 1 98  ? 15.913  -0.816  -0.113  1.00 0.00 ? 252 GLU A CB   1  
ATOM   1479  C  CG   . GLU A 1 98  ? 16.817  0.416   -0.196  1.00 0.00 ? 252 GLU A CG   1  
ATOM   1480  C  CD   . GLU A 1 98  ? 17.606  0.384   -1.507  1.00 0.00 ? 252 GLU A CD   1  
ATOM   1481  O  OE1  . GLU A 1 98  ? 18.506  -0.432  -1.615  1.00 0.00 ? 252 GLU A OE1  1  
ATOM   1482  O  OE2  . GLU A 1 98  ? 17.296  1.177   -2.381  1.00 0.00 ? 252 GLU A OE2  1  
ATOM   1483  H  H    . GLU A 1 98  ? 16.641  -2.070  -2.195  1.00 0.00 ? 252 GLU A H    1  
ATOM   1484  H  HA   . GLU A 1 98  ? 17.732  -1.843  0.418   1.00 0.00 ? 252 GLU A HA   1  
ATOM   1485  H  HB2  . GLU A 1 98  ? 15.293  -0.869  -0.996  1.00 0.00 ? 252 GLU A HB2  1  
ATOM   1486  H  HB3  . GLU A 1 98  ? 15.286  -0.741  0.763   1.00 0.00 ? 252 GLU A HB3  1  
ATOM   1487  H  HG2  . GLU A 1 98  ? 16.211  1.310   -0.161  1.00 0.00 ? 252 GLU A HG2  1  
ATOM   1488  H  HG3  . GLU A 1 98  ? 17.505  0.414   0.635   1.00 0.00 ? 252 GLU A HG3  1  
ATOM   1489  N  N    . LEU A 1 99  ? 15.212  -3.966  0.233   1.00 0.00 ? 253 LEU A N    1  
ATOM   1490  C  CA   . LEU A 1 99  ? 14.501  -5.033  1.021   1.00 0.00 ? 253 LEU A CA   1  
ATOM   1491  C  C    . LEU A 1 99  ? 15.518  -5.953  1.719   1.00 0.00 ? 253 LEU A C    1  
ATOM   1492  O  O    . LEU A 1 99  ? 15.280  -6.411  2.820   1.00 0.00 ? 253 LEU A O    1  
ATOM   1493  C  CB   . LEU A 1 99  ? 13.670  -5.839  0.010   1.00 0.00 ? 253 LEU A CB   1  
ATOM   1494  C  CG   . LEU A 1 99  ? 12.478  -6.478  0.718   1.00 0.00 ? 253 LEU A CG   1  
ATOM   1495  C  CD1  . LEU A 1 99  ? 11.410  -6.844  -0.314  1.00 0.00 ? 253 LEU A CD1  1  
ATOM   1496  C  CD2  . LEU A 1 99  ? 12.935  -7.743  1.449   1.00 0.00 ? 253 LEU A CD2  1  
ATOM   1497  H  H    . LEU A 1 99  ? 15.049  -3.878  -0.733  1.00 0.00 ? 253 LEU A H    1  
ATOM   1498  H  HA   . LEU A 1 99  ? 13.848  -4.581  1.752   1.00 0.00 ? 253 LEU A HA   1  
ATOM   1499  H  HB2  . LEU A 1 99  ? 13.314  -5.179  -0.769  1.00 0.00 ? 253 LEU A HB2  1  
ATOM   1500  H  HB3  . LEU A 1 99  ? 14.286  -6.609  -0.427  1.00 0.00 ? 253 LEU A HB3  1  
ATOM   1501  H  HG   . LEU A 1 99  ? 12.066  -5.777  1.428   1.00 0.00 ? 253 LEU A HG   1  
ATOM   1502  H  HD11 . LEU A 1 99  ? 10.552  -7.265  0.189   1.00 0.00 ? 253 LEU A HD11 1  
ATOM   1503  H  HD12 . LEU A 1 99  ? 11.813  -7.568  -1.006  1.00 0.00 ? 253 LEU A HD12 1  
ATOM   1504  H  HD13 . LEU A 1 99  ? 11.112  -5.958  -0.854  1.00 0.00 ? 253 LEU A HD13 1  
ATOM   1505  H  HD21 . LEU A 1 99  ? 13.689  -8.246  0.861   1.00 0.00 ? 253 LEU A HD21 1  
ATOM   1506  H  HD22 . LEU A 1 99  ? 12.091  -8.401  1.592   1.00 0.00 ? 253 LEU A HD22 1  
ATOM   1507  H  HD23 . LEU A 1 99  ? 13.349  -7.474  2.409   1.00 0.00 ? 253 LEU A HD23 1  
ATOM   1508  N  N    . SER A 1 100 ? 16.651  -6.233  1.098   1.00 0.00 ? 254 SER A N    1  
ATOM   1509  C  CA   . SER A 1 100 ? 17.656  -7.131  1.776   1.00 0.00 ? 254 SER A CA   1  
ATOM   1510  C  C    . SER A 1 100 ? 18.164  -6.457  3.057   1.00 0.00 ? 254 SER A C    1  
ATOM   1511  O  O    . SER A 1 100 ? 18.158  -7.057  4.116   1.00 0.00 ? 254 SER A O    1  
ATOM   1512  C  CB   . SER A 1 100 ? 18.812  -7.340  0.786   1.00 0.00 ? 254 SER A CB   1  
ATOM   1513  O  OG   . SER A 1 100 ? 18.515  -8.447  -0.053  1.00 0.00 ? 254 SER A OG   1  
ATOM   1514  H  H    . SER A 1 100 ? 16.836  -5.854  0.201   1.00 0.00 ? 254 SER A H    1  
ATOM   1515  H  HA   . SER A 1 100 ? 17.200  -8.078  2.021   1.00 0.00 ? 254 SER A HA   1  
ATOM   1516  H  HB2  . SER A 1 100 ? 18.933  -6.458  0.180   1.00 0.00 ? 254 SER A HB2  1  
ATOM   1517  H  HB3  . SER A 1 100 ? 19.726  -7.525  1.335   1.00 0.00 ? 254 SER A HB3  1  
ATOM   1518  H  HG   . SER A 1 100 ? 17.882  -8.157  -0.715  1.00 0.00 ? 254 SER A HG   1  
ATOM   1519  N  N    . THR A 1 101 ? 18.587  -5.210  2.981   1.00 0.00 ? 255 THR A N    1  
ATOM   1520  C  CA   . THR A 1 101 ? 19.075  -4.513  4.228   1.00 0.00 ? 255 THR A CA   1  
ATOM   1521  C  C    . THR A 1 101 ? 17.976  -4.520  5.306   1.00 0.00 ? 255 THR A C    1  
ATOM   1522  O  O    . THR A 1 101 ? 18.270  -4.572  6.486   1.00 0.00 ? 255 THR A O    1  
ATOM   1523  C  CB   . THR A 1 101 ? 19.417  -3.069  3.827   1.00 0.00 ? 255 THR A CB   1  
ATOM   1524  O  OG1  . THR A 1 101 ? 20.055  -3.072  2.557   1.00 0.00 ? 255 THR A OG1  1  
ATOM   1525  C  CG2  . THR A 1 101 ? 20.355  -2.457  4.868   1.00 0.00 ? 255 THR A CG2  1  
ATOM   1526  H  H    . THR A 1 101 ? 18.572  -4.737  2.114   1.00 0.00 ? 255 THR A H    1  
ATOM   1527  H  HA   . THR A 1 101 ? 19.953  -5.008  4.606   1.00 0.00 ? 255 THR A HA   1  
ATOM   1528  H  HB   . THR A 1 101 ? 18.512  -2.485  3.774   1.00 0.00 ? 255 THR A HB   1  
ATOM   1529  H  HG1  . THR A 1 101 ? 19.967  -2.194  2.179   1.00 0.00 ? 255 THR A HG1  1  
ATOM   1530  H  HG21 . THR A 1 101 ? 20.129  -1.407  4.982   1.00 0.00 ? 255 THR A HG21 1  
ATOM   1531  H  HG22 . THR A 1 101 ? 21.378  -2.571  4.543   1.00 0.00 ? 255 THR A HG22 1  
ATOM   1532  H  HG23 . THR A 1 101 ? 20.219  -2.959  5.815   1.00 0.00 ? 255 THR A HG23 1  
ATOM   1533  N  N    . ILE A 1 102 ? 16.713  -4.482  4.920   1.00 0.00 ? 256 ILE A N    1  
ATOM   1534  C  CA   . ILE A 1 102 ? 15.616  -4.503  5.954   1.00 0.00 ? 256 ILE A CA   1  
ATOM   1535  C  C    . ILE A 1 102 ? 15.746  -5.760  6.838   1.00 0.00 ? 256 ILE A C    1  
ATOM   1536  O  O    . ILE A 1 102 ? 15.433  -5.719  8.014   1.00 0.00 ? 256 ILE A O    1  
ATOM   1537  C  CB   . ILE A 1 102 ? 14.274  -4.508  5.186   1.00 0.00 ? 256 ILE A CB   1  
ATOM   1538  C  CG1  . ILE A 1 102 ? 14.089  -3.161  4.478   1.00 0.00 ? 256 ILE A CG1  1  
ATOM   1539  C  CG2  . ILE A 1 102 ? 13.110  -4.727  6.158   1.00 0.00 ? 256 ILE A CG2  1  
ATOM   1540  C  CD1  . ILE A 1 102 ? 12.844  -3.216  3.588   1.00 0.00 ? 256 ILE A CD1  1  
ATOM   1541  H  H    . ILE A 1 102 ? 16.492  -4.449  3.962   1.00 0.00 ? 256 ILE A H    1  
ATOM   1542  H  HA   . ILE A 1 102 ? 15.679  -3.621  6.568   1.00 0.00 ? 256 ILE A HA   1  
ATOM   1543  H  HB   . ILE A 1 102 ? 14.282  -5.302  4.455   1.00 0.00 ? 256 ILE A HB   1  
ATOM   1544  H  HG12 . ILE A 1 102 ? 13.969  -2.381  5.216   1.00 0.00 ? 256 ILE A HG12 1  
ATOM   1545  H  HG13 . ILE A 1 102 ? 14.954  -2.950  3.869   1.00 0.00 ? 256 ILE A HG13 1  
ATOM   1546  H  HG21 . ILE A 1 102 ? 12.902  -5.784  6.238   1.00 0.00 ? 256 ILE A HG21 1  
ATOM   1547  H  HG22 . ILE A 1 102 ? 12.235  -4.215  5.794   1.00 0.00 ? 256 ILE A HG22 1  
ATOM   1548  H  HG23 . ILE A 1 102 ? 13.380  -4.341  7.128   1.00 0.00 ? 256 ILE A HG23 1  
ATOM   1549  H  HD11 . ILE A 1 102 ? 12.001  -2.803  4.122   1.00 0.00 ? 256 ILE A HD11 1  
ATOM   1550  H  HD12 . ILE A 1 102 ? 12.635  -4.241  3.322   1.00 0.00 ? 256 ILE A HD12 1  
ATOM   1551  H  HD13 . ILE A 1 102 ? 13.018  -2.640  2.691   1.00 0.00 ? 256 ILE A HD13 1  
ATOM   1552  N  N    . MET A 1 103 ? 16.206  -6.871  6.294   1.00 0.00 ? 257 MET A N    1  
ATOM   1553  C  CA   . MET A 1 103 ? 16.344  -8.102  7.143   1.00 0.00 ? 257 MET A CA   1  
ATOM   1554  C  C    . MET A 1 103 ? 17.796  -8.284  7.638   1.00 0.00 ? 257 MET A C    1  
ATOM   1555  O  O    . MET A 1 103 ? 18.197  -9.385  7.967   1.00 0.00 ? 257 MET A O    1  
ATOM   1556  C  CB   . MET A 1 103 ? 15.927  -9.275  6.248   1.00 0.00 ? 257 MET A CB   1  
ATOM   1557  C  CG   . MET A 1 103 ? 14.400  -9.389  6.235   1.00 0.00 ? 257 MET A CG   1  
ATOM   1558  S  SD   . MET A 1 103 ? 13.862  -10.465 7.589   1.00 0.00 ? 257 MET A SD   1  
ATOM   1559  C  CE   . MET A 1 103 ? 12.402  -9.512  8.077   1.00 0.00 ? 257 MET A CE   1  
ATOM   1560  H  H    . MET A 1 103 ? 16.464  -6.894  5.342   1.00 0.00 ? 257 MET A H    1  
ATOM   1561  H  HA   . MET A 1 103 ? 15.676  -8.040  7.988   1.00 0.00 ? 257 MET A HA   1  
ATOM   1562  H  HB2  . MET A 1 103 ? 16.285  -9.106  5.242   1.00 0.00 ? 257 MET A HB2  1  
ATOM   1563  H  HB3  . MET A 1 103 ? 16.351  -10.191 6.632   1.00 0.00 ? 257 MET A HB3  1  
ATOM   1564  H  HG2  . MET A 1 103 ? 13.964  -8.408  6.359   1.00 0.00 ? 257 MET A HG2  1  
ATOM   1565  H  HG3  . MET A 1 103 ? 14.077  -9.807  5.293   1.00 0.00 ? 257 MET A HG3  1  
ATOM   1566  H  HE1  . MET A 1 103 ? 11.781  -9.339  7.210   1.00 0.00 ? 257 MET A HE1  1  
ATOM   1567  H  HE2  . MET A 1 103 ? 12.711  -8.565  8.490   1.00 0.00 ? 257 MET A HE2  1  
ATOM   1568  H  HE3  . MET A 1 103 ? 11.845  -10.063 8.823   1.00 0.00 ? 257 MET A HE3  1  
ATOM   1569  N  N    . ASP A 1 104 ? 18.589  -7.225  7.708   1.00 0.00 ? 258 ASP A N    1  
ATOM   1570  C  CA   . ASP A 1 104 ? 19.999  -7.379  8.198   1.00 0.00 ? 258 ASP A CA   1  
ATOM   1571  C  C    . ASP A 1 104 ? 20.636  -6.002  8.470   1.00 0.00 ? 258 ASP A C    1  
ATOM   1572  O  O    . ASP A 1 104 ? 21.612  -5.632  7.843   1.00 0.00 ? 258 ASP A O    1  
ATOM   1573  C  CB   . ASP A 1 104 ? 20.734  -8.102  7.067   1.00 0.00 ? 258 ASP A CB   1  
ATOM   1574  C  CG   . ASP A 1 104 ? 21.862  -8.953  7.653   1.00 0.00 ? 258 ASP A CG   1  
ATOM   1575  O  OD1  . ASP A 1 104 ? 21.562  -9.847  8.427   1.00 0.00 ? 258 ASP A OD1  1  
ATOM   1576  O  OD2  . ASP A 1 104 ? 23.006  -8.697  7.316   1.00 0.00 ? 258 ASP A OD2  1  
ATOM   1577  H  H    . ASP A 1 104 ? 18.262  -6.337  7.447   1.00 0.00 ? 258 ASP A H    1  
ATOM   1578  H  HA   . ASP A 1 104 ? 20.019  -7.981  9.093   1.00 0.00 ? 258 ASP A HA   1  
ATOM   1579  H  HB2  . ASP A 1 104 ? 20.040  -8.737  6.535   1.00 0.00 ? 258 ASP A HB2  1  
ATOM   1580  H  HB3  . ASP A 1 104 ? 21.151  -7.375  6.386   1.00 0.00 ? 258 ASP A HB3  1  
ATOM   1581  N  N    . GLU A 1 105 ? 20.090  -5.238  9.397   1.00 0.00 ? 259 GLU A N    1  
ATOM   1582  C  CA   . GLU A 1 105 ? 20.671  -3.894  9.692   1.00 0.00 ? 259 GLU A CA   1  
ATOM   1583  C  C    . GLU A 1 105 ? 20.905  -3.728  11.202  1.00 0.00 ? 259 GLU A C    1  
ATOM   1584  O  O    . GLU A 1 105 ? 22.034  -3.641  11.647  1.00 0.00 ? 259 GLU A O    1  
ATOM   1585  C  CB   . GLU A 1 105 ? 19.627  -2.885  9.185   1.00 0.00 ? 259 GLU A CB   1  
ATOM   1586  C  CG   . GLU A 1 105 ? 20.287  -1.898  8.218   1.00 0.00 ? 259 GLU A CG   1  
ATOM   1587  C  CD   . GLU A 1 105 ? 19.212  -1.234  7.355   1.00 0.00 ? 259 GLU A CD   1  
ATOM   1588  O  OE1  . GLU A 1 105 ? 18.421  -1.954  6.771   1.00 0.00 ? 259 GLU A OE1  1  
ATOM   1589  O  OE2  . GLU A 1 105 ? 19.200  -0.015  7.294   1.00 0.00 ? 259 GLU A OE2  1  
ATOM   1590  H  H    . GLU A 1 105 ? 19.301  -5.546  9.896   1.00 0.00 ? 259 GLU A H    1  
ATOM   1591  H  HA   . GLU A 1 105 ? 21.595  -3.768  9.161   1.00 0.00 ? 259 GLU A HA   1  
ATOM   1592  H  HB2  . GLU A 1 105 ? 18.833  -3.412  8.674   1.00 0.00 ? 259 GLU A HB2  1  
ATOM   1593  H  HB3  . GLU A 1 105 ? 19.215  -2.340  10.021  1.00 0.00 ? 259 GLU A HB3  1  
ATOM   1594  H  HG2  . GLU A 1 105 ? 20.817  -1.143  8.780   1.00 0.00 ? 259 GLU A HG2  1  
ATOM   1595  H  HG3  . GLU A 1 105 ? 20.981  -2.427  7.582   1.00 0.00 ? 259 GLU A HG3  1  
ATOM   1596  N  N    . ASN A 1 106 ? 19.855  -3.682  11.993  1.00 0.00 ? 260 ASN A N    1  
ATOM   1597  C  CA   . ASN A 1 106 ? 20.039  -3.522  13.470  1.00 0.00 ? 260 ASN A CA   1  
ATOM   1598  C  C    . ASN A 1 106 ? 18.865  -4.160  14.232  1.00 0.00 ? 260 ASN A C    1  
ATOM   1599  O  O    . ASN A 1 106 ? 18.432  -3.648  15.247  1.00 0.00 ? 260 ASN A O    1  
ATOM   1600  C  CB   . ASN A 1 106 ? 20.068  -2.011  13.701  1.00 0.00 ? 260 ASN A CB   1  
ATOM   1601  C  CG   . ASN A 1 106 ? 20.672  -1.715  15.080  1.00 0.00 ? 260 ASN A CG   1  
ATOM   1602  O  OD1  . ASN A 1 106 ? 20.021  -1.901  16.088  1.00 0.00 ? 260 ASN A OD1  1  
ATOM   1603  N  ND2  . ASN A 1 106 ? 21.898  -1.260  15.172  1.00 0.00 ? 260 ASN A ND2  1  
ATOM   1604  H  H    . ASN A 1 106 ? 18.948  -3.755  11.619  1.00 0.00 ? 260 ASN A H    1  
ATOM   1605  H  HA   . ASN A 1 106 ? 20.973  -3.960  13.783  1.00 0.00 ? 260 ASN A HA   1  
ATOM   1606  H  HB2  . ASN A 1 106 ? 20.668  -1.541  12.935  1.00 0.00 ? 260 ASN A HB2  1  
ATOM   1607  H  HB3  . ASN A 1 106 ? 19.062  -1.620  13.661  1.00 0.00 ? 260 ASN A HB3  1  
ATOM   1608  H  HD21 . ASN A 1 106 ? 22.434  -1.106  14.364  1.00 0.00 ? 260 ASN A HD21 1  
ATOM   1609  H  HD22 . ASN A 1 106 ? 22.282  -1.072  16.054  1.00 0.00 ? 260 ASN A HD22 1  
ATOM   1610  N  N    . ASN A 1 107 ? 18.340  -5.273  13.752  1.00 0.00 ? 261 ASN A N    1  
ATOM   1611  C  CA   . ASN A 1 107 ? 17.190  -5.936  14.454  1.00 0.00 ? 261 ASN A CA   1  
ATOM   1612  C  C    . ASN A 1 107 ? 16.054  -4.931  14.756  1.00 0.00 ? 261 ASN A C    1  
ATOM   1613  O  O    . ASN A 1 107 ? 15.342  -5.082  15.730  1.00 0.00 ? 261 ASN A O    1  
ATOM   1614  C  CB   . ASN A 1 107 ? 17.779  -6.481  15.757  1.00 0.00 ? 261 ASN A CB   1  
ATOM   1615  C  CG   . ASN A 1 107 ? 18.278  -7.914  15.533  1.00 0.00 ? 261 ASN A CG   1  
ATOM   1616  O  OD1  . ASN A 1 107 ? 17.757  -8.622  14.694  1.00 0.00 ? 261 ASN A OD1  1  
ATOM   1617  N  ND2  . ASN A 1 107 ? 19.273  -8.380  16.249  1.00 0.00 ? 261 ASN A ND2  1  
ATOM   1618  H  H    . ASN A 1 107 ? 18.700  -5.676  12.927  1.00 0.00 ? 261 ASN A H    1  
ATOM   1619  H  HA   . ASN A 1 107 ? 16.813  -6.752  13.858  1.00 0.00 ? 261 ASN A HA   1  
ATOM   1620  H  HB2  . ASN A 1 107 ? 18.604  -5.856  16.068  1.00 0.00 ? 261 ASN A HB2  1  
ATOM   1621  H  HB3  . ASN A 1 107 ? 17.019  -6.483  16.523  1.00 0.00 ? 261 ASN A HB3  1  
ATOM   1622  H  HD21 . ASN A 1 107 ? 19.702  -7.817  16.930  1.00 0.00 ? 261 ASN A HD21 1  
ATOM   1623  H  HD22 . ASN A 1 107 ? 19.590  -9.296  16.104  1.00 0.00 ? 261 ASN A HD22 1  
ATOM   1624  N  N    . GLN A 1 108 ? 15.874  -3.915  13.932  1.00 0.00 ? 262 GLN A N    1  
ATOM   1625  C  CA   . GLN A 1 108 ? 14.778  -2.921  14.187  1.00 0.00 ? 262 GLN A CA   1  
ATOM   1626  C  C    . GLN A 1 108 ? 14.373  -2.237  12.870  1.00 0.00 ? 262 GLN A C    1  
ATOM   1627  O  O    . GLN A 1 108 ? 15.000  -1.283  12.449  1.00 0.00 ? 262 GLN A O    1  
ATOM   1628  C  CB   . GLN A 1 108 ? 15.377  -1.899  15.157  1.00 0.00 ? 262 GLN A CB   1  
ATOM   1629  C  CG   . GLN A 1 108 ? 14.879  -2.179  16.580  1.00 0.00 ? 262 GLN A CG   1  
ATOM   1630  C  CD   . GLN A 1 108 ? 16.016  -1.937  17.581  1.00 0.00 ? 262 GLN A CD   1  
ATOM   1631  O  OE1  . GLN A 1 108 ? 16.657  -2.870  18.020  1.00 0.00 ? 262 GLN A OE1  1  
ATOM   1632  N  NE2  . GLN A 1 108 ? 16.299  -0.716  17.965  1.00 0.00 ? 262 GLN A NE2  1  
ATOM   1633  H  H    . GLN A 1 108 ? 16.452  -3.806  13.145  1.00 0.00 ? 262 GLN A H    1  
ATOM   1634  H  HA   . GLN A 1 108 ? 13.926  -3.407  14.637  1.00 0.00 ? 262 GLN A HA   1  
ATOM   1635  H  HB2  . GLN A 1 108 ? 16.454  -1.968  15.130  1.00 0.00 ? 262 GLN A HB2  1  
ATOM   1636  H  HB3  . GLN A 1 108 ? 15.072  -0.906  14.863  1.00 0.00 ? 262 GLN A HB3  1  
ATOM   1637  H  HG2  . GLN A 1 108 ? 14.053  -1.521  16.807  1.00 0.00 ? 262 GLN A HG2  1  
ATOM   1638  H  HG3  . GLN A 1 108 ? 14.551  -3.205  16.653  1.00 0.00 ? 262 GLN A HG3  1  
ATOM   1639  H  HE21 . GLN A 1 108 ? 15.788  0.047   17.617  1.00 0.00 ? 262 GLN A HE21 1  
ATOM   1640  H  HE22 . GLN A 1 108 ? 17.026  -0.563  18.605  1.00 0.00 ? 262 GLN A HE22 1  
ATOM   1641  N  N    . TRP A 1 109 ? 13.347  -2.726  12.206  1.00 0.00 ? 263 TRP A N    1  
ATOM   1642  C  CA   . TRP A 1 109 ? 12.935  -2.108  10.910  1.00 0.00 ? 263 TRP A CA   1  
ATOM   1643  C  C    . TRP A 1 109 ? 11.612  -1.331  11.050  1.00 0.00 ? 263 TRP A C    1  
ATOM   1644  O  O    . TRP A 1 109 ? 10.654  -1.823  11.616  1.00 0.00 ? 263 TRP A O    1  
ATOM   1645  C  CB   . TRP A 1 109 ? 12.762  -3.301  9.950   1.00 0.00 ? 263 TRP A CB   1  
ATOM   1646  C  CG   . TRP A 1 109 ? 12.163  -2.850  8.647   1.00 0.00 ? 263 TRP A CG   1  
ATOM   1647  C  CD1  . TRP A 1 109 ? 12.734  -1.978  7.786   1.00 0.00 ? 263 TRP A CD1  1  
ATOM   1648  C  CD2  . TRP A 1 109 ? 10.889  -3.234  8.054   1.00 0.00 ? 263 TRP A CD2  1  
ATOM   1649  N  NE1  . TRP A 1 109 ? 11.887  -1.795  6.706   1.00 0.00 ? 263 TRP A NE1  1  
ATOM   1650  C  CE2  . TRP A 1 109 ? 10.736  -2.549  6.825   1.00 0.00 ? 263 TRP A CE2  1  
ATOM   1651  C  CE3  . TRP A 1 109 ? 9.860   -4.101  8.462   1.00 0.00 ? 263 TRP A CE3  1  
ATOM   1652  C  CZ2  . TRP A 1 109 ? 9.602   -2.718  6.029   1.00 0.00 ? 263 TRP A CZ2  1  
ATOM   1653  C  CZ3  . TRP A 1 109 ? 8.717   -4.274  7.663   1.00 0.00 ? 263 TRP A CZ3  1  
ATOM   1654  C  CH2  . TRP A 1 109 ? 8.588   -3.583  6.449   1.00 0.00 ? 263 TRP A CH2  1  
ATOM   1655  H  H    . TRP A 1 109 ? 12.860  -3.509  12.549  1.00 0.00 ? 263 TRP A H    1  
ATOM   1656  H  HA   . TRP A 1 109 ? 13.712  -1.458  10.542  1.00 0.00 ? 263 TRP A HA   1  
ATOM   1657  H  HB2  . TRP A 1 109 ? 13.723  -3.751  9.772   1.00 0.00 ? 263 TRP A HB2  1  
ATOM   1658  H  HB3  . TRP A 1 109 ? 12.109  -4.030  10.408  1.00 0.00 ? 263 TRP A HB3  1  
ATOM   1659  H  HD1  . TRP A 1 109 ? 13.691  -1.503  7.919   1.00 0.00 ? 263 TRP A HD1  1  
ATOM   1660  H  HE1  . TRP A 1 109 ? 12.064  -1.208  5.942   1.00 0.00 ? 263 TRP A HE1  1  
ATOM   1661  H  HE3  . TRP A 1 109 ? 9.953   -4.640  9.393   1.00 0.00 ? 263 TRP A HE3  1  
ATOM   1662  H  HZ2  . TRP A 1 109 ? 9.507   -2.182  5.095   1.00 0.00 ? 263 TRP A HZ2  1  
ATOM   1663  H  HZ3  . TRP A 1 109 ? 7.933   -4.943  7.986   1.00 0.00 ? 263 TRP A HZ3  1  
ATOM   1664  H  HH2  . TRP A 1 109 ? 7.708   -3.721  5.839   1.00 0.00 ? 263 TRP A HH2  1  
ATOM   1665  N  N    . TYR A 1 110 ? 11.538  -0.148  10.472  1.00 0.00 ? 264 TYR A N    1  
ATOM   1666  C  CA   . TYR A 1 110 ? 10.256  0.620   10.504  1.00 0.00 ? 264 TYR A CA   1  
ATOM   1667  C  C    . TYR A 1 110 ? 9.525   0.301   9.201   1.00 0.00 ? 264 TYR A C    1  
ATOM   1668  O  O    . TYR A 1 110 ? 10.162  0.084   8.185   1.00 0.00 ? 264 TYR A O    1  
ATOM   1669  C  CB   . TYR A 1 110 ? 10.632  2.104   10.590  1.00 0.00 ? 264 TYR A CB   1  
ATOM   1670  C  CG   . TYR A 1 110 ? 10.555  2.545   12.032  1.00 0.00 ? 264 TYR A CG   1  
ATOM   1671  C  CD1  . TYR A 1 110 ? 9.326   2.929   12.582  1.00 0.00 ? 264 TYR A CD1  1  
ATOM   1672  C  CD2  . TYR A 1 110 ? 11.710  2.560   12.820  1.00 0.00 ? 264 TYR A CD2  1  
ATOM   1673  C  CE1  . TYR A 1 110 ? 9.253   3.329   13.920  1.00 0.00 ? 264 TYR A CE1  1  
ATOM   1674  C  CE2  . TYR A 1 110 ? 11.638  2.960   14.158  1.00 0.00 ? 264 TYR A CE2  1  
ATOM   1675  C  CZ   . TYR A 1 110 ? 10.410  3.345   14.709  1.00 0.00 ? 264 TYR A CZ   1  
ATOM   1676  O  OH   . TYR A 1 110 ? 10.339  3.741   16.029  1.00 0.00 ? 264 TYR A OH   1  
ATOM   1677  H  H    . TYR A 1 110 ? 12.310  0.207   9.972   1.00 0.00 ? 264 TYR A H    1  
ATOM   1678  H  HA   . TYR A 1 110 ? 9.657   0.331   11.355  1.00 0.00 ? 264 TYR A HA   1  
ATOM   1679  H  HB2  . TYR A 1 110 ? 11.636  2.247   10.220  1.00 0.00 ? 264 TYR A HB2  1  
ATOM   1680  H  HB3  . TYR A 1 110 ? 9.941   2.687   9.999   1.00 0.00 ? 264 TYR A HB3  1  
ATOM   1681  H  HD1  . TYR A 1 110 ? 8.433   2.915   11.972  1.00 0.00 ? 264 TYR A HD1  1  
ATOM   1682  H  HD2  . TYR A 1 110 ? 12.658  2.263   12.395  1.00 0.00 ? 264 TYR A HD2  1  
ATOM   1683  H  HE1  . TYR A 1 110 ? 8.305   3.626   14.344  1.00 0.00 ? 264 TYR A HE1  1  
ATOM   1684  H  HE2  . TYR A 1 110 ? 12.530  2.968   14.766  1.00 0.00 ? 264 TYR A HE2  1  
ATOM   1685  H  HH   . TYR A 1 110 ? 10.170  4.686   16.047  1.00 0.00 ? 264 TYR A HH   1  
ATOM   1686  N  N    . CYS A 1 111 ? 8.214   0.224   9.207   1.00 0.00 ? 265 CYS A N    1  
ATOM   1687  C  CA   . CYS A 1 111 ? 7.503   -0.137  7.949   1.00 0.00 ? 265 CYS A CA   1  
ATOM   1688  C  C    . CYS A 1 111 ? 6.414   0.908   7.597   1.00 0.00 ? 265 CYS A C    1  
ATOM   1689  O  O    . CYS A 1 111 ? 6.573   2.080   7.883   1.00 0.00 ? 265 CYS A O    1  
ATOM   1690  C  CB   . CYS A 1 111 ? 6.952   -1.552  8.231   1.00 0.00 ? 265 CYS A CB   1  
ATOM   1691  S  SG   . CYS A 1 111 ? 5.521   -1.496  9.343   1.00 0.00 ? 265 CYS A SG   1  
ATOM   1692  H  H    . CYS A 1 111 ? 7.706   0.372   10.034  1.00 0.00 ? 265 CYS A H    1  
ATOM   1693  H  HA   . CYS A 1 111 ? 8.213   -0.192  7.138   1.00 0.00 ? 265 CYS A HA   1  
ATOM   1694  H  HB2  . CYS A 1 111 ? 6.654   -2.008  7.299   1.00 0.00 ? 265 CYS A HB2  1  
ATOM   1695  H  HB3  . CYS A 1 111 ? 7.731   -2.150  8.682   1.00 0.00 ? 265 CYS A HB3  1  
ATOM   1696  N  N    . TYR A 1 112 ? 5.327   0.507   6.962   1.00 0.00 ? 266 TYR A N    1  
ATOM   1697  C  CA   . TYR A 1 112 ? 4.266   1.505   6.584   1.00 0.00 ? 266 TYR A CA   1  
ATOM   1698  C  C    . TYR A 1 112 ? 3.206   1.617   7.698   1.00 0.00 ? 266 TYR A C    1  
ATOM   1699  O  O    . TYR A 1 112 ? 2.710   2.694   7.973   1.00 0.00 ? 266 TYR A O    1  
ATOM   1700  C  CB   . TYR A 1 112 ? 3.635   0.983   5.275   1.00 0.00 ? 266 TYR A CB   1  
ATOM   1701  C  CG   . TYR A 1 112 ? 4.717   0.708   4.248   1.00 0.00 ? 266 TYR A CG   1  
ATOM   1702  C  CD1  . TYR A 1 112 ? 5.206   1.746   3.448   1.00 0.00 ? 266 TYR A CD1  1  
ATOM   1703  C  CD2  . TYR A 1 112 ? 5.234   -0.588  4.101   1.00 0.00 ? 266 TYR A CD2  1  
ATOM   1704  C  CE1  . TYR A 1 112 ? 6.208   1.492   2.503   1.00 0.00 ? 266 TYR A CE1  1  
ATOM   1705  C  CE2  . TYR A 1 112 ? 6.236   -0.842  3.158   1.00 0.00 ? 266 TYR A CE2  1  
ATOM   1706  C  CZ   . TYR A 1 112 ? 6.724   0.198   2.359   1.00 0.00 ? 266 TYR A CZ   1  
ATOM   1707  O  OH   . TYR A 1 112 ? 7.712   -0.051  1.428   1.00 0.00 ? 266 TYR A OH   1  
ATOM   1708  H  H    . TYR A 1 112 ? 5.212   -0.438  6.723   1.00 0.00 ? 266 TYR A H    1  
ATOM   1709  H  HA   . TYR A 1 112 ? 4.717   2.470   6.408   1.00 0.00 ? 266 TYR A HA   1  
ATOM   1710  H  HB2  . TYR A 1 112 ? 3.096   0.070   5.478   1.00 0.00 ? 266 TYR A HB2  1  
ATOM   1711  H  HB3  . TYR A 1 112 ? 2.953   1.724   4.886   1.00 0.00 ? 266 TYR A HB3  1  
ATOM   1712  H  HD1  . TYR A 1 112 ? 4.810   2.741   3.558   1.00 0.00 ? 266 TYR A HD1  1  
ATOM   1713  H  HD2  . TYR A 1 112 ? 4.857   -1.391  4.718   1.00 0.00 ? 266 TYR A HD2  1  
ATOM   1714  H  HE1  . TYR A 1 112 ? 6.584   2.295   1.886   1.00 0.00 ? 266 TYR A HE1  1  
ATOM   1715  H  HE2  . TYR A 1 112 ? 6.635   -1.840  3.050   1.00 0.00 ? 266 TYR A HE2  1  
ATOM   1716  H  HH   . TYR A 1 112 ? 8.555   0.188   1.819   1.00 0.00 ? 266 TYR A HH   1  
ATOM   1717  N  N    . ILE A 1 113 ? 2.858   0.522   8.348   1.00 0.00 ? 267 ILE A N    1  
ATOM   1718  C  CA   . ILE A 1 113 ? 1.829   0.601   9.452   1.00 0.00 ? 267 ILE A CA   1  
ATOM   1719  C  C    . ILE A 1 113 ? 2.375   1.458   10.611  1.00 0.00 ? 267 ILE A C    1  
ATOM   1720  O  O    . ILE A 1 113 ? 1.663   2.257   11.188  1.00 0.00 ? 267 ILE A O    1  
ATOM   1721  C  CB   . ILE A 1 113 ? 1.572   -0.841  9.953   1.00 0.00 ? 267 ILE A CB   1  
ATOM   1722  C  CG1  . ILE A 1 113 ? 1.121   -1.764  8.800   1.00 0.00 ? 267 ILE A CG1  1  
ATOM   1723  C  CG2  . ILE A 1 113 ? 0.473   -0.812  11.016  1.00 0.00 ? 267 ILE A CG2  1  
ATOM   1724  C  CD1  . ILE A 1 113 ? -0.121  -1.194  8.105   1.00 0.00 ? 267 ILE A CD1  1  
ATOM   1725  H  H    . ILE A 1 113 ? 3.275   -0.333  8.115   1.00 0.00 ? 267 ILE A H    1  
ATOM   1726  H  HA   . ILE A 1 113 ? 0.917   1.029   9.077   1.00 0.00 ? 267 ILE A HA   1  
ATOM   1727  H  HB   . ILE A 1 113 ? 2.483   -1.233  10.397  1.00 0.00 ? 267 ILE A HB   1  
ATOM   1728  H  HG12 . ILE A 1 113 ? 1.914   -1.868  8.080   1.00 0.00 ? 267 ILE A HG12 1  
ATOM   1729  H  HG13 . ILE A 1 113 ? 0.881   -2.737  9.203   1.00 0.00 ? 267 ILE A HG13 1  
ATOM   1730  H  HG21 . ILE A 1 113 ? 0.142   -1.819  11.220  1.00 0.00 ? 267 ILE A HG21 1  
ATOM   1731  H  HG22 . ILE A 1 113 ? -0.360  -0.225  10.655  1.00 0.00 ? 267 ILE A HG22 1  
ATOM   1732  H  HG23 . ILE A 1 113 ? 0.859   -0.369  11.922  1.00 0.00 ? 267 ILE A HG23 1  
ATOM   1733  H  HD11 . ILE A 1 113 ? -0.458  -0.310  8.624   1.00 0.00 ? 267 ILE A HD11 1  
ATOM   1734  H  HD12 . ILE A 1 113 ? -0.906  -1.935  8.110   1.00 0.00 ? 267 ILE A HD12 1  
ATOM   1735  H  HD13 . ILE A 1 113 ? 0.127   -0.942  7.084   1.00 0.00 ? 267 ILE A HD13 1  
ATOM   1736  N  N    . CYS A 1 114 ? 3.634   1.290   10.956  1.00 0.00 ? 268 CYS A N    1  
ATOM   1737  C  CA   . CYS A 1 114 ? 4.237   2.088   12.083  1.00 0.00 ? 268 CYS A CA   1  
ATOM   1738  C  C    . CYS A 1 114 ? 4.056   3.590   11.824  1.00 0.00 ? 268 CYS A C    1  
ATOM   1739  O  O    . CYS A 1 114 ? 3.595   4.320   12.680  1.00 0.00 ? 268 CYS A O    1  
ATOM   1740  C  CB   . CYS A 1 114 ? 5.736   1.741   12.093  1.00 0.00 ? 268 CYS A CB   1  
ATOM   1741  S  SG   . CYS A 1 114 ? 5.988   0.137   12.895  1.00 0.00 ? 268 CYS A SG   1  
ATOM   1742  H  H    . CYS A 1 114 ? 4.179   0.640   10.475  1.00 0.00 ? 268 CYS A H    1  
ATOM   1743  H  HA   . CYS A 1 114 ? 3.788   1.811   13.023  1.00 0.00 ? 268 CYS A HA   1  
ATOM   1744  H  HB2  . CYS A 1 114 ? 6.101   1.695   11.078  1.00 0.00 ? 268 CYS A HB2  1  
ATOM   1745  H  HB3  . CYS A 1 114 ? 6.275   2.502   12.634  1.00 0.00 ? 268 CYS A HB3  1  
ATOM   1746  N  N    . HIS A 1 115 ? 4.411   4.056   10.644  1.00 0.00 ? 269 HIS A N    1  
ATOM   1747  C  CA   . HIS A 1 115 ? 4.251   5.515   10.328  1.00 0.00 ? 269 HIS A CA   1  
ATOM   1748  C  C    . HIS A 1 115 ? 4.599   5.799   8.855   1.00 0.00 ? 269 HIS A C    1  
ATOM   1749  O  O    . HIS A 1 115 ? 5.255   5.000   8.217   1.00 0.00 ? 269 HIS A O    1  
ATOM   1750  C  CB   . HIS A 1 115 ? 5.203   6.267   11.274  1.00 0.00 ? 269 HIS A CB   1  
ATOM   1751  C  CG   . HIS A 1 115 ? 6.627   5.776   11.144  1.00 0.00 ? 269 HIS A CG   1  
ATOM   1752  N  ND1  . HIS A 1 115 ? 7.651   6.336   11.893  1.00 0.00 ? 269 HIS A ND1  1  
ATOM   1753  C  CD2  . HIS A 1 115 ? 7.224   4.799   10.375  1.00 0.00 ? 269 HIS A CD2  1  
ATOM   1754  C  CE1  . HIS A 1 115 ? 8.791   5.706   11.565  1.00 0.00 ? 269 HIS A CE1  1  
ATOM   1755  N  NE2  . HIS A 1 115 ? 8.588   4.762   10.644  1.00 0.00 ? 269 HIS A NE2  1  
ATOM   1756  H  H    . HIS A 1 115 ? 4.770   3.444   9.962   1.00 0.00 ? 269 HIS A H    1  
ATOM   1757  H  HA   . HIS A 1 115 ? 3.235   5.820   10.525  1.00 0.00 ? 269 HIS A HA   1  
ATOM   1758  H  HB2  . HIS A 1 115 ? 5.173   7.319   11.041  1.00 0.00 ? 269 HIS A HB2  1  
ATOM   1759  H  HB3  . HIS A 1 115 ? 4.871   6.123   12.293  1.00 0.00 ? 269 HIS A HB3  1  
ATOM   1760  H  HD1  . HIS A 1 115 ? 7.560   7.063   12.545  1.00 0.00 ? 269 HIS A HD1  1  
ATOM   1761  H  HD2  . HIS A 1 115 ? 6.720   4.153   9.678   1.00 0.00 ? 269 HIS A HD2  1  
ATOM   1762  H  HE1  . HIS A 1 115 ? 9.755   5.933   11.997  1.00 0.00 ? 269 HIS A HE1  1  
ATOM   1763  N  N    . PRO A 1 116 ? 4.139   6.924   8.352   1.00 0.00 ? 270 PRO A N    1  
ATOM   1764  C  CA   . PRO A 1 116 ? 4.412   7.276   6.936   1.00 0.00 ? 270 PRO A CA   1  
ATOM   1765  C  C    . PRO A 1 116 ? 5.901   7.592   6.735   1.00 0.00 ? 270 PRO A C    1  
ATOM   1766  O  O    . PRO A 1 116 ? 6.275   8.737   6.563   1.00 0.00 ? 270 PRO A O    1  
ATOM   1767  C  CB   . PRO A 1 116 ? 3.547   8.513   6.697   1.00 0.00 ? 270 PRO A CB   1  
ATOM   1768  C  CG   . PRO A 1 116 ? 3.348   9.109   8.051   1.00 0.00 ? 270 PRO A CG   1  
ATOM   1769  C  CD   . PRO A 1 116 ? 3.341   7.963   9.027   1.00 0.00 ? 270 PRO A CD   1  
ATOM   1770  H  HA   . PRO A 1 116 ? 4.101   6.478   6.282   1.00 0.00 ? 270 PRO A HA   1  
ATOM   1771  H  HB2  . PRO A 1 116 ? 4.060   9.209   6.047   1.00 0.00 ? 270 PRO A HB2  1  
ATOM   1772  H  HB3  . PRO A 1 116 ? 2.596   8.231   6.273   1.00 0.00 ? 270 PRO A HB3  1  
ATOM   1773  H  HG2  . PRO A 1 116 ? 4.158   9.789   8.278   1.00 0.00 ? 270 PRO A HG2  1  
ATOM   1774  H  HG3  . PRO A 1 116 ? 2.403   9.628   8.093   1.00 0.00 ? 270 PRO A HG3  1  
ATOM   1775  H  HD2  . PRO A 1 116 ? 3.804   8.259   9.959   1.00 0.00 ? 270 PRO A HD2  1  
ATOM   1776  H  HD3  . PRO A 1 116 ? 2.336   7.611   9.194   1.00 0.00 ? 270 PRO A HD3  1  
ATOM   1777  N  N    . GLU A 1 117 ? 6.757   6.589   6.751   1.00 0.00 ? 271 GLU A N    1  
ATOM   1778  C  CA   . GLU A 1 117 ? 8.216   6.856   6.554   1.00 0.00 ? 271 GLU A CA   1  
ATOM   1779  C  C    . GLU A 1 117 ? 8.663   6.452   5.136   1.00 0.00 ? 271 GLU A C    1  
ATOM   1780  O  O    . GLU A 1 117 ? 9.141   7.296   4.403   1.00 0.00 ? 271 GLU A O    1  
ATOM   1781  C  CB   . GLU A 1 117 ? 8.954   6.046   7.633   1.00 0.00 ? 271 GLU A CB   1  
ATOM   1782  C  CG   . GLU A 1 117 ? 9.498   6.987   8.715   1.00 0.00 ? 271 GLU A CG   1  
ATOM   1783  C  CD   . GLU A 1 117 ? 10.524  7.943   8.101   1.00 0.00 ? 271 GLU A CD   1  
ATOM   1784  O  OE1  . GLU A 1 117 ? 11.641  7.512   7.870   1.00 0.00 ? 271 GLU A OE1  1  
ATOM   1785  O  OE2  . GLU A 1 117 ? 10.173  9.089   7.874   1.00 0.00 ? 271 GLU A OE2  1  
ATOM   1786  H  H    . GLU A 1 117 ? 6.442   5.671   6.891   1.00 0.00 ? 271 GLU A H    1  
ATOM   1787  H  HA   . GLU A 1 117 ? 8.408   7.908   6.701   1.00 0.00 ? 271 GLU A HA   1  
ATOM   1788  H  HB2  . GLU A 1 117 ? 8.270   5.338   8.083   1.00 0.00 ? 271 GLU A HB2  1  
ATOM   1789  H  HB3  . GLU A 1 117 ? 9.775   5.511   7.180   1.00 0.00 ? 271 GLU A HB3  1  
ATOM   1790  H  HG2  . GLU A 1 117 ? 8.684   7.556   9.140   1.00 0.00 ? 271 GLU A HG2  1  
ATOM   1791  H  HG3  . GLU A 1 117 ? 9.973   6.405   9.490   1.00 0.00 ? 271 GLU A HG3  1  
ATOM   1792  N  N    . PRO A 1 118 ? 8.507   5.188   4.763   1.00 0.00 ? 272 PRO A N    1  
ATOM   1793  C  CA   . PRO A 1 118 ? 8.923   4.761   3.406   1.00 0.00 ? 272 PRO A CA   1  
ATOM   1794  C  C    . PRO A 1 118 ? 7.796   4.892   2.353   1.00 0.00 ? 272 PRO A C    1  
ATOM   1795  O  O    . PRO A 1 118 ? 7.789   4.153   1.385   1.00 0.00 ? 272 PRO A O    1  
ATOM   1796  C  CB   . PRO A 1 118 ? 9.270   3.291   3.599   1.00 0.00 ? 272 PRO A CB   1  
ATOM   1797  C  CG   . PRO A 1 118 ? 8.464   2.831   4.780   1.00 0.00 ? 272 PRO A CG   1  
ATOM   1798  C  CD   . PRO A 1 118 ? 7.973   4.050   5.527   1.00 0.00 ? 272 PRO A CD   1  
ATOM   1799  H  HA   . PRO A 1 118 ? 9.797   5.303   3.096   1.00 0.00 ? 272 PRO A HA   1  
ATOM   1800  H  HB2  . PRO A 1 118 ? 8.999   2.726   2.716   1.00 0.00 ? 272 PRO A HB2  1  
ATOM   1801  H  HB3  . PRO A 1 118 ? 10.323  3.179   3.806   1.00 0.00 ? 272 PRO A HB3  1  
ATOM   1802  H  HG2  . PRO A 1 118 ? 7.621   2.247   4.439   1.00 0.00 ? 272 PRO A HG2  1  
ATOM   1803  H  HG3  . PRO A 1 118 ? 9.083   2.234   5.432   1.00 0.00 ? 272 PRO A HG3  1  
ATOM   1804  H  HD2  . PRO A 1 118 ? 6.893   4.068   5.542   1.00 0.00 ? 272 PRO A HD2  1  
ATOM   1805  H  HD3  . PRO A 1 118 ? 8.363   4.046   6.525   1.00 0.00 ? 272 PRO A HD3  1  
ATOM   1806  N  N    . LEU A 1 119 ? 6.854   5.807   2.504   1.00 0.00 ? 273 LEU A N    1  
ATOM   1807  C  CA   . LEU A 1 119 ? 5.772   5.929   1.469   1.00 0.00 ? 273 LEU A CA   1  
ATOM   1808  C  C    . LEU A 1 119 ? 5.149   7.341   1.459   1.00 0.00 ? 273 LEU A C    1  
ATOM   1809  O  O    . LEU A 1 119 ? 3.965   7.489   1.216   1.00 0.00 ? 273 LEU A O    1  
ATOM   1810  C  CB   . LEU A 1 119 ? 4.726   4.851   1.828   1.00 0.00 ? 273 LEU A CB   1  
ATOM   1811  C  CG   . LEU A 1 119 ? 3.919   5.231   3.084   1.00 0.00 ? 273 LEU A CG   1  
ATOM   1812  C  CD1  . LEU A 1 119 ? 2.716   4.294   3.215   1.00 0.00 ? 273 LEU A CD1  1  
ATOM   1813  C  CD2  . LEU A 1 119 ? 4.805   5.104   4.326   1.00 0.00 ? 273 LEU A CD2  1  
ATOM   1814  H  H    . LEU A 1 119 ? 6.860   6.405   3.276   1.00 0.00 ? 273 LEU A H    1  
ATOM   1815  H  HA   . LEU A 1 119 ? 6.182   5.712   0.495   1.00 0.00 ? 273 LEU A HA   1  
ATOM   1816  H  HB2  . LEU A 1 119 ? 4.047   4.731   0.998   1.00 0.00 ? 273 LEU A HB2  1  
ATOM   1817  H  HB3  . LEU A 1 119 ? 5.234   3.914   2.004   1.00 0.00 ? 273 LEU A HB3  1  
ATOM   1818  H  HG   . LEU A 1 119 ? 3.565   6.246   2.997   1.00 0.00 ? 273 LEU A HG   1  
ATOM   1819  H  HD11 . LEU A 1 119 ? 3.009   3.290   2.947   1.00 0.00 ? 273 LEU A HD11 1  
ATOM   1820  H  HD12 . LEU A 1 119 ? 1.929   4.626   2.554   1.00 0.00 ? 273 LEU A HD12 1  
ATOM   1821  H  HD13 . LEU A 1 119 ? 2.360   4.305   4.234   1.00 0.00 ? 273 LEU A HD13 1  
ATOM   1822  H  HD21 . LEU A 1 119 ? 5.174   6.081   4.604   1.00 0.00 ? 273 LEU A HD21 1  
ATOM   1823  H  HD22 . LEU A 1 119 ? 5.638   4.456   4.105   1.00 0.00 ? 273 LEU A HD22 1  
ATOM   1824  H  HD23 . LEU A 1 119 ? 4.231   4.690   5.142   1.00 0.00 ? 273 LEU A HD23 1  
ATOM   1825  N  N    . LEU A 1 120 ? 5.925   8.381   1.704   1.00 0.00 ? 274 LEU A N    1  
ATOM   1826  C  CA   . LEU A 1 120 ? 5.325   9.767   1.688   1.00 0.00 ? 274 LEU A CA   1  
ATOM   1827  C  C    . LEU A 1 120 ? 4.732   10.051  0.302   1.00 0.00 ? 274 LEU A C    1  
ATOM   1828  O  O    . LEU A 1 120 ? 3.603   10.487  0.188   1.00 0.00 ? 274 LEU A O    1  
ATOM   1829  C  CB   . LEU A 1 120 ? 6.452   10.777  2.009   1.00 0.00 ? 274 LEU A CB   1  
ATOM   1830  C  CG   . LEU A 1 120 ? 6.148   11.506  3.328   1.00 0.00 ? 274 LEU A CG   1  
ATOM   1831  C  CD1  . LEU A 1 120 ? 4.818   12.260  3.214   1.00 0.00 ? 274 LEU A CD1  1  
ATOM   1832  C  CD2  . LEU A 1 120 ? 6.061   10.489  4.471   1.00 0.00 ? 274 LEU A CD2  1  
ATOM   1833  H  H    . LEU A 1 120 ? 6.882   8.248   1.887   1.00 0.00 ? 274 LEU A H    1  
ATOM   1834  H  HA   . LEU A 1 120 ? 4.551   9.834   2.431   1.00 0.00 ? 274 LEU A HA   1  
ATOM   1835  H  HB2  . LEU A 1 120 ? 7.394   10.259  2.099   1.00 0.00 ? 274 LEU A HB2  1  
ATOM   1836  H  HB3  . LEU A 1 120 ? 6.521   11.503  1.213   1.00 0.00 ? 274 LEU A HB3  1  
ATOM   1837  H  HG   . LEU A 1 120 ? 6.940   12.211  3.535   1.00 0.00 ? 274 LEU A HG   1  
ATOM   1838  H  HD11 . LEU A 1 120 ? 4.695   12.625  2.205   1.00 0.00 ? 274 LEU A HD11 1  
ATOM   1839  H  HD12 . LEU A 1 120 ? 4.816   13.093  3.901   1.00 0.00 ? 274 LEU A HD12 1  
ATOM   1840  H  HD13 . LEU A 1 120 ? 4.003   11.592  3.457   1.00 0.00 ? 274 LEU A HD13 1  
ATOM   1841  H  HD21 . LEU A 1 120 ? 6.372   10.956  5.393   1.00 0.00 ? 274 LEU A HD21 1  
ATOM   1842  H  HD22 . LEU A 1 120 ? 6.707   9.649   4.256   1.00 0.00 ? 274 LEU A HD22 1  
ATOM   1843  H  HD23 . LEU A 1 120 ? 5.041   10.143  4.568   1.00 0.00 ? 274 LEU A HD23 1  
ATOM   1844  N  N    . ASP A 1 121 ? 5.475   9.790   -0.753  1.00 0.00 ? 275 ASP A N    1  
ATOM   1845  C  CA   . ASP A 1 121 ? 4.926   10.038  -2.138  1.00 0.00 ? 275 ASP A CA   1  
ATOM   1846  C  C    . ASP A 1 121 ? 3.607   9.267   -2.326  1.00 0.00 ? 275 ASP A C    1  
ATOM   1847  O  O    . ASP A 1 121 ? 2.675   9.765   -2.929  1.00 0.00 ? 275 ASP A O    1  
ATOM   1848  C  CB   . ASP A 1 121 ? 5.981   9.527   -3.132  1.00 0.00 ? 275 ASP A CB   1  
ATOM   1849  C  CG   . ASP A 1 121 ? 5.602   9.963   -4.549  1.00 0.00 ? 275 ASP A CG   1  
ATOM   1850  O  OD1  . ASP A 1 121 ? 4.888   9.221   -5.204  1.00 0.00 ? 275 ASP A OD1  1  
ATOM   1851  O  OD2  . ASP A 1 121 ? 6.032   11.030  -4.954  1.00 0.00 ? 275 ASP A OD2  1  
ATOM   1852  H  H    . ASP A 1 121 ? 6.383   9.423   -0.631  1.00 0.00 ? 275 ASP A H    1  
ATOM   1853  H  HA   . ASP A 1 121 ? 4.762   11.090  -2.288  1.00 0.00 ? 275 ASP A HA   1  
ATOM   1854  H  HB2  . ASP A 1 121 ? 6.946   9.938   -2.874  1.00 0.00 ? 275 ASP A HB2  1  
ATOM   1855  H  HB3  . ASP A 1 121 ? 6.024   8.450   -3.088  1.00 0.00 ? 275 ASP A HB3  1  
ATOM   1856  N  N    . LEU A 1 122 ? 3.521   8.059   -1.809  1.00 0.00 ? 276 LEU A N    1  
ATOM   1857  C  CA   . LEU A 1 122 ? 2.244   7.268   -1.961  1.00 0.00 ? 276 LEU A CA   1  
ATOM   1858  C  C    . LEU A 1 122 ? 1.082   8.023   -1.302  1.00 0.00 ? 276 LEU A C    1  
ATOM   1859  O  O    . LEU A 1 122 ? 0.021   8.162   -1.881  1.00 0.00 ? 276 LEU A O    1  
ATOM   1860  C  CB   . LEU A 1 122 ? 2.457   5.915   -1.247  1.00 0.00 ? 276 LEU A CB   1  
ATOM   1861  C  CG   . LEU A 1 122 ? 2.659   4.802   -2.277  1.00 0.00 ? 276 LEU A CG   1  
ATOM   1862  C  CD1  . LEU A 1 122 ? 3.947   5.060   -3.062  1.00 0.00 ? 276 LEU A CD1  1  
ATOM   1863  C  CD2  . LEU A 1 122 ? 2.761   3.453   -1.552  1.00 0.00 ? 276 LEU A CD2  1  
ATOM   1864  H  H    . LEU A 1 122 ? 4.289   7.681   -1.323  1.00 0.00 ? 276 LEU A H    1  
ATOM   1865  H  HA   . LEU A 1 122 ? 2.031   7.110   -3.002  1.00 0.00 ? 276 LEU A HA   1  
ATOM   1866  H  HB2  . LEU A 1 122 ? 3.324   5.970   -0.607  1.00 0.00 ? 276 LEU A HB2  1  
ATOM   1867  H  HB3  . LEU A 1 122 ? 1.591   5.687   -0.647  1.00 0.00 ? 276 LEU A HB3  1  
ATOM   1868  H  HG   . LEU A 1 122 ? 1.820   4.785   -2.958  1.00 0.00 ? 276 LEU A HG   1  
ATOM   1869  H  HD11 . LEU A 1 122 ? 4.767   5.199   -2.373  1.00 0.00 ? 276 LEU A HD11 1  
ATOM   1870  H  HD12 . LEU A 1 122 ? 3.829   5.947   -3.666  1.00 0.00 ? 276 LEU A HD12 1  
ATOM   1871  H  HD13 . LEU A 1 122 ? 4.153   4.214   -3.702  1.00 0.00 ? 276 LEU A HD13 1  
ATOM   1872  H  HD21 . LEU A 1 122 ? 3.055   3.614   -0.524  1.00 0.00 ? 276 LEU A HD21 1  
ATOM   1873  H  HD22 . LEU A 1 122 ? 3.497   2.833   -2.044  1.00 0.00 ? 276 LEU A HD22 1  
ATOM   1874  H  HD23 . LEU A 1 122 ? 1.802   2.958   -1.577  1.00 0.00 ? 276 LEU A HD23 1  
ATOM   1875  N  N    . VAL A 1 123 ? 1.273   8.511   -0.097  1.00 0.00 ? 277 VAL A N    1  
ATOM   1876  C  CA   . VAL A 1 123 ? 0.160   9.257   0.589   1.00 0.00 ? 277 VAL A CA   1  
ATOM   1877  C  C    . VAL A 1 123 ? -0.116  10.577  -0.145  1.00 0.00 ? 277 VAL A C    1  
ATOM   1878  O  O    . VAL A 1 123 ? -1.259  10.965  -0.307  1.00 0.00 ? 277 VAL A O    1  
ATOM   1879  C  CB   . VAL A 1 123 ? 0.625   9.513   2.033   1.00 0.00 ? 277 VAL A CB   1  
ATOM   1880  C  CG1  . VAL A 1 123 ? -0.452  10.290  2.804   1.00 0.00 ? 277 VAL A CG1  1  
ATOM   1881  C  CG2  . VAL A 1 123 ? 0.885   8.163   2.721   1.00 0.00 ? 277 VAL A CG2  1  
ATOM   1882  H  H    . VAL A 1 123 ? 2.144   8.385   0.350   1.00 0.00 ? 277 VAL A H    1  
ATOM   1883  H  HA   . VAL A 1 123 ? -0.731  8.654   0.596   1.00 0.00 ? 277 VAL A HA   1  
ATOM   1884  H  HB   . VAL A 1 123 ? 1.539   10.090  2.017   1.00 0.00 ? 277 VAL A HB   1  
ATOM   1885  H  HG11 . VAL A 1 123 ? -1.172  10.698  2.110   1.00 0.00 ? 277 VAL A HG11 1  
ATOM   1886  H  HG12 . VAL A 1 123 ? 0.011   11.096  3.354   1.00 0.00 ? 277 VAL A HG12 1  
ATOM   1887  H  HG13 . VAL A 1 123 ? -0.954  9.629   3.494   1.00 0.00 ? 277 VAL A HG13 1  
ATOM   1888  H  HG21 . VAL A 1 123 ? 0.394   7.371   2.168   1.00 0.00 ? 277 VAL A HG21 1  
ATOM   1889  H  HG22 . VAL A 1 123 ? 0.498   8.190   3.729   1.00 0.00 ? 277 VAL A HG22 1  
ATOM   1890  H  HG23 . VAL A 1 123 ? 1.948   7.974   2.750   1.00 0.00 ? 277 VAL A HG23 1  
ATOM   1891  N  N    . THR A 1 124 ? 0.909   11.262  -0.606  1.00 0.00 ? 278 THR A N    1  
ATOM   1892  C  CA   . THR A 1 124 ? 0.659   12.550  -1.347  1.00 0.00 ? 278 THR A CA   1  
ATOM   1893  C  C    . THR A 1 124 ? -0.104  12.252  -2.649  1.00 0.00 ? 278 THR A C    1  
ATOM   1894  O  O    . THR A 1 124 ? -0.958  13.020  -3.053  1.00 0.00 ? 278 THR A O    1  
ATOM   1895  C  CB   . THR A 1 124 ? 2.034   13.176  -1.657  1.00 0.00 ? 278 THR A CB   1  
ATOM   1896  O  OG1  . THR A 1 124 ? 3.041   12.501  -0.916  1.00 0.00 ? 278 THR A OG1  1  
ATOM   1897  C  CG2  . THR A 1 124 ? 2.024   14.658  -1.269  1.00 0.00 ? 278 THR A CG2  1  
ATOM   1898  H  H    . THR A 1 124 ? 1.826   10.925  -0.478  1.00 0.00 ? 278 THR A H    1  
ATOM   1899  H  HA   . THR A 1 124 ? 0.080   13.220  -0.729  1.00 0.00 ? 278 THR A HA   1  
ATOM   1900  H  HB   . THR A 1 124 ? 2.242   13.087  -2.712  1.00 0.00 ? 278 THR A HB   1  
ATOM   1901  H  HG1  . THR A 1 124 ? 3.896   12.775  -1.256  1.00 0.00 ? 278 THR A HG1  1  
ATOM   1902  H  HG21 . THR A 1 124 ? 1.005   15.013  -1.222  1.00 0.00 ? 278 THR A HG21 1  
ATOM   1903  H  HG22 . THR A 1 124 ? 2.570   15.227  -2.007  1.00 0.00 ? 278 THR A HG22 1  
ATOM   1904  H  HG23 . THR A 1 124 ? 2.493   14.779  -0.302  1.00 0.00 ? 278 THR A HG23 1  
ATOM   1905  N  N    . ALA A 1 125 ? 0.178   11.138  -3.307  1.00 0.00 ? 279 ALA A N    1  
ATOM   1906  C  CA   . ALA A 1 125 ? -0.571  10.818  -4.575  1.00 0.00 ? 279 ALA A CA   1  
ATOM   1907  C  C    . ALA A 1 125 ? -2.051  10.513  -4.268  1.00 0.00 ? 279 ALA A C    1  
ATOM   1908  O  O    . ALA A 1 125 ? -2.912  10.744  -5.097  1.00 0.00 ? 279 ALA A O    1  
ATOM   1909  C  CB   . ALA A 1 125 ? 0.107   9.583   -5.191  1.00 0.00 ? 279 ALA A CB   1  
ATOM   1910  H  H    . ALA A 1 125 ? 0.866   10.515  -2.962  1.00 0.00 ? 279 ALA A H    1  
ATOM   1911  H  HA   . ALA A 1 125 ? -0.504  11.647  -5.258  1.00 0.00 ? 279 ALA A HA   1  
ATOM   1912  H  HB1  . ALA A 1 125 ? 1.148   9.565   -4.906  1.00 0.00 ? 279 ALA A HB1  1  
ATOM   1913  H  HB2  . ALA A 1 125 ? 0.029   9.629   -6.267  1.00 0.00 ? 279 ALA A HB2  1  
ATOM   1914  H  HB3  . ALA A 1 125 ? -0.381  8.689   -4.833  1.00 0.00 ? 279 ALA A HB3  1  
ATOM   1915  N  N    . CYS A 1 126 ? -2.362  9.998   -3.091  1.00 0.00 ? 280 CYS A N    1  
ATOM   1916  C  CA   . CYS A 1 126 ? -3.802  9.691   -2.768  1.00 0.00 ? 280 CYS A CA   1  
ATOM   1917  C  C    . CYS A 1 126 ? -4.626  10.986  -2.797  1.00 0.00 ? 280 CYS A C    1  
ATOM   1918  O  O    . CYS A 1 126 ? -5.643  11.057  -3.459  1.00 0.00 ? 280 CYS A O    1  
ATOM   1919  C  CB   . CYS A 1 126 ? -3.814  9.076   -1.351  1.00 0.00 ? 280 CYS A CB   1  
ATOM   1920  S  SG   . CYS A 1 126 ? -5.513  8.694   -0.838  1.00 0.00 ? 280 CYS A SG   1  
ATOM   1921  H  H    . CYS A 1 126 ? -1.658  9.817   -2.431  1.00 0.00 ? 280 CYS A H    1  
ATOM   1922  H  HA   . CYS A 1 126 ? -4.198  8.985   -3.480  1.00 0.00 ? 280 CYS A HA   1  
ATOM   1923  H  HB2  . CYS A 1 126 ? -3.231  8.167   -1.353  1.00 0.00 ? 280 CYS A HB2  1  
ATOM   1924  H  HB3  . CYS A 1 126 ? -3.378  9.777   -0.654  1.00 0.00 ? 280 CYS A HB3  1  
ATOM   1925  H  HG   . CYS A 1 126 ? -5.887  8.080   -1.473  1.00 0.00 ? 280 CYS A HG   1  
ATOM   1926  N  N    . ASN A 1 127 ? -4.203  12.008  -2.082  1.00 0.00 ? 281 ASN A N    1  
ATOM   1927  C  CA   . ASN A 1 127 ? -4.995  13.291  -2.084  1.00 0.00 ? 281 ASN A CA   1  
ATOM   1928  C  C    . ASN A 1 127 ? -5.077  13.864  -3.504  1.00 0.00 ? 281 ASN A C    1  
ATOM   1929  O  O    . ASN A 1 127 ? -6.109  14.367  -3.909  1.00 0.00 ? 281 ASN A O    1  
ATOM   1930  C  CB   . ASN A 1 127 ? -4.263  14.273  -1.155  1.00 0.00 ? 281 ASN A CB   1  
ATOM   1931  C  CG   . ASN A 1 127 ? -4.238  13.710  0.271   1.00 0.00 ? 281 ASN A CG   1  
ATOM   1932  O  OD1  . ASN A 1 127 ? -4.111  12.517  0.459   1.00 0.00 ? 281 ASN A OD1  1  
ATOM   1933  N  ND2  . ASN A 1 127 ? -4.353  14.520  1.296   1.00 0.00 ? 281 ASN A ND2  1  
ATOM   1934  H  H    . ASN A 1 127 ? -3.374  11.928  -1.549  1.00 0.00 ? 281 ASN A H    1  
ATOM   1935  H  HA   . ASN A 1 127 ? -5.987  13.105  -1.713  1.00 0.00 ? 281 ASN A HA   1  
ATOM   1936  H  HB2  . ASN A 1 127 ? -3.251  14.413  -1.506  1.00 0.00 ? 281 ASN A HB2  1  
ATOM   1937  H  HB3  . ASN A 1 127 ? -4.779  15.222  -1.156  1.00 0.00 ? 281 ASN A HB3  1  
ATOM   1938  H  HD21 . ASN A 1 127 ? -4.455  15.487  1.157   1.00 0.00 ? 281 ASN A HD21 1  
ATOM   1939  H  HD22 . ASN A 1 127 ? -4.336  14.158  2.206   1.00 0.00 ? 281 ASN A HD22 1  
ATOM   1940  N  N    . SER A 1 128 ? -4.010  13.787  -4.268  1.00 0.00 ? 282 SER A N    1  
ATOM   1941  C  CA   . SER A 1 128 ? -4.064  14.331  -5.671  1.00 0.00 ? 282 SER A CA   1  
ATOM   1942  C  C    . SER A 1 128 ? -4.933  13.424  -6.553  1.00 0.00 ? 282 SER A C    1  
ATOM   1943  O  O    . SER A 1 128 ? -5.650  13.903  -7.413  1.00 0.00 ? 282 SER A O    1  
ATOM   1944  C  CB   . SER A 1 128 ? -2.621  14.365  -6.194  1.00 0.00 ? 282 SER A CB   1  
ATOM   1945  O  OG   . SER A 1 128 ? -2.445  15.515  -7.012  1.00 0.00 ? 282 SER A OG   1  
ATOM   1946  H  H    . SER A 1 128 ? -3.187  13.368  -3.924  1.00 0.00 ? 282 SER A H    1  
ATOM   1947  H  HA   . SER A 1 128 ? -4.475  15.325  -5.659  1.00 0.00 ? 282 SER A HA   1  
ATOM   1948  H  HB2  . SER A 1 128 ? -1.936  14.413  -5.364  1.00 0.00 ? 282 SER A HB2  1  
ATOM   1949  H  HB3  . SER A 1 128 ? -2.426  13.469  -6.767  1.00 0.00 ? 282 SER A HB3  1  
ATOM   1950  H  HG   . SER A 1 128 ? -2.848  15.336  -7.865  1.00 0.00 ? 282 SER A HG   1  
ATOM   1951  N  N    . VAL A 1 129 ? -4.893  12.123  -6.345  1.00 0.00 ? 283 VAL A N    1  
ATOM   1952  C  CA   . VAL A 1 129 ? -5.747  11.215  -7.186  1.00 0.00 ? 283 VAL A CA   1  
ATOM   1953  C  C    . VAL A 1 129 ? -7.194  11.262  -6.689  1.00 0.00 ? 283 VAL A C    1  
ATOM   1954  O  O    . VAL A 1 129 ? -8.116  11.261  -7.486  1.00 0.00 ? 283 VAL A O    1  
ATOM   1955  C  CB   . VAL A 1 129 ? -5.163  9.798   -7.047  1.00 0.00 ? 283 VAL A CB   1  
ATOM   1956  C  CG1  . VAL A 1 129 ? -5.992  8.812   -7.876  1.00 0.00 ? 283 VAL A CG1  1  
ATOM   1957  C  CG2  . VAL A 1 129 ? -3.717  9.794   -7.549  1.00 0.00 ? 283 VAL A CG2  1  
ATOM   1958  H  H    . VAL A 1 129 ? -4.317  11.752  -5.638  1.00 0.00 ? 283 VAL A H    1  
ATOM   1959  H  HA   . VAL A 1 129 ? -5.712  11.532  -8.213  1.00 0.00 ? 283 VAL A HA   1  
ATOM   1960  H  HB   . VAL A 1 129 ? -5.186  9.502   -6.008  1.00 0.00 ? 283 VAL A HB   1  
ATOM   1961  H  HG11 . VAL A 1 129 ? -5.617  7.810   -7.725  1.00 0.00 ? 283 VAL A HG11 1  
ATOM   1962  H  HG12 . VAL A 1 129 ? -5.918  9.070   -8.922  1.00 0.00 ? 283 VAL A HG12 1  
ATOM   1963  H  HG13 . VAL A 1 129 ? -7.026  8.860   -7.565  1.00 0.00 ? 283 VAL A HG13 1  
ATOM   1964  H  HG21 . VAL A 1 129 ? -3.138  9.090   -6.969  1.00 0.00 ? 283 VAL A HG21 1  
ATOM   1965  H  HG22 . VAL A 1 129 ? -3.296  10.782  -7.442  1.00 0.00 ? 283 VAL A HG22 1  
ATOM   1966  H  HG23 . VAL A 1 129 ? -3.698  9.505   -8.589  1.00 0.00 ? 283 VAL A HG23 1  
ATOM   1967  N  N    . PHE A 1 130 ? -7.414  11.330  -5.392  1.00 0.00 ? 284 PHE A N    1  
ATOM   1968  C  CA   . PHE A 1 130 ? -8.832  11.409  -4.904  1.00 0.00 ? 284 PHE A CA   1  
ATOM   1969  C  C    . PHE A 1 130 ? -9.383  12.817  -5.173  1.00 0.00 ? 284 PHE A C    1  
ATOM   1970  O  O    . PHE A 1 130 ? -10.564 12.976  -5.420  1.00 0.00 ? 284 PHE A O    1  
ATOM   1971  C  CB   . PHE A 1 130 ? -8.840  11.083  -3.397  1.00 0.00 ? 284 PHE A CB   1  
ATOM   1972  C  CG   . PHE A 1 130 ? -9.492  9.734   -3.191  1.00 0.00 ? 284 PHE A CG   1  
ATOM   1973  C  CD1  . PHE A 1 130 ? -10.820 9.535   -3.587  1.00 0.00 ? 284 PHE A CD1  1  
ATOM   1974  C  CD2  . PHE A 1 130 ? -8.767  8.681   -2.622  1.00 0.00 ? 284 PHE A CD2  1  
ATOM   1975  C  CE1  . PHE A 1 130 ? -11.423 8.283   -3.416  1.00 0.00 ? 284 PHE A CE1  1  
ATOM   1976  C  CE2  . PHE A 1 130 ? -9.371  7.429   -2.448  1.00 0.00 ? 284 PHE A CE2  1  
ATOM   1977  C  CZ   . PHE A 1 130 ? -10.698 7.230   -2.846  1.00 0.00 ? 284 PHE A CZ   1  
ATOM   1978  H  H    . PHE A 1 130 ? -6.659  11.357  -4.759  1.00 0.00 ? 284 PHE A H    1  
ATOM   1979  H  HA   . PHE A 1 130 ? -9.429  10.687  -5.440  1.00 0.00 ? 284 PHE A HA   1  
ATOM   1980  H  HB2  . PHE A 1 130 ? -7.830  11.058  -3.019  1.00 0.00 ? 284 PHE A HB2  1  
ATOM   1981  H  HB3  . PHE A 1 130 ? -9.403  11.837  -2.869  1.00 0.00 ? 284 PHE A HB3  1  
ATOM   1982  H  HD1  . PHE A 1 130 ? -11.380 10.347  -4.027  1.00 0.00 ? 284 PHE A HD1  1  
ATOM   1983  H  HD2  . PHE A 1 130 ? -7.743  8.834   -2.316  1.00 0.00 ? 284 PHE A HD2  1  
ATOM   1984  H  HE1  . PHE A 1 130 ? -12.446 8.131   -3.724  1.00 0.00 ? 284 PHE A HE1  1  
ATOM   1985  H  HE2  . PHE A 1 130 ? -8.812  6.617   -2.009  1.00 0.00 ? 284 PHE A HE2  1  
ATOM   1986  H  HZ   . PHE A 1 130 ? -11.163 6.264   -2.716  1.00 0.00 ? 284 PHE A HZ   1  
ATOM   1987  N  N    . GLU A 1 131 ? -8.544  13.846  -5.166  1.00 0.00 ? 285 GLU A N    1  
ATOM   1988  C  CA   . GLU A 1 131 ? -9.068  15.226  -5.471  1.00 0.00 ? 285 GLU A CA   1  
ATOM   1989  C  C    . GLU A 1 131 ? -9.721  15.215  -6.861  1.00 0.00 ? 285 GLU A C    1  
ATOM   1990  O  O    . GLU A 1 131 ? -10.762 15.812  -7.062  1.00 0.00 ? 285 GLU A O    1  
ATOM   1991  C  CB   . GLU A 1 131 ? -7.866  16.185  -5.448  1.00 0.00 ? 285 GLU A CB   1  
ATOM   1992  C  CG   . GLU A 1 131 ? -8.348  17.618  -5.690  1.00 0.00 ? 285 GLU A CG   1  
ATOM   1993  C  CD   . GLU A 1 131 ? -7.537  18.586  -4.826  1.00 0.00 ? 285 GLU A CD   1  
ATOM   1994  O  OE1  . GLU A 1 131 ? -7.330  18.279  -3.663  1.00 0.00 ? 285 GLU A OE1  1  
ATOM   1995  O  OE2  . GLU A 1 131 ? -7.137  19.616  -5.341  1.00 0.00 ? 285 GLU A OE2  1  
ATOM   1996  H  H    . GLU A 1 131 ? -7.584  13.706  -4.988  1.00 0.00 ? 285 GLU A H    1  
ATOM   1997  H  HA   . GLU A 1 131 ? -9.791  15.519  -4.730  1.00 0.00 ? 285 GLU A HA   1  
ATOM   1998  H  HB2  . GLU A 1 131 ? -7.377  16.125  -4.487  1.00 0.00 ? 285 GLU A HB2  1  
ATOM   1999  H  HB3  . GLU A 1 131 ? -7.169  15.906  -6.224  1.00 0.00 ? 285 GLU A HB3  1  
ATOM   2000  H  HG2  . GLU A 1 131 ? -8.218  17.870  -6.733  1.00 0.00 ? 285 GLU A HG2  1  
ATOM   2001  H  HG3  . GLU A 1 131 ? -9.393  17.696  -5.429  1.00 0.00 ? 285 GLU A HG3  1  
ATOM   2002  N  N    . ASN A 1 132 ? -9.137  14.511  -7.816  1.00 0.00 ? 286 ASN A N    1  
ATOM   2003  C  CA   . ASN A 1 132 ? -9.776  14.446  -9.180  1.00 0.00 ? 286 ASN A CA   1  
ATOM   2004  C  C    . ASN A 1 132 ? -11.192 13.846  -9.061  1.00 0.00 ? 286 ASN A C    1  
ATOM   2005  O  O    . ASN A 1 132 ? -12.077 14.190  -9.822  1.00 0.00 ? 286 ASN A O    1  
ATOM   2006  C  CB   . ASN A 1 132 ? -8.887  13.540  -10.047 1.00 0.00 ? 286 ASN A CB   1  
ATOM   2007  C  CG   . ASN A 1 132 ? -7.620  14.304  -10.453 1.00 0.00 ? 286 ASN A CG   1  
ATOM   2008  O  OD1  . ASN A 1 132 ? -6.757  14.541  -9.632  1.00 0.00 ? 286 ASN A OD1  1  
ATOM   2009  N  ND2  . ASN A 1 132 ? -7.467  14.705  -11.692 1.00 0.00 ? 286 ASN A ND2  1  
ATOM   2010  H  H    . ASN A 1 132 ? -8.303  14.010  -7.627  1.00 0.00 ? 286 ASN A H    1  
ATOM   2011  H  HA   . ASN A 1 132 ? -9.828  15.431  -9.610  1.00 0.00 ? 286 ASN A HA   1  
ATOM   2012  H  HB2  . ASN A 1 132 ? -8.613  12.660  -9.484  1.00 0.00 ? 286 ASN A HB2  1  
ATOM   2013  H  HB3  . ASN A 1 132 ? -9.428  13.247  -10.934 1.00 0.00 ? 286 ASN A HB3  1  
ATOM   2014  H  HD21 . ASN A 1 132 ? -8.159  14.520  -12.364 1.00 0.00 ? 286 ASN A HD21 1  
ATOM   2015  H  HD22 . ASN A 1 132 ? -6.657  15.193  -11.948 1.00 0.00 ? 286 ASN A HD22 1  
ATOM   2016  N  N    . LEU A 1 133 ? -11.422 12.960  -8.102  1.00 0.00 ? 287 LEU A N    1  
ATOM   2017  C  CA   . LEU A 1 133 ? -12.796 12.359  -7.939  1.00 0.00 ? 287 LEU A CA   1  
ATOM   2018  C  C    . LEU A 1 133 ? -13.840 13.481  -7.789  1.00 0.00 ? 287 LEU A C    1  
ATOM   2019  O  O    . LEU A 1 133 ? -14.927 13.395  -8.330  1.00 0.00 ? 287 LEU A O    1  
ATOM   2020  C  CB   . LEU A 1 133 ? -12.747 11.511  -6.649  1.00 0.00 ? 287 LEU A CB   1  
ATOM   2021  C  CG   . LEU A 1 133 ? -13.797 10.388  -6.684  1.00 0.00 ? 287 LEU A CG   1  
ATOM   2022  C  CD1  . LEU A 1 133 ? -15.196 10.972  -6.920  1.00 0.00 ? 287 LEU A CD1  1  
ATOM   2023  C  CD2  . LEU A 1 133 ? -13.454 9.399   -7.803  1.00 0.00 ? 287 LEU A CD2  1  
ATOM   2024  H  H    . LEU A 1 133 ? -10.698 12.700  -7.492  1.00 0.00 ? 287 LEU A H    1  
ATOM   2025  H  HA   . LEU A 1 133 ? -13.036 11.734  -8.785  1.00 0.00 ? 287 LEU A HA   1  
ATOM   2026  H  HB2  . LEU A 1 133 ? -11.765 11.071  -6.552  1.00 0.00 ? 287 LEU A HB2  1  
ATOM   2027  H  HB3  . LEU A 1 133 ? -12.933 12.149  -5.800  1.00 0.00 ? 287 LEU A HB3  1  
ATOM   2028  H  HG   . LEU A 1 133 ? -13.789 9.870   -5.736  1.00 0.00 ? 287 LEU A HG   1  
ATOM   2029  H  HD11 . LEU A 1 133 ? -15.939 10.308  -6.507  1.00 0.00 ? 287 LEU A HD11 1  
ATOM   2030  H  HD12 . LEU A 1 133 ? -15.364 11.086  -7.980  1.00 0.00 ? 287 LEU A HD12 1  
ATOM   2031  H  HD13 . LEU A 1 133 ? -15.268 11.936  -6.438  1.00 0.00 ? 287 LEU A HD13 1  
ATOM   2032  H  HD21 . LEU A 1 133 ? -13.671 9.847   -8.761  1.00 0.00 ? 287 LEU A HD21 1  
ATOM   2033  H  HD22 . LEU A 1 133 ? -14.046 8.501   -7.683  1.00 0.00 ? 287 LEU A HD22 1  
ATOM   2034  H  HD23 . LEU A 1 133 ? -12.405 9.147   -7.751  1.00 0.00 ? 287 LEU A HD23 1  
ATOM   2035  N  N    . GLU A 1 134 ? -13.520 14.536  -7.061  1.00 0.00 ? 288 GLU A N    1  
ATOM   2036  C  CA   . GLU A 1 134 ? -14.517 15.655  -6.895  1.00 0.00 ? 288 GLU A CA   1  
ATOM   2037  C  C    . GLU A 1 134 ? -14.871 16.248  -8.266  1.00 0.00 ? 288 GLU A C    1  
ATOM   2038  O  O    . GLU A 1 134 ? -16.022 16.529  -8.544  1.00 0.00 ? 288 GLU A O    1  
ATOM   2039  C  CB   . GLU A 1 134 ? -13.849 16.723  -6.013  1.00 0.00 ? 288 GLU A CB   1  
ATOM   2040  C  CG   . GLU A 1 134 ? -14.149 16.431  -4.542  1.00 0.00 ? 288 GLU A CG   1  
ATOM   2041  C  CD   . GLU A 1 134 ? -15.531 16.979  -4.184  1.00 0.00 ? 288 GLU A CD   1  
ATOM   2042  O  OE1  . GLU A 1 134 ? -15.804 18.117  -4.531  1.00 0.00 ? 288 GLU A OE1  1  
ATOM   2043  O  OE2  . GLU A 1 134 ? -16.294 16.252  -3.569  1.00 0.00 ? 288 GLU A OE2  1  
ATOM   2044  H  H    . GLU A 1 134 ? -12.630 14.588  -6.630  1.00 0.00 ? 288 GLU A H    1  
ATOM   2045  H  HA   . GLU A 1 134 ? -15.406 15.287  -6.415  1.00 0.00 ? 288 GLU A HA   1  
ATOM   2046  H  HB2  . GLU A 1 134 ? -12.781 16.706  -6.174  1.00 0.00 ? 288 GLU A HB2  1  
ATOM   2047  H  HB3  . GLU A 1 134 ? -14.237 17.697  -6.271  1.00 0.00 ? 288 GLU A HB3  1  
ATOM   2048  H  HG2  . GLU A 1 134 ? -14.129 15.364  -4.376  1.00 0.00 ? 288 GLU A HG2  1  
ATOM   2049  H  HG3  . GLU A 1 134 ? -13.404 16.907  -3.922  1.00 0.00 ? 288 GLU A HG3  1  
ATOM   2050  N  N    . GLN A 1 135 ? -13.894 16.431  -9.129  1.00 0.00 ? 289 GLN A N    1  
ATOM   2051  C  CA   . GLN A 1 135 ? -14.203 17.001  -10.490 1.00 0.00 ? 289 GLN A CA   1  
ATOM   2052  C  C    . GLN A 1 135 ? -15.114 16.033  -11.259 1.00 0.00 ? 289 GLN A C    1  
ATOM   2053  O  O    . GLN A 1 135 ? -16.037 16.453  -11.931 1.00 0.00 ? 289 GLN A O    1  
ATOM   2054  C  CB   . GLN A 1 135 ? -12.860 17.162  -11.221 1.00 0.00 ? 289 GLN A CB   1  
ATOM   2055  C  CG   . GLN A 1 135 ? -12.023 18.234  -10.519 1.00 0.00 ? 289 GLN A CG   1  
ATOM   2056  C  CD   . GLN A 1 135 ? -12.552 19.624  -10.895 1.00 0.00 ? 289 GLN A CD   1  
ATOM   2057  O  OE1  . GLN A 1 135 ? -13.224 20.258  -10.106 1.00 0.00 ? 289 GLN A OE1  1  
ATOM   2058  N  NE2  . GLN A 1 135 ? -12.279 20.132  -12.072 1.00 0.00 ? 289 GLN A NE2  1  
ATOM   2059  H  H    . GLN A 1 135 ? -12.971 16.189  -8.883  1.00 0.00 ? 289 GLN A H    1  
ATOM   2060  H  HA   . GLN A 1 135 ? -14.684 17.962  -10.389 1.00 0.00 ? 289 GLN A HA   1  
ATOM   2061  H  HB2  . GLN A 1 135 ? -12.328 16.222  -11.206 1.00 0.00 ? 289 GLN A HB2  1  
ATOM   2062  H  HB3  . GLN A 1 135 ? -13.039 17.459  -12.243 1.00 0.00 ? 289 GLN A HB3  1  
ATOM   2063  H  HG2  . GLN A 1 135 ? -12.089 18.099  -9.449  1.00 0.00 ? 289 GLN A HG2  1  
ATOM   2064  H  HG3  . GLN A 1 135 ? -10.993 18.148  -10.831 1.00 0.00 ? 289 GLN A HG3  1  
ATOM   2065  H  HE21 . GLN A 1 135 ? -11.737 19.628  -12.718 1.00 0.00 ? 289 GLN A HE21 1  
ATOM   2066  H  HE22 . GLN A 1 135 ? -12.619 21.020  -12.309 1.00 0.00 ? 289 GLN A HE22 1  
ATOM   2067  N  N    . LEU A 1 136 ? -14.871 14.739  -11.163 1.00 0.00 ? 290 LEU A N    1  
ATOM   2068  C  CA   . LEU A 1 136 ? -15.750 13.759  -11.897 1.00 0.00 ? 290 LEU A CA   1  
ATOM   2069  C  C    . LEU A 1 136 ? -17.204 13.893  -11.412 1.00 0.00 ? 290 LEU A C    1  
ATOM   2070  O  O    . LEU A 1 136 ? -18.129 13.814  -12.198 1.00 0.00 ? 290 LEU A O    1  
ATOM   2071  C  CB   . LEU A 1 136 ? -15.211 12.356  -11.577 1.00 0.00 ? 290 LEU A CB   1  
ATOM   2072  C  CG   . LEU A 1 136 ? -15.640 11.379  -12.673 1.00 0.00 ? 290 LEU A CG   1  
ATOM   2073  C  CD1  . LEU A 1 136 ? -14.708 11.524  -13.878 1.00 0.00 ? 290 LEU A CD1  1  
ATOM   2074  C  CD2  . LEU A 1 136 ? -15.560 9.948   -12.138 1.00 0.00 ? 290 LEU A CD2  1  
ATOM   2075  H  H    . LEU A 1 136 ? -14.120 14.418  -10.608 1.00 0.00 ? 290 LEU A H    1  
ATOM   2076  H  HA   . LEU A 1 136 ? -15.698 13.939  -12.955 1.00 0.00 ? 290 LEU A HA   1  
ATOM   2077  H  HB2  . LEU A 1 136 ? -14.132 12.388  -11.525 1.00 0.00 ? 290 LEU A HB2  1  
ATOM   2078  H  HB3  . LEU A 1 136 ? -15.607 12.026  -10.628 1.00 0.00 ? 290 LEU A HB3  1  
ATOM   2079  H  HG   . LEU A 1 136 ? -16.654 11.598  -12.974 1.00 0.00 ? 290 LEU A HG   1  
ATOM   2080  H  HD11 . LEU A 1 136 ? -13.682 11.528  -13.542 1.00 0.00 ? 290 LEU A HD11 1  
ATOM   2081  H  HD12 . LEU A 1 136 ? -14.922 12.451  -14.389 1.00 0.00 ? 290 LEU A HD12 1  
ATOM   2082  H  HD13 . LEU A 1 136 ? -14.863 10.696  -14.554 1.00 0.00 ? 290 LEU A HD13 1  
ATOM   2083  H  HD21 . LEU A 1 136 ? -14.671 9.837   -11.536 1.00 0.00 ? 290 LEU A HD21 1  
ATOM   2084  H  HD22 . LEU A 1 136 ? -15.522 9.256   -12.966 1.00 0.00 ? 290 LEU A HD22 1  
ATOM   2085  H  HD23 . LEU A 1 136 ? -16.432 9.740   -11.535 1.00 0.00 ? 290 LEU A HD23 1  
ATOM   2086  N  N    . LEU A 1 137 ? -17.415 14.098  -10.127 1.00 0.00 ? 291 LEU A N    1  
ATOM   2087  C  CA   . LEU A 1 137 ? -18.827 14.239  -9.613  1.00 0.00 ? 291 LEU A CA   1  
ATOM   2088  C  C    . LEU A 1 137 ? -19.548 15.401  -10.323 1.00 0.00 ? 291 LEU A C    1  
ATOM   2089  O  O    . LEU A 1 137 ? -20.740 15.334  -10.559 1.00 0.00 ? 291 LEU A O    1  
ATOM   2090  C  CB   . LEU A 1 137 ? -18.723 14.530  -8.107  1.00 0.00 ? 291 LEU A CB   1  
ATOM   2091  C  CG   . LEU A 1 137 ? -19.979 14.019  -7.400  1.00 0.00 ? 291 LEU A CG   1  
ATOM   2092  C  CD1  . LEU A 1 137 ? -19.710 13.908  -5.898  1.00 0.00 ? 291 LEU A CD1  1  
ATOM   2093  C  CD2  . LEU A 1 137 ? -21.132 14.997  -7.640  1.00 0.00 ? 291 LEU A CD2  1  
ATOM   2094  H  H    . LEU A 1 137 ? -16.649 14.161  -9.509  1.00 0.00 ? 291 LEU A H    1  
ATOM   2095  H  HA   . LEU A 1 137 ? -19.369 13.319  -9.769  1.00 0.00 ? 291 LEU A HA   1  
ATOM   2096  H  HB2  . LEU A 1 137 ? -17.854 14.030  -7.703  1.00 0.00 ? 291 LEU A HB2  1  
ATOM   2097  H  HB3  . LEU A 1 137 ? -18.632 15.594  -7.950  1.00 0.00 ? 291 LEU A HB3  1  
ATOM   2098  H  HG   . LEU A 1 137 ? -20.242 13.046  -7.791  1.00 0.00 ? 291 LEU A HG   1  
ATOM   2099  H  HD11 . LEU A 1 137 ? -19.899 14.862  -5.427  1.00 0.00 ? 291 LEU A HD11 1  
ATOM   2100  H  HD12 . LEU A 1 137 ? -18.681 13.625  -5.736  1.00 0.00 ? 291 LEU A HD12 1  
ATOM   2101  H  HD13 . LEU A 1 137 ? -20.361 13.161  -5.470  1.00 0.00 ? 291 LEU A HD13 1  
ATOM   2102  H  HD21 . LEU A 1 137 ? -20.745 16.004  -7.687  1.00 0.00 ? 291 LEU A HD21 1  
ATOM   2103  H  HD22 . LEU A 1 137 ? -21.843 14.921  -6.831  1.00 0.00 ? 291 LEU A HD22 1  
ATOM   2104  H  HD23 . LEU A 1 137 ? -21.620 14.755  -8.573  1.00 0.00 ? 291 LEU A HD23 1  
ATOM   2105  N  N    . GLN A 1 138 ? -18.843 16.463  -10.670 1.00 0.00 ? 292 GLN A N    1  
ATOM   2106  C  CA   . GLN A 1 138 ? -19.523 17.612  -11.369 1.00 0.00 ? 292 GLN A CA   1  
ATOM   2107  C  C    . GLN A 1 138 ? -19.658 17.329  -12.877 1.00 0.00 ? 292 GLN A C    1  
ATOM   2108  O  O    . GLN A 1 138 ? -20.618 17.745  -13.497 1.00 0.00 ? 292 GLN A O    1  
ATOM   2109  C  CB   . GLN A 1 138 ? -18.642 18.851  -11.138 1.00 0.00 ? 292 GLN A CB   1  
ATOM   2110  C  CG   . GLN A 1 138 ? -19.027 19.513  -9.813  1.00 0.00 ? 292 GLN A CG   1  
ATOM   2111  C  CD   . GLN A 1 138 ? -18.879 21.035  -9.937  1.00 0.00 ? 292 GLN A CD   1  
ATOM   2112  O  OE1  . GLN A 1 138 ? -18.152 21.645  -9.179  1.00 0.00 ? 292 GLN A OE1  1  
ATOM   2113  N  NE2  . GLN A 1 138 ? -19.540 21.684  -10.866 1.00 0.00 ? 292 GLN A NE2  1  
ATOM   2114  H  H    . GLN A 1 138 ? -17.877 16.502  -10.476 1.00 0.00 ? 292 GLN A H    1  
ATOM   2115  H  HA   . GLN A 1 138 ? -20.499 17.777  -10.939 1.00 0.00 ? 292 GLN A HA   1  
ATOM   2116  H  HB2  . GLN A 1 138 ? -17.604 18.554  -11.106 1.00 0.00 ? 292 GLN A HB2  1  
ATOM   2117  H  HB3  . GLN A 1 138 ? -18.791 19.553  -11.945 1.00 0.00 ? 292 GLN A HB3  1  
ATOM   2118  H  HG2  . GLN A 1 138 ? -20.052 19.268  -9.574  1.00 0.00 ? 292 GLN A HG2  1  
ATOM   2119  H  HG3  . GLN A 1 138 ? -18.378 19.153  -9.029  1.00 0.00 ? 292 GLN A HG3  1  
ATOM   2120  H  HE21 . GLN A 1 138 ? -20.131 21.202  -11.484 1.00 0.00 ? 292 GLN A HE21 1  
ATOM   2121  H  HE22 . GLN A 1 138 ? -19.443 22.656  -10.943 1.00 0.00 ? 292 GLN A HE22 1  
ATOM   2122  N  N    . GLN A 1 139 ? -18.713 16.628  -13.477 1.00 0.00 ? 293 GLN A N    1  
ATOM   2123  C  CA   . GLN A 1 139 ? -18.819 16.337  -14.943 1.00 0.00 ? 293 GLN A CA   1  
ATOM   2124  C  C    . GLN A 1 139 ? -19.185 14.860  -15.171 1.00 0.00 ? 293 GLN A C    1  
ATOM   2125  O  O    . GLN A 1 139 ? -18.444 14.124  -15.797 1.00 0.00 ? 293 GLN A O    1  
ATOM   2126  C  CB   . GLN A 1 139 ? -17.434 16.647  -15.523 1.00 0.00 ? 293 GLN A CB   1  
ATOM   2127  C  CG   . GLN A 1 139 ? -17.186 18.156  -15.478 1.00 0.00 ? 293 GLN A CG   1  
ATOM   2128  C  CD   . GLN A 1 139 ? -16.082 18.524  -16.477 1.00 0.00 ? 293 GLN A CD   1  
ATOM   2129  O  OE1  . GLN A 1 139 ? -15.054 17.878  -16.521 1.00 0.00 ? 293 GLN A OE1  1  
ATOM   2130  N  NE2  . GLN A 1 139 ? -16.246 19.540  -17.289 1.00 0.00 ? 293 GLN A NE2  1  
ATOM   2131  H  H    . GLN A 1 139 ? -17.940 16.294  -12.968 1.00 0.00 ? 293 GLN A H    1  
ATOM   2132  H  HA   . GLN A 1 139 ? -19.558 16.979  -15.398 1.00 0.00 ? 293 GLN A HA   1  
ATOM   2133  H  HB2  . GLN A 1 139 ? -16.678 16.141  -14.939 1.00 0.00 ? 293 GLN A HB2  1  
ATOM   2134  H  HB3  . GLN A 1 139 ? -17.387 16.307  -16.546 1.00 0.00 ? 293 GLN A HB3  1  
ATOM   2135  H  HG2  . GLN A 1 139 ? -18.096 18.678  -15.738 1.00 0.00 ? 293 GLN A HG2  1  
ATOM   2136  H  HG3  . GLN A 1 139 ? -16.878 18.442  -14.484 1.00 0.00 ? 293 GLN A HG3  1  
ATOM   2137  H  HE21 . GLN A 1 139 ? -17.073 20.069  -17.263 1.00 0.00 ? 293 GLN A HE21 1  
ATOM   2138  H  HE22 . GLN A 1 139 ? -15.539 19.772  -17.927 1.00 0.00 ? 293 GLN A HE22 1  
ATOM   2139  N  N    . ASN A 1 140 ? -20.323 14.418  -14.673 1.00 0.00 ? 294 ASN A N    1  
ATOM   2140  C  CA   . ASN A 1 140 ? -20.724 12.992  -14.870 1.00 0.00 ? 294 ASN A CA   1  
ATOM   2141  C  C    . ASN A 1 140 ? -22.097 12.917  -15.555 1.00 0.00 ? 294 ASN A C    1  
ATOM   2142  O  O    . ASN A 1 140 ? -23.117 12.849  -14.895 1.00 0.00 ? 294 ASN A O    1  
ATOM   2143  C  CB   . ASN A 1 140 ? -20.795 12.400  -13.463 1.00 0.00 ? 294 ASN A CB   1  
ATOM   2144  C  CG   . ASN A 1 140 ? -20.455 10.905  -13.519 1.00 0.00 ? 294 ASN A CG   1  
ATOM   2145  O  OD1  . ASN A 1 140 ? -19.297 10.538  -13.504 1.00 0.00 ? 294 ASN A OD1  1  
ATOM   2146  N  ND2  . ASN A 1 140 ? -21.418 10.017  -13.583 1.00 0.00 ? 294 ASN A ND2  1  
ATOM   2147  H  H    . ASN A 1 140 ? -20.914 15.022  -14.171 1.00 0.00 ? 294 ASN A H    1  
ATOM   2148  H  HA   . ASN A 1 140 ? -19.982 12.470  -15.454 1.00 0.00 ? 294 ASN A HA   1  
ATOM   2149  H  HB2  . ASN A 1 140 ? -20.088 12.908  -12.822 1.00 0.00 ? 294 ASN A HB2  1  
ATOM   2150  H  HB3  . ASN A 1 140 ? -21.792 12.525  -13.069 1.00 0.00 ? 294 ASN A HB3  1  
ATOM   2151  H  HD21 . ASN A 1 140 ? -22.357 10.302  -13.595 1.00 0.00 ? 294 ASN A HD21 1  
ATOM   2152  H  HD22 . ASN A 1 140 ? -21.198 9.063   -13.619 1.00 0.00 ? 294 ASN A HD22 1  
ATOM   2153  N  N    . LYS A 1 141 ? -22.137 12.926  -16.873 1.00 0.00 ? 295 LYS A N    1  
ATOM   2154  C  CA   . LYS A 1 141 ? -23.449 12.853  -17.584 1.00 0.00 ? 295 LYS A CA   1  
ATOM   2155  C  C    . LYS A 1 141 ? -23.514 11.583  -18.447 1.00 0.00 ? 295 LYS A C    1  
ATOM   2156  O  O    . LYS A 1 141 ? -22.495 11.038  -18.827 1.00 0.00 ? 295 LYS A O    1  
ATOM   2157  C  CB   . LYS A 1 141 ? -23.493 14.103  -18.463 1.00 0.00 ? 295 LYS A CB   1  
ATOM   2158  C  CG   . LYS A 1 141 ? -24.936 14.379  -18.887 1.00 0.00 ? 295 LYS A CG   1  
ATOM   2159  C  CD   . LYS A 1 141 ? -24.978 15.619  -19.783 1.00 0.00 ? 295 LYS A CD   1  
ATOM   2160  C  CE   . LYS A 1 141 ? -24.685 16.866  -18.945 1.00 0.00 ? 295 LYS A CE   1  
ATOM   2161  N  NZ   . LYS A 1 141 ? -24.886 18.011  -19.876 1.00 0.00 ? 295 LYS A NZ   1  
ATOM   2162  H  H    . LYS A 1 141 ? -21.306 12.980  -17.396 1.00 0.00 ? 295 LYS A H    1  
ATOM   2163  H  HA   . LYS A 1 141 ? -24.262 12.871  -16.876 1.00 0.00 ? 295 LYS A HA   1  
ATOM   2164  H  HB2  . LYS A 1 141 ? -23.111 14.947  -17.907 1.00 0.00 ? 295 LYS A HB2  1  
ATOM   2165  H  HB3  . LYS A 1 141 ? -22.886 13.946  -19.342 1.00 0.00 ? 295 LYS A HB3  1  
ATOM   2166  H  HG2  . LYS A 1 141 ? -25.321 13.528  -19.430 1.00 0.00 ? 295 LYS A HG2  1  
ATOM   2167  H  HG3  . LYS A 1 141 ? -25.542 14.551  -18.010 1.00 0.00 ? 295 LYS A HG3  1  
ATOM   2168  H  HD2  . LYS A 1 141 ? -24.235 15.525  -20.562 1.00 0.00 ? 295 LYS A HD2  1  
ATOM   2169  H  HD3  . LYS A 1 141 ? -25.957 15.709  -20.228 1.00 0.00 ? 295 LYS A HD3  1  
ATOM   2170  H  HE2  . LYS A 1 141 ? -25.373 16.928  -18.113 1.00 0.00 ? 295 LYS A HE2  1  
ATOM   2171  H  HE3  . LYS A 1 141 ? -23.665 16.851  -18.592 1.00 0.00 ? 295 LYS A HE3  1  
ATOM   2172  H  HZ1  . LYS A 1 141 ? -24.809 18.904  -19.350 1.00 0.00 ? 295 LYS A HZ1  1  
ATOM   2173  H  HZ2  . LYS A 1 141 ? -25.830 17.943  -20.309 1.00 0.00 ? 295 LYS A HZ2  1  
ATOM   2174  H  HZ3  . LYS A 1 141 ? -24.161 17.985  -20.620 1.00 0.00 ? 295 LYS A HZ3  1  
ATOM   2175  N  N    . LYS A 1 142 ? -24.702 11.105  -18.761 1.00 0.00 ? 296 LYS A N    1  
ATOM   2176  C  CA   . LYS A 1 142 ? -24.816 9.873   -19.598 1.00 0.00 ? 296 LYS A CA   1  
ATOM   2177  C  C    . LYS A 1 142 ? -25.559 10.185  -20.899 1.00 0.00 ? 296 LYS A C    1  
ATOM   2178  O  O    . LYS A 1 142 ? -26.658 10.708  -20.820 1.00 0.00 ? 296 LYS A O    1  
ATOM   2179  C  CB   . LYS A 1 142 ? -25.616 8.888   -18.746 1.00 0.00 ? 296 LYS A CB   1  
ATOM   2180  C  CG   . LYS A 1 142 ? -25.436 7.472   -19.296 1.00 0.00 ? 296 LYS A CG   1  
ATOM   2181  C  CD   . LYS A 1 142 ? -24.131 6.879   -18.761 1.00 0.00 ? 296 LYS A CD   1  
ATOM   2182  C  CE   . LYS A 1 142 ? -24.313 6.481   -17.295 1.00 0.00 ? 296 LYS A CE   1  
ATOM   2183  N  NZ   . LYS A 1 142 ? -24.632 5.027   -17.328 1.00 0.00 ? 296 LYS A NZ   1  
ATOM   2184  O  OXT  . LYS A 1 142 ? -25.015 9.896   -21.952 1.00 0.00 ? 296 LYS A OXT  1  
ATOM   2185  H  H    . LYS A 1 142 ? -25.518 11.554  -18.447 1.00 0.00 ? 296 LYS A H    1  
ATOM   2186  H  HA   . LYS A 1 142 ? -23.838 9.469   -19.808 1.00 0.00 ? 296 LYS A HA   1  
ATOM   2187  H  HB2  . LYS A 1 142 ? -25.264 8.926   -17.725 1.00 0.00 ? 296 LYS A HB2  1  
ATOM   2188  H  HB3  . LYS A 1 142 ? -26.663 9.153   -18.776 1.00 0.00 ? 296 LYS A HB3  1  
ATOM   2189  H  HG2  . LYS A 1 142 ? -26.267 6.856   -18.984 1.00 0.00 ? 296 LYS A HG2  1  
ATOM   2190  H  HG3  . LYS A 1 142 ? -25.398 7.507   -20.374 1.00 0.00 ? 296 LYS A HG3  1  
ATOM   2191  H  HD2  . LYS A 1 142 ? -23.868 6.006   -19.342 1.00 0.00 ? 296 LYS A HD2  1  
ATOM   2192  H  HD3  . LYS A 1 142 ? -23.343 7.613   -18.838 1.00 0.00 ? 296 LYS A HD3  1  
ATOM   2193  H  HE2  . LYS A 1 142 ? -23.399 6.656   -16.743 1.00 0.00 ? 296 LYS A HE2  1  
ATOM   2194  H  HE3  . LYS A 1 142 ? -25.131 7.029   -16.855 1.00 0.00 ? 296 LYS A HE3  1  
ATOM   2195  H  HZ1  . LYS A 1 142 ? -23.853 4.511   -17.784 1.00 0.00 ? 296 LYS A HZ1  1  
ATOM   2196  H  HZ2  . LYS A 1 142 ? -25.510 4.877   -17.867 1.00 0.00 ? 296 LYS A HZ2  1  
ATOM   2197  H  HZ3  . LYS A 1 142 ? -24.756 4.676   -16.358 1.00 0.00 ? 296 LYS A HZ3  1  
HETATM 2198  ZN ZN   . ZN  B 2 .   ? -4.904  -2.748  -5.518  1.00 0.00 ? 1   ZN  A ZN   1  
HETATM 2199  ZN ZN   . ZN  C 2 .   ? 1.918   -7.023  -0.487  1.00 0.00 ? 2   ZN  A ZN   1  
HETATM 2200  ZN ZN   . ZN  D 2 .   ? 5.719   -1.763  11.615  1.00 0.00 ? 3   ZN  A ZN   1  
ATOM   2201  N  N    . GLY A 1 1   ? 5.984   6.001   -44.009 1.00 0.00 ? 155 GLY A N    2  
ATOM   2202  C  CA   . GLY A 1 1   ? 5.687   6.460   -42.623 1.00 0.00 ? 155 GLY A CA   2  
ATOM   2203  C  C    . GLY A 1 1   ? 4.332   7.182   -42.600 1.00 0.00 ? 155 GLY A C    2  
ATOM   2204  O  O    . GLY A 1 1   ? 4.277   8.398   -42.594 1.00 0.00 ? 155 GLY A O    2  
ATOM   2205  H  H1   . GLY A 1 1   ? 6.068   6.826   -44.637 1.00 0.00 ? 155 GLY A H1   2  
ATOM   2206  H  H2   . GLY A 1 1   ? 5.214   5.388   -44.344 1.00 0.00 ? 155 GLY A H2   2  
ATOM   2207  H  H3   . GLY A 1 1   ? 6.878   5.472   -44.016 1.00 0.00 ? 155 GLY A H3   2  
ATOM   2208  H  HA2  . GLY A 1 1   ? 5.653   5.606   -41.962 1.00 0.00 ? 155 GLY A HA2  2  
ATOM   2209  H  HA3  . GLY A 1 1   ? 6.458   7.140   -42.294 1.00 0.00 ? 155 GLY A HA3  2  
ATOM   2210  N  N    . ALA A 1 2   ? 3.236   6.449   -42.587 1.00 0.00 ? 156 ALA A N    2  
ATOM   2211  C  CA   . ALA A 1 2   ? 1.896   7.105   -42.564 1.00 0.00 ? 156 ALA A CA   2  
ATOM   2212  C  C    . ALA A 1 2   ? 1.042   6.531   -41.424 1.00 0.00 ? 156 ALA A C    2  
ATOM   2213  O  O    . ALA A 1 2   ? 0.941   5.328   -41.269 1.00 0.00 ? 156 ALA A O    2  
ATOM   2214  C  CB   . ALA A 1 2   ? 1.271   6.776   -43.920 1.00 0.00 ? 156 ALA A CB   2  
ATOM   2215  H  H    . ALA A 1 2   ? 3.294   5.467   -42.591 1.00 0.00 ? 156 ALA A H    2  
ATOM   2216  H  HA   . ALA A 1 2   ? 2.001   8.174   -42.455 1.00 0.00 ? 156 ALA A HA   2  
ATOM   2217  H  HB1  . ALA A 1 2   ? 0.389   7.382   -44.067 1.00 0.00 ? 156 ALA A HB1  2  
ATOM   2218  H  HB2  . ALA A 1 2   ? 0.998   5.731   -43.946 1.00 0.00 ? 156 ALA A HB2  2  
ATOM   2219  H  HB3  . ALA A 1 2   ? 1.983   6.982   -44.704 1.00 0.00 ? 156 ALA A HB3  2  
ATOM   2220  N  N    . MET A 1 3   ? 0.425   7.376   -40.622 1.00 0.00 ? 157 MET A N    2  
ATOM   2221  C  CA   . MET A 1 3   ? -0.417  6.865   -39.499 1.00 0.00 ? 157 MET A CA   2  
ATOM   2222  C  C    . MET A 1 3   ? -1.779  7.577   -39.488 1.00 0.00 ? 157 MET A C    2  
ATOM   2223  O  O    . MET A 1 3   ? -1.891  8.696   -39.022 1.00 0.00 ? 157 MET A O    2  
ATOM   2224  C  CB   . MET A 1 3   ? 0.371   7.196   -38.231 1.00 0.00 ? 157 MET A CB   2  
ATOM   2225  C  CG   . MET A 1 3   ? -0.191  6.393   -37.055 1.00 0.00 ? 157 MET A CG   2  
ATOM   2226  S  SD   . MET A 1 3   ? 1.123   6.097   -35.846 1.00 0.00 ? 157 MET A SD   2  
ATOM   2227  C  CE   . MET A 1 3   ? 1.795   4.598   -36.604 1.00 0.00 ? 157 MET A CE   2  
ATOM   2228  H  H    . MET A 1 3   ? 0.514   8.346   -40.757 1.00 0.00 ? 157 MET A H    2  
ATOM   2229  H  HA   . MET A 1 3   ? -0.550  5.797   -39.583 1.00 0.00 ? 157 MET A HA   2  
ATOM   2230  H  HB2  . MET A 1 3   ? 1.411   6.942   -38.377 1.00 0.00 ? 157 MET A HB2  2  
ATOM   2231  H  HB3  . MET A 1 3   ? 0.284   8.250   -38.018 1.00 0.00 ? 157 MET A HB3  2  
ATOM   2232  H  HG2  . MET A 1 3   ? -0.990  6.950   -36.590 1.00 0.00 ? 157 MET A HG2  2  
ATOM   2233  H  HG3  . MET A 1 3   ? -0.571  5.448   -37.413 1.00 0.00 ? 157 MET A HG3  2  
ATOM   2234  H  HE1  . MET A 1 3   ? 2.786   4.803   -36.988 1.00 0.00 ? 157 MET A HE1  2  
ATOM   2235  H  HE2  . MET A 1 3   ? 1.156   4.285   -37.414 1.00 0.00 ? 157 MET A HE2  2  
ATOM   2236  H  HE3  . MET A 1 3   ? 1.846   3.812   -35.863 1.00 0.00 ? 157 MET A HE3  2  
ATOM   2237  N  N    . ALA A 1 4   ? -2.816  6.943   -39.997 1.00 0.00 ? 158 ALA A N    2  
ATOM   2238  C  CA   . ALA A 1 4   ? -4.161  7.594   -40.010 1.00 0.00 ? 158 ALA A CA   2  
ATOM   2239  C  C    . ALA A 1 4   ? -5.168  6.750   -39.214 1.00 0.00 ? 158 ALA A C    2  
ATOM   2240  O  O    . ALA A 1 4   ? -6.270  6.507   -39.668 1.00 0.00 ? 158 ALA A O    2  
ATOM   2241  C  CB   . ALA A 1 4   ? -4.558  7.653   -41.485 1.00 0.00 ? 158 ALA A CB   2  
ATOM   2242  H  H    . ALA A 1 4   ? -2.713  6.039   -40.371 1.00 0.00 ? 158 ALA A H    2  
ATOM   2243  H  HA   . ALA A 1 4   ? -4.099  8.592   -39.604 1.00 0.00 ? 158 ALA A HA   2  
ATOM   2244  H  HB1  . ALA A 1 4   ? -5.172  8.524   -41.657 1.00 0.00 ? 158 ALA A HB1  2  
ATOM   2245  H  HB2  . ALA A 1 4   ? -5.113  6.764   -41.744 1.00 0.00 ? 158 ALA A HB2  2  
ATOM   2246  H  HB3  . ALA A 1 4   ? -3.669  7.714   -42.094 1.00 0.00 ? 158 ALA A HB3  2  
ATOM   2247  N  N    . ASP A 1 5   ? -4.803  6.299   -38.029 1.00 0.00 ? 159 ASP A N    2  
ATOM   2248  C  CA   . ASP A 1 5   ? -5.748  5.474   -37.219 1.00 0.00 ? 159 ASP A CA   2  
ATOM   2249  C  C    . ASP A 1 5   ? -5.872  6.050   -35.800 1.00 0.00 ? 159 ASP A C    2  
ATOM   2250  O  O    . ASP A 1 5   ? -5.038  6.824   -35.368 1.00 0.00 ? 159 ASP A O    2  
ATOM   2251  C  CB   . ASP A 1 5   ? -5.122  4.080   -37.179 1.00 0.00 ? 159 ASP A CB   2  
ATOM   2252  C  CG   . ASP A 1 5   ? -5.053  3.509   -38.597 1.00 0.00 ? 159 ASP A CG   2  
ATOM   2253  O  OD1  . ASP A 1 5   ? -6.036  3.631   -39.310 1.00 0.00 ? 159 ASP A OD1  2  
ATOM   2254  O  OD2  . ASP A 1 5   ? -4.021  2.960   -38.944 1.00 0.00 ? 159 ASP A OD2  2  
ATOM   2255  H  H    . ASP A 1 5   ? -3.910  6.502   -37.673 1.00 0.00 ? 159 ASP A H    2  
ATOM   2256  H  HA   . ASP A 1 5   ? -6.714  5.430   -37.694 1.00 0.00 ? 159 ASP A HA   2  
ATOM   2257  H  HB2  . ASP A 1 5   ? -4.125  4.145   -36.767 1.00 0.00 ? 159 ASP A HB2  2  
ATOM   2258  H  HB3  . ASP A 1 5   ? -5.724  3.432   -36.560 1.00 0.00 ? 159 ASP A HB3  2  
ATOM   2259  N  N    . LYS A 1 6   ? -6.904  5.681   -35.067 1.00 0.00 ? 160 LYS A N    2  
ATOM   2260  C  CA   . LYS A 1 6   ? -7.068  6.215   -33.681 1.00 0.00 ? 160 LYS A CA   2  
ATOM   2261  C  C    . LYS A 1 6   ? -6.998  5.067   -32.660 1.00 0.00 ? 160 LYS A C    2  
ATOM   2262  O  O    . LYS A 1 6   ? -7.358  3.946   -32.962 1.00 0.00 ? 160 LYS A O    2  
ATOM   2263  C  CB   . LYS A 1 6   ? -8.452  6.864   -33.666 1.00 0.00 ? 160 LYS A CB   2  
ATOM   2264  C  CG   . LYS A 1 6   ? -8.319  8.359   -33.958 1.00 0.00 ? 160 LYS A CG   2  
ATOM   2265  C  CD   . LYS A 1 6   ? -9.483  9.112   -33.312 1.00 0.00 ? 160 LYS A CD   2  
ATOM   2266  C  CE   . LYS A 1 6   ? -9.010  10.496  -32.859 1.00 0.00 ? 160 LYS A CE   2  
ATOM   2267  N  NZ   . LYS A 1 6   ? -8.585  10.311  -31.444 1.00 0.00 ? 160 LYS A NZ   2  
ATOM   2268  H  H    . LYS A 1 6   ? -7.572  5.055   -35.426 1.00 0.00 ? 160 LYS A H    2  
ATOM   2269  H  HA   . LYS A 1 6   ? -6.311  6.954   -33.470 1.00 0.00 ? 160 LYS A HA   2  
ATOM   2270  H  HB2  . LYS A 1 6   ? -9.074  6.402   -34.420 1.00 0.00 ? 160 LYS A HB2  2  
ATOM   2271  H  HB3  . LYS A 1 6   ? -8.903  6.727   -32.695 1.00 0.00 ? 160 LYS A HB3  2  
ATOM   2272  H  HG2  . LYS A 1 6   ? -7.385  8.723   -33.554 1.00 0.00 ? 160 LYS A HG2  2  
ATOM   2273  H  HG3  . LYS A 1 6   ? -8.337  8.521   -35.025 1.00 0.00 ? 160 LYS A HG3  2  
ATOM   2274  H  HD2  . LYS A 1 6   ? -10.284 9.221   -34.030 1.00 0.00 ? 160 LYS A HD2  2  
ATOM   2275  H  HD3  . LYS A 1 6   ? -9.840  8.558   -32.457 1.00 0.00 ? 160 LYS A HD3  2  
ATOM   2276  H  HE2  . LYS A 1 6   ? -8.177  10.823  -33.466 1.00 0.00 ? 160 LYS A HE2  2  
ATOM   2277  H  HE3  . LYS A 1 6   ? -9.819  11.207  -32.913 1.00 0.00 ? 160 LYS A HE3  2  
ATOM   2278  H  HZ1  . LYS A 1 6   ? -7.866  9.563   -31.392 1.00 0.00 ? 160 LYS A HZ1  2  
ATOM   2279  H  HZ2  . LYS A 1 6   ? -9.409  10.044  -30.867 1.00 0.00 ? 160 LYS A HZ2  2  
ATOM   2280  H  HZ3  . LYS A 1 6   ? -8.183  11.200  -31.084 1.00 0.00 ? 160 LYS A HZ3  2  
ATOM   2281  N  N    . ARG A 1 7   ? -6.537  5.336   -31.454 1.00 0.00 ? 161 ARG A N    2  
ATOM   2282  C  CA   . ARG A 1 7   ? -6.450  4.253   -30.428 1.00 0.00 ? 161 ARG A CA   2  
ATOM   2283  C  C    . ARG A 1 7   ? -6.920  4.775   -29.063 1.00 0.00 ? 161 ARG A C    2  
ATOM   2284  O  O    . ARG A 1 7   ? -7.912  4.314   -28.528 1.00 0.00 ? 161 ARG A O    2  
ATOM   2285  C  CB   . ARG A 1 7   ? -4.970  3.873   -30.378 1.00 0.00 ? 161 ARG A CB   2  
ATOM   2286  C  CG   . ARG A 1 7   ? -4.595  3.114   -31.652 1.00 0.00 ? 161 ARG A CG   2  
ATOM   2287  C  CD   . ARG A 1 7   ? -3.399  2.200   -31.370 1.00 0.00 ? 161 ARG A CD   2  
ATOM   2288  N  NE   . ARG A 1 7   ? -2.952  1.725   -32.714 1.00 0.00 ? 161 ARG A NE   2  
ATOM   2289  C  CZ   . ARG A 1 7   ? -2.308  2.526   -33.549 1.00 0.00 ? 161 ARG A CZ   2  
ATOM   2290  N  NH1  . ARG A 1 7   ? -2.035  3.772   -33.229 1.00 0.00 ? 161 ARG A NH1  2  
ATOM   2291  N  NH2  . ARG A 1 7   ? -1.933  2.076   -34.718 1.00 0.00 ? 161 ARG A NH2  2  
ATOM   2292  H  H    . ARG A 1 7   ? -6.248  6.246   -31.222 1.00 0.00 ? 161 ARG A H    2  
ATOM   2293  H  HA   . ARG A 1 7   ? -7.037  3.406   -30.726 1.00 0.00 ? 161 ARG A HA   2  
ATOM   2294  H  HB2  . ARG A 1 7   ? -4.370  4.770   -30.302 1.00 0.00 ? 161 ARG A HB2  2  
ATOM   2295  H  HB3  . ARG A 1 7   ? -4.787  3.245   -29.520 1.00 0.00 ? 161 ARG A HB3  2  
ATOM   2296  H  HG2  . ARG A 1 7   ? -5.435  2.519   -31.977 1.00 0.00 ? 161 ARG A HG2  2  
ATOM   2297  H  HG3  . ARG A 1 7   ? -4.331  3.818   -32.427 1.00 0.00 ? 161 ARG A HG3  2  
ATOM   2298  H  HD2  . ARG A 1 7   ? -2.610  2.756   -30.882 1.00 0.00 ? 161 ARG A HD2  2  
ATOM   2299  H  HD3  . ARG A 1 7   ? -3.702  1.362   -30.763 1.00 0.00 ? 161 ARG A HD3  2  
ATOM   2300  H  HE   . ARG A 1 7   ? -3.141  0.799   -32.980 1.00 0.00 ? 161 ARG A HE   2  
ATOM   2301  H  HH11 . ARG A 1 7   ? -2.310  4.140   -32.342 1.00 0.00 ? 161 ARG A HH11 2  
ATOM   2302  H  HH12 . ARG A 1 7   ? -1.548  4.355   -33.879 1.00 0.00 ? 161 ARG A HH12 2  
ATOM   2303  H  HH21 . ARG A 1 7   ? -2.133  1.131   -34.978 1.00 0.00 ? 161 ARG A HH21 2  
ATOM   2304  H  HH22 . ARG A 1 7   ? -1.446  2.677   -35.353 1.00 0.00 ? 161 ARG A HH22 2  
ATOM   2305  N  N    . GLY A 1 8   ? -6.220  5.731   -28.495 1.00 0.00 ? 162 GLY A N    2  
ATOM   2306  C  CA   . GLY A 1 8   ? -6.632  6.276   -27.167 1.00 0.00 ? 162 GLY A CA   2  
ATOM   2307  C  C    . GLY A 1 8   ? -5.387  6.541   -26.309 1.00 0.00 ? 162 GLY A C    2  
ATOM   2308  O  O    . GLY A 1 8   ? -4.869  5.643   -25.672 1.00 0.00 ? 162 GLY A O    2  
ATOM   2309  H  H    . GLY A 1 8   ? -5.423  6.091   -28.941 1.00 0.00 ? 162 GLY A H    2  
ATOM   2310  H  HA2  . GLY A 1 8   ? -7.175  7.199   -27.311 1.00 0.00 ? 162 GLY A HA2  2  
ATOM   2311  H  HA3  . GLY A 1 8   ? -7.264  5.560   -26.664 1.00 0.00 ? 162 GLY A HA3  2  
ATOM   2312  N  N    . ASP A 1 9   ? -4.898  7.766   -26.282 1.00 0.00 ? 163 ASP A N    2  
ATOM   2313  C  CA   . ASP A 1 9   ? -3.689  8.073   -25.461 1.00 0.00 ? 163 ASP A CA   2  
ATOM   2314  C  C    . ASP A 1 9   ? -3.975  9.249   -24.514 1.00 0.00 ? 163 ASP A C    2  
ATOM   2315  O  O    . ASP A 1 9   ? -4.200  10.360  -24.955 1.00 0.00 ? 163 ASP A O    2  
ATOM   2316  C  CB   . ASP A 1 9   ? -2.608  8.451   -26.474 1.00 0.00 ? 163 ASP A CB   2  
ATOM   2317  C  CG   . ASP A 1 9   ? -1.228  8.243   -25.849 1.00 0.00 ? 163 ASP A CG   2  
ATOM   2318  O  OD1  . ASP A 1 9   ? -0.993  8.787   -24.783 1.00 0.00 ? 163 ASP A OD1  2  
ATOM   2319  O  OD2  . ASP A 1 9   ? -0.427  7.543   -26.448 1.00 0.00 ? 163 ASP A OD2  2  
ATOM   2320  H  H    . ASP A 1 9   ? -5.327  8.484   -26.800 1.00 0.00 ? 163 ASP A H    2  
ATOM   2321  H  HA   . ASP A 1 9   ? -3.383  7.203   -24.901 1.00 0.00 ? 163 ASP A HA   2  
ATOM   2322  H  HB2  . ASP A 1 9   ? -2.705  7.829   -27.352 1.00 0.00 ? 163 ASP A HB2  2  
ATOM   2323  H  HB3  . ASP A 1 9   ? -2.722  9.488   -26.752 1.00 0.00 ? 163 ASP A HB3  2  
ATOM   2324  N  N    . GLY A 1 10  ? -3.970  9.017   -23.215 1.00 0.00 ? 164 GLY A N    2  
ATOM   2325  C  CA   . GLY A 1 10  ? -4.244  10.129  -22.257 1.00 0.00 ? 164 GLY A CA   2  
ATOM   2326  C  C    . GLY A 1 10  ? -2.947  10.509  -21.528 1.00 0.00 ? 164 GLY A C    2  
ATOM   2327  O  O    . GLY A 1 10  ? -2.202  9.649   -21.097 1.00 0.00 ? 164 GLY A O    2  
ATOM   2328  H  H    . GLY A 1 10  ? -3.788  8.116   -22.871 1.00 0.00 ? 164 GLY A H    2  
ATOM   2329  H  HA2  . GLY A 1 10  ? -4.619  10.985  -22.798 1.00 0.00 ? 164 GLY A HA2  2  
ATOM   2330  H  HA3  . GLY A 1 10  ? -4.978  9.808   -21.534 1.00 0.00 ? 164 GLY A HA3  2  
ATOM   2331  N  N    . LEU A 1 11  ? -2.668  11.789  -21.383 1.00 0.00 ? 165 LEU A N    2  
ATOM   2332  C  CA   . LEU A 1 11  ? -1.419  12.209  -20.680 1.00 0.00 ? 165 LEU A CA   2  
ATOM   2333  C  C    . LEU A 1 11  ? -1.720  13.356  -19.700 1.00 0.00 ? 165 LEU A C    2  
ATOM   2334  O  O    . LEU A 1 11  ? -1.097  14.400  -19.753 1.00 0.00 ? 165 LEU A O    2  
ATOM   2335  C  CB   . LEU A 1 11  ? -0.481  12.682  -21.792 1.00 0.00 ? 165 LEU A CB   2  
ATOM   2336  C  CG   . LEU A 1 11  ? 0.971   12.465  -21.362 1.00 0.00 ? 165 LEU A CG   2  
ATOM   2337  C  CD1  . LEU A 1 11  ? 1.850   12.287  -22.601 1.00 0.00 ? 165 LEU A CD1  2  
ATOM   2338  C  CD2  . LEU A 1 11  ? 1.454   13.682  -20.568 1.00 0.00 ? 165 LEU A CD2  2  
ATOM   2339  H  H    . LEU A 1 11  ? -3.278  12.475  -21.735 1.00 0.00 ? 165 LEU A H    2  
ATOM   2340  H  HA   . LEU A 1 11  ? -0.981  11.372  -20.159 1.00 0.00 ? 165 LEU A HA   2  
ATOM   2341  H  HB2  . LEU A 1 11  ? -0.679  12.119  -22.692 1.00 0.00 ? 165 LEU A HB2  2  
ATOM   2342  H  HB3  . LEU A 1 11  ? -0.646  13.732  -21.980 1.00 0.00 ? 165 LEU A HB3  2  
ATOM   2343  H  HG   . LEU A 1 11  ? 1.035   11.581  -20.745 1.00 0.00 ? 165 LEU A HG   2  
ATOM   2344  H  HD11 . LEU A 1 11  ? 1.931   11.236  -22.836 1.00 0.00 ? 165 LEU A HD11 2  
ATOM   2345  H  HD12 . LEU A 1 11  ? 2.833   12.689  -22.407 1.00 0.00 ? 165 LEU A HD12 2  
ATOM   2346  H  HD13 . LEU A 1 11  ? 1.407   12.809  -23.436 1.00 0.00 ? 165 LEU A HD13 2  
ATOM   2347  H  HD21 . LEU A 1 11  ? 1.167   13.572  -19.532 1.00 0.00 ? 165 LEU A HD21 2  
ATOM   2348  H  HD22 . LEU A 1 11  ? 1.004   14.577  -20.973 1.00 0.00 ? 165 LEU A HD22 2  
ATOM   2349  H  HD23 . LEU A 1 11  ? 2.528   13.755  -20.639 1.00 0.00 ? 165 LEU A HD23 2  
ATOM   2350  N  N    . HIS A 1 12  ? -2.669  13.173  -18.804 1.00 0.00 ? 166 HIS A N    2  
ATOM   2351  C  CA   . HIS A 1 12  ? -2.999  14.256  -17.830 1.00 0.00 ? 166 HIS A CA   2  
ATOM   2352  C  C    . HIS A 1 12  ? -3.186  13.668  -16.421 1.00 0.00 ? 166 HIS A C    2  
ATOM   2353  O  O    . HIS A 1 12  ? -4.212  13.862  -15.797 1.00 0.00 ? 166 HIS A O    2  
ATOM   2354  C  CB   . HIS A 1 12  ? -4.307  14.861  -18.341 1.00 0.00 ? 166 HIS A CB   2  
ATOM   2355  C  CG   . HIS A 1 12  ? -4.002  15.962  -19.319 1.00 0.00 ? 166 HIS A CG   2  
ATOM   2356  N  ND1  . HIS A 1 12  ? -3.250  17.073  -18.970 1.00 0.00 ? 166 HIS A ND1  2  
ATOM   2357  C  CD2  . HIS A 1 12  ? -4.339  16.138  -20.638 1.00 0.00 ? 166 HIS A CD2  2  
ATOM   2358  C  CE1  . HIS A 1 12  ? -3.161  17.860  -20.057 1.00 0.00 ? 166 HIS A CE1  2  
ATOM   2359  N  NE2  . HIS A 1 12  ? -3.807  17.337  -21.102 1.00 0.00 ? 166 HIS A NE2  2  
ATOM   2360  H  H    . HIS A 1 12  ? -3.165  12.324  -18.770 1.00 0.00 ? 166 HIS A H    2  
ATOM   2361  H  HA   . HIS A 1 12  ? -2.223  15.006  -17.825 1.00 0.00 ? 166 HIS A HA   2  
ATOM   2362  H  HB2  . HIS A 1 12  ? -4.890  14.095  -18.832 1.00 0.00 ? 166 HIS A HB2  2  
ATOM   2363  H  HB3  . HIS A 1 12  ? -4.867  15.264  -17.510 1.00 0.00 ? 166 HIS A HB3  2  
ATOM   2364  H  HD1  . HIS A 1 12  ? -2.856  17.253  -18.091 1.00 0.00 ? 166 HIS A HD1  2  
ATOM   2365  H  HD2  . HIS A 1 12  ? -4.928  15.449  -21.226 1.00 0.00 ? 166 HIS A HD2  2  
ATOM   2366  H  HE1  . HIS A 1 12  ? -2.631  18.801  -20.082 1.00 0.00 ? 166 HIS A HE1  2  
ATOM   2367  N  N    . GLY A 1 13  ? -2.203  12.950  -15.914 1.00 0.00 ? 167 GLY A N    2  
ATOM   2368  C  CA   . GLY A 1 13  ? -2.336  12.359  -14.549 1.00 0.00 ? 167 GLY A CA   2  
ATOM   2369  C  C    . GLY A 1 13  ? -2.927  10.945  -14.657 1.00 0.00 ? 167 GLY A C    2  
ATOM   2370  O  O    . GLY A 1 13  ? -3.987  10.755  -15.222 1.00 0.00 ? 167 GLY A O    2  
ATOM   2371  H  H    . GLY A 1 13  ? -1.378  12.800  -16.427 1.00 0.00 ? 167 GLY A H    2  
ATOM   2372  H  HA2  . GLY A 1 13  ? -1.363  12.310  -14.082 1.00 0.00 ? 167 GLY A HA2  2  
ATOM   2373  H  HA3  . GLY A 1 13  ? -2.992  12.973  -13.952 1.00 0.00 ? 167 GLY A HA3  2  
ATOM   2374  N  N    . ILE A 1 14  ? -2.252  9.949   -14.118 1.00 0.00 ? 168 ILE A N    2  
ATOM   2375  C  CA   . ILE A 1 14  ? -2.785  8.554   -14.194 1.00 0.00 ? 168 ILE A CA   2  
ATOM   2376  C  C    . ILE A 1 14  ? -3.033  8.006   -12.781 1.00 0.00 ? 168 ILE A C    2  
ATOM   2377  O  O    . ILE A 1 14  ? -2.369  8.394   -11.837 1.00 0.00 ? 168 ILE A O    2  
ATOM   2378  C  CB   . ILE A 1 14  ? -1.692  7.745   -14.905 1.00 0.00 ? 168 ILE A CB   2  
ATOM   2379  C  CG1  . ILE A 1 14  ? -1.423  8.336   -16.300 1.00 0.00 ? 168 ILE A CG1  2  
ATOM   2380  C  CG2  . ILE A 1 14  ? -2.135  6.282   -15.043 1.00 0.00 ? 168 ILE A CG2  2  
ATOM   2381  C  CD1  . ILE A 1 14  ? -2.699  8.297   -17.152 1.00 0.00 ? 168 ILE A CD1  2  
ATOM   2382  H  H    . ILE A 1 14  ? -1.396  10.114  -13.663 1.00 0.00 ? 168 ILE A H    2  
ATOM   2383  H  HA   . ILE A 1 14  ? -3.696  8.529   -14.770 1.00 0.00 ? 168 ILE A HA   2  
ATOM   2384  H  HB   . ILE A 1 14  ? -0.785  7.785   -14.319 1.00 0.00 ? 168 ILE A HB   2  
ATOM   2385  H  HG12 . ILE A 1 14  ? -1.094  9.360   -16.195 1.00 0.00 ? 168 ILE A HG12 2  
ATOM   2386  H  HG13 . ILE A 1 14  ? -0.651  7.762   -16.789 1.00 0.00 ? 168 ILE A HG13 2  
ATOM   2387  H  HG21 . ILE A 1 14  ? -2.961  6.220   -15.736 1.00 0.00 ? 168 ILE A HG21 2  
ATOM   2388  H  HG22 . ILE A 1 14  ? -2.446  5.907   -14.079 1.00 0.00 ? 168 ILE A HG22 2  
ATOM   2389  H  HG23 . ILE A 1 14  ? -1.311  5.690   -15.412 1.00 0.00 ? 168 ILE A HG23 2  
ATOM   2390  H  HD11 . ILE A 1 14  ? -3.090  7.291   -17.170 1.00 0.00 ? 168 ILE A HD11 2  
ATOM   2391  H  HD12 . ILE A 1 14  ? -2.468  8.611   -18.160 1.00 0.00 ? 168 ILE A HD12 2  
ATOM   2392  H  HD13 . ILE A 1 14  ? -3.435  8.963   -16.728 1.00 0.00 ? 168 ILE A HD13 2  
ATOM   2393  N  N    . VAL A 1 15  ? -3.976  7.101   -12.628 1.00 0.00 ? 169 VAL A N    2  
ATOM   2394  C  CA   . VAL A 1 15  ? -4.252  6.527   -11.272 1.00 0.00 ? 169 VAL A CA   2  
ATOM   2395  C  C    . VAL A 1 15  ? -3.680  5.105   -11.190 1.00 0.00 ? 169 VAL A C    2  
ATOM   2396  O  O    . VAL A 1 15  ? -3.895  4.301   -12.078 1.00 0.00 ? 169 VAL A O    2  
ATOM   2397  C  CB   . VAL A 1 15  ? -5.781  6.507   -11.131 1.00 0.00 ? 169 VAL A CB   2  
ATOM   2398  C  CG1  . VAL A 1 15  ? -6.168  5.940   -9.760  1.00 0.00 ? 169 VAL A CG1  2  
ATOM   2399  C  CG2  . VAL A 1 15  ? -6.324  7.933   -11.266 1.00 0.00 ? 169 VAL A CG2  2  
ATOM   2400  H  H    . VAL A 1 15  ? -4.498  6.794   -13.406 1.00 0.00 ? 169 VAL A H    2  
ATOM   2401  H  HA   . VAL A 1 15  ? -3.819  7.151   -10.506 1.00 0.00 ? 169 VAL A HA   2  
ATOM   2402  H  HB   . VAL A 1 15  ? -6.203  5.885   -11.908 1.00 0.00 ? 169 VAL A HB   2  
ATOM   2403  H  HG11 . VAL A 1 15  ? -5.321  6.000   -9.092  1.00 0.00 ? 169 VAL A HG11 2  
ATOM   2404  H  HG12 . VAL A 1 15  ? -6.464  4.907   -9.870  1.00 0.00 ? 169 VAL A HG12 2  
ATOM   2405  H  HG13 . VAL A 1 15  ? -6.990  6.507   -9.352  1.00 0.00 ? 169 VAL A HG13 2  
ATOM   2406  H  HG21 . VAL A 1 15  ? -5.560  8.638   -10.973 1.00 0.00 ? 169 VAL A HG21 2  
ATOM   2407  H  HG22 . VAL A 1 15  ? -7.186  8.052   -10.627 1.00 0.00 ? 169 VAL A HG22 2  
ATOM   2408  H  HG23 . VAL A 1 15  ? -6.607  8.115   -12.292 1.00 0.00 ? 169 VAL A HG23 2  
ATOM   2409  N  N    . SER A 1 16  ? -2.946  4.785   -10.142 1.00 0.00 ? 170 SER A N    2  
ATOM   2410  C  CA   . SER A 1 16  ? -2.364  3.414   -10.035 1.00 0.00 ? 170 SER A CA   2  
ATOM   2411  C  C    . SER A 1 16  ? -2.452  2.888   -8.597  1.00 0.00 ? 170 SER A C    2  
ATOM   2412  O  O    . SER A 1 16  ? -2.466  3.653   -7.651  1.00 0.00 ? 170 SER A O    2  
ATOM   2413  C  CB   . SER A 1 16  ? -0.905  3.570   -10.459 1.00 0.00 ? 170 SER A CB   2  
ATOM   2414  O  OG   . SER A 1 16  ? -0.803  4.613   -11.418 1.00 0.00 ? 170 SER A OG   2  
ATOM   2415  H  H    . SER A 1 16  ? -2.771  5.444   -9.435  1.00 0.00 ? 170 SER A H    2  
ATOM   2416  H  HA   . SER A 1 16  ? -2.868  2.739   -10.703 1.00 0.00 ? 170 SER A HA   2  
ATOM   2417  H  HB2  . SER A 1 16  ? -0.303  3.817   -9.600  1.00 0.00 ? 170 SER A HB2  2  
ATOM   2418  H  HB3  . SER A 1 16  ? -0.553  2.640   -10.884 1.00 0.00 ? 170 SER A HB3  2  
ATOM   2419  H  HG   . SER A 1 16  ? -0.012  4.461   -11.940 1.00 0.00 ? 170 SER A HG   2  
ATOM   2420  N  N    . CYS A 1 17  ? -2.502  1.582   -8.427  1.00 0.00 ? 171 CYS A N    2  
ATOM   2421  C  CA   . CYS A 1 17  ? -2.577  1.012   -7.041  1.00 0.00 ? 171 CYS A CA   2  
ATOM   2422  C  C    . CYS A 1 17  ? -1.167  0.660   -6.543  1.00 0.00 ? 171 CYS A C    2  
ATOM   2423  O  O    . CYS A 1 17  ? -0.363  0.123   -7.286  1.00 0.00 ? 171 CYS A O    2  
ATOM   2424  C  CB   . CYS A 1 17  ? -3.433  -0.256  -7.144  1.00 0.00 ? 171 CYS A CB   2  
ATOM   2425  S  SG   . CYS A 1 17  ? -3.751  -0.900  -5.483  1.00 0.00 ? 171 CYS A SG   2  
ATOM   2426  H  H    . CYS A 1 17  ? -2.481  0.981   -9.211  1.00 0.00 ? 171 CYS A H    2  
ATOM   2427  H  HA   . CYS A 1 17  ? -3.045  1.716   -6.371  1.00 0.00 ? 171 CYS A HA   2  
ATOM   2428  H  HB2  . CYS A 1 17  ? -4.370  -0.024  -7.628  1.00 0.00 ? 171 CYS A HB2  2  
ATOM   2429  H  HB3  . CYS A 1 17  ? -2.904  -0.998  -7.721  1.00 0.00 ? 171 CYS A HB3  2  
ATOM   2430  N  N    . THR A 1 18  ? -0.860  0.957   -5.295  1.00 0.00 ? 172 THR A N    2  
ATOM   2431  C  CA   . THR A 1 18  ? 0.512   0.635   -4.762  1.00 0.00 ? 172 THR A CA   2  
ATOM   2432  C  C    . THR A 1 18  ? 0.612   -0.852  -4.371  1.00 0.00 ? 172 THR A C    2  
ATOM   2433  O  O    . THR A 1 18  ? 1.637   -1.477  -4.570  1.00 0.00 ? 172 THR A O    2  
ATOM   2434  C  CB   . THR A 1 18  ? 0.741   1.548   -3.530  1.00 0.00 ? 172 THR A CB   2  
ATOM   2435  O  OG1  . THR A 1 18  ? 2.113   1.474   -3.125  1.00 0.00 ? 172 THR A OG1  2  
ATOM   2436  C  CG2  . THR A 1 18  ? -0.173  1.135   -2.356  1.00 0.00 ? 172 THR A CG2  2  
ATOM   2437  H  H    . THR A 1 18  ? -1.529  1.390   -4.716  1.00 0.00 ? 172 THR A H    2  
ATOM   2438  H  HA   . THR A 1 18  ? 1.252   0.860   -5.515  1.00 0.00 ? 172 THR A HA   2  
ATOM   2439  H  HB   . THR A 1 18  ? 0.514   2.567   -3.804  1.00 0.00 ? 172 THR A HB   2  
ATOM   2440  H  HG1  . THR A 1 18  ? 2.322   0.564   -2.880  1.00 0.00 ? 172 THR A HG1  2  
ATOM   2441  H  HG21 . THR A 1 18  ? -1.206  1.259   -2.635  1.00 0.00 ? 172 THR A HG21 2  
ATOM   2442  H  HG22 . THR A 1 18  ? 0.040   1.751   -1.497  1.00 0.00 ? 172 THR A HG22 2  
ATOM   2443  H  HG23 . THR A 1 18  ? 0.010   0.099   -2.107  1.00 0.00 ? 172 THR A HG23 2  
ATOM   2444  N  N    . ALA A 1 19  ? -0.439  -1.426  -3.818  1.00 0.00 ? 173 ALA A N    2  
ATOM   2445  C  CA   . ALA A 1 19  ? -0.370  -2.879  -3.425  1.00 0.00 ? 173 ALA A CA   2  
ATOM   2446  C  C    . ALA A 1 19  ? -0.385  -3.782  -4.676  1.00 0.00 ? 173 ALA A C    2  
ATOM   2447  O  O    . ALA A 1 19  ? 0.174   -4.862  -4.661  1.00 0.00 ? 173 ALA A O    2  
ATOM   2448  C  CB   . ALA A 1 19  ? -1.596  -3.152  -2.536  1.00 0.00 ? 173 ALA A CB   2  
ATOM   2449  H  H    . ALA A 1 19  ? -1.264  -0.906  -3.667  1.00 0.00 ? 173 ALA A H    2  
ATOM   2450  H  HA   . ALA A 1 19  ? 0.529   -3.058  -2.862  1.00 0.00 ? 173 ALA A HA   2  
ATOM   2451  H  HB1  . ALA A 1 19  ? -1.364  -2.884  -1.513  1.00 0.00 ? 173 ALA A HB1  2  
ATOM   2452  H  HB2  . ALA A 1 19  ? -1.852  -4.200  -2.584  1.00 0.00 ? 173 ALA A HB2  2  
ATOM   2453  H  HB3  . ALA A 1 19  ? -2.431  -2.559  -2.881  1.00 0.00 ? 173 ALA A HB3  2  
ATOM   2454  N  N    . CYS A 1 20  ? -1.003  -3.353  -5.761  1.00 0.00 ? 174 CYS A N    2  
ATOM   2455  C  CA   . CYS A 1 20  ? -1.025  -4.199  -6.998  1.00 0.00 ? 174 CYS A CA   2  
ATOM   2456  C  C    . CYS A 1 20  ? 0.091   -3.771  -7.964  1.00 0.00 ? 174 CYS A C    2  
ATOM   2457  O  O    . CYS A 1 20  ? 0.682   -4.599  -8.633  1.00 0.00 ? 174 CYS A O    2  
ATOM   2458  C  CB   . CYS A 1 20  ? -2.396  -3.964  -7.644  1.00 0.00 ? 174 CYS A CB   2  
ATOM   2459  S  SG   . CYS A 1 20  ? -3.701  -4.589  -6.561  1.00 0.00 ? 174 CYS A SG   2  
ATOM   2460  H  H    . CYS A 1 20  ? -1.443  -2.479  -5.767  1.00 0.00 ? 174 CYS A H    2  
ATOM   2461  H  HA   . CYS A 1 20  ? -0.915  -5.235  -6.742  1.00 0.00 ? 174 CYS A HA   2  
ATOM   2462  H  HB2  . CYS A 1 20  ? -2.539  -2.909  -7.805  1.00 0.00 ? 174 CYS A HB2  2  
ATOM   2463  H  HB3  . CYS A 1 20  ? -2.436  -4.477  -8.589  1.00 0.00 ? 174 CYS A HB3  2  
ATOM   2464  N  N    . GLY A 1 21  ? 0.377   -2.490  -8.058  1.00 0.00 ? 175 GLY A N    2  
ATOM   2465  C  CA   . GLY A 1 21  ? 1.438   -2.025  -8.996  1.00 0.00 ? 175 GLY A CA   2  
ATOM   2466  C  C    . GLY A 1 21  ? 0.837   -1.894  -10.401 1.00 0.00 ? 175 GLY A C    2  
ATOM   2467  O  O    . GLY A 1 21  ? 1.471   -2.238  -11.381 1.00 0.00 ? 175 GLY A O    2  
ATOM   2468  H  H    . GLY A 1 21  ? -0.113  -1.831  -7.526  1.00 0.00 ? 175 GLY A H    2  
ATOM   2469  H  HA2  . GLY A 1 21  ? 1.814   -1.065  -8.668  1.00 0.00 ? 175 GLY A HA2  2  
ATOM   2470  H  HA3  . GLY A 1 21  ? 2.244   -2.742  -9.016  1.00 0.00 ? 175 GLY A HA3  2  
ATOM   2471  N  N    . GLN A 1 22  ? -0.386  -1.407  -10.513 1.00 0.00 ? 176 GLN A N    2  
ATOM   2472  C  CA   . GLN A 1 22  ? -1.014  -1.273  -11.869 1.00 0.00 ? 176 GLN A CA   2  
ATOM   2473  C  C    . GLN A 1 22  ? -2.207  -0.301  -11.835 1.00 0.00 ? 176 GLN A C    2  
ATOM   2474  O  O    . GLN A 1 22  ? -2.800  -0.075  -10.796 1.00 0.00 ? 176 GLN A O    2  
ATOM   2475  C  CB   . GLN A 1 22  ? -1.487  -2.688  -12.227 1.00 0.00 ? 176 GLN A CB   2  
ATOM   2476  C  CG   . GLN A 1 22  ? -0.573  -3.286  -13.303 1.00 0.00 ? 176 GLN A CG   2  
ATOM   2477  C  CD   . GLN A 1 22  ? -1.196  -3.066  -14.687 1.00 0.00 ? 176 GLN A CD   2  
ATOM   2478  O  OE1  . GLN A 1 22  ? -2.403  -3.010  -14.816 1.00 0.00 ? 176 GLN A OE1  2  
ATOM   2479  N  NE2  . GLN A 1 22  ? -0.425  -2.938  -15.740 1.00 0.00 ? 176 GLN A NE2  2  
ATOM   2480  H  H    . GLN A 1 22  ? -0.891  -1.138  -9.708  1.00 0.00 ? 176 GLN A H    2  
ATOM   2481  H  HA   . GLN A 1 22  ? -0.286  -0.936  -12.590 1.00 0.00 ? 176 GLN A HA   2  
ATOM   2482  H  HB2  . GLN A 1 22  ? -1.456  -3.312  -11.345 1.00 0.00 ? 176 GLN A HB2  2  
ATOM   2483  H  HB3  . GLN A 1 22  ? -2.499  -2.647  -12.602 1.00 0.00 ? 176 GLN A HB3  2  
ATOM   2484  H  HG2  . GLN A 1 22  ? 0.392   -2.802  -13.262 1.00 0.00 ? 176 GLN A HG2  2  
ATOM   2485  H  HG3  . GLN A 1 22  ? -0.454  -4.344  -13.127 1.00 0.00 ? 176 GLN A HG3  2  
ATOM   2486  H  HE21 . GLN A 1 22  ? 0.552   -2.982  -15.648 1.00 0.00 ? 176 GLN A HE21 2  
ATOM   2487  H  HE22 . GLN A 1 22  ? -0.826  -2.799  -16.623 1.00 0.00 ? 176 GLN A HE22 2  
ATOM   2488  N  N    . GLN A 1 23  ? -2.561  0.277   -12.966 1.00 0.00 ? 177 GLN A N    2  
ATOM   2489  C  CA   . GLN A 1 23  ? -3.723  1.241   -12.992 1.00 0.00 ? 177 GLN A CA   2  
ATOM   2490  C  C    . GLN A 1 23  ? -4.989  0.583   -12.422 1.00 0.00 ? 177 GLN A C    2  
ATOM   2491  O  O    . GLN A 1 23  ? -5.145  -0.623  -12.478 1.00 0.00 ? 177 GLN A O    2  
ATOM   2492  C  CB   . GLN A 1 23  ? -3.947  1.620   -14.465 1.00 0.00 ? 177 GLN A CB   2  
ATOM   2493  C  CG   . GLN A 1 23  ? -4.981  2.745   -14.554 1.00 0.00 ? 177 GLN A CG   2  
ATOM   2494  C  CD   . GLN A 1 23  ? -5.322  3.012   -16.025 1.00 0.00 ? 177 GLN A CD   2  
ATOM   2495  O  OE1  . GLN A 1 23  ? -6.406  2.691   -16.473 1.00 0.00 ? 177 GLN A OE1  2  
ATOM   2496  N  NE2  . GLN A 1 23  ? -4.442  3.588   -16.807 1.00 0.00 ? 177 GLN A NE2  2  
ATOM   2497  H  H    . GLN A 1 23  ? -2.058  0.078   -13.793 1.00 0.00 ? 177 GLN A H    2  
ATOM   2498  H  HA   . GLN A 1 23  ? -3.484  2.123   -12.423 1.00 0.00 ? 177 GLN A HA   2  
ATOM   2499  H  HB2  . GLN A 1 23  ? -3.014  1.953   -14.897 1.00 0.00 ? 177 GLN A HB2  2  
ATOM   2500  H  HB3  . GLN A 1 23  ? -4.307  0.759   -15.007 1.00 0.00 ? 177 GLN A HB3  2  
ATOM   2501  H  HG2  . GLN A 1 23  ? -5.876  2.453   -14.024 1.00 0.00 ? 177 GLN A HG2  2  
ATOM   2502  H  HG3  . GLN A 1 23  ? -4.577  3.642   -14.113 1.00 0.00 ? 177 GLN A HG3  2  
ATOM   2503  H  HE21 . GLN A 1 23  ? -3.563  3.851   -16.457 1.00 0.00 ? 177 GLN A HE21 2  
ATOM   2504  H  HE22 . GLN A 1 23  ? -4.662  3.757   -17.747 1.00 0.00 ? 177 GLN A HE22 2  
ATOM   2505  N  N    . VAL A 1 24  ? -5.902  1.368   -11.884 1.00 0.00 ? 178 VAL A N    2  
ATOM   2506  C  CA   . VAL A 1 24  ? -7.165  0.772   -11.323 1.00 0.00 ? 178 VAL A CA   2  
ATOM   2507  C  C    . VAL A 1 24  ? -8.225  0.676   -12.433 1.00 0.00 ? 178 VAL A C    2  
ATOM   2508  O  O    . VAL A 1 24  ? -8.110  1.331   -13.452 1.00 0.00 ? 178 VAL A O    2  
ATOM   2509  C  CB   . VAL A 1 24  ? -7.635  1.717   -10.201 1.00 0.00 ? 178 VAL A CB   2  
ATOM   2510  C  CG1  . VAL A 1 24  ? -8.870  1.128   -9.518  1.00 0.00 ? 178 VAL A CG1  2  
ATOM   2511  C  CG2  . VAL A 1 24  ? -6.518  1.883   -9.168  1.00 0.00 ? 178 VAL A CG2  2  
ATOM   2512  H  H    . VAL A 1 24  ? -5.760  2.344   -11.859 1.00 0.00 ? 178 VAL A H    2  
ATOM   2513  H  HA   . VAL A 1 24  ? -6.964  -0.207  -10.917 1.00 0.00 ? 178 VAL A HA   2  
ATOM   2514  H  HB   . VAL A 1 24  ? -7.886  2.682   -10.621 1.00 0.00 ? 178 VAL A HB   2  
ATOM   2515  H  HG11 . VAL A 1 24  ? -9.750  1.362   -10.100 1.00 0.00 ? 178 VAL A HG11 2  
ATOM   2516  H  HG12 . VAL A 1 24  ? -8.970  1.550   -8.529  1.00 0.00 ? 178 VAL A HG12 2  
ATOM   2517  H  HG13 . VAL A 1 24  ? -8.763  0.056   -9.443  1.00 0.00 ? 178 VAL A HG13 2  
ATOM   2518  H  HG21 . VAL A 1 24  ? -5.855  2.676   -9.477  1.00 0.00 ? 178 VAL A HG21 2  
ATOM   2519  H  HG22 . VAL A 1 24  ? -5.963  0.960   -9.088  1.00 0.00 ? 178 VAL A HG22 2  
ATOM   2520  H  HG23 . VAL A 1 24  ? -6.949  2.128   -8.208  1.00 0.00 ? 178 VAL A HG23 2  
ATOM   2521  N  N    . ASN A 1 25  ? -9.248  -0.140  -12.256 1.00 0.00 ? 179 ASN A N    2  
ATOM   2522  C  CA   . ASN A 1 25  ? -10.303 -0.271  -13.333 1.00 0.00 ? 179 ASN A CA   2  
ATOM   2523  C  C    . ASN A 1 25  ? -10.866 1.109   -13.724 1.00 0.00 ? 179 ASN A C    2  
ATOM   2524  O  O    . ASN A 1 25  ? -11.807 1.589   -13.122 1.00 0.00 ? 179 ASN A O    2  
ATOM   2525  C  CB   . ASN A 1 25  ? -11.424 -1.143  -12.745 1.00 0.00 ? 179 ASN A CB   2  
ATOM   2526  C  CG   . ASN A 1 25  ? -12.401 -1.540  -13.859 1.00 0.00 ? 179 ASN A CG   2  
ATOM   2527  O  OD1  . ASN A 1 25  ? -13.321 -0.805  -14.159 1.00 0.00 ? 179 ASN A OD1  2  
ATOM   2528  N  ND2  . ASN A 1 25  ? -12.246 -2.677  -14.492 1.00 0.00 ? 179 ASN A ND2  2  
ATOM   2529  H  H    . ASN A 1 25  ? -9.313  -0.671  -11.428 1.00 0.00 ? 179 ASN A H    2  
ATOM   2530  H  HA   . ASN A 1 25  ? -9.885  -0.757  -14.200 1.00 0.00 ? 179 ASN A HA   2  
ATOM   2531  H  HB2  . ASN A 1 25  ? -10.995 -2.033  -12.307 1.00 0.00 ? 179 ASN A HB2  2  
ATOM   2532  H  HB3  . ASN A 1 25  ? -11.953 -0.586  -11.987 1.00 0.00 ? 179 ASN A HB3  2  
ATOM   2533  H  HD21 . ASN A 1 25  ? -11.506 -3.280  -14.257 1.00 0.00 ? 179 ASN A HD21 2  
ATOM   2534  H  HD22 . ASN A 1 25  ? -12.871 -2.930  -15.202 1.00 0.00 ? 179 ASN A HD22 2  
ATOM   2535  N  N    . HIS A 1 26  ? -10.303 1.748   -14.735 1.00 0.00 ? 180 HIS A N    2  
ATOM   2536  C  CA   . HIS A 1 26  ? -10.812 3.091   -15.171 1.00 0.00 ? 180 HIS A CA   2  
ATOM   2537  C  C    . HIS A 1 26  ? -10.932 4.057   -13.977 1.00 0.00 ? 180 HIS A C    2  
ATOM   2538  O  O    . HIS A 1 26  ? -10.561 3.725   -12.866 1.00 0.00 ? 180 HIS A O    2  
ATOM   2539  C  CB   . HIS A 1 26  ? -12.191 2.817   -15.776 1.00 0.00 ? 180 HIS A CB   2  
ATOM   2540  C  CG   . HIS A 1 26  ? -12.031 2.049   -17.060 1.00 0.00 ? 180 HIS A CG   2  
ATOM   2541  N  ND1  . HIS A 1 26  ? -12.930 1.070   -17.452 1.00 0.00 ? 180 HIS A ND1  2  
ATOM   2542  C  CD2  . HIS A 1 26  ? -11.084 2.106   -18.051 1.00 0.00 ? 180 HIS A CD2  2  
ATOM   2543  C  CE1  . HIS A 1 26  ? -12.509 0.581   -18.632 1.00 0.00 ? 180 HIS A CE1  2  
ATOM   2544  N  NE2  . HIS A 1 26  ? -11.387 1.178   -19.044 1.00 0.00 ? 180 HIS A NE2  2  
ATOM   2545  H  H    . HIS A 1 26  ? -9.548  1.343   -15.215 1.00 0.00 ? 180 HIS A H    2  
ATOM   2546  H  HA   . HIS A 1 26  ? -10.161 3.508   -15.922 1.00 0.00 ? 180 HIS A HA   2  
ATOM   2547  H  HB2  . HIS A 1 26  ? -12.781 2.237   -15.081 1.00 0.00 ? 180 HIS A HB2  2  
ATOM   2548  H  HB3  . HIS A 1 26  ? -12.689 3.753   -15.978 1.00 0.00 ? 180 HIS A HB3  2  
ATOM   2549  H  HD1  . HIS A 1 26  ? -13.728 0.785   -16.958 1.00 0.00 ? 180 HIS A HD1  2  
ATOM   2550  H  HD2  . HIS A 1 26  ? -10.231 2.770   -18.061 1.00 0.00 ? 180 HIS A HD2  2  
ATOM   2551  H  HE1  . HIS A 1 26  ? -13.017 -0.198  -19.181 1.00 0.00 ? 180 HIS A HE1  2  
ATOM   2552  N  N    . PHE A 1 27  ? -11.454 5.248   -14.195 1.00 0.00 ? 181 PHE A N    2  
ATOM   2553  C  CA   . PHE A 1 27  ? -11.600 6.223   -13.072 1.00 0.00 ? 181 PHE A CA   2  
ATOM   2554  C  C    . PHE A 1 27  ? -13.094 6.463   -12.791 1.00 0.00 ? 181 PHE A C    2  
ATOM   2555  O  O    . PHE A 1 27  ? -13.760 7.167   -13.527 1.00 0.00 ? 181 PHE A O    2  
ATOM   2556  C  CB   . PHE A 1 27  ? -10.914 7.505   -13.566 1.00 0.00 ? 181 PHE A CB   2  
ATOM   2557  C  CG   . PHE A 1 27  ? -11.081 8.622   -12.555 1.00 0.00 ? 181 PHE A CG   2  
ATOM   2558  C  CD1  . PHE A 1 27  ? -10.782 8.405   -11.201 1.00 0.00 ? 181 PHE A CD1  2  
ATOM   2559  C  CD2  . PHE A 1 27  ? -11.536 9.877   -12.976 1.00 0.00 ? 181 PHE A CD2  2  
ATOM   2560  C  CE1  . PHE A 1 27  ? -10.940 9.444   -10.275 1.00 0.00 ? 181 PHE A CE1  2  
ATOM   2561  C  CE2  . PHE A 1 27  ? -11.690 10.915  -12.050 1.00 0.00 ? 181 PHE A CE2  2  
ATOM   2562  C  CZ   . PHE A 1 27  ? -11.393 10.698  -10.700 1.00 0.00 ? 181 PHE A CZ   2  
ATOM   2563  H  H    . PHE A 1 27  ? -11.753 5.500   -15.097 1.00 0.00 ? 181 PHE A H    2  
ATOM   2564  H  HA   . PHE A 1 27  ? -11.105 5.856   -12.187 1.00 0.00 ? 181 PHE A HA   2  
ATOM   2565  H  HB2  . PHE A 1 27  ? -9.862  7.313   -13.713 1.00 0.00 ? 181 PHE A HB2  2  
ATOM   2566  H  HB3  . PHE A 1 27  ? -11.355 7.807   -14.505 1.00 0.00 ? 181 PHE A HB3  2  
ATOM   2567  H  HD1  . PHE A 1 27  ? -10.433 7.438   -10.870 1.00 0.00 ? 181 PHE A HD1  2  
ATOM   2568  H  HD2  . PHE A 1 27  ? -11.766 10.045  -14.018 1.00 0.00 ? 181 PHE A HD2  2  
ATOM   2569  H  HE1  . PHE A 1 27  ? -10.710 9.278   -9.233  1.00 0.00 ? 181 PHE A HE1  2  
ATOM   2570  H  HE2  . PHE A 1 27  ? -12.041 11.882  -12.377 1.00 0.00 ? 181 PHE A HE2  2  
ATOM   2571  H  HZ   . PHE A 1 27  ? -11.513 11.499  -9.986  1.00 0.00 ? 181 PHE A HZ   2  
ATOM   2572  N  N    . GLN A 1 28  ? -13.625 5.884   -11.734 1.00 0.00 ? 182 GLN A N    2  
ATOM   2573  C  CA   . GLN A 1 28  ? -15.072 6.083   -11.416 1.00 0.00 ? 182 GLN A CA   2  
ATOM   2574  C  C    . GLN A 1 28  ? -15.222 6.894   -10.120 1.00 0.00 ? 182 GLN A C    2  
ATOM   2575  O  O    . GLN A 1 28  ? -14.335 6.905   -9.289  1.00 0.00 ? 182 GLN A O    2  
ATOM   2576  C  CB   . GLN A 1 28  ? -15.640 4.672   -11.238 1.00 0.00 ? 182 GLN A CB   2  
ATOM   2577  C  CG   . GLN A 1 28  ? -17.157 4.746   -11.074 1.00 0.00 ? 182 GLN A CG   2  
ATOM   2578  C  CD   . GLN A 1 28  ? -17.797 5.184   -12.398 1.00 0.00 ? 182 GLN A CD   2  
ATOM   2579  O  OE1  . GLN A 1 28  ? -17.986 6.362   -12.628 1.00 0.00 ? 182 GLN A OE1  2  
ATOM   2580  N  NE2  . GLN A 1 28  ? -18.141 4.285   -13.288 1.00 0.00 ? 182 GLN A NE2  2  
ATOM   2581  H  H    . GLN A 1 28  ? -13.072 5.319   -11.149 1.00 0.00 ? 182 GLN A H    2  
ATOM   2582  H  HA   . GLN A 1 28  ? -15.571 6.581   -12.232 1.00 0.00 ? 182 GLN A HA   2  
ATOM   2583  H  HB2  . GLN A 1 28  ? -15.399 4.075   -12.106 1.00 0.00 ? 182 GLN A HB2  2  
ATOM   2584  H  HB3  . GLN A 1 28  ? -15.209 4.221   -10.360 1.00 0.00 ? 182 GLN A HB3  2  
ATOM   2585  H  HG2  . GLN A 1 28  ? -17.535 3.775   -10.793 1.00 0.00 ? 182 GLN A HG2  2  
ATOM   2586  H  HG3  . GLN A 1 28  ? -17.399 5.463   -10.305 1.00 0.00 ? 182 GLN A HG3  2  
ATOM   2587  H  HE21 . GLN A 1 28  ? -17.992 3.330   -13.112 1.00 0.00 ? 182 GLN A HE21 2  
ATOM   2588  H  HE22 . GLN A 1 28  ? -18.549 4.567   -14.133 1.00 0.00 ? 182 GLN A HE22 2  
ATOM   2589  N  N    . LYS A 1 29  ? -16.333 7.584   -9.943  1.00 0.00 ? 183 LYS A N    2  
ATOM   2590  C  CA   . LYS A 1 29  ? -16.515 8.406   -8.690  1.00 0.00 ? 183 LYS A CA   2  
ATOM   2591  C  C    . LYS A 1 29  ? -16.305 7.564   -7.413  1.00 0.00 ? 183 LYS A C    2  
ATOM   2592  O  O    . LYS A 1 29  ? -15.942 8.101   -6.382  1.00 0.00 ? 183 LYS A O    2  
ATOM   2593  C  CB   . LYS A 1 29  ? -17.951 8.961   -8.725  1.00 0.00 ? 183 LYS A CB   2  
ATOM   2594  C  CG   . LYS A 1 29  ? -18.957 7.805   -8.776  1.00 0.00 ? 183 LYS A CG   2  
ATOM   2595  C  CD   . LYS A 1 29  ? -19.486 7.522   -7.368  1.00 0.00 ? 183 LYS A CD   2  
ATOM   2596  C  CE   . LYS A 1 29  ? -20.603 8.512   -7.033  1.00 0.00 ? 183 LYS A CE   2  
ATOM   2597  N  NZ   . LYS A 1 29  ? -21.113 8.080   -5.702  1.00 0.00 ? 183 LYS A NZ   2  
ATOM   2598  H  H    . LYS A 1 29  ? -17.035 7.569   -10.637 1.00 0.00 ? 183 LYS A H    2  
ATOM   2599  H  HA   . LYS A 1 29  ? -15.820 9.227   -8.696  1.00 0.00 ? 183 LYS A HA   2  
ATOM   2600  H  HB2  . LYS A 1 29  ? -18.127 9.554   -7.840  1.00 0.00 ? 183 LYS A HB2  2  
ATOM   2601  H  HB3  . LYS A 1 29  ? -18.074 9.579   -9.602  1.00 0.00 ? 183 LYS A HB3  2  
ATOM   2602  H  HG2  . LYS A 1 29  ? -19.781 8.075   -9.421  1.00 0.00 ? 183 LYS A HG2  2  
ATOM   2603  H  HG3  . LYS A 1 29  ? -18.474 6.921   -9.161  1.00 0.00 ? 183 LYS A HG3  2  
ATOM   2604  H  HD2  . LYS A 1 29  ? -19.871 6.513   -7.325  1.00 0.00 ? 183 LYS A HD2  2  
ATOM   2605  H  HD3  . LYS A 1 29  ? -18.684 7.633   -6.653  1.00 0.00 ? 183 LYS A HD3  2  
ATOM   2606  H  HE2  . LYS A 1 29  ? -20.210 9.518   -6.981  1.00 0.00 ? 183 LYS A HE2  2  
ATOM   2607  H  HE3  . LYS A 1 29  ? -21.391 8.452   -7.768  1.00 0.00 ? 183 LYS A HE3  2  
ATOM   2608  H  HZ1  . LYS A 1 29  ? -21.455 7.100   -5.762  1.00 0.00 ? 183 LYS A HZ1  2  
ATOM   2609  H  HZ2  . LYS A 1 29  ? -21.894 8.704   -5.412  1.00 0.00 ? 183 LYS A HZ2  2  
ATOM   2610  H  HZ3  . LYS A 1 29  ? -20.346 8.135   -5.003  1.00 0.00 ? 183 LYS A HZ3  2  
ATOM   2611  N  N    . ASP A 1 30  ? -16.533 6.266   -7.451  1.00 0.00 ? 184 ASP A N    2  
ATOM   2612  C  CA   . ASP A 1 30  ? -16.346 5.445   -6.214  1.00 0.00 ? 184 ASP A CA   2  
ATOM   2613  C  C    . ASP A 1 30  ? -15.556 4.155   -6.501  1.00 0.00 ? 184 ASP A C    2  
ATOM   2614  O  O    . ASP A 1 30  ? -15.773 3.149   -5.851  1.00 0.00 ? 184 ASP A O    2  
ATOM   2615  C  CB   . ASP A 1 30  ? -17.766 5.106   -5.751  1.00 0.00 ? 184 ASP A CB   2  
ATOM   2616  C  CG   . ASP A 1 30  ? -18.183 6.053   -4.624  1.00 0.00 ? 184 ASP A CG   2  
ATOM   2617  O  OD1  . ASP A 1 30  ? -17.763 7.199   -4.652  1.00 0.00 ? 184 ASP A OD1  2  
ATOM   2618  O  OD2  . ASP A 1 30  ? -18.914 5.616   -3.751  1.00 0.00 ? 184 ASP A OD2  2  
ATOM   2619  H  H    . ASP A 1 30  ? -16.832 5.838   -8.275  1.00 0.00 ? 184 ASP A H    2  
ATOM   2620  H  HA   . ASP A 1 30  ? -15.844 6.024   -5.456  1.00 0.00 ? 184 ASP A HA   2  
ATOM   2621  H  HB2  . ASP A 1 30  ? -18.448 5.212   -6.582  1.00 0.00 ? 184 ASP A HB2  2  
ATOM   2622  H  HB3  . ASP A 1 30  ? -17.793 4.088   -5.392  1.00 0.00 ? 184 ASP A HB3  2  
ATOM   2623  N  N    . SER A 1 31  ? -14.631 4.168   -7.442  1.00 0.00 ? 185 SER A N    2  
ATOM   2624  C  CA   . SER A 1 31  ? -13.837 2.917   -7.710  1.00 0.00 ? 185 SER A CA   2  
ATOM   2625  C  C    . SER A 1 31  ? -12.594 2.890   -6.807  1.00 0.00 ? 185 SER A C    2  
ATOM   2626  O  O    . SER A 1 31  ? -12.511 2.085   -5.905  1.00 0.00 ? 185 SER A O    2  
ATOM   2627  C  CB   . SER A 1 31  ? -13.430 2.961   -9.188  1.00 0.00 ? 185 SER A CB   2  
ATOM   2628  O  OG   . SER A 1 31  ? -12.273 2.158   -9.379  1.00 0.00 ? 185 SER A OG   2  
ATOM   2629  H  H    . SER A 1 31  ? -14.450 4.991   -7.952  1.00 0.00 ? 185 SER A H    2  
ATOM   2630  H  HA   . SER A 1 31  ? -14.448 2.046   -7.524  1.00 0.00 ? 185 SER A HA   2  
ATOM   2631  H  HB2  . SER A 1 31  ? -14.231 2.577   -9.796  1.00 0.00 ? 185 SER A HB2  2  
ATOM   2632  H  HB3  . SER A 1 31  ? -13.223 3.984   -9.471  1.00 0.00 ? 185 SER A HB3  2  
ATOM   2633  H  HG   . SER A 1 31  ? -12.055 2.168   -10.314 1.00 0.00 ? 185 SER A HG   2  
ATOM   2634  N  N    . ILE A 1 32  ? -11.623 3.759   -7.037  1.00 0.00 ? 186 ILE A N    2  
ATOM   2635  C  CA   . ILE A 1 32  ? -10.382 3.758   -6.166  1.00 0.00 ? 186 ILE A CA   2  
ATOM   2636  C  C    . ILE A 1 32  ? -10.747 3.778   -4.672  1.00 0.00 ? 186 ILE A C    2  
ATOM   2637  O  O    . ILE A 1 32  ? -11.823 4.201   -4.293  1.00 0.00 ? 186 ILE A O    2  
ATOM   2638  C  CB   . ILE A 1 32  ? -9.581  5.028   -6.511  1.00 0.00 ? 186 ILE A CB   2  
ATOM   2639  C  CG1  . ILE A 1 32  ? -10.464 6.270   -6.337  1.00 0.00 ? 186 ILE A CG1  2  
ATOM   2640  C  CG2  . ILE A 1 32  ? -9.081  4.951   -7.953  1.00 0.00 ? 186 ILE A CG2  2  
ATOM   2641  C  CD1  . ILE A 1 32  ? -9.590  7.524   -6.358  1.00 0.00 ? 186 ILE A CD1  2  
ATOM   2642  H  H    . ILE A 1 32  ? -11.706 4.397   -7.780  1.00 0.00 ? 186 ILE A H    2  
ATOM   2643  H  HA   . ILE A 1 32  ? -9.784  2.885   -6.377  1.00 0.00 ? 186 ILE A HA   2  
ATOM   2644  H  HB   . ILE A 1 32  ? -8.730  5.098   -5.847  1.00 0.00 ? 186 ILE A HB   2  
ATOM   2645  H  HG12 . ILE A 1 32  ? -11.181 6.324   -7.142  1.00 0.00 ? 186 ILE A HG12 2  
ATOM   2646  H  HG13 . ILE A 1 32  ? -10.984 6.214   -5.394  1.00 0.00 ? 186 ILE A HG13 2  
ATOM   2647  H  HG21 . ILE A 1 32  ? -8.271  5.653   -8.088  1.00 0.00 ? 186 ILE A HG21 2  
ATOM   2648  H  HG22 . ILE A 1 32  ? -9.887  5.198   -8.627  1.00 0.00 ? 186 ILE A HG22 2  
ATOM   2649  H  HG23 . ILE A 1 32  ? -8.729  3.950   -8.158  1.00 0.00 ? 186 ILE A HG23 2  
ATOM   2650  H  HD11 . ILE A 1 32  ? -10.148 8.359   -5.961  1.00 0.00 ? 186 ILE A HD11 2  
ATOM   2651  H  HD12 . ILE A 1 32  ? -9.294  7.739   -7.375  1.00 0.00 ? 186 ILE A HD12 2  
ATOM   2652  H  HD13 . ILE A 1 32  ? -8.710  7.359   -5.754  1.00 0.00 ? 186 ILE A HD13 2  
ATOM   2653  N  N    . TYR A 1 33  ? -9.849  3.323   -3.821  1.00 0.00 ? 187 TYR A N    2  
ATOM   2654  C  CA   . TYR A 1 33  ? -10.131 3.314   -2.355  1.00 0.00 ? 187 TYR A CA   2  
ATOM   2655  C  C    . TYR A 1 33  ? -8.903  3.789   -1.574  1.00 0.00 ? 187 TYR A C    2  
ATOM   2656  O  O    . TYR A 1 33  ? -7.821  3.908   -2.119  1.00 0.00 ? 187 TYR A O    2  
ATOM   2657  C  CB   . TYR A 1 33  ? -10.430 1.855   -2.014  1.00 0.00 ? 187 TYR A CB   2  
ATOM   2658  C  CG   . TYR A 1 33  ? -11.912 1.602   -2.119  1.00 0.00 ? 187 TYR A CG   2  
ATOM   2659  C  CD1  . TYR A 1 33  ? -12.743 1.826   -1.016  1.00 0.00 ? 187 TYR A CD1  2  
ATOM   2660  C  CD2  . TYR A 1 33  ? -12.452 1.137   -3.320  1.00 0.00 ? 187 TYR A CD2  2  
ATOM   2661  C  CE1  . TYR A 1 33  ? -14.119 1.586   -1.116  1.00 0.00 ? 187 TYR A CE1  2  
ATOM   2662  C  CE2  . TYR A 1 33  ? -13.826 0.895   -3.424  1.00 0.00 ? 187 TYR A CE2  2  
ATOM   2663  C  CZ   . TYR A 1 33  ? -14.661 1.120   -2.322  1.00 0.00 ? 187 TYR A CZ   2  
ATOM   2664  O  OH   . TYR A 1 33  ? -16.017 0.882   -2.422  1.00 0.00 ? 187 TYR A OH   2  
ATOM   2665  H  H    . TYR A 1 33  ? -8.985  2.987   -4.149  1.00 0.00 ? 187 TYR A H    2  
ATOM   2666  H  HA   . TYR A 1 33  ? -10.981 3.932   -2.117  1.00 0.00 ? 187 TYR A HA   2  
ATOM   2667  H  HB2  . TYR A 1 33  ? -9.905  1.210   -2.704  1.00 0.00 ? 187 TYR A HB2  2  
ATOM   2668  H  HB3  . TYR A 1 33  ? -10.101 1.646   -1.007  1.00 0.00 ? 187 TYR A HB3  2  
ATOM   2669  H  HD1  . TYR A 1 33  ? -12.324 2.186   -0.088  1.00 0.00 ? 187 TYR A HD1  2  
ATOM   2670  H  HD2  . TYR A 1 33  ? -11.807 0.960   -4.170  1.00 0.00 ? 187 TYR A HD2  2  
ATOM   2671  H  HE1  . TYR A 1 33  ? -14.761 1.758   -0.265  1.00 0.00 ? 187 TYR A HE1  2  
ATOM   2672  H  HE2  . TYR A 1 33  ? -14.241 0.535   -4.353  1.00 0.00 ? 187 TYR A HE2  2  
ATOM   2673  H  HH   . TYR A 1 33  ? -16.433 1.679   -2.758  1.00 0.00 ? 187 TYR A HH   2  
ATOM   2674  N  N    . ARG A 1 34  ? -9.062  4.052   -0.298  1.00 0.00 ? 188 ARG A N    2  
ATOM   2675  C  CA   . ARG A 1 34  ? -7.901  4.507   0.523   1.00 0.00 ? 188 ARG A CA   2  
ATOM   2676  C  C    . ARG A 1 34  ? -7.530  3.420   1.538   1.00 0.00 ? 188 ARG A C    2  
ATOM   2677  O  O    . ARG A 1 34  ? -8.398  2.828   2.152   1.00 0.00 ? 188 ARG A O    2  
ATOM   2678  C  CB   . ARG A 1 34  ? -8.382  5.768   1.248   1.00 0.00 ? 188 ARG A CB   2  
ATOM   2679  C  CG   . ARG A 1 34  ? -8.393  6.952   0.277   1.00 0.00 ? 188 ARG A CG   2  
ATOM   2680  C  CD   . ARG A 1 34  ? -7.942  8.221   1.007   1.00 0.00 ? 188 ARG A CD   2  
ATOM   2681  N  NE   . ARG A 1 34  ? -9.059  8.541   1.947   1.00 0.00 ? 188 ARG A NE   2  
ATOM   2682  C  CZ   . ARG A 1 34  ? -10.207 9.034   1.509   1.00 0.00 ? 188 ARG A CZ   2  
ATOM   2683  N  NH1  . ARG A 1 34  ? -10.412 9.262   0.231   1.00 0.00 ? 188 ARG A NH1  2  
ATOM   2684  N  NH2  . ARG A 1 34  ? -11.163 9.302   2.361   1.00 0.00 ? 188 ARG A NH2  2  
ATOM   2685  H  H    . ARG A 1 34  ? -9.946  3.939   0.123   1.00 0.00 ? 188 ARG A H    2  
ATOM   2686  H  HA   . ARG A 1 34  ? -7.058  4.741   -0.109  1.00 0.00 ? 188 ARG A HA   2  
ATOM   2687  H  HB2  . ARG A 1 34  ? -9.382  5.605   1.626   1.00 0.00 ? 188 ARG A HB2  2  
ATOM   2688  H  HB3  . ARG A 1 34  ? -7.718  5.984   2.071   1.00 0.00 ? 188 ARG A HB3  2  
ATOM   2689  H  HG2  . ARG A 1 34  ? -7.720  6.751   -0.545  1.00 0.00 ? 188 ARG A HG2  2  
ATOM   2690  H  HG3  . ARG A 1 34  ? -9.392  7.096   -0.103  1.00 0.00 ? 188 ARG A HG3  2  
ATOM   2691  H  HD2  . ARG A 1 34  ? -7.027  8.033   1.553   1.00 0.00 ? 188 ARG A HD2  2  
ATOM   2692  H  HD3  . ARG A 1 34  ? -7.805  9.029   0.306   1.00 0.00 ? 188 ARG A HD3  2  
ATOM   2693  H  HE   . ARG A 1 34  ? -8.935  8.382   2.908   1.00 0.00 ? 188 ARG A HE   2  
ATOM   2694  H  HH11 . ARG A 1 34  ? -9.698  9.066   -0.440  1.00 0.00 ? 188 ARG A HH11 2  
ATOM   2695  H  HH12 . ARG A 1 34  ? -11.288 9.635   -0.072  1.00 0.00 ? 188 ARG A HH12 2  
ATOM   2696  H  HH21 . ARG A 1 34  ? -11.023 9.134   3.337   1.00 0.00 ? 188 ARG A HH21 2  
ATOM   2697  H  HH22 . ARG A 1 34  ? -12.033 9.674   2.037   1.00 0.00 ? 188 ARG A HH22 2  
ATOM   2698  N  N    . HIS A 1 35  ? -6.254  3.153   1.736   1.00 0.00 ? 189 HIS A N    2  
ATOM   2699  C  CA   . HIS A 1 35  ? -5.871  2.100   2.736   1.00 0.00 ? 189 HIS A CA   2  
ATOM   2700  C  C    . HIS A 1 35  ? -6.273  2.597   4.135   1.00 0.00 ? 189 HIS A C    2  
ATOM   2701  O  O    . HIS A 1 35  ? -6.003  3.733   4.473   1.00 0.00 ? 189 HIS A O    2  
ATOM   2702  C  CB   . HIS A 1 35  ? -4.350  1.925   2.627   1.00 0.00 ? 189 HIS A CB   2  
ATOM   2703  C  CG   . HIS A 1 35  ? -3.974  0.508   2.974   1.00 0.00 ? 189 HIS A CG   2  
ATOM   2704  N  ND1  . HIS A 1 35  ? -3.616  0.131   4.256   1.00 0.00 ? 189 HIS A ND1  2  
ATOM   2705  C  CD2  . HIS A 1 35  ? -3.921  -0.640  2.224   1.00 0.00 ? 189 HIS A CD2  2  
ATOM   2706  C  CE1  . HIS A 1 35  ? -3.377  -1.187  4.247   1.00 0.00 ? 189 HIS A CE1  2  
ATOM   2707  N  NE2  . HIS A 1 35  ? -3.546  -1.712  3.030   1.00 0.00 ? 189 HIS A NE2  2  
ATOM   2708  H  H    . HIS A 1 35  ? -5.562  3.651   1.241   1.00 0.00 ? 189 HIS A H    2  
ATOM   2709  H  HA   . HIS A 1 35  ? -6.370  1.173   2.504   1.00 0.00 ? 189 HIS A HA   2  
ATOM   2710  H  HB2  . HIS A 1 35  ? -4.036  2.142   1.616   1.00 0.00 ? 189 HIS A HB2  2  
ATOM   2711  H  HB3  . HIS A 1 35  ? -3.866  2.608   3.305   1.00 0.00 ? 189 HIS A HB3  2  
ATOM   2712  H  HD1  . HIS A 1 35  ? -3.522  0.721   5.020   1.00 0.00 ? 189 HIS A HD1  2  
ATOM   2713  H  HD2  . HIS A 1 35  ? -4.122  -0.698  1.166   1.00 0.00 ? 189 HIS A HD2  2  
ATOM   2714  H  HE1  . HIS A 1 35  ? -3.097  -1.755  5.122   1.00 0.00 ? 189 HIS A HE1  2  
ATOM   2715  N  N    . PRO A 1 36  ? -6.934  1.757   4.902   1.00 0.00 ? 190 PRO A N    2  
ATOM   2716  C  CA   . PRO A 1 36  ? -7.390  2.180   6.252   1.00 0.00 ? 190 PRO A CA   2  
ATOM   2717  C  C    . PRO A 1 36  ? -6.209  2.309   7.229   1.00 0.00 ? 190 PRO A C    2  
ATOM   2718  O  O    . PRO A 1 36  ? -6.198  3.192   8.068   1.00 0.00 ? 190 PRO A O    2  
ATOM   2719  C  CB   . PRO A 1 36  ? -8.334  1.059   6.680   1.00 0.00 ? 190 PRO A CB   2  
ATOM   2720  C  CG   . PRO A 1 36  ? -7.892  -0.139  5.906   1.00 0.00 ? 190 PRO A CG   2  
ATOM   2721  C  CD   . PRO A 1 36  ? -7.315  0.363   4.609   1.00 0.00 ? 190 PRO A CD   2  
ATOM   2722  H  HA   . PRO A 1 36  ? -7.932  3.109   6.191   1.00 0.00 ? 190 PRO A HA   2  
ATOM   2723  H  HB2  . PRO A 1 36  ? -8.247  0.880   7.742   1.00 0.00 ? 190 PRO A HB2  2  
ATOM   2724  H  HB3  . PRO A 1 36  ? -9.352  1.309   6.420   1.00 0.00 ? 190 PRO A HB3  2  
ATOM   2725  H  HG2  . PRO A 1 36  ? -7.139  -0.680  6.464   1.00 0.00 ? 190 PRO A HG2  2  
ATOM   2726  H  HG3  . PRO A 1 36  ? -8.736  -0.781  5.704   1.00 0.00 ? 190 PRO A HG3  2  
ATOM   2727  H  HD2  . PRO A 1 36  ? -6.447  -0.221  4.333   1.00 0.00 ? 190 PRO A HD2  2  
ATOM   2728  H  HD3  . PRO A 1 36  ? -8.057  0.337   3.828   1.00 0.00 ? 190 PRO A HD3  2  
ATOM   2729  N  N    . SER A 1 37  ? -5.226  1.437   7.147   1.00 0.00 ? 191 SER A N    2  
ATOM   2730  C  CA   . SER A 1 37  ? -4.069  1.530   8.104   1.00 0.00 ? 191 SER A CA   2  
ATOM   2731  C  C    . SER A 1 37  ? -2.791  2.114   7.456   1.00 0.00 ? 191 SER A C    2  
ATOM   2732  O  O    . SER A 1 37  ? -1.719  1.974   8.015   1.00 0.00 ? 191 SER A O    2  
ATOM   2733  C  CB   . SER A 1 37  ? -3.807  0.090   8.553   1.00 0.00 ? 191 SER A CB   2  
ATOM   2734  O  OG   . SER A 1 37  ? -4.950  -0.401  9.243   1.00 0.00 ? 191 SER A OG   2  
ATOM   2735  H  H    . SER A 1 37  ? -5.255  0.719   6.474   1.00 0.00 ? 191 SER A H    2  
ATOM   2736  H  HA   . SER A 1 37  ? -4.348  2.124   8.959   1.00 0.00 ? 191 SER A HA   2  
ATOM   2737  H  HB2  . SER A 1 37  ? -3.620  -0.531  7.690   1.00 0.00 ? 191 SER A HB2  2  
ATOM   2738  H  HB3  . SER A 1 37  ? -2.944  0.068   9.204   1.00 0.00 ? 191 SER A HB3  2  
ATOM   2739  H  HG   . SER A 1 37  ? -4.892  -0.111  10.156  1.00 0.00 ? 191 SER A HG   2  
ATOM   2740  N  N    . LEU A 1 38  ? -2.863  2.752   6.298   1.00 0.00 ? 192 LEU A N    2  
ATOM   2741  C  CA   . LEU A 1 38  ? -1.599  3.298   5.682   1.00 0.00 ? 192 LEU A CA   2  
ATOM   2742  C  C    . LEU A 1 38  ? -1.744  4.713   5.066   1.00 0.00 ? 192 LEU A C    2  
ATOM   2743  O  O    . LEU A 1 38  ? -0.794  5.200   4.483   1.00 0.00 ? 192 LEU A O    2  
ATOM   2744  C  CB   . LEU A 1 38  ? -1.243  2.315   4.558   1.00 0.00 ? 192 LEU A CB   2  
ATOM   2745  C  CG   . LEU A 1 38  ? -0.710  0.991   5.114   1.00 0.00 ? 192 LEU A CG   2  
ATOM   2746  C  CD1  . LEU A 1 38  ? -0.306  0.102   3.934   1.00 0.00 ? 192 LEU A CD1  2  
ATOM   2747  C  CD2  . LEU A 1 38  ? 0.518   1.241   5.997   1.00 0.00 ? 192 LEU A CD2  2  
ATOM   2748  H  H    . LEU A 1 38  ? -3.721  2.852   5.837   1.00 0.00 ? 192 LEU A H    2  
ATOM   2749  H  HA   . LEU A 1 38  ? -0.808  3.298   6.412   1.00 0.00 ? 192 LEU A HA   2  
ATOM   2750  H  HB2  . LEU A 1 38  ? -2.122  2.118   3.969   1.00 0.00 ? 192 LEU A HB2  2  
ATOM   2751  H  HB3  . LEU A 1 38  ? -0.489  2.761   3.927   1.00 0.00 ? 192 LEU A HB3  2  
ATOM   2752  H  HG   . LEU A 1 38  ? -1.483  0.502   5.690   1.00 0.00 ? 192 LEU A HG   2  
ATOM   2753  H  HD11 . LEU A 1 38  ? 0.303   -0.718  4.288   1.00 0.00 ? 192 LEU A HD11 2  
ATOM   2754  H  HD12 . LEU A 1 38  ? 0.258   0.692   3.224   1.00 0.00 ? 192 LEU A HD12 2  
ATOM   2755  H  HD13 . LEU A 1 38  ? -1.194  -0.290  3.451   1.00 0.00 ? 192 LEU A HD13 2  
ATOM   2756  H  HD21 . LEU A 1 38  ? 1.160   0.374   5.973   1.00 0.00 ? 192 LEU A HD21 2  
ATOM   2757  H  HD22 . LEU A 1 38  ? 0.199   1.423   7.013   1.00 0.00 ? 192 LEU A HD22 2  
ATOM   2758  H  HD23 . LEU A 1 38  ? 1.056   2.100   5.629   1.00 0.00 ? 192 LEU A HD23 2  
ATOM   2759  N  N    . GLN A 1 39  ? -2.884  5.383   5.158   1.00 0.00 ? 193 GLN A N    2  
ATOM   2760  C  CA   . GLN A 1 39  ? -3.011  6.751   4.539   1.00 0.00 ? 193 GLN A CA   2  
ATOM   2761  C  C    . GLN A 1 39  ? -2.526  6.731   3.074   1.00 0.00 ? 193 GLN A C    2  
ATOM   2762  O  O    . GLN A 1 39  ? -1.808  7.613   2.646   1.00 0.00 ? 193 GLN A O    2  
ATOM   2763  C  CB   . GLN A 1 39  ? -2.114  7.660   5.385   1.00 0.00 ? 193 GLN A CB   2  
ATOM   2764  C  CG   . GLN A 1 39  ? -2.808  7.971   6.713   1.00 0.00 ? 193 GLN A CG   2  
ATOM   2765  C  CD   . GLN A 1 39  ? -1.806  8.625   7.672   1.00 0.00 ? 193 GLN A CD   2  
ATOM   2766  O  OE1  . GLN A 1 39  ? -1.057  9.497   7.278   1.00 0.00 ? 193 GLN A OE1  2  
ATOM   2767  N  NE2  . GLN A 1 39  ? -1.756  8.245   8.926   1.00 0.00 ? 193 GLN A NE2  2  
ATOM   2768  H  H    . GLN A 1 39  ? -3.650  5.004   5.622   1.00 0.00 ? 193 GLN A H    2  
ATOM   2769  H  HA   . GLN A 1 39  ? -4.033  7.090   4.589   1.00 0.00 ? 193 GLN A HA   2  
ATOM   2770  H  HB2  . GLN A 1 39  ? -1.175  7.161   5.576   1.00 0.00 ? 193 GLN A HB2  2  
ATOM   2771  H  HB3  . GLN A 1 39  ? -1.930  8.581   4.853   1.00 0.00 ? 193 GLN A HB3  2  
ATOM   2772  H  HG2  . GLN A 1 39  ? -3.634  8.645   6.538   1.00 0.00 ? 193 GLN A HG2  2  
ATOM   2773  H  HG3  . GLN A 1 39  ? -3.177  7.055   7.150   1.00 0.00 ? 193 GLN A HG3  2  
ATOM   2774  H  HE21 . GLN A 1 39  ? -2.357  7.541   9.256   1.00 0.00 ? 193 GLN A HE21 2  
ATOM   2775  H  HE22 . GLN A 1 39  ? -1.115  8.664   9.536   1.00 0.00 ? 193 GLN A HE22 2  
ATOM   2776  N  N    . VAL A 1 40  ? -2.895  5.720   2.310   1.00 0.00 ? 194 VAL A N    2  
ATOM   2777  C  CA   . VAL A 1 40  ? -2.431  5.644   0.890   1.00 0.00 ? 194 VAL A CA   2  
ATOM   2778  C  C    . VAL A 1 40  ? -3.582  5.200   -0.031  1.00 0.00 ? 194 VAL A C    2  
ATOM   2779  O  O    . VAL A 1 40  ? -4.597  4.718   0.429   1.00 0.00 ? 194 VAL A O    2  
ATOM   2780  C  CB   . VAL A 1 40  ? -1.284  4.622   0.918   1.00 0.00 ? 194 VAL A CB   2  
ATOM   2781  C  CG1  . VAL A 1 40  ? -1.814  3.230   1.281   1.00 0.00 ? 194 VAL A CG1  2  
ATOM   2782  C  CG2  . VAL A 1 40  ? -0.606  4.574   -0.452  1.00 0.00 ? 194 VAL A CG2  2  
ATOM   2783  H  H    . VAL A 1 40  ? -3.464  5.008   2.673   1.00 0.00 ? 194 VAL A H    2  
ATOM   2784  H  HA   . VAL A 1 40  ? -2.056  6.600   0.563   1.00 0.00 ? 194 VAL A HA   2  
ATOM   2785  H  HB   . VAL A 1 40  ? -0.560  4.926   1.661   1.00 0.00 ? 194 VAL A HB   2  
ATOM   2786  H  HG11 . VAL A 1 40  ? -0.994  2.530   1.305   1.00 0.00 ? 194 VAL A HG11 2  
ATOM   2787  H  HG12 . VAL A 1 40  ? -2.536  2.914   0.543   1.00 0.00 ? 194 VAL A HG12 2  
ATOM   2788  H  HG13 . VAL A 1 40  ? -2.282  3.265   2.252   1.00 0.00 ? 194 VAL A HG13 2  
ATOM   2789  H  HG21 . VAL A 1 40  ? 0.283   3.966   -0.392  1.00 0.00 ? 194 VAL A HG21 2  
ATOM   2790  H  HG22 . VAL A 1 40  ? -0.336  5.576   -0.754  1.00 0.00 ? 194 VAL A HG22 2  
ATOM   2791  H  HG23 . VAL A 1 40  ? -1.286  4.149   -1.176  1.00 0.00 ? 194 VAL A HG23 2  
ATOM   2792  N  N    . LEU A 1 41  ? -3.438  5.383   -1.327  1.00 0.00 ? 195 LEU A N    2  
ATOM   2793  C  CA   . LEU A 1 41  ? -4.548  4.991   -2.268  1.00 0.00 ? 195 LEU A CA   2  
ATOM   2794  C  C    . LEU A 1 41  ? -4.386  3.549   -2.783  1.00 0.00 ? 195 LEU A C    2  
ATOM   2795  O  O    . LEU A 1 41  ? -3.290  3.087   -3.028  1.00 0.00 ? 195 LEU A O    2  
ATOM   2796  C  CB   . LEU A 1 41  ? -4.467  5.964   -3.450  1.00 0.00 ? 195 LEU A CB   2  
ATOM   2797  C  CG   . LEU A 1 41  ? -5.807  5.987   -4.189  1.00 0.00 ? 195 LEU A CG   2  
ATOM   2798  C  CD1  . LEU A 1 41  ? -6.072  7.396   -4.718  1.00 0.00 ? 195 LEU A CD1  2  
ATOM   2799  C  CD2  . LEU A 1 41  ? -5.760  5.008   -5.364  1.00 0.00 ? 195 LEU A CD2  2  
ATOM   2800  H  H    . LEU A 1 41  ? -2.613  5.795   -1.675  1.00 0.00 ? 195 LEU A H    2  
ATOM   2801  H  HA   . LEU A 1 41  ? -5.503  5.101   -1.778  1.00 0.00 ? 195 LEU A HA   2  
ATOM   2802  H  HB2  . LEU A 1 41  ? -4.237  6.951   -3.087  1.00 0.00 ? 195 LEU A HB2  2  
ATOM   2803  H  HB3  . LEU A 1 41  ? -3.691  5.641   -4.128  1.00 0.00 ? 195 LEU A HB3  2  
ATOM   2804  H  HG   . LEU A 1 41  ? -6.598  5.703   -3.511  1.00 0.00 ? 195 LEU A HG   2  
ATOM   2805  H  HD11 . LEU A 1 41  ? -5.136  7.851   -5.007  1.00 0.00 ? 195 LEU A HD11 2  
ATOM   2806  H  HD12 . LEU A 1 41  ? -6.537  7.990   -3.947  1.00 0.00 ? 195 LEU A HD12 2  
ATOM   2807  H  HD13 . LEU A 1 41  ? -6.725  7.342   -5.577  1.00 0.00 ? 195 LEU A HD13 2  
ATOM   2808  H  HD21 . LEU A 1 41  ? -6.598  5.192   -6.020  1.00 0.00 ? 195 LEU A HD21 2  
ATOM   2809  H  HD22 . LEU A 1 41  ? -5.811  3.996   -4.992  1.00 0.00 ? 195 LEU A HD22 2  
ATOM   2810  H  HD23 . LEU A 1 41  ? -4.838  5.144   -5.911  1.00 0.00 ? 195 LEU A HD23 2  
ATOM   2811  N  N    . ILE A 1 42  ? -5.488  2.850   -2.977  1.00 0.00 ? 196 ILE A N    2  
ATOM   2812  C  CA   . ILE A 1 42  ? -5.428  1.452   -3.508  1.00 0.00 ? 196 ILE A CA   2  
ATOM   2813  C  C    . ILE A 1 42  ? -6.576  1.256   -4.519  1.00 0.00 ? 196 ILE A C    2  
ATOM   2814  O  O    . ILE A 1 42  ? -7.181  2.222   -4.948  1.00 0.00 ? 196 ILE A O    2  
ATOM   2815  C  CB   . ILE A 1 42  ? -5.579  0.528   -2.285  1.00 0.00 ? 196 ILE A CB   2  
ATOM   2816  C  CG1  . ILE A 1 42  ? -6.845  0.896   -1.497  1.00 0.00 ? 196 ILE A CG1  2  
ATOM   2817  C  CG2  . ILE A 1 42  ? -4.346  0.666   -1.380  1.00 0.00 ? 196 ILE A CG2  2  
ATOM   2818  C  CD1  . ILE A 1 42  ? -7.038  -0.089  -0.340  1.00 0.00 ? 196 ILE A CD1  2  
ATOM   2819  H  H    . ILE A 1 42  ? -6.367  3.254   -2.791  1.00 0.00 ? 196 ILE A H    2  
ATOM   2820  H  HA   . ILE A 1 42  ? -4.477  1.276   -3.989  1.00 0.00 ? 196 ILE A HA   2  
ATOM   2821  H  HB   . ILE A 1 42  ? -5.650  -0.497  -2.618  1.00 0.00 ? 196 ILE A HB   2  
ATOM   2822  H  HG12 . ILE A 1 42  ? -6.746  1.898   -1.105  1.00 0.00 ? 196 ILE A HG12 2  
ATOM   2823  H  HG13 . ILE A 1 42  ? -7.703  0.849   -2.153  1.00 0.00 ? 196 ILE A HG13 2  
ATOM   2824  H  HG21 . ILE A 1 42  ? -4.599  1.246   -0.506  1.00 0.00 ? 196 ILE A HG21 2  
ATOM   2825  H  HG22 . ILE A 1 42  ? -3.551  1.159   -1.922  1.00 0.00 ? 196 ILE A HG22 2  
ATOM   2826  H  HG23 . ILE A 1 42  ? -4.013  -0.317  -1.076  1.00 0.00 ? 196 ILE A HG23 2  
ATOM   2827  H  HD11 . ILE A 1 42  ? -6.507  -1.005  -0.554  1.00 0.00 ? 196 ILE A HD11 2  
ATOM   2828  H  HD12 . ILE A 1 42  ? -8.090  -0.303  -0.220  1.00 0.00 ? 196 ILE A HD12 2  
ATOM   2829  H  HD13 . ILE A 1 42  ? -6.652  0.346   0.571   1.00 0.00 ? 196 ILE A HD13 2  
ATOM   2830  N  N    . CYS A 1 43  ? -6.883  0.037   -4.912  1.00 0.00 ? 197 CYS A N    2  
ATOM   2831  C  CA   . CYS A 1 43  ? -7.990  -0.166  -5.898  1.00 0.00 ? 197 CYS A CA   2  
ATOM   2832  C  C    . CYS A 1 43  ? -9.171  -0.906  -5.238  1.00 0.00 ? 197 CYS A C    2  
ATOM   2833  O  O    . CYS A 1 43  ? -9.018  -1.514  -4.195  1.00 0.00 ? 197 CYS A O    2  
ATOM   2834  C  CB   . CYS A 1 43  ? -7.363  -0.974  -7.055  1.00 0.00 ? 197 CYS A CB   2  
ATOM   2835  S  SG   . CYS A 1 43  ? -6.948  -2.670  -6.547  1.00 0.00 ? 197 CYS A SG   2  
ATOM   2836  H  H    . CYS A 1 43  ? -6.396  -0.733  -4.568  1.00 0.00 ? 197 CYS A H    2  
ATOM   2837  H  HA   . CYS A 1 43  ? -8.324  0.793   -6.271  1.00 0.00 ? 197 CYS A HA   2  
ATOM   2838  H  HB2  . CYS A 1 43  ? -8.063  -1.015  -7.876  1.00 0.00 ? 197 CYS A HB2  2  
ATOM   2839  H  HB3  . CYS A 1 43  ? -6.464  -0.472  -7.384  1.00 0.00 ? 197 CYS A HB3  2  
ATOM   2840  N  N    . LYS A 1 44  ? -10.355 -0.843  -5.824  1.00 0.00 ? 198 LYS A N    2  
ATOM   2841  C  CA   . LYS A 1 44  ? -11.550 -1.537  -5.202  1.00 0.00 ? 198 LYS A CA   2  
ATOM   2842  C  C    . LYS A 1 44  ? -11.224 -2.997  -4.848  1.00 0.00 ? 198 LYS A C    2  
ATOM   2843  O  O    . LYS A 1 44  ? -11.655 -3.494  -3.824  1.00 0.00 ? 198 LYS A O    2  
ATOM   2844  C  CB   . LYS A 1 44  ? -12.681 -1.476  -6.239  1.00 0.00 ? 198 LYS A CB   2  
ATOM   2845  C  CG   . LYS A 1 44  ? -13.955 -2.085  -5.650  1.00 0.00 ? 198 LYS A CG   2  
ATOM   2846  C  CD   . LYS A 1 44  ? -15.178 -1.470  -6.332  1.00 0.00 ? 198 LYS A CD   2  
ATOM   2847  C  CE   . LYS A 1 44  ? -15.339 -2.068  -7.731  1.00 0.00 ? 198 LYS A CE   2  
ATOM   2848  N  NZ   . LYS A 1 44  ? -16.188 -3.276  -7.537  1.00 0.00 ? 198 LYS A NZ   2  
ATOM   2849  H  H    . LYS A 1 44  ? -10.458 -0.331  -6.661  1.00 0.00 ? 198 LYS A H    2  
ATOM   2850  H  HA   . LYS A 1 44  ? -11.851 -1.017  -4.315  1.00 0.00 ? 198 LYS A HA   2  
ATOM   2851  H  HB2  . LYS A 1 44  ? -12.864 -0.443  -6.502  1.00 0.00 ? 198 LYS A HB2  2  
ATOM   2852  H  HB3  . LYS A 1 44  ? -12.392 -2.027  -7.122  1.00 0.00 ? 198 LYS A HB3  2  
ATOM   2853  H  HG2  . LYS A 1 44  ? -13.950 -3.153  -5.812  1.00 0.00 ? 198 LYS A HG2  2  
ATOM   2854  H  HG3  . LYS A 1 44  ? -13.994 -1.882  -4.591  1.00 0.00 ? 198 LYS A HG3  2  
ATOM   2855  H  HD2  . LYS A 1 44  ? -16.061 -1.681  -5.745  1.00 0.00 ? 198 LYS A HD2  2  
ATOM   2856  H  HD3  . LYS A 1 44  ? -15.047 -0.401  -6.412  1.00 0.00 ? 198 LYS A HD3  2  
ATOM   2857  H  HE2  . LYS A 1 44  ? -15.830 -1.361  -8.386  1.00 0.00 ? 198 LYS A HE2  2  
ATOM   2858  H  HE3  . LYS A 1 44  ? -14.379 -2.351  -8.132  1.00 0.00 ? 198 LYS A HE3  2  
ATOM   2859  H  HZ1  . LYS A 1 44  ? -15.643 -4.007  -7.038  1.00 0.00 ? 198 LYS A HZ1  2  
ATOM   2860  H  HZ2  . LYS A 1 44  ? -16.490 -3.639  -8.465  1.00 0.00 ? 198 LYS A HZ2  2  
ATOM   2861  H  HZ3  . LYS A 1 44  ? -17.025 -3.026  -6.973  1.00 0.00 ? 198 LYS A HZ3  2  
ATOM   2862  N  N    . ASN A 1 45  ? -10.461 -3.683  -5.669  1.00 0.00 ? 199 ASN A N    2  
ATOM   2863  C  CA   . ASN A 1 45  ? -10.116 -5.110  -5.333  1.00 0.00 ? 199 ASN A CA   2  
ATOM   2864  C  C    . ASN A 1 45  ? -9.269  -5.172  -4.049  1.00 0.00 ? 199 ASN A C    2  
ATOM   2865  O  O    . ASN A 1 45  ? -9.310  -6.157  -3.338  1.00 0.00 ? 199 ASN A O    2  
ATOM   2866  C  CB   . ASN A 1 45  ? -9.326  -5.674  -6.525  1.00 0.00 ? 199 ASN A CB   2  
ATOM   2867  C  CG   . ASN A 1 45  ? -10.301 -6.148  -7.608  1.00 0.00 ? 199 ASN A CG   2  
ATOM   2868  O  OD1  . ASN A 1 45  ? -11.329 -6.720  -7.302  1.00 0.00 ? 199 ASN A OD1  2  
ATOM   2869  N  ND2  . ASN A 1 45  ? -10.027 -5.937  -8.873  1.00 0.00 ? 199 ASN A ND2  2  
ATOM   2870  H  H    . ASN A 1 45  ? -10.112 -3.258  -6.487  1.00 0.00 ? 199 ASN A H    2  
ATOM   2871  H  HA   . ASN A 1 45  ? -11.021 -5.676  -5.192  1.00 0.00 ? 199 ASN A HA   2  
ATOM   2872  H  HB2  . ASN A 1 45  ? -8.684  -4.903  -6.928  1.00 0.00 ? 199 ASN A HB2  2  
ATOM   2873  H  HB3  . ASN A 1 45  ? -8.724  -6.507  -6.196  1.00 0.00 ? 199 ASN A HB3  2  
ATOM   2874  H  HD21 . ASN A 1 45  ? -9.200  -5.476  -9.133  1.00 0.00 ? 199 ASN A HD21 2  
ATOM   2875  H  HD22 . ASN A 1 45  ? -10.653 -6.241  -9.564  1.00 0.00 ? 199 ASN A HD22 2  
ATOM   2876  N  N    . CYS A 1 46  ? -8.519  -4.135  -3.728  1.00 0.00 ? 200 CYS A N    2  
ATOM   2877  C  CA   . CYS A 1 46  ? -7.704  -4.170  -2.466  1.00 0.00 ? 200 CYS A CA   2  
ATOM   2878  C  C    . CYS A 1 46  ? -8.627  -3.888  -1.280  1.00 0.00 ? 200 CYS A C    2  
ATOM   2879  O  O    . CYS A 1 46  ? -8.628  -4.611  -0.306  1.00 0.00 ? 200 CYS A O    2  
ATOM   2880  C  CB   . CYS A 1 46  ? -6.644  -3.061  -2.584  1.00 0.00 ? 200 CYS A CB   2  
ATOM   2881  S  SG   . CYS A 1 46  ? -5.162  -3.714  -3.390  1.00 0.00 ? 200 CYS A SG   2  
ATOM   2882  H  H    . CYS A 1 46  ? -8.509  -3.338  -4.299  1.00 0.00 ? 200 CYS A H    2  
ATOM   2883  H  HA   . CYS A 1 46  ? -7.230  -5.130  -2.352  1.00 0.00 ? 200 CYS A HA   2  
ATOM   2884  H  HB2  . CYS A 1 46  ? -7.040  -2.244  -3.166  1.00 0.00 ? 200 CYS A HB2  2  
ATOM   2885  H  HB3  . CYS A 1 46  ? -6.388  -2.705  -1.596  1.00 0.00 ? 200 CYS A HB3  2  
ATOM   2886  N  N    . PHE A 1 47  ? -9.424  -2.846  -1.360  1.00 0.00 ? 201 PHE A N    2  
ATOM   2887  C  CA   . PHE A 1 47  ? -10.360 -2.532  -0.222  1.00 0.00 ? 201 PHE A CA   2  
ATOM   2888  C  C    . PHE A 1 47  ? -11.360 -3.682  -0.033  1.00 0.00 ? 201 PHE A C    2  
ATOM   2889  O  O    . PHE A 1 47  ? -11.711 -4.012  1.085   1.00 0.00 ? 201 PHE A O    2  
ATOM   2890  C  CB   . PHE A 1 47  ? -11.094 -1.233  -0.598  1.00 0.00 ? 201 PHE A CB   2  
ATOM   2891  C  CG   . PHE A 1 47  ? -11.480 -0.479  0.654   1.00 0.00 ? 201 PHE A CG   2  
ATOM   2892  C  CD1  . PHE A 1 47  ? -10.558 0.377   1.271   1.00 0.00 ? 201 PHE A CD1  2  
ATOM   2893  C  CD2  . PHE A 1 47  ? -12.764 -0.629  1.191   1.00 0.00 ? 201 PHE A CD2  2  
ATOM   2894  C  CE1  . PHE A 1 47  ? -10.920 1.080   2.428   1.00 0.00 ? 201 PHE A CE1  2  
ATOM   2895  C  CE2  . PHE A 1 47  ? -13.125 0.075   2.347   1.00 0.00 ? 201 PHE A CE2  2  
ATOM   2896  C  CZ   . PHE A 1 47  ? -12.204 0.928   2.965   1.00 0.00 ? 201 PHE A CZ   2  
ATOM   2897  H  H    . PHE A 1 47  ? -9.410  -2.281  -2.169  1.00 0.00 ? 201 PHE A H    2  
ATOM   2898  H  HA   . PHE A 1 47  ? -9.794  -2.391  0.685   1.00 0.00 ? 201 PHE A HA   2  
ATOM   2899  H  HB2  . PHE A 1 47  ? -10.446 -0.617  -1.202  1.00 0.00 ? 201 PHE A HB2  2  
ATOM   2900  H  HB3  . PHE A 1 47  ? -11.985 -1.474  -1.159  1.00 0.00 ? 201 PHE A HB3  2  
ATOM   2901  H  HD1  . PHE A 1 47  ? -9.569  0.496   0.856   1.00 0.00 ? 201 PHE A HD1  2  
ATOM   2902  H  HD2  . PHE A 1 47  ? -13.475 -1.287  0.716   1.00 0.00 ? 201 PHE A HD2  2  
ATOM   2903  H  HE1  . PHE A 1 47  ? -10.209 1.738   2.906   1.00 0.00 ? 201 PHE A HE1  2  
ATOM   2904  H  HE2  . PHE A 1 47  ? -14.117 -0.041  2.760   1.00 0.00 ? 201 PHE A HE2  2  
ATOM   2905  H  HZ   . PHE A 1 47  ? -12.484 1.470   3.857   1.00 0.00 ? 201 PHE A HZ   2  
ATOM   2906  N  N    . LYS A 1 48  ? -11.812 -4.313  -1.103  1.00 0.00 ? 202 LYS A N    2  
ATOM   2907  C  CA   . LYS A 1 48  ? -12.773 -5.456  -0.927  1.00 0.00 ? 202 LYS A CA   2  
ATOM   2908  C  C    . LYS A 1 48  ? -11.998 -6.712  -0.512  1.00 0.00 ? 202 LYS A C    2  
ATOM   2909  O  O    . LYS A 1 48  ? -12.464 -7.480  0.305   1.00 0.00 ? 202 LYS A O    2  
ATOM   2910  C  CB   . LYS A 1 48  ? -13.467 -5.669  -2.282  1.00 0.00 ? 202 LYS A CB   2  
ATOM   2911  C  CG   . LYS A 1 48  ? -14.680 -4.742  -2.388  1.00 0.00 ? 202 LYS A CG   2  
ATOM   2912  C  CD   . LYS A 1 48  ? -15.937 -5.490  -1.939  1.00 0.00 ? 202 LYS A CD   2  
ATOM   2913  C  CE   . LYS A 1 48  ? -16.889 -4.517  -1.241  1.00 0.00 ? 202 LYS A CE   2  
ATOM   2914  N  NZ   . LYS A 1 48  ? -16.610 -4.683  0.213   1.00 0.00 ? 202 LYS A NZ   2  
ATOM   2915  H  H    . LYS A 1 48  ? -11.506 -4.050  -2.007  1.00 0.00 ? 202 LYS A H    2  
ATOM   2916  H  HA   . LYS A 1 48  ? -13.504 -5.211  -0.170  1.00 0.00 ? 202 LYS A HA   2  
ATOM   2917  H  HB2  . LYS A 1 48  ? -12.773 -5.448  -3.080  1.00 0.00 ? 202 LYS A HB2  2  
ATOM   2918  H  HB3  . LYS A 1 48  ? -13.792 -6.695  -2.362  1.00 0.00 ? 202 LYS A HB3  2  
ATOM   2919  H  HG2  . LYS A 1 48  ? -14.529 -3.879  -1.756  1.00 0.00 ? 202 LYS A HG2  2  
ATOM   2920  H  HG3  . LYS A 1 48  ? -14.800 -4.422  -3.412  1.00 0.00 ? 202 LYS A HG3  2  
ATOM   2921  H  HD2  . LYS A 1 48  ? -16.427 -5.919  -2.801  1.00 0.00 ? 202 LYS A HD2  2  
ATOM   2922  H  HD3  . LYS A 1 48  ? -15.662 -6.277  -1.253  1.00 0.00 ? 202 LYS A HD3  2  
ATOM   2923  H  HE2  . LYS A 1 48  ? -16.683 -3.502  -1.552  1.00 0.00 ? 202 LYS A HE2  2  
ATOM   2924  H  HE3  . LYS A 1 48  ? -17.915 -4.776  -1.451  1.00 0.00 ? 202 LYS A HE3  2  
ATOM   2925  H  HZ1  . LYS A 1 48  ? -17.333 -4.181  0.765   1.00 0.00 ? 202 LYS A HZ1  2  
ATOM   2926  H  HZ2  . LYS A 1 48  ? -15.670 -4.292  0.433   1.00 0.00 ? 202 LYS A HZ2  2  
ATOM   2927  H  HZ3  . LYS A 1 48  ? -16.630 -5.694  0.457   1.00 0.00 ? 202 LYS A HZ3  2  
ATOM   2928  N  N    . TYR A 1 49  ? -10.812 -6.920  -1.048  1.00 0.00 ? 203 TYR A N    2  
ATOM   2929  C  CA   . TYR A 1 49  ? -10.019 -8.131  -0.643  1.00 0.00 ? 203 TYR A CA   2  
ATOM   2930  C  C    . TYR A 1 49  ? -9.454  -7.930  0.774   1.00 0.00 ? 203 TYR A C    2  
ATOM   2931  O  O    . TYR A 1 49  ? -9.386  -8.869  1.546   1.00 0.00 ? 203 TYR A O    2  
ATOM   2932  C  CB   . TYR A 1 49  ? -8.882  -8.273  -1.668  1.00 0.00 ? 203 TYR A CB   2  
ATOM   2933  C  CG   . TYR A 1 49  ? -8.050  -9.497  -1.363  1.00 0.00 ? 203 TYR A CG   2  
ATOM   2934  C  CD1  . TYR A 1 49  ? -8.668  -10.736 -1.144  1.00 0.00 ? 203 TYR A CD1  2  
ATOM   2935  C  CD2  . TYR A 1 49  ? -6.658  -9.390  -1.309  1.00 0.00 ? 203 TYR A CD2  2  
ATOM   2936  C  CE1  . TYR A 1 49  ? -7.890  -11.866 -0.872  1.00 0.00 ? 203 TYR A CE1  2  
ATOM   2937  C  CE2  . TYR A 1 49  ? -5.879  -10.520 -1.036  1.00 0.00 ? 203 TYR A CE2  2  
ATOM   2938  C  CZ   . TYR A 1 49  ? -6.495  -11.758 -0.817  1.00 0.00 ? 203 TYR A CZ   2  
ATOM   2939  O  OH   . TYR A 1 49  ? -5.726  -12.873 -0.548  1.00 0.00 ? 203 TYR A OH   2  
ATOM   2940  H  H    . TYR A 1 49  ? -10.441 -6.278  -1.699  1.00 0.00 ? 203 TYR A H    2  
ATOM   2941  H  HA   . TYR A 1 49  ? -10.649 -9.008  -0.666  1.00 0.00 ? 203 TYR A HA   2  
ATOM   2942  H  HB2  . TYR A 1 49  ? -9.304  -8.366  -2.658  1.00 0.00 ? 203 TYR A HB2  2  
ATOM   2943  H  HB3  . TYR A 1 49  ? -8.254  -7.395  -1.629  1.00 0.00 ? 203 TYR A HB3  2  
ATOM   2944  H  HD1  . TYR A 1 49  ? -9.745  -10.819 -1.186  1.00 0.00 ? 203 TYR A HD1  2  
ATOM   2945  H  HD2  . TYR A 1 49  ? -6.183  -8.433  -1.477  1.00 0.00 ? 203 TYR A HD2  2  
ATOM   2946  H  HE1  . TYR A 1 49  ? -8.365  -12.822 -0.703  1.00 0.00 ? 203 TYR A HE1  2  
ATOM   2947  H  HE2  . TYR A 1 49  ? -4.804  -10.437 -0.996  1.00 0.00 ? 203 TYR A HE2  2  
ATOM   2948  H  HH   . TYR A 1 49  ? -5.766  -13.452 -1.312  1.00 0.00 ? 203 TYR A HH   2  
ATOM   2949  N  N    . TYR A 1 50  ? -9.070  -6.716  1.142   1.00 0.00 ? 204 TYR A N    2  
ATOM   2950  C  CA   . TYR A 1 50  ? -8.543  -6.506  2.537   1.00 0.00 ? 204 TYR A CA   2  
ATOM   2951  C  C    . TYR A 1 50  ? -9.677  -6.744  3.548   1.00 0.00 ? 204 TYR A C    2  
ATOM   2952  O  O    . TYR A 1 50  ? -9.452  -7.275  4.619   1.00 0.00 ? 204 TYR A O    2  
ATOM   2953  C  CB   . TYR A 1 50  ? -8.043  -5.053  2.623   1.00 0.00 ? 204 TYR A CB   2  
ATOM   2954  C  CG   . TYR A 1 50  ? -6.944  -4.953  3.655   1.00 0.00 ? 204 TYR A CG   2  
ATOM   2955  C  CD1  . TYR A 1 50  ? -5.836  -5.805  3.582   1.00 0.00 ? 204 TYR A CD1  2  
ATOM   2956  C  CD2  . TYR A 1 50  ? -7.030  -4.004  4.680   1.00 0.00 ? 204 TYR A CD2  2  
ATOM   2957  C  CE1  . TYR A 1 50  ? -4.816  -5.711  4.534   1.00 0.00 ? 204 TYR A CE1  2  
ATOM   2958  C  CE2  . TYR A 1 50  ? -6.009  -3.908  5.633   1.00 0.00 ? 204 TYR A CE2  2  
ATOM   2959  C  CZ   . TYR A 1 50  ? -4.902  -4.763  5.561   1.00 0.00 ? 204 TYR A CZ   2  
ATOM   2960  O  OH   . TYR A 1 50  ? -3.895  -4.670  6.500   1.00 0.00 ? 204 TYR A OH   2  
ATOM   2961  H  H    . TYR A 1 50  ? -9.148  -5.955  0.516   1.00 0.00 ? 204 TYR A H    2  
ATOM   2962  H  HA   . TYR A 1 50  ? -7.729  -7.188  2.728   1.00 0.00 ? 204 TYR A HA   2  
ATOM   2963  H  HB2  . TYR A 1 50  ? -7.657  -4.749  1.664   1.00 0.00 ? 204 TYR A HB2  2  
ATOM   2964  H  HB3  . TYR A 1 50  ? -8.861  -4.407  2.904   1.00 0.00 ? 204 TYR A HB3  2  
ATOM   2965  H  HD1  . TYR A 1 50  ? -5.770  -6.536  2.791   1.00 0.00 ? 204 TYR A HD1  2  
ATOM   2966  H  HD2  . TYR A 1 50  ? -7.885  -3.346  4.736   1.00 0.00 ? 204 TYR A HD2  2  
ATOM   2967  H  HE1  . TYR A 1 50  ? -3.963  -6.372  4.476   1.00 0.00 ? 204 TYR A HE1  2  
ATOM   2968  H  HE2  . TYR A 1 50  ? -6.076  -3.176  6.424   1.00 0.00 ? 204 TYR A HE2  2  
ATOM   2969  H  HH   . TYR A 1 50  ? -4.171  -5.157  7.280   1.00 0.00 ? 204 TYR A HH   2  
ATOM   2970  N  N    . MET A 1 51  ? -10.902 -6.374  3.212   1.00 0.00 ? 205 MET A N    2  
ATOM   2971  C  CA   . MET A 1 51  ? -12.040 -6.612  4.162   1.00 0.00 ? 205 MET A CA   2  
ATOM   2972  C  C    . MET A 1 51  ? -12.604 -8.023  3.934   1.00 0.00 ? 205 MET A C    2  
ATOM   2973  O  O    . MET A 1 51  ? -12.908 -8.732  4.874   1.00 0.00 ? 205 MET A O    2  
ATOM   2974  C  CB   . MET A 1 51  ? -13.099 -5.543  3.846   1.00 0.00 ? 205 MET A CB   2  
ATOM   2975  C  CG   . MET A 1 51  ? -14.313 -5.732  4.760   1.00 0.00 ? 205 MET A CG   2  
ATOM   2976  S  SD   . MET A 1 51  ? -15.424 -4.313  4.587   1.00 0.00 ? 205 MET A SD   2  
ATOM   2977  C  CE   . MET A 1 51  ? -14.989 -3.493  6.139   1.00 0.00 ? 205 MET A CE   2  
ATOM   2978  H  H    . MET A 1 51  ? -11.071 -5.961  2.332   1.00 0.00 ? 205 MET A H    2  
ATOM   2979  H  HA   . MET A 1 51  ? -11.702 -6.509  5.178   1.00 0.00 ? 205 MET A HA   2  
ATOM   2980  H  HB2  . MET A 1 51  ? -12.677 -4.561  4.007   1.00 0.00 ? 205 MET A HB2  2  
ATOM   2981  H  HB3  . MET A 1 51  ? -13.409 -5.637  2.817   1.00 0.00 ? 205 MET A HB3  2  
ATOM   2982  H  HG2  . MET A 1 51  ? -14.834 -6.634  4.481   1.00 0.00 ? 205 MET A HG2  2  
ATOM   2983  H  HG3  . MET A 1 51  ? -13.983 -5.808  5.785   1.00 0.00 ? 205 MET A HG3  2  
ATOM   2984  H  HE1  . MET A 1 51  ? -15.726 -3.736  6.893   1.00 0.00 ? 205 MET A HE1  2  
ATOM   2985  H  HE2  . MET A 1 51  ? -14.969 -2.426  5.991   1.00 0.00 ? 205 MET A HE2  2  
ATOM   2986  H  HE3  . MET A 1 51  ? -14.014 -3.829  6.462   1.00 0.00 ? 205 MET A HE3  2  
ATOM   2987  N  N    . SER A 1 52  ? -12.739 -8.443  2.690   1.00 0.00 ? 206 SER A N    2  
ATOM   2988  C  CA   . SER A 1 52  ? -13.278 -9.827  2.417   1.00 0.00 ? 206 SER A CA   2  
ATOM   2989  C  C    . SER A 1 52  ? -12.428 -10.879 3.148   1.00 0.00 ? 206 SER A C    2  
ATOM   2990  O  O    . SER A 1 52  ? -12.949 -11.842 3.680   1.00 0.00 ? 206 SER A O    2  
ATOM   2991  C  CB   . SER A 1 52  ? -13.192 -10.048 0.899   1.00 0.00 ? 206 SER A CB   2  
ATOM   2992  O  OG   . SER A 1 52  ? -13.392 -11.427 0.614   1.00 0.00 ? 206 SER A OG   2  
ATOM   2993  H  H    . SER A 1 52  ? -12.480 -7.851  1.946   1.00 0.00 ? 206 SER A H    2  
ATOM   2994  H  HA   . SER A 1 52  ? -14.300 -9.892  2.736   1.00 0.00 ? 206 SER A HA   2  
ATOM   2995  H  HB2  . SER A 1 52  ? -13.954 -9.470  0.404   1.00 0.00 ? 206 SER A HB2  2  
ATOM   2996  H  HB3  . SER A 1 52  ? -12.218 -9.734  0.545   1.00 0.00 ? 206 SER A HB3  2  
ATOM   2997  H  HG   . SER A 1 52  ? -13.286 -11.552 -0.332  1.00 0.00 ? 206 SER A HG   2  
ATOM   2998  N  N    . ASP A 1 53  ? -11.124 -10.698 3.185   1.00 0.00 ? 207 ASP A N    2  
ATOM   2999  C  CA   . ASP A 1 53  ? -10.250 -11.682 3.889   1.00 0.00 ? 207 ASP A CA   2  
ATOM   3000  C  C    . ASP A 1 53  ? -9.583  -11.014 5.101   1.00 0.00 ? 207 ASP A C    2  
ATOM   3001  O  O    . ASP A 1 53  ? -9.211  -9.857  5.043   1.00 0.00 ? 207 ASP A O    2  
ATOM   3002  C  CB   . ASP A 1 53  ? -9.199  -12.096 2.857   1.00 0.00 ? 207 ASP A CB   2  
ATOM   3003  C  CG   . ASP A 1 53  ? -9.759  -13.216 1.978   1.00 0.00 ? 207 ASP A CG   2  
ATOM   3004  O  OD1  . ASP A 1 53  ? -9.885  -14.323 2.472   1.00 0.00 ? 207 ASP A OD1  2  
ATOM   3005  O  OD2  . ASP A 1 53  ? -10.052 -12.945 0.824   1.00 0.00 ? 207 ASP A OD2  2  
ATOM   3006  H  H    . ASP A 1 53  ? -10.721 -9.912  2.756   1.00 0.00 ? 207 ASP A H    2  
ATOM   3007  H  HA   . ASP A 1 53  ? -10.822 -12.542 4.200   1.00 0.00 ? 207 ASP A HA   2  
ATOM   3008  H  HB2  . ASP A 1 53  ? -8.946  -11.244 2.241   1.00 0.00 ? 207 ASP A HB2  2  
ATOM   3009  H  HB3  . ASP A 1 53  ? -8.314  -12.449 3.365   1.00 0.00 ? 207 ASP A HB3  2  
ATOM   3010  N  N    . ASP A 1 54  ? -9.428  -11.728 6.197   1.00 0.00 ? 208 ASP A N    2  
ATOM   3011  C  CA   . ASP A 1 54  ? -8.785  -11.116 7.402   1.00 0.00 ? 208 ASP A CA   2  
ATOM   3012  C  C    . ASP A 1 54  ? -7.430  -11.781 7.675   1.00 0.00 ? 208 ASP A C    2  
ATOM   3013  O  O    . ASP A 1 54  ? -7.215  -12.925 7.321   1.00 0.00 ? 208 ASP A O    2  
ATOM   3014  C  CB   . ASP A 1 54  ? -9.756  -11.382 8.555   1.00 0.00 ? 208 ASP A CB   2  
ATOM   3015  C  CG   . ASP A 1 54  ? -10.916 -10.388 8.484   1.00 0.00 ? 208 ASP A CG   2  
ATOM   3016  O  OD1  . ASP A 1 54  ? -10.664 -9.202  8.616   1.00 0.00 ? 208 ASP A OD1  2  
ATOM   3017  O  OD2  . ASP A 1 54  ? -12.039 -10.830 8.299   1.00 0.00 ? 208 ASP A OD2  2  
ATOM   3018  H  H    . ASP A 1 54  ? -9.733  -12.662 6.231   1.00 0.00 ? 208 ASP A H    2  
ATOM   3019  H  HA   . ASP A 1 54  ? -8.657  -10.054 7.265   1.00 0.00 ? 208 ASP A HA   2  
ATOM   3020  H  HB2  . ASP A 1 54  ? -10.137 -12.389 8.480   1.00 0.00 ? 208 ASP A HB2  2  
ATOM   3021  H  HB3  . ASP A 1 54  ? -9.239  -11.261 9.495   1.00 0.00 ? 208 ASP A HB3  2  
ATOM   3022  N  N    . ILE A 1 55  ? -6.513  -11.076 8.305   1.00 0.00 ? 209 ILE A N    2  
ATOM   3023  C  CA   . ILE A 1 55  ? -5.176  -11.683 8.597   1.00 0.00 ? 209 ILE A CA   2  
ATOM   3024  C  C    . ILE A 1 55  ? -5.098  -12.093 10.075  1.00 0.00 ? 209 ILE A C    2  
ATOM   3025  O  O    . ILE A 1 55  ? -5.108  -11.255 10.958  1.00 0.00 ? 209 ILE A O    2  
ATOM   3026  C  CB   . ILE A 1 55  ? -4.141  -10.595 8.265   1.00 0.00 ? 209 ILE A CB   2  
ATOM   3027  C  CG1  . ILE A 1 55  ? -4.223  -10.250 6.768   1.00 0.00 ? 209 ILE A CG1  2  
ATOM   3028  C  CG2  . ILE A 1 55  ? -2.729  -11.092 8.598   1.00 0.00 ? 209 ILE A CG2  2  
ATOM   3029  C  CD1  . ILE A 1 55  ? -3.945  -11.498 5.915   1.00 0.00 ? 209 ILE A CD1  2  
ATOM   3030  H  H    . ILE A 1 55  ? -6.707  -10.152 8.589   1.00 0.00 ? 209 ILE A H    2  
ATOM   3031  H  HA   . ILE A 1 55  ? -5.016  -12.544 7.968   1.00 0.00 ? 209 ILE A HA   2  
ATOM   3032  H  HB   . ILE A 1 55  ? -4.355  -9.711  8.849   1.00 0.00 ? 209 ILE A HB   2  
ATOM   3033  H  HG12 . ILE A 1 55  ? -5.210  -9.874  6.542   1.00 0.00 ? 209 ILE A HG12 2  
ATOM   3034  H  HG13 . ILE A 1 55  ? -3.490  -9.491  6.537   1.00 0.00 ? 209 ILE A HG13 2  
ATOM   3035  H  HG21 . ILE A 1 55  ? -2.025  -10.282 8.480   1.00 0.00 ? 209 ILE A HG21 2  
ATOM   3036  H  HG22 . ILE A 1 55  ? -2.464  -11.899 7.931   1.00 0.00 ? 209 ILE A HG22 2  
ATOM   3037  H  HG23 . ILE A 1 55  ? -2.703  -11.445 9.619   1.00 0.00 ? 209 ILE A HG23 2  
ATOM   3038  H  HD11 . ILE A 1 55  ? -3.644  -12.317 6.555   1.00 0.00 ? 209 ILE A HD11 2  
ATOM   3039  H  HD12 . ILE A 1 55  ? -3.156  -11.283 5.209   1.00 0.00 ? 209 ILE A HD12 2  
ATOM   3040  H  HD13 . ILE A 1 55  ? -4.842  -11.773 5.379   1.00 0.00 ? 209 ILE A HD13 2  
ATOM   3041  N  N    . SER A 1 56  ? -5.021  -13.378 10.351  1.00 0.00 ? 210 SER A N    2  
ATOM   3042  C  CA   . SER A 1 56  ? -4.946  -13.837 11.776  1.00 0.00 ? 210 SER A CA   2  
ATOM   3043  C  C    . SER A 1 56  ? -4.374  -15.263 11.857  1.00 0.00 ? 210 SER A C    2  
ATOM   3044  O  O    . SER A 1 56  ? -4.976  -16.202 11.369  1.00 0.00 ? 210 SER A O    2  
ATOM   3045  C  CB   . SER A 1 56  ? -6.389  -13.816 12.282  1.00 0.00 ? 210 SER A CB   2  
ATOM   3046  O  OG   . SER A 1 56  ? -7.086  -12.730 11.682  1.00 0.00 ? 210 SER A OG   2  
ATOM   3047  H  H    . SER A 1 56  ? -5.016  -14.040 9.620   1.00 0.00 ? 210 SER A H    2  
ATOM   3048  H  HA   . SER A 1 56  ? -4.343  -13.157 12.358  1.00 0.00 ? 210 SER A HA   2  
ATOM   3049  H  HB2  . SER A 1 56  ? -6.877  -14.741 12.021  1.00 0.00 ? 210 SER A HB2  2  
ATOM   3050  H  HB3  . SER A 1 56  ? -6.389  -13.704 13.358  1.00 0.00 ? 210 SER A HB3  2  
ATOM   3051  H  HG   . SER A 1 56  ? -7.470  -13.038 10.856  1.00 0.00 ? 210 SER A HG   2  
ATOM   3052  N  N    . ARG A 1 57  ? -3.215  -15.440 12.467  1.00 0.00 ? 211 ARG A N    2  
ATOM   3053  C  CA   . ARG A 1 57  ? -2.611  -16.812 12.575  1.00 0.00 ? 211 ARG A CA   2  
ATOM   3054  C  C    . ARG A 1 57  ? -2.548  -17.486 11.192  1.00 0.00 ? 211 ARG A C    2  
ATOM   3055  O  O    . ARG A 1 57  ? -3.481  -18.157 10.789  1.00 0.00 ? 211 ARG A O    2  
ATOM   3056  C  CB   . ARG A 1 57  ? -3.544  -17.590 13.508  1.00 0.00 ? 211 ARG A CB   2  
ATOM   3057  C  CG   . ARG A 1 57  ? -3.579  -16.912 14.878  1.00 0.00 ? 211 ARG A CG   2  
ATOM   3058  C  CD   . ARG A 1 57  ? -4.801  -17.399 15.659  1.00 0.00 ? 211 ARG A CD   2  
ATOM   3059  N  NE   . ARG A 1 57  ? -4.470  -17.144 17.094  1.00 0.00 ? 211 ARG A NE   2  
ATOM   3060  C  CZ   . ARG A 1 57  ? -3.551  -17.859 17.725  1.00 0.00 ? 211 ARG A CZ   2  
ATOM   3061  N  NH1  . ARG A 1 57  ? -2.895  -18.821 17.118  1.00 0.00 ? 211 ARG A NH1  2  
ATOM   3062  N  NH2  . ARG A 1 57  ? -3.287  -17.607 18.982  1.00 0.00 ? 211 ARG A NH2  2  
ATOM   3063  H  H    . ARG A 1 57  ? -2.741  -14.674 12.857  1.00 0.00 ? 211 ARG A H    2  
ATOM   3064  H  HA   . ARG A 1 57  ? -1.625  -16.753 13.008  1.00 0.00 ? 211 ARG A HA   2  
ATOM   3065  H  HB2  . ARG A 1 57  ? -4.539  -17.608 13.089  1.00 0.00 ? 211 ARG A HB2  2  
ATOM   3066  H  HB3  . ARG A 1 57  ? -3.180  -18.601 13.618  1.00 0.00 ? 211 ARG A HB3  2  
ATOM   3067  H  HG2  . ARG A 1 57  ? -2.680  -17.159 15.425  1.00 0.00 ? 211 ARG A HG2  2  
ATOM   3068  H  HG3  . ARG A 1 57  ? -3.639  -15.842 14.749  1.00 0.00 ? 211 ARG A HG3  2  
ATOM   3069  H  HD2  . ARG A 1 57  ? -5.679  -16.838 15.367  1.00 0.00 ? 211 ARG A HD2  2  
ATOM   3070  H  HD3  . ARG A 1 57  ? -4.956  -18.455 15.498  1.00 0.00 ? 211 ARG A HD3  2  
ATOM   3071  H  HE   . ARG A 1 57  ? -4.944  -16.431 17.575  1.00 0.00 ? 211 ARG A HE   2  
ATOM   3072  H  HH11 . ARG A 1 57  ? -3.078  -19.034 16.159  1.00 0.00 ? 211 ARG A HH11 2  
ATOM   3073  H  HH12 . ARG A 1 57  ? -2.207  -19.346 17.619  1.00 0.00 ? 211 ARG A HH12 2  
ATOM   3074  H  HH21 . ARG A 1 57  ? -3.777  -16.878 19.459  1.00 0.00 ? 211 ARG A HH21 2  
ATOM   3075  H  HH22 . ARG A 1 57  ? -2.594  -18.143 19.464  1.00 0.00 ? 211 ARG A HH22 2  
ATOM   3076  N  N    . ASP A 1 58  ? -1.469  -17.307 10.456  1.00 0.00 ? 212 ASP A N    2  
ATOM   3077  C  CA   . ASP A 1 58  ? -1.381  -17.936 9.103   1.00 0.00 ? 212 ASP A CA   2  
ATOM   3078  C  C    . ASP A 1 58  ? -0.200  -18.913 9.015   1.00 0.00 ? 212 ASP A C    2  
ATOM   3079  O  O    . ASP A 1 58  ? -0.377  -20.070 8.679   1.00 0.00 ? 212 ASP A O    2  
ATOM   3080  C  CB   . ASP A 1 58  ? -1.180  -16.767 8.138   1.00 0.00 ? 212 ASP A CB   2  
ATOM   3081  C  CG   . ASP A 1 58  ? -1.222  -17.282 6.697   1.00 0.00 ? 212 ASP A CG   2  
ATOM   3082  O  OD1  . ASP A 1 58  ? -0.179  -17.673 6.199   1.00 0.00 ? 212 ASP A OD1  2  
ATOM   3083  O  OD2  . ASP A 1 58  ? -2.295  -17.275 6.117   1.00 0.00 ? 212 ASP A OD2  2  
ATOM   3084  H  H    . ASP A 1 58  ? -0.725  -16.754 10.786  1.00 0.00 ? 212 ASP A H    2  
ATOM   3085  H  HA   . ASP A 1 58  ? -2.294  -18.444 8.873   1.00 0.00 ? 212 ASP A HA   2  
ATOM   3086  H  HB2  . ASP A 1 58  ? -1.967  -16.041 8.285   1.00 0.00 ? 212 ASP A HB2  2  
ATOM   3087  H  HB3  . ASP A 1 58  ? -0.223  -16.305 8.326   1.00 0.00 ? 212 ASP A HB3  2  
ATOM   3088  N  N    . SER A 1 59  ? 1.000   -18.464 9.299   1.00 0.00 ? 213 SER A N    2  
ATOM   3089  C  CA   . SER A 1 59  ? 2.184   -19.386 9.209   1.00 0.00 ? 213 SER A CA   2  
ATOM   3090  C  C    . SER A 1 59  ? 2.568   -19.949 10.589  1.00 0.00 ? 213 SER A C    2  
ATOM   3091  O  O    . SER A 1 59  ? 3.053   -21.062 10.684  1.00 0.00 ? 213 SER A O    2  
ATOM   3092  C  CB   . SER A 1 59  ? 3.330   -18.541 8.643   1.00 0.00 ? 213 SER A CB   2  
ATOM   3093  O  OG   . SER A 1 59  ? 3.186   -18.437 7.233   1.00 0.00 ? 213 SER A OG   2  
ATOM   3094  H  H    . SER A 1 59  ? 1.123   -17.523 9.561   1.00 0.00 ? 213 SER A H    2  
ATOM   3095  H  HA   . SER A 1 59  ? 1.967   -20.197 8.531   1.00 0.00 ? 213 SER A HA   2  
ATOM   3096  H  HB2  . SER A 1 59  ? 3.302   -17.557 9.076   1.00 0.00 ? 213 SER A HB2  2  
ATOM   3097  H  HB3  . SER A 1 59  ? 4.275   -19.011 8.885   1.00 0.00 ? 213 SER A HB3  2  
ATOM   3098  H  HG   . SER A 1 59  ? 3.818   -17.788 6.917   1.00 0.00 ? 213 SER A HG   2  
ATOM   3099  N  N    . ASP A 1 60  ? 2.371   -19.204 11.660  1.00 0.00 ? 214 ASP A N    2  
ATOM   3100  C  CA   . ASP A 1 60  ? 2.749   -19.729 13.011  1.00 0.00 ? 214 ASP A CA   2  
ATOM   3101  C  C    . ASP A 1 60  ? 1.845   -19.133 14.102  1.00 0.00 ? 214 ASP A C    2  
ATOM   3102  O  O    . ASP A 1 60  ? 2.304   -18.834 15.188  1.00 0.00 ? 214 ASP A O    2  
ATOM   3103  C  CB   . ASP A 1 60  ? 4.193   -19.276 13.218  1.00 0.00 ? 214 ASP A CB   2  
ATOM   3104  C  CG   . ASP A 1 60  ? 5.099   -19.966 12.196  1.00 0.00 ? 214 ASP A CG   2  
ATOM   3105  O  OD1  . ASP A 1 60  ? 5.372   -21.142 12.376  1.00 0.00 ? 214 ASP A OD1  2  
ATOM   3106  O  OD2  . ASP A 1 60  ? 5.504   -19.308 11.252  1.00 0.00 ? 214 ASP A OD2  2  
ATOM   3107  H  H    . ASP A 1 60  ? 1.986   -18.305 11.578  1.00 0.00 ? 214 ASP A H    2  
ATOM   3108  H  HA   . ASP A 1 60  ? 2.696   -20.806 13.025  1.00 0.00 ? 214 ASP A HA   2  
ATOM   3109  H  HB2  . ASP A 1 60  ? 4.253   -18.204 13.089  1.00 0.00 ? 214 ASP A HB2  2  
ATOM   3110  H  HB3  . ASP A 1 60  ? 4.513   -19.536 14.215  1.00 0.00 ? 214 ASP A HB3  2  
ATOM   3111  N  N    . GLY A 1 61  ? 0.569   -18.955 13.828  1.00 0.00 ? 215 GLY A N    2  
ATOM   3112  C  CA   . GLY A 1 61  ? -0.347  -18.374 14.859  1.00 0.00 ? 215 GLY A CA   2  
ATOM   3113  C  C    . GLY A 1 61  ? 0.185   -17.011 15.345  1.00 0.00 ? 215 GLY A C    2  
ATOM   3114  O  O    . GLY A 1 61  ? -0.021  -16.644 16.488  1.00 0.00 ? 215 GLY A O    2  
ATOM   3115  H  H    . GLY A 1 61  ? 0.210   -19.200 12.947  1.00 0.00 ? 215 GLY A H    2  
ATOM   3116  H  HA2  . GLY A 1 61  ? -1.328  -18.243 14.429  1.00 0.00 ? 215 GLY A HA2  2  
ATOM   3117  H  HA3  . GLY A 1 61  ? -0.411  -19.049 15.698  1.00 0.00 ? 215 GLY A HA3  2  
ATOM   3118  N  N    . MET A 1 62  ? 0.860   -16.255 14.499  1.00 0.00 ? 216 MET A N    2  
ATOM   3119  C  CA   . MET A 1 62  ? 1.384   -14.926 14.939  1.00 0.00 ? 216 MET A CA   2  
ATOM   3120  C  C    . MET A 1 62  ? 1.298   -13.903 13.791  1.00 0.00 ? 216 MET A C    2  
ATOM   3121  O  O    . MET A 1 62  ? 2.153   -13.051 13.660  1.00 0.00 ? 216 MET A O    2  
ATOM   3122  C  CB   . MET A 1 62  ? 2.843   -15.184 15.317  1.00 0.00 ? 216 MET A CB   2  
ATOM   3123  C  CG   . MET A 1 62  ? 3.294   -14.150 16.351  1.00 0.00 ? 216 MET A CG   2  
ATOM   3124  S  SD   . MET A 1 62  ? 4.731   -14.783 17.250  1.00 0.00 ? 216 MET A SD   2  
ATOM   3125  C  CE   . MET A 1 62  ? 3.829   -15.853 18.397  1.00 0.00 ? 216 MET A CE   2  
ATOM   3126  H  H    . MET A 1 62  ? 1.020   -16.553 13.577  1.00 0.00 ? 216 MET A H    2  
ATOM   3127  H  HA   . MET A 1 62  ? 0.838   -14.572 15.800  1.00 0.00 ? 216 MET A HA   2  
ATOM   3128  H  HB2  . MET A 1 62  ? 2.936   -16.177 15.735  1.00 0.00 ? 216 MET A HB2  2  
ATOM   3129  H  HB3  . MET A 1 62  ? 3.463   -15.104 14.438  1.00 0.00 ? 216 MET A HB3  2  
ATOM   3130  H  HG2  . MET A 1 62  ? 3.558   -13.232 15.850  1.00 0.00 ? 216 MET A HG2  2  
ATOM   3131  H  HG3  . MET A 1 62  ? 2.488   -13.963 17.046  1.00 0.00 ? 216 MET A HG3  2  
ATOM   3132  H  HE1  . MET A 1 62  ? 4.517   -16.551 18.854  1.00 0.00 ? 216 MET A HE1  2  
ATOM   3133  H  HE2  . MET A 1 62  ? 3.069   -16.399 17.860  1.00 0.00 ? 216 MET A HE2  2  
ATOM   3134  H  HE3  . MET A 1 62  ? 3.361   -15.248 19.162  1.00 0.00 ? 216 MET A HE3  2  
ATOM   3135  N  N    . ASP A 1 63  ? 0.269   -13.973 12.962  1.00 0.00 ? 217 ASP A N    2  
ATOM   3136  C  CA   . ASP A 1 63  ? 0.128   -13.001 11.828  1.00 0.00 ? 217 ASP A CA   2  
ATOM   3137  C  C    . ASP A 1 63  ? 1.385   -13.002 10.941  1.00 0.00 ? 217 ASP A C    2  
ATOM   3138  O  O    . ASP A 1 63  ? 2.401   -12.435 11.295  1.00 0.00 ? 217 ASP A O    2  
ATOM   3139  C  CB   . ASP A 1 63  ? -0.068  -11.628 12.482  1.00 0.00 ? 217 ASP A CB   2  
ATOM   3140  C  CG   . ASP A 1 63  ? -0.845  -10.717 11.531  1.00 0.00 ? 217 ASP A CG   2  
ATOM   3141  O  OD1  . ASP A 1 63  ? -0.212  -10.064 10.717  1.00 0.00 ? 217 ASP A OD1  2  
ATOM   3142  O  OD2  . ASP A 1 63  ? -2.061  -10.685 11.633  1.00 0.00 ? 217 ASP A OD2  2  
ATOM   3143  H  H    . ASP A 1 63  ? -0.418  -14.663 13.085  1.00 0.00 ? 217 ASP A H    2  
ATOM   3144  H  HA   . ASP A 1 63  ? -0.740  -13.249 11.237  1.00 0.00 ? 217 ASP A HA   2  
ATOM   3145  H  HB2  . ASP A 1 63  ? -0.621  -11.744 13.402  1.00 0.00 ? 217 ASP A HB2  2  
ATOM   3146  H  HB3  . ASP A 1 63  ? 0.895   -11.189 12.692  1.00 0.00 ? 217 ASP A HB3  2  
ATOM   3147  N  N    . GLU A 1 64  ? 1.325   -13.629 9.782   1.00 0.00 ? 218 GLU A N    2  
ATOM   3148  C  CA   . GLU A 1 64  ? 2.515   -13.655 8.882   1.00 0.00 ? 218 GLU A CA   2  
ATOM   3149  C  C    . GLU A 1 64  ? 2.091   -13.361 7.435   1.00 0.00 ? 218 GLU A C    2  
ATOM   3150  O  O    . GLU A 1 64  ? 2.465   -14.071 6.522   1.00 0.00 ? 218 GLU A O    2  
ATOM   3151  C  CB   . GLU A 1 64  ? 3.076   -15.072 9.003   1.00 0.00 ? 218 GLU A CB   2  
ATOM   3152  C  CG   . GLU A 1 64  ? 4.596   -15.037 8.829   1.00 0.00 ? 218 GLU A CG   2  
ATOM   3153  C  CD   . GLU A 1 64  ? 5.237   -16.110 9.710   1.00 0.00 ? 218 GLU A CD   2  
ATOM   3154  O  OE1  . GLU A 1 64  ? 5.248   -15.929 10.917  1.00 0.00 ? 218 GLU A OE1  2  
ATOM   3155  O  OE2  . GLU A 1 64  ? 5.706   -17.094 9.163   1.00 0.00 ? 218 GLU A OE2  2  
ATOM   3156  H  H    . GLU A 1 64  ? 0.496   -14.076 9.500   1.00 0.00 ? 218 GLU A H    2  
ATOM   3157  H  HA   . GLU A 1 64  ? 3.250   -12.937 9.211   1.00 0.00 ? 218 GLU A HA   2  
ATOM   3158  H  HB2  . GLU A 1 64  ? 2.833   -15.472 9.977   1.00 0.00 ? 218 GLU A HB2  2  
ATOM   3159  H  HB3  . GLU A 1 64  ? 2.642   -15.698 8.237   1.00 0.00 ? 218 GLU A HB3  2  
ATOM   3160  H  HG2  . GLU A 1 64  ? 4.843   -15.223 7.794   1.00 0.00 ? 218 GLU A HG2  2  
ATOM   3161  H  HG3  . GLU A 1 64  ? 4.969   -14.066 9.119   1.00 0.00 ? 218 GLU A HG3  2  
ATOM   3162  N  N    . GLN A 1 65  ? 1.312   -12.320 7.218   1.00 0.00 ? 219 GLN A N    2  
ATOM   3163  C  CA   . GLN A 1 65  ? 0.873   -11.988 5.828   1.00 0.00 ? 219 GLN A CA   2  
ATOM   3164  C  C    . GLN A 1 65  ? 1.281   -10.545 5.480   1.00 0.00 ? 219 GLN A C    2  
ATOM   3165  O  O    . GLN A 1 65  ? 1.968   -9.897  6.245   1.00 0.00 ? 219 GLN A O    2  
ATOM   3166  C  CB   . GLN A 1 65  ? -0.653  -12.132 5.847   1.00 0.00 ? 219 GLN A CB   2  
ATOM   3167  C  CG   . GLN A 1 65  ? -1.111  -12.936 4.626   1.00 0.00 ? 219 GLN A CG   2  
ATOM   3168  C  CD   . GLN A 1 65  ? -0.660  -14.396 4.773   1.00 0.00 ? 219 GLN A CD   2  
ATOM   3169  O  OE1  . GLN A 1 65  ? 0.288   -14.680 5.477   1.00 0.00 ? 219 GLN A OE1  2  
ATOM   3170  N  NE2  . GLN A 1 65  ? -1.302  -15.345 4.133   1.00 0.00 ? 219 GLN A NE2  2  
ATOM   3171  H  H    . GLN A 1 65  ? 1.019   -11.755 7.967   1.00 0.00 ? 219 GLN A H    2  
ATOM   3172  H  HA   . GLN A 1 65  ? 1.304   -12.682 5.123   1.00 0.00 ? 219 GLN A HA   2  
ATOM   3173  H  HB2  . GLN A 1 65  ? -0.956  -12.645 6.749   1.00 0.00 ? 219 GLN A HB2  2  
ATOM   3174  H  HB3  . GLN A 1 65  ? -1.109  -11.153 5.821   1.00 0.00 ? 219 GLN A HB3  2  
ATOM   3175  H  HG2  . GLN A 1 65  ? -2.188  -12.898 4.553   1.00 0.00 ? 219 GLN A HG2  2  
ATOM   3176  H  HG3  . GLN A 1 65  ? -0.674  -12.517 3.733   1.00 0.00 ? 219 GLN A HG3  2  
ATOM   3177  H  HE21 . GLN A 1 65  ? -2.069  -15.129 3.560   1.00 0.00 ? 219 GLN A HE21 2  
ATOM   3178  H  HE22 . GLN A 1 65  ? -1.012  -16.277 4.228   1.00 0.00 ? 219 GLN A HE22 2  
ATOM   3179  N  N    . CYS A 1 66  ? 0.866   -10.037 4.336   1.00 0.00 ? 220 CYS A N    2  
ATOM   3180  C  CA   . CYS A 1 66  ? 1.246   -8.626  3.959   1.00 0.00 ? 220 CYS A CA   2  
ATOM   3181  C  C    . CYS A 1 66  ? 0.287   -7.614  4.608   1.00 0.00 ? 220 CYS A C    2  
ATOM   3182  O  O    . CYS A 1 66  ? -0.856  -7.928  4.883   1.00 0.00 ? 220 CYS A O    2  
ATOM   3183  C  CB   . CYS A 1 66  ? 1.114   -8.545  2.432   1.00 0.00 ? 220 CYS A CB   2  
ATOM   3184  S  SG   . CYS A 1 66  ? 1.690   -6.930  1.852   1.00 0.00 ? 220 CYS A SG   2  
ATOM   3185  H  H    . CYS A 1 66  ? 0.308   -10.581 3.728   1.00 0.00 ? 220 CYS A H    2  
ATOM   3186  H  HA   . CYS A 1 66  ? 2.266   -8.417  4.248   1.00 0.00 ? 220 CYS A HA   2  
ATOM   3187  H  HB2  . CYS A 1 66  ? 1.706   -9.323  1.978   1.00 0.00 ? 220 CYS A HB2  2  
ATOM   3188  H  HB3  . CYS A 1 66  ? 0.079   -8.675  2.157   1.00 0.00 ? 220 CYS A HB3  2  
ATOM   3189  N  N    . ARG A 1 67  ? 0.733   -6.391  4.825   1.00 0.00 ? 221 ARG A N    2  
ATOM   3190  C  CA   . ARG A 1 67  ? -0.173  -5.358  5.422   1.00 0.00 ? 221 ARG A CA   2  
ATOM   3191  C  C    . ARG A 1 67  ? -0.625  -4.372  4.325   1.00 0.00 ? 221 ARG A C    2  
ATOM   3192  O  O    . ARG A 1 67  ? -0.768  -3.189  4.573   1.00 0.00 ? 221 ARG A O    2  
ATOM   3193  C  CB   . ARG A 1 67  ? 0.662   -4.636  6.484   1.00 0.00 ? 221 ARG A CB   2  
ATOM   3194  C  CG   . ARG A 1 67  ? 0.382   -5.246  7.858   1.00 0.00 ? 221 ARG A CG   2  
ATOM   3195  C  CD   . ARG A 1 67  ? -1.030  -4.852  8.317   1.00 0.00 ? 221 ARG A CD   2  
ATOM   3196  N  NE   . ARG A 1 67  ? -1.477  -5.920  9.284   1.00 0.00 ? 221 ARG A NE   2  
ATOM   3197  C  CZ   . ARG A 1 67  ? -2.376  -5.660  10.224  1.00 0.00 ? 221 ARG A CZ   2  
ATOM   3198  N  NH1  . ARG A 1 67  ? -2.943  -4.480  10.329  1.00 0.00 ? 221 ARG A NH1  2  
ATOM   3199  N  NH2  . ARG A 1 67  ? -2.725  -6.604  11.060  1.00 0.00 ? 221 ARG A NH2  2  
ATOM   3200  H  H    . ARG A 1 67  ? 1.652   -6.145  4.575   1.00 0.00 ? 221 ARG A H    2  
ATOM   3201  H  HA   . ARG A 1 67  ? -1.029  -5.829  5.880   1.00 0.00 ? 221 ARG A HA   2  
ATOM   3202  H  HB2  . ARG A 1 67  ? 1.712   -4.743  6.248   1.00 0.00 ? 221 ARG A HB2  2  
ATOM   3203  H  HB3  . ARG A 1 67  ? 0.402   -3.589  6.497   1.00 0.00 ? 221 ARG A HB3  2  
ATOM   3204  H  HG2  . ARG A 1 67  ? 0.456   -6.322  7.795   1.00 0.00 ? 221 ARG A HG2  2  
ATOM   3205  H  HG3  . ARG A 1 67  ? 1.105   -4.877  8.569   1.00 0.00 ? 221 ARG A HG3  2  
ATOM   3206  H  HD2  . ARG A 1 67  ? -0.998  -3.890  8.808   1.00 0.00 ? 221 ARG A HD2  2  
ATOM   3207  H  HD3  . ARG A 1 67  ? -1.700  -4.818  7.471   1.00 0.00 ? 221 ARG A HD3  2  
ATOM   3208  H  HE   . ARG A 1 67  ? -1.099  -6.827  9.221   1.00 0.00 ? 221 ARG A HE   2  
ATOM   3209  H  HH11 . ARG A 1 67  ? -2.711  -3.745  9.697   1.00 0.00 ? 221 ARG A HH11 2  
ATOM   3210  H  HH12 . ARG A 1 67  ? -3.616  -4.317  11.052  1.00 0.00 ? 221 ARG A HH12 2  
ATOM   3211  H  HH21 . ARG A 1 67  ? -2.314  -7.513  10.987  1.00 0.00 ? 221 ARG A HH21 2  
ATOM   3212  H  HH22 . ARG A 1 67  ? -3.401  -6.417  11.772  1.00 0.00 ? 221 ARG A HH22 2  
ATOM   3213  N  N    . TRP A 1 68  ? -0.853  -4.850  3.115   1.00 0.00 ? 222 TRP A N    2  
ATOM   3214  C  CA   . TRP A 1 68  ? -1.294  -3.940  2.009   1.00 0.00 ? 222 TRP A CA   2  
ATOM   3215  C  C    . TRP A 1 68  ? -2.153  -4.722  0.999   1.00 0.00 ? 222 TRP A C    2  
ATOM   3216  O  O    . TRP A 1 68  ? -3.304  -4.402  0.773   1.00 0.00 ? 222 TRP A O    2  
ATOM   3217  C  CB   . TRP A 1 68  ? 0.004   -3.469  1.334   1.00 0.00 ? 222 TRP A CB   2  
ATOM   3218  C  CG   . TRP A 1 68  ? -0.063  -1.998  1.064   1.00 0.00 ? 222 TRP A CG   2  
ATOM   3219  C  CD1  . TRP A 1 68  ? -1.163  -1.324  0.648   1.00 0.00 ? 222 TRP A CD1  2  
ATOM   3220  C  CD2  . TRP A 1 68  ? 1.000   -1.011  1.177   1.00 0.00 ? 222 TRP A CD2  2  
ATOM   3221  N  NE1  . TRP A 1 68  ? -0.846  0.015   0.524   1.00 0.00 ? 222 TRP A NE1  2  
ATOM   3222  C  CE2  . TRP A 1 68  ? 0.478   0.257   0.838   1.00 0.00 ? 222 TRP A CE2  2  
ATOM   3223  C  CE3  . TRP A 1 68  ? 2.352   -1.093  1.546   1.00 0.00 ? 222 TRP A CE3  2  
ATOM   3224  C  CZ2  . TRP A 1 68  ? 1.271   1.402   0.869   1.00 0.00 ? 222 TRP A CZ2  2  
ATOM   3225  C  CZ3  . TRP A 1 68  ? 3.155   0.058   1.572   1.00 0.00 ? 222 TRP A CZ3  2  
ATOM   3226  C  CH2  . TRP A 1 68  ? 2.613   1.304   1.237   1.00 0.00 ? 222 TRP A CH2  2  
ATOM   3227  H  H    . TRP A 1 68  ? -0.735  -5.808  2.931   1.00 0.00 ? 222 TRP A H    2  
ATOM   3228  H  HA   . TRP A 1 68  ? -1.838  -3.094  2.405   1.00 0.00 ? 222 TRP A HA   2  
ATOM   3229  H  HB2  . TRP A 1 68  ? 0.840   -3.673  1.988   1.00 0.00 ? 222 TRP A HB2  2  
ATOM   3230  H  HB3  . TRP A 1 68  ? 0.141   -3.998  0.403   1.00 0.00 ? 222 TRP A HB3  2  
ATOM   3231  H  HD1  . TRP A 1 68  ? -2.132  -1.760  0.457   1.00 0.00 ? 222 TRP A HD1  2  
ATOM   3232  H  HE1  . TRP A 1 68  ? -1.467  0.719   0.246   1.00 0.00 ? 222 TRP A HE1  2  
ATOM   3233  H  HE3  . TRP A 1 68  ? 2.779   -2.048  1.803   1.00 0.00 ? 222 TRP A HE3  2  
ATOM   3234  H  HZ2  . TRP A 1 68  ? 0.849   2.357   0.623   1.00 0.00 ? 222 TRP A HZ2  2  
ATOM   3235  H  HZ3  . TRP A 1 68  ? 4.193   -0.016  1.856   1.00 0.00 ? 222 TRP A HZ3  2  
ATOM   3236  H  HH2  . TRP A 1 68  ? 3.235   2.185   1.257   1.00 0.00 ? 222 TRP A HH2  2  
ATOM   3237  N  N    . CYS A 1 69  ? -1.595  -5.754  0.399   1.00 0.00 ? 223 CYS A N    2  
ATOM   3238  C  CA   . CYS A 1 69  ? -2.376  -6.567  -0.589  1.00 0.00 ? 223 CYS A CA   2  
ATOM   3239  C  C    . CYS A 1 69  ? -2.964  -7.847  0.059   1.00 0.00 ? 223 CYS A C    2  
ATOM   3240  O  O    . CYS A 1 69  ? -3.797  -8.500  -0.536  1.00 0.00 ? 223 CYS A O    2  
ATOM   3241  C  CB   . CYS A 1 69  ? -1.395  -6.904  -1.738  1.00 0.00 ? 223 CYS A CB   2  
ATOM   3242  S  SG   . CYS A 1 69  ? -0.100  -8.063  -1.195  1.00 0.00 ? 223 CYS A SG   2  
ATOM   3243  H  H    . CYS A 1 69  ? -0.667  -5.995  0.605   1.00 0.00 ? 223 CYS A H    2  
ATOM   3244  H  HA   . CYS A 1 69  ? -3.182  -5.967  -0.982  1.00 0.00 ? 223 CYS A HA   2  
ATOM   3245  H  HB2  . CYS A 1 69  ? -1.946  -7.352  -2.552  1.00 0.00 ? 223 CYS A HB2  2  
ATOM   3246  H  HB3  . CYS A 1 69  ? -0.933  -5.991  -2.087  1.00 0.00 ? 223 CYS A HB3  2  
ATOM   3247  N  N    . ALA A 1 70  ? -2.551  -8.219  1.268   1.00 0.00 ? 224 ALA A N    2  
ATOM   3248  C  CA   . ALA A 1 70  ? -3.106  -9.453  1.921   1.00 0.00 ? 224 ALA A CA   2  
ATOM   3249  C  C    . ALA A 1 70  ? -2.794  -10.683 1.060   1.00 0.00 ? 224 ALA A C    2  
ATOM   3250  O  O    . ALA A 1 70  ? -3.686  -11.409 0.661   1.00 0.00 ? 224 ALA A O    2  
ATOM   3251  C  CB   . ALA A 1 70  ? -4.624  -9.232  2.039   1.00 0.00 ? 224 ALA A CB   2  
ATOM   3252  H  H    . ALA A 1 70  ? -1.876  -7.700  1.745   1.00 0.00 ? 224 ALA A H    2  
ATOM   3253  H  HA   . ALA A 1 70  ? -2.678  -9.574  2.905   1.00 0.00 ? 224 ALA A HA   2  
ATOM   3254  H  HB1  . ALA A 1 70  ? -5.085  -9.358  1.070   1.00 0.00 ? 224 ALA A HB1  2  
ATOM   3255  H  HB2  . ALA A 1 70  ? -4.818  -8.233  2.403   1.00 0.00 ? 224 ALA A HB2  2  
ATOM   3256  H  HB3  . ALA A 1 70  ? -5.039  -9.951  2.730   1.00 0.00 ? 224 ALA A HB3  2  
ATOM   3257  N  N    . GLU A 1 71  ? -1.532  -10.926 0.769   1.00 0.00 ? 225 GLU A N    2  
ATOM   3258  C  CA   . GLU A 1 71  ? -1.173  -12.109 -0.070  1.00 0.00 ? 225 GLU A CA   2  
ATOM   3259  C  C    . GLU A 1 71  ? -0.300  -13.095 0.725   1.00 0.00 ? 225 GLU A C    2  
ATOM   3260  O  O    . GLU A 1 71  ? -0.731  -14.188 1.040   1.00 0.00 ? 225 GLU A O    2  
ATOM   3261  C  CB   . GLU A 1 71  ? -0.403  -11.532 -1.259  1.00 0.00 ? 225 GLU A CB   2  
ATOM   3262  C  CG   . GLU A 1 71  ? -1.373  -10.798 -2.189  1.00 0.00 ? 225 GLU A CG   2  
ATOM   3263  C  CD   . GLU A 1 71  ? -2.097  -11.812 -3.076  1.00 0.00 ? 225 GLU A CD   2  
ATOM   3264  O  OE1  . GLU A 1 71  ? -1.457  -12.756 -3.507  1.00 0.00 ? 225 GLU A OE1  2  
ATOM   3265  O  OE2  . GLU A 1 71  ? -3.281  -11.628 -3.309  1.00 0.00 ? 225 GLU A OE2  2  
ATOM   3266  H  H    . GLU A 1 71  ? -0.821  -10.328 1.102   1.00 0.00 ? 225 GLU A H    2  
ATOM   3267  H  HA   . GLU A 1 71  ? -2.061  -12.602 -0.417  1.00 0.00 ? 225 GLU A HA   2  
ATOM   3268  H  HB2  . GLU A 1 71  ? 0.347   -10.841 -0.903  1.00 0.00 ? 225 GLU A HB2  2  
ATOM   3269  H  HB3  . GLU A 1 71  ? 0.077   -12.333 -1.803  1.00 0.00 ? 225 GLU A HB3  2  
ATOM   3270  H  HG2  . GLU A 1 71  ? -2.096  -10.255 -1.597  1.00 0.00 ? 225 GLU A HG2  2  
ATOM   3271  H  HG3  . GLU A 1 71  ? -0.824  -10.107 -2.810  1.00 0.00 ? 225 GLU A HG3  2  
ATOM   3272  N  N    . GLY A 1 72  ? 0.919   -12.723 1.053   1.00 0.00 ? 226 GLY A N    2  
ATOM   3273  C  CA   . GLY A 1 72  ? 1.803   -13.648 1.825   1.00 0.00 ? 226 GLY A CA   2  
ATOM   3274  C  C    . GLY A 1 72  ? 2.964   -14.121 0.935   1.00 0.00 ? 226 GLY A C    2  
ATOM   3275  O  O    . GLY A 1 72  ? 3.228   -13.541 -0.102  1.00 0.00 ? 226 GLY A O    2  
ATOM   3276  H  H    . GLY A 1 72  ? 1.253   -11.839 0.793   1.00 0.00 ? 226 GLY A H    2  
ATOM   3277  H  HA2  . GLY A 1 72  ? 2.196   -13.131 2.687   1.00 0.00 ? 226 GLY A HA2  2  
ATOM   3278  H  HA3  . GLY A 1 72  ? 1.231   -14.505 2.148   1.00 0.00 ? 226 GLY A HA3  2  
ATOM   3279  N  N    . GLY A 1 73  ? 3.664   -15.169 1.329   1.00 0.00 ? 227 GLY A N    2  
ATOM   3280  C  CA   . GLY A 1 73  ? 4.803   -15.665 0.500   1.00 0.00 ? 227 GLY A CA   2  
ATOM   3281  C  C    . GLY A 1 73  ? 5.951   -14.646 0.543   1.00 0.00 ? 227 GLY A C    2  
ATOM   3282  O  O    . GLY A 1 73  ? 5.809   -13.533 0.072   1.00 0.00 ? 227 GLY A O    2  
ATOM   3283  H  H    . GLY A 1 73  ? 3.441   -15.627 2.169   1.00 0.00 ? 227 GLY A H    2  
ATOM   3284  H  HA2  . GLY A 1 73  ? 5.146   -16.613 0.891   1.00 0.00 ? 227 GLY A HA2  2  
ATOM   3285  H  HA3  . GLY A 1 73  ? 4.478   -15.793 -0.521  1.00 0.00 ? 227 GLY A HA3  2  
ATOM   3286  N  N    . ASN A 1 74  ? 7.092   -15.007 1.109   1.00 0.00 ? 228 ASN A N    2  
ATOM   3287  C  CA   . ASN A 1 74  ? 8.243   -14.044 1.182   1.00 0.00 ? 228 ASN A CA   2  
ATOM   3288  C  C    . ASN A 1 74  ? 7.789   -12.711 1.797   1.00 0.00 ? 228 ASN A C    2  
ATOM   3289  O  O    . ASN A 1 74  ? 7.442   -11.788 1.084   1.00 0.00 ? 228 ASN A O    2  
ATOM   3290  C  CB   . ASN A 1 74  ? 8.693   -13.840 -0.268  1.00 0.00 ? 228 ASN A CB   2  
ATOM   3291  C  CG   . ASN A 1 74  ? 10.193  -13.515 -0.298  1.00 0.00 ? 228 ASN A CG   2  
ATOM   3292  O  OD1  . ASN A 1 74  ? 10.576  -12.372 -0.143  1.00 0.00 ? 228 ASN A OD1  2  
ATOM   3293  N  ND2  . ASN A 1 74  ? 11.066  -14.474 -0.491  1.00 0.00 ? 228 ASN A ND2  2  
ATOM   3294  H  H    . ASN A 1 74  ? 7.192   -15.907 1.489   1.00 0.00 ? 228 ASN A H    2  
ATOM   3295  H  HA   . ASN A 1 74  ? 9.050   -14.466 1.759   1.00 0.00 ? 228 ASN A HA   2  
ATOM   3296  H  HB2  . ASN A 1 74  ? 8.508   -14.743 -0.832  1.00 0.00 ? 228 ASN A HB2  2  
ATOM   3297  H  HB3  . ASN A 1 74  ? 8.141   -13.022 -0.705  1.00 0.00 ? 228 ASN A HB3  2  
ATOM   3298  H  HD21 . ASN A 1 74  ? 10.768  -15.400 -0.618  1.00 0.00 ? 228 ASN A HD21 2  
ATOM   3299  H  HD22 . ASN A 1 74  ? 12.023  -14.263 -0.510  1.00 0.00 ? 228 ASN A HD22 2  
ATOM   3300  N  N    . LEU A 1 75  ? 7.773   -12.600 3.112   1.00 0.00 ? 229 LEU A N    2  
ATOM   3301  C  CA   . LEU A 1 75  ? 7.321   -11.322 3.740   1.00 0.00 ? 229 LEU A CA   2  
ATOM   3302  C  C    . LEU A 1 75  ? 8.408   -10.738 4.657   1.00 0.00 ? 229 LEU A C    2  
ATOM   3303  O  O    . LEU A 1 75  ? 9.398   -11.383 4.944   1.00 0.00 ? 229 LEU A O    2  
ATOM   3304  C  CB   . LEU A 1 75  ? 6.081   -11.684 4.569   1.00 0.00 ? 229 LEU A CB   2  
ATOM   3305  C  CG   . LEU A 1 75  ? 5.020   -12.367 3.696   1.00 0.00 ? 229 LEU A CG   2  
ATOM   3306  C  CD1  . LEU A 1 75  ? 3.798   -12.713 4.556   1.00 0.00 ? 229 LEU A CD1  2  
ATOM   3307  C  CD2  . LEU A 1 75  ? 4.591   -11.425 2.568   1.00 0.00 ? 229 LEU A CD2  2  
ATOM   3308  H  H    . LEU A 1 75  ? 8.046   -13.354 3.682   1.00 0.00 ? 229 LEU A H    2  
ATOM   3309  H  HA   . LEU A 1 75  ? 7.057   -10.613 2.976   1.00 0.00 ? 229 LEU A HA   2  
ATOM   3310  H  HB2  . LEU A 1 75  ? 6.370   -12.354 5.366   1.00 0.00 ? 229 LEU A HB2  2  
ATOM   3311  H  HB3  . LEU A 1 75  ? 5.664   -10.784 4.996   1.00 0.00 ? 229 LEU A HB3  2  
ATOM   3312  H  HG   . LEU A 1 75  ? 5.430   -13.273 3.275   1.00 0.00 ? 229 LEU A HG   2  
ATOM   3313  H  HD11 . LEU A 1 75  ? 4.079   -12.726 5.598   1.00 0.00 ? 229 LEU A HD11 2  
ATOM   3314  H  HD12 . LEU A 1 75  ? 3.424   -13.686 4.272   1.00 0.00 ? 229 LEU A HD12 2  
ATOM   3315  H  HD13 . LEU A 1 75  ? 3.024   -11.972 4.402   1.00 0.00 ? 229 LEU A HD13 2  
ATOM   3316  H  HD21 . LEU A 1 75  ? 4.507   -10.419 2.951   1.00 0.00 ? 229 LEU A HD21 2  
ATOM   3317  H  HD22 . LEU A 1 75  ? 3.635   -11.742 2.178   1.00 0.00 ? 229 LEU A HD22 2  
ATOM   3318  H  HD23 . LEU A 1 75  ? 5.328   -11.450 1.779   1.00 0.00 ? 229 LEU A HD23 2  
ATOM   3319  N  N    . ILE A 1 76  ? 8.218   -9.521  5.131   1.00 0.00 ? 230 ILE A N    2  
ATOM   3320  C  CA   . ILE A 1 76  ? 9.223   -8.899  6.041   1.00 0.00 ? 230 ILE A CA   2  
ATOM   3321  C  C    . ILE A 1 76  ? 8.563   -8.590  7.391   1.00 0.00 ? 230 ILE A C    2  
ATOM   3322  O  O    . ILE A 1 76  ? 7.871   -7.598  7.526   1.00 0.00 ? 230 ILE A O    2  
ATOM   3323  C  CB   . ILE A 1 76  ? 9.650   -7.603  5.342   1.00 0.00 ? 230 ILE A CB   2  
ATOM   3324  C  CG1  . ILE A 1 76  ? 10.375  -7.952  4.043   1.00 0.00 ? 230 ILE A CG1  2  
ATOM   3325  C  CG2  . ILE A 1 76  ? 10.591  -6.790  6.247   1.00 0.00 ? 230 ILE A CG2  2  
ATOM   3326  C  CD1  . ILE A 1 76  ? 10.669  -6.671  3.263   1.00 0.00 ? 230 ILE A CD1  2  
ATOM   3327  H  H    . ILE A 1 76  ? 7.406   -9.020  4.897   1.00 0.00 ? 230 ILE A H    2  
ATOM   3328  H  HA   . ILE A 1 76  ? 10.072  -9.550  6.173   1.00 0.00 ? 230 ILE A HA   2  
ATOM   3329  H  HB   . ILE A 1 76  ? 8.773   -7.013  5.117   1.00 0.00 ? 230 ILE A HB   2  
ATOM   3330  H  HG12 . ILE A 1 76  ? 11.303  -8.455  4.273   1.00 0.00 ? 230 ILE A HG12 2  
ATOM   3331  H  HG13 . ILE A 1 76  ? 9.752   -8.600  3.446   1.00 0.00 ? 230 ILE A HG13 2  
ATOM   3332  H  HG21 . ILE A 1 76  ? 11.493  -7.355  6.430   1.00 0.00 ? 230 ILE A HG21 2  
ATOM   3333  H  HG22 . ILE A 1 76  ? 10.100  -6.579  7.188   1.00 0.00 ? 230 ILE A HG22 2  
ATOM   3334  H  HG23 . ILE A 1 76  ? 10.843  -5.859  5.760   1.00 0.00 ? 230 ILE A HG23 2  
ATOM   3335  H  HD11 . ILE A 1 76  ? 11.700  -6.386  3.417   1.00 0.00 ? 230 ILE A HD11 2  
ATOM   3336  H  HD12 . ILE A 1 76  ? 10.019  -5.877  3.607   1.00 0.00 ? 230 ILE A HD12 2  
ATOM   3337  H  HD13 . ILE A 1 76  ? 10.496  -6.845  2.213   1.00 0.00 ? 230 ILE A HD13 2  
ATOM   3338  N  N    . CYS A 1 77  ? 8.772   -9.419  8.392   1.00 0.00 ? 231 CYS A N    2  
ATOM   3339  C  CA   . CYS A 1 77  ? 8.141   -9.132  9.728   1.00 0.00 ? 231 CYS A CA   2  
ATOM   3340  C  C    . CYS A 1 77  ? 8.639   -7.777  10.247  1.00 0.00 ? 231 CYS A C    2  
ATOM   3341  O  O    . CYS A 1 77  ? 9.721   -7.339  9.906   1.00 0.00 ? 231 CYS A O    2  
ATOM   3342  C  CB   . CYS A 1 77  ? 8.570   -10.257 10.680  1.00 0.00 ? 231 CYS A CB   2  
ATOM   3343  S  SG   . CYS A 1 77  ? 7.732   -10.056 12.270  1.00 0.00 ? 231 CYS A SG   2  
ATOM   3344  H  H    . CYS A 1 77  ? 9.340   -10.216 8.264   1.00 0.00 ? 231 CYS A H    2  
ATOM   3345  H  HA   . CYS A 1 77  ? 7.063   -9.113  9.633   1.00 0.00 ? 231 CYS A HA   2  
ATOM   3346  H  HB2  . CYS A 1 77  ? 8.304   -11.212 10.250  1.00 0.00 ? 231 CYS A HB2  2  
ATOM   3347  H  HB3  . CYS A 1 77  ? 9.640   -10.214 10.826  1.00 0.00 ? 231 CYS A HB3  2  
ATOM   3348  H  HG   . CYS A 1 77  ? 7.144   -10.805 12.393  1.00 0.00 ? 231 CYS A HG   2  
ATOM   3349  N  N    . CYS A 1 78  ? 7.854   -7.105  11.055  1.00 0.00 ? 232 CYS A N    2  
ATOM   3350  C  CA   . CYS A 1 78  ? 8.283   -5.774  11.576  1.00 0.00 ? 232 CYS A CA   2  
ATOM   3351  C  C    . CYS A 1 78  ? 8.633   -5.866  13.068  1.00 0.00 ? 232 CYS A C    2  
ATOM   3352  O  O    . CYS A 1 78  ? 8.103   -6.695  13.783  1.00 0.00 ? 232 CYS A O    2  
ATOM   3353  C  CB   . CYS A 1 78  ? 7.080   -4.849  11.364  1.00 0.00 ? 232 CYS A CB   2  
ATOM   3354  S  SG   . CYS A 1 78  ? 7.496   -3.168  11.893  1.00 0.00 ? 232 CYS A SG   2  
ATOM   3355  H  H    . CYS A 1 78  ? 6.975   -7.473  11.312  1.00 0.00 ? 232 CYS A H    2  
ATOM   3356  H  HA   . CYS A 1 78  ? 9.129   -5.408  11.016  1.00 0.00 ? 232 CYS A HA   2  
ATOM   3357  H  HB2  . CYS A 1 78  ? 6.815   -4.841  10.316  1.00 0.00 ? 232 CYS A HB2  2  
ATOM   3358  H  HB3  . CYS A 1 78  ? 6.243   -5.211  11.942  1.00 0.00 ? 232 CYS A HB3  2  
ATOM   3359  N  N    . ASP A 1 79  ? 9.509   -5.007  13.544  1.00 0.00 ? 233 ASP A N    2  
ATOM   3360  C  CA   . ASP A 1 79  ? 9.873   -5.039  14.994  1.00 0.00 ? 233 ASP A CA   2  
ATOM   3361  C  C    . ASP A 1 79  ? 9.235   -3.838  15.709  1.00 0.00 ? 233 ASP A C    2  
ATOM   3362  O  O    . ASP A 1 79  ? 9.856   -3.212  16.548  1.00 0.00 ? 233 ASP A O    2  
ATOM   3363  C  CB   . ASP A 1 79  ? 11.401  -4.945  15.039  1.00 0.00 ? 233 ASP A CB   2  
ATOM   3364  C  CG   . ASP A 1 79  ? 11.930  -5.776  16.210  1.00 0.00 ? 233 ASP A CG   2  
ATOM   3365  O  OD1  . ASP A 1 79  ? 11.930  -6.990  16.095  1.00 0.00 ? 233 ASP A OD1  2  
ATOM   3366  O  OD2  . ASP A 1 79  ? 12.325  -5.183  17.199  1.00 0.00 ? 233 ASP A OD2  2  
ATOM   3367  H  H    . ASP A 1 79  ? 9.918   -4.332  12.949  1.00 0.00 ? 233 ASP A H    2  
ATOM   3368  H  HA   . ASP A 1 79  ? 9.544   -5.963  15.444  1.00 0.00 ? 233 ASP A HA   2  
ATOM   3369  H  HB2  . ASP A 1 79  ? 11.811  -5.324  14.113  1.00 0.00 ? 233 ASP A HB2  2  
ATOM   3370  H  HB3  . ASP A 1 79  ? 11.695  -3.915  15.170  1.00 0.00 ? 233 ASP A HB3  2  
ATOM   3371  N  N    . PHE A 1 80  ? 8.000   -3.505  15.382  1.00 0.00 ? 234 PHE A N    2  
ATOM   3372  C  CA   . PHE A 1 80  ? 7.340   -2.339  16.046  1.00 0.00 ? 234 PHE A CA   2  
ATOM   3373  C  C    . PHE A 1 80  ? 5.810   -2.523  16.081  1.00 0.00 ? 234 PHE A C    2  
ATOM   3374  O  O    . PHE A 1 80  ? 5.211   -2.509  17.140  1.00 0.00 ? 234 PHE A O    2  
ATOM   3375  C  CB   . PHE A 1 80  ? 7.709   -1.134  15.177  1.00 0.00 ? 234 PHE A CB   2  
ATOM   3376  C  CG   . PHE A 1 80  ? 9.106   -0.652  15.508  1.00 0.00 ? 234 PHE A CG   2  
ATOM   3377  C  CD1  . PHE A 1 80  ? 9.494   -0.450  16.841  1.00 0.00 ? 234 PHE A CD1  2  
ATOM   3378  C  CD2  . PHE A 1 80  ? 10.014  -0.398  14.472  1.00 0.00 ? 234 PHE A CD2  2  
ATOM   3379  C  CE1  . PHE A 1 80  ? 10.786  0.002   17.133  1.00 0.00 ? 234 PHE A CE1  2  
ATOM   3380  C  CE2  . PHE A 1 80  ? 11.304  0.054   14.766  1.00 0.00 ? 234 PHE A CE2  2  
ATOM   3381  C  CZ   . PHE A 1 80  ? 11.691  0.254   16.096  1.00 0.00 ? 234 PHE A CZ   2  
ATOM   3382  H  H    . PHE A 1 80  ? 7.511   -4.017  14.699  1.00 0.00 ? 234 PHE A H    2  
ATOM   3383  H  HA   . PHE A 1 80  ? 7.726   -2.206  17.043  1.00 0.00 ? 234 PHE A HA   2  
ATOM   3384  H  HB2  . PHE A 1 80  ? 7.672   -1.423  14.138  1.00 0.00 ? 234 PHE A HB2  2  
ATOM   3385  H  HB3  . PHE A 1 80  ? 7.004   -0.336  15.352  1.00 0.00 ? 234 PHE A HB3  2  
ATOM   3386  H  HD1  . PHE A 1 80  ? 8.796   -0.644  17.642  1.00 0.00 ? 234 PHE A HD1  2  
ATOM   3387  H  HD2  . PHE A 1 80  ? 9.720   -0.554  13.446  1.00 0.00 ? 234 PHE A HD2  2  
ATOM   3388  H  HE1  . PHE A 1 80  ? 11.085  0.155   18.160  1.00 0.00 ? 234 PHE A HE1  2  
ATOM   3389  H  HE2  . PHE A 1 80  ? 12.000  0.253   13.964  1.00 0.00 ? 234 PHE A HE2  2  
ATOM   3390  H  HZ   . PHE A 1 80  ? 12.689  0.602   16.322  1.00 0.00 ? 234 PHE A HZ   2  
ATOM   3391  N  N    . CYS A 1 81  ? 5.170   -2.690  14.938  1.00 0.00 ? 235 CYS A N    2  
ATOM   3392  C  CA   . CYS A 1 81  ? 3.673   -2.867  14.941  1.00 0.00 ? 235 CYS A CA   2  
ATOM   3393  C  C    . CYS A 1 81  ? 3.257   -4.356  14.857  1.00 0.00 ? 235 CYS A C    2  
ATOM   3394  O  O    . CYS A 1 81  ? 2.133   -4.656  14.502  1.00 0.00 ? 235 CYS A O    2  
ATOM   3395  C  CB   . CYS A 1 81  ? 3.141   -2.073  13.729  1.00 0.00 ? 235 CYS A CB   2  
ATOM   3396  S  SG   . CYS A 1 81  ? 3.698   -2.814  12.166  1.00 0.00 ? 235 CYS A SG   2  
ATOM   3397  H  H    . CYS A 1 81  ? 5.669   -2.695  14.090  1.00 0.00 ? 235 CYS A H    2  
ATOM   3398  H  HA   . CYS A 1 81  ? 3.269   -2.437  15.845  1.00 0.00 ? 235 CYS A HA   2  
ATOM   3399  H  HB2  . CYS A 1 81  ? 2.063   -2.070  13.752  1.00 0.00 ? 235 CYS A HB2  2  
ATOM   3400  H  HB3  . CYS A 1 81  ? 3.499   -1.054  13.788  1.00 0.00 ? 235 CYS A HB3  2  
ATOM   3401  N  N    . HIS A 1 82  ? 4.131   -5.291  15.195  1.00 0.00 ? 236 HIS A N    2  
ATOM   3402  C  CA   . HIS A 1 82  ? 3.753   -6.745  15.147  1.00 0.00 ? 236 HIS A CA   2  
ATOM   3403  C  C    . HIS A 1 82  ? 3.083   -7.126  13.809  1.00 0.00 ? 236 HIS A C    2  
ATOM   3404  O  O    . HIS A 1 82  ? 2.023   -7.725  13.797  1.00 0.00 ? 236 HIS A O    2  
ATOM   3405  C  CB   . HIS A 1 82  ? 2.771   -6.929  16.306  1.00 0.00 ? 236 HIS A CB   2  
ATOM   3406  C  CG   . HIS A 1 82  ? 2.864   -8.339  16.823  1.00 0.00 ? 236 HIS A CG   2  
ATOM   3407  N  ND1  . HIS A 1 82  ? 3.107   -8.622  18.158  1.00 0.00 ? 236 HIS A ND1  2  
ATOM   3408  C  CD2  . HIS A 1 82  ? 2.749   -9.555  16.197  1.00 0.00 ? 236 HIS A CD2  2  
ATOM   3409  C  CE1  . HIS A 1 82  ? 3.130   -9.960  18.291  1.00 0.00 ? 236 HIS A CE1  2  
ATOM   3410  N  NE2  . HIS A 1 82  ? 2.917   -10.578 17.126  1.00 0.00 ? 236 HIS A NE2  2  
ATOM   3411  H  H    . HIS A 1 82  ? 5.029   -5.045  15.497  1.00 0.00 ? 236 HIS A H    2  
ATOM   3412  H  HA   . HIS A 1 82  ? 4.624   -7.359  15.312  1.00 0.00 ? 236 HIS A HA   2  
ATOM   3413  H  HB2  . HIS A 1 82  ? 3.015   -6.239  17.098  1.00 0.00 ? 236 HIS A HB2  2  
ATOM   3414  H  HB3  . HIS A 1 82  ? 1.765   -6.740  15.960  1.00 0.00 ? 236 HIS A HB3  2  
ATOM   3415  H  HD1  . HIS A 1 82  ? 3.238   -7.966  18.874  1.00 0.00 ? 236 HIS A HD1  2  
ATOM   3416  H  HD2  . HIS A 1 82  ? 2.557   -9.698  15.144  1.00 0.00 ? 236 HIS A HD2  2  
ATOM   3417  H  HE1  . HIS A 1 82  ? 3.299   -10.473 19.226  1.00 0.00 ? 236 HIS A HE1  2  
ATOM   3418  N  N    . ASN A 1 83  ? 3.690   -6.798  12.687  1.00 0.00 ? 237 ASN A N    2  
ATOM   3419  C  CA   . ASN A 1 83  ? 3.078   -7.164  11.368  1.00 0.00 ? 237 ASN A CA   2  
ATOM   3420  C  C    . ASN A 1 83  ? 4.175   -7.390  10.315  1.00 0.00 ? 237 ASN A C    2  
ATOM   3421  O  O    . ASN A 1 83  ? 5.335   -7.143  10.572  1.00 0.00 ? 237 ASN A O    2  
ATOM   3422  C  CB   . ASN A 1 83  ? 2.201   -5.973  10.984  1.00 0.00 ? 237 ASN A CB   2  
ATOM   3423  C  CG   . ASN A 1 83  ? 0.969   -5.926  11.897  1.00 0.00 ? 237 ASN A CG   2  
ATOM   3424  O  OD1  . ASN A 1 83  ? 0.343   -6.940  12.135  1.00 0.00 ? 237 ASN A OD1  2  
ATOM   3425  N  ND2  . ASN A 1 83  ? 0.588   -4.787  12.423  1.00 0.00 ? 237 ASN A ND2  2  
ATOM   3426  H  H    . ASN A 1 83  ? 4.550   -6.322  12.709  1.00 0.00 ? 237 ASN A H    2  
ATOM   3427  H  HA   . ASN A 1 83  ? 2.470   -8.049  11.471  1.00 0.00 ? 237 ASN A HA   2  
ATOM   3428  H  HB2  . ASN A 1 83  ? 2.767   -5.062  11.092  1.00 0.00 ? 237 ASN A HB2  2  
ATOM   3429  H  HB3  . ASN A 1 83  ? 1.881   -6.078  9.958   1.00 0.00 ? 237 ASN A HB3  2  
ATOM   3430  H  HD21 . ASN A 1 83  ? 1.085   -3.961  12.236  1.00 0.00 ? 237 ASN A HD21 2  
ATOM   3431  H  HD22 . ASN A 1 83  ? -0.200  -4.761  13.006  1.00 0.00 ? 237 ASN A HD22 2  
ATOM   3432  N  N    . ALA A 1 84  ? 3.825   -7.862  9.135   1.00 0.00 ? 238 ALA A N    2  
ATOM   3433  C  CA   . ALA A 1 84  ? 4.865   -8.103  8.087   1.00 0.00 ? 238 ALA A CA   2  
ATOM   3434  C  C    . ALA A 1 84  ? 4.340   -7.696  6.698   1.00 0.00 ? 238 ALA A C    2  
ATOM   3435  O  O    . ALA A 1 84  ? 3.152   -7.738  6.446   1.00 0.00 ? 238 ALA A O    2  
ATOM   3436  C  CB   . ALA A 1 84  ? 5.126   -9.608  8.136   1.00 0.00 ? 238 ALA A CB   2  
ATOM   3437  H  H    . ALA A 1 84  ? 2.883   -8.063  8.939   1.00 0.00 ? 238 ALA A H    2  
ATOM   3438  H  HA   . ALA A 1 84  ? 5.774   -7.568  8.321   1.00 0.00 ? 238 ALA A HA   2  
ATOM   3439  H  HB1  . ALA A 1 84  ? 4.417   -10.119 7.501   1.00 0.00 ? 238 ALA A HB1  2  
ATOM   3440  H  HB2  . ALA A 1 84  ? 5.018   -9.959  9.152   1.00 0.00 ? 238 ALA A HB2  2  
ATOM   3441  H  HB3  . ALA A 1 84  ? 6.129   -9.810  7.790   1.00 0.00 ? 238 ALA A HB3  2  
ATOM   3442  N  N    . PHE A 1 85  ? 5.217   -7.316  5.793   1.00 0.00 ? 239 PHE A N    2  
ATOM   3443  C  CA   . PHE A 1 85  ? 4.764   -6.929  4.418   1.00 0.00 ? 239 PHE A CA   2  
ATOM   3444  C  C    . PHE A 1 85  ? 5.288   -7.961  3.408   1.00 0.00 ? 239 PHE A C    2  
ATOM   3445  O  O    . PHE A 1 85  ? 5.937   -8.912  3.794   1.00 0.00 ? 239 PHE A O    2  
ATOM   3446  C  CB   . PHE A 1 85  ? 5.382   -5.553  4.156   1.00 0.00 ? 239 PHE A CB   2  
ATOM   3447  C  CG   . PHE A 1 85  ? 4.458   -4.476  4.677   1.00 0.00 ? 239 PHE A CG   2  
ATOM   3448  C  CD1  . PHE A 1 85  ? 3.450   -3.957  3.854   1.00 0.00 ? 239 PHE A CD1  2  
ATOM   3449  C  CD2  . PHE A 1 85  ? 4.610   -3.999  5.982   1.00 0.00 ? 239 PHE A CD2  2  
ATOM   3450  C  CE1  . PHE A 1 85  ? 2.592   -2.960  4.340   1.00 0.00 ? 239 PHE A CE1  2  
ATOM   3451  C  CE2  . PHE A 1 85  ? 3.753   -3.001  6.468   1.00 0.00 ? 239 PHE A CE2  2  
ATOM   3452  C  CZ   . PHE A 1 85  ? 2.745   -2.482  5.647   1.00 0.00 ? 239 PHE A CZ   2  
ATOM   3453  H  H    . PHE A 1 85  ? 6.176   -7.297  6.010   1.00 0.00 ? 239 PHE A H    2  
ATOM   3454  H  HA   . PHE A 1 85  ? 3.688   -6.870  4.377   1.00 0.00 ? 239 PHE A HA   2  
ATOM   3455  H  HB2  . PHE A 1 85  ? 6.335   -5.484  4.660   1.00 0.00 ? 239 PHE A HB2  2  
ATOM   3456  H  HB3  . PHE A 1 85  ? 5.527   -5.419  3.094   1.00 0.00 ? 239 PHE A HB3  2  
ATOM   3457  H  HD1  . PHE A 1 85  ? 3.334   -4.326  2.846   1.00 0.00 ? 239 PHE A HD1  2  
ATOM   3458  H  HD2  . PHE A 1 85  ? 5.390   -4.399  6.615   1.00 0.00 ? 239 PHE A HD2  2  
ATOM   3459  H  HE1  . PHE A 1 85  ? 1.815   -2.558  3.706   1.00 0.00 ? 239 PHE A HE1  2  
ATOM   3460  H  HE2  . PHE A 1 85  ? 3.869   -2.635  7.476   1.00 0.00 ? 239 PHE A HE2  2  
ATOM   3461  H  HZ   . PHE A 1 85  ? 2.084   -1.712  6.022   1.00 0.00 ? 239 PHE A HZ   2  
ATOM   3462  N  N    . CYS A 1 86  ? 5.021   -7.794  2.126   1.00 0.00 ? 240 CYS A N    2  
ATOM   3463  C  CA   . CYS A 1 86  ? 5.527   -8.791  1.130   1.00 0.00 ? 240 CYS A CA   2  
ATOM   3464  C  C    . CYS A 1 86  ? 6.520   -8.131  0.147   1.00 0.00 ? 240 CYS A C    2  
ATOM   3465  O  O    . CYS A 1 86  ? 6.592   -6.921  0.051   1.00 0.00 ? 240 CYS A O    2  
ATOM   3466  C  CB   . CYS A 1 86  ? 4.269   -9.373  0.432   1.00 0.00 ? 240 CYS A CB   2  
ATOM   3467  S  SG   . CYS A 1 86  ? 3.659   -8.325  -0.924  1.00 0.00 ? 240 CYS A SG   2  
ATOM   3468  H  H    . CYS A 1 86  ? 4.501   -7.023  1.822   1.00 0.00 ? 240 CYS A H    2  
ATOM   3469  H  HA   . CYS A 1 86  ? 6.033   -9.585  1.654   1.00 0.00 ? 240 CYS A HA   2  
ATOM   3470  H  HB2  . CYS A 1 86  ? 4.509   -10.346 0.033   1.00 0.00 ? 240 CYS A HB2  2  
ATOM   3471  H  HB3  . CYS A 1 86  ? 3.488   -9.487  1.169   1.00 0.00 ? 240 CYS A HB3  2  
ATOM   3472  N  N    . LYS A 1 87  ? 7.295   -8.921  -0.571  1.00 0.00 ? 241 LYS A N    2  
ATOM   3473  C  CA   . LYS A 1 87  ? 8.292   -8.325  -1.534  1.00 0.00 ? 241 LYS A CA   2  
ATOM   3474  C  C    . LYS A 1 87  ? 7.582   -7.646  -2.723  1.00 0.00 ? 241 LYS A C    2  
ATOM   3475  O  O    . LYS A 1 87  ? 8.049   -6.642  -3.227  1.00 0.00 ? 241 LYS A O    2  
ATOM   3476  C  CB   . LYS A 1 87  ? 9.161   -9.490  -2.038  1.00 0.00 ? 241 LYS A CB   2  
ATOM   3477  C  CG   . LYS A 1 87  ? 10.296  -8.945  -2.909  1.00 0.00 ? 241 LYS A CG   2  
ATOM   3478  C  CD   . LYS A 1 87  ? 10.592  -9.932  -4.040  1.00 0.00 ? 241 LYS A CD   2  
ATOM   3479  C  CE   . LYS A 1 87  ? 11.578  -10.992 -3.547  1.00 0.00 ? 241 LYS A CE   2  
ATOM   3480  N  NZ   . LYS A 1 87  ? 11.374  -12.158 -4.451  1.00 0.00 ? 241 LYS A NZ   2  
ATOM   3481  H  H    . LYS A 1 87  ? 7.223   -9.902  -0.469  1.00 0.00 ? 241 LYS A H    2  
ATOM   3482  H  HA   . LYS A 1 87  ? 8.913   -7.607  -1.022  1.00 0.00 ? 241 LYS A HA   2  
ATOM   3483  H  HB2  . LYS A 1 87  ? 9.578   -10.020 -1.191  1.00 0.00 ? 241 LYS A HB2  2  
ATOM   3484  H  HB3  . LYS A 1 87  ? 8.554   -10.166 -2.620  1.00 0.00 ? 241 LYS A HB3  2  
ATOM   3485  H  HG2  . LYS A 1 87  ? 10.001  -7.994  -3.328  1.00 0.00 ? 241 LYS A HG2  2  
ATOM   3486  H  HG3  . LYS A 1 87  ? 11.182  -8.815  -2.307  1.00 0.00 ? 241 LYS A HG3  2  
ATOM   3487  H  HD2  . LYS A 1 87  ? 9.673   -10.410 -4.350  1.00 0.00 ? 241 LYS A HD2  2  
ATOM   3488  H  HD3  . LYS A 1 87  ? 11.023  -9.403  -4.876  1.00 0.00 ? 241 LYS A HD3  2  
ATOM   3489  H  HE2  . LYS A 1 87  ? 12.593  -10.626 -3.624  1.00 0.00 ? 241 LYS A HE2  2  
ATOM   3490  H  HE3  . LYS A 1 87  ? 11.354  -11.271 -2.529  1.00 0.00 ? 241 LYS A HE3  2  
ATOM   3491  H  HZ1  . LYS A 1 87  ? 10.413  -12.533 -4.323  1.00 0.00 ? 241 LYS A HZ1  2  
ATOM   3492  H  HZ2  . LYS A 1 87  ? 12.069  -12.898 -4.225  1.00 0.00 ? 241 LYS A HZ2  2  
ATOM   3493  H  HZ3  . LYS A 1 87  ? 11.496  -11.857 -5.439  1.00 0.00 ? 241 LYS A HZ3  2  
ATOM   3494  N  N    . LYS A 1 88  ? 6.467   -8.180  -3.182  1.00 0.00 ? 242 LYS A N    2  
ATOM   3495  C  CA   . LYS A 1 88  ? 5.756   -7.540  -4.353  1.00 0.00 ? 242 LYS A CA   2  
ATOM   3496  C  C    . LYS A 1 88  ? 5.285   -6.105  -4.028  1.00 0.00 ? 242 LYS A C    2  
ATOM   3497  O  O    . LYS A 1 88  ? 5.059   -5.318  -4.930  1.00 0.00 ? 242 LYS A O    2  
ATOM   3498  C  CB   . LYS A 1 88  ? 4.541   -8.428  -4.668  1.00 0.00 ? 242 LYS A CB   2  
ATOM   3499  C  CG   . LYS A 1 88  ? 3.923   -7.994  -5.999  1.00 0.00 ? 242 LYS A CG   2  
ATOM   3500  C  CD   . LYS A 1 88  ? 2.545   -8.639  -6.156  1.00 0.00 ? 242 LYS A CD   2  
ATOM   3501  C  CE   . LYS A 1 88  ? 1.632   -7.705  -6.954  1.00 0.00 ? 242 LYS A CE   2  
ATOM   3502  N  NZ   . LYS A 1 88  ? 0.388   -8.490  -7.186  1.00 0.00 ? 242 LYS A NZ   2  
ATOM   3503  H  H    . LYS A 1 88  ? 6.106   -8.997  -2.765  1.00 0.00 ? 242 LYS A H    2  
ATOM   3504  H  HA   . LYS A 1 88  ? 6.413   -7.520  -5.207  1.00 0.00 ? 242 LYS A HA   2  
ATOM   3505  H  HB2  . LYS A 1 88  ? 4.856   -9.458  -4.735  1.00 0.00 ? 242 LYS A HB2  2  
ATOM   3506  H  HB3  . LYS A 1 88  ? 3.807   -8.325  -3.883  1.00 0.00 ? 242 LYS A HB3  2  
ATOM   3507  H  HG2  . LYS A 1 88  ? 3.823   -6.919  -6.015  1.00 0.00 ? 242 LYS A HG2  2  
ATOM   3508  H  HG3  . LYS A 1 88  ? 4.560   -8.309  -6.811  1.00 0.00 ? 242 LYS A HG3  2  
ATOM   3509  H  HD2  . LYS A 1 88  ? 2.645   -9.579  -6.679  1.00 0.00 ? 242 LYS A HD2  2  
ATOM   3510  H  HD3  . LYS A 1 88  ? 2.114   -8.812  -5.181  1.00 0.00 ? 242 LYS A HD3  2  
ATOM   3511  H  HE2  . LYS A 1 88  ? 1.416   -6.813  -6.382  1.00 0.00 ? 242 LYS A HE2  2  
ATOM   3512  H  HE3  . LYS A 1 88  ? 2.088   -7.448  -7.897  1.00 0.00 ? 242 LYS A HE3  2  
ATOM   3513  H  HZ1  . LYS A 1 88  ? 0.619   -9.363  -7.699  1.00 0.00 ? 242 LYS A HZ1  2  
ATOM   3514  H  HZ2  . LYS A 1 88  ? -0.280  -7.923  -7.747  1.00 0.00 ? 242 LYS A HZ2  2  
ATOM   3515  H  HZ3  . LYS A 1 88  ? -0.045  -8.732  -6.272  1.00 0.00 ? 242 LYS A HZ3  2  
ATOM   3516  N  N    . CYS A 1 89  ? 5.138   -5.744  -2.766  1.00 0.00 ? 243 CYS A N    2  
ATOM   3517  C  CA   . CYS A 1 89  ? 4.679   -4.350  -2.442  1.00 0.00 ? 243 CYS A CA   2  
ATOM   3518  C  C    . CYS A 1 89  ? 5.895   -3.421  -2.330  1.00 0.00 ? 243 CYS A C    2  
ATOM   3519  O  O    . CYS A 1 89  ? 5.869   -2.306  -2.818  1.00 0.00 ? 243 CYS A O    2  
ATOM   3520  C  CB   . CYS A 1 89  ? 3.929   -4.438  -1.100  1.00 0.00 ? 243 CYS A CB   2  
ATOM   3521  S  SG   . CYS A 1 89  ? 2.218   -4.970  -1.385  1.00 0.00 ? 243 CYS A SG   2  
ATOM   3522  H  H    . CYS A 1 89  ? 5.333   -6.376  -2.045  1.00 0.00 ? 243 CYS A H    2  
ATOM   3523  H  HA   . CYS A 1 89  ? 4.016   -3.992  -3.213  1.00 0.00 ? 243 CYS A HA   2  
ATOM   3524  H  HB2  . CYS A 1 89  ? 4.425   -5.152  -0.458  1.00 0.00 ? 243 CYS A HB2  2  
ATOM   3525  H  HB3  . CYS A 1 89  ? 3.931   -3.468  -0.625  1.00 0.00 ? 243 CYS A HB3  2  
ATOM   3526  N  N    . ILE A 1 90  ? 6.971   -3.872  -1.714  1.00 0.00 ? 244 ILE A N    2  
ATOM   3527  C  CA   . ILE A 1 90  ? 8.186   -2.991  -1.616  1.00 0.00 ? 244 ILE A CA   2  
ATOM   3528  C  C    . ILE A 1 90  ? 8.823   -2.861  -3.006  1.00 0.00 ? 244 ILE A C    2  
ATOM   3529  O  O    . ILE A 1 90  ? 9.264   -1.794  -3.388  1.00 0.00 ? 244 ILE A O    2  
ATOM   3530  C  CB   . ILE A 1 90  ? 9.150   -3.666  -0.629  1.00 0.00 ? 244 ILE A CB   2  
ATOM   3531  C  CG1  . ILE A 1 90  ? 8.462   -3.784  0.731   1.00 0.00 ? 244 ILE A CG1  2  
ATOM   3532  C  CG2  . ILE A 1 90  ? 10.417  -2.819  -0.484  1.00 0.00 ? 244 ILE A CG2  2  
ATOM   3533  C  CD1  . ILE A 1 90  ? 8.942   -5.052  1.436   1.00 0.00 ? 244 ILE A CD1  2  
ATOM   3534  H  H    . ILE A 1 90  ? 6.982   -4.786  -1.342  1.00 0.00 ? 244 ILE A H    2  
ATOM   3535  H  HA   . ILE A 1 90  ? 7.906   -2.015  -1.247  1.00 0.00 ? 244 ILE A HA   2  
ATOM   3536  H  HB   . ILE A 1 90  ? 9.410   -4.649  -0.992  1.00 0.00 ? 244 ILE A HB   2  
ATOM   3537  H  HG12 . ILE A 1 90  ? 8.706   -2.921  1.334   1.00 0.00 ? 244 ILE A HG12 2  
ATOM   3538  H  HG13 . ILE A 1 90  ? 7.393   -3.834  0.591   1.00 0.00 ? 244 ILE A HG13 2  
ATOM   3539  H  HG21 . ILE A 1 90  ? 11.062  -2.987  -1.334  1.00 0.00 ? 244 ILE A HG21 2  
ATOM   3540  H  HG22 . ILE A 1 90  ? 10.935  -3.098  0.422   1.00 0.00 ? 244 ILE A HG22 2  
ATOM   3541  H  HG23 . ILE A 1 90  ? 10.147  -1.773  -0.437  1.00 0.00 ? 244 ILE A HG23 2  
ATOM   3542  H  HD11 . ILE A 1 90  ? 8.569   -5.063  2.451   1.00 0.00 ? 244 ILE A HD11 2  
ATOM   3543  H  HD12 . ILE A 1 90  ? 10.021  -5.069  1.449   1.00 0.00 ? 244 ILE A HD12 2  
ATOM   3544  H  HD13 . ILE A 1 90  ? 8.573   -5.919  0.908   1.00 0.00 ? 244 ILE A HD13 2  
ATOM   3545  N  N    . LEU A 1 91  ? 8.855   -3.930  -3.784  1.00 0.00 ? 245 LEU A N    2  
ATOM   3546  C  CA   . LEU A 1 91  ? 9.446   -3.825  -5.166  1.00 0.00 ? 245 LEU A CA   2  
ATOM   3547  C  C    . LEU A 1 91  ? 8.676   -2.767  -5.975  1.00 0.00 ? 245 LEU A C    2  
ATOM   3548  O  O    . LEU A 1 91  ? 9.266   -2.014  -6.727  1.00 0.00 ? 245 LEU A O    2  
ATOM   3549  C  CB   . LEU A 1 91  ? 9.301   -5.207  -5.824  1.00 0.00 ? 245 LEU A CB   2  
ATOM   3550  C  CG   . LEU A 1 91  ? 10.404  -5.396  -6.867  1.00 0.00 ? 245 LEU A CG   2  
ATOM   3551  C  CD1  . LEU A 1 91  ? 10.348  -6.821  -7.418  1.00 0.00 ? 245 LEU A CD1  2  
ATOM   3552  C  CD2  . LEU A 1 91  ? 10.197  -4.400  -8.011  1.00 0.00 ? 245 LEU A CD2  2  
ATOM   3553  H  H    . LEU A 1 91  ? 8.482   -4.784  -3.468  1.00 0.00 ? 245 LEU A H    2  
ATOM   3554  H  HA   . LEU A 1 91  ? 10.486  -3.554  -5.101  1.00 0.00 ? 245 LEU A HA   2  
ATOM   3555  H  HB2  . LEU A 1 91  ? 9.384   -5.976  -5.068  1.00 0.00 ? 245 LEU A HB2  2  
ATOM   3556  H  HB3  . LEU A 1 91  ? 8.337   -5.277  -6.305  1.00 0.00 ? 245 LEU A HB3  2  
ATOM   3557  H  HG   . LEU A 1 91  ? 11.366  -5.224  -6.408  1.00 0.00 ? 245 LEU A HG   2  
ATOM   3558  H  HD11 . LEU A 1 91  ? 9.971   -7.487  -6.655  1.00 0.00 ? 245 LEU A HD11 2  
ATOM   3559  H  HD12 . LEU A 1 91  ? 11.340  -7.133  -7.710  1.00 0.00 ? 245 LEU A HD12 2  
ATOM   3560  H  HD13 . LEU A 1 91  ? 9.694   -6.850  -8.276  1.00 0.00 ? 245 LEU A HD13 2  
ATOM   3561  H  HD21 . LEU A 1 91  ? 10.656  -4.786  -8.910  1.00 0.00 ? 245 LEU A HD21 2  
ATOM   3562  H  HD22 . LEU A 1 91  ? 10.651  -3.455  -7.753  1.00 0.00 ? 245 LEU A HD22 2  
ATOM   3563  H  HD23 . LEU A 1 91  ? 9.139   -4.258  -8.178  1.00 0.00 ? 245 LEU A HD23 2  
ATOM   3564  N  N    . ARG A 1 92  ? 7.366   -2.688  -5.816  1.00 0.00 ? 246 ARG A N    2  
ATOM   3565  C  CA   . ARG A 1 92  ? 6.588   -1.648  -6.578  1.00 0.00 ? 246 ARG A CA   2  
ATOM   3566  C  C    . ARG A 1 92  ? 6.651   -0.275  -5.870  1.00 0.00 ? 246 ARG A C    2  
ATOM   3567  O  O    . ARG A 1 92  ? 6.352   0.737   -6.477  1.00 0.00 ? 246 ARG A O    2  
ATOM   3568  C  CB   . ARG A 1 92  ? 5.138   -2.150  -6.639  1.00 0.00 ? 246 ARG A CB   2  
ATOM   3569  C  CG   . ARG A 1 92  ? 5.001   -3.178  -7.762  1.00 0.00 ? 246 ARG A CG   2  
ATOM   3570  C  CD   . ARG A 1 92  ? 4.726   -2.459  -9.085  1.00 0.00 ? 246 ARG A CD   2  
ATOM   3571  N  NE   . ARG A 1 92  ? 6.075   -2.241  -9.694  1.00 0.00 ? 246 ARG A NE   2  
ATOM   3572  C  CZ   . ARG A 1 92  ? 6.745   -3.237  -10.254 1.00 0.00 ? 246 ARG A CZ   2  
ATOM   3573  N  NH1  . ARG A 1 92  ? 6.255   -4.456  -10.294 1.00 0.00 ? 246 ARG A NH1  2  
ATOM   3574  N  NH2  . ARG A 1 92  ? 7.921   -3.009  -10.779 1.00 0.00 ? 246 ARG A NH2  2  
ATOM   3575  H  H    . ARG A 1 92  ? 6.901   -3.298  -5.188  1.00 0.00 ? 246 ARG A H    2  
ATOM   3576  H  HA   . ARG A 1 92  ? 6.981   -1.560  -7.578  1.00 0.00 ? 246 ARG A HA   2  
ATOM   3577  H  HB2  . ARG A 1 92  ? 4.876   -2.607  -5.696  1.00 0.00 ? 246 ARG A HB2  2  
ATOM   3578  H  HB3  . ARG A 1 92  ? 4.478   -1.318  -6.832  1.00 0.00 ? 246 ARG A HB3  2  
ATOM   3579  H  HG2  . ARG A 1 92  ? 5.918   -3.746  -7.844  1.00 0.00 ? 246 ARG A HG2  2  
ATOM   3580  H  HG3  . ARG A 1 92  ? 4.183   -3.847  -7.542  1.00 0.00 ? 246 ARG A HG3  2  
ATOM   3581  H  HD2  . ARG A 1 92  ? 4.115   -3.077  -9.728  1.00 0.00 ? 246 ARG A HD2  2  
ATOM   3582  H  HD3  . ARG A 1 92  ? 4.246   -1.510  -8.904  1.00 0.00 ? 246 ARG A HD3  2  
ATOM   3583  H  HE   . ARG A 1 92  ? 6.466   -1.341  -9.678  1.00 0.00 ? 246 ARG A HE   2  
ATOM   3584  H  HH11 . ARG A 1 92  ? 5.360   -4.656  -9.900  1.00 0.00 ? 246 ARG A HH11 2  
ATOM   3585  H  HH12 . ARG A 1 92  ? 6.784   -5.189  -10.722 1.00 0.00 ? 246 ARG A HH12 2  
ATOM   3586  H  HH21 . ARG A 1 92  ? 8.309   -2.088  -10.756 1.00 0.00 ? 246 ARG A HH21 2  
ATOM   3587  H  HH22 . ARG A 1 92  ? 8.432   -3.758  -11.202 1.00 0.00 ? 246 ARG A HH22 2  
ATOM   3588  N  N    . ASN A 1 93  ? 7.031   -0.215  -4.601  1.00 0.00 ? 247 ASN A N    2  
ATOM   3589  C  CA   . ASN A 1 93  ? 7.096   1.114   -3.905  1.00 0.00 ? 247 ASN A CA   2  
ATOM   3590  C  C    . ASN A 1 93  ? 8.532   1.658   -3.908  1.00 0.00 ? 247 ASN A C    2  
ATOM   3591  O  O    . ASN A 1 93  ? 8.745   2.835   -4.130  1.00 0.00 ? 247 ASN A O    2  
ATOM   3592  C  CB   . ASN A 1 93  ? 6.623   0.862   -2.467  1.00 0.00 ? 247 ASN A CB   2  
ATOM   3593  C  CG   . ASN A 1 93  ? 6.389   2.203   -1.761  1.00 0.00 ? 247 ASN A CG   2  
ATOM   3594  O  OD1  . ASN A 1 93  ? 7.002   3.194   -2.108  1.00 0.00 ? 247 ASN A OD1  2  
ATOM   3595  N  ND2  . ASN A 1 93  ? 5.525   2.284   -0.779  1.00 0.00 ? 247 ASN A ND2  2  
ATOM   3596  H  H    . ASN A 1 93  ? 7.272   -1.028  -4.113  1.00 0.00 ? 247 ASN A H    2  
ATOM   3597  H  HA   . ASN A 1 93  ? 6.438   1.814   -4.387  1.00 0.00 ? 247 ASN A HA   2  
ATOM   3598  H  HB2  . ASN A 1 93  ? 5.702   0.297   -2.486  1.00 0.00 ? 247 ASN A HB2  2  
ATOM   3599  H  HB3  . ASN A 1 93  ? 7.378   0.302   -1.933  1.00 0.00 ? 247 ASN A HB3  2  
ATOM   3600  H  HD21 . ASN A 1 93  ? 5.024   1.489   -0.492  1.00 0.00 ? 247 ASN A HD21 2  
ATOM   3601  H  HD22 . ASN A 1 93  ? 5.378   3.142   -0.330  1.00 0.00 ? 247 ASN A HD22 2  
ATOM   3602  N  N    . LEU A 1 94  ? 9.520   0.821   -3.661  1.00 0.00 ? 248 LEU A N    2  
ATOM   3603  C  CA   . LEU A 1 94  ? 10.933  1.327   -3.652  1.00 0.00 ? 248 LEU A CA   2  
ATOM   3604  C  C    . LEU A 1 94  ? 11.949  0.284   -4.175  1.00 0.00 ? 248 LEU A C    2  
ATOM   3605  O  O    . LEU A 1 94  ? 13.119  0.359   -3.846  1.00 0.00 ? 248 LEU A O    2  
ATOM   3606  C  CB   . LEU A 1 94  ? 11.225  1.684   -2.187  1.00 0.00 ? 248 LEU A CB   2  
ATOM   3607  C  CG   . LEU A 1 94  ? 11.146  0.435   -1.299  1.00 0.00 ? 248 LEU A CG   2  
ATOM   3608  C  CD1  . LEU A 1 94  ? 12.509  -0.255  -1.259  1.00 0.00 ? 248 LEU A CD1  2  
ATOM   3609  C  CD2  . LEU A 1 94  ? 10.748  0.850   0.120   1.00 0.00 ? 248 LEU A CD2  2  
ATOM   3610  H  H    . LEU A 1 94  ? 9.332   -0.122  -3.481  1.00 0.00 ? 248 LEU A H    2  
ATOM   3611  H  HA   . LEU A 1 94  ? 10.997  2.223   -4.250  1.00 0.00 ? 248 LEU A HA   2  
ATOM   3612  H  HB2  . LEU A 1 94  ? 12.214  2.110   -2.115  1.00 0.00 ? 248 LEU A HB2  2  
ATOM   3613  H  HB3  . LEU A 1 94  ? 10.500  2.409   -1.846  1.00 0.00 ? 248 LEU A HB3  2  
ATOM   3614  H  HG   . LEU A 1 94  ? 10.412  -0.247  -1.692  1.00 0.00 ? 248 LEU A HG   2  
ATOM   3615  H  HD11 . LEU A 1 94  ? 13.291  0.487   -1.326  1.00 0.00 ? 248 LEU A HD11 2  
ATOM   3616  H  HD12 . LEU A 1 94  ? 12.589  -0.939  -2.092  1.00 0.00 ? 248 LEU A HD12 2  
ATOM   3617  H  HD13 . LEU A 1 94  ? 12.610  -0.801  -0.333  1.00 0.00 ? 248 LEU A HD13 2  
ATOM   3618  H  HD21 . LEU A 1 94  ? 9.673   0.917   0.188   1.00 0.00 ? 248 LEU A HD21 2  
ATOM   3619  H  HD22 . LEU A 1 94  ? 11.184  1.811   0.350   1.00 0.00 ? 248 LEU A HD22 2  
ATOM   3620  H  HD23 . LEU A 1 94  ? 11.109  0.115   0.825   1.00 0.00 ? 248 LEU A HD23 2  
ATOM   3621  N  N    . GLY A 1 95  ? 11.542  -0.663  -5.000  1.00 0.00 ? 249 GLY A N    2  
ATOM   3622  C  CA   . GLY A 1 95  ? 12.525  -1.659  -5.533  1.00 0.00 ? 249 GLY A CA   2  
ATOM   3623  C  C    . GLY A 1 95  ? 12.763  -2.780  -4.511  1.00 0.00 ? 249 GLY A C    2  
ATOM   3624  O  O    . GLY A 1 95  ? 12.263  -2.732  -3.403  1.00 0.00 ? 249 GLY A O    2  
ATOM   3625  H  H    . GLY A 1 95  ? 10.605  -0.712  -5.285  1.00 0.00 ? 249 GLY A H    2  
ATOM   3626  H  HA2  . GLY A 1 95  ? 12.140  -2.086  -6.448  1.00 0.00 ? 249 GLY A HA2  2  
ATOM   3627  H  HA3  . GLY A 1 95  ? 13.462  -1.163  -5.736  1.00 0.00 ? 249 GLY A HA3  2  
ATOM   3628  N  N    . ARG A 1 96  ? 13.522  -3.792  -4.879  1.00 0.00 ? 250 ARG A N    2  
ATOM   3629  C  CA   . ARG A 1 96  ? 13.790  -4.922  -3.925  1.00 0.00 ? 250 ARG A CA   2  
ATOM   3630  C  C    . ARG A 1 96  ? 15.166  -4.783  -3.241  1.00 0.00 ? 250 ARG A C    2  
ATOM   3631  O  O    . ARG A 1 96  ? 15.355  -5.282  -2.149  1.00 0.00 ? 250 ARG A O    2  
ATOM   3632  C  CB   . ARG A 1 96  ? 13.751  -6.197  -4.774  1.00 0.00 ? 250 ARG A CB   2  
ATOM   3633  C  CG   . ARG A 1 96  ? 13.769  -7.422  -3.859  1.00 0.00 ? 250 ARG A CG   2  
ATOM   3634  C  CD   . ARG A 1 96  ? 14.540  -8.562  -4.542  1.00 0.00 ? 250 ARG A CD   2  
ATOM   3635  N  NE   . ARG A 1 96  ? 14.880  -9.556  -3.460  1.00 0.00 ? 250 ARG A NE   2  
ATOM   3636  C  CZ   . ARG A 1 96  ? 15.085  -10.834 -3.743  1.00 0.00 ? 250 ARG A CZ   2  
ATOM   3637  N  NH1  . ARG A 1 96  ? 15.043  -11.284 -4.977  1.00 0.00 ? 250 ARG A NH1  2  
ATOM   3638  N  NH2  . ARG A 1 96  ? 15.357  -11.673 -2.776  1.00 0.00 ? 250 ARG A NH2  2  
ATOM   3639  H  H    . ARG A 1 96  ? 13.914  -3.811  -5.786  1.00 0.00 ? 250 ARG A H    2  
ATOM   3640  H  HA   . ARG A 1 96  ? 13.014  -4.962  -3.181  1.00 0.00 ? 250 ARG A HA   2  
ATOM   3641  H  HB2  . ARG A 1 96  ? 12.851  -6.205  -5.372  1.00 0.00 ? 250 ARG A HB2  2  
ATOM   3642  H  HB3  . ARG A 1 96  ? 14.614  -6.220  -5.422  1.00 0.00 ? 250 ARG A HB3  2  
ATOM   3643  H  HG2  . ARG A 1 96  ? 14.252  -7.168  -2.926  1.00 0.00 ? 250 ARG A HG2  2  
ATOM   3644  H  HG3  . ARG A 1 96  ? 12.756  -7.741  -3.664  1.00 0.00 ? 250 ARG A HG3  2  
ATOM   3645  H  HD2  . ARG A 1 96  ? 13.917  -9.024  -5.294  1.00 0.00 ? 250 ARG A HD2  2  
ATOM   3646  H  HD3  . ARG A 1 96  ? 15.445  -8.183  -4.990  1.00 0.00 ? 250 ARG A HD3  2  
ATOM   3647  H  HE   . ARG A 1 96  ? 14.951  -9.255  -2.524  1.00 0.00 ? 250 ARG A HE   2  
ATOM   3648  H  HH11 . ARG A 1 96  ? 14.855  -10.665 -5.737  1.00 0.00 ? 250 ARG A HH11 2  
ATOM   3649  H  HH12 . ARG A 1 96  ? 15.201  -12.254 -5.156  1.00 0.00 ? 250 ARG A HH12 2  
ATOM   3650  H  HH21 . ARG A 1 96  ? 15.408  -11.348 -1.832  1.00 0.00 ? 250 ARG A HH21 2  
ATOM   3651  H  HH22 . ARG A 1 96  ? 15.514  -12.639 -2.982  1.00 0.00 ? 250 ARG A HH22 2  
ATOM   3652  N  N    . LYS A 1 97  ? 16.134  -4.129  -3.866  1.00 0.00 ? 251 LYS A N    2  
ATOM   3653  C  CA   . LYS A 1 97  ? 17.498  -3.993  -3.215  1.00 0.00 ? 251 LYS A CA   2  
ATOM   3654  C  C    . LYS A 1 97  ? 17.364  -3.483  -1.772  1.00 0.00 ? 251 LYS A C    2  
ATOM   3655  O  O    . LYS A 1 97  ? 17.787  -4.146  -0.843  1.00 0.00 ? 251 LYS A O    2  
ATOM   3656  C  CB   . LYS A 1 97  ? 18.292  -2.982  -4.059  1.00 0.00 ? 251 LYS A CB   2  
ATOM   3657  C  CG   . LYS A 1 97  ? 19.725  -2.891  -3.530  1.00 0.00 ? 251 LYS A CG   2  
ATOM   3658  C  CD   . LYS A 1 97  ? 20.256  -1.471  -3.740  1.00 0.00 ? 251 LYS A CD   2  
ATOM   3659  C  CE   . LYS A 1 97  ? 21.525  -1.273  -2.909  1.00 0.00 ? 251 LYS A CE   2  
ATOM   3660  N  NZ   . LYS A 1 97  ? 21.579  0.191   -2.634  1.00 0.00 ? 251 LYS A NZ   2  
ATOM   3661  H  H    . LYS A 1 97  ? 15.970  -3.742  -4.755  1.00 0.00 ? 251 LYS A H    2  
ATOM   3662  H  HA   . LYS A 1 97  ? 18.002  -4.947  -3.217  1.00 0.00 ? 251 LYS A HA   2  
ATOM   3663  H  HB2  . LYS A 1 97  ? 18.307  -3.307  -5.089  1.00 0.00 ? 251 LYS A HB2  2  
ATOM   3664  H  HB3  . LYS A 1 97  ? 17.824  -2.012  -3.993  1.00 0.00 ? 251 LYS A HB3  2  
ATOM   3665  H  HG2  . LYS A 1 97  ? 19.736  -3.127  -2.476  1.00 0.00 ? 251 LYS A HG2  2  
ATOM   3666  H  HG3  . LYS A 1 97  ? 20.351  -3.590  -4.064  1.00 0.00 ? 251 LYS A HG3  2  
ATOM   3667  H  HD2  . LYS A 1 97  ? 20.483  -1.323  -4.786  1.00 0.00 ? 251 LYS A HD2  2  
ATOM   3668  H  HD3  . LYS A 1 97  ? 19.509  -0.757  -3.429  1.00 0.00 ? 251 LYS A HD3  2  
ATOM   3669  H  HE2  . LYS A 1 97  ? 21.459  -1.829  -1.984  1.00 0.00 ? 251 LYS A HE2  2  
ATOM   3670  H  HE3  . LYS A 1 97  ? 22.395  -1.575  -3.471  1.00 0.00 ? 251 LYS A HE3  2  
ATOM   3671  H  HZ1  . LYS A 1 97  ? 21.733  0.706   -3.524  1.00 0.00 ? 251 LYS A HZ1  2  
ATOM   3672  H  HZ2  . LYS A 1 97  ? 22.361  0.391   -1.977  1.00 0.00 ? 251 LYS A HZ2  2  
ATOM   3673  H  HZ3  . LYS A 1 97  ? 20.681  0.497   -2.209  1.00 0.00 ? 251 LYS A HZ3  2  
ATOM   3674  N  N    . GLU A 1 98  ? 16.760  -2.328  -1.565  1.00 0.00 ? 252 GLU A N    2  
ATOM   3675  C  CA   . GLU A 1 98  ? 16.592  -1.819  -0.152  1.00 0.00 ? 252 GLU A CA   2  
ATOM   3676  C  C    . GLU A 1 98  ? 15.912  -2.898  0.718   1.00 0.00 ? 252 GLU A C    2  
ATOM   3677  O  O    . GLU A 1 98  ? 16.164  -2.991  1.904   1.00 0.00 ? 252 GLU A O    2  
ATOM   3678  C  CB   . GLU A 1 98  ? 15.701  -0.569  -0.231  1.00 0.00 ? 252 GLU A CB   2  
ATOM   3679  C  CG   . GLU A 1 98  ? 16.045  0.376   0.924   1.00 0.00 ? 252 GLU A CG   2  
ATOM   3680  C  CD   . GLU A 1 98  ? 15.881  1.825   0.464   1.00 0.00 ? 252 GLU A CD   2  
ATOM   3681  O  OE1  . GLU A 1 98  ? 14.849  2.131   -0.110  1.00 0.00 ? 252 GLU A OE1  2  
ATOM   3682  O  OE2  . GLU A 1 98  ? 16.789  2.606   0.695   1.00 0.00 ? 252 GLU A OE2  2  
ATOM   3683  H  H    . GLU A 1 98  ? 16.409  -1.813  -2.328  1.00 0.00 ? 252 GLU A H    2  
ATOM   3684  H  HA   . GLU A 1 98  ? 17.550  -1.562  0.261   1.00 0.00 ? 252 GLU A HA   2  
ATOM   3685  H  HB2  . GLU A 1 98  ? 15.869  -0.064  -1.171  1.00 0.00 ? 252 GLU A HB2  2  
ATOM   3686  H  HB3  . GLU A 1 98  ? 14.664  -0.860  -0.158  1.00 0.00 ? 252 GLU A HB3  2  
ATOM   3687  H  HG2  . GLU A 1 98  ? 15.383  0.183   1.756   1.00 0.00 ? 252 GLU A HG2  2  
ATOM   3688  H  HG3  . GLU A 1 98  ? 17.067  0.211   1.231   1.00 0.00 ? 252 GLU A HG3  2  
ATOM   3689  N  N    . LEU A 1 99  ? 15.059  -3.722  0.134   1.00 0.00 ? 253 LEU A N    2  
ATOM   3690  C  CA   . LEU A 1 99  ? 14.380  -4.799  0.939   1.00 0.00 ? 253 LEU A CA   2  
ATOM   3691  C  C    . LEU A 1 99  ? 15.425  -5.711  1.606   1.00 0.00 ? 253 LEU A C    2  
ATOM   3692  O  O    . LEU A 1 99  ? 15.208  -6.195  2.701   1.00 0.00 ? 253 LEU A O    2  
ATOM   3693  C  CB   . LEU A 1 99  ? 13.529  -5.609  -0.051  1.00 0.00 ? 253 LEU A CB   2  
ATOM   3694  C  CG   . LEU A 1 99  ? 12.379  -6.283  0.694   1.00 0.00 ? 253 LEU A CG   2  
ATOM   3695  C  CD1  . LEU A 1 99  ? 11.273  -6.650  -0.298  1.00 0.00 ? 253 LEU A CD1  2  
ATOM   3696  C  CD2  . LEU A 1 99  ? 12.891  -7.552  1.380   1.00 0.00 ? 253 LEU A CD2  2  
ATOM   3697  H  H    . LEU A 1 99  ? 14.870  -3.635  -0.827  1.00 0.00 ? 253 LEU A H    2  
ATOM   3698  H  HA   . LEU A 1 99  ? 13.744  -4.355  1.688   1.00 0.00 ? 253 LEU A HA   2  
ATOM   3699  H  HB2  . LEU A 1 99  ? 13.129  -4.946  -0.806  1.00 0.00 ? 253 LEU A HB2  2  
ATOM   3700  H  HB3  . LEU A 1 99  ? 14.143  -6.360  -0.522  1.00 0.00 ? 253 LEU A HB3  2  
ATOM   3701  H  HG   . LEU A 1 99  ? 11.985  -5.604  1.435   1.00 0.00 ? 253 LEU A HG   2  
ATOM   3702  H  HD11 . LEU A 1 99  ? 10.334  -6.738  0.227   1.00 0.00 ? 253 LEU A HD11 2  
ATOM   3703  H  HD12 . LEU A 1 99  ? 11.512  -7.591  -0.770  1.00 0.00 ? 253 LEU A HD12 2  
ATOM   3704  H  HD13 . LEU A 1 99  ? 11.194  -5.879  -1.051  1.00 0.00 ? 253 LEU A HD13 2  
ATOM   3705  H  HD21 . LEU A 1 99  ? 13.190  -7.320  2.391   1.00 0.00 ? 253 LEU A HD21 2  
ATOM   3706  H  HD22 . LEU A 1 99  ? 13.738  -7.940  0.833   1.00 0.00 ? 253 LEU A HD22 2  
ATOM   3707  H  HD23 . LEU A 1 99  ? 12.105  -8.292  1.398   1.00 0.00 ? 253 LEU A HD23 2  
ATOM   3708  N  N    . SER A 1 100 ? 16.556  -5.959  0.968   1.00 0.00 ? 254 SER A N    2  
ATOM   3709  C  CA   . SER A 1 100 ? 17.585  -6.851  1.618   1.00 0.00 ? 254 SER A CA   2  
ATOM   3710  C  C    . SER A 1 100 ? 18.080  -6.201  2.916   1.00 0.00 ? 254 SER A C    2  
ATOM   3711  O  O    . SER A 1 100 ? 18.092  -6.830  3.958   1.00 0.00 ? 254 SER A O    2  
ATOM   3712  C  CB   . SER A 1 100 ? 18.743  -7.004  0.621   1.00 0.00 ? 254 SER A CB   2  
ATOM   3713  O  OG   . SER A 1 100 ? 19.355  -8.273  0.804   1.00 0.00 ? 254 SER A OG   2  
ATOM   3714  H  H    . SER A 1 100 ? 16.724  -5.562  0.077   1.00 0.00 ? 254 SER A H    2  
ATOM   3715  H  HA   . SER A 1 100 ? 17.153  -7.816  1.836   1.00 0.00 ? 254 SER A HA   2  
ATOM   3716  H  HB2  . SER A 1 100 ? 18.366  -6.934  -0.385  1.00 0.00 ? 254 SER A HB2  2  
ATOM   3717  H  HB3  . SER A 1 100 ? 19.466  -6.216  0.787   1.00 0.00 ? 254 SER A HB3  2  
ATOM   3718  H  HG   . SER A 1 100 ? 20.168  -8.288  0.293   1.00 0.00 ? 254 SER A HG   2  
ATOM   3719  N  N    . THR A 1 101 ? 18.472  -4.943  2.874   1.00 0.00 ? 255 THR A N    2  
ATOM   3720  C  CA   . THR A 1 101 ? 18.946  -4.269  4.140   1.00 0.00 ? 255 THR A CA   2  
ATOM   3721  C  C    . THR A 1 101 ? 17.845  -4.324  5.213   1.00 0.00 ? 255 THR A C    2  
ATOM   3722  O  O    . THR A 1 101 ? 18.136  -4.416  6.391   1.00 0.00 ? 255 THR A O    2  
ATOM   3723  C  CB   . THR A 1 101 ? 19.264  -2.805  3.774   1.00 0.00 ? 255 THR A CB   2  
ATOM   3724  O  OG1  . THR A 1 101 ? 20.216  -2.761  2.705   1.00 0.00 ? 255 THR A OG1  2  
ATOM   3725  C  CG2  . THR A 1 101 ? 19.818  -2.076  5.006   1.00 0.00 ? 255 THR A CG2  2  
ATOM   3726  H  H    . THR A 1 101 ? 18.443  -4.446  2.021   1.00 0.00 ? 255 THR A H    2  
ATOM   3727  H  HA   . THR A 1 101 ? 19.832  -4.757  4.507   1.00 0.00 ? 255 THR A HA   2  
ATOM   3728  H  HB   . THR A 1 101 ? 18.355  -2.315  3.457   1.00 0.00 ? 255 THR A HB   2  
ATOM   3729  H  HG1  . THR A 1 101 ? 21.030  -3.199  2.985   1.00 0.00 ? 255 THR A HG1  2  
ATOM   3730  H  HG21 . THR A 1 101 ? 20.291  -1.155  4.697   1.00 0.00 ? 255 THR A HG21 2  
ATOM   3731  H  HG22 . THR A 1 101 ? 20.544  -2.705  5.500   1.00 0.00 ? 255 THR A HG22 2  
ATOM   3732  H  HG23 . THR A 1 101 ? 19.010  -1.856  5.687   1.00 0.00 ? 255 THR A HG23 2  
ATOM   3733  N  N    . ILE A 1 102 ? 16.583  -4.280  4.824   1.00 0.00 ? 256 ILE A N    2  
ATOM   3734  C  CA   . ILE A 1 102 ? 15.483  -4.345  5.853   1.00 0.00 ? 256 ILE A CA   2  
ATOM   3735  C  C    . ILE A 1 102 ? 15.620  -5.630  6.695   1.00 0.00 ? 256 ILE A C    2  
ATOM   3736  O  O    . ILE A 1 102 ? 15.298  -5.631  7.869   1.00 0.00 ? 256 ILE A O    2  
ATOM   3737  C  CB   . ILE A 1 102 ? 14.145  -4.336  5.079   1.00 0.00 ? 256 ILE A CB   2  
ATOM   3738  C  CG1  . ILE A 1 102 ? 13.948  -2.966  4.421   1.00 0.00 ? 256 ILE A CG1  2  
ATOM   3739  C  CG2  . ILE A 1 102 ? 12.980  -4.603  6.036   1.00 0.00 ? 256 ILE A CG2  2  
ATOM   3740  C  CD1  . ILE A 1 102 ? 12.711  -3.002  3.518   1.00 0.00 ? 256 ILE A CD1  2  
ATOM   3741  H  H    . ILE A 1 102 ? 16.366  -4.213  3.867   1.00 0.00 ? 256 ILE A H    2  
ATOM   3742  H  HA   . ILE A 1 102 ? 15.536  -3.485  6.496   1.00 0.00 ? 256 ILE A HA   2  
ATOM   3743  H  HB   . ILE A 1 102 ? 14.165  -5.101  4.319   1.00 0.00 ? 256 ILE A HB   2  
ATOM   3744  H  HG12 . ILE A 1 102 ? 13.811  -2.217  5.188   1.00 0.00 ? 256 ILE A HG12 2  
ATOM   3745  H  HG13 . ILE A 1 102 ? 14.816  -2.720  3.829   1.00 0.00 ? 256 ILE A HG13 2  
ATOM   3746  H  HG21 . ILE A 1 102 ? 12.087  -4.132  5.657   1.00 0.00 ? 256 ILE A HG21 2  
ATOM   3747  H  HG22 . ILE A 1 102 ? 13.218  -4.203  7.008   1.00 0.00 ? 256 ILE A HG22 2  
ATOM   3748  H  HG23 . ILE A 1 102 ? 12.818  -5.668  6.118   1.00 0.00 ? 256 ILE A HG23 2  
ATOM   3749  H  HD11 . ILE A 1 102 ? 12.891  -2.401  2.639   1.00 0.00 ? 256 ILE A HD11 2  
ATOM   3750  H  HD12 . ILE A 1 102 ? 11.862  -2.608  4.056   1.00 0.00 ? 256 ILE A HD12 2  
ATOM   3751  H  HD13 . ILE A 1 102 ? 12.510  -4.021  3.223   1.00 0.00 ? 256 ILE A HD13 2  
ATOM   3752  N  N    . MET A 1 103 ? 16.094  -6.718  6.118   1.00 0.00 ? 257 MET A N    2  
ATOM   3753  C  CA   . MET A 1 103 ? 16.238  -7.975  6.927   1.00 0.00 ? 257 MET A CA   2  
ATOM   3754  C  C    . MET A 1 103 ? 17.685  -8.157  7.437   1.00 0.00 ? 257 MET A C    2  
ATOM   3755  O  O    . MET A 1 103 ? 18.089  -9.262  7.749   1.00 0.00 ? 257 MET A O    2  
ATOM   3756  C  CB   . MET A 1 103 ? 15.846  -9.123  5.990   1.00 0.00 ? 257 MET A CB   2  
ATOM   3757  C  CG   . MET A 1 103 ? 14.344  -9.397  6.118   1.00 0.00 ? 257 MET A CG   2  
ATOM   3758  S  SD   . MET A 1 103 ? 14.002  -10.131 7.738   1.00 0.00 ? 257 MET A SD   2  
ATOM   3759  C  CE   . MET A 1 103 ? 12.217  -9.840  7.754   1.00 0.00 ? 257 MET A CE   2  
ATOM   3760  H  H    . MET A 1 103 ? 16.358  -6.707  5.167   1.00 0.00 ? 257 MET A H    2  
ATOM   3761  H  HA   . MET A 1 103 ? 15.557  -7.949  7.764   1.00 0.00 ? 257 MET A HA   2  
ATOM   3762  H  HB2  . MET A 1 103 ? 16.079  -8.852  4.970   1.00 0.00 ? 257 MET A HB2  2  
ATOM   3763  H  HB3  . MET A 1 103 ? 16.396  -10.012 6.259   1.00 0.00 ? 257 MET A HB3  2  
ATOM   3764  H  HG2  . MET A 1 103 ? 13.798  -8.468  6.018   1.00 0.00 ? 257 MET A HG2  2  
ATOM   3765  H  HG3  . MET A 1 103 ? 14.035  -10.079 5.340   1.00 0.00 ? 257 MET A HG3  2  
ATOM   3766  H  HE1  . MET A 1 103 ? 11.767  -10.317 6.895   1.00 0.00 ? 257 MET A HE1  2  
ATOM   3767  H  HE2  . MET A 1 103 ? 12.023  -8.781  7.718   1.00 0.00 ? 257 MET A HE2  2  
ATOM   3768  H  HE3  . MET A 1 103 ? 11.794  -10.250 8.663   1.00 0.00 ? 257 MET A HE3  2  
ATOM   3769  N  N    . ASP A 1 104 ? 18.470  -7.095  7.539   1.00 0.00 ? 258 ASP A N    2  
ATOM   3770  C  CA   . ASP A 1 104 ? 19.875  -7.249  8.046   1.00 0.00 ? 258 ASP A CA   2  
ATOM   3771  C  C    . ASP A 1 104 ? 20.503  -5.871  8.332   1.00 0.00 ? 258 ASP A C    2  
ATOM   3772  O  O    . ASP A 1 104 ? 21.459  -5.477  7.687   1.00 0.00 ? 258 ASP A O    2  
ATOM   3773  C  CB   . ASP A 1 104 ? 20.627  -7.963  6.919   1.00 0.00 ? 258 ASP A CB   2  
ATOM   3774  C  CG   . ASP A 1 104 ? 21.927  -8.554  7.467   1.00 0.00 ? 258 ASP A CG   2  
ATOM   3775  O  OD1  . ASP A 1 104 ? 22.534  -7.917  8.312   1.00 0.00 ? 258 ASP A OD1  2  
ATOM   3776  O  OD2  . ASP A 1 104 ? 22.293  -9.634  7.033   1.00 0.00 ? 258 ASP A OD2  2  
ATOM   3777  H  H    . ASP A 1 104 ? 18.140  -6.204  7.293   1.00 0.00 ? 258 ASP A H    2  
ATOM   3778  H  HA   . ASP A 1 104 ? 19.886  -7.855  8.938   1.00 0.00 ? 258 ASP A HA   2  
ATOM   3779  H  HB2  . ASP A 1 104 ? 20.009  -8.755  6.521   1.00 0.00 ? 258 ASP A HB2  2  
ATOM   3780  H  HB3  . ASP A 1 104 ? 20.856  -7.257  6.136   1.00 0.00 ? 258 ASP A HB3  2  
ATOM   3781  N  N    . GLU A 1 105 ? 19.973  -5.133  9.287   1.00 0.00 ? 259 GLU A N    2  
ATOM   3782  C  CA   . GLU A 1 105 ? 20.545  -3.788  9.593   1.00 0.00 ? 259 GLU A CA   2  
ATOM   3783  C  C    . GLU A 1 105 ? 20.811  -3.642  11.099  1.00 0.00 ? 259 GLU A C    2  
ATOM   3784  O  O    . GLU A 1 105 ? 21.949  -3.559  11.521  1.00 0.00 ? 259 GLU A O    2  
ATOM   3785  C  CB   . GLU A 1 105 ? 19.482  -2.783  9.120   1.00 0.00 ? 259 GLU A CB   2  
ATOM   3786  C  CG   . GLU A 1 105 ? 20.107  -1.791  8.135   1.00 0.00 ? 259 GLU A CG   2  
ATOM   3787  C  CD   . GLU A 1 105 ? 20.919  -0.749  8.906   1.00 0.00 ? 259 GLU A CD   2  
ATOM   3788  O  OE1  . GLU A 1 105 ? 21.779  -1.147  9.674   1.00 0.00 ? 259 GLU A OE1  2  
ATOM   3789  O  OE2  . GLU A 1 105 ? 20.666  0.429   8.715   1.00 0.00 ? 259 GLU A OE2  2  
ATOM   3790  H  H    . GLU A 1 105 ? 19.198  -5.459  9.798   1.00 0.00 ? 259 GLU A H    2  
ATOM   3791  H  HA   . GLU A 1 105 ? 21.457  -3.645  9.046   1.00 0.00 ? 259 GLU A HA   2  
ATOM   3792  H  HB2  . GLU A 1 105 ? 18.674  -3.312  8.632   1.00 0.00 ? 259 GLU A HB2  2  
ATOM   3793  H  HB3  . GLU A 1 105 ? 19.093  -2.241  9.970   1.00 0.00 ? 259 GLU A HB3  2  
ATOM   3794  H  HG2  . GLU A 1 105 ? 20.756  -2.323  7.454   1.00 0.00 ? 259 GLU A HG2  2  
ATOM   3795  H  HG3  . GLU A 1 105 ? 19.326  -1.297  7.578   1.00 0.00 ? 259 GLU A HG3  2  
ATOM   3796  N  N    . ASN A 1 106 ? 19.779  -3.606  11.914  1.00 0.00 ? 260 ASN A N    2  
ATOM   3797  C  CA   . ASN A 1 106 ? 19.996  -3.464  13.389  1.00 0.00 ? 260 ASN A CA   2  
ATOM   3798  C  C    . ASN A 1 106 ? 18.834  -4.102  14.169  1.00 0.00 ? 260 ASN A C    2  
ATOM   3799  O  O    . ASN A 1 106 ? 18.422  -3.595  15.195  1.00 0.00 ? 260 ASN A O    2  
ATOM   3800  C  CB   . ASN A 1 106 ? 20.042  -1.955  13.638  1.00 0.00 ? 260 ASN A CB   2  
ATOM   3801  C  CG   . ASN A 1 106 ? 21.500  -1.481  13.641  1.00 0.00 ? 260 ASN A CG   2  
ATOM   3802  O  OD1  . ASN A 1 106 ? 22.361  -2.146  14.182  1.00 0.00 ? 260 ASN A OD1  2  
ATOM   3803  N  ND2  . ASN A 1 106 ? 21.822  -0.351  13.059  1.00 0.00 ? 260 ASN A ND2  2  
ATOM   3804  H  H    . ASN A 1 106 ? 18.863  -3.675  11.561  1.00 0.00 ? 260 ASN A H    2  
ATOM   3805  H  HA   . ASN A 1 106 ? 20.933  -3.914  13.676  1.00 0.00 ? 260 ASN A HA   2  
ATOM   3806  H  HB2  . ASN A 1 106 ? 19.498  -1.446  12.856  1.00 0.00 ? 260 ASN A HB2  2  
ATOM   3807  H  HB3  . ASN A 1 106 ? 19.591  -1.734  14.594  1.00 0.00 ? 260 ASN A HB3  2  
ATOM   3808  H  HD21 . ASN A 1 106 ? 21.135  0.195   12.619  1.00 0.00 ? 260 ASN A HD21 2  
ATOM   3809  H  HD22 . ASN A 1 106 ? 22.754  -0.049  13.063  1.00 0.00 ? 260 ASN A HD22 2  
ATOM   3810  N  N    . ASN A 1 107 ? 18.298  -5.211  13.693  1.00 0.00 ? 261 ASN A N    2  
ATOM   3811  C  CA   . ASN A 1 107 ? 17.157  -5.874  14.412  1.00 0.00 ? 261 ASN A CA   2  
ATOM   3812  C  C    . ASN A 1 107 ? 16.025  -4.869  14.727  1.00 0.00 ? 261 ASN A C    2  
ATOM   3813  O  O    . ASN A 1 107 ? 15.321  -5.020  15.706  1.00 0.00 ? 261 ASN A O    2  
ATOM   3814  C  CB   . ASN A 1 107 ? 17.763  -6.416  15.709  1.00 0.00 ? 261 ASN A CB   2  
ATOM   3815  C  CG   . ASN A 1 107 ? 17.010  -7.682  16.136  1.00 0.00 ? 261 ASN A CG   2  
ATOM   3816  O  OD1  . ASN A 1 107 ? 16.401  -7.709  17.188  1.00 0.00 ? 261 ASN A OD1  2  
ATOM   3817  N  ND2  . ASN A 1 107 ? 17.020  -8.742  15.364  1.00 0.00 ? 261 ASN A ND2  2  
ATOM   3818  H  H    . ASN A 1 107 ? 18.641  -5.609  12.858  1.00 0.00 ? 261 ASN A H    2  
ATOM   3819  H  HA   . ASN A 1 107 ? 16.774  -6.692  13.822  1.00 0.00 ? 261 ASN A HA   2  
ATOM   3820  H  HB2  . ASN A 1 107 ? 18.805  -6.653  15.548  1.00 0.00 ? 261 ASN A HB2  2  
ATOM   3821  H  HB3  . ASN A 1 107 ? 17.678  -5.671  16.485  1.00 0.00 ? 261 ASN A HB3  2  
ATOM   3822  H  HD21 . ASN A 1 107 ? 17.508  -8.731  14.512  1.00 0.00 ? 261 ASN A HD21 2  
ATOM   3823  H  HD22 . ASN A 1 107 ? 16.538  -9.549  15.639  1.00 0.00 ? 261 ASN A HD22 2  
ATOM   3824  N  N    . GLN A 1 108 ? 15.838  -3.852  13.906  1.00 0.00 ? 262 GLN A N    2  
ATOM   3825  C  CA   . GLN A 1 108 ? 14.744  -2.860  14.171  1.00 0.00 ? 262 GLN A CA   2  
ATOM   3826  C  C    . GLN A 1 108 ? 14.326  -2.175  12.859  1.00 0.00 ? 262 GLN A C    2  
ATOM   3827  O  O    . GLN A 1 108 ? 14.959  -1.232  12.423  1.00 0.00 ? 262 GLN A O    2  
ATOM   3828  C  CB   . GLN A 1 108 ? 15.349  -1.835  15.134  1.00 0.00 ? 262 GLN A CB   2  
ATOM   3829  C  CG   . GLN A 1 108 ? 14.993  -2.208  16.579  1.00 0.00 ? 262 GLN A CG   2  
ATOM   3830  C  CD   . GLN A 1 108 ? 16.211  -2.839  17.267  1.00 0.00 ? 262 GLN A CD   2  
ATOM   3831  O  OE1  . GLN A 1 108 ? 16.122  -3.930  17.796  1.00 0.00 ? 262 GLN A OE1  2  
ATOM   3832  N  NE2  . GLN A 1 108 ? 17.355  -2.199  17.289  1.00 0.00 ? 262 GLN A NE2  2  
ATOM   3833  H  H    . GLN A 1 108 ? 16.409  -3.742  13.113  1.00 0.00 ? 262 GLN A H    2  
ATOM   3834  H  HA   . GLN A 1 108 ? 13.898  -3.345  14.630  1.00 0.00 ? 262 GLN A HA   2  
ATOM   3835  H  HB2  . GLN A 1 108 ? 16.423  -1.822  15.016  1.00 0.00 ? 262 GLN A HB2  2  
ATOM   3836  H  HB3  . GLN A 1 108 ? 14.950  -0.857  14.911  1.00 0.00 ? 262 GLN A HB3  2  
ATOM   3837  H  HG2  . GLN A 1 108 ? 14.699  -1.318  17.116  1.00 0.00 ? 262 GLN A HG2  2  
ATOM   3838  H  HG3  . GLN A 1 108 ? 14.176  -2.914  16.582  1.00 0.00 ? 262 GLN A HG3  2  
ATOM   3839  H  HE21 . GLN A 1 108 ? 17.439  -1.316  16.868  1.00 0.00 ? 262 GLN A HE21 2  
ATOM   3840  H  HE22 . GLN A 1 108 ? 18.132  -2.604  17.729  1.00 0.00 ? 262 GLN A HE22 2  
ATOM   3841  N  N    . TRP A 1 109 ? 13.284  -2.656  12.213  1.00 0.00 ? 263 TRP A N    2  
ATOM   3842  C  CA   . TRP A 1 109 ? 12.861  -2.039  10.921  1.00 0.00 ? 263 TRP A CA   2  
ATOM   3843  C  C    . TRP A 1 109 ? 11.534  -1.270  11.066  1.00 0.00 ? 263 TRP A C    2  
ATOM   3844  O  O    . TRP A 1 109 ? 10.581  -1.766  11.636  1.00 0.00 ? 263 TRP A O    2  
ATOM   3845  C  CB   . TRP A 1 109 ? 12.690  -3.231  9.963   1.00 0.00 ? 263 TRP A CB   2  
ATOM   3846  C  CG   . TRP A 1 109 ? 12.105  -2.775  8.656   1.00 0.00 ? 263 TRP A CG   2  
ATOM   3847  C  CD1  . TRP A 1 109 ? 12.687  -1.903  7.803   1.00 0.00 ? 263 TRP A CD1  2  
ATOM   3848  C  CD2  . TRP A 1 109 ? 10.836  -3.153  8.048   1.00 0.00 ? 263 TRP A CD2  2  
ATOM   3849  N  NE1  . TRP A 1 109 ? 11.852  -1.713  6.716   1.00 0.00 ? 263 TRP A NE1  2  
ATOM   3850  C  CE2  . TRP A 1 109 ? 10.698  -2.462  6.822   1.00 0.00 ? 263 TRP A CE2  2  
ATOM   3851  C  CE3  . TRP A 1 109 ? 9.802   -4.019  8.443   1.00 0.00 ? 263 TRP A CE3  2  
ATOM   3852  C  CZ2  . TRP A 1 109 ? 9.571   -2.624  6.013   1.00 0.00 ? 263 TRP A CZ2  2  
ATOM   3853  C  CZ3  . TRP A 1 109 ? 8.666   -4.186  7.631   1.00 0.00 ? 263 TRP A CZ3  2  
ATOM   3854  C  CH2  . TRP A 1 109 ? 8.551   -3.488  6.419   1.00 0.00 ? 263 TRP A CH2  2  
ATOM   3855  H  H    . TRP A 1 109 ? 12.793  -3.431  12.566  1.00 0.00 ? 263 TRP A H    2  
ATOM   3856  H  HA   . TRP A 1 109 ? 13.633  -1.384  10.549  1.00 0.00 ? 263 TRP A HA   2  
ATOM   3857  H  HB2  . TRP A 1 109 ? 13.650  -3.687  9.791   1.00 0.00 ? 263 TRP A HB2  2  
ATOM   3858  H  HB3  . TRP A 1 109 ? 12.029  -3.956  10.414  1.00 0.00 ? 263 TRP A HB3  2  
ATOM   3859  H  HD1  . TRP A 1 109 ? 13.644  -1.431  7.946   1.00 0.00 ? 263 TRP A HD1  2  
ATOM   3860  H  HE1  . TRP A 1 109 ? 12.038  -1.123  5.956   1.00 0.00 ? 263 TRP A HE1  2  
ATOM   3861  H  HE3  . TRP A 1 109 ? 9.884   -4.563  9.373   1.00 0.00 ? 263 TRP A HE3  2  
ATOM   3862  H  HZ2  . TRP A 1 109 ? 9.488   -2.084  5.081   1.00 0.00 ? 263 TRP A HZ2  2  
ATOM   3863  H  HZ3  . TRP A 1 109 ? 7.876   -4.853  7.943   1.00 0.00 ? 263 TRP A HZ3  2  
ATOM   3864  H  HH2  . TRP A 1 109 ? 7.675   -3.618  5.799   1.00 0.00 ? 263 TRP A HH2  2  
ATOM   3865  N  N    . TYR A 1 110 ? 11.452  -0.087  10.490  1.00 0.00 ? 264 TYR A N    2  
ATOM   3866  C  CA   . TYR A 1 110 ? 10.167  0.675   10.527  1.00 0.00 ? 264 TYR A CA   2  
ATOM   3867  C  C    . TYR A 1 110 ? 9.446   0.380   9.211   1.00 0.00 ? 264 TYR A C    2  
ATOM   3868  O  O    . TYR A 1 110 ? 10.088  0.237   8.186   1.00 0.00 ? 264 TYR A O    2  
ATOM   3869  C  CB   . TYR A 1 110 ? 10.537  2.159   10.641  1.00 0.00 ? 264 TYR A CB   2  
ATOM   3870  C  CG   . TYR A 1 110 ? 10.445  2.577   12.088  1.00 0.00 ? 264 TYR A CG   2  
ATOM   3871  C  CD1  . TYR A 1 110 ? 9.206   2.929   12.637  1.00 0.00 ? 264 TYR A CD1  2  
ATOM   3872  C  CD2  . TYR A 1 110 ? 11.596  2.606   12.883  1.00 0.00 ? 264 TYR A CD2  2  
ATOM   3873  C  CE1  . TYR A 1 110 ? 9.119   3.310   13.980  1.00 0.00 ? 264 TYR A CE1  2  
ATOM   3874  C  CE2  . TYR A 1 110 ? 11.509  2.987   14.226  1.00 0.00 ? 264 TYR A CE2  2  
ATOM   3875  C  CZ   . TYR A 1 110 ? 10.271  3.339   14.776  1.00 0.00 ? 264 TYR A CZ   2  
ATOM   3876  O  OH   . TYR A 1 110 ? 10.184  3.715   16.101  1.00 0.00 ? 264 TYR A OH   2  
ATOM   3877  H  H    . TYR A 1 110 ? 12.220  0.273   9.986   1.00 0.00 ? 264 TYR A H    2  
ATOM   3878  H  HA   . TYR A 1 110 ? 9.564   0.369   11.368  1.00 0.00 ? 264 TYR A HA   2  
ATOM   3879  H  HB2  . TYR A 1 110 ? 11.546  2.311   10.284  1.00 0.00 ? 264 TYR A HB2  2  
ATOM   3880  H  HB3  . TYR A 1 110 ? 9.852   2.750   10.052  1.00 0.00 ? 264 TYR A HB3  2  
ATOM   3881  H  HD1  . TYR A 1 110 ? 8.317   2.905   12.023  1.00 0.00 ? 264 TYR A HD1  2  
ATOM   3882  H  HD2  . TYR A 1 110 ? 12.552  2.335   12.459  1.00 0.00 ? 264 TYR A HD2  2  
ATOM   3883  H  HE1  . TYR A 1 110 ? 8.162   3.582   14.402  1.00 0.00 ? 264 TYR A HE1  2  
ATOM   3884  H  HE2  . TYR A 1 110 ? 12.397  3.004   14.840  1.00 0.00 ? 264 TYR A HE2  2  
ATOM   3885  H  HH   . TYR A 1 110 ? 9.965   2.935   16.616  1.00 0.00 ? 264 TYR A HH   2  
ATOM   3886  N  N    . CYS A 1 111 ? 8.140   0.240   9.217   1.00 0.00 ? 265 CYS A N    2  
ATOM   3887  C  CA   . CYS A 1 111 ? 7.439   -0.102  7.945   1.00 0.00 ? 265 CYS A CA   2  
ATOM   3888  C  C    . CYS A 1 111 ? 6.341   0.937   7.606   1.00 0.00 ? 265 CYS A C    2  
ATOM   3889  O  O    . CYS A 1 111 ? 6.484   2.106   7.915   1.00 0.00 ? 265 CYS A O    2  
ATOM   3890  C  CB   . CYS A 1 111 ? 6.901   -1.527  8.196   1.00 0.00 ? 265 CYS A CB   2  
ATOM   3891  S  SG   . CYS A 1 111 ? 5.463   -1.505  9.299   1.00 0.00 ? 265 CYS A SG   2  
ATOM   3892  H  H    . CYS A 1 111 ? 7.630   0.326   10.051  1.00 0.00 ? 265 CYS A H    2  
ATOM   3893  H  HA   . CYS A 1 111 ? 8.156   -0.134  7.139   1.00 0.00 ? 265 CYS A HA   2  
ATOM   3894  H  HB2  . CYS A 1 111 ? 6.614   -1.968  7.254   1.00 0.00 ? 265 CYS A HB2  2  
ATOM   3895  H  HB3  . CYS A 1 111 ? 7.683   -2.125  8.642   1.00 0.00 ? 265 CYS A HB3  2  
ATOM   3896  N  N    . TYR A 1 112 ? 5.261   0.536   6.956   1.00 0.00 ? 266 TYR A N    2  
ATOM   3897  C  CA   . TYR A 1 112 ? 4.191   1.529   6.592   1.00 0.00 ? 266 TYR A CA   2  
ATOM   3898  C  C    . TYR A 1 112 ? 3.127   1.608   7.706   1.00 0.00 ? 266 TYR A C    2  
ATOM   3899  O  O    . TYR A 1 112 ? 2.625   2.675   8.006   1.00 0.00 ? 266 TYR A O    2  
ATOM   3900  C  CB   . TYR A 1 112 ? 3.568   1.021   5.272   1.00 0.00 ? 266 TYR A CB   2  
ATOM   3901  C  CG   . TYR A 1 112 ? 4.653   0.789   4.236   1.00 0.00 ? 266 TYR A CG   2  
ATOM   3902  C  CD1  . TYR A 1 112 ? 5.098   1.846   3.436   1.00 0.00 ? 266 TYR A CD1  2  
ATOM   3903  C  CD2  . TYR A 1 112 ? 5.214   -0.487  4.082   1.00 0.00 ? 266 TYR A CD2  2  
ATOM   3904  C  CE1  . TYR A 1 112 ? 6.103   1.631   2.484   1.00 0.00 ? 266 TYR A CE1  2  
ATOM   3905  C  CE2  . TYR A 1 112 ? 6.219   -0.702  3.133   1.00 0.00 ? 266 TYR A CE2  2  
ATOM   3906  C  CZ   . TYR A 1 112 ? 6.664   0.357   2.333   1.00 0.00 ? 266 TYR A CZ   2  
ATOM   3907  O  OH   . TYR A 1 112 ? 7.654   0.145   1.395   1.00 0.00 ? 266 TYR A OH   2  
ATOM   3908  H  H    . TYR A 1 112 ? 5.159   -0.405  6.700   1.00 0.00 ? 266 TYR A H    2  
ATOM   3909  H  HA   . TYR A 1 112 ? 4.631   2.501   6.434   1.00 0.00 ? 266 TYR A HA   2  
ATOM   3910  H  HB2  . TYR A 1 112 ? 3.048   0.094   5.457   1.00 0.00 ? 266 TYR A HB2  2  
ATOM   3911  H  HB3  . TYR A 1 112 ? 2.870   1.757   4.900   1.00 0.00 ? 266 TYR A HB3  2  
ATOM   3912  H  HD1  . TYR A 1 112 ? 4.667   2.827   3.553   1.00 0.00 ? 266 TYR A HD1  2  
ATOM   3913  H  HD2  . TYR A 1 112 ? 4.872   -1.304  4.700   1.00 0.00 ? 266 TYR A HD2  2  
ATOM   3914  H  HE1  . TYR A 1 112 ? 6.445   2.448   1.867   1.00 0.00 ? 266 TYR A HE1  2  
ATOM   3915  H  HE2  . TYR A 1 112 ? 6.653   -1.686  3.019   1.00 0.00 ? 266 TYR A HE2  2  
ATOM   3916  H  HH   . TYR A 1 112 ? 7.241   -0.207  0.602   1.00 0.00 ? 266 TYR A HH   2  
ATOM   3917  N  N    . ILE A 1 113 ? 2.784   0.496   8.329   1.00 0.00 ? 267 ILE A N    2  
ATOM   3918  C  CA   . ILE A 1 113 ? 1.753   0.543   9.433   1.00 0.00 ? 267 ILE A CA   2  
ATOM   3919  C  C    . ILE A 1 113 ? 2.281   1.396   10.602  1.00 0.00 ? 267 ILE A C    2  
ATOM   3920  O  O    . ILE A 1 113 ? 1.555   2.176   11.187  1.00 0.00 ? 267 ILE A O    2  
ATOM   3921  C  CB   . ILE A 1 113 ? 1.521   -0.910  9.918   1.00 0.00 ? 267 ILE A CB   2  
ATOM   3922  C  CG1  . ILE A 1 113 ? 1.075   -1.823  8.756   1.00 0.00 ? 267 ILE A CG1  2  
ATOM   3923  C  CG2  . ILE A 1 113 ? 0.429   -0.912  10.988  1.00 0.00 ? 267 ILE A CG2  2  
ATOM   3924  C  CD1  . ILE A 1 113 ? -0.176  -1.258  8.074   1.00 0.00 ? 267 ILE A CD1  2  
ATOM   3925  H  H    . ILE A 1 113 ? 3.206   -0.351  8.076   1.00 0.00 ? 267 ILE A H    2  
ATOM   3926  H  HA   . ILE A 1 113 ? 0.833   0.958   9.062   1.00 0.00 ? 267 ILE A HA   2  
ATOM   3927  H  HB   . ILE A 1 113 ? 2.442   -1.294  10.350  1.00 0.00 ? 267 ILE A HB   2  
ATOM   3928  H  HG12 . ILE A 1 113 ? 1.867   -1.909  8.031   1.00 0.00 ? 267 ILE A HG12 2  
ATOM   3929  H  HG13 . ILE A 1 113 ? 0.849   -2.803  9.147   1.00 0.00 ? 267 ILE A HG13 2  
ATOM   3930  H  HG21 . ILE A 1 113 ? 0.136   -1.931  11.202  1.00 0.00 ? 267 ILE A HG21 2  
ATOM   3931  H  HG22 . ILE A 1 113 ? -0.426  -0.359  10.631  1.00 0.00 ? 267 ILE A HG22 2  
ATOM   3932  H  HG23 . ILE A 1 113 ? 0.806   -0.450  11.889  1.00 0.00 ? 267 ILE A HG23 2  
ATOM   3933  H  HD11 . ILE A 1 113 ? -0.944  -2.017  8.048   1.00 0.00 ? 267 ILE A HD11 2  
ATOM   3934  H  HD12 . ILE A 1 113 ? 0.070   -0.963  7.065   1.00 0.00 ? 267 ILE A HD12 2  
ATOM   3935  H  HD13 . ILE A 1 113 ? -0.536  -0.401  8.624   1.00 0.00 ? 267 ILE A HD13 2  
ATOM   3936  N  N    . CYS A 1 114 ? 3.541   1.244   10.947  1.00 0.00 ? 268 CYS A N    2  
ATOM   3937  C  CA   . CYS A 1 114 ? 4.128   2.037   12.085  1.00 0.00 ? 268 CYS A CA   2  
ATOM   3938  C  C    . CYS A 1 114 ? 3.935   3.540   11.839  1.00 0.00 ? 268 CYS A C    2  
ATOM   3939  O  O    . CYS A 1 114 ? 3.467   4.259   12.703  1.00 0.00 ? 268 CYS A O    2  
ATOM   3940  C  CB   . CYS A 1 114 ? 5.628   1.702   12.106  1.00 0.00 ? 268 CYS A CB   2  
ATOM   3941  S  SG   . CYS A 1 114 ? 5.879   0.084   12.876  1.00 0.00 ? 268 CYS A SG   2  
ATOM   3942  H  H    . CYS A 1 114 ? 4.098   0.608   10.460  1.00 0.00 ? 268 CYS A H    2  
ATOM   3943  H  HA   . CYS A 1 114 ? 3.673   1.748   13.019  1.00 0.00 ? 268 CYS A HA   2  
ATOM   3944  H  HB2  . CYS A 1 114 ? 6.006   1.681   11.095  1.00 0.00 ? 268 CYS A HB2  2  
ATOM   3945  H  HB3  . CYS A 1 114 ? 6.156   2.454   12.671  1.00 0.00 ? 268 CYS A HB3  2  
ATOM   3946  N  N    . HIS A 1 115 ? 4.286   4.022   10.665  1.00 0.00 ? 269 HIS A N    2  
ATOM   3947  C  CA   . HIS A 1 115 ? 4.116   5.483   10.363  1.00 0.00 ? 269 HIS A CA   2  
ATOM   3948  C  C    . HIS A 1 115 ? 4.472   5.788   8.898   1.00 0.00 ? 269 HIS A C    2  
ATOM   3949  O  O    . HIS A 1 115 ? 5.139   5.002   8.254   1.00 0.00 ? 269 HIS A O    2  
ATOM   3950  C  CB   . HIS A 1 115 ? 5.057   6.232   11.323  1.00 0.00 ? 269 HIS A CB   2  
ATOM   3951  C  CG   . HIS A 1 115 ? 6.485   5.753   11.195  1.00 0.00 ? 269 HIS A CG   2  
ATOM   3952  N  ND1  . HIS A 1 115 ? 7.502   6.313   11.955  1.00 0.00 ? 269 HIS A ND1  2  
ATOM   3953  C  CD2  . HIS A 1 115 ? 7.093   4.789   10.419  1.00 0.00 ? 269 HIS A CD2  2  
ATOM   3954  C  CE1  . HIS A 1 115 ? 8.649   5.693   11.626  1.00 0.00 ? 269 HIS A CE1  2  
ATOM   3955  N  NE2  . HIS A 1 115 ? 8.456   4.757   10.695  1.00 0.00 ? 269 HIS A NE2  2  
ATOM   3956  H  H    . HIS A 1 115 ? 4.653   3.419   9.976   1.00 0.00 ? 269 HIS A H    2  
ATOM   3957  H  HA   . HIS A 1 115 ? 3.096   5.778   10.558  1.00 0.00 ? 269 HIS A HA   2  
ATOM   3958  H  HB2  . HIS A 1 115 ? 5.021   7.287   11.101  1.00 0.00 ? 269 HIS A HB2  2  
ATOM   3959  H  HB3  . HIS A 1 115 ? 4.721   6.077   12.338  1.00 0.00 ? 269 HIS A HB3  2  
ATOM   3960  H  HD1  . HIS A 1 115 ? 7.404   7.032   12.612  1.00 0.00 ? 269 HIS A HD1  2  
ATOM   3961  H  HD2  . HIS A 1 115 ? 6.596   4.149   9.711   1.00 0.00 ? 269 HIS A HD2  2  
ATOM   3962  H  HE1  . HIS A 1 115 ? 9.608   5.920   12.066  1.00 0.00 ? 269 HIS A HE1  2  
ATOM   3963  N  N    . PRO A 1 116 ? 4.013   6.919   8.406   1.00 0.00 ? 270 PRO A N    2  
ATOM   3964  C  CA   . PRO A 1 116 ? 4.301   7.292   7.000   1.00 0.00 ? 270 PRO A CA   2  
ATOM   3965  C  C    . PRO A 1 116 ? 5.793   7.609   6.827   1.00 0.00 ? 270 PRO A C    2  
ATOM   3966  O  O    . PRO A 1 116 ? 6.174   8.756   6.696   1.00 0.00 ? 270 PRO A O    2  
ATOM   3967  C  CB   . PRO A 1 116 ? 3.440   8.534   6.770   1.00 0.00 ? 270 PRO A CB   2  
ATOM   3968  C  CG   . PRO A 1 116 ? 3.227   9.107   8.132   1.00 0.00 ? 270 PRO A CG   2  
ATOM   3969  C  CD   . PRO A 1 116 ? 3.202   7.945   9.087   1.00 0.00 ? 270 PRO A CD   2  
ATOM   3970  H  HA   . PRO A 1 116 ? 3.999   6.505   6.330   1.00 0.00 ? 270 PRO A HA   2  
ATOM   3971  H  HB2  . PRO A 1 116 ? 3.962   9.239   6.138   1.00 0.00 ? 270 PRO A HB2  2  
ATOM   3972  H  HB3  . PRO A 1 116 ? 2.493   8.261   6.331   1.00 0.00 ? 270 PRO A HB3  2  
ATOM   3973  H  HG2  . PRO A 1 116 ? 4.037   9.778   8.381   1.00 0.00 ? 270 PRO A HG2  2  
ATOM   3974  H  HG3  . PRO A 1 116 ? 2.285   9.632   8.172   1.00 0.00 ? 270 PRO A HG3  2  
ATOM   3975  H  HD2  . PRO A 1 116 ? 3.646   8.222   10.032  1.00 0.00 ? 270 PRO A HD2  2  
ATOM   3976  H  HD3  . PRO A 1 116 ? 2.193   7.589   9.228   1.00 0.00 ? 270 PRO A HD3  2  
ATOM   3977  N  N    . GLU A 1 117 ? 6.645   6.601   6.828   1.00 0.00 ? 271 GLU A N    2  
ATOM   3978  C  CA   . GLU A 1 117 ? 8.107   6.866   6.662   1.00 0.00 ? 271 GLU A CA   2  
ATOM   3979  C  C    . GLU A 1 117 ? 8.578   6.485   5.245   1.00 0.00 ? 271 GLU A C    2  
ATOM   3980  O  O    . GLU A 1 117 ? 9.066   7.343   4.533   1.00 0.00 ? 271 GLU A O    2  
ATOM   3981  C  CB   . GLU A 1 117 ? 8.819   6.035   7.742   1.00 0.00 ? 271 GLU A CB   2  
ATOM   3982  C  CG   . GLU A 1 117 ? 9.399   6.962   8.815   1.00 0.00 ? 271 GLU A CG   2  
ATOM   3983  C  CD   . GLU A 1 117 ? 10.642  6.317   9.434   1.00 0.00 ? 271 GLU A CD   2  
ATOM   3984  O  OE1  . GLU A 1 117 ? 10.672  5.101   9.528   1.00 0.00 ? 271 GLU A OE1  2  
ATOM   3985  O  OE2  . GLU A 1 117 ? 11.543  7.051   9.804   1.00 0.00 ? 271 GLU A OE2  2  
ATOM   3986  H  H    . GLU A 1 117 ? 6.324   5.681   6.937   1.00 0.00 ? 271 GLU A H    2  
ATOM   3987  H  HA   . GLU A 1 117 ? 8.300   7.915   6.830   1.00 0.00 ? 271 GLU A HA   2  
ATOM   3988  H  HB2  . GLU A 1 117 ? 8.112   5.356   8.198   1.00 0.00 ? 271 GLU A HB2  2  
ATOM   3989  H  HB3  . GLU A 1 117 ? 9.619   5.469   7.290   1.00 0.00 ? 271 GLU A HB3  2  
ATOM   3990  H  HG2  . GLU A 1 117 ? 9.669   7.907   8.366   1.00 0.00 ? 271 GLU A HG2  2  
ATOM   3991  H  HG3  . GLU A 1 117 ? 8.661   7.127   9.585   1.00 0.00 ? 271 GLU A HG3  2  
ATOM   3992  N  N    . PRO A 1 118 ? 8.431   5.227   4.850   1.00 0.00 ? 272 PRO A N    2  
ATOM   3993  C  CA   . PRO A 1 118 ? 8.869   4.825   3.492   1.00 0.00 ? 272 PRO A CA   2  
ATOM   3994  C  C    . PRO A 1 118 ? 7.754   4.966   2.428   1.00 0.00 ? 272 PRO A C    2  
ATOM   3995  O  O    . PRO A 1 118 ? 7.751   4.229   1.457   1.00 0.00 ? 272 PRO A O    2  
ATOM   3996  C  CB   . PRO A 1 118 ? 9.221   3.352   3.666   1.00 0.00 ? 272 PRO A CB   2  
ATOM   3997  C  CG   . PRO A 1 118 ? 8.400   2.871   4.827   1.00 0.00 ? 272 PRO A CG   2  
ATOM   3998  C  CD   . PRO A 1 118 ? 7.890   4.075   5.587   1.00 0.00 ? 272 PRO A CD   2  
ATOM   3999  H  HA   . PRO A 1 118 ? 9.744   5.375   3.202   1.00 0.00 ? 272 PRO A HA   2  
ATOM   4000  H  HB2  . PRO A 1 118 ? 8.966   2.802   2.771   1.00 0.00 ? 272 PRO A HB2  2  
ATOM   4001  H  HB3  . PRO A 1 118 ? 10.271  3.243   3.888   1.00 0.00 ? 272 PRO A HB3  2  
ATOM   4002  H  HG2  . PRO A 1 118 ? 7.565   2.287   4.465   1.00 0.00 ? 272 PRO A HG2  2  
ATOM   4003  H  HG3  . PRO A 1 118 ? 9.011   2.266   5.479   1.00 0.00 ? 272 PRO A HG3  2  
ATOM   4004  H  HD2  . PRO A 1 118 ? 6.811   4.088   5.585   1.00 0.00 ? 272 PRO A HD2  2  
ATOM   4005  H  HD3  . PRO A 1 118 ? 8.265   4.055   6.591   1.00 0.00 ? 272 PRO A HD3  2  
ATOM   4006  N  N    . LEU A 1 119 ? 6.819   5.888   2.572   1.00 0.00 ? 273 LEU A N    2  
ATOM   4007  C  CA   . LEU A 1 119 ? 5.749   6.024   1.526   1.00 0.00 ? 273 LEU A CA   2  
ATOM   4008  C  C    . LEU A 1 119 ? 5.133   7.440   1.528   1.00 0.00 ? 273 LEU A C    2  
ATOM   4009  O  O    . LEU A 1 119 ? 3.951   7.596   1.280   1.00 0.00 ? 273 LEU A O    2  
ATOM   4010  C  CB   . LEU A 1 119 ? 4.696   4.942   1.859   1.00 0.00 ? 273 LEU A CB   2  
ATOM   4011  C  CG   . LEU A 1 119 ? 3.872   5.307   3.109   1.00 0.00 ? 273 LEU A CG   2  
ATOM   4012  C  CD1  . LEU A 1 119 ? 2.675   4.358   3.220   1.00 0.00 ? 273 LEU A CD1  2  
ATOM   4013  C  CD2  . LEU A 1 119 ? 4.744   5.173   4.358   1.00 0.00 ? 273 LEU A CD2  2  
ATOM   4014  H  H    . LEU A 1 119 ? 6.823   6.484   3.344   1.00 0.00 ? 273 LEU A H    2  
ATOM   4015  H  HA   . LEU A 1 119 ? 6.170   5.819   0.555   1.00 0.00 ? 273 LEU A HA   2  
ATOM   4016  H  HB2  . LEU A 1 119 ? 4.027   4.834   1.019   1.00 0.00 ? 273 LEU A HB2  2  
ATOM   4017  H  HB3  . LEU A 1 119 ? 5.201   4.003   2.031   1.00 0.00 ? 273 LEU A HB3  2  
ATOM   4018  H  HG   . LEU A 1 119 ? 3.513   6.321   3.027   1.00 0.00 ? 273 LEU A HG   2  
ATOM   4019  H  HD11 . LEU A 1 119 ? 2.420   4.221   4.261   1.00 0.00 ? 273 LEU A HD11 2  
ATOM   4020  H  HD12 . LEU A 1 119 ? 2.929   3.403   2.785   1.00 0.00 ? 273 LEU A HD12 2  
ATOM   4021  H  HD13 . LEU A 1 119 ? 1.831   4.780   2.695   1.00 0.00 ? 273 LEU A HD13 2  
ATOM   4022  H  HD21 . LEU A 1 119 ? 5.127   6.145   4.634   1.00 0.00 ? 273 LEU A HD21 2  
ATOM   4023  H  HD22 . LEU A 1 119 ? 5.569   4.510   4.149   1.00 0.00 ? 273 LEU A HD22 2  
ATOM   4024  H  HD23 . LEU A 1 119 ? 4.157   4.773   5.172   1.00 0.00 ? 273 LEU A HD23 2  
ATOM   4025  N  N    . LEU A 1 120 ? 5.916   8.472   1.783   1.00 0.00 ? 274 LEU A N    2  
ATOM   4026  C  CA   . LEU A 1 120 ? 5.326   9.860   1.773   1.00 0.00 ? 274 LEU A CA   2  
ATOM   4027  C  C    . LEU A 1 120 ? 4.809   10.173  0.365   1.00 0.00 ? 274 LEU A C    2  
ATOM   4028  O  O    . LEU A 1 120 ? 3.657   10.517  0.190   1.00 0.00 ? 274 LEU A O    2  
ATOM   4029  C  CB   . LEU A 1 120 ? 6.442   10.855  2.172   1.00 0.00 ? 274 LEU A CB   2  
ATOM   4030  C  CG   . LEU A 1 120 ? 6.081   11.551  3.494   1.00 0.00 ? 274 LEU A CG   2  
ATOM   4031  C  CD1  . LEU A 1 120 ? 4.758   12.311  3.342   1.00 0.00 ? 274 LEU A CD1  2  
ATOM   4032  C  CD2  . LEU A 1 120 ? 5.944   10.506  4.605   1.00 0.00 ? 274 LEU A CD2  2  
ATOM   4033  H  H    . LEU A 1 120 ? 6.871   8.331   1.965   1.00 0.00 ? 274 LEU A H    2  
ATOM   4034  H  HA   . LEU A 1 120 ? 4.515   9.916   2.476   1.00 0.00 ? 274 LEU A HA   2  
ATOM   4035  H  HB2  . LEU A 1 120 ? 7.377   10.330  2.291   1.00 0.00 ? 274 LEU A HB2  2  
ATOM   4036  H  HB3  . LEU A 1 120 ? 6.551   11.601  1.399   1.00 0.00 ? 274 LEU A HB3  2  
ATOM   4037  H  HG   . LEU A 1 120 ? 6.864   12.250  3.752   1.00 0.00 ? 274 LEU A HG   2  
ATOM   4038  H  HD11 . LEU A 1 120 ? 3.936   11.657  3.597   1.00 0.00 ? 274 LEU A HD11 2  
ATOM   4039  H  HD12 . LEU A 1 120 ? 4.648   12.644  2.320   1.00 0.00 ? 274 LEU A HD12 2  
ATOM   4040  H  HD13 . LEU A 1 120 ? 4.755   13.166  4.001   1.00 0.00 ? 274 LEU A HD13 2  
ATOM   4041  H  HD21 . LEU A 1 120 ? 6.164   10.963  5.559   1.00 0.00 ? 274 LEU A HD21 2  
ATOM   4042  H  HD22 . LEU A 1 120 ? 6.637   9.696   4.425   1.00 0.00 ? 274 LEU A HD22 2  
ATOM   4043  H  HD23 . LEU A 1 120 ? 4.935   10.120  4.614   1.00 0.00 ? 274 LEU A HD23 2  
ATOM   4044  N  N    . ASP A 1 121 ? 5.644   10.033  -0.644  1.00 0.00 ? 275 ASP A N    2  
ATOM   4045  C  CA   . ASP A 1 121 ? 5.170   10.309  -2.052  1.00 0.00 ? 275 ASP A CA   2  
ATOM   4046  C  C    . ASP A 1 121 ? 3.942   9.436   -2.367  1.00 0.00 ? 275 ASP A C    2  
ATOM   4047  O  O    . ASP A 1 121 ? 3.005   9.882   -3.003  1.00 0.00 ? 275 ASP A O    2  
ATOM   4048  C  CB   . ASP A 1 121 ? 6.332   9.946   -2.991  1.00 0.00 ? 275 ASP A CB   2  
ATOM   4049  C  CG   . ASP A 1 121 ? 7.490   10.921  -2.771  1.00 0.00 ? 275 ASP A CG   2  
ATOM   4050  O  OD1  . ASP A 1 121 ? 8.229   10.729  -1.820  1.00 0.00 ? 275 ASP A OD1  2  
ATOM   4051  O  OD2  . ASP A 1 121 ? 7.617   11.846  -3.559  1.00 0.00 ? 275 ASP A OD2  2  
ATOM   4052  H  H    . ASP A 1 121 ? 6.569   9.734   -0.473  1.00 0.00 ? 275 ASP A H    2  
ATOM   4053  H  HA   . ASP A 1 121 ? 4.921   11.350  -2.161  1.00 0.00 ? 275 ASP A HA   2  
ATOM   4054  H  HB2  . ASP A 1 121 ? 6.663   8.939   -2.780  1.00 0.00 ? 275 ASP A HB2  2  
ATOM   4055  H  HB3  . ASP A 1 121 ? 6.000   10.009  -4.016  1.00 0.00 ? 275 ASP A HB3  2  
ATOM   4056  N  N    . LEU A 1 122 ? 3.936   8.200   -1.913  1.00 0.00 ? 276 LEU A N    2  
ATOM   4057  C  CA   . LEU A 1 122 ? 2.752   7.306   -2.179  1.00 0.00 ? 276 LEU A CA   2  
ATOM   4058  C  C    . LEU A 1 122 ? 1.507   7.873   -1.484  1.00 0.00 ? 276 LEU A C    2  
ATOM   4059  O  O    . LEU A 1 122 ? 0.425   7.866   -2.043  1.00 0.00 ? 276 LEU A O    2  
ATOM   4060  C  CB   . LEU A 1 122 ? 3.113   5.930   -1.589  1.00 0.00 ? 276 LEU A CB   2  
ATOM   4061  C  CG   . LEU A 1 122 ? 2.329   4.826   -2.298  1.00 0.00 ? 276 LEU A CG   2  
ATOM   4062  C  CD1  . LEU A 1 122 ? 2.874   4.637   -3.715  1.00 0.00 ? 276 LEU A CD1  2  
ATOM   4063  C  CD2  . LEU A 1 122 ? 2.488   3.520   -1.514  1.00 0.00 ? 276 LEU A CD2  2  
ATOM   4064  H  H    . LEU A 1 122 ? 4.704   7.866   -1.393  1.00 0.00 ? 276 LEU A H    2  
ATOM   4065  H  HA   . LEU A 1 122 ? 2.578   7.227   -3.236  1.00 0.00 ? 276 LEU A HA   2  
ATOM   4066  H  HB2  . LEU A 1 122 ? 4.171   5.755   -1.715  1.00 0.00 ? 276 LEU A HB2  2  
ATOM   4067  H  HB3  . LEU A 1 122 ? 2.871   5.921   -0.537  1.00 0.00 ? 276 LEU A HB3  2  
ATOM   4068  H  HG   . LEU A 1 122 ? 1.284   5.096   -2.344  1.00 0.00 ? 276 LEU A HG   2  
ATOM   4069  H  HD11 . LEU A 1 122 ? 3.315   5.561   -4.058  1.00 0.00 ? 276 LEU A HD11 2  
ATOM   4070  H  HD12 . LEU A 1 122 ? 2.067   4.356   -4.376  1.00 0.00 ? 276 LEU A HD12 2  
ATOM   4071  H  HD13 . LEU A 1 122 ? 3.624   3.859   -3.712  1.00 0.00 ? 276 LEU A HD13 2  
ATOM   4072  H  HD21 . LEU A 1 122 ? 3.341   2.973   -1.891  1.00 0.00 ? 276 LEU A HD21 2  
ATOM   4073  H  HD22 . LEU A 1 122 ? 1.600   2.920   -1.629  1.00 0.00 ? 276 LEU A HD22 2  
ATOM   4074  H  HD23 . LEU A 1 122 ? 2.638   3.742   -0.468  1.00 0.00 ? 276 LEU A HD23 2  
ATOM   4075  N  N    . VAL A 1 123 ? 1.648   8.373   -0.274  1.00 0.00 ? 277 VAL A N    2  
ATOM   4076  C  CA   . VAL A 1 123 ? 0.451   8.948   0.438   1.00 0.00 ? 277 VAL A CA   2  
ATOM   4077  C  C    . VAL A 1 123 ? 0.042   10.266  -0.237  1.00 0.00 ? 277 VAL A C    2  
ATOM   4078  O  O    . VAL A 1 123 ? -1.132  10.521  -0.438  1.00 0.00 ? 277 VAL A O    2  
ATOM   4079  C  CB   . VAL A 1 123 ? 0.881   9.178   1.900   1.00 0.00 ? 277 VAL A CB   2  
ATOM   4080  C  CG1  . VAL A 1 123 ? -0.251  9.862   2.681   1.00 0.00 ? 277 VAL A CG1  2  
ATOM   4081  C  CG2  . VAL A 1 123 ? 1.206   7.824   2.547   1.00 0.00 ? 277 VAL A CG2  2  
ATOM   4082  H  H    . VAL A 1 123 ? 2.534   8.375   0.156   1.00 0.00 ? 277 VAL A H    2  
ATOM   4083  H  HA   . VAL A 1 123 ? -0.367  8.250   0.402   1.00 0.00 ? 277 VAL A HA   2  
ATOM   4084  H  HB   . VAL A 1 123 ? 1.760   9.807   1.920   1.00 0.00 ? 277 VAL A HB   2  
ATOM   4085  H  HG11 . VAL A 1 123 ? -0.045  10.919  2.757   1.00 0.00 ? 277 VAL A HG11 2  
ATOM   4086  H  HG12 . VAL A 1 123 ? -0.316  9.437   3.672   1.00 0.00 ? 277 VAL A HG12 2  
ATOM   4087  H  HG13 . VAL A 1 123 ? -1.186  9.713   2.163   1.00 0.00 ? 277 VAL A HG13 2  
ATOM   4088  H  HG21 . VAL A 1 123 ? 1.387   7.088   1.777   1.00 0.00 ? 277 VAL A HG21 2  
ATOM   4089  H  HG22 . VAL A 1 123 ? 0.374   7.506   3.159   1.00 0.00 ? 277 VAL A HG22 2  
ATOM   4090  H  HG23 . VAL A 1 123 ? 2.088   7.924   3.163   1.00 0.00 ? 277 VAL A HG23 2  
ATOM   4091  N  N    . THR A 1 124 ? 0.995   11.097  -0.605  1.00 0.00 ? 278 THR A N    2  
ATOM   4092  C  CA   . THR A 1 124 ? 0.626   12.388  -1.287  1.00 0.00 ? 278 THR A CA   2  
ATOM   4093  C  C    . THR A 1 124 ? -0.083  12.080  -2.616  1.00 0.00 ? 278 THR A C    2  
ATOM   4094  O  O    . THR A 1 124 ? -1.020  12.762  -2.989  1.00 0.00 ? 278 THR A O    2  
ATOM   4095  C  CB   . THR A 1 124 ? 1.935   13.164  -1.540  1.00 0.00 ? 278 THR A CB   2  
ATOM   4096  O  OG1  . THR A 1 124 ? 2.999   12.545  -0.832  1.00 0.00 ? 278 THR A OG1  2  
ATOM   4097  C  CG2  . THR A 1 124 ? 1.779   14.611  -1.060  1.00 0.00 ? 278 THR A CG2  2  
ATOM   4098  H  H    . THR A 1 124 ? 1.939   10.864  -0.446  1.00 0.00 ? 278 THR A H    2  
ATOM   4099  H  HA   . THR A 1 124 ? -0.027  12.965  -0.648  1.00 0.00 ? 278 THR A HA   2  
ATOM   4100  H  HB   . THR A 1 124 ? 2.157   13.163  -2.596  1.00 0.00 ? 278 THR A HB   2  
ATOM   4101  H  HG1  . THR A 1 124 ? 3.825   12.915  -1.153  1.00 0.00 ? 278 THR A HG1  2  
ATOM   4102  H  HG21 . THR A 1 124 ? 2.206   14.710  -0.073  1.00 0.00 ? 278 THR A HG21 2  
ATOM   4103  H  HG22 . THR A 1 124 ? 0.731   14.869  -1.027  1.00 0.00 ? 278 THR A HG22 2  
ATOM   4104  H  HG23 . THR A 1 124 ? 2.291   15.274  -1.742  1.00 0.00 ? 278 THR A HG23 2  
ATOM   4105  N  N    . ALA A 1 125 ? 0.339   11.050  -3.333  1.00 0.00 ? 279 ALA A N    2  
ATOM   4106  C  CA   . ALA A 1 125 ? -0.353  10.720  -4.631  1.00 0.00 ? 279 ALA A CA   2  
ATOM   4107  C  C    . ALA A 1 125 ? -1.836  10.388  -4.379  1.00 0.00 ? 279 ALA A C    2  
ATOM   4108  O  O    . ALA A 1 125 ? -2.677  10.638  -5.224  1.00 0.00 ? 279 ALA A O    2  
ATOM   4109  C  CB   . ALA A 1 125 ? 0.368   9.497   -5.222  1.00 0.00 ? 279 ALA A CB   2  
ATOM   4110  H  H    . ALA A 1 125 ? 1.097   10.497  -3.013  1.00 0.00 ? 279 ALA A H    2  
ATOM   4111  H  HA   . ALA A 1 125 ? -0.275  11.551  -5.309  1.00 0.00 ? 279 ALA A HA   2  
ATOM   4112  H  HB1  . ALA A 1 125 ? -0.222  9.086   -6.026  1.00 0.00 ? 279 ALA A HB1  2  
ATOM   4113  H  HB2  . ALA A 1 125 ? 0.499   8.750   -4.452  1.00 0.00 ? 279 ALA A HB2  2  
ATOM   4114  H  HB3  . ALA A 1 125 ? 1.334   9.798   -5.599  1.00 0.00 ? 279 ALA A HB3  2  
ATOM   4115  N  N    . CYS A 1 126 ? -2.172  9.828   -3.231  1.00 0.00 ? 280 CYS A N    2  
ATOM   4116  C  CA   . CYS A 1 126 ? -3.616  9.492   -2.958  1.00 0.00 ? 280 CYS A CA   2  
ATOM   4117  C  C    . CYS A 1 126 ? -4.460  10.773  -2.968  1.00 0.00 ? 280 CYS A C    2  
ATOM   4118  O  O    . CYS A 1 126 ? -5.469  10.844  -3.644  1.00 0.00 ? 280 CYS A O    2  
ATOM   4119  C  CB   . CYS A 1 126 ? -3.657  8.835   -1.561  1.00 0.00 ? 280 CYS A CB   2  
ATOM   4120  S  SG   . CYS A 1 126 ? -5.358  8.372   -1.136  1.00 0.00 ? 280 CYS A SG   2  
ATOM   4121  H  H    . CYS A 1 126 ? -1.483  9.632   -2.558  1.00 0.00 ? 280 CYS A H    2  
ATOM   4122  H  HA   . CYS A 1 126 ? -3.981  8.803   -3.700  1.00 0.00 ? 280 CYS A HA   2  
ATOM   4123  H  HB2  . CYS A 1 126 ? -3.038  7.951   -1.564  1.00 0.00 ? 280 CYS A HB2  2  
ATOM   4124  H  HB3  . CYS A 1 126 ? -3.281  9.533   -0.827  1.00 0.00 ? 280 CYS A HB3  2  
ATOM   4125  H  HG   . CYS A 1 126 ? -5.453  8.434   -0.183  1.00 0.00 ? 280 CYS A HG   2  
ATOM   4126  N  N    . ASN A 1 127 ? -4.064  11.782  -2.222  1.00 0.00 ? 281 ASN A N    2  
ATOM   4127  C  CA   . ASN A 1 127 ? -4.878  13.051  -2.203  1.00 0.00 ? 281 ASN A CA   2  
ATOM   4128  C  C    . ASN A 1 127 ? -4.963  13.652  -3.612  1.00 0.00 ? 281 ASN A C    2  
ATOM   4129  O  O    . ASN A 1 127 ? -5.997  14.156  -4.006  1.00 0.00 ? 281 ASN A O    2  
ATOM   4130  C  CB   . ASN A 1 127 ? -4.166  14.025  -1.251  1.00 0.00 ? 281 ASN A CB   2  
ATOM   4131  C  CG   . ASN A 1 127 ? -4.613  13.750  0.190   1.00 0.00 ? 281 ASN A CG   2  
ATOM   4132  O  OD1  . ASN A 1 127 ? -5.765  13.444  0.429   1.00 0.00 ? 281 ASN A OD1  2  
ATOM   4133  N  ND2  . ASN A 1 127 ? -3.750  13.848  1.173   1.00 0.00 ? 281 ASN A ND2  2  
ATOM   4134  H  H    . ASN A 1 127 ? -3.242  11.700  -1.677  1.00 0.00 ? 281 ASN A H    2  
ATOM   4135  H  HA   . ASN A 1 127 ? -5.868  12.842  -1.841  1.00 0.00 ? 281 ASN A HA   2  
ATOM   4136  H  HB2  . ASN A 1 127 ? -3.097  13.888  -1.329  1.00 0.00 ? 281 ASN A HB2  2  
ATOM   4137  H  HB3  . ASN A 1 127 ? -4.421  15.040  -1.518  1.00 0.00 ? 281 ASN A HB3  2  
ATOM   4138  H  HD21 . ASN A 1 127 ? -2.817  14.095  0.992   1.00 0.00 ? 281 ASN A HD21 2  
ATOM   4139  H  HD22 . ASN A 1 127 ? -4.038  13.672  2.093   1.00 0.00 ? 281 ASN A HD22 2  
ATOM   4140  N  N    . SER A 1 128 ? -3.894  13.603  -4.378  1.00 0.00 ? 282 SER A N    2  
ATOM   4141  C  CA   . SER A 1 128 ? -3.953  14.180  -5.767  1.00 0.00 ? 282 SER A CA   2  
ATOM   4142  C  C    . SER A 1 128 ? -4.831  13.303  -6.669  1.00 0.00 ? 282 SER A C    2  
ATOM   4143  O  O    . SER A 1 128 ? -5.559  13.809  -7.504  1.00 0.00 ? 282 SER A O    2  
ATOM   4144  C  CB   . SER A 1 128 ? -2.512  14.219  -6.297  1.00 0.00 ? 282 SER A CB   2  
ATOM   4145  O  OG   . SER A 1 128 ? -2.421  15.182  -7.339  1.00 0.00 ? 282 SER A OG   2  
ATOM   4146  H  H    . SER A 1 128 ? -3.067  13.185  -4.043  1.00 0.00 ? 282 SER A H    2  
ATOM   4147  H  HA   . SER A 1 128 ? -4.358  15.175  -5.730  1.00 0.00 ? 282 SER A HA   2  
ATOM   4148  H  HB2  . SER A 1 128 ? -1.841  14.494  -5.501  1.00 0.00 ? 282 SER A HB2  2  
ATOM   4149  H  HB3  . SER A 1 128 ? -2.240  13.240  -6.672  1.00 0.00 ? 282 SER A HB3  2  
ATOM   4150  H  HG   . SER A 1 128 ? -1.595  15.037  -7.806  1.00 0.00 ? 282 SER A HG   2  
ATOM   4151  N  N    . VAL A 1 129 ? -4.788  11.996  -6.507  1.00 0.00 ? 283 VAL A N    2  
ATOM   4152  C  CA   . VAL A 1 129 ? -5.652  11.117  -7.368  1.00 0.00 ? 283 VAL A CA   2  
ATOM   4153  C  C    . VAL A 1 129 ? -7.091  11.142  -6.846  1.00 0.00 ? 283 VAL A C    2  
ATOM   4154  O  O    . VAL A 1 129 ? -8.027  11.174  -7.624  1.00 0.00 ? 283 VAL A O    2  
ATOM   4155  C  CB   . VAL A 1 129 ? -5.063  9.698   -7.291  1.00 0.00 ? 283 VAL A CB   2  
ATOM   4156  C  CG1  . VAL A 1 129 ? -5.920  8.730   -8.115  1.00 0.00 ? 283 VAL A CG1  2  
ATOM   4157  C  CG2  . VAL A 1 129 ? -3.637  9.710   -7.846  1.00 0.00 ? 283 VAL A CG2  2  
ATOM   4158  H  H    . VAL A 1 129 ? -4.203  11.602  -5.818  1.00 0.00 ? 283 VAL A H    2  
ATOM   4159  H  HA   . VAL A 1 129 ? -5.635  11.472  -8.382  1.00 0.00 ? 283 VAL A HA   2  
ATOM   4160  H  HB   . VAL A 1 129 ? -5.046  9.374   -6.262  1.00 0.00 ? 283 VAL A HB   2  
ATOM   4161  H  HG11 . VAL A 1 129 ? -5.405  7.785   -8.210  1.00 0.00 ? 283 VAL A HG11 2  
ATOM   4162  H  HG12 . VAL A 1 129 ? -6.091  9.146   -9.096  1.00 0.00 ? 283 VAL A HG12 2  
ATOM   4163  H  HG13 . VAL A 1 129 ? -6.868  8.575   -7.619  1.00 0.00 ? 283 VAL A HG13 2  
ATOM   4164  H  HG21 . VAL A 1 129 ? -3.119  8.818   -7.528  1.00 0.00 ? 283 VAL A HG21 2  
ATOM   4165  H  HG22 . VAL A 1 129 ? -3.115  10.580  -7.477  1.00 0.00 ? 283 VAL A HG22 2  
ATOM   4166  H  HG23 . VAL A 1 129 ? -3.672  9.741   -8.925  1.00 0.00 ? 283 VAL A HG23 2  
ATOM   4167  N  N    . PHE A 1 130 ? -7.288  11.155  -5.543  1.00 0.00 ? 284 PHE A N    2  
ATOM   4168  C  CA   . PHE A 1 130 ? -8.696  11.211  -5.028  1.00 0.00 ? 284 PHE A CA   2  
ATOM   4169  C  C    . PHE A 1 130 ? -9.259  12.624  -5.247  1.00 0.00 ? 284 PHE A C    2  
ATOM   4170  O  O    . PHE A 1 130 ? -10.446 12.786  -5.462  1.00 0.00 ? 284 PHE A O    2  
ATOM   4171  C  CB   . PHE A 1 130 ? -8.675  10.843  -3.530  1.00 0.00 ? 284 PHE A CB   2  
ATOM   4172  C  CG   . PHE A 1 130 ? -9.389  9.523   -3.336  1.00 0.00 ? 284 PHE A CG   2  
ATOM   4173  C  CD1  . PHE A 1 130 ? -10.717 9.379   -3.756  1.00 0.00 ? 284 PHE A CD1  2  
ATOM   4174  C  CD2  . PHE A 1 130 ? -8.721  8.440   -2.751  1.00 0.00 ? 284 PHE A CD2  2  
ATOM   4175  C  CE1  . PHE A 1 130 ? -11.377 8.156   -3.591  1.00 0.00 ? 284 PHE A CE1  2  
ATOM   4176  C  CE2  . PHE A 1 130 ? -9.380  7.216   -2.588  1.00 0.00 ? 284 PHE A CE2  2  
ATOM   4177  C  CZ   . PHE A 1 130 ? -10.709 7.074   -3.008  1.00 0.00 ? 284 PHE A CZ   2  
ATOM   4178  H  H    . PHE A 1 130 ? -6.522  11.154  -4.922  1.00 0.00 ? 284 PHE A H    2  
ATOM   4179  H  HA   . PHE A 1 130 ? -9.299  10.501  -5.573  1.00 0.00 ? 284 PHE A HA   2  
ATOM   4180  H  HB2  . PHE A 1 130 ? -7.656  10.756  -3.186  1.00 0.00 ? 284 PHE A HB2  2  
ATOM   4181  H  HB3  . PHE A 1 130 ? -9.182  11.610  -2.964  1.00 0.00 ? 284 PHE A HB3  2  
ATOM   4182  H  HD1  . PHE A 1 130 ? -11.233 10.214  -4.208  1.00 0.00 ? 284 PHE A HD1  2  
ATOM   4183  H  HD2  . PHE A 1 130 ? -7.697  8.550   -2.426  1.00 0.00 ? 284 PHE A HD2  2  
ATOM   4184  H  HE1  . PHE A 1 130 ? -12.401 8.047   -3.914  1.00 0.00 ? 284 PHE A HE1  2  
ATOM   4185  H  HE2  . PHE A 1 130 ? -8.865  6.381   -2.138  1.00 0.00 ? 284 PHE A HE2  2  
ATOM   4186  H  HZ   . PHE A 1 130 ? -11.218 6.128   -2.882  1.00 0.00 ? 284 PHE A HZ   2  
ATOM   4187  N  N    . GLU A 1 131 ? -8.422  13.657  -5.230  1.00 0.00 ? 285 GLU A N    2  
ATOM   4188  C  CA   . GLU A 1 131 ? -8.958  15.044  -5.484  1.00 0.00 ? 285 GLU A CA   2  
ATOM   4189  C  C    . GLU A 1 131 ? -9.644  15.072  -6.857  1.00 0.00 ? 285 GLU A C    2  
ATOM   4190  O  O    . GLU A 1 131 ? -10.688 15.676  -7.018  1.00 0.00 ? 285 GLU A O    2  
ATOM   4191  C  CB   . GLU A 1 131 ? -7.756  16.004  -5.464  1.00 0.00 ? 285 GLU A CB   2  
ATOM   4192  C  CG   . GLU A 1 131 ? -8.242  17.439  -5.680  1.00 0.00 ? 285 GLU A CG   2  
ATOM   4193  C  CD   . GLU A 1 131 ? -7.037  18.367  -5.842  1.00 0.00 ? 285 GLU A CD   2  
ATOM   4194  O  OE1  . GLU A 1 131 ? -6.187  18.064  -6.664  1.00 0.00 ? 285 GLU A OE1  2  
ATOM   4195  O  OE2  . GLU A 1 131 ? -6.985  19.366  -5.144  1.00 0.00 ? 285 GLU A OE2  2  
ATOM   4196  H  H    . GLU A 1 131 ? -7.459  13.516  -5.078  1.00 0.00 ? 285 GLU A H    2  
ATOM   4197  H  HA   . GLU A 1 131 ? -9.662  15.314  -4.717  1.00 0.00 ? 285 GLU A HA   2  
ATOM   4198  H  HB2  . GLU A 1 131 ? -7.257  15.934  -4.508  1.00 0.00 ? 285 GLU A HB2  2  
ATOM   4199  H  HB3  . GLU A 1 131 ? -7.068  15.736  -6.251  1.00 0.00 ? 285 GLU A HB3  2  
ATOM   4200  H  HG2  . GLU A 1 131 ? -8.853  17.482  -6.570  1.00 0.00 ? 285 GLU A HG2  2  
ATOM   4201  H  HG3  . GLU A 1 131 ? -8.825  17.755  -4.828  1.00 0.00 ? 285 GLU A HG3  2  
ATOM   4202  N  N    . ASN A 1 132 ? -9.083  14.397  -7.848  1.00 0.00 ? 286 ASN A N    2  
ATOM   4203  C  CA   . ASN A 1 132 ? -9.751  14.376  -9.201  1.00 0.00 ? 286 ASN A CA   2  
ATOM   4204  C  C    . ASN A 1 132 ? -11.182 13.813  -9.070  1.00 0.00 ? 286 ASN A C    2  
ATOM   4205  O  O    . ASN A 1 132 ? -12.063 14.183  -9.824  1.00 0.00 ? 286 ASN A O    2  
ATOM   4206  C  CB   . ASN A 1 132 ? -8.905  13.461  -10.101 1.00 0.00 ? 286 ASN A CB   2  
ATOM   4207  C  CG   . ASN A 1 132 ? -9.131  13.839  -11.570 1.00 0.00 ? 286 ASN A CG   2  
ATOM   4208  O  OD1  . ASN A 1 132 ? -9.249  15.004  -11.894 1.00 0.00 ? 286 ASN A OD1  2  
ATOM   4209  N  ND2  . ASN A 1 132 ? -9.198  12.901  -12.484 1.00 0.00 ? 286 ASN A ND2  2  
ATOM   4210  H  H    . ASN A 1 132 ? -8.245  13.894  -7.693  1.00 0.00 ? 286 ASN A H    2  
ATOM   4211  H  HA   . ASN A 1 132 ? -9.782  15.370  -9.612  1.00 0.00 ? 286 ASN A HA   2  
ATOM   4212  H  HB2  . ASN A 1 132 ? -7.859  13.581  -9.855  1.00 0.00 ? 286 ASN A HB2  2  
ATOM   4213  H  HB3  . ASN A 1 132 ? -9.195  12.433  -9.947  1.00 0.00 ? 286 ASN A HB3  2  
ATOM   4214  H  HD21 . ASN A 1 132 ? -9.104  11.955  -12.234 1.00 0.00 ? 286 ASN A HD21 2  
ATOM   4215  H  HD22 . ASN A 1 132 ? -9.342  13.144  -13.422 1.00 0.00 ? 286 ASN A HD22 2  
ATOM   4216  N  N    . LEU A 1 133 ? -11.429 12.932  -8.113  1.00 0.00 ? 287 LEU A N    2  
ATOM   4217  C  CA   . LEU A 1 133 ? -12.818 12.369  -7.945  1.00 0.00 ? 287 LEU A CA   2  
ATOM   4218  C  C    . LEU A 1 133 ? -13.826 13.514  -7.746  1.00 0.00 ? 287 LEU A C    2  
ATOM   4219  O  O    . LEU A 1 133 ? -14.919 13.479  -8.278  1.00 0.00 ? 287 LEU A O    2  
ATOM   4220  C  CB   . LEU A 1 133 ? -12.778 11.484  -6.680  1.00 0.00 ? 287 LEU A CB   2  
ATOM   4221  C  CG   . LEU A 1 133 ? -13.841 10.375  -6.752  1.00 0.00 ? 287 LEU A CG   2  
ATOM   4222  C  CD1  . LEU A 1 133 ? -15.230 10.975  -7.010  1.00 0.00 ? 287 LEU A CD1  2  
ATOM   4223  C  CD2  . LEU A 1 133 ? -13.482 9.404   -7.879  1.00 0.00 ? 287 LEU A CD2  2  
ATOM   4224  H  H    . LEU A 1 133 ? -10.709 12.649  -7.508  1.00 0.00 ? 287 LEU A H    2  
ATOM   4225  H  HA   . LEU A 1 133 ? -13.089 11.774  -8.803  1.00 0.00 ? 287 LEU A HA   2  
ATOM   4226  H  HB2  . LEU A 1 133 ? -11.802 11.031  -6.595  1.00 0.00 ? 287 LEU A HB2  2  
ATOM   4227  H  HB3  . LEU A 1 133 ? -12.960 12.098  -5.813  1.00 0.00 ? 287 LEU A HB3  2  
ATOM   4228  H  HG   . LEU A 1 133 ? -13.857 9.841   -5.813  1.00 0.00 ? 287 LEU A HG   2  
ATOM   4229  H  HD11 . LEU A 1 133 ? -15.307 11.930  -6.513  1.00 0.00 ? 287 LEU A HD11 2  
ATOM   4230  H  HD12 . LEU A 1 133 ? -15.989 10.308  -6.627  1.00 0.00 ? 287 LEU A HD12 2  
ATOM   4231  H  HD13 . LEU A 1 133 ? -15.373 11.109  -8.072  1.00 0.00 ? 287 LEU A HD13 2  
ATOM   4232  H  HD21 . LEU A 1 133 ? -13.999 8.467   -7.724  1.00 0.00 ? 287 LEU A HD21 2  
ATOM   4233  H  HD22 . LEU A 1 133 ? -12.416 9.229   -7.878  1.00 0.00 ? 287 LEU A HD22 2  
ATOM   4234  H  HD23 . LEU A 1 133 ? -13.778 9.825   -8.828  1.00 0.00 ? 287 LEU A HD23 2  
ATOM   4235  N  N    . GLU A 1 134 ? -13.469 14.532  -6.982  1.00 0.00 ? 288 GLU A N    2  
ATOM   4236  C  CA   . GLU A 1 134 ? -14.432 15.673  -6.764  1.00 0.00 ? 288 GLU A CA   2  
ATOM   4237  C  C    . GLU A 1 134 ? -14.794 16.317  -8.109  1.00 0.00 ? 288 GLU A C    2  
ATOM   4238  O  O    . GLU A 1 134 ? -15.945 16.626  -8.361  1.00 0.00 ? 288 GLU A O    2  
ATOM   4239  C  CB   . GLU A 1 134 ? -13.718 16.694  -5.865  1.00 0.00 ? 288 GLU A CB   2  
ATOM   4240  C  CG   . GLU A 1 134 ? -14.754 17.597  -5.193  1.00 0.00 ? 288 GLU A CG   2  
ATOM   4241  C  CD   . GLU A 1 134 ? -14.049 18.790  -4.547  1.00 0.00 ? 288 GLU A CD   2  
ATOM   4242  O  OE1  . GLU A 1 134 ? -12.951 18.606  -4.048  1.00 0.00 ? 288 GLU A OE1  2  
ATOM   4243  O  OE2  . GLU A 1 134 ? -14.618 19.870  -4.563  1.00 0.00 ? 288 GLU A OE2  2  
ATOM   4244  H  H    . GLU A 1 134 ? -12.576 14.541  -6.557  1.00 0.00 ? 288 GLU A H    2  
ATOM   4245  H  HA   . GLU A 1 134 ? -15.321 15.315  -6.277  1.00 0.00 ? 288 GLU A HA   2  
ATOM   4246  H  HB2  . GLU A 1 134 ? -13.150 16.171  -5.109  1.00 0.00 ? 288 GLU A HB2  2  
ATOM   4247  H  HB3  . GLU A 1 134 ? -13.051 17.296  -6.464  1.00 0.00 ? 288 GLU A HB3  2  
ATOM   4248  H  HG2  . GLU A 1 134 ? -15.457 17.951  -5.934  1.00 0.00 ? 288 GLU A HG2  2  
ATOM   4249  H  HG3  . GLU A 1 134 ? -15.281 17.038  -4.435  1.00 0.00 ? 288 GLU A HG3  2  
ATOM   4250  N  N    . GLN A 1 135 ? -13.827 16.517  -8.978  1.00 0.00 ? 289 GLN A N    2  
ATOM   4251  C  CA   . GLN A 1 135 ? -14.144 17.139  -10.314 1.00 0.00 ? 289 GLN A CA   2  
ATOM   4252  C  C    . GLN A 1 135 ? -15.085 16.214  -11.100 1.00 0.00 ? 289 GLN A C    2  
ATOM   4253  O  O    . GLN A 1 135 ? -16.020 16.670  -11.730 1.00 0.00 ? 289 GLN A O    2  
ATOM   4254  C  CB   . GLN A 1 135 ? -12.809 17.298  -11.061 1.00 0.00 ? 289 GLN A CB   2  
ATOM   4255  C  CG   . GLN A 1 135 ? -11.954 18.354  -10.358 1.00 0.00 ? 289 GLN A CG   2  
ATOM   4256  C  CD   . GLN A 1 135 ? -12.406 19.753  -10.794 1.00 0.00 ? 289 GLN A CD   2  
ATOM   4257  O  OE1  . GLN A 1 135 ? -13.580 19.982  -11.005 1.00 0.00 ? 289 GLN A OE1  2  
ATOM   4258  N  NE2  . GLN A 1 135 ? -11.521 20.709  -10.941 1.00 0.00 ? 289 GLN A NE2  2  
ATOM   4259  H  H    . GLN A 1 135 ? -12.904 16.251  -8.754  1.00 0.00 ? 289 GLN A H    2  
ATOM   4260  H  HA   . GLN A 1 135 ? -14.605 18.104  -10.173 1.00 0.00 ? 289 GLN A HA   2  
ATOM   4261  H  HB2  . GLN A 1 135 ? -12.284 16.354  -11.066 1.00 0.00 ? 289 GLN A HB2  2  
ATOM   4262  H  HB3  . GLN A 1 135 ? -13.000 17.610  -12.076 1.00 0.00 ? 289 GLN A HB3  2  
ATOM   4263  H  HG2  . GLN A 1 135 ? -12.068 18.255  -9.288  1.00 0.00 ? 289 GLN A HG2  2  
ATOM   4264  H  HG3  . GLN A 1 135 ? -10.917 18.214  -10.624 1.00 0.00 ? 289 GLN A HG3  2  
ATOM   4265  H  HE21 . GLN A 1 135 ? -10.568 20.537  -10.773 1.00 0.00 ? 289 GLN A HE21 2  
ATOM   4266  H  HE22 . GLN A 1 135 ? -11.812 21.602  -11.221 1.00 0.00 ? 289 GLN A HE22 2  
ATOM   4267  N  N    . LEU A 1 136 ? -14.852 14.915  -11.063 1.00 0.00 ? 290 LEU A N    2  
ATOM   4268  C  CA   . LEU A 1 136 ? -15.758 13.975  -11.814 1.00 0.00 ? 290 LEU A CA   2  
ATOM   4269  C  C    . LEU A 1 136 ? -17.178 14.044  -11.230 1.00 0.00 ? 290 LEU A C    2  
ATOM   4270  O  O    . LEU A 1 136 ? -18.151 14.037  -11.960 1.00 0.00 ? 290 LEU A O    2  
ATOM   4271  C  CB   . LEU A 1 136 ? -15.179 12.563  -11.633 1.00 0.00 ? 290 LEU A CB   2  
ATOM   4272  C  CG   . LEU A 1 136 ? -15.649 11.664  -12.776 1.00 0.00 ? 290 LEU A CG   2  
ATOM   4273  C  CD1  . LEU A 1 136 ? -14.616 11.690  -13.904 1.00 0.00 ? 290 LEU A CD1  2  
ATOM   4274  C  CD2  . LEU A 1 136 ? -15.806 10.230  -12.263 1.00 0.00 ? 290 LEU A CD2  2  
ATOM   4275  H  H    . LEU A 1 136 ? -14.090 14.566  -10.541 1.00 0.00 ? 290 LEU A H    2  
ATOM   4276  H  HA   . LEU A 1 136 ? -15.777 14.233  -12.858 1.00 0.00 ? 290 LEU A HA   2  
ATOM   4277  H  HB2  . LEU A 1 136 ? -14.100 12.614  -11.635 1.00 0.00 ? 290 LEU A HB2  2  
ATOM   4278  H  HB3  . LEU A 1 136 ? -15.518 12.153  -10.693 1.00 0.00 ? 290 LEU A HB3  2  
ATOM   4279  H  HG   . LEU A 1 136 ? -16.599 12.021  -13.148 1.00 0.00 ? 290 LEU A HG   2  
ATOM   4280  H  HD11 . LEU A 1 136 ? -14.529 12.696  -14.288 1.00 0.00 ? 290 LEU A HD11 2  
ATOM   4281  H  HD12 . LEU A 1 136 ? -14.931 11.028  -14.697 1.00 0.00 ? 290 LEU A HD12 2  
ATOM   4282  H  HD13 . LEU A 1 136 ? -13.659 11.366  -13.523 1.00 0.00 ? 290 LEU A HD13 2  
ATOM   4283  H  HD21 . LEU A 1 136 ? -14.957 9.975   -11.645 1.00 0.00 ? 290 LEU A HD21 2  
ATOM   4284  H  HD22 . LEU A 1 136 ? -15.856 9.552   -13.102 1.00 0.00 ? 290 LEU A HD22 2  
ATOM   4285  H  HD23 . LEU A 1 136 ? -16.712 10.153  -11.682 1.00 0.00 ? 290 LEU A HD23 2  
ATOM   4286  N  N    . LEU A 1 137 ? -17.305 14.117  -9.922  1.00 0.00 ? 291 LEU A N    2  
ATOM   4287  C  CA   . LEU A 1 137 ? -18.682 14.190  -9.307  1.00 0.00 ? 291 LEU A CA   2  
ATOM   4288  C  C    . LEU A 1 137 ? -19.412 15.462  -9.775  1.00 0.00 ? 291 LEU A C    2  
ATOM   4289  O  O    . LEU A 1 137 ? -20.615 15.447  -9.964  1.00 0.00 ? 291 LEU A O    2  
ATOM   4290  C  CB   . LEU A 1 137 ? -18.485 14.227  -7.782  1.00 0.00 ? 291 LEU A CB   2  
ATOM   4291  C  CG   . LEU A 1 137 ? -19.764 13.750  -7.091  1.00 0.00 ? 291 LEU A CG   2  
ATOM   4292  C  CD1  . LEU A 1 137 ? -19.827 12.223  -7.132  1.00 0.00 ? 291 LEU A CD1  2  
ATOM   4293  C  CD2  . LEU A 1 137 ? -19.760 14.220  -5.635  1.00 0.00 ? 291 LEU A CD2  2  
ATOM   4294  H  H    . LEU A 1 137 ? -16.501 14.124  -9.351  1.00 0.00 ? 291 LEU A H    2  
ATOM   4295  H  HA   . LEU A 1 137 ? -19.254 13.316  -9.579  1.00 0.00 ? 291 LEU A HA   2  
ATOM   4296  H  HB2  . LEU A 1 137 ? -17.665 13.579  -7.510  1.00 0.00 ? 291 LEU A HB2  2  
ATOM   4297  H  HB3  . LEU A 1 137 ? -18.266 15.237  -7.472  1.00 0.00 ? 291 LEU A HB3  2  
ATOM   4298  H  HG   . LEU A 1 137 ? -20.623 14.159  -7.602  1.00 0.00 ? 291 LEU A HG   2  
ATOM   4299  H  HD11 . LEU A 1 137 ? -20.106 11.900  -8.124  1.00 0.00 ? 291 LEU A HD11 2  
ATOM   4300  H  HD12 . LEU A 1 137 ? -20.560 11.874  -6.419  1.00 0.00 ? 291 LEU A HD12 2  
ATOM   4301  H  HD13 . LEU A 1 137 ? -18.859 11.815  -6.880  1.00 0.00 ? 291 LEU A HD13 2  
ATOM   4302  H  HD21 . LEU A 1 137 ? -18.941 13.753  -5.107  1.00 0.00 ? 291 LEU A HD21 2  
ATOM   4303  H  HD22 . LEU A 1 137 ? -20.693 13.947  -5.165  1.00 0.00 ? 291 LEU A HD22 2  
ATOM   4304  H  HD23 . LEU A 1 137 ? -19.641 15.294  -5.603  1.00 0.00 ? 291 LEU A HD23 2  
ATOM   4305  N  N    . GLN A 1 138 ? -18.707 16.562  -9.964  1.00 0.00 ? 292 GLN A N    2  
ATOM   4306  C  CA   . GLN A 1 138 ? -19.397 17.820  -10.423 1.00 0.00 ? 292 GLN A CA   2  
ATOM   4307  C  C    . GLN A 1 138 ? -19.571 17.817  -11.952 1.00 0.00 ? 292 GLN A C    2  
ATOM   4308  O  O    . GLN A 1 138 ? -20.557 18.318  -12.460 1.00 0.00 ? 292 GLN A O    2  
ATOM   4309  C  CB   . GLN A 1 138 ? -18.500 18.990  -9.993  1.00 0.00 ? 292 GLN A CB   2  
ATOM   4310  C  CG   . GLN A 1 138 ? -18.359 18.993  -8.469  1.00 0.00 ? 292 GLN A CG   2  
ATOM   4311  C  CD   . GLN A 1 138 ? -18.105 20.424  -7.979  1.00 0.00 ? 292 GLN A CD   2  
ATOM   4312  O  OE1  . GLN A 1 138 ? -17.205 21.085  -8.455  1.00 0.00 ? 292 GLN A OE1  2  
ATOM   4313  N  NE2  . GLN A 1 138 ? -18.864 20.938  -7.043  1.00 0.00 ? 292 GLN A NE2  2  
ATOM   4314  H  H    . GLN A 1 138 ? -17.734 16.559  -9.810  1.00 0.00 ? 292 GLN A H    2  
ATOM   4315  H  HA   . GLN A 1 138 ? -20.360 17.907  -9.943  1.00 0.00 ? 292 GLN A HA   2  
ATOM   4316  H  HB2  . GLN A 1 138 ? -17.525 18.881  -10.444 1.00 0.00 ? 292 GLN A HB2  2  
ATOM   4317  H  HB3  . GLN A 1 138 ? -18.943 19.921  -10.312 1.00 0.00 ? 292 GLN A HB3  2  
ATOM   4318  H  HG2  . GLN A 1 138 ? -19.268 18.613  -8.023  1.00 0.00 ? 292 GLN A HG2  2  
ATOM   4319  H  HG3  . GLN A 1 138 ? -17.528 18.364  -8.183  1.00 0.00 ? 292 GLN A HG3  2  
ATOM   4320  H  HE21 . GLN A 1 138 ? -19.596 20.413  -6.651  1.00 0.00 ? 292 GLN A HE21 2  
ATOM   4321  H  HE22 . GLN A 1 138 ? -18.701 21.853  -6.731  1.00 0.00 ? 292 GLN A HE22 2  
ATOM   4322  N  N    . GLN A 1 139 ? -18.634 17.258  -12.693 1.00 0.00 ? 293 GLN A N    2  
ATOM   4323  C  CA   . GLN A 1 139 ? -18.779 17.239  -14.186 1.00 0.00 ? 293 GLN A CA   2  
ATOM   4324  C  C    . GLN A 1 139 ? -19.215 15.841  -14.660 1.00 0.00 ? 293 GLN A C    2  
ATOM   4325  O  O    . GLN A 1 139 ? -18.517 15.193  -15.418 1.00 0.00 ? 293 GLN A O    2  
ATOM   4326  C  CB   . GLN A 1 139 ? -17.393 17.591  -14.743 1.00 0.00 ? 293 GLN A CB   2  
ATOM   4327  C  CG   . GLN A 1 139 ? -17.239 19.112  -14.804 1.00 0.00 ? 293 GLN A CG   2  
ATOM   4328  C  CD   . GLN A 1 139 ? -15.987 19.467  -15.615 1.00 0.00 ? 293 GLN A CD   2  
ATOM   4329  O  OE1  . GLN A 1 139 ? -16.091 19.928  -16.735 1.00 0.00 ? 293 GLN A OE1  2  
ATOM   4330  N  NE2  . GLN A 1 139 ? -14.797 19.274  -15.100 1.00 0.00 ? 293 GLN A NE2  2  
ATOM   4331  H  H    . GLN A 1 139 ? -17.842 16.852  -12.274 1.00 0.00 ? 293 GLN A H    2  
ATOM   4332  H  HA   . GLN A 1 139 ? -19.499 17.979  -14.500 1.00 0.00 ? 293 GLN A HA   2  
ATOM   4333  H  HB2  . GLN A 1 139 ? -16.631 17.177  -14.099 1.00 0.00 ? 293 GLN A HB2  2  
ATOM   4334  H  HB3  . GLN A 1 139 ? -17.289 17.180  -15.736 1.00 0.00 ? 293 GLN A HB3  2  
ATOM   4335  H  HG2  . GLN A 1 139 ? -18.110 19.543  -15.276 1.00 0.00 ? 293 GLN A HG2  2  
ATOM   4336  H  HG3  . GLN A 1 139 ? -17.140 19.505  -13.803 1.00 0.00 ? 293 GLN A HG3  2  
ATOM   4337  H  HE21 . GLN A 1 139 ? -14.701 18.901  -14.197 1.00 0.00 ? 293 GLN A HE21 2  
ATOM   4338  H  HE22 . GLN A 1 139 ? -13.998 19.501  -15.620 1.00 0.00 ? 293 GLN A HE22 2  
ATOM   4339  N  N    . ASN A 1 140 ? -20.367 15.371  -14.221 1.00 0.00 ? 294 ASN A N    2  
ATOM   4340  C  CA   . ASN A 1 140 ? -20.837 14.019  -14.654 1.00 0.00 ? 294 ASN A CA   2  
ATOM   4341  C  C    . ASN A 1 140 ? -22.188 14.134  -15.378 1.00 0.00 ? 294 ASN A C    2  
ATOM   4342  O  O    . ASN A 1 140 ? -23.062 13.306  -15.195 1.00 0.00 ? 294 ASN A O    2  
ATOM   4343  C  CB   . ASN A 1 140 ? -20.991 13.219  -13.359 1.00 0.00 ? 294 ASN A CB   2  
ATOM   4344  C  CG   . ASN A 1 140 ? -21.356 11.768  -13.694 1.00 0.00 ? 294 ASN A CG   2  
ATOM   4345  O  OD1  . ASN A 1 140 ? -20.793 11.187  -14.600 1.00 0.00 ? 294 ASN A OD1  2  
ATOM   4346  N  ND2  . ASN A 1 140 ? -22.280 11.149  -13.001 1.00 0.00 ? 294 ASN A ND2  2  
ATOM   4347  H  H    . ASN A 1 140 ? -20.922 15.903  -13.610 1.00 0.00 ? 294 ASN A H    2  
ATOM   4348  H  HA   . ASN A 1 140 ? -20.105 13.552  -15.292 1.00 0.00 ? 294 ASN A HA   2  
ATOM   4349  H  HB2  . ASN A 1 140 ? -20.061 13.240  -12.812 1.00 0.00 ? 294 ASN A HB2  2  
ATOM   4350  H  HB3  . ASN A 1 140 ? -21.774 13.655  -12.757 1.00 0.00 ? 294 ASN A HB3  2  
ATOM   4351  H  HD21 . ASN A 1 140 ? -22.742 11.609  -12.266 1.00 0.00 ? 294 ASN A HD21 2  
ATOM   4352  H  HD22 . ASN A 1 140 ? -22.511 10.221  -13.217 1.00 0.00 ? 294 ASN A HD22 2  
ATOM   4353  N  N    . LYS A 1 141 ? -22.372 15.151  -16.197 1.00 0.00 ? 295 LYS A N    2  
ATOM   4354  C  CA   . LYS A 1 141 ? -23.670 15.302  -16.923 1.00 0.00 ? 295 LYS A CA   2  
ATOM   4355  C  C    . LYS A 1 141 ? -23.433 15.879  -18.328 1.00 0.00 ? 295 LYS A C    2  
ATOM   4356  O  O    . LYS A 1 141 ? -22.305 16.112  -18.720 1.00 0.00 ? 295 LYS A O    2  
ATOM   4357  C  CB   . LYS A 1 141 ? -24.486 16.278  -16.072 1.00 0.00 ? 295 LYS A CB   2  
ATOM   4358  C  CG   . LYS A 1 141 ? -25.947 15.824  -16.029 1.00 0.00 ? 295 LYS A CG   2  
ATOM   4359  C  CD   . LYS A 1 141 ? -26.612 16.360  -14.759 1.00 0.00 ? 295 LYS A CD   2  
ATOM   4360  C  CE   . LYS A 1 141 ? -27.742 15.419  -14.337 1.00 0.00 ? 295 LYS A CE   2  
ATOM   4361  N  NZ   . LYS A 1 141 ? -28.892 15.783  -15.211 1.00 0.00 ? 295 LYS A NZ   2  
ATOM   4362  H  H    . LYS A 1 141 ? -21.659 15.813  -16.336 1.00 0.00 ? 295 LYS A H    2  
ATOM   4363  H  HA   . LYS A 1 141 ? -24.179 14.353  -16.986 1.00 0.00 ? 295 LYS A HA   2  
ATOM   4364  H  HB2  . LYS A 1 141 ? -24.086 16.301  -15.068 1.00 0.00 ? 295 LYS A HB2  2  
ATOM   4365  H  HB3  . LYS A 1 141 ? -24.431 17.265  -16.504 1.00 0.00 ? 295 LYS A HB3  2  
ATOM   4366  H  HG2  . LYS A 1 141 ? -26.467 16.203  -16.896 1.00 0.00 ? 295 LYS A HG2  2  
ATOM   4367  H  HG3  . LYS A 1 141 ? -25.989 14.745  -16.027 1.00 0.00 ? 295 LYS A HG3  2  
ATOM   4368  H  HD2  . LYS A 1 141 ? -25.878 16.421  -13.968 1.00 0.00 ? 295 LYS A HD2  2  
ATOM   4369  H  HD3  . LYS A 1 141 ? -27.017 17.341  -14.952 1.00 0.00 ? 295 LYS A HD3  2  
ATOM   4370  H  HE2  . LYS A 1 141 ? -27.453 14.389  -14.502 1.00 0.00 ? 295 LYS A HE2  2  
ATOM   4371  H  HE3  . LYS A 1 141 ? -27.999 15.578  -13.302 1.00 0.00 ? 295 LYS A HE3  2  
ATOM   4372  H  HZ1  . LYS A 1 141 ? -28.585 15.795  -16.203 1.00 0.00 ? 295 LYS A HZ1  2  
ATOM   4373  H  HZ2  . LYS A 1 141 ? -29.243 16.726  -14.945 1.00 0.00 ? 295 LYS A HZ2  2  
ATOM   4374  H  HZ3  . LYS A 1 141 ? -29.652 15.084  -15.094 1.00 0.00 ? 295 LYS A HZ3  2  
ATOM   4375  N  N    . LYS A 1 142 ? -24.483 16.112  -19.090 1.00 0.00 ? 296 LYS A N    2  
ATOM   4376  C  CA   . LYS A 1 142 ? -24.301 16.673  -20.462 1.00 0.00 ? 296 LYS A CA   2  
ATOM   4377  C  C    . LYS A 1 142 ? -25.079 17.984  -20.606 1.00 0.00 ? 296 LYS A C    2  
ATOM   4378  O  O    . LYS A 1 142 ? -25.532 18.494  -19.594 1.00 0.00 ? 296 LYS A O    2  
ATOM   4379  C  CB   . LYS A 1 142 ? -24.866 15.609  -21.403 1.00 0.00 ? 296 LYS A CB   2  
ATOM   4380  C  CG   . LYS A 1 142 ? -23.914 14.411  -21.452 1.00 0.00 ? 296 LYS A CG   2  
ATOM   4381  C  CD   . LYS A 1 142 ? -24.702 13.146  -21.795 1.00 0.00 ? 296 LYS A CD   2  
ATOM   4382  C  CE   . LYS A 1 142 ? -23.813 12.194  -22.599 1.00 0.00 ? 296 LYS A CE   2  
ATOM   4383  N  NZ   . LYS A 1 142 ? -24.746 11.170  -23.147 1.00 0.00 ? 296 LYS A NZ   2  
ATOM   4384  O  OXT  . LYS A 1 142 ? -25.206 18.455  -21.724 1.00 0.00 ? 296 LYS A OXT  2  
ATOM   4385  H  H    . LYS A 1 142 ? -25.389 15.920  -18.762 1.00 0.00 ? 296 LYS A H    2  
ATOM   4386  H  HA   . LYS A 1 142 ? -23.254 16.831  -20.670 1.00 0.00 ? 296 LYS A HA   2  
ATOM   4387  H  HB2  . LYS A 1 142 ? -25.833 15.286  -21.042 1.00 0.00 ? 296 LYS A HB2  2  
ATOM   4388  H  HB3  . LYS A 1 142 ? -24.972 16.023  -22.395 1.00 0.00 ? 296 LYS A HB3  2  
ATOM   4389  H  HG2  . LYS A 1 142 ? -23.159 14.583  -22.205 1.00 0.00 ? 296 LYS A HG2  2  
ATOM   4390  H  HG3  . LYS A 1 142 ? -23.441 14.289  -20.489 1.00 0.00 ? 296 LYS A HG3  2  
ATOM   4391  H  HD2  . LYS A 1 142 ? -25.018 12.661  -20.882 1.00 0.00 ? 296 LYS A HD2  2  
ATOM   4392  H  HD3  . LYS A 1 142 ? -25.568 13.409  -22.382 1.00 0.00 ? 296 LYS A HD3  2  
ATOM   4393  H  HE2  . LYS A 1 142 ? -23.323 12.728  -23.401 1.00 0.00 ? 296 LYS A HE2  2  
ATOM   4394  H  HE3  . LYS A 1 142 ? -23.085 11.725  -21.956 1.00 0.00 ? 296 LYS A HE3  2  
ATOM   4395  H  HZ1  . LYS A 1 142 ? -25.384 11.615  -23.836 1.00 0.00 ? 296 LYS A HZ1  2  
ATOM   4396  H  HZ2  . LYS A 1 142 ? -25.305 10.760  -22.371 1.00 0.00 ? 296 LYS A HZ2  2  
ATOM   4397  H  HZ3  . LYS A 1 142 ? -24.201 10.420  -23.616 1.00 0.00 ? 296 LYS A HZ3  2  
HETATM 4398  ZN ZN   . ZN  B 2 .   ? -4.891  -2.906  -5.529  1.00 0.00 ? 1   ZN  A ZN   2  
HETATM 4399  ZN ZN   . ZN  C 2 .   ? 1.824   -7.036  -0.435  1.00 0.00 ? 2   ZN  A ZN   2  
HETATM 4400  ZN ZN   . ZN  D 2 .   ? 5.677   -1.805  11.563  1.00 0.00 ? 3   ZN  A ZN   2  
ATOM   4401  N  N    . GLY A 1 1   ? 17.647  -2.264  -35.482 1.00 0.00 ? 155 GLY A N    3  
ATOM   4402  C  CA   . GLY A 1 1   ? 17.185  -1.475  -34.305 1.00 0.00 ? 155 GLY A CA   3  
ATOM   4403  C  C    . GLY A 1 1   ? 15.844  -2.031  -33.809 1.00 0.00 ? 155 GLY A C    3  
ATOM   4404  O  O    . GLY A 1 1   ? 15.052  -2.529  -34.588 1.00 0.00 ? 155 GLY A O    3  
ATOM   4405  H  H1   . GLY A 1 1   ? 17.448  -3.272  -35.325 1.00 0.00 ? 155 GLY A H1   3  
ATOM   4406  H  H2   . GLY A 1 1   ? 18.672  -2.130  -35.609 1.00 0.00 ? 155 GLY A H2   3  
ATOM   4407  H  H3   . GLY A 1 1   ? 17.148  -1.942  -36.334 1.00 0.00 ? 155 GLY A H3   3  
ATOM   4408  H  HA2  . GLY A 1 1   ? 17.921  -1.545  -33.516 1.00 0.00 ? 155 GLY A HA2  3  
ATOM   4409  H  HA3  . GLY A 1 1   ? 17.059  -0.443  -34.591 1.00 0.00 ? 155 GLY A HA3  3  
ATOM   4410  N  N    . ALA A 1 2   ? 15.577  -1.956  -32.520 1.00 0.00 ? 156 ALA A N    3  
ATOM   4411  C  CA   . ALA A 1 2   ? 14.284  -2.483  -31.990 1.00 0.00 ? 156 ALA A CA   3  
ATOM   4412  C  C    . ALA A 1 2   ? 13.672  -1.486  -30.994 1.00 0.00 ? 156 ALA A C    3  
ATOM   4413  O  O    . ALA A 1 2   ? 14.215  -0.421  -30.769 1.00 0.00 ? 156 ALA A O    3  
ATOM   4414  C  CB   . ALA A 1 2   ? 14.649  -3.791  -31.288 1.00 0.00 ? 156 ALA A CB   3  
ATOM   4415  H  H    . ALA A 1 2   ? 16.224  -1.551  -31.901 1.00 0.00 ? 156 ALA A H    3  
ATOM   4416  H  HA   . ALA A 1 2   ? 13.597  -2.678  -32.799 1.00 0.00 ? 156 ALA A HA   3  
ATOM   4417  H  HB1  . ALA A 1 2   ? 13.842  -4.085  -30.633 1.00 0.00 ? 156 ALA A HB1  3  
ATOM   4418  H  HB2  . ALA A 1 2   ? 15.549  -3.648  -30.708 1.00 0.00 ? 156 ALA A HB2  3  
ATOM   4419  H  HB3  . ALA A 1 2   ? 14.815  -4.562  -32.025 1.00 0.00 ? 156 ALA A HB3  3  
ATOM   4420  N  N    . MET A 1 3   ? 12.547  -1.819  -30.392 1.00 0.00 ? 157 MET A N    3  
ATOM   4421  C  CA   . MET A 1 3   ? 11.915  -0.881  -29.416 1.00 0.00 ? 157 MET A CA   3  
ATOM   4422  C  C    . MET A 1 3   ? 11.813  -1.544  -28.032 1.00 0.00 ? 157 MET A C    3  
ATOM   4423  O  O    . MET A 1 3   ? 10.829  -2.189  -27.725 1.00 0.00 ? 157 MET A O    3  
ATOM   4424  C  CB   . MET A 1 3   ? 10.521  -0.602  -29.980 1.00 0.00 ? 157 MET A CB   3  
ATOM   4425  C  CG   . MET A 1 3   ? 10.574  0.633   -30.881 1.00 0.00 ? 157 MET A CG   3  
ATOM   4426  S  SD   . MET A 1 3   ? 8.930   1.388   -30.965 1.00 0.00 ? 157 MET A SD   3  
ATOM   4427  C  CE   . MET A 1 3   ? 8.577   0.969   -32.689 1.00 0.00 ? 157 MET A CE   3  
ATOM   4428  H  H    . MET A 1 3   ? 12.117  -2.682  -30.582 1.00 0.00 ? 157 MET A H    3  
ATOM   4429  H  HA   . MET A 1 3   ? 12.479  0.036   -29.355 1.00 0.00 ? 157 MET A HA   3  
ATOM   4430  H  HB2  . MET A 1 3   ? 10.188  -1.454  -30.555 1.00 0.00 ? 157 MET A HB2  3  
ATOM   4431  H  HB3  . MET A 1 3   ? 9.832   -0.424  -29.168 1.00 0.00 ? 157 MET A HB3  3  
ATOM   4432  H  HG2  . MET A 1 3   ? 11.276  1.345   -30.474 1.00 0.00 ? 157 MET A HG2  3  
ATOM   4433  H  HG3  . MET A 1 3   ? 10.887  0.343   -31.872 1.00 0.00 ? 157 MET A HG3  3  
ATOM   4434  H  HE1  . MET A 1 3   ? 7.544   1.203   -32.911 1.00 0.00 ? 157 MET A HE1  3  
ATOM   4435  H  HE2  . MET A 1 3   ? 8.745   -0.084  -32.848 1.00 0.00 ? 157 MET A HE2  3  
ATOM   4436  H  HE3  . MET A 1 3   ? 9.228   1.538   -33.338 1.00 0.00 ? 157 MET A HE3  3  
ATOM   4437  N  N    . ALA A 1 4   ? 12.819  -1.389  -27.194 1.00 0.00 ? 158 ALA A N    3  
ATOM   4438  C  CA   . ALA A 1 4   ? 12.765  -2.013  -25.838 1.00 0.00 ? 158 ALA A CA   3  
ATOM   4439  C  C    . ALA A 1 4   ? 13.247  -1.013  -24.775 1.00 0.00 ? 158 ALA A C    3  
ATOM   4440  O  O    . ALA A 1 4   ? 14.389  -1.055  -24.356 1.00 0.00 ? 158 ALA A O    3  
ATOM   4441  C  CB   . ALA A 1 4   ? 13.710  -3.212  -25.914 1.00 0.00 ? 158 ALA A CB   3  
ATOM   4442  H  H    . ALA A 1 4   ? 13.607  -0.864  -27.455 1.00 0.00 ? 158 ALA A H    3  
ATOM   4443  H  HA   . ALA A 1 4   ? 11.763  -2.345  -25.615 1.00 0.00 ? 158 ALA A HA   3  
ATOM   4444  H  HB1  . ALA A 1 4   ? 14.258  -3.298  -24.988 1.00 0.00 ? 158 ALA A HB1  3  
ATOM   4445  H  HB2  . ALA A 1 4   ? 14.403  -3.073  -26.731 1.00 0.00 ? 158 ALA A HB2  3  
ATOM   4446  H  HB3  . ALA A 1 4   ? 13.137  -4.112  -26.079 1.00 0.00 ? 158 ALA A HB3  3  
ATOM   4447  N  N    . ASP A 1 5   ? 12.391  -0.114  -24.334 1.00 0.00 ? 159 ASP A N    3  
ATOM   4448  C  CA   . ASP A 1 5   ? 12.814  0.879   -23.301 1.00 0.00 ? 159 ASP A CA   3  
ATOM   4449  C  C    . ASP A 1 5   ? 11.751  0.980   -22.195 1.00 0.00 ? 159 ASP A C    3  
ATOM   4450  O  O    . ASP A 1 5   ? 10.913  1.861   -22.219 1.00 0.00 ? 159 ASP A O    3  
ATOM   4451  C  CB   . ASP A 1 5   ? 12.933  2.206   -24.051 1.00 0.00 ? 159 ASP A CB   3  
ATOM   4452  C  CG   . ASP A 1 5   ? 13.898  3.130   -23.306 1.00 0.00 ? 159 ASP A CG   3  
ATOM   4453  O  OD1  . ASP A 1 5   ? 13.753  3.256   -22.101 1.00 0.00 ? 159 ASP A OD1  3  
ATOM   4454  O  OD2  . ASP A 1 5   ? 14.766  3.695   -23.952 1.00 0.00 ? 159 ASP A OD2  3  
ATOM   4455  H  H    . ASP A 1 5   ? 11.472  -0.089  -24.681 1.00 0.00 ? 159 ASP A H    3  
ATOM   4456  H  HA   . ASP A 1 5   ? 13.769  0.604   -22.883 1.00 0.00 ? 159 ASP A HA   3  
ATOM   4457  H  HB2  . ASP A 1 5   ? 13.308  2.022   -25.049 1.00 0.00 ? 159 ASP A HB2  3  
ATOM   4458  H  HB3  . ASP A 1 5   ? 11.963  2.675   -24.112 1.00 0.00 ? 159 ASP A HB3  3  
ATOM   4459  N  N    . LYS A 1 6   ? 11.777  0.088   -21.225 1.00 0.00 ? 160 LYS A N    3  
ATOM   4460  C  CA   . LYS A 1 6   ? 10.765  0.145   -20.128 1.00 0.00 ? 160 LYS A CA   3  
ATOM   4461  C  C    . LYS A 1 6   ? 11.465  0.303   -18.768 1.00 0.00 ? 160 LYS A C    3  
ATOM   4462  O  O    . LYS A 1 6   ? 12.627  -0.028  -18.627 1.00 0.00 ? 160 LYS A O    3  
ATOM   4463  C  CB   . LYS A 1 6   ? 10.027  -1.192  -20.199 1.00 0.00 ? 160 LYS A CB   3  
ATOM   4464  C  CG   . LYS A 1 6   ? 9.026   -1.161  -21.356 1.00 0.00 ? 160 LYS A CG   3  
ATOM   4465  C  CD   . LYS A 1 6   ? 8.105   -2.380  -21.268 1.00 0.00 ? 160 LYS A CD   3  
ATOM   4466  C  CE   . LYS A 1 6   ? 7.049   -2.303  -22.372 1.00 0.00 ? 160 LYS A CE   3  
ATOM   4467  N  NZ   . LYS A 1 6   ? 7.755   -2.733  -23.610 1.00 0.00 ? 160 LYS A NZ   3  
ATOM   4468  H  H    . LYS A 1 6   ? 12.459  -0.619  -21.216 1.00 0.00 ? 160 LYS A H    3  
ATOM   4469  H  HA   . LYS A 1 6   ? 10.075  0.958   -20.294 1.00 0.00 ? 160 LYS A HA   3  
ATOM   4470  H  HB2  . LYS A 1 6   ? 10.740  -1.988  -20.360 1.00 0.00 ? 160 LYS A HB2  3  
ATOM   4471  H  HB3  . LYS A 1 6   ? 9.499   -1.362  -19.274 1.00 0.00 ? 160 LYS A HB3  3  
ATOM   4472  H  HG2  . LYS A 1 6   ? 8.436   -0.258  -21.298 1.00 0.00 ? 160 LYS A HG2  3  
ATOM   4473  H  HG3  . LYS A 1 6   ? 9.558   -1.183  -22.295 1.00 0.00 ? 160 LYS A HG3  3  
ATOM   4474  H  HD2  . LYS A 1 6   ? 8.689   -3.281  -21.388 1.00 0.00 ? 160 LYS A HD2  3  
ATOM   4475  H  HD3  . LYS A 1 6   ? 7.617   -2.393  -20.305 1.00 0.00 ? 160 LYS A HD3  3  
ATOM   4476  H  HE2  . LYS A 1 6   ? 6.227   -2.971  -22.152 1.00 0.00 ? 160 LYS A HE2  3  
ATOM   4477  H  HE3  . LYS A 1 6   ? 6.692   -1.290  -22.482 1.00 0.00 ? 160 LYS A HE3  3  
ATOM   4478  H  HZ1  . LYS A 1 6   ? 8.571   -2.110  -23.778 1.00 0.00 ? 160 LYS A HZ1  3  
ATOM   4479  H  HZ2  . LYS A 1 6   ? 7.103   -2.676  -24.419 1.00 0.00 ? 160 LYS A HZ2  3  
ATOM   4480  H  HZ3  . LYS A 1 6   ? 8.086   -3.711  -23.499 1.00 0.00 ? 160 LYS A HZ3  3  
ATOM   4481  N  N    . ARG A 1 7   ? 10.771  0.807   -17.767 1.00 0.00 ? 161 ARG A N    3  
ATOM   4482  C  CA   . ARG A 1 7   ? 11.409  0.980   -16.427 1.00 0.00 ? 161 ARG A CA   3  
ATOM   4483  C  C    . ARG A 1 7   ? 10.452  0.522   -15.317 1.00 0.00 ? 161 ARG A C    3  
ATOM   4484  O  O    . ARG A 1 7   ? 10.723  -0.436  -14.619 1.00 0.00 ? 161 ARG A O    3  
ATOM   4485  C  CB   . ARG A 1 7   ? 11.687  2.480   -16.312 1.00 0.00 ? 161 ARG A CB   3  
ATOM   4486  C  CG   . ARG A 1 7   ? 13.001  2.812   -17.020 1.00 0.00 ? 161 ARG A CG   3  
ATOM   4487  C  CD   . ARG A 1 7   ? 13.515  4.169   -16.535 1.00 0.00 ? 161 ARG A CD   3  
ATOM   4488  N  NE   . ARG A 1 7   ? 13.007  5.155   -17.536 1.00 0.00 ? 161 ARG A NE   3  
ATOM   4489  C  CZ   . ARG A 1 7   ? 13.505  5.211   -18.762 1.00 0.00 ? 161 ARG A CZ   3  
ATOM   4490  N  NH1  . ARG A 1 7   ? 14.470  4.406   -19.146 1.00 0.00 ? 161 ARG A NH1  3  
ATOM   4491  N  NH2  . ARG A 1 7   ? 13.033  6.085   -19.612 1.00 0.00 ? 161 ARG A NH2  3  
ATOM   4492  H  H    . ARG A 1 7   ? 9.832   1.072   -17.895 1.00 0.00 ? 161 ARG A H    3  
ATOM   4493  H  HA   . ARG A 1 7   ? 12.329  0.431   -16.376 1.00 0.00 ? 161 ARG A HA   3  
ATOM   4494  H  HB2  . ARG A 1 7   ? 10.880  3.032   -16.772 1.00 0.00 ? 161 ARG A HB2  3  
ATOM   4495  H  HB3  . ARG A 1 7   ? 11.763  2.753   -15.271 1.00 0.00 ? 161 ARG A HB3  3  
ATOM   4496  H  HG2  . ARG A 1 7   ? 13.733  2.048   -16.798 1.00 0.00 ? 161 ARG A HG2  3  
ATOM   4497  H  HG3  . ARG A 1 7   ? 12.836  2.852   -18.087 1.00 0.00 ? 161 ARG A HG3  3  
ATOM   4498  H  HD2  . ARG A 1 7   ? 13.122  4.389   -15.552 1.00 0.00 ? 161 ARG A HD2  3  
ATOM   4499  H  HD3  . ARG A 1 7   ? 14.595  4.181   -16.521 1.00 0.00 ? 161 ARG A HD3  3  
ATOM   4500  H  HE   . ARG A 1 7   ? 12.287  5.770   -17.277 1.00 0.00 ? 161 ARG A HE   3  
ATOM   4501  H  HH11 . ARG A 1 7   ? 14.848  3.731   -18.515 1.00 0.00 ? 161 ARG A HH11 3  
ATOM   4502  H  HH12 . ARG A 1 7   ? 14.828  4.471   -20.077 1.00 0.00 ? 161 ARG A HH12 3  
ATOM   4503  H  HH21 . ARG A 1 7   ? 12.299  6.706   -19.336 1.00 0.00 ? 161 ARG A HH21 3  
ATOM   4504  H  HH22 . ARG A 1 7   ? 13.406  6.133   -20.539 1.00 0.00 ? 161 ARG A HH22 3  
ATOM   4505  N  N    . GLY A 1 8   ? 9.337   1.198   -15.148 1.00 0.00 ? 162 GLY A N    3  
ATOM   4506  C  CA   . GLY A 1 8   ? 8.371   0.797   -14.082 1.00 0.00 ? 162 GLY A CA   3  
ATOM   4507  C  C    . GLY A 1 8   ? 6.938   0.880   -14.628 1.00 0.00 ? 162 GLY A C    3  
ATOM   4508  O  O    . GLY A 1 8   ? 6.556   0.108   -15.488 1.00 0.00 ? 162 GLY A O    3  
ATOM   4509  H  H    . GLY A 1 8   ? 9.134   1.969   -15.719 1.00 0.00 ? 162 GLY A H    3  
ATOM   4510  H  HA2  . GLY A 1 8   ? 8.581   -0.216  -13.769 1.00 0.00 ? 162 GLY A HA2  3  
ATOM   4511  H  HA3  . GLY A 1 8   ? 8.470   1.462   -13.238 1.00 0.00 ? 162 GLY A HA3  3  
ATOM   4512  N  N    . ASP A 1 9   ? 6.138   1.807   -14.138 1.00 0.00 ? 163 ASP A N    3  
ATOM   4513  C  CA   . ASP A 1 9   ? 4.735   1.925   -14.636 1.00 0.00 ? 163 ASP A CA   3  
ATOM   4514  C  C    . ASP A 1 9   ? 4.325   3.403   -14.722 1.00 0.00 ? 163 ASP A C    3  
ATOM   4515  O  O    . ASP A 1 9   ? 3.211   3.758   -14.382 1.00 0.00 ? 163 ASP A O    3  
ATOM   4516  C  CB   . ASP A 1 9   ? 3.885   1.190   -13.600 1.00 0.00 ? 163 ASP A CB   3  
ATOM   4517  C  CG   . ASP A 1 9   ? 2.675   0.555   -14.289 1.00 0.00 ? 163 ASP A CG   3  
ATOM   4518  O  OD1  . ASP A 1 9   ? 2.863   -0.433  -14.980 1.00 0.00 ? 163 ASP A OD1  3  
ATOM   4519  O  OD2  . ASP A 1 9   ? 1.581   1.067   -14.113 1.00 0.00 ? 163 ASP A OD2  3  
ATOM   4520  H  H    . ASP A 1 9   ? 6.458   2.424   -13.442 1.00 0.00 ? 163 ASP A H    3  
ATOM   4521  H  HA   . ASP A 1 9   ? 4.637   1.450   -15.599 1.00 0.00 ? 163 ASP A HA   3  
ATOM   4522  H  HB2  . ASP A 1 9   ? 4.478   0.420   -13.129 1.00 0.00 ? 163 ASP A HB2  3  
ATOM   4523  H  HB3  . ASP A 1 9   ? 3.543   1.890   -12.852 1.00 0.00 ? 163 ASP A HB3  3  
ATOM   4524  N  N    . GLY A 1 10  ? 5.210   4.270   -15.172 1.00 0.00 ? 164 GLY A N    3  
ATOM   4525  C  CA   . GLY A 1 10  ? 4.857   5.717   -15.273 1.00 0.00 ? 164 GLY A CA   3  
ATOM   4526  C  C    . GLY A 1 10  ? 5.327   6.451   -14.009 1.00 0.00 ? 164 GLY A C    3  
ATOM   4527  O  O    . GLY A 1 10  ? 6.063   5.901   -13.210 1.00 0.00 ? 164 GLY A O    3  
ATOM   4528  H  H    . GLY A 1 10  ? 6.106   3.971   -15.443 1.00 0.00 ? 164 GLY A H    3  
ATOM   4529  H  HA2  . GLY A 1 10  ? 5.340   6.145   -16.140 1.00 0.00 ? 164 GLY A HA2  3  
ATOM   4530  H  HA3  . GLY A 1 10  ? 3.787   5.821   -15.368 1.00 0.00 ? 164 GLY A HA3  3  
ATOM   4531  N  N    . LEU A 1 11  ? 4.914   7.688   -13.816 1.00 0.00 ? 165 LEU A N    3  
ATOM   4532  C  CA   . LEU A 1 11  ? 5.346   8.441   -12.600 1.00 0.00 ? 165 LEU A CA   3  
ATOM   4533  C  C    . LEU A 1 11  ? 4.207   9.336   -12.092 1.00 0.00 ? 165 LEU A C    3  
ATOM   4534  O  O    . LEU A 1 11  ? 3.755   9.192   -10.971 1.00 0.00 ? 165 LEU A O    3  
ATOM   4535  C  CB   . LEU A 1 11  ? 6.534   9.290   -13.062 1.00 0.00 ? 165 LEU A CB   3  
ATOM   4536  C  CG   . LEU A 1 11  ? 7.609   9.302   -11.973 1.00 0.00 ? 165 LEU A CG   3  
ATOM   4537  C  CD1  . LEU A 1 11  ? 8.411   8.001   -12.032 1.00 0.00 ? 165 LEU A CD1  3  
ATOM   4538  C  CD2  . LEU A 1 11  ? 8.548   10.490  -12.199 1.00 0.00 ? 165 LEU A CD2  3  
ATOM   4539  H  H    . LEU A 1 11  ? 4.320   8.122   -14.469 1.00 0.00 ? 165 LEU A H    3  
ATOM   4540  H  HA   . LEU A 1 11  ? 5.658   7.761   -11.831 1.00 0.00 ? 165 LEU A HA   3  
ATOM   4541  H  HB2  . LEU A 1 11  ? 6.945   8.871   -13.969 1.00 0.00 ? 165 LEU A HB2  3  
ATOM   4542  H  HB3  . LEU A 1 11  ? 6.204   10.300  -13.249 1.00 0.00 ? 165 LEU A HB3  3  
ATOM   4543  H  HG   . LEU A 1 11  ? 7.139   9.391   -11.004 1.00 0.00 ? 165 LEU A HG   3  
ATOM   4544  H  HD11 . LEU A 1 11  ? 8.958   7.957   -12.962 1.00 0.00 ? 165 LEU A HD11 3  
ATOM   4545  H  HD12 . LEU A 1 11  ? 7.736   7.160   -11.971 1.00 0.00 ? 165 LEU A HD12 3  
ATOM   4546  H  HD13 . LEU A 1 11  ? 9.104   7.968   -11.205 1.00 0.00 ? 165 LEU A HD13 3  
ATOM   4547  H  HD21 . LEU A 1 11  ? 9.163   10.634  -11.323 1.00 0.00 ? 165 LEU A HD21 3  
ATOM   4548  H  HD22 . LEU A 1 11  ? 7.964   11.380  -12.380 1.00 0.00 ? 165 LEU A HD22 3  
ATOM   4549  H  HD23 . LEU A 1 11  ? 9.178   10.292  -13.054 1.00 0.00 ? 165 LEU A HD23 3  
ATOM   4550  N  N    . HIS A 1 12  ? 3.738   10.258  -12.905 1.00 0.00 ? 166 HIS A N    3  
ATOM   4551  C  CA   . HIS A 1 12  ? 2.629   11.156  -12.462 1.00 0.00 ? 166 HIS A CA   3  
ATOM   4552  C  C    . HIS A 1 12  ? 1.635   11.376  -13.612 1.00 0.00 ? 166 HIS A C    3  
ATOM   4553  O  O    . HIS A 1 12  ? 1.975   11.203  -14.767 1.00 0.00 ? 166 HIS A O    3  
ATOM   4554  C  CB   . HIS A 1 12  ? 3.311   12.471  -12.083 1.00 0.00 ? 166 HIS A CB   3  
ATOM   4555  C  CG   . HIS A 1 12  ? 2.381   13.288  -11.229 1.00 0.00 ? 166 HIS A CG   3  
ATOM   4556  N  ND1  . HIS A 1 12  ? 2.174   13.011  -9.888  1.00 0.00 ? 166 HIS A ND1  3  
ATOM   4557  C  CD2  . HIS A 1 12  ? 1.596   14.378  -11.513 1.00 0.00 ? 166 HIS A CD2  3  
ATOM   4558  C  CE1  . HIS A 1 12  ? 1.295   13.916  -9.418  1.00 0.00 ? 166 HIS A CE1  3  
ATOM   4559  N  NE2  . HIS A 1 12  ? 0.910   14.772  -10.368 1.00 0.00 ? 166 HIS A NE2  3  
ATOM   4560  H  H    . HIS A 1 12  ? 4.114   10.360  -13.804 1.00 0.00 ? 166 HIS A H    3  
ATOM   4561  H  HA   . HIS A 1 12  ? 2.127   10.740  -11.602 1.00 0.00 ? 166 HIS A HA   3  
ATOM   4562  H  HB2  . HIS A 1 12  ? 4.216   12.262  -11.532 1.00 0.00 ? 166 HIS A HB2  3  
ATOM   4563  H  HB3  . HIS A 1 12  ? 3.554   13.022  -12.980 1.00 0.00 ? 166 HIS A HB3  3  
ATOM   4564  H  HD1  . HIS A 1 12  ? 2.591   12.288  -9.374  1.00 0.00 ? 166 HIS A HD1  3  
ATOM   4565  H  HD2  . HIS A 1 12  ? 1.522   14.857  -12.478 1.00 0.00 ? 166 HIS A HD2  3  
ATOM   4566  H  HE1  . HIS A 1 12  ? 0.943   13.945  -8.397  1.00 0.00 ? 166 HIS A HE1  3  
ATOM   4567  N  N    . GLY A 1 13  ? 0.408   11.754  -13.311 1.00 0.00 ? 167 GLY A N    3  
ATOM   4568  C  CA   . GLY A 1 13  ? -0.593  11.977  -14.397 1.00 0.00 ? 167 GLY A CA   3  
ATOM   4569  C  C    . GLY A 1 13  ? -1.576  10.797  -14.452 1.00 0.00 ? 167 GLY A C    3  
ATOM   4570  O  O    . GLY A 1 13  ? -2.759  10.984  -14.673 1.00 0.00 ? 167 GLY A O    3  
ATOM   4571  H  H    . GLY A 1 13  ? 0.144   11.889  -12.374 1.00 0.00 ? 167 GLY A H    3  
ATOM   4572  H  HA2  . GLY A 1 13  ? -1.137  12.890  -14.202 1.00 0.00 ? 167 GLY A HA2  3  
ATOM   4573  H  HA3  . GLY A 1 13  ? -0.083  12.059  -15.345 1.00 0.00 ? 167 GLY A HA3  3  
ATOM   4574  N  N    . ILE A 1 14  ? -1.105  9.580   -14.255 1.00 0.00 ? 168 ILE A N    3  
ATOM   4575  C  CA   . ILE A 1 14  ? -2.031  8.402   -14.299 1.00 0.00 ? 168 ILE A CA   3  
ATOM   4576  C  C    . ILE A 1 14  ? -2.288  7.876   -12.880 1.00 0.00 ? 168 ILE A C    3  
ATOM   4577  O  O    . ILE A 1 14  ? -1.519  8.131   -11.971 1.00 0.00 ? 168 ILE A O    3  
ATOM   4578  C  CB   . ILE A 1 14  ? -1.312  7.342   -15.147 1.00 0.00 ? 168 ILE A CB   3  
ATOM   4579  C  CG1  . ILE A 1 14  ? -1.030  7.908   -16.542 1.00 0.00 ? 168 ILE A CG1  3  
ATOM   4580  C  CG2  . ILE A 1 14  ? -2.195  6.098   -15.276 1.00 0.00 ? 168 ILE A CG2  3  
ATOM   4581  C  CD1  . ILE A 1 14  ? 0.357   8.553   -16.561 1.00 0.00 ? 168 ILE A CD1  3  
ATOM   4582  H  H    . ILE A 1 14  ? -0.148  9.440   -14.075 1.00 0.00 ? 168 ILE A H    3  
ATOM   4583  H  HA   . ILE A 1 14  ? -2.965  8.671   -14.765 1.00 0.00 ? 168 ILE A HA   3  
ATOM   4584  H  HB   . ILE A 1 14  ? -0.380  7.073   -14.671 1.00 0.00 ? 168 ILE A HB   3  
ATOM   4585  H  HG12 . ILE A 1 14  ? -1.067  7.109   -17.269 1.00 0.00 ? 168 ILE A HG12 3  
ATOM   4586  H  HG13 . ILE A 1 14  ? -1.774  8.651   -16.786 1.00 0.00 ? 168 ILE A HG13 3  
ATOM   4587  H  HG21 . ILE A 1 14  ? -1.767  5.428   -16.007 1.00 0.00 ? 168 ILE A HG21 3  
ATOM   4588  H  HG22 . ILE A 1 14  ? -3.185  6.390   -15.590 1.00 0.00 ? 168 ILE A HG22 3  
ATOM   4589  H  HG23 . ILE A 1 14  ? -2.253  5.598   -14.320 1.00 0.00 ? 168 ILE A HG23 3  
ATOM   4590  H  HD11 . ILE A 1 14  ? 0.765   8.500   -17.560 1.00 0.00 ? 168 ILE A HD11 3  
ATOM   4591  H  HD12 . ILE A 1 14  ? 1.008   8.027   -15.878 1.00 0.00 ? 168 ILE A HD12 3  
ATOM   4592  H  HD13 . ILE A 1 14  ? 0.278   9.587   -16.260 1.00 0.00 ? 168 ILE A HD13 3  
ATOM   4593  N  N    . VAL A 1 15  ? -3.361  7.141   -12.684 1.00 0.00 ? 169 VAL A N    3  
ATOM   4594  C  CA   . VAL A 1 15  ? -3.659  6.598   -11.319 1.00 0.00 ? 169 VAL A CA   3  
ATOM   4595  C  C    . VAL A 1 15  ? -3.242  5.122   -11.246 1.00 0.00 ? 169 VAL A C    3  
ATOM   4596  O  O    . VAL A 1 15  ? -3.395  4.388   -12.205 1.00 0.00 ? 169 VAL A O    3  
ATOM   4597  C  CB   . VAL A 1 15  ? -5.176  6.741   -11.130 1.00 0.00 ? 169 VAL A CB   3  
ATOM   4598  C  CG1  . VAL A 1 15  ? -5.569  6.240   -9.739  1.00 0.00 ? 169 VAL A CG1  3  
ATOM   4599  C  CG2  . VAL A 1 15  ? -5.573  8.213   -11.269 1.00 0.00 ? 169 VAL A CG2  3  
ATOM   4600  H  H    . VAL A 1 15  ? -3.967  6.942   -13.437 1.00 0.00 ? 169 VAL A H    3  
ATOM   4601  H  HA   . VAL A 1 15  ? -3.139  7.171   -10.568 1.00 0.00 ? 169 VAL A HA   3  
ATOM   4602  H  HB   . VAL A 1 15  ? -5.688  6.155   -11.880 1.00 0.00 ? 169 VAL A HB   3  
ATOM   4603  H  HG11 . VAL A 1 15  ? -6.453  6.764   -9.404  1.00 0.00 ? 169 VAL A HG11 3  
ATOM   4604  H  HG12 . VAL A 1 15  ? -4.759  6.423   -9.048  1.00 0.00 ? 169 VAL A HG12 3  
ATOM   4605  H  HG13 . VAL A 1 15  ? -5.773  5.181   -9.781  1.00 0.00 ? 169 VAL A HG13 3  
ATOM   4606  H  HG21 . VAL A 1 15  ? -6.543  8.368   -10.817 1.00 0.00 ? 169 VAL A HG21 3  
ATOM   4607  H  HG22 . VAL A 1 15  ? -5.619  8.476   -12.316 1.00 0.00 ? 169 VAL A HG22 3  
ATOM   4608  H  HG23 . VAL A 1 15  ? -4.841  8.832   -10.773 1.00 0.00 ? 169 VAL A HG23 3  
ATOM   4609  N  N    . SER A 1 16  ? -2.711  4.678   -10.124 1.00 0.00 ? 170 SER A N    3  
ATOM   4610  C  CA   . SER A 1 16  ? -2.286  3.250   -10.019 1.00 0.00 ? 170 SER A CA   3  
ATOM   4611  C  C    . SER A 1 16  ? -2.362  2.754   -8.569  1.00 0.00 ? 170 SER A C    3  
ATOM   4612  O  O    . SER A 1 16  ? -2.257  3.528   -7.637  1.00 0.00 ? 170 SER A O    3  
ATOM   4613  C  CB   . SER A 1 16  ? -0.841  3.231   -10.516 1.00 0.00 ? 170 SER A CB   3  
ATOM   4614  O  OG   . SER A 1 16  ? -0.502  1.911   -10.918 1.00 0.00 ? 170 SER A OG   3  
ATOM   4615  H  H    . SER A 1 16  ? -2.588  5.283   -9.358  1.00 0.00 ? 170 SER A H    3  
ATOM   4616  H  HA   . SER A 1 16  ? -2.897  2.631   -10.650 1.00 0.00 ? 170 SER A HA   3  
ATOM   4617  H  HB2  . SER A 1 16  ? -0.739  3.896   -11.358 1.00 0.00 ? 170 SER A HB2  3  
ATOM   4618  H  HB3  . SER A 1 16  ? -0.184  3.557   -9.720  1.00 0.00 ? 170 SER A HB3  3  
ATOM   4619  H  HG   . SER A 1 16  ? -0.295  1.403   -10.129 1.00 0.00 ? 170 SER A HG   3  
ATOM   4620  N  N    . CYS A 1 17  ? -2.538  1.463   -8.376  1.00 0.00 ? 171 CYS A N    3  
ATOM   4621  C  CA   . CYS A 1 17  ? -2.609  0.920   -6.977  1.00 0.00 ? 171 CYS A CA   3  
ATOM   4622  C  C    . CYS A 1 17  ? -1.202  0.561   -6.480  1.00 0.00 ? 171 CYS A C    3  
ATOM   4623  O  O    . CYS A 1 17  ? -0.408  -0.000  -7.215  1.00 0.00 ? 171 CYS A O    3  
ATOM   4624  C  CB   . CYS A 1 17  ? -3.483  -0.338  -7.044  1.00 0.00 ? 171 CYS A CB   3  
ATOM   4625  S  SG   . CYS A 1 17  ? -3.759  -0.963  -5.369  1.00 0.00 ? 171 CYS A SG   3  
ATOM   4626  H  H    . CYS A 1 17  ? -2.611  0.854   -9.151  1.00 0.00 ? 171 CYS A H    3  
ATOM   4627  H  HA   . CYS A 1 17  ? -3.064  1.645   -6.317  1.00 0.00 ? 171 CYS A HA   3  
ATOM   4628  H  HB2  . CYS A 1 17  ? -4.430  -0.099  -7.502  1.00 0.00 ? 171 CYS A HB2  3  
ATOM   4629  H  HB3  . CYS A 1 17  ? -2.979  -1.091  -7.628  1.00 0.00 ? 171 CYS A HB3  3  
ATOM   4630  N  N    . THR A 1 18  ? -0.885  0.880   -5.240  1.00 0.00 ? 172 THR A N    3  
ATOM   4631  C  CA   . THR A 1 18  ? 0.485   0.550   -4.705  1.00 0.00 ? 172 THR A CA   3  
ATOM   4632  C  C    . THR A 1 18  ? 0.577   -0.938  -4.311  1.00 0.00 ? 172 THR A C    3  
ATOM   4633  O  O    . THR A 1 18  ? 1.602   -1.567  -4.504  1.00 0.00 ? 172 THR A O    3  
ATOM   4634  C  CB   . THR A 1 18  ? 0.714   1.462   -3.476  1.00 0.00 ? 172 THR A CB   3  
ATOM   4635  O  OG1  . THR A 1 18  ? 2.075   1.372   -3.081  1.00 0.00 ? 172 THR A OG1  3  
ATOM   4636  C  CG2  . THR A 1 18  ? -0.183  1.044   -2.296  1.00 0.00 ? 172 THR A CG2  3  
ATOM   4637  H  H    . THR A 1 18  ? -1.547  1.332   -4.667  1.00 0.00 ? 172 THR A H    3  
ATOM   4638  H  HA   . THR A 1 18  ? 1.228   0.771   -5.457  1.00 0.00 ? 172 THR A HA   3  
ATOM   4639  H  HB   . THR A 1 18  ? 0.491   2.483   -3.745  1.00 0.00 ? 172 THR A HB   3  
ATOM   4640  H  HG1  . THR A 1 18  ? 2.604   1.850   -3.724  1.00 0.00 ? 172 THR A HG1  3  
ATOM   4641  H  HG21 . THR A 1 18  ? 0.163   0.101   -1.899  1.00 0.00 ? 172 THR A HG21 3  
ATOM   4642  H  HG22 . THR A 1 18  ? -1.202  0.938   -2.630  1.00 0.00 ? 172 THR A HG22 3  
ATOM   4643  H  HG23 . THR A 1 18  ? -0.140  1.795   -1.523  1.00 0.00 ? 172 THR A HG23 3  
ATOM   4644  N  N    . ALA A 1 19  ? -0.477  -1.507  -3.762  1.00 0.00 ? 173 ALA A N    3  
ATOM   4645  C  CA   . ALA A 1 19  ? -0.416  -2.960  -3.367  1.00 0.00 ? 173 ALA A CA   3  
ATOM   4646  C  C    . ALA A 1 19  ? -0.428  -3.865  -4.615  1.00 0.00 ? 173 ALA A C    3  
ATOM   4647  O  O    . ALA A 1 19  ? 0.123   -4.950  -4.595  1.00 0.00 ? 173 ALA A O    3  
ATOM   4648  C  CB   . ALA A 1 19  ? -1.650  -3.226  -2.488  1.00 0.00 ? 173 ALA A CB   3  
ATOM   4649  H  H    . ALA A 1 19  ? -1.300  -0.984  -3.616  1.00 0.00 ? 173 ALA A H    3  
ATOM   4650  H  HA   . ALA A 1 19  ? 0.478   -3.143  -2.796  1.00 0.00 ? 173 ALA A HA   3  
ATOM   4651  H  HB1  . ALA A 1 19  ? -1.905  -4.274  -2.530  1.00 0.00 ? 173 ALA A HB1  3  
ATOM   4652  H  HB2  . ALA A 1 19  ? -2.482  -2.636  -2.847  1.00 0.00 ? 173 ALA A HB2  3  
ATOM   4653  H  HB3  . ALA A 1 19  ? -1.429  -2.947  -1.465  1.00 0.00 ? 173 ALA A HB3  3  
ATOM   4654  N  N    . CYS A 1 20  ? -1.041  -3.436  -5.703  1.00 0.00 ? 174 CYS A N    3  
ATOM   4655  C  CA   . CYS A 1 20  ? -1.065  -4.285  -6.938  1.00 0.00 ? 174 CYS A CA   3  
ATOM   4656  C  C    . CYS A 1 20  ? 0.045   -3.857  -7.913  1.00 0.00 ? 174 CYS A C    3  
ATOM   4657  O  O    . CYS A 1 20  ? 0.627   -4.684  -8.590  1.00 0.00 ? 174 CYS A O    3  
ATOM   4658  C  CB   . CYS A 1 20  ? -2.440  -4.055  -7.575  1.00 0.00 ? 174 CYS A CB   3  
ATOM   4659  S  SG   . CYS A 1 20  ? -3.737  -4.653  -6.466  1.00 0.00 ? 174 CYS A SG   3  
ATOM   4660  H  H    . CYS A 1 20  ? -1.477  -2.561  -5.711  1.00 0.00 ? 174 CYS A H    3  
ATOM   4661  H  HA   . CYS A 1 20  ? -0.950  -5.319  -6.682  1.00 0.00 ? 174 CYS A HA   3  
ATOM   4662  H  HB2  . CYS A 1 20  ? -2.580  -3.002  -7.755  1.00 0.00 ? 174 CYS A HB2  3  
ATOM   4663  H  HB3  . CYS A 1 20  ? -2.493  -4.586  -8.509  1.00 0.00 ? 174 CYS A HB3  3  
ATOM   4664  N  N    . GLY A 1 21  ? 0.333   -2.576  -8.008  1.00 0.00 ? 175 GLY A N    3  
ATOM   4665  C  CA   . GLY A 1 21  ? 1.387   -2.111  -8.953  1.00 0.00 ? 175 GLY A CA   3  
ATOM   4666  C  C    . GLY A 1 21  ? 0.775   -1.985  -10.356 1.00 0.00 ? 175 GLY A C    3  
ATOM   4667  O  O    . GLY A 1 21  ? 1.401   -2.335  -11.339 1.00 0.00 ? 175 GLY A O    3  
ATOM   4668  H  H    . GLY A 1 21  ? -0.151  -1.916  -7.470  1.00 0.00 ? 175 GLY A H    3  
ATOM   4669  H  HA2  . GLY A 1 21  ? 1.764   -1.149  -8.631  1.00 0.00 ? 175 GLY A HA2  3  
ATOM   4670  H  HA3  . GLY A 1 21  ? 2.193   -2.827  -8.978  1.00 0.00 ? 175 GLY A HA3  3  
ATOM   4671  N  N    . GLN A 1 22  ? -0.448  -1.497  -10.459 1.00 0.00 ? 176 GLN A N    3  
ATOM   4672  C  CA   . GLN A 1 22  ? -1.085  -1.367  -11.809 1.00 0.00 ? 176 GLN A CA   3  
ATOM   4673  C  C    . GLN A 1 22  ? -2.258  -0.372  -11.776 1.00 0.00 ? 176 GLN A C    3  
ATOM   4674  O  O    . GLN A 1 22  ? -2.829  -0.112  -10.735 1.00 0.00 ? 176 GLN A O    3  
ATOM   4675  C  CB   . GLN A 1 22  ? -1.589  -2.773  -12.142 1.00 0.00 ? 176 GLN A CB   3  
ATOM   4676  C  CG   . GLN A 1 22  ? -0.526  -3.519  -12.949 1.00 0.00 ? 176 GLN A CG   3  
ATOM   4677  C  CD   . GLN A 1 22  ? -1.203  -4.548  -13.862 1.00 0.00 ? 176 GLN A CD   3  
ATOM   4678  O  OE1  . GLN A 1 22  ? -1.506  -5.644  -13.435 1.00 0.00 ? 176 GLN A OE1  3  
ATOM   4679  N  NE2  . GLN A 1 22  ? -1.457  -4.246  -15.113 1.00 0.00 ? 176 GLN A NE2  3  
ATOM   4680  H  H    . GLN A 1 22  ? -0.946  -1.224  -9.652  1.00 0.00 ? 176 GLN A H    3  
ATOM   4681  H  HA   . GLN A 1 22  ? -0.359  -1.058  -12.543 1.00 0.00 ? 176 GLN A HA   3  
ATOM   4682  H  HB2  . GLN A 1 22  ? -1.790  -3.309  -11.225 1.00 0.00 ? 176 GLN A HB2  3  
ATOM   4683  H  HB3  . GLN A 1 22  ? -2.496  -2.701  -12.723 1.00 0.00 ? 176 GLN A HB3  3  
ATOM   4684  H  HG2  . GLN A 1 22  ? 0.030   -2.813  -13.549 1.00 0.00 ? 176 GLN A HG2  3  
ATOM   4685  H  HG3  . GLN A 1 22  ? 0.147   -4.027  -12.275 1.00 0.00 ? 176 GLN A HG3  3  
ATOM   4686  H  HE21 . GLN A 1 22  ? -1.217  -3.363  -15.470 1.00 0.00 ? 176 GLN A HE21 3  
ATOM   4687  H  HE22 . GLN A 1 22  ? -1.890  -4.906  -15.694 1.00 0.00 ? 176 GLN A HE22 3  
ATOM   4688  N  N    . GLN A 1 23  ? -2.619  0.186   -12.915 1.00 0.00 ? 177 GLN A N    3  
ATOM   4689  C  CA   . GLN A 1 23  ? -3.765  1.170   -12.942 1.00 0.00 ? 177 GLN A CA   3  
ATOM   4690  C  C    . GLN A 1 23  ? -5.037  0.531   -12.365 1.00 0.00 ? 177 GLN A C    3  
ATOM   4691  O  O    . GLN A 1 23  ? -5.206  -0.673  -12.415 1.00 0.00 ? 177 GLN A O    3  
ATOM   4692  C  CB   . GLN A 1 23  ? -3.989  1.547   -14.415 1.00 0.00 ? 177 GLN A CB   3  
ATOM   4693  C  CG   . GLN A 1 23  ? -4.956  2.729   -14.499 1.00 0.00 ? 177 GLN A CG   3  
ATOM   4694  C  CD   . GLN A 1 23  ? -5.226  3.067   -15.970 1.00 0.00 ? 177 GLN A CD   3  
ATOM   4695  O  OE1  . GLN A 1 23  ? -5.441  2.183   -16.774 1.00 0.00 ? 177 GLN A OE1  3  
ATOM   4696  N  NE2  . GLN A 1 23  ? -5.225  4.319   -16.364 1.00 0.00 ? 177 GLN A NE2  3  
ATOM   4697  H  H    . GLN A 1 23  ? -2.136  -0.042  -13.746 1.00 0.00 ? 177 GLN A H    3  
ATOM   4698  H  HA   . GLN A 1 23  ? -3.511  2.052   -12.377 1.00 0.00 ? 177 GLN A HA   3  
ATOM   4699  H  HB2  . GLN A 1 23  ? -3.044  1.821   -14.864 1.00 0.00 ? 177 GLN A HB2  3  
ATOM   4700  H  HB3  . GLN A 1 23  ? -4.408  0.704   -14.943 1.00 0.00 ? 177 GLN A HB3  3  
ATOM   4701  H  HG2  . GLN A 1 23  ? -5.885  2.469   -14.012 1.00 0.00 ? 177 GLN A HG2  3  
ATOM   4702  H  HG3  . GLN A 1 23  ? -4.521  3.586   -14.008 1.00 0.00 ? 177 GLN A HG3  3  
ATOM   4703  H  HE21 . GLN A 1 23  ? -5.054  5.042   -15.722 1.00 0.00 ? 177 GLN A HE21 3  
ATOM   4704  H  HE22 . GLN A 1 23  ? -5.398  4.533   -17.304 1.00 0.00 ? 177 GLN A HE22 3  
ATOM   4705  N  N    . VAL A 1 24  ? -5.940  1.327   -11.827 1.00 0.00 ? 178 VAL A N    3  
ATOM   4706  C  CA   . VAL A 1 24  ? -7.204  0.744   -11.258 1.00 0.00 ? 178 VAL A CA   3  
ATOM   4707  C  C    . VAL A 1 24  ? -8.261  0.626   -12.368 1.00 0.00 ? 178 VAL A C    3  
ATOM   4708  O  O    . VAL A 1 24  ? -8.152  1.267   -13.396 1.00 0.00 ? 178 VAL A O    3  
ATOM   4709  C  CB   . VAL A 1 24  ? -7.679  1.708   -10.155 1.00 0.00 ? 178 VAL A CB   3  
ATOM   4710  C  CG1  . VAL A 1 24  ? -8.920  1.131   -9.472  1.00 0.00 ? 178 VAL A CG1  3  
ATOM   4711  C  CG2  . VAL A 1 24  ? -6.567  1.884   -9.117  1.00 0.00 ? 178 VAL A CG2  3  
ATOM   4712  H  H    . VAL A 1 24  ? -5.786  2.303   -11.804 1.00 0.00 ? 178 VAL A H    3  
ATOM   4713  H  HA   . VAL A 1 24  ? -7.004  -0.228  -10.834 1.00 0.00 ? 178 VAL A HA   3  
ATOM   4714  H  HB   . VAL A 1 24  ? -7.922  2.666   -10.591 1.00 0.00 ? 178 VAL A HB   3  
ATOM   4715  H  HG11 . VAL A 1 24  ? -9.049  1.599   -8.508  1.00 0.00 ? 178 VAL A HG11 3  
ATOM   4716  H  HG12 . VAL A 1 24  ? -8.796  0.066   -9.341  1.00 0.00 ? 178 VAL A HG12 3  
ATOM   4717  H  HG13 . VAL A 1 24  ? -9.789  1.320   -10.083 1.00 0.00 ? 178 VAL A HG13 3  
ATOM   4718  H  HG21 . VAL A 1 24  ? -5.915  2.689   -9.421  1.00 0.00 ? 178 VAL A HG21 3  
ATOM   4719  H  HG22 . VAL A 1 24  ? -5.998  0.969   -9.041  1.00 0.00 ? 178 VAL A HG22 3  
ATOM   4720  H  HG23 . VAL A 1 24  ? -7.004  2.116   -8.158  1.00 0.00 ? 178 VAL A HG23 3  
ATOM   4721  N  N    . ASN A 1 25  ? -9.277  -0.197  -12.181 1.00 0.00 ? 179 ASN A N    3  
ATOM   4722  C  CA   . ASN A 1 25  ? -10.329 -0.353  -13.257 1.00 0.00 ? 179 ASN A CA   3  
ATOM   4723  C  C    . ASN A 1 25  ? -10.905 1.017   -13.663 1.00 0.00 ? 179 ASN A C    3  
ATOM   4724  O  O    . ASN A 1 25  ? -11.844 1.500   -13.061 1.00 0.00 ? 179 ASN A O    3  
ATOM   4725  C  CB   . ASN A 1 25  ? -11.442 -1.231  -12.663 1.00 0.00 ? 179 ASN A CB   3  
ATOM   4726  C  CG   . ASN A 1 25  ? -12.384 -1.690  -13.782 1.00 0.00 ? 179 ASN A CG   3  
ATOM   4727  O  OD1  . ASN A 1 25  ? -13.342 -1.013  -14.095 1.00 0.00 ? 179 ASN A OD1  3  
ATOM   4728  N  ND2  . ASN A 1 25  ? -12.156 -2.821  -14.406 1.00 0.00 ? 179 ASN A ND2  3  
ATOM   4729  H  H    . ASN A 1 25  ? -9.338  -0.718  -11.345 1.00 0.00 ? 179 ASN A H    3  
ATOM   4730  H  HA   . ASN A 1 25  ? -9.903  -0.842  -14.120 1.00 0.00 ? 179 ASN A HA   3  
ATOM   4731  H  HB2  . ASN A 1 25  ? -11.002 -2.094  -12.185 1.00 0.00 ? 179 ASN A HB2  3  
ATOM   4732  H  HB3  . ASN A 1 25  ? -12.000 -0.662  -11.936 1.00 0.00 ? 179 ASN A HB3  3  
ATOM   4733  H  HD21 . ASN A 1 25  ? -11.385 -3.377  -14.162 1.00 0.00 ? 179 ASN A HD21 3  
ATOM   4734  H  HD22 . ASN A 1 25  ? -12.761 -3.112  -15.121 1.00 0.00 ? 179 ASN A HD22 3  
ATOM   4735  N  N    . HIS A 1 26  ? -10.356 1.645   -14.690 1.00 0.00 ? 180 HIS A N    3  
ATOM   4736  C  CA   . HIS A 1 26  ? -10.878 2.977   -15.140 1.00 0.00 ? 180 HIS A CA   3  
ATOM   4737  C  C    . HIS A 1 26  ? -10.986 3.960   -13.958 1.00 0.00 ? 180 HIS A C    3  
ATOM   4738  O  O    . HIS A 1 26  ? -10.596 3.646   -12.850 1.00 0.00 ? 180 HIS A O    3  
ATOM   4739  C  CB   . HIS A 1 26  ? -12.266 2.685   -15.721 1.00 0.00 ? 180 HIS A CB   3  
ATOM   4740  C  CG   . HIS A 1 26  ? -12.512 3.565   -16.916 1.00 0.00 ? 180 HIS A CG   3  
ATOM   4741  N  ND1  . HIS A 1 26  ? -13.765 4.076   -17.211 1.00 0.00 ? 180 HIS A ND1  3  
ATOM   4742  C  CD2  . HIS A 1 26  ? -11.675 4.032   -17.899 1.00 0.00 ? 180 HIS A CD2  3  
ATOM   4743  C  CE1  . HIS A 1 26  ? -13.649 4.815   -18.330 1.00 0.00 ? 180 HIS A CE1  3  
ATOM   4744  N  NE2  . HIS A 1 26  ? -12.395 4.822   -18.792 1.00 0.00 ? 180 HIS A NE2  3  
ATOM   4745  H  H    . HIS A 1 26  ? -9.602  1.238   -15.171 1.00 0.00 ? 180 HIS A H    3  
ATOM   4746  H  HA   . HIS A 1 26  ? -10.240 3.386   -15.907 1.00 0.00 ? 180 HIS A HA   3  
ATOM   4747  H  HB2  . HIS A 1 26  ? -12.317 1.648   -16.021 1.00 0.00 ? 180 HIS A HB2  3  
ATOM   4748  H  HB3  . HIS A 1 26  ? -13.018 2.880   -14.971 1.00 0.00 ? 180 HIS A HB3  3  
ATOM   4749  H  HD1  . HIS A 1 26  ? -14.587 3.929   -16.698 1.00 0.00 ? 180 HIS A HD1  3  
ATOM   4750  H  HD2  . HIS A 1 26  ? -10.618 3.819   -17.970 1.00 0.00 ? 180 HIS A HD2  3  
ATOM   4751  H  HE1  . HIS A 1 26  ? -14.469 5.339   -18.798 1.00 0.00 ? 180 HIS A HE1  3  
ATOM   4752  N  N    . PHE A 1 27  ? -11.519 5.145   -14.186 1.00 0.00 ? 181 PHE A N    3  
ATOM   4753  C  CA   . PHE A 1 27  ? -11.655 6.134   -13.074 1.00 0.00 ? 181 PHE A CA   3  
ATOM   4754  C  C    . PHE A 1 27  ? -13.144 6.360   -12.762 1.00 0.00 ? 181 PHE A C    3  
ATOM   4755  O  O    . PHE A 1 27  ? -13.806 7.138   -13.422 1.00 0.00 ? 181 PHE A O    3  
ATOM   4756  C  CB   . PHE A 1 27  ? -10.999 7.419   -13.600 1.00 0.00 ? 181 PHE A CB   3  
ATOM   4757  C  CG   . PHE A 1 27  ? -11.131 8.533   -12.580 1.00 0.00 ? 181 PHE A CG   3  
ATOM   4758  C  CD1  . PHE A 1 27  ? -10.769 8.317   -11.243 1.00 0.00 ? 181 PHE A CD1  3  
ATOM   4759  C  CD2  . PHE A 1 27  ? -11.614 9.785   -12.979 1.00 0.00 ? 181 PHE A CD2  3  
ATOM   4760  C  CE1  . PHE A 1 27  ? -10.891 9.352   -10.308 1.00 0.00 ? 181 PHE A CE1  3  
ATOM   4761  C  CE2  . PHE A 1 27  ? -11.734 10.820  -12.043 1.00 0.00 ? 181 PHE A CE2  3  
ATOM   4762  C  CZ   . PHE A 1 27  ? -11.373 10.603  -10.709 1.00 0.00 ? 181 PHE A CZ   3  
ATOM   4763  H  H    . PHE A 1 27  ? -11.835 5.384   -15.086 1.00 0.00 ? 181 PHE A H    3  
ATOM   4764  H  HA   . PHE A 1 27  ? -11.134 5.786   -12.195 1.00 0.00 ? 181 PHE A HA   3  
ATOM   4765  H  HB2  . PHE A 1 27  ? -9.953  7.233   -13.792 1.00 0.00 ? 181 PHE A HB2  3  
ATOM   4766  H  HB3  . PHE A 1 27  ? -11.483 7.717   -14.517 1.00 0.00 ? 181 PHE A HB3  3  
ATOM   4767  H  HD1  . PHE A 1 27  ? -10.397 7.352   -10.931 1.00 0.00 ? 181 PHE A HD1  3  
ATOM   4768  H  HD2  . PHE A 1 27  ? -11.893 9.955   -14.008 1.00 0.00 ? 181 PHE A HD2  3  
ATOM   4769  H  HE1  . PHE A 1 27  ? -10.613 9.186   -9.278  1.00 0.00 ? 181 PHE A HE1  3  
ATOM   4770  H  HE2  . PHE A 1 27  ? -12.106 11.786  -12.352 1.00 0.00 ? 181 PHE A HE2  3  
ATOM   4771  H  HZ   . PHE A 1 27  ? -11.467 11.401  -9.989  1.00 0.00 ? 181 PHE A HZ   3  
ATOM   4772  N  N    . GLN A 1 28  ? -13.675 5.686   -11.763 1.00 0.00 ? 182 GLN A N    3  
ATOM   4773  C  CA   . GLN A 1 28  ? -15.119 5.869   -11.419 1.00 0.00 ? 182 GLN A CA   3  
ATOM   4774  C  C    . GLN A 1 28  ? -15.251 6.662   -10.110 1.00 0.00 ? 182 GLN A C    3  
ATOM   4775  O  O    . GLN A 1 28  ? -14.395 6.589   -9.249  1.00 0.00 ? 182 GLN A O    3  
ATOM   4776  C  CB   . GLN A 1 28  ? -15.680 4.454   -11.257 1.00 0.00 ? 182 GLN A CB   3  
ATOM   4777  C  CG   . GLN A 1 28  ? -17.179 4.520   -10.963 1.00 0.00 ? 182 GLN A CG   3  
ATOM   4778  C  CD   . GLN A 1 28  ? -17.957 4.605   -12.281 1.00 0.00 ? 182 GLN A CD   3  
ATOM   4779  O  OE1  . GLN A 1 28  ? -18.412 5.666   -12.659 1.00 0.00 ? 182 GLN A OE1  3  
ATOM   4780  N  NE2  . GLN A 1 28  ? -18.134 3.527   -13.008 1.00 0.00 ? 182 GLN A NE2  3  
ATOM   4781  H  H    . GLN A 1 28  ? -13.124 5.061   -11.238 1.00 0.00 ? 182 GLN A H    3  
ATOM   4782  H  HA   . GLN A 1 28  ? -15.632 6.379   -12.220 1.00 0.00 ? 182 GLN A HA   3  
ATOM   4783  H  HB2  . GLN A 1 28  ? -15.515 3.895   -12.166 1.00 0.00 ? 182 GLN A HB2  3  
ATOM   4784  H  HB3  . GLN A 1 28  ? -15.180 3.962   -10.439 1.00 0.00 ? 182 GLN A HB3  3  
ATOM   4785  H  HG2  . GLN A 1 28  ? -17.477 3.633   -10.422 1.00 0.00 ? 182 GLN A HG2  3  
ATOM   4786  H  HG3  . GLN A 1 28  ? -17.390 5.392   -10.366 1.00 0.00 ? 182 GLN A HG3  3  
ATOM   4787  H  HE21 . GLN A 1 28  ? -17.771 2.664   -12.713 1.00 0.00 ? 182 GLN A HE21 3  
ATOM   4788  H  HE22 . GLN A 1 28  ? -18.632 3.584   -13.849 1.00 0.00 ? 182 GLN A HE22 3  
ATOM   4789  N  N    . LYS A 1 29  ? -16.311 7.432   -9.954  1.00 0.00 ? 183 LYS A N    3  
ATOM   4790  C  CA   . LYS A 1 29  ? -16.478 8.244   -8.690  1.00 0.00 ? 183 LYS A CA   3  
ATOM   4791  C  C    . LYS A 1 29  ? -16.295 7.384   -7.419  1.00 0.00 ? 183 LYS A C    3  
ATOM   4792  O  O    . LYS A 1 29  ? -15.893 7.894   -6.389  1.00 0.00 ? 183 LYS A O    3  
ATOM   4793  C  CB   . LYS A 1 29  ? -17.902 8.830   -8.726  1.00 0.00 ? 183 LYS A CB   3  
ATOM   4794  C  CG   . LYS A 1 29  ? -18.932 7.698   -8.796  1.00 0.00 ? 183 LYS A CG   3  
ATOM   4795  C  CD   . LYS A 1 29  ? -20.137 8.155   -9.621  1.00 0.00 ? 183 LYS A CD   3  
ATOM   4796  C  CE   . LYS A 1 29  ? -21.209 8.724   -8.689  1.00 0.00 ? 183 LYS A CE   3  
ATOM   4797  N  NZ   . LYS A 1 29  ? -21.920 7.534   -8.148  1.00 0.00 ? 183 LYS A NZ   3  
ATOM   4798  H  H    . LYS A 1 29  ? -16.986 7.487   -10.672 1.00 0.00 ? 183 LYS A H    3  
ATOM   4799  H  HA   . LYS A 1 29  ? -15.766 9.048   -8.684  1.00 0.00 ? 183 LYS A HA   3  
ATOM   4800  H  HB2  . LYS A 1 29  ? -18.070 9.414   -7.834  1.00 0.00 ? 183 LYS A HB2  3  
ATOM   4801  H  HB3  . LYS A 1 29  ? -18.007 9.463   -9.594  1.00 0.00 ? 183 LYS A HB3  3  
ATOM   4802  H  HG2  . LYS A 1 29  ? -18.485 6.831   -9.260  1.00 0.00 ? 183 LYS A HG2  3  
ATOM   4803  H  HG3  . LYS A 1 29  ? -19.257 7.445   -7.798  1.00 0.00 ? 183 LYS A HG3  3  
ATOM   4804  H  HD2  . LYS A 1 29  ? -19.825 8.916   -10.321 1.00 0.00 ? 183 LYS A HD2  3  
ATOM   4805  H  HD3  . LYS A 1 29  ? -20.543 7.313   -10.161 1.00 0.00 ? 183 LYS A HD3  3  
ATOM   4806  H  HE2  . LYS A 1 29  ? -20.749 9.289   -7.889  1.00 0.00 ? 183 LYS A HE2  3  
ATOM   4807  H  HE3  . LYS A 1 29  ? -21.897 9.345   -9.243  1.00 0.00 ? 183 LYS A HE3  3  
ATOM   4808  H  HZ1  . LYS A 1 29  ? -22.282 6.957   -8.933  1.00 0.00 ? 183 LYS A HZ1  3  
ATOM   4809  H  HZ2  . LYS A 1 29  ? -22.715 7.845   -7.552  1.00 0.00 ? 183 LYS A HZ2  3  
ATOM   4810  H  HZ3  . LYS A 1 29  ? -21.262 6.965   -7.579  1.00 0.00 ? 183 LYS A HZ3  3  
ATOM   4811  N  N    . ASP A 1 30  ? -16.592 6.103   -7.464  1.00 0.00 ? 184 ASP A N    3  
ATOM   4812  C  CA   . ASP A 1 30  ? -16.436 5.263   -6.235  1.00 0.00 ? 184 ASP A CA   3  
ATOM   4813  C  C    . ASP A 1 30  ? -15.620 3.989   -6.513  1.00 0.00 ? 184 ASP A C    3  
ATOM   4814  O  O    . ASP A 1 30  ? -15.862 2.963   -5.903  1.00 0.00 ? 184 ASP A O    3  
ATOM   4815  C  CB   . ASP A 1 30  ? -17.863 4.902   -5.825  1.00 0.00 ? 184 ASP A CB   3  
ATOM   4816  C  CG   . ASP A 1 30  ? -17.880 4.483   -4.353  1.00 0.00 ? 184 ASP A CG   3  
ATOM   4817  O  OD1  . ASP A 1 30  ? -17.331 5.211   -3.544  1.00 0.00 ? 184 ASP A OD1  3  
ATOM   4818  O  OD2  . ASP A 1 30  ? -18.444 3.441   -4.062  1.00 0.00 ? 184 ASP A OD2  3  
ATOM   4819  H  H    . ASP A 1 30  ? -16.925 5.698   -8.287  1.00 0.00 ? 184 ASP A H    3  
ATOM   4820  H  HA   . ASP A 1 30  ? -15.968 5.837   -5.452  1.00 0.00 ? 184 ASP A HA   3  
ATOM   4821  H  HB2  . ASP A 1 30  ? -18.505 5.761   -5.963  1.00 0.00 ? 184 ASP A HB2  3  
ATOM   4822  H  HB3  . ASP A 1 30  ? -18.217 4.085   -6.434  1.00 0.00 ? 184 ASP A HB3  3  
ATOM   4823  N  N    . SER A 1 31  ? -14.646 4.036   -7.401  1.00 0.00 ? 185 SER A N    3  
ATOM   4824  C  CA   . SER A 1 31  ? -13.826 2.804   -7.661  1.00 0.00 ? 185 SER A CA   3  
ATOM   4825  C  C    . SER A 1 31  ? -12.596 2.801   -6.739  1.00 0.00 ? 185 SER A C    3  
ATOM   4826  O  O    . SER A 1 31  ? -12.509 1.996   -5.839  1.00 0.00 ? 185 SER A O    3  
ATOM   4827  C  CB   . SER A 1 31  ? -13.400 2.862   -9.132  1.00 0.00 ? 185 SER A CB   3  
ATOM   4828  O  OG   . SER A 1 31  ? -12.172 2.163   -9.294  1.00 0.00 ? 185 SER A OG   3  
ATOM   4829  H  H    . SER A 1 31  ? -14.446 4.877   -7.876  1.00 0.00 ? 185 SER A H    3  
ATOM   4830  H  HA   . SER A 1 31  ? -14.421 1.920   -7.485  1.00 0.00 ? 185 SER A HA   3  
ATOM   4831  H  HB2  . SER A 1 31  ? -14.154 2.398   -9.746  1.00 0.00 ? 185 SER A HB2  3  
ATOM   4832  H  HB3  . SER A 1 31  ? -13.281 3.894   -9.429  1.00 0.00 ? 185 SER A HB3  3  
ATOM   4833  H  HG   . SER A 1 31  ? -11.914 2.226   -10.216 1.00 0.00 ? 185 SER A HG   3  
ATOM   4834  N  N    . ILE A 1 32  ? -11.642 3.690   -6.953  1.00 0.00 ? 186 ILE A N    3  
ATOM   4835  C  CA   . ILE A 1 32  ? -10.414 3.715   -6.064  1.00 0.00 ? 186 ILE A CA   3  
ATOM   4836  C  C    . ILE A 1 32  ? -10.799 3.723   -4.574  1.00 0.00 ? 186 ILE A C    3  
ATOM   4837  O  O    . ILE A 1 32  ? -11.893 4.109   -4.209  1.00 0.00 ? 186 ILE A O    3  
ATOM   4838  C  CB   . ILE A 1 32  ? -9.635  5.002   -6.397  1.00 0.00 ? 186 ILE A CB   3  
ATOM   4839  C  CG1  . ILE A 1 32  ? -10.541 6.228   -6.213  1.00 0.00 ? 186 ILE A CG1  3  
ATOM   4840  C  CG2  . ILE A 1 32  ? -9.132  4.949   -7.838  1.00 0.00 ? 186 ILE A CG2  3  
ATOM   4841  C  CD1  . ILE A 1 32  ? -9.707  7.501   -6.341  1.00 0.00 ? 186 ILE A CD1  3  
ATOM   4842  H  H    . ILE A 1 32  ? -11.728 4.328   -7.697  1.00 0.00 ? 186 ILE A H    3  
ATOM   4843  H  HA   . ILE A 1 32  ? -9.793  2.856   -6.268  1.00 0.00 ? 186 ILE A HA   3  
ATOM   4844  H  HB   . ILE A 1 32  ? -8.788  5.083   -5.731  1.00 0.00 ? 186 ILE A HB   3  
ATOM   4845  H  HG12 . ILE A 1 32  ? -11.311 6.232   -6.968  1.00 0.00 ? 186 ILE A HG12 3  
ATOM   4846  H  HG13 . ILE A 1 32  ? -10.997 6.196   -5.234  1.00 0.00 ? 186 ILE A HG13 3  
ATOM   4847  H  HG21 . ILE A 1 32  ? -8.794  3.947   -8.062  1.00 0.00 ? 186 ILE A HG21 3  
ATOM   4848  H  HG22 . ILE A 1 32  ? -8.313  5.644   -7.957  1.00 0.00 ? 186 ILE A HG22 3  
ATOM   4849  H  HG23 . ILE A 1 32  ? -9.933  5.219   -8.510  1.00 0.00 ? 186 ILE A HG23 3  
ATOM   4850  H  HD11 . ILE A 1 32  ? -10.173 8.294   -5.777  1.00 0.00 ? 186 ILE A HD11 3  
ATOM   4851  H  HD12 . ILE A 1 32  ? -9.644  7.788   -7.381  1.00 0.00 ? 186 ILE A HD12 3  
ATOM   4852  H  HD13 . ILE A 1 32  ? -8.714  7.322   -5.957  1.00 0.00 ? 186 ILE A HD13 3  
ATOM   4853  N  N    . TYR A 1 33  ? -9.896  3.298   -3.712  1.00 0.00 ? 187 TYR A N    3  
ATOM   4854  C  CA   . TYR A 1 33  ? -10.194 3.278   -2.249  1.00 0.00 ? 187 TYR A CA   3  
ATOM   4855  C  C    . TYR A 1 33  ? -8.985  3.773   -1.452  1.00 0.00 ? 187 TYR A C    3  
ATOM   4856  O  O    . TYR A 1 33  ? -7.906  3.939   -1.989  1.00 0.00 ? 187 TYR A O    3  
ATOM   4857  C  CB   . TYR A 1 33  ? -10.474 1.813   -1.916  1.00 0.00 ? 187 TYR A CB   3  
ATOM   4858  C  CG   . TYR A 1 33  ? -11.952 1.540   -2.034  1.00 0.00 ? 187 TYR A CG   3  
ATOM   4859  C  CD1  . TYR A 1 33  ? -12.795 1.749   -0.936  1.00 0.00 ? 187 TYR A CD1  3  
ATOM   4860  C  CD2  . TYR A 1 33  ? -12.476 1.072   -3.240  1.00 0.00 ? 187 TYR A CD2  3  
ATOM   4861  C  CE1  . TYR A 1 33  ? -14.167 1.491   -1.049  1.00 0.00 ? 187 TYR A CE1  3  
ATOM   4862  C  CE2  . TYR A 1 33  ? -13.845 0.812   -3.357  1.00 0.00 ? 187 TYR A CE2  3  
ATOM   4863  C  CZ   . TYR A 1 33  ? -14.692 1.022   -2.260  1.00 0.00 ? 187 TYR A CZ   3  
ATOM   4864  O  OH   . TYR A 1 33  ? -16.044 0.766   -2.374  1.00 0.00 ? 187 TYR A OH   3  
ATOM   4865  H  H    . TYR A 1 33  ? -9.017  2.990   -4.029  1.00 0.00 ? 187 TYR A H    3  
ATOM   4866  H  HA   . TYR A 1 33  ? -11.059 3.880   -2.019  1.00 0.00 ? 187 TYR A HA   3  
ATOM   4867  H  HB2  . TYR A 1 33  ? -9.934  1.180   -2.605  1.00 0.00 ? 187 TYR A HB2  3  
ATOM   4868  H  HB3  . TYR A 1 33  ? -10.149 1.606   -0.907  1.00 0.00 ? 187 TYR A HB3  3  
ATOM   4869  H  HD1  . TYR A 1 33  ? -12.389 2.111   -0.003  1.00 0.00 ? 187 TYR A HD1  3  
ATOM   4870  H  HD2  . TYR A 1 33  ? -11.820 0.907   -4.084  1.00 0.00 ? 187 TYR A HD2  3  
ATOM   4871  H  HE1  . TYR A 1 33  ? -14.819 1.651   -0.203  1.00 0.00 ? 187 TYR A HE1  3  
ATOM   4872  H  HE2  . TYR A 1 33  ? -14.247 0.450   -4.291  1.00 0.00 ? 187 TYR A HE2  3  
ATOM   4873  H  HH   . TYR A 1 33  ? -16.420 1.417   -2.971  1.00 0.00 ? 187 TYR A HH   3  
ATOM   4874  N  N    . ARG A 1 34  ? -9.158  4.003   -0.171  1.00 0.00 ? 188 ARG A N    3  
ATOM   4875  C  CA   . ARG A 1 34  ? -8.015  4.479   0.666   1.00 0.00 ? 188 ARG A CA   3  
ATOM   4876  C  C    . ARG A 1 34  ? -7.609  3.384   1.659   1.00 0.00 ? 188 ARG A C    3  
ATOM   4877  O  O    . ARG A 1 34  ? -8.459  2.738   2.243   1.00 0.00 ? 188 ARG A O    3  
ATOM   4878  C  CB   . ARG A 1 34  ? -8.542  5.703   1.418   1.00 0.00 ? 188 ARG A CB   3  
ATOM   4879  C  CG   . ARG A 1 34  ? -8.928  6.796   0.422   1.00 0.00 ? 188 ARG A CG   3  
ATOM   4880  C  CD   . ARG A 1 34  ? -9.270  8.080   1.181   1.00 0.00 ? 188 ARG A CD   3  
ATOM   4881  N  NE   . ARG A 1 34  ? -10.381 8.707   0.401   1.00 0.00 ? 188 ARG A NE   3  
ATOM   4882  C  CZ   . ARG A 1 34  ? -11.610 8.215   0.439   1.00 0.00 ? 188 ARG A CZ   3  
ATOM   4883  N  NH1  . ARG A 1 34  ? -11.902 7.155   1.158   1.00 0.00 ? 188 ARG A NH1  3  
ATOM   4884  N  NH2  . ARG A 1 34  ? -12.558 8.792   -0.253  1.00 0.00 ? 188 ARG A NH2  3  
ATOM   4885  H  H    . ARG A 1 34  ? -10.040 3.854   0.244   1.00 0.00 ? 188 ARG A H    3  
ATOM   4886  H  HA   . ARG A 1 34  ? -7.179  4.757   0.043   1.00 0.00 ? 188 ARG A HA   3  
ATOM   4887  H  HB2  . ARG A 1 34  ? -9.410  5.421   1.998   1.00 0.00 ? 188 ARG A HB2  3  
ATOM   4888  H  HB3  . ARG A 1 34  ? -7.775  6.077   2.079   1.00 0.00 ? 188 ARG A HB3  3  
ATOM   4889  H  HG2  . ARG A 1 34  ? -8.101  6.980   -0.248  1.00 0.00 ? 188 ARG A HG2  3  
ATOM   4890  H  HG3  . ARG A 1 34  ? -9.789  6.477   -0.146  1.00 0.00 ? 188 ARG A HG3  3  
ATOM   4891  H  HD2  . ARG A 1 34  ? -9.595  7.847   2.185   1.00 0.00 ? 188 ARG A HD2  3  
ATOM   4892  H  HD3  . ARG A 1 34  ? -8.417  8.740   1.205   1.00 0.00 ? 188 ARG A HD3  3  
ATOM   4893  H  HE   . ARG A 1 34  ? -10.192 9.499   -0.146  1.00 0.00 ? 188 ARG A HE   3  
ATOM   4894  H  HH11 . ARG A 1 34  ? -11.197 6.695   1.694   1.00 0.00 ? 188 ARG A HH11 3  
ATOM   4895  H  HH12 . ARG A 1 34  ? -12.839 6.805   1.168   1.00 0.00 ? 188 ARG A HH12 3  
ATOM   4896  H  HH21 . ARG A 1 34  ? -12.353 9.600   -0.806  1.00 0.00 ? 188 ARG A HH21 3  
ATOM   4897  H  HH22 . ARG A 1 34  ? -13.488 8.426   -0.229  1.00 0.00 ? 188 ARG A HH22 3  
ATOM   4898  N  N    . HIS A 1 35  ? -6.325  3.175   1.872   1.00 0.00 ? 189 HIS A N    3  
ATOM   4899  C  CA   . HIS A 1 35  ? -5.912  2.120   2.857   1.00 0.00 ? 189 HIS A CA   3  
ATOM   4900  C  C    . HIS A 1 35  ? -6.286  2.605   4.266   1.00 0.00 ? 189 HIS A C    3  
ATOM   4901  O  O    . HIS A 1 35  ? -6.005  3.737   4.609   1.00 0.00 ? 189 HIS A O    3  
ATOM   4902  C  CB   . HIS A 1 35  ? -4.391  1.955   2.714   1.00 0.00 ? 189 HIS A CB   3  
ATOM   4903  C  CG   . HIS A 1 35  ? -4.008  0.536   3.043   1.00 0.00 ? 189 HIS A CG   3  
ATOM   4904  N  ND1  . HIS A 1 35  ? -3.627  0.148   4.314   1.00 0.00 ? 189 HIS A ND1  3  
ATOM   4905  C  CD2  . HIS A 1 35  ? -3.981  -0.606  2.283   1.00 0.00 ? 189 HIS A CD2  3  
ATOM   4906  C  CE1  . HIS A 1 35  ? -3.398  -1.172  4.290   1.00 0.00 ? 189 HIS A CE1  3  
ATOM   4907  N  NE2  . HIS A 1 35  ? -3.598  -1.686  3.075   1.00 0.00 ? 189 HIS A NE2  3  
ATOM   4908  H  H    . HIS A 1 35  ? -5.649  3.718   1.404   1.00 0.00 ? 189 HIS A H    3  
ATOM   4909  H  HA   . HIS A 1 35  ? -6.408  1.190   2.629   1.00 0.00 ? 189 HIS A HA   3  
ATOM   4910  H  HB2  . HIS A 1 35  ? -4.098  2.182   1.699   1.00 0.00 ? 189 HIS A HB2  3  
ATOM   4911  H  HB3  . HIS A 1 35  ? -3.898  2.633   3.390   1.00 0.00 ? 189 HIS A HB3  3  
ATOM   4912  H  HD1  . HIS A 1 35  ? -3.512  0.731   5.079   1.00 0.00 ? 189 HIS A HD1  3  
ATOM   4913  H  HD2  . HIS A 1 35  ? -4.200  -0.655  1.229   1.00 0.00 ? 189 HIS A HD2  3  
ATOM   4914  H  HE1  . HIS A 1 35  ? -3.103  -1.750  5.156   1.00 0.00 ? 189 HIS A HE1  3  
ATOM   4915  N  N    . PRO A 1 36  ? -6.938  1.761   5.038   1.00 0.00 ? 190 PRO A N    3  
ATOM   4916  C  CA   . PRO A 1 36  ? -7.369  2.174   6.397   1.00 0.00 ? 190 PRO A CA   3  
ATOM   4917  C  C    . PRO A 1 36  ? -6.170  2.290   7.355   1.00 0.00 ? 190 PRO A C    3  
ATOM   4918  O  O    . PRO A 1 36  ? -6.145  3.161   8.206   1.00 0.00 ? 190 PRO A O    3  
ATOM   4919  C  CB   . PRO A 1 36  ? -8.314  1.056   6.830   1.00 0.00 ? 190 PRO A CB   3  
ATOM   4920  C  CG   . PRO A 1 36  ? -7.889  -0.139  6.040   1.00 0.00 ? 190 PRO A CG   3  
ATOM   4921  C  CD   . PRO A 1 36  ? -7.330  0.371   4.739   1.00 0.00 ? 190 PRO A CD   3  
ATOM   4922  H  HA   . PRO A 1 36  ? -7.907  3.108   6.353   1.00 0.00 ? 190 PRO A HA   3  
ATOM   4923  H  HB2  . PRO A 1 36  ? -8.212  0.867   7.889   1.00 0.00 ? 190 PRO A HB2  3  
ATOM   4924  H  HB3  . PRO A 1 36  ? -9.333  1.313   6.586   1.00 0.00 ? 190 PRO A HB3  3  
ATOM   4925  H  HG2  . PRO A 1 36  ? -7.131  -0.687  6.581   1.00 0.00 ? 190 PRO A HG2  3  
ATOM   4926  H  HG3  . PRO A 1 36  ? -8.739  -0.775  5.845   1.00 0.00 ? 190 PRO A HG3  3  
ATOM   4927  H  HD2  . PRO A 1 36  ? -6.469  -0.215  4.445   1.00 0.00 ? 190 PRO A HD2  3  
ATOM   4928  H  HD3  . PRO A 1 36  ? -8.084  0.355   3.968   1.00 0.00 ? 190 PRO A HD3  3  
ATOM   4929  N  N    . SER A 1 37  ? -5.187  1.422   7.244   1.00 0.00 ? 191 SER A N    3  
ATOM   4930  C  CA   . SER A 1 37  ? -4.012  1.504   8.180   1.00 0.00 ? 191 SER A CA   3  
ATOM   4931  C  C    . SER A 1 37  ? -2.744  2.087   7.512   1.00 0.00 ? 191 SER A C    3  
ATOM   4932  O  O    . SER A 1 37  ? -1.660  1.926   8.043   1.00 0.00 ? 191 SER A O    3  
ATOM   4933  C  CB   . SER A 1 37  ? -3.747  0.059   8.614   1.00 0.00 ? 191 SER A CB   3  
ATOM   4934  O  OG   . SER A 1 37  ? -4.881  -0.435  9.317   1.00 0.00 ? 191 SER A OG   3  
ATOM   4935  H  H    . SER A 1 37  ? -5.226  0.714   6.561   1.00 0.00 ? 191 SER A H    3  
ATOM   4936  H  HA   . SER A 1 37  ? -4.273  2.092   9.045   1.00 0.00 ? 191 SER A HA   3  
ATOM   4937  H  HB2  . SER A 1 37  ? -3.574  -0.556  7.743   1.00 0.00 ? 191 SER A HB2  3  
ATOM   4938  H  HB3  . SER A 1 37  ? -2.873  0.030   9.252   1.00 0.00 ? 191 SER A HB3  3  
ATOM   4939  H  HG   . SER A 1 37  ? -5.559  -0.648  8.672   1.00 0.00 ? 191 SER A HG   3  
ATOM   4940  N  N    . LEU A 1 38  ? -2.838  2.743   6.366   1.00 0.00 ? 192 LEU A N    3  
ATOM   4941  C  CA   . LEU A 1 38  ? -1.584  3.287   5.729   1.00 0.00 ? 192 LEU A CA   3  
ATOM   4942  C  C    . LEU A 1 38  ? -1.734  4.709   5.129   1.00 0.00 ? 192 LEU A C    3  
ATOM   4943  O  O    . LEU A 1 38  ? -0.795  5.194   4.525   1.00 0.00 ? 192 LEU A O    3  
ATOM   4944  C  CB   . LEU A 1 38  ? -1.257  2.311   4.590   1.00 0.00 ? 192 LEU A CB   3  
ATOM   4945  C  CG   . LEU A 1 38  ? -0.705  0.984   5.123   1.00 0.00 ? 192 LEU A CG   3  
ATOM   4946  C  CD1  . LEU A 1 38  ? -0.322  0.107   3.926   1.00 0.00 ? 192 LEU A CD1  3  
ATOM   4947  C  CD2  . LEU A 1 38  ? 0.543   1.234   5.979   1.00 0.00 ? 192 LEU A CD2  3  
ATOM   4948  H  H    . LEU A 1 38  ? -3.705  2.857   5.928   1.00 0.00 ? 192 LEU A H    3  
ATOM   4949  H  HA   . LEU A 1 38  ? -0.779  3.277   6.442   1.00 0.00 ? 192 LEU A HA   3  
ATOM   4950  H  HB2  . LEU A 1 38  ? -2.152  2.114   4.026   1.00 0.00 ? 192 LEU A HB2  3  
ATOM   4951  H  HB3  . LEU A 1 38  ? -0.522  2.763   3.940   1.00 0.00 ? 192 LEU A HB3  3  
ATOM   4952  H  HG   . LEU A 1 38  ? -1.460  0.485   5.711   1.00 0.00 ? 192 LEU A HG   3  
ATOM   4953  H  HD11 . LEU A 1 38  ? 0.310   -0.704  4.257   1.00 0.00 ? 192 LEU A HD11 3  
ATOM   4954  H  HD12 . LEU A 1 38  ? 0.213   0.710   3.203   1.00 0.00 ? 192 LEU A HD12 3  
ATOM   4955  H  HD13 . LEU A 1 38  ? -1.217  -0.296  3.466   1.00 0.00 ? 192 LEU A HD13 3  
ATOM   4956  H  HD21 . LEU A 1 38  ? 1.190   0.371   5.929   1.00 0.00 ? 192 LEU A HD21 3  
ATOM   4957  H  HD22 . LEU A 1 38  ? 0.248   1.401   7.005   1.00 0.00 ? 192 LEU A HD22 3  
ATOM   4958  H  HD23 . LEU A 1 38  ? 1.067   2.101   5.608   1.00 0.00 ? 192 LEU A HD23 3  
ATOM   4959  N  N    . GLN A 1 39  ? -2.866  5.388   5.259   1.00 0.00 ? 193 GLN A N    3  
ATOM   4960  C  CA   . GLN A 1 39  ? -2.997  6.763   4.657   1.00 0.00 ? 193 GLN A CA   3  
ATOM   4961  C  C    . GLN A 1 39  ? -2.549  6.752   3.179   1.00 0.00 ? 193 GLN A C    3  
ATOM   4962  O  O    . GLN A 1 39  ? -1.889  7.665   2.724   1.00 0.00 ? 193 GLN A O    3  
ATOM   4963  C  CB   . GLN A 1 39  ? -2.072  7.657   5.492   1.00 0.00 ? 193 GLN A CB   3  
ATOM   4964  C  CG   . GLN A 1 39  ? -2.794  8.958   5.849   1.00 0.00 ? 193 GLN A CG   3  
ATOM   4965  C  CD   . GLN A 1 39  ? -2.252  9.496   7.178   1.00 0.00 ? 193 GLN A CD   3  
ATOM   4966  O  OE1  . GLN A 1 39  ? -1.609  10.528  7.208   1.00 0.00 ? 193 GLN A OE1  3  
ATOM   4967  N  NE2  . GLN A 1 39  ? -2.482  8.843   8.291   1.00 0.00 ? 193 GLN A NE2  3  
ATOM   4968  H  H    . GLN A 1 39  ? -3.622  5.010   5.741   1.00 0.00 ? 193 GLN A H    3  
ATOM   4969  H  HA   . GLN A 1 39  ? -4.016  7.108   4.735   1.00 0.00 ? 193 GLN A HA   3  
ATOM   4970  H  HB2  . GLN A 1 39  ? -1.794  7.139   6.399   1.00 0.00 ? 193 GLN A HB2  3  
ATOM   4971  H  HB3  . GLN A 1 39  ? -1.181  7.886   4.924   1.00 0.00 ? 193 GLN A HB3  3  
ATOM   4972  H  HG2  . GLN A 1 39  ? -2.627  9.688   5.069   1.00 0.00 ? 193 GLN A HG2  3  
ATOM   4973  H  HG3  . GLN A 1 39  ? -3.853  8.769   5.945   1.00 0.00 ? 193 GLN A HG3  3  
ATOM   4974  H  HE21 . GLN A 1 39  ? -3.000  8.008   8.281   1.00 0.00 ? 193 GLN A HE21 3  
ATOM   4975  H  HE22 . GLN A 1 39  ? -2.134  9.188   9.141   1.00 0.00 ? 193 GLN A HE22 3  
ATOM   4976  N  N    . VAL A 1 40  ? -2.886  5.717   2.435   1.00 0.00 ? 194 VAL A N    3  
ATOM   4977  C  CA   . VAL A 1 40  ? -2.457  5.647   1.003   1.00 0.00 ? 194 VAL A CA   3  
ATOM   4978  C  C    . VAL A 1 40  ? -3.625  5.201   0.106   1.00 0.00 ? 194 VAL A C    3  
ATOM   4979  O  O    . VAL A 1 40  ? -4.625  4.707   0.585   1.00 0.00 ? 194 VAL A O    3  
ATOM   4980  C  CB   . VAL A 1 40  ? -1.301  4.633   0.997   1.00 0.00 ? 194 VAL A CB   3  
ATOM   4981  C  CG1  . VAL A 1 40  ? -1.809  3.226   1.337   1.00 0.00 ? 194 VAL A CG1  3  
ATOM   4982  C  CG2  . VAL A 1 40  ? -0.642  4.617   -0.384  1.00 0.00 ? 194 VAL A CG2  3  
ATOM   4983  H  H    . VAL A 1 40  ? -3.411  4.980   2.819   1.00 0.00 ? 194 VAL A H    3  
ATOM   4984  H  HA   . VAL A 1 40  ? -2.096  6.608   0.672   1.00 0.00 ? 194 VAL A HA   3  
ATOM   4985  H  HB   . VAL A 1 40  ? -0.570  4.930   1.735   1.00 0.00 ? 194 VAL A HB   3  
ATOM   4986  H  HG11 . VAL A 1 40  ? -2.285  3.238   2.305   1.00 0.00 ? 194 VAL A HG11 3  
ATOM   4987  H  HG12 . VAL A 1 40  ? -0.976  2.541   1.358   1.00 0.00 ? 194 VAL A HG12 3  
ATOM   4988  H  HG13 . VAL A 1 40  ? -2.520  2.908   0.588   1.00 0.00 ? 194 VAL A HG13 3  
ATOM   4989  H  HG21 . VAL A 1 40  ? -0.400  5.628   -0.676  1.00 0.00 ? 194 VAL A HG21 3  
ATOM   4990  H  HG22 . VAL A 1 40  ? -1.323  4.188   -1.103  1.00 0.00 ? 194 VAL A HG22 3  
ATOM   4991  H  HG23 . VAL A 1 40  ? 0.260   4.028   -0.344  1.00 0.00 ? 194 VAL A HG23 3  
ATOM   4992  N  N    . LEU A 1 41  ? -3.511  5.394   -1.193  1.00 0.00 ? 195 LEU A N    3  
ATOM   4993  C  CA   . LEU A 1 41  ? -4.636  4.996   -2.112  1.00 0.00 ? 195 LEU A CA   3  
ATOM   4994  C  C    . LEU A 1 41  ? -4.444  3.577   -2.675  1.00 0.00 ? 195 LEU A C    3  
ATOM   4995  O  O    . LEU A 1 41  ? -3.342  3.165   -2.982  1.00 0.00 ? 195 LEU A O    3  
ATOM   4996  C  CB   . LEU A 1 41  ? -4.621  6.010   -3.263  1.00 0.00 ? 195 LEU A CB   3  
ATOM   4997  C  CG   . LEU A 1 41  ? -5.985  6.015   -3.956  1.00 0.00 ? 195 LEU A CG   3  
ATOM   4998  C  CD1  . LEU A 1 41  ? -6.315  7.434   -4.422  1.00 0.00 ? 195 LEU A CD1  3  
ATOM   4999  C  CD2  . LEU A 1 41  ? -5.948  5.075   -5.165  1.00 0.00 ? 195 LEU A CD2  3  
ATOM   5000  H  H    . LEU A 1 41  ? -2.695  5.813   -1.557  1.00 0.00 ? 195 LEU A H    3  
ATOM   5001  H  HA   . LEU A 1 41  ? -5.578  5.061   -1.590  1.00 0.00 ? 195 LEU A HA   3  
ATOM   5002  H  HB2  . LEU A 1 41  ? -4.407  6.991   -2.874  1.00 0.00 ? 195 LEU A HB2  3  
ATOM   5003  H  HB3  . LEU A 1 41  ? -3.859  5.733   -3.976  1.00 0.00 ? 195 LEU A HB3  3  
ATOM   5004  H  HG   . LEU A 1 41  ? -6.742  5.681   -3.261  1.00 0.00 ? 195 LEU A HG   3  
ATOM   5005  H  HD11 . LEU A 1 41  ? -5.860  7.610   -5.386  1.00 0.00 ? 195 LEU A HD11 3  
ATOM   5006  H  HD12 . LEU A 1 41  ? -5.932  8.146   -3.707  1.00 0.00 ? 195 LEU A HD12 3  
ATOM   5007  H  HD13 . LEU A 1 41  ? -7.385  7.545   -4.503  1.00 0.00 ? 195 LEU A HD13 3  
ATOM   5008  H  HD21 . LEU A 1 41  ? -5.728  5.644   -6.057  1.00 0.00 ? 195 LEU A HD21 3  
ATOM   5009  H  HD22 . LEU A 1 41  ? -6.907  4.593   -5.275  1.00 0.00 ? 195 LEU A HD22 3  
ATOM   5010  H  HD23 . LEU A 1 41  ? -5.183  4.327   -5.017  1.00 0.00 ? 195 LEU A HD23 3  
ATOM   5011  N  N    . ILE A 1 42  ? -5.525  2.838   -2.836  1.00 0.00 ? 196 ILE A N    3  
ATOM   5012  C  CA   . ILE A 1 42  ? -5.434  1.455   -3.402  1.00 0.00 ? 196 ILE A CA   3  
ATOM   5013  C  C    . ILE A 1 42  ? -6.575  1.262   -4.420  1.00 0.00 ? 196 ILE A C    3  
ATOM   5014  O  O    . ILE A 1 42  ? -7.174  2.228   -4.857  1.00 0.00 ? 196 ILE A O    3  
ATOM   5015  C  CB   . ILE A 1 42  ? -5.577  0.503   -2.200  1.00 0.00 ? 196 ILE A CB   3  
ATOM   5016  C  CG1  . ILE A 1 42  ? -6.880  0.803   -1.446  1.00 0.00 ? 196 ILE A CG1  3  
ATOM   5017  C  CG2  . ILE A 1 42  ? -4.377  0.670   -1.254  1.00 0.00 ? 196 ILE A CG2  3  
ATOM   5018  C  CD1  . ILE A 1 42  ? -7.085  -0.237  -0.341  1.00 0.00 ? 196 ILE A CD1  3  
ATOM   5019  H  H    . ILE A 1 42  ? -6.409  3.198   -2.598  1.00 0.00 ? 196 ILE A H    3  
ATOM   5020  H  HA   . ILE A 1 42  ? -4.479  1.306   -3.883  1.00 0.00 ? 196 ILE A HA   3  
ATOM   5021  H  HB   . ILE A 1 42  ? -5.596  -0.518  -2.551  1.00 0.00 ? 196 ILE A HB   3  
ATOM   5022  H  HG12 . ILE A 1 42  ? -6.823  1.789   -1.006  1.00 0.00 ? 196 ILE A HG12 3  
ATOM   5023  H  HG13 . ILE A 1 42  ? -7.712  0.763   -2.133  1.00 0.00 ? 196 ILE A HG13 3  
ATOM   5024  H  HG21 . ILE A 1 42  ? -3.844  -0.269  -1.184  1.00 0.00 ? 196 ILE A HG21 3  
ATOM   5025  H  HG22 . ILE A 1 42  ? -4.722  0.958   -0.271  1.00 0.00 ? 196 ILE A HG22 3  
ATOM   5026  H  HG23 . ILE A 1 42  ? -3.713  1.429   -1.636  1.00 0.00 ? 196 ILE A HG23 3  
ATOM   5027  H  HD11 . ILE A 1 42  ? -7.609  -1.091  -0.743  1.00 0.00 ? 196 ILE A HD11 3  
ATOM   5028  H  HD12 . ILE A 1 42  ? -7.666  0.198   0.459   1.00 0.00 ? 196 ILE A HD12 3  
ATOM   5029  H  HD13 . ILE A 1 42  ? -6.125  -0.551  0.041   1.00 0.00 ? 196 ILE A HD13 3  
ATOM   5030  N  N    . CYS A 1 43  ? -6.885  0.043   -4.813  1.00 0.00 ? 197 CYS A N    3  
ATOM   5031  C  CA   . CYS A 1 43  ? -7.984  -0.164  -5.805  1.00 0.00 ? 197 CYS A CA   3  
ATOM   5032  C  C    . CYS A 1 43  ? -9.169  -0.904  -5.150  1.00 0.00 ? 197 CYS A C    3  
ATOM   5033  O  O    . CYS A 1 43  ? -9.027  -1.486  -4.091  1.00 0.00 ? 197 CYS A O    3  
ATOM   5034  C  CB   . CYS A 1 43  ? -7.349  -0.976  -6.954  1.00 0.00 ? 197 CYS A CB   3  
ATOM   5035  S  SG   . CYS A 1 43  ? -6.954  -2.678  -6.441  1.00 0.00 ? 197 CYS A SG   3  
ATOM   5036  H  H    . CYS A 1 43  ? -6.402  -0.728  -4.462  1.00 0.00 ? 197 CYS A H    3  
ATOM   5037  H  HA   . CYS A 1 43  ? -8.317  0.794   -6.183  1.00 0.00 ? 197 CYS A HA   3  
ATOM   5038  H  HB2  . CYS A 1 43  ? -8.038  -1.013  -7.783  1.00 0.00 ? 197 CYS A HB2  3  
ATOM   5039  H  HB3  . CYS A 1 43  ? -6.442  -0.482  -7.273  1.00 0.00 ? 197 CYS A HB3  3  
ATOM   5040  N  N    . LYS A 1 44  ? -10.340 -0.877  -5.761  1.00 0.00 ? 198 LYS A N    3  
ATOM   5041  C  CA   . LYS A 1 44  ? -11.532 -1.579  -5.145  1.00 0.00 ? 198 LYS A CA   3  
ATOM   5042  C  C    . LYS A 1 44  ? -11.191 -3.035  -4.796  1.00 0.00 ? 198 LYS A C    3  
ATOM   5043  O  O    . LYS A 1 44  ? -11.586 -3.531  -3.756  1.00 0.00 ? 198 LYS A O    3  
ATOM   5044  C  CB   . LYS A 1 44  ? -12.661 -1.523  -6.187  1.00 0.00 ? 198 LYS A CB   3  
ATOM   5045  C  CG   . LYS A 1 44  ? -13.927 -2.167  -5.615  1.00 0.00 ? 198 LYS A CG   3  
ATOM   5046  C  CD   . LYS A 1 44  ? -15.076 -2.010  -6.612  1.00 0.00 ? 198 LYS A CD   3  
ATOM   5047  C  CE   . LYS A 1 44  ? -16.196 -2.992  -6.261  1.00 0.00 ? 198 LYS A CE   3  
ATOM   5048  N  NZ   . LYS A 1 44  ? -16.916 -3.227  -7.542  1.00 0.00 ? 198 LYS A NZ   3  
ATOM   5049  H  H    . LYS A 1 44  ? -10.435 -0.389  -6.614  1.00 0.00 ? 198 LYS A H    3  
ATOM   5050  H  HA   . LYS A 1 44  ? -11.840 -1.064  -4.257  1.00 0.00 ? 198 LYS A HA   3  
ATOM   5051  H  HB2  . LYS A 1 44  ? -12.863 -0.490  -6.433  1.00 0.00 ? 198 LYS A HB2  3  
ATOM   5052  H  HB3  . LYS A 1 44  ? -12.357 -2.054  -7.076  1.00 0.00 ? 198 LYS A HB3  3  
ATOM   5053  H  HG2  . LYS A 1 44  ? -13.746 -3.217  -5.435  1.00 0.00 ? 198 LYS A HG2  3  
ATOM   5054  H  HG3  . LYS A 1 44  ? -14.190 -1.682  -4.686  1.00 0.00 ? 198 LYS A HG3  3  
ATOM   5055  H  HD2  . LYS A 1 44  ? -15.455 -0.999  -6.568  1.00 0.00 ? 198 LYS A HD2  3  
ATOM   5056  H  HD3  . LYS A 1 44  ? -14.719 -2.217  -7.609  1.00 0.00 ? 198 LYS A HD3  3  
ATOM   5057  H  HE2  . LYS A 1 44  ? -15.778 -3.916  -5.885  1.00 0.00 ? 198 LYS A HE2  3  
ATOM   5058  H  HE3  . LYS A 1 44  ? -16.865 -2.557  -5.535  1.00 0.00 ? 198 LYS A HE3  3  
ATOM   5059  H  HZ1  . LYS A 1 44  ? -17.192 -2.314  -7.958  1.00 0.00 ? 198 LYS A HZ1  3  
ATOM   5060  H  HZ2  . LYS A 1 44  ? -17.767 -3.799  -7.362  1.00 0.00 ? 198 LYS A HZ2  3  
ATOM   5061  H  HZ3  . LYS A 1 44  ? -16.293 -3.731  -8.204  1.00 0.00 ? 198 LYS A HZ3  3  
ATOM   5062  N  N    . ASN A 1 45  ? -10.454 -3.720  -5.640  1.00 0.00 ? 199 ASN A N    3  
ATOM   5063  C  CA   . ASN A 1 45  ? -10.094 -5.147  -5.313  1.00 0.00 ? 199 ASN A CA   3  
ATOM   5064  C  C    . ASN A 1 45  ? -9.255  -5.214  -4.023  1.00 0.00 ? 199 ASN A C    3  
ATOM   5065  O  O    . ASN A 1 45  ? -9.268  -6.217  -3.337  1.00 0.00 ? 199 ASN A O    3  
ATOM   5066  C  CB   . ASN A 1 45  ? -9.288  -5.690  -6.504  1.00 0.00 ? 199 ASN A CB   3  
ATOM   5067  C  CG   . ASN A 1 45  ? -10.249 -6.120  -7.619  1.00 0.00 ? 199 ASN A CG   3  
ATOM   5068  O  OD1  . ASN A 1 45  ? -11.202 -5.424  -7.911  1.00 0.00 ? 199 ASN A OD1  3  
ATOM   5069  N  ND2  . ASN A 1 45  ? -10.043 -7.243  -8.264  1.00 0.00 ? 199 ASN A ND2  3  
ATOM   5070  H  H    . ASN A 1 45  ? -10.136 -3.298  -6.472  1.00 0.00 ? 199 ASN A H    3  
ATOM   5071  H  HA   . ASN A 1 45  ? -10.993 -5.726  -5.185  1.00 0.00 ? 199 ASN A HA   3  
ATOM   5072  H  HB2  . ASN A 1 45  ? -8.628  -4.919  -6.873  1.00 0.00 ? 199 ASN A HB2  3  
ATOM   5073  H  HB3  . ASN A 1 45  ? -8.706  -6.542  -6.186  1.00 0.00 ? 199 ASN A HB3  3  
ATOM   5074  H  HD21 . ASN A 1 45  ? -9.276  -7.813  -8.037  1.00 0.00 ? 199 ASN A HD21 3  
ATOM   5075  H  HD22 . ASN A 1 45  ? -10.658 -7.515  -8.977  1.00 0.00 ? 199 ASN A HD22 3  
ATOM   5076  N  N    . CYS A 1 46  ? -8.541  -4.159  -3.669  1.00 0.00 ? 200 CYS A N    3  
ATOM   5077  C  CA   . CYS A 1 46  ? -7.736  -4.202  -2.402  1.00 0.00 ? 200 CYS A CA   3  
ATOM   5078  C  C    . CYS A 1 46  ? -8.669  -3.927  -1.223  1.00 0.00 ? 200 CYS A C    3  
ATOM   5079  O  O    . CYS A 1 46  ? -8.682  -4.656  -0.255  1.00 0.00 ? 200 CYS A O    3  
ATOM   5080  C  CB   . CYS A 1 46  ? -6.673  -3.095  -2.505  1.00 0.00 ? 200 CYS A CB   3  
ATOM   5081  S  SG   . CYS A 1 46  ? -5.179  -3.756  -3.281  1.00 0.00 ? 200 CYS A SG   3  
ATOM   5082  H  H    . CYS A 1 46  ? -8.552  -3.347  -4.218  1.00 0.00 ? 200 CYS A H    3  
ATOM   5083  H  HA   . CYS A 1 46  ? -7.267  -5.163  -2.288  1.00 0.00 ? 200 CYS A HA   3  
ATOM   5084  H  HB2  . CYS A 1 46  ? -7.056  -2.280  -3.100  1.00 0.00 ? 200 CYS A HB2  3  
ATOM   5085  H  HB3  . CYS A 1 46  ? -6.433  -2.734  -1.515  1.00 0.00 ? 200 CYS A HB3  3  
ATOM   5086  N  N    . PHE A 1 47  ? -9.465  -2.884  -1.307  1.00 0.00 ? 201 PHE A N    3  
ATOM   5087  C  CA   . PHE A 1 47  ? -10.414 -2.581  -0.179  1.00 0.00 ? 201 PHE A CA   3  
ATOM   5088  C  C    . PHE A 1 47  ? -11.448 -3.710  -0.046  1.00 0.00 ? 201 PHE A C    3  
ATOM   5089  O  O    . PHE A 1 47  ? -11.856 -4.042  1.051   1.00 0.00 ? 201 PHE A O    3  
ATOM   5090  C  CB   . PHE A 1 47  ? -11.105 -1.251  -0.528  1.00 0.00 ? 201 PHE A CB   3  
ATOM   5091  C  CG   . PHE A 1 47  ? -11.497 -0.522  0.737   1.00 0.00 ? 201 PHE A CG   3  
ATOM   5092  C  CD1  . PHE A 1 47  ? -10.574 0.313   1.382   1.00 0.00 ? 201 PHE A CD1  3  
ATOM   5093  C  CD2  . PHE A 1 47  ? -12.786 -0.675  1.260   1.00 0.00 ? 201 PHE A CD2  3  
ATOM   5094  C  CE1  . PHE A 1 47  ? -10.942 0.993   2.550   1.00 0.00 ? 201 PHE A CE1  3  
ATOM   5095  C  CE2  . PHE A 1 47  ? -13.153 0.004   2.427   1.00 0.00 ? 201 PHE A CE2  3  
ATOM   5096  C  CZ   . PHE A 1 47  ? -12.232 0.839   3.072   1.00 0.00 ? 201 PHE A CZ   3  
ATOM   5097  H  H    . PHE A 1 47  ? -9.445  -2.315  -2.112  1.00 0.00 ? 201 PHE A H    3  
ATOM   5098  H  HA   . PHE A 1 47  ? -9.863  -2.483  0.743   1.00 0.00 ? 201 PHE A HA   3  
ATOM   5099  H  HB2  . PHE A 1 47  ? -10.428 -0.635  -1.101  1.00 0.00 ? 201 PHE A HB2  3  
ATOM   5100  H  HB3  . PHE A 1 47  ? -11.990 -1.450  -1.115  1.00 0.00 ? 201 PHE A HB3  3  
ATOM   5101  H  HD1  . PHE A 1 47  ? -9.579  0.432   0.979   1.00 0.00 ? 201 PHE A HD1  3  
ATOM   5102  H  HD2  . PHE A 1 47  ? -13.496 -1.318  0.763   1.00 0.00 ? 201 PHE A HD2  3  
ATOM   5103  H  HE1  . PHE A 1 47  ? -10.231 1.637   3.049   1.00 0.00 ? 201 PHE A HE1  3  
ATOM   5104  H  HE2  . PHE A 1 47  ? -14.148 -0.113  2.828   1.00 0.00 ? 201 PHE A HE2  3  
ATOM   5105  H  HZ   . PHE A 1 47  ? -12.516 1.363   3.972   1.00 0.00 ? 201 PHE A HZ   3  
ATOM   5106  N  N    . LYS A 1 48  ? -11.865 -4.322  -1.142  1.00 0.00 ? 202 LYS A N    3  
ATOM   5107  C  CA   . LYS A 1 48  ? -12.858 -5.444  -1.020  1.00 0.00 ? 202 LYS A CA   3  
ATOM   5108  C  C    . LYS A 1 48  ? -12.127 -6.720  -0.585  1.00 0.00 ? 202 LYS A C    3  
ATOM   5109  O  O    . LYS A 1 48  ? -12.629 -7.470  0.228   1.00 0.00 ? 202 LYS A O    3  
ATOM   5110  C  CB   . LYS A 1 48  ? -13.494 -5.629  -2.407  1.00 0.00 ? 202 LYS A CB   3  
ATOM   5111  C  CG   . LYS A 1 48  ? -14.958 -6.044  -2.247  1.00 0.00 ? 202 LYS A CG   3  
ATOM   5112  C  CD   . LYS A 1 48  ? -15.717 -5.746  -3.542  1.00 0.00 ? 202 LYS A CD   3  
ATOM   5113  C  CE   . LYS A 1 48  ? -17.180 -6.169  -3.386  1.00 0.00 ? 202 LYS A CE   3  
ATOM   5114  N  NZ   . LYS A 1 48  ? -17.253 -7.529  -3.986  1.00 0.00 ? 202 LYS A NZ   3  
ATOM   5115  H  H    . LYS A 1 48  ? -11.515 -4.061  -2.030  1.00 0.00 ? 202 LYS A H    3  
ATOM   5116  H  HA   . LYS A 1 48  ? -13.616 -5.191  -0.294  1.00 0.00 ? 202 LYS A HA   3  
ATOM   5117  H  HB2  . LYS A 1 48  ? -13.440 -4.700  -2.955  1.00 0.00 ? 202 LYS A HB2  3  
ATOM   5118  H  HB3  . LYS A 1 48  ? -12.962 -6.398  -2.948  1.00 0.00 ? 202 LYS A HB3  3  
ATOM   5119  H  HG2  . LYS A 1 48  ? -15.011 -7.101  -2.032  1.00 0.00 ? 202 LYS A HG2  3  
ATOM   5120  H  HG3  . LYS A 1 48  ? -15.403 -5.488  -1.435  1.00 0.00 ? 202 LYS A HG3  3  
ATOM   5121  H  HD2  . LYS A 1 48  ? -15.667 -4.688  -3.753  1.00 0.00 ? 202 LYS A HD2  3  
ATOM   5122  H  HD3  . LYS A 1 48  ? -15.271 -6.298  -4.356  1.00 0.00 ? 202 LYS A HD3  3  
ATOM   5123  H  HE2  . LYS A 1 48  ? -17.452 -6.200  -2.339  1.00 0.00 ? 202 LYS A HE2  3  
ATOM   5124  H  HE3  . LYS A 1 48  ? -17.827 -5.492  -3.923  1.00 0.00 ? 202 LYS A HE3  3  
ATOM   5125  H  HZ1  . LYS A 1 48  ? -17.069 -7.470  -5.007  1.00 0.00 ? 202 LYS A HZ1  3  
ATOM   5126  H  HZ2  . LYS A 1 48  ? -18.202 -7.928  -3.826  1.00 0.00 ? 202 LYS A HZ2  3  
ATOM   5127  H  HZ3  . LYS A 1 48  ? -16.541 -8.143  -3.543  1.00 0.00 ? 202 LYS A HZ3  3  
ATOM   5128  N  N    . TYR A 1 49  ? -10.938 -6.966  -1.099  1.00 0.00 ? 203 TYR A N    3  
ATOM   5129  C  CA   . TYR A 1 49  ? -10.191 -8.199  -0.672  1.00 0.00 ? 203 TYR A CA   3  
ATOM   5130  C  C    . TYR A 1 49  ? -9.646  -8.000  0.751   1.00 0.00 ? 203 TYR A C    3  
ATOM   5131  O  O    . TYR A 1 49  ? -9.650  -8.925  1.544   1.00 0.00 ? 203 TYR A O    3  
ATOM   5132  C  CB   . TYR A 1 49  ? -9.044  -8.388  -1.684  1.00 0.00 ? 203 TYR A CB   3  
ATOM   5133  C  CG   . TYR A 1 49  ? -8.196  -9.577  -1.297  1.00 0.00 ? 203 TYR A CG   3  
ATOM   5134  C  CD1  . TYR A 1 49  ? -8.792  -10.821 -1.057  1.00 0.00 ? 203 TYR A CD1  3  
ATOM   5135  C  CD2  . TYR A 1 49  ? -6.810  -9.432  -1.179  1.00 0.00 ? 203 TYR A CD2  3  
ATOM   5136  C  CE1  . TYR A 1 49  ? -8.002  -11.919 -0.698  1.00 0.00 ? 203 TYR A CE1  3  
ATOM   5137  C  CE2  . TYR A 1 49  ? -6.018  -10.529 -0.820  1.00 0.00 ? 203 TYR A CE2  3  
ATOM   5138  C  CZ   . TYR A 1 49  ? -6.614  -11.773 -0.580  1.00 0.00 ? 203 TYR A CZ   3  
ATOM   5139  O  OH   . TYR A 1 49  ? -5.834  -12.854 -0.227  1.00 0.00 ? 203 TYR A OH   3  
ATOM   5140  H  H    . TYR A 1 49  ? -10.536 -6.337  -1.746  1.00 0.00 ? 203 TYR A H    3  
ATOM   5141  H  HA   . TYR A 1 49  ? -10.852 -9.054  -0.694  1.00 0.00 ? 203 TYR A HA   3  
ATOM   5142  H  HB2  . TYR A 1 49  ? -9.459  -8.551  -2.668  1.00 0.00 ? 203 TYR A HB2  3  
ATOM   5143  H  HB3  . TYR A 1 49  ? -8.430  -7.500  -1.697  1.00 0.00 ? 203 TYR A HB3  3  
ATOM   5144  H  HD1  . TYR A 1 49  ? -9.863  -10.934 -1.149  1.00 0.00 ? 203 TYR A HD1  3  
ATOM   5145  H  HD2  . TYR A 1 49  ? -6.350  -8.470  -1.364  1.00 0.00 ? 203 TYR A HD2  3  
ATOM   5146  H  HE1  . TYR A 1 49  ? -8.461  -12.878 -0.513  1.00 0.00 ? 203 TYR A HE1  3  
ATOM   5147  H  HE2  . TYR A 1 49  ? -4.948  -10.416 -0.729  1.00 0.00 ? 203 TYR A HE2  3  
ATOM   5148  H  HH   . TYR A 1 49  ? -5.382  -13.165 -1.014  1.00 0.00 ? 203 TYR A HH   3  
ATOM   5149  N  N    . TYR A 1 50  ? -9.199  -6.805  1.102   1.00 0.00 ? 204 TYR A N    3  
ATOM   5150  C  CA   . TYR A 1 50  ? -8.692  -6.599  2.503   1.00 0.00 ? 204 TYR A CA   3  
ATOM   5151  C  C    . TYR A 1 50  ? -9.862  -6.743  3.493   1.00 0.00 ? 204 TYR A C    3  
ATOM   5152  O  O    . TYR A 1 50  ? -9.681  -7.213  4.600   1.00 0.00 ? 204 TYR A O    3  
ATOM   5153  C  CB   . TYR A 1 50  ? -8.096  -5.182  2.572   1.00 0.00 ? 204 TYR A CB   3  
ATOM   5154  C  CG   . TYR A 1 50  ? -7.088  -5.110  3.694   1.00 0.00 ? 204 TYR A CG   3  
ATOM   5155  C  CD1  . TYR A 1 50  ? -6.051  -6.050  3.763   1.00 0.00 ? 204 TYR A CD1  3  
ATOM   5156  C  CD2  . TYR A 1 50  ? -7.185  -4.104  4.662   1.00 0.00 ? 204 TYR A CD2  3  
ATOM   5157  C  CE1  . TYR A 1 50  ? -5.115  -5.985  4.798   1.00 0.00 ? 204 TYR A CE1  3  
ATOM   5158  C  CE2  . TYR A 1 50  ? -6.248  -4.039  5.699   1.00 0.00 ? 204 TYR A CE2  3  
ATOM   5159  C  CZ   . TYR A 1 50  ? -5.212  -4.980  5.768   1.00 0.00 ? 204 TYR A CZ   3  
ATOM   5160  O  OH   . TYR A 1 50  ? -4.289  -4.915  6.791   1.00 0.00 ? 204 TYR A OH   3  
ATOM   5161  H  H    . TYR A 1 50  ? -9.221  -6.053  0.460   1.00 0.00 ? 204 TYR A H    3  
ATOM   5162  H  HA   . TYR A 1 50  ? -7.929  -7.330  2.727   1.00 0.00 ? 204 TYR A HA   3  
ATOM   5163  H  HB2  . TYR A 1 50  ? -7.606  -4.953  1.639   1.00 0.00 ? 204 TYR A HB2  3  
ATOM   5164  H  HB3  . TYR A 1 50  ? -8.885  -4.466  2.751   1.00 0.00 ? 204 TYR A HB3  3  
ATOM   5165  H  HD1  . TYR A 1 50  ? -5.976  -6.825  3.015   1.00 0.00 ? 204 TYR A HD1  3  
ATOM   5166  H  HD2  . TYR A 1 50  ? -7.984  -3.379  4.610   1.00 0.00 ? 204 TYR A HD2  3  
ATOM   5167  H  HE1  . TYR A 1 50  ? -4.317  -6.712  4.850   1.00 0.00 ? 204 TYR A HE1  3  
ATOM   5168  H  HE2  . TYR A 1 50  ? -6.323  -3.262  6.446   1.00 0.00 ? 204 TYR A HE2  3  
ATOM   5169  H  HH   . TYR A 1 50  ? -4.739  -5.135  7.611   1.00 0.00 ? 204 TYR A HH   3  
ATOM   5170  N  N    . MET A 1 51  ? -11.067 -6.360  3.100   1.00 0.00 ? 205 MET A N    3  
ATOM   5171  C  CA   . MET A 1 51  ? -12.236 -6.508  4.032   1.00 0.00 ? 205 MET A CA   3  
ATOM   5172  C  C    . MET A 1 51  ? -12.853 -7.904  3.855   1.00 0.00 ? 205 MET A C    3  
ATOM   5173  O  O    . MET A 1 51  ? -13.203 -8.554  4.823   1.00 0.00 ? 205 MET A O    3  
ATOM   5174  C  CB   . MET A 1 51  ? -13.242 -5.412  3.641   1.00 0.00 ? 205 MET A CB   3  
ATOM   5175  C  CG   . MET A 1 51  ? -14.480 -5.505  4.534   1.00 0.00 ? 205 MET A CG   3  
ATOM   5176  S  SD   . MET A 1 51  ? -15.589 -4.119  4.176   1.00 0.00 ? 205 MET A SD   3  
ATOM   5177  C  CE   . MET A 1 51  ? -16.105 -3.794  5.881   1.00 0.00 ? 205 MET A CE   3  
ATOM   5178  H  H    . MET A 1 51  ? -11.204 -5.994  2.195   1.00 0.00 ? 205 MET A H    3  
ATOM   5179  H  HA   . MET A 1 51  ? -11.917 -6.370  5.049   1.00 0.00 ? 205 MET A HA   3  
ATOM   5180  H  HB2  . MET A 1 51  ? -12.782 -4.442  3.764   1.00 0.00 ? 205 MET A HB2  3  
ATOM   5181  H  HB3  . MET A 1 51  ? -13.534 -5.543  2.610   1.00 0.00 ? 205 MET A HB3  3  
ATOM   5182  H  HG2  . MET A 1 51  ? -14.993 -6.436  4.341   1.00 0.00 ? 205 MET A HG2  3  
ATOM   5183  H  HG3  . MET A 1 51  ? -14.181 -5.469  5.572   1.00 0.00 ? 205 MET A HG3  3  
ATOM   5184  H  HE1  . MET A 1 51  ? -15.311 -4.078  6.557   1.00 0.00 ? 205 MET A HE1  3  
ATOM   5185  H  HE2  . MET A 1 51  ? -16.989 -4.367  6.107   1.00 0.00 ? 205 MET A HE2  3  
ATOM   5186  H  HE3  . MET A 1 51  ? -16.323 -2.740  5.995   1.00 0.00 ? 205 MET A HE3  3  
ATOM   5187  N  N    . SER A 1 52  ? -12.982 -8.378  2.630   1.00 0.00 ? 206 SER A N    3  
ATOM   5188  C  CA   . SER A 1 52  ? -13.574 -9.752  2.419   1.00 0.00 ? 206 SER A CA   3  
ATOM   5189  C  C    . SER A 1 52  ? -12.765 -10.798 3.200   1.00 0.00 ? 206 SER A C    3  
ATOM   5190  O  O    . SER A 1 52  ? -13.321 -11.702 3.794   1.00 0.00 ? 206 SER A O    3  
ATOM   5191  C  CB   . SER A 1 52  ? -13.505 -10.054 0.915   1.00 0.00 ? 206 SER A CB   3  
ATOM   5192  O  OG   . SER A 1 52  ? -12.145 -10.212 0.531   1.00 0.00 ? 206 SER A OG   3  
ATOM   5193  H  H    . SER A 1 52  ? -12.686 -7.836  1.864   1.00 0.00 ? 206 SER A H    3  
ATOM   5194  H  HA   . SER A 1 52  ? -14.595 -9.761  2.742   1.00 0.00 ? 206 SER A HA   3  
ATOM   5195  H  HB2  . SER A 1 52  ? -14.040 -10.965 0.706   1.00 0.00 ? 206 SER A HB2  3  
ATOM   5196  H  HB3  . SER A 1 52  ? -13.956 -9.241  0.363   1.00 0.00 ? 206 SER A HB3  3  
ATOM   5197  H  HG   . SER A 1 52  ? -12.120 -10.758 -0.259  1.00 0.00 ? 206 SER A HG   3  
ATOM   5198  N  N    . ASP A 1 53  ? -11.454 -10.674 3.212   1.00 0.00 ? 207 ASP A N    3  
ATOM   5199  C  CA   . ASP A 1 53  ? -10.614 -11.654 3.961   1.00 0.00 ? 207 ASP A CA   3  
ATOM   5200  C  C    . ASP A 1 53  ? -9.844  -10.932 5.078   1.00 0.00 ? 207 ASP A C    3  
ATOM   5201  O  O    . ASP A 1 53  ? -9.356  -9.834  4.883   1.00 0.00 ? 207 ASP A O    3  
ATOM   5202  C  CB   . ASP A 1 53  ? -9.647  -12.222 2.921   1.00 0.00 ? 207 ASP A CB   3  
ATOM   5203  C  CG   . ASP A 1 53  ? -10.404 -13.159 1.979   1.00 0.00 ? 207 ASP A CG   3  
ATOM   5204  O  OD1  . ASP A 1 53  ? -10.599 -14.307 2.345   1.00 0.00 ? 207 ASP A OD1  3  
ATOM   5205  O  OD2  . ASP A 1 53  ? -10.778 -12.714 0.905   1.00 0.00 ? 207 ASP A OD2  3  
ATOM   5206  H  H    . ASP A 1 53  ? -11.022 -9.935  2.732   1.00 0.00 ? 207 ASP A H    3  
ATOM   5207  H  HA   . ASP A 1 53  ? -11.225 -12.443 4.370   1.00 0.00 ? 207 ASP A HA   3  
ATOM   5208  H  HB2  . ASP A 1 53  ? -9.214  -11.412 2.352   1.00 0.00 ? 207 ASP A HB2  3  
ATOM   5209  H  HB3  . ASP A 1 53  ? -8.864  -12.773 3.420   1.00 0.00 ? 207 ASP A HB3  3  
ATOM   5210  N  N    . ASP A 1 54  ? -9.728  -11.533 6.243   1.00 0.00 ? 208 ASP A N    3  
ATOM   5211  C  CA   . ASP A 1 54  ? -8.985  -10.865 7.358   1.00 0.00 ? 208 ASP A CA   3  
ATOM   5212  C  C    . ASP A 1 54  ? -7.658  -11.588 7.618   1.00 0.00 ? 208 ASP A C    3  
ATOM   5213  O  O    . ASP A 1 54  ? -7.542  -12.777 7.386   1.00 0.00 ? 208 ASP A O    3  
ATOM   5214  C  CB   . ASP A 1 54  ? -9.902  -10.969 8.581   1.00 0.00 ? 208 ASP A CB   3  
ATOM   5215  C  CG   . ASP A 1 54  ? -10.926 -9.834  8.549   1.00 0.00 ? 208 ASP A CG   3  
ATOM   5216  O  OD1  . ASP A 1 54  ? -11.972 -10.022 7.949   1.00 0.00 ? 208 ASP A OD1  3  
ATOM   5217  O  OD2  . ASP A 1 54  ? -10.649 -8.795  9.125   1.00 0.00 ? 208 ASP A OD2  3  
ATOM   5218  H  H    . ASP A 1 54  ? -10.126 -12.423 6.386   1.00 0.00 ? 208 ASP A H    3  
ATOM   5219  H  HA   . ASP A 1 54  ? -8.804  -9.829  7.123   1.00 0.00 ? 208 ASP A HA   3  
ATOM   5220  H  HB2  . ASP A 1 54  ? -10.416 -11.920 8.565   1.00 0.00 ? 208 ASP A HB2  3  
ATOM   5221  H  HB3  . ASP A 1 54  ? -9.312  -10.893 9.482   1.00 0.00 ? 208 ASP A HB3  3  
ATOM   5222  N  N    . ILE A 1 55  ? -6.656  -10.884 8.103   1.00 0.00 ? 209 ILE A N    3  
ATOM   5223  C  CA   . ILE A 1 55  ? -5.342  -11.550 8.375   1.00 0.00 ? 209 ILE A CA   3  
ATOM   5224  C  C    . ILE A 1 55  ? -5.193  -11.823 9.879   1.00 0.00 ? 209 ILE A C    3  
ATOM   5225  O  O    . ILE A 1 55  ? -5.194  -10.909 10.682  1.00 0.00 ? 209 ILE A O    3  
ATOM   5226  C  CB   . ILE A 1 55  ? -4.263  -10.573 7.887   1.00 0.00 ? 209 ILE A CB   3  
ATOM   5227  C  CG1  . ILE A 1 55  ? -4.455  -10.300 6.385   1.00 0.00 ? 209 ILE A CG1  3  
ATOM   5228  C  CG2  . ILE A 1 55  ? -2.874  -11.176 8.124   1.00 0.00 ? 209 ILE A CG2  3  
ATOM   5229  C  CD1  . ILE A 1 55  ? -4.376  -11.611 5.589   1.00 0.00 ? 209 ILE A CD1  3  
ATOM   5230  H  H    . ILE A 1 55  ? -6.769  -9.923  8.290   1.00 0.00 ? 209 ILE A H    3  
ATOM   5231  H  HA   . ILE A 1 55  ? -5.276  -12.475 7.823   1.00 0.00 ? 209 ILE A HA   3  
ATOM   5232  H  HB   . ILE A 1 55  ? -4.347  -9.645  8.434   1.00 0.00 ? 209 ILE A HB   3  
ATOM   5233  H  HG12 . ILE A 1 55  ? -5.420  -9.843  6.226   1.00 0.00 ? 209 ILE A HG12 3  
ATOM   5234  H  HG13 . ILE A 1 55  ? -3.681  -9.629  6.043   1.00 0.00 ? 209 ILE A HG13 3  
ATOM   5235  H  HG21 . ILE A 1 55  ? -2.849  -12.184 7.737   1.00 0.00 ? 209 ILE A HG21 3  
ATOM   5236  H  HG22 . ILE A 1 55  ? -2.664  -11.193 9.184   1.00 0.00 ? 209 ILE A HG22 3  
ATOM   5237  H  HG23 . ILE A 1 55  ? -2.129  -10.578 7.621   1.00 0.00 ? 209 ILE A HG23 3  
ATOM   5238  H  HD11 . ILE A 1 55  ? -5.350  -11.843 5.183   1.00 0.00 ? 209 ILE A HD11 3  
ATOM   5239  H  HD12 . ILE A 1 55  ? -4.058  -12.414 6.241   1.00 0.00 ? 209 ILE A HD12 3  
ATOM   5240  H  HD13 . ILE A 1 55  ? -3.668  -11.499 4.780   1.00 0.00 ? 209 ILE A HD13 3  
ATOM   5241  N  N    . SER A 1 56  ? -5.064  -13.075 10.265  1.00 0.00 ? 210 SER A N    3  
ATOM   5242  C  CA   . SER A 1 56  ? -4.914  -13.400 11.724  1.00 0.00 ? 210 SER A CA   3  
ATOM   5243  C  C    . SER A 1 56  ? -4.558  -14.883 11.923  1.00 0.00 ? 210 SER A C    3  
ATOM   5244  O  O    . SER A 1 56  ? -5.268  -15.759 11.465  1.00 0.00 ? 210 SER A O    3  
ATOM   5245  C  CB   . SER A 1 56  ? -6.278  -13.095 12.344  1.00 0.00 ? 210 SER A CB   3  
ATOM   5246  O  OG   . SER A 1 56  ? -6.123  -12.904 13.745  1.00 0.00 ? 210 SER A OG   3  
ATOM   5247  H  H    . SER A 1 56  ? -5.064  -13.801 9.596   1.00 0.00 ? 210 SER A H    3  
ATOM   5248  H  HA   . SER A 1 56  ? -4.161  -12.771 12.171  1.00 0.00 ? 210 SER A HA   3  
ATOM   5249  H  HB2  . SER A 1 56  ? -6.684  -12.199 11.906  1.00 0.00 ? 210 SER A HB2  3  
ATOM   5250  H  HB3  . SER A 1 56  ? -6.951  -13.922 12.155  1.00 0.00 ? 210 SER A HB3  3  
ATOM   5251  H  HG   . SER A 1 56  ? -6.988  -12.711 14.115  1.00 0.00 ? 210 SER A HG   3  
ATOM   5252  N  N    . ARG A 1 57  ? -3.466  -15.177 12.604  1.00 0.00 ? 211 ARG A N    3  
ATOM   5253  C  CA   . ARG A 1 57  ? -3.070  -16.607 12.833  1.00 0.00 ? 211 ARG A CA   3  
ATOM   5254  C  C    . ARG A 1 57  ? -3.032  -17.385 11.503  1.00 0.00 ? 211 ARG A C    3  
ATOM   5255  O  O    . ARG A 1 57  ? -3.909  -18.182 11.223  1.00 0.00 ? 211 ARG A O    3  
ATOM   5256  C  CB   . ARG A 1 57  ? -4.145  -17.182 13.762  1.00 0.00 ? 211 ARG A CB   3  
ATOM   5257  C  CG   . ARG A 1 57  ? -3.692  -17.042 15.217  1.00 0.00 ? 211 ARG A CG   3  
ATOM   5258  C  CD   . ARG A 1 57  ? -4.327  -18.151 16.058  1.00 0.00 ? 211 ARG A CD   3  
ATOM   5259  N  NE   . ARG A 1 57  ? -3.264  -18.558 17.027  1.00 0.00 ? 211 ARG A NE   3  
ATOM   5260  C  CZ   . ARG A 1 57  ? -2.975  -17.813 18.084  1.00 0.00 ? 211 ARG A CZ   3  
ATOM   5261  N  NH1  . ARG A 1 57  ? -3.608  -16.686 18.323  1.00 0.00 ? 211 ARG A NH1  3  
ATOM   5262  N  NH2  . ARG A 1 57  ? -2.038  -18.201 18.911  1.00 0.00 ? 211 ARG A NH2  3  
ATOM   5263  H  H    . ARG A 1 57  ? -2.903  -14.459 12.971  1.00 0.00 ? 211 ARG A H    3  
ATOM   5264  H  HA   . ARG A 1 57  ? -2.109  -16.652 13.318  1.00 0.00 ? 211 ARG A HA   3  
ATOM   5265  H  HB2  . ARG A 1 57  ? -5.070  -16.642 13.619  1.00 0.00 ? 211 ARG A HB2  3  
ATOM   5266  H  HB3  . ARG A 1 57  ? -4.298  -18.225 13.533  1.00 0.00 ? 211 ARG A HB3  3  
ATOM   5267  H  HG2  . ARG A 1 57  ? -2.616  -17.121 15.268  1.00 0.00 ? 211 ARG A HG2  3  
ATOM   5268  H  HG3  . ARG A 1 57  ? -4.001  -16.081 15.600  1.00 0.00 ? 211 ARG A HG3  3  
ATOM   5269  H  HD2  . ARG A 1 57  ? -5.195  -17.774 16.582  1.00 0.00 ? 211 ARG A HD2  3  
ATOM   5270  H  HD3  . ARG A 1 57  ? -4.597  -18.989 15.434  1.00 0.00 ? 211 ARG A HD3  3  
ATOM   5271  H  HE   . ARG A 1 57  ? -2.774  -19.395 16.875  1.00 0.00 ? 211 ARG A HE   3  
ATOM   5272  H  HH11 . ARG A 1 57  ? -4.327  -16.368 17.706  1.00 0.00 ? 211 ARG A HH11 3  
ATOM   5273  H  HH12 . ARG A 1 57  ? -3.369  -16.144 19.128  1.00 0.00 ? 211 ARG A HH12 3  
ATOM   5274  H  HH21 . ARG A 1 57  ? -1.546  -19.054 18.744  1.00 0.00 ? 211 ARG A HH21 3  
ATOM   5275  H  HH22 . ARG A 1 57  ? -1.815  -17.642 19.710  1.00 0.00 ? 211 ARG A HH22 3  
ATOM   5276  N  N    . ASP A 1 58  ? -2.025  -17.162 10.682  1.00 0.00 ? 212 ASP A N    3  
ATOM   5277  C  CA   . ASP A 1 58  ? -1.945  -17.896 9.381   1.00 0.00 ? 212 ASP A CA   3  
ATOM   5278  C  C    . ASP A 1 58  ? -0.554  -18.531 9.210   1.00 0.00 ? 212 ASP A C    3  
ATOM   5279  O  O    . ASP A 1 58  ? 0.415   -18.057 9.767   1.00 0.00 ? 212 ASP A O    3  
ATOM   5280  C  CB   . ASP A 1 58  ? -2.199  -16.837 8.300   1.00 0.00 ? 212 ASP A CB   3  
ATOM   5281  C  CG   . ASP A 1 58  ? -1.146  -15.728 8.392   1.00 0.00 ? 212 ASP A CG   3  
ATOM   5282  O  OD1  . ASP A 1 58  ? 0.015   -16.020 8.159   1.00 0.00 ? 212 ASP A OD1  3  
ATOM   5283  O  OD2  . ASP A 1 58  ? -1.521  -14.607 8.693   1.00 0.00 ? 212 ASP A OD2  3  
ATOM   5284  H  H    . ASP A 1 58  ? -1.322  -16.517 10.919  1.00 0.00 ? 212 ASP A H    3  
ATOM   5285  H  HA   . ASP A 1 58  ? -2.709  -18.656 9.334   1.00 0.00 ? 212 ASP A HA   3  
ATOM   5286  H  HB2  . ASP A 1 58  ? -2.147  -17.301 7.326   1.00 0.00 ? 212 ASP A HB2  3  
ATOM   5287  H  HB3  . ASP A 1 58  ? -3.180  -16.410 8.442   1.00 0.00 ? 212 ASP A HB3  3  
ATOM   5288  N  N    . SER A 1 59  ? -0.445  -19.598 8.435   1.00 0.00 ? 213 SER A N    3  
ATOM   5289  C  CA   . SER A 1 59  ? 0.884   -20.273 8.220   1.00 0.00 ? 213 SER A CA   3  
ATOM   5290  C  C    . SER A 1 59  ? 1.414   -20.878 9.535   1.00 0.00 ? 213 SER A C    3  
ATOM   5291  O  O    . SER A 1 59  ? 1.448   -22.084 9.687   1.00 0.00 ? 213 SER A O    3  
ATOM   5292  C  CB   . SER A 1 59  ? 1.840   -19.195 7.684   1.00 0.00 ? 213 SER A CB   3  
ATOM   5293  O  OG   . SER A 1 59  ? 2.315   -19.586 6.402   1.00 0.00 ? 213 SER A OG   3  
ATOM   5294  H  H    . SER A 1 59  ? -1.241  -19.962 7.990   1.00 0.00 ? 213 SER A H    3  
ATOM   5295  H  HA   . SER A 1 59  ? 0.775   -21.053 7.482   1.00 0.00 ? 213 SER A HA   3  
ATOM   5296  H  HB2  . SER A 1 59  ? 1.320   -18.258 7.596   1.00 0.00 ? 213 SER A HB2  3  
ATOM   5297  H  HB3  . SER A 1 59  ? 2.673   -19.080 8.366   1.00 0.00 ? 213 SER A HB3  3  
ATOM   5298  H  HG   . SER A 1 59  ? 2.735   -18.825 5.997   1.00 0.00 ? 213 SER A HG   3  
ATOM   5299  N  N    . ASP A 1 60  ? 1.829   -20.061 10.482  1.00 0.00 ? 214 ASP A N    3  
ATOM   5300  C  CA   . ASP A 1 60  ? 2.354   -20.613 11.772  1.00 0.00 ? 214 ASP A CA   3  
ATOM   5301  C  C    . ASP A 1 60  ? 1.434   -20.221 12.937  1.00 0.00 ? 214 ASP A C    3  
ATOM   5302  O  O    . ASP A 1 60  ? 1.901   -19.899 14.014  1.00 0.00 ? 214 ASP A O    3  
ATOM   5303  C  CB   . ASP A 1 60  ? 3.730   -19.970 11.945  1.00 0.00 ? 214 ASP A CB   3  
ATOM   5304  C  CG   . ASP A 1 60  ? 4.544   -20.771 12.964  1.00 0.00 ? 214 ASP A CG   3  
ATOM   5305  O  OD1  . ASP A 1 60  ? 4.303   -20.603 14.147  1.00 0.00 ? 214 ASP A OD1  3  
ATOM   5306  O  OD2  . ASP A 1 60  ? 5.393   -21.538 12.543  1.00 0.00 ? 214 ASP A OD2  3  
ATOM   5307  H  H    . ASP A 1 60  ? 1.798   -19.088 10.349  1.00 0.00 ? 214 ASP A H    3  
ATOM   5308  H  HA   . ASP A 1 60  ? 2.453   -21.685 11.710  1.00 0.00 ? 214 ASP A HA   3  
ATOM   5309  H  HB2  . ASP A 1 60  ? 4.246   -19.963 10.996  1.00 0.00 ? 214 ASP A HB2  3  
ATOM   5310  H  HB3  . ASP A 1 60  ? 3.610   -18.957 12.298  1.00 0.00 ? 214 ASP A HB3  3  
ATOM   5311  N  N    . GLY A 1 61  ? 0.131   -20.241 12.739  1.00 0.00 ? 215 GLY A N    3  
ATOM   5312  C  CA   . GLY A 1 61  ? -0.807  -19.864 13.843  1.00 0.00 ? 215 GLY A CA   3  
ATOM   5313  C  C    . GLY A 1 61  ? -0.468  -18.460 14.385  1.00 0.00 ? 215 GLY A C    3  
ATOM   5314  O  O    . GLY A 1 61  ? -0.661  -18.189 15.556  1.00 0.00 ? 215 GLY A O    3  
ATOM   5315  H  H    . GLY A 1 61  ? -0.234  -20.500 11.864  1.00 0.00 ? 215 GLY A H    3  
ATOM   5316  H  HA2  . GLY A 1 61  ? -1.819  -19.867 13.466  1.00 0.00 ? 215 GLY A HA2  3  
ATOM   5317  H  HA3  . GLY A 1 61  ? -0.721  -20.582 14.644  1.00 0.00 ? 215 GLY A HA3  3  
ATOM   5318  N  N    . MET A 1 62  ? 0.033   -17.565 13.554  1.00 0.00 ? 216 MET A N    3  
ATOM   5319  C  CA   . MET A 1 62  ? 0.372   -16.192 14.044  1.00 0.00 ? 216 MET A CA   3  
ATOM   5320  C  C    . MET A 1 62  ? 0.110   -15.159 12.934  1.00 0.00 ? 216 MET A C    3  
ATOM   5321  O  O    . MET A 1 62  ? -0.581  -15.447 11.976  1.00 0.00 ? 216 MET A O    3  
ATOM   5322  C  CB   . MET A 1 62  ? 1.863   -16.256 14.389  1.00 0.00 ? 216 MET A CB   3  
ATOM   5323  C  CG   . MET A 1 62  ? 2.115   -15.549 15.723  1.00 0.00 ? 216 MET A CG   3  
ATOM   5324  S  SD   . MET A 1 62  ? 3.871   -15.133 15.862  1.00 0.00 ? 216 MET A SD   3  
ATOM   5325  C  CE   . MET A 1 62  ? 3.880   -14.779 17.636  1.00 0.00 ? 216 MET A CE   3  
ATOM   5326  H  H    . MET A 1 62  ? 0.186   -17.789 12.610  1.00 0.00 ? 216 MET A H    3  
ATOM   5327  H  HA   . MET A 1 62  ? -0.204  -15.954 14.926  1.00 0.00 ? 216 MET A HA   3  
ATOM   5328  H  HB2  . MET A 1 62  ? 2.172   -17.289 14.466  1.00 0.00 ? 216 MET A HB2  3  
ATOM   5329  H  HB3  . MET A 1 62  ? 2.434   -15.768 13.613  1.00 0.00 ? 216 MET A HB3  3  
ATOM   5330  H  HG2  . MET A 1 62  ? 1.526   -14.645 15.768  1.00 0.00 ? 216 MET A HG2  3  
ATOM   5331  H  HG3  . MET A 1 62  ? 1.835   -16.203 16.535  1.00 0.00 ? 216 MET A HG3  3  
ATOM   5332  H  HE1  . MET A 1 62  ? 4.900   -14.648 17.972  1.00 0.00 ? 216 MET A HE1  3  
ATOM   5333  H  HE2  . MET A 1 62  ? 3.431   -15.602 18.170  1.00 0.00 ? 216 MET A HE2  3  
ATOM   5334  H  HE3  . MET A 1 62  ? 3.313   -13.878 17.826  1.00 0.00 ? 216 MET A HE3  3  
ATOM   5335  N  N    . ASP A 1 63  ? 0.660   -13.964 13.041  1.00 0.00 ? 217 ASP A N    3  
ATOM   5336  C  CA   . ASP A 1 63  ? 0.431   -12.944 11.964  1.00 0.00 ? 217 ASP A CA   3  
ATOM   5337  C  C    . ASP A 1 63  ? 1.597   -12.982 10.966  1.00 0.00 ? 217 ASP A C    3  
ATOM   5338  O  O    . ASP A 1 63  ? 2.695   -12.560 11.280  1.00 0.00 ? 217 ASP A O    3  
ATOM   5339  C  CB   . ASP A 1 63  ? 0.367   -11.583 12.670  1.00 0.00 ? 217 ASP A CB   3  
ATOM   5340  C  CG   . ASP A 1 63  ? -0.474  -10.614 11.838  1.00 0.00 ? 217 ASP A CG   3  
ATOM   5341  O  OD1  . ASP A 1 63  ? -1.684  -10.769 11.828  1.00 0.00 ? 217 ASP A OD1  3  
ATOM   5342  O  OD2  . ASP A 1 63  ? 0.107   -9.732  11.226  1.00 0.00 ? 217 ASP A OD2  3  
ATOM   5343  H  H    . ASP A 1 63  ? 1.228   -13.746 13.816  1.00 0.00 ? 217 ASP A H    3  
ATOM   5344  H  HA   . ASP A 1 63  ? -0.501  -13.141 11.456  1.00 0.00 ? 217 ASP A HA   3  
ATOM   5345  H  HB2  . ASP A 1 63  ? -0.081  -11.705 13.646  1.00 0.00 ? 217 ASP A HB2  3  
ATOM   5346  H  HB3  . ASP A 1 63  ? 1.366   -11.188 12.780  1.00 0.00 ? 217 ASP A HB3  3  
ATOM   5347  N  N    . GLU A 1 64  ? 1.377   -13.489 9.770   1.00 0.00 ? 218 GLU A N    3  
ATOM   5348  C  CA   . GLU A 1 64  ? 2.487   -13.555 8.771   1.00 0.00 ? 218 GLU A CA   3  
ATOM   5349  C  C    . GLU A 1 64  ? 1.960   -13.234 7.363   1.00 0.00 ? 218 GLU A C    3  
ATOM   5350  O  O    . GLU A 1 64  ? 2.209   -13.968 6.425   1.00 0.00 ? 218 GLU A O    3  
ATOM   5351  C  CB   . GLU A 1 64  ? 2.993   -14.997 8.842   1.00 0.00 ? 218 GLU A CB   3  
ATOM   5352  C  CG   . GLU A 1 64  ? 4.517   -15.014 8.694   1.00 0.00 ? 218 GLU A CG   3  
ATOM   5353  C  CD   . GLU A 1 64  ? 5.166   -15.044 10.081  1.00 0.00 ? 218 GLU A CD   3  
ATOM   5354  O  OE1  . GLU A 1 64  ? 4.961   -16.018 10.788  1.00 0.00 ? 218 GLU A OE1  3  
ATOM   5355  O  OE2  . GLU A 1 64  ? 5.855   -14.094 10.411  1.00 0.00 ? 218 GLU A OE2  3  
ATOM   5356  H  H    . GLU A 1 64  ? 0.486   -13.832 9.529   1.00 0.00 ? 218 GLU A H    3  
ATOM   5357  H  HA   . GLU A 1 64  ? 3.277   -12.873 9.043   1.00 0.00 ? 218 GLU A HA   3  
ATOM   5358  H  HB2  . GLU A 1 64  ? 2.717   -15.428 9.793   1.00 0.00 ? 218 GLU A HB2  3  
ATOM   5359  H  HB3  . GLU A 1 64  ? 2.551   -15.573 8.043   1.00 0.00 ? 218 GLU A HB3  3  
ATOM   5360  H  HG2  . GLU A 1 64  ? 4.814   -15.891 8.139   1.00 0.00 ? 218 GLU A HG2  3  
ATOM   5361  H  HG3  . GLU A 1 64  ? 4.839   -14.128 8.168   1.00 0.00 ? 218 GLU A HG3  3  
ATOM   5362  N  N    . GLN A 1 65  ? 1.240   -12.144 7.206   1.00 0.00 ? 219 GLN A N    3  
ATOM   5363  C  CA   . GLN A 1 65  ? 0.710   -11.785 5.856   1.00 0.00 ? 219 GLN A CA   3  
ATOM   5364  C  C    . GLN A 1 65  ? 1.055   -10.322 5.535   1.00 0.00 ? 219 GLN A C    3  
ATOM   5365  O  O    . GLN A 1 65  ? 1.510   -9.591  6.395   1.00 0.00 ? 219 GLN A O    3  
ATOM   5366  C  CB   . GLN A 1 65  ? -0.810  -11.979 5.956   1.00 0.00 ? 219 GLN A CB   3  
ATOM   5367  C  CG   . GLN A 1 65  ? -1.293  -12.913 4.838   1.00 0.00 ? 219 GLN A CG   3  
ATOM   5368  C  CD   . GLN A 1 65  ? -0.659  -14.302 5.008   1.00 0.00 ? 219 GLN A CD   3  
ATOM   5369  O  OE1  . GLN A 1 65  ? -0.188  -14.637 6.075   1.00 0.00 ? 219 GLN A OE1  3  
ATOM   5370  N  NE2  . GLN A 1 65  ? -0.626  -15.132 3.995   1.00 0.00 ? 219 GLN A NE2  3  
ATOM   5371  H  H    . GLN A 1 65  ? 1.049   -11.559 7.971   1.00 0.00 ? 219 GLN A H    3  
ATOM   5372  H  HA   . GLN A 1 65  ? 1.121   -12.441 5.105   1.00 0.00 ? 219 GLN A HA   3  
ATOM   5373  H  HB2  . GLN A 1 65  ? -1.055  -12.413 6.915   1.00 0.00 ? 219 GLN A HB2  3  
ATOM   5374  H  HB3  . GLN A 1 65  ? -1.303  -11.023 5.859   1.00 0.00 ? 219 GLN A HB3  3  
ATOM   5375  H  HG2  . GLN A 1 65  ? -2.368  -13.000 4.886   1.00 0.00 ? 219 GLN A HG2  3  
ATOM   5376  H  HG3  . GLN A 1 65  ? -1.007  -12.505 3.880   1.00 0.00 ? 219 GLN A HG3  3  
ATOM   5377  H  HE21 . GLN A 1 65  ? -1.001  -14.873 3.125   1.00 0.00 ? 219 GLN A HE21 3  
ATOM   5378  H  HE22 . GLN A 1 65  ? -0.223  -16.019 4.106   1.00 0.00 ? 219 GLN A HE22 3  
ATOM   5379  N  N    . CYS A 1 66  ? 0.847   -9.887  4.310   1.00 0.00 ? 220 CYS A N    3  
ATOM   5380  C  CA   . CYS A 1 66  ? 1.178   -8.456  3.960   1.00 0.00 ? 220 CYS A CA   3  
ATOM   5381  C  C    . CYS A 1 66  ? 0.155   -7.497  4.581   1.00 0.00 ? 220 CYS A C    3  
ATOM   5382  O  O    . CYS A 1 66  ? -0.988  -7.860  4.793   1.00 0.00 ? 220 CYS A O    3  
ATOM   5383  C  CB   . CYS A 1 66  ? 1.095   -8.354  2.434   1.00 0.00 ? 220 CYS A CB   3  
ATOM   5384  S  SG   . CYS A 1 66  ? 1.695   -6.736  1.892   1.00 0.00 ? 220 CYS A SG   3  
ATOM   5385  H  H    . CYS A 1 66  ? 0.476   -10.498 3.624   1.00 0.00 ? 220 CYS A H    3  
ATOM   5386  H  HA   . CYS A 1 66  ? 2.175   -8.208  4.290   1.00 0.00 ? 220 CYS A HA   3  
ATOM   5387  H  HB2  . CYS A 1 66  ? 1.693   -9.130  1.986   1.00 0.00 ? 220 CYS A HB2  3  
ATOM   5388  H  HB3  . CYS A 1 66  ? 0.068   -8.470  2.128   1.00 0.00 ? 220 CYS A HB3  3  
ATOM   5389  N  N    . ARG A 1 67  ? 0.539   -6.261  4.835   1.00 0.00 ? 221 ARG A N    3  
ATOM   5390  C  CA   . ARG A 1 67  ? -0.439  -5.278  5.394   1.00 0.00 ? 221 ARG A CA   3  
ATOM   5391  C  C    . ARG A 1 67  ? -0.846  -4.293  4.280   1.00 0.00 ? 221 ARG A C    3  
ATOM   5392  O  O    . ARG A 1 67  ? -1.006  -3.111  4.515   1.00 0.00 ? 221 ARG A O    3  
ATOM   5393  C  CB   . ARG A 1 67  ? 0.297   -4.547  6.526   1.00 0.00 ? 221 ARG A CB   3  
ATOM   5394  C  CG   . ARG A 1 67  ? -0.265  -4.991  7.882   1.00 0.00 ? 221 ARG A CG   3  
ATOM   5395  C  CD   . ARG A 1 67  ? -1.729  -4.556  7.999   1.00 0.00 ? 221 ARG A CD   3  
ATOM   5396  N  NE   . ARG A 1 67  ? -2.375  -5.595  8.859   1.00 0.00 ? 221 ARG A NE   3  
ATOM   5397  C  CZ   . ARG A 1 67  ? -2.281  -5.556  10.179  1.00 0.00 ? 221 ARG A CZ   3  
ATOM   5398  N  NH1  . ARG A 1 67  ? -1.587  -4.624  10.792  1.00 0.00 ? 221 ARG A NH1  3  
ATOM   5399  N  NH2  . ARG A 1 67  ? -2.883  -6.469  10.897  1.00 0.00 ? 221 ARG A NH2  3  
ATOM   5400  H  H    . ARG A 1 67  ? 1.457   -5.973  4.628   1.00 0.00 ? 221 ARG A H    3  
ATOM   5401  H  HA   . ARG A 1 67  ? -1.307  -5.790  5.779   1.00 0.00 ? 221 ARG A HA   3  
ATOM   5402  H  HB2  . ARG A 1 67  ? 1.351   -4.782  6.480   1.00 0.00 ? 221 ARG A HB2  3  
ATOM   5403  H  HB3  . ARG A 1 67  ? 0.161   -3.482  6.415   1.00 0.00 ? 221 ARG A HB3  3  
ATOM   5404  H  HG2  . ARG A 1 67  ? -0.200  -6.066  7.962   1.00 0.00 ? 221 ARG A HG2  3  
ATOM   5405  H  HG3  . ARG A 1 67  ? 0.308   -4.535  8.675   1.00 0.00 ? 221 ARG A HG3  3  
ATOM   5406  H  HD2  . ARG A 1 67  ? -1.796  -3.583  8.465   1.00 0.00 ? 221 ARG A HD2  3  
ATOM   5407  H  HD3  . ARG A 1 67  ? -2.196  -4.540  7.027   1.00 0.00 ? 221 ARG A HD3  3  
ATOM   5408  H  HE   . ARG A 1 67  ? -2.887  -6.316  8.430   1.00 0.00 ? 221 ARG A HE   3  
ATOM   5409  H  HH11 . ARG A 1 67  ? -1.109  -3.920  10.269  1.00 0.00 ? 221 ARG A HH11 3  
ATOM   5410  H  HH12 . ARG A 1 67  ? -1.538  -4.618  11.790  1.00 0.00 ? 221 ARG A HH12 3  
ATOM   5411  H  HH21 . ARG A 1 67  ? -3.408  -7.192  10.448  1.00 0.00 ? 221 ARG A HH21 3  
ATOM   5412  H  HH22 . ARG A 1 67  ? -2.818  -6.445  11.894  1.00 0.00 ? 221 ARG A HH22 3  
ATOM   5413  N  N    . TRP A 1 68  ? -1.012  -4.779  3.063   1.00 0.00 ? 222 TRP A N    3  
ATOM   5414  C  CA   . TRP A 1 68  ? -1.403  -3.885  1.930   1.00 0.00 ? 222 TRP A CA   3  
ATOM   5415  C  C    . TRP A 1 68  ? -2.218  -4.686  0.898   1.00 0.00 ? 222 TRP A C    3  
ATOM   5416  O  O    . TRP A 1 68  ? -3.359  -4.376  0.616   1.00 0.00 ? 222 TRP A O    3  
ATOM   5417  C  CB   . TRP A 1 68  ? -0.078  -3.426  1.304   1.00 0.00 ? 222 TRP A CB   3  
ATOM   5418  C  CG   . TRP A 1 68  ? -0.118  -1.952  1.037   1.00 0.00 ? 222 TRP A CG   3  
ATOM   5419  C  CD1  . TRP A 1 68  ? -1.204  -1.260  0.614   1.00 0.00 ? 222 TRP A CD1  3  
ATOM   5420  C  CD2  . TRP A 1 68  ? 0.958   -0.983  1.163   1.00 0.00 ? 222 TRP A CD2  3  
ATOM   5421  N  NE1  . TRP A 1 68  ? -0.864  0.074   0.495   1.00 0.00 ? 222 TRP A NE1  3  
ATOM   5422  C  CE2  . TRP A 1 68  ? 0.460   0.293   0.820   1.00 0.00 ? 222 TRP A CE2  3  
ATOM   5423  C  CE3  . TRP A 1 68  ? 2.307   -1.087  1.545   1.00 0.00 ? 222 TRP A CE3  3  
ATOM   5424  C  CZ2  . TRP A 1 68  ? 1.269   1.426   0.862   1.00 0.00 ? 222 TRP A CZ2  3  
ATOM   5425  C  CZ3  . TRP A 1 68  ? 3.125   0.053   1.580   1.00 0.00 ? 222 TRP A CZ3  3  
ATOM   5426  C  CH2  . TRP A 1 68  ? 2.606   1.307   1.242   1.00 0.00 ? 222 TRP A CH2  3  
ATOM   5427  H  H    . TRP A 1 68  ? -0.879  -5.737  2.892   1.00 0.00 ? 222 TRP A H    3  
ATOM   5428  H  HA   . TRP A 1 68  ? -1.962  -3.034  2.289   1.00 0.00 ? 222 TRP A HA   3  
ATOM   5429  H  HB2  . TRP A 1 68  ? 0.732   -3.641  1.986   1.00 0.00 ? 222 TRP A HB2  3  
ATOM   5430  H  HB3  . TRP A 1 68  ? 0.088   -3.953  0.377   1.00 0.00 ? 222 TRP A HB3  3  
ATOM   5431  H  HD1  . TRP A 1 68  ? -2.178  -1.680  0.413   1.00 0.00 ? 222 TRP A HD1  3  
ATOM   5432  H  HE1  . TRP A 1 68  ? -1.472  0.788   0.213   1.00 0.00 ? 222 TRP A HE1  3  
ATOM   5433  H  HE3  . TRP A 1 68  ? 2.717   -2.050  1.806   1.00 0.00 ? 222 TRP A HE3  3  
ATOM   5434  H  HZ2  . TRP A 1 68  ? 0.862   2.389   0.614   1.00 0.00 ? 222 TRP A HZ2  3  
ATOM   5435  H  HZ3  . TRP A 1 68  ? 4.159   -0.036  1.874   1.00 0.00 ? 222 TRP A HZ3  3  
ATOM   5436  H  HH2  . TRP A 1 68  ? 3.241   2.179   1.268   1.00 0.00 ? 222 TRP A HH2  3  
ATOM   5437  N  N    . CYS A 1 69  ? -1.629  -5.728  0.342   1.00 0.00 ? 223 CYS A N    3  
ATOM   5438  C  CA   . CYS A 1 69  ? -2.364  -6.565  -0.661  1.00 0.00 ? 223 CYS A CA   3  
ATOM   5439  C  C    . CYS A 1 69  ? -2.934  -7.864  -0.026  1.00 0.00 ? 223 CYS A C    3  
ATOM   5440  O  O    . CYS A 1 69  ? -3.613  -8.618  -0.693  1.00 0.00 ? 223 CYS A O    3  
ATOM   5441  C  CB   . CYS A 1 69  ? -1.343  -6.880  -1.781  1.00 0.00 ? 223 CYS A CB   3  
ATOM   5442  S  SG   . CYS A 1 69  ? -0.026  -7.989  -1.193  1.00 0.00 ? 223 CYS A SG   3  
ATOM   5443  H  H    . CYS A 1 69  ? -0.710  -5.962  0.595   1.00 0.00 ? 223 CYS A H    3  
ATOM   5444  H  HA   . CYS A 1 69  ? -3.175  -5.989  -1.077  1.00 0.00 ? 223 CYS A HA   3  
ATOM   5445  H  HB2  . CYS A 1 69  ? -1.857  -7.351  -2.604  1.00 0.00 ? 223 CYS A HB2  3  
ATOM   5446  H  HB3  . CYS A 1 69  ? -0.902  -5.955  -2.125  1.00 0.00 ? 223 CYS A HB3  3  
ATOM   5447  N  N    . ALA A 1 70  ? -2.671  -8.139  1.249   1.00 0.00 ? 224 ALA A N    3  
ATOM   5448  C  CA   . ALA A 1 70  ? -3.210  -9.383  1.893   1.00 0.00 ? 224 ALA A CA   3  
ATOM   5449  C  C    . ALA A 1 70  ? -2.781  -10.624 1.095   1.00 0.00 ? 224 ALA A C    3  
ATOM   5450  O  O    . ALA A 1 70  ? -3.598  -11.450 0.733   1.00 0.00 ? 224 ALA A O    3  
ATOM   5451  C  CB   . ALA A 1 70  ? -4.737  -9.227  1.904   1.00 0.00 ? 224 ALA A CB   3  
ATOM   5452  H  H    . ALA A 1 70  ? -2.118  -7.540  1.785   1.00 0.00 ? 224 ALA A H    3  
ATOM   5453  H  HA   . ALA A 1 70  ? -2.847  -9.457  2.906   1.00 0.00 ? 224 ALA A HA   3  
ATOM   5454  H  HB1  . ALA A 1 70  ? -5.195  -10.186 2.091   1.00 0.00 ? 224 ALA A HB1  3  
ATOM   5455  H  HB2  . ALA A 1 70  ? -5.073  -8.848  0.952   1.00 0.00 ? 224 ALA A HB2  3  
ATOM   5456  H  HB3  . ALA A 1 70  ? -5.023  -8.535  2.686   1.00 0.00 ? 224 ALA A HB3  3  
ATOM   5457  N  N    . GLU A 1 71  ? -1.499  -10.764 0.830   1.00 0.00 ? 225 GLU A N    3  
ATOM   5458  C  CA   . GLU A 1 71  ? -1.006  -11.950 0.070   1.00 0.00 ? 225 GLU A CA   3  
ATOM   5459  C  C    . GLU A 1 71  ? 0.286   -12.475 0.715   1.00 0.00 ? 225 GLU A C    3  
ATOM   5460  O  O    . GLU A 1 71  ? 1.224   -11.726 0.918   1.00 0.00 ? 225 GLU A O    3  
ATOM   5461  C  CB   . GLU A 1 71  ? -0.729  -11.436 -1.347  1.00 0.00 ? 225 GLU A CB   3  
ATOM   5462  C  CG   . GLU A 1 71  ? -2.017  -10.869 -1.956  1.00 0.00 ? 225 GLU A CG   3  
ATOM   5463  C  CD   . GLU A 1 71  ? -2.085  -11.231 -3.441  1.00 0.00 ? 225 GLU A CD   3  
ATOM   5464  O  OE1  . GLU A 1 71  ? -1.246  -10.754 -4.186  1.00 0.00 ? 225 GLU A OE1  3  
ATOM   5465  O  OE2  . GLU A 1 71  ? -2.976  -11.980 -3.808  1.00 0.00 ? 225 GLU A OE2  3  
ATOM   5466  H  H    . GLU A 1 71  ? -0.855  -10.088 1.139   1.00 0.00 ? 225 GLU A H    3  
ATOM   5467  H  HA   . GLU A 1 71  ? -1.759  -12.723 0.044   1.00 0.00 ? 225 GLU A HA   3  
ATOM   5468  H  HB2  . GLU A 1 71  ? 0.021   -10.661 -1.305  1.00 0.00 ? 225 GLU A HB2  3  
ATOM   5469  H  HB3  . GLU A 1 71  ? -0.371  -12.250 -1.959  1.00 0.00 ? 225 GLU A HB3  3  
ATOM   5470  H  HG2  . GLU A 1 71  ? -2.872  -11.287 -1.444  1.00 0.00 ? 225 GLU A HG2  3  
ATOM   5471  H  HG3  . GLU A 1 71  ? -2.022  -9.795  -1.849  1.00 0.00 ? 225 GLU A HG3  3  
ATOM   5472  N  N    . GLY A 1 72  ? 0.345   -13.748 1.053   1.00 0.00 ? 226 GLY A N    3  
ATOM   5473  C  CA   . GLY A 1 72  ? 1.578   -14.293 1.696   1.00 0.00 ? 226 GLY A CA   3  
ATOM   5474  C  C    . GLY A 1 72  ? 2.652   -14.560 0.629   1.00 0.00 ? 226 GLY A C    3  
ATOM   5475  O  O    . GLY A 1 72  ? 2.489   -14.200 -0.522  1.00 0.00 ? 226 GLY A O    3  
ATOM   5476  H  H    . GLY A 1 72  ? -0.421  -14.342 0.893   1.00 0.00 ? 226 GLY A H    3  
ATOM   5477  H  HA2  . GLY A 1 72  ? 1.953   -13.577 2.414   1.00 0.00 ? 226 GLY A HA2  3  
ATOM   5478  H  HA3  . GLY A 1 72  ? 1.341   -15.218 2.200   1.00 0.00 ? 226 GLY A HA3  3  
ATOM   5479  N  N    . GLY A 1 73  ? 3.753   -15.189 0.999   1.00 0.00 ? 227 GLY A N    3  
ATOM   5480  C  CA   . GLY A 1 73  ? 4.829   -15.472 0.003   1.00 0.00 ? 227 GLY A CA   3  
ATOM   5481  C  C    . GLY A 1 73  ? 5.990   -14.487 0.208   1.00 0.00 ? 227 GLY A C    3  
ATOM   5482  O  O    . GLY A 1 73  ? 5.918   -13.349 -0.211  1.00 0.00 ? 227 GLY A O    3  
ATOM   5483  H  H    . GLY A 1 73  ? 3.872   -15.473 1.933   1.00 0.00 ? 227 GLY A H    3  
ATOM   5484  H  HA2  . GLY A 1 73  ? 5.185   -16.484 0.135   1.00 0.00 ? 227 GLY A HA2  3  
ATOM   5485  H  HA3  . GLY A 1 73  ? 4.436   -15.355 -0.996  1.00 0.00 ? 227 GLY A HA3  3  
ATOM   5486  N  N    . ASN A 1 74  ? 7.065   -14.909 0.855   1.00 0.00 ? 228 ASN A N    3  
ATOM   5487  C  CA   . ASN A 1 74  ? 8.227   -13.985 1.088   1.00 0.00 ? 228 ASN A CA   3  
ATOM   5488  C  C    . ASN A 1 74  ? 7.750   -12.678 1.741   1.00 0.00 ? 228 ASN A C    3  
ATOM   5489  O  O    . ASN A 1 74  ? 7.347   -11.755 1.057   1.00 0.00 ? 228 ASN A O    3  
ATOM   5490  C  CB   . ASN A 1 74  ? 8.812   -13.708 -0.300  1.00 0.00 ? 228 ASN A CB   3  
ATOM   5491  C  CG   . ASN A 1 74  ? 9.854   -14.781 -0.641  1.00 0.00 ? 228 ASN A CG   3  
ATOM   5492  O  OD1  . ASN A 1 74  ? 9.506   -15.853 -1.095  1.00 0.00 ? 228 ASN A OD1  3  
ATOM   5493  N  ND2  . ASN A 1 74  ? 11.128  -14.542 -0.443  1.00 0.00 ? 228 ASN A ND2  3  
ATOM   5494  H  H    . ASN A 1 74  ? 7.109   -15.831 1.191   1.00 0.00 ? 228 ASN A H    3  
ATOM   5495  H  HA   . ASN A 1 74  ? 8.968   -14.463 1.707   1.00 0.00 ? 228 ASN A HA   3  
ATOM   5496  H  HB2  . ASN A 1 74  ? 8.021   -13.726 -1.036  1.00 0.00 ? 228 ASN A HB2  3  
ATOM   5497  H  HB3  . ASN A 1 74  ? 9.285   -12.737 -0.305  1.00 0.00 ? 228 ASN A HB3  3  
ATOM   5498  H  HD21 . ASN A 1 74  ? 11.422  -13.680 -0.078  1.00 0.00 ? 228 ASN A HD21 3  
ATOM   5499  H  HD22 . ASN A 1 74  ? 11.792  -15.230 -0.663  1.00 0.00 ? 228 ASN A HD22 3  
ATOM   5500  N  N    . LEU A 1 75  ? 7.780   -12.589 3.058   1.00 0.00 ? 229 LEU A N    3  
ATOM   5501  C  CA   . LEU A 1 75  ? 7.312   -11.336 3.724   1.00 0.00 ? 229 LEU A CA   3  
ATOM   5502  C  C    . LEU A 1 75  ? 8.406   -10.753 4.634   1.00 0.00 ? 229 LEU A C    3  
ATOM   5503  O  O    . LEU A 1 75  ? 9.373   -11.418 4.954   1.00 0.00 ? 229 LEU A O    3  
ATOM   5504  C  CB   . LEU A 1 75  ? 6.096   -11.751 4.560   1.00 0.00 ? 229 LEU A CB   3  
ATOM   5505  C  CG   . LEU A 1 75  ? 5.018   -12.358 3.658   1.00 0.00 ? 229 LEU A CG   3  
ATOM   5506  C  CD1  . LEU A 1 75  ? 3.882   -12.913 4.522   1.00 0.00 ? 229 LEU A CD1  3  
ATOM   5507  C  CD2  . LEU A 1 75  ? 4.462   -11.282 2.725   1.00 0.00 ? 229 LEU A CD2  3  
ATOM   5508  H  H    . LEU A 1 75  ? 8.100   -13.341 3.603   1.00 0.00 ? 229 LEU A H    3  
ATOM   5509  H  HA   . LEU A 1 75  ? 7.018   -10.615 2.984   1.00 0.00 ? 229 LEU A HA   3  
ATOM   5510  H  HB2  . LEU A 1 75  ? 6.401   -12.481 5.296   1.00 0.00 ? 229 LEU A HB2  3  
ATOM   5511  H  HB3  . LEU A 1 75  ? 5.694   -10.883 5.061   1.00 0.00 ? 229 LEU A HB3  3  
ATOM   5512  H  HG   . LEU A 1 75  ? 5.447   -13.159 3.072   1.00 0.00 ? 229 LEU A HG   3  
ATOM   5513  H  HD11 . LEU A 1 75  ? 2.944   -12.801 3.999   1.00 0.00 ? 229 LEU A HD11 3  
ATOM   5514  H  HD12 . LEU A 1 75  ? 3.842   -12.368 5.455   1.00 0.00 ? 229 LEU A HD12 3  
ATOM   5515  H  HD13 . LEU A 1 75  ? 4.060   -13.958 4.724   1.00 0.00 ? 229 LEU A HD13 3  
ATOM   5516  H  HD21 . LEU A 1 75  ? 3.434   -11.510 2.485   1.00 0.00 ? 229 LEU A HD21 3  
ATOM   5517  H  HD22 . LEU A 1 75  ? 5.047   -11.255 1.819   1.00 0.00 ? 229 LEU A HD22 3  
ATOM   5518  H  HD23 . LEU A 1 75  ? 4.511   -10.321 3.215   1.00 0.00 ? 229 LEU A HD23 3  
ATOM   5519  N  N    . ILE A 1 76  ? 8.254   -9.513  5.063   1.00 0.00 ? 230 ILE A N    3  
ATOM   5520  C  CA   . ILE A 1 76  ? 9.277   -8.894  5.961   1.00 0.00 ? 230 ILE A CA   3  
ATOM   5521  C  C    . ILE A 1 76  ? 8.651   -8.608  7.333   1.00 0.00 ? 230 ILE A C    3  
ATOM   5522  O  O    . ILE A 1 76  ? 7.964   -7.620  7.502   1.00 0.00 ? 230 ILE A O    3  
ATOM   5523  C  CB   . ILE A 1 76  ? 9.681   -7.583  5.270   1.00 0.00 ? 230 ILE A CB   3  
ATOM   5524  C  CG1  . ILE A 1 76  ? 10.392  -7.903  3.952   1.00 0.00 ? 230 ILE A CG1  3  
ATOM   5525  C  CG2  . ILE A 1 76  ? 10.625  -6.769  6.174   1.00 0.00 ? 230 ILE A CG2  3  
ATOM   5526  C  CD1  . ILE A 1 76  ? 10.705  -6.603  3.208   1.00 0.00 ? 230 ILE A CD1  3  
ATOM   5527  H  H    . ILE A 1 76  ? 7.463   -8.992  4.802   1.00 0.00 ? 230 ILE A H    3  
ATOM   5528  H  HA   . ILE A 1 76  ? 10.134  -9.541  6.062   1.00 0.00 ? 230 ILE A HA   3  
ATOM   5529  H  HB   . ILE A 1 76  ? 8.794   -7.001  5.066   1.00 0.00 ? 230 ILE A HB   3  
ATOM   5530  H  HG12 . ILE A 1 76  ? 11.312  -8.431  4.159   1.00 0.00 ? 230 ILE A HG12 3  
ATOM   5531  H  HG13 . ILE A 1 76  ? 9.753   -8.521  3.339   1.00 0.00 ? 230 ILE A HG13 3  
ATOM   5532  H  HG21 . ILE A 1 76  ? 11.569  -7.284  6.267   1.00 0.00 ? 230 ILE A HG21 3  
ATOM   5533  H  HG22 . ILE A 1 76  ? 10.180  -6.650  7.152   1.00 0.00 ? 230 ILE A HG22 3  
ATOM   5534  H  HG23 . ILE A 1 76  ? 10.789  -5.793  5.737   1.00 0.00 ? 230 ILE A HG23 3  
ATOM   5535  H  HD11 . ILE A 1 76  ? 10.508  -6.733  2.155   1.00 0.00 ? 230 ILE A HD11 3  
ATOM   5536  H  HD12 . ILE A 1 76  ? 11.745  -6.348  3.352   1.00 0.00 ? 230 ILE A HD12 3  
ATOM   5537  H  HD13 . ILE A 1 76  ? 10.082  -5.807  3.595   1.00 0.00 ? 230 ILE A HD13 3  
ATOM   5538  N  N    . CYS A 1 77  ? 8.892   -9.449  8.317   1.00 0.00 ? 231 CYS A N    3  
ATOM   5539  C  CA   . CYS A 1 77  ? 8.301   -9.180  9.678   1.00 0.00 ? 231 CYS A CA   3  
ATOM   5540  C  C    . CYS A 1 77  ? 8.808   -7.829  10.198  1.00 0.00 ? 231 CYS A C    3  
ATOM   5541  O  O    . CYS A 1 77  ? 9.920   -7.428  9.905   1.00 0.00 ? 231 CYS A O    3  
ATOM   5542  C  CB   . CYS A 1 77  ? 8.771   -10.316 10.599  1.00 0.00 ? 231 CYS A CB   3  
ATOM   5543  S  SG   . CYS A 1 77  ? 7.611   -11.703 10.491  1.00 0.00 ? 231 CYS A SG   3  
ATOM   5544  H  H    . CYS A 1 77  ? 9.463   -10.239 8.163   1.00 0.00 ? 231 CYS A H    3  
ATOM   5545  H  HA   . CYS A 1 77  ? 7.222   -9.171  9.619   1.00 0.00 ? 231 CYS A HA   3  
ATOM   5546  H  HB2  . CYS A 1 77  ? 9.753   -10.644 10.293  1.00 0.00 ? 231 CYS A HB2  3  
ATOM   5547  H  HB3  . CYS A 1 77  ? 8.812   -9.959  11.619  1.00 0.00 ? 231 CYS A HB3  3  
ATOM   5548  H  HG   . CYS A 1 77  ? 7.150   -11.639 9.652   1.00 0.00 ? 231 CYS A HG   3  
ATOM   5549  N  N    . CYS A 1 78  ? 8.004   -7.116  10.957  1.00 0.00 ? 232 CYS A N    3  
ATOM   5550  C  CA   . CYS A 1 78  ? 8.456   -5.787  11.476  1.00 0.00 ? 232 CYS A CA   3  
ATOM   5551  C  C    . CYS A 1 78  ? 8.807   -5.888  12.967  1.00 0.00 ? 232 CYS A C    3  
ATOM   5552  O  O    . CYS A 1 78  ? 8.254   -6.700  13.685  1.00 0.00 ? 232 CYS A O    3  
ATOM   5553  C  CB   . CYS A 1 78  ? 7.268   -4.839  11.264  1.00 0.00 ? 232 CYS A CB   3  
ATOM   5554  S  SG   . CYS A 1 78  ? 7.710   -3.168  11.807  1.00 0.00 ? 232 CYS A SG   3  
ATOM   5555  H  H    . CYS A 1 78  ? 7.106   -7.451  11.181  1.00 0.00 ? 232 CYS A H    3  
ATOM   5556  H  HA   . CYS A 1 78  ? 9.308   -5.437  10.916  1.00 0.00 ? 232 CYS A HA   3  
ATOM   5557  H  HB2  . CYS A 1 78  ? 7.009   -4.818  10.215  1.00 0.00 ? 232 CYS A HB2  3  
ATOM   5558  H  HB3  . CYS A 1 78  ? 6.423   -5.190  11.835  1.00 0.00 ? 232 CYS A HB3  3  
ATOM   5559  N  N    . ASP A 1 79  ? 9.715   -5.059  13.440  1.00 0.00 ? 233 ASP A N    3  
ATOM   5560  C  CA   . ASP A 1 79  ? 10.083  -5.106  14.889  1.00 0.00 ? 233 ASP A CA   3  
ATOM   5561  C  C    . ASP A 1 79  ? 9.488   -3.890  15.615  1.00 0.00 ? 233 ASP A C    3  
ATOM   5562  O  O    . ASP A 1 79  ? 10.130  -3.295  16.459  1.00 0.00 ? 233 ASP A O    3  
ATOM   5563  C  CB   . ASP A 1 79  ? 11.614  -5.062  14.928  1.00 0.00 ? 233 ASP A CB   3  
ATOM   5564  C  CG   . ASP A 1 79  ? 12.119  -5.895  16.107  1.00 0.00 ? 233 ASP A CG   3  
ATOM   5565  O  OD1  . ASP A 1 79  ? 12.009  -7.109  16.041  1.00 0.00 ? 233 ASP A OD1  3  
ATOM   5566  O  OD2  . ASP A 1 79  ? 12.608  -5.305  17.058  1.00 0.00 ? 233 ASP A OD2  3  
ATOM   5567  H  H    . ASP A 1 79  ? 10.146  -4.400  12.845  1.00 0.00 ? 233 ASP A H    3  
ATOM   5568  H  HA   . ASP A 1 79  ? 9.729   -6.022  15.337  1.00 0.00 ? 233 ASP A HA   3  
ATOM   5569  H  HB2  . ASP A 1 79  ? 12.009  -5.464  14.006  1.00 0.00 ? 233 ASP A HB2  3  
ATOM   5570  H  HB3  . ASP A 1 79  ? 11.942  -4.040  15.045  1.00 0.00 ? 233 ASP A HB3  3  
ATOM   5571  N  N    . PHE A 1 80  ? 8.266   -3.511  15.291  1.00 0.00 ? 234 PHE A N    3  
ATOM   5572  C  CA   . PHE A 1 80  ? 7.645   -2.331  15.965  1.00 0.00 ? 234 PHE A CA   3  
ATOM   5573  C  C    . PHE A 1 80  ? 6.114   -2.487  16.033  1.00 0.00 ? 234 PHE A C    3  
ATOM   5574  O  O    . PHE A 1 80  ? 5.537   -2.479  17.105  1.00 0.00 ? 234 PHE A O    3  
ATOM   5575  C  CB   . PHE A 1 80  ? 8.020   -1.135  15.087  1.00 0.00 ? 234 PHE A CB   3  
ATOM   5576  C  CG   . PHE A 1 80  ? 9.434   -0.681  15.384  1.00 0.00 ? 234 PHE A CG   3  
ATOM   5577  C  CD1  . PHE A 1 80  ? 9.858   -0.488  16.707  1.00 0.00 ? 234 PHE A CD1  3  
ATOM   5578  C  CD2  . PHE A 1 80  ? 10.321  -0.443  14.326  1.00 0.00 ? 234 PHE A CD2  3  
ATOM   5579  C  CE1  . PHE A 1 80  ? 11.166  -0.060  16.968  1.00 0.00 ? 234 PHE A CE1  3  
ATOM   5580  C  CE2  . PHE A 1 80  ? 11.626  -0.016  14.588  1.00 0.00 ? 234 PHE A CE2  3  
ATOM   5581  C  CZ   . PHE A 1 80  ? 12.050  0.176   15.908  1.00 0.00 ? 234 PHE A CZ   3  
ATOM   5582  H  H    . PHE A 1 80  ? 7.759   -4.000  14.604  1.00 0.00 ? 234 PHE A H    3  
ATOM   5583  H  HA   . PHE A 1 80  ? 8.054   -2.204  16.955  1.00 0.00 ? 234 PHE A HA   3  
ATOM   5584  H  HB2  . PHE A 1 80  ? 7.953   -1.424  14.049  1.00 0.00 ? 234 PHE A HB2  3  
ATOM   5585  H  HB3  . PHE A 1 80  ? 7.335   -0.322  15.277  1.00 0.00 ? 234 PHE A HB3  3  
ATOM   5586  H  HD1  . PHE A 1 80  ? 9.177   -0.669  17.524  1.00 0.00 ? 234 PHE A HD1  3  
ATOM   5587  H  HD2  . PHE A 1 80  ? 9.999   -0.592  13.307  1.00 0.00 ? 234 PHE A HD2  3  
ATOM   5588  H  HE1  . PHE A 1 80  ? 11.492  0.088   17.986  1.00 0.00 ? 234 PHE A HE1  3  
ATOM   5589  H  HE2  . PHE A 1 80  ? 12.306  0.170   13.769  1.00 0.00 ? 234 PHE A HE2  3  
ATOM   5590  H  HZ   . PHE A 1 80  ? 13.058  0.506   16.110  1.00 0.00 ? 234 PHE A HZ   3  
ATOM   5591  N  N    . CYS A 1 81  ? 5.447   -2.628  14.900  1.00 0.00 ? 235 CYS A N    3  
ATOM   5592  C  CA   . CYS A 1 81  ? 3.948   -2.781  14.932  1.00 0.00 ? 235 CYS A CA   3  
ATOM   5593  C  C    . CYS A 1 81  ? 3.511   -4.266  14.875  1.00 0.00 ? 235 CYS A C    3  
ATOM   5594  O  O    . CYS A 1 81  ? 2.375   -4.554  14.548  1.00 0.00 ? 235 CYS A O    3  
ATOM   5595  C  CB   . CYS A 1 81  ? 3.404   -1.999  13.715  1.00 0.00 ? 235 CYS A CB   3  
ATOM   5596  S  SG   . CYS A 1 81  ? 3.924   -2.772  12.153  1.00 0.00 ? 235 CYS A SG   3  
ATOM   5597  H  H    . CYS A 1 81  ? 5.928   -2.633  14.043  1.00 0.00 ? 235 CYS A H    3  
ATOM   5598  H  HA   . CYS A 1 81  ? 3.564   -2.333  15.836  1.00 0.00 ? 235 CYS A HA   3  
ATOM   5599  H  HB2  . CYS A 1 81  ? 2.327   -1.982  13.757  1.00 0.00 ? 235 CYS A HB2  3  
ATOM   5600  H  HB3  . CYS A 1 81  ? 3.776   -0.985  13.752  1.00 0.00 ? 235 CYS A HB3  3  
ATOM   5601  N  N    . HIS A 1 82  ? 4.381   -5.209  15.200  1.00 0.00 ? 236 HIS A N    3  
ATOM   5602  C  CA   . HIS A 1 82  ? 3.983   -6.658  15.170  1.00 0.00 ? 236 HIS A CA   3  
ATOM   5603  C  C    . HIS A 1 82  ? 3.293   -7.031  13.841  1.00 0.00 ? 236 HIS A C    3  
ATOM   5604  O  O    . HIS A 1 82  ? 2.228   -7.620  13.841  1.00 0.00 ? 236 HIS A O    3  
ATOM   5605  C  CB   . HIS A 1 82  ? 3.012   -6.824  16.341  1.00 0.00 ? 236 HIS A CB   3  
ATOM   5606  C  CG   . HIS A 1 82  ? 3.782   -7.152  17.590  1.00 0.00 ? 236 HIS A CG   3  
ATOM   5607  N  ND1  . HIS A 1 82  ? 4.089   -6.194  18.544  1.00 0.00 ? 236 HIS A ND1  3  
ATOM   5608  C  CD2  . HIS A 1 82  ? 4.314   -8.329  18.056  1.00 0.00 ? 236 HIS A CD2  3  
ATOM   5609  C  CE1  . HIS A 1 82  ? 4.777   -6.806  19.526  1.00 0.00 ? 236 HIS A CE1  3  
ATOM   5610  N  NE2  . HIS A 1 82  ? 4.941   -8.108  19.278  1.00 0.00 ? 236 HIS A NE2  3  
ATOM   5611  H  H    . HIS A 1 82  ? 5.291   -4.973  15.476  1.00 0.00 ? 236 HIS A H    3  
ATOM   5612  H  HA   . HIS A 1 82  ? 4.848   -7.283  15.326  1.00 0.00 ? 236 HIS A HA   3  
ATOM   5613  H  HB2  . HIS A 1 82  ? 2.464   -5.905  16.487  1.00 0.00 ? 236 HIS A HB2  3  
ATOM   5614  H  HB3  . HIS A 1 82  ? 2.320   -7.625  16.124  1.00 0.00 ? 236 HIS A HB3  3  
ATOM   5615  H  HD1  . HIS A 1 82  ? 3.849   -5.245  18.509  1.00 0.00 ? 236 HIS A HD1  3  
ATOM   5616  H  HD2  . HIS A 1 82  ? 4.255   -9.282  17.551  1.00 0.00 ? 236 HIS A HD2  3  
ATOM   5617  H  HE1  . HIS A 1 82  ? 5.149   -6.304  20.407  1.00 0.00 ? 236 HIS A HE1  3  
ATOM   5618  N  N    . ASN A 1 83  ? 3.887   -6.700  12.713  1.00 0.00 ? 237 ASN A N    3  
ATOM   5619  C  CA   . ASN A 1 83  ? 3.250   -7.050  11.401  1.00 0.00 ? 237 ASN A CA   3  
ATOM   5620  C  C    . ASN A 1 83  ? 4.328   -7.277  10.326  1.00 0.00 ? 237 ASN A C    3  
ATOM   5621  O  O    . ASN A 1 83  ? 5.469   -6.899  10.505  1.00 0.00 ? 237 ASN A O    3  
ATOM   5622  C  CB   . ASN A 1 83  ? 2.373   -5.842  11.045  1.00 0.00 ? 237 ASN A CB   3  
ATOM   5623  C  CG   . ASN A 1 83  ? 0.892   -6.240  11.118  1.00 0.00 ? 237 ASN A CG   3  
ATOM   5624  O  OD1  . ASN A 1 83  ? 0.282   -6.523  10.106  1.00 0.00 ? 237 ASN A OD1  3  
ATOM   5625  N  ND2  . ASN A 1 83  ? 0.281   -6.278  12.277  1.00 0.00 ? 237 ASN A ND2  3  
ATOM   5626  H  H    . ASN A 1 83  ? 4.748   -6.227  12.726  1.00 0.00 ? 237 ASN A H    3  
ATOM   5627  H  HA   . ASN A 1 83  ? 2.640   -7.932  11.508  1.00 0.00 ? 237 ASN A HA   3  
ATOM   5628  H  HB2  . ASN A 1 83  ? 2.562   -5.040  11.743  1.00 0.00 ? 237 ASN A HB2  3  
ATOM   5629  H  HB3  . ASN A 1 83  ? 2.604   -5.509  10.044  1.00 0.00 ? 237 ASN A HB3  3  
ATOM   5630  H  HD21 . ASN A 1 83  ? 0.764   -6.053  13.101  1.00 0.00 ? 237 ASN A HD21 3  
ATOM   5631  H  HD22 . ASN A 1 83  ? -0.664  -6.535  12.321  1.00 0.00 ? 237 ASN A HD22 3  
ATOM   5632  N  N    . ALA A 1 84  ? 3.981   -7.897  9.215   1.00 0.00 ? 238 ALA A N    3  
ATOM   5633  C  CA   . ALA A 1 84  ? 4.998   -8.148  8.150   1.00 0.00 ? 238 ALA A CA   3  
ATOM   5634  C  C    . ALA A 1 84  ? 4.458   -7.734  6.769   1.00 0.00 ? 238 ALA A C    3  
ATOM   5635  O  O    . ALA A 1 84  ? 3.277   -7.847  6.503   1.00 0.00 ? 238 ALA A O    3  
ATOM   5636  C  CB   . ALA A 1 84  ? 5.241   -9.657  8.191   1.00 0.00 ? 238 ALA A CB   3  
ATOM   5637  H  H    . ALA A 1 84  ? 3.056   -8.203  9.084   1.00 0.00 ? 238 ALA A H    3  
ATOM   5638  H  HA   . ALA A 1 84  ? 5.915   -7.625  8.372   1.00 0.00 ? 238 ALA A HA   3  
ATOM   5639  H  HB1  . ALA A 1 84  ? 6.282   -9.860  7.986   1.00 0.00 ? 238 ALA A HB1  3  
ATOM   5640  H  HB2  . ALA A 1 84  ? 4.626   -10.141 7.447   1.00 0.00 ? 238 ALA A HB2  3  
ATOM   5641  H  HB3  . ALA A 1 84  ? 4.988   -10.035 9.170   1.00 0.00 ? 238 ALA A HB3  3  
ATOM   5642  N  N    . PHE A 1 85  ? 5.316   -7.271  5.880   1.00 0.00 ? 239 PHE A N    3  
ATOM   5643  C  CA   . PHE A 1 85  ? 4.846   -6.874  4.512   1.00 0.00 ? 239 PHE A CA   3  
ATOM   5644  C  C    . PHE A 1 85  ? 5.362   -7.895  3.487   1.00 0.00 ? 239 PHE A C    3  
ATOM   5645  O  O    . PHE A 1 85  ? 6.045   -8.832  3.853   1.00 0.00 ? 239 PHE A O    3  
ATOM   5646  C  CB   . PHE A 1 85  ? 5.456   -5.492  4.249   1.00 0.00 ? 239 PHE A CB   3  
ATOM   5647  C  CG   . PHE A 1 85  ? 4.520   -4.421  4.758   1.00 0.00 ? 239 PHE A CG   3  
ATOM   5648  C  CD1  . PHE A 1 85  ? 3.488   -3.943  3.940   1.00 0.00 ? 239 PHE A CD1  3  
ATOM   5649  C  CD2  . PHE A 1 85  ? 4.685   -3.909  6.049   1.00 0.00 ? 239 PHE A CD2  3  
ATOM   5650  C  CE1  . PHE A 1 85  ? 2.620   -2.950  4.417   1.00 0.00 ? 239 PHE A CE1  3  
ATOM   5651  C  CE2  . PHE A 1 85  ? 3.817   -2.916  6.525   1.00 0.00 ? 239 PHE A CE2  3  
ATOM   5652  C  CZ   . PHE A 1 85  ? 2.784   -2.437  5.709   1.00 0.00 ? 239 PHE A CZ   3  
ATOM   5653  H  H    . PHE A 1 85  ? 6.272   -7.199  6.106   1.00 0.00 ? 239 PHE A H    3  
ATOM   5654  H  HA   . PHE A 1 85  ? 3.770   -6.819  4.483   1.00 0.00 ? 239 PHE A HA   3  
ATOM   5655  H  HB2  . PHE A 1 85  ? 6.404   -5.414  4.761   1.00 0.00 ? 239 PHE A HB2  3  
ATOM   5656  H  HB3  . PHE A 1 85  ? 5.607   -5.362  3.188   1.00 0.00 ? 239 PHE A HB3  3  
ATOM   5657  H  HD1  . PHE A 1 85  ? 3.361   -4.339  2.944   1.00 0.00 ? 239 PHE A HD1  3  
ATOM   5658  H  HD2  . PHE A 1 85  ? 5.484   -4.277  6.677   1.00 0.00 ? 239 PHE A HD2  3  
ATOM   5659  H  HE1  . PHE A 1 85  ? 1.822   -2.579  3.787   1.00 0.00 ? 239 PHE A HE1  3  
ATOM   5660  H  HE2  . PHE A 1 85  ? 3.943   -2.522  7.521   1.00 0.00 ? 239 PHE A HE2  3  
ATOM   5661  H  HZ   . PHE A 1 85  ? 2.115   -1.672  6.076   1.00 0.00 ? 239 PHE A HZ   3  
ATOM   5662  N  N    . CYS A 1 86  ? 5.053   -7.735  2.212   1.00 0.00 ? 240 CYS A N    3  
ATOM   5663  C  CA   . CYS A 1 86  ? 5.549   -8.722  1.204   1.00 0.00 ? 240 CYS A CA   3  
ATOM   5664  C  C    . CYS A 1 86  ? 6.549   -8.059  0.231   1.00 0.00 ? 240 CYS A C    3  
ATOM   5665  O  O    . CYS A 1 86  ? 6.663   -6.849  0.182   1.00 0.00 ? 240 CYS A O    3  
ATOM   5666  C  CB   . CYS A 1 86  ? 4.282   -9.282  0.503   1.00 0.00 ? 240 CYS A CB   3  
ATOM   5667  S  SG   . CYS A 1 86  ? 3.691   -8.215  -0.847  1.00 0.00 ? 240 CYS A SG   3  
ATOM   5668  H  H    . CYS A 1 86  ? 4.505   -6.975  1.925   1.00 0.00 ? 240 CYS A H    3  
ATOM   5669  H  HA   . CYS A 1 86  ? 6.045   -9.527  1.717   1.00 0.00 ? 240 CYS A HA   3  
ATOM   5670  H  HB2  . CYS A 1 86  ? 4.512   -10.254 0.096   1.00 0.00 ? 240 CYS A HB2  3  
ATOM   5671  H  HB3  . CYS A 1 86  ? 3.499   -9.391  1.238   1.00 0.00 ? 240 CYS A HB3  3  
ATOM   5672  N  N    . LYS A 1 87  ? 7.282   -8.847  -0.529  1.00 0.00 ? 241 LYS A N    3  
ATOM   5673  C  CA   . LYS A 1 87  ? 8.289   -8.251  -1.485  1.00 0.00 ? 241 LYS A CA   3  
ATOM   5674  C  C    . LYS A 1 87  ? 7.593   -7.575  -2.684  1.00 0.00 ? 241 LYS A C    3  
ATOM   5675  O  O    . LYS A 1 87  ? 8.069   -6.575  -3.188  1.00 0.00 ? 241 LYS A O    3  
ATOM   5676  C  CB   . LYS A 1 87  ? 9.164   -9.421  -1.971  1.00 0.00 ? 241 LYS A CB   3  
ATOM   5677  C  CG   . LYS A 1 87  ? 10.275  -8.892  -2.879  1.00 0.00 ? 241 LYS A CG   3  
ATOM   5678  C  CD   . LYS A 1 87  ? 11.445  -9.879  -2.880  1.00 0.00 ? 241 LYS A CD   3  
ATOM   5679  C  CE   . LYS A 1 87  ? 11.152  -11.019 -3.858  1.00 0.00 ? 241 LYS A CE   3  
ATOM   5680  N  NZ   . LYS A 1 87  ? 12.013  -12.146 -3.403  1.00 0.00 ? 241 LYS A NZ   3  
ATOM   5681  H  H    . LYS A 1 87  ? 7.177   -9.827  -0.461  1.00 0.00 ? 241 LYS A H    3  
ATOM   5682  H  HA   . LYS A 1 87  ? 8.905   -7.532  -0.967  1.00 0.00 ? 241 LYS A HA   3  
ATOM   5683  H  HB2  . LYS A 1 87  ? 9.601   -9.920  -1.118  1.00 0.00 ? 241 LYS A HB2  3  
ATOM   5684  H  HB3  . LYS A 1 87  ? 8.553   -10.121 -2.522  1.00 0.00 ? 241 LYS A HB3  3  
ATOM   5685  H  HG2  . LYS A 1 87  ? 9.896   -8.782  -3.886  1.00 0.00 ? 241 LYS A HG2  3  
ATOM   5686  H  HG3  . LYS A 1 87  ? 10.614  -7.934  -2.517  1.00 0.00 ? 241 LYS A HG3  3  
ATOM   5687  H  HD2  . LYS A 1 87  ? 12.347  -9.368  -3.181  1.00 0.00 ? 241 LYS A HD2  3  
ATOM   5688  H  HD3  . LYS A 1 87  ? 11.574  -10.284 -1.888  1.00 0.00 ? 241 LYS A HD3  3  
ATOM   5689  H  HE2  . LYS A 1 87  ? 10.108  -11.296 -3.809  1.00 0.00 ? 241 LYS A HE2  3  
ATOM   5690  H  HE3  . LYS A 1 87  ? 11.419  -10.732 -4.862  1.00 0.00 ? 241 LYS A HE3  3  
ATOM   5691  H  HZ1  . LYS A 1 87  ? 11.822  -12.986 -3.985  1.00 0.00 ? 241 LYS A HZ1  3  
ATOM   5692  H  HZ2  . LYS A 1 87  ? 11.806  -12.360 -2.405  1.00 0.00 ? 241 LYS A HZ2  3  
ATOM   5693  H  HZ3  . LYS A 1 87  ? 13.013  -11.880 -3.500  1.00 0.00 ? 241 LYS A HZ3  3  
ATOM   5694  N  N    . LYS A 1 88  ? 6.483   -8.109  -3.155  1.00 0.00 ? 242 LYS A N    3  
ATOM   5695  C  CA   . LYS A 1 88  ? 5.789   -7.473  -4.339  1.00 0.00 ? 242 LYS A CA   3  
ATOM   5696  C  C    . LYS A 1 88  ? 5.330   -6.029  -4.032  1.00 0.00 ? 242 LYS A C    3  
ATOM   5697  O  O    . LYS A 1 88  ? 5.132   -5.244  -4.943  1.00 0.00 ? 242 LYS A O    3  
ATOM   5698  C  CB   . LYS A 1 88  ? 4.566   -8.351  -4.654  1.00 0.00 ? 242 LYS A CB   3  
ATOM   5699  C  CG   . LYS A 1 88  ? 3.958   -7.922  -5.991  1.00 0.00 ? 242 LYS A CG   3  
ATOM   5700  C  CD   . LYS A 1 88  ? 3.174   -9.090  -6.592  1.00 0.00 ? 242 LYS A CD   3  
ATOM   5701  C  CE   . LYS A 1 88  ? 2.117   -8.552  -7.560  1.00 0.00 ? 242 LYS A CE   3  
ATOM   5702  N  NZ   . LYS A 1 88  ? 2.858   -8.269  -8.820  1.00 0.00 ? 242 LYS A NZ   3  
ATOM   5703  H  H    . LYS A 1 88  ? 6.116   -8.924  -2.740  1.00 0.00 ? 242 LYS A H    3  
ATOM   5704  H  HA   . LYS A 1 88  ? 6.451   -7.467  -5.188  1.00 0.00 ? 242 LYS A HA   3  
ATOM   5705  H  HB2  . LYS A 1 88  ? 4.872   -9.385  -4.711  1.00 0.00 ? 242 LYS A HB2  3  
ATOM   5706  H  HB3  . LYS A 1 88  ? 3.830   -8.235  -3.871  1.00 0.00 ? 242 LYS A HB3  3  
ATOM   5707  H  HG2  . LYS A 1 88  ? 3.294   -7.085  -5.832  1.00 0.00 ? 242 LYS A HG2  3  
ATOM   5708  H  HG3  . LYS A 1 88  ? 4.746   -7.633  -6.668  1.00 0.00 ? 242 LYS A HG3  3  
ATOM   5709  H  HD2  . LYS A 1 88  ? 3.851   -9.742  -7.125  1.00 0.00 ? 242 LYS A HD2  3  
ATOM   5710  H  HD3  . LYS A 1 88  ? 2.687   -9.642  -5.803  1.00 0.00 ? 242 LYS A HD3  3  
ATOM   5711  H  HE2  . LYS A 1 88  ? 1.350   -9.296  -7.730  1.00 0.00 ? 242 LYS A HE2  3  
ATOM   5712  H  HE3  . LYS A 1 88  ? 1.682   -7.643  -7.175  1.00 0.00 ? 242 LYS A HE3  3  
ATOM   5713  H  HZ1  . LYS A 1 88  ? 2.211   -7.852  -9.518  1.00 0.00 ? 242 LYS A HZ1  3  
ATOM   5714  H  HZ2  . LYS A 1 88  ? 3.250   -9.157  -9.198  1.00 0.00 ? 242 LYS A HZ2  3  
ATOM   5715  H  HZ3  . LYS A 1 88  ? 3.632   -7.604  -8.627  1.00 0.00 ? 242 LYS A HZ3  3  
ATOM   5716  N  N    . CYS A 1 89  ? 5.159   -5.660  -2.776  1.00 0.00 ? 243 CYS A N    3  
ATOM   5717  C  CA   . CYS A 1 89  ? 4.711   -4.259  -2.467  1.00 0.00 ? 243 CYS A CA   3  
ATOM   5718  C  C    . CYS A 1 89  ? 5.930   -3.335  -2.364  1.00 0.00 ? 243 CYS A C    3  
ATOM   5719  O  O    . CYS A 1 89  ? 5.902   -2.220  -2.851  1.00 0.00 ? 243 CYS A O    3  
ATOM   5720  C  CB   . CYS A 1 89  ? 3.958   -4.326  -1.125  1.00 0.00 ? 243 CYS A CB   3  
ATOM   5721  S  SG   . CYS A 1 89  ? 2.251   -4.873  -1.405  1.00 0.00 ? 243 CYS A SG   3  
ATOM   5722  H  H    . CYS A 1 89  ? 5.332   -6.292  -2.048  1.00 0.00 ? 243 CYS A H    3  
ATOM   5723  H  HA   . CYS A 1 89  ? 4.051   -3.905  -3.243  1.00 0.00 ? 243 CYS A HA   3  
ATOM   5724  H  HB2  . CYS A 1 89  ? 4.455   -5.025  -0.470  1.00 0.00 ? 243 CYS A HB2  3  
ATOM   5725  H  HB3  . CYS A 1 89  ? 3.952   -3.347  -0.669  1.00 0.00 ? 243 CYS A HB3  3  
ATOM   5726  N  N    . ILE A 1 90  ? 7.011   -3.788  -1.759  1.00 0.00 ? 244 ILE A N    3  
ATOM   5727  C  CA   . ILE A 1 90  ? 8.227   -2.908  -1.674  1.00 0.00 ? 244 ILE A CA   3  
ATOM   5728  C  C    . ILE A 1 90  ? 8.858   -2.796  -3.070  1.00 0.00 ? 244 ILE A C    3  
ATOM   5729  O  O    . ILE A 1 90  ? 9.311   -1.737  -3.458  1.00 0.00 ? 244 ILE A O    3  
ATOM   5730  C  CB   . ILE A 1 90  ? 9.191   -3.567  -0.676  1.00 0.00 ? 244 ILE A CB   3  
ATOM   5731  C  CG1  . ILE A 1 90  ? 8.524   -3.608  0.701   1.00 0.00 ? 244 ILE A CG1  3  
ATOM   5732  C  CG2  . ILE A 1 90  ? 10.483  -2.749  -0.585  1.00 0.00 ? 244 ILE A CG2  3  
ATOM   5733  C  CD1  . ILE A 1 90  ? 9.406   -4.384  1.678   1.00 0.00 ? 244 ILE A CD1  3  
ATOM   5734  H  H    . ILE A 1 90  ? 7.025   -4.703  -1.388  1.00 0.00 ? 244 ILE A H    3  
ATOM   5735  H  HA   . ILE A 1 90  ? 7.945   -1.927  -1.319  1.00 0.00 ? 244 ILE A HA   3  
ATOM   5736  H  HB   . ILE A 1 90  ? 9.419   -4.572  -1.000  1.00 0.00 ? 244 ILE A HB   3  
ATOM   5737  H  HG12 . ILE A 1 90  ? 8.386   -2.598  1.061   1.00 0.00 ? 244 ILE A HG12 3  
ATOM   5738  H  HG13 . ILE A 1 90  ? 7.564   -4.095  0.621   1.00 0.00 ? 244 ILE A HG13 3  
ATOM   5739  H  HG21 . ILE A 1 90  ? 10.242  -1.720  -0.358  1.00 0.00 ? 244 ILE A HG21 3  
ATOM   5740  H  HG22 . ILE A 1 90  ? 11.006  -2.795  -1.530  1.00 0.00 ? 244 ILE A HG22 3  
ATOM   5741  H  HG23 . ILE A 1 90  ? 11.112  -3.153  0.194   1.00 0.00 ? 244 ILE A HG23 3  
ATOM   5742  H  HD11 . ILE A 1 90  ? 10.432  -4.350  1.343   1.00 0.00 ? 244 ILE A HD11 3  
ATOM   5743  H  HD12 . ILE A 1 90  ? 9.075   -5.411  1.723   1.00 0.00 ? 244 ILE A HD12 3  
ATOM   5744  H  HD13 . ILE A 1 90  ? 9.333   -3.939  2.660   1.00 0.00 ? 244 ILE A HD13 3  
ATOM   5745  N  N    . LEU A 1 91  ? 8.871   -3.868  -3.845  1.00 0.00 ? 245 LEU A N    3  
ATOM   5746  C  CA   . LEU A 1 91  ? 9.458   -3.774  -5.230  1.00 0.00 ? 245 LEU A CA   3  
ATOM   5747  C  C    . LEU A 1 91  ? 8.718   -2.691  -6.033  1.00 0.00 ? 245 LEU A C    3  
ATOM   5748  O  O    . LEU A 1 91  ? 9.327   -1.952  -6.784  1.00 0.00 ? 245 LEU A O    3  
ATOM   5749  C  CB   . LEU A 1 91  ? 9.271   -5.148  -5.894  1.00 0.00 ? 245 LEU A CB   3  
ATOM   5750  C  CG   . LEU A 1 91  ? 10.377  -5.372  -6.928  1.00 0.00 ? 245 LEU A CG   3  
ATOM   5751  C  CD1  . LEU A 1 91  ? 10.273  -6.790  -7.491  1.00 0.00 ? 245 LEU A CD1  3  
ATOM   5752  C  CD2  . LEU A 1 91  ? 10.224  -4.359  -8.066  1.00 0.00 ? 245 LEU A CD2  3  
ATOM   5753  H  H    . LEU A 1 91  ? 8.488   -4.716  -3.524  1.00 0.00 ? 245 LEU A H    3  
ATOM   5754  H  HA   . LEU A 1 91  ? 10.505  -3.534  -5.169  1.00 0.00 ? 245 LEU A HA   3  
ATOM   5755  H  HB2  . LEU A 1 91  ? 9.319   -5.922  -5.141  1.00 0.00 ? 245 LEU A HB2  3  
ATOM   5756  H  HB3  . LEU A 1 91  ? 8.310   -5.184  -6.385  1.00 0.00 ? 245 LEU A HB3  3  
ATOM   5757  H  HG   . LEU A 1 91  ? 11.341  -5.242  -6.456  1.00 0.00 ? 245 LEU A HG   3  
ATOM   5758  H  HD11 . LEU A 1 91  ? 11.199  -7.052  -7.983  1.00 0.00 ? 245 LEU A HD11 3  
ATOM   5759  H  HD12 . LEU A 1 91  ? 9.462   -6.836  -8.204  1.00 0.00 ? 245 LEU A HD12 3  
ATOM   5760  H  HD13 . LEU A 1 91  ? 10.084  -7.485  -6.686  1.00 0.00 ? 245 LEU A HD13 3  
ATOM   5761  H  HD21 . LEU A 1 91  ? 9.174   -4.176  -8.245  1.00 0.00 ? 245 LEU A HD21 3  
ATOM   5762  H  HD22 . LEU A 1 91  ? 10.678  -4.754  -8.962  1.00 0.00 ? 245 LEU A HD22 3  
ATOM   5763  H  HD23 . LEU A 1 91  ? 10.709  -3.435  -7.792  1.00 0.00 ? 245 LEU A HD23 3  
ATOM   5764  N  N    . ARG A 1 92  ? 7.411   -2.574  -5.872  1.00 0.00 ? 246 ARG A N    3  
ATOM   5765  C  CA   . ARG A 1 92  ? 6.663   -1.508  -6.629  1.00 0.00 ? 246 ARG A CA   3  
ATOM   5766  C  C    . ARG A 1 92  ? 6.760   -0.141  -5.912  1.00 0.00 ? 246 ARG A C    3  
ATOM   5767  O  O    . ARG A 1 92  ? 6.513   0.885   -6.517  1.00 0.00 ? 246 ARG A O    3  
ATOM   5768  C  CB   . ARG A 1 92  ? 5.199   -1.970  -6.700  1.00 0.00 ? 246 ARG A CB   3  
ATOM   5769  C  CG   . ARG A 1 92  ? 4.383   -0.973  -7.529  1.00 0.00 ? 246 ARG A CG   3  
ATOM   5770  C  CD   . ARG A 1 92  ? 3.646   -0.009  -6.596  1.00 0.00 ? 246 ARG A CD   3  
ATOM   5771  N  NE   . ARG A 1 92  ? 2.851   0.874   -7.503  1.00 0.00 ? 246 ARG A NE   3  
ATOM   5772  C  CZ   . ARG A 1 92  ? 3.431   1.827   -8.217  1.00 0.00 ? 246 ARG A CZ   3  
ATOM   5773  N  NH1  . ARG A 1 92  ? 4.727   2.036   -8.156  1.00 0.00 ? 246 ARG A NH1  3  
ATOM   5774  N  NH2  . ARG A 1 92  ? 2.704   2.578   -9.002  1.00 0.00 ? 246 ARG A NH2  3  
ATOM   5775  H  H    . ARG A 1 92  ? 6.927   -3.173  -5.245  1.00 0.00 ? 246 ARG A H    3  
ATOM   5776  H  HA   . ARG A 1 92  ? 7.062   -1.423  -7.627  1.00 0.00 ? 246 ARG A HA   3  
ATOM   5777  H  HB2  . ARG A 1 92  ? 5.154   -2.946  -7.162  1.00 0.00 ? 246 ARG A HB2  3  
ATOM   5778  H  HB3  . ARG A 1 92  ? 4.791   -2.026  -5.702  1.00 0.00 ? 246 ARG A HB3  3  
ATOM   5779  H  HG2  . ARG A 1 92  ? 5.045   -0.414  -8.175  1.00 0.00 ? 246 ARG A HG2  3  
ATOM   5780  H  HG3  . ARG A 1 92  ? 3.664   -1.509  -8.128  1.00 0.00 ? 246 ARG A HG3  3  
ATOM   5781  H  HD2  . ARG A 1 92  ? 2.992   -0.558  -5.933  1.00 0.00 ? 246 ARG A HD2  3  
ATOM   5782  H  HD3  . ARG A 1 92  ? 4.350   0.580   -6.029  1.00 0.00 ? 246 ARG A HD3  3  
ATOM   5783  H  HE   . ARG A 1 92  ? 1.880   0.742   -7.567  1.00 0.00 ? 246 ARG A HE   3  
ATOM   5784  H  HH11 . ARG A 1 92  ? 5.304   1.475   -7.564  1.00 0.00 ? 246 ARG A HH11 3  
ATOM   5785  H  HH12 . ARG A 1 92  ? 5.138   2.761   -8.707  1.00 0.00 ? 246 ARG A HH12 3  
ATOM   5786  H  HH21 . ARG A 1 92  ? 1.716   2.433   -9.061  1.00 0.00 ? 246 ARG A HH21 3  
ATOM   5787  H  HH22 . ARG A 1 92  ? 3.136   3.300   -9.545  1.00 0.00 ? 246 ARG A HH22 3  
ATOM   5788  N  N    . ASN A 1 93  ? 7.116   -0.104  -4.636  1.00 0.00 ? 247 ASN A N    3  
ATOM   5789  C  CA   . ASN A 1 93  ? 7.214   1.217   -3.927  1.00 0.00 ? 247 ASN A CA   3  
ATOM   5790  C  C    . ASN A 1 93  ? 8.664   1.719   -3.920  1.00 0.00 ? 247 ASN A C    3  
ATOM   5791  O  O    . ASN A 1 93  ? 8.913   2.892   -4.128  1.00 0.00 ? 247 ASN A O    3  
ATOM   5792  C  CB   . ASN A 1 93  ? 6.730   0.963   -2.492  1.00 0.00 ? 247 ASN A CB   3  
ATOM   5793  C  CG   . ASN A 1 93  ? 6.521   2.304   -1.778  1.00 0.00 ? 247 ASN A CG   3  
ATOM   5794  O  OD1  . ASN A 1 93  ? 5.474   2.908   -1.900  1.00 0.00 ? 247 ASN A OD1  3  
ATOM   5795  N  ND2  . ASN A 1 93  ? 7.475   2.804   -1.030  1.00 0.00 ? 247 ASN A ND2  3  
ATOM   5796  H  H    . ASN A 1 93  ? 7.318   -0.930  -4.150  1.00 0.00 ? 247 ASN A H    3  
ATOM   5797  H  HA   . ASN A 1 93  ? 6.578   1.939   -4.404  1.00 0.00 ? 247 ASN A HA   3  
ATOM   5798  H  HB2  . ASN A 1 93  ? 5.798   0.418   -2.517  1.00 0.00 ? 247 ASN A HB2  3  
ATOM   5799  H  HB3  . ASN A 1 93  ? 7.473   0.386   -1.959  1.00 0.00 ? 247 ASN A HB3  3  
ATOM   5800  H  HD21 . ASN A 1 93  ? 8.326   2.326   -0.924  1.00 0.00 ? 247 ASN A HD21 3  
ATOM   5801  H  HD22 . ASN A 1 93  ? 7.339   3.662   -0.575  1.00 0.00 ? 247 ASN A HD22 3  
ATOM   5802  N  N    . LEU A 1 94  ? 9.625   0.851   -3.675  1.00 0.00 ? 248 LEU A N    3  
ATOM   5803  C  CA   . LEU A 1 94  ? 11.052  1.316   -3.653  1.00 0.00 ? 248 LEU A CA   3  
ATOM   5804  C  C    . LEU A 1 94  ? 12.040  0.265   -4.215  1.00 0.00 ? 248 LEU A C    3  
ATOM   5805  O  O    . LEU A 1 94  ? 13.216  0.312   -3.906  1.00 0.00 ? 248 LEU A O    3  
ATOM   5806  C  CB   . LEU A 1 94  ? 11.352  1.616   -2.177  1.00 0.00 ? 248 LEU A CB   3  
ATOM   5807  C  CG   . LEU A 1 94  ? 11.269  0.337   -1.335  1.00 0.00 ? 248 LEU A CG   3  
ATOM   5808  C  CD1  . LEU A 1 94  ? 12.631  -0.353  -1.315  1.00 0.00 ? 248 LEU A CD1  3  
ATOM   5809  C  CD2  . LEU A 1 94  ? 10.866  0.701   0.096   1.00 0.00 ? 248 LEU A CD2  3  
ATOM   5810  H  H    . LEU A 1 94  ? 9.408   -0.088  -3.504  1.00 0.00 ? 248 LEU A H    3  
ATOM   5811  H  HA   . LEU A 1 94  ? 11.139  2.229   -4.220  1.00 0.00 ? 248 LEU A HA   3  
ATOM   5812  H  HB2  . LEU A 1 94  ? 12.346  2.031   -2.094  1.00 0.00 ? 248 LEU A HB2  3  
ATOM   5813  H  HB3  . LEU A 1 94  ? 10.635  2.333   -1.806  1.00 0.00 ? 248 LEU A HB3  3  
ATOM   5814  H  HG   . LEU A 1 94  ? 10.536  -0.331  -1.756  1.00 0.00 ? 248 LEU A HG   3  
ATOM   5815  H  HD11 . LEU A 1 94  ? 13.410  0.393   -1.357  1.00 0.00 ? 248 LEU A HD11 3  
ATOM   5816  H  HD12 . LEU A 1 94  ? 12.714  -1.010  -2.168  1.00 0.00 ? 248 LEU A HD12 3  
ATOM   5817  H  HD13 . LEU A 1 94  ? 12.731  -0.928  -0.407  1.00 0.00 ? 248 LEU A HD13 3  
ATOM   5818  H  HD21 . LEU A 1 94  ? 11.305  1.651   0.363   1.00 0.00 ? 248 LEU A HD21 3  
ATOM   5819  H  HD22 . LEU A 1 94  ? 11.220  -0.062  0.774   1.00 0.00 ? 248 LEU A HD22 3  
ATOM   5820  H  HD23 . LEU A 1 94  ? 9.790   0.770   0.161   1.00 0.00 ? 248 LEU A HD23 3  
ATOM   5821  N  N    . GLY A 1 95  ? 11.602  -0.659  -5.053  1.00 0.00 ? 249 GLY A N    3  
ATOM   5822  C  CA   . GLY A 1 95  ? 12.559  -1.659  -5.626  1.00 0.00 ? 249 GLY A CA   3  
ATOM   5823  C  C    . GLY A 1 95  ? 12.810  -2.801  -4.630  1.00 0.00 ? 249 GLY A C    3  
ATOM   5824  O  O    . GLY A 1 95  ? 12.342  -2.770  -3.508  1.00 0.00 ? 249 GLY A O    3  
ATOM   5825  H  H    . GLY A 1 95  ? 10.660  -0.687  -5.323  1.00 0.00 ? 249 GLY A H    3  
ATOM   5826  H  HA2  . GLY A 1 95  ? 12.145  -2.066  -6.537  1.00 0.00 ? 249 GLY A HA2  3  
ATOM   5827  H  HA3  . GLY A 1 95  ? 13.497  -1.171  -5.845  1.00 0.00 ? 249 GLY A HA3  3  
ATOM   5828  N  N    . ARG A 1 96  ? 13.552  -3.814  -5.037  1.00 0.00 ? 250 ARG A N    3  
ATOM   5829  C  CA   . ARG A 1 96  ? 13.834  -4.963  -4.112  1.00 0.00 ? 250 ARG A CA   3  
ATOM   5830  C  C    . ARG A 1 96  ? 15.217  -4.827  -3.443  1.00 0.00 ? 250 ARG A C    3  
ATOM   5831  O  O    . ARG A 1 96  ? 15.417  -5.322  -2.349  1.00 0.00 ? 250 ARG A O    3  
ATOM   5832  C  CB   . ARG A 1 96  ? 13.791  -6.222  -4.986  1.00 0.00 ? 250 ARG A CB   3  
ATOM   5833  C  CG   . ARG A 1 96  ? 13.959  -7.463  -4.107  1.00 0.00 ? 250 ARG A CG   3  
ATOM   5834  C  CD   . ARG A 1 96  ? 14.034  -8.710  -4.992  1.00 0.00 ? 250 ARG A CD   3  
ATOM   5835  N  NE   . ARG A 1 96  ? 15.037  -9.596  -4.327  1.00 0.00 ? 250 ARG A NE   3  
ATOM   5836  C  CZ   . ARG A 1 96  ? 16.331  -9.313  -4.357  1.00 0.00 ? 250 ARG A CZ   3  
ATOM   5837  N  NH1  . ARG A 1 96  ? 16.784  -8.244  -4.969  1.00 0.00 ? 250 ARG A NH1  3  
ATOM   5838  N  NH2  . ARG A 1 96  ? 17.181  -10.113 -3.766  1.00 0.00 ? 250 ARG A NH2  3  
ATOM   5839  H  H    . ARG A 1 96  ? 13.921  -3.818  -5.953  1.00 0.00 ? 250 ARG A H    3  
ATOM   5840  H  HA   . ARG A 1 96  ? 13.070  -5.022  -3.357  1.00 0.00 ? 250 ARG A HA   3  
ATOM   5841  H  HB2  . ARG A 1 96  ? 12.842  -6.270  -5.501  1.00 0.00 ? 250 ARG A HB2  3  
ATOM   5842  H  HB3  . ARG A 1 96  ? 14.592  -6.184  -5.709  1.00 0.00 ? 250 ARG A HB3  3  
ATOM   5843  H  HG2  . ARG A 1 96  ? 14.869  -7.375  -3.531  1.00 0.00 ? 250 ARG A HG2  3  
ATOM   5844  H  HG3  . ARG A 1 96  ? 13.116  -7.548  -3.439  1.00 0.00 ? 250 ARG A HG3  3  
ATOM   5845  H  HD2  . ARG A 1 96  ? 13.068  -9.196  -5.036  1.00 0.00 ? 250 ARG A HD2  3  
ATOM   5846  H  HD3  . ARG A 1 96  ? 14.371  -8.448  -5.982  1.00 0.00 ? 250 ARG A HD3  3  
ATOM   5847  H  HE   . ARG A 1 96  ? 14.727  -10.402 -3.860  1.00 0.00 ? 250 ARG A HE   3  
ATOM   5848  H  HH11 . ARG A 1 96  ? 16.156  -7.616  -5.428  1.00 0.00 ? 250 ARG A HH11 3  
ATOM   5849  H  HH12 . ARG A 1 96  ? 17.766  -8.055  -4.976  1.00 0.00 ? 250 ARG A HH12 3  
ATOM   5850  H  HH21 . ARG A 1 96  ? 16.852  -10.932 -3.295  1.00 0.00 ? 250 ARG A HH21 3  
ATOM   5851  H  HH22 . ARG A 1 96  ? 18.158  -9.906  -3.785  1.00 0.00 ? 250 ARG A HH22 3  
ATOM   5852  N  N    . LYS A 1 97  ? 16.179  -4.174  -4.078  1.00 0.00 ? 251 LYS A N    3  
ATOM   5853  C  CA   . LYS A 1 97  ? 17.545  -4.037  -3.436  1.00 0.00 ? 251 LYS A CA   3  
ATOM   5854  C  C    . LYS A 1 97  ? 17.411  -3.484  -2.010  1.00 0.00 ? 251 LYS A C    3  
ATOM   5855  O  O    . LYS A 1 97  ? 17.849  -4.107  -1.061  1.00 0.00 ? 251 LYS A O    3  
ATOM   5856  C  CB   . LYS A 1 97  ? 18.351  -3.061  -4.307  1.00 0.00 ? 251 LYS A CB   3  
ATOM   5857  C  CG   . LYS A 1 97  ? 19.845  -3.322  -4.117  1.00 0.00 ? 251 LYS A CG   3  
ATOM   5858  C  CD   . LYS A 1 97  ? 20.648  -2.235  -4.835  1.00 0.00 ? 251 LYS A CD   3  
ATOM   5859  C  CE   . LYS A 1 97  ? 22.078  -2.728  -5.070  1.00 0.00 ? 251 LYS A CE   3  
ATOM   5860  N  NZ   . LYS A 1 97  ? 22.712  -2.725  -3.723  1.00 0.00 ? 251 LYS A NZ   3  
ATOM   5861  H  H    . LYS A 1 97  ? 16.006  -3.786  -4.964  1.00 0.00 ? 251 LYS A H    3  
ATOM   5862  H  HA   . LYS A 1 97  ? 18.037  -4.998  -3.408  1.00 0.00 ? 251 LYS A HA   3  
ATOM   5863  H  HB2  . LYS A 1 97  ? 18.088  -3.204  -5.346  1.00 0.00 ? 251 LYS A HB2  3  
ATOM   5864  H  HB3  . LYS A 1 97  ? 18.124  -2.047  -4.015  1.00 0.00 ? 251 LYS A HB3  3  
ATOM   5865  H  HG2  . LYS A 1 97  ? 20.082  -3.309  -3.063  1.00 0.00 ? 251 LYS A HG2  3  
ATOM   5866  H  HG3  . LYS A 1 97  ? 20.099  -4.286  -4.532  1.00 0.00 ? 251 LYS A HG3  3  
ATOM   5867  H  HD2  . LYS A 1 97  ? 20.182  -2.011  -5.784  1.00 0.00 ? 251 LYS A HD2  3  
ATOM   5868  H  HD3  . LYS A 1 97  ? 20.673  -1.344  -4.225  1.00 0.00 ? 251 LYS A HD3  3  
ATOM   5869  H  HE2  . LYS A 1 97  ? 22.065  -3.728  -5.482  1.00 0.00 ? 251 LYS A HE2  3  
ATOM   5870  H  HE3  . LYS A 1 97  ? 22.604  -2.054  -5.728  1.00 0.00 ? 251 LYS A HE3  3  
ATOM   5871  H  HZ1  . LYS A 1 97  ? 22.761  -1.751  -3.364  1.00 0.00 ? 251 LYS A HZ1  3  
ATOM   5872  H  HZ2  . LYS A 1 97  ? 23.672  -3.119  -3.792  1.00 0.00 ? 251 LYS A HZ2  3  
ATOM   5873  H  HZ3  . LYS A 1 97  ? 22.144  -3.304  -3.071  1.00 0.00 ? 251 LYS A HZ3  3  
ATOM   5874  N  N    . GLU A 1 98  ? 16.791  -2.331  -1.842  1.00 0.00 ? 252 GLU A N    3  
ATOM   5875  C  CA   . GLU A 1 98  ? 16.619  -1.775  -0.448  1.00 0.00 ? 252 GLU A CA   3  
ATOM   5876  C  C    . GLU A 1 98  ? 15.958  -2.832  0.463   1.00 0.00 ? 252 GLU A C    3  
ATOM   5877  O  O    . GLU A 1 98  ? 16.226  -2.882  1.649   1.00 0.00 ? 252 GLU A O    3  
ATOM   5878  C  CB   . GLU A 1 98  ? 15.713  -0.539  -0.567  1.00 0.00 ? 252 GLU A CB   3  
ATOM   5879  C  CG   . GLU A 1 98  ? 16.577  0.722   -0.651  1.00 0.00 ? 252 GLU A CG   3  
ATOM   5880  C  CD   . GLU A 1 98  ? 15.847  1.788   -1.470  1.00 0.00 ? 252 GLU A CD   3  
ATOM   5881  O  OE1  . GLU A 1 98  ? 15.794  1.645   -2.680  1.00 0.00 ? 252 GLU A OE1  3  
ATOM   5882  O  OE2  . GLU A 1 98  ? 15.352  2.730   -0.872  1.00 0.00 ? 252 GLU A OE2  3  
ATOM   5883  H  H    . GLU A 1 98  ? 16.430  -1.849  -2.621  1.00 0.00 ? 252 GLU A H    3  
ATOM   5884  H  HA   . GLU A 1 98  ? 17.575  -1.490  -0.048  1.00 0.00 ? 252 GLU A HA   3  
ATOM   5885  H  HB2  . GLU A 1 98  ? 15.107  -0.621  -1.457  1.00 0.00 ? 252 GLU A HB2  3  
ATOM   5886  H  HB3  . GLU A 1 98  ? 15.073  -0.477  0.300   1.00 0.00 ? 252 GLU A HB3  3  
ATOM   5887  H  HG2  . GLU A 1 98  ? 16.764  1.096   0.345   1.00 0.00 ? 252 GLU A HG2  3  
ATOM   5888  H  HG3  . GLU A 1 98  ? 17.515  0.483   -1.129  1.00 0.00 ? 252 GLU A HG3  3  
ATOM   5889  N  N    . LEU A 1 99  ? 15.109  -3.686  -0.084  1.00 0.00 ? 253 LEU A N    3  
ATOM   5890  C  CA   . LEU A 1 99  ? 14.455  -4.743  0.766   1.00 0.00 ? 253 LEU A CA   3  
ATOM   5891  C  C    . LEU A 1 99  ? 15.524  -5.613  1.456   1.00 0.00 ? 253 LEU A C    3  
ATOM   5892  O  O    . LEU A 1 99  ? 15.315  -6.083  2.558   1.00 0.00 ? 253 LEU A O    3  
ATOM   5893  C  CB   . LEU A 1 99  ? 13.604  -5.601  -0.183  1.00 0.00 ? 253 LEU A CB   3  
ATOM   5894  C  CG   . LEU A 1 99  ? 12.457  -6.245  0.599   1.00 0.00 ? 253 LEU A CG   3  
ATOM   5895  C  CD1  . LEU A 1 99  ? 11.285  -6.522  -0.348  1.00 0.00 ? 253 LEU A CD1  3  
ATOM   5896  C  CD2  . LEU A 1 99  ? 12.938  -7.561  1.216   1.00 0.00 ? 253 LEU A CD2  3  
ATOM   5897  H  H    . LEU A 1 99  ? 14.911  -3.635  -1.046  1.00 0.00 ? 253 LEU A H    3  
ATOM   5898  H  HA   . LEU A 1 99  ? 13.822  -4.281  1.506   1.00 0.00 ? 253 LEU A HA   3  
ATOM   5899  H  HB2  . LEU A 1 99  ? 13.199  -4.976  -0.965  1.00 0.00 ? 253 LEU A HB2  3  
ATOM   5900  H  HB3  . LEU A 1 99  ? 14.220  -6.371  -0.620  1.00 0.00 ? 253 LEU A HB3  3  
ATOM   5901  H  HG   . LEU A 1 99  ? 12.135  -5.574  1.381   1.00 0.00 ? 253 LEU A HG   3  
ATOM   5902  H  HD11 . LEU A 1 99  ? 11.343  -7.541  -0.703  1.00 0.00 ? 253 LEU A HD11 3  
ATOM   5903  H  HD12 . LEU A 1 99  ? 11.331  -5.845  -1.187  1.00 0.00 ? 253 LEU A HD12 3  
ATOM   5904  H  HD13 . LEU A 1 99  ? 10.355  -6.379  0.181   1.00 0.00 ? 253 LEU A HD13 3  
ATOM   5905  H  HD21 . LEU A 1 99  ? 13.376  -7.366  2.183   1.00 0.00 ? 253 LEU A HD21 3  
ATOM   5906  H  HD22 . LEU A 1 99  ? 13.675  -8.014  0.571   1.00 0.00 ? 253 LEU A HD22 3  
ATOM   5907  H  HD23 . LEU A 1 99  ? 12.099  -8.232  1.330   1.00 0.00 ? 253 LEU A HD23 3  
ATOM   5908  N  N    . SER A 1 100 ? 16.669  -5.834  0.832   1.00 0.00 ? 254 SER A N    3  
ATOM   5909  C  CA   . SER A 1 100 ? 17.721  -6.677  1.512   1.00 0.00 ? 254 SER A CA   3  
ATOM   5910  C  C    . SER A 1 100 ? 18.170  -5.983  2.804   1.00 0.00 ? 254 SER A C    3  
ATOM   5911  O  O    . SER A 1 100 ? 18.197  -6.593  3.857   1.00 0.00 ? 254 SER A O    3  
ATOM   5912  C  CB   . SER A 1 100 ? 18.899  -6.804  0.534   1.00 0.00 ? 254 SER A CB   3  
ATOM   5913  O  OG   . SER A 1 100 ? 19.772  -5.696  0.706   1.00 0.00 ? 254 SER A OG   3  
ATOM   5914  H  H    . SER A 1 100 ? 16.834  -5.449  -0.064  1.00 0.00 ? 254 SER A H    3  
ATOM   5915  H  HA   . SER A 1 100 ? 17.322  -7.653  1.744   1.00 0.00 ? 254 SER A HA   3  
ATOM   5916  H  HB2  . SER A 1 100 ? 19.439  -7.714  0.733   1.00 0.00 ? 254 SER A HB2  3  
ATOM   5917  H  HB3  . SER A 1 100 ? 18.523  -6.825  -0.481  1.00 0.00 ? 254 SER A HB3  3  
ATOM   5918  H  HG   . SER A 1 100 ? 20.539  -5.831  0.143   1.00 0.00 ? 254 SER A HG   3  
ATOM   5919  N  N    . THR A 1 101 ? 18.502  -4.708  2.744   1.00 0.00 ? 255 THR A N    3  
ATOM   5920  C  CA   . THR A 1 101 ? 18.924  -3.991  4.003   1.00 0.00 ? 255 THR A CA   3  
ATOM   5921  C  C    . THR A 1 101 ? 17.795  -4.055  5.044   1.00 0.00 ? 255 THR A C    3  
ATOM   5922  O  O    . THR A 1 101 ? 18.051  -4.141  6.230   1.00 0.00 ? 255 THR A O    3  
ATOM   5923  C  CB   . THR A 1 101 ? 19.208  -2.530  3.615   1.00 0.00 ? 255 THR A CB   3  
ATOM   5924  O  OG1  . THR A 1 101 ? 20.134  -2.499  2.538   1.00 0.00 ? 255 THR A OG1  3  
ATOM   5925  C  CG2  . THR A 1 101 ? 19.794  -1.785  4.815   1.00 0.00 ? 255 THR A CG2  3  
ATOM   5926  H  H    . THR A 1 101 ? 18.458  -4.227  1.882   1.00 0.00 ? 255 THR A H    3  
ATOM   5927  H  HA   . THR A 1 101 ? 19.814  -4.444  4.406   1.00 0.00 ? 255 THR A HA   3  
ATOM   5928  H  HB   . THR A 1 101 ? 18.288  -2.053  3.313   1.00 0.00 ? 255 THR A HB   3  
ATOM   5929  H  HG1  . THR A 1 101 ? 20.088  -1.631  2.132   1.00 0.00 ? 255 THR A HG1  3  
ATOM   5930  H  HG21 . THR A 1 101 ? 19.191  -1.980  5.689   1.00 0.00 ? 255 THR A HG21 3  
ATOM   5931  H  HG22 . THR A 1 101 ? 19.801  -0.725  4.612   1.00 0.00 ? 255 THR A HG22 3  
ATOM   5932  H  HG23 . THR A 1 101 ? 20.804  -2.125  4.991   1.00 0.00 ? 255 THR A HG23 3  
ATOM   5933  N  N    . ILE A 1 102 ? 16.544  -4.031  4.616   1.00 0.00 ? 256 ILE A N    3  
ATOM   5934  C  CA   . ILE A 1 102 ? 15.413  -4.111  5.610   1.00 0.00 ? 256 ILE A CA   3  
ATOM   5935  C  C    . ILE A 1 102 ? 15.569  -5.373  6.488   1.00 0.00 ? 256 ILE A C    3  
ATOM   5936  O  O    . ILE A 1 102 ? 15.178  -5.370  7.641   1.00 0.00 ? 256 ILE A O    3  
ATOM   5937  C  CB   . ILE A 1 102 ? 14.101  -4.162  4.792   1.00 0.00 ? 256 ILE A CB   3  
ATOM   5938  C  CG1  . ILE A 1 102 ? 13.876  -2.803  4.117   1.00 0.00 ? 256 ILE A CG1  3  
ATOM   5939  C  CG2  . ILE A 1 102 ? 12.912  -4.477  5.708   1.00 0.00 ? 256 ILE A CG2  3  
ATOM   5940  C  CD1  . ILE A 1 102 ? 12.653  -2.874  3.198   1.00 0.00 ? 256 ILE A CD1  3  
ATOM   5941  H  H    . ILE A 1 102 ? 16.355  -3.972  3.653   1.00 0.00 ? 256 ILE A H    3  
ATOM   5942  H  HA   . ILE A 1 102 ? 15.416  -3.235  6.235   1.00 0.00 ? 256 ILE A HA   3  
ATOM   5943  H  HB   . ILE A 1 102 ? 14.179  -4.928  4.039   1.00 0.00 ? 256 ILE A HB   3  
ATOM   5944  H  HG12 . ILE A 1 102 ? 13.716  -2.050  4.874   1.00 0.00 ? 256 ILE A HG12 3  
ATOM   5945  H  HG13 . ILE A 1 102 ? 14.746  -2.543  3.533   1.00 0.00 ? 256 ILE A HG13 3  
ATOM   5946  H  HG21 . ILE A 1 102 ? 13.124  -4.121  6.702   1.00 0.00 ? 256 ILE A HG21 3  
ATOM   5947  H  HG22 . ILE A 1 102 ? 12.755  -5.544  5.736   1.00 0.00 ? 256 ILE A HG22 3  
ATOM   5948  H  HG23 . ILE A 1 102 ? 12.025  -3.993  5.331   1.00 0.00 ? 256 ILE A HG23 3  
ATOM   5949  H  HD11 . ILE A 1 102 ? 12.839  -2.293  2.307   1.00 0.00 ? 256 ILE A HD11 3  
ATOM   5950  H  HD12 . ILE A 1 102 ? 11.792  -2.475  3.714   1.00 0.00 ? 256 ILE A HD12 3  
ATOM   5951  H  HD13 . ILE A 1 102 ? 12.465  -3.902  2.926   1.00 0.00 ? 256 ILE A HD13 3  
ATOM   5952  N  N    . MET A 1 103 ? 16.144  -6.442  5.968   1.00 0.00 ? 257 MET A N    3  
ATOM   5953  C  CA   . MET A 1 103 ? 16.314  -7.670  6.815   1.00 0.00 ? 257 MET A CA   3  
ATOM   5954  C  C    . MET A 1 103 ? 17.730  -7.741  7.431   1.00 0.00 ? 257 MET A C    3  
ATOM   5955  O  O    . MET A 1 103 ? 18.177  -8.805  7.818   1.00 0.00 ? 257 MET A O    3  
ATOM   5956  C  CB   . MET A 1 103 ? 16.072  -8.863  5.882   1.00 0.00 ? 257 MET A CB   3  
ATOM   5957  C  CG   . MET A 1 103 ? 14.593  -9.258  5.932   1.00 0.00 ? 257 MET A CG   3  
ATOM   5958  S  SD   . MET A 1 103 ? 14.219  -9.986  7.548   1.00 0.00 ? 257 MET A SD   3  
ATOM   5959  C  CE   . MET A 1 103 ? 12.449  -9.606  7.569   1.00 0.00 ? 257 MET A CE   3  
ATOM   5960  H  H    . MET A 1 103 ? 16.468  -6.435  5.034   1.00 0.00 ? 257 MET A H    3  
ATOM   5961  H  HA   . MET A 1 103 ? 15.575  -7.675  7.602   1.00 0.00 ? 257 MET A HA   3  
ATOM   5962  H  HB2  . MET A 1 103 ? 16.339  -8.590  4.871   1.00 0.00 ? 257 MET A HB2  3  
ATOM   5963  H  HB3  . MET A 1 103 ? 16.677  -9.698  6.201   1.00 0.00 ? 257 MET A HB3  3  
ATOM   5964  H  HG2  . MET A 1 103 ? 13.980  -8.382  5.779   1.00 0.00 ? 257 MET A HG2  3  
ATOM   5965  H  HG3  . MET A 1 103 ? 14.388  -9.982  5.155   1.00 0.00 ? 257 MET A HG3  3  
ATOM   5966  H  HE1  . MET A 1 103 ? 11.988  -10.085 8.423   1.00 0.00 ? 257 MET A HE1  3  
ATOM   5967  H  HE2  . MET A 1 103 ? 11.990  -9.971  6.665   1.00 0.00 ? 257 MET A HE2  3  
ATOM   5968  H  HE3  . MET A 1 103 ? 12.313  -8.536  7.633   1.00 0.00 ? 257 MET A HE3  3  
ATOM   5969  N  N    . ASP A 1 104 ? 18.444  -6.629  7.540   1.00 0.00 ? 258 ASP A N    3  
ATOM   5970  C  CA   . ASP A 1 104 ? 19.814  -6.673  8.144   1.00 0.00 ? 258 ASP A CA   3  
ATOM   5971  C  C    . ASP A 1 104 ? 20.145  -5.328  8.821   1.00 0.00 ? 258 ASP A C    3  
ATOM   5972  O  O    . ASP A 1 104 ? 21.099  -4.666  8.453   1.00 0.00 ? 258 ASP A O    3  
ATOM   5973  C  CB   . ASP A 1 104 ? 20.755  -6.934  6.967   1.00 0.00 ? 258 ASP A CB   3  
ATOM   5974  C  CG   . ASP A 1 104 ? 21.916  -7.818  7.428   1.00 0.00 ? 258 ASP A CG   3  
ATOM   5975  O  OD1  . ASP A 1 104 ? 22.549  -7.467  8.409   1.00 0.00 ? 258 ASP A OD1  3  
ATOM   5976  O  OD2  . ASP A 1 104 ? 22.153  -8.831  6.789   1.00 0.00 ? 258 ASP A OD2  3  
ATOM   5977  H  H    . ASP A 1 104 ? 18.085  -5.770  7.233   1.00 0.00 ? 258 ASP A H    3  
ATOM   5978  H  HA   . ASP A 1 104 ? 19.883  -7.481  8.857   1.00 0.00 ? 258 ASP A HA   3  
ATOM   5979  H  HB2  . ASP A 1 104 ? 20.213  -7.433  6.176   1.00 0.00 ? 258 ASP A HB2  3  
ATOM   5980  H  HB3  . ASP A 1 104 ? 21.144  -5.995  6.602   1.00 0.00 ? 258 ASP A HB3  3  
ATOM   5981  N  N    . GLU A 1 105 ? 19.363  -4.912  9.801   1.00 0.00 ? 259 GLU A N    3  
ATOM   5982  C  CA   . GLU A 1 105 ? 19.643  -3.608  10.478  1.00 0.00 ? 259 GLU A CA   3  
ATOM   5983  C  C    . GLU A 1 105 ? 19.358  -3.700  11.989  1.00 0.00 ? 259 GLU A C    3  
ATOM   5984  O  O    . GLU A 1 105 ? 18.388  -3.150  12.474  1.00 0.00 ? 259 GLU A O    3  
ATOM   5985  C  CB   . GLU A 1 105 ? 18.695  -2.610  9.812   1.00 0.00 ? 259 GLU A CB   3  
ATOM   5986  C  CG   . GLU A 1 105 ? 19.382  -1.984  8.597   1.00 0.00 ? 259 GLU A CG   3  
ATOM   5987  C  CD   . GLU A 1 105 ? 20.203  -0.772  9.041   1.00 0.00 ? 259 GLU A CD   3  
ATOM   5988  O  OE1  . GLU A 1 105 ? 21.038  -0.935  9.916   1.00 0.00 ? 259 GLU A OE1  3  
ATOM   5989  O  OE2  . GLU A 1 105 ? 19.982  0.299   8.500   1.00 0.00 ? 259 GLU A OE2  3  
ATOM   5990  H  H    . GLU A 1 105 ? 18.593  -5.451  10.086  1.00 0.00 ? 259 GLU A H    3  
ATOM   5991  H  HA   . GLU A 1 105 ? 20.666  -3.310  10.307  1.00 0.00 ? 259 GLU A HA   3  
ATOM   5992  H  HB2  . GLU A 1 105 ? 17.798  -3.122  9.496   1.00 0.00 ? 259 GLU A HB2  3  
ATOM   5993  H  HB3  . GLU A 1 105 ? 18.437  -1.833  10.516  1.00 0.00 ? 259 GLU A HB3  3  
ATOM   5994  H  HG2  . GLU A 1 105 ? 20.034  -2.712  8.137   1.00 0.00 ? 259 GLU A HG2  3  
ATOM   5995  H  HG3  . GLU A 1 105 ? 18.635  -1.667  7.884   1.00 0.00 ? 259 GLU A HG3  3  
ATOM   5996  N  N    . ASN A 1 106 ? 20.198  -4.387  12.742  1.00 0.00 ? 260 ASN A N    3  
ATOM   5997  C  CA   . ASN A 1 106 ? 19.980  -4.508  14.223  1.00 0.00 ? 260 ASN A CA   3  
ATOM   5998  C  C    . ASN A 1 106 ? 18.566  -5.030  14.538  1.00 0.00 ? 260 ASN A C    3  
ATOM   5999  O  O    . ASN A 1 106 ? 17.987  -4.673  15.547  1.00 0.00 ? 260 ASN A O    3  
ATOM   6000  C  CB   . ASN A 1 106 ? 20.164  -3.093  14.779  1.00 0.00 ? 260 ASN A CB   3  
ATOM   6001  C  CG   . ASN A 1 106 ? 21.659  -2.799  14.948  1.00 0.00 ? 260 ASN A CG   3  
ATOM   6002  O  OD1  . ASN A 1 106 ? 22.423  -2.943  14.015  1.00 0.00 ? 260 ASN A OD1  3  
ATOM   6003  N  ND2  . ASN A 1 106 ? 22.119  -2.391  16.107  1.00 0.00 ? 260 ASN A ND2  3  
ATOM   6004  H  H    . ASN A 1 106 ? 20.977  -4.826  12.336  1.00 0.00 ? 260 ASN A H    3  
ATOM   6005  H  HA   . ASN A 1 106 ? 20.720  -5.165  14.653  1.00 0.00 ? 260 ASN A HA   3  
ATOM   6006  H  HB2  . ASN A 1 106 ? 19.731  -2.378  14.093  1.00 0.00 ? 260 ASN A HB2  3  
ATOM   6007  H  HB3  . ASN A 1 106 ? 19.674  -3.016  15.738  1.00 0.00 ? 260 ASN A HB3  3  
ATOM   6008  H  HD21 . ASN A 1 106 ? 21.511  -2.270  16.868  1.00 0.00 ? 260 ASN A HD21 3  
ATOM   6009  H  HD22 . ASN A 1 106 ? 23.074  -2.203  16.213  1.00 0.00 ? 260 ASN A HD22 3  
ATOM   6010  N  N    . ASN A 1 107 ? 18.007  -5.879  13.697  1.00 0.00 ? 261 ASN A N    3  
ATOM   6011  C  CA   . ASN A 1 107 ? 16.634  -6.427  13.965  1.00 0.00 ? 261 ASN A CA   3  
ATOM   6012  C  C    . ASN A 1 107 ? 15.627  -5.311  14.321  1.00 0.00 ? 261 ASN A C    3  
ATOM   6013  O  O    . ASN A 1 107 ? 14.699  -5.537  15.077  1.00 0.00 ? 261 ASN A O    3  
ATOM   6014  C  CB   . ASN A 1 107 ? 16.814  -7.375  15.151  1.00 0.00 ? 261 ASN A CB   3  
ATOM   6015  C  CG   . ASN A 1 107 ? 17.446  -8.685  14.667  1.00 0.00 ? 261 ASN A CG   3  
ATOM   6016  O  OD1  . ASN A 1 107 ? 18.625  -8.728  14.378  1.00 0.00 ? 261 ASN A OD1  3  
ATOM   6017  N  ND2  . ASN A 1 107 ? 16.713  -9.768  14.565  1.00 0.00 ? 261 ASN A ND2  3  
ATOM   6018  H  H    . ASN A 1 107 ? 18.490  -6.168  12.891  1.00 0.00 ? 261 ASN A H    3  
ATOM   6019  H  HA   . ASN A 1 107 ? 16.284  -6.982  13.109  1.00 0.00 ? 261 ASN A HA   3  
ATOM   6020  H  HB2  . ASN A 1 107 ? 17.458  -6.912  15.886  1.00 0.00 ? 261 ASN A HB2  3  
ATOM   6021  H  HB3  . ASN A 1 107 ? 15.852  -7.584  15.595  1.00 0.00 ? 261 ASN A HB3  3  
ATOM   6022  H  HD21 . ASN A 1 107 ? 15.758  -9.745  14.797  1.00 0.00 ? 261 ASN A HD21 3  
ATOM   6023  H  HD22 . ASN A 1 107 ? 17.119  -10.604 14.256  1.00 0.00 ? 261 ASN A HD22 3  
ATOM   6024  N  N    . GLN A 1 108 ? 15.787  -4.118  13.782  1.00 0.00 ? 262 GLN A N    3  
ATOM   6025  C  CA   . GLN A 1 108 ? 14.823  -3.019  14.094  1.00 0.00 ? 262 GLN A CA   3  
ATOM   6026  C  C    . GLN A 1 108 ? 14.440  -2.286  12.802  1.00 0.00 ? 262 GLN A C    3  
ATOM   6027  O  O    . GLN A 1 108 ? 15.059  -1.304  12.436  1.00 0.00 ? 262 GLN A O    3  
ATOM   6028  C  CB   . GLN A 1 108 ? 15.569  -2.079  15.041  1.00 0.00 ? 262 GLN A CB   3  
ATOM   6029  C  CG   . GLN A 1 108 ? 15.248  -2.453  16.490  1.00 0.00 ? 262 GLN A CG   3  
ATOM   6030  C  CD   . GLN A 1 108 ? 16.443  -2.105  17.386  1.00 0.00 ? 262 GLN A CD   3  
ATOM   6031  O  OE1  . GLN A 1 108 ? 16.473  -1.048  17.985  1.00 0.00 ? 262 GLN A OE1  3  
ATOM   6032  N  NE2  . GLN A 1 108 ? 17.438  -2.950  17.510  1.00 0.00 ? 262 GLN A NE2  3  
ATOM   6033  H  H    . GLN A 1 108 ? 16.532  -3.945  13.165  1.00 0.00 ? 262 GLN A H    3  
ATOM   6034  H  HA   . GLN A 1 108 ? 13.944  -3.413  14.579  1.00 0.00 ? 262 GLN A HA   3  
ATOM   6035  H  HB2  . GLN A 1 108 ? 16.632  -2.164  14.872  1.00 0.00 ? 262 GLN A HB2  3  
ATOM   6036  H  HB3  . GLN A 1 108 ? 15.253  -1.061  14.858  1.00 0.00 ? 262 GLN A HB3  3  
ATOM   6037  H  HG2  . GLN A 1 108 ? 14.377  -1.903  16.818  1.00 0.00 ? 262 GLN A HG2  3  
ATOM   6038  H  HG3  . GLN A 1 108 ? 15.050  -3.512  16.553  1.00 0.00 ? 262 GLN A HG3  3  
ATOM   6039  H  HE21 . GLN A 1 108 ? 17.424  -3.808  17.030  1.00 0.00 ? 262 GLN A HE21 3  
ATOM   6040  H  HE22 . GLN A 1 108 ? 18.199  -2.725  18.083  1.00 0.00 ? 262 GLN A HE22 3  
ATOM   6041  N  N    . TRP A 1 109 ? 13.438  -2.765  12.095  1.00 0.00 ? 263 TRP A N    3  
ATOM   6042  C  CA   . TRP A 1 109 ? 13.040  -2.099  10.817  1.00 0.00 ? 263 TRP A CA   3  
ATOM   6043  C  C    . TRP A 1 109 ? 11.717  -1.325  10.977  1.00 0.00 ? 263 TRP A C    3  
ATOM   6044  O  O    . TRP A 1 109 ? 10.778  -1.808  11.581  1.00 0.00 ? 263 TRP A O    3  
ATOM   6045  C  CB   . TRP A 1 109 ? 12.871  -3.257  9.814   1.00 0.00 ? 263 TRP A CB   3  
ATOM   6046  C  CG   . TRP A 1 109 ? 12.244  -2.768  8.537   1.00 0.00 ? 263 TRP A CG   3  
ATOM   6047  C  CD1  . TRP A 1 109 ? 12.798  -1.875  7.687   1.00 0.00 ? 263 TRP A CD1  3  
ATOM   6048  C  CD2  . TRP A 1 109 ? 10.955  -3.131  7.963   1.00 0.00 ? 263 TRP A CD2  3  
ATOM   6049  N  NE1  . TRP A 1 109 ? 11.926  -1.657  6.635   1.00 0.00 ? 263 TRP A NE1  3  
ATOM   6050  C  CE2  . TRP A 1 109 ? 10.775  -2.409  6.760   1.00 0.00 ? 263 TRP A CE2  3  
ATOM   6051  C  CE3  . TRP A 1 109 ? 9.934   -4.005  8.370   1.00 0.00 ? 263 TRP A CE3  3  
ATOM   6052  C  CZ2  . TRP A 1 109 ? 9.621   -2.550  5.986   1.00 0.00 ? 263 TRP A CZ2  3  
ATOM   6053  C  CZ3  . TRP A 1 109 ? 8.771   -4.151  7.594   1.00 0.00 ? 263 TRP A CZ3  3  
ATOM   6054  C  CH2  . TRP A 1 109 ? 8.616   -3.423  6.406   1.00 0.00 ? 263 TRP A CH2  3  
ATOM   6055  H  H    . TRP A 1 109 ? 12.956  -3.568  12.394  1.00 0.00 ? 263 TRP A H    3  
ATOM   6056  H  HA   . TRP A 1 109 ? 13.822  -1.438  10.481  1.00 0.00 ? 263 TRP A HA   3  
ATOM   6057  H  HB2  . TRP A 1 109 ? 13.837  -3.685  9.603   1.00 0.00 ? 263 TRP A HB2  3  
ATOM   6058  H  HB3  . TRP A 1 109 ? 12.238  -4.015  10.252  1.00 0.00 ? 263 TRP A HB3  3  
ATOM   6059  H  HD1  . TRP A 1 109 ? 13.760  -1.411  7.808   1.00 0.00 ? 263 TRP A HD1  3  
ATOM   6060  H  HE1  . TRP A 1 109 ? 12.085  -1.047  5.885   1.00 0.00 ? 263 TRP A HE1  3  
ATOM   6061  H  HE3  . TRP A 1 109 ? 10.048  -4.572  9.281   1.00 0.00 ? 263 TRP A HE3  3  
ATOM   6062  H  HZ2  . TRP A 1 109 ? 9.506   -1.985  5.072   1.00 0.00 ? 263 TRP A HZ2  3  
ATOM   6063  H  HZ3  . TRP A 1 109 ? 7.993   -4.827  7.916   1.00 0.00 ? 263 TRP A HZ3  3  
ATOM   6064  H  HH2  . TRP A 1 109 ? 7.719   -3.539  5.812   1.00 0.00 ? 263 TRP A HH2  3  
ATOM   6065  N  N    . TYR A 1 110 ? 11.623  -0.156  10.376  1.00 0.00 ? 264 TYR A N    3  
ATOM   6066  C  CA   . TYR A 1 110 ? 10.341  0.608   10.425  1.00 0.00 ? 264 TYR A CA   3  
ATOM   6067  C  C    . TYR A 1 110 ? 9.595   0.291   9.129   1.00 0.00 ? 264 TYR A C    3  
ATOM   6068  O  O    . TYR A 1 110 ? 10.221  -0.040  8.138   1.00 0.00 ? 264 TYR A O    3  
ATOM   6069  C  CB   . TYR A 1 110 ? 10.717  2.092   10.505  1.00 0.00 ? 264 TYR A CB   3  
ATOM   6070  C  CG   . TYR A 1 110 ? 10.681  2.527   11.950  1.00 0.00 ? 264 TYR A CG   3  
ATOM   6071  C  CD1  . TYR A 1 110 ? 9.472   2.925   12.530  1.00 0.00 ? 264 TYR A CD1  3  
ATOM   6072  C  CD2  . TYR A 1 110 ? 11.856  2.525   12.710  1.00 0.00 ? 264 TYR A CD2  3  
ATOM   6073  C  CE1  . TYR A 1 110 ? 9.436   3.323   13.871  1.00 0.00 ? 264 TYR A CE1  3  
ATOM   6074  C  CE2  . TYR A 1 110 ? 11.822  2.921   14.051  1.00 0.00 ? 264 TYR A CE2  3  
ATOM   6075  C  CZ   . TYR A 1 110 ? 10.612  3.321   14.633  1.00 0.00 ? 264 TYR A CZ   3  
ATOM   6076  O  OH   . TYR A 1 110 ? 10.578  3.711   15.955  1.00 0.00 ? 264 TYR A OH   3  
ATOM   6077  H  H    . TYR A 1 110 ? 12.379  0.190   9.846   1.00 0.00 ? 264 TYR A H    3  
ATOM   6078  H  HA   . TYR A 1 110 ? 9.753   0.319   11.284  1.00 0.00 ? 264 TYR A HA   3  
ATOM   6079  H  HB2  . TYR A 1 110 ? 11.711  2.237   10.107  1.00 0.00 ? 264 TYR A HB2  3  
ATOM   6080  H  HB3  . TYR A 1 110 ? 10.010  2.676   9.936   1.00 0.00 ? 264 TYR A HB3  3  
ATOM   6081  H  HD1  . TYR A 1 110 ? 8.565   2.925   11.943  1.00 0.00 ? 264 TYR A HD1  3  
ATOM   6082  H  HD2  . TYR A 1 110 ? 12.789  2.217   12.261  1.00 0.00 ? 264 TYR A HD2  3  
ATOM   6083  H  HE1  . TYR A 1 110 ? 8.503   3.630   14.318  1.00 0.00 ? 264 TYR A HE1  3  
ATOM   6084  H  HE2  . TYR A 1 110 ? 12.728  2.915   14.638  1.00 0.00 ? 264 TYR A HE2  3  
ATOM   6085  H  HH   . TYR A 1 110 ? 10.687  2.928   16.499  1.00 0.00 ? 264 TYR A HH   3  
ATOM   6086  N  N    . CYS A 1 111 ? 8.283   0.341   9.114   1.00 0.00 ? 265 CYS A N    3  
ATOM   6087  C  CA   . CYS A 1 111 ? 7.565   -0.014  7.858   1.00 0.00 ? 265 CYS A CA   3  
ATOM   6088  C  C    . CYS A 1 111 ? 6.450   1.011   7.534   1.00 0.00 ? 265 CYS A C    3  
ATOM   6089  O  O    . CYS A 1 111 ? 6.595   2.185   7.818   1.00 0.00 ? 265 CYS A O    3  
ATOM   6090  C  CB   . CYS A 1 111 ? 7.051   -1.446  8.123   1.00 0.00 ? 265 CYS A CB   3  
ATOM   6091  S  SG   . CYS A 1 111 ? 5.647   -1.441  9.269   1.00 0.00 ? 265 CYS A SG   3  
ATOM   6092  H  H    . CYS A 1 111 ? 7.778   0.583   9.921   1.00 0.00 ? 265 CYS A H    3  
ATOM   6093  H  HA   . CYS A 1 111 ? 8.269   -0.040  7.041   1.00 0.00 ? 265 CYS A HA   3  
ATOM   6094  H  HB2  . CYS A 1 111 ? 6.741   -1.889  7.189   1.00 0.00 ? 265 CYS A HB2  3  
ATOM   6095  H  HB3  . CYS A 1 111 ? 7.852   -2.036  8.544   1.00 0.00 ? 265 CYS A HB3  3  
ATOM   6096  N  N    . TYR A 1 112 ? 5.354   0.593   6.924   1.00 0.00 ? 266 TYR A N    3  
ATOM   6097  C  CA   . TYR A 1 112 ? 4.269   1.575   6.571   1.00 0.00 ? 266 TYR A CA   3  
ATOM   6098  C  C    . TYR A 1 112 ? 3.236   1.676   7.711   1.00 0.00 ? 266 TYR A C    3  
ATOM   6099  O  O    . TYR A 1 112 ? 2.727   2.745   7.990   1.00 0.00 ? 266 TYR A O    3  
ATOM   6100  C  CB   . TYR A 1 112 ? 3.613   1.042   5.280   1.00 0.00 ? 266 TYR A CB   3  
ATOM   6101  C  CG   . TYR A 1 112 ? 4.673   0.798   4.221   1.00 0.00 ? 266 TYR A CG   3  
ATOM   6102  C  CD1  . TYR A 1 112 ? 5.096   1.846   3.396   1.00 0.00 ? 266 TYR A CD1  3  
ATOM   6103  C  CD2  . TYR A 1 112 ? 5.237   -0.477  4.073   1.00 0.00 ? 266 TYR A CD2  3  
ATOM   6104  C  CE1  . TYR A 1 112 ? 6.080   1.621   2.424   1.00 0.00 ? 266 TYR A CE1  3  
ATOM   6105  C  CE2  . TYR A 1 112 ? 6.220   -0.703  3.103   1.00 0.00 ? 266 TYR A CE2  3  
ATOM   6106  C  CZ   . TYR A 1 112 ? 6.642   0.346   2.279   1.00 0.00 ? 266 TYR A CZ   3  
ATOM   6107  O  OH   . TYR A 1 112 ? 7.611   0.126   1.322   1.00 0.00 ? 266 TYR A OH   3  
ATOM   6108  H  H    . TYR A 1 112 ? 5.248   -0.353  6.684   1.00 0.00 ? 266 TYR A H    3  
ATOM   6109  H  HA   . TYR A 1 112 ? 4.701   2.547   6.383   1.00 0.00 ? 266 TYR A HA   3  
ATOM   6110  H  HB2  . TYR A 1 112 ? 3.104   0.114   5.494   1.00 0.00 ? 266 TYR A HB2  3  
ATOM   6111  H  HB3  . TYR A 1 112 ? 2.902   1.766   4.913   1.00 0.00 ? 266 TYR A HB3  3  
ATOM   6112  H  HD1  . TYR A 1 112 ? 4.664   2.828   3.509   1.00 0.00 ? 266 TYR A HD1  3  
ATOM   6113  H  HD2  . TYR A 1 112 ? 4.912   -1.287  4.709   1.00 0.00 ? 266 TYR A HD2  3  
ATOM   6114  H  HE1  . TYR A 1 112 ? 6.405   2.430   1.788   1.00 0.00 ? 266 TYR A HE1  3  
ATOM   6115  H  HE2  . TYR A 1 112 ? 6.655   -1.687  2.994   1.00 0.00 ? 266 TYR A HE2  3  
ATOM   6116  H  HH   . TYR A 1 112 ? 7.195   -0.309  0.573   1.00 0.00 ? 266 TYR A HH   3  
ATOM   6117  N  N    . ILE A 1 113 ? 2.926   0.580   8.380   1.00 0.00 ? 267 ILE A N    3  
ATOM   6118  C  CA   . ILE A 1 113 ? 1.924   0.652   9.509   1.00 0.00 ? 267 ILE A CA   3  
ATOM   6119  C  C    . ILE A 1 113 ? 2.505   1.488   10.664  1.00 0.00 ? 267 ILE A C    3  
ATOM   6120  O  O    . ILE A 1 113 ? 1.813   2.287   11.268  1.00 0.00 ? 267 ILE A O    3  
ATOM   6121  C  CB   . ILE A 1 113 ? 1.665   -0.793  9.998   1.00 0.00 ? 267 ILE A CB   3  
ATOM   6122  C  CG1  . ILE A 1 113 ? 1.190   -1.698  8.842   1.00 0.00 ? 267 ILE A CG1  3  
ATOM   6123  C  CG2  . ILE A 1 113 ? 0.582   -0.764  11.078  1.00 0.00 ? 267 ILE A CG2  3  
ATOM   6124  C  CD1  . ILE A 1 113 ? -0.071  -1.124  8.186   1.00 0.00 ? 267 ILE A CD1  3  
ATOM   6125  H  H    . ILE A 1 113 ? 3.352   -0.270  8.146   1.00 0.00 ? 267 ILE A H    3  
ATOM   6126  H  HA   . ILE A 1 113 ? 1.008   1.094   9.162   1.00 0.00 ? 267 ILE A HA   3  
ATOM   6127  H  HB   . ILE A 1 113 ? 2.580   -1.196  10.426  1.00 0.00 ? 267 ILE A HB   3  
ATOM   6128  H  HG12 . ILE A 1 113 ? 1.967   -1.786  8.102   1.00 0.00 ? 267 ILE A HG12 3  
ATOM   6129  H  HG13 . ILE A 1 113 ? 0.966   -2.679  9.234   1.00 0.00 ? 267 ILE A HG13 3  
ATOM   6130  H  HG21 . ILE A 1 113 ? -0.335  -0.381  10.655  1.00 0.00 ? 267 ILE A HG21 3  
ATOM   6131  H  HG22 . ILE A 1 113 ? 0.899   -0.126  11.889  1.00 0.00 ? 267 ILE A HG22 3  
ATOM   6132  H  HG23 . ILE A 1 113 ? 0.417   -1.765  11.449  1.00 0.00 ? 267 ILE A HG23 3  
ATOM   6133  H  HD11 . ILE A 1 113 ? 0.130   -0.917  7.146   1.00 0.00 ? 267 ILE A HD11 3  
ATOM   6134  H  HD12 . ILE A 1 113 ? -0.362  -0.213  8.686   1.00 0.00 ? 267 ILE A HD12 3  
ATOM   6135  H  HD13 . ILE A 1 113 ? -0.873  -1.843  8.258   1.00 0.00 ? 267 ILE A HD13 3  
ATOM   6136  N  N    . CYS A 1 114 ? 3.770   1.308   10.975  1.00 0.00 ? 268 CYS A N    3  
ATOM   6137  C  CA   . CYS A 1 114 ? 4.405   2.089   12.097  1.00 0.00 ? 268 CYS A CA   3  
ATOM   6138  C  C    . CYS A 1 114 ? 4.228   3.595   11.857  1.00 0.00 ? 268 CYS A C    3  
ATOM   6139  O  O    . CYS A 1 114 ? 3.826   4.324   12.743  1.00 0.00 ? 268 CYS A O    3  
ATOM   6140  C  CB   . CYS A 1 114 ? 5.899   1.727   12.072  1.00 0.00 ? 268 CYS A CB   3  
ATOM   6141  S  SG   . CYS A 1 114 ? 6.144   0.106   12.840  1.00 0.00 ? 268 CYS A SG   3  
ATOM   6142  H  H    . CYS A 1 114 ? 4.300   0.660   10.473  1.00 0.00 ? 268 CYS A H    3  
ATOM   6143  H  HA   . CYS A 1 114 ? 3.974   1.806   13.044  1.00 0.00 ? 268 CYS A HA   3  
ATOM   6144  H  HB2  . CYS A 1 114 ? 6.245   1.696   11.049  1.00 0.00 ? 268 CYS A HB2  3  
ATOM   6145  H  HB3  . CYS A 1 114 ? 6.457   2.472   12.617  1.00 0.00 ? 268 CYS A HB3  3  
ATOM   6146  N  N    . HIS A 1 115 ? 4.515   4.064   10.659  1.00 0.00 ? 269 HIS A N    3  
ATOM   6147  C  CA   . HIS A 1 115 ? 4.351   5.527   10.359  1.00 0.00 ? 269 HIS A CA   3  
ATOM   6148  C  C    . HIS A 1 115 ? 4.644   5.821   8.877   1.00 0.00 ? 269 HIS A C    3  
ATOM   6149  O  O    . HIS A 1 115 ? 5.308   5.046   8.219   1.00 0.00 ? 269 HIS A O    3  
ATOM   6150  C  CB   . HIS A 1 115 ? 5.339   6.275   11.269  1.00 0.00 ? 269 HIS A CB   3  
ATOM   6151  C  CG   . HIS A 1 115 ? 6.753   5.765   11.100  1.00 0.00 ? 269 HIS A CG   3  
ATOM   6152  N  ND1  . HIS A 1 115 ? 7.806   6.317   11.816  1.00 0.00 ? 269 HIS A ND1  3  
ATOM   6153  C  CD2  . HIS A 1 115 ? 7.314   4.774   10.323  1.00 0.00 ? 269 HIS A CD2  3  
ATOM   6154  C  CE1  . HIS A 1 115 ? 8.928   5.667   11.461  1.00 0.00 ? 269 HIS A CE1  3  
ATOM   6155  N  NE2  . HIS A 1 115 ? 8.686   4.720   10.554  1.00 0.00 ? 269 HIS A NE2  3  
ATOM   6156  H  H    . HIS A 1 115 ? 4.824   3.452   9.953   1.00 0.00 ? 269 HIS A H    3  
ATOM   6157  H  HA   . HIS A 1 115 ? 3.343   5.834   10.597  1.00 0.00 ? 269 HIS A HA   3  
ATOM   6158  H  HB2  . HIS A 1 115 ? 5.316   7.326   11.024  1.00 0.00 ? 269 HIS A HB2  3  
ATOM   6159  H  HB3  . HIS A 1 115 ? 5.038   6.149   12.298  1.00 0.00 ? 269 HIS A HB3  3  
ATOM   6160  H  HD1  . HIS A 1 115 ? 7.743   7.049   12.464  1.00 0.00 ? 269 HIS A HD1  3  
ATOM   6161  H  HD2  . HIS A 1 115 ? 6.782   4.131   9.643   1.00 0.00 ? 269 HIS A HD2  3  
ATOM   6162  H  HE1  . HIS A 1 115 ? 9.904   5.882   11.867  1.00 0.00 ? 269 HIS A HE1  3  
ATOM   6163  N  N    . PRO A 1 116 ? 4.132   6.932   8.392   1.00 0.00 ? 270 PRO A N    3  
ATOM   6164  C  CA   . PRO A 1 116 ? 4.352   7.299   6.970   1.00 0.00 ? 270 PRO A CA   3  
ATOM   6165  C  C    . PRO A 1 116 ? 5.820   7.685   6.737   1.00 0.00 ? 270 PRO A C    3  
ATOM   6166  O  O    . PRO A 1 116 ? 6.134   8.844   6.541   1.00 0.00 ? 270 PRO A O    3  
ATOM   6167  C  CB   . PRO A 1 116 ? 3.425   8.494   6.757   1.00 0.00 ? 270 PRO A CB   3  
ATOM   6168  C  CG   . PRO A 1 116 ? 3.237   9.082   8.117   1.00 0.00 ? 270 PRO A CG   3  
ATOM   6169  C  CD   . PRO A 1 116 ? 3.321   7.941   9.096   1.00 0.00 ? 270 PRO A CD   3  
ATOM   6170  H  HA   . PRO A 1 116 ? 4.062   6.488   6.321   1.00 0.00 ? 270 PRO A HA   3  
ATOM   6171  H  HB2  . PRO A 1 116 ? 3.889   9.213   6.094   1.00 0.00 ? 270 PRO A HB2  3  
ATOM   6172  H  HB3  . PRO A 1 116 ? 2.476   8.170   6.360   1.00 0.00 ? 270 PRO A HB3  3  
ATOM   6173  H  HG2  . PRO A 1 116 ? 4.017   9.804   8.319   1.00 0.00 ? 270 PRO A HG2  3  
ATOM   6174  H  HG3  . PRO A 1 116 ? 2.268   9.552   8.188   1.00 0.00 ? 270 PRO A HG3  3  
ATOM   6175  H  HD2  . PRO A 1 116 ? 3.810   8.259   10.007  1.00 0.00 ? 270 PRO A HD2  3  
ATOM   6176  H  HD3  . PRO A 1 116 ? 2.339   7.548   9.306   1.00 0.00 ? 270 PRO A HD3  3  
ATOM   6177  N  N    . GLU A 1 117 ? 6.725   6.724   6.756   1.00 0.00 ? 271 GLU A N    3  
ATOM   6178  C  CA   . GLU A 1 117 ? 8.166   7.060   6.535   1.00 0.00 ? 271 GLU A CA   3  
ATOM   6179  C  C    . GLU A 1 117 ? 8.614   6.669   5.112   1.00 0.00 ? 271 GLU A C    3  
ATOM   6180  O  O    . GLU A 1 117 ? 9.056   7.528   4.374   1.00 0.00 ? 271 GLU A O    3  
ATOM   6181  C  CB   . GLU A 1 117 ? 8.956   6.290   7.605   1.00 0.00 ? 271 GLU A CB   3  
ATOM   6182  C  CG   . GLU A 1 117 ? 9.494   7.264   8.658   1.00 0.00 ? 271 GLU A CG   3  
ATOM   6183  C  CD   . GLU A 1 117 ? 10.510  8.206   8.010   1.00 0.00 ? 271 GLU A CD   3  
ATOM   6184  O  OE1  . GLU A 1 117 ? 11.427  7.711   7.377   1.00 0.00 ? 271 GLU A OE1  3  
ATOM   6185  O  OE2  . GLU A 1 117 ? 10.352  9.408   8.158   1.00 0.00 ? 271 GLU A OE2  3  
ATOM   6186  H  H    . GLU A 1 117 ? 6.456   5.796   6.917   1.00 0.00 ? 271 GLU A H    3  
ATOM   6187  H  HA   . GLU A 1 117 ? 8.312   8.120   6.674   1.00 0.00 ? 271 GLU A HA   3  
ATOM   6188  H  HB2  . GLU A 1 117 ? 8.306   5.567   8.082   1.00 0.00 ? 271 GLU A HB2  3  
ATOM   6189  H  HB3  . GLU A 1 117 ? 9.783   5.775   7.139   1.00 0.00 ? 271 GLU A HB3  3  
ATOM   6190  H  HG2  . GLU A 1 117 ? 8.676   7.840   9.066   1.00 0.00 ? 271 GLU A HG2  3  
ATOM   6191  H  HG3  . GLU A 1 117 ? 9.975   6.709   9.449   1.00 0.00 ? 271 GLU A HG3  3  
ATOM   6192  N  N    . PRO A 1 118 ? 8.499   5.400   4.743   1.00 0.00 ? 272 PRO A N    3  
ATOM   6193  C  CA   . PRO A 1 118 ? 8.918   4.985   3.385   1.00 0.00 ? 272 PRO A CA   3  
ATOM   6194  C  C    . PRO A 1 118 ? 7.777   5.071   2.342   1.00 0.00 ? 272 PRO A C    3  
ATOM   6195  O  O    . PRO A 1 118 ? 7.787   4.330   1.375   1.00 0.00 ? 272 PRO A O    3  
ATOM   6196  C  CB   . PRO A 1 118 ? 9.322   3.529   3.578   1.00 0.00 ? 272 PRO A CB   3  
ATOM   6197  C  CG   . PRO A 1 118 ? 8.547   3.044   4.770   1.00 0.00 ? 272 PRO A CG   3  
ATOM   6198  C  CD   . PRO A 1 118 ? 8.011   4.247   5.514   1.00 0.00 ? 272 PRO A CD   3  
ATOM   6199  H  HA   . PRO A 1 118 ? 9.767   5.558   3.065   1.00 0.00 ? 272 PRO A HA   3  
ATOM   6200  H  HB2  . PRO A 1 118 ? 9.065   2.951   2.701   1.00 0.00 ? 272 PRO A HB2  3  
ATOM   6201  H  HB3  . PRO A 1 118 ? 10.381  3.458   3.776   1.00 0.00 ? 272 PRO A HB3  3  
ATOM   6202  H  HG2  . PRO A 1 118 ? 7.726   2.422   4.440   1.00 0.00 ? 272 PRO A HG2  3  
ATOM   6203  H  HG3  . PRO A 1 118 ? 9.195   2.478   5.420   1.00 0.00 ? 272 PRO A HG3  3  
ATOM   6204  H  HD2  . PRO A 1 118 ? 6.932   4.223   5.531   1.00 0.00 ? 272 PRO A HD2  3  
ATOM   6205  H  HD3  . PRO A 1 118 ? 8.404   4.262   6.511   1.00 0.00 ? 272 PRO A HD3  3  
ATOM   6206  N  N    . LEU A 1 119 ? 6.810   5.956   2.497   1.00 0.00 ? 273 LEU A N    3  
ATOM   6207  C  CA   . LEU A 1 119 ? 5.715   6.045   1.473   1.00 0.00 ? 273 LEU A CA   3  
ATOM   6208  C  C    . LEU A 1 119 ? 5.066   7.444   1.462   1.00 0.00 ? 273 LEU A C    3  
ATOM   6209  O  O    . LEU A 1 119 ? 3.876   7.568   1.231   1.00 0.00 ? 273 LEU A O    3  
ATOM   6210  C  CB   . LEU A 1 119 ? 4.696   4.946   1.844   1.00 0.00 ? 273 LEU A CB   3  
ATOM   6211  C  CG   . LEU A 1 119 ? 3.902   5.308   3.113   1.00 0.00 ? 273 LEU A CG   3  
ATOM   6212  C  CD1  . LEU A 1 119 ? 2.707   4.361   3.250   1.00 0.00 ? 273 LEU A CD1  3  
ATOM   6213  C  CD2  . LEU A 1 119 ? 4.805   5.172   4.340   1.00 0.00 ? 273 LEU A CD2  3  
ATOM   6214  H  H    . LEU A 1 119 ? 6.805   6.558   3.265   1.00 0.00 ? 273 LEU A H    3  
ATOM   6215  H  HA   . LEU A 1 119 ? 6.122   5.833   0.496   1.00 0.00 ? 273 LEU A HA   3  
ATOM   6216  H  HB2  . LEU A 1 119 ? 4.005   4.815   1.024   1.00 0.00 ? 273 LEU A HB2  3  
ATOM   6217  H  HB3  . LEU A 1 119 ? 5.222   4.019   2.010   1.00 0.00 ? 273 LEU A HB3  3  
ATOM   6218  H  HG   . LEU A 1 119 ? 3.542   6.322   3.041   1.00 0.00 ? 273 LEU A HG   3  
ATOM   6219  H  HD11 . LEU A 1 119 ? 2.924   3.429   2.748   1.00 0.00 ? 273 LEU A HD11 3  
ATOM   6220  H  HD12 . LEU A 1 119 ? 1.835   4.813   2.801   1.00 0.00 ? 273 LEU A HD12 3  
ATOM   6221  H  HD13 . LEU A 1 119 ? 2.516   4.169   4.295   1.00 0.00 ? 273 LEU A HD13 3  
ATOM   6222  H  HD21 . LEU A 1 119 ? 5.630   4.517   4.105   1.00 0.00 ? 273 LEU A HD21 3  
ATOM   6223  H  HD22 . LEU A 1 119 ? 4.240   4.759   5.163   1.00 0.00 ? 273 LEU A HD22 3  
ATOM   6224  H  HD23 . LEU A 1 119 ? 5.185   6.145   4.615   1.00 0.00 ? 273 LEU A HD23 3  
ATOM   6225  N  N    . LEU A 1 120 ? 5.828   8.499   1.688   1.00 0.00 ? 274 LEU A N    3  
ATOM   6226  C  CA   . LEU A 1 120 ? 5.205   9.872   1.665   1.00 0.00 ? 274 LEU A CA   3  
ATOM   6227  C  C    . LEU A 1 120 ? 4.652   10.141  0.264   1.00 0.00 ? 274 LEU A C    3  
ATOM   6228  O  O    . LEU A 1 120 ? 3.484   10.437  0.103   1.00 0.00 ? 274 LEU A O    3  
ATOM   6229  C  CB   . LEU A 1 120 ? 6.307   10.901  2.018   1.00 0.00 ? 274 LEU A CB   3  
ATOM   6230  C  CG   . LEU A 1 120 ? 5.952   11.630  3.322   1.00 0.00 ? 274 LEU A CG   3  
ATOM   6231  C  CD1  . LEU A 1 120 ? 4.616   12.366  3.163   1.00 0.00 ? 274 LEU A CD1  3  
ATOM   6232  C  CD2  . LEU A 1 120 ? 5.845   10.616  4.466   1.00 0.00 ? 274 LEU A CD2  3  
ATOM   6233  H  H    . LEU A 1 120 ? 6.789   8.384   1.857   1.00 0.00 ? 274 LEU A H    3  
ATOM   6234  H  HA   . LEU A 1 120 ? 4.409   9.925   2.386   1.00 0.00 ? 274 LEU A HA   3  
ATOM   6235  H  HB2  . LEU A 1 120 ? 7.254   10.397  2.139   1.00 0.00 ? 274 LEU A HB2  3  
ATOM   6236  H  HB3  . LEU A 1 120 ? 6.391   11.625  1.220   1.00 0.00 ? 274 LEU A HB3  3  
ATOM   6237  H  HG   . LEU A 1 120 ? 6.727   12.348  3.550   1.00 0.00 ? 274 LEU A HG   3  
ATOM   6238  H  HD11 . LEU A 1 120 ? 3.803   11.682  3.357   1.00 0.00 ? 274 LEU A HD11 3  
ATOM   6239  H  HD12 . LEU A 1 120 ? 4.531   12.748  2.154   1.00 0.00 ? 274 LEU A HD12 3  
ATOM   6240  H  HD13 . LEU A 1 120 ? 4.571   13.187  3.862   1.00 0.00 ? 274 LEU A HD13 3  
ATOM   6241  H  HD21 . LEU A 1 120 ? 6.474   9.763   4.252   1.00 0.00 ? 274 LEU A HD21 3  
ATOM   6242  H  HD22 . LEU A 1 120 ? 4.819   10.291  4.564   1.00 0.00 ? 274 LEU A HD22 3  
ATOM   6243  H  HD23 . LEU A 1 120 ? 6.165   11.077  5.389   1.00 0.00 ? 274 LEU A HD23 3  
ATOM   6244  N  N    . ASP A 1 121 ? 5.473   10.012  -0.758  1.00 0.00 ? 275 ASP A N    3  
ATOM   6245  C  CA   . ASP A 1 121 ? 4.963   10.240  -2.163  1.00 0.00 ? 275 ASP A CA   3  
ATOM   6246  C  C    . ASP A 1 121 ? 3.727   9.357   -2.425  1.00 0.00 ? 275 ASP A C    3  
ATOM   6247  O  O    . ASP A 1 121 ? 2.808   9.761   -3.114  1.00 0.00 ? 275 ASP A O    3  
ATOM   6248  C  CB   . ASP A 1 121 ? 6.106   9.860   -3.122  1.00 0.00 ? 275 ASP A CB   3  
ATOM   6249  C  CG   . ASP A 1 121 ? 6.517   8.403   -2.894  1.00 0.00 ? 275 ASP A CG   3  
ATOM   6250  O  OD1  . ASP A 1 121 ? 6.929   8.091   -1.789  1.00 0.00 ? 275 ASP A OD1  3  
ATOM   6251  O  OD2  . ASP A 1 121 ? 6.410   7.625   -3.828  1.00 0.00 ? 275 ASP A OD2  3  
ATOM   6252  H  H    . ASP A 1 121 ? 6.410   9.749   -0.599  1.00 0.00 ? 275 ASP A H    3  
ATOM   6253  H  HA   . ASP A 1 121 ? 4.706   11.278  -2.295  1.00 0.00 ? 275 ASP A HA   3  
ATOM   6254  H  HB2  . ASP A 1 121 ? 5.773   9.984   -4.143  1.00 0.00 ? 275 ASP A HB2  3  
ATOM   6255  H  HB3  . ASP A 1 121 ? 6.955   10.503  -2.942  1.00 0.00 ? 275 ASP A HB3  3  
ATOM   6256  N  N    . LEU A 1 122 ? 3.692   8.163   -1.867  1.00 0.00 ? 276 LEU A N    3  
ATOM   6257  C  CA   . LEU A 1 122 ? 2.496   7.272   -2.077  1.00 0.00 ? 276 LEU A CA   3  
ATOM   6258  C  C    . LEU A 1 122 ? 1.282   7.875   -1.357  1.00 0.00 ? 276 LEU A C    3  
ATOM   6259  O  O    . LEU A 1 122 ? 0.189   7.899   -1.893  1.00 0.00 ? 276 LEU A O    3  
ATOM   6260  C  CB   . LEU A 1 122 ? 2.860   5.906   -1.465  1.00 0.00 ? 276 LEU A CB   3  
ATOM   6261  C  CG   . LEU A 1 122 ? 2.193   4.776   -2.249  1.00 0.00 ? 276 LEU A CG   3  
ATOM   6262  C  CD1  . LEU A 1 122 ? 2.821   4.673   -3.643  1.00 0.00 ? 276 LEU A CD1  3  
ATOM   6263  C  CD2  . LEU A 1 122 ? 2.398   3.454   -1.497  1.00 0.00 ? 276 LEU A CD2  3  
ATOM   6264  H  H    . LEU A 1 122 ? 4.442   7.862   -1.303  1.00 0.00 ? 276 LEU A H    3  
ATOM   6265  H  HA   . LEU A 1 122 ? 2.287   7.170   -3.126  1.00 0.00 ? 276 LEU A HA   3  
ATOM   6266  H  HB2  . LEU A 1 122 ? 3.932   5.775   -1.495  1.00 0.00 ? 276 LEU A HB2  3  
ATOM   6267  H  HB3  . LEU A 1 122 ? 2.525   5.874   -0.438  1.00 0.00 ? 276 LEU A HB3  3  
ATOM   6268  H  HG   . LEU A 1 122 ? 1.136   4.979   -2.344  1.00 0.00 ? 276 LEU A HG   3  
ATOM   6269  H  HD11 . LEU A 1 122 ? 3.266   5.620   -3.909  1.00 0.00 ? 276 LEU A HD11 3  
ATOM   6270  H  HD12 . LEU A 1 122 ? 2.057   4.419   -4.364  1.00 0.00 ? 276 LEU A HD12 3  
ATOM   6271  H  HD13 . LEU A 1 122 ? 3.583   3.906   -3.641  1.00 0.00 ? 276 LEU A HD13 3  
ATOM   6272  H  HD21 . LEU A 1 122 ? 2.606   3.656   -0.456  1.00 0.00 ? 276 LEU A HD21 3  
ATOM   6273  H  HD22 . LEU A 1 122 ? 3.228   2.915   -1.931  1.00 0.00 ? 276 LEU A HD22 3  
ATOM   6274  H  HD23 . LEU A 1 122 ? 1.505   2.856   -1.574  1.00 0.00 ? 276 LEU A HD23 3  
ATOM   6275  N  N    . VAL A 1 123 ? 1.467   8.379   -0.155  1.00 0.00 ? 277 VAL A N    3  
ATOM   6276  C  CA   . VAL A 1 123 ? 0.309   9.001   0.578   1.00 0.00 ? 277 VAL A CA   3  
ATOM   6277  C  C    . VAL A 1 123 ? -0.042  10.343  -0.083  1.00 0.00 ? 277 VAL A C    3  
ATOM   6278  O  O    . VAL A 1 123 ? -1.202  10.663  -0.267  1.00 0.00 ? 277 VAL A O    3  
ATOM   6279  C  CB   . VAL A 1 123 ? 0.769   9.206   2.034   1.00 0.00 ? 277 VAL A CB   3  
ATOM   6280  C  CG1  . VAL A 1 123 ? -0.330  9.913   2.838   1.00 0.00 ? 277 VAL A CG1  3  
ATOM   6281  C  CG2  . VAL A 1 123 ? 1.075   7.840   2.666   1.00 0.00 ? 277 VAL A CG2  3  
ATOM   6282  H  H    . VAL A 1 123 ? 2.365   8.362   0.251   1.00 0.00 ? 277 VAL A H    3  
ATOM   6283  H  HA   . VAL A 1 123 ? -0.542  8.344   0.549   1.00 0.00 ? 277 VAL A HA   3  
ATOM   6284  H  HB   . VAL A 1 123 ? 1.663   9.814   2.043   1.00 0.00 ? 277 VAL A HB   3  
ATOM   6285  H  HG11 . VAL A 1 123 ? -0.387  9.484   3.829   1.00 0.00 ? 277 VAL A HG11 3  
ATOM   6286  H  HG12 . VAL A 1 123 ? -1.279  9.788   2.337   1.00 0.00 ? 277 VAL A HG12 3  
ATOM   6287  H  HG13 . VAL A 1 123 ? -0.100  10.965  2.915   1.00 0.00 ? 277 VAL A HG13 3  
ATOM   6288  H  HG21 . VAL A 1 123 ? 1.995   7.902   3.227   1.00 0.00 ? 277 VAL A HG21 3  
ATOM   6289  H  HG22 . VAL A 1 123 ? 1.178   7.094   1.889   1.00 0.00 ? 277 VAL A HG22 3  
ATOM   6290  H  HG23 . VAL A 1 123 ? 0.268   7.558   3.328   1.00 0.00 ? 277 VAL A HG23 3  
ATOM   6291  N  N    . THR A 1 124 ? 0.952   11.124  -0.457  1.00 0.00 ? 278 THR A N    3  
ATOM   6292  C  CA   . THR A 1 124 ? 0.649   12.438  -1.128  1.00 0.00 ? 278 THR A CA   3  
ATOM   6293  C  C    . THR A 1 124 ? -0.096  12.181  -2.449  1.00 0.00 ? 278 THR A C    3  
ATOM   6294  O  O    . THR A 1 124 ? -0.978  12.935  -2.818  1.00 0.00 ? 278 THR A O    3  
ATOM   6295  C  CB   . THR A 1 124 ? 1.999   13.135  -1.399  1.00 0.00 ? 278 THR A CB   3  
ATOM   6296  O  OG1  . THR A 1 124 ? 2.988   12.670  -0.473  1.00 0.00 ? 278 THR A OG1  3  
ATOM   6297  C  CG2  . THR A 1 124 ? 1.831   14.653  -1.264  1.00 0.00 ? 278 THR A CG2  3  
ATOM   6298  H  H    . THR A 1 124 ? 1.883   10.839  -0.312  1.00 0.00 ? 278 THR A H    3  
ATOM   6299  H  HA   . THR A 1 124 ? 0.044   13.052  -0.478  1.00 0.00 ? 278 THR A HA   3  
ATOM   6300  H  HB   . THR A 1 124 ? 2.320   12.905  -2.404  1.00 0.00 ? 278 THR A HB   3  
ATOM   6301  H  HG1  . THR A 1 124 ? 2.713   12.892  0.425   1.00 0.00 ? 278 THR A HG1  3  
ATOM   6302  H  HG21 . THR A 1 124 ? 2.171   14.966  -0.287  1.00 0.00 ? 278 THR A HG21 3  
ATOM   6303  H  HG22 . THR A 1 124 ? 0.789   14.914  -1.384  1.00 0.00 ? 278 THR A HG22 3  
ATOM   6304  H  HG23 . THR A 1 124 ? 2.416   15.149  -2.024  1.00 0.00 ? 278 THR A HG23 3  
ATOM   6305  N  N    . ALA A 1 125 ? 0.237   11.118  -3.166  1.00 0.00 ? 279 ALA A N    3  
ATOM   6306  C  CA   . ALA A 1 125 ? -0.490  10.840  -4.458  1.00 0.00 ? 279 ALA A CA   3  
ATOM   6307  C  C    . ALA A 1 125 ? -1.966  10.488  -4.187  1.00 0.00 ? 279 ALA A C    3  
ATOM   6308  O  O    . ALA A 1 125 ? -2.823  10.756  -5.008  1.00 0.00 ? 279 ALA A O    3  
ATOM   6309  C  CB   . ALA A 1 125 ? 0.223   9.649   -5.120  1.00 0.00 ? 279 ALA A CB   3  
ATOM   6310  H  H    . ALA A 1 125 ? 0.950   10.507  -2.852  1.00 0.00 ? 279 ALA A H    3  
ATOM   6311  H  HA   . ALA A 1 125 ? -0.432  11.699  -5.102  1.00 0.00 ? 279 ALA A HA   3  
ATOM   6312  H  HB1  . ALA A 1 125 ? 0.308   8.839   -4.410  1.00 0.00 ? 279 ALA A HB1  3  
ATOM   6313  H  HB2  . ALA A 1 125 ? 1.209   9.952   -5.439  1.00 0.00 ? 279 ALA A HB2  3  
ATOM   6314  H  HB3  . ALA A 1 125 ? -0.346  9.319   -5.977  1.00 0.00 ? 279 ALA A HB3  3  
ATOM   6315  N  N    . CYS A 1 126 ? -2.279  9.895   -3.048  1.00 0.00 ? 280 CYS A N    3  
ATOM   6316  C  CA   . CYS A 1 126 ? -3.717  9.542   -2.758  1.00 0.00 ? 280 CYS A CA   3  
ATOM   6317  C  C    . CYS A 1 126 ? -4.577  10.815  -2.775  1.00 0.00 ? 280 CYS A C    3  
ATOM   6318  O  O    . CYS A 1 126 ? -5.609  10.858  -3.417  1.00 0.00 ? 280 CYS A O    3  
ATOM   6319  C  CB   . CYS A 1 126 ? -3.739  8.899   -1.355  1.00 0.00 ? 280 CYS A CB   3  
ATOM   6320  S  SG   . CYS A 1 126 ? -5.435  8.440   -0.900  1.00 0.00 ? 280 CYS A SG   3  
ATOM   6321  H  H    . CYS A 1 126 ? -1.577  9.686   -2.393  1.00 0.00 ? 280 CYS A H    3  
ATOM   6322  H  HA   . CYS A 1 126 ? -4.081  8.841   -3.492  1.00 0.00 ? 280 CYS A HA   3  
ATOM   6323  H  HB2  . CYS A 1 126 ? -3.120  8.015   -1.357  1.00 0.00 ? 280 CYS A HB2  3  
ATOM   6324  H  HB3  . CYS A 1 126 ? -3.353  9.604   -0.634  1.00 0.00 ? 280 CYS A HB3  3  
ATOM   6325  H  HG   . CYS A 1 126 ? -5.414  7.554   -0.533  1.00 0.00 ? 280 CYS A HG   3  
ATOM   6326  N  N    . ASN A 1 127 ? -4.164  11.850  -2.074  1.00 0.00 ? 281 ASN A N    3  
ATOM   6327  C  CA   . ASN A 1 127 ? -4.986  13.112  -2.067  1.00 0.00 ? 281 ASN A CA   3  
ATOM   6328  C  C    . ASN A 1 127 ? -5.082  13.688  -3.484  1.00 0.00 ? 281 ASN A C    3  
ATOM   6329  O  O    . ASN A 1 127 ? -6.130  14.150  -3.895  1.00 0.00 ? 281 ASN A O    3  
ATOM   6330  C  CB   . ASN A 1 127 ? -4.276  14.105  -1.134  1.00 0.00 ? 281 ASN A CB   3  
ATOM   6331  C  CG   . ASN A 1 127 ? -4.735  13.867  0.311   1.00 0.00 ? 281 ASN A CG   3  
ATOM   6332  O  OD1  . ASN A 1 127 ? -5.918  13.870  0.587   1.00 0.00 ? 281 ASN A OD1  3  
ATOM   6333  N  ND2  . ASN A 1 127 ? -3.847  13.659  1.254   1.00 0.00 ? 281 ASN A ND2  3  
ATOM   6334  H  H    . ASN A 1 127 ? -3.320  11.792  -1.559  1.00 0.00 ? 281 ASN A H    3  
ATOM   6335  H  HA   . ASN A 1 127 ? -5.973  12.901  -1.695  1.00 0.00 ? 281 ASN A HA   3  
ATOM   6336  H  HB2  . ASN A 1 127 ? -3.207  13.960  -1.202  1.00 0.00 ? 281 ASN A HB2  3  
ATOM   6337  H  HB3  . ASN A 1 127 ? -4.522  15.114  -1.426  1.00 0.00 ? 281 ASN A HB3  3  
ATOM   6338  H  HD21 . ASN A 1 127 ? -2.888  13.655  1.042   1.00 0.00 ? 281 ASN A HD21 3  
ATOM   6339  H  HD22 . ASN A 1 127 ? -4.143  13.508  2.175   1.00 0.00 ? 281 ASN A HD22 3  
ATOM   6340  N  N    . SER A 1 128 ? -4.007  13.656  -4.241  1.00 0.00 ? 282 SER A N    3  
ATOM   6341  C  CA   . SER A 1 128 ? -4.072  14.204  -5.642  1.00 0.00 ? 282 SER A CA   3  
ATOM   6342  C  C    . SER A 1 128 ? -4.930  13.288  -6.527  1.00 0.00 ? 282 SER A C    3  
ATOM   6343  O  O    . SER A 1 128 ? -5.658  13.761  -7.381  1.00 0.00 ? 282 SER A O    3  
ATOM   6344  C  CB   . SER A 1 128 ? -2.630  14.259  -6.169  1.00 0.00 ? 282 SER A CB   3  
ATOM   6345  O  OG   . SER A 1 128 ? -2.485  15.386  -7.022  1.00 0.00 ? 282 SER A OG   3  
ATOM   6346  H  H    . SER A 1 128 ? -3.170  13.269  -3.892  1.00 0.00 ? 282 SER A H    3  
ATOM   6347  H  HA   . SER A 1 128 ? -4.495  15.192  -5.627  1.00 0.00 ? 282 SER A HA   3  
ATOM   6348  H  HB2  . SER A 1 128 ? -1.946  14.349  -5.342  1.00 0.00 ? 282 SER A HB2  3  
ATOM   6349  H  HB3  . SER A 1 128 ? -2.413  13.350  -6.715  1.00 0.00 ? 282 SER A HB3  3  
ATOM   6350  H  HG   . SER A 1 128 ? -1.549  15.510  -7.195  1.00 0.00 ? 282 SER A HG   3  
ATOM   6351  N  N    . VAL A 1 129 ? -4.867  11.987  -6.328  1.00 0.00 ? 283 VAL A N    3  
ATOM   6352  C  CA   . VAL A 1 129 ? -5.708  11.068  -7.170  1.00 0.00 ? 283 VAL A CA   3  
ATOM   6353  C  C    . VAL A 1 129 ? -7.158  11.105  -6.683  1.00 0.00 ? 283 VAL A C    3  
ATOM   6354  O  O    . VAL A 1 129 ? -8.075  11.112  -7.486  1.00 0.00 ? 283 VAL A O    3  
ATOM   6355  C  CB   . VAL A 1 129 ? -5.114  9.656   -7.020  1.00 0.00 ? 283 VAL A CB   3  
ATOM   6356  C  CG1  . VAL A 1 129 ? -5.933  8.654   -7.841  1.00 0.00 ? 283 VAL A CG1  3  
ATOM   6357  C  CG2  . VAL A 1 129 ? -3.668  9.659   -7.520  1.00 0.00 ? 283 VAL A CG2  3  
ATOM   6358  H  H    . VAL A 1 129 ? -4.281  11.622  -5.624  1.00 0.00 ? 283 VAL A H    3  
ATOM   6359  H  HA   . VAL A 1 129 ? -5.669  11.380  -8.198  1.00 0.00 ? 283 VAL A HA   3  
ATOM   6360  H  HB   . VAL A 1 129 ? -5.135  9.369   -5.979  1.00 0.00 ? 283 VAL A HB   3  
ATOM   6361  H  HG11 . VAL A 1 129 ? -5.545  7.658   -7.685  1.00 0.00 ? 283 VAL A HG11 3  
ATOM   6362  H  HG12 . VAL A 1 129 ? -5.864  8.906   -8.888  1.00 0.00 ? 283 VAL A HG12 3  
ATOM   6363  H  HG13 . VAL A 1 129 ? -6.967  8.691   -7.529  1.00 0.00 ? 283 VAL A HG13 3  
ATOM   6364  H  HG21 . VAL A 1 129 ? -3.232  10.633  -7.357  1.00 0.00 ? 283 VAL A HG21 3  
ATOM   6365  H  HG22 . VAL A 1 129 ? -3.651  9.429   -8.575  1.00 0.00 ? 283 VAL A HG22 3  
ATOM   6366  H  HG23 . VAL A 1 129 ? -3.099  8.915   -6.981  1.00 0.00 ? 283 VAL A HG23 3  
ATOM   6367  N  N    . PHE A 1 130 ? -7.386  11.156  -5.388  1.00 0.00 ? 284 PHE A N    3  
ATOM   6368  C  CA   . PHE A 1 130 ? -8.806  11.226  -4.908  1.00 0.00 ? 284 PHE A CA   3  
ATOM   6369  C  C    . PHE A 1 130 ? -9.359  12.634  -5.170  1.00 0.00 ? 284 PHE A C    3  
ATOM   6370  O  O    . PHE A 1 130 ? -10.538 12.793  -5.427  1.00 0.00 ? 284 PHE A O    3  
ATOM   6371  C  CB   . PHE A 1 130 ? -8.821  10.887  -3.405  1.00 0.00 ? 284 PHE A CB   3  
ATOM   6372  C  CG   . PHE A 1 130 ? -9.483  9.541   -3.214  1.00 0.00 ? 284 PHE A CG   3  
ATOM   6373  C  CD1  . PHE A 1 130 ? -10.809 9.355   -3.623  1.00 0.00 ? 284 PHE A CD1  3  
ATOM   6374  C  CD2  . PHE A 1 130 ? -8.769  8.479   -2.650  1.00 0.00 ? 284 PHE A CD2  3  
ATOM   6375  C  CE1  . PHE A 1 130 ? -11.422 8.108   -3.466  1.00 0.00 ? 284 PHE A CE1  3  
ATOM   6376  C  CE2  . PHE A 1 130 ? -9.383  7.229   -2.496  1.00 0.00 ? 284 PHE A CE2  3  
ATOM   6377  C  CZ   . PHE A 1 130 ? -10.709 7.043   -2.902  1.00 0.00 ? 284 PHE A CZ   3  
ATOM   6378  H  H    . PHE A 1 130 ? -6.633  11.176  -4.750  1.00 0.00 ? 284 PHE A H    3  
ATOM   6379  H  HA   . PHE A 1 130 ? -9.397  10.506  -5.453  1.00 0.00 ? 284 PHE A HA   3  
ATOM   6380  H  HB2  . PHE A 1 130 ? -7.812  10.852  -3.023  1.00 0.00 ? 284 PHE A HB2  3  
ATOM   6381  H  HB3  . PHE A 1 130 ? -9.381  11.640  -2.871  1.00 0.00 ? 284 PHE A HB3  3  
ATOM   6382  H  HD1  . PHE A 1 130 ? -11.361 10.175  -4.060  1.00 0.00 ? 284 PHE A HD1  3  
ATOM   6383  H  HD2  . PHE A 1 130 ? -7.747  8.621   -2.334  1.00 0.00 ? 284 PHE A HD2  3  
ATOM   6384  H  HE1  . PHE A 1 130 ? -12.445 7.966   -3.782  1.00 0.00 ? 284 PHE A HE1  3  
ATOM   6385  H  HE2  . PHE A 1 130 ? -8.832  6.408   -2.060  1.00 0.00 ? 284 PHE A HE2  3  
ATOM   6386  H  HZ   . PHE A 1 130 ? -11.182 6.079   -2.785  1.00 0.00 ? 284 PHE A HZ   3  
ATOM   6387  N  N    . GLU A 1 131 ? -8.522  13.665  -5.147  1.00 0.00 ? 285 GLU A N    3  
ATOM   6388  C  CA   . GLU A 1 131 ? -9.045  15.048  -5.446  1.00 0.00 ? 285 GLU A CA   3  
ATOM   6389  C  C    . GLU A 1 131 ? -9.702  15.044  -6.834  1.00 0.00 ? 285 GLU A C    3  
ATOM   6390  O  O    . GLU A 1 131 ? -10.741 15.647  -7.031  1.00 0.00 ? 285 GLU A O    3  
ATOM   6391  C  CB   . GLU A 1 131 ? -7.837  16.001  -5.428  1.00 0.00 ? 285 GLU A CB   3  
ATOM   6392  C  CG   . GLU A 1 131 ? -8.310  17.436  -5.674  1.00 0.00 ? 285 GLU A CG   3  
ATOM   6393  C  CD   . GLU A 1 131 ? -7.229  18.207  -6.433  1.00 0.00 ? 285 GLU A CD   3  
ATOM   6394  O  OE1  . GLU A 1 131 ? -6.125  18.297  -5.922  1.00 0.00 ? 285 GLU A OE1  3  
ATOM   6395  O  OE2  . GLU A 1 131 ? -7.523  18.694  -7.512  1.00 0.00 ? 285 GLU A OE2  3  
ATOM   6396  H  H    . GLU A 1 131 ? -7.565  13.525  -4.962  1.00 0.00 ? 285 GLU A H    3  
ATOM   6397  H  HA   . GLU A 1 131 ? -9.762  15.342  -4.699  1.00 0.00 ? 285 GLU A HA   3  
ATOM   6398  H  HB2  . GLU A 1 131 ? -7.348  15.944  -4.467  1.00 0.00 ? 285 GLU A HB2  3  
ATOM   6399  H  HB3  . GLU A 1 131 ? -7.141  15.716  -6.203  1.00 0.00 ? 285 GLU A HB3  3  
ATOM   6400  H  HG2  . GLU A 1 131 ? -9.220  17.420  -6.257  1.00 0.00 ? 285 GLU A HG2  3  
ATOM   6401  H  HG3  . GLU A 1 131 ? -8.498  17.919  -4.728  1.00 0.00 ? 285 GLU A HG3  3  
ATOM   6402  N  N    . ASN A 1 132 ? -9.125  14.340  -7.793  1.00 0.00 ? 286 ASN A N    3  
ATOM   6403  C  CA   . ASN A 1 132 ? -9.767  14.283  -9.156  1.00 0.00 ? 286 ASN A CA   3  
ATOM   6404  C  C    . ASN A 1 132 ? -11.187 13.692  -9.039  1.00 0.00 ? 286 ASN A C    3  
ATOM   6405  O  O    . ASN A 1 132 ? -12.071 14.050  -9.794  1.00 0.00 ? 286 ASN A O    3  
ATOM   6406  C  CB   . ASN A 1 132 ? -8.885  13.376  -10.029 1.00 0.00 ? 286 ASN A CB   3  
ATOM   6407  C  CG   . ASN A 1 132 ? -7.639  14.151  -10.476 1.00 0.00 ? 286 ASN A CG   3  
ATOM   6408  O  OD1  . ASN A 1 132 ? -6.538  13.829  -10.074 1.00 0.00 ? 286 ASN A OD1  3  
ATOM   6409  N  ND2  . ASN A 1 132 ? -7.758  15.166  -11.297 1.00 0.00 ? 286 ASN A ND2  3  
ATOM   6410  H  H    . ASN A 1 132 ? -8.292  13.835  -7.609  1.00 0.00 ? 286 ASN A H    3  
ATOM   6411  H  HA   . ASN A 1 132 ? -9.814  15.271  -9.583  1.00 0.00 ? 286 ASN A HA   3  
ATOM   6412  H  HB2  . ASN A 1 132 ? -8.585  12.509  -9.456  1.00 0.00 ? 286 ASN A HB2  3  
ATOM   6413  H  HB3  . ASN A 1 132 ? -9.441  13.060  -10.897 1.00 0.00 ? 286 ASN A HB3  3  
ATOM   6414  H  HD21 . ASN A 1 132 ? -8.644  15.435  -11.628 1.00 0.00 ? 286 ASN A HD21 3  
ATOM   6415  H  HD22 . ASN A 1 132 ? -6.962  15.659  -11.581 1.00 0.00 ? 286 ASN A HD22 3  
ATOM   6416  N  N    . LEU A 1 133 ? -11.418 12.797  -8.090  1.00 0.00 ? 287 LEU A N    3  
ATOM   6417  C  CA   . LEU A 1 133 ? -12.796 12.202  -7.931  1.00 0.00 ? 287 LEU A CA   3  
ATOM   6418  C  C    . LEU A 1 133 ? -13.830 13.325  -7.740  1.00 0.00 ? 287 LEU A C    3  
ATOM   6419  O  O    . LEU A 1 133 ? -14.915 13.271  -8.290  1.00 0.00 ? 287 LEU A O    3  
ATOM   6420  C  CB   . LEU A 1 133 ? -12.743 11.319  -6.665  1.00 0.00 ? 287 LEU A CB   3  
ATOM   6421  C  CG   . LEU A 1 133 ? -13.789 10.193  -6.732  1.00 0.00 ? 287 LEU A CG   3  
ATOM   6422  C  CD1  . LEU A 1 133 ? -15.189 10.774  -6.974  1.00 0.00 ? 287 LEU A CD1  3  
ATOM   6423  C  CD2  . LEU A 1 133 ? -13.427 9.229   -7.865  1.00 0.00 ? 287 LEU A CD2  3  
ATOM   6424  H  H    . LEU A 1 133 ? -10.694 12.525  -7.485  1.00 0.00 ? 287 LEU A H    3  
ATOM   6425  H  HA   . LEU A 1 133 ? -13.048 11.601  -8.791  1.00 0.00 ? 287 LEU A HA   3  
ATOM   6426  H  HB2  . LEU A 1 133 ? -11.759 10.881  -6.579  1.00 0.00 ? 287 LEU A HB2  3  
ATOM   6427  H  HB3  . LEU A 1 133 ? -12.933 11.933  -5.799  1.00 0.00 ? 287 LEU A HB3  3  
ATOM   6428  H  HG   . LEU A 1 133 ? -13.788 9.656   -5.795  1.00 0.00 ? 287 LEU A HG   3  
ATOM   6429  H  HD11 . LEU A 1 133 ? -15.271 11.730  -6.482  1.00 0.00 ? 287 LEU A HD11 3  
ATOM   6430  H  HD12 . LEU A 1 133 ? -15.932 10.100  -6.576  1.00 0.00 ? 287 LEU A HD12 3  
ATOM   6431  H  HD13 . LEU A 1 133 ? -15.348 10.899  -8.035  1.00 0.00 ? 287 LEU A HD13 3  
ATOM   6432  H  HD21 . LEU A 1 133 ? -12.377 8.978   -7.802  1.00 0.00 ? 287 LEU A HD21 3  
ATOM   6433  H  HD22 . LEU A 1 133 ? -13.628 9.697   -8.817  1.00 0.00 ? 287 LEU A HD22 3  
ATOM   6434  H  HD23 . LEU A 1 133 ? -14.018 8.328   -7.775  1.00 0.00 ? 287 LEU A HD23 3  
ATOM   6435  N  N    . GLU A 1 134 ? -13.505 14.343  -6.965  1.00 0.00 ? 288 GLU A N    3  
ATOM   6436  C  CA   . GLU A 1 134 ? -14.494 15.462  -6.755  1.00 0.00 ? 288 GLU A CA   3  
ATOM   6437  C  C    . GLU A 1 134 ? -14.825 16.124  -8.099  1.00 0.00 ? 288 GLU A C    3  
ATOM   6438  O  O    . GLU A 1 134 ? -15.972 16.424  -8.378  1.00 0.00 ? 288 GLU A O    3  
ATOM   6439  C  CB   . GLU A 1 134 ? -13.825 16.479  -5.815  1.00 0.00 ? 288 GLU A CB   3  
ATOM   6440  C  CG   . GLU A 1 134 ? -13.941 15.991  -4.370  1.00 0.00 ? 288 GLU A CG   3  
ATOM   6441  C  CD   . GLU A 1 134 ? -15.306 16.383  -3.805  1.00 0.00 ? 288 GLU A CD   3  
ATOM   6442  O  OE1  . GLU A 1 134 ? -16.264 15.680  -4.081  1.00 0.00 ? 288 GLU A OE1  3  
ATOM   6443  O  OE2  . GLU A 1 134 ? -15.372 17.380  -3.105  1.00 0.00 ? 288 GLU A OE2  3  
ATOM   6444  H  H    . GLU A 1 134 ? -12.618 14.367  -6.528  1.00 0.00 ? 288 GLU A H    3  
ATOM   6445  H  HA   . GLU A 1 134 ? -15.391 15.081  -6.302  1.00 0.00 ? 288 GLU A HA   3  
ATOM   6446  H  HB2  . GLU A 1 134 ? -12.782 16.581  -6.080  1.00 0.00 ? 288 GLU A HB2  3  
ATOM   6447  H  HB3  . GLU A 1 134 ? -14.316 17.435  -5.909  1.00 0.00 ? 288 GLU A HB3  3  
ATOM   6448  H  HG2  . GLU A 1 134 ? -13.835 14.916  -4.343  1.00 0.00 ? 288 GLU A HG2  3  
ATOM   6449  H  HG3  . GLU A 1 134 ? -13.163 16.443  -3.773  1.00 0.00 ? 288 GLU A HG3  3  
ATOM   6450  N  N    . GLN A 1 135 ? -13.836 16.347  -8.937  1.00 0.00 ? 289 GLN A N    3  
ATOM   6451  C  CA   . GLN A 1 135 ? -14.122 16.987  -10.271 1.00 0.00 ? 289 GLN A CA   3  
ATOM   6452  C  C    . GLN A 1 135 ? -15.054 16.081  -11.090 1.00 0.00 ? 289 GLN A C    3  
ATOM   6453  O  O    . GLN A 1 135 ? -15.963 16.554  -11.745 1.00 0.00 ? 289 GLN A O    3  
ATOM   6454  C  CB   . GLN A 1 135 ? -12.770 17.144  -10.986 1.00 0.00 ? 289 GLN A CB   3  
ATOM   6455  C  CG   . GLN A 1 135 ? -11.862 18.059  -10.163 1.00 0.00 ? 289 GLN A CG   3  
ATOM   6456  C  CD   . GLN A 1 135 ? -10.966 18.875  -11.106 1.00 0.00 ? 289 GLN A CD   3  
ATOM   6457  O  OE1  . GLN A 1 135 ? -10.677 18.443  -12.205 1.00 0.00 ? 289 GLN A OE1  3  
ATOM   6458  N  NE2  . GLN A 1 135 ? -10.508 20.043  -10.725 1.00 0.00 ? 289 GLN A NE2  3  
ATOM   6459  H  H    . GLN A 1 135 ? -12.917 16.089  -8.690  1.00 0.00 ? 289 GLN A H    3  
ATOM   6460  H  HA   . GLN A 1 135 ? -14.577 17.956  -10.128 1.00 0.00 ? 289 GLN A HA   3  
ATOM   6461  H  HB2  . GLN A 1 135 ? -12.305 16.174  -11.093 1.00 0.00 ? 289 GLN A HB2  3  
ATOM   6462  H  HB3  . GLN A 1 135 ? -12.928 17.578  -11.962 1.00 0.00 ? 289 GLN A HB3  3  
ATOM   6463  H  HG2  . GLN A 1 135 ? -12.467 18.730  -9.571  1.00 0.00 ? 289 GLN A HG2  3  
ATOM   6464  H  HG3  . GLN A 1 135 ? -11.243 17.461  -9.511  1.00 0.00 ? 289 GLN A HG3  3  
ATOM   6465  H  HE21 . GLN A 1 135 ? -10.735 20.401  -9.839  1.00 0.00 ? 289 GLN A HE21 3  
ATOM   6466  H  HE22 . GLN A 1 135 ? -9.937  20.562  -11.328 1.00 0.00 ? 289 GLN A HE22 3  
ATOM   6467  N  N    . LEU A 1 136 ? -14.842 14.778  -11.058 1.00 0.00 ? 290 LEU A N    3  
ATOM   6468  C  CA   . LEU A 1 136 ? -15.739 13.856  -11.844 1.00 0.00 ? 290 LEU A CA   3  
ATOM   6469  C  C    . LEU A 1 136 ? -17.188 13.984  -11.347 1.00 0.00 ? 290 LEU A C    3  
ATOM   6470  O  O    . LEU A 1 136 ? -18.116 13.993  -12.134 1.00 0.00 ? 290 LEU A O    3  
ATOM   6471  C  CB   . LEU A 1 136 ? -15.222 12.428  -11.604 1.00 0.00 ? 290 LEU A CB   3  
ATOM   6472  C  CG   . LEU A 1 136 ? -15.663 11.519  -12.751 1.00 0.00 ? 290 LEU A CG   3  
ATOM   6473  C  CD1  . LEU A 1 136 ? -14.797 11.791  -13.982 1.00 0.00 ? 290 LEU A CD1  3  
ATOM   6474  C  CD2  . LEU A 1 136 ? -15.501 10.057  -12.329 1.00 0.00 ? 290 LEU A CD2  3  
ATOM   6475  H  H    . LEU A 1 136 ? -14.101 14.413  -10.517 1.00 0.00 ? 290 LEU A H    3  
ATOM   6476  H  HA   . LEU A 1 136 ? -15.686 14.094  -12.891 1.00 0.00 ? 290 LEU A HA   3  
ATOM   6477  H  HB2  . LEU A 1 136 ? -14.143 12.441  -11.550 1.00 0.00 ? 290 LEU A HB2  3  
ATOM   6478  H  HB3  . LEU A 1 136 ? -15.622 12.053  -10.674 1.00 0.00 ? 290 LEU A HB3  3  
ATOM   6479  H  HG   . LEU A 1 136 ? -16.699 11.715  -12.988 1.00 0.00 ? 290 LEU A HG   3  
ATOM   6480  H  HD11 . LEU A 1 136 ? -13.777 11.501  -13.775 1.00 0.00 ? 290 LEU A HD11 3  
ATOM   6481  H  HD12 . LEU A 1 136 ? -14.831 12.844  -14.221 1.00 0.00 ? 290 LEU A HD12 3  
ATOM   6482  H  HD13 . LEU A 1 136 ? -15.170 11.220  -14.819 1.00 0.00 ? 290 LEU A HD13 3  
ATOM   6483  H  HD21 . LEU A 1 136 ? -14.483 9.885   -12.009 1.00 0.00 ? 290 LEU A HD21 3  
ATOM   6484  H  HD22 . LEU A 1 136 ? -15.729 9.413   -13.165 1.00 0.00 ? 290 LEU A HD22 3  
ATOM   6485  H  HD23 . LEU A 1 136 ? -16.175 9.840   -11.513 1.00 0.00 ? 290 LEU A HD23 3  
ATOM   6486  N  N    . LEU A 1 137 ? -17.391 14.085  -10.050 1.00 0.00 ? 291 LEU A N    3  
ATOM   6487  C  CA   . LEU A 1 137 ? -18.799 14.214  -9.520  1.00 0.00 ? 291 LEU A CA   3  
ATOM   6488  C  C    . LEU A 1 137 ? -19.460 15.503  -10.044 1.00 0.00 ? 291 LEU A C    3  
ATOM   6489  O  O    . LEU A 1 137 ? -20.652 15.528  -10.286 1.00 0.00 ? 291 LEU A O    3  
ATOM   6490  C  CB   . LEU A 1 137 ? -18.692 14.266  -7.987  1.00 0.00 ? 291 LEU A CB   3  
ATOM   6491  C  CG   . LEU A 1 137 ? -20.040 13.886  -7.368  1.00 0.00 ? 291 LEU A CG   3  
ATOM   6492  C  CD1  . LEU A 1 137 ? -20.189 12.364  -7.363  1.00 0.00 ? 291 LEU A CD1  3  
ATOM   6493  C  CD2  . LEU A 1 137 ? -20.105 14.409  -5.931  1.00 0.00 ? 291 LEU A CD2  3  
ATOM   6494  H  H    . LEU A 1 137 ? -16.622 14.076  -9.433  1.00 0.00 ? 291 LEU A H    3  
ATOM   6495  H  HA   . LEU A 1 137 ? -19.382 13.356  -9.814  1.00 0.00 ? 291 LEU A HA   3  
ATOM   6496  H  HB2  . LEU A 1 137 ? -17.934 13.570  -7.655  1.00 0.00 ? 291 LEU A HB2  3  
ATOM   6497  H  HB3  . LEU A 1 137 ? -18.424 15.265  -7.678  1.00 0.00 ? 291 LEU A HB3  3  
ATOM   6498  H  HG   . LEU A 1 137 ? -20.838 14.325  -7.950  1.00 0.00 ? 291 LEU A HG   3  
ATOM   6499  H  HD11 . LEU A 1 137 ? -19.492 11.936  -6.657  1.00 0.00 ? 291 LEU A HD11 3  
ATOM   6500  H  HD12 . LEU A 1 137 ? -19.984 11.978  -8.350  1.00 0.00 ? 291 LEU A HD12 3  
ATOM   6501  H  HD13 . LEU A 1 137 ? -21.197 12.103  -7.077  1.00 0.00 ? 291 LEU A HD13 3  
ATOM   6502  H  HD21 . LEU A 1 137 ? -19.113 14.418  -5.505  1.00 0.00 ? 291 LEU A HD21 3  
ATOM   6503  H  HD22 . LEU A 1 137 ? -20.744 13.766  -5.343  1.00 0.00 ? 291 LEU A HD22 3  
ATOM   6504  H  HD23 . LEU A 1 137 ? -20.505 15.412  -5.931  1.00 0.00 ? 291 LEU A HD23 3  
ATOM   6505  N  N    . GLN A 1 138 ? -18.707 16.572  -10.223 1.00 0.00 ? 292 GLN A N    3  
ATOM   6506  C  CA   . GLN A 1 138 ? -19.327 17.844  -10.733 1.00 0.00 ? 292 GLN A CA   3  
ATOM   6507  C  C    . GLN A 1 138 ? -19.252 17.907  -12.270 1.00 0.00 ? 292 GLN A C    3  
ATOM   6508  O  O    . GLN A 1 138 ? -20.151 18.425  -12.909 1.00 0.00 ? 292 GLN A O    3  
ATOM   6509  C  CB   . GLN A 1 138 ? -18.521 18.993  -10.113 1.00 0.00 ? 292 GLN A CB   3  
ATOM   6510  C  CG   . GLN A 1 138 ? -18.860 19.110  -8.624  1.00 0.00 ? 292 GLN A CG   3  
ATOM   6511  C  CD   . GLN A 1 138 ? -19.996 20.123  -8.437  1.00 0.00 ? 292 GLN A CD   3  
ATOM   6512  O  OE1  . GLN A 1 138 ? -19.749 21.306  -8.303  1.00 0.00 ? 292 GLN A OE1  3  
ATOM   6513  N  NE2  . GLN A 1 138 ? -21.241 19.715  -8.421  1.00 0.00 ? 292 GLN A NE2  3  
ATOM   6514  H  H    . GLN A 1 138 ? -17.742 16.539  -10.026 1.00 0.00 ? 292 GLN A H    3  
ATOM   6515  H  HA   . GLN A 1 138 ? -20.355 17.907  -10.412 1.00 0.00 ? 292 GLN A HA   3  
ATOM   6516  H  HB2  . GLN A 1 138 ? -17.464 18.794  -10.226 1.00 0.00 ? 292 GLN A HB2  3  
ATOM   6517  H  HB3  . GLN A 1 138 ? -18.769 19.918  -10.611 1.00 0.00 ? 292 GLN A HB3  3  
ATOM   6518  H  HG2  . GLN A 1 138 ? -19.171 18.145  -8.250  1.00 0.00 ? 292 GLN A HG2  3  
ATOM   6519  H  HG3  . GLN A 1 138 ? -17.989 19.444  -8.082  1.00 0.00 ? 292 GLN A HG3  3  
ATOM   6520  H  HE21 . GLN A 1 138 ? -21.454 18.761  -8.528  1.00 0.00 ? 292 GLN A HE21 3  
ATOM   6521  H  HE22 . GLN A 1 138 ? -21.966 20.363  -8.300  1.00 0.00 ? 292 GLN A HE22 3  
ATOM   6522  N  N    . GLN A 1 139 ? -18.201 17.387  -12.874 1.00 0.00 ? 293 GLN A N    3  
ATOM   6523  C  CA   . GLN A 1 139 ? -18.104 17.432  -14.370 1.00 0.00 ? 293 GLN A CA   3  
ATOM   6524  C  C    . GLN A 1 139 ? -18.485 16.066  -14.966 1.00 0.00 ? 293 GLN A C    3  
ATOM   6525  O  O    . GLN A 1 139 ? -17.672 15.411  -15.593 1.00 0.00 ? 293 GLN A O    3  
ATOM   6526  C  CB   . GLN A 1 139 ? -16.641 17.772  -14.686 1.00 0.00 ? 293 GLN A CB   3  
ATOM   6527  C  CG   . GLN A 1 139 ? -16.330 19.190  -14.204 1.00 0.00 ? 293 GLN A CG   3  
ATOM   6528  C  CD   . GLN A 1 139 ? -14.812 19.363  -14.068 1.00 0.00 ? 293 GLN A CD   3  
ATOM   6529  O  OE1  . GLN A 1 139 ? -14.127 18.453  -13.644 1.00 0.00 ? 293 GLN A OE1  3  
ATOM   6530  N  NE2  . GLN A 1 139 ? -14.248 20.494  -14.413 1.00 0.00 ? 293 GLN A NE2  3  
ATOM   6531  H  H    . GLN A 1 139 ? -17.482 16.967  -12.349 1.00 0.00 ? 293 GLN A H    3  
ATOM   6532  H  HA   . GLN A 1 139 ? -18.752 18.202  -14.761 1.00 0.00 ? 293 GLN A HA   3  
ATOM   6533  H  HB2  . GLN A 1 139 ? -15.992 17.070  -14.183 1.00 0.00 ? 293 GLN A HB2  3  
ATOM   6534  H  HB3  . GLN A 1 139 ? -16.480 17.713  -15.751 1.00 0.00 ? 293 GLN A HB3  3  
ATOM   6535  H  HG2  . GLN A 1 139 ? -16.713 19.905  -14.918 1.00 0.00 ? 293 GLN A HG2  3  
ATOM   6536  H  HG3  . GLN A 1 139 ? -16.796 19.355  -13.243 1.00 0.00 ? 293 GLN A HG3  3  
ATOM   6537  H  HE21 . GLN A 1 139 ? -14.791 21.236  -14.759 1.00 0.00 ? 293 GLN A HE21 3  
ATOM   6538  H  HE22 . GLN A 1 139 ? -13.277 20.601  -14.327 1.00 0.00 ? 293 GLN A HE22 3  
ATOM   6539  N  N    . ASN A 1 140 ? -19.716 15.629  -14.781 1.00 0.00 ? 294 ASN A N    3  
ATOM   6540  C  CA   . ASN A 1 140 ? -20.135 14.309  -15.342 1.00 0.00 ? 294 ASN A CA   3  
ATOM   6541  C  C    . ASN A 1 140 ? -21.353 14.490  -16.264 1.00 0.00 ? 294 ASN A C    3  
ATOM   6542  O  O    . ASN A 1 140 ? -22.471 14.197  -15.884 1.00 0.00 ? 294 ASN A O    3  
ATOM   6543  C  CB   . ASN A 1 140 ? -20.504 13.455  -14.121 1.00 0.00 ? 294 ASN A CB   3  
ATOM   6544  C  CG   . ASN A 1 140 ? -19.441 12.369  -13.906 1.00 0.00 ? 294 ASN A CG   3  
ATOM   6545  O  OD1  . ASN A 1 140 ? -18.313 12.523  -14.327 1.00 0.00 ? 294 ASN A OD1  3  
ATOM   6546  N  ND2  . ASN A 1 140 ? -19.751 11.269  -13.265 1.00 0.00 ? 294 ASN A ND2  3  
ATOM   6547  H  H    . ASN A 1 140 ? -20.363 16.167  -14.274 1.00 0.00 ? 294 ASN A H    3  
ATOM   6548  H  HA   . ASN A 1 140 ? -19.320 13.854  -15.882 1.00 0.00 ? 294 ASN A HA   3  
ATOM   6549  H  HB2  . ASN A 1 140 ? -20.559 14.084  -13.244 1.00 0.00 ? 294 ASN A HB2  3  
ATOM   6550  H  HB3  . ASN A 1 140 ? -21.464 12.987  -14.285 1.00 0.00 ? 294 ASN A HB3  3  
ATOM   6551  H  HD21 . ASN A 1 140 ? -20.661 11.133  -12.920 1.00 0.00 ? 294 ASN A HD21 3  
ATOM   6552  H  HD22 . ASN A 1 140 ? -19.071 10.576  -13.129 1.00 0.00 ? 294 ASN A HD22 3  
ATOM   6553  N  N    . LYS A 1 141 ? -21.149 14.971  -17.475 1.00 0.00 ? 295 LYS A N    3  
ATOM   6554  C  CA   . LYS A 1 141 ? -22.301 15.164  -18.408 1.00 0.00 ? 295 LYS A CA   3  
ATOM   6555  C  C    . LYS A 1 141 ? -21.871 14.870  -19.855 1.00 0.00 ? 295 LYS A C    3  
ATOM   6556  O  O    . LYS A 1 141 ? -22.133 15.650  -20.751 1.00 0.00 ? 295 LYS A O    3  
ATOM   6557  C  CB   . LYS A 1 141 ? -22.694 16.634  -18.252 1.00 0.00 ? 295 LYS A CB   3  
ATOM   6558  C  CG   . LYS A 1 141 ? -24.213 16.773  -18.373 1.00 0.00 ? 295 LYS A CG   3  
ATOM   6559  C  CD   . LYS A 1 141 ? -24.583 18.250  -18.518 1.00 0.00 ? 295 LYS A CD   3  
ATOM   6560  C  CE   . LYS A 1 141 ? -26.106 18.397  -18.519 1.00 0.00 ? 295 LYS A CE   3  
ATOM   6561  N  NZ   . LYS A 1 141 ? -26.387 19.483  -19.498 1.00 0.00 ? 295 LYS A NZ   3  
ATOM   6562  H  H    . LYS A 1 141 ? -20.240 15.204  -17.771 1.00 0.00 ? 295 LYS A H    3  
ATOM   6563  H  HA   . LYS A 1 141 ? -23.126 14.531  -18.123 1.00 0.00 ? 295 LYS A HA   3  
ATOM   6564  H  HB2  . LYS A 1 141 ? -22.375 16.991  -17.284 1.00 0.00 ? 295 LYS A HB2  3  
ATOM   6565  H  HB3  . LYS A 1 141 ? -22.219 17.218  -19.026 1.00 0.00 ? 295 LYS A HB3  3  
ATOM   6566  H  HG2  . LYS A 1 141 ? -24.556 16.228  -19.241 1.00 0.00 ? 295 LYS A HG2  3  
ATOM   6567  H  HG3  . LYS A 1 141 ? -24.683 16.372  -17.487 1.00 0.00 ? 295 LYS A HG3  3  
ATOM   6568  H  HD2  . LYS A 1 141 ? -24.167 18.808  -17.692 1.00 0.00 ? 295 LYS A HD2  3  
ATOM   6569  H  HD3  . LYS A 1 141 ? -24.186 18.631  -19.446 1.00 0.00 ? 295 LYS A HD3  3  
ATOM   6570  H  HE2  . LYS A 1 141 ? -26.571 17.473  -18.835 1.00 0.00 ? 295 LYS A HE2  3  
ATOM   6571  H  HE3  . LYS A 1 141 ? -26.458 18.682  -17.540 1.00 0.00 ? 295 LYS A HE3  3  
ATOM   6572  H  HZ1  . LYS A 1 141 ? -25.881 20.346  -19.216 1.00 0.00 ? 295 LYS A HZ1  3  
ATOM   6573  H  HZ2  . LYS A 1 141 ? -27.411 19.673  -19.521 1.00 0.00 ? 295 LYS A HZ2  3  
ATOM   6574  H  HZ3  . LYS A 1 141 ? -26.067 19.190  -20.443 1.00 0.00 ? 295 LYS A HZ3  3  
ATOM   6575  N  N    . LYS A 1 142 ? -21.214 13.752  -20.093 1.00 0.00 ? 296 LYS A N    3  
ATOM   6576  C  CA   . LYS A 1 142 ? -20.775 13.423  -21.482 1.00 0.00 ? 296 LYS A CA   3  
ATOM   6577  C  C    . LYS A 1 142 ? -21.439 12.126  -21.953 1.00 0.00 ? 296 LYS A C    3  
ATOM   6578  O  O    . LYS A 1 142 ? -21.300 11.129  -21.265 1.00 0.00 ? 296 LYS A O    3  
ATOM   6579  C  CB   . LYS A 1 142 ? -19.259 13.246  -21.387 1.00 0.00 ? 296 LYS A CB   3  
ATOM   6580  C  CG   . LYS A 1 142 ? -18.580 14.614  -21.478 1.00 0.00 ? 296 LYS A CG   3  
ATOM   6581  C  CD   . LYS A 1 142 ? -17.141 14.438  -21.969 1.00 0.00 ? 296 LYS A CD   3  
ATOM   6582  C  CE   . LYS A 1 142 ? -17.152 13.994  -23.434 1.00 0.00 ? 296 LYS A CE   3  
ATOM   6583  N  NZ   . LYS A 1 142 ? -15.929 14.602  -24.028 1.00 0.00 ? 296 LYS A NZ   3  
ATOM   6584  O  OXT  . LYS A 1 142 ? -22.074 12.154  -22.995 1.00 0.00 ? 296 LYS A OXT  3  
ATOM   6585  H  H    . LYS A 1 142 ? -21.009 13.130  -19.360 1.00 0.00 ? 296 LYS A H    3  
ATOM   6586  H  HA   . LYS A 1 142 ? -21.010 14.234  -22.154 1.00 0.00 ? 296 LYS A HA   3  
ATOM   6587  H  HB2  . LYS A 1 142 ? -19.010 12.781  -20.444 1.00 0.00 ? 296 LYS A HB2  3  
ATOM   6588  H  HB3  . LYS A 1 142 ? -18.918 12.622  -22.198 1.00 0.00 ? 296 LYS A HB3  3  
ATOM   6589  H  HG2  . LYS A 1 142 ? -19.123 15.241  -22.170 1.00 0.00 ? 296 LYS A HG2  3  
ATOM   6590  H  HG3  . LYS A 1 142 ? -18.570 15.077  -20.502 1.00 0.00 ? 296 LYS A HG3  3  
ATOM   6591  H  HD2  . LYS A 1 142 ? -16.614 15.377  -21.880 1.00 0.00 ? 296 LYS A HD2  3  
ATOM   6592  H  HD3  . LYS A 1 142 ? -16.645 13.688  -21.371 1.00 0.00 ? 296 LYS A HD3  3  
ATOM   6593  H  HE2  . LYS A 1 142 ? -17.108 12.916  -23.498 1.00 0.00 ? 296 LYS A HE2  3  
ATOM   6594  H  HE3  . LYS A 1 142 ? -18.032 14.367  -23.934 1.00 0.00 ? 296 LYS A HE3  3  
ATOM   6595  H  HZ1  . LYS A 1 142 ? -15.092 14.283  -23.502 1.00 0.00 ? 296 LYS A HZ1  3  
ATOM   6596  H  HZ2  . LYS A 1 142 ? -15.998 15.640  -23.976 1.00 0.00 ? 296 LYS A HZ2  3  
ATOM   6597  H  HZ3  . LYS A 1 142 ? -15.843 14.309  -25.022 1.00 0.00 ? 296 LYS A HZ3  3  
HETATM 6598  ZN ZN   . ZN  B 2 .   ? -4.905  -2.961  -5.423  1.00 0.00 ? 1   ZN  A ZN   3  
HETATM 6599  ZN ZN   . ZN  C 2 .   ? 1.856   -6.909  -0.394  1.00 0.00 ? 2   ZN  A ZN   3  
HETATM 6600  ZN ZN   . ZN  D 2 .   ? 5.903   -1.777  11.522  1.00 0.00 ? 3   ZN  A ZN   3  
ATOM   6601  N  N    . GLY A 1 1   ? -20.424 25.081  -35.836 1.00 0.00 ? 155 GLY A N    4  
ATOM   6602  C  CA   . GLY A 1 1   ? -20.143 24.236  -37.032 1.00 0.00 ? 155 GLY A CA   4  
ATOM   6603  C  C    . GLY A 1 1   ? -18.850 23.440  -36.807 1.00 0.00 ? 155 GLY A C    4  
ATOM   6604  O  O    . GLY A 1 1   ? -18.851 22.225  -36.865 1.00 0.00 ? 155 GLY A O    4  
ATOM   6605  H  H1   . GLY A 1 1   ? -19.802 25.914  -35.847 1.00 0.00 ? 155 GLY A H1   4  
ATOM   6606  H  H2   . GLY A 1 1   ? -20.250 24.528  -34.973 1.00 0.00 ? 155 GLY A H2   4  
ATOM   6607  H  H3   . GLY A 1 1   ? -21.416 25.392  -35.856 1.00 0.00 ? 155 GLY A H3   4  
ATOM   6608  H  HA2  . GLY A 1 1   ? -20.966 23.552  -37.190 1.00 0.00 ? 155 GLY A HA2  4  
ATOM   6609  H  HA3  . GLY A 1 1   ? -20.027 24.867  -37.900 1.00 0.00 ? 155 GLY A HA3  4  
ATOM   6610  N  N    . ALA A 1 2   ? -17.743 24.110  -36.551 1.00 0.00 ? 156 ALA A N    4  
ATOM   6611  C  CA   . ALA A 1 2   ? -16.461 23.379  -36.325 1.00 0.00 ? 156 ALA A CA   4  
ATOM   6612  C  C    . ALA A 1 2   ? -15.941 23.645  -34.902 1.00 0.00 ? 156 ALA A C    4  
ATOM   6613  O  O    . ALA A 1 2   ? -15.391 24.695  -34.629 1.00 0.00 ? 156 ALA A O    4  
ATOM   6614  C  CB   . ALA A 1 2   ? -15.493 23.947  -37.363 1.00 0.00 ? 156 ALA A CB   4  
ATOM   6615  H  H    . ALA A 1 2   ? -17.755 25.092  -36.506 1.00 0.00 ? 156 ALA A H    4  
ATOM   6616  H  HA   . ALA A 1 2   ? -16.596 22.322  -36.486 1.00 0.00 ? 156 ALA A HA   4  
ATOM   6617  H  HB1  . ALA A 1 2   ? -15.495 23.317  -38.240 1.00 0.00 ? 156 ALA A HB1  4  
ATOM   6618  H  HB2  . ALA A 1 2   ? -14.497 23.981  -36.947 1.00 0.00 ? 156 ALA A HB2  4  
ATOM   6619  H  HB3  . ALA A 1 2   ? -15.803 24.945  -37.636 1.00 0.00 ? 156 ALA A HB3  4  
ATOM   6620  N  N    . MET A 1 3   ? -16.109 22.704  -33.995 1.00 0.00 ? 157 MET A N    4  
ATOM   6621  C  CA   . MET A 1 3   ? -15.622 22.916  -32.599 1.00 0.00 ? 157 MET A CA   4  
ATOM   6622  C  C    . MET A 1 3   ? -14.654 21.791  -32.198 1.00 0.00 ? 157 MET A C    4  
ATOM   6623  O  O    . MET A 1 3   ? -14.684 20.715  -32.765 1.00 0.00 ? 157 MET A O    4  
ATOM   6624  C  CB   . MET A 1 3   ? -16.878 22.877  -31.729 1.00 0.00 ? 157 MET A CB   4  
ATOM   6625  C  CG   . MET A 1 3   ? -16.720 23.849  -30.559 1.00 0.00 ? 157 MET A CG   4  
ATOM   6626  S  SD   . MET A 1 3   ? -18.353 24.403  -30.010 1.00 0.00 ? 157 MET A SD   4  
ATOM   6627  C  CE   . MET A 1 3   ? -18.124 24.070  -28.246 1.00 0.00 ? 157 MET A CE   4  
ATOM   6628  H  H    . MET A 1 3   ? -16.556 21.860  -34.228 1.00 0.00 ? 157 MET A H    4  
ATOM   6629  H  HA   . MET A 1 3   ? -15.141 23.877  -32.510 1.00 0.00 ? 157 MET A HA   4  
ATOM   6630  H  HB2  . MET A 1 3   ? -17.735 23.162  -32.323 1.00 0.00 ? 157 MET A HB2  4  
ATOM   6631  H  HB3  . MET A 1 3   ? -17.022 21.878  -31.348 1.00 0.00 ? 157 MET A HB3  4  
ATOM   6632  H  HG2  . MET A 1 3   ? -16.216 23.352  -29.744 1.00 0.00 ? 157 MET A HG2  4  
ATOM   6633  H  HG3  . MET A 1 3   ? -16.138 24.702  -30.875 1.00 0.00 ? 157 MET A HG3  4  
ATOM   6634  H  HE1  . MET A 1 3   ? -19.060 24.222  -27.727 1.00 0.00 ? 157 MET A HE1  4  
ATOM   6635  H  HE2  . MET A 1 3   ? -17.379 24.738  -27.845 1.00 0.00 ? 157 MET A HE2  4  
ATOM   6636  H  HE3  . MET A 1 3   ? -17.795 23.047  -28.113 1.00 0.00 ? 157 MET A HE3  4  
ATOM   6637  N  N    . ALA A 1 4   ? -13.795 22.027  -31.226 1.00 0.00 ? 158 ALA A N    4  
ATOM   6638  C  CA   . ALA A 1 4   ? -12.834 20.965  -30.801 1.00 0.00 ? 158 ALA A CA   4  
ATOM   6639  C  C    . ALA A 1 4   ? -12.849 20.818  -29.271 1.00 0.00 ? 158 ALA A C    4  
ATOM   6640  O  O    . ALA A 1 4   ? -12.898 21.800  -28.554 1.00 0.00 ? 158 ALA A O    4  
ATOM   6641  C  CB   . ALA A 1 4   ? -11.468 21.453  -31.279 1.00 0.00 ? 158 ALA A CB   4  
ATOM   6642  H  H    . ALA A 1 4   ? -13.780 22.901  -30.775 1.00 0.00 ? 158 ALA A H    4  
ATOM   6643  H  HA   . ALA A 1 4   ? -13.078 20.026  -31.273 1.00 0.00 ? 158 ALA A HA   4  
ATOM   6644  H  HB1  . ALA A 1 4   ? -11.319 22.475  -30.963 1.00 0.00 ? 158 ALA A HB1  4  
ATOM   6645  H  HB2  . ALA A 1 4   ? -11.423 21.400  -32.357 1.00 0.00 ? 158 ALA A HB2  4  
ATOM   6646  H  HB3  . ALA A 1 4   ? -10.694 20.830  -30.856 1.00 0.00 ? 158 ALA A HB3  4  
ATOM   6647  N  N    . ASP A 1 5   ? -12.807 19.602  -28.763 1.00 0.00 ? 159 ASP A N    4  
ATOM   6648  C  CA   . ASP A 1 5   ? -12.818 19.408  -27.283 1.00 0.00 ? 159 ASP A CA   4  
ATOM   6649  C  C    . ASP A 1 5   ? -11.718 18.418  -26.867 1.00 0.00 ? 159 ASP A C    4  
ATOM   6650  O  O    . ASP A 1 5   ? -11.953 17.530  -26.068 1.00 0.00 ? 159 ASP A O    4  
ATOM   6651  C  CB   . ASP A 1 5   ? -14.201 18.837  -26.968 1.00 0.00 ? 159 ASP A CB   4  
ATOM   6652  C  CG   . ASP A 1 5   ? -15.242 19.956  -27.024 1.00 0.00 ? 159 ASP A CG   4  
ATOM   6653  O  OD1  . ASP A 1 5   ? -15.765 20.198  -28.100 1.00 0.00 ? 159 ASP A OD1  4  
ATOM   6654  O  OD2  . ASP A 1 5   ? -15.498 20.553  -25.992 1.00 0.00 ? 159 ASP A OD2  4  
ATOM   6655  H  H    . ASP A 1 5   ? -12.767 18.817  -29.353 1.00 0.00 ? 159 ASP A H    4  
ATOM   6656  H  HA   . ASP A 1 5   ? -12.685 20.352  -26.777 1.00 0.00 ? 159 ASP A HA   4  
ATOM   6657  H  HB2  . ASP A 1 5   ? -14.449 18.077  -27.694 1.00 0.00 ? 159 ASP A HB2  4  
ATOM   6658  H  HB3  . ASP A 1 5   ? -14.195 18.402  -25.980 1.00 0.00 ? 159 ASP A HB3  4  
ATOM   6659  N  N    . LYS A 1 6   ? -10.522 18.559  -27.401 1.00 0.00 ? 160 LYS A N    4  
ATOM   6660  C  CA   . LYS A 1 6   ? -9.420  17.619  -27.029 1.00 0.00 ? 160 LYS A CA   4  
ATOM   6661  C  C    . LYS A 1 6   ? -8.271  18.388  -26.357 1.00 0.00 ? 160 LYS A C    4  
ATOM   6662  O  O    . LYS A 1 6   ? -7.740  19.327  -26.921 1.00 0.00 ? 160 LYS A O    4  
ATOM   6663  C  CB   . LYS A 1 6   ? -8.957  17.009  -28.353 1.00 0.00 ? 160 LYS A CB   4  
ATOM   6664  C  CG   . LYS A 1 6   ? -7.971  15.873  -28.074 1.00 0.00 ? 160 LYS A CG   4  
ATOM   6665  C  CD   . LYS A 1 6   ? -8.736  14.557  -27.927 1.00 0.00 ? 160 LYS A CD   4  
ATOM   6666  C  CE   . LYS A 1 6   ? -7.878  13.405  -28.457 1.00 0.00 ? 160 LYS A CE   4  
ATOM   6667  N  NZ   . LYS A 1 6   ? -8.851  12.431  -29.025 1.00 0.00 ? 160 LYS A NZ   4  
ATOM   6668  H  H    . LYS A 1 6   ? -10.345 19.279  -28.046 1.00 0.00 ? 160 LYS A H    4  
ATOM   6669  H  HA   . LYS A 1 6   ? -9.790  16.846  -26.375 1.00 0.00 ? 160 LYS A HA   4  
ATOM   6670  H  HB2  . LYS A 1 6   ? -9.812  16.622  -28.888 1.00 0.00 ? 160 LYS A HB2  4  
ATOM   6671  H  HB3  . LYS A 1 6   ? -8.472  17.768  -28.948 1.00 0.00 ? 160 LYS A HB3  4  
ATOM   6672  H  HG2  . LYS A 1 6   ? -7.272  15.796  -28.894 1.00 0.00 ? 160 LYS A HG2  4  
ATOM   6673  H  HG3  . LYS A 1 6   ? -7.433  16.079  -27.161 1.00 0.00 ? 160 LYS A HG3  4  
ATOM   6674  H  HD2  . LYS A 1 6   ? -8.962  14.387  -26.884 1.00 0.00 ? 160 LYS A HD2  4  
ATOM   6675  H  HD3  . LYS A 1 6   ? -9.654  14.608  -28.491 1.00 0.00 ? 160 LYS A HD3  4  
ATOM   6676  H  HE2  . LYS A 1 6   ? -7.206  13.762  -29.225 1.00 0.00 ? 160 LYS A HE2  4  
ATOM   6677  H  HE3  . LYS A 1 6   ? -7.324  12.947  -27.653 1.00 0.00 ? 160 LYS A HE3  4  
ATOM   6678  H  HZ1  . LYS A 1 6   ? -9.475  12.917  -29.700 1.00 0.00 ? 160 LYS A HZ1  4  
ATOM   6679  H  HZ2  . LYS A 1 6   ? -9.421  12.023  -28.256 1.00 0.00 ? 160 LYS A HZ2  4  
ATOM   6680  H  HZ3  . LYS A 1 6   ? -8.336  11.674  -29.516 1.00 0.00 ? 160 LYS A HZ3  4  
ATOM   6681  N  N    . ARG A 1 7   ? -7.881  18.001  -25.159 1.00 0.00 ? 161 ARG A N    4  
ATOM   6682  C  CA   . ARG A 1 7   ? -6.768  18.716  -24.467 1.00 0.00 ? 161 ARG A CA   4  
ATOM   6683  C  C    . ARG A 1 7   ? -5.788  17.705  -23.851 1.00 0.00 ? 161 ARG A C    4  
ATOM   6684  O  O    . ARG A 1 7   ? -6.050  17.147  -22.802 1.00 0.00 ? 161 ARG A O    4  
ATOM   6685  C  CB   . ARG A 1 7   ? -7.449  19.539  -23.372 1.00 0.00 ? 161 ARG A CB   4  
ATOM   6686  C  CG   . ARG A 1 7   ? -7.790  20.928  -23.916 1.00 0.00 ? 161 ARG A CG   4  
ATOM   6687  C  CD   . ARG A 1 7   ? -6.623  21.882  -23.648 1.00 0.00 ? 161 ARG A CD   4  
ATOM   6688  N  NE   . ARG A 1 7   ? -5.637  21.601  -24.737 1.00 0.00 ? 161 ARG A NE   4  
ATOM   6689  C  CZ   . ARG A 1 7   ? -5.843  22.022  -25.976 1.00 0.00 ? 161 ARG A CZ   4  
ATOM   6690  N  NH1  . ARG A 1 7   ? -6.919  22.701  -26.299 1.00 0.00 ? 161 ARG A NH1  4  
ATOM   6691  N  NH2  . ARG A 1 7   ? -4.958  21.760  -26.902 1.00 0.00 ? 161 ARG A NH2  4  
ATOM   6692  H  H    . ARG A 1 7   ? -8.318  17.241  -24.715 1.00 0.00 ? 161 ARG A H    4  
ATOM   6693  H  HA   . ARG A 1 7   ? -6.254  19.369  -25.155 1.00 0.00 ? 161 ARG A HA   4  
ATOM   6694  H  HB2  . ARG A 1 7   ? -8.354  19.041  -23.059 1.00 0.00 ? 161 ARG A HB2  4  
ATOM   6695  H  HB3  . ARG A 1 7   ? -6.781  19.638  -22.529 1.00 0.00 ? 161 ARG A HB3  4  
ATOM   6696  H  HG2  . ARG A 1 7   ? -7.967  20.864  -24.979 1.00 0.00 ? 161 ARG A HG2  4  
ATOM   6697  H  HG3  . ARG A 1 7   ? -8.675  21.300  -23.424 1.00 0.00 ? 161 ARG A HG3  4  
ATOM   6698  H  HD2  . ARG A 1 7   ? -6.960  22.909  -23.697 1.00 0.00 ? 161 ARG A HD2  4  
ATOM   6699  H  HD3  . ARG A 1 7   ? -6.180  21.675  -22.687 1.00 0.00 ? 161 ARG A HD3  4  
ATOM   6700  H  HE   . ARG A 1 7   ? -4.824  21.095  -24.525 1.00 0.00 ? 161 ARG A HE   4  
ATOM   6701  H  HH11 . ARG A 1 7   ? -7.611  22.915  -25.610 1.00 0.00 ? 161 ARG A HH11 4  
ATOM   6702  H  HH12 . ARG A 1 7   ? -7.049  23.007  -27.242 1.00 0.00 ? 161 ARG A HH12 4  
ATOM   6703  H  HH21 . ARG A 1 7   ? -4.132  21.243  -26.674 1.00 0.00 ? 161 ARG A HH21 4  
ATOM   6704  H  HH22 . ARG A 1 7   ? -5.106  22.074  -27.839 1.00 0.00 ? 161 ARG A HH22 4  
ATOM   6705  N  N    . GLY A 1 8   ? -4.661  17.462  -24.491 1.00 0.00 ? 162 GLY A N    4  
ATOM   6706  C  CA   . GLY A 1 8   ? -3.679  16.487  -23.933 1.00 0.00 ? 162 GLY A CA   4  
ATOM   6707  C  C    . GLY A 1 8   ? -2.327  17.183  -23.721 1.00 0.00 ? 162 GLY A C    4  
ATOM   6708  O  O    . GLY A 1 8   ? -1.492  17.198  -24.606 1.00 0.00 ? 162 GLY A O    4  
ATOM   6709  H  H    . GLY A 1 8   ? -4.461  17.918  -25.338 1.00 0.00 ? 162 GLY A H    4  
ATOM   6710  H  HA2  . GLY A 1 8   ? -4.044  16.110  -22.987 1.00 0.00 ? 162 GLY A HA2  4  
ATOM   6711  H  HA3  . GLY A 1 8   ? -3.553  15.667  -24.623 1.00 0.00 ? 162 GLY A HA3  4  
ATOM   6712  N  N    . ASP A 1 9   ? -2.100  17.760  -22.558 1.00 0.00 ? 163 ASP A N    4  
ATOM   6713  C  CA   . ASP A 1 9   ? -0.800  18.450  -22.304 1.00 0.00 ? 163 ASP A CA   4  
ATOM   6714  C  C    . ASP A 1 9   ? -0.301  18.136  -20.885 1.00 0.00 ? 163 ASP A C    4  
ATOM   6715  O  O    . ASP A 1 9   ? -1.005  17.531  -20.099 1.00 0.00 ? 163 ASP A O    4  
ATOM   6716  C  CB   . ASP A 1 9   ? -1.108  19.941  -22.448 1.00 0.00 ? 163 ASP A CB   4  
ATOM   6717  C  CG   . ASP A 1 9   ? 0.162   20.688  -22.858 1.00 0.00 ? 163 ASP A CG   4  
ATOM   6718  O  OD1  . ASP A 1 9   ? 0.800   20.257  -23.805 1.00 0.00 ? 163 ASP A OD1  4  
ATOM   6719  O  OD2  . ASP A 1 9   ? 0.476   21.677  -22.218 1.00 0.00 ? 163 ASP A OD2  4  
ATOM   6720  H  H    . ASP A 1 9   ? -2.782  17.740  -21.850 1.00 0.00 ? 163 ASP A H    4  
ATOM   6721  H  HA   . ASP A 1 9   ? -0.067  18.152  -23.037 1.00 0.00 ? 163 ASP A HA   4  
ATOM   6722  H  HB2  . ASP A 1 9   ? -1.868  20.080  -23.203 1.00 0.00 ? 163 ASP A HB2  4  
ATOM   6723  H  HB3  . ASP A 1 9   ? -1.462  20.328  -21.504 1.00 0.00 ? 163 ASP A HB3  4  
ATOM   6724  N  N    . GLY A 1 10  ? 0.908   18.541  -20.548 1.00 0.00 ? 164 GLY A N    4  
ATOM   6725  C  CA   . GLY A 1 10  ? 1.437   18.260  -19.180 1.00 0.00 ? 164 GLY A CA   4  
ATOM   6726  C  C    . GLY A 1 10  ? 2.473   17.129  -19.254 1.00 0.00 ? 164 GLY A C    4  
ATOM   6727  O  O    . GLY A 1 10  ? 3.296   17.099  -20.150 1.00 0.00 ? 164 GLY A O    4  
ATOM   6728  H  H    . GLY A 1 10  ? 1.468   19.028  -21.192 1.00 0.00 ? 164 GLY A H    4  
ATOM   6729  H  HA2  . GLY A 1 10  ? 1.901   19.151  -18.784 1.00 0.00 ? 164 GLY A HA2  4  
ATOM   6730  H  HA3  . GLY A 1 10  ? 0.626   17.958  -18.535 1.00 0.00 ? 164 GLY A HA3  4  
ATOM   6731  N  N    . LEU A 1 11  ? 2.444   16.198  -18.320 1.00 0.00 ? 165 LEU A N    4  
ATOM   6732  C  CA   . LEU A 1 11  ? 3.433   15.079  -18.350 1.00 0.00 ? 165 LEU A CA   4  
ATOM   6733  C  C    . LEU A 1 11  ? 2.771   13.771  -17.895 1.00 0.00 ? 165 LEU A C    4  
ATOM   6734  O  O    . LEU A 1 11  ? 2.651   12.833  -18.662 1.00 0.00 ? 165 LEU A O    4  
ATOM   6735  C  CB   . LEU A 1 11  ? 4.530   15.493  -17.368 1.00 0.00 ? 165 LEU A CB   4  
ATOM   6736  C  CG   . LEU A 1 11  ? 5.583   16.325  -18.100 1.00 0.00 ? 165 LEU A CG   4  
ATOM   6737  C  CD1  . LEU A 1 11  ? 6.353   17.178  -17.089 1.00 0.00 ? 165 LEU A CD1  4  
ATOM   6738  C  CD2  . LEU A 1 11  ? 6.556   15.393  -18.824 1.00 0.00 ? 165 LEU A CD2  4  
ATOM   6739  H  H    . LEU A 1 11  ? 1.775   16.235  -17.601 1.00 0.00 ? 165 LEU A H    4  
ATOM   6740  H  HA   . LEU A 1 11  ? 3.844   14.967  -19.334 1.00 0.00 ? 165 LEU A HA   4  
ATOM   6741  H  HB2  . LEU A 1 11  ? 4.096   16.080  -16.571 1.00 0.00 ? 165 LEU A HB2  4  
ATOM   6742  H  HB3  . LEU A 1 11  ? 4.996   14.611  -16.954 1.00 0.00 ? 165 LEU A HB3  4  
ATOM   6743  H  HG   . LEU A 1 11  ? 5.097   16.971  -18.818 1.00 0.00 ? 165 LEU A HG   4  
ATOM   6744  H  HD11 . LEU A 1 11  ? 6.848   17.989  -17.605 1.00 0.00 ? 165 LEU A HD11 4  
ATOM   6745  H  HD12 . LEU A 1 11  ? 7.088   16.567  -16.589 1.00 0.00 ? 165 LEU A HD12 4  
ATOM   6746  H  HD13 . LEU A 1 11  ? 5.664   17.583  -16.362 1.00 0.00 ? 165 LEU A HD13 4  
ATOM   6747  H  HD21 . LEU A 1 11  ? 7.051   14.758  -18.103 1.00 0.00 ? 165 LEU A HD21 4  
ATOM   6748  H  HD22 . LEU A 1 11  ? 7.293   15.980  -19.352 1.00 0.00 ? 165 LEU A HD22 4  
ATOM   6749  H  HD23 . LEU A 1 11  ? 6.011   14.782  -19.529 1.00 0.00 ? 165 LEU A HD23 4  
ATOM   6750  N  N    . HIS A 1 12  ? 2.339   13.698  -16.655 1.00 0.00 ? 166 HIS A N    4  
ATOM   6751  C  CA   . HIS A 1 12  ? 1.687   12.449  -16.158 1.00 0.00 ? 166 HIS A CA   4  
ATOM   6752  C  C    . HIS A 1 12  ? 0.245   12.743  -15.713 1.00 0.00 ? 166 HIS A C    4  
ATOM   6753  O  O    . HIS A 1 12  ? -0.249  13.839  -15.894 1.00 0.00 ? 166 HIS A O    4  
ATOM   6754  C  CB   . HIS A 1 12  ? 2.540   12.009  -14.966 1.00 0.00 ? 166 HIS A CB   4  
ATOM   6755  C  CG   . HIS A 1 12  ? 3.607   11.060  -15.437 1.00 0.00 ? 166 HIS A CG   4  
ATOM   6756  N  ND1  . HIS A 1 12  ? 4.058   10.008  -14.655 1.00 0.00 ? 166 HIS A ND1  4  
ATOM   6757  C  CD2  . HIS A 1 12  ? 4.324   10.991  -16.606 1.00 0.00 ? 166 HIS A CD2  4  
ATOM   6758  C  CE1  . HIS A 1 12  ? 5.004   9.357   -15.357 1.00 0.00 ? 166 HIS A CE1  4  
ATOM   6759  N  NE2  . HIS A 1 12  ? 5.205   9.915   -16.554 1.00 0.00 ? 166 HIS A NE2  4  
ATOM   6760  H  H    . HIS A 1 12  ? 2.445   14.464  -16.050 1.00 0.00 ? 166 HIS A H    4  
ATOM   6761  H  HA   . HIS A 1 12  ? 1.700   11.688  -16.922 1.00 0.00 ? 166 HIS A HA   4  
ATOM   6762  H  HB2  . HIS A 1 12  ? 3.001   12.874  -14.515 1.00 0.00 ? 166 HIS A HB2  4  
ATOM   6763  H  HB3  . HIS A 1 12  ? 1.914   11.513  -14.240 1.00 0.00 ? 166 HIS A HB3  4  
ATOM   6764  H  HD1  . HIS A 1 12  ? 3.746   9.780   -13.755 1.00 0.00 ? 166 HIS A HD1  4  
ATOM   6765  H  HD2  . HIS A 1 12  ? 4.219   11.669  -17.441 1.00 0.00 ? 166 HIS A HD2  4  
ATOM   6766  H  HE1  . HIS A 1 12  ? 5.536   8.489   -14.997 1.00 0.00 ? 166 HIS A HE1  4  
ATOM   6767  N  N    . GLY A 1 13  ? -0.434  11.774  -15.130 1.00 0.00 ? 167 GLY A N    4  
ATOM   6768  C  CA   . GLY A 1 13  ? -1.841  12.013  -14.680 1.00 0.00 ? 167 GLY A CA   4  
ATOM   6769  C  C    . GLY A 1 13  ? -2.656  10.716  -14.808 1.00 0.00 ? 167 GLY A C    4  
ATOM   6770  O  O    . GLY A 1 13  ? -3.621  10.659  -15.547 1.00 0.00 ? 167 GLY A O    4  
ATOM   6771  H  H    . GLY A 1 13  ? -0.021  10.892  -14.989 1.00 0.00 ? 167 GLY A H    4  
ATOM   6772  H  HA2  . GLY A 1 13  ? -1.837  12.336  -13.648 1.00 0.00 ? 167 GLY A HA2  4  
ATOM   6773  H  HA3  . GLY A 1 13  ? -2.290  12.778  -15.294 1.00 0.00 ? 167 GLY A HA3  4  
ATOM   6774  N  N    . ILE A 1 14  ? -2.277  9.672   -14.097 1.00 0.00 ? 168 ILE A N    4  
ATOM   6775  C  CA   . ILE A 1 14  ? -3.035  8.387   -14.188 1.00 0.00 ? 168 ILE A CA   4  
ATOM   6776  C  C    . ILE A 1 14  ? -3.281  7.818   -12.783 1.00 0.00 ? 168 ILE A C    4  
ATOM   6777  O  O    . ILE A 1 14  ? -2.557  8.119   -11.852 1.00 0.00 ? 168 ILE A O    4  
ATOM   6778  C  CB   . ILE A 1 14  ? -2.137  7.448   -15.003 1.00 0.00 ? 168 ILE A CB   4  
ATOM   6779  C  CG1  . ILE A 1 14  ? -1.884  8.052   -16.387 1.00 0.00 ? 168 ILE A CG1  4  
ATOM   6780  C  CG2  . ILE A 1 14  ? -2.824  6.088   -15.164 1.00 0.00 ? 168 ILE A CG2  4  
ATOM   6781  C  CD1  . ILE A 1 14  ? -0.858  7.201   -17.136 1.00 0.00 ? 168 ILE A CD1  4  
ATOM   6782  H  H    . ILE A 1 14  ? -1.494  9.731   -13.505 1.00 0.00 ? 168 ILE A H    4  
ATOM   6783  H  HA   . ILE A 1 14  ? -3.973  8.535   -14.698 1.00 0.00 ? 168 ILE A HA   4  
ATOM   6784  H  HB   . ILE A 1 14  ? -1.196  7.316   -14.489 1.00 0.00 ? 168 ILE A HB   4  
ATOM   6785  H  HG12 . ILE A 1 14  ? -2.811  8.075   -16.944 1.00 0.00 ? 168 ILE A HG12 4  
ATOM   6786  H  HG13 . ILE A 1 14  ? -1.505  9.057   -16.278 1.00 0.00 ? 168 ILE A HG13 4  
ATOM   6787  H  HG21 . ILE A 1 14  ? -3.888  6.233   -15.271 1.00 0.00 ? 168 ILE A HG21 4  
ATOM   6788  H  HG22 . ILE A 1 14  ? -2.629  5.480   -14.293 1.00 0.00 ? 168 ILE A HG22 4  
ATOM   6789  H  HG23 . ILE A 1 14  ? -2.437  5.593   -16.043 1.00 0.00 ? 168 ILE A HG23 4  
ATOM   6790  H  HD11 . ILE A 1 14  ? -0.005  7.020   -16.498 1.00 0.00 ? 168 ILE A HD11 4  
ATOM   6791  H  HD12 . ILE A 1 14  ? -0.538  7.722   -18.026 1.00 0.00 ? 168 ILE A HD12 4  
ATOM   6792  H  HD13 . ILE A 1 14  ? -1.306  6.258   -17.413 1.00 0.00 ? 168 ILE A HD13 4  
ATOM   6793  N  N    . VAL A 1 15  ? -4.290  6.989   -12.626 1.00 0.00 ? 169 VAL A N    4  
ATOM   6794  C  CA   . VAL A 1 15  ? -4.570  6.396   -11.276 1.00 0.00 ? 169 VAL A CA   4  
ATOM   6795  C  C    . VAL A 1 15  ? -3.923  5.005   -11.183 1.00 0.00 ? 169 VAL A C    4  
ATOM   6796  O  O    . VAL A 1 15  ? -4.050  4.202   -12.088 1.00 0.00 ? 169 VAL A O    4  
ATOM   6797  C  CB   . VAL A 1 15  ? -6.099  6.291   -11.166 1.00 0.00 ? 169 VAL A CB   4  
ATOM   6798  C  CG1  . VAL A 1 15  ? -6.482  5.709   -9.803  1.00 0.00 ? 169 VAL A CG1  4  
ATOM   6799  C  CG2  . VAL A 1 15  ? -6.715  7.685   -11.313 1.00 0.00 ? 169 VAL A CG2  4  
ATOM   6800  H  H    . VAL A 1 15  ? -4.858  6.752   -13.397 1.00 0.00 ? 169 VAL A H    4  
ATOM   6801  H  HA   . VAL A 1 15  ? -4.186  7.038   -10.498 1.00 0.00 ? 169 VAL A HA   4  
ATOM   6802  H  HB   . VAL A 1 15  ? -6.471  5.647   -11.949 1.00 0.00 ? 169 VAL A HB   4  
ATOM   6803  H  HG11 . VAL A 1 15  ? -6.409  6.479   -9.049  1.00 0.00 ? 169 VAL A HG11 4  
ATOM   6804  H  HG12 . VAL A 1 15  ? -5.812  4.899   -9.555  1.00 0.00 ? 169 VAL A HG12 4  
ATOM   6805  H  HG13 . VAL A 1 15  ? -7.495  5.339   -9.842  1.00 0.00 ? 169 VAL A HG13 4  
ATOM   6806  H  HG21 . VAL A 1 15  ? -6.055  8.418   -10.872 1.00 0.00 ? 169 VAL A HG21 4  
ATOM   6807  H  HG22 . VAL A 1 15  ? -7.670  7.710   -10.810 1.00 0.00 ? 169 VAL A HG22 4  
ATOM   6808  H  HG23 . VAL A 1 15  ? -6.853  7.908   -12.360 1.00 0.00 ? 169 VAL A HG23 4  
ATOM   6809  N  N    . SER A 1 16  ? -3.227  4.711   -10.103 1.00 0.00 ? 170 SER A N    4  
ATOM   6810  C  CA   . SER A 1 16  ? -2.576  3.372   -9.980  1.00 0.00 ? 170 SER A CA   4  
ATOM   6811  C  C    . SER A 1 16  ? -2.650  2.857   -8.537  1.00 0.00 ? 170 SER A C    4  
ATOM   6812  O  O    . SER A 1 16  ? -2.691  3.630   -7.599  1.00 0.00 ? 170 SER A O    4  
ATOM   6813  C  CB   . SER A 1 16  ? -1.123  3.597   -10.393 1.00 0.00 ? 170 SER A CB   4  
ATOM   6814  O  OG   . SER A 1 16  ? -0.529  2.348   -10.721 1.00 0.00 ? 170 SER A OG   4  
ATOM   6815  H  H    . SER A 1 16  ? -3.125  5.368   -9.379  1.00 0.00 ? 170 SER A H    4  
ATOM   6816  H  HA   . SER A 1 16  ? -3.040  2.667   -10.646 1.00 0.00 ? 170 SER A HA   4  
ATOM   6817  H  HB2  . SER A 1 16  ? -1.087  4.244   -11.254 1.00 0.00 ? 170 SER A HB2  4  
ATOM   6818  H  HB3  . SER A 1 16  ? -0.584  4.060   -9.576  1.00 0.00 ? 170 SER A HB3  4  
ATOM   6819  H  HG   . SER A 1 16  ? 0.369   2.515   -11.018 1.00 0.00 ? 170 SER A HG   4  
ATOM   6820  N  N    . CYS A 1 17  ? -2.658  1.552   -8.353  1.00 0.00 ? 171 CYS A N    4  
ATOM   6821  C  CA   . CYS A 1 17  ? -2.718  0.993   -6.962  1.00 0.00 ? 171 CYS A CA   4  
ATOM   6822  C  C    . CYS A 1 17  ? -1.305  0.637   -6.478  1.00 0.00 ? 171 CYS A C    4  
ATOM   6823  O  O    . CYS A 1 17  ? -0.523  0.061   -7.214  1.00 0.00 ? 171 CYS A O    4  
ATOM   6824  C  CB   . CYS A 1 17  ? -3.583  -0.268  -7.043  1.00 0.00 ? 171 CYS A CB   4  
ATOM   6825  S  SG   . CYS A 1 17  ? -3.875  -0.902  -5.374  1.00 0.00 ? 171 CYS A SG   4  
ATOM   6826  H  H    . CYS A 1 17  ? -2.614  0.943   -9.130  1.00 0.00 ? 171 CYS A H    4  
ATOM   6827  H  HA   . CYS A 1 17  ? -3.173  1.708   -6.292  1.00 0.00 ? 171 CYS A HA   4  
ATOM   6828  H  HB2  . CYS A 1 17  ? -4.529  -0.030  -7.509  1.00 0.00 ? 171 CYS A HB2  4  
ATOM   6829  H  HB3  . CYS A 1 17  ? -3.071  -1.016  -7.626  1.00 0.00 ? 171 CYS A HB3  4  
ATOM   6830  N  N    . THR A 1 18  ? -0.969  0.976   -5.247  1.00 0.00 ? 172 THR A N    4  
ATOM   6831  C  CA   . THR A 1 18  ? 0.408   0.651   -4.728  1.00 0.00 ? 172 THR A CA   4  
ATOM   6832  C  C    . THR A 1 18  ? 0.506   -0.835  -4.326  1.00 0.00 ? 172 THR A C    4  
ATOM   6833  O  O    . THR A 1 18  ? 1.528   -1.465  -4.530  1.00 0.00 ? 172 THR A O    4  
ATOM   6834  C  CB   . THR A 1 18  ? 0.656   1.573   -3.510  1.00 0.00 ? 172 THR A CB   4  
ATOM   6835  O  OG1  . THR A 1 18  ? 2.021   1.484   -3.132  1.00 0.00 ? 172 THR A OG1  4  
ATOM   6836  C  CG2  . THR A 1 18  ? -0.227  1.165   -2.317  1.00 0.00 ? 172 THR A CG2  4  
ATOM   6837  H  H    . THR A 1 18  ? -1.621  1.441   -4.673  1.00 0.00 ? 172 THR A H    4  
ATOM   6838  H  HA   . THR A 1 18  ? 1.140   0.865   -5.492  1.00 0.00 ? 172 THR A HA   4  
ATOM   6839  H  HB   . THR A 1 18  ? 0.429   2.592   -3.785  1.00 0.00 ? 172 THR A HB   4  
ATOM   6840  H  HG1  . THR A 1 18  ? 2.541   1.967   -3.779  1.00 0.00 ? 172 THR A HG1  4  
ATOM   6841  H  HG21 . THR A 1 18  ? -0.175  1.926   -1.552  1.00 0.00 ? 172 THR A HG21 4  
ATOM   6842  H  HG22 . THR A 1 18  ? 0.125   0.228   -1.912  1.00 0.00 ? 172 THR A HG22 4  
ATOM   6843  H  HG23 . THR A 1 18  ? -1.250  1.053   -2.638  1.00 0.00 ? 172 THR A HG23 4  
ATOM   6844  N  N    . ALA A 1 19  ? -0.541  -1.400  -3.759  1.00 0.00 ? 173 ALA A N    4  
ATOM   6845  C  CA   . ALA A 1 19  ? -0.476  -2.851  -3.353  1.00 0.00 ? 173 ALA A CA   4  
ATOM   6846  C  C    . ALA A 1 19  ? -0.504  -3.768  -4.593  1.00 0.00 ? 173 ALA A C    4  
ATOM   6847  O  O    . ALA A 1 19  ? 0.049   -4.852  -4.570  1.00 0.00 ? 173 ALA A O    4  
ATOM   6848  C  CB   . ALA A 1 19  ? -1.696  -3.113  -2.453  1.00 0.00 ? 173 ALA A CB   4  
ATOM   6849  H  H    . ALA A 1 19  ? -1.361  -0.876  -3.604  1.00 0.00 ? 173 ALA A H    4  
ATOM   6850  H  HA   . ALA A 1 19  ? 0.428   -3.030  -2.794  1.00 0.00 ? 173 ALA A HA   4  
ATOM   6851  H  HB1  . ALA A 1 19  ? -2.527  -2.507  -2.785  1.00 0.00 ? 173 ALA A HB1  4  
ATOM   6852  H  HB2  . ALA A 1 19  ? -1.451  -2.856  -1.431  1.00 0.00 ? 173 ALA A HB2  4  
ATOM   6853  H  HB3  . ALA A 1 19  ? -1.967  -4.158  -2.507  1.00 0.00 ? 173 ALA A HB3  4  
ATOM   6854  N  N    . CYS A 1 20  ? -1.130  -3.349  -5.678  1.00 0.00 ? 174 CYS A N    4  
ATOM   6855  C  CA   . CYS A 1 20  ? -1.168  -4.212  -6.904  1.00 0.00 ? 174 CYS A CA   4  
ATOM   6856  C  C    . CYS A 1 20  ? -0.062  -3.805  -7.890  1.00 0.00 ? 174 CYS A C    4  
ATOM   6857  O  O    . CYS A 1 20  ? 0.498   -4.643  -8.572  1.00 0.00 ? 174 CYS A O    4  
ATOM   6858  C  CB   . CYS A 1 20  ? -2.545  -3.979  -7.539  1.00 0.00 ? 174 CYS A CB   4  
ATOM   6859  S  SG   . CYS A 1 20  ? -3.843  -4.593  -6.439  1.00 0.00 ? 174 CYS A SG   4  
ATOM   6860  H  H    . CYS A 1 20  ? -1.567  -2.474  -5.690  1.00 0.00 ? 174 CYS A H    4  
ATOM   6861  H  HA   . CYS A 1 20  ? -1.060  -5.245  -6.635  1.00 0.00 ? 174 CYS A HA   4  
ATOM   6862  H  HB2  . CYS A 1 20  ? -2.688  -2.925  -7.707  1.00 0.00 ? 174 CYS A HB2  4  
ATOM   6863  H  HB3  . CYS A 1 20  ? -2.595  -4.500  -8.478  1.00 0.00 ? 174 CYS A HB3  4  
ATOM   6864  N  N    . GLY A 1 21  ? 0.249   -2.529  -7.989  1.00 0.00 ? 175 GLY A N    4  
ATOM   6865  C  CA   . GLY A 1 21  ? 1.302   -2.086  -8.948  1.00 0.00 ? 175 GLY A CA   4  
ATOM   6866  C  C    . GLY A 1 21  ? 0.681   -1.980  -10.347 1.00 0.00 ? 175 GLY A C    4  
ATOM   6867  O  O    . GLY A 1 21  ? 1.295   -2.353  -11.329 1.00 0.00 ? 175 GLY A O    4  
ATOM   6868  H  H    . GLY A 1 21  ? -0.216  -1.859  -7.448  1.00 0.00 ? 175 GLY A H    4  
ATOM   6869  H  HA2  . GLY A 1 21  ? 1.686   -1.122  -8.644  1.00 0.00 ? 175 GLY A HA2  4  
ATOM   6870  H  HA3  . GLY A 1 21  ? 2.104   -2.808  -8.966  1.00 0.00 ? 175 GLY A HA3  4  
ATOM   6871  N  N    . GLN A 1 22  ? -0.539  -1.482  -10.450 1.00 0.00 ? 176 GLN A N    4  
ATOM   6872  C  CA   . GLN A 1 22  ? -1.189  -1.372  -11.797 1.00 0.00 ? 176 GLN A CA   4  
ATOM   6873  C  C    . GLN A 1 22  ? -2.373  -0.389  -11.760 1.00 0.00 ? 176 GLN A C    4  
ATOM   6874  O  O    . GLN A 1 22  ? -2.937  -0.128  -10.714 1.00 0.00 ? 176 GLN A O    4  
ATOM   6875  C  CB   . GLN A 1 22  ? -1.681  -2.790  -12.116 1.00 0.00 ? 176 GLN A CB   4  
ATOM   6876  C  CG   . GLN A 1 22  ? -0.786  -3.422  -13.187 1.00 0.00 ? 176 GLN A CG   4  
ATOM   6877  C  CD   . GLN A 1 22  ? -0.608  -4.917  -12.892 1.00 0.00 ? 176 GLN A CD   4  
ATOM   6878  O  OE1  . GLN A 1 22  ? -1.534  -5.573  -12.458 1.00 0.00 ? 176 GLN A OE1  4  
ATOM   6879  N  NE2  . GLN A 1 22  ? 0.550   -5.492  -13.108 1.00 0.00 ? 176 GLN A NE2  4  
ATOM   6880  H  H    . GLN A 1 22  ? -1.029  -1.190  -9.643  1.00 0.00 ? 176 GLN A H    4  
ATOM   6881  H  HA   . GLN A 1 22  ? -0.472  -1.056  -12.537 1.00 0.00 ? 176 GLN A HA   4  
ATOM   6882  H  HB2  . GLN A 1 22  ? -1.650  -3.391  -11.220 1.00 0.00 ? 176 GLN A HB2  4  
ATOM   6883  H  HB3  . GLN A 1 22  ? -2.697  -2.745  -12.482 1.00 0.00 ? 176 GLN A HB3  4  
ATOM   6884  H  HG2  . GLN A 1 22  ? -1.245  -3.299  -14.158 1.00 0.00 ? 176 GLN A HG2  4  
ATOM   6885  H  HG3  . GLN A 1 22  ? 0.179   -2.939  -13.181 1.00 0.00 ? 176 GLN A HG3  4  
ATOM   6886  H  HE21 . GLN A 1 22  ? 1.306   -4.972  -13.458 1.00 0.00 ? 176 GLN A HE21 4  
ATOM   6887  H  HE22 . GLN A 1 22  ? 0.662   -6.447  -12.918 1.00 0.00 ? 176 GLN A HE22 4  
ATOM   6888  N  N    . GLN A 1 23  ? -2.751  0.158   -12.897 1.00 0.00 ? 177 GLN A N    4  
ATOM   6889  C  CA   . GLN A 1 23  ? -3.906  1.130   -12.917 1.00 0.00 ? 177 GLN A CA   4  
ATOM   6890  C  C    . GLN A 1 23  ? -5.170  0.479   -12.337 1.00 0.00 ? 177 GLN A C    4  
ATOM   6891  O  O    . GLN A 1 23  ? -5.315  -0.728  -12.357 1.00 0.00 ? 177 GLN A O    4  
ATOM   6892  C  CB   . GLN A 1 23  ? -4.141  1.508   -14.389 1.00 0.00 ? 177 GLN A CB   4  
ATOM   6893  C  CG   . GLN A 1 23  ? -2.979  2.372   -14.886 1.00 0.00 ? 177 GLN A CG   4  
ATOM   6894  C  CD   . GLN A 1 23  ? -3.073  2.531   -16.409 1.00 0.00 ? 177 GLN A CD   4  
ATOM   6895  O  OE1  . GLN A 1 23  ? -2.221  2.052   -17.130 1.00 0.00 ? 177 GLN A OE1  4  
ATOM   6896  N  NE2  . GLN A 1 23  ? -4.079  3.186   -16.938 1.00 0.00 ? 177 GLN A NE2  4  
ATOM   6897  H  H    . GLN A 1 23  ? -2.273  -0.069  -13.731 1.00 0.00 ? 177 GLN A H    4  
ATOM   6898  H  HA   . GLN A 1 23  ? -3.659  2.011   -12.352 1.00 0.00 ? 177 GLN A HA   4  
ATOM   6899  H  HB2  . GLN A 1 23  ? -4.202  0.610   -14.986 1.00 0.00 ? 177 GLN A HB2  4  
ATOM   6900  H  HB3  . GLN A 1 23  ? -5.062  2.063   -14.476 1.00 0.00 ? 177 GLN A HB3  4  
ATOM   6901  H  HG2  . GLN A 1 23  ? -3.029  3.345   -14.418 1.00 0.00 ? 177 GLN A HG2  4  
ATOM   6902  H  HG3  . GLN A 1 23  ? -2.043  1.898   -14.632 1.00 0.00 ? 177 GLN A HG3  4  
ATOM   6903  H  HE21 . GLN A 1 23  ? -4.774  3.577   -16.364 1.00 0.00 ? 177 GLN A HE21 4  
ATOM   6904  H  HE22 . GLN A 1 23  ? -4.136  3.285   -17.911 1.00 0.00 ? 177 GLN A HE22 4  
ATOM   6905  N  N    . VAL A 1 24  ? -6.092  1.272   -11.828 1.00 0.00 ? 178 VAL A N    4  
ATOM   6906  C  CA   . VAL A 1 24  ? -7.352  0.685   -11.257 1.00 0.00 ? 178 VAL A CA   4  
ATOM   6907  C  C    . VAL A 1 24  ? -8.419  0.587   -12.359 1.00 0.00 ? 178 VAL A C    4  
ATOM   6908  O  O    . VAL A 1 24  ? -8.310  1.236   -13.380 1.00 0.00 ? 178 VAL A O    4  
ATOM   6909  C  CB   . VAL A 1 24  ? -7.812  1.639   -10.138 1.00 0.00 ? 178 VAL A CB   4  
ATOM   6910  C  CG1  . VAL A 1 24  ? -9.049  1.062   -9.449  1.00 0.00 ? 178 VAL A CG1  4  
ATOM   6911  C  CG2  . VAL A 1 24  ? -6.690  1.799   -9.108  1.00 0.00 ? 178 VAL A CG2  4  
ATOM   6912  H  H    . VAL A 1 24  ? -5.957  2.250   -11.832 1.00 0.00 ? 178 VAL A H    4  
ATOM   6913  H  HA   . VAL A 1 24  ? -7.152  -0.293  -10.846 1.00 0.00 ? 178 VAL A HA   4  
ATOM   6914  H  HB   . VAL A 1 24  ? -8.056  2.603   -10.561 1.00 0.00 ? 178 VAL A HB   4  
ATOM   6915  H  HG11 . VAL A 1 24  ? -9.926  1.284   -10.038 1.00 0.00 ? 178 VAL A HG11 4  
ATOM   6916  H  HG12 . VAL A 1 24  ? -9.153  1.502   -8.468  1.00 0.00 ? 178 VAL A HG12 4  
ATOM   6917  H  HG13 . VAL A 1 24  ? -8.942  -0.008  -9.352  1.00 0.00 ? 178 VAL A HG13 4  
ATOM   6918  H  HG21 . VAL A 1 24  ? -5.927  2.453   -9.505  1.00 0.00 ? 178 VAL A HG21 4  
ATOM   6919  H  HG22 . VAL A 1 24  ? -6.259  0.833   -8.892  1.00 0.00 ? 178 VAL A HG22 4  
ATOM   6920  H  HG23 . VAL A 1 24  ? -7.092  2.226   -8.201  1.00 0.00 ? 178 VAL A HG23 4  
ATOM   6921  N  N    . ASN A 1 25  ? -9.442  -0.227  -12.173 1.00 0.00 ? 179 ASN A N    4  
ATOM   6922  C  CA   . ASN A 1 25  ? -10.505 -0.361  -13.242 1.00 0.00 ? 179 ASN A CA   4  
ATOM   6923  C  C    . ASN A 1 25  ? -11.056 1.019   -13.647 1.00 0.00 ? 179 ASN A C    4  
ATOM   6924  O  O    . ASN A 1 25  ? -11.978 1.525   -13.038 1.00 0.00 ? 179 ASN A O    4  
ATOM   6925  C  CB   . ASN A 1 25  ? -11.632 -1.214  -12.637 1.00 0.00 ? 179 ASN A CB   4  
ATOM   6926  C  CG   . ASN A 1 25  ? -12.582 -1.672  -13.750 1.00 0.00 ? 179 ASN A CG   4  
ATOM   6927  O  OD1  . ASN A 1 25  ? -12.167 -1.847  -14.878 1.00 0.00 ? 179 ASN A OD1  4  
ATOM   6928  N  ND2  . ASN A 1 25  ? -13.850 -1.875  -13.486 1.00 0.00 ? 179 ASN A ND2  4  
ATOM   6929  H  H    . ASN A 1 25  ? -9.503  -0.755  -11.341 1.00 0.00 ? 179 ASN A H    4  
ATOM   6930  H  HA   . ASN A 1 25  ? -10.096 -0.862  -14.106 1.00 0.00 ? 179 ASN A HA   4  
ATOM   6931  H  HB2  . ASN A 1 25  ? -11.206 -2.078  -12.148 1.00 0.00 ? 179 ASN A HB2  4  
ATOM   6932  H  HB3  . ASN A 1 25  ? -12.180 -0.627  -11.917 1.00 0.00 ? 179 ASN A HB3  4  
ATOM   6933  H  HD21 . ASN A 1 25  ? -14.197 -1.736  -12.578 1.00 0.00 ? 179 ASN A HD21 4  
ATOM   6934  H  HD22 . ASN A 1 25  ? -14.456 -2.167  -14.199 1.00 0.00 ? 179 ASN A HD22 4  
ATOM   6935  N  N    . HIS A 1 26  ? -10.502 1.634   -14.678 1.00 0.00 ? 180 HIS A N    4  
ATOM   6936  C  CA   . HIS A 1 26  ? -10.997 2.977   -15.127 1.00 0.00 ? 180 HIS A CA   4  
ATOM   6937  C  C    . HIS A 1 26  ? -11.080 3.962   -13.946 1.00 0.00 ? 180 HIS A C    4  
ATOM   6938  O  O    . HIS A 1 26  ? -10.686 3.642   -12.840 1.00 0.00 ? 180 HIS A O    4  
ATOM   6939  C  CB   . HIS A 1 26  ? -12.393 2.714   -15.703 1.00 0.00 ? 180 HIS A CB   4  
ATOM   6940  C  CG   . HIS A 1 26  ? -12.618 3.591   -16.904 1.00 0.00 ? 180 HIS A CG   4  
ATOM   6941  N  ND1  . HIS A 1 26  ? -13.871 4.084   -17.235 1.00 0.00 ? 180 HIS A ND1  4  
ATOM   6942  C  CD2  . HIS A 1 26  ? -11.761 4.072   -17.863 1.00 0.00 ? 180 HIS A CD2  4  
ATOM   6943  C  CE1  . HIS A 1 26  ? -13.733 4.825   -18.350 1.00 0.00 ? 180 HIS A CE1  4  
ATOM   6944  N  NE2  . HIS A 1 26  ? -12.468 4.851   -18.775 1.00 0.00 ? 180 HIS A NE2  4  
ATOM   6945  H  H    . HIS A 1 26  ? -9.760  1.210   -15.164 1.00 0.00 ? 180 HIS A H    4  
ATOM   6946  H  HA   . HIS A 1 26  ? -10.354 3.372   -15.896 1.00 0.00 ? 180 HIS A HA   4  
ATOM   6947  H  HB2  . HIS A 1 26  ? -12.471 1.677   -15.994 1.00 0.00 ? 180 HIS A HB2  4  
ATOM   6948  H  HB3  . HIS A 1 26  ? -13.138 2.934   -14.953 1.00 0.00 ? 180 HIS A HB3  4  
ATOM   6949  H  HD1  . HIS A 1 26  ? -14.704 3.923   -16.745 1.00 0.00 ? 180 HIS A HD1  4  
ATOM   6950  H  HD2  . HIS A 1 26  ? -10.700 3.876   -17.903 1.00 0.00 ? 180 HIS A HD2  4  
ATOM   6951  H  HE1  . HIS A 1 26  ? -14.548 5.336   -18.841 1.00 0.00 ? 180 HIS A HE1  4  
ATOM   6952  N  N    . PHE A 1 27  ? -11.594 5.156   -14.170 1.00 0.00 ? 181 PHE A N    4  
ATOM   6953  C  CA   . PHE A 1 27  ? -11.704 6.148   -13.059 1.00 0.00 ? 181 PHE A CA   4  
ATOM   6954  C  C    . PHE A 1 27  ? -13.187 6.410   -12.747 1.00 0.00 ? 181 PHE A C    4  
ATOM   6955  O  O    . PHE A 1 27  ? -13.854 7.132   -13.463 1.00 0.00 ? 181 PHE A O    4  
ATOM   6956  C  CB   . PHE A 1 27  ? -11.017 7.415   -13.585 1.00 0.00 ? 181 PHE A CB   4  
ATOM   6957  C  CG   . PHE A 1 27  ? -11.108 8.531   -12.562 1.00 0.00 ? 181 PHE A CG   4  
ATOM   6958  C  CD1  . PHE A 1 27  ? -10.761 8.298   -11.222 1.00 0.00 ? 181 PHE A CD1  4  
ATOM   6959  C  CD2  . PHE A 1 27  ? -11.535 9.803   -12.962 1.00 0.00 ? 181 PHE A CD2  4  
ATOM   6960  C  CE1  . PHE A 1 27  ? -10.845 9.338   -10.289 1.00 0.00 ? 181 PHE A CE1  4  
ATOM   6961  C  CE2  . PHE A 1 27  ? -11.619 10.840  -12.026 1.00 0.00 ? 181 PHE A CE2  4  
ATOM   6962  C  CZ   . PHE A 1 27  ? -11.272 10.608  -10.691 1.00 0.00 ? 181 PHE A CZ   4  
ATOM   6963  H  H    . PHE A 1 27  ? -11.912 5.398   -15.069 1.00 0.00 ? 181 PHE A H    4  
ATOM   6964  H  HA   . PHE A 1 27  ? -11.192 5.788   -12.179 1.00 0.00 ? 181 PHE A HA   4  
ATOM   6965  H  HB2  . PHE A 1 27  ? -9.978  7.201   -13.786 1.00 0.00 ? 181 PHE A HB2  4  
ATOM   6966  H  HB3  . PHE A 1 27  ? -11.500 7.729   -14.498 1.00 0.00 ? 181 PHE A HB3  4  
ATOM   6967  H  HD1  . PHE A 1 27  ? -10.433 7.319   -10.909 1.00 0.00 ? 181 PHE A HD1  4  
ATOM   6968  H  HD2  . PHE A 1 27  ? -11.802 9.983   -13.992 1.00 0.00 ? 181 PHE A HD2  4  
ATOM   6969  H  HE1  . PHE A 1 27  ? -10.578 9.159   -9.258  1.00 0.00 ? 181 PHE A HE1  4  
ATOM   6970  H  HE2  . PHE A 1 27  ? -11.949 11.821  -12.336 1.00 0.00 ? 181 PHE A HE2  4  
ATOM   6971  H  HZ   . PHE A 1 27  ? -11.335 11.410  -9.970  1.00 0.00 ? 181 PHE A HZ   4  
ATOM   6972  N  N    . GLN A 1 28  ? -13.707 5.828   -11.686 1.00 0.00 ? 182 GLN A N    4  
ATOM   6973  C  CA   . GLN A 1 28  ? -15.146 6.047   -11.341 1.00 0.00 ? 182 GLN A CA   4  
ATOM   6974  C  C    . GLN A 1 28  ? -15.260 6.873   -10.049 1.00 0.00 ? 182 GLN A C    4  
ATOM   6975  O  O    . GLN A 1 28  ? -14.373 6.849   -9.216  1.00 0.00 ? 182 GLN A O    4  
ATOM   6976  C  CB   . GLN A 1 28  ? -15.728 4.646   -11.141 1.00 0.00 ? 182 GLN A CB   4  
ATOM   6977  C  CG   . GLN A 1 28  ? -17.239 4.742   -10.933 1.00 0.00 ? 182 GLN A CG   4  
ATOM   6978  C  CD   . GLN A 1 28  ? -17.924 5.046   -12.271 1.00 0.00 ? 182 GLN A CD   4  
ATOM   6979  O  OE1  . GLN A 1 28  ? -18.117 6.196   -12.614 1.00 0.00 ? 182 GLN A OE1  4  
ATOM   6980  N  NE2  . GLN A 1 28  ? -18.304 4.063   -13.050 1.00 0.00 ? 182 GLN A NE2  4  
ATOM   6981  H  H    . GLN A 1 28  ? -13.154 5.247   -11.118 1.00 0.00 ? 182 GLN A H    4  
ATOM   6982  H  HA   . GLN A 1 28  ? -15.653 6.546   -12.151 1.00 0.00 ? 182 GLN A HA   4  
ATOM   6983  H  HB2  . GLN A 1 28  ? -15.521 4.043   -12.013 1.00 0.00 ? 182 GLN A HB2  4  
ATOM   6984  H  HB3  . GLN A 1 28  ? -15.279 4.192   -10.275 1.00 0.00 ? 182 GLN A HB3  4  
ATOM   6985  H  HG2  . GLN A 1 28  ? -17.607 3.805   -10.542 1.00 0.00 ? 182 GLN A HG2  4  
ATOM   6986  H  HG3  . GLN A 1 28  ? -17.454 5.532   -10.232 1.00 0.00 ? 182 GLN A HG3  4  
ATOM   6987  H  HE21 . GLN A 1 28  ? -18.153 3.130   -12.782 1.00 0.00 ? 182 GLN A HE21 4  
ATOM   6988  H  HE22 . GLN A 1 28  ? -18.741 4.259   -13.905 1.00 0.00 ? 182 GLN A HE22 4  
ATOM   6989  N  N    . LYS A 1 29  ? -16.339 7.611   -9.878  1.00 0.00 ? 183 LYS A N    4  
ATOM   6990  C  CA   . LYS A 1 29  ? -16.487 8.450   -8.630  1.00 0.00 ? 183 LYS A CA   4  
ATOM   6991  C  C    . LYS A 1 29  ? -16.298 7.611   -7.348  1.00 0.00 ? 183 LYS A C    4  
ATOM   6992  O  O    . LYS A 1 29  ? -15.901 8.138   -6.325  1.00 0.00 ? 183 LYS A O    4  
ATOM   6993  C  CB   . LYS A 1 29  ? -17.902 9.053   -8.663  1.00 0.00 ? 183 LYS A CB   4  
ATOM   6994  C  CG   . LYS A 1 29  ? -18.950 7.936   -8.685  1.00 0.00 ? 183 LYS A CG   4  
ATOM   6995  C  CD   . LYS A 1 29  ? -20.317 8.512   -8.313  1.00 0.00 ? 183 LYS A CD   4  
ATOM   6996  C  CE   . LYS A 1 29  ? -21.399 7.458   -8.555  1.00 0.00 ? 183 LYS A CE   4  
ATOM   6997  N  NZ   . LYS A 1 29  ? -21.558 6.763   -7.247  1.00 0.00 ? 183 LYS A NZ   4  
ATOM   6998  H  H    . LYS A 1 29  ? -17.039 7.625   -10.574 1.00 0.00 ? 183 LYS A H    4  
ATOM   6999  H  HA   . LYS A 1 29  ? -15.763 9.244   -8.648  1.00 0.00 ? 183 LYS A HA   4  
ATOM   7000  H  HB2  . LYS A 1 29  ? -18.050 9.666   -7.786  1.00 0.00 ? 183 LYS A HB2  4  
ATOM   7001  H  HB3  . LYS A 1 29  ? -18.012 9.663   -9.548  1.00 0.00 ? 183 LYS A HB3  4  
ATOM   7002  H  HG2  . LYS A 1 29  ? -18.999 7.506   -9.675  1.00 0.00 ? 183 LYS A HG2  4  
ATOM   7003  H  HG3  . LYS A 1 29  ? -18.679 7.172   -7.974  1.00 0.00 ? 183 LYS A HG3  4  
ATOM   7004  H  HD2  . LYS A 1 29  ? -20.316 8.796   -7.271  1.00 0.00 ? 183 LYS A HD2  4  
ATOM   7005  H  HD3  . LYS A 1 29  ? -20.521 9.380   -8.923  1.00 0.00 ? 183 LYS A HD3  4  
ATOM   7006  H  HE2  . LYS A 1 29  ? -22.326 7.932   -8.846  1.00 0.00 ? 183 LYS A HE2  4  
ATOM   7007  H  HE3  . LYS A 1 29  ? -21.080 6.756   -9.309  1.00 0.00 ? 183 LYS A HE3  4  
ATOM   7008  H  HZ1  . LYS A 1 29  ? -21.791 7.459   -6.510  1.00 0.00 ? 183 LYS A HZ1  4  
ATOM   7009  H  HZ2  . LYS A 1 29  ? -20.669 6.281   -7.001  1.00 0.00 ? 183 LYS A HZ2  4  
ATOM   7010  H  HZ3  . LYS A 1 29  ? -22.325 6.064   -7.315  1.00 0.00 ? 183 LYS A HZ3  4  
ATOM   7011  N  N    . ASP A 1 30  ? -16.586 6.325   -7.373  1.00 0.00 ? 184 ASP A N    4  
ATOM   7012  C  CA   . ASP A 1 30  ? -16.425 5.505   -6.132  1.00 0.00 ? 184 ASP A CA   4  
ATOM   7013  C  C    . ASP A 1 30  ? -15.647 4.204   -6.403  1.00 0.00 ? 184 ASP A C    4  
ATOM   7014  O  O    . ASP A 1 30  ? -15.886 3.204   -5.752  1.00 0.00 ? 184 ASP A O    4  
ATOM   7015  C  CB   . ASP A 1 30  ? -17.852 5.186   -5.688  1.00 0.00 ? 184 ASP A CB   4  
ATOM   7016  C  CG   . ASP A 1 30  ? -18.373 6.311   -4.793  1.00 0.00 ? 184 ASP A CG   4  
ATOM   7017  O  OD1  . ASP A 1 30  ? -17.778 6.537   -3.751  1.00 0.00 ? 184 ASP A OD1  4  
ATOM   7018  O  OD2  . ASP A 1 30  ? -19.358 6.928   -5.163  1.00 0.00 ? 184 ASP A OD2  4  
ATOM   7019  H  H    . ASP A 1 30  ? -16.915 5.905   -8.191  1.00 0.00 ? 184 ASP A H    4  
ATOM   7020  H  HA   . ASP A 1 30  ? -15.928 6.081   -5.369  1.00 0.00 ? 184 ASP A HA   4  
ATOM   7021  H  HB2  . ASP A 1 30  ? -18.487 5.092   -6.557  1.00 0.00 ? 184 ASP A HB2  4  
ATOM   7022  H  HB3  . ASP A 1 30  ? -17.858 4.258   -5.136  1.00 0.00 ? 184 ASP A HB3  4  
ATOM   7023  N  N    . SER A 1 31  ? -14.707 4.202   -7.329  1.00 0.00 ? 185 SER A N    4  
ATOM   7024  C  CA   . SER A 1 31  ? -13.925 2.942   -7.580  1.00 0.00 ? 185 SER A CA   4  
ATOM   7025  C  C    . SER A 1 31  ? -12.683 2.916   -6.675  1.00 0.00 ? 185 SER A C    4  
ATOM   7026  O  O    . SER A 1 31  ? -12.606 2.119   -5.767  1.00 0.00 ? 185 SER A O    4  
ATOM   7027  C  CB   . SER A 1 31  ? -13.516 2.959   -9.057  1.00 0.00 ? 185 SER A CB   4  
ATOM   7028  O  OG   . SER A 1 31  ? -14.487 2.255   -9.822  1.00 0.00 ? 185 SER A OG   4  
ATOM   7029  H  H    . SER A 1 31  ? -14.509 5.022   -7.838  1.00 0.00 ? 185 SER A H    4  
ATOM   7030  H  HA   . SER A 1 31  ? -14.543 2.079   -7.380  1.00 0.00 ? 185 SER A HA   4  
ATOM   7031  H  HB2  . SER A 1 31  ? -13.458 3.974   -9.406  1.00 0.00 ? 185 SER A HB2  4  
ATOM   7032  H  HB3  . SER A 1 31  ? -12.548 2.488   -9.167  1.00 0.00 ? 185 SER A HB3  4  
ATOM   7033  H  HG   . SER A 1 31  ? -14.231 2.306   -10.745 1.00 0.00 ? 185 SER A HG   4  
ATOM   7034  N  N    . ILE A 1 32  ? -11.707 3.774   -6.913  1.00 0.00 ? 186 ILE A N    4  
ATOM   7035  C  CA   . ILE A 1 32  ? -10.465 3.777   -6.043  1.00 0.00 ? 186 ILE A CA   4  
ATOM   7036  C  C    . ILE A 1 32  ? -10.824 3.798   -4.546  1.00 0.00 ? 186 ILE A C    4  
ATOM   7037  O  O    . ILE A 1 32  ? -11.904 4.209   -4.165  1.00 0.00 ? 186 ILE A O    4  
ATOM   7038  C  CB   . ILE A 1 32  ? -9.665  5.046   -6.391  1.00 0.00 ? 186 ILE A CB   4  
ATOM   7039  C  CG1  . ILE A 1 32  ? -10.545 6.289   -6.195  1.00 0.00 ? 186 ILE A CG1  4  
ATOM   7040  C  CG2  . ILE A 1 32  ? -9.184  4.979   -7.839  1.00 0.00 ? 186 ILE A CG2  4  
ATOM   7041  C  CD1  . ILE A 1 32  ? -9.687  7.545   -6.337  1.00 0.00 ? 186 ILE A CD1  4  
ATOM   7042  H  H    . ILE A 1 32  ? -11.787 4.405   -7.665  1.00 0.00 ? 186 ILE A H    4  
ATOM   7043  H  HA   . ILE A 1 32  ? -9.866  2.904   -6.253  1.00 0.00 ? 186 ILE A HA   4  
ATOM   7044  H  HB   . ILE A 1 32  ? -8.807  5.112   -5.737  1.00 0.00 ? 186 ILE A HB   4  
ATOM   7045  H  HG12 . ILE A 1 32  ? -11.325 6.306   -6.940  1.00 0.00 ? 186 ILE A HG12 4  
ATOM   7046  H  HG13 . ILE A 1 32  ? -10.986 6.267   -5.211  1.00 0.00 ? 186 ILE A HG13 4  
ATOM   7047  H  HG21 . ILE A 1 32  ? -9.987  5.268   -8.500  1.00 0.00 ? 186 ILE A HG21 4  
ATOM   7048  H  HG22 . ILE A 1 32  ? -8.874  3.969   -8.067  1.00 0.00 ? 186 ILE A HG22 4  
ATOM   7049  H  HG23 . ILE A 1 32  ? -8.349  5.654   -7.971  1.00 0.00 ? 186 ILE A HG23 4  
ATOM   7050  H  HD11 . ILE A 1 32  ? -8.712  7.365   -5.911  1.00 0.00 ? 186 ILE A HD11 4  
ATOM   7051  H  HD12 . ILE A 1 32  ? -10.162 8.364   -5.818  1.00 0.00 ? 186 ILE A HD12 4  
ATOM   7052  H  HD13 . ILE A 1 32  ? -9.583  7.794   -7.383  1.00 0.00 ? 186 ILE A HD13 4  
ATOM   7053  N  N    . TYR A 1 33  ? -9.918  3.358   -3.697  1.00 0.00 ? 187 TYR A N    4  
ATOM   7054  C  CA   . TYR A 1 33  ? -10.193 3.350   -2.228  1.00 0.00 ? 187 TYR A CA   4  
ATOM   7055  C  C    . TYR A 1 33  ? -8.961  3.818   -1.452  1.00 0.00 ? 187 TYR A C    4  
ATOM   7056  O  O    . TYR A 1 33  ? -7.892  3.984   -2.008  1.00 0.00 ? 187 TYR A O    4  
ATOM   7057  C  CB   . TYR A 1 33  ? -10.498 1.894   -1.883  1.00 0.00 ? 187 TYR A CB   4  
ATOM   7058  C  CG   . TYR A 1 33  ? -11.982 1.652   -1.965  1.00 0.00 ? 187 TYR A CG   4  
ATOM   7059  C  CD1  . TYR A 1 33  ? -12.794 1.868   -0.844  1.00 0.00 ? 187 TYR A CD1  4  
ATOM   7060  C  CD2  . TYR A 1 33  ? -12.545 1.204   -3.161  1.00 0.00 ? 187 TYR A CD2  4  
ATOM   7061  C  CE1  . TYR A 1 33  ? -14.172 1.635   -0.926  1.00 0.00 ? 187 TYR A CE1  4  
ATOM   7062  C  CE2  . TYR A 1 33  ? -13.920 0.972   -3.245  1.00 0.00 ? 187 TYR A CE2  4  
ATOM   7063  C  CZ   . TYR A 1 33  ? -14.736 1.188   -2.127  1.00 0.00 ? 187 TYR A CZ   4  
ATOM   7064  O  OH   . TYR A 1 33  ? -16.094 0.958   -2.209  1.00 0.00 ? 187 TYR A OH   4  
ATOM   7065  H  H    . TYR A 1 33  ? -9.051  3.031   -4.027  1.00 0.00 ? 187 TYR A H    4  
ATOM   7066  H  HA   . TYR A 1 33  ? -11.039 3.973   -1.986  1.00 0.00 ? 187 TYR A HA   4  
ATOM   7067  H  HB2  . TYR A 1 33  ? -9.988  1.245   -2.581  1.00 0.00 ? 187 TYR A HB2  4  
ATOM   7068  H  HB3  . TYR A 1 33  ? -10.154 1.683   -0.881  1.00 0.00 ? 187 TYR A HB3  4  
ATOM   7069  H  HD1  . TYR A 1 33  ? -12.358 2.213   0.081   1.00 0.00 ? 187 TYR A HD1  4  
ATOM   7070  H  HD2  . TYR A 1 33  ? -11.912 1.035   -4.022  1.00 0.00 ? 187 TYR A HD2  4  
ATOM   7071  H  HE1  . TYR A 1 33  ? -14.799 1.801   -0.061  1.00 0.00 ? 187 TYR A HE1  4  
ATOM   7072  H  HE2  . TYR A 1 33  ? -14.352 0.625   -4.174  1.00 0.00 ? 187 TYR A HE2  4  
ATOM   7073  H  HH   . TYR A 1 33  ? -16.234 0.009   -2.240  1.00 0.00 ? 187 TYR A HH   4  
ATOM   7074  N  N    . ARG A 1 34  ? -9.103  4.023   -0.164  1.00 0.00 ? 188 ARG A N    4  
ATOM   7075  C  CA   . ARG A 1 34  ? -7.941  4.470   0.659   1.00 0.00 ? 188 ARG A CA   4  
ATOM   7076  C  C    . ARG A 1 34  ? -7.560  3.370   1.658   1.00 0.00 ? 188 ARG A C    4  
ATOM   7077  O  O    . ARG A 1 34  ? -8.423  2.729   2.230   1.00 0.00 ? 188 ARG A O    4  
ATOM   7078  C  CB   . ARG A 1 34  ? -8.426  5.717   1.400   1.00 0.00 ? 188 ARG A CB   4  
ATOM   7079  C  CG   . ARG A 1 34  ? -8.498  6.896   0.429   1.00 0.00 ? 188 ARG A CG   4  
ATOM   7080  C  CD   . ARG A 1 34  ? -8.209  8.197   1.183   1.00 0.00 ? 188 ARG A CD   4  
ATOM   7081  N  NE   . ARG A 1 34  ? -8.998  9.243   0.464   1.00 0.00 ? 188 ARG A NE   4  
ATOM   7082  C  CZ   . ARG A 1 34  ? -10.316 9.312   0.579   1.00 0.00 ? 188 ARG A CZ   4  
ATOM   7083  N  NH1  . ARG A 1 34  ? -10.983 8.463   1.328   1.00 0.00 ? 188 ARG A NH1  4  
ATOM   7084  N  NH2  . ARG A 1 34  ? -10.973 10.241  -0.065  1.00 0.00 ? 188 ARG A NH2  4  
ATOM   7085  H  H    . ARG A 1 34  ? -9.978  3.874   0.266   1.00 0.00 ? 188 ARG A H    4  
ATOM   7086  H  HA   . ARG A 1 34  ? -7.102  4.716   0.027   1.00 0.00 ? 188 ARG A HA   4  
ATOM   7087  H  HB2  . ARG A 1 34  ? -9.407  5.531   1.814   1.00 0.00 ? 188 ARG A HB2  4  
ATOM   7088  H  HB3  . ARG A 1 34  ? -7.738  5.952   2.198   1.00 0.00 ? 188 ARG A HB3  4  
ATOM   7089  H  HG2  . ARG A 1 34  ? -7.768  6.762   -0.355  1.00 0.00 ? 188 ARG A HG2  4  
ATOM   7090  H  HG3  . ARG A 1 34  ? -9.486  6.947   -0.003  1.00 0.00 ? 188 ARG A HG3  4  
ATOM   7091  H  HD2  . ARG A 1 34  ? -8.535  8.114   2.210   1.00 0.00 ? 188 ARG A HD2  4  
ATOM   7092  H  HD3  . ARG A 1 34  ? -7.156  8.432   1.137   1.00 0.00 ? 188 ARG A HD3  4  
ATOM   7093  H  HE   . ARG A 1 34  ? -8.526  9.891   -0.103  1.00 0.00 ? 188 ARG A HE   4  
ATOM   7094  H  HH11 . ARG A 1 34  ? -10.504 7.744   1.829   1.00 0.00 ? 188 ARG A HH11 4  
ATOM   7095  H  HH12 . ARG A 1 34  ? -11.978 8.538   1.396   1.00 0.00 ? 188 ARG A HH12 4  
ATOM   7096  H  HH21 . ARG A 1 34  ? -10.481 10.896  -0.639  1.00 0.00 ? 188 ARG A HH21 4  
ATOM   7097  H  HH22 . ARG A 1 34  ? -11.968 10.299  0.018   1.00 0.00 ? 188 ARG A HH22 4  
ATOM   7098  N  N    . HIS A 1 35  ? -6.281  3.147   1.889   1.00 0.00 ? 189 HIS A N    4  
ATOM   7099  C  CA   . HIS A 1 35  ? -5.885  2.083   2.874   1.00 0.00 ? 189 HIS A CA   4  
ATOM   7100  C  C    . HIS A 1 35  ? -6.278  2.558   4.283   1.00 0.00 ? 189 HIS A C    4  
ATOM   7101  O  O    . HIS A 1 35  ? -6.006  3.689   4.637   1.00 0.00 ? 189 HIS A O    4  
ATOM   7102  C  CB   . HIS A 1 35  ? -4.363  1.918   2.753   1.00 0.00 ? 189 HIS A CB   4  
ATOM   7103  C  CG   . HIS A 1 35  ? -3.980  0.496   3.075   1.00 0.00 ? 189 HIS A CG   4  
ATOM   7104  N  ND1  . HIS A 1 35  ? -3.596  0.103   4.344   1.00 0.00 ? 189 HIS A ND1  4  
ATOM   7105  C  CD2  . HIS A 1 35  ? -3.944  -0.642  2.309   1.00 0.00 ? 189 HIS A CD2  4  
ATOM   7106  C  CE1  . HIS A 1 35  ? -3.360  -1.217  4.313   1.00 0.00 ? 189 HIS A CE1  4  
ATOM   7107  N  NE2  . HIS A 1 35  ? -3.555  -1.725  3.094   1.00 0.00 ? 189 HIS A NE2  4  
ATOM   7108  H  H    . HIS A 1 35  ? -5.594  3.682   1.430   1.00 0.00 ? 189 HIS A H    4  
ATOM   7109  H  HA   . HIS A 1 35  ? -6.380  1.156   2.632   1.00 0.00 ? 189 HIS A HA   4  
ATOM   7110  H  HB2  . HIS A 1 35  ? -4.056  2.152   1.744   1.00 0.00 ? 189 HIS A HB2  4  
ATOM   7111  H  HB3  . HIS A 1 35  ? -3.879  2.591   3.440   1.00 0.00 ? 189 HIS A HB3  4  
ATOM   7112  H  HD1  . HIS A 1 35  ? -3.484  0.682   5.113   1.00 0.00 ? 189 HIS A HD1  4  
ATOM   7113  H  HD2  . HIS A 1 35  ? -4.165  -0.687  1.255   1.00 0.00 ? 189 HIS A HD2  4  
ATOM   7114  H  HE1  . HIS A 1 35  ? -3.063  -1.796  5.176   1.00 0.00 ? 189 HIS A HE1  4  
ATOM   7115  N  N    . PRO A 1 36  ? -6.931  1.704   5.042   1.00 0.00 ? 190 PRO A N    4  
ATOM   7116  C  CA   . PRO A 1 36  ? -7.375  2.103   6.403   1.00 0.00 ? 190 PRO A CA   4  
ATOM   7117  C  C    . PRO A 1 36  ? -6.185  2.216   7.372   1.00 0.00 ? 190 PRO A C    4  
ATOM   7118  O  O    . PRO A 1 36  ? -6.173  3.075   8.234   1.00 0.00 ? 190 PRO A O    4  
ATOM   7119  C  CB   . PRO A 1 36  ? -8.317  0.976   6.819   1.00 0.00 ? 190 PRO A CB   4  
ATOM   7120  C  CG   . PRO A 1 36  ? -7.882  -0.209  6.021   1.00 0.00 ? 190 PRO A CG   4  
ATOM   7121  C  CD   . PRO A 1 36  ? -7.313  0.315   4.729   1.00 0.00 ? 190 PRO A CD   4  
ATOM   7122  H  HA   . PRO A 1 36  ? -7.917  3.034   6.363   1.00 0.00 ? 190 PRO A HA   4  
ATOM   7123  H  HB2  . PRO A 1 36  ? -8.220  0.778   7.877   1.00 0.00 ? 190 PRO A HB2  4  
ATOM   7124  H  HB3  . PRO A 1 36  ? -9.337  1.232   6.572   1.00 0.00 ? 190 PRO A HB3  4  
ATOM   7125  H  HG2  . PRO A 1 36  ? -7.128  -0.762  6.563   1.00 0.00 ? 190 PRO A HG2  4  
ATOM   7126  H  HG3  . PRO A 1 36  ? -8.728  -0.845  5.812   1.00 0.00 ? 190 PRO A HG3  4  
ATOM   7127  H  HD2  . PRO A 1 36  ? -6.445  -0.264  4.438   1.00 0.00 ? 190 PRO A HD2  4  
ATOM   7128  H  HD3  . PRO A 1 36  ? -8.059  0.301   3.952   1.00 0.00 ? 190 PRO A HD3  4  
ATOM   7129  N  N    . SER A 1 37  ? -5.194  1.355   7.259   1.00 0.00 ? 191 SER A N    4  
ATOM   7130  C  CA   . SER A 1 37  ? -4.030  1.433   8.208   1.00 0.00 ? 191 SER A CA   4  
ATOM   7131  C  C    . SER A 1 37  ? -2.754  2.018   7.555   1.00 0.00 ? 191 SER A C    4  
ATOM   7132  O  O    . SER A 1 37  ? -1.675  1.846   8.090   1.00 0.00 ? 191 SER A O    4  
ATOM   7133  C  CB   . SER A 1 37  ? -3.772  -0.014  8.639   1.00 0.00 ? 191 SER A CB   4  
ATOM   7134  O  OG   . SER A 1 37  ? -4.907  -0.504  9.340   1.00 0.00 ? 191 SER A OG   4  
ATOM   7135  H  H    . SER A 1 37  ? -5.223  0.654   6.568   1.00 0.00 ? 191 SER A H    4  
ATOM   7136  H  HA   . SER A 1 37  ? -4.299  2.018   9.071   1.00 0.00 ? 191 SER A HA   4  
ATOM   7137  H  HB2  . SER A 1 37  ? -3.600  -0.626  7.767   1.00 0.00 ? 191 SER A HB2  4  
ATOM   7138  H  HB3  . SER A 1 37  ? -2.899  -0.048  9.278   1.00 0.00 ? 191 SER A HB3  4  
ATOM   7139  H  HG   . SER A 1 37  ? -4.745  -1.424  9.561   1.00 0.00 ? 191 SER A HG   4  
ATOM   7140  N  N    . LEU A 1 38  ? -2.840  2.688   6.415   1.00 0.00 ? 192 LEU A N    4  
ATOM   7141  C  CA   . LEU A 1 38  ? -1.580  3.232   5.792   1.00 0.00 ? 192 LEU A CA   4  
ATOM   7142  C  C    . LEU A 1 38  ? -1.720  4.655   5.196   1.00 0.00 ? 192 LEU A C    4  
ATOM   7143  O  O    . LEU A 1 38  ? -0.776  5.139   4.600   1.00 0.00 ? 192 LEU A O    4  
ATOM   7144  C  CB   . LEU A 1 38  ? -1.243  2.259   4.654   1.00 0.00 ? 192 LEU A CB   4  
ATOM   7145  C  CG   . LEU A 1 38  ? -0.685  0.936   5.191   1.00 0.00 ? 192 LEU A CG   4  
ATOM   7146  C  CD1  . LEU A 1 38  ? -0.304  0.053   4.000   1.00 0.00 ? 192 LEU A CD1  4  
ATOM   7147  C  CD2  . LEU A 1 38  ? 0.563   1.196   6.042   1.00 0.00 ? 192 LEU A CD2  4  
ATOM   7148  H  H    . LEU A 1 38  ? -3.703  2.810   5.973   1.00 0.00 ? 192 LEU A H    4  
ATOM   7149  H  HA   . LEU A 1 38  ? -0.781  3.219   6.514   1.00 0.00 ? 192 LEU A HA   4  
ATOM   7150  H  HB2  . LEU A 1 38  ? -2.136  2.056   4.087   1.00 0.00 ? 192 LEU A HB2  4  
ATOM   7151  H  HB3  . LEU A 1 38  ? -0.509  2.715   4.007   1.00 0.00 ? 192 LEU A HB3  4  
ATOM   7152  H  HG   . LEU A 1 38  ? -1.438  0.438   5.787   1.00 0.00 ? 192 LEU A HG   4  
ATOM   7153  H  HD11 . LEU A 1 38  ? -1.199  -0.287  3.495   1.00 0.00 ? 192 LEU A HD11 4  
ATOM   7154  H  HD12 . LEU A 1 38  ? 0.261   -0.802  4.346   1.00 0.00 ? 192 LEU A HD12 4  
ATOM   7155  H  HD13 . LEU A 1 38  ? 0.300   0.630   3.311   1.00 0.00 ? 192 LEU A HD13 4  
ATOM   7156  H  HD21 . LEU A 1 38  ? 0.268   1.438   7.052   1.00 0.00 ? 192 LEU A HD21 4  
ATOM   7157  H  HD22 . LEU A 1 38  ? 1.115   2.023   5.623   1.00 0.00 ? 192 LEU A HD22 4  
ATOM   7158  H  HD23 . LEU A 1 38  ? 1.185   0.313   6.050   1.00 0.00 ? 192 LEU A HD23 4  
ATOM   7159  N  N    . GLN A 1 39  ? -2.850  5.339   5.324   1.00 0.00 ? 193 GLN A N    4  
ATOM   7160  C  CA   . GLN A 1 39  ? -2.973  6.716   4.726   1.00 0.00 ? 193 GLN A CA   4  
ATOM   7161  C  C    . GLN A 1 39  ? -2.510  6.711   3.254   1.00 0.00 ? 193 GLN A C    4  
ATOM   7162  O  O    . GLN A 1 39  ? -1.802  7.599   2.821   1.00 0.00 ? 193 GLN A O    4  
ATOM   7163  C  CB   . GLN A 1 39  ? -2.056  7.604   5.572   1.00 0.00 ? 193 GLN A CB   4  
ATOM   7164  C  CG   . GLN A 1 39  ? -2.877  8.302   6.658   1.00 0.00 ? 193 GLN A CG   4  
ATOM   7165  C  CD   . GLN A 1 39  ? -3.419  7.257   7.641   1.00 0.00 ? 193 GLN A CD   4  
ATOM   7166  O  OE1  . GLN A 1 39  ? -2.675  6.435   8.136   1.00 0.00 ? 193 GLN A OE1  4  
ATOM   7167  N  NE2  . GLN A 1 39  ? -4.694  7.251   7.951   1.00 0.00 ? 193 GLN A NE2  4  
ATOM   7168  H  H    . GLN A 1 39  ? -3.610  4.963   5.801   1.00 0.00 ? 193 GLN A H    4  
ATOM   7169  H  HA   . GLN A 1 39  ? -3.992  7.064   4.796   1.00 0.00 ? 193 GLN A HA   4  
ATOM   7170  H  HB2  . GLN A 1 39  ? -1.293  6.994   6.033   1.00 0.00 ? 193 GLN A HB2  4  
ATOM   7171  H  HB3  . GLN A 1 39  ? -1.590  8.346   4.941   1.00 0.00 ? 193 GLN A HB3  4  
ATOM   7172  H  HG2  . GLN A 1 39  ? -2.250  9.004   7.188   1.00 0.00 ? 193 GLN A HG2  4  
ATOM   7173  H  HG3  . GLN A 1 39  ? -3.703  8.828   6.203   1.00 0.00 ? 193 GLN A HG3  4  
ATOM   7174  H  HE21 . GLN A 1 39  ? -5.305  7.911   7.558   1.00 0.00 ? 193 GLN A HE21 4  
ATOM   7175  H  HE22 . GLN A 1 39  ? -5.039  6.582   8.579   1.00 0.00 ? 193 GLN A HE22 4  
ATOM   7176  N  N    . VAL A 1 40  ? -2.888  5.707   2.489   1.00 0.00 ? 194 VAL A N    4  
ATOM   7177  C  CA   . VAL A 1 40  ? -2.450  5.640   1.060   1.00 0.00 ? 194 VAL A CA   4  
ATOM   7178  C  C    . VAL A 1 40  ? -3.617  5.199   0.161   1.00 0.00 ? 194 VAL A C    4  
ATOM   7179  O  O    . VAL A 1 40  ? -4.623  4.718   0.642   1.00 0.00 ? 194 VAL A O    4  
ATOM   7180  C  CB   . VAL A 1 40  ? -1.300  4.620   1.061   1.00 0.00 ? 194 VAL A CB   4  
ATOM   7181  C  CG1  . VAL A 1 40  ? -1.817  3.223   1.425   1.00 0.00 ? 194 VAL A CG1  4  
ATOM   7182  C  CG2  . VAL A 1 40  ? -0.646  4.579   -0.320  1.00 0.00 ? 194 VAL A CG2  4  
ATOM   7183  H  H    . VAL A 1 40  ? -3.452  4.989   2.855   1.00 0.00 ? 194 VAL A H    4  
ATOM   7184  H  HA   . VAL A 1 40  ? -2.084  6.599   0.731   1.00 0.00 ? 194 VAL A HA   4  
ATOM   7185  H  HB   . VAL A 1 40  ? -0.564  4.922   1.793   1.00 0.00 ? 194 VAL A HB   4  
ATOM   7186  H  HG11 . VAL A 1 40  ? -2.287  3.254   2.395   1.00 0.00 ? 194 VAL A HG11 4  
ATOM   7187  H  HG12 . VAL A 1 40  ? -0.991  2.532   1.450   1.00 0.00 ? 194 VAL A HG12 4  
ATOM   7188  H  HG13 . VAL A 1 40  ? -2.535  2.900   0.686   1.00 0.00 ? 194 VAL A HG13 4  
ATOM   7189  H  HG21 . VAL A 1 40  ? -1.337  4.158   -1.035  1.00 0.00 ? 194 VAL A HG21 4  
ATOM   7190  H  HG22 . VAL A 1 40  ? 0.246   3.972   -0.279  1.00 0.00 ? 194 VAL A HG22 4  
ATOM   7191  H  HG23 . VAL A 1 40  ? -0.383  5.583   -0.622  1.00 0.00 ? 194 VAL A HG23 4  
ATOM   7192  N  N    . LEU A 1 41  ? -3.501  5.382   -1.137  1.00 0.00 ? 195 LEU A N    4  
ATOM   7193  C  CA   . LEU A 1 41  ? -4.634  4.989   -2.051  1.00 0.00 ? 195 LEU A CA   4  
ATOM   7194  C  C    . LEU A 1 41  ? -4.467  3.560   -2.598  1.00 0.00 ? 195 LEU A C    4  
ATOM   7195  O  O    . LEU A 1 41  ? -3.368  3.098   -2.833  1.00 0.00 ? 195 LEU A O    4  
ATOM   7196  C  CB   . LEU A 1 41  ? -4.611  5.989   -3.212  1.00 0.00 ? 195 LEU A CB   4  
ATOM   7197  C  CG   . LEU A 1 41  ? -5.987  6.024   -3.880  1.00 0.00 ? 195 LEU A CG   4  
ATOM   7198  C  CD1  . LEU A 1 41  ? -6.288  7.443   -4.361  1.00 0.00 ? 195 LEU A CD1  4  
ATOM   7199  C  CD2  . LEU A 1 41  ? -5.997  5.067   -5.077  1.00 0.00 ? 195 LEU A CD2  4  
ATOM   7200  H  H    . LEU A 1 41  ? -2.684  5.793   -1.504  1.00 0.00 ? 195 LEU A H    4  
ATOM   7201  H  HA   . LEU A 1 41  ? -5.573  5.073   -1.526  1.00 0.00 ? 195 LEU A HA   4  
ATOM   7202  H  HB2  . LEU A 1 41  ? -4.365  6.969   -2.837  1.00 0.00 ? 195 LEU A HB2  4  
ATOM   7203  H  HB3  . LEU A 1 41  ? -3.869  5.684   -3.935  1.00 0.00 ? 195 LEU A HB3  4  
ATOM   7204  H  HG   . LEU A 1 41  ? -6.740  5.719   -3.168  1.00 0.00 ? 195 LEU A HG   4  
ATOM   7205  H  HD11 . LEU A 1 41  ? -7.354  7.565   -4.479  1.00 0.00 ? 195 LEU A HD11 4  
ATOM   7206  H  HD12 . LEU A 1 41  ? -5.799  7.614   -5.308  1.00 0.00 ? 195 LEU A HD12 4  
ATOM   7207  H  HD13 . LEU A 1 41  ? -5.923  8.153   -3.634  1.00 0.00 ? 195 LEU A HD13 4  
ATOM   7208  H  HD21 . LEU A 1 41  ? -5.786  5.618   -5.982  1.00 0.00 ? 195 LEU A HD21 4  
ATOM   7209  H  HD22 . LEU A 1 41  ? -6.969  4.602   -5.158  1.00 0.00 ? 195 LEU A HD22 4  
ATOM   7210  H  HD23 . LEU A 1 41  ? -5.246  4.304   -4.936  1.00 0.00 ? 195 LEU A HD23 4  
ATOM   7211  N  N    . ILE A 1 42  ? -5.568  2.868   -2.824  1.00 0.00 ? 196 ILE A N    4  
ATOM   7212  C  CA   . ILE A 1 42  ? -5.505  1.480   -3.380  1.00 0.00 ? 196 ILE A CA   4  
ATOM   7213  C  C    . ILE A 1 42  ? -6.658  1.294   -4.390  1.00 0.00 ? 196 ILE A C    4  
ATOM   7214  O  O    . ILE A 1 42  ? -7.248  2.266   -4.825  1.00 0.00 ? 196 ILE A O    4  
ATOM   7215  C  CB   . ILE A 1 42  ? -5.647  0.538   -2.169  1.00 0.00 ? 196 ILE A CB   4  
ATOM   7216  C  CG1  . ILE A 1 42  ? -6.916  0.884   -1.377  1.00 0.00 ? 196 ILE A CG1  4  
ATOM   7217  C  CG2  . ILE A 1 42  ? -4.418  0.683   -1.263  1.00 0.00 ? 196 ILE A CG2  4  
ATOM   7218  C  CD1  . ILE A 1 42  ? -7.111  -0.132  -0.247  1.00 0.00 ? 196 ILE A CD1  4  
ATOM   7219  H  H    . ILE A 1 42  ? -6.448  3.271   -2.640  1.00 0.00 ? 196 ILE A H    4  
ATOM   7220  H  HA   . ILE A 1 42  ? -4.557  1.313   -3.868  1.00 0.00 ? 196 ILE A HA   4  
ATOM   7221  H  HB   . ILE A 1 42  ? -5.705  -0.483  -2.511  1.00 0.00 ? 196 ILE A HB   4  
ATOM   7222  H  HG12 . ILE A 1 42  ? -6.818  1.875   -0.957  1.00 0.00 ? 196 ILE A HG12 4  
ATOM   7223  H  HG13 . ILE A 1 42  ? -7.770  0.854   -2.035  1.00 0.00 ? 196 ILE A HG13 4  
ATOM   7224  H  HG21 . ILE A 1 42  ? -4.657  1.322   -0.427  1.00 0.00 ? 196 ILE A HG21 4  
ATOM   7225  H  HG22 . ILE A 1 42  ? -3.602  1.115   -1.825  1.00 0.00 ? 196 ILE A HG22 4  
ATOM   7226  H  HG23 . ILE A 1 42  ? -4.124  -0.291  -0.900  1.00 0.00 ? 196 ILE A HG23 4  
ATOM   7227  H  HD11 . ILE A 1 42  ? -6.148  -0.424  0.147   1.00 0.00 ? 196 ILE A HD11 4  
ATOM   7228  H  HD12 . ILE A 1 42  ? -7.621  -1.003  -0.631  1.00 0.00 ? 196 ILE A HD12 4  
ATOM   7229  H  HD13 . ILE A 1 42  ? -7.700  0.313   0.539   1.00 0.00 ? 196 ILE A HD13 4  
ATOM   7230  N  N    . CYS A 1 43  ? -6.984  0.077   -4.776  1.00 0.00 ? 197 CYS A N    4  
ATOM   7231  C  CA   . CYS A 1 43  ? -8.092  -0.118  -5.761  1.00 0.00 ? 197 CYS A CA   4  
ATOM   7232  C  C    . CYS A 1 43  ? -9.284  -0.843  -5.102  1.00 0.00 ? 197 CYS A C    4  
ATOM   7233  O  O    . CYS A 1 43  ? -9.142  -1.449  -4.056  1.00 0.00 ? 197 CYS A O    4  
ATOM   7234  C  CB   . CYS A 1 43  ? -7.474  -0.936  -6.916  1.00 0.00 ? 197 CYS A CB   4  
ATOM   7235  S  SG   . CYS A 1 43  ? -7.084  -2.637  -6.402  1.00 0.00 ? 197 CYS A SG   4  
ATOM   7236  H  H    . CYS A 1 43  ? -6.506  -0.698  -4.427  1.00 0.00 ? 197 CYS A H    4  
ATOM   7237  H  HA   . CYS A 1 43  ? -8.415  0.844   -6.138  1.00 0.00 ? 197 CYS A HA   4  
ATOM   7238  H  HB2  . CYS A 1 43  ? -8.172  -0.970  -7.737  1.00 0.00 ? 197 CYS A HB2  4  
ATOM   7239  H  HB3  . CYS A 1 43  ? -6.568  -0.448  -7.243  1.00 0.00 ? 197 CYS A HB3  4  
ATOM   7240  N  N    . LYS A 1 44  ? -10.463 -0.774  -5.695  1.00 0.00 ? 198 LYS A N    4  
ATOM   7241  C  CA   . LYS A 1 44  ? -11.667 -1.455  -5.077  1.00 0.00 ? 198 LYS A CA   4  
ATOM   7242  C  C    . LYS A 1 44  ? -11.358 -2.920  -4.729  1.00 0.00 ? 198 LYS A C    4  
ATOM   7243  O  O    . LYS A 1 44  ? -11.791 -3.415  -3.704  1.00 0.00 ? 198 LYS A O    4  
ATOM   7244  C  CB   . LYS A 1 44  ? -12.795 -1.377  -6.118  1.00 0.00 ? 198 LYS A CB   4  
ATOM   7245  C  CG   . LYS A 1 44  ? -14.077 -1.984  -5.539  1.00 0.00 ? 198 LYS A CG   4  
ATOM   7246  C  CD   . LYS A 1 44  ? -15.182 -1.942  -6.595  1.00 0.00 ? 198 LYS A CD   4  
ATOM   7247  C  CE   . LYS A 1 44  ? -16.300 -2.912  -6.204  1.00 0.00 ? 198 LYS A CE   4  
ATOM   7248  N  NZ   . LYS A 1 44  ? -15.889 -4.223  -6.778  1.00 0.00 ? 198 LYS A NZ   4  
ATOM   7249  H  H    . LYS A 1 44  ? -10.557 -0.266  -6.536  1.00 0.00 ? 198 LYS A H    4  
ATOM   7250  H  HA   . LYS A 1 44  ? -11.964 -0.935  -4.189  1.00 0.00 ? 198 LYS A HA   4  
ATOM   7251  H  HB2  . LYS A 1 44  ? -12.972 -0.340  -6.370  1.00 0.00 ? 198 LYS A HB2  4  
ATOM   7252  H  HB3  . LYS A 1 44  ? -12.508 -1.921  -7.004  1.00 0.00 ? 198 LYS A HB3  4  
ATOM   7253  H  HG2  . LYS A 1 44  ? -13.890 -3.009  -5.251  1.00 0.00 ? 198 LYS A HG2  4  
ATOM   7254  H  HG3  . LYS A 1 44  ? -14.385 -1.417  -4.674  1.00 0.00 ? 198 LYS A HG3  4  
ATOM   7255  H  HD2  . LYS A 1 44  ? -15.581 -0.940  -6.660  1.00 0.00 ? 198 LYS A HD2  4  
ATOM   7256  H  HD3  . LYS A 1 44  ? -14.777 -2.232  -7.553  1.00 0.00 ? 198 LYS A HD3  4  
ATOM   7257  H  HE2  . LYS A 1 44  ? -16.378 -2.978  -5.127  1.00 0.00 ? 198 LYS A HE2  4  
ATOM   7258  H  HE3  . LYS A 1 44  ? -17.239 -2.599  -6.632  1.00 0.00 ? 198 LYS A HE3  4  
ATOM   7259  H  HZ1  . LYS A 1 44  ? -15.727 -4.119  -7.799  1.00 0.00 ? 198 LYS A HZ1  4  
ATOM   7260  H  HZ2  . LYS A 1 44  ? -16.642 -4.923  -6.616  1.00 0.00 ? 198 LYS A HZ2  4  
ATOM   7261  H  HZ3  . LYS A 1 44  ? -15.012 -4.544  -6.320  1.00 0.00 ? 198 LYS A HZ3  4  
ATOM   7262  N  N    . ASN A 1 45  ? -10.610 -3.613  -5.556  1.00 0.00 ? 199 ASN A N    4  
ATOM   7263  C  CA   . ASN A 1 45  ? -10.283 -5.046  -5.228  1.00 0.00 ? 199 ASN A CA   4  
ATOM   7264  C  C    . ASN A 1 45  ? -9.424  -5.131  -3.953  1.00 0.00 ? 199 ASN A C    4  
ATOM   7265  O  O    . ASN A 1 45  ? -9.451  -6.132  -3.264  1.00 0.00 ? 199 ASN A O    4  
ATOM   7266  C  CB   . ASN A 1 45  ? -9.513  -5.617  -6.430  1.00 0.00 ? 199 ASN A CB   4  
ATOM   7267  C  CG   . ASN A 1 45  ? -10.503 -5.995  -7.539  1.00 0.00 ? 199 ASN A CG   4  
ATOM   7268  O  OD1  . ASN A 1 45  ? -11.430 -5.259  -7.812  1.00 0.00 ? 199 ASN A OD1  4  
ATOM   7269  N  ND2  . ASN A 1 45  ? -10.351 -7.119  -8.198  1.00 0.00 ? 199 ASN A ND2  4  
ATOM   7270  H  H    . ASN A 1 45  ? -10.260 -3.191  -6.375  1.00 0.00 ? 199 ASN A H    4  
ATOM   7271  H  HA   . ASN A 1 45  ? -11.195 -5.599  -5.081  1.00 0.00 ? 199 ASN A HA   4  
ATOM   7272  H  HB2  . ASN A 1 45  ? -8.823  -4.873  -6.801  1.00 0.00 ? 199 ASN A HB2  4  
ATOM   7273  H  HB3  . ASN A 1 45  ? -8.966  -6.496  -6.123  1.00 0.00 ? 199 ASN A HB3  4  
ATOM   7274  H  HD21 . ASN A 1 45  ? -9.606  -7.722  -7.985  1.00 0.00 ? 199 ASN A HD21 4  
ATOM   7275  H  HD22 . ASN A 1 45  ? -10.984 -7.357  -8.905  1.00 0.00 ? 199 ASN A HD22 4  
ATOM   7276  N  N    . CYS A 1 46  ? -8.676  -4.096  -3.614  1.00 0.00 ? 200 CYS A N    4  
ATOM   7277  C  CA   . CYS A 1 46  ? -7.848  -4.157  -2.360  1.00 0.00 ? 200 CYS A CA   4  
ATOM   7278  C  C    . CYS A 1 46  ? -8.754  -3.888  -1.155  1.00 0.00 ? 200 CYS A C    4  
ATOM   7279  O  O    . CYS A 1 46  ? -8.717  -4.601  -0.175  1.00 0.00 ? 200 CYS A O    4  
ATOM   7280  C  CB   . CYS A 1 46  ? -6.780  -3.054  -2.470  1.00 0.00 ? 200 CYS A CB   4  
ATOM   7281  S  SG   . CYS A 1 46  ? -5.297  -3.715  -3.268  1.00 0.00 ? 200 CYS A SG   4  
ATOM   7282  H  H    . CYS A 1 46  ? -8.675  -3.285  -4.165  1.00 0.00 ? 200 CYS A H    4  
ATOM   7283  H  HA   . CYS A 1 46  ? -7.381  -5.123  -2.266  1.00 0.00 ? 200 CYS A HA   4  
ATOM   7284  H  HB2  . CYS A 1 46  ? -7.166  -2.235  -3.055  1.00 0.00 ? 200 CYS A HB2  4  
ATOM   7285  H  HB3  . CYS A 1 46  ? -6.528  -2.701  -1.481  1.00 0.00 ? 200 CYS A HB3  4  
ATOM   7286  N  N    . PHE A 1 47  ? -9.576  -2.865  -1.229  1.00 0.00 ? 201 PHE A N    4  
ATOM   7287  C  CA   . PHE A 1 47  ? -10.492 -2.561  -0.075  1.00 0.00 ? 201 PHE A CA   4  
ATOM   7288  C  C    . PHE A 1 47  ? -11.491 -3.707  0.125   1.00 0.00 ? 201 PHE A C    4  
ATOM   7289  O  O    . PHE A 1 47  ? -11.828 -4.039  1.247   1.00 0.00 ? 201 PHE A O    4  
ATOM   7290  C  CB   . PHE A 1 47  ? -11.229 -1.256  -0.429  1.00 0.00 ? 201 PHE A CB   4  
ATOM   7291  C  CG   . PHE A 1 47  ? -11.576 -0.497  0.830   1.00 0.00 ? 201 PHE A CG   4  
ATOM   7292  C  CD1  . PHE A 1 47  ? -10.625 0.334   1.436   1.00 0.00 ? 201 PHE A CD1  4  
ATOM   7293  C  CD2  . PHE A 1 47  ? -12.855 -0.616  1.387   1.00 0.00 ? 201 PHE A CD2  4  
ATOM   7294  C  CE1  . PHE A 1 47  ? -10.951 1.042   2.599   1.00 0.00 ? 201 PHE A CE1  4  
ATOM   7295  C  CE2  . PHE A 1 47  ? -13.182 0.092   2.549   1.00 0.00 ? 201 PHE A CE2  4  
ATOM   7296  C  CZ   . PHE A 1 47  ? -12.230 0.921   3.156   1.00 0.00 ? 201 PHE A CZ   4  
ATOM   7297  H  H    . PHE A 1 47  ? -9.591  -2.306  -2.042  1.00 0.00 ? 201 PHE A H    4  
ATOM   7298  H  HA   . PHE A 1 47  ? -9.911  -2.428  0.824   1.00 0.00 ? 201 PHE A HA   4  
ATOM   7299  H  HB2  . PHE A 1 47  ? -10.594 -0.644  -1.052  1.00 0.00 ? 201 PHE A HB2  4  
ATOM   7300  H  HB3  . PHE A 1 47  ? -12.136 -1.493  -0.965  1.00 0.00 ? 201 PHE A HB3  4  
ATOM   7301  H  HD1  . PHE A 1 47  ? -9.638  0.429   1.006   1.00 0.00 ? 201 PHE A HD1  4  
ATOM   7302  H  HD2  . PHE A 1 47  ? -13.589 -1.256  0.920   1.00 0.00 ? 201 PHE A HD2  4  
ATOM   7303  H  HE1  . PHE A 1 47  ? -10.217 1.681   3.068   1.00 0.00 ? 201 PHE A HE1  4  
ATOM   7304  H  HE2  . PHE A 1 47  ? -14.170 0.001   2.976   1.00 0.00 ? 201 PHE A HE2  4  
ATOM   7305  H  HZ   . PHE A 1 47  ? -12.483 1.467   4.052   1.00 0.00 ? 201 PHE A HZ   4  
ATOM   7306  N  N    . LYS A 1 48  ? -11.959 -4.333  -0.939  1.00 0.00 ? 202 LYS A N    4  
ATOM   7307  C  CA   . LYS A 1 48  ? -12.922 -5.473  -0.753  1.00 0.00 ? 202 LYS A CA   4  
ATOM   7308  C  C    . LYS A 1 48  ? -12.143 -6.741  -0.388  1.00 0.00 ? 202 LYS A C    4  
ATOM   7309  O  O    . LYS A 1 48  ? -12.586 -7.519  0.434   1.00 0.00 ? 202 LYS A O    4  
ATOM   7310  C  CB   . LYS A 1 48  ? -13.662 -5.654  -2.086  1.00 0.00 ? 202 LYS A CB   4  
ATOM   7311  C  CG   . LYS A 1 48  ? -15.035 -6.277  -1.827  1.00 0.00 ? 202 LYS A CG   4  
ATOM   7312  C  CD   . LYS A 1 48  ? -15.971 -5.955  -2.993  1.00 0.00 ? 202 LYS A CD   4  
ATOM   7313  C  CE   . LYS A 1 48  ? -17.342 -6.585  -2.737  1.00 0.00 ? 202 LYS A CE   4  
ATOM   7314  N  NZ   . LYS A 1 48  ? -17.264 -7.938  -3.357  1.00 0.00 ? 202 LYS A NZ   4  
ATOM   7315  H  H    . LYS A 1 48  ? -11.667 -4.070  -1.847  1.00 0.00 ? 202 LYS A H    4  
ATOM   7316  H  HA   . LYS A 1 48  ? -13.623 -5.239  0.034   1.00 0.00 ? 202 LYS A HA   4  
ATOM   7317  H  HB2  . LYS A 1 48  ? -13.786 -4.692  -2.562  1.00 0.00 ? 202 LYS A HB2  4  
ATOM   7318  H  HB3  . LYS A 1 48  ? -13.089 -6.304  -2.730  1.00 0.00 ? 202 LYS A HB3  4  
ATOM   7319  H  HG2  . LYS A 1 48  ? -14.932 -7.348  -1.731  1.00 0.00 ? 202 LYS A HG2  4  
ATOM   7320  H  HG3  . LYS A 1 48  ? -15.448 -5.873  -0.915  1.00 0.00 ? 202 LYS A HG3  4  
ATOM   7321  H  HD2  . LYS A 1 48  ? -16.078 -4.883  -3.083  1.00 0.00 ? 202 LYS A HD2  4  
ATOM   7322  H  HD3  . LYS A 1 48  ? -15.559 -6.355  -3.907  1.00 0.00 ? 202 LYS A HD3  4  
ATOM   7323  H  HE2  . LYS A 1 48  ? -17.525 -6.666  -1.674  1.00 0.00 ? 202 LYS A HE2  4  
ATOM   7324  H  HE3  . LYS A 1 48  ? -18.118 -6.006  -3.211  1.00 0.00 ? 202 LYS A HE3  4  
ATOM   7325  H  HZ1  . LYS A 1 48  ? -16.984 -7.847  -4.353  1.00 0.00 ? 202 LYS A HZ1  4  
ATOM   7326  H  HZ2  . LYS A 1 48  ? -18.195 -8.400  -3.297  1.00 0.00 ? 202 LYS A HZ2  4  
ATOM   7327  H  HZ3  . LYS A 1 48  ? -16.560 -8.511  -2.851  1.00 0.00 ? 202 LYS A HZ3  4  
ATOM   7328  N  N    . TYR A 1 49  ? -10.979 -6.951  -0.970  1.00 0.00 ? 203 TYR A N    4  
ATOM   7329  C  CA   . TYR A 1 49  ? -10.185 -8.176  -0.613  1.00 0.00 ? 203 TYR A CA   4  
ATOM   7330  C  C    . TYR A 1 49  ? -9.554  -7.998  0.779   1.00 0.00 ? 203 TYR A C    4  
ATOM   7331  O  O    . TYR A 1 49  ? -9.458  -8.950  1.531   1.00 0.00 ? 203 TYR A O    4  
ATOM   7332  C  CB   . TYR A 1 49  ? -9.102  -8.330  -1.695  1.00 0.00 ? 203 TYR A CB   4  
ATOM   7333  C  CG   . TYR A 1 49  ? -8.248  -9.538  -1.400  1.00 0.00 ? 203 TYR A CG   4  
ATOM   7334  C  CD1  . TYR A 1 49  ? -8.822  -10.813 -1.353  1.00 0.00 ? 203 TYR A CD1  4  
ATOM   7335  C  CD2  . TYR A 1 49  ? -6.878  -9.378  -1.173  1.00 0.00 ? 203 TYR A CD2  4  
ATOM   7336  C  CE1  . TYR A 1 49  ? -8.025  -11.929 -1.078  1.00 0.00 ? 203 TYR A CE1  4  
ATOM   7337  C  CE2  . TYR A 1 49  ? -6.081  -10.493 -0.897  1.00 0.00 ? 203 TYR A CE2  4  
ATOM   7338  C  CZ   . TYR A 1 49  ? -6.653  -11.769 -0.850  1.00 0.00 ? 203 TYR A CZ   4  
ATOM   7339  O  OH   . TYR A 1 49  ? -5.866  -12.871 -0.578  1.00 0.00 ? 203 TYR A OH   4  
ATOM   7340  H  H    . TYR A 1 49  ? -10.624 -6.301  -1.623  1.00 0.00 ? 203 TYR A H    4  
ATOM   7341  H  HA   . TYR A 1 49  ? -10.832 -9.042  -0.613  1.00 0.00 ? 203 TYR A HA   4  
ATOM   7342  H  HB2  . TYR A 1 49  ? -9.574  -8.453  -2.659  1.00 0.00 ? 203 TYR A HB2  4  
ATOM   7343  H  HB3  . TYR A 1 49  ? -8.481  -7.447  -1.710  1.00 0.00 ? 203 TYR A HB3  4  
ATOM   7344  H  HD1  . TYR A 1 49  ? -9.882  -10.935 -1.529  1.00 0.00 ? 203 TYR A HD1  4  
ATOM   7345  H  HD2  . TYR A 1 49  ? -6.436  -8.391  -1.210  1.00 0.00 ? 203 TYR A HD2  4  
ATOM   7346  H  HE1  . TYR A 1 49  ? -8.468  -12.915 -1.041  1.00 0.00 ? 203 TYR A HE1  4  
ATOM   7347  H  HE2  . TYR A 1 49  ? -5.025  -10.369 -0.722  1.00 0.00 ? 203 TYR A HE2  4  
ATOM   7348  H  HH   . TYR A 1 49  ? -5.431  -13.132 -1.391  1.00 0.00 ? 203 TYR A HH   4  
ATOM   7349  N  N    . TYR A 1 50  ? -9.140  -6.794  1.146   1.00 0.00 ? 204 TYR A N    4  
ATOM   7350  C  CA   . TYR A 1 50  ? -8.547  -6.620  2.520   1.00 0.00 ? 204 TYR A CA   4  
ATOM   7351  C  C    . TYR A 1 50  ? -9.640  -6.837  3.580   1.00 0.00 ? 204 TYR A C    4  
ATOM   7352  O  O    . TYR A 1 50  ? -9.372  -7.354  4.647   1.00 0.00 ? 204 TYR A O    4  
ATOM   7353  C  CB   . TYR A 1 50  ? -7.988  -5.188  2.601   1.00 0.00 ? 204 TYR A CB   4  
ATOM   7354  C  CG   . TYR A 1 50  ? -6.940  -5.113  3.688   1.00 0.00 ? 204 TYR A CG   4  
ATOM   7355  C  CD1  . TYR A 1 50  ? -5.885  -6.035  3.713   1.00 0.00 ? 204 TYR A CD1  4  
ATOM   7356  C  CD2  . TYR A 1 50  ? -7.021  -4.118  4.670   1.00 0.00 ? 204 TYR A CD2  4  
ATOM   7357  C  CE1  . TYR A 1 50  ? -4.914  -5.963  4.716   1.00 0.00 ? 204 TYR A CE1  4  
ATOM   7358  C  CE2  . TYR A 1 50  ? -6.050  -4.045  5.675   1.00 0.00 ? 204 TYR A CE2  4  
ATOM   7359  C  CZ   . TYR A 1 50  ? -4.996  -4.968  5.698   1.00 0.00 ? 204 TYR A CZ   4  
ATOM   7360  O  OH   . TYR A 1 50  ? -4.037  -4.896  6.689   1.00 0.00 ? 204 TYR A OH   4  
ATOM   7361  H  H    . TYR A 1 50  ? -9.239  -6.018  0.539   1.00 0.00 ? 204 TYR A H    4  
ATOM   7362  H  HA   . TYR A 1 50  ? -7.749  -7.332  2.665   1.00 0.00 ? 204 TYR A HA   4  
ATOM   7363  H  HB2  . TYR A 1 50  ? -7.539  -4.924  1.656   1.00 0.00 ? 204 TYR A HB2  4  
ATOM   7364  H  HB3  . TYR A 1 50  ? -8.789  -4.500  2.825   1.00 0.00 ? 204 TYR A HB3  4  
ATOM   7365  H  HD1  . TYR A 1 50  ? -5.822  -6.802  2.955   1.00 0.00 ? 204 TYR A HD1  4  
ATOM   7366  H  HD2  . TYR A 1 50  ? -7.834  -3.407  4.652   1.00 0.00 ? 204 TYR A HD2  4  
ATOM   7367  H  HE1  . TYR A 1 50  ? -4.102  -6.676  4.733   1.00 0.00 ? 204 TYR A HE1  4  
ATOM   7368  H  HE2  . TYR A 1 50  ? -6.112  -3.277  6.432   1.00 0.00 ? 204 TYR A HE2  4  
ATOM   7369  H  HH   . TYR A 1 50  ? -4.453  -5.134  7.521   1.00 0.00 ? 204 TYR A HH   4  
ATOM   7370  N  N    . MET A 1 51  ? -10.877 -6.469  3.290   1.00 0.00 ? 205 MET A N    4  
ATOM   7371  C  CA   . MET A 1 51  ? -11.974 -6.691  4.291   1.00 0.00 ? 205 MET A CA   4  
ATOM   7372  C  C    . MET A 1 51  ? -12.591 -8.083  4.070   1.00 0.00 ? 205 MET A C    4  
ATOM   7373  O  O    . MET A 1 51  ? -12.889 -8.788  5.015   1.00 0.00 ? 205 MET A O    4  
ATOM   7374  C  CB   . MET A 1 51  ? -13.015 -5.585  4.042   1.00 0.00 ? 205 MET A CB   4  
ATOM   7375  C  CG   . MET A 1 51  ? -14.199 -5.762  4.997   1.00 0.00 ? 205 MET A CG   4  
ATOM   7376  S  SD   . MET A 1 51  ? -13.655 -5.467  6.698   1.00 0.00 ? 205 MET A SD   4  
ATOM   7377  C  CE   . MET A 1 51  ? -14.649 -6.761  7.481   1.00 0.00 ? 205 MET A CE   4  
ATOM   7378  H  H    . MET A 1 51  ? -11.085 -6.068  2.414   1.00 0.00 ? 205 MET A H    4  
ATOM   7379  H  HA   . MET A 1 51  ? -11.585 -6.614  5.290   1.00 0.00 ? 205 MET A HA   4  
ATOM   7380  H  HB2  . MET A 1 51  ? -12.559 -4.620  4.210   1.00 0.00 ? 205 MET A HB2  4  
ATOM   7381  H  HB3  . MET A 1 51  ? -13.365 -5.645  3.023   1.00 0.00 ? 205 MET A HB3  4  
ATOM   7382  H  HG2  . MET A 1 51  ? -14.976 -5.059  4.740   1.00 0.00 ? 205 MET A HG2  4  
ATOM   7383  H  HG3  . MET A 1 51  ? -14.580 -6.769  4.910   1.00 0.00 ? 205 MET A HG3  4  
ATOM   7384  H  HE1  . MET A 1 51  ? -15.233 -6.329  8.281   1.00 0.00 ? 205 MET A HE1  4  
ATOM   7385  H  HE2  . MET A 1 51  ? -13.999 -7.522  7.883   1.00 0.00 ? 205 MET A HE2  4  
ATOM   7386  H  HE3  . MET A 1 51  ? -15.306 -7.203  6.746   1.00 0.00 ? 205 MET A HE3  4  
ATOM   7387  N  N    . SER A 1 52  ? -12.777 -8.489  2.828   1.00 0.00 ? 206 SER A N    4  
ATOM   7388  C  CA   . SER A 1 52  ? -13.371 -9.854  2.563   1.00 0.00 ? 206 SER A CA   4  
ATOM   7389  C  C    . SER A 1 52  ? -12.549 -10.943 3.273   1.00 0.00 ? 206 SER A C    4  
ATOM   7390  O  O    . SER A 1 52  ? -13.096 -11.911 3.768   1.00 0.00 ? 206 SER A O    4  
ATOM   7391  C  CB   . SER A 1 52  ? -13.325 -10.074 1.044   1.00 0.00 ? 206 SER A CB   4  
ATOM   7392  O  OG   . SER A 1 52  ? -13.763 -11.393 0.747   1.00 0.00 ? 206 SER A OG   4  
ATOM   7393  H  H    . SER A 1 52  ? -12.525 -7.902  2.080   1.00 0.00 ? 206 SER A H    4  
ATOM   7394  H  HA   . SER A 1 52  ? -14.388 -9.882  2.903   1.00 0.00 ? 206 SER A HA   4  
ATOM   7395  H  HB2  . SER A 1 52  ? -13.974 -9.366  0.556   1.00 0.00 ? 206 SER A HB2  4  
ATOM   7396  H  HB3  . SER A 1 52  ? -12.312 -9.931  0.692   1.00 0.00 ? 206 SER A HB3  4  
ATOM   7397  H  HG   . SER A 1 52  ? -13.646 -11.540 -0.194  1.00 0.00 ? 206 SER A HG   4  
ATOM   7398  N  N    . ASP A 1 53  ? -11.242 -10.796 3.329   1.00 0.00 ? 207 ASP A N    4  
ATOM   7399  C  CA   . ASP A 1 53  ? -10.399 -11.827 4.012   1.00 0.00 ? 207 ASP A CA   4  
ATOM   7400  C  C    . ASP A 1 53  ? -9.773  -11.241 5.286   1.00 0.00 ? 207 ASP A C    4  
ATOM   7401  O  O    . ASP A 1 53  ? -9.496  -10.059 5.357   1.00 0.00 ? 207 ASP A O    4  
ATOM   7402  C  CB   . ASP A 1 53  ? -9.312  -12.194 2.999   1.00 0.00 ? 207 ASP A CB   4  
ATOM   7403  C  CG   . ASP A 1 53  ? -9.908  -13.084 1.908   1.00 0.00 ? 207 ASP A CG   4  
ATOM   7404  O  OD1  . ASP A 1 53  ? -10.138 -14.250 2.183   1.00 0.00 ? 207 ASP A OD1  4  
ATOM   7405  O  OD2  . ASP A 1 53  ? -10.125 -12.585 0.816   1.00 0.00 ? 207 ASP A OD2  4  
ATOM   7406  H  H    . ASP A 1 53  ? -10.815 -10.007 2.928   1.00 0.00 ? 207 ASP A H    4  
ATOM   7407  H  HA   . ASP A 1 53  ? -10.989 -12.698 4.251   1.00 0.00 ? 207 ASP A HA   4  
ATOM   7408  H  HB2  . ASP A 1 53  ? -8.917  -11.292 2.554   1.00 0.00 ? 207 ASP A HB2  4  
ATOM   7409  H  HB3  . ASP A 1 53  ? -8.518  -12.725 3.501   1.00 0.00 ? 207 ASP A HB3  4  
ATOM   7410  N  N    . ASP A 1 54  ? -9.549  -12.058 6.295   1.00 0.00 ? 208 ASP A N    4  
ATOM   7411  C  CA   . ASP A 1 54  ? -8.942  -11.539 7.560   1.00 0.00 ? 208 ASP A CA   4  
ATOM   7412  C  C    . ASP A 1 54  ? -7.540  -12.131 7.760   1.00 0.00 ? 208 ASP A C    4  
ATOM   7413  O  O    . ASP A 1 54  ? -7.245  -13.210 7.279   1.00 0.00 ? 208 ASP A O    4  
ATOM   7414  C  CB   . ASP A 1 54  ? -9.883  -11.998 8.676   1.00 0.00 ? 208 ASP A CB   4  
ATOM   7415  C  CG   . ASP A 1 54  ? -11.118 -11.094 8.706   1.00 0.00 ? 208 ASP A CG   4  
ATOM   7416  O  OD1  . ASP A 1 54  ? -10.966 -9.909  8.463   1.00 0.00 ? 208 ASP A OD1  4  
ATOM   7417  O  OD2  . ASP A 1 54  ? -12.195 -11.604 8.971   1.00 0.00 ? 208 ASP A OD2  4  
ATOM   7418  H  H    . ASP A 1 54  ? -9.779  -13.012 6.223   1.00 0.00 ? 208 ASP A H    4  
ATOM   7419  H  HA   . ASP A 1 54  ? -8.891  -10.461 7.541   1.00 0.00 ? 208 ASP A HA   4  
ATOM   7420  H  HB2  . ASP A 1 54  ? -10.187 -13.018 8.493   1.00 0.00 ? 208 ASP A HB2  4  
ATOM   7421  H  HB3  . ASP A 1 54  ? -9.373  -11.937 9.625   1.00 0.00 ? 208 ASP A HB3  4  
ATOM   7422  N  N    . ILE A 1 55  ? -6.674  -11.438 8.468   1.00 0.00 ? 209 ILE A N    4  
ATOM   7423  C  CA   . ILE A 1 55  ? -5.293  -11.973 8.695   1.00 0.00 ? 209 ILE A CA   4  
ATOM   7424  C  C    . ILE A 1 55  ? -5.144  -12.449 10.149  1.00 0.00 ? 209 ILE A C    4  
ATOM   7425  O  O    . ILE A 1 55  ? -5.617  -11.804 11.066  1.00 0.00 ? 209 ILE A O    4  
ATOM   7426  C  CB   . ILE A 1 55  ? -4.342  -10.801 8.410   1.00 0.00 ? 209 ILE A CB   4  
ATOM   7427  C  CG1  . ILE A 1 55  ? -4.542  -10.303 6.968   1.00 0.00 ? 209 ILE A CG1  4  
ATOM   7428  C  CG2  . ILE A 1 55  ? -2.890  -11.252 8.603   1.00 0.00 ? 209 ILE A CG2  4  
ATOM   7429  C  CD1  . ILE A 1 55  ? -4.251  -11.430 5.966   1.00 0.00 ? 209 ILE A CD1  4  
ATOM   7430  H  H    . ILE A 1 55  ? -6.931  -10.568 8.853   1.00 0.00 ? 209 ILE A H    4  
ATOM   7431  H  HA   . ILE A 1 55  ? -5.090  -12.784 8.013   1.00 0.00 ? 209 ILE A HA   4  
ATOM   7432  H  HB   . ILE A 1 55  ? -4.558  -9.996  9.099   1.00 0.00 ? 209 ILE A HB   4  
ATOM   7433  H  HG12 . ILE A 1 55  ? -5.562  -9.970  6.844   1.00 0.00 ? 209 ILE A HG12 4  
ATOM   7434  H  HG13 . ILE A 1 55  ? -3.871  -9.478  6.780   1.00 0.00 ? 209 ILE A HG13 4  
ATOM   7435  H  HG21 . ILE A 1 55  ? -2.706  -12.136 8.011   1.00 0.00 ? 209 ILE A HG21 4  
ATOM   7436  H  HG22 . ILE A 1 55  ? -2.717  -11.475 9.646   1.00 0.00 ? 209 ILE A HG22 4  
ATOM   7437  H  HG23 . ILE A 1 55  ? -2.223  -10.463 8.289   1.00 0.00 ? 209 ILE A HG23 4  
ATOM   7438  H  HD11 . ILE A 1 55  ? -3.732  -12.234 6.467   1.00 0.00 ? 209 ILE A HD11 4  
ATOM   7439  H  HD12 . ILE A 1 55  ? -3.637  -11.049 5.164   1.00 0.00 ? 209 ILE A HD12 4  
ATOM   7440  H  HD13 . ILE A 1 55  ? -5.182  -11.800 5.561   1.00 0.00 ? 209 ILE A HD13 4  
ATOM   7441  N  N    . SER A 1 56  ? -4.488  -13.570 10.369  1.00 0.00 ? 210 SER A N    4  
ATOM   7442  C  CA   . SER A 1 56  ? -4.312  -14.075 11.764  1.00 0.00 ? 210 SER A CA   4  
ATOM   7443  C  C    . SER A 1 56  ? -2.823  -14.327 12.048  1.00 0.00 ? 210 SER A C    4  
ATOM   7444  O  O    . SER A 1 56  ? -1.968  -13.884 11.306  1.00 0.00 ? 210 SER A O    4  
ATOM   7445  C  CB   . SER A 1 56  ? -5.099  -15.384 11.814  1.00 0.00 ? 210 SER A CB   4  
ATOM   7446  O  OG   . SER A 1 56  ? -5.593  -15.583 13.133  1.00 0.00 ? 210 SER A OG   4  
ATOM   7447  H  H    . SER A 1 56  ? -4.109  -14.081 9.619   1.00 0.00 ? 210 SER A H    4  
ATOM   7448  H  HA   . SER A 1 56  ? -4.719  -13.371 12.473  1.00 0.00 ? 210 SER A HA   4  
ATOM   7449  H  HB2  . SER A 1 56  ? -5.928  -15.335 11.129  1.00 0.00 ? 210 SER A HB2  4  
ATOM   7450  H  HB3  . SER A 1 56  ? -4.449  -16.202 11.534  1.00 0.00 ? 210 SER A HB3  4  
ATOM   7451  H  HG   . SER A 1 56  ? -6.041  -16.432 13.155  1.00 0.00 ? 210 SER A HG   4  
ATOM   7452  N  N    . ARG A 1 57  ? -2.503  -15.037 13.111  1.00 0.00 ? 211 ARG A N    4  
ATOM   7453  C  CA   . ARG A 1 57  ? -1.066  -15.309 13.423  1.00 0.00 ? 211 ARG A CA   4  
ATOM   7454  C  C    . ARG A 1 57  ? -0.765  -16.807 13.268  1.00 0.00 ? 211 ARG A C    4  
ATOM   7455  O  O    . ARG A 1 57  ? -1.387  -17.635 13.907  1.00 0.00 ? 211 ARG A O    4  
ATOM   7456  C  CB   . ARG A 1 57  ? -0.880  -14.872 14.878  1.00 0.00 ? 211 ARG A CB   4  
ATOM   7457  C  CG   . ARG A 1 57  ? -0.882  -13.344 14.958  1.00 0.00 ? 211 ARG A CG   4  
ATOM   7458  C  CD   . ARG A 1 57  ? -2.295  -12.850 15.278  1.00 0.00 ? 211 ARG A CD   4  
ATOM   7459  N  NE   . ARG A 1 57  ? -2.125  -11.414 15.656  1.00 0.00 ? 211 ARG A NE   4  
ATOM   7460  C  CZ   . ARG A 1 57  ? -1.562  -11.066 16.804  1.00 0.00 ? 211 ARG A CZ   4  
ATOM   7461  N  NH1  . ARG A 1 57  ? -1.132  -11.968 17.657  1.00 0.00 ? 211 ARG A NH1  4  
ATOM   7462  N  NH2  . ARG A 1 57  ? -1.430  -9.799  17.101  1.00 0.00 ? 211 ARG A NH2  4  
ATOM   7463  H  H    . ARG A 1 57  ? -3.205  -15.393 13.702  1.00 0.00 ? 211 ARG A H    4  
ATOM   7464  H  HA   . ARG A 1 57  ? -0.426  -14.727 12.779  1.00 0.00 ? 211 ARG A HA   4  
ATOM   7465  H  HB2  . ARG A 1 57  ? -1.688  -15.266 15.477  1.00 0.00 ? 211 ARG A HB2  4  
ATOM   7466  H  HB3  . ARG A 1 57  ? 0.061   -15.249 15.250  1.00 0.00 ? 211 ARG A HB3  4  
ATOM   7467  H  HG2  . ARG A 1 57  ? -0.203  -13.024 15.735  1.00 0.00 ? 211 ARG A HG2  4  
ATOM   7468  H  HG3  . ARG A 1 57  ? -0.565  -12.933 14.011  1.00 0.00 ? 211 ARG A HG3  4  
ATOM   7469  H  HD2  . ARG A 1 57  ? -2.929  -12.941 14.406  1.00 0.00 ? 211 ARG A HD2  4  
ATOM   7470  H  HD3  . ARG A 1 57  ? -2.709  -13.404 16.106  1.00 0.00 ? 211 ARG A HD3  4  
ATOM   7471  H  HE   . ARG A 1 57  ? -2.438  -10.717 15.038  1.00 0.00 ? 211 ARG A HE   4  
ATOM   7472  H  HH11 . ARG A 1 57  ? -1.220  -12.941 17.453  1.00 0.00 ? 211 ARG A HH11 4  
ATOM   7473  H  HH12 . ARG A 1 57  ? -0.711  -11.677 18.516  1.00 0.00 ? 211 ARG A HH12 4  
ATOM   7474  H  HH21 . ARG A 1 57  ? -1.753  -9.100  16.464  1.00 0.00 ? 211 ARG A HH21 4  
ATOM   7475  H  HH22 . ARG A 1 57  ? -1.007  -9.530  17.966  1.00 0.00 ? 211 ARG A HH22 4  
ATOM   7476  N  N    . ASP A 1 58  ? 0.182   -17.168 12.423  1.00 0.00 ? 212 ASP A N    4  
ATOM   7477  C  CA   . ASP A 1 58  ? 0.506   -18.614 12.237  1.00 0.00 ? 212 ASP A CA   4  
ATOM   7478  C  C    . ASP A 1 58  ? 2.024   -18.811 12.083  1.00 0.00 ? 212 ASP A C    4  
ATOM   7479  O  O    . ASP A 1 58  ? 2.788   -17.878 12.221  1.00 0.00 ? 212 ASP A O    4  
ATOM   7480  C  CB   . ASP A 1 58  ? -0.219  -19.018 10.953  1.00 0.00 ? 212 ASP A CB   4  
ATOM   7481  C  CG   . ASP A 1 58  ? -0.766  -20.439 11.100  1.00 0.00 ? 212 ASP A CG   4  
ATOM   7482  O  OD1  . ASP A 1 58  ? -1.545  -20.662 12.012  1.00 0.00 ? 212 ASP A OD1  4  
ATOM   7483  O  OD2  . ASP A 1 58  ? -0.399  -21.281 10.296  1.00 0.00 ? 212 ASP A OD2  4  
ATOM   7484  H  H    . ASP A 1 58  ? 0.677   -16.489 11.909  1.00 0.00 ? 212 ASP A H    4  
ATOM   7485  H  HA   . ASP A 1 58  ? 0.134   -19.193 13.067  1.00 0.00 ? 212 ASP A HA   4  
ATOM   7486  H  HB2  . ASP A 1 58  ? -1.035  -18.335 10.770  1.00 0.00 ? 212 ASP A HB2  4  
ATOM   7487  H  HB3  . ASP A 1 58  ? 0.473   -18.985 10.123  1.00 0.00 ? 212 ASP A HB3  4  
ATOM   7488  N  N    . SER A 1 59  ? 2.467   -20.024 11.789  1.00 0.00 ? 213 SER A N    4  
ATOM   7489  C  CA   . SER A 1 59  ? 3.937   -20.298 11.620  1.00 0.00 ? 213 SER A CA   4  
ATOM   7490  C  C    . SER A 1 59  ? 4.698   -20.060 12.940  1.00 0.00 ? 213 SER A C    4  
ATOM   7491  O  O    . SER A 1 59  ? 5.127   -21.002 13.581  1.00 0.00 ? 213 SER A O    4  
ATOM   7492  C  CB   . SER A 1 59  ? 4.435   -19.352 10.515  1.00 0.00 ? 213 SER A CB   4  
ATOM   7493  O  OG   . SER A 1 59  ? 4.899   -20.122 9.415   1.00 0.00 ? 213 SER A OG   4  
ATOM   7494  H  H    . SER A 1 59  ? 1.830   -20.764 11.677  1.00 0.00 ? 213 SER A H    4  
ATOM   7495  H  HA   . SER A 1 59  ? 4.078   -21.321 11.304  1.00 0.00 ? 213 SER A HA   4  
ATOM   7496  H  HB2  . SER A 1 59  ? 3.628   -18.720 10.187  1.00 0.00 ? 213 SER A HB2  4  
ATOM   7497  H  HB3  . SER A 1 59  ? 5.237   -18.737 10.901  1.00 0.00 ? 213 SER A HB3  4  
ATOM   7498  H  HG   . SER A 1 59  ? 4.134   -20.442 8.931   1.00 0.00 ? 213 SER A HG   4  
ATOM   7499  N  N    . ASP A 1 60  ? 4.874   -18.822 13.355  1.00 0.00 ? 214 ASP A N    4  
ATOM   7500  C  CA   . ASP A 1 60  ? 5.608   -18.554 14.628  1.00 0.00 ? 214 ASP A CA   4  
ATOM   7501  C  C    . ASP A 1 60  ? 4.690   -17.838 15.629  1.00 0.00 ? 214 ASP A C    4  
ATOM   7502  O  O    . ASP A 1 60  ? 5.114   -16.933 16.321  1.00 0.00 ? 214 ASP A O    4  
ATOM   7503  C  CB   . ASP A 1 60  ? 6.767   -17.642 14.228  1.00 0.00 ? 214 ASP A CB   4  
ATOM   7504  C  CG   . ASP A 1 60  ? 7.837   -17.664 15.319  1.00 0.00 ? 214 ASP A CG   4  
ATOM   7505  O  OD1  . ASP A 1 60  ? 7.470   -17.737 16.480  1.00 0.00 ? 214 ASP A OD1  4  
ATOM   7506  O  OD2  . ASP A 1 60  ? 9.006   -17.608 14.976  1.00 0.00 ? 214 ASP A OD2  4  
ATOM   7507  H  H    . ASP A 1 60  ? 4.524   -18.066 12.833  1.00 0.00 ? 214 ASP A H    4  
ATOM   7508  H  HA   . ASP A 1 60  ? 5.987   -19.472 15.049  1.00 0.00 ? 214 ASP A HA   4  
ATOM   7509  H  HB2  . ASP A 1 60  ? 7.192   -17.988 13.297  1.00 0.00 ? 214 ASP A HB2  4  
ATOM   7510  H  HB3  . ASP A 1 60  ? 6.401   -16.633 14.105  1.00 0.00 ? 214 ASP A HB3  4  
ATOM   7511  N  N    . GLY A 1 61  ? 3.432   -18.226 15.708  1.00 0.00 ? 215 GLY A N    4  
ATOM   7512  C  CA   . GLY A 1 61  ? 2.496   -17.552 16.660  1.00 0.00 ? 215 GLY A CA   4  
ATOM   7513  C  C    . GLY A 1 61  ? 2.443   -16.037 16.375  1.00 0.00 ? 215 GLY A C    4  
ATOM   7514  O  O    . GLY A 1 61  ? 2.232   -15.248 17.277  1.00 0.00 ? 215 GLY A O    4  
ATOM   7515  H  H    . GLY A 1 61  ? 3.100   -18.954 15.139  1.00 0.00 ? 215 GLY A H    4  
ATOM   7516  H  HA2  . GLY A 1 61  ? 1.508   -17.974 16.547  1.00 0.00 ? 215 GLY A HA2  4  
ATOM   7517  H  HA3  . GLY A 1 61  ? 2.840   -17.710 17.671  1.00 0.00 ? 215 GLY A HA3  4  
ATOM   7518  N  N    . MET A 1 62  ? 2.629   -15.618 15.135  1.00 0.00 ? 216 MET A N    4  
ATOM   7519  C  CA   . MET A 1 62  ? 2.582   -14.157 14.824  1.00 0.00 ? 216 MET A CA   4  
ATOM   7520  C  C    . MET A 1 62  ? 1.959   -13.931 13.436  1.00 0.00 ? 216 MET A C    4  
ATOM   7521  O  O    . MET A 1 62  ? 1.810   -14.861 12.665  1.00 0.00 ? 216 MET A O    4  
ATOM   7522  C  CB   . MET A 1 62  ? 4.043   -13.703 14.835  1.00 0.00 ? 216 MET A CB   4  
ATOM   7523  C  CG   . MET A 1 62  ? 4.413   -13.204 16.233  1.00 0.00 ? 216 MET A CG   4  
ATOM   7524  S  SD   . MET A 1 62  ? 6.070   -12.477 16.196  1.00 0.00 ? 216 MET A SD   4  
ATOM   7525  C  CE   . MET A 1 62  ? 6.790   -13.484 17.515  1.00 0.00 ? 216 MET A CE   4  
ATOM   7526  H  H    . MET A 1 62  ? 2.797   -16.258 14.410  1.00 0.00 ? 216 MET A H    4  
ATOM   7527  H  HA   . MET A 1 62  ? 2.025   -13.627 15.580  1.00 0.00 ? 216 MET A HA   4  
ATOM   7528  H  HB2  . MET A 1 62  ? 4.679   -14.534 14.568  1.00 0.00 ? 216 MET A HB2  4  
ATOM   7529  H  HB3  . MET A 1 62  ? 4.177   -12.903 14.123  1.00 0.00 ? 216 MET A HB3  4  
ATOM   7530  H  HG2  . MET A 1 62  ? 3.699   -12.458 16.550  1.00 0.00 ? 216 MET A HG2  4  
ATOM   7531  H  HG3  . MET A 1 62  ? 4.399   -14.033 16.925  1.00 0.00 ? 216 MET A HG3  4  
ATOM   7532  H  HE1  . MET A 1 62  ? 6.688   -12.965 18.459  1.00 0.00 ? 216 MET A HE1  4  
ATOM   7533  H  HE2  . MET A 1 62  ? 7.834   -13.654 17.311  1.00 0.00 ? 216 MET A HE2  4  
ATOM   7534  H  HE3  . MET A 1 62  ? 6.274   -14.434 17.564  1.00 0.00 ? 216 MET A HE3  4  
ATOM   7535  N  N    . ASP A 1 63  ? 1.594   -12.707 13.109  1.00 0.00 ? 217 ASP A N    4  
ATOM   7536  C  CA   . ASP A 1 63  ? 0.980   -12.453 11.754  1.00 0.00 ? 217 ASP A CA   4  
ATOM   7537  C  C    . ASP A 1 63  ? 1.979   -12.827 10.648  1.00 0.00 ? 217 ASP A C    4  
ATOM   7538  O  O    . ASP A 1 63  ? 3.136   -12.453 10.705  1.00 0.00 ? 217 ASP A O    4  
ATOM   7539  C  CB   . ASP A 1 63  ? 0.652   -10.953 11.687  1.00 0.00 ? 217 ASP A CB   4  
ATOM   7540  C  CG   . ASP A 1 63  ? -0.497  -10.638 12.646  1.00 0.00 ? 217 ASP A CG   4  
ATOM   7541  O  OD1  . ASP A 1 63  ? -1.591  -11.120 12.407  1.00 0.00 ? 217 ASP A OD1  4  
ATOM   7542  O  OD2  . ASP A 1 63  ? -0.262  -9.919  13.604  1.00 0.00 ? 217 ASP A OD2  4  
ATOM   7543  H  H    . ASP A 1 63  ? 1.724   -11.965 13.747  1.00 0.00 ? 217 ASP A H    4  
ATOM   7544  H  HA   . ASP A 1 63  ? 0.075   -13.032 11.644  1.00 0.00 ? 217 ASP A HA   4  
ATOM   7545  H  HB2  . ASP A 1 63  ? 1.525   -10.382 11.969  1.00 0.00 ? 217 ASP A HB2  4  
ATOM   7546  H  HB3  . ASP A 1 63  ? 0.361   -10.693 10.681  1.00 0.00 ? 217 ASP A HB3  4  
ATOM   7547  N  N    . GLU A 1 64  ? 1.545   -13.558 9.641   1.00 0.00 ? 218 GLU A N    4  
ATOM   7548  C  CA   . GLU A 1 64  ? 2.478   -13.944 8.541   1.00 0.00 ? 218 GLU A CA   4  
ATOM   7549  C  C    . GLU A 1 64  ? 1.868   -13.571 7.182   1.00 0.00 ? 218 GLU A C    4  
ATOM   7550  O  O    . GLU A 1 64  ? 1.906   -14.348 6.247   1.00 0.00 ? 218 GLU A O    4  
ATOM   7551  C  CB   . GLU A 1 64  ? 2.636   -15.459 8.665   1.00 0.00 ? 218 GLU A CB   4  
ATOM   7552  C  CG   . GLU A 1 64  ? 3.499   -15.784 9.886   1.00 0.00 ? 218 GLU A CG   4  
ATOM   7553  C  CD   . GLU A 1 64  ? 4.976   -15.777 9.484   1.00 0.00 ? 218 GLU A CD   4  
ATOM   7554  O  OE1  . GLU A 1 64  ? 5.289   -16.332 8.443   1.00 0.00 ? 218 GLU A OE1  4  
ATOM   7555  O  OE2  . GLU A 1 64  ? 5.768   -15.218 10.224  1.00 0.00 ? 218 GLU A OE2  4  
ATOM   7556  H  H    . GLU A 1 64  ? 0.608   -13.852 9.606   1.00 0.00 ? 218 GLU A H    4  
ATOM   7557  H  HA   . GLU A 1 64  ? 3.431   -13.459 8.670   1.00 0.00 ? 218 GLU A HA   4  
ATOM   7558  H  HB2  . GLU A 1 64  ? 1.663   -15.915 8.779   1.00 0.00 ? 218 GLU A HB2  4  
ATOM   7559  H  HB3  . GLU A 1 64  ? 3.113   -15.846 7.777   1.00 0.00 ? 218 GLU A HB3  4  
ATOM   7560  H  HG2  . GLU A 1 64  ? 3.331   -15.042 10.653  1.00 0.00 ? 218 GLU A HG2  4  
ATOM   7561  H  HG3  . GLU A 1 64  ? 3.236   -16.761 10.264  1.00 0.00 ? 218 GLU A HG3  4  
ATOM   7562  N  N    . GLN A 1 65  ? 1.310   -12.386 7.065   1.00 0.00 ? 219 GLN A N    4  
ATOM   7563  C  CA   . GLN A 1 65  ? 0.703   -11.965 5.768   1.00 0.00 ? 219 GLN A CA   4  
ATOM   7564  C  C    . GLN A 1 65  ? 1.115   -10.521 5.438   1.00 0.00 ? 219 GLN A C    4  
ATOM   7565  O  O    . GLN A 1 65  ? 1.671   -9.832  6.270   1.00 0.00 ? 219 GLN A O    4  
ATOM   7566  C  CB   . GLN A 1 65  ? -0.807  -12.055 5.989   1.00 0.00 ? 219 GLN A CB   4  
ATOM   7567  C  CG   . GLN A 1 65  ? -1.255  -13.513 5.862   1.00 0.00 ? 219 GLN A CG   4  
ATOM   7568  C  CD   . GLN A 1 65  ? -1.689  -13.791 4.418   1.00 0.00 ? 219 GLN A CD   4  
ATOM   7569  O  OE1  . GLN A 1 65  ? -2.783  -13.436 4.025   1.00 0.00 ? 219 GLN A OE1  4  
ATOM   7570  N  NE2  . GLN A 1 65  ? -0.876  -14.413 3.599   1.00 0.00 ? 219 GLN A NE2  4  
ATOM   7571  H  H    . GLN A 1 65  ? 1.291   -11.768 7.831   1.00 0.00 ? 219 GLN A H    4  
ATOM   7572  H  HA   . GLN A 1 65  ? 1.002   -12.634 4.976   1.00 0.00 ? 219 GLN A HA   4  
ATOM   7573  H  HB2  . GLN A 1 65  ? -1.047  -11.688 6.976   1.00 0.00 ? 219 GLN A HB2  4  
ATOM   7574  H  HB3  . GLN A 1 65  ? -1.317  -11.457 5.249   1.00 0.00 ? 219 GLN A HB3  4  
ATOM   7575  H  HG2  . GLN A 1 65  ? -0.436  -14.165 6.125   1.00 0.00 ? 219 GLN A HG2  4  
ATOM   7576  H  HG3  . GLN A 1 65  ? -2.087  -13.693 6.526   1.00 0.00 ? 219 GLN A HG3  4  
ATOM   7577  H  HE21 . GLN A 1 65  ? 0.011   -14.705 3.905   1.00 0.00 ? 219 GLN A HE21 4  
ATOM   7578  H  HE22 . GLN A 1 65  ? -1.154  -14.589 2.676   1.00 0.00 ? 219 GLN A HE22 4  
ATOM   7579  N  N    . CYS A 1 66  ? 0.848   -10.055 4.233   1.00 0.00 ? 220 CYS A N    4  
ATOM   7580  C  CA   . CYS A 1 66  ? 1.237   -8.643  3.875   1.00 0.00 ? 220 CYS A CA   4  
ATOM   7581  C  C    . CYS A 1 66  ? 0.293   -7.638  4.551   1.00 0.00 ? 220 CYS A C    4  
ATOM   7582  O  O    . CYS A 1 66  ? -0.850  -7.949  4.828   1.00 0.00 ? 220 CYS A O    4  
ATOM   7583  C  CB   . CYS A 1 66  ? 1.092   -8.529  2.351   1.00 0.00 ? 220 CYS A CB   4  
ATOM   7584  S  SG   . CYS A 1 66  ? 1.694   -6.914  1.800   1.00 0.00 ? 220 CYS A SG   4  
ATOM   7585  H  H    . CYS A 1 66  ? 0.392   -10.632 3.570   1.00 0.00 ? 220 CYS A H    4  
ATOM   7586  H  HA   . CYS A 1 66  ? 2.262   -8.449  4.158   1.00 0.00 ? 220 CYS A HA   4  
ATOM   7587  H  HB2  . CYS A 1 66  ? 1.663   -9.309  1.876   1.00 0.00 ? 220 CYS A HB2  4  
ATOM   7588  H  HB3  . CYS A 1 66  ? 0.051   -8.631  2.086   1.00 0.00 ? 220 CYS A HB3  4  
ATOM   7589  N  N    . ARG A 1 67  ? 0.749   -6.423  4.788   1.00 0.00 ? 221 ARG A N    4  
ATOM   7590  C  CA   . ARG A 1 67  ? -0.148  -5.397  5.409   1.00 0.00 ? 221 ARG A CA   4  
ATOM   7591  C  C    . ARG A 1 67  ? -0.612  -4.399  4.328   1.00 0.00 ? 221 ARG A C    4  
ATOM   7592  O  O    . ARG A 1 67  ? -0.732  -3.215  4.583   1.00 0.00 ? 221 ARG A O    4  
ATOM   7593  C  CB   . ARG A 1 67  ? 0.704   -4.690  6.469   1.00 0.00 ? 221 ARG A CB   4  
ATOM   7594  C  CG   . ARG A 1 67  ? 0.478   -5.346  7.834   1.00 0.00 ? 221 ARG A CG   4  
ATOM   7595  C  CD   . ARG A 1 67  ? -0.898  -4.935  8.389   1.00 0.00 ? 221 ARG A CD   4  
ATOM   7596  N  NE   . ARG A 1 67  ? -1.760  -6.174  8.363   1.00 0.00 ? 221 ARG A NE   4  
ATOM   7597  C  CZ   . ARG A 1 67  ? -2.766  -6.329  9.212   1.00 0.00 ? 221 ARG A CZ   4  
ATOM   7598  N  NH1  . ARG A 1 67  ? -3.087  -5.395  10.080  1.00 0.00 ? 221 ARG A NH1  4  
ATOM   7599  N  NH2  . ARG A 1 67  ? -3.478  -7.426  9.176   1.00 0.00 ? 221 ARG A NH2  4  
ATOM   7600  H  H    . ARG A 1 67  ? 1.668   -6.178  4.535   1.00 0.00 ? 221 ARG A H    4  
ATOM   7601  H  HA   . ARG A 1 67  ? -0.998  -5.871  5.873   1.00 0.00 ? 221 ARG A HA   4  
ATOM   7602  H  HB2  . ARG A 1 67  ? 1.748   -4.766  6.201   1.00 0.00 ? 221 ARG A HB2  4  
ATOM   7603  H  HB3  . ARG A 1 67  ? 0.421   -3.649  6.522   1.00 0.00 ? 221 ARG A HB3  4  
ATOM   7604  H  HG2  . ARG A 1 67  ? 0.521   -6.421  7.726   1.00 0.00 ? 221 ARG A HG2  4  
ATOM   7605  H  HG3  . ARG A 1 67  ? 1.248   -5.024  8.518   1.00 0.00 ? 221 ARG A HG3  4  
ATOM   7606  H  HD2  . ARG A 1 67  ? -0.787  -4.580  9.402   1.00 0.00 ? 221 ARG A HD2  4  
ATOM   7607  H  HD3  . ARG A 1 67  ? -1.340  -4.168  7.771   1.00 0.00 ? 221 ARG A HD3  4  
ATOM   7608  H  HE   . ARG A 1 67  ? -1.576  -6.884  7.704   1.00 0.00 ? 221 ARG A HE   4  
ATOM   7609  H  HH11 . ARG A 1 67  ? -2.576  -4.540  10.119  1.00 0.00 ? 221 ARG A HH11 4  
ATOM   7610  H  HH12 . ARG A 1 67  ? -3.850  -5.545  10.708  1.00 0.00 ? 221 ARG A HH12 4  
ATOM   7611  H  HH21 . ARG A 1 67  ? -3.260  -8.141  8.511   1.00 0.00 ? 221 ARG A HH21 4  
ATOM   7612  H  HH22 . ARG A 1 67  ? -4.238  -7.550  9.813   1.00 0.00 ? 221 ARG A HH22 4  
ATOM   7613  N  N    . TRP A 1 68  ? -0.869  -4.869  3.120   1.00 0.00 ? 222 TRP A N    4  
ATOM   7614  C  CA   . TRP A 1 68  ? -1.319  -3.950  2.025   1.00 0.00 ? 222 TRP A CA   4  
ATOM   7615  C  C    . TRP A 1 68  ? -2.182  -4.728  1.013   1.00 0.00 ? 222 TRP A C    4  
ATOM   7616  O  O    . TRP A 1 68  ? -3.336  -4.412  0.797   1.00 0.00 ? 222 TRP A O    4  
ATOM   7617  C  CB   . TRP A 1 68  ? -0.027  -3.471  1.349   1.00 0.00 ? 222 TRP A CB   4  
ATOM   7618  C  CG   . TRP A 1 68  ? -0.091  -1.995  1.107   1.00 0.00 ? 222 TRP A CG   4  
ATOM   7619  C  CD1  . TRP A 1 68  ? -1.194  -1.306  0.725   1.00 0.00 ? 222 TRP A CD1  4  
ATOM   7620  C  CD2  . TRP A 1 68  ? 0.981   -1.020  1.218   1.00 0.00 ? 222 TRP A CD2  4  
ATOM   7621  N  NE1  . TRP A 1 68  ? -0.869  0.031   0.619   1.00 0.00 ? 222 TRP A NE1  4  
ATOM   7622  C  CE2  . TRP A 1 68  ? 0.462   0.258   0.912   1.00 0.00 ? 222 TRP A CE2  4  
ATOM   7623  C  CE3  . TRP A 1 68  ? 2.339   -1.120  1.561   1.00 0.00 ? 222 TRP A CE3  4  
ATOM   7624  C  CZ2  . TRP A 1 68  ? 1.264   1.396   0.948   1.00 0.00 ? 222 TRP A CZ2  4  
ATOM   7625  C  CZ3  . TRP A 1 68  ? 3.150   0.024   1.593   1.00 0.00 ? 222 TRP A CZ3  4  
ATOM   7626  C  CH2  . TRP A 1 68  ? 2.612   1.280   1.291   1.00 0.00 ? 222 TRP A CH2  4  
ATOM   7627  H  H    . TRP A 1 68  ? -0.766  -5.827  2.930   1.00 0.00 ? 222 TRP A H    4  
ATOM   7628  H  HA   . TRP A 1 68  ? -1.863  -3.110  2.433   1.00 0.00 ? 222 TRP A HA   4  
ATOM   7629  H  HB2  . TRP A 1 68  ? 0.814   -3.690  1.989   1.00 0.00 ? 222 TRP A HB2  4  
ATOM   7630  H  HB3  . TRP A 1 68  ? 0.101   -3.983  0.406   1.00 0.00 ? 222 TRP A HB3  4  
ATOM   7631  H  HD1  . TRP A 1 68  ? -2.170  -1.732  0.545   1.00 0.00 ? 222 TRP A HD1  4  
ATOM   7632  H  HE1  . TRP A 1 68  ? -1.491  0.745   0.366   1.00 0.00 ? 222 TRP A HE1  4  
ATOM   7633  H  HE3  . TRP A 1 68  ? 2.763   -2.084  1.793   1.00 0.00 ? 222 TRP A HE3  4  
ATOM   7634  H  HZ2  . TRP A 1 68  ? 0.844   2.359   0.728   1.00 0.00 ? 222 TRP A HZ2  4  
ATOM   7635  H  HZ3  . TRP A 1 68  ? 4.193   -0.063  1.854   1.00 0.00 ? 222 TRP A HZ3  4  
ATOM   7636  H  HH2  . TRP A 1 68  ? 3.241   2.158   1.314   1.00 0.00 ? 222 TRP A HH2  4  
ATOM   7637  N  N    . CYS A 1 69  ? -1.620  -5.751  0.399   1.00 0.00 ? 223 CYS A N    4  
ATOM   7638  C  CA   . CYS A 1 69  ? -2.401  -6.560  -0.592  1.00 0.00 ? 223 CYS A CA   4  
ATOM   7639  C  C    . CYS A 1 69  ? -2.968  -7.857  0.043   1.00 0.00 ? 223 CYS A C    4  
ATOM   7640  O  O    . CYS A 1 69  ? -3.772  -8.531  -0.570  1.00 0.00 ? 223 CYS A O    4  
ATOM   7641  C  CB   . CYS A 1 69  ? -1.427  -6.869  -1.754  1.00 0.00 ? 223 CYS A CB   4  
ATOM   7642  S  SG   . CYS A 1 69  ? -0.117  -8.023  -1.240  1.00 0.00 ? 223 CYS A SG   4  
ATOM   7643  H  H    . CYS A 1 69  ? -0.691  -5.990  0.598   1.00 0.00 ? 223 CYS A H    4  
ATOM   7644  H  HA   . CYS A 1 69  ? -3.219  -5.964  -0.969  1.00 0.00 ? 223 CYS A HA   4  
ATOM   7645  H  HB2  . CYS A 1 69  ? -1.981  -7.309  -2.570  1.00 0.00 ? 223 CYS A HB2  4  
ATOM   7646  H  HB3  . CYS A 1 69  ? -0.977  -5.948  -2.092  1.00 0.00 ? 223 CYS A HB3  4  
ATOM   7647  N  N    . ALA A 1 70  ? -2.572  -8.220  1.259   1.00 0.00 ? 224 ALA A N    4  
ATOM   7648  C  CA   . ALA A 1 70  ? -3.107  -9.469  1.900   1.00 0.00 ? 224 ALA A CA   4  
ATOM   7649  C  C    . ALA A 1 70  ? -2.786  -10.687 1.025   1.00 0.00 ? 224 ALA A C    4  
ATOM   7650  O  O    . ALA A 1 70  ? -3.667  -11.443 0.660   1.00 0.00 ? 224 ALA A O    4  
ATOM   7651  C  CB   . ALA A 1 70  ? -4.627  -9.270  2.032   1.00 0.00 ? 224 ALA A CB   4  
ATOM   7652  H  H    . ALA A 1 70  ? -1.922  -7.684  1.752   1.00 0.00 ? 224 ALA A H    4  
ATOM   7653  H  HA   . ALA A 1 70  ? -2.671  -9.595  2.879   1.00 0.00 ? 224 ALA A HA   4  
ATOM   7654  H  HB1  . ALA A 1 70  ? -4.861  -8.946  3.037   1.00 0.00 ? 224 ALA A HB1  4  
ATOM   7655  H  HB2  . ALA A 1 70  ? -5.130  -10.204 1.830   1.00 0.00 ? 224 ALA A HB2  4  
ATOM   7656  H  HB3  . ALA A 1 70  ? -4.963  -8.524  1.328   1.00 0.00 ? 224 ALA A HB3  4  
ATOM   7657  N  N    . GLU A 1 71  ? -1.528  -10.889 0.689   1.00 0.00 ? 225 GLU A N    4  
ATOM   7658  C  CA   . GLU A 1 71  ? -1.162  -12.063 -0.164  1.00 0.00 ? 225 GLU A CA   4  
ATOM   7659  C  C    . GLU A 1 71  ? -0.292  -13.056 0.624   1.00 0.00 ? 225 GLU A C    4  
ATOM   7660  O  O    . GLU A 1 71  ? -0.723  -14.152 0.926   1.00 0.00 ? 225 GLU A O    4  
ATOM   7661  C  CB   . GLU A 1 71  ? -0.386  -11.474 -1.344  1.00 0.00 ? 225 GLU A CB   4  
ATOM   7662  C  CG   . GLU A 1 71  ? -1.355  -10.753 -2.284  1.00 0.00 ? 225 GLU A CG   4  
ATOM   7663  C  CD   . GLU A 1 71  ? -2.020  -11.772 -3.212  1.00 0.00 ? 225 GLU A CD   4  
ATOM   7664  O  OE1  . GLU A 1 71  ? -2.870  -12.508 -2.738  1.00 0.00 ? 225 GLU A OE1  4  
ATOM   7665  O  OE2  . GLU A 1 71  ? -1.669  -11.798 -4.379  1.00 0.00 ? 225 GLU A OE2  4  
ATOM   7666  H  H    . GLU A 1 71  ? -0.825  -10.271 0.998   1.00 0.00 ? 225 GLU A H    4  
ATOM   7667  H  HA   . GLU A 1 71  ? -2.049  -12.553 -0.520  1.00 0.00 ? 225 GLU A HA   4  
ATOM   7668  H  HB2  . GLU A 1 71  ? 0.349   -10.773 -0.977  1.00 0.00 ? 225 GLU A HB2  4  
ATOM   7669  H  HB3  . GLU A 1 71  ? 0.110   -12.268 -1.881  1.00 0.00 ? 225 GLU A HB3  4  
ATOM   7670  H  HG2  . GLU A 1 71  ? -2.112  -10.247 -1.701  1.00 0.00 ? 225 GLU A HG2  4  
ATOM   7671  H  HG3  . GLU A 1 71  ? -0.814  -10.031 -2.875  1.00 0.00 ? 225 GLU A HG3  4  
ATOM   7672  N  N    . GLY A 1 72  ? 0.926   -12.687 0.958   1.00 0.00 ? 226 GLY A N    4  
ATOM   7673  C  CA   . GLY A 1 72  ? 1.808   -13.620 1.723   1.00 0.00 ? 226 GLY A CA   4  
ATOM   7674  C  C    . GLY A 1 72  ? 2.968   -14.087 0.830   1.00 0.00 ? 226 GLY A C    4  
ATOM   7675  O  O    . GLY A 1 72  ? 3.261   -13.471 -0.178  1.00 0.00 ? 226 GLY A O    4  
ATOM   7676  H  H    . GLY A 1 72  ? 1.261   -11.800 0.708   1.00 0.00 ? 226 GLY A H    4  
ATOM   7677  H  HA2  . GLY A 1 72  ? 2.201   -13.110 2.591   1.00 0.00 ? 226 GLY A HA2  4  
ATOM   7678  H  HA3  . GLY A 1 72  ? 1.234   -14.478 2.039   1.00 0.00 ? 226 GLY A HA3  4  
ATOM   7679  N  N    . GLY A 1 73  ? 3.633   -15.169 1.188   1.00 0.00 ? 227 GLY A N    4  
ATOM   7680  C  CA   . GLY A 1 73  ? 4.769   -15.662 0.353   1.00 0.00 ? 227 GLY A CA   4  
ATOM   7681  C  C    . GLY A 1 73  ? 5.916   -14.644 0.395   1.00 0.00 ? 227 GLY A C    4  
ATOM   7682  O  O    . GLY A 1 73  ? 5.771   -13.527 -0.062  1.00 0.00 ? 227 GLY A O    4  
ATOM   7683  H  H    . GLY A 1 73  ? 3.385   -15.656 2.006   1.00 0.00 ? 227 GLY A H    4  
ATOM   7684  H  HA2  . GLY A 1 73  ? 5.113   -16.612 0.740   1.00 0.00 ? 227 GLY A HA2  4  
ATOM   7685  H  HA3  . GLY A 1 73  ? 4.439   -15.786 -0.667  1.00 0.00 ? 227 GLY A HA3  4  
ATOM   7686  N  N    . ASN A 1 74  ? 7.064   -15.011 0.944   1.00 0.00 ? 228 ASN A N    4  
ATOM   7687  C  CA   . ASN A 1 74  ? 8.217   -14.050 1.014   1.00 0.00 ? 228 ASN A CA   4  
ATOM   7688  C  C    . ASN A 1 74  ? 7.769   -12.721 1.646   1.00 0.00 ? 228 ASN A C    4  
ATOM   7689  O  O    . ASN A 1 74  ? 7.413   -11.793 0.944   1.00 0.00 ? 228 ASN A O    4  
ATOM   7690  C  CB   . ASN A 1 74  ? 8.652   -13.834 -0.438  1.00 0.00 ? 228 ASN A CB   4  
ATOM   7691  C  CG   . ASN A 1 74  ? 10.174  -13.650 -0.496  1.00 0.00 ? 228 ASN A CG   4  
ATOM   7692  O  OD1  . ASN A 1 74  ? 10.775  -13.196 0.457   1.00 0.00 ? 228 ASN A OD1  4  
ATOM   7693  N  ND2  . ASN A 1 74  ? 10.832  -13.985 -1.580  1.00 0.00 ? 228 ASN A ND2  4  
ATOM   7694  H  H    . ASN A 1 74  ? 7.169   -15.916 1.313   1.00 0.00 ? 228 ASN A H    4  
ATOM   7695  H  HA   . ASN A 1 74  ? 9.028   -14.477 1.580   1.00 0.00 ? 228 ASN A HA   4  
ATOM   7696  H  HB2  . ASN A 1 74  ? 8.369   -14.693 -1.030  1.00 0.00 ? 228 ASN A HB2  4  
ATOM   7697  H  HB3  . ASN A 1 74  ? 8.170   -12.951 -0.832  1.00 0.00 ? 228 ASN A HB3  4  
ATOM   7698  H  HD21 . ASN A 1 74  ? 10.357  -14.352 -2.357  1.00 0.00 ? 228 ASN A HD21 4  
ATOM   7699  H  HD22 . ASN A 1 74  ? 11.804  -13.866 -1.615  1.00 0.00 ? 228 ASN A HD22 4  
ATOM   7700  N  N    . LEU A 1 75  ? 7.767   -12.623 2.962   1.00 0.00 ? 229 LEU A N    4  
ATOM   7701  C  CA   . LEU A 1 75  ? 7.321   -11.352 3.606   1.00 0.00 ? 229 LEU A CA   4  
ATOM   7702  C  C    . LEU A 1 75  ? 8.419   -10.778 4.517   1.00 0.00 ? 229 LEU A C    4  
ATOM   7703  O  O    . LEU A 1 75  ? 9.386   -11.446 4.829   1.00 0.00 ? 229 LEU A O    4  
ATOM   7704  C  CB   . LEU A 1 75  ? 6.092   -11.723 4.446   1.00 0.00 ? 229 LEU A CB   4  
ATOM   7705  C  CG   . LEU A 1 75  ? 5.026   -12.401 3.577   1.00 0.00 ? 229 LEU A CG   4  
ATOM   7706  C  CD1  . LEU A 1 75  ? 3.838   -12.812 4.453   1.00 0.00 ? 229 LEU A CD1  4  
ATOM   7707  C  CD2  . LEU A 1 75  ? 4.547   -11.429 2.497   1.00 0.00 ? 229 LEU A CD2  4  
ATOM   7708  H  H    . LEU A 1 75  ? 8.046   -13.382 3.521   1.00 0.00 ? 229 LEU A H    4  
ATOM   7709  H  HA   . LEU A 1 75  ? 7.049   -10.635 2.852   1.00 0.00 ? 229 LEU A HA   4  
ATOM   7710  H  HB2  . LEU A 1 75  ? 6.390   -12.399 5.235   1.00 0.00 ? 229 LEU A HB2  4  
ATOM   7711  H  HB3  . LEU A 1 75  ? 5.676   -10.828 4.884   1.00 0.00 ? 229 LEU A HB3  4  
ATOM   7712  H  HG   . LEU A 1 75  ? 5.450   -13.280 3.110   1.00 0.00 ? 229 LEU A HG   4  
ATOM   7713  H  HD11 . LEU A 1 75  ? 3.063   -12.061 4.386   1.00 0.00 ? 229 LEU A HD11 4  
ATOM   7714  H  HD12 . LEU A 1 75  ? 4.161   -12.903 5.480   1.00 0.00 ? 229 LEU A HD12 4  
ATOM   7715  H  HD13 . LEU A 1 75  ? 3.451   -13.760 4.111   1.00 0.00 ? 229 LEU A HD13 4  
ATOM   7716  H  HD21 . LEU A 1 75  ? 5.256   -11.419 1.681   1.00 0.00 ? 229 LEU A HD21 4  
ATOM   7717  H  HD22 . LEU A 1 75  ? 4.466   -10.437 2.916   1.00 0.00 ? 229 LEU A HD22 4  
ATOM   7718  H  HD23 . LEU A 1 75  ? 3.582   -11.745 2.130   1.00 0.00 ? 229 LEU A HD23 4  
ATOM   7719  N  N    . ILE A 1 76  ? 8.264   -9.545  4.963   1.00 0.00 ? 230 ILE A N    4  
ATOM   7720  C  CA   . ILE A 1 76  ? 9.283   -8.936  5.869   1.00 0.00 ? 230 ILE A CA   4  
ATOM   7721  C  C    . ILE A 1 76  ? 8.646   -8.664  7.238   1.00 0.00 ? 230 ILE A C    4  
ATOM   7722  O  O    . ILE A 1 76  ? 7.965   -7.671  7.416   1.00 0.00 ? 230 ILE A O    4  
ATOM   7723  C  CB   . ILE A 1 76  ? 9.694   -7.621  5.190   1.00 0.00 ? 230 ILE A CB   4  
ATOM   7724  C  CG1  . ILE A 1 76  ? 10.434  -7.937  3.889   1.00 0.00 ? 230 ILE A CG1  4  
ATOM   7725  C  CG2  . ILE A 1 76  ? 10.616  -6.807  6.115   1.00 0.00 ? 230 ILE A CG2  4  
ATOM   7726  C  CD1  . ILE A 1 76  ? 10.750  -6.637  3.148   1.00 0.00 ? 230 ILE A CD1  4  
ATOM   7727  H  H    . ILE A 1 76  ? 7.470   -9.022  4.712   1.00 0.00 ? 230 ILE A H    4  
ATOM   7728  H  HA   . ILE A 1 76  ? 10.137  -9.586  5.970   1.00 0.00 ? 230 ILE A HA   4  
ATOM   7729  H  HB   . ILE A 1 76  ? 8.809   -7.042  4.968   1.00 0.00 ? 230 ILE A HB   4  
ATOM   7730  H  HG12 . ILE A 1 76  ? 11.355  -8.455  4.116   1.00 0.00 ? 230 ILE A HG12 4  
ATOM   7731  H  HG13 . ILE A 1 76  ? 9.814   -8.563  3.265   1.00 0.00 ? 230 ILE A HG13 4  
ATOM   7732  H  HG21 . ILE A 1 76  ? 10.131  -6.658  7.069   1.00 0.00 ? 230 ILE A HG21 4  
ATOM   7733  H  HG22 . ILE A 1 76  ? 10.821  -5.846  5.664   1.00 0.00 ? 230 ILE A HG22 4  
ATOM   7734  H  HG23 . ILE A 1 76  ? 11.544  -7.340  6.260   1.00 0.00 ? 230 ILE A HG23 4  
ATOM   7735  H  HD11 . ILE A 1 76  ? 10.630  -6.793  2.088   1.00 0.00 ? 230 ILE A HD11 4  
ATOM   7736  H  HD12 . ILE A 1 76  ? 11.767  -6.342  3.359   1.00 0.00 ? 230 ILE A HD12 4  
ATOM   7737  H  HD13 . ILE A 1 76  ? 10.073  -5.859  3.477   1.00 0.00 ? 230 ILE A HD13 4  
ATOM   7738  N  N    . CYS A 1 77  ? 8.865   -9.524  8.210   1.00 0.00 ? 231 CYS A N    4  
ATOM   7739  C  CA   . CYS A 1 77  ? 8.259   -9.276  9.566   1.00 0.00 ? 231 CYS A CA   4  
ATOM   7740  C  C    . CYS A 1 77  ? 8.767   -7.937  10.117  1.00 0.00 ? 231 CYS A C    4  
ATOM   7741  O  O    . CYS A 1 77  ? 9.875   -7.526  9.824   1.00 0.00 ? 231 CYS A O    4  
ATOM   7742  C  CB   . CYS A 1 77  ? 8.710   -10.431 10.473  1.00 0.00 ? 231 CYS A CB   4  
ATOM   7743  S  SG   . CYS A 1 77  ? 7.558   -11.817 10.303  1.00 0.00 ? 231 CYS A SG   4  
ATOM   7744  H  H    . CYS A 1 77  ? 9.426   -10.320 8.047   1.00 0.00 ? 231 CYS A H    4  
ATOM   7745  H  HA   . CYS A 1 77  ? 7.180   -9.257  9.493   1.00 0.00 ? 231 CYS A HA   4  
ATOM   7746  H  HB2  . CYS A 1 77  ? 9.701   -10.748 10.183  1.00 0.00 ? 231 CYS A HB2  4  
ATOM   7747  H  HB3  . CYS A 1 77  ? 8.724   -10.097 11.501  1.00 0.00 ? 231 CYS A HB3  4  
ATOM   7748  H  HG   . CYS A 1 77  ? 7.437   -11.988 9.367   1.00 0.00 ? 231 CYS A HG   4  
ATOM   7749  N  N    . CYS A 1 78  ? 7.968   -7.248  10.901  1.00 0.00 ? 232 CYS A N    4  
ATOM   7750  C  CA   . CYS A 1 78  ? 8.419   -5.931  11.450  1.00 0.00 ? 232 CYS A CA   4  
ATOM   7751  C  C    . CYS A 1 78  ? 8.754   -6.056  12.941  1.00 0.00 ? 232 CYS A C    4  
ATOM   7752  O  O    . CYS A 1 78  ? 8.179   -6.864  13.646  1.00 0.00 ? 232 CYS A O    4  
ATOM   7753  C  CB   . CYS A 1 78  ? 7.238   -4.977  11.237  1.00 0.00 ? 232 CYS A CB   4  
ATOM   7754  S  SG   . CYS A 1 78  ? 7.677   -3.315  11.806  1.00 0.00 ? 232 CYS A SG   4  
ATOM   7755  H  H    . CYS A 1 78  ? 7.072   -7.592  11.123  1.00 0.00 ? 232 CYS A H    4  
ATOM   7756  H  HA   . CYS A 1 78  ? 9.278   -5.577  10.906  1.00 0.00 ? 232 CYS A HA   4  
ATOM   7757  H  HB2  . CYS A 1 78  ? 6.989   -4.943  10.188  1.00 0.00 ? 232 CYS A HB2  4  
ATOM   7758  H  HB3  . CYS A 1 78  ? 6.386   -5.333  11.795  1.00 0.00 ? 232 CYS A HB3  4  
ATOM   7759  N  N    . ASP A 1 79  ? 9.675   -5.250  13.430  1.00 0.00 ? 233 ASP A N    4  
ATOM   7760  C  CA   . ASP A 1 79  ? 10.030  -5.317  14.883  1.00 0.00 ? 233 ASP A CA   4  
ATOM   7761  C  C    . ASP A 1 79  ? 9.425   -4.112  15.618  1.00 0.00 ? 233 ASP A C    4  
ATOM   7762  O  O    . ASP A 1 79  ? 10.058  -3.526  16.476  1.00 0.00 ? 233 ASP A O    4  
ATOM   7763  C  CB   . ASP A 1 79  ? 11.560  -5.270  14.938  1.00 0.00 ? 233 ASP A CB   4  
ATOM   7764  C  CG   . ASP A 1 79  ? 12.060  -6.190  16.053  1.00 0.00 ? 233 ASP A CG   4  
ATOM   7765  O  OD1  . ASP A 1 79  ? 11.670  -7.346  16.060  1.00 0.00 ? 233 ASP A OD1  4  
ATOM   7766  O  OD2  . ASP A 1 79  ? 12.826  -5.725  16.880  1.00 0.00 ? 233 ASP A OD2  4  
ATOM   7767  H  H    . ASP A 1 79  ? 10.122  -4.591  12.843  1.00 0.00 ? 233 ASP A H    4  
ATOM   7768  H  HA   . ASP A 1 79  ? 9.673   -6.239  15.314  1.00 0.00 ? 233 ASP A HA   4  
ATOM   7769  H  HB2  . ASP A 1 79  ? 11.965  -5.597  13.990  1.00 0.00 ? 233 ASP A HB2  4  
ATOM   7770  H  HB3  . ASP A 1 79  ? 11.882  -4.259  15.137  1.00 0.00 ? 233 ASP A HB3  4  
ATOM   7771  N  N    . PHE A 1 80  ? 8.206   -3.733  15.288  1.00 0.00 ? 234 PHE A N    4  
ATOM   7772  C  CA   . PHE A 1 80  ? 7.576   -2.562  15.971  1.00 0.00 ? 234 PHE A CA   4  
ATOM   7773  C  C    . PHE A 1 80  ? 6.045   -2.726  16.027  1.00 0.00 ? 234 PHE A C    4  
ATOM   7774  O  O    . PHE A 1 80  ? 5.461   -2.726  17.095  1.00 0.00 ? 234 PHE A O    4  
ATOM   7775  C  CB   . PHE A 1 80  ? 7.949   -1.355  15.106  1.00 0.00 ? 234 PHE A CB   4  
ATOM   7776  C  CG   . PHE A 1 80  ? 9.356   -0.893  15.423  1.00 0.00 ? 234 PHE A CG   4  
ATOM   7777  C  CD1  . PHE A 1 80  ? 9.761   -0.703  16.752  1.00 0.00 ? 234 PHE A CD1  4  
ATOM   7778  C  CD2  . PHE A 1 80  ? 10.255  -0.641  14.379  1.00 0.00 ? 234 PHE A CD2  4  
ATOM   7779  C  CE1  . PHE A 1 80  ? 11.062  -0.267  17.033  1.00 0.00 ? 234 PHE A CE1  4  
ATOM   7780  C  CE2  . PHE A 1 80  ? 11.553  -0.204  14.660  1.00 0.00 ? 234 PHE A CE2  4  
ATOM   7781  C  CZ   . PHE A 1 80  ? 11.958  -0.018  15.987  1.00 0.00 ? 234 PHE A CZ   4  
ATOM   7782  H  H    . PHE A 1 80  ? 7.706   -4.213  14.589  1.00 0.00 ? 234 PHE A H    4  
ATOM   7783  H  HA   . PHE A 1 80  ? 7.978   -2.443  16.964  1.00 0.00 ? 234 PHE A HA   4  
ATOM   7784  H  HB2  . PHE A 1 80  ? 7.894   -1.634  14.065  1.00 0.00 ? 234 PHE A HB2  4  
ATOM   7785  H  HB3  . PHE A 1 80  ? 7.256   -0.549  15.298  1.00 0.00 ? 234 PHE A HB3  4  
ATOM   7786  H  HD1  . PHE A 1 80  ? 9.071   -0.894  17.560  1.00 0.00 ? 234 PHE A HD1  4  
ATOM   7787  H  HD2  . PHE A 1 80  ? 9.949   -0.788  13.355  1.00 0.00 ? 234 PHE A HD2  4  
ATOM   7788  H  HE1  . PHE A 1 80  ? 11.374  -0.123  18.057  1.00 0.00 ? 234 PHE A HE1  4  
ATOM   7789  H  HE2  . PHE A 1 80  ? 12.241  -0.005  13.852  1.00 0.00 ? 234 PHE A HE2  4  
ATOM   7790  H  HZ   . PHE A 1 80  ? 12.960  0.320   16.203  1.00 0.00 ? 234 PHE A HZ   4  
ATOM   7791  N  N    . CYS A 1 81  ? 5.388   -2.864  14.889  1.00 0.00 ? 235 CYS A N    4  
ATOM   7792  C  CA   . CYS A 1 81  ? 3.890   -3.024  14.909  1.00 0.00 ? 235 CYS A CA   4  
ATOM   7793  C  C    . CYS A 1 81  ? 3.456   -4.508  14.811  1.00 0.00 ? 235 CYS A C    4  
ATOM   7794  O  O    . CYS A 1 81  ? 2.321   -4.788  14.473  1.00 0.00 ? 235 CYS A O    4  
ATOM   7795  C  CB   . CYS A 1 81  ? 3.355   -2.215  13.706  1.00 0.00 ? 235 CYS A CB   4  
ATOM   7796  S  SG   . CYS A 1 81  ? 3.884   -2.954  12.131  1.00 0.00 ? 235 CYS A SG   4  
ATOM   7797  H  H    . CYS A 1 81  ? 5.875   -2.862  14.035  1.00 0.00 ? 235 CYS A H    4  
ATOM   7798  H  HA   . CYS A 1 81  ? 3.498   -2.599  15.820  1.00 0.00 ? 235 CYS A HA   4  
ATOM   7799  H  HB2  . CYS A 1 81  ? 2.276   -2.199  13.742  1.00 0.00 ? 235 CYS A HB2  4  
ATOM   7800  H  HB3  . CYS A 1 81  ? 3.727   -1.203  13.768  1.00 0.00 ? 235 CYS A HB3  4  
ATOM   7801  N  N    . HIS A 1 82  ? 4.326   -5.460  15.110  1.00 0.00 ? 236 HIS A N    4  
ATOM   7802  C  CA   . HIS A 1 82  ? 3.928   -6.908  15.035  1.00 0.00 ? 236 HIS A CA   4  
ATOM   7803  C  C    . HIS A 1 82  ? 3.243   -7.235  13.693  1.00 0.00 ? 236 HIS A C    4  
ATOM   7804  O  O    . HIS A 1 82  ? 2.186   -7.837  13.667  1.00 0.00 ? 236 HIS A O    4  
ATOM   7805  C  CB   . HIS A 1 82  ? 2.953   -7.110  16.196  1.00 0.00 ? 236 HIS A CB   4  
ATOM   7806  C  CG   . HIS A 1 82  ? 3.715   -7.509  17.429  1.00 0.00 ? 236 HIS A CG   4  
ATOM   7807  N  ND1  . HIS A 1 82  ? 4.275   -6.576  18.288  1.00 0.00 ? 236 HIS A ND1  4  
ATOM   7808  C  CD2  . HIS A 1 82  ? 4.017   -8.738  17.962  1.00 0.00 ? 236 HIS A CD2  4  
ATOM   7809  C  CE1  . HIS A 1 82  ? 4.880   -7.251  19.281  1.00 0.00 ? 236 HIS A CE1  4  
ATOM   7810  N  NE2  . HIS A 1 82  ? 4.753   -8.572  19.132  1.00 0.00 ? 236 HIS A NE2  4  
ATOM   7811  H  H    . HIS A 1 82  ? 5.236   -5.232  15.393  1.00 0.00 ? 236 HIS A H    4  
ATOM   7812  H  HA   . HIS A 1 82  ? 4.793   -7.537  15.174  1.00 0.00 ? 236 HIS A HA   4  
ATOM   7813  H  HB2  . HIS A 1 82  ? 2.421   -6.187  16.384  1.00 0.00 ? 236 HIS A HB2  4  
ATOM   7814  H  HB3  . HIS A 1 82  ? 2.247   -7.887  15.942  1.00 0.00 ? 236 HIS A HB3  4  
ATOM   7815  H  HD1  . HIS A 1 82  ? 4.236   -5.601  18.188  1.00 0.00 ? 236 HIS A HD1  4  
ATOM   7816  H  HD2  . HIS A 1 82  ? 3.729   -9.689  17.538  1.00 0.00 ? 236 HIS A HD2  4  
ATOM   7817  H  HE1  . HIS A 1 82  ? 5.405   -6.782  20.100  1.00 0.00 ? 236 HIS A HE1  4  
ATOM   7818  N  N    . ASN A 1 83  ? 3.833   -6.848  12.581  1.00 0.00 ? 237 ASN A N    4  
ATOM   7819  C  CA   . ASN A 1 83  ? 3.205   -7.144  11.256  1.00 0.00 ? 237 ASN A CA   4  
ATOM   7820  C  C    . ASN A 1 83  ? 4.291   -7.382  10.190  1.00 0.00 ? 237 ASN A C    4  
ATOM   7821  O  O    . ASN A 1 83  ? 5.442   -7.047  10.395  1.00 0.00 ? 237 ASN A O    4  
ATOM   7822  C  CB   . ASN A 1 83  ? 2.375   -5.897  10.916  1.00 0.00 ? 237 ASN A CB   4  
ATOM   7823  C  CG   . ASN A 1 83  ? 0.901   -6.287  10.729  1.00 0.00 ? 237 ASN A CG   4  
ATOM   7824  O  OD1  . ASN A 1 83  ? 0.589   -7.134  9.915   1.00 0.00 ? 237 ASN A OD1  4  
ATOM   7825  N  ND2  . ASN A 1 83  ? -0.026  -5.708  11.452  1.00 0.00 ? 237 ASN A ND2  4  
ATOM   7826  H  H    . ASN A 1 83  ? 4.687   -6.363  12.617  1.00 0.00 ? 237 ASN A H    4  
ATOM   7827  H  HA   . ASN A 1 83  ? 2.562   -8.008  11.332  1.00 0.00 ? 237 ASN A HA   4  
ATOM   7828  H  HB2  . ASN A 1 83  ? 2.455   -5.180  11.720  1.00 0.00 ? 237 ASN A HB2  4  
ATOM   7829  H  HB3  . ASN A 1 83  ? 2.743   -5.454  10.002  1.00 0.00 ? 237 ASN A HB3  4  
ATOM   7830  H  HD21 . ASN A 1 83  ? 0.216   -5.022  12.113  1.00 0.00 ? 237 ASN A HD21 4  
ATOM   7831  H  HD22 . ASN A 1 83  ? -0.965  -5.958  11.331  1.00 0.00 ? 237 ASN A HD22 4  
ATOM   7832  N  N    . ALA A 1 84  ? 3.939   -7.959  9.059   1.00 0.00 ? 238 ALA A N    4  
ATOM   7833  C  CA   . ALA A 1 84  ? 4.959   -8.216  7.998   1.00 0.00 ? 238 ALA A CA   4  
ATOM   7834  C  C    . ALA A 1 84  ? 4.415   -7.804  6.618   1.00 0.00 ? 238 ALA A C    4  
ATOM   7835  O  O    . ALA A 1 84  ? 3.232   -7.917  6.359   1.00 0.00 ? 238 ALA A O    4  
ATOM   7836  C  CB   . ALA A 1 84  ? 5.198   -9.726  8.043   1.00 0.00 ? 238 ALA A CB   4  
ATOM   7837  H  H    . ALA A 1 84  ? 3.005   -8.228  8.907   1.00 0.00 ? 238 ALA A H    4  
ATOM   7838  H  HA   . ALA A 1 84  ? 5.877   -7.694  8.218   1.00 0.00 ? 238 ALA A HA   4  
ATOM   7839  H  HB1  . ALA A 1 84  ? 4.919   -10.106 9.015   1.00 0.00 ? 238 ALA A HB1  4  
ATOM   7840  H  HB2  . ALA A 1 84  ? 6.244   -9.930  7.864   1.00 0.00 ? 238 ALA A HB2  4  
ATOM   7841  H  HB3  . ALA A 1 84  ? 4.602   -10.209 7.283   1.00 0.00 ? 238 ALA A HB3  4  
ATOM   7842  N  N    . PHE A 1 85  ? 5.266   -7.346  5.722   1.00 0.00 ? 239 PHE A N    4  
ATOM   7843  C  CA   . PHE A 1 85  ? 4.784   -6.955  4.357   1.00 0.00 ? 239 PHE A CA   4  
ATOM   7844  C  C    . PHE A 1 85  ? 5.295   -7.979  3.333   1.00 0.00 ? 239 PHE A C    4  
ATOM   7845  O  O    . PHE A 1 85  ? 5.937   -8.939  3.705   1.00 0.00 ? 239 PHE A O    4  
ATOM   7846  C  CB   . PHE A 1 85  ? 5.381   -5.569  4.087   1.00 0.00 ? 239 PHE A CB   4  
ATOM   7847  C  CG   . PHE A 1 85  ? 4.453   -4.506  4.629   1.00 0.00 ? 239 PHE A CG   4  
ATOM   7848  C  CD1  . PHE A 1 85  ? 3.368   -4.063  3.860   1.00 0.00 ? 239 PHE A CD1  4  
ATOM   7849  C  CD2  . PHE A 1 85  ? 4.676   -3.965  5.899   1.00 0.00 ? 239 PHE A CD2  4  
ATOM   7850  C  CE1  . PHE A 1 85  ? 2.505   -3.079  4.366   1.00 0.00 ? 239 PHE A CE1  4  
ATOM   7851  C  CE2  . PHE A 1 85  ? 3.815   -2.981  6.404   1.00 0.00 ? 239 PHE A CE2  4  
ATOM   7852  C  CZ   . PHE A 1 85  ? 2.729   -2.538  5.637   1.00 0.00 ? 239 PHE A CZ   4  
ATOM   7853  H  H    . PHE A 1 85  ? 6.223   -7.273  5.941   1.00 0.00 ? 239 PHE A H    4  
ATOM   7854  H  HA   . PHE A 1 85  ? 3.707   -6.906  4.338   1.00 0.00 ? 239 PHE A HA   4  
ATOM   7855  H  HB2  . PHE A 1 85  ? 6.342   -5.490  4.575   1.00 0.00 ? 239 PHE A HB2  4  
ATOM   7856  H  HB3  . PHE A 1 85  ? 5.505   -5.431  3.024   1.00 0.00 ? 239 PHE A HB3  4  
ATOM   7857  H  HD1  . PHE A 1 85  ? 3.195   -4.480  2.879   1.00 0.00 ? 239 PHE A HD1  4  
ATOM   7858  H  HD2  . PHE A 1 85  ? 5.515   -4.305  6.489   1.00 0.00 ? 239 PHE A HD2  4  
ATOM   7859  H  HE1  . PHE A 1 85  ? 1.668   -2.735  3.774   1.00 0.00 ? 239 PHE A HE1  4  
ATOM   7860  H  HE2  . PHE A 1 85  ? 3.987   -2.565  7.384   1.00 0.00 ? 239 PHE A HE2  4  
ATOM   7861  H  HZ   . PHE A 1 85  ? 2.062   -1.780  6.029   1.00 0.00 ? 239 PHE A HZ   4  
ATOM   7862  N  N    . CYS A 1 86  ? 5.024   -7.795  2.053   1.00 0.00 ? 240 CYS A N    4  
ATOM   7863  C  CA   . CYS A 1 86  ? 5.515   -8.787  1.045   1.00 0.00 ? 240 CYS A CA   4  
ATOM   7864  C  C    . CYS A 1 86  ? 6.495   -8.127  0.049   1.00 0.00 ? 240 CYS A C    4  
ATOM   7865  O  O    . CYS A 1 86  ? 6.577   -6.916  -0.038  1.00 0.00 ? 240 CYS A O    4  
ATOM   7866  C  CB   . CYS A 1 86  ? 4.244   -9.363  0.364   1.00 0.00 ? 240 CYS A CB   4  
ATOM   7867  S  SG   . CYS A 1 86  ? 3.629   -8.315  -0.992  1.00 0.00 ? 240 CYS A SG   4  
ATOM   7868  H  H    . CYS A 1 86  ? 4.507   -7.017  1.761   1.00 0.00 ? 240 CYS A H    4  
ATOM   7869  H  HA   . CYS A 1 86  ? 6.025   -9.585  1.558   1.00 0.00 ? 240 CYS A HA   4  
ATOM   7870  H  HB2  . CYS A 1 86  ? 4.474   -10.339 -0.034  1.00 0.00 ? 240 CYS A HB2  4  
ATOM   7871  H  HB3  . CYS A 1 86  ? 3.470   -9.466  1.109   1.00 0.00 ? 240 CYS A HB3  4  
ATOM   7872  N  N    . LYS A 1 87  ? 7.245   -8.919  -0.692  1.00 0.00 ? 241 LYS A N    4  
ATOM   7873  C  CA   . LYS A 1 87  ? 8.229   -8.327  -1.673  1.00 0.00 ? 241 LYS A CA   4  
ATOM   7874  C  C    . LYS A 1 87  ? 7.500   -7.639  -2.846  1.00 0.00 ? 241 LYS A C    4  
ATOM   7875  O  O    . LYS A 1 87  ? 7.966   -6.637  -3.357  1.00 0.00 ? 241 LYS A O    4  
ATOM   7876  C  CB   . LYS A 1 87  ? 9.079   -9.501  -2.195  1.00 0.00 ? 241 LYS A CB   4  
ATOM   7877  C  CG   . LYS A 1 87  ? 10.157  -8.977  -3.147  1.00 0.00 ? 241 LYS A CG   4  
ATOM   7878  C  CD   . LYS A 1 87  ? 10.813  -10.152 -3.874  1.00 0.00 ? 241 LYS A CD   4  
ATOM   7879  C  CE   . LYS A 1 87  ? 10.098  -10.395 -5.205  1.00 0.00 ? 241 LYS A CE   4  
ATOM   7880  N  NZ   . LYS A 1 87  ? 10.846  -9.575  -6.198  1.00 0.00 ? 241 LYS A NZ   4  
ATOM   7881  H  H    . LYS A 1 87  ? 7.163   -9.900  -0.596  1.00 0.00 ? 241 LYS A H    4  
ATOM   7882  H  HA   . LYS A 1 87  ? 8.866   -7.616  -1.169  1.00 0.00 ? 241 LYS A HA   4  
ATOM   7883  H  HB2  . LYS A 1 87  ? 9.549   -10.003 -1.359  1.00 0.00 ? 241 LYS A HB2  4  
ATOM   7884  H  HB3  . LYS A 1 87  ? 8.444   -10.198 -2.721  1.00 0.00 ? 241 LYS A HB3  4  
ATOM   7885  H  HG2  . LYS A 1 87  ? 9.704   -8.312  -3.870  1.00 0.00 ? 241 LYS A HG2  4  
ATOM   7886  H  HG3  . LYS A 1 87  ? 10.904  -8.440  -2.585  1.00 0.00 ? 241 LYS A HG3  4  
ATOM   7887  H  HD2  . LYS A 1 87  ? 11.854  -9.925  -4.058  1.00 0.00 ? 241 LYS A HD2  4  
ATOM   7888  H  HD3  . LYS A 1 87  ? 10.741  -11.038 -3.262  1.00 0.00 ? 241 LYS A HD3  4  
ATOM   7889  H  HE2  . LYS A 1 87  ? 10.142  -11.443 -5.468  1.00 0.00 ? 241 LYS A HE2  4  
ATOM   7890  H  HE3  . LYS A 1 87  ? 9.073   -10.063 -5.148  1.00 0.00 ? 241 LYS A HE3  4  
ATOM   7891  H  HZ1  . LYS A 1 87  ? 10.507  -9.795  -7.155  1.00 0.00 ? 241 LYS A HZ1  4  
ATOM   7892  H  HZ2  . LYS A 1 87  ? 11.862  -9.790  -6.129  1.00 0.00 ? 241 LYS A HZ2  4  
ATOM   7893  H  HZ3  . LYS A 1 87  ? 10.691  -8.566  -6.001  1.00 0.00 ? 241 LYS A HZ3  4  
ATOM   7894  N  N    . LYS A 1 88  ? 6.372   -8.163  -3.284  1.00 0.00 ? 242 LYS A N    4  
ATOM   7895  C  CA   . LYS A 1 88  ? 5.644   -7.514  -4.440  1.00 0.00 ? 242 LYS A CA   4  
ATOM   7896  C  C    . LYS A 1 88  ? 5.197   -6.073  -4.106  1.00 0.00 ? 242 LYS A C    4  
ATOM   7897  O  O    . LYS A 1 88  ? 4.962   -5.284  -5.003  1.00 0.00 ? 242 LYS A O    4  
ATOM   7898  C  CB   . LYS A 1 88  ? 4.410   -8.386  -4.726  1.00 0.00 ? 242 LYS A CB   4  
ATOM   7899  C  CG   . LYS A 1 88  ? 4.832   -9.621  -5.525  1.00 0.00 ? 242 LYS A CG   4  
ATOM   7900  C  CD   . LYS A 1 88  ? 5.008   -9.242  -6.996  1.00 0.00 ? 242 LYS A CD   4  
ATOM   7901  C  CE   . LYS A 1 88  ? 3.670   -9.393  -7.725  1.00 0.00 ? 242 LYS A CE   4  
ATOM   7902  N  NZ   . LYS A 1 88  ? 3.663   -8.304  -8.742  1.00 0.00 ? 242 LYS A NZ   4  
ATOM   7903  H  H    . LYS A 1 88  ? 6.013   -8.979  -2.863  1.00 0.00 ? 242 LYS A H    4  
ATOM   7904  H  HA   . LYS A 1 88  ? 6.280   -7.502  -5.309  1.00 0.00 ? 242 LYS A HA   4  
ATOM   7905  H  HB2  . LYS A 1 88  ? 3.964   -8.695  -3.792  1.00 0.00 ? 242 LYS A HB2  4  
ATOM   7906  H  HB3  . LYS A 1 88  ? 3.692   -7.817  -5.297  1.00 0.00 ? 242 LYS A HB3  4  
ATOM   7907  H  HG2  . LYS A 1 88  ? 5.766   -9.999  -5.135  1.00 0.00 ? 242 LYS A HG2  4  
ATOM   7908  H  HG3  . LYS A 1 88  ? 4.072   -10.382 -5.439  1.00 0.00 ? 242 LYS A HG3  4  
ATOM   7909  H  HD2  . LYS A 1 88  ? 5.343   -8.217  -7.066  1.00 0.00 ? 242 LYS A HD2  4  
ATOM   7910  H  HD3  . LYS A 1 88  ? 5.739   -9.893  -7.450  1.00 0.00 ? 242 LYS A HD3  4  
ATOM   7911  H  HE2  . LYS A 1 88  ? 3.613   -10.361 -8.206  1.00 0.00 ? 242 LYS A HE2  4  
ATOM   7912  H  HE3  . LYS A 1 88  ? 2.850   -9.263  -7.038  1.00 0.00 ? 242 LYS A HE3  4  
ATOM   7913  H  HZ1  . LYS A 1 88  ? 4.432   -8.459  -9.423  1.00 0.00 ? 242 LYS A HZ1  4  
ATOM   7914  H  HZ2  . LYS A 1 88  ? 3.798   -7.387  -8.268  1.00 0.00 ? 242 LYS A HZ2  4  
ATOM   7915  H  HZ3  . LYS A 1 88  ? 2.753   -8.305  -9.244  1.00 0.00 ? 242 LYS A HZ3  4  
ATOM   7916  N  N    . CYS A 1 89  ? 5.078   -5.713  -2.841  1.00 0.00 ? 243 CYS A N    4  
ATOM   7917  C  CA   . CYS A 1 89  ? 4.642   -4.313  -2.506  1.00 0.00 ? 243 CYS A CA   4  
ATOM   7918  C  C    . CYS A 1 89  ? 5.869   -3.396  -2.409  1.00 0.00 ? 243 CYS A C    4  
ATOM   7919  O  O    . CYS A 1 89  ? 5.839   -2.275  -2.882  1.00 0.00 ? 243 CYS A O    4  
ATOM   7920  C  CB   . CYS A 1 89  ? 3.910   -4.395  -1.155  1.00 0.00 ? 243 CYS A CB   4  
ATOM   7921  S  SG   . CYS A 1 89  ? 2.195   -4.928  -1.419  1.00 0.00 ? 243 CYS A SG   4  
ATOM   7922  H  H    . CYS A 1 89  ? 5.278   -6.347  -2.123  1.00 0.00 ? 243 CYS A H    4  
ATOM   7923  H  HA   . CYS A 1 89  ? 3.971   -3.945  -3.268  1.00 0.00 ? 243 CYS A HA   4  
ATOM   7924  H  HB2  . CYS A 1 89  ? 4.411   -5.108  -0.518  1.00 0.00 ? 243 CYS A HB2  4  
ATOM   7925  H  HB3  . CYS A 1 89  ? 3.916   -3.424  -0.683  1.00 0.00 ? 243 CYS A HB3  4  
ATOM   7926  N  N    . ILE A 1 90  ? 6.954   -3.861  -1.823  1.00 0.00 ? 244 ILE A N    4  
ATOM   7927  C  CA   . ILE A 1 90  ? 8.177   -2.987  -1.740  1.00 0.00 ? 244 ILE A CA   4  
ATOM   7928  C  C    . ILE A 1 90  ? 8.783   -2.845  -3.142  1.00 0.00 ? 244 ILE A C    4  
ATOM   7929  O  O    . ILE A 1 90  ? 9.197   -1.770  -3.531  1.00 0.00 ? 244 ILE A O    4  
ATOM   7930  C  CB   . ILE A 1 90  ? 9.157   -3.679  -0.783  1.00 0.00 ? 244 ILE A CB   4  
ATOM   7931  C  CG1  . ILE A 1 90  ? 8.498   -3.808  0.590   1.00 0.00 ? 244 ILE A CG1  4  
ATOM   7932  C  CG2  . ILE A 1 90  ? 10.432  -2.841  -0.657  1.00 0.00 ? 244 ILE A CG2  4  
ATOM   7933  C  CD1  . ILE A 1 90  ? 9.013   -5.067  1.286   1.00 0.00 ? 244 ILE A CD1  4  
ATOM   7934  H  H    . ILE A 1 90  ? 6.968   -4.780  -1.462  1.00 0.00 ? 244 ILE A H    4  
ATOM   7935  H  HA   . ILE A 1 90  ? 7.910   -2.016  -1.353  1.00 0.00 ? 244 ILE A HA   4  
ATOM   7936  H  HB   . ILE A 1 90  ? 9.403   -4.659  -1.163  1.00 0.00 ? 244 ILE A HB   4  
ATOM   7937  H  HG12 . ILE A 1 90  ? 8.739   -2.940  1.186   1.00 0.00 ? 244 ILE A HG12 4  
ATOM   7938  H  HG13 . ILE A 1 90  ? 7.428   -3.876  0.469   1.00 0.00 ? 244 ILE A HG13 4  
ATOM   7939  H  HG21 . ILE A 1 90  ? 10.929  -3.081  0.272   1.00 0.00 ? 244 ILE A HG21 4  
ATOM   7940  H  HG22 . ILE A 1 90  ? 10.175  -1.791  -0.669  1.00 0.00 ? 244 ILE A HG22 4  
ATOM   7941  H  HG23 . ILE A 1 90  ? 11.090  -3.061  -1.485  1.00 0.00 ? 244 ILE A HG23 4  
ATOM   7942  H  HD11 . ILE A 1 90  ? 8.663   -5.940  0.756   1.00 0.00 ? 244 ILE A HD11 4  
ATOM   7943  H  HD12 . ILE A 1 90  ? 8.648   -5.090  2.302   1.00 0.00 ? 244 ILE A HD12 4  
ATOM   7944  H  HD13 . ILE A 1 90  ? 10.092  -5.057  1.291   1.00 0.00 ? 244 ILE A HD13 4  
ATOM   7945  N  N    . LEU A 1 91  ? 8.818   -3.911  -3.923  1.00 0.00 ? 245 LEU A N    4  
ATOM   7946  C  CA   . LEU A 1 91  ? 9.378   -3.794  -5.317  1.00 0.00 ? 245 LEU A CA   4  
ATOM   7947  C  C    . LEU A 1 91  ? 8.582   -2.733  -6.101  1.00 0.00 ? 245 LEU A C    4  
ATOM   7948  O  O    . LEU A 1 91  ? 9.151   -1.965  -6.856  1.00 0.00 ? 245 LEU A O    4  
ATOM   7949  C  CB   . LEU A 1 91  ? 9.227   -5.180  -5.977  1.00 0.00 ? 245 LEU A CB   4  
ATOM   7950  C  CG   . LEU A 1 91  ? 9.727   -5.130  -7.425  1.00 0.00 ? 245 LEU A CG   4  
ATOM   7951  C  CD1  . LEU A 1 91  ? 11.234  -4.877  -7.441  1.00 0.00 ? 245 LEU A CD1  4  
ATOM   7952  C  CD2  . LEU A 1 91  ? 9.429   -6.465  -8.112  1.00 0.00 ? 245 LEU A CD2  4  
ATOM   7953  H  H    . LEU A 1 91  ? 8.465   -4.773  -3.598  1.00 0.00 ? 245 LEU A H    4  
ATOM   7954  H  HA   . LEU A 1 91  ? 10.417  -3.518  -5.271  1.00 0.00 ? 245 LEU A HA   4  
ATOM   7955  H  HB2  . LEU A 1 91  ? 9.804   -5.905  -5.423  1.00 0.00 ? 245 LEU A HB2  4  
ATOM   7956  H  HB3  . LEU A 1 91  ? 8.186   -5.468  -5.968  1.00 0.00 ? 245 LEU A HB3  4  
ATOM   7957  H  HG   . LEU A 1 91  ? 9.222   -4.332  -7.952  1.00 0.00 ? 245 LEU A HG   4  
ATOM   7958  H  HD11 . LEU A 1 91  ? 11.572  -4.775  -8.462  1.00 0.00 ? 245 LEU A HD11 4  
ATOM   7959  H  HD12 . LEU A 1 91  ? 11.743  -5.706  -6.976  1.00 0.00 ? 245 LEU A HD12 4  
ATOM   7960  H  HD13 . LEU A 1 91  ? 11.453  -3.969  -6.898  1.00 0.00 ? 245 LEU A HD13 4  
ATOM   7961  H  HD21 . LEU A 1 91  ? 10.226  -7.162  -7.903  1.00 0.00 ? 245 LEU A HD21 4  
ATOM   7962  H  HD22 . LEU A 1 91  ? 9.353   -6.312  -9.178  1.00 0.00 ? 245 LEU A HD22 4  
ATOM   7963  H  HD23 . LEU A 1 91  ? 8.496   -6.861  -7.739  1.00 0.00 ? 245 LEU A HD23 4  
ATOM   7964  N  N    . ARG A 1 92  ? 7.274   -2.669  -5.918  1.00 0.00 ? 246 ARG A N    4  
ATOM   7965  C  CA   . ARG A 1 92  ? 6.472   -1.629  -6.655  1.00 0.00 ? 246 ARG A CA   4  
ATOM   7966  C  C    . ARG A 1 92  ? 6.546   -0.257  -5.945  1.00 0.00 ? 246 ARG A C    4  
ATOM   7967  O  O    . ARG A 1 92  ? 6.230   0.756   -6.542  1.00 0.00 ? 246 ARG A O    4  
ATOM   7968  C  CB   . ARG A 1 92  ? 5.022   -2.136  -6.681  1.00 0.00 ? 246 ARG A CB   4  
ATOM   7969  C  CG   . ARG A 1 92  ? 4.839   -3.100  -7.855  1.00 0.00 ? 246 ARG A CG   4  
ATOM   7970  C  CD   . ARG A 1 92  ? 4.743   -2.305  -9.159  1.00 0.00 ? 246 ARG A CD   4  
ATOM   7971  N  NE   . ARG A 1 92  ? 4.584   -3.338  -10.229 1.00 0.00 ? 246 ARG A NE   4  
ATOM   7972  C  CZ   . ARG A 1 92  ? 5.611   -4.061  -10.646 1.00 0.00 ? 246 ARG A CZ   4  
ATOM   7973  N  NH1  . ARG A 1 92  ? 6.811   -3.905  -10.134 1.00 0.00 ? 246 ARG A NH1  4  
ATOM   7974  N  NH2  . ARG A 1 92  ? 5.435   -4.953  -11.586 1.00 0.00 ? 246 ARG A NH2  4  
ATOM   7975  H  H    . ARG A 1 92  ? 6.827   -3.290  -5.290  1.00 0.00 ? 246 ARG A H    4  
ATOM   7976  H  HA   . ARG A 1 92  ? 6.838   -1.535  -7.665  1.00 0.00 ? 246 ARG A HA   4  
ATOM   7977  H  HB2  . ARG A 1 92  ? 4.803   -2.648  -5.755  1.00 0.00 ? 246 ARG A HB2  4  
ATOM   7978  H  HB3  . ARG A 1 92  ? 4.350   -1.298  -6.798  1.00 0.00 ? 246 ARG A HB3  4  
ATOM   7979  H  HG2  . ARG A 1 92  ? 5.685   -3.772  -7.903  1.00 0.00 ? 246 ARG A HG2  4  
ATOM   7980  H  HG3  . ARG A 1 92  ? 3.933   -3.670  -7.715  1.00 0.00 ? 246 ARG A HG3  4  
ATOM   7981  H  HD2  . ARG A 1 92  ? 3.884   -1.649  -9.135  1.00 0.00 ? 246 ARG A HD2  4  
ATOM   7982  H  HD3  . ARG A 1 92  ? 5.646   -1.739  -9.324  1.00 0.00 ? 246 ARG A HD3  4  
ATOM   7983  H  HE   . ARG A 1 92  ? 3.697   -3.478  -10.629 1.00 0.00 ? 246 ARG A HE   4  
ATOM   7984  H  HH11 . ARG A 1 92  ? 6.972   -3.231  -9.415  1.00 0.00 ? 246 ARG A HH11 4  
ATOM   7985  H  HH12 . ARG A 1 92  ? 7.570   -4.464  -10.468 1.00 0.00 ? 246 ARG A HH12 4  
ATOM   7986  H  HH21 . ARG A 1 92  ? 4.528   -5.086  -11.986 1.00 0.00 ? 246 ARG A HH21 4  
ATOM   7987  H  HH22 . ARG A 1 92  ? 6.208   -5.502  -11.905 1.00 0.00 ? 246 ARG A HH22 4  
ATOM   7988  N  N    . ASN A 1 93  ? 6.955   -0.200  -4.687  1.00 0.00 ? 247 ASN A N    4  
ATOM   7989  C  CA   . ASN A 1 93  ? 7.031   1.126   -3.986  1.00 0.00 ? 247 ASN A CA   4  
ATOM   7990  C  C    . ASN A 1 93  ? 8.465   1.675   -4.023  1.00 0.00 ? 247 ASN A C    4  
ATOM   7991  O  O    . ASN A 1 93  ? 8.668   2.856   -4.237  1.00 0.00 ? 247 ASN A O    4  
ATOM   7992  C  CB   . ASN A 1 93  ? 6.598   0.866   -2.537  1.00 0.00 ? 247 ASN A CB   4  
ATOM   7993  C  CG   . ASN A 1 93  ? 6.555   2.194   -1.769  1.00 0.00 ? 247 ASN A CG   4  
ATOM   7994  O  OD1  . ASN A 1 93  ? 5.518   2.821   -1.686  1.00 0.00 ? 247 ASN A OD1  4  
ATOM   7995  N  ND2  . ASN A 1 93  ? 7.641   2.656   -1.200  1.00 0.00 ? 247 ASN A ND2  4  
ATOM   7996  H  H    . ASN A 1 93  ? 7.210   -1.015  -4.207  1.00 0.00 ? 247 ASN A H    4  
ATOM   7997  H  HA   . ASN A 1 93  ? 6.359   1.826   -4.448  1.00 0.00 ? 247 ASN A HA   4  
ATOM   7998  H  HB2  . ASN A 1 93  ? 5.617   0.414   -2.531  1.00 0.00 ? 247 ASN A HB2  4  
ATOM   7999  H  HB3  . ASN A 1 93  ? 7.305   0.201   -2.063  1.00 0.00 ? 247 ASN A HB3  4  
ATOM   8000  H  HD21 . ASN A 1 93  ? 8.486   2.157   -1.261  1.00 0.00 ? 247 ASN A HD21 4  
ATOM   8001  H  HD22 . ASN A 1 93  ? 7.612   3.504   -0.711  1.00 0.00 ? 247 ASN A HD22 4  
ATOM   8002  N  N    . LEU A 1 94  ? 9.462   0.839   -3.812  1.00 0.00 ? 248 LEU A N    4  
ATOM   8003  C  CA   . LEU A 1 94  ? 10.872  1.348   -3.835  1.00 0.00 ? 248 LEU A CA   4  
ATOM   8004  C  C    . LEU A 1 94  ? 11.878  0.300   -4.359  1.00 0.00 ? 248 LEU A C    4  
ATOM   8005  O  O    . LEU A 1 94  ? 13.050  0.363   -4.032  1.00 0.00 ? 248 LEU A O    4  
ATOM   8006  C  CB   . LEU A 1 94  ? 11.190  1.726   -2.381  1.00 0.00 ? 248 LEU A CB   4  
ATOM   8007  C  CG   . LEU A 1 94  ? 11.086  0.499   -1.466  1.00 0.00 ? 248 LEU A CG   4  
ATOM   8008  C  CD1  . LEU A 1 94  ? 12.419  -0.246  -1.448  1.00 0.00 ? 248 LEU A CD1  4  
ATOM   8009  C  CD2  . LEU A 1 94  ? 10.744  0.958   -0.045  1.00 0.00 ? 248 LEU A CD2  4  
ATOM   8010  H  H    . LEU A 1 94  ? 9.282   -0.108  -3.638  1.00 0.00 ? 248 LEU A H    4  
ATOM   8011  H  HA   . LEU A 1 94  ? 10.925  2.234   -4.448  1.00 0.00 ? 248 LEU A HA   4  
ATOM   8012  H  HB2  . LEU A 1 94  ? 12.192  2.125   -2.328  1.00 0.00 ? 248 LEU A HB2  4  
ATOM   8013  H  HB3  . LEU A 1 94  ? 10.490  2.479   -2.048  1.00 0.00 ? 248 LEU A HB3  4  
ATOM   8014  H  HG   . LEU A 1 94  ? 10.313  -0.160  -1.824  1.00 0.00 ? 248 LEU A HG   4  
ATOM   8015  H  HD11 . LEU A 1 94  ? 12.520  -0.782  -0.517  1.00 0.00 ? 248 LEU A HD11 4  
ATOM   8016  H  HD12 . LEU A 1 94  ? 13.229  0.463   -1.544  1.00 0.00 ? 248 LEU A HD12 4  
ATOM   8017  H  HD13 . LEU A 1 94  ? 12.453  -0.943  -2.272  1.00 0.00 ? 248 LEU A HD13 4  
ATOM   8018  H  HD21 . LEU A 1 94  ? 9.673   0.937   0.091   1.00 0.00 ? 248 LEU A HD21 4  
ATOM   8019  H  HD22 . LEU A 1 94  ? 11.107  1.964   0.105   1.00 0.00 ? 248 LEU A HD22 4  
ATOM   8020  H  HD23 . LEU A 1 94  ? 11.211  0.296   0.669   1.00 0.00 ? 248 LEU A HD23 4  
ATOM   8021  N  N    . GLY A 1 95  ? 11.462  -0.644  -5.187  1.00 0.00 ? 249 GLY A N    4  
ATOM   8022  C  CA   . GLY A 1 95  ? 12.435  -1.645  -5.724  1.00 0.00 ? 249 GLY A CA   4  
ATOM   8023  C  C    . GLY A 1 95  ? 12.712  -2.738  -4.683  1.00 0.00 ? 249 GLY A C    4  
ATOM   8024  O  O    . GLY A 1 95  ? 12.162  -2.726  -3.599  1.00 0.00 ? 249 GLY A O    4  
ATOM   8025  H  H    . GLY A 1 95  ? 10.523  -0.684  -5.472  1.00 0.00 ? 249 GLY A H    4  
ATOM   8026  H  HA2  . GLY A 1 95  ? 12.027  -2.095  -6.617  1.00 0.00 ? 249 GLY A HA2  4  
ATOM   8027  H  HA3  . GLY A 1 95  ? 13.362  -1.148  -5.968  1.00 0.00 ? 249 GLY A HA3  4  
ATOM   8028  N  N    . ARG A 1 96  ? 13.565  -3.692  -5.009  1.00 0.00 ? 250 ARG A N    4  
ATOM   8029  C  CA   . ARG A 1 96  ? 13.877  -4.792  -4.034  1.00 0.00 ? 250 ARG A CA   4  
ATOM   8030  C  C    . ARG A 1 96  ? 15.229  -4.572  -3.324  1.00 0.00 ? 250 ARG A C    4  
ATOM   8031  O  O    . ARG A 1 96  ? 15.427  -5.062  -2.227  1.00 0.00 ? 250 ARG A O    4  
ATOM   8032  C  CB   . ARG A 1 96  ? 13.928  -6.076  -4.868  1.00 0.00 ? 250 ARG A CB   4  
ATOM   8033  C  CG   . ARG A 1 96  ? 13.771  -7.290  -3.949  1.00 0.00 ? 250 ARG A CG   4  
ATOM   8034  C  CD   . ARG A 1 96  ? 14.597  -8.457  -4.494  1.00 0.00 ? 250 ARG A CD   4  
ATOM   8035  N  NE   . ARG A 1 96  ? 15.853  -8.451  -3.683  1.00 0.00 ? 250 ARG A NE   4  
ATOM   8036  C  CZ   . ARG A 1 96  ? 15.864  -8.874  -2.427  1.00 0.00 ? 250 ARG A CZ   4  
ATOM   8037  N  NH1  . ARG A 1 96  ? 14.773  -9.315  -1.844  1.00 0.00 ? 250 ARG A NH1  4  
ATOM   8038  N  NH2  . ARG A 1 96  ? 16.981  -8.855  -1.749  1.00 0.00 ? 250 ARG A NH2  4  
ATOM   8039  H  H    . ARG A 1 96  ? 13.997  -3.684  -5.896  1.00 0.00 ? 250 ARG A H    4  
ATOM   8040  H  HA   . ARG A 1 96  ? 13.090  -4.869  -3.305  1.00 0.00 ? 250 ARG A HA   4  
ATOM   8041  H  HB2  . ARG A 1 96  ? 13.128  -6.065  -5.593  1.00 0.00 ? 250 ARG A HB2  4  
ATOM   8042  H  HB3  . ARG A 1 96  ? 14.878  -6.132  -5.378  1.00 0.00 ? 250 ARG A HB3  4  
ATOM   8043  H  HG2  . ARG A 1 96  ? 14.114  -7.036  -2.957  1.00 0.00 ? 250 ARG A HG2  4  
ATOM   8044  H  HG3  . ARG A 1 96  ? 12.731  -7.576  -3.907  1.00 0.00 ? 250 ARG A HG3  4  
ATOM   8045  H  HD2  . ARG A 1 96  ? 14.063  -9.388  -4.359  1.00 0.00 ? 250 ARG A HD2  4  
ATOM   8046  H  HD3  . ARG A 1 96  ? 14.829  -8.302  -5.535  1.00 0.00 ? 250 ARG A HD3  4  
ATOM   8047  H  HE   . ARG A 1 96  ? 16.684  -8.128  -4.093  1.00 0.00 ? 250 ARG A HE   4  
ATOM   8048  H  HH11 . ARG A 1 96  ? 13.906  -9.340  -2.341  1.00 0.00 ? 250 ARG A HH11 4  
ATOM   8049  H  HH12 . ARG A 1 96  ? 14.808  -9.627  -0.895  1.00 0.00 ? 250 ARG A HH12 4  
ATOM   8050  H  HH21 . ARG A 1 96  ? 17.820  -8.522  -2.178  1.00 0.00 ? 250 ARG A HH21 4  
ATOM   8051  H  HH22 . ARG A 1 96  ? 16.996  -9.172  -0.801  1.00 0.00 ? 250 ARG A HH22 4  
ATOM   8052  N  N    . LYS A 1 97  ? 16.172  -3.865  -3.929  1.00 0.00 ? 251 LYS A N    4  
ATOM   8053  C  CA   . LYS A 1 97  ? 17.517  -3.651  -3.256  1.00 0.00 ? 251 LYS A CA   4  
ATOM   8054  C  C    . LYS A 1 97  ? 17.334  -3.178  -1.806  1.00 0.00 ? 251 LYS A C    4  
ATOM   8055  O  O    . LYS A 1 97  ? 17.776  -3.838  -0.883  1.00 0.00 ? 251 LYS A O    4  
ATOM   8056  C  CB   . LYS A 1 97  ? 18.255  -2.580  -4.074  1.00 0.00 ? 251 LYS A CB   4  
ATOM   8057  C  CG   . LYS A 1 97  ? 19.687  -2.433  -3.554  1.00 0.00 ? 251 LYS A CG   4  
ATOM   8058  C  CD   . LYS A 1 97  ? 19.764  -1.257  -2.579  1.00 0.00 ? 251 LYS A CD   4  
ATOM   8059  C  CE   . LYS A 1 97  ? 20.938  -1.464  -1.619  1.00 0.00 ? 251 LYS A CE   4  
ATOM   8060  N  NZ   . LYS A 1 97  ? 22.155  -1.231  -2.445  1.00 0.00 ? 251 LYS A NZ   4  
ATOM   8061  H  H    . LYS A 1 97  ? 16.004  -3.491  -4.822  1.00 0.00 ? 251 LYS A H    4  
ATOM   8062  H  HA   . LYS A 1 97  ? 18.080  -4.572  -3.266  1.00 0.00 ? 251 LYS A HA   4  
ATOM   8063  H  HB2  . LYS A 1 97  ? 18.275  -2.873  -5.113  1.00 0.00 ? 251 LYS A HB2  4  
ATOM   8064  H  HB3  . LYS A 1 97  ? 17.739  -1.635  -3.977  1.00 0.00 ? 251 LYS A HB3  4  
ATOM   8065  H  HG2  . LYS A 1 97  ? 19.982  -3.341  -3.048  1.00 0.00 ? 251 LYS A HG2  4  
ATOM   8066  H  HG3  . LYS A 1 97  ? 20.354  -2.253  -4.385  1.00 0.00 ? 251 LYS A HG3  4  
ATOM   8067  H  HD2  . LYS A 1 97  ? 19.908  -0.339  -3.132  1.00 0.00 ? 251 LYS A HD2  4  
ATOM   8068  H  HD3  . LYS A 1 97  ? 18.846  -1.197  -2.014  1.00 0.00 ? 251 LYS A HD3  4  
ATOM   8069  H  HE2  . LYS A 1 97  ? 20.889  -0.750  -0.808  1.00 0.00 ? 251 LYS A HE2  4  
ATOM   8070  H  HE3  . LYS A 1 97  ? 20.939  -2.472  -1.237  1.00 0.00 ? 251 LYS A HE3  4  
ATOM   8071  H  HZ1  . LYS A 1 97  ? 22.220  -1.962  -3.181  1.00 0.00 ? 251 LYS A HZ1  4  
ATOM   8072  H  HZ2  . LYS A 1 97  ? 22.999  -1.273  -1.838  1.00 0.00 ? 251 LYS A HZ2  4  
ATOM   8073  H  HZ3  . LYS A 1 97  ? 22.097  -0.295  -2.895  1.00 0.00 ? 251 LYS A HZ3  4  
ATOM   8074  N  N    . GLU A 1 98  ? 16.671  -2.058  -1.585  1.00 0.00 ? 252 GLU A N    4  
ATOM   8075  C  CA   . GLU A 1 98  ? 16.457  -1.590  -0.164  1.00 0.00 ? 252 GLU A CA   4  
ATOM   8076  C  C    . GLU A 1 98  ? 15.816  -2.721  0.670   1.00 0.00 ? 252 GLU A C    4  
ATOM   8077  O  O    . GLU A 1 98  ? 16.054  -2.828  1.859   1.00 0.00 ? 252 GLU A O    4  
ATOM   8078  C  CB   . GLU A 1 98  ? 15.510  -0.380  -0.225  1.00 0.00 ? 252 GLU A CB   4  
ATOM   8079  C  CG   . GLU A 1 98  ? 15.814  0.564   0.938   1.00 0.00 ? 252 GLU A CG   4  
ATOM   8080  C  CD   . GLU A 1 98  ? 14.947  0.189   2.142   1.00 0.00 ? 252 GLU A CD   4  
ATOM   8081  O  OE1  . GLU A 1 98  ? 13.777  -0.090  1.940   1.00 0.00 ? 252 GLU A OE1  4  
ATOM   8082  O  OE2  . GLU A 1 98  ? 15.469  0.186   3.244   1.00 0.00 ? 252 GLU A OE2  4  
ATOM   8083  H  H    . GLU A 1 98  ? 16.306  -1.545  -2.342  1.00 0.00 ? 252 GLU A H    4  
ATOM   8084  H  HA   . GLU A 1 98  ? 17.396  -1.299  0.271   1.00 0.00 ? 252 GLU A HA   4  
ATOM   8085  H  HB2  . GLU A 1 98  ? 15.652  0.141   -1.161  1.00 0.00 ? 252 GLU A HB2  4  
ATOM   8086  H  HB3  . GLU A 1 98  ? 14.489  -0.720  -0.152  1.00 0.00 ? 252 GLU A HB3  4  
ATOM   8087  H  HG2  . GLU A 1 98  ? 16.858  0.482   1.205   1.00 0.00 ? 252 GLU A HG2  4  
ATOM   8088  H  HG3  . GLU A 1 98  ? 15.596  1.580   0.644   1.00 0.00 ? 252 GLU A HG3  4  
ATOM   8089  N  N    . LEU A 1 99  ? 15.017  -3.575  0.052   1.00 0.00 ? 253 LEU A N    4  
ATOM   8090  C  CA   . LEU A 1 99  ? 14.380  -4.704  0.820   1.00 0.00 ? 253 LEU A CA   4  
ATOM   8091  C  C    . LEU A 1 99  ? 15.460  -5.565  1.501   1.00 0.00 ? 253 LEU A C    4  
ATOM   8092  O  O    . LEU A 1 99  ? 15.243  -6.082  2.579   1.00 0.00 ? 253 LEU A O    4  
ATOM   8093  C  CB   . LEU A 1 99  ? 13.605  -5.543  -0.208  1.00 0.00 ? 253 LEU A CB   4  
ATOM   8094  C  CG   . LEU A 1 99  ? 12.470  -6.290  0.489   1.00 0.00 ? 253 LEU A CG   4  
ATOM   8095  C  CD1  . LEU A 1 99  ? 11.441  -6.736  -0.551  1.00 0.00 ? 253 LEU A CD1  4  
ATOM   8096  C  CD2  . LEU A 1 99  ? 13.033  -7.518  1.208   1.00 0.00 ? 253 LEU A CD2  4  
ATOM   8097  H  H    . LEU A 1 99  ? 14.842  -3.477  -0.910  1.00 0.00 ? 253 LEU A H    4  
ATOM   8098  H  HA   . LEU A 1 99  ? 13.700  -4.311  1.558   1.00 0.00 ? 253 LEU A HA   4  
ATOM   8099  H  HB2  . LEU A 1 99  ? 13.195  -4.892  -0.966  1.00 0.00 ? 253 LEU A HB2  4  
ATOM   8100  H  HB3  . LEU A 1 99  ? 14.274  -6.254  -0.669  1.00 0.00 ? 253 LEU A HB3  4  
ATOM   8101  H  HG   . LEU A 1 99  ? 11.997  -5.634  1.206   1.00 0.00 ? 253 LEU A HG   4  
ATOM   8102  H  HD11 . LEU A 1 99  ? 11.935  -7.309  -1.320  1.00 0.00 ? 253 LEU A HD11 4  
ATOM   8103  H  HD12 . LEU A 1 99  ? 10.974  -5.867  -0.993  1.00 0.00 ? 253 LEU A HD12 4  
ATOM   8104  H  HD13 . LEU A 1 99  ? 10.688  -7.346  -0.074  1.00 0.00 ? 253 LEU A HD13 4  
ATOM   8105  H  HD21 . LEU A 1 99  ? 13.914  -7.865  0.691   1.00 0.00 ? 253 LEU A HD21 4  
ATOM   8106  H  HD22 . LEU A 1 99  ? 12.290  -8.301  1.219   1.00 0.00 ? 253 LEU A HD22 4  
ATOM   8107  H  HD23 . LEU A 1 99  ? 13.291  -7.253  2.224   1.00 0.00 ? 253 LEU A HD23 4  
ATOM   8108  N  N    . SER A 1 100 ? 16.623  -5.727  0.892   1.00 0.00 ? 254 SER A N    4  
ATOM   8109  C  CA   . SER A 1 100 ? 17.687  -6.564  1.559   1.00 0.00 ? 254 SER A CA   4  
ATOM   8110  C  C    . SER A 1 100 ? 18.135  -5.880  2.857   1.00 0.00 ? 254 SER A C    4  
ATOM   8111  O  O    . SER A 1 100 ? 18.145  -6.494  3.908   1.00 0.00 ? 254 SER A O    4  
ATOM   8112  C  CB   . SER A 1 100 ? 18.860  -6.668  0.573   1.00 0.00 ? 254 SER A CB   4  
ATOM   8113  O  OG   . SER A 1 100 ? 19.500  -7.927  0.736   1.00 0.00 ? 254 SER A OG   4  
ATOM   8114  H  H    . SER A 1 100 ? 16.792  -5.302  0.014   1.00 0.00 ? 254 SER A H    4  
ATOM   8115  H  HA   . SER A 1 100 ? 17.300  -7.547  1.782   1.00 0.00 ? 254 SER A HA   4  
ATOM   8116  H  HB2  . SER A 1 100 ? 18.493  -6.585  -0.436  1.00 0.00 ? 254 SER A HB2  4  
ATOM   8117  H  HB3  . SER A 1 100 ? 19.562  -5.867  0.766   1.00 0.00 ? 254 SER A HB3  4  
ATOM   8118  H  HG   . SER A 1 100 ? 20.135  -8.031  0.023   1.00 0.00 ? 254 SER A HG   4  
ATOM   8119  N  N    . THR A 1 101 ? 18.487  -4.610  2.805   1.00 0.00 ? 255 THR A N    4  
ATOM   8120  C  CA   . THR A 1 101 ? 18.912  -3.903  4.070   1.00 0.00 ? 255 THR A CA   4  
ATOM   8121  C  C    . THR A 1 101 ? 17.798  -3.998  5.129   1.00 0.00 ? 255 THR A C    4  
ATOM   8122  O  O    . THR A 1 101 ? 18.076  -4.061  6.312   1.00 0.00 ? 255 THR A O    4  
ATOM   8123  C  CB   . THR A 1 101 ? 19.166  -2.429  3.692   1.00 0.00 ? 255 THR A CB   4  
ATOM   8124  O  OG1  . THR A 1 101 ? 19.848  -2.356  2.435   1.00 0.00 ? 255 THR A OG1  4  
ATOM   8125  C  CG2  . THR A 1 101 ? 20.001  -1.748  4.787   1.00 0.00 ? 255 THR A CG2  4  
ATOM   8126  H  H    . THR A 1 101 ? 18.459  -4.126  1.945   1.00 0.00 ? 255 THR A H    4  
ATOM   8127  H  HA   . THR A 1 101 ? 19.815  -4.345  4.454   1.00 0.00 ? 255 THR A HA   4  
ATOM   8128  H  HB   . THR A 1 101 ? 18.218  -1.918  3.608   1.00 0.00 ? 255 THR A HB   4  
ATOM   8129  H  HG1  . THR A 1 101 ? 20.696  -2.813  2.505   1.00 0.00 ? 255 THR A HG1  4  
ATOM   8130  H  HG21 . THR A 1 101 ? 19.363  -1.111  5.381   1.00 0.00 ? 255 THR A HG21 4  
ATOM   8131  H  HG22 . THR A 1 101 ? 20.777  -1.153  4.329   1.00 0.00 ? 255 THR A HG22 4  
ATOM   8132  H  HG23 . THR A 1 101 ? 20.451  -2.499  5.419   1.00 0.00 ? 255 THR A HG23 4  
ATOM   8133  N  N    . ILE A 1 102 ? 16.542  -4.022  4.720   1.00 0.00 ? 256 ILE A N    4  
ATOM   8134  C  CA   . ILE A 1 102 ? 15.429  -4.130  5.733   1.00 0.00 ? 256 ILE A CA   4  
ATOM   8135  C  C    . ILE A 1 102 ? 15.624  -5.387  6.605   1.00 0.00 ? 256 ILE A C    4  
ATOM   8136  O  O    . ILE A 1 102 ? 15.269  -5.386  7.769   1.00 0.00 ? 256 ILE A O    4  
ATOM   8137  C  CB   . ILE A 1 102 ? 14.108  -4.213  4.934   1.00 0.00 ? 256 ILE A CB   4  
ATOM   8138  C  CG1  . ILE A 1 102 ? 13.838  -2.860  4.265   1.00 0.00 ? 256 ILE A CG1  4  
ATOM   8139  C  CG2  . ILE A 1 102 ? 12.943  -4.552  5.871   1.00 0.00 ? 256 ILE A CG2  4  
ATOM   8140  C  CD1  . ILE A 1 102 ? 12.609  -2.967  3.356   1.00 0.00 ? 256 ILE A CD1  4  
ATOM   8141  H  H    . ILE A 1 102 ? 16.336  -3.977  3.760   1.00 0.00 ? 256 ILE A H    4  
ATOM   8142  H  HA   . ILE A 1 102 ? 15.421  -3.255  6.357   1.00 0.00 ? 256 ILE A HA   4  
ATOM   8143  H  HB   . ILE A 1 102 ? 14.192  -4.978  4.180   1.00 0.00 ? 256 ILE A HB   4  
ATOM   8144  H  HG12 . ILE A 1 102 ? 13.659  -2.113  5.024   1.00 0.00 ? 256 ILE A HG12 4  
ATOM   8145  H  HG13 . ILE A 1 102 ? 14.694  -2.573  3.674   1.00 0.00 ? 256 ILE A HG13 4  
ATOM   8146  H  HG21 . ILE A 1 102 ? 13.175  -4.206  6.865   1.00 0.00 ? 256 ILE A HG21 4  
ATOM   8147  H  HG22 . ILE A 1 102 ? 12.797  -5.621  5.889   1.00 0.00 ? 256 ILE A HG22 4  
ATOM   8148  H  HG23 . ILE A 1 102 ? 12.045  -4.072  5.518   1.00 0.00 ? 256 ILE A HG23 4  
ATOM   8149  H  HD11 . ILE A 1 102 ? 11.742  -2.595  3.879   1.00 0.00 ? 256 ILE A HD11 4  
ATOM   8150  H  HD12 . ILE A 1 102 ? 12.450  -4.001  3.085   1.00 0.00 ? 256 ILE A HD12 4  
ATOM   8151  H  HD13 . ILE A 1 102 ? 12.771  -2.382  2.463   1.00 0.00 ? 256 ILE A HD13 4  
ATOM   8152  N  N    . MET A 1 103 ? 16.186  -6.454  6.066   1.00 0.00 ? 257 MET A N    4  
ATOM   8153  C  CA   . MET A 1 103 ? 16.386  -7.681  6.909   1.00 0.00 ? 257 MET A CA   4  
ATOM   8154  C  C    . MET A 1 103 ? 17.811  -7.738  7.507   1.00 0.00 ? 257 MET A C    4  
ATOM   8155  O  O    . MET A 1 103 ? 18.264  -8.795  7.905   1.00 0.00 ? 257 MET A O    4  
ATOM   8156  C  CB   . MET A 1 103 ? 16.142  -8.874  5.975   1.00 0.00 ? 257 MET A CB   4  
ATOM   8157  C  CG   . MET A 1 103 ? 14.649  -9.219  5.972   1.00 0.00 ? 257 MET A CG   4  
ATOM   8158  S  SD   . MET A 1 103 ? 14.203  -9.979  7.554   1.00 0.00 ? 257 MET A SD   4  
ATOM   8159  C  CE   . MET A 1 103 ? 12.445  -9.552  7.535   1.00 0.00 ? 257 MET A CE   4  
ATOM   8160  H  H    . MET A 1 103 ? 16.476  -6.444  5.122   1.00 0.00 ? 257 MET A H    4  
ATOM   8161  H  HA   . MET A 1 103 ? 15.658  -7.697  7.705   1.00 0.00 ? 257 MET A HA   4  
ATOM   8162  H  HB2  . MET A 1 103 ? 16.456  -8.618  4.974   1.00 0.00 ? 257 MET A HB2  4  
ATOM   8163  H  HB3  . MET A 1 103 ? 16.706  -9.726  6.323   1.00 0.00 ? 257 MET A HB3  4  
ATOM   8164  H  HG2  . MET A 1 103 ? 14.069  -8.318  5.828   1.00 0.00 ? 257 MET A HG2  4  
ATOM   8165  H  HG3  . MET A 1 103 ? 14.441  -9.911  5.169   1.00 0.00 ? 257 MET A HG3  4  
ATOM   8166  H  HE1  . MET A 1 103 ? 12.332  -8.488  7.692   1.00 0.00 ? 257 MET A HE1  4  
ATOM   8167  H  HE2  . MET A 1 103 ? 11.932  -10.086 8.320   1.00 0.00 ? 257 MET A HE2  4  
ATOM   8168  H  HE3  . MET A 1 103 ? 12.020  -9.827  6.579   1.00 0.00 ? 257 MET A HE3  4  
ATOM   8169  N  N    . ASP A 1 104 ? 18.523  -6.624  7.590   1.00 0.00 ? 258 ASP A N    4  
ATOM   8170  C  CA   . ASP A 1 104 ? 19.901  -6.656  8.181   1.00 0.00 ? 258 ASP A CA   4  
ATOM   8171  C  C    . ASP A 1 104 ? 20.406  -5.225  8.449   1.00 0.00 ? 258 ASP A C    4  
ATOM   8172  O  O    . ASP A 1 104 ? 21.267  -4.726  7.746   1.00 0.00 ? 258 ASP A O    4  
ATOM   8173  C  CB   . ASP A 1 104 ? 20.769  -7.345  7.124   1.00 0.00 ? 258 ASP A CB   4  
ATOM   8174  C  CG   . ASP A 1 104 ? 20.980  -8.812  7.506   1.00 0.00 ? 258 ASP A CG   4  
ATOM   8175  O  OD1  . ASP A 1 104 ? 21.583  -9.054  8.538   1.00 0.00 ? 258 ASP A OD1  4  
ATOM   8176  O  OD2  . ASP A 1 104 ? 20.534  -9.667  6.759   1.00 0.00 ? 258 ASP A OD2  4  
ATOM   8177  H  H    . ASP A 1 104 ? 18.154  -5.771  7.274   1.00 0.00 ? 258 ASP A H    4  
ATOM   8178  H  HA   . ASP A 1 104 ? 19.904  -7.230  9.094   1.00 0.00 ? 258 ASP A HA   4  
ATOM   8179  H  HB2  . ASP A 1 104 ? 20.277  -7.289  6.164   1.00 0.00 ? 258 ASP A HB2  4  
ATOM   8180  H  HB3  . ASP A 1 104 ? 21.727  -6.849  7.066   1.00 0.00 ? 258 ASP A HB3  4  
ATOM   8181  N  N    . GLU A 1 105 ? 19.870  -4.553  9.452   1.00 0.00 ? 259 GLU A N    4  
ATOM   8182  C  CA   . GLU A 1 105 ? 20.321  -3.156  9.736   1.00 0.00 ? 259 GLU A CA   4  
ATOM   8183  C  C    . GLU A 1 105 ? 20.606  -2.963  11.235  1.00 0.00 ? 259 GLU A C    4  
ATOM   8184  O  O    . GLU A 1 105 ? 21.743  -2.776  11.627  1.00 0.00 ? 259 GLU A O    4  
ATOM   8185  C  CB   . GLU A 1 105 ? 19.156  -2.261  9.279   1.00 0.00 ? 259 GLU A CB   4  
ATOM   8186  C  CG   . GLU A 1 105 ? 19.654  -1.257  8.235   1.00 0.00 ? 259 GLU A CG   4  
ATOM   8187  C  CD   . GLU A 1 105 ? 18.733  -0.035  8.222   1.00 0.00 ? 259 GLU A CD   4  
ATOM   8188  O  OE1  . GLU A 1 105 ? 18.348  0.402   9.294   1.00 0.00 ? 259 GLU A OE1  4  
ATOM   8189  O  OE2  . GLU A 1 105 ? 18.429  0.442   7.142   1.00 0.00 ? 259 GLU A OE2  4  
ATOM   8190  H  H    . GLU A 1 105 ? 19.169  -4.959  10.007  1.00 0.00 ? 259 GLU A H    4  
ATOM   8191  H  HA   . GLU A 1 105 ? 21.203  -2.932  9.164   1.00 0.00 ? 259 GLU A HA   4  
ATOM   8192  H  HB2  . GLU A 1 105 ? 18.377  -2.874  8.845   1.00 0.00 ? 259 GLU A HB2  4  
ATOM   8193  H  HB3  . GLU A 1 105 ? 18.760  -1.724  10.127  1.00 0.00 ? 259 GLU A HB3  4  
ATOM   8194  H  HG2  . GLU A 1 105 ? 20.659  -0.949  8.481   1.00 0.00 ? 259 GLU A HG2  4  
ATOM   8195  H  HG3  . GLU A 1 105 ? 19.646  -1.719  7.260   1.00 0.00 ? 259 GLU A HG3  4  
ATOM   8196  N  N    . ASN A 1 106 ? 19.594  -2.999  12.077  1.00 0.00 ? 260 ASN A N    4  
ATOM   8197  C  CA   . ASN A 1 106 ? 19.834  -2.806  13.541  1.00 0.00 ? 260 ASN A CA   4  
ATOM   8198  C  C    . ASN A 1 106 ? 18.832  -3.634  14.359  1.00 0.00 ? 260 ASN A C    4  
ATOM   8199  O  O    . ASN A 1 106 ? 18.303  -3.170  15.350  1.00 0.00 ? 260 ASN A O    4  
ATOM   8200  C  CB   . ASN A 1 106 ? 19.617  -1.312  13.784  1.00 0.00 ? 260 ASN A CB   4  
ATOM   8201  C  CG   . ASN A 1 106 ? 20.447  -0.865  14.994  1.00 0.00 ? 260 ASN A CG   4  
ATOM   8202  O  OD1  . ASN A 1 106 ? 20.279  -1.384  16.080  1.00 0.00 ? 260 ASN A OD1  4  
ATOM   8203  N  ND2  . ASN A 1 106 ? 21.344  0.082   14.858  1.00 0.00 ? 260 ASN A ND2  4  
ATOM   8204  H  H    . ASN A 1 106 ? 18.678  -3.147  11.749  1.00 0.00 ? 260 ASN A H    4  
ATOM   8205  H  HA   . ASN A 1 106 ? 20.845  -3.078  13.796  1.00 0.00 ? 260 ASN A HA   4  
ATOM   8206  H  HB2  . ASN A 1 106 ? 19.925  -0.757  12.909  1.00 0.00 ? 260 ASN A HB2  4  
ATOM   8207  H  HB3  . ASN A 1 106 ? 18.572  -1.126  13.979  1.00 0.00 ? 260 ASN A HB3  4  
ATOM   8208  H  HD21 . ASN A 1 106 ? 21.489  0.508   13.986  1.00 0.00 ? 260 ASN A HD21 4  
ATOM   8209  H  HD22 . ASN A 1 106 ? 21.873  0.366   15.632  1.00 0.00 ? 260 ASN A HD22 4  
ATOM   8210  N  N    . ASN A 1 107 ? 18.562  -4.858  13.950  1.00 0.00 ? 261 ASN A N    4  
ATOM   8211  C  CA   . ASN A 1 107 ? 17.588  -5.716  14.706  1.00 0.00 ? 261 ASN A CA   4  
ATOM   8212  C  C    . ASN A 1 107 ? 16.242  -4.988  14.921  1.00 0.00 ? 261 ASN A C    4  
ATOM   8213  O  O    . ASN A 1 107 ? 15.551  -5.244  15.888  1.00 0.00 ? 261 ASN A O    4  
ATOM   8214  C  CB   . ASN A 1 107 ? 18.261  -6.004  16.052  1.00 0.00 ? 261 ASN A CB   4  
ATOM   8215  C  CG   . ASN A 1 107 ? 17.809  -7.375  16.568  1.00 0.00 ? 261 ASN A CG   4  
ATOM   8216  O  OD1  . ASN A 1 107 ? 17.599  -8.285  15.792  1.00 0.00 ? 261 ASN A OD1  4  
ATOM   8217  N  ND2  . ASN A 1 107 ? 17.647  -7.569  17.856  1.00 0.00 ? 261 ASN A ND2  4  
ATOM   8218  H  H    . ASN A 1 107 ? 18.998  -5.217  13.142  1.00 0.00 ? 261 ASN A H    4  
ATOM   8219  H  HA   . ASN A 1 107 ? 17.426  -6.643  14.178  1.00 0.00 ? 261 ASN A HA   4  
ATOM   8220  H  HB2  . ASN A 1 107 ? 19.334  -6.002  15.925  1.00 0.00 ? 261 ASN A HB2  4  
ATOM   8221  H  HB3  . ASN A 1 107 ? 17.981  -5.243  16.764  1.00 0.00 ? 261 ASN A HB3  4  
ATOM   8222  H  HD21 . ASN A 1 107 ? 17.813  -6.841  18.492  1.00 0.00 ? 261 ASN A HD21 4  
ATOM   8223  H  HD22 . ASN A 1 107 ? 17.358  -8.446  18.182  1.00 0.00 ? 261 ASN A HD22 4  
ATOM   8224  N  N    . GLN A 1 108 ? 15.857  -4.095  14.027  1.00 0.00 ? 262 GLN A N    4  
ATOM   8225  C  CA   . GLN A 1 108 ? 14.547  -3.377  14.192  1.00 0.00 ? 262 GLN A CA   4  
ATOM   8226  C  C    . GLN A 1 108 ? 14.211  -2.579  12.913  1.00 0.00 ? 262 GLN A C    4  
ATOM   8227  O  O    . GLN A 1 108 ? 14.896  -1.633  12.570  1.00 0.00 ? 262 GLN A O    4  
ATOM   8228  C  CB   . GLN A 1 108 ? 14.730  -2.452  15.405  1.00 0.00 ? 262 GLN A CB   4  
ATOM   8229  C  CG   . GLN A 1 108 ? 15.800  -1.393  15.118  1.00 0.00 ? 262 GLN A CG   4  
ATOM   8230  C  CD   . GLN A 1 108 ? 16.656  -1.166  16.371  1.00 0.00 ? 262 GLN A CD   4  
ATOM   8231  O  OE1  . GLN A 1 108 ? 16.855  -2.076  17.152  1.00 0.00 ? 262 GLN A OE1  4  
ATOM   8232  N  NE2  . GLN A 1 108 ? 17.177  0.015   16.602  1.00 0.00 ? 262 GLN A NE2  4  
ATOM   8233  H  H    . GLN A 1 108 ? 16.419  -3.905  13.243  1.00 0.00 ? 262 GLN A H    4  
ATOM   8234  H  HA   . GLN A 1 108 ? 13.762  -4.090  14.395  1.00 0.00 ? 262 GLN A HA   4  
ATOM   8235  H  HB2  . GLN A 1 108 ? 13.792  -1.959  15.622  1.00 0.00 ? 262 GLN A HB2  4  
ATOM   8236  H  HB3  . GLN A 1 108 ? 15.028  -3.040  16.260  1.00 0.00 ? 262 GLN A HB3  4  
ATOM   8237  H  HG2  . GLN A 1 108 ? 16.429  -1.731  14.307  1.00 0.00 ? 262 GLN A HG2  4  
ATOM   8238  H  HG3  . GLN A 1 108 ? 15.319  -0.467  14.839  1.00 0.00 ? 262 GLN A HG3  4  
ATOM   8239  H  HE21 . GLN A 1 108 ? 17.023  0.757   15.979  1.00 0.00 ? 262 GLN A HE21 4  
ATOM   8240  H  HE22 . GLN A 1 108 ? 17.723  0.157   17.404  1.00 0.00 ? 262 GLN A HE22 4  
ATOM   8241  N  N    . TRP A 1 109 ? 13.188  -2.976  12.190  1.00 0.00 ? 263 TRP A N    4  
ATOM   8242  C  CA   . TRP A 1 109 ? 12.847  -2.258  10.925  1.00 0.00 ? 263 TRP A CA   4  
ATOM   8243  C  C    . TRP A 1 109 ? 11.535  -1.463  11.059  1.00 0.00 ? 263 TRP A C    4  
ATOM   8244  O  O    . TRP A 1 109 ? 10.540  -1.972  11.541  1.00 0.00 ? 263 TRP A O    4  
ATOM   8245  C  CB   . TRP A 1 109 ? 12.698  -3.386  9.886   1.00 0.00 ? 263 TRP A CB   4  
ATOM   8246  C  CG   . TRP A 1 109 ? 12.102  -2.867  8.607   1.00 0.00 ? 263 TRP A CG   4  
ATOM   8247  C  CD1  . TRP A 1 109 ? 12.668  -1.952  7.789   1.00 0.00 ? 263 TRP A CD1  4  
ATOM   8248  C  CD2  . TRP A 1 109 ? 10.831  -3.228  7.996   1.00 0.00 ? 263 TRP A CD2  4  
ATOM   8249  N  NE1  . TRP A 1 109 ? 11.820  -1.722  6.719   1.00 0.00 ? 263 TRP A NE1  4  
ATOM   8250  C  CE2  . TRP A 1 109 ? 10.673  -2.486  6.803   1.00 0.00 ? 263 TRP A CE2  4  
ATOM   8251  C  CE3  . TRP A 1 109 ? 9.810   -4.119  8.363   1.00 0.00 ? 263 TRP A CE3  4  
ATOM   8252  C  CZ2  . TRP A 1 109 ? 9.538   -2.623  6.001   1.00 0.00 ? 263 TRP A CZ2  4  
ATOM   8253  C  CZ3  . TRP A 1 109 ? 8.667   -4.261  7.560   1.00 0.00 ? 263 TRP A CZ3  4  
ATOM   8254  C  CH2  . TRP A 1 109 ? 8.531   -3.513  6.381   1.00 0.00 ? 263 TRP A CH2  4  
ATOM   8255  H  H    . TRP A 1 109 ? 12.660  -3.759  12.461  1.00 0.00 ? 263 TRP A H    4  
ATOM   8256  H  HA   . TRP A 1 109 ? 13.654  -1.604  10.636  1.00 0.00 ? 263 TRP A HA   4  
ATOM   8257  H  HB2  . TRP A 1 109 ? 13.667  -3.810  9.688   1.00 0.00 ? 263 TRP A HB2  4  
ATOM   8258  H  HB3  . TRP A 1 109 ? 12.056  -4.154  10.291  1.00 0.00 ? 263 TRP A HB3  4  
ATOM   8259  H  HD1  . TRP A 1 109 ? 13.624  -1.480  7.945   1.00 0.00 ? 263 TRP A HD1  4  
ATOM   8260  H  HE1  . TRP A 1 109 ? 11.993  -1.100  5.983   1.00 0.00 ? 263 TRP A HE1  4  
ATOM   8261  H  HE3  . TRP A 1 109 ? 9.910   -4.699  9.267   1.00 0.00 ? 263 TRP A HE3  4  
ATOM   8262  H  HZ2  . TRP A 1 109 ? 9.438   -2.043  5.094   1.00 0.00 ? 263 TRP A HZ2  4  
ATOM   8263  H  HZ3  . TRP A 1 109 ? 7.888   -4.950  7.853   1.00 0.00 ? 263 TRP A HZ3  4  
ATOM   8264  H  HH2  . TRP A 1 109 ? 7.650   -3.628  5.767   1.00 0.00 ? 263 TRP A HH2  4  
ATOM   8265  N  N    . TYR A 1 110 ? 11.512  -0.239  10.566  1.00 0.00 ? 264 TYR A N    4  
ATOM   8266  C  CA   . TYR A 1 110 ? 10.243  0.550   10.596  1.00 0.00 ? 264 TYR A CA   4  
ATOM   8267  C  C    . TYR A 1 110 ? 9.537   0.284   9.267   1.00 0.00 ? 264 TYR A C    4  
ATOM   8268  O  O    . TYR A 1 110 ? 10.195  0.089   8.260   1.00 0.00 ? 264 TYR A O    4  
ATOM   8269  C  CB   . TYR A 1 110 ? 10.636  2.027   10.732  1.00 0.00 ? 264 TYR A CB   4  
ATOM   8270  C  CG   . TYR A 1 110 ? 10.561  2.423   12.185  1.00 0.00 ? 264 TYR A CG   4  
ATOM   8271  C  CD1  . TYR A 1 110 ? 9.336   2.809   12.743  1.00 0.00 ? 264 TYR A CD1  4  
ATOM   8272  C  CD2  . TYR A 1 110 ? 11.713  2.395   12.976  1.00 0.00 ? 264 TYR A CD2  4  
ATOM   8273  C  CE1  . TYR A 1 110 ? 9.266   3.170   14.093  1.00 0.00 ? 264 TYR A CE1  4  
ATOM   8274  C  CE2  . TYR A 1 110 ? 11.643  2.755   14.326  1.00 0.00 ? 264 TYR A CE2  4  
ATOM   8275  C  CZ   . TYR A 1 110 ? 10.419  3.142   14.885  1.00 0.00 ? 264 TYR A CZ   4  
ATOM   8276  O  OH   . TYR A 1 110 ? 10.351  3.497   16.217  1.00 0.00 ? 264 TYR A OH   4  
ATOM   8277  H  H    . TYR A 1 110 ? 12.314  0.134   10.130  1.00 0.00 ? 264 TYR A H    4  
ATOM   8278  H  HA   . TYR A 1 110 ? 9.623   0.245   11.426  1.00 0.00 ? 264 TYR A HA   4  
ATOM   8279  H  HB2  . TYR A 1 110 ? 11.643  2.171   10.369  1.00 0.00 ? 264 TYR A HB2  4  
ATOM   8280  H  HB3  . TYR A 1 110 ? 9.954   2.636   10.157  1.00 0.00 ? 264 TYR A HB3  4  
ATOM   8281  H  HD1  . TYR A 1 110 ? 8.445   2.827   12.131  1.00 0.00 ? 264 TYR A HD1  4  
ATOM   8282  H  HD2  . TYR A 1 110 ? 12.658  2.097   12.545  1.00 0.00 ? 264 TYR A HD2  4  
ATOM   8283  H  HE1  . TYR A 1 110 ? 8.321   3.468   14.523  1.00 0.00 ? 264 TYR A HE1  4  
ATOM   8284  H  HE2  . TYR A 1 110 ? 12.533  2.728   14.935  1.00 0.00 ? 264 TYR A HE2  4  
ATOM   8285  H  HH   . TYR A 1 110 ? 10.282  4.454   16.267  1.00 0.00 ? 264 TYR A HH   4  
ATOM   8286  N  N    . CYS A 1 111 ? 8.225   0.224   9.239   1.00 0.00 ? 265 CYS A N    4  
ATOM   8287  C  CA   . CYS A 1 111 ? 7.544   -0.088  7.950   1.00 0.00 ? 265 CYS A CA   4  
ATOM   8288  C  C    . CYS A 1 111 ? 6.420   0.932   7.637   1.00 0.00 ? 265 CYS A C    4  
ATOM   8289  O  O    . CYS A 1 111 ? 6.533   2.095   7.978   1.00 0.00 ? 265 CYS A O    4  
ATOM   8290  C  CB   . CYS A 1 111 ? 7.044   -1.535  8.145   1.00 0.00 ? 265 CYS A CB   4  
ATOM   8291  S  SG   . CYS A 1 111 ? 5.617   -1.592  9.262   1.00 0.00 ? 265 CYS A SG   4  
ATOM   8292  H  H    . CYS A 1 111 ? 7.697   0.352   10.057  1.00 0.00 ? 265 CYS A H    4  
ATOM   8293  H  HA   . CYS A 1 111 ? 8.267   -0.072  7.150   1.00 0.00 ? 265 CYS A HA   4  
ATOM   8294  H  HB2  . CYS A 1 111 ? 6.757   -1.943  7.188   1.00 0.00 ? 265 CYS A HB2  4  
ATOM   8295  H  HB3  . CYS A 1 111 ? 7.844   -2.131  8.559   1.00 0.00 ? 265 CYS A HB3  4  
ATOM   8296  N  N    . TYR A 1 112 ? 5.352   0.522   6.974   1.00 0.00 ? 266 TYR A N    4  
ATOM   8297  C  CA   . TYR A 1 112 ? 4.257   1.498   6.631   1.00 0.00 ? 266 TYR A CA   4  
ATOM   8298  C  C    . TYR A 1 112 ? 3.207   1.548   7.760   1.00 0.00 ? 266 TYR A C    4  
ATOM   8299  O  O    . TYR A 1 112 ? 2.686   2.601   8.074   1.00 0.00 ? 266 TYR A O    4  
ATOM   8300  C  CB   . TYR A 1 112 ? 3.624   0.994   5.314   1.00 0.00 ? 266 TYR A CB   4  
ATOM   8301  C  CG   . TYR A 1 112 ? 4.703   0.748   4.273   1.00 0.00 ? 266 TYR A CG   4  
ATOM   8302  C  CD1  . TYR A 1 112 ? 5.197   1.813   3.513   1.00 0.00 ? 266 TYR A CD1  4  
ATOM   8303  C  CD2  . TYR A 1 112 ? 5.212   -0.544  4.077   1.00 0.00 ? 266 TYR A CD2  4  
ATOM   8304  C  CE1  . TYR A 1 112 ? 6.197   1.590   2.558   1.00 0.00 ? 266 TYR A CE1  4  
ATOM   8305  C  CE2  . TYR A 1 112 ? 6.213   -0.768  3.125   1.00 0.00 ? 266 TYR A CE2  4  
ATOM   8306  C  CZ   . TYR A 1 112 ? 6.705   0.300   2.363   1.00 0.00 ? 266 TYR A CZ   4  
ATOM   8307  O  OH   . TYR A 1 112 ? 7.692   0.080   1.424   1.00 0.00 ? 266 TYR A OH   4  
ATOM   8308  H  H    . TYR A 1 112 ? 5.274   -0.414  6.691   1.00 0.00 ? 266 TYR A H    4  
ATOM   8309  H  HA   . TYR A 1 112 ? 4.677   2.481   6.478   1.00 0.00 ? 266 TYR A HA   4  
ATOM   8310  H  HB2  . TYR A 1 112 ? 3.091   0.074   5.501   1.00 0.00 ? 266 TYR A HB2  4  
ATOM   8311  H  HB3  . TYR A 1 112 ? 2.936   1.737   4.942   1.00 0.00 ? 266 TYR A HB3  4  
ATOM   8312  H  HD1  . TYR A 1 112 ? 4.808   2.806   3.662   1.00 0.00 ? 266 TYR A HD1  4  
ATOM   8313  H  HD2  . TYR A 1 112 ? 4.832   -1.368  4.663   1.00 0.00 ? 266 TYR A HD2  4  
ATOM   8314  H  HE1  . TYR A 1 112 ? 6.577   2.413   1.971   1.00 0.00 ? 266 TYR A HE1  4  
ATOM   8315  H  HE2  . TYR A 1 112 ? 6.606   -1.764  2.976   1.00 0.00 ? 266 TYR A HE2  4  
ATOM   8316  H  HH   . TYR A 1 112 ? 8.542   0.215   1.850   1.00 0.00 ? 266 TYR A HH   4  
ATOM   8317  N  N    . ILE A 1 113 ? 2.900   0.425   8.382   1.00 0.00 ? 267 ILE A N    4  
ATOM   8318  C  CA   . ILE A 1 113 ? 1.887   0.439   9.503   1.00 0.00 ? 267 ILE A CA   4  
ATOM   8319  C  C    . ILE A 1 113 ? 2.439   1.251   10.691  1.00 0.00 ? 267 ILE A C    4  
ATOM   8320  O  O    . ILE A 1 113 ? 1.716   1.990   11.332  1.00 0.00 ? 267 ILE A O    4  
ATOM   8321  C  CB   . ILE A 1 113 ? 1.654   -1.024  9.946   1.00 0.00 ? 267 ILE A CB   4  
ATOM   8322  C  CG1  . ILE A 1 113 ? 1.236   -1.918  8.757   1.00 0.00 ? 267 ILE A CG1  4  
ATOM   8323  C  CG2  . ILE A 1 113 ? 0.546   -1.053  10.999  1.00 0.00 ? 267 ILE A CG2  4  
ATOM   8324  C  CD1  . ILE A 1 113 ? -0.027  -1.372  8.083   1.00 0.00 ? 267 ILE A CD1  4  
ATOM   8325  H  H    . ILE A 1 113 ? 3.341   -0.410  8.121   1.00 0.00 ? 267 ILE A H    4  
ATOM   8326  H  HA   . ILE A 1 113 ? 0.966   0.875   9.165   1.00 0.00 ? 267 ILE A HA   4  
ATOM   8327  H  HB   . ILE A 1 113 ? 2.569   -1.412  10.387  1.00 0.00 ? 267 ILE A HB   4  
ATOM   8328  H  HG12 . ILE A 1 113 ? 2.031   -1.966  8.034   1.00 0.00 ? 267 ILE A HG12 4  
ATOM   8329  H  HG13 . ILE A 1 113 ? 1.033   -2.914  9.122   1.00 0.00 ? 267 ILE A HG13 4  
ATOM   8330  H  HG21 . ILE A 1 113 ? -0.332  -0.558  10.609  1.00 0.00 ? 267 ILE A HG21 4  
ATOM   8331  H  HG22 . ILE A 1 113 ? 0.881   -0.542  11.890  1.00 0.00 ? 267 ILE A HG22 4  
ATOM   8332  H  HG23 . ILE A 1 113 ? 0.304   -2.077  11.241  1.00 0.00 ? 267 ILE A HG23 4  
ATOM   8333  H  HD11 . ILE A 1 113 ? 0.057   -0.306  7.965   1.00 0.00 ? 267 ILE A HD11 4  
ATOM   8334  H  HD12 . ILE A 1 113 ? -0.889  -1.600  8.693   1.00 0.00 ? 267 ILE A HD12 4  
ATOM   8335  H  HD13 . ILE A 1 113 ? -0.140  -1.832  7.112   1.00 0.00 ? 267 ILE A HD13 4  
ATOM   8336  N  N    . CYS A 1 114 ? 3.715   1.118   10.987  1.00 0.00 ? 268 CYS A N    4  
ATOM   8337  C  CA   . CYS A 1 114 ? 4.316   1.883   12.136  1.00 0.00 ? 268 CYS A CA   4  
ATOM   8338  C  C    . CYS A 1 114 ? 4.107   3.389   11.929  1.00 0.00 ? 268 CYS A C    4  
ATOM   8339  O  O    . CYS A 1 114 ? 3.657   4.087   12.817  1.00 0.00 ? 268 CYS A O    4  
ATOM   8340  C  CB   . CYS A 1 114 ? 5.819   1.556   12.125  1.00 0.00 ? 268 CYS A CB   4  
ATOM   8341  S  SG   . CYS A 1 114 ? 6.095   -0.075  12.860  1.00 0.00 ? 268 CYS A SG   4  
ATOM   8342  H  H    . CYS A 1 114 ? 4.273   0.520   10.456  1.00 0.00 ? 268 CYS A H    4  
ATOM   8343  H  HA   . CYS A 1 114 ? 3.878   1.568   13.070  1.00 0.00 ? 268 CYS A HA   4  
ATOM   8344  H  HB2  . CYS A 1 114 ? 6.179   1.557   11.107  1.00 0.00 ? 268 CYS A HB2  4  
ATOM   8345  H  HB3  . CYS A 1 114 ? 6.352   2.302   12.693  1.00 0.00 ? 268 CYS A HB3  4  
ATOM   8346  N  N    . HIS A 1 115 ? 4.422   3.896   10.753  1.00 0.00 ? 269 HIS A N    4  
ATOM   8347  C  CA   . HIS A 1 115 ? 4.230   5.362   10.483  1.00 0.00 ? 269 HIS A CA   4  
ATOM   8348  C  C    . HIS A 1 115 ? 4.563   5.698   9.017   1.00 0.00 ? 269 HIS A C    4  
ATOM   8349  O  O    . HIS A 1 115 ? 5.236   4.935   8.353   1.00 0.00 ? 269 HIS A O    4  
ATOM   8350  C  CB   . HIS A 1 115 ? 5.175   6.109   11.441  1.00 0.00 ? 269 HIS A CB   4  
ATOM   8351  C  CG   . HIS A 1 115 ? 6.605   5.635   11.302  1.00 0.00 ? 269 HIS A CG   4  
ATOM   8352  N  ND1  . HIS A 1 115 ? 7.621   6.181   12.071  1.00 0.00 ? 269 HIS A ND1  4  
ATOM   8353  C  CD2  . HIS A 1 115 ? 7.211   4.688   10.506  1.00 0.00 ? 269 HIS A CD2  4  
ATOM   8354  C  CE1  . HIS A 1 115 ? 8.768   5.569   11.727  1.00 0.00 ? 269 HIS A CE1  4  
ATOM   8355  N  NE2  . HIS A 1 115 ? 8.575   4.651   10.779  1.00 0.00 ? 269 HIS A NE2  4  
ATOM   8356  H  H    . HIS A 1 115 ? 4.772   3.310   10.043  1.00 0.00 ? 269 HIS A H    4  
ATOM   8357  H  HA   . HIS A 1 115 ? 3.210   5.641   10.696  1.00 0.00 ? 269 HIS A HA   4  
ATOM   8358  H  HB2  . HIS A 1 115 ? 5.134   7.165   11.224  1.00 0.00 ? 269 HIS A HB2  4  
ATOM   8359  H  HB3  . HIS A 1 115 ? 4.846   5.947   12.457  1.00 0.00 ? 269 HIS A HB3  4  
ATOM   8360  H  HD1  . HIS A 1 115 ? 7.522   6.885   12.744  1.00 0.00 ? 269 HIS A HD1  4  
ATOM   8361  H  HD2  . HIS A 1 115 ? 6.713   4.064   9.783   1.00 0.00 ? 269 HIS A HD2  4  
ATOM   8362  H  HE1  . HIS A 1 115 ? 9.728   5.790   12.170  1.00 0.00 ? 269 HIS A HE1  4  
ATOM   8363  N  N    . PRO A 1 116 ? 4.076   6.829   8.550   1.00 0.00 ? 270 PRO A N    4  
ATOM   8364  C  CA   . PRO A 1 116 ? 4.338   7.231   7.145   1.00 0.00 ? 270 PRO A CA   4  
ATOM   8365  C  C    . PRO A 1 116 ? 5.821   7.588   6.960   1.00 0.00 ? 270 PRO A C    4  
ATOM   8366  O  O    . PRO A 1 116 ? 6.168   8.746   6.818   1.00 0.00 ? 270 PRO A O    4  
ATOM   8367  C  CB   . PRO A 1 116 ? 3.445   8.455   6.947   1.00 0.00 ? 270 PRO A CB   4  
ATOM   8368  C  CG   . PRO A 1 116 ? 3.235   9.003   8.320   1.00 0.00 ? 270 PRO A CG   4  
ATOM   8369  C  CD   . PRO A 1 116 ? 3.255   7.827   9.259   1.00 0.00 ? 270 PRO A CD   4  
ATOM   8370  H  HA   . PRO A 1 116 ? 4.047   6.447   6.466   1.00 0.00 ? 270 PRO A HA   4  
ATOM   8371  H  HB2  . PRO A 1 116 ? 3.940   9.183   6.319   1.00 0.00 ? 270 PRO A HB2  4  
ATOM   8372  H  HB3  . PRO A 1 116 ? 2.499   8.164   6.516   1.00 0.00 ? 270 PRO A HB3  4  
ATOM   8373  H  HG2  . PRO A 1 116 ? 4.030   9.692   8.567   1.00 0.00 ? 270 PRO A HG2  4  
ATOM   8374  H  HG3  . PRO A 1 116 ? 2.279   9.499   8.379   1.00 0.00 ? 270 PRO A HG3  4  
ATOM   8375  H  HD2  . PRO A 1 116 ? 3.713   8.103   10.200  1.00 0.00 ? 270 PRO A HD2  4  
ATOM   8376  H  HD3  . PRO A 1 116 ? 2.258   7.446   9.416   1.00 0.00 ? 270 PRO A HD3  4  
ATOM   8377  N  N    . GLU A 1 117 ? 6.700   6.605   6.962   1.00 0.00 ? 271 GLU A N    4  
ATOM   8378  C  CA   . GLU A 1 117 ? 8.155   6.910   6.786   1.00 0.00 ? 271 GLU A CA   4  
ATOM   8379  C  C    . GLU A 1 117 ? 8.633   6.538   5.368   1.00 0.00 ? 271 GLU A C    4  
ATOM   8380  O  O    . GLU A 1 117 ? 9.107   7.404   4.659   1.00 0.00 ? 271 GLU A O    4  
ATOM   8381  C  CB   . GLU A 1 117 ? 8.895   6.101   7.862   1.00 0.00 ? 271 GLU A CB   4  
ATOM   8382  C  CG   . GLU A 1 117 ? 9.363   7.032   8.984   1.00 0.00 ? 271 GLU A CG   4  
ATOM   8383  C  CD   . GLU A 1 117 ? 10.659  6.489   9.590   1.00 0.00 ? 271 GLU A CD   4  
ATOM   8384  O  OE1  . GLU A 1 117 ? 10.786  5.280   9.681   1.00 0.00 ? 271 GLU A OE1  4  
ATOM   8385  O  OE2  . GLU A 1 117 ? 11.502  7.293   9.952   1.00 0.00 ? 271 GLU A OE2  4  
ATOM   8386  H  H    . GLU A 1 117 ? 6.405   5.678   7.080   1.00 0.00 ? 271 GLU A H    4  
ATOM   8387  H  HA   . GLU A 1 117 ? 8.321   7.964   6.952   1.00 0.00 ? 271 GLU A HA   4  
ATOM   8388  H  HB2  . GLU A 1 117 ? 8.230   5.352   8.270   1.00 0.00 ? 271 GLU A HB2  4  
ATOM   8389  H  HB3  . GLU A 1 117 ? 9.751   5.615   7.419   1.00 0.00 ? 271 GLU A HB3  4  
ATOM   8390  H  HG2  . GLU A 1 117 ? 9.538   8.020   8.582   1.00 0.00 ? 271 GLU A HG2  4  
ATOM   8391  H  HG3  . GLU A 1 117 ? 8.605   7.084   9.750   1.00 0.00 ? 271 GLU A HG3  4  
ATOM   8392  N  N    . PRO A 1 118 ? 8.508   5.278   4.972   1.00 0.00 ? 272 PRO A N    4  
ATOM   8393  C  CA   . PRO A 1 118 ? 8.957   4.883   3.615   1.00 0.00 ? 272 PRO A CA   4  
ATOM   8394  C  C    . PRO A 1 118 ? 7.845   5.009   2.546   1.00 0.00 ? 272 PRO A C    4  
ATOM   8395  O  O    . PRO A 1 118 ? 7.874   4.292   1.561   1.00 0.00 ? 272 PRO A O    4  
ATOM   8396  C  CB   . PRO A 1 118 ? 9.330   3.416   3.790   1.00 0.00 ? 272 PRO A CB   4  
ATOM   8397  C  CG   . PRO A 1 118 ? 8.513   2.922   4.949   1.00 0.00 ? 272 PRO A CG   4  
ATOM   8398  C  CD   . PRO A 1 118 ? 7.982   4.118   5.707   1.00 0.00 ? 272 PRO A CD   4  
ATOM   8399  H  HA   . PRO A 1 118 ? 9.824   5.447   3.331   1.00 0.00 ? 272 PRO A HA   4  
ATOM   8400  H  HB2  . PRO A 1 118 ? 9.086   2.861   2.895   1.00 0.00 ? 272 PRO A HB2  4  
ATOM   8401  H  HB3  . PRO A 1 118 ? 10.381  3.323   4.016   1.00 0.00 ? 272 PRO A HB3  4  
ATOM   8402  H  HG2  . PRO A 1 118 ? 7.690   2.323   4.584   1.00 0.00 ? 272 PRO A HG2  4  
ATOM   8403  H  HG3  . PRO A 1 118 ? 9.133   2.327   5.604   1.00 0.00 ? 272 PRO A HG3  4  
ATOM   8404  H  HD2  . PRO A 1 118 ? 6.903   4.114   5.700   1.00 0.00 ? 272 PRO A HD2  4  
ATOM   8405  H  HD3  . PRO A 1 118 ? 8.353   4.105   6.713   1.00 0.00 ? 272 PRO A HD3  4  
ATOM   8406  N  N    . LEU A 1 119 ? 6.881   5.900   2.698   1.00 0.00 ? 273 LEU A N    4  
ATOM   8407  C  CA   . LEU A 1 119 ? 5.816   6.023   1.647   1.00 0.00 ? 273 LEU A CA   4  
ATOM   8408  C  C    . LEU A 1 119 ? 5.175   7.427   1.650   1.00 0.00 ? 273 LEU A C    4  
ATOM   8409  O  O    . LEU A 1 119 ? 3.994   7.565   1.388   1.00 0.00 ? 273 LEU A O    4  
ATOM   8410  C  CB   . LEU A 1 119 ? 4.781   4.920   1.965   1.00 0.00 ? 273 LEU A CB   4  
ATOM   8411  C  CG   . LEU A 1 119 ? 3.934   5.266   3.204   1.00 0.00 ? 273 LEU A CG   4  
ATOM   8412  C  CD1  . LEU A 1 119 ? 2.755   4.290   3.300   1.00 0.00 ? 273 LEU A CD1  4  
ATOM   8413  C  CD2  . LEU A 1 119 ? 4.791   5.153   4.466   1.00 0.00 ? 273 LEU A CD2  4  
ATOM   8414  H  H    . LEU A 1 119 ? 6.860   6.482   3.482   1.00 0.00 ? 273 LEU A H    4  
ATOM   8415  H  HA   . LEU A 1 119 ? 6.248   5.831   0.677   1.00 0.00 ? 273 LEU A HA   4  
ATOM   8416  H  HB2  . LEU A 1 119 ? 4.125   4.799   1.115   1.00 0.00 ? 273 LEU A HB2  4  
ATOM   8417  H  HB3  . LEU A 1 119 ? 5.302   3.991   2.141   1.00 0.00 ? 273 LEU A HB3  4  
ATOM   8418  H  HG   . LEU A 1 119 ? 3.551   6.271   3.116   1.00 0.00 ? 273 LEU A HG   4  
ATOM   8419  H  HD11 . LEU A 1 119 ? 3.049   3.329   2.904   1.00 0.00 ? 273 LEU A HD11 4  
ATOM   8420  H  HD12 . LEU A 1 119 ? 1.923   4.673   2.728   1.00 0.00 ? 273 LEU A HD12 4  
ATOM   8421  H  HD13 . LEU A 1 119 ? 2.462   4.179   4.334   1.00 0.00 ? 273 LEU A HD13 4  
ATOM   8422  H  HD21 . LEU A 1 119 ? 5.142   6.134   4.750   1.00 0.00 ? 273 LEU A HD21 4  
ATOM   8423  H  HD22 . LEU A 1 119 ? 5.637   4.513   4.266   1.00 0.00 ? 273 LEU A HD22 4  
ATOM   8424  H  HD23 . LEU A 1 119 ? 4.204   4.733   5.269   1.00 0.00 ? 273 LEU A HD23 4  
ATOM   8425  N  N    . LEU A 1 120 ? 5.936   8.471   1.923   1.00 0.00 ? 274 LEU A N    4  
ATOM   8426  C  CA   . LEU A 1 120 ? 5.322   9.850   1.917   1.00 0.00 ? 274 LEU A CA   4  
ATOM   8427  C  C    . LEU A 1 120 ? 4.778   10.156  0.517   1.00 0.00 ? 274 LEU A C    4  
ATOM   8428  O  O    . LEU A 1 120 ? 3.629   10.520  0.362   1.00 0.00 ? 274 LEU A O    4  
ATOM   8429  C  CB   . LEU A 1 120 ? 6.427   10.865  2.300   1.00 0.00 ? 274 LEU A CB   4  
ATOM   8430  C  CG   . LEU A 1 120 ? 6.072   11.562  3.623   1.00 0.00 ? 274 LEU A CG   4  
ATOM   8431  C  CD1  . LEU A 1 120 ? 4.737   12.304  3.482   1.00 0.00 ? 274 LEU A CD1  4  
ATOM   8432  C  CD2  . LEU A 1 120 ? 5.959   10.518  4.740   1.00 0.00 ? 274 LEU A CD2  4  
ATOM   8433  H  H    . LEU A 1 120 ? 6.892   8.346   2.117   1.00 0.00 ? 274 LEU A H    4  
ATOM   8434  H  HA   . LEU A 1 120 ? 4.521   9.895   2.633   1.00 0.00 ? 274 LEU A HA   4  
ATOM   8435  H  HB2  . LEU A 1 120 ? 7.371   10.355  2.409   1.00 0.00 ? 274 LEU A HB2  4  
ATOM   8436  H  HB3  . LEU A 1 120 ? 6.515   11.609  1.523   1.00 0.00 ? 274 LEU A HB3  4  
ATOM   8437  H  HG   . LEU A 1 120 ? 6.848   12.270  3.871   1.00 0.00 ? 274 LEU A HG   4  
ATOM   8438  H  HD11 . LEU A 1 120 ? 3.926   11.635  3.727   1.00 0.00 ? 274 LEU A HD11 4  
ATOM   8439  H  HD12 . LEU A 1 120 ? 4.624   12.651  2.464   1.00 0.00 ? 274 LEU A HD12 4  
ATOM   8440  H  HD13 . LEU A 1 120 ? 4.723   13.150  4.154   1.00 0.00 ? 274 LEU A HD13 4  
ATOM   8441  H  HD21 . LEU A 1 120 ? 6.256   10.963  5.679   1.00 0.00 ? 274 LEU A HD21 4  
ATOM   8442  H  HD22 . LEU A 1 120 ? 6.604   9.681   4.517   1.00 0.00 ? 274 LEU A HD22 4  
ATOM   8443  H  HD23 . LEU A 1 120 ? 4.937   10.176  4.811   1.00 0.00 ? 274 LEU A HD23 4  
ATOM   8444  N  N    . ASP A 1 121 ? 5.589   9.994   -0.507  1.00 0.00 ? 275 ASP A N    4  
ATOM   8445  C  CA   . ASP A 1 121 ? 5.091   10.265  -1.907  1.00 0.00 ? 275 ASP A CA   4  
ATOM   8446  C  C    . ASP A 1 121 ? 3.853   9.400   -2.199  1.00 0.00 ? 275 ASP A C    4  
ATOM   8447  O  O    . ASP A 1 121 ? 2.913   9.849   -2.829  1.00 0.00 ? 275 ASP A O    4  
ATOM   8448  C  CB   . ASP A 1 121 ? 6.233   9.891   -2.865  1.00 0.00 ? 275 ASP A CB   4  
ATOM   8449  C  CG   . ASP A 1 121 ? 5.924   10.427  -4.264  1.00 0.00 ? 275 ASP A CG   4  
ATOM   8450  O  OD1  . ASP A 1 121 ? 6.211   11.587  -4.509  1.00 0.00 ? 275 ASP A OD1  4  
ATOM   8451  O  OD2  . ASP A 1 121 ? 5.405   9.669   -5.067  1.00 0.00 ? 275 ASP A OD2  4  
ATOM   8452  H  H    . ASP A 1 121 ? 6.512   9.684   -0.353  1.00 0.00 ? 275 ASP A H    4  
ATOM   8453  H  HA   . ASP A 1 121 ? 4.848   11.306  -2.018  1.00 0.00 ? 275 ASP A HA   4  
ATOM   8454  H  HB2  . ASP A 1 121 ? 7.156   10.321  -2.509  1.00 0.00 ? 275 ASP A HB2  4  
ATOM   8455  H  HB3  . ASP A 1 121 ? 6.328   8.816   -2.907  1.00 0.00 ? 275 ASP A HB3  4  
ATOM   8456  N  N    . LEU A 1 122 ? 3.843   8.166   -1.739  1.00 0.00 ? 276 LEU A N    4  
ATOM   8457  C  CA   . LEU A 1 122 ? 2.648   7.283   -1.991  1.00 0.00 ? 276 LEU A CA   4  
ATOM   8458  C  C    . LEU A 1 122 ? 1.413   7.868   -1.290  1.00 0.00 ? 276 LEU A C    4  
ATOM   8459  O  O    . LEU A 1 122 ? 0.329   7.869   -1.843  1.00 0.00 ? 276 LEU A O    4  
ATOM   8460  C  CB   . LEU A 1 122 ? 2.993   5.903   -1.402  1.00 0.00 ? 276 LEU A CB   4  
ATOM   8461  C  CG   . LEU A 1 122 ? 2.288   4.802   -2.193  1.00 0.00 ? 276 LEU A CG   4  
ATOM   8462  C  CD1  . LEU A 1 122 ? 2.924   4.678   -3.580  1.00 0.00 ? 276 LEU A CD1  4  
ATOM   8463  C  CD2  . LEU A 1 122 ? 2.433   3.472   -1.444  1.00 0.00 ? 276 LEU A CD2  4  
ATOM   8464  H  H    . LEU A 1 122 ? 4.614   7.829   -1.227  1.00 0.00 ? 276 LEU A H    4  
ATOM   8465  H  HA   . LEU A 1 122 ? 2.465   7.201   -3.046  1.00 0.00 ? 276 LEU A HA   4  
ATOM   8466  H  HB2  . LEU A 1 122 ? 4.062   5.750   -1.451  1.00 0.00 ? 276 LEU A HB2  4  
ATOM   8467  H  HB3  . LEU A 1 122 ? 2.673   5.864   -0.371  1.00 0.00 ? 276 LEU A HB3  4  
ATOM   8468  H  HG   . LEU A 1 122 ? 1.240   5.047   -2.296  1.00 0.00 ? 276 LEU A HG   4  
ATOM   8469  H  HD11 . LEU A 1 122 ? 3.678   3.906   -3.562  1.00 0.00 ? 276 LEU A HD11 4  
ATOM   8470  H  HD12 . LEU A 1 122 ? 3.376   5.619   -3.854  1.00 0.00 ? 276 LEU A HD12 4  
ATOM   8471  H  HD13 . LEU A 1 122 ? 2.162   4.421   -4.302  1.00 0.00 ? 276 LEU A HD13 4  
ATOM   8472  H  HD21 . LEU A 1 122 ? 3.284   2.932   -1.832  1.00 0.00 ? 276 LEU A HD21 4  
ATOM   8473  H  HD22 . LEU A 1 122 ? 1.541   2.883   -1.581  1.00 0.00 ? 276 LEU A HD22 4  
ATOM   8474  H  HD23 . LEU A 1 122 ? 2.578   3.664   -0.391  1.00 0.00 ? 276 LEU A HD23 4  
ATOM   8475  N  N    . VAL A 1 123 ? 1.565   8.373   -0.085  1.00 0.00 ? 277 VAL A N    4  
ATOM   8476  C  CA   . VAL A 1 123 ? 0.378   8.968   0.627   1.00 0.00 ? 277 VAL A CA   4  
ATOM   8477  C  C    . VAL A 1 123 ? -0.021  10.283  -0.058  1.00 0.00 ? 277 VAL A C    4  
ATOM   8478  O  O    . VAL A 1 123 ? -1.195  10.551  -0.250  1.00 0.00 ? 277 VAL A O    4  
ATOM   8479  C  CB   . VAL A 1 123 ? 0.812   9.209   2.086   1.00 0.00 ? 277 VAL A CB   4  
ATOM   8480  C  CG1  . VAL A 1 123 ? -0.316  9.899   2.864   1.00 0.00 ? 277 VAL A CG1  4  
ATOM   8481  C  CG2  . VAL A 1 123 ? 1.137   7.861   2.743   1.00 0.00 ? 277 VAL A CG2  4  
ATOM   8482  H  H    . VAL A 1 123 ? 2.454   8.371   0.340   1.00 0.00 ? 277 VAL A H    4  
ATOM   8483  H  HA   . VAL A 1 123 ? -0.446  8.277   0.601   1.00 0.00 ? 277 VAL A HA   4  
ATOM   8484  H  HB   . VAL A 1 123 ? 1.692   9.837   2.099   1.00 0.00 ? 277 VAL A HB   4  
ATOM   8485  H  HG11 . VAL A 1 123 ? -0.124  10.960  2.910   1.00 0.00 ? 277 VAL A HG11 4  
ATOM   8486  H  HG12 . VAL A 1 123 ? -0.363  9.499   3.866   1.00 0.00 ? 277 VAL A HG12 4  
ATOM   8487  H  HG13 . VAL A 1 123 ? -1.257  9.725   2.362   1.00 0.00 ? 277 VAL A HG13 4  
ATOM   8488  H  HG21 . VAL A 1 123 ? 2.204   7.701   2.726   1.00 0.00 ? 277 VAL A HG21 4  
ATOM   8489  H  HG22 . VAL A 1 123 ? 0.645   7.065   2.201   1.00 0.00 ? 277 VAL A HG22 4  
ATOM   8490  H  HG23 . VAL A 1 123 ? 0.791   7.865   3.767   1.00 0.00 ? 277 VAL A HG23 4  
ATOM   8491  N  N    . THR A 1 124 ? 0.938   11.098  -0.447  1.00 0.00 ? 278 THR A N    4  
ATOM   8492  C  CA   . THR A 1 124 ? 0.577   12.385  -1.140  1.00 0.00 ? 278 THR A CA   4  
ATOM   8493  C  C    . THR A 1 124 ? -0.135  12.063  -2.465  1.00 0.00 ? 278 THR A C    4  
ATOM   8494  O  O    . THR A 1 124 ? -1.075  12.740  -2.840  1.00 0.00 ? 278 THR A O    4  
ATOM   8495  C  CB   . THR A 1 124 ? 1.890   13.150  -1.402  1.00 0.00 ? 278 THR A CB   4  
ATOM   8496  O  OG1  . THR A 1 124 ? 2.953   12.525  -0.696  1.00 0.00 ? 278 THR A OG1  4  
ATOM   8497  C  CG2  . THR A 1 124 ? 1.746   14.599  -0.925  1.00 0.00 ? 278 THR A CG2  4  
ATOM   8498  H  H    . THR A 1 124 ? 1.882   10.855  -0.296  1.00 0.00 ? 278 THR A H    4  
ATOM   8499  H  HA   . THR A 1 124 ? -0.073  12.971  -0.507  1.00 0.00 ? 278 THR A HA   4  
ATOM   8500  H  HB   . THR A 1 124 ? 2.107   13.144  -2.459  1.00 0.00 ? 278 THR A HB   4  
ATOM   8501  H  HG1  . THR A 1 124 ? 3.781   12.893  -1.016  1.00 0.00 ? 278 THR A HG1  4  
ATOM   8502  H  HG21 . THR A 1 124 ? 2.194   14.701  0.053   1.00 0.00 ? 278 THR A HG21 4  
ATOM   8503  H  HG22 . THR A 1 124 ? 0.700   14.861  -0.872  1.00 0.00 ? 278 THR A HG22 4  
ATOM   8504  H  HG23 . THR A 1 124 ? 2.247   15.257  -1.619  1.00 0.00 ? 278 THR A HG23 4  
ATOM   8505  N  N    . ALA A 1 125 ? 0.289   11.030  -3.173  1.00 0.00 ? 279 ALA A N    4  
ATOM   8506  C  CA   . ALA A 1 125 ? -0.406  10.685  -4.466  1.00 0.00 ? 279 ALA A CA   4  
ATOM   8507  C  C    . ALA A 1 125 ? -1.892  10.372  -4.208  1.00 0.00 ? 279 ALA A C    4  
ATOM   8508  O  O    . ALA A 1 125 ? -2.732  10.631  -5.050  1.00 0.00 ? 279 ALA A O    4  
ATOM   8509  C  CB   . ALA A 1 125 ? 0.303   9.445   -5.036  1.00 0.00 ? 279 ALA A CB   4  
ATOM   8510  H  H    . ALA A 1 125 ? 1.047   10.481  -2.851  1.00 0.00 ? 279 ALA A H    4  
ATOM   8511  H  HA   . ALA A 1 125 ? -0.319  11.504  -5.159  1.00 0.00 ? 279 ALA A HA   4  
ATOM   8512  H  HB1  . ALA A 1 125 ? -0.266  9.053   -5.866  1.00 0.00 ? 279 ALA A HB1  4  
ATOM   8513  H  HB2  . ALA A 1 125 ? 0.381   8.690   -4.266  1.00 0.00 ? 279 ALA A HB2  4  
ATOM   8514  H  HB3  . ALA A 1 125 ? 1.291   9.718   -5.374  1.00 0.00 ? 279 ALA A HB3  4  
ATOM   8515  N  N    . CYS A 1 126 ? -2.230  9.820   -3.056  1.00 0.00 ? 280 CYS A N    4  
ATOM   8516  C  CA   . CYS A 1 126 ? -3.676  9.504   -2.773  1.00 0.00 ? 280 CYS A CA   4  
ATOM   8517  C  C    . CYS A 1 126 ? -4.505  10.796  -2.812  1.00 0.00 ? 280 CYS A C    4  
ATOM   8518  O  O    . CYS A 1 126 ? -5.518  10.862  -3.482  1.00 0.00 ? 280 CYS A O    4  
ATOM   8519  C  CB   . CYS A 1 126 ? -3.724  8.880   -1.362  1.00 0.00 ? 280 CYS A CB   4  
ATOM   8520  S  SG   . CYS A 1 126 ? -5.432  8.464   -0.915  1.00 0.00 ? 280 CYS A SG   4  
ATOM   8521  H  H    . CYS A 1 126 ? -1.539  9.619   -2.386  1.00 0.00 ? 280 CYS A H    4  
ATOM   8522  H  HA   . CYS A 1 126 ? -4.050  8.802   -3.501  1.00 0.00 ? 280 CYS A HA   4  
ATOM   8523  H  HB2  . CYS A 1 126 ? -3.123  7.983   -1.348  1.00 0.00 ? 280 CYS A HB2  4  
ATOM   8524  H  HB3  . CYS A 1 126 ? -3.328  9.586   -0.646  1.00 0.00 ? 280 CYS A HB3  4  
ATOM   8525  H  HG   . CYS A 1 126 ? -5.480  7.514   -0.778  1.00 0.00 ? 280 CYS A HG   4  
ATOM   8526  N  N    . ASN A 1 127 ? -4.088  11.821  -2.099  1.00 0.00 ? 281 ASN A N    4  
ATOM   8527  C  CA   . ASN A 1 127 ? -4.881  13.103  -2.112  1.00 0.00 ? 281 ASN A CA   4  
ATOM   8528  C  C    . ASN A 1 127 ? -4.949  13.669  -3.536  1.00 0.00 ? 281 ASN A C    4  
ATOM   8529  O  O    . ASN A 1 127 ? -5.978  14.162  -3.958  1.00 0.00 ? 281 ASN A O    4  
ATOM   8530  C  CB   . ASN A 1 127 ? -4.158  14.087  -1.181  1.00 0.00 ? 281 ASN A CB   4  
ATOM   8531  C  CG   . ASN A 1 127 ? -4.583  13.826  0.271   1.00 0.00 ? 281 ASN A CG   4  
ATOM   8532  O  OD1  . ASN A 1 127 ? -5.752  13.904  0.592   1.00 0.00 ? 281 ASN A OD1  4  
ATOM   8533  N  ND2  . ASN A 1 127 ? -3.680  13.518  1.170   1.00 0.00 ? 281 ASN A ND2  4  
ATOM   8534  H  H    . ASN A 1 127 ? -3.261  11.744  -1.561  1.00 0.00 ? 281 ASN A H    4  
ATOM   8535  H  HA   . ASN A 1 127 ? -5.877  12.917  -1.750  1.00 0.00 ? 281 ASN A HA   4  
ATOM   8536  H  HB2  . ASN A 1 127 ? -3.090  13.952  -1.274  1.00 0.00 ? 281 ASN A HB2  4  
ATOM   8537  H  HB3  . ASN A 1 127 ? -4.419  15.098  -1.454  1.00 0.00 ? 281 ASN A HB3  4  
ATOM   8538  H  HD21 . ASN A 1 127 ? -2.733  13.452  0.923   1.00 0.00 ? 281 ASN A HD21 4  
ATOM   8539  H  HD22 . ASN A 1 127 ? -3.954  13.352  2.097   1.00 0.00 ? 281 ASN A HD22 4  
ATOM   8540  N  N    . SER A 1 128 ? -3.870  13.596  -4.287  1.00 0.00 ? 282 SER A N    4  
ATOM   8541  C  CA   . SER A 1 128 ? -3.909  14.134  -5.693  1.00 0.00 ? 282 SER A CA   4  
ATOM   8542  C  C    . SER A 1 128 ? -4.785  13.235  -6.577  1.00 0.00 ? 282 SER A C    4  
ATOM   8543  O  O    . SER A 1 128 ? -5.499  13.721  -7.435  1.00 0.00 ? 282 SER A O    4  
ATOM   8544  C  CB   . SER A 1 128 ? -2.462  14.146  -6.207  1.00 0.00 ? 282 SER A CB   4  
ATOM   8545  O  OG   . SER A 1 128 ? -2.318  15.175  -7.179  1.00 0.00 ? 282 SER A OG   4  
ATOM   8546  H  H    . SER A 1 128 ? -3.049  13.184  -3.929  1.00 0.00 ? 282 SER A H    4  
ATOM   8547  H  HA   . SER A 1 128 ? -4.305  15.133  -5.688  1.00 0.00 ? 282 SER A HA   4  
ATOM   8548  H  HB2  . SER A 1 128 ? -1.788  14.335  -5.389  1.00 0.00 ? 282 SER A HB2  4  
ATOM   8549  H  HB3  . SER A 1 128 ? -2.230  13.185  -6.647  1.00 0.00 ? 282 SER A HB3  4  
ATOM   8550  H  HG   . SER A 1 128 ? -1.539  14.979  -7.704  1.00 0.00 ? 282 SER A HG   4  
ATOM   8551  N  N    . VAL A 1 129 ? -4.753  11.934  -6.372  1.00 0.00 ? 283 VAL A N    4  
ATOM   8552  C  CA   . VAL A 1 129 ? -5.613  11.032  -7.215  1.00 0.00 ? 283 VAL A CA   4  
ATOM   8553  C  C    . VAL A 1 129 ? -7.062  11.100  -6.726  1.00 0.00 ? 283 VAL A C    4  
ATOM   8554  O  O    . VAL A 1 129 ? -7.980  11.125  -7.527  1.00 0.00 ? 283 VAL A O    4  
ATOM   8555  C  CB   . VAL A 1 129 ? -5.049  9.609   -7.065  1.00 0.00 ? 283 VAL A CB   4  
ATOM   8556  C  CG1  . VAL A 1 129 ? -5.890  8.623   -7.885  1.00 0.00 ? 283 VAL A CG1  4  
ATOM   8557  C  CG2  . VAL A 1 129 ? -3.604  9.581   -7.568  1.00 0.00 ? 283 VAL A CG2  4  
ATOM   8558  H  H    . VAL A 1 129 ? -4.179  11.558  -5.666  1.00 0.00 ? 283 VAL A H    4  
ATOM   8559  H  HA   . VAL A 1 129 ? -5.569  11.344  -8.242  1.00 0.00 ? 283 VAL A HA   4  
ATOM   8560  H  HB   . VAL A 1 129 ? -5.073  9.322   -6.024  1.00 0.00 ? 283 VAL A HB   4  
ATOM   8561  H  HG11 . VAL A 1 129 ? -5.673  8.752   -8.934  1.00 0.00 ? 283 VAL A HG11 4  
ATOM   8562  H  HG12 . VAL A 1 129 ? -6.939  8.811   -7.708  1.00 0.00 ? 283 VAL A HG12 4  
ATOM   8563  H  HG13 . VAL A 1 129 ? -5.651  7.612   -7.589  1.00 0.00 ? 283 VAL A HG13 4  
ATOM   8564  H  HG21 . VAL A 1 129 ? -3.162  10.560  -7.447  1.00 0.00 ? 283 VAL A HG21 4  
ATOM   8565  H  HG22 . VAL A 1 129 ? -3.592  9.308   -8.613  1.00 0.00 ? 283 VAL A HG22 4  
ATOM   8566  H  HG23 . VAL A 1 129 ? -3.038  8.859   -7.000  1.00 0.00 ? 283 VAL A HG23 4  
ATOM   8567  N  N    . PHE A 1 130 ? -7.287  11.159  -5.429  1.00 0.00 ? 284 PHE A N    4  
ATOM   8568  C  CA   . PHE A 1 130 ? -8.705  11.259  -4.947  1.00 0.00 ? 284 PHE A CA   4  
ATOM   8569  C  C    . PHE A 1 130 ? -9.234  12.674  -5.222  1.00 0.00 ? 284 PHE A C    4  
ATOM   8570  O  O    . PHE A 1 130 ? -10.413 12.851  -5.470  1.00 0.00 ? 284 PHE A O    4  
ATOM   8571  C  CB   . PHE A 1 130 ? -8.723  10.936  -3.439  1.00 0.00 ? 284 PHE A CB   4  
ATOM   8572  C  CG   . PHE A 1 130 ? -9.416  9.607   -3.232  1.00 0.00 ? 284 PHE A CG   4  
ATOM   8573  C  CD1  . PHE A 1 130 ? -10.741 9.440   -3.652  1.00 0.00 ? 284 PHE A CD1  4  
ATOM   8574  C  CD2  . PHE A 1 130 ? -8.730  8.540   -2.639  1.00 0.00 ? 284 PHE A CD2  4  
ATOM   8575  C  CE1  . PHE A 1 130 ? -11.382 8.209   -3.479  1.00 0.00 ? 284 PHE A CE1  4  
ATOM   8576  C  CE2  . PHE A 1 130 ? -9.371  7.305   -2.468  1.00 0.00 ? 284 PHE A CE2  4  
ATOM   8577  C  CZ   . PHE A 1 130 ? -10.698 7.141   -2.888  1.00 0.00 ? 284 PHE A CZ   4  
ATOM   8578  H  H    . PHE A 1 130 ? -6.534  11.165  -4.792  1.00 0.00 ? 284 PHE A H    4  
ATOM   8579  H  HA   . PHE A 1 130 ? -9.310  10.544  -5.484  1.00 0.00 ? 284 PHE A HA   4  
ATOM   8580  H  HB2  . PHE A 1 130 ? -7.714  10.880  -3.061  1.00 0.00 ? 284 PHE A HB2  4  
ATOM   8581  H  HB3  . PHE A 1 130 ? -9.264  11.707  -2.913  1.00 0.00 ? 284 PHE A HB3  4  
ATOM   8582  H  HD1  . PHE A 1 130 ? -11.271 10.264  -4.110  1.00 0.00 ? 284 PHE A HD1  4  
ATOM   8583  H  HD2  . PHE A 1 130 ? -7.708  8.668   -2.315  1.00 0.00 ? 284 PHE A HD2  4  
ATOM   8584  H  HE1  . PHE A 1 130 ? -12.404 8.082   -3.803  1.00 0.00 ? 284 PHE A HE1  4  
ATOM   8585  H  HE2  . PHE A 1 130 ? -8.843  6.482   -2.012  1.00 0.00 ? 284 PHE A HE2  4  
ATOM   8586  H  HZ   . PHE A 1 130 ? -11.191 6.188   -2.758  1.00 0.00 ? 284 PHE A HZ   4  
ATOM   8587  N  N    . GLU A 1 131 ? -8.380  13.691  -5.218  1.00 0.00 ? 285 GLU A N    4  
ATOM   8588  C  CA   . GLU A 1 131 ? -8.882  15.079  -5.527  1.00 0.00 ? 285 GLU A CA   4  
ATOM   8589  C  C    . GLU A 1 131 ? -9.535  15.074  -6.917  1.00 0.00 ? 285 GLU A C    4  
ATOM   8590  O  O    . GLU A 1 131 ? -10.566 15.687  -7.120  1.00 0.00 ? 285 GLU A O    4  
ATOM   8591  C  CB   . GLU A 1 131 ? -7.662  16.015  -5.510  1.00 0.00 ? 285 GLU A CB   4  
ATOM   8592  C  CG   . GLU A 1 131 ? -8.117  17.452  -5.773  1.00 0.00 ? 285 GLU A CG   4  
ATOM   8593  C  CD   . GLU A 1 131 ? -8.015  17.753  -7.270  1.00 0.00 ? 285 GLU A CD   4  
ATOM   8594  O  OE1  . GLU A 1 131 ? -6.996  17.422  -7.853  1.00 0.00 ? 285 GLU A OE1  4  
ATOM   8595  O  OE2  . GLU A 1 131 ? -8.957  18.311  -7.807  1.00 0.00 ? 285 GLU A OE2  4  
ATOM   8596  H  H    . GLU A 1 131 ? -7.423  13.537  -5.039  1.00 0.00 ? 285 GLU A H    4  
ATOM   8597  H  HA   . GLU A 1 131 ? -9.598  15.386  -4.787  1.00 0.00 ? 285 GLU A HA   4  
ATOM   8598  H  HB2  . GLU A 1 131 ? -7.181  15.961  -4.544  1.00 0.00 ? 285 GLU A HB2  4  
ATOM   8599  H  HB3  . GLU A 1 131 ? -6.965  15.713  -6.277  1.00 0.00 ? 285 GLU A HB3  4  
ATOM   8600  H  HG2  . GLU A 1 131 ? -9.140  17.571  -5.450  1.00 0.00 ? 285 GLU A HG2  4  
ATOM   8601  H  HG3  . GLU A 1 131 ? -7.484  18.136  -5.227  1.00 0.00 ? 285 GLU A HG3  4  
ATOM   8602  N  N    . ASN A 1 132 ? -8.964  14.359  -7.872  1.00 0.00 ? 286 ASN A N    4  
ATOM   8603  C  CA   . ASN A 1 132 ? -9.603  14.303  -9.237  1.00 0.00 ? 286 ASN A CA   4  
ATOM   8604  C  C    . ASN A 1 132 ? -11.035 13.743  -9.119  1.00 0.00 ? 286 ASN A C    4  
ATOM   8605  O  O    . ASN A 1 132 ? -11.904 14.095  -9.894  1.00 0.00 ? 286 ASN A O    4  
ATOM   8606  C  CB   . ASN A 1 132 ? -8.738  13.369  -10.098 1.00 0.00 ? 286 ASN A CB   4  
ATOM   8607  C  CG   . ASN A 1 132 ? -7.550  14.154  -10.668 1.00 0.00 ? 286 ASN A CG   4  
ATOM   8608  O  OD1  . ASN A 1 132 ? -7.736  15.156  -11.328 1.00 0.00 ? 286 ASN A OD1  4  
ATOM   8609  N  ND2  . ASN A 1 132 ? -6.325  13.742  -10.442 1.00 0.00 ? 286 ASN A ND2  4  
ATOM   8610  H  H    . ASN A 1 132 ? -8.138  13.846  -7.682  1.00 0.00 ? 286 ASN A H    4  
ATOM   8611  H  HA   . ASN A 1 132 ? -9.627  15.288  -9.672  1.00 0.00 ? 286 ASN A HA   4  
ATOM   8612  H  HB2  . ASN A 1 132 ? -8.375  12.553  -9.490  1.00 0.00 ? 286 ASN A HB2  4  
ATOM   8613  H  HB3  . ASN A 1 132 ? -9.331  12.977  -10.910 1.00 0.00 ? 286 ASN A HB3  4  
ATOM   8614  H  HD21 . ASN A 1 132 ? -6.163  12.933  -9.910  1.00 0.00 ? 286 ASN A HD21 4  
ATOM   8615  H  HD22 . ASN A 1 132 ? -5.568  14.245  -10.807 1.00 0.00 ? 286 ASN A HD22 4  
ATOM   8616  N  N    . LEU A 1 133 ? -11.297 12.881  -8.147  1.00 0.00 ? 287 LEU A N    4  
ATOM   8617  C  CA   . LEU A 1 133 ? -12.688 12.320  -7.987  1.00 0.00 ? 287 LEU A CA   4  
ATOM   8618  C  C    . LEU A 1 133 ? -13.700 13.470  -7.847  1.00 0.00 ? 287 LEU A C    4  
ATOM   8619  O  O    . LEU A 1 133 ? -14.780 13.419  -8.407  1.00 0.00 ? 287 LEU A O    4  
ATOM   8620  C  CB   . LEU A 1 133 ? -12.669 11.476  -6.695  1.00 0.00 ? 287 LEU A CB   4  
ATOM   8621  C  CG   . LEU A 1 133 ? -13.742 10.376  -6.741  1.00 0.00 ? 287 LEU A CG   4  
ATOM   8622  C  CD1  . LEU A 1 133 ? -15.125 10.988  -6.987  1.00 0.00 ? 287 LEU A CD1  4  
ATOM   8623  C  CD2  . LEU A 1 133 ? -13.408 9.385   -7.860  1.00 0.00 ? 287 LEU A CD2  4  
ATOM   8624  H  H    . LEU A 1 133 ? -10.586 12.613  -7.525  1.00 0.00 ? 287 LEU A H    4  
ATOM   8625  H  HA   . LEU A 1 133 ? -12.942 11.698  -8.831  1.00 0.00 ? 287 LEU A HA   4  
ATOM   8626  H  HB2  . LEU A 1 133 ? -11.698 11.017  -6.585  1.00 0.00 ? 287 LEU A HB2  4  
ATOM   8627  H  HB3  . LEU A 1 133 ? -12.854 12.120  -5.850  1.00 0.00 ? 287 LEU A HB3  4  
ATOM   8628  H  HG   . LEU A 1 133 ? -13.751 9.853   -5.795  1.00 0.00 ? 287 LEU A HG   4  
ATOM   8629  H  HD11 . LEU A 1 133 ? -15.289 11.091  -8.049  1.00 0.00 ? 287 LEU A HD11 4  
ATOM   8630  H  HD12 . LEU A 1 133 ? -15.177 11.960  -6.519  1.00 0.00 ? 287 LEU A HD12 4  
ATOM   8631  H  HD13 . LEU A 1 133 ? -15.885 10.347  -6.566  1.00 0.00 ? 287 LEU A HD13 4  
ATOM   8632  H  HD21 . LEU A 1 133 ? -13.637 9.829   -8.817  1.00 0.00 ? 287 LEU A HD21 4  
ATOM   8633  H  HD22 . LEU A 1 133 ? -13.993 8.485   -7.730  1.00 0.00 ? 287 LEU A HD22 4  
ATOM   8634  H  HD23 . LEU A 1 133 ? -12.356 9.138   -7.820  1.00 0.00 ? 287 LEU A HD23 4  
ATOM   8635  N  N    . GLU A 1 134 ? -13.359 14.510  -7.109  1.00 0.00 ? 288 GLU A N    4  
ATOM   8636  C  CA   . GLU A 1 134 ? -14.325 15.657  -6.953  1.00 0.00 ? 288 GLU A CA   4  
ATOM   8637  C  C    . GLU A 1 134 ? -14.579 16.309  -8.319  1.00 0.00 ? 288 GLU A C    4  
ATOM   8638  O  O    . GLU A 1 134 ? -15.703 16.633  -8.654  1.00 0.00 ? 288 GLU A O    4  
ATOM   8639  C  CB   . GLU A 1 134 ? -13.672 16.667  -5.998  1.00 0.00 ? 288 GLU A CB   4  
ATOM   8640  C  CG   . GLU A 1 134 ? -14.760 17.478  -5.290  1.00 0.00 ? 288 GLU A CG   4  
ATOM   8641  C  CD   . GLU A 1 134 ? -14.283 17.855  -3.886  1.00 0.00 ? 288 GLU A CD   4  
ATOM   8642  O  OE1  . GLU A 1 134 ? -13.489 18.775  -3.778  1.00 0.00 ? 288 GLU A OE1  4  
ATOM   8643  O  OE2  . GLU A 1 134 ? -14.719 17.216  -2.942  1.00 0.00 ? 288 GLU A OE2  4  
ATOM   8644  H  H    . GLU A 1 134 ? -12.475 14.533  -6.664  1.00 0.00 ? 288 GLU A H    4  
ATOM   8645  H  HA   . GLU A 1 134 ? -15.252 15.304  -6.538  1.00 0.00 ? 288 GLU A HA   4  
ATOM   8646  H  HB2  . GLU A 1 134 ? -13.081 16.137  -5.264  1.00 0.00 ? 288 GLU A HB2  4  
ATOM   8647  H  HB3  . GLU A 1 134 ? -13.036 17.333  -6.559  1.00 0.00 ? 288 GLU A HB3  4  
ATOM   8648  H  HG2  . GLU A 1 134 ? -14.963 18.375  -5.855  1.00 0.00 ? 288 GLU A HG2  4  
ATOM   8649  H  HG3  . GLU A 1 134 ? -15.659 16.886  -5.215  1.00 0.00 ? 288 GLU A HG3  4  
ATOM   8650  N  N    . GLN A 1 135 ? -13.546 16.495  -9.115  1.00 0.00 ? 289 GLN A N    4  
ATOM   8651  C  CA   . GLN A 1 135 ? -13.755 17.124  -10.469 1.00 0.00 ? 289 GLN A CA   4  
ATOM   8652  C  C    . GLN A 1 135 ? -14.680 16.234  -11.313 1.00 0.00 ? 289 GLN A C    4  
ATOM   8653  O  O    . GLN A 1 135 ? -15.550 16.725  -12.007 1.00 0.00 ? 289 GLN A O    4  
ATOM   8654  C  CB   . GLN A 1 135 ? -12.371 17.229  -11.131 1.00 0.00 ? 289 GLN A CB   4  
ATOM   8655  C  CG   . GLN A 1 135 ? -11.583 18.372  -10.489 1.00 0.00 ? 289 GLN A CG   4  
ATOM   8656  C  CD   . GLN A 1 135 ? -11.854 19.674  -11.254 1.00 0.00 ? 289 GLN A CD   4  
ATOM   8657  O  OE1  . GLN A 1 135 ? -11.166 19.980  -12.209 1.00 0.00 ? 289 GLN A OE1  4  
ATOM   8658  N  NE2  . GLN A 1 135 ? -12.831 20.463  -10.878 1.00 0.00 ? 289 GLN A NE2  4  
ATOM   8659  H  H    . GLN A 1 135 ? -12.646 16.218  -8.823  1.00 0.00 ? 289 GLN A H    4  
ATOM   8660  H  HA   . GLN A 1 135 ? -14.186 18.107  -10.359 1.00 0.00 ? 289 GLN A HA   4  
ATOM   8661  H  HB2  . GLN A 1 135 ? -11.836 16.301  -10.994 1.00 0.00 ? 289 GLN A HB2  4  
ATOM   8662  H  HB3  . GLN A 1 135 ? -12.491 17.425  -12.186 1.00 0.00 ? 289 GLN A HB3  4  
ATOM   8663  H  HG2  . GLN A 1 135 ? -11.891 18.488  -9.459  1.00 0.00 ? 289 GLN A HG2  4  
ATOM   8664  H  HG3  . GLN A 1 135 ? -10.528 18.148  -10.527 1.00 0.00 ? 289 GLN A HG3  4  
ATOM   8665  H  HE21 . GLN A 1 135 ? -13.393 20.226  -10.108 1.00 0.00 ? 289 GLN A HE21 4  
ATOM   8666  H  HE22 . GLN A 1 135 ? -13.002 21.294  -11.368 1.00 0.00 ? 289 GLN A HE22 4  
ATOM   8667  N  N    . LEU A 1 136 ? -14.506 14.926  -11.257 1.00 0.00 ? 290 LEU A N    4  
ATOM   8668  C  CA   . LEU A 1 136 ? -15.400 14.020  -12.065 1.00 0.00 ? 290 LEU A CA   4  
ATOM   8669  C  C    . LEU A 1 136 ? -16.868 14.228  -11.659 1.00 0.00 ? 290 LEU A C    4  
ATOM   8670  O  O    . LEU A 1 136 ? -17.749 14.235  -12.497 1.00 0.00 ? 290 LEU A O    4  
ATOM   8671  C  CB   . LEU A 1 136 ? -14.966 12.577  -11.757 1.00 0.00 ? 290 LEU A CB   4  
ATOM   8672  C  CG   . LEU A 1 136 ? -15.675 11.615  -12.712 1.00 0.00 ? 290 LEU A CG   4  
ATOM   8673  C  CD1  . LEU A 1 136 ? -14.743 10.448  -13.046 1.00 0.00 ? 290 LEU A CD1  4  
ATOM   8674  C  CD2  . LEU A 1 136 ? -16.943 11.075  -12.045 1.00 0.00 ? 290 LEU A CD2  4  
ATOM   8675  H  H    . LEU A 1 136 ? -13.796 14.547  -10.683 1.00 0.00 ? 290 LEU A H    4  
ATOM   8676  H  HA   . LEU A 1 136 ? -15.277 14.223  -13.113 1.00 0.00 ? 290 LEU A HA   4  
ATOM   8677  H  HB2  . LEU A 1 136 ? -13.897 12.490  -11.883 1.00 0.00 ? 290 LEU A HB2  4  
ATOM   8678  H  HB3  . LEU A 1 136 ? -15.230 12.331  -10.739 1.00 0.00 ? 290 LEU A HB3  4  
ATOM   8679  H  HG   . LEU A 1 136 ? -15.937 12.137  -13.620 1.00 0.00 ? 290 LEU A HG   4  
ATOM   8680  H  HD11 . LEU A 1 136 ? -14.164 10.691  -13.925 1.00 0.00 ? 290 LEU A HD11 4  
ATOM   8681  H  HD12 . LEU A 1 136 ? -15.330 9.560   -13.235 1.00 0.00 ? 290 LEU A HD12 4  
ATOM   8682  H  HD13 . LEU A 1 136 ? -14.078 10.269  -12.215 1.00 0.00 ? 290 LEU A HD13 4  
ATOM   8683  H  HD21 . LEU A 1 136 ? -17.662 11.874  -11.940 1.00 0.00 ? 290 LEU A HD21 4  
ATOM   8684  H  HD22 . LEU A 1 136 ? -16.698 10.682  -11.069 1.00 0.00 ? 290 LEU A HD22 4  
ATOM   8685  H  HD23 . LEU A 1 136 ? -17.364 10.290  -12.654 1.00 0.00 ? 290 LEU A HD23 4  
ATOM   8686  N  N    . LEU A 1 137 ? -17.140 14.404  -10.383 1.00 0.00 ? 291 LEU A N    4  
ATOM   8687  C  CA   . LEU A 1 137 ? -18.569 14.615  -9.945  1.00 0.00 ? 291 LEU A CA   4  
ATOM   8688  C  C    . LEU A 1 137 ? -19.177 15.843  -10.651 1.00 0.00 ? 291 LEU A C    4  
ATOM   8689  O  O    . LEU A 1 137 ? -20.358 15.865  -10.940 1.00 0.00 ? 291 LEU A O    4  
ATOM   8690  C  CB   . LEU A 1 137 ? -18.537 14.846  -8.426  1.00 0.00 ? 291 LEU A CB   4  
ATOM   8691  C  CG   . LEU A 1 137 ? -19.907 14.517  -7.830  1.00 0.00 ? 291 LEU A CG   4  
ATOM   8692  C  CD1  . LEU A 1 137 ? -19.996 13.016  -7.550  1.00 0.00 ? 291 LEU A CD1  4  
ATOM   8693  C  CD2  . LEU A 1 137 ? -20.090 15.290  -6.522  1.00 0.00 ? 291 LEU A CD2  4  
ATOM   8694  H  H    . LEU A 1 137 ? -16.410 14.398  -9.721  1.00 0.00 ? 291 LEU A H    4  
ATOM   8695  H  HA   . LEU A 1 137 ? -19.155 13.736  -10.167 1.00 0.00 ? 291 LEU A HA   4  
ATOM   8696  H  HB2  . LEU A 1 137 ? -17.787 14.208  -7.981  1.00 0.00 ? 291 LEU A HB2  4  
ATOM   8697  H  HB3  . LEU A 1 137 ? -18.297 15.879  -8.223  1.00 0.00 ? 291 LEU A HB3  4  
ATOM   8698  H  HG   . LEU A 1 137 ? -20.680 14.800  -8.529  1.00 0.00 ? 291 LEU A HG   4  
ATOM   8699  H  HD11 . LEU A 1 137 ? -21.016 12.686  -7.679  1.00 0.00 ? 291 LEU A HD11 4  
ATOM   8700  H  HD12 . LEU A 1 137 ? -19.679 12.820  -6.536  1.00 0.00 ? 291 LEU A HD12 4  
ATOM   8701  H  HD13 . LEU A 1 137 ? -19.355 12.483  -8.237  1.00 0.00 ? 291 LEU A HD13 4  
ATOM   8702  H  HD21 . LEU A 1 137 ? -19.128 15.444  -6.056  1.00 0.00 ? 291 LEU A HD21 4  
ATOM   8703  H  HD22 . LEU A 1 137 ? -20.727 14.725  -5.856  1.00 0.00 ? 291 LEU A HD22 4  
ATOM   8704  H  HD23 . LEU A 1 137 ? -20.547 16.247  -6.730  1.00 0.00 ? 291 LEU A HD23 4  
ATOM   8705  N  N    . GLN A 1 138 ? -18.389 16.865  -10.929 1.00 0.00 ? 292 GLN A N    4  
ATOM   8706  C  CA   . GLN A 1 138 ? -18.954 18.080  -11.614 1.00 0.00 ? 292 GLN A CA   4  
ATOM   8707  C  C    . GLN A 1 138 ? -18.715 18.025  -13.136 1.00 0.00 ? 292 GLN A C    4  
ATOM   8708  O  O    . GLN A 1 138 ? -19.519 18.527  -13.899 1.00 0.00 ? 292 GLN A O    4  
ATOM   8709  C  CB   . GLN A 1 138 ? -18.225 19.284  -11.005 1.00 0.00 ? 292 GLN A CB   4  
ATOM   8710  C  CG   . GLN A 1 138 ? -18.953 19.737  -9.738  1.00 0.00 ? 292 GLN A CG   4  
ATOM   8711  C  CD   . GLN A 1 138 ? -18.254 20.976  -9.161  1.00 0.00 ? 292 GLN A CD   4  
ATOM   8712  O  OE1  . GLN A 1 138 ? -17.684 21.757  -9.897  1.00 0.00 ? 292 GLN A OE1  4  
ATOM   8713  N  NE2  . GLN A 1 138 ? -18.268 21.193  -7.869  1.00 0.00 ? 292 GLN A NE2  4  
ATOM   8714  H  H    . GLN A 1 138 ? -17.434 16.836  -10.688 1.00 0.00 ? 292 GLN A H    4  
ATOM   8715  H  HA   . GLN A 1 138 ? -20.010 18.157  -11.410 1.00 0.00 ? 292 GLN A HA   4  
ATOM   8716  H  HB2  . GLN A 1 138 ? -17.211 19.003  -10.758 1.00 0.00 ? 292 GLN A HB2  4  
ATOM   8717  H  HB3  . GLN A 1 138 ? -18.209 20.094  -11.719 1.00 0.00 ? 292 GLN A HB3  4  
ATOM   8718  H  HG2  . GLN A 1 138 ? -19.978 19.982  -9.981  1.00 0.00 ? 292 GLN A HG2  4  
ATOM   8719  H  HG3  . GLN A 1 138 ? -18.934 18.944  -9.008  1.00 0.00 ? 292 GLN A HG3  4  
ATOM   8720  H  HE21 . GLN A 1 138 ? -18.725 20.567  -7.264  1.00 0.00 ? 292 GLN A HE21 4  
ATOM   8721  H  HE22 . GLN A 1 138 ? -17.821 21.983  -7.503  1.00 0.00 ? 292 GLN A HE22 4  
ATOM   8722  N  N    . GLN A 1 139 ? -17.627 17.430  -13.591 1.00 0.00 ? 293 GLN A N    4  
ATOM   8723  C  CA   . GLN A 1 139 ? -17.376 17.372  -15.069 1.00 0.00 ? 293 GLN A CA   4  
ATOM   8724  C  C    . GLN A 1 139 ? -17.762 15.990  -15.627 1.00 0.00 ? 293 GLN A C    4  
ATOM   8725  O  O    . GLN A 1 139 ? -16.926 15.270  -16.142 1.00 0.00 ? 293 GLN A O    4  
ATOM   8726  C  CB   . GLN A 1 139 ? -15.872 17.627  -15.247 1.00 0.00 ? 293 GLN A CB   4  
ATOM   8727  C  CG   . GLN A 1 139 ? -15.522 17.652  -16.742 1.00 0.00 ? 293 GLN A CG   4  
ATOM   8728  C  CD   . GLN A 1 139 ? -15.229 19.092  -17.185 1.00 0.00 ? 293 GLN A CD   4  
ATOM   8729  O  OE1  . GLN A 1 139 ? -14.226 19.347  -17.821 1.00 0.00 ? 293 GLN A OE1  4  
ATOM   8730  N  NE2  . GLN A 1 139 ? -16.065 20.054  -16.879 1.00 0.00 ? 293 GLN A NE2  4  
ATOM   8731  H  H    . GLN A 1 139 ? -16.981 17.027  -12.967 1.00 0.00 ? 293 GLN A H    4  
ATOM   8732  H  HA   . GLN A 1 139 ? -17.938 18.142  -15.571 1.00 0.00 ? 293 GLN A HA   4  
ATOM   8733  H  HB2  . GLN A 1 139 ? -15.614 18.575  -14.798 1.00 0.00 ? 293 GLN A HB2  4  
ATOM   8734  H  HB3  . GLN A 1 139 ? -15.315 16.838  -14.764 1.00 0.00 ? 293 GLN A HB3  4  
ATOM   8735  H  HG2  . GLN A 1 139 ? -14.648 17.039  -16.914 1.00 0.00 ? 293 GLN A HG2  4  
ATOM   8736  H  HG3  . GLN A 1 139 ? -16.350 17.262  -17.316 1.00 0.00 ? 293 GLN A HG3  4  
ATOM   8737  H  HE21 . GLN A 1 139 ? -16.880 19.861  -16.366 1.00 0.00 ? 293 GLN A HE21 4  
ATOM   8738  H  HE22 . GLN A 1 139 ? -15.876 20.973  -17.163 1.00 0.00 ? 293 GLN A HE22 4  
ATOM   8739  N  N    . ASN A 1 140 ? -19.023 15.615  -15.538 1.00 0.00 ? 294 ASN A N    4  
ATOM   8740  C  CA   . ASN A 1 140 ? -19.450 14.286  -16.072 1.00 0.00 ? 294 ASN A CA   4  
ATOM   8741  C  C    . ASN A 1 140 ? -20.815 14.411  -16.771 1.00 0.00 ? 294 ASN A C    4  
ATOM   8742  O  O    . ASN A 1 140 ? -21.847 14.240  -16.150 1.00 0.00 ? 294 ASN A O    4  
ATOM   8743  C  CB   . ASN A 1 140 ? -19.553 13.377  -14.847 1.00 0.00 ? 294 ASN A CB   4  
ATOM   8744  C  CG   . ASN A 1 140 ? -19.957 11.963  -15.285 1.00 0.00 ? 294 ASN A CG   4  
ATOM   8745  O  OD1  . ASN A 1 140 ? -19.107 11.126  -15.518 1.00 0.00 ? 294 ASN A OD1  4  
ATOM   8746  N  ND2  . ASN A 1 140 ? -21.225 11.654  -15.410 1.00 0.00 ? 294 ASN A ND2  4  
ATOM   8747  H  H    . ASN A 1 140 ? -19.690 16.207  -15.124 1.00 0.00 ? 294 ASN A H    4  
ATOM   8748  H  HA   . ASN A 1 140 ? -18.710 13.900  -16.756 1.00 0.00 ? 294 ASN A HA   4  
ATOM   8749  H  HB2  . ASN A 1 140 ? -18.596 13.338  -14.349 1.00 0.00 ? 294 ASN A HB2  4  
ATOM   8750  H  HB3  . ASN A 1 140 ? -20.297 13.767  -14.169 1.00 0.00 ? 294 ASN A HB3  4  
ATOM   8751  H  HD21 . ASN A 1 140 ? -21.920 12.321  -15.223 1.00 0.00 ? 294 ASN A HD21 4  
ATOM   8752  H  HD22 . ASN A 1 140 ? -21.480 10.750  -15.690 1.00 0.00 ? 294 ASN A HD22 4  
ATOM   8753  N  N    . LYS A 1 141 ? -20.830 14.708  -18.055 1.00 0.00 ? 295 LYS A N    4  
ATOM   8754  C  CA   . LYS A 1 141 ? -22.132 14.840  -18.777 1.00 0.00 ? 295 LYS A CA   4  
ATOM   8755  C  C    . LYS A 1 141 ? -22.160 13.906  -19.997 1.00 0.00 ? 295 LYS A C    4  
ATOM   8756  O  O    . LYS A 1 141 ? -21.668 14.250  -21.055 1.00 0.00 ? 295 LYS A O    4  
ATOM   8757  C  CB   . LYS A 1 141 ? -22.191 16.302  -19.222 1.00 0.00 ? 295 LYS A CB   4  
ATOM   8758  C  CG   . LYS A 1 141 ? -22.225 17.209  -17.990 1.00 0.00 ? 295 LYS A CG   4  
ATOM   8759  C  CD   . LYS A 1 141 ? -22.617 18.627  -18.411 1.00 0.00 ? 295 LYS A CD   4  
ATOM   8760  C  CE   . LYS A 1 141 ? -23.426 19.287  -17.293 1.00 0.00 ? 295 LYS A CE   4  
ATOM   8761  N  NZ   . LYS A 1 141 ? -24.812 18.766  -17.462 1.00 0.00 ? 295 LYS A NZ   4  
ATOM   8762  H  H    . LYS A 1 141 ? -19.989 14.844  -18.545 1.00 0.00 ? 295 LYS A H    4  
ATOM   8763  H  HA   . LYS A 1 141 ? -22.955 14.622  -18.115 1.00 0.00 ? 295 LYS A HA   4  
ATOM   8764  H  HB2  . LYS A 1 141 ? -21.318 16.533  -19.815 1.00 0.00 ? 295 LYS A HB2  4  
ATOM   8765  H  HB3  . LYS A 1 141 ? -23.081 16.464  -19.810 1.00 0.00 ? 295 LYS A HB3  4  
ATOM   8766  H  HG2  . LYS A 1 141 ? -22.949 16.829  -17.284 1.00 0.00 ? 295 LYS A HG2  4  
ATOM   8767  H  HG3  . LYS A 1 141 ? -21.248 17.229  -17.529 1.00 0.00 ? 295 LYS A HG3  4  
ATOM   8768  H  HD2  . LYS A 1 141 ? -21.724 19.205  -18.599 1.00 0.00 ? 295 LYS A HD2  4  
ATOM   8769  H  HD3  . LYS A 1 141 ? -23.215 18.584  -19.309 1.00 0.00 ? 295 LYS A HD3  4  
ATOM   8770  H  HE2  . LYS A 1 141 ? -23.031 19.005  -16.327 1.00 0.00 ? 295 LYS A HE2  4  
ATOM   8771  H  HE3  . LYS A 1 141 ? -23.419 20.360  -17.405 1.00 0.00 ? 295 LYS A HE3  4  
ATOM   8772  H  HZ1  . LYS A 1 141 ? -24.810 17.733  -17.346 1.00 0.00 ? 295 LYS A HZ1  4  
ATOM   8773  H  HZ2  . LYS A 1 141 ? -25.158 19.008  -18.414 1.00 0.00 ? 295 LYS A HZ2  4  
ATOM   8774  H  HZ3  . LYS A 1 141 ? -25.433 19.192  -16.748 1.00 0.00 ? 295 LYS A HZ3  4  
ATOM   8775  N  N    . LYS A 1 142 ? -22.733 12.722  -19.865 1.00 0.00 ? 296 LYS A N    4  
ATOM   8776  C  CA   . LYS A 1 142 ? -22.791 11.767  -21.022 1.00 0.00 ? 296 LYS A CA   4  
ATOM   8777  C  C    . LYS A 1 142 ? -21.394 11.545  -21.615 1.00 0.00 ? 296 LYS A C    4  
ATOM   8778  O  O    . LYS A 1 142 ? -21.008 12.315  -22.479 1.00 0.00 ? 296 LYS A O    4  
ATOM   8779  C  CB   . LYS A 1 142 ? -23.714 12.430  -22.051 1.00 0.00 ? 296 LYS A CB   4  
ATOM   8780  C  CG   . LYS A 1 142 ? -24.110 11.405  -23.116 1.00 0.00 ? 296 LYS A CG   4  
ATOM   8781  C  CD   . LYS A 1 142 ? -23.046 11.371  -24.214 1.00 0.00 ? 296 LYS A CD   4  
ATOM   8782  C  CE   . LYS A 1 142 ? -23.642 10.761  -25.485 1.00 0.00 ? 296 LYS A CE   4  
ATOM   8783  N  NZ   . LYS A 1 142 ? -22.649 11.055  -26.555 1.00 0.00 ? 296 LYS A NZ   4  
ATOM   8784  O  OXT  . LYS A 1 142 ? -20.735 10.608  -21.193 1.00 0.00 ? 296 LYS A OXT  4  
ATOM   8785  H  H    . LYS A 1 142 ? -23.127 12.457  -19.005 1.00 0.00 ? 296 LYS A H    4  
ATOM   8786  H  HA   . LYS A 1 142 ? -23.214 10.827  -20.707 1.00 0.00 ? 296 LYS A HA   4  
ATOM   8787  H  HB2  . LYS A 1 142 ? -24.600 12.796  -21.555 1.00 0.00 ? 296 LYS A HB2  4  
ATOM   8788  H  HB3  . LYS A 1 142 ? -23.196 13.252  -22.521 1.00 0.00 ? 296 LYS A HB3  4  
ATOM   8789  H  HG2  . LYS A 1 142 ? -24.193 10.428  -22.663 1.00 0.00 ? 296 LYS A HG2  4  
ATOM   8790  H  HG3  . LYS A 1 142 ? -25.061 11.683  -23.547 1.00 0.00 ? 296 LYS A HG3  4  
ATOM   8791  H  HD2  . LYS A 1 142 ? -22.710 12.377  -24.420 1.00 0.00 ? 296 LYS A HD2  4  
ATOM   8792  H  HD3  . LYS A 1 142 ? -22.210 10.771  -23.888 1.00 0.00 ? 296 LYS A HD3  4  
ATOM   8793  H  HE2  . LYS A 1 142 ? -23.766 9.693   -25.366 1.00 0.00 ? 296 LYS A HE2  4  
ATOM   8794  H  HE3  . LYS A 1 142 ? -24.586 11.228  -25.720 1.00 0.00 ? 296 LYS A HE3  4  
ATOM   8795  H  HZ1  . LYS A 1 142 ? -21.707 10.738  -26.251 1.00 0.00 ? 296 LYS A HZ1  4  
ATOM   8796  H  HZ2  . LYS A 1 142 ? -22.629 12.079  -26.738 1.00 0.00 ? 296 LYS A HZ2  4  
ATOM   8797  H  HZ3  . LYS A 1 142 ? -22.916 10.552  -27.425 1.00 0.00 ? 296 LYS A HZ3  4  
HETATM 8798  ZN ZN   . ZN  B 2 .   ? -5.021  -2.904  -5.405  1.00 0.00 ? 1   ZN  A ZN   4  
HETATM 8799  ZN ZN   . ZN  C 2 .   ? 1.813   -7.003  -0.488  1.00 0.00 ? 2   ZN  A ZN   4  
HETATM 8800  ZN ZN   . ZN  D 2 .   ? 5.859   -1.939  11.518  1.00 0.00 ? 3   ZN  A ZN   4  
ATOM   8801  N  N    . GLY A 1 1   ? 19.025  -6.508  -6.932  1.00 0.00 ? 155 GLY A N    5  
ATOM   8802  C  CA   . GLY A 1 1   ? 17.980  -6.283  -7.970  1.00 0.00 ? 155 GLY A CA   5  
ATOM   8803  C  C    . GLY A 1 1   ? 17.929  -4.792  -8.334  1.00 0.00 ? 155 GLY A C    5  
ATOM   8804  O  O    . GLY A 1 1   ? 17.029  -4.084  -7.923  1.00 0.00 ? 155 GLY A O    5  
ATOM   8805  H  H1   . GLY A 1 1   ? 19.833  -5.879  -7.112  1.00 0.00 ? 155 GLY A H1   5  
ATOM   8806  H  H2   . GLY A 1 1   ? 19.341  -7.499  -6.969  1.00 0.00 ? 155 GLY A H2   5  
ATOM   8807  H  H3   . GLY A 1 1   ? 18.631  -6.304  -5.992  1.00 0.00 ? 155 GLY A H3   5  
ATOM   8808  H  HA2  . GLY A 1 1   ? 18.217  -6.862  -8.851  1.00 0.00 ? 155 GLY A HA2  5  
ATOM   8809  H  HA3  . GLY A 1 1   ? 17.019  -6.589  -7.586  1.00 0.00 ? 155 GLY A HA3  5  
ATOM   8810  N  N    . ALA A 1 2   ? 18.886  -4.306  -9.100  1.00 0.00 ? 156 ALA A N    5  
ATOM   8811  C  CA   . ALA A 1 2   ? 18.879  -2.862  -9.480  1.00 0.00 ? 156 ALA A CA   5  
ATOM   8812  C  C    . ALA A 1 2   ? 18.840  -2.716  -11.010 1.00 0.00 ? 156 ALA A C    5  
ATOM   8813  O  O    . ALA A 1 2   ? 19.693  -3.235  -11.705 1.00 0.00 ? 156 ALA A O    5  
ATOM   8814  C  CB   . ALA A 1 2   ? 20.185  -2.299  -8.921  1.00 0.00 ? 156 ALA A CB   5  
ATOM   8815  H  H    . ALA A 1 2   ? 19.608  -4.888  -9.425  1.00 0.00 ? 156 ALA A H    5  
ATOM   8816  H  HA   . ALA A 1 2   ? 18.037  -2.357  -9.031  1.00 0.00 ? 156 ALA A HA   5  
ATOM   8817  H  HB1  . ALA A 1 2   ? 20.978  -3.016  -9.068  1.00 0.00 ? 156 ALA A HB1  5  
ATOM   8818  H  HB2  . ALA A 1 2   ? 20.069  -2.102  -7.865  1.00 0.00 ? 156 ALA A HB2  5  
ATOM   8819  H  HB3  . ALA A 1 2   ? 20.431  -1.381  -9.434  1.00 0.00 ? 156 ALA A HB3  5  
ATOM   8820  N  N    . MET A 1 3   ? 17.859  -2.014  -11.542 1.00 0.00 ? 157 MET A N    5  
ATOM   8821  C  CA   . MET A 1 3   ? 17.780  -1.844  -13.025 1.00 0.00 ? 157 MET A CA   5  
ATOM   8822  C  C    . MET A 1 3   ? 17.557  -0.364  -13.377 1.00 0.00 ? 157 MET A C    5  
ATOM   8823  O  O    . MET A 1 3   ? 17.421  0.469   -12.501 1.00 0.00 ? 157 MET A O    5  
ATOM   8824  C  CB   . MET A 1 3   ? 16.576  -2.686  -13.455 1.00 0.00 ? 157 MET A CB   5  
ATOM   8825  C  CG   . MET A 1 3   ? 16.890  -3.391  -14.775 1.00 0.00 ? 157 MET A CG   5  
ATOM   8826  S  SD   . MET A 1 3   ? 15.752  -4.781  -15.002 1.00 0.00 ? 157 MET A SD   5  
ATOM   8827  C  CE   . MET A 1 3   ? 16.925  -6.101  -14.610 1.00 0.00 ? 157 MET A CE   5  
ATOM   8828  H  H    . MET A 1 3   ? 17.176  -1.599  -10.971 1.00 0.00 ? 157 MET A H    5  
ATOM   8829  H  HA   . MET A 1 3   ? 18.676  -2.214  -13.496 1.00 0.00 ? 157 MET A HA   5  
ATOM   8830  H  HB2  . MET A 1 3   ? 16.363  -3.422  -12.694 1.00 0.00 ? 157 MET A HB2  5  
ATOM   8831  H  HB3  . MET A 1 3   ? 15.717  -2.044  -13.587 1.00 0.00 ? 157 MET A HB3  5  
ATOM   8832  H  HG2  . MET A 1 3   ? 16.774  -2.695  -15.592 1.00 0.00 ? 157 MET A HG2  5  
ATOM   8833  H  HG3  . MET A 1 3   ? 17.906  -3.757  -14.755 1.00 0.00 ? 157 MET A HG3  5  
ATOM   8834  H  HE1  . MET A 1 3   ? 17.460  -6.384  -15.506 1.00 0.00 ? 157 MET A HE1  5  
ATOM   8835  H  HE2  . MET A 1 3   ? 16.393  -6.957  -14.226 1.00 0.00 ? 157 MET A HE2  5  
ATOM   8836  H  HE3  . MET A 1 3   ? 17.624  -5.751  -13.863 1.00 0.00 ? 157 MET A HE3  5  
ATOM   8837  N  N    . ALA A 1 4   ? 17.517  -0.028  -14.651 1.00 0.00 ? 158 ALA A N    5  
ATOM   8838  C  CA   . ALA A 1 4   ? 17.302  1.397   -15.042 1.00 0.00 ? 158 ALA A CA   5  
ATOM   8839  C  C    . ALA A 1 4   ? 15.983  1.541   -15.821 1.00 0.00 ? 158 ALA A C    5  
ATOM   8840  O  O    . ALA A 1 4   ? 15.983  1.864   -16.995 1.00 0.00 ? 158 ALA A O    5  
ATOM   8841  C  CB   . ALA A 1 4   ? 18.496  1.747   -15.933 1.00 0.00 ? 158 ALA A CB   5  
ATOM   8842  H  H    . ALA A 1 4   ? 17.627  -0.711  -15.351 1.00 0.00 ? 158 ALA A H    5  
ATOM   8843  H  HA   . ALA A 1 4   ? 17.295  2.029   -14.170 1.00 0.00 ? 158 ALA A HA   5  
ATOM   8844  H  HB1  . ALA A 1 4   ? 19.373  1.891   -15.317 1.00 0.00 ? 158 ALA A HB1  5  
ATOM   8845  H  HB2  . ALA A 1 4   ? 18.286  2.656   -16.477 1.00 0.00 ? 158 ALA A HB2  5  
ATOM   8846  H  HB3  . ALA A 1 4   ? 18.674  0.943   -16.631 1.00 0.00 ? 158 ALA A HB3  5  
ATOM   8847  N  N    . ASP A 1 5   ? 14.855  1.303   -15.179 1.00 0.00 ? 159 ASP A N    5  
ATOM   8848  C  CA   . ASP A 1 5   ? 13.548  1.429   -15.891 1.00 0.00 ? 159 ASP A CA   5  
ATOM   8849  C  C    . ASP A 1 5   ? 12.487  2.025   -14.952 1.00 0.00 ? 159 ASP A C    5  
ATOM   8850  O  O    . ASP A 1 5   ? 11.892  1.317   -14.160 1.00 0.00 ? 159 ASP A O    5  
ATOM   8851  C  CB   . ASP A 1 5   ? 13.173  0.001   -16.287 1.00 0.00 ? 159 ASP A CB   5  
ATOM   8852  C  CG   . ASP A 1 5   ? 14.114  -0.487  -17.391 1.00 0.00 ? 159 ASP A CG   5  
ATOM   8853  O  OD1  . ASP A 1 5   ? 14.296  0.243   -18.351 1.00 0.00 ? 159 ASP A OD1  5  
ATOM   8854  O  OD2  . ASP A 1 5   ? 14.634  -1.582  -17.256 1.00 0.00 ? 159 ASP A OD2  5  
ATOM   8855  H  H    . ASP A 1 5   ? 14.867  1.043   -14.232 1.00 0.00 ? 159 ASP A H    5  
ATOM   8856  H  HA   . ASP A 1 5   ? 13.656  2.040   -16.774 1.00 0.00 ? 159 ASP A HA   5  
ATOM   8857  H  HB2  . ASP A 1 5   ? 13.262  -0.645  -15.425 1.00 0.00 ? 159 ASP A HB2  5  
ATOM   8858  H  HB3  . ASP A 1 5   ? 12.156  -0.018  -16.648 1.00 0.00 ? 159 ASP A HB3  5  
ATOM   8859  N  N    . LYS A 1 6   ? 12.242  3.317   -15.031 1.00 0.00 ? 160 LYS A N    5  
ATOM   8860  C  CA   . LYS A 1 6   ? 11.219  3.942   -14.138 1.00 0.00 ? 160 LYS A CA   5  
ATOM   8861  C  C    . LYS A 1 6   ? 10.304  4.873   -14.949 1.00 0.00 ? 160 LYS A C    5  
ATOM   8862  O  O    . LYS A 1 6   ? 10.533  5.100   -16.122 1.00 0.00 ? 160 LYS A O    5  
ATOM   8863  C  CB   . LYS A 1 6   ? 12.024  4.740   -13.112 1.00 0.00 ? 160 LYS A CB   5  
ATOM   8864  C  CG   . LYS A 1 6   ? 12.516  3.804   -12.007 1.00 0.00 ? 160 LYS A CG   5  
ATOM   8865  C  CD   . LYS A 1 6   ? 12.763  4.608   -10.729 1.00 0.00 ? 160 LYS A CD   5  
ATOM   8866  C  CE   . LYS A 1 6   ? 14.231  5.037   -10.672 1.00 0.00 ? 160 LYS A CE   5  
ATOM   8867  N  NZ   . LYS A 1 6   ? 14.904  3.994   -9.849  1.00 0.00 ? 160 LYS A NZ   5  
ATOM   8868  H  H    . LYS A 1 6   ? 12.729  3.879   -15.675 1.00 0.00 ? 160 LYS A H    5  
ATOM   8869  H  HA   . LYS A 1 6   ? 10.639  3.181   -13.641 1.00 0.00 ? 160 LYS A HA   5  
ATOM   8870  H  HB2  . LYS A 1 6   ? 12.871  5.200   -13.599 1.00 0.00 ? 160 LYS A HB2  5  
ATOM   8871  H  HB3  . LYS A 1 6   ? 11.397  5.506   -12.680 1.00 0.00 ? 160 LYS A HB3  5  
ATOM   8872  H  HG2  . LYS A 1 6   ? 11.767  3.047   -11.818 1.00 0.00 ? 160 LYS A HG2  5  
ATOM   8873  H  HG3  . LYS A 1 6   ? 13.435  3.332   -12.317 1.00 0.00 ? 160 LYS A HG3  5  
ATOM   8874  H  HD2  . LYS A 1 6   ? 12.130  5.484   -10.726 1.00 0.00 ? 160 LYS A HD2  5  
ATOM   8875  H  HD3  . LYS A 1 6   ? 12.535  3.996   -9.869  1.00 0.00 ? 160 LYS A HD3  5  
ATOM   8876  H  HE2  . LYS A 1 6   ? 14.652  5.066   -11.668 1.00 0.00 ? 160 LYS A HE2  5  
ATOM   8877  H  HE3  . LYS A 1 6   ? 14.323  6.001   -10.194 1.00 0.00 ? 160 LYS A HE3  5  
ATOM   8878  H  HZ1  . LYS A 1 6   ? 15.877  4.293   -9.638  1.00 0.00 ? 160 LYS A HZ1  5  
ATOM   8879  H  HZ2  . LYS A 1 6   ? 14.923  3.097   -10.376 1.00 0.00 ? 160 LYS A HZ2  5  
ATOM   8880  H  HZ3  . LYS A 1 6   ? 14.384  3.864   -8.959  1.00 0.00 ? 160 LYS A HZ3  5  
ATOM   8881  N  N    . ARG A 1 7   ? 9.270   5.414   -14.337 1.00 0.00 ? 161 ARG A N    5  
ATOM   8882  C  CA   . ARG A 1 7   ? 8.351   6.326   -15.084 1.00 0.00 ? 161 ARG A CA   5  
ATOM   8883  C  C    . ARG A 1 7   ? 7.993   7.544   -14.218 1.00 0.00 ? 161 ARG A C    5  
ATOM   8884  O  O    . ARG A 1 7   ? 7.161   7.455   -13.334 1.00 0.00 ? 161 ARG A O    5  
ATOM   8885  C  CB   . ARG A 1 7   ? 7.106   5.486   -15.369 1.00 0.00 ? 161 ARG A CB   5  
ATOM   8886  C  CG   . ARG A 1 7   ? 6.420   6.003   -16.635 1.00 0.00 ? 161 ARG A CG   5  
ATOM   8887  C  CD   . ARG A 1 7   ? 4.966   5.525   -16.660 1.00 0.00 ? 161 ARG A CD   5  
ATOM   8888  N  NE   . ARG A 1 7   ? 4.181   6.648   -16.059 1.00 0.00 ? 161 ARG A NE   5  
ATOM   8889  C  CZ   . ARG A 1 7   ? 3.931   7.755   -16.743 1.00 0.00 ? 161 ARG A CZ   5  
ATOM   8890  N  NH1  . ARG A 1 7   ? 4.361   7.912   -17.975 1.00 0.00 ? 161 ARG A NH1  5  
ATOM   8891  N  NH2  . ARG A 1 7   ? 3.241   8.716   -16.185 1.00 0.00 ? 161 ARG A NH2  5  
ATOM   8892  H  H    . ARG A 1 7   ? 9.095   5.223   -13.389 1.00 0.00 ? 161 ARG A H    5  
ATOM   8893  H  HA   . ARG A 1 7   ? 8.804   6.641   -16.010 1.00 0.00 ? 161 ARG A HA   5  
ATOM   8894  H  HB2  . ARG A 1 7   ? 7.392   4.454   -15.509 1.00 0.00 ? 161 ARG A HB2  5  
ATOM   8895  H  HB3  . ARG A 1 7   ? 6.422   5.560   -14.536 1.00 0.00 ? 161 ARG A HB3  5  
ATOM   8896  H  HG2  . ARG A 1 7   ? 6.446   7.083   -16.643 1.00 0.00 ? 161 ARG A HG2  5  
ATOM   8897  H  HG3  . ARG A 1 7   ? 6.936   5.624   -17.505 1.00 0.00 ? 161 ARG A HG3  5  
ATOM   8898  H  HD2  . ARG A 1 7   ? 4.649   5.344   -17.678 1.00 0.00 ? 161 ARG A HD2  5  
ATOM   8899  H  HD3  . ARG A 1 7   ? 4.851   4.634   -16.063 1.00 0.00 ? 161 ARG A HD3  5  
ATOM   8900  H  HE   . ARG A 1 7   ? 3.847   6.558   -15.141 1.00 0.00 ? 161 ARG A HE   5  
ATOM   8901  H  HH11 . ARG A 1 7   ? 4.889   7.193   -18.422 1.00 0.00 ? 161 ARG A HH11 5  
ATOM   8902  H  HH12 . ARG A 1 7   ? 4.157   8.758   -18.466 1.00 0.00 ? 161 ARG A HH12 5  
ATOM   8903  H  HH21 . ARG A 1 7   ? 2.906   8.612   -15.248 1.00 0.00 ? 161 ARG A HH21 5  
ATOM   8904  H  HH22 . ARG A 1 7   ? 3.048   9.554   -16.694 1.00 0.00 ? 161 ARG A HH22 5  
ATOM   8905  N  N    . GLY A 1 8   ? 8.610   8.683   -14.463 1.00 0.00 ? 162 GLY A N    5  
ATOM   8906  C  CA   . GLY A 1 8   ? 8.296   9.895   -13.648 1.00 0.00 ? 162 GLY A CA   5  
ATOM   8907  C  C    . GLY A 1 8   ? 7.815   11.023  -14.572 1.00 0.00 ? 162 GLY A C    5  
ATOM   8908  O  O    . GLY A 1 8   ? 8.614   11.765  -15.113 1.00 0.00 ? 162 GLY A O    5  
ATOM   8909  H  H    . GLY A 1 8   ? 9.280   8.742   -15.180 1.00 0.00 ? 162 GLY A H    5  
ATOM   8910  H  HA2  . GLY A 1 8   ? 7.521   9.656   -12.934 1.00 0.00 ? 162 GLY A HA2  5  
ATOM   8911  H  HA3  . GLY A 1 8   ? 9.184   10.216  -13.125 1.00 0.00 ? 162 GLY A HA3  5  
ATOM   8912  N  N    . ASP A 1 9   ? 6.518   11.162  -14.761 1.00 0.00 ? 163 ASP A N    5  
ATOM   8913  C  CA   . ASP A 1 9   ? 6.003   12.245  -15.651 1.00 0.00 ? 163 ASP A CA   5  
ATOM   8914  C  C    . ASP A 1 9   ? 4.747   12.884  -15.037 1.00 0.00 ? 163 ASP A C    5  
ATOM   8915  O  O    . ASP A 1 9   ? 3.739   13.036  -15.702 1.00 0.00 ? 163 ASP A O    5  
ATOM   8916  C  CB   . ASP A 1 9   ? 5.662   11.546  -16.968 1.00 0.00 ? 163 ASP A CB   5  
ATOM   8917  C  CG   . ASP A 1 9   ? 5.856   12.522  -18.130 1.00 0.00 ? 163 ASP A CG   5  
ATOM   8918  O  OD1  . ASP A 1 9   ? 5.183   13.539  -18.141 1.00 0.00 ? 163 ASP A OD1  5  
ATOM   8919  O  OD2  . ASP A 1 9   ? 6.675   12.236  -18.988 1.00 0.00 ? 163 ASP A OD2  5  
ATOM   8920  H  H    . ASP A 1 9   ? 5.883   10.556  -14.319 1.00 0.00 ? 163 ASP A H    5  
ATOM   8921  H  HA   . ASP A 1 9   ? 6.764   12.991  -15.815 1.00 0.00 ? 163 ASP A HA   5  
ATOM   8922  H  HB2  . ASP A 1 9   ? 6.311   10.693  -17.100 1.00 0.00 ? 163 ASP A HB2  5  
ATOM   8923  H  HB3  . ASP A 1 9   ? 4.635   11.216  -16.945 1.00 0.00 ? 163 ASP A HB3  5  
ATOM   8924  N  N    . GLY A 1 10  ? 4.793   13.260  -13.775 1.00 0.00 ? 164 GLY A N    5  
ATOM   8925  C  CA   . GLY A 1 10  ? 3.599   13.886  -13.135 1.00 0.00 ? 164 GLY A CA   5  
ATOM   8926  C  C    . GLY A 1 10  ? 2.537   12.809  -12.869 1.00 0.00 ? 164 GLY A C    5  
ATOM   8927  O  O    . GLY A 1 10  ? 2.514   11.785  -13.525 1.00 0.00 ? 164 GLY A O    5  
ATOM   8928  H  H    . GLY A 1 10  ? 5.613   13.132  -13.248 1.00 0.00 ? 164 GLY A H    5  
ATOM   8929  H  HA2  . GLY A 1 10  ? 3.891   14.345  -12.201 1.00 0.00 ? 164 GLY A HA2  5  
ATOM   8930  H  HA3  . GLY A 1 10  ? 3.188   14.636  -13.793 1.00 0.00 ? 164 GLY A HA3  5  
ATOM   8931  N  N    . LEU A 1 11  ? 1.656   13.028  -11.913 1.00 0.00 ? 165 LEU A N    5  
ATOM   8932  C  CA   . LEU A 1 11  ? 0.604   12.010  -11.617 1.00 0.00 ? 165 LEU A CA   5  
ATOM   8933  C  C    . LEU A 1 11  ? -0.792  12.653  -11.685 1.00 0.00 ? 165 LEU A C    5  
ATOM   8934  O  O    . LEU A 1 11  ? -1.458  12.807  -10.678 1.00 0.00 ? 165 LEU A O    5  
ATOM   8935  C  CB   . LEU A 1 11  ? 0.909   11.527  -10.198 1.00 0.00 ? 165 LEU A CB   5  
ATOM   8936  C  CG   . LEU A 1 11  ? 1.847   10.321  -10.259 1.00 0.00 ? 165 LEU A CG   5  
ATOM   8937  C  CD1  . LEU A 1 11  ? 3.295   10.804  -10.343 1.00 0.00 ? 165 LEU A CD1  5  
ATOM   8938  C  CD2  . LEU A 1 11  ? 1.666   9.471   -9.000  1.00 0.00 ? 165 LEU A CD2  5  
ATOM   8939  H  H    . LEU A 1 11  ? 1.684   13.859  -11.390 1.00 0.00 ? 165 LEU A H    5  
ATOM   8940  H  HA   . LEU A 1 11  ? 0.673   11.186  -12.310 1.00 0.00 ? 165 LEU A HA   5  
ATOM   8941  H  HB2  . LEU A 1 11  ? 1.381   12.323  -9.641  1.00 0.00 ? 165 LEU A HB2  5  
ATOM   8942  H  HB3  . LEU A 1 11  ? -0.010  11.242  -9.709  1.00 0.00 ? 165 LEU A HB3  5  
ATOM   8943  H  HG   . LEU A 1 11  ? 1.614   9.729   -11.133 1.00 0.00 ? 165 LEU A HG   5  
ATOM   8944  H  HD11 . LEU A 1 11  ? 3.418   11.681  -9.725  1.00 0.00 ? 165 LEU A HD11 5  
ATOM   8945  H  HD12 . LEU A 1 11  ? 3.535   11.048  -11.367 1.00 0.00 ? 165 LEU A HD12 5  
ATOM   8946  H  HD13 . LEU A 1 11  ? 3.956   10.024  -9.995  1.00 0.00 ? 165 LEU A HD13 5  
ATOM   8947  H  HD21 . LEU A 1 11  ? 1.840   8.432   -9.238  1.00 0.00 ? 165 LEU A HD21 5  
ATOM   8948  H  HD22 . LEU A 1 11  ? 0.658   9.590   -8.626  1.00 0.00 ? 165 LEU A HD22 5  
ATOM   8949  H  HD23 . LEU A 1 11  ? 2.369   9.791   -8.245  1.00 0.00 ? 165 LEU A HD23 5  
ATOM   8950  N  N    . HIS A 1 12  ? -1.244  13.031  -12.865 1.00 0.00 ? 166 HIS A N    5  
ATOM   8951  C  CA   . HIS A 1 12  ? -2.593  13.660  -12.984 1.00 0.00 ? 166 HIS A CA   5  
ATOM   8952  C  C    . HIS A 1 12  ? -3.297  13.165  -14.256 1.00 0.00 ? 166 HIS A C    5  
ATOM   8953  O  O    . HIS A 1 12  ? -2.967  13.583  -15.351 1.00 0.00 ? 166 HIS A O    5  
ATOM   8954  C  CB   . HIS A 1 12  ? -2.324  15.162  -13.068 1.00 0.00 ? 166 HIS A CB   5  
ATOM   8955  C  CG   . HIS A 1 12  ? -3.623  15.911  -12.952 1.00 0.00 ? 166 HIS A CG   5  
ATOM   8956  N  ND1  . HIS A 1 12  ? -4.101  16.378  -11.739 1.00 0.00 ? 166 HIS A ND1  5  
ATOM   8957  C  CD2  . HIS A 1 12  ? -4.555  16.282  -13.890 1.00 0.00 ? 166 HIS A CD2  5  
ATOM   8958  C  CE1  . HIS A 1 12  ? -5.272  16.998  -11.974 1.00 0.00 ? 166 HIS A CE1  5  
ATOM   8959  N  NE2  . HIS A 1 12  ? -5.595  16.968  -13.271 1.00 0.00 ? 166 HIS A NE2  5  
ATOM   8960  H  H    . HIS A 1 12  ? -0.698  12.901  -13.672 1.00 0.00 ? 166 HIS A H    5  
ATOM   8961  H  HA   . HIS A 1 12  ? -3.189  13.439  -12.113 1.00 0.00 ? 166 HIS A HA   5  
ATOM   8962  H  HB2  . HIS A 1 12  ? -1.666  15.456  -12.264 1.00 0.00 ? 166 HIS A HB2  5  
ATOM   8963  H  HB3  . HIS A 1 12  ? -1.860  15.392  -14.016 1.00 0.00 ? 166 HIS A HB3  5  
ATOM   8964  H  HD1  . HIS A 1 12  ? -3.665  16.275  -10.866 1.00 0.00 ? 166 HIS A HD1  5  
ATOM   8965  H  HD2  . HIS A 1 12  ? -4.491  16.073  -14.948 1.00 0.00 ? 166 HIS A HD2  5  
ATOM   8966  H  HE1  . HIS A 1 12  ? -5.876  17.463  -11.210 1.00 0.00 ? 166 HIS A HE1  5  
ATOM   8967  N  N    . GLY A 1 13  ? -4.265  12.280  -14.128 1.00 0.00 ? 167 GLY A N    5  
ATOM   8968  C  CA   . GLY A 1 13  ? -4.979  11.770  -15.336 1.00 0.00 ? 167 GLY A CA   5  
ATOM   8969  C  C    . GLY A 1 13  ? -5.192  10.255  -15.207 1.00 0.00 ? 167 GLY A C    5  
ATOM   8970  O  O    . GLY A 1 13  ? -6.245  9.746   -15.547 1.00 0.00 ? 167 GLY A O    5  
ATOM   8971  H  H    . GLY A 1 13  ? -4.523  11.949  -13.239 1.00 0.00 ? 167 GLY A H    5  
ATOM   8972  H  HA2  . GLY A 1 13  ? -5.936  12.264  -15.423 1.00 0.00 ? 167 GLY A HA2  5  
ATOM   8973  H  HA3  . GLY A 1 13  ? -4.388  11.972  -16.216 1.00 0.00 ? 167 GLY A HA3  5  
ATOM   8974  N  N    . ILE A 1 14  ? -4.207  9.526   -14.720 1.00 0.00 ? 168 ILE A N    5  
ATOM   8975  C  CA   . ILE A 1 14  ? -4.371  8.048   -14.579 1.00 0.00 ? 168 ILE A CA   5  
ATOM   8976  C  C    . ILE A 1 14  ? -4.278  7.643   -13.097 1.00 0.00 ? 168 ILE A C    5  
ATOM   8977  O  O    . ILE A 1 14  ? -3.558  8.252   -12.329 1.00 0.00 ? 168 ILE A O    5  
ATOM   8978  C  CB   . ILE A 1 14  ? -3.214  7.436   -15.378 1.00 0.00 ? 168 ILE A CB   5  
ATOM   8979  C  CG1  . ILE A 1 14  ? -3.317  7.872   -16.842 1.00 0.00 ? 168 ILE A CG1  5  
ATOM   8980  C  CG2  . ILE A 1 14  ? -3.285  5.906   -15.303 1.00 0.00 ? 168 ILE A CG2  5  
ATOM   8981  C  CD1  . ILE A 1 14  ? -2.024  7.510   -17.576 1.00 0.00 ? 168 ILE A CD1  5  
ATOM   8982  H  H    . ILE A 1 14  ? -3.362  9.947   -14.449 1.00 0.00 ? 168 ILE A H    5  
ATOM   8983  H  HA   . ILE A 1 14  ? -5.314  7.730   -14.994 1.00 0.00 ? 168 ILE A HA   5  
ATOM   8984  H  HB   . ILE A 1 14  ? -2.274  7.772   -14.965 1.00 0.00 ? 168 ILE A HB   5  
ATOM   8985  H  HG12 . ILE A 1 14  ? -4.151  7.370   -17.310 1.00 0.00 ? 168 ILE A HG12 5  
ATOM   8986  H  HG13 . ILE A 1 14  ? -3.467  8.941   -16.889 1.00 0.00 ? 168 ILE A HG13 5  
ATOM   8987  H  HG21 . ILE A 1 14  ? -3.429  5.601   -14.277 1.00 0.00 ? 168 ILE A HG21 5  
ATOM   8988  H  HG22 . ILE A 1 14  ? -2.363  5.484   -15.677 1.00 0.00 ? 168 ILE A HG22 5  
ATOM   8989  H  HG23 . ILE A 1 14  ? -4.110  5.553   -15.904 1.00 0.00 ? 168 ILE A HG23 5  
ATOM   8990  H  HD11 . ILE A 1 14  ? -1.795  6.468   -17.407 1.00 0.00 ? 168 ILE A HD11 5  
ATOM   8991  H  HD12 . ILE A 1 14  ? -1.216  8.121   -17.204 1.00 0.00 ? 168 ILE A HD12 5  
ATOM   8992  H  HD13 . ILE A 1 14  ? -2.151  7.684   -18.635 1.00 0.00 ? 168 ILE A HD13 5  
ATOM   8993  N  N    . VAL A 1 15  ? -4.997  6.616   -12.694 1.00 0.00 ? 169 VAL A N    5  
ATOM   8994  C  CA   . VAL A 1 15  ? -4.938  6.171   -11.265 1.00 0.00 ? 169 VAL A CA   5  
ATOM   8995  C  C    . VAL A 1 15  ? -4.180  4.841   -11.176 1.00 0.00 ? 169 VAL A C    5  
ATOM   8996  O  O    . VAL A 1 15  ? -4.270  4.021   -12.069 1.00 0.00 ? 169 VAL A O    5  
ATOM   8997  C  CB   . VAL A 1 15  ? -6.399  5.994   -10.833 1.00 0.00 ? 169 VAL A CB   5  
ATOM   8998  C  CG1  . VAL A 1 15  ? -6.460  5.514   -9.376  1.00 0.00 ? 169 VAL A CG1  5  
ATOM   8999  C  CG2  . VAL A 1 15  ? -7.134  7.332   -10.962 1.00 0.00 ? 169 VAL A CG2  5  
ATOM   9000  H  H    . VAL A 1 15  ? -5.568  6.129   -13.332 1.00 0.00 ? 169 VAL A H    5  
ATOM   9001  H  HA   . VAL A 1 15  ? -4.458  6.920   -10.654 1.00 0.00 ? 169 VAL A HA   5  
ATOM   9002  H  HB   . VAL A 1 15  ? -6.872  5.261   -11.469 1.00 0.00 ? 169 VAL A HB   5  
ATOM   9003  H  HG11 . VAL A 1 15  ? -6.749  6.333   -8.734  1.00 0.00 ? 169 VAL A HG11 5  
ATOM   9004  H  HG12 . VAL A 1 15  ? -5.491  5.146   -9.074  1.00 0.00 ? 169 VAL A HG12 5  
ATOM   9005  H  HG13 . VAL A 1 15  ? -7.186  4.719   -9.292  1.00 0.00 ? 169 VAL A HG13 5  
ATOM   9006  H  HG21 . VAL A 1 15  ? -7.967  7.354   -10.275 1.00 0.00 ? 169 VAL A HG21 5  
ATOM   9007  H  HG22 . VAL A 1 15  ? -7.498  7.448   -11.973 1.00 0.00 ? 169 VAL A HG22 5  
ATOM   9008  H  HG23 . VAL A 1 15  ? -6.455  8.140   -10.731 1.00 0.00 ? 169 VAL A HG23 5  
ATOM   9009  N  N    . SER A 1 16  ? -3.427  4.618   -10.117 1.00 0.00 ? 170 SER A N    5  
ATOM   9010  C  CA   . SER A 1 16  ? -2.669  3.336   -10.002 1.00 0.00 ? 170 SER A CA   5  
ATOM   9011  C  C    . SER A 1 16  ? -2.740  2.778   -8.574  1.00 0.00 ? 170 SER A C    5  
ATOM   9012  O  O    . SER A 1 16  ? -2.839  3.522   -7.616  1.00 0.00 ? 170 SER A O    5  
ATOM   9013  C  CB   . SER A 1 16  ? -1.229  3.697   -10.364 1.00 0.00 ? 170 SER A CB   5  
ATOM   9014  O  OG   . SER A 1 16  ? -1.234  4.764   -11.303 1.00 0.00 ? 170 SER A OG   5  
ATOM   9015  H  H    . SER A 1 16  ? -3.356  5.292   -9.406  1.00 0.00 ? 170 SER A H    5  
ATOM   9016  H  HA   . SER A 1 16  ? -3.049  2.612   -10.701 1.00 0.00 ? 170 SER A HA   5  
ATOM   9017  H  HB2  . SER A 1 16  ? -0.701  4.008   -9.478  1.00 0.00 ? 170 SER A HB2  5  
ATOM   9018  H  HB3  . SER A 1 16  ? -0.737  2.832   -10.788 1.00 0.00 ? 170 SER A HB3  5  
ATOM   9019  H  HG   . SER A 1 16  ? -0.410  4.730   -11.795 1.00 0.00 ? 170 SER A HG   5  
ATOM   9020  N  N    . CYS A 1 17  ? -2.680  1.468   -8.424  1.00 0.00 ? 171 CYS A N    5  
ATOM   9021  C  CA   . CYS A 1 17  ? -2.732  0.870   -7.049  1.00 0.00 ? 171 CYS A CA   5  
ATOM   9022  C  C    . CYS A 1 17  ? -1.311  0.528   -6.578  1.00 0.00 ? 171 CYS A C    5  
ATOM   9023  O  O    . CYS A 1 17  ? -0.497  0.055   -7.354  1.00 0.00 ? 171 CYS A O    5  
ATOM   9024  C  CB   . CYS A 1 17  ? -3.568  -0.408  -7.171  1.00 0.00 ? 171 CYS A CB   5  
ATOM   9025  S  SG   . CYS A 1 17  ? -3.896  -1.064  -5.517  1.00 0.00 ? 171 CYS A SG   5  
ATOM   9026  H  H    . CYS A 1 17  ? -2.589  0.883   -9.213  1.00 0.00 ? 171 CYS A H    5  
ATOM   9027  H  HA   . CYS A 1 17  ? -3.202  1.553   -6.358  1.00 0.00 ? 171 CYS A HA   5  
ATOM   9028  H  HB2  . CYS A 1 17  ? -4.504  -0.184  -7.663  1.00 0.00 ? 171 CYS A HB2  5  
ATOM   9029  H  HB3  . CYS A 1 17  ? -3.022  -1.140  -7.745  1.00 0.00 ? 171 CYS A HB3  5  
ATOM   9030  N  N    . THR A 1 18  ? -1.003  0.763   -5.317  1.00 0.00 ? 172 THR A N    5  
ATOM   9031  C  CA   . THR A 1 18  ? 0.382   0.449   -4.812  1.00 0.00 ? 172 THR A CA   5  
ATOM   9032  C  C    . THR A 1 18  ? 0.506   -1.044  -4.446  1.00 0.00 ? 172 THR A C    5  
ATOM   9033  O  O    . THR A 1 18  ? 1.535   -1.653  -4.677  1.00 0.00 ? 172 THR A O    5  
ATOM   9034  C  CB   . THR A 1 18  ? 0.617   1.351   -3.577  1.00 0.00 ? 172 THR A CB   5  
ATOM   9035  O  OG1  . THR A 1 18  ? 1.993   1.303   -3.225  1.00 0.00 ? 172 THR A OG1  5  
ATOM   9036  C  CG2  . THR A 1 18  ? -0.227  0.885   -2.377  1.00 0.00 ? 172 THR A CG2  5  
ATOM   9037  H  H    . THR A 1 18  ? -1.680  1.145   -4.710  1.00 0.00 ? 172 THR A H    5  
ATOM   9038  H  HA   . THR A 1 18  ? 1.105   0.693   -5.575  1.00 0.00 ? 172 THR A HA   5  
ATOM   9039  H  HB   . THR A 1 18  ? 0.349   2.367   -3.823  1.00 0.00 ? 172 THR A HB   5  
ATOM   9040  H  HG1  . THR A 1 18  ? 2.474   1.866   -3.836  1.00 0.00 ? 172 THR A HG1  5  
ATOM   9041  H  HG21 . THR A 1 18  ? -0.160  1.614   -1.583  1.00 0.00 ? 172 THR A HG21 5  
ATOM   9042  H  HG22 . THR A 1 18  ? 0.146   -0.065  -2.023  1.00 0.00 ? 172 THR A HG22 5  
ATOM   9043  H  HG23 . THR A 1 18  ? -1.258  0.776   -2.674  1.00 0.00 ? 172 THR A HG23 5  
ATOM   9044  N  N    . ALA A 1 19  ? -0.525  -1.639  -3.879  1.00 0.00 ? 173 ALA A N    5  
ATOM   9045  C  CA   . ALA A 1 19  ? -0.431  -3.097  -3.511  1.00 0.00 ? 173 ALA A CA   5  
ATOM   9046  C  C    . ALA A 1 19  ? -0.482  -3.981  -4.773  1.00 0.00 ? 173 ALA A C    5  
ATOM   9047  O  O    . ALA A 1 19  ? 0.095   -5.053  -4.798  1.00 0.00 ? 173 ALA A O    5  
ATOM   9048  C  CB   . ALA A 1 19  ? -1.623  -3.396  -2.586  1.00 0.00 ? 173 ALA A CB   5  
ATOM   9049  H  H    . ALA A 1 19  ? -1.353  -1.132  -3.704  1.00 0.00 ? 173 ALA A H    5  
ATOM   9050  H  HA   . ALA A 1 19  ? 0.489   -3.277  -2.982  1.00 0.00 ? 173 ALA A HA   5  
ATOM   9051  H  HB1  . ALA A 1 19  ? -1.859  -4.450  -2.631  1.00 0.00 ? 173 ALA A HB1  5  
ATOM   9052  H  HB2  . ALA A 1 19  ? -2.479  -2.819  -2.905  1.00 0.00 ? 173 ALA A HB2  5  
ATOM   9053  H  HB3  . ALA A 1 19  ? -1.366  -3.126  -1.570  1.00 0.00 ? 173 ALA A HB3  5  
ATOM   9054  N  N    . CYS A 1 20  ? -1.152  -3.547  -5.825  1.00 0.00 ? 174 CYS A N    5  
ATOM   9055  C  CA   . CYS A 1 20  ? -1.210  -4.377  -7.072  1.00 0.00 ? 174 CYS A CA   5  
ATOM   9056  C  C    . CYS A 1 20  ? -0.115  -3.947  -8.064  1.00 0.00 ? 174 CYS A C    5  
ATOM   9057  O  O    . CYS A 1 20  ? 0.400   -4.762  -8.806  1.00 0.00 ? 174 CYS A O    5  
ATOM   9058  C  CB   . CYS A 1 20  ? -2.594  -4.125  -7.685  1.00 0.00 ? 174 CYS A CB   5  
ATOM   9059  S  SG   . CYS A 1 20  ? -3.881  -4.751  -6.581  1.00 0.00 ? 174 CYS A SG   5  
ATOM   9060  H  H    . CYS A 1 20  ? -1.606  -2.680  -5.799  1.00 0.00 ? 174 CYS A H    5  
ATOM   9061  H  HA   . CYS A 1 20  ? -1.102  -5.417  -6.833  1.00 0.00 ? 174 CYS A HA   5  
ATOM   9062  H  HB2  . CYS A 1 20  ? -2.733  -3.067  -7.831  1.00 0.00 ? 174 CYS A HB2  5  
ATOM   9063  H  HB3  . CYS A 1 20  ? -2.660  -4.627  -8.634  1.00 0.00 ? 174 CYS A HB3  5  
ATOM   9064  N  N    . GLY A 1 21  ? 0.232   -2.675  -8.104  1.00 0.00 ? 175 GLY A N    5  
ATOM   9065  C  CA   . GLY A 1 21  ? 1.272   -2.214  -9.067  1.00 0.00 ? 175 GLY A CA   5  
ATOM   9066  C  C    . GLY A 1 21  ? 0.634   -2.111  -10.458 1.00 0.00 ? 175 GLY A C    5  
ATOM   9067  O  O    . GLY A 1 21  ? 1.230   -2.498  -11.445 1.00 0.00 ? 175 GLY A O    5  
ATOM   9068  H  H    . GLY A 1 21  ? -0.199  -2.022  -7.516  1.00 0.00 ? 175 GLY A H    5  
ATOM   9069  H  HA2  . GLY A 1 21  ? 1.645   -1.246  -8.762  1.00 0.00 ? 175 GLY A HA2  5  
ATOM   9070  H  HA3  . GLY A 1 21  ? 2.083   -2.926  -9.095  1.00 0.00 ? 175 GLY A HA3  5  
ATOM   9071  N  N    . GLN A 1 22  ? -0.581  -1.602  -10.546 1.00 0.00 ? 176 GLN A N    5  
ATOM   9072  C  CA   . GLN A 1 22  ? -1.250  -1.495  -11.883 1.00 0.00 ? 176 GLN A CA   5  
ATOM   9073  C  C    . GLN A 1 22  ? -2.415  -0.490  -11.839 1.00 0.00 ? 176 GLN A C    5  
ATOM   9074  O  O    . GLN A 1 22  ? -2.962  -0.215  -10.789 1.00 0.00 ? 176 GLN A O    5  
ATOM   9075  C  CB   . GLN A 1 22  ? -1.777  -2.903  -12.172 1.00 0.00 ? 176 GLN A CB   5  
ATOM   9076  C  CG   . GLN A 1 22  ? -0.825  -3.628  -13.125 1.00 0.00 ? 176 GLN A CG   5  
ATOM   9077  C  CD   . GLN A 1 22  ? -1.562  -4.791  -13.798 1.00 0.00 ? 176 GLN A CD   5  
ATOM   9078  O  OE1  . GLN A 1 22  ? -1.627  -5.874  -13.252 1.00 0.00 ? 176 GLN A OE1  5  
ATOM   9079  N  NE2  . GLN A 1 22  ? -2.126  -4.619  -14.969 1.00 0.00 ? 176 GLN A NE2  5  
ATOM   9080  H  H    . GLN A 1 22  ? -1.056  -1.300  -9.734  1.00 0.00 ? 176 GLN A H    5  
ATOM   9081  H  HA   . GLN A 1 22  ? -0.540  -1.206  -12.641 1.00 0.00 ? 176 GLN A HA   5  
ATOM   9082  H  HB2  . GLN A 1 22  ? -1.850  -3.455  -11.245 1.00 0.00 ? 176 GLN A HB2  5  
ATOM   9083  H  HB3  . GLN A 1 22  ? -2.754  -2.835  -12.626 1.00 0.00 ? 176 GLN A HB3  5  
ATOM   9084  H  HG2  . GLN A 1 22  ? -0.475  -2.937  -13.879 1.00 0.00 ? 176 GLN A HG2  5  
ATOM   9085  H  HG3  . GLN A 1 22  ? 0.018   -4.011  -12.570 1.00 0.00 ? 176 GLN A HG3  5  
ATOM   9086  H  HE21 . GLN A 1 22  ? -2.079  -3.748  -15.420 1.00 0.00 ? 176 GLN A HE21 5  
ATOM   9087  H  HE22 . GLN A 1 22  ? -2.597  -5.365  -15.397 1.00 0.00 ? 176 GLN A HE22 5  
ATOM   9088  N  N    . GLN A 1 23  ? -2.792  0.061   -12.975 1.00 0.00 ? 177 GLN A N    5  
ATOM   9089  C  CA   . GLN A 1 23  ? -3.927  1.055   -12.985 1.00 0.00 ? 177 GLN A CA   5  
ATOM   9090  C  C    . GLN A 1 23  ? -5.203  0.427   -12.406 1.00 0.00 ? 177 GLN A C    5  
ATOM   9091  O  O    . GLN A 1 23  ? -5.388  -0.775  -12.462 1.00 0.00 ? 177 GLN A O    5  
ATOM   9092  C  CB   . GLN A 1 23  ? -4.156  1.451   -14.452 1.00 0.00 ? 177 GLN A CB   5  
ATOM   9093  C  CG   . GLN A 1 23  ? -3.153  2.535   -14.852 1.00 0.00 ? 177 GLN A CG   5  
ATOM   9094  C  CD   . GLN A 1 23  ? -3.480  3.041   -16.262 1.00 0.00 ? 177 GLN A CD   5  
ATOM   9095  O  OE1  . GLN A 1 23  ? -4.613  2.969   -16.693 1.00 0.00 ? 177 GLN A OE1  5  
ATOM   9096  N  NE2  . GLN A 1 23  ? -2.532  3.555   -17.009 1.00 0.00 ? 177 GLN A NE2  5  
ATOM   9097  H  H    . GLN A 1 23  ? -2.327  -0.177  -13.813 1.00 0.00 ? 177 GLN A H    5  
ATOM   9098  H  HA   . GLN A 1 23  ? -3.658  1.924   -12.413 1.00 0.00 ? 177 GLN A HA   5  
ATOM   9099  H  HB2  . GLN A 1 23  ? -4.022  0.585   -15.083 1.00 0.00 ? 177 GLN A HB2  5  
ATOM   9100  H  HB3  . GLN A 1 23  ? -5.160  1.832   -14.570 1.00 0.00 ? 177 GLN A HB3  5  
ATOM   9101  H  HG2  . GLN A 1 23  ? -3.211  3.356   -14.151 1.00 0.00 ? 177 GLN A HG2  5  
ATOM   9102  H  HG3  . GLN A 1 23  ? -2.154  2.123   -14.842 1.00 0.00 ? 177 GLN A HG3  5  
ATOM   9103  H  HE21 . GLN A 1 23  ? -1.611  3.619   -16.671 1.00 0.00 ? 177 GLN A HE21 5  
ATOM   9104  H  HE22 . GLN A 1 23  ? -2.743  3.877   -17.909 1.00 0.00 ? 177 GLN A HE22 5  
ATOM   9105  N  N    . VAL A 1 24  ? -6.093  1.232   -11.860 1.00 0.00 ? 178 VAL A N    5  
ATOM   9106  C  CA   . VAL A 1 24  ? -7.367  0.666   -11.292 1.00 0.00 ? 178 VAL A CA   5  
ATOM   9107  C  C    . VAL A 1 24  ? -8.432  0.602   -12.398 1.00 0.00 ? 178 VAL A C    5  
ATOM   9108  O  O    . VAL A 1 24  ? -8.296  1.249   -13.418 1.00 0.00 ? 178 VAL A O    5  
ATOM   9109  C  CB   . VAL A 1 24  ? -7.810  1.617   -10.161 1.00 0.00 ? 178 VAL A CB   5  
ATOM   9110  C  CG1  . VAL A 1 24  ? -9.031  1.033   -9.450  1.00 0.00 ? 178 VAL A CG1  5  
ATOM   9111  C  CG2  . VAL A 1 24  ? -6.672  1.783   -9.150  1.00 0.00 ? 178 VAL A CG2  5  
ATOM   9112  H  H    . VAL A 1 24  ? -5.929  2.204   -11.835 1.00 0.00 ? 178 VAL A H    5  
ATOM   9113  H  HA   . VAL A 1 24  ? -7.187  -0.321  -10.893 1.00 0.00 ? 178 VAL A HA   5  
ATOM   9114  H  HB   . VAL A 1 24  ? -8.070  2.581   -10.578 1.00 0.00 ? 178 VAL A HB   5  
ATOM   9115  H  HG11 . VAL A 1 24  ? -8.945  -0.043  -9.413  1.00 0.00 ? 178 VAL A HG11 5  
ATOM   9116  H  HG12 . VAL A 1 24  ? -9.927  1.304   -9.988  1.00 0.00 ? 178 VAL A HG12 5  
ATOM   9117  H  HG13 . VAL A 1 24  ? -9.083  1.424   -8.445  1.00 0.00 ? 178 VAL A HG13 5  
ATOM   9118  H  HG21 . VAL A 1 24  ? -5.987  2.543   -9.500  1.00 0.00 ? 178 VAL A HG21 5  
ATOM   9119  H  HG22 . VAL A 1 24  ? -6.145  0.847   -9.044  1.00 0.00 ? 178 VAL A HG22 5  
ATOM   9120  H  HG23 . VAL A 1 24  ? -7.079  2.078   -8.194  1.00 0.00 ? 178 VAL A HG23 5  
ATOM   9121  N  N    . ASN A 1 25  ? -9.481  -0.179  -12.219 1.00 0.00 ? 179 ASN A N    5  
ATOM   9122  C  CA   . ASN A 1 25  ? -10.540 -0.276  -13.295 1.00 0.00 ? 179 ASN A CA   5  
ATOM   9123  C  C    . ASN A 1 25  ? -11.066 1.121   -13.675 1.00 0.00 ? 179 ASN A C    5  
ATOM   9124  O  O    . ASN A 1 25  ? -12.000 1.618   -13.074 1.00 0.00 ? 179 ASN A O    5  
ATOM   9125  C  CB   . ASN A 1 25  ? -11.684 -1.123  -12.713 1.00 0.00 ? 179 ASN A CB   5  
ATOM   9126  C  CG   . ASN A 1 25  ? -12.609 -1.581  -13.846 1.00 0.00 ? 179 ASN A CG   5  
ATOM   9127  O  OD1  . ASN A 1 25  ? -12.153 -1.853  -14.940 1.00 0.00 ? 179 ASN A OD1  5  
ATOM   9128  N  ND2  . ASN A 1 25  ? -13.899 -1.683  -13.637 1.00 0.00 ? 179 ASN A ND2  5  
ATOM   9129  H  H    . ASN A 1 25  ? -9.564  -0.707  -11.390 1.00 0.00 ? 179 ASN A H    5  
ATOM   9130  H  HA   . ASN A 1 25  ? -10.135 -0.765  -14.167 1.00 0.00 ? 179 ASN A HA   5  
ATOM   9131  H  HB2  . ASN A 1 25  ? -11.272 -1.987  -12.211 1.00 0.00 ? 179 ASN A HB2  5  
ATOM   9132  H  HB3  . ASN A 1 25  ? -12.248 -0.532  -12.008 1.00 0.00 ? 179 ASN A HB3  5  
ATOM   9133  H  HD21 . ASN A 1 25  ? -14.279 -1.466  -12.758 1.00 0.00 ? 179 ASN A HD21 5  
ATOM   9134  H  HD22 . ASN A 1 25  ? -14.489 -1.976  -14.363 1.00 0.00 ? 179 ASN A HD22 5  
ATOM   9135  N  N    . HIS A 1 26  ? -10.479 1.759   -14.672 1.00 0.00 ? 180 HIS A N    5  
ATOM   9136  C  CA   . HIS A 1 26  ? -10.948 3.121   -15.094 1.00 0.00 ? 180 HIS A CA   5  
ATOM   9137  C  C    . HIS A 1 26  ? -11.052 4.072   -13.887 1.00 0.00 ? 180 HIS A C    5  
ATOM   9138  O  O    . HIS A 1 26  ? -10.696 3.715   -12.780 1.00 0.00 ? 180 HIS A O    5  
ATOM   9139  C  CB   . HIS A 1 26  ? -12.331 2.892   -15.713 1.00 0.00 ? 180 HIS A CB   5  
ATOM   9140  C  CG   . HIS A 1 26  ? -12.194 2.718   -17.201 1.00 0.00 ? 180 HIS A CG   5  
ATOM   9141  N  ND1  . HIS A 1 26  ? -12.642 1.580   -17.855 1.00 0.00 ? 180 HIS A ND1  5  
ATOM   9142  C  CD2  . HIS A 1 26  ? -11.665 3.527   -18.176 1.00 0.00 ? 180 HIS A CD2  5  
ATOM   9143  C  CE1  . HIS A 1 26  ? -12.375 1.736   -19.165 1.00 0.00 ? 180 HIS A CE1  5  
ATOM   9144  N  NE2  . HIS A 1 26  ? -11.780 2.905   -19.415 1.00 0.00 ? 180 HIS A NE2  5  
ATOM   9145  H  H    . HIS A 1 26  ? -9.728  1.342   -15.151 1.00 0.00 ? 180 HIS A H    5  
ATOM   9146  H  HA   . HIS A 1 26  ? -10.280 3.532   -15.834 1.00 0.00 ? 180 HIS A HA   5  
ATOM   9147  H  HB2  . HIS A 1 26  ? -12.774 2.005   -15.285 1.00 0.00 ? 180 HIS A HB2  5  
ATOM   9148  H  HB3  . HIS A 1 26  ? -12.961 3.744   -15.508 1.00 0.00 ? 180 HIS A HB3  5  
ATOM   9149  H  HD1  . HIS A 1 26  ? -13.073 0.805   -17.440 1.00 0.00 ? 180 HIS A HD1  5  
ATOM   9150  H  HD2  . HIS A 1 26  ? -11.226 4.499   -18.006 1.00 0.00 ? 180 HIS A HD2  5  
ATOM   9151  H  HE1  . HIS A 1 26  ? -12.613 1.003   -19.923 1.00 0.00 ? 180 HIS A HE1  5  
ATOM   9152  N  N    . PHE A 1 27  ? -11.545 5.277   -14.091 1.00 0.00 ? 181 PHE A N    5  
ATOM   9153  C  CA   . PHE A 1 27  ? -11.678 6.238   -12.955 1.00 0.00 ? 181 PHE A CA   5  
ATOM   9154  C  C    . PHE A 1 27  ? -13.168 6.514   -12.688 1.00 0.00 ? 181 PHE A C    5  
ATOM   9155  O  O    . PHE A 1 27  ? -13.795 7.279   -13.397 1.00 0.00 ? 181 PHE A O    5  
ATOM   9156  C  CB   . PHE A 1 27  ? -10.951 7.508   -13.419 1.00 0.00 ? 181 PHE A CB   5  
ATOM   9157  C  CG   . PHE A 1 27  ? -11.095 8.609   -12.387 1.00 0.00 ? 181 PHE A CG   5  
ATOM   9158  C  CD1  . PHE A 1 27  ? -10.801 8.360   -11.038 1.00 0.00 ? 181 PHE A CD1  5  
ATOM   9159  C  CD2  . PHE A 1 27  ? -11.524 9.880   -12.785 1.00 0.00 ? 181 PHE A CD2  5  
ATOM   9160  C  CE1  . PHE A 1 27  ? -10.936 9.384   -10.093 1.00 0.00 ? 181 PHE A CE1  5  
ATOM   9161  C  CE2  . PHE A 1 27  ? -11.659 10.903  -11.840 1.00 0.00 ? 181 PHE A CE2  5  
ATOM   9162  C  CZ   . PHE A 1 27  ? -11.366 10.655  -10.494 1.00 0.00 ? 181 PHE A CZ   5  
ATOM   9163  H  H    . PHE A 1 27  ? -11.835 5.549   -14.991 1.00 0.00 ? 181 PHE A H    5  
ATOM   9164  H  HA   . PHE A 1 27  ? -11.204 5.842   -12.071 1.00 0.00 ? 181 PHE A HA   5  
ATOM   9165  H  HB2  . PHE A 1 27  ? -9.903  7.288   -13.562 1.00 0.00 ? 181 PHE A HB2  5  
ATOM   9166  H  HB3  . PHE A 1 27  ? -11.377 7.839   -14.356 1.00 0.00 ? 181 PHE A HB3  5  
ATOM   9167  H  HD1  . PHE A 1 27  ? -10.470 7.381   -10.725 1.00 0.00 ? 181 PHE A HD1  5  
ATOM   9168  H  HD2  . PHE A 1 27  ? -11.751 10.072  -13.824 1.00 0.00 ? 181 PHE A HD2  5  
ATOM   9169  H  HE1  . PHE A 1 27  ? -10.709 9.194   -9.055  1.00 0.00 ? 181 PHE A HE1  5  
ATOM   9170  H  HE2  . PHE A 1 27  ? -11.991 11.883  -12.148 1.00 0.00 ? 181 PHE A HE2  5  
ATOM   9171  H  HZ   . PHE A 1 27  ? -11.470 11.445  -9.765  1.00 0.00 ? 181 PHE A HZ   5  
ATOM   9172  N  N    . GLN A 1 28  ? -13.738 5.897   -11.675 1.00 0.00 ? 182 GLN A N    5  
ATOM   9173  C  CA   . GLN A 1 28  ? -15.184 6.130   -11.373 1.00 0.00 ? 182 GLN A CA   5  
ATOM   9174  C  C    . GLN A 1 28  ? -15.330 6.926   -10.067 1.00 0.00 ? 182 GLN A C    5  
ATOM   9175  O  O    . GLN A 1 28  ? -14.458 6.893   -9.219  1.00 0.00 ? 182 GLN A O    5  
ATOM   9176  C  CB   . GLN A 1 28  ? -15.795 4.733   -11.227 1.00 0.00 ? 182 GLN A CB   5  
ATOM   9177  C  CG   . GLN A 1 28  ? -17.310 4.849   -11.058 1.00 0.00 ? 182 GLN A CG   5  
ATOM   9178  C  CD   . GLN A 1 28  ? -17.943 5.284   -12.385 1.00 0.00 ? 182 GLN A CD   5  
ATOM   9179  O  OE1  . GLN A 1 28  ? -18.042 6.463   -12.662 1.00 0.00 ? 182 GLN A OE1  5  
ATOM   9180  N  NE2  . GLN A 1 28  ? -18.381 4.381   -13.229 1.00 0.00 ? 182 GLN A NE2  5  
ATOM   9181  H  H    . GLN A 1 28  ? -13.216 5.284   -11.111 1.00 0.00 ? 182 GLN A H    5  
ATOM   9182  H  HA   . GLN A 1 28  ? -15.657 6.655   -12.188 1.00 0.00 ? 182 GLN A HA   5  
ATOM   9183  H  HB2  . GLN A 1 28  ? -15.574 4.150   -12.108 1.00 0.00 ? 182 GLN A HB2  5  
ATOM   9184  H  HB3  . GLN A 1 28  ? -15.378 4.249   -10.360 1.00 0.00 ? 182 GLN A HB3  5  
ATOM   9185  H  HG2  . GLN A 1 28  ? -17.712 3.891   -10.761 1.00 0.00 ? 182 GLN A HG2  5  
ATOM   9186  H  HG3  . GLN A 1 28  ? -17.531 5.583   -10.299 1.00 0.00 ? 182 GLN A HG3  5  
ATOM   9187  H  HE21 . GLN A 1 28  ? -18.307 3.424   -13.015 1.00 0.00 ? 182 GLN A HE21 5  
ATOM   9188  H  HE22 . GLN A 1 28  ? -18.786 4.660   -14.076 1.00 0.00 ? 182 GLN A HE22 5  
ATOM   9189  N  N    . LYS A 1 29  ? -16.416 7.655   -9.902  1.00 0.00 ? 183 LYS A N    5  
ATOM   9190  C  CA   . LYS A 1 29  ? -16.595 8.467   -8.641  1.00 0.00 ? 183 LYS A CA   5  
ATOM   9191  C  C    . LYS A 1 29  ? -16.413 7.609   -7.370  1.00 0.00 ? 183 LYS A C    5  
ATOM   9192  O  O    . LYS A 1 29  ? -16.040 8.126   -6.333  1.00 0.00 ? 183 LYS A O    5  
ATOM   9193  C  CB   . LYS A 1 29  ? -18.019 9.049   -8.685  1.00 0.00 ? 183 LYS A CB   5  
ATOM   9194  C  CG   . LYS A 1 29  ? -19.049 7.917   -8.743  1.00 0.00 ? 183 LYS A CG   5  
ATOM   9195  C  CD   . LYS A 1 29  ? -20.433 8.467   -8.391  1.00 0.00 ? 183 LYS A CD   5  
ATOM   9196  C  CE   . LYS A 1 29  ? -20.506 8.746   -6.888  1.00 0.00 ? 183 LYS A CE   5  
ATOM   9197  N  NZ   . LYS A 1 29  ? -21.176 7.550   -6.307  1.00 0.00 ? 183 LYS A NZ   5  
ATOM   9198  H  H    . LYS A 1 29  ? -17.103 7.678   -10.611 1.00 0.00 ? 183 LYS A H    5  
ATOM   9199  H  HA   . LYS A 1 29  ? -15.883 9.273   -8.633  1.00 0.00 ? 183 LYS A HA   5  
ATOM   9200  H  HB2  . LYS A 1 29  ? -18.189 9.645   -7.799  1.00 0.00 ? 183 LYS A HB2  5  
ATOM   9201  H  HB3  . LYS A 1 29  ? -18.125 9.674   -9.560  1.00 0.00 ? 183 LYS A HB3  5  
ATOM   9202  H  HG2  . LYS A 1 29  ? -19.070 7.499   -9.738  1.00 0.00 ? 183 LYS A HG2  5  
ATOM   9203  H  HG3  . LYS A 1 29  ? -18.780 7.148   -8.035  1.00 0.00 ? 183 LYS A HG3  5  
ATOM   9204  H  HD2  . LYS A 1 29  ? -20.605 9.383   -8.938  1.00 0.00 ? 183 LYS A HD2  5  
ATOM   9205  H  HD3  . LYS A 1 29  ? -21.187 7.741   -8.657  1.00 0.00 ? 183 LYS A HD3  5  
ATOM   9206  H  HE2  . LYS A 1 29  ? -19.512 8.862   -6.479  1.00 0.00 ? 183 LYS A HE2  5  
ATOM   9207  H  HE3  . LYS A 1 29  ? -21.097 9.629   -6.698  1.00 0.00 ? 183 LYS A HE3  5  
ATOM   9208  H  HZ1  . LYS A 1 29  ? -20.534 6.734   -6.361  1.00 0.00 ? 183 LYS A HZ1  5  
ATOM   9209  H  HZ2  . LYS A 1 29  ? -22.045 7.346   -6.841  1.00 0.00 ? 183 LYS A HZ2  5  
ATOM   9210  H  HZ3  . LYS A 1 29  ? -21.414 7.735   -5.312  1.00 0.00 ? 183 LYS A HZ3  5  
ATOM   9211  N  N    . ASP A 1 30  ? -16.682 6.320   -7.422  1.00 0.00 ? 184 ASP A N    5  
ATOM   9212  C  CA   . ASP A 1 30  ? -16.527 5.482   -6.192  1.00 0.00 ? 184 ASP A CA   5  
ATOM   9213  C  C    . ASP A 1 30  ? -15.764 4.175   -6.479  1.00 0.00 ? 184 ASP A C    5  
ATOM   9214  O  O    . ASP A 1 30  ? -16.009 3.171   -5.836  1.00 0.00 ? 184 ASP A O    5  
ATOM   9215  C  CB   . ASP A 1 30  ? -17.956 5.174   -5.747  1.00 0.00 ? 184 ASP A CB   5  
ATOM   9216  C  CG   . ASP A 1 30  ? -17.991 4.989   -4.229  1.00 0.00 ? 184 ASP A CG   5  
ATOM   9217  O  OD1  . ASP A 1 30  ? -17.686 3.898   -3.778  1.00 0.00 ? 184 ASP A OD1  5  
ATOM   9218  O  OD2  . ASP A 1 30  ? -18.321 5.943   -3.543  1.00 0.00 ? 184 ASP A OD2  5  
ATOM   9219  H  H    . ASP A 1 30  ? -16.992 5.909   -8.251  1.00 0.00 ? 184 ASP A H    5  
ATOM   9220  H  HA   . ASP A 1 30  ? -16.022 6.043   -5.422  1.00 0.00 ? 184 ASP A HA   5  
ATOM   9221  H  HB2  . ASP A 1 30  ? -18.604 5.993   -6.026  1.00 0.00 ? 184 ASP A HB2  5  
ATOM   9222  H  HB3  . ASP A 1 30  ? -18.295 4.266   -6.226  1.00 0.00 ? 184 ASP A HB3  5  
ATOM   9223  N  N    . SER A 1 31  ? -14.831 4.171   -7.412  1.00 0.00 ? 185 SER A N    5  
ATOM   9224  C  CA   . SER A 1 31  ? -14.063 2.905   -7.679  1.00 0.00 ? 185 SER A CA   5  
ATOM   9225  C  C    . SER A 1 31  ? -12.819 2.858   -6.775  1.00 0.00 ? 185 SER A C    5  
ATOM   9226  O  O    . SER A 1 31  ? -12.750 2.054   -5.872  1.00 0.00 ? 185 SER A O    5  
ATOM   9227  C  CB   . SER A 1 31  ? -13.657 2.937   -9.156  1.00 0.00 ? 185 SER A CB   5  
ATOM   9228  O  OG   . SER A 1 31  ? -12.523 2.101   -9.350  1.00 0.00 ? 185 SER A OG   5  
ATOM   9229  H  H    . SER A 1 31  ? -14.626 4.992   -7.917  1.00 0.00 ? 185 SER A H    5  
ATOM   9230  H  HA   . SER A 1 31  ? -14.689 2.046   -7.488  1.00 0.00 ? 185 SER A HA   5  
ATOM   9231  H  HB2  . SER A 1 31  ? -14.470 2.577   -9.764  1.00 0.00 ? 185 SER A HB2  5  
ATOM   9232  H  HB3  . SER A 1 31  ? -13.421 3.953   -9.439  1.00 0.00 ? 185 SER A HB3  5  
ATOM   9233  H  HG   . SER A 1 31  ? -12.822 1.189   -9.340  1.00 0.00 ? 185 SER A HG   5  
ATOM   9234  N  N    . ILE A 1 32  ? -11.835 3.711   -7.008  1.00 0.00 ? 186 ILE A N    5  
ATOM   9235  C  CA   . ILE A 1 32  ? -10.591 3.697   -6.138  1.00 0.00 ? 186 ILE A CA   5  
ATOM   9236  C  C    . ILE A 1 32  ? -10.951 3.692   -4.642  1.00 0.00 ? 186 ILE A C    5  
ATOM   9237  O  O    . ILE A 1 32  ? -12.022 4.118   -4.253  1.00 0.00 ? 186 ILE A O    5  
ATOM   9238  C  CB   . ILE A 1 32  ? -9.786  4.972   -6.458  1.00 0.00 ? 186 ILE A CB   5  
ATOM   9239  C  CG1  . ILE A 1 32  ? -10.674 6.216   -6.306  1.00 0.00 ? 186 ILE A CG1  5  
ATOM   9240  C  CG2  . ILE A 1 32  ? -9.240  4.904   -7.883  1.00 0.00 ? 186 ILE A CG2  5  
ATOM   9241  C  CD1  . ILE A 1 32  ? -9.804  7.475   -6.339  1.00 0.00 ? 186 ILE A CD1  5  
ATOM   9242  H  H    . ILE A 1 32  ? -11.909 4.347   -7.754  1.00 0.00 ? 186 ILE A H    5  
ATOM   9243  H  HA   . ILE A 1 32  ? -9.994  2.827   -6.364  1.00 0.00 ? 186 ILE A HA   5  
ATOM   9244  H  HB   . ILE A 1 32  ? -8.956  5.043   -5.769  1.00 0.00 ? 186 ILE A HB   5  
ATOM   9245  H  HG12 . ILE A 1 32  ? -11.386 6.258   -7.115  1.00 0.00 ? 186 ILE A HG12 5  
ATOM   9246  H  HG13 . ILE A 1 32  ? -11.201 6.171   -5.365  1.00 0.00 ? 186 ILE A HG13 5  
ATOM   9247  H  HG21 . ILE A 1 32  ? -8.748  3.952   -8.033  1.00 0.00 ? 186 ILE A HG21 5  
ATOM   9248  H  HG22 . ILE A 1 32  ? -8.531  5.706   -8.030  1.00 0.00 ? 186 ILE A HG22 5  
ATOM   9249  H  HG23 . ILE A 1 32  ? -10.050 5.008   -8.588  1.00 0.00 ? 186 ILE A HG23 5  
ATOM   9250  H  HD11 . ILE A 1 32  ? -8.853  7.247   -6.799  1.00 0.00 ? 186 ILE A HD11 5  
ATOM   9251  H  HD12 . ILE A 1 32  ? -9.642  7.827   -5.331  1.00 0.00 ? 186 ILE A HD12 5  
ATOM   9252  H  HD13 . ILE A 1 32  ? -10.304 8.242   -6.912  1.00 0.00 ? 186 ILE A HD13 5  
ATOM   9253  N  N    . TYR A 1 33  ? -10.057 3.211   -3.804  1.00 0.00 ? 187 TYR A N    5  
ATOM   9254  C  CA   . TYR A 1 33  ? -10.336 3.176   -2.337  1.00 0.00 ? 187 TYR A CA   5  
ATOM   9255  C  C    . TYR A 1 33  ? -9.112  3.649   -1.551  1.00 0.00 ? 187 TYR A C    5  
ATOM   9256  O  O    . TYR A 1 33  ? -8.038  3.810   -2.100  1.00 0.00 ? 187 TYR A O    5  
ATOM   9257  C  CB   . TYR A 1 33  ? -10.625 1.709   -2.022  1.00 0.00 ? 187 TYR A CB   5  
ATOM   9258  C  CG   . TYR A 1 33  ? -12.105 1.448   -2.129  1.00 0.00 ? 187 TYR A CG   5  
ATOM   9259  C  CD1  . TYR A 1 33  ? -12.936 1.643   -1.020  1.00 0.00 ? 187 TYR A CD1  5  
ATOM   9260  C  CD2  . TYR A 1 33  ? -12.646 1.005   -3.339  1.00 0.00 ? 187 TYR A CD2  5  
ATOM   9261  C  CE1  . TYR A 1 33  ? -14.310 1.395   -1.122  1.00 0.00 ? 187 TYR A CE1  5  
ATOM   9262  C  CE2  . TYR A 1 33  ? -14.018 0.756   -3.444  1.00 0.00 ? 187 TYR A CE2  5  
ATOM   9263  C  CZ   . TYR A 1 33  ? -14.852 0.950   -2.336  1.00 0.00 ? 187 TYR A CZ   5  
ATOM   9264  O  OH   . TYR A 1 33  ? -16.206 0.704   -2.439  1.00 0.00 ? 187 TYR A OH   5  
ATOM   9265  H  H    . TYR A 1 33  ? -9.198  2.871   -4.139  1.00 0.00 ? 187 TYR A H    5  
ATOM   9266  H  HA   . TYR A 1 33  ? -11.191 3.783   -2.089  1.00 0.00 ? 187 TYR A HA   5  
ATOM   9267  H  HB2  . TYR A 1 33  ? -10.097 1.080   -2.723  1.00 0.00 ? 187 TYR A HB2  5  
ATOM   9268  H  HB3  . TYR A 1 33  ? -10.294 1.486   -1.018  1.00 0.00 ? 187 TYR A HB3  5  
ATOM   9269  H  HD1  . TYR A 1 33  ? -12.517 1.987   -0.085  1.00 0.00 ? 187 TYR A HD1  5  
ATOM   9270  H  HD2  . TYR A 1 33  ? -12.002 0.852   -4.195  1.00 0.00 ? 187 TYR A HD2  5  
ATOM   9271  H  HE1  . TYR A 1 33  ? -14.951 1.544   -0.266  1.00 0.00 ? 187 TYR A HE1  5  
ATOM   9272  H  HE2  . TYR A 1 33  ? -14.431 0.412   -4.380  1.00 0.00 ? 187 TYR A HE2  5  
ATOM   9273  H  HH   . TYR A 1 33  ? -16.605 1.437   -2.911  1.00 0.00 ? 187 TYR A HH   5  
ATOM   9274  N  N    . ARG A 1 34  ? -9.266  3.862   -0.266  1.00 0.00 ? 188 ARG A N    5  
ATOM   9275  C  CA   . ARG A 1 34  ? -8.110  4.316   0.561   1.00 0.00 ? 188 ARG A CA   5  
ATOM   9276  C  C    . ARG A 1 34  ? -7.730  3.219   1.564   1.00 0.00 ? 188 ARG A C    5  
ATOM   9277  O  O    . ARG A 1 34  ? -8.594  2.610   2.168   1.00 0.00 ? 188 ARG A O    5  
ATOM   9278  C  CB   . ARG A 1 34  ? -8.604  5.562   1.298   1.00 0.00 ? 188 ARG A CB   5  
ATOM   9279  C  CG   . ARG A 1 34  ? -8.848  6.690   0.294   1.00 0.00 ? 188 ARG A CG   5  
ATOM   9280  C  CD   . ARG A 1 34  ? -8.899  8.029   1.032   1.00 0.00 ? 188 ARG A CD   5  
ATOM   9281  N  NE   . ARG A 1 34  ? -9.803  8.890   0.208   1.00 0.00 ? 188 ARG A NE   5  
ATOM   9282  C  CZ   . ARG A 1 34  ? -11.105 8.659   0.147   1.00 0.00 ? 188 ARG A CZ   5  
ATOM   9283  N  NH1  . ARG A 1 34  ? -11.657 7.664   0.805   1.00 0.00 ? 188 ARG A NH1  5  
ATOM   9284  N  NH2  . ARG A 1 34  ? -11.865 9.434   -0.584  1.00 0.00 ? 188 ARG A NH2  5  
ATOM   9285  H  H    . ARG A 1 34  ? -10.144 3.717   0.158   1.00 0.00 ? 188 ARG A H    5  
ATOM   9286  H  HA   . ARG A 1 34  ? -7.269  4.564   -0.066  1.00 0.00 ? 188 ARG A HA   5  
ATOM   9287  H  HB2  . ARG A 1 34  ? -9.526  5.333   1.814   1.00 0.00 ? 188 ARG A HB2  5  
ATOM   9288  H  HB3  . ARG A 1 34  ? -7.860  5.876   2.015   1.00 0.00 ? 188 ARG A HB3  5  
ATOM   9289  H  HG2  . ARG A 1 34  ? -8.045  6.707   -0.430  1.00 0.00 ? 188 ARG A HG2  5  
ATOM   9290  H  HG3  . ARG A 1 34  ? -9.786  6.524   -0.212  1.00 0.00 ? 188 ARG A HG3  5  
ATOM   9291  H  HD2  . ARG A 1 34  ? -9.307  7.894   2.026   1.00 0.00 ? 188 ARG A HD2  5  
ATOM   9292  H  HD3  . ARG A 1 34  ? -7.916  8.469   1.084   1.00 0.00 ? 188 ARG A HD3  5  
ATOM   9293  H  HE   . ARG A 1 34  ? -9.418  9.640   -0.296  1.00 0.00 ? 188 ARG A HE   5  
ATOM   9294  H  HH11 . ARG A 1 34  ? -11.098 7.058   1.369   1.00 0.00 ? 188 ARG A HH11 5  
ATOM   9295  H  HH12 . ARG A 1 34  ? -12.643 7.514   0.741   1.00 0.00 ? 188 ARG A HH12 5  
ATOM   9296  H  HH21 . ARG A 1 34  ? -11.461 10.195  -1.091  1.00 0.00 ? 188 ARG A HH21 5  
ATOM   9297  H  HH22 . ARG A 1 34  ? -12.849 9.266   -0.634  1.00 0.00 ? 188 ARG A HH22 5  
ATOM   9298  N  N    . HIS A 1 35  ? -6.451  2.966   1.761   1.00 0.00 ? 189 HIS A N    5  
ATOM   9299  C  CA   . HIS A 1 35  ? -6.059  1.904   2.749   1.00 0.00 ? 189 HIS A CA   5  
ATOM   9300  C  C    . HIS A 1 35  ? -6.444  2.391   4.156   1.00 0.00 ? 189 HIS A C    5  
ATOM   9301  O  O    . HIS A 1 35  ? -6.167  3.522   4.501   1.00 0.00 ? 189 HIS A O    5  
ATOM   9302  C  CB   . HIS A 1 35  ? -4.539  1.729   2.620   1.00 0.00 ? 189 HIS A CB   5  
ATOM   9303  C  CG   . HIS A 1 35  ? -4.158  0.311   2.962   1.00 0.00 ? 189 HIS A CG   5  
ATOM   9304  N  ND1  . HIS A 1 35  ? -3.785  -0.067  4.238   1.00 0.00 ? 189 HIS A ND1  5  
ATOM   9305  C  CD2  . HIS A 1 35  ? -4.109  -0.836  2.208   1.00 0.00 ? 189 HIS A CD2  5  
ATOM   9306  C  CE1  . HIS A 1 35  ? -3.539  -1.386  4.223   1.00 0.00 ? 189 HIS A CE1  5  
ATOM   9307  N  NE2  . HIS A 1 35  ? -3.720  -1.907  3.007   1.00 0.00 ? 189 HIS A NE2  5  
ATOM   9308  H  H    . HIS A 1 35  ? -5.763  3.478   1.274   1.00 0.00 ? 189 HIS A H    5  
ATOM   9309  H  HA   . HIS A 1 35  ? -6.561  0.979   2.514   1.00 0.00 ? 189 HIS A HA   5  
ATOM   9310  H  HB2  . HIS A 1 35  ? -4.241  1.945   1.606   1.00 0.00 ? 189 HIS A HB2  5  
ATOM   9311  H  HB3  . HIS A 1 35  ? -4.047  2.411   3.291   1.00 0.00 ? 189 HIS A HB3  5  
ATOM   9312  H  HD1  . HIS A 1 35  ? -3.686  0.521   5.003   1.00 0.00 ? 189 HIS A HD1  5  
ATOM   9313  H  HD2  . HIS A 1 35  ? -4.320  -0.892  1.152   1.00 0.00 ? 189 HIS A HD2  5  
ATOM   9314  H  HE1  . HIS A 1 35  ? -3.247  -1.954  5.094   1.00 0.00 ? 189 HIS A HE1  5  
ATOM   9315  N  N    . PRO A 1 36  ? -7.101  1.545   4.922   1.00 0.00 ? 190 PRO A N    5  
ATOM   9316  C  CA   . PRO A 1 36  ? -7.542  1.957   6.280   1.00 0.00 ? 190 PRO A CA   5  
ATOM   9317  C  C    . PRO A 1 36  ? -6.352  2.083   7.247   1.00 0.00 ? 190 PRO A C    5  
ATOM   9318  O  O    . PRO A 1 36  ? -6.334  2.962   8.089   1.00 0.00 ? 190 PRO A O    5  
ATOM   9319  C  CB   . PRO A 1 36  ? -8.480  0.831   6.708   1.00 0.00 ? 190 PRO A CB   5  
ATOM   9320  C  CG   . PRO A 1 36  ? -8.042  -0.360  5.921   1.00 0.00 ? 190 PRO A CG   5  
ATOM   9321  C  CD   . PRO A 1 36  ? -7.487  0.155   4.620   1.00 0.00 ? 190 PRO A CD   5  
ATOM   9322  H  HA   . PRO A 1 36  ? -8.087  2.886   6.232   1.00 0.00 ? 190 PRO A HA   5  
ATOM   9323  H  HB2  . PRO A 1 36  ? -8.383  0.643   7.768   1.00 0.00 ? 190 PRO A HB2  5  
ATOM   9324  H  HB3  . PRO A 1 36  ? -9.501  1.080   6.458   1.00 0.00 ? 190 PRO A HB3  5  
ATOM   9325  H  HG2  . PRO A 1 36  ? -7.278  -0.900  6.464   1.00 0.00 ? 190 PRO A HG2  5  
ATOM   9326  H  HG3  . PRO A 1 36  ? -8.884  -1.006  5.726   1.00 0.00 ? 190 PRO A HG3  5  
ATOM   9327  H  HD2  . PRO A 1 36  ? -6.624  -0.426  4.321   1.00 0.00 ? 190 PRO A HD2  5  
ATOM   9328  H  HD3  . PRO A 1 36  ? -8.243  0.139   3.851   1.00 0.00 ? 190 PRO A HD3  5  
ATOM   9329  N  N    . SER A 1 37  ? -5.368  1.213   7.153   1.00 0.00 ? 191 SER A N    5  
ATOM   9330  C  CA   . SER A 1 37  ? -4.203  1.303   8.101   1.00 0.00 ? 191 SER A CA   5  
ATOM   9331  C  C    . SER A 1 37  ? -2.931  1.892   7.445   1.00 0.00 ? 191 SER A C    5  
ATOM   9332  O  O    . SER A 1 37  ? -1.853  1.743   7.990   1.00 0.00 ? 191 SER A O    5  
ATOM   9333  C  CB   . SER A 1 37  ? -3.935  -0.140  8.542   1.00 0.00 ? 191 SER A CB   5  
ATOM   9334  O  OG   . SER A 1 37  ? -5.065  -0.631  9.252   1.00 0.00 ? 191 SER A OG   5  
ATOM   9335  H  H    . SER A 1 37  ? -5.403  0.497   6.478   1.00 0.00 ? 191 SER A H    5  
ATOM   9336  H  HA   . SER A 1 37  ? -4.476  1.892   8.961   1.00 0.00 ? 191 SER A HA   5  
ATOM   9337  H  HB2  . SER A 1 37  ? -3.765  -0.758  7.674   1.00 0.00 ? 191 SER A HB2  5  
ATOM   9338  H  HB3  . SER A 1 37  ? -3.059  -0.164  9.177   1.00 0.00 ? 191 SER A HB3  5  
ATOM   9339  H  HG   . SER A 1 37  ? -4.913  -1.559  9.447   1.00 0.00 ? 191 SER A HG   5  
ATOM   9340  N  N    . LEU A 1 38  ? -3.015  2.540   6.294   1.00 0.00 ? 192 LEU A N    5  
ATOM   9341  C  CA   . LEU A 1 38  ? -1.757  3.090   5.670   1.00 0.00 ? 192 LEU A CA   5  
ATOM   9342  C  C    . LEU A 1 38  ? -1.903  4.509   5.068   1.00 0.00 ? 192 LEU A C    5  
ATOM   9343  O  O    . LEU A 1 38  ? -0.956  5.003   4.483   1.00 0.00 ? 192 LEU A O    5  
ATOM   9344  C  CB   . LEU A 1 38  ? -1.414  2.120   4.533   1.00 0.00 ? 192 LEU A CB   5  
ATOM   9345  C  CG   . LEU A 1 38  ? -0.873  0.790   5.066   1.00 0.00 ? 192 LEU A CG   5  
ATOM   9346  C  CD1  . LEU A 1 38  ? -0.472  -0.078  3.870   1.00 0.00 ? 192 LEU A CD1  5  
ATOM   9347  C  CD2  . LEU A 1 38  ? 0.361   1.032   5.944   1.00 0.00 ? 192 LEU A CD2  5  
ATOM   9348  H  H    . LEU A 1 38  ? -3.877  2.646   5.845   1.00 0.00 ? 192 LEU A H    5  
ATOM   9349  H  HA   . LEU A 1 38  ? -0.957  3.082   6.391   1.00 0.00 ? 192 LEU A HA   5  
ATOM   9350  H  HB2  . LEU A 1 38  ? -2.301  1.927   3.954   1.00 0.00 ? 192 LEU A HB2  5  
ATOM   9351  H  HB3  . LEU A 1 38  ? -0.669  2.573   3.896   1.00 0.00 ? 192 LEU A HB3  5  
ATOM   9352  H  HG   . LEU A 1 38  ? -1.638  0.287   5.640   1.00 0.00 ? 192 LEU A HG   5  
ATOM   9353  H  HD11 . LEU A 1 38  ? -1.359  -0.494  3.407   1.00 0.00 ? 192 LEU A HD11 5  
ATOM   9354  H  HD12 . LEU A 1 38  ? 0.173   -0.880  4.202   1.00 0.00 ? 192 LEU A HD12 5  
ATOM   9355  H  HD13 . LEU A 1 38  ? 0.054   0.536   3.150   1.00 0.00 ? 192 LEU A HD13 5  
ATOM   9356  H  HD21 . LEU A 1 38  ? 0.886   1.908   5.594   1.00 0.00 ? 192 LEU A HD21 5  
ATOM   9357  H  HD22 . LEU A 1 38  ? 1.014   0.174   5.888   1.00 0.00 ? 192 LEU A HD22 5  
ATOM   9358  H  HD23 . LEU A 1 38  ? 0.052   1.181   6.967   1.00 0.00 ? 192 LEU A HD23 5  
ATOM   9359  N  N    . GLN A 1 39  ? -3.042  5.181   5.173   1.00 0.00 ? 193 GLN A N    5  
ATOM   9360  C  CA   . GLN A 1 39  ? -3.172  6.553   4.566   1.00 0.00 ? 193 GLN A CA   5  
ATOM   9361  C  C    . GLN A 1 39  ? -2.701  6.540   3.096   1.00 0.00 ? 193 GLN A C    5  
ATOM   9362  O  O    . GLN A 1 39  ? -2.000  7.432   2.662   1.00 0.00 ? 193 GLN A O    5  
ATOM   9363  C  CB   . GLN A 1 39  ? -2.263  7.455   5.410   1.00 0.00 ? 193 GLN A CB   5  
ATOM   9364  C  CG   . GLN A 1 39  ? -2.754  7.461   6.859   1.00 0.00 ? 193 GLN A CG   5  
ATOM   9365  C  CD   . GLN A 1 39  ? -1.928  8.463   7.675   1.00 0.00 ? 193 GLN A CD   5  
ATOM   9366  O  OE1  . GLN A 1 39  ? -2.246  9.634   7.713   1.00 0.00 ? 193 GLN A OE1  5  
ATOM   9367  N  NE2  . GLN A 1 39  ? -0.872  8.054   8.336   1.00 0.00 ? 193 GLN A NE2  5  
ATOM   9368  H  H    . GLN A 1 39  ? -3.806  4.798   5.637   1.00 0.00 ? 193 GLN A H    5  
ATOM   9369  H  HA   . GLN A 1 39  ? -4.193  6.895   4.629   1.00 0.00 ? 193 GLN A HA   5  
ATOM   9370  H  HB2  . GLN A 1 39  ? -1.249  7.081   5.373   1.00 0.00 ? 193 GLN A HB2  5  
ATOM   9371  H  HB3  . GLN A 1 39  ? -2.290  8.461   5.018   1.00 0.00 ? 193 GLN A HB3  5  
ATOM   9372  H  HG2  . GLN A 1 39  ? -3.796  7.747   6.884   1.00 0.00 ? 193 GLN A HG2  5  
ATOM   9373  H  HG3  . GLN A 1 39  ? -2.640  6.475   7.282   1.00 0.00 ? 193 GLN A HG3  5  
ATOM   9374  H  HE21 . GLN A 1 39  ? -0.605  7.109   8.312   1.00 0.00 ? 193 GLN A HE21 5  
ATOM   9375  H  HE22 . GLN A 1 39  ? -0.345  8.696   8.857   1.00 0.00 ? 193 GLN A HE22 5  
ATOM   9376  N  N    . VAL A 1 40  ? -3.066  5.528   2.334   1.00 0.00 ? 194 VAL A N    5  
ATOM   9377  C  CA   . VAL A 1 40  ? -2.616  5.462   0.908   1.00 0.00 ? 194 VAL A CA   5  
ATOM   9378  C  C    . VAL A 1 40  ? -3.780  5.044   -0.008  1.00 0.00 ? 194 VAL A C    5  
ATOM   9379  O  O    . VAL A 1 40  ? -4.792  4.552   0.455   1.00 0.00 ? 194 VAL A O    5  
ATOM   9380  C  CB   . VAL A 1 40  ? -1.482  4.424   0.910   1.00 0.00 ? 194 VAL A CB   5  
ATOM   9381  C  CG1  . VAL A 1 40  ? -2.025  3.034   1.261   1.00 0.00 ? 194 VAL A CG1  5  
ATOM   9382  C  CG2  . VAL A 1 40  ? -0.823  4.380   -0.470  1.00 0.00 ? 194 VAL A CG2  5  
ATOM   9383  H  H    . VAL A 1 40  ? -3.624  4.807   2.700   1.00 0.00 ? 194 VAL A H    5  
ATOM   9384  H  HA   . VAL A 1 40  ? -2.231  6.418   0.588   1.00 0.00 ? 194 VAL A HA   5  
ATOM   9385  H  HB   . VAL A 1 40  ? -0.745  4.710   1.646   1.00 0.00 ? 194 VAL A HB   5  
ATOM   9386  H  HG11 . VAL A 1 40  ? -2.772  2.746   0.536   1.00 0.00 ? 194 VAL A HG11 5  
ATOM   9387  H  HG12 . VAL A 1 40  ? -2.466  3.058   2.245   1.00 0.00 ? 194 VAL A HG12 5  
ATOM   9388  H  HG13 . VAL A 1 40  ? -1.218  2.320   1.249   1.00 0.00 ? 194 VAL A HG13 5  
ATOM   9389  H  HG21 . VAL A 1 40  ? -1.402  3.748   -1.127  1.00 0.00 ? 194 VAL A HG21 5  
ATOM   9390  H  HG22 . VAL A 1 40  ? 0.178   3.985   -0.377  1.00 0.00 ? 194 VAL A HG22 5  
ATOM   9391  H  HG23 . VAL A 1 40  ? -0.778  5.379   -0.878  1.00 0.00 ? 194 VAL A HG23 5  
ATOM   9392  N  N    . LEU A 1 41  ? -3.651  5.253   -1.302  1.00 0.00 ? 195 LEU A N    5  
ATOM   9393  C  CA   . LEU A 1 41  ? -4.772  4.880   -2.237  1.00 0.00 ? 195 LEU A CA   5  
ATOM   9394  C  C    . LEU A 1 41  ? -4.604  3.452   -2.782  1.00 0.00 ? 195 LEU A C    5  
ATOM   9395  O  O    . LEU A 1 41  ? -3.507  3.017   -3.076  1.00 0.00 ? 195 LEU A O    5  
ATOM   9396  C  CB   . LEU A 1 41  ? -4.719  5.884   -3.396  1.00 0.00 ? 195 LEU A CB   5  
ATOM   9397  C  CG   . LEU A 1 41  ? -6.073  5.912   -4.107  1.00 0.00 ? 195 LEU A CG   5  
ATOM   9398  C  CD1  . LEU A 1 41  ? -6.359  7.328   -4.610  1.00 0.00 ? 195 LEU A CD1  5  
ATOM   9399  C  CD2  . LEU A 1 41  ? -6.044  4.948   -5.296  1.00 0.00 ? 195 LEU A CD2  5  
ATOM   9400  H  H    . LEU A 1 41  ? -2.827  5.666   -1.653  1.00 0.00 ? 195 LEU A H    5  
ATOM   9401  H  HA   . LEU A 1 41  ? -5.720  4.969   -1.728  1.00 0.00 ? 195 LEU A HA   5  
ATOM   9402  H  HB2  . LEU A 1 41  ? -4.490  6.864   -3.011  1.00 0.00 ? 195 LEU A HB2  5  
ATOM   9403  H  HB3  . LEU A 1 41  ? -3.953  5.583   -4.094  1.00 0.00 ? 195 LEU A HB3  5  
ATOM   9404  H  HG   . LEU A 1 41  ? -6.849  5.612   -3.418  1.00 0.00 ? 195 LEU A HG   5  
ATOM   9405  H  HD11 . LEU A 1 41  ? -5.823  7.496   -5.533  1.00 0.00 ? 195 LEU A HD11 5  
ATOM   9406  H  HD12 . LEU A 1 41  ? -6.035  8.045   -3.870  1.00 0.00 ? 195 LEU A HD12 5  
ATOM   9407  H  HD13 . LEU A 1 41  ? -7.418  7.442   -4.783  1.00 0.00 ? 195 LEU A HD13 5  
ATOM   9408  H  HD21 . LEU A 1 41  ? -5.981  3.933   -4.935  1.00 0.00 ? 195 LEU A HD21 5  
ATOM   9409  H  HD22 . LEU A 1 41  ? -5.186  5.165   -5.915  1.00 0.00 ? 195 LEU A HD22 5  
ATOM   9410  H  HD23 . LEU A 1 41  ? -6.946  5.068   -5.878  1.00 0.00 ? 195 LEU A HD23 5  
ATOM   9411  N  N    . ILE A 1 42  ? -5.695  2.728   -2.939  1.00 0.00 ? 196 ILE A N    5  
ATOM   9412  C  CA   . ILE A 1 42  ? -5.621  1.336   -3.488  1.00 0.00 ? 196 ILE A CA   5  
ATOM   9413  C  C    . ILE A 1 42  ? -6.767  1.144   -4.501  1.00 0.00 ? 196 ILE A C    5  
ATOM   9414  O  O    . ILE A 1 42  ? -7.398  2.106   -4.899  1.00 0.00 ? 196 ILE A O    5  
ATOM   9415  C  CB   . ILE A 1 42  ? -5.774  0.391   -2.277  1.00 0.00 ? 196 ILE A CB   5  
ATOM   9416  C  CG1  . ILE A 1 42  ? -7.019  0.772   -1.458  1.00 0.00 ? 196 ILE A CG1  5  
ATOM   9417  C  CG2  . ILE A 1 42  ? -4.524  0.474   -1.390  1.00 0.00 ? 196 ILE A CG2  5  
ATOM   9418  C  CD1  . ILE A 1 42  ? -7.223  -0.239  -0.325  1.00 0.00 ? 196 ILE A CD1  5  
ATOM   9419  H  H    . ILE A 1 42  ? -6.575  3.106   -2.710  1.00 0.00 ? 196 ILE A H    5  
ATOM   9420  H  HA   . ILE A 1 42  ? -4.668  1.174   -3.968  1.00 0.00 ? 196 ILE A HA   5  
ATOM   9421  H  HB   . ILE A 1 42  ? -5.878  -0.623  -2.629  1.00 0.00 ? 196 ILE A HB   5  
ATOM   9422  H  HG12 . ILE A 1 42  ? -6.885  1.758   -1.039  1.00 0.00 ? 196 ILE A HG12 5  
ATOM   9423  H  HG13 . ILE A 1 42  ? -7.886  0.770   -2.101  1.00 0.00 ? 196 ILE A HG13 5  
ATOM   9424  H  HG21 . ILE A 1 42  ? -3.907  -0.398  -1.559  1.00 0.00 ? 196 ILE A HG21 5  
ATOM   9425  H  HG22 . ILE A 1 42  ? -4.817  0.509   -0.351  1.00 0.00 ? 196 ILE A HG22 5  
ATOM   9426  H  HG23 . ILE A 1 42  ? -3.962  1.361   -1.634  1.00 0.00 ? 196 ILE A HG23 5  
ATOM   9427  H  HD11 . ILE A 1 42  ? -8.275  -0.463  -0.229  1.00 0.00 ? 196 ILE A HD11 5  
ATOM   9428  H  HD12 . ILE A 1 42  ? -6.858  0.180   0.601   1.00 0.00 ? 196 ILE A HD12 5  
ATOM   9429  H  HD13 . ILE A 1 42  ? -6.681  -1.146  -0.547  1.00 0.00 ? 196 ILE A HD13 5  
ATOM   9430  N  N    . CYS A 1 43  ? -7.048  -0.071  -4.927  1.00 0.00 ? 197 CYS A N    5  
ATOM   9431  C  CA   . CYS A 1 43  ? -8.156  -0.276  -5.912  1.00 0.00 ? 197 CYS A CA   5  
ATOM   9432  C  C    . CYS A 1 43  ? -9.336  -1.011  -5.241  1.00 0.00 ? 197 CYS A C    5  
ATOM   9433  O  O    . CYS A 1 43  ? -9.185  -1.587  -4.180  1.00 0.00 ? 197 CYS A O    5  
ATOM   9434  C  CB   . CYS A 1 43  ? -7.535  -1.091  -7.069  1.00 0.00 ? 197 CYS A CB   5  
ATOM   9435  S  SG   . CYS A 1 43  ? -7.128  -2.789  -6.558  1.00 0.00 ? 197 CYS A SG   5  
ATOM   9436  H  H    . CYS A 1 43  ? -6.540  -0.839  -4.604  1.00 0.00 ? 197 CYS A H    5  
ATOM   9437  H  HA   . CYS A 1 43  ? -8.490  0.683   -6.286  1.00 0.00 ? 197 CYS A HA   5  
ATOM   9438  H  HB2  . CYS A 1 43  ? -8.238  -1.131  -7.887  1.00 0.00 ? 197 CYS A HB2  5  
ATOM   9439  H  HB3  . CYS A 1 43  ? -6.635  -0.595  -7.404  1.00 0.00 ? 197 CYS A HB3  5  
ATOM   9440  N  N    . LYS A 1 44  ? -10.514 -0.978  -5.837  1.00 0.00 ? 198 LYS A N    5  
ATOM   9441  C  CA   . LYS A 1 44  ? -11.706 -1.667  -5.204  1.00 0.00 ? 198 LYS A CA   5  
ATOM   9442  C  C    . LYS A 1 44  ? -11.371 -3.115  -4.811  1.00 0.00 ? 198 LYS A C    5  
ATOM   9443  O  O    . LYS A 1 44  ? -11.694 -3.549  -3.720  1.00 0.00 ? 198 LYS A O    5  
ATOM   9444  C  CB   . LYS A 1 44  ? -12.832 -1.638  -6.249  1.00 0.00 ? 198 LYS A CB   5  
ATOM   9445  C  CG   . LYS A 1 44  ? -14.101 -2.266  -5.665  1.00 0.00 ? 198 LYS A CG   5  
ATOM   9446  C  CD   . LYS A 1 44  ? -15.109 -2.519  -6.786  1.00 0.00 ? 198 LYS A CD   5  
ATOM   9447  C  CE   . LYS A 1 44  ? -14.673 -3.740  -7.600  1.00 0.00 ? 198 LYS A CE   5  
ATOM   9448  N  NZ   . LYS A 1 44  ? -15.942 -4.412  -7.994  1.00 0.00 ? 198 LYS A NZ   5  
ATOM   9449  H  H    . LYS A 1 44  ? -10.616 -0.490  -6.689  1.00 0.00 ? 198 LYS A H    5  
ATOM   9450  H  HA   . LYS A 1 44  ? -12.018 -1.128  -4.332  1.00 0.00 ? 198 LYS A HA   5  
ATOM   9451  H  HB2  . LYS A 1 44  ? -13.033 -0.612  -6.522  1.00 0.00 ? 198 LYS A HB2  5  
ATOM   9452  H  HB3  . LYS A 1 44  ? -12.527 -2.193  -7.125  1.00 0.00 ? 198 LYS A HB3  5  
ATOM   9453  H  HG2  . LYS A 1 44  ? -13.851 -3.201  -5.185  1.00 0.00 ? 198 LYS A HG2  5  
ATOM   9454  H  HG3  . LYS A 1 44  ? -14.533 -1.594  -4.939  1.00 0.00 ? 198 LYS A HG3  5  
ATOM   9455  H  HD2  . LYS A 1 44  ? -16.085 -2.699  -6.359  1.00 0.00 ? 198 LYS A HD2  5  
ATOM   9456  H  HD3  . LYS A 1 44  ? -15.152 -1.656  -7.434  1.00 0.00 ? 198 LYS A HD3  5  
ATOM   9457  H  HE2  . LYS A 1 44  ? -14.120 -3.429  -8.476  1.00 0.00 ? 198 LYS A HE2  5  
ATOM   9458  H  HE3  . LYS A 1 44  ? -14.076 -4.403  -6.993  1.00 0.00 ? 198 LYS A HE3  5  
ATOM   9459  H  HZ1  . LYS A 1 44  ? -15.725 -5.291  -8.507  1.00 0.00 ? 198 LYS A HZ1  5  
ATOM   9460  H  HZ2  . LYS A 1 44  ? -16.493 -3.778  -8.608  1.00 0.00 ? 198 LYS A HZ2  5  
ATOM   9461  H  HZ3  . LYS A 1 44  ? -16.494 -4.639  -7.143  1.00 0.00 ? 198 LYS A HZ3  5  
ATOM   9462  N  N    . ASN A 1 45  ? -10.724 -3.862  -5.675  1.00 0.00 ? 199 ASN A N    5  
ATOM   9463  C  CA   . ASN A 1 45  ? -10.375 -5.283  -5.308  1.00 0.00 ? 199 ASN A CA   5  
ATOM   9464  C  C    . ASN A 1 45  ? -9.502  -5.322  -4.040  1.00 0.00 ? 199 ASN A C    5  
ATOM   9465  O  O    . ASN A 1 45  ? -9.529  -6.292  -3.307  1.00 0.00 ? 199 ASN A O    5  
ATOM   9466  C  CB   . ASN A 1 45  ? -9.610  -5.878  -6.500  1.00 0.00 ? 199 ASN A CB   5  
ATOM   9467  C  CG   . ASN A 1 45  ? -10.607 -6.467  -7.507  1.00 0.00 ? 199 ASN A CG   5  
ATOM   9468  O  OD1  . ASN A 1 45  ? -11.417 -7.302  -7.153  1.00 0.00 ? 199 ASN A OD1  5  
ATOM   9469  N  ND2  . ASN A 1 45  ? -10.587 -6.070  -8.756  1.00 0.00 ? 199 ASN A ND2  5  
ATOM   9470  H  H    . ASN A 1 45  ? -10.467 -3.489  -6.550  1.00 0.00 ? 199 ASN A H    5  
ATOM   9471  H  HA   . ASN A 1 45  ? -11.279 -5.844  -5.136  1.00 0.00 ? 199 ASN A HA   5  
ATOM   9472  H  HB2  . ASN A 1 45  ? -9.030  -5.102  -6.979  1.00 0.00 ? 199 ASN A HB2  5  
ATOM   9473  H  HB3  . ASN A 1 45  ? -8.951  -6.659  -6.152  1.00 0.00 ? 199 ASN A HB3  5  
ATOM   9474  H  HD21 . ASN A 1 45  ? -9.938  -5.396  -9.053  1.00 0.00 ? 199 ASN A HD21 5  
ATOM   9475  H  HD22 . ASN A 1 45  ? -11.225 -6.447  -9.397  1.00 0.00 ? 199 ASN A HD22 5  
ATOM   9476  N  N    . CYS A 1 46  ? -8.739  -4.281  -3.759  1.00 0.00 ? 200 CYS A N    5  
ATOM   9477  C  CA   . CYS A 1 46  ? -7.893  -4.296  -2.516  1.00 0.00 ? 200 CYS A CA   5  
ATOM   9478  C  C    . CYS A 1 46  ? -8.782  -4.015  -1.303  1.00 0.00 ? 200 CYS A C    5  
ATOM   9479  O  O    . CYS A 1 46  ? -8.710  -4.704  -0.308  1.00 0.00 ? 200 CYS A O    5  
ATOM   9480  C  CB   . CYS A 1 46  ? -6.846  -3.179  -2.665  1.00 0.00 ? 200 CYS A CB   5  
ATOM   9481  S  SG   . CYS A 1 46  ? -5.346  -3.845  -3.424  1.00 0.00 ? 200 CYS A SG   5  
ATOM   9482  H  H    . CYS A 1 46  ? -8.736  -3.498  -4.348  1.00 0.00 ? 200 CYS A H    5  
ATOM   9483  H  HA   . CYS A 1 46  ? -7.404  -5.251  -2.406  1.00 0.00 ? 200 CYS A HA   5  
ATOM   9484  H  HB2  . CYS A 1 46  ? -7.244  -2.391  -3.284  1.00 0.00 ? 200 CYS A HB2  5  
ATOM   9485  H  HB3  . CYS A 1 46  ? -6.607  -2.781  -1.690  1.00 0.00 ? 200 CYS A HB3  5  
ATOM   9486  N  N    . PHE A 1 47  ? -9.628  -3.012  -1.381  1.00 0.00 ? 201 PHE A N    5  
ATOM   9487  C  CA   . PHE A 1 47  ? -10.524 -2.704  -0.212  1.00 0.00 ? 201 PHE A CA   5  
ATOM   9488  C  C    . PHE A 1 47  ? -11.475 -3.882  0.047   1.00 0.00 ? 201 PHE A C    5  
ATOM   9489  O  O    . PHE A 1 47  ? -11.761 -4.201  1.187   1.00 0.00 ? 201 PHE A O    5  
ATOM   9490  C  CB   . PHE A 1 47  ? -11.318 -1.437  -0.579  1.00 0.00 ? 201 PHE A CB   5  
ATOM   9491  C  CG   . PHE A 1 47  ? -11.692 -0.681  0.674   1.00 0.00 ? 201 PHE A CG   5  
ATOM   9492  C  CD1  . PHE A 1 47  ? -10.758 0.159   1.297   1.00 0.00 ? 201 PHE A CD1  5  
ATOM   9493  C  CD2  . PHE A 1 47  ? -12.977 -0.815  1.211   1.00 0.00 ? 201 PHE A CD2  5  
ATOM   9494  C  CE1  . PHE A 1 47  ? -11.111 0.861   2.457   1.00 0.00 ? 201 PHE A CE1  5  
ATOM   9495  C  CE2  . PHE A 1 47  ? -13.329 -0.113  2.370   1.00 0.00 ? 201 PHE A CE2  5  
ATOM   9496  C  CZ   . PHE A 1 47  ? -12.397 0.725   2.993   1.00 0.00 ? 201 PHE A CZ   5  
ATOM   9497  H  H    . PHE A 1 47  ? -9.671  -2.471  -2.204  1.00 0.00 ? 201 PHE A H    5  
ATOM   9498  H  HA   . PHE A 1 47  ? -9.926  -2.525  0.668   1.00 0.00 ? 201 PHE A HA   5  
ATOM   9499  H  HB2  . PHE A 1 47  ? -10.710 -0.805  -1.211  1.00 0.00 ? 201 PHE A HB2  5  
ATOM   9500  H  HB3  . PHE A 1 47  ? -12.215 -1.717  -1.111  1.00 0.00 ? 201 PHE A HB3  5  
ATOM   9501  H  HD1  . PHE A 1 47  ? -9.766  0.266   0.882   1.00 0.00 ? 201 PHE A HD1  5  
ATOM   9502  H  HD2  . PHE A 1 47  ? -13.698 -1.462  0.733   1.00 0.00 ? 201 PHE A HD2  5  
ATOM   9503  H  HE1  . PHE A 1 47  ? -10.390 1.507   2.938   1.00 0.00 ? 201 PHE A HE1  5  
ATOM   9504  H  HE2  . PHE A 1 47  ? -14.322 -0.216  2.783   1.00 0.00 ? 201 PHE A HE2  5  
ATOM   9505  H  HZ   . PHE A 1 47  ? -12.669 1.266   3.887   1.00 0.00 ? 201 PHE A HZ   5  
ATOM   9506  N  N    . LYS A 1 48  ? -11.953 -4.549  -0.988  1.00 0.00 ? 202 LYS A N    5  
ATOM   9507  C  CA   . LYS A 1 48  ? -12.863 -5.721  -0.746  1.00 0.00 ? 202 LYS A CA   5  
ATOM   9508  C  C    . LYS A 1 48  ? -12.022 -6.946  -0.363  1.00 0.00 ? 202 LYS A C    5  
ATOM   9509  O  O    . LYS A 1 48  ? -12.419 -7.729  0.480   1.00 0.00 ? 202 LYS A O    5  
ATOM   9510  C  CB   . LYS A 1 48  ? -13.623 -5.974  -2.058  1.00 0.00 ? 202 LYS A CB   5  
ATOM   9511  C  CG   . LYS A 1 48  ? -14.824 -5.031  -2.142  1.00 0.00 ? 202 LYS A CG   5  
ATOM   9512  C  CD   . LYS A 1 48  ? -15.779 -5.517  -3.234  1.00 0.00 ? 202 LYS A CD   5  
ATOM   9513  C  CE   . LYS A 1 48  ? -16.577 -6.717  -2.719  1.00 0.00 ? 202 LYS A CE   5  
ATOM   9514  N  NZ   . LYS A 1 48  ? -17.119 -7.371  -3.942  1.00 0.00 ? 202 LYS A NZ   5  
ATOM   9515  H  H    . LYS A 1 48  ? -11.698 -4.296  -1.910  1.00 0.00 ? 202 LYS A H    5  
ATOM   9516  H  HA   . LYS A 1 48  ? -13.558 -5.492  0.048   1.00 0.00 ? 202 LYS A HA   5  
ATOM   9517  H  HB2  . LYS A 1 48  ? -12.964 -5.796  -2.894  1.00 0.00 ? 202 LYS A HB2  5  
ATOM   9518  H  HB3  . LYS A 1 48  ? -13.968 -6.997  -2.082  1.00 0.00 ? 202 LYS A HB3  5  
ATOM   9519  H  HG2  . LYS A 1 48  ? -15.338 -5.017  -1.192  1.00 0.00 ? 202 LYS A HG2  5  
ATOM   9520  H  HG3  . LYS A 1 48  ? -14.484 -4.035  -2.382  1.00 0.00 ? 202 LYS A HG3  5  
ATOM   9521  H  HD2  . LYS A 1 48  ? -16.459 -4.719  -3.499  1.00 0.00 ? 202 LYS A HD2  5  
ATOM   9522  H  HD3  . LYS A 1 48  ? -15.213 -5.811  -4.105  1.00 0.00 ? 202 LYS A HD3  5  
ATOM   9523  H  HE2  . LYS A 1 48  ? -15.927 -7.395  -2.182  1.00 0.00 ? 202 LYS A HE2  5  
ATOM   9524  H  HE3  . LYS A 1 48  ? -17.386 -6.388  -2.085  1.00 0.00 ? 202 LYS A HE3  5  
ATOM   9525  H  HZ1  . LYS A 1 48  ? -16.335 -7.677  -4.549  1.00 0.00 ? 202 LYS A HZ1  5  
ATOM   9526  H  HZ2  . LYS A 1 48  ? -17.718 -6.694  -4.460  1.00 0.00 ? 202 LYS A HZ2  5  
ATOM   9527  H  HZ3  . LYS A 1 48  ? -17.687 -8.198  -3.669  1.00 0.00 ? 202 LYS A HZ3  5  
ATOM   9528  N  N    . TYR A 1 49  ? -10.856 -7.114  -0.957  1.00 0.00 ? 203 TYR A N    5  
ATOM   9529  C  CA   . TYR A 1 49  ? -9.999  -8.293  -0.589  1.00 0.00 ? 203 TYR A CA   5  
ATOM   9530  C  C    . TYR A 1 49  ? -9.357  -8.061  0.790   1.00 0.00 ? 203 TYR A C    5  
ATOM   9531  O  O    . TYR A 1 49  ? -9.216  -8.991  1.563   1.00 0.00 ? 203 TYR A O    5  
ATOM   9532  C  CB   . TYR A 1 49  ? -8.922  -8.409  -1.681  1.00 0.00 ? 203 TYR A CB   5  
ATOM   9533  C  CG   . TYR A 1 49  ? -8.064  -9.627  -1.441  1.00 0.00 ? 203 TYR A CG   5  
ATOM   9534  C  CD1  . TYR A 1 49  ? -8.656  -10.876 -1.206  1.00 0.00 ? 203 TYR A CD1  5  
ATOM   9535  C  CD2  . TYR A 1 49  ? -6.670  -9.507  -1.463  1.00 0.00 ? 203 TYR A CD2  5  
ATOM   9536  C  CE1  . TYR A 1 49  ? -7.853  -12.002 -0.992  1.00 0.00 ? 203 TYR A CE1  5  
ATOM   9537  C  CE2  . TYR A 1 49  ? -5.867  -10.634 -1.249  1.00 0.00 ? 203 TYR A CE2  5  
ATOM   9538  C  CZ   . TYR A 1 49  ? -6.458  -11.881 -1.013  1.00 0.00 ? 203 TYR A CZ   5  
ATOM   9539  O  OH   . TYR A 1 49  ? -5.666  -12.992 -0.804  1.00 0.00 ? 203 TYR A OH   5  
ATOM   9540  H  H    . TYR A 1 49  ? -10.543 -6.463  -1.628  1.00 0.00 ? 203 TYR A H    5  
ATOM   9541  H  HA   . TYR A 1 49  ? -10.600 -9.191  -0.567  1.00 0.00 ? 203 TYR A HA   5  
ATOM   9542  H  HB2  . TYR A 1 49  ? -9.399  -8.493  -2.646  1.00 0.00 ? 203 TYR A HB2  5  
ATOM   9543  H  HB3  . TYR A 1 49  ? -8.301  -7.525  -1.665  1.00 0.00 ? 203 TYR A HB3  5  
ATOM   9544  H  HD1  . TYR A 1 49  ? -9.731  -10.968 -1.189  1.00 0.00 ? 203 TYR A HD1  5  
ATOM   9545  H  HD2  . TYR A 1 49  ? -6.215  -8.543  -1.643  1.00 0.00 ? 203 TYR A HD2  5  
ATOM   9546  H  HE1  . TYR A 1 49  ? -8.309  -12.964 -0.810  1.00 0.00 ? 203 TYR A HE1  5  
ATOM   9547  H  HE2  . TYR A 1 49  ? -4.792  -10.543 -1.267  1.00 0.00 ? 203 TYR A HE2  5  
ATOM   9548  H  HH   . TYR A 1 49  ? -5.433  -13.018 0.127   1.00 0.00 ? 203 TYR A HH   5  
ATOM   9549  N  N    . TYR A 1 50  ? -8.990  -6.833  1.126   1.00 0.00 ? 204 TYR A N    5  
ATOM   9550  C  CA   . TYR A 1 50  ? -8.392  -6.597  2.487   1.00 0.00 ? 204 TYR A CA   5  
ATOM   9551  C  C    . TYR A 1 50  ? -9.487  -6.774  3.551   1.00 0.00 ? 204 TYR A C    5  
ATOM   9552  O  O    . TYR A 1 50  ? -9.233  -7.287  4.624   1.00 0.00 ? 204 TYR A O    5  
ATOM   9553  C  CB   . TYR A 1 50  ? -7.846  -5.159  2.507   1.00 0.00 ? 204 TYR A CB   5  
ATOM   9554  C  CG   . TYR A 1 50  ? -6.690  -5.076  3.474   1.00 0.00 ? 204 TYR A CG   5  
ATOM   9555  C  CD1  . TYR A 1 50  ? -5.598  -5.940  3.329   1.00 0.00 ? 204 TYR A CD1  5  
ATOM   9556  C  CD2  . TYR A 1 50  ? -6.707  -4.137  4.512   1.00 0.00 ? 204 TYR A CD2  5  
ATOM   9557  C  CE1  . TYR A 1 50  ? -4.524  -5.867  4.221   1.00 0.00 ? 204 TYR A CE1  5  
ATOM   9558  C  CE2  . TYR A 1 50  ? -5.632  -4.064  5.406   1.00 0.00 ? 204 TYR A CE2  5  
ATOM   9559  C  CZ   . TYR A 1 50  ? -4.539  -4.929  5.260   1.00 0.00 ? 204 TYR A CZ   5  
ATOM   9560  O  OH   . TYR A 1 50  ? -3.480  -4.856  6.141   1.00 0.00 ? 204 TYR A OH   5  
ATOM   9561  H  H    . TYR A 1 50  ? -9.132  -6.078  0.502   1.00 0.00 ? 204 TYR A H    5  
ATOM   9562  H  HA   . TYR A 1 50  ? -7.590  -7.298  2.663   1.00 0.00 ? 204 TYR A HA   5  
ATOM   9563  H  HB2  . TYR A 1 50  ? -7.506  -4.889  1.521   1.00 0.00 ? 204 TYR A HB2  5  
ATOM   9564  H  HB3  . TYR A 1 50  ? -8.626  -4.480  2.820   1.00 0.00 ? 204 TYR A HB3  5  
ATOM   9565  H  HD1  . TYR A 1 50  ? -5.585  -6.662  2.527   1.00 0.00 ? 204 TYR A HD1  5  
ATOM   9566  H  HD2  . TYR A 1 50  ? -7.550  -3.471  4.625   1.00 0.00 ? 204 TYR A HD2  5  
ATOM   9567  H  HE1  . TYR A 1 50  ? -3.682  -6.535  4.107   1.00 0.00 ? 204 TYR A HE1  5  
ATOM   9568  H  HE2  . TYR A 1 50  ? -5.645  -3.340  6.208   1.00 0.00 ? 204 TYR A HE2  5  
ATOM   9569  H  HH   . TYR A 1 50  ? -2.991  -4.051  5.952   1.00 0.00 ? 204 TYR A HH   5  
ATOM   9570  N  N    . MET A 1 51  ? -10.714 -6.379  3.254   1.00 0.00 ? 205 MET A N    5  
ATOM   9571  C  CA   . MET A 1 51  ? -11.818 -6.566  4.255   1.00 0.00 ? 205 MET A CA   5  
ATOM   9572  C  C    . MET A 1 51  ? -12.349 -8.005  4.151   1.00 0.00 ? 205 MET A C    5  
ATOM   9573  O  O    . MET A 1 51  ? -12.624 -8.642  5.151   1.00 0.00 ? 205 MET A O    5  
ATOM   9574  C  CB   . MET A 1 51  ? -12.916 -5.551  3.891   1.00 0.00 ? 205 MET A CB   5  
ATOM   9575  C  CG   . MET A 1 51  ? -14.104 -5.710  4.842   1.00 0.00 ? 205 MET A CG   5  
ATOM   9576  S  SD   . MET A 1 51  ? -13.615 -5.206  6.511   1.00 0.00 ? 205 MET A SD   5  
ATOM   9577  C  CE   . MET A 1 51  ? -15.056 -5.870  7.380   1.00 0.00 ? 205 MET A CE   5  
ATOM   9578  H  H    . MET A 1 51  ? -10.909 -5.985  2.372   1.00 0.00 ? 205 MET A H    5  
ATOM   9579  H  HA   . MET A 1 51  ? -11.454 -6.377  5.249   1.00 0.00 ? 205 MET A HA   5  
ATOM   9580  H  HB2  . MET A 1 51  ? -12.520 -4.548  3.975   1.00 0.00 ? 205 MET A HB2  5  
ATOM   9581  H  HB3  . MET A 1 51  ? -13.243 -5.724  2.877   1.00 0.00 ? 205 MET A HB3  5  
ATOM   9582  H  HG2  . MET A 1 51  ? -14.922 -5.091  4.503   1.00 0.00 ? 205 MET A HG2  5  
ATOM   9583  H  HG3  . MET A 1 51  ? -14.416 -6.744  4.854   1.00 0.00 ? 205 MET A HG3  5  
ATOM   9584  H  HE1  . MET A 1 51  ? -15.635 -5.054  7.791   1.00 0.00 ? 205 MET A HE1  5  
ATOM   9585  H  HE2  . MET A 1 51  ? -14.729 -6.515  8.181   1.00 0.00 ? 205 MET A HE2  5  
ATOM   9586  H  HE3  . MET A 1 51  ? -15.663 -6.437  6.688   1.00 0.00 ? 205 MET A HE3  5  
ATOM   9587  N  N    . SER A 1 52  ? -12.484 -8.531  2.947   1.00 0.00 ? 206 SER A N    5  
ATOM   9588  C  CA   . SER A 1 52  ? -12.988 -9.947  2.794   1.00 0.00 ? 206 SER A CA   5  
ATOM   9589  C  C    . SER A 1 52  ? -12.120 -10.908 3.624   1.00 0.00 ? 206 SER A C    5  
ATOM   9590  O  O    . SER A 1 52  ? -12.622 -11.825 4.246   1.00 0.00 ? 206 SER A O    5  
ATOM   9591  C  CB   . SER A 1 52  ? -12.880 -10.300 1.303   1.00 0.00 ? 206 SER A CB   5  
ATOM   9592  O  OG   . SER A 1 52  ? -12.946 -11.712 1.148   1.00 0.00 ? 206 SER A OG   5  
ATOM   9593  H  H    . SER A 1 52  ? -12.250 -7.998  2.153   1.00 0.00 ? 206 SER A H    5  
ATOM   9594  H  HA   . SER A 1 52  ? -14.011 -10.010 3.109   1.00 0.00 ? 206 SER A HA   5  
ATOM   9595  H  HB2  . SER A 1 52  ? -13.693 -9.846  0.763   1.00 0.00 ? 206 SER A HB2  5  
ATOM   9596  H  HB3  . SER A 1 52  ? -11.941 -9.928  0.914   1.00 0.00 ? 206 SER A HB3  5  
ATOM   9597  H  HG   . SER A 1 52  ? -12.717 -11.921 0.241   1.00 0.00 ? 206 SER A HG   5  
ATOM   9598  N  N    . ASP A 1 53  ? -10.821 -10.697 3.643   1.00 0.00 ? 207 ASP A N    5  
ATOM   9599  C  CA   . ASP A 1 53  ? -9.925  -11.589 4.437   1.00 0.00 ? 207 ASP A CA   5  
ATOM   9600  C  C    . ASP A 1 53  ? -9.129  -10.753 5.452   1.00 0.00 ? 207 ASP A C    5  
ATOM   9601  O  O    . ASP A 1 53  ? -8.699  -9.656  5.149   1.00 0.00 ? 207 ASP A O    5  
ATOM   9602  C  CB   . ASP A 1 53  ? -8.987  -12.226 3.411   1.00 0.00 ? 207 ASP A CB   5  
ATOM   9603  C  CG   . ASP A 1 53  ? -9.531  -13.597 3.004   1.00 0.00 ? 207 ASP A CG   5  
ATOM   9604  O  OD1  . ASP A 1 53  ? -10.644 -13.646 2.507   1.00 0.00 ? 207 ASP A OD1  5  
ATOM   9605  O  OD2  . ASP A 1 53  ? -8.825  -14.574 3.196   1.00 0.00 ? 207 ASP A OD2  5  
ATOM   9606  H  H    . ASP A 1 53  ? -10.434 -9.947  3.139   1.00 0.00 ? 207 ASP A H    5  
ATOM   9607  H  HA   . ASP A 1 53  ? -10.498 -12.350 4.941   1.00 0.00 ? 207 ASP A HA   5  
ATOM   9608  H  HB2  . ASP A 1 53  ? -8.922  -11.591 2.540   1.00 0.00 ? 207 ASP A HB2  5  
ATOM   9609  H  HB3  . ASP A 1 53  ? -8.007  -12.345 3.845   1.00 0.00 ? 207 ASP A HB3  5  
ATOM   9610  N  N    . ASP A 1 54  ? -8.927  -11.255 6.652   1.00 0.00 ? 208 ASP A N    5  
ATOM   9611  C  CA   . ASP A 1 54  ? -8.159  -10.471 7.671   1.00 0.00 ? 208 ASP A CA   5  
ATOM   9612  C  C    . ASP A 1 54  ? -6.790  -11.120 7.924   1.00 0.00 ? 208 ASP A C    5  
ATOM   9613  O  O    . ASP A 1 54  ? -6.639  -12.321 7.804   1.00 0.00 ? 208 ASP A O    5  
ATOM   9614  C  CB   . ASP A 1 54  ? -9.012  -10.505 8.941   1.00 0.00 ? 208 ASP A CB   5  
ATOM   9615  C  CG   . ASP A 1 54  ? -10.067 -9.399  8.877   1.00 0.00 ? 208 ASP A CG   5  
ATOM   9616  O  OD1  . ASP A 1 54  ? -11.107 -9.633  8.283   1.00 0.00 ? 208 ASP A OD1  5  
ATOM   9617  O  OD2  . ASP A 1 54  ? -9.817  -8.337  9.424   1.00 0.00 ? 208 ASP A OD2  5  
ATOM   9618  H  H    . ASP A 1 54  ? -9.279  -12.145 6.886   1.00 0.00 ? 208 ASP A H    5  
ATOM   9619  H  HA   . ASP A 1 54  ? -8.031  -9.452  7.341   1.00 0.00 ? 208 ASP A HA   5  
ATOM   9620  H  HB2  . ASP A 1 54  ? -9.501  -11.466 9.020   1.00 0.00 ? 208 ASP A HB2  5  
ATOM   9621  H  HB3  . ASP A 1 54  ? -8.381  -10.350 9.803   1.00 0.00 ? 208 ASP A HB3  5  
ATOM   9622  N  N    . ILE A 1 55  ? -5.791  -10.335 8.275   1.00 0.00 ? 209 ILE A N    5  
ATOM   9623  C  CA   . ILE A 1 55  ? -4.438  -10.921 8.536   1.00 0.00 ? 209 ILE A CA   5  
ATOM   9624  C  C    . ILE A 1 55  ? -4.130  -10.886 10.040  1.00 0.00 ? 209 ILE A C    5  
ATOM   9625  O  O    . ILE A 1 55  ? -4.175  -9.841  10.662  1.00 0.00 ? 209 ILE A O    5  
ATOM   9626  C  CB   . ILE A 1 55  ? -3.449  -10.040 7.759   1.00 0.00 ? 209 ILE A CB   5  
ATOM   9627  C  CG1  . ILE A 1 55  ? -3.802  -10.057 6.262   1.00 0.00 ? 209 ILE A CG1  5  
ATOM   9628  C  CG2  . ILE A 1 55  ? -2.023  -10.565 7.957   1.00 0.00 ? 209 ILE A CG2  5  
ATOM   9629  C  CD1  . ILE A 1 55  ? -3.749  -11.490 5.713   1.00 0.00 ? 209 ILE A CD1  5  
ATOM   9630  H  H    . ILE A 1 55  ? -5.931  -9.366  8.371   1.00 0.00 ? 209 ILE A H    5  
ATOM   9631  H  HA   . ILE A 1 55  ? -4.394  -11.934 8.170   1.00 0.00 ? 209 ILE A HA   5  
ATOM   9632  H  HB   . ILE A 1 55  ? -3.510  -9.027  8.130   1.00 0.00 ? 209 ILE A HB   5  
ATOM   9633  H  HG12 . ILE A 1 55  ? -4.797  -9.659  6.125   1.00 0.00 ? 209 ILE A HG12 5  
ATOM   9634  H  HG13 . ILE A 1 55  ? -3.096  -9.444  5.723   1.00 0.00 ? 209 ILE A HG13 5  
ATOM   9635  H  HG21 . ILE A 1 55  ? -1.552  -10.030 8.770   1.00 0.00 ? 209 ILE A HG21 5  
ATOM   9636  H  HG22 . ILE A 1 55  ? -1.454  -10.413 7.051   1.00 0.00 ? 209 ILE A HG22 5  
ATOM   9637  H  HG23 . ILE A 1 55  ? -2.054  -11.619 8.191   1.00 0.00 ? 209 ILE A HG23 5  
ATOM   9638  H  HD11 . ILE A 1 55  ? -3.099  -11.522 4.852   1.00 0.00 ? 209 ILE A HD11 5  
ATOM   9639  H  HD12 . ILE A 1 55  ? -4.742  -11.801 5.424   1.00 0.00 ? 209 ILE A HD12 5  
ATOM   9640  H  HD13 . ILE A 1 55  ? -3.372  -12.159 6.476   1.00 0.00 ? 209 ILE A HD13 5  
ATOM   9641  N  N    . SER A 1 56  ? -3.818  -12.021 10.631  1.00 0.00 ? 210 SER A N    5  
ATOM   9642  C  CA   . SER A 1 56  ? -3.508  -12.041 12.100  1.00 0.00 ? 210 SER A CA   5  
ATOM   9643  C  C    . SER A 1 56  ? -2.931  -13.403 12.522  1.00 0.00 ? 210 SER A C    5  
ATOM   9644  O  O    . SER A 1 56  ? -1.828  -13.483 13.027  1.00 0.00 ? 210 SER A O    5  
ATOM   9645  C  CB   . SER A 1 56  ? -4.850  -11.793 12.793  1.00 0.00 ? 210 SER A CB   5  
ATOM   9646  O  OG   . SER A 1 56  ? -4.654  -10.915 13.893  1.00 0.00 ? 210 SER A OG   5  
ATOM   9647  H  H    . SER A 1 56  ? -3.787  -12.858 10.110  1.00 0.00 ? 210 SER A H    5  
ATOM   9648  H  HA   . SER A 1 56  ? -2.819  -11.255 12.346  1.00 0.00 ? 210 SER A HA   5  
ATOM   9649  H  HB2  . SER A 1 56  ? -5.537  -11.342 12.098  1.00 0.00 ? 210 SER A HB2  5  
ATOM   9650  H  HB3  . SER A 1 56  ? -5.256  -12.734 13.138  1.00 0.00 ? 210 SER A HB3  5  
ATOM   9651  H  HG   . SER A 1 56  ? -4.251  -11.417 14.606  1.00 0.00 ? 210 SER A HG   5  
ATOM   9652  N  N    . ARG A 1 57  ? -3.671  -14.470 12.320  1.00 0.00 ? 211 ARG A N    5  
ATOM   9653  C  CA   . ARG A 1 57  ? -3.165  -15.819 12.711  1.00 0.00 ? 211 ARG A CA   5  
ATOM   9654  C  C    . ARG A 1 57  ? -3.005  -16.706 11.465  1.00 0.00 ? 211 ARG A C    5  
ATOM   9655  O  O    . ARG A 1 57  ? -3.978  -17.203 10.928  1.00 0.00 ? 211 ARG A O    5  
ATOM   9656  C  CB   . ARG A 1 57  ? -4.235  -16.392 13.643  1.00 0.00 ? 211 ARG A CB   5  
ATOM   9657  C  CG   . ARG A 1 57  ? -3.823  -16.161 15.099  1.00 0.00 ? 211 ARG A CG   5  
ATOM   9658  C  CD   . ARG A 1 57  ? -4.173  -14.729 15.511  1.00 0.00 ? 211 ARG A CD   5  
ATOM   9659  N  NE   . ARG A 1 57  ? -5.651  -14.741 15.734  1.00 0.00 ? 211 ARG A NE   5  
ATOM   9660  C  CZ   . ARG A 1 57  ? -6.183  -15.356 16.781  1.00 0.00 ? 211 ARG A CZ   5  
ATOM   9661  N  NH1  . ARG A 1 57  ? -5.435  -15.984 17.660  1.00 0.00 ? 211 ARG A NH1  5  
ATOM   9662  N  NH2  . ARG A 1 57  ? -7.480  -15.341 16.947  1.00 0.00 ? 211 ARG A NH2  5  
ATOM   9663  H  H    . ARG A 1 57  ? -4.559  -14.385 11.912  1.00 0.00 ? 211 ARG A H    5  
ATOM   9664  H  HA   . ARG A 1 57  ? -2.226  -15.732 13.233  1.00 0.00 ? 211 ARG A HA   5  
ATOM   9665  H  HB2  . ARG A 1 57  ? -5.177  -15.899 13.453  1.00 0.00 ? 211 ARG A HB2  5  
ATOM   9666  H  HB3  . ARG A 1 57  ? -4.338  -17.451 13.464  1.00 0.00 ? 211 ARG A HB3  5  
ATOM   9667  H  HG2  . ARG A 1 57  ? -4.348  -16.858 15.736  1.00 0.00 ? 211 ARG A HG2  5  
ATOM   9668  H  HG3  . ARG A 1 57  ? -2.758  -16.312 15.201  1.00 0.00 ? 211 ARG A HG3  5  
ATOM   9669  H  HD2  . ARG A 1 57  ? -3.654  -14.463 16.422  1.00 0.00 ? 211 ARG A HD2  5  
ATOM   9670  H  HD3  . ARG A 1 57  ? -3.926  -14.039 14.720  1.00 0.00 ? 211 ARG A HD3  5  
ATOM   9671  H  HE   . ARG A 1 57  ? -6.235  -14.283 15.093  1.00 0.00 ? 211 ARG A HE   5  
ATOM   9672  H  HH11 . ARG A 1 57  ? -4.443  -16.010 17.554  1.00 0.00 ? 211 ARG A HH11 5  
ATOM   9673  H  HH12 . ARG A 1 57  ? -5.864  -16.438 18.440  1.00 0.00 ? 211 ARG A HH12 5  
ATOM   9674  H  HH21 . ARG A 1 57  ? -8.064  -14.869 16.288  1.00 0.00 ? 211 ARG A HH21 5  
ATOM   9675  H  HH22 . ARG A 1 57  ? -7.888  -15.802 17.735  1.00 0.00 ? 211 ARG A HH22 5  
ATOM   9676  N  N    . ASP A 1 58  ? -1.789  -16.913 11.000  1.00 0.00 ? 212 ASP A N    5  
ATOM   9677  C  CA   . ASP A 1 58  ? -1.592  -17.777 9.784   1.00 0.00 ? 212 ASP A CA   5  
ATOM   9678  C  C    . ASP A 1 58  ? -1.539  -19.261 10.190  1.00 0.00 ? 212 ASP A C    5  
ATOM   9679  O  O    . ASP A 1 58  ? -1.911  -19.615 11.293  1.00 0.00 ? 212 ASP A O    5  
ATOM   9680  C  CB   . ASP A 1 58  ? -0.257  -17.340 9.158   1.00 0.00 ? 212 ASP A CB   5  
ATOM   9681  C  CG   . ASP A 1 58  ? -0.391  -17.306 7.634   1.00 0.00 ? 212 ASP A CG   5  
ATOM   9682  O  OD1  . ASP A 1 58  ? -1.085  -18.155 7.101   1.00 0.00 ? 212 ASP A OD1  5  
ATOM   9683  O  OD2  . ASP A 1 58  ? 0.202   -16.430 7.027   1.00 0.00 ? 212 ASP A OD2  5  
ATOM   9684  H  H    . ASP A 1 58  ? -1.013  -16.504 11.451  1.00 0.00 ? 212 ASP A H    5  
ATOM   9685  H  HA   . ASP A 1 58  ? -2.395  -17.614 9.083   1.00 0.00 ? 212 ASP A HA   5  
ATOM   9686  H  HB2  . ASP A 1 58  ? 0.004   -16.356 9.519   1.00 0.00 ? 212 ASP A HB2  5  
ATOM   9687  H  HB3  . ASP A 1 58  ? 0.517   -18.041 9.434   1.00 0.00 ? 212 ASP A HB3  5  
ATOM   9688  N  N    . SER A 1 59  ? -1.094  -20.136 9.306   1.00 0.00 ? 213 SER A N    5  
ATOM   9689  C  CA   . SER A 1 59  ? -1.039  -21.608 9.654   1.00 0.00 ? 213 SER A CA   5  
ATOM   9690  C  C    . SER A 1 59  ? -0.350  -21.853 11.013  1.00 0.00 ? 213 SER A C    5  
ATOM   9691  O  O    . SER A 1 59  ? -0.673  -22.803 11.701  1.00 0.00 ? 213 SER A O    5  
ATOM   9692  C  CB   . SER A 1 59  ? -0.233  -22.289 8.539   1.00 0.00 ? 213 SER A CB   5  
ATOM   9693  O  OG   . SER A 1 59  ? 0.255   -23.539 9.008   1.00 0.00 ? 213 SER A OG   5  
ATOM   9694  H  H    . SER A 1 59  ? -0.811  -19.827 8.413   1.00 0.00 ? 213 SER A H    5  
ATOM   9695  H  HA   . SER A 1 59  ? -2.038  -22.015 9.674   1.00 0.00 ? 213 SER A HA   5  
ATOM   9696  H  HB2  . SER A 1 59  ? -0.867  -22.455 7.683   1.00 0.00 ? 213 SER A HB2  5  
ATOM   9697  H  HB3  . SER A 1 59  ? 0.594   -21.652 8.253   1.00 0.00 ? 213 SER A HB3  5  
ATOM   9698  H  HG   . SER A 1 59  ? 0.504   -24.066 8.244   1.00 0.00 ? 213 SER A HG   5  
ATOM   9699  N  N    . ASP A 1 60  ? 0.596   -21.020 11.409  1.00 0.00 ? 214 ASP A N    5  
ATOM   9700  C  CA   . ASP A 1 60  ? 1.282   -21.250 12.726  1.00 0.00 ? 214 ASP A CA   5  
ATOM   9701  C  C    . ASP A 1 60  ? 0.732   -20.303 13.808  1.00 0.00 ? 214 ASP A C    5  
ATOM   9702  O  O    . ASP A 1 60  ? 1.465   -19.869 14.677  1.00 0.00 ? 214 ASP A O    5  
ATOM   9703  C  CB   . ASP A 1 60  ? 2.767   -20.969 12.475  1.00 0.00 ? 214 ASP A CB   5  
ATOM   9704  C  CG   . ASP A 1 60  ? 3.611   -21.735 13.496  1.00 0.00 ? 214 ASP A CG   5  
ATOM   9705  O  OD1  . ASP A 1 60  ? 3.463   -22.943 13.571  1.00 0.00 ? 214 ASP A OD1  5  
ATOM   9706  O  OD2  . ASP A 1 60  ? 4.392   -21.099 14.184  1.00 0.00 ? 214 ASP A OD2  5  
ATOM   9707  H  H    . ASP A 1 60  ? 0.854   -20.255 10.846  1.00 0.00 ? 214 ASP A H    5  
ATOM   9708  H  HA   . ASP A 1 60  ? 1.154   -22.275 13.035  1.00 0.00 ? 214 ASP A HA   5  
ATOM   9709  H  HB2  . ASP A 1 60  ? 3.030   -21.289 11.476  1.00 0.00 ? 214 ASP A HB2  5  
ATOM   9710  H  HB3  . ASP A 1 60  ? 2.956   -19.911 12.575  1.00 0.00 ? 214 ASP A HB3  5  
ATOM   9711  N  N    . GLY A 1 61  ? -0.549  -19.982 13.777  1.00 0.00 ? 215 GLY A N    5  
ATOM   9712  C  CA   . GLY A 1 61  ? -1.134  -19.071 14.816  1.00 0.00 ? 215 GLY A CA   5  
ATOM   9713  C  C    . GLY A 1 61  ? -0.293  -17.787 14.961  1.00 0.00 ? 215 GLY A C    5  
ATOM   9714  O  O    . GLY A 1 61  ? -0.179  -17.245 16.045  1.00 0.00 ? 215 GLY A O    5  
ATOM   9715  H  H    . GLY A 1 61  ? -1.133  -20.346 13.076  1.00 0.00 ? 215 GLY A H    5  
ATOM   9716  H  HA2  . GLY A 1 61  ? -2.141  -18.807 14.529  1.00 0.00 ? 215 GLY A HA2  5  
ATOM   9717  H  HA3  . GLY A 1 61  ? -1.158  -19.586 15.765  1.00 0.00 ? 215 GLY A HA3  5  
ATOM   9718  N  N    . MET A 1 62  ? 0.293   -17.293 13.888  1.00 0.00 ? 216 MET A N    5  
ATOM   9719  C  CA   . MET A 1 62  ? 1.115   -16.050 13.991  1.00 0.00 ? 216 MET A CA   5  
ATOM   9720  C  C    . MET A 1 62  ? 0.905   -15.170 12.749  1.00 0.00 ? 216 MET A C    5  
ATOM   9721  O  O    . MET A 1 62  ? 0.745   -15.674 11.653  1.00 0.00 ? 216 MET A O    5  
ATOM   9722  C  CB   . MET A 1 62  ? 2.562   -16.536 14.065  1.00 0.00 ? 216 MET A CB   5  
ATOM   9723  C  CG   . MET A 1 62  ? 3.385   -15.569 14.919  1.00 0.00 ? 216 MET A CG   5  
ATOM   9724  S  SD   . MET A 1 62  ? 5.108   -16.118 14.962  1.00 0.00 ? 216 MET A SD   5  
ATOM   9725  C  CE   . MET A 1 62  ? 5.663   -15.245 13.477  1.00 0.00 ? 216 MET A CE   5  
ATOM   9726  H  H    . MET A 1 62  ? 0.196   -17.735 13.018  1.00 0.00 ? 216 MET A H    5  
ATOM   9727  H  HA   . MET A 1 62  ? 0.862   -15.504 14.887  1.00 0.00 ? 216 MET A HA   5  
ATOM   9728  H  HB2  . MET A 1 62  ? 2.588   -17.521 14.510  1.00 0.00 ? 216 MET A HB2  5  
ATOM   9729  H  HB3  . MET A 1 62  ? 2.979   -16.580 13.070  1.00 0.00 ? 216 MET A HB3  5  
ATOM   9730  H  HG2  . MET A 1 62  ? 3.333   -14.578 14.489  1.00 0.00 ? 216 MET A HG2  5  
ATOM   9731  H  HG3  . MET A 1 62  ? 2.988   -15.548 15.923  1.00 0.00 ? 216 MET A HG3  5  
ATOM   9732  H  HE1  . MET A 1 62  ? 5.826   -15.958 12.681  1.00 0.00 ? 216 MET A HE1  5  
ATOM   9733  H  HE2  . MET A 1 62  ? 6.584   -14.726 13.686  1.00 0.00 ? 216 MET A HE2  5  
ATOM   9734  H  HE3  . MET A 1 62  ? 4.908   -14.530 13.178  1.00 0.00 ? 216 MET A HE3  5  
ATOM   9735  N  N    . ASP A 1 63  ? 0.906   -13.860 12.904  1.00 0.00 ? 217 ASP A N    5  
ATOM   9736  C  CA   . ASP A 1 63  ? 0.705   -12.967 11.705  1.00 0.00 ? 217 ASP A CA   5  
ATOM   9737  C  C    . ASP A 1 63  ? 1.809   -13.229 10.668  1.00 0.00 ? 217 ASP A C    5  
ATOM   9738  O  O    . ASP A 1 63  ? 2.955   -12.882 10.882  1.00 0.00 ? 217 ASP A O    5  
ATOM   9739  C  CB   . ASP A 1 63  ? 0.789   -11.517 12.208  1.00 0.00 ? 217 ASP A CB   5  
ATOM   9740  C  CG   . ASP A 1 63  ? 0.308   -10.567 11.111  1.00 0.00 ? 217 ASP A CG   5  
ATOM   9741  O  OD1  . ASP A 1 63  ? 0.895   -10.583 10.041  1.00 0.00 ? 217 ASP A OD1  5  
ATOM   9742  O  OD2  . ASP A 1 63  ? -0.639  -9.838  11.358  1.00 0.00 ? 217 ASP A OD2  5  
ATOM   9743  H  H    . ASP A 1 63  ? 1.038   -13.470 13.802  1.00 0.00 ? 217 ASP A H    5  
ATOM   9744  H  HA   . ASP A 1 63  ? -0.265  -13.147 11.266  1.00 0.00 ? 217 ASP A HA   5  
ATOM   9745  H  HB2  . ASP A 1 63  ? 0.164   -11.404 13.083  1.00 0.00 ? 217 ASP A HB2  5  
ATOM   9746  H  HB3  . ASP A 1 63  ? 1.811   -11.283 12.464  1.00 0.00 ? 217 ASP A HB3  5  
ATOM   9747  N  N    . GLU A 1 64  ? 1.478   -13.839 9.548   1.00 0.00 ? 218 GLU A N    5  
ATOM   9748  C  CA   . GLU A 1 64  ? 2.517   -14.116 8.513   1.00 0.00 ? 218 GLU A CA   5  
ATOM   9749  C  C    . GLU A 1 64  ? 1.988   -13.751 7.119   1.00 0.00 ? 218 GLU A C    5  
ATOM   9750  O  O    . GLU A 1 64  ? 2.110   -14.522 6.185   1.00 0.00 ? 218 GLU A O    5  
ATOM   9751  C  CB   . GLU A 1 64  ? 2.788   -15.619 8.610   1.00 0.00 ? 218 GLU A CB   5  
ATOM   9752  C  CG   . GLU A 1 64  ? 4.000   -15.863 9.511   1.00 0.00 ? 218 GLU A CG   5  
ATOM   9753  C  CD   . GLU A 1 64  ? 4.581   -17.248 9.221   1.00 0.00 ? 218 GLU A CD   5  
ATOM   9754  O  OE1  . GLU A 1 64  ? 3.905   -18.224 9.504   1.00 0.00 ? 218 GLU A OE1  5  
ATOM   9755  O  OE2  . GLU A 1 64  ? 5.691   -17.310 8.720   1.00 0.00 ? 218 GLU A OE2  5  
ATOM   9756  H  H    . GLU A 1 64  ? 0.548   -14.115 9.386   1.00 0.00 ? 218 GLU A H    5  
ATOM   9757  H  HA   . GLU A 1 64  ? 3.419   -13.564 8.728   1.00 0.00 ? 218 GLU A HA   5  
ATOM   9758  H  HB2  . GLU A 1 64  ? 1.922   -16.113 9.027   1.00 0.00 ? 218 GLU A HB2  5  
ATOM   9759  H  HB3  . GLU A 1 64  ? 2.989   -16.013 7.625   1.00 0.00 ? 218 GLU A HB3  5  
ATOM   9760  H  HG2  . GLU A 1 64  ? 4.749   -15.110 9.318   1.00 0.00 ? 218 GLU A HG2  5  
ATOM   9761  H  HG3  . GLU A 1 64  ? 3.695   -15.813 10.546  1.00 0.00 ? 218 GLU A HG3  5  
ATOM   9762  N  N    . GLN A 1 65  ? 1.400   -12.583 6.970   1.00 0.00 ? 219 GLN A N    5  
ATOM   9763  C  CA   . GLN A 1 65  ? 0.867   -12.177 5.635   1.00 0.00 ? 219 GLN A CA   5  
ATOM   9764  C  C    . GLN A 1 65  ? 1.204   -10.703 5.359   1.00 0.00 ? 219 GLN A C    5  
ATOM   9765  O  O    . GLN A 1 65  ? 1.794   -10.037 6.188   1.00 0.00 ? 219 GLN A O    5  
ATOM   9766  C  CB   . GLN A 1 65  ? -0.648  -12.377 5.734   1.00 0.00 ? 219 GLN A CB   5  
ATOM   9767  C  CG   . GLN A 1 65  ? -1.053  -13.647 4.981   1.00 0.00 ? 219 GLN A CG   5  
ATOM   9768  C  CD   . GLN A 1 65  ? -1.382  -13.298 3.523   1.00 0.00 ? 219 GLN A CD   5  
ATOM   9769  O  OE1  . GLN A 1 65  ? -0.898  -12.311 3.004   1.00 0.00 ? 219 GLN A OE1  5  
ATOM   9770  N  NE2  . GLN A 1 65  ? -2.189  -14.066 2.833   1.00 0.00 ? 219 GLN A NE2  5  
ATOM   9771  H  H    . GLN A 1 65  ? 1.310   -11.970 7.732   1.00 0.00 ? 219 GLN A H    5  
ATOM   9772  H  HA   . GLN A 1 65  ? 1.275   -12.808 4.860   1.00 0.00 ? 219 GLN A HA   5  
ATOM   9773  H  HB2  . GLN A 1 65  ? -0.931  -12.468 6.772   1.00 0.00 ? 219 GLN A HB2  5  
ATOM   9774  H  HB3  . GLN A 1 65  ? -1.152  -11.527 5.297   1.00 0.00 ? 219 GLN A HB3  5  
ATOM   9775  H  HG2  . GLN A 1 65  ? -0.239  -14.356 5.007   1.00 0.00 ? 219 GLN A HG2  5  
ATOM   9776  H  HG3  . GLN A 1 65  ? -1.924  -14.081 5.449   1.00 0.00 ? 219 GLN A HG3  5  
ATOM   9777  H  HE21 . GLN A 1 65  ? -2.586  -14.866 3.242   1.00 0.00 ? 219 GLN A HE21 5  
ATOM   9778  H  HE22 . GLN A 1 65  ? -2.397  -13.841 1.901   1.00 0.00 ? 219 GLN A HE22 5  
ATOM   9779  N  N    . CYS A 1 66  ? 0.835   -10.187 4.204   1.00 0.00 ? 220 CYS A N    5  
ATOM   9780  C  CA   . CYS A 1 66  ? 1.148   -8.746  3.893   1.00 0.00 ? 220 CYS A CA   5  
ATOM   9781  C  C    . CYS A 1 66  ? 0.079   -7.819  4.494   1.00 0.00 ? 220 CYS A C    5  
ATOM   9782  O  O    . CYS A 1 66  ? -1.060  -8.211  4.666   1.00 0.00 ? 220 CYS A O    5  
ATOM   9783  C  CB   . CYS A 1 66  ? 1.128   -8.630  2.365   1.00 0.00 ? 220 CYS A CB   5  
ATOM   9784  S  SG   . CYS A 1 66  ? 1.630   -6.964  1.867   1.00 0.00 ? 220 CYS A SG   5  
ATOM   9785  H  H    . CYS A 1 66  ? 0.356   -10.746 3.544   1.00 0.00 ? 220 CYS A H    5  
ATOM   9786  H  HA   . CYS A 1 66  ? 2.126   -8.483  4.267   1.00 0.00 ? 220 CYS A HA   5  
ATOM   9787  H  HB2  . CYS A 1 66  ? 1.808   -9.352  1.943   1.00 0.00 ? 220 CYS A HB2  5  
ATOM   9788  H  HB3  . CYS A 1 66  ? 0.130   -8.825  2.005   1.00 0.00 ? 220 CYS A HB3  5  
ATOM   9789  N  N    . ARG A 1 67  ? 0.428   -6.580  4.786   1.00 0.00 ? 221 ARG A N    5  
ATOM   9790  C  CA   . ARG A 1 67  ? -0.587  -5.629  5.341   1.00 0.00 ? 221 ARG A CA   5  
ATOM   9791  C  C    . ARG A 1 67  ? -0.980  -4.605  4.257   1.00 0.00 ? 221 ARG A C    5  
ATOM   9792  O  O    . ARG A 1 67  ? -1.210  -3.446  4.545   1.00 0.00 ? 221 ARG A O    5  
ATOM   9793  C  CB   . ARG A 1 67  ? 0.093   -4.936  6.525   1.00 0.00 ? 221 ARG A CB   5  
ATOM   9794  C  CG   . ARG A 1 67  ? 0.065   -5.862  7.744   1.00 0.00 ? 221 ARG A CG   5  
ATOM   9795  C  CD   . ARG A 1 67  ? -1.369  -5.958  8.291   1.00 0.00 ? 221 ARG A CD   5  
ATOM   9796  N  NE   . ARG A 1 67  ? -1.483  -4.919  9.377   1.00 0.00 ? 221 ARG A NE   5  
ATOM   9797  C  CZ   . ARG A 1 67  ? -2.349  -5.055  10.372  1.00 0.00 ? 221 ARG A CZ   5  
ATOM   9798  N  NH1  . ARG A 1 67  ? -3.171  -6.077  10.436  1.00 0.00 ? 221 ARG A NH1  5  
ATOM   9799  N  NH2  . ARG A 1 67  ? -2.404  -4.141  11.307  1.00 0.00 ? 221 ARG A NH2  5  
ATOM   9800  H  H    . ARG A 1 67  ? 1.347   -6.270  4.619   1.00 0.00 ? 221 ARG A H    5  
ATOM   9801  H  HA   . ARG A 1 67  ? -1.458  -6.169  5.677   1.00 0.00 ? 221 ARG A HA   5  
ATOM   9802  H  HB2  . ARG A 1 67  ? 1.117   -4.707  6.268   1.00 0.00 ? 221 ARG A HB2  5  
ATOM   9803  H  HB3  . ARG A 1 67  ? -0.433  -4.023  6.758   1.00 0.00 ? 221 ARG A HB3  5  
ATOM   9804  H  HG2  . ARG A 1 67  ? 0.408   -6.846  7.456   1.00 0.00 ? 221 ARG A HG2  5  
ATOM   9805  H  HG3  . ARG A 1 67  ? 0.714   -5.465  8.511   1.00 0.00 ? 221 ARG A HG3  5  
ATOM   9806  H  HD2  . ARG A 1 67  ? -2.083  -5.755  7.505   1.00 0.00 ? 221 ARG A HD2  5  
ATOM   9807  H  HD3  . ARG A 1 67  ? -1.538  -6.939  8.703   1.00 0.00 ? 221 ARG A HD3  5  
ATOM   9808  H  HE   . ARG A 1 67  ? -0.905  -4.120  9.351   1.00 0.00 ? 221 ARG A HE   5  
ATOM   9809  H  HH11 . ARG A 1 67  ? -3.165  -6.780  9.729   1.00 0.00 ? 221 ARG A HH11 5  
ATOM   9810  H  HH12 . ARG A 1 67  ? -3.810  -6.151  11.201  1.00 0.00 ? 221 ARG A HH12 5  
ATOM   9811  H  HH21 . ARG A 1 67  ? -1.797  -3.348  11.269  1.00 0.00 ? 221 ARG A HH21 5  
ATOM   9812  H  HH22 . ARG A 1 67  ? -3.054  -4.236  12.061  1.00 0.00 ? 221 ARG A HH22 5  
ATOM   9813  N  N    . TRP A 1 68  ? -1.062  -5.030  3.011   1.00 0.00 ? 222 TRP A N    5  
ATOM   9814  C  CA   . TRP A 1 68  ? -1.444  -4.094  1.904   1.00 0.00 ? 222 TRP A CA   5  
ATOM   9815  C  C    . TRP A 1 68  ? -2.229  -4.871  0.834   1.00 0.00 ? 222 TRP A C    5  
ATOM   9816  O  O    . TRP A 1 68  ? -3.377  -4.582  0.560   1.00 0.00 ? 222 TRP A O    5  
ATOM   9817  C  CB   . TRP A 1 68  ? -0.116  -3.590  1.319   1.00 0.00 ? 222 TRP A CB   5  
ATOM   9818  C  CG   . TRP A 1 68  ? -0.209  -2.126  1.020   1.00 0.00 ? 222 TRP A CG   5  
ATOM   9819  C  CD1  . TRP A 1 68  ? -1.306  -1.486  0.546   1.00 0.00 ? 222 TRP A CD1  5  
ATOM   9820  C  CD2  . TRP A 1 68  ? 0.825   -1.113  1.157   1.00 0.00 ? 222 TRP A CD2  5  
ATOM   9821  N  NE1  . TRP A 1 68  ? -1.015  -0.143  0.410   1.00 0.00 ? 222 TRP A NE1  5  
ATOM   9822  C  CE2  . TRP A 1 68  ? 0.287   0.135   0.771   1.00 0.00 ? 222 TRP A CE2  5  
ATOM   9823  C  CE3  . TRP A 1 68  ? 2.163   -1.156  1.582   1.00 0.00 ? 222 TRP A CE3  5  
ATOM   9824  C  CZ2  . TRP A 1 68  ? 1.050   1.299   0.812   1.00 0.00 ? 222 TRP A CZ2  5  
ATOM   9825  C  CZ3  . TRP A 1 68  ? 2.936   0.015   1.619   1.00 0.00 ? 222 TRP A CZ3  5  
ATOM   9826  C  CH2  . TRP A 1 68  ? 2.379   1.240   1.237   1.00 0.00 ? 222 TRP A CH2  5  
ATOM   9827  H  H    . TRP A 1 68  ? -0.878  -5.972  2.799   1.00 0.00 ? 222 TRP A H    5  
ATOM   9828  H  HA   . TRP A 1 68  ? -2.023  -3.266  2.287   1.00 0.00 ? 222 TRP A HA   5  
ATOM   9829  H  HB2  . TRP A 1 68  ? 0.676   -3.759  2.035   1.00 0.00 ? 222 TRP A HB2  5  
ATOM   9830  H  HB3  . TRP A 1 68  ? 0.106   -4.127  0.409   1.00 0.00 ? 222 TRP A HB3  5  
ATOM   9831  H  HD1  . TRP A 1 68  ? -2.257  -1.949  0.325   1.00 0.00 ? 222 TRP A HD1  5  
ATOM   9832  H  HE1  . TRP A 1 68  ? -1.641  0.541   0.094   1.00 0.00 ? 222 TRP A HE1  5  
ATOM   9833  H  HE3  . TRP A 1 68  ? 2.600   -2.097  1.875   1.00 0.00 ? 222 TRP A HE3  5  
ATOM   9834  H  HZ2  . TRP A 1 68  ? 0.615   2.238   0.529   1.00 0.00 ? 222 TRP A HZ2  5  
ATOM   9835  H  HZ3  . TRP A 1 68  ? 3.963   -0.029  1.944   1.00 0.00 ? 222 TRP A HZ3  5  
ATOM   9836  H  HH2  . TRP A 1 68  ? 2.978   2.138   1.267   1.00 0.00 ? 222 TRP A HH2  5  
ATOM   9837  N  N    . CYS A 1 69  ? -1.612  -5.878  0.246   1.00 0.00 ? 223 CYS A N    5  
ATOM   9838  C  CA   . CYS A 1 69  ? -2.319  -6.699  -0.785  1.00 0.00 ? 223 CYS A CA   5  
ATOM   9839  C  C    . CYS A 1 69  ? -2.908  -7.992  -0.162  1.00 0.00 ? 223 CYS A C    5  
ATOM   9840  O  O    . CYS A 1 69  ? -3.731  -8.643  -0.774  1.00 0.00 ? 223 CYS A O    5  
ATOM   9841  C  CB   . CYS A 1 69  ? -1.269  -7.014  -1.880  1.00 0.00 ? 223 CYS A CB   5  
ATOM   9842  S  SG   . CYS A 1 69  ? 0.021   -8.143  -1.267  1.00 0.00 ? 223 CYS A SG   5  
ATOM   9843  H  H    . CYS A 1 69  ? -0.693  -6.103  0.500   1.00 0.00 ? 223 CYS A H    5  
ATOM   9844  H  HA   . CYS A 1 69  ? -3.118  -6.117  -1.218  1.00 0.00 ? 223 CYS A HA   5  
ATOM   9845  H  HB2  . CYS A 1 69  ? -1.764  -7.472  -2.722  1.00 0.00 ? 223 CYS A HB2  5  
ATOM   9846  H  HB3  . CYS A 1 69  ? -0.809  -6.090  -2.202  1.00 0.00 ? 223 CYS A HB3  5  
ATOM   9847  N  N    . ALA A 1 70  ? -2.498  -8.381  1.044   1.00 0.00 ? 224 ALA A N    5  
ATOM   9848  C  CA   . ALA A 1 70  ? -3.044  -9.626  1.674   1.00 0.00 ? 224 ALA A CA   5  
ATOM   9849  C  C    . ALA A 1 70  ? -2.716  -10.834 0.789   1.00 0.00 ? 224 ALA A C    5  
ATOM   9850  O  O    . ALA A 1 70  ? -3.599  -11.540 0.341   1.00 0.00 ? 224 ALA A O    5  
ATOM   9851  C  CB   . ALA A 1 70  ? -4.562  -9.424  1.797   1.00 0.00 ? 224 ALA A CB   5  
ATOM   9852  H  H    . ALA A 1 70  ? -1.828  -7.866  1.532   1.00 0.00 ? 224 ALA A H    5  
ATOM   9853  H  HA   . ALA A 1 70  ? -2.613  -9.761  2.654   1.00 0.00 ? 224 ALA A HA   5  
ATOM   9854  H  HB1  . ALA A 1 70  ? -4.969  -10.165 2.471   1.00 0.00 ? 224 ALA A HB1  5  
ATOM   9855  H  HB2  . ALA A 1 70  ? -5.022  -9.530  0.826   1.00 0.00 ? 224 ALA A HB2  5  
ATOM   9856  H  HB3  . ALA A 1 70  ? -4.765  -8.436  2.187   1.00 0.00 ? 224 ALA A HB3  5  
ATOM   9857  N  N    . GLU A 1 71  ? -1.447  -11.074 0.534   1.00 0.00 ? 225 GLU A N    5  
ATOM   9858  C  CA   . GLU A 1 71  ? -1.065  -12.235 -0.326  1.00 0.00 ? 225 GLU A CA   5  
ATOM   9859  C  C    . GLU A 1 71  ? -0.140  -13.192 0.443   1.00 0.00 ? 225 GLU A C    5  
ATOM   9860  O  O    . GLU A 1 71  ? -0.518  -14.310 0.742   1.00 0.00 ? 225 GLU A O    5  
ATOM   9861  C  CB   . GLU A 1 71  ? -0.336  -11.617 -1.522  1.00 0.00 ? 225 GLU A CB   5  
ATOM   9862  C  CG   . GLU A 1 71  ? -1.362  -11.077 -2.522  1.00 0.00 ? 225 GLU A CG   5  
ATOM   9863  C  CD   . GLU A 1 71  ? -0.826  -11.247 -3.945  1.00 0.00 ? 225 GLU A CD   5  
ATOM   9864  O  OE1  . GLU A 1 71  ? 0.355   -11.013 -4.144  1.00 0.00 ? 225 GLU A OE1  5  
ATOM   9865  O  OE2  . GLU A 1 71  ? -1.605  -11.606 -4.812  1.00 0.00 ? 225 GLU A OE2  5  
ATOM   9866  H  H    . GLU A 1 71  ? -0.743  -10.490 0.908   1.00 0.00 ? 225 GLU A H    5  
ATOM   9867  H  HA   . GLU A 1 71  ? -1.941  -12.755 -0.662  1.00 0.00 ? 225 GLU A HA   5  
ATOM   9868  H  HB2  . GLU A 1 71  ? 0.295   -10.809 -1.180  1.00 0.00 ? 225 GLU A HB2  5  
ATOM   9869  H  HB3  . GLU A 1 71  ? 0.271   -12.370 -2.001  1.00 0.00 ? 225 GLU A HB3  5  
ATOM   9870  H  HG2  . GLU A 1 71  ? -2.287  -11.625 -2.419  1.00 0.00 ? 225 GLU A HG2  5  
ATOM   9871  H  HG3  . GLU A 1 71  ? -1.540  -10.029 -2.330  1.00 0.00 ? 225 GLU A HG3  5  
ATOM   9872  N  N    . GLY A 1 72  ? 1.061   -12.768 0.769   1.00 0.00 ? 226 GLY A N    5  
ATOM   9873  C  CA   . GLY A 1 72  ? 1.994   -13.663 1.519   1.00 0.00 ? 226 GLY A CA   5  
ATOM   9874  C  C    . GLY A 1 72  ? 3.178   -14.050 0.620   1.00 0.00 ? 226 GLY A C    5  
ATOM   9875  O  O    . GLY A 1 72  ? 3.430   -13.411 -0.385  1.00 0.00 ? 226 GLY A O    5  
ATOM   9876  H  H    . GLY A 1 72  ? 1.350   -11.864 0.522   1.00 0.00 ? 226 GLY A H    5  
ATOM   9877  H  HA2  . GLY A 1 72  ? 2.359   -13.146 2.395   1.00 0.00 ? 226 GLY A HA2  5  
ATOM   9878  H  HA3  . GLY A 1 72  ? 1.469   -14.557 1.820   1.00 0.00 ? 226 GLY A HA3  5  
ATOM   9879  N  N    . GLY A 1 73  ? 3.911   -15.089 0.970   1.00 0.00 ? 227 GLY A N    5  
ATOM   9880  C  CA   . GLY A 1 73  ? 5.074   -15.504 0.130   1.00 0.00 ? 227 GLY A CA   5  
ATOM   9881  C  C    . GLY A 1 73  ? 6.231   -14.515 0.335   1.00 0.00 ? 227 GLY A C    5  
ATOM   9882  O  O    . GLY A 1 73  ? 6.158   -13.379 -0.091  1.00 0.00 ? 227 GLY A O    5  
ATOM   9883  H  H    . GLY A 1 73  ? 3.698   -15.597 1.785   1.00 0.00 ? 227 GLY A H    5  
ATOM   9884  H  HA2  . GLY A 1 73  ? 5.391   -16.497 0.419   1.00 0.00 ? 227 GLY A HA2  5  
ATOM   9885  H  HA3  . GLY A 1 73  ? 4.786   -15.505 -0.910  1.00 0.00 ? 227 GLY A HA3  5  
ATOM   9886  N  N    . ASN A 1 74  ? 7.303   -14.930 0.992   1.00 0.00 ? 228 ASN A N    5  
ATOM   9887  C  CA   . ASN A 1 74  ? 8.461   -14.001 1.225   1.00 0.00 ? 228 ASN A CA   5  
ATOM   9888  C  C    . ASN A 1 74  ? 7.976   -12.688 1.860   1.00 0.00 ? 228 ASN A C    5  
ATOM   9889  O  O    . ASN A 1 74  ? 7.682   -11.736 1.161   1.00 0.00 ? 228 ASN A O    5  
ATOM   9890  C  CB   . ASN A 1 74  ? 9.057   -13.739 -0.161  1.00 0.00 ? 228 ASN A CB   5  
ATOM   9891  C  CG   . ASN A 1 74  ? 10.175  -14.752 -0.437  1.00 0.00 ? 228 ASN A CG   5  
ATOM   9892  O  OD1  . ASN A 1 74  ? 10.030  -15.922 -0.142  1.00 0.00 ? 228 ASN A OD1  5  
ATOM   9893  N  ND2  . ASN A 1 74  ? 11.294  -14.357 -0.994  1.00 0.00 ? 228 ASN A ND2  5  
ATOM   9894  H  H    . ASN A 1 74  ? 7.348   -15.849 1.335   1.00 0.00 ? 228 ASN A H    5  
ATOM   9895  H  HA   . ASN A 1 74  ? 9.196   -14.471 1.856   1.00 0.00 ? 228 ASN A HA   5  
ATOM   9896  H  HB2  . ASN A 1 74  ? 8.285   -13.840 -0.911  1.00 0.00 ? 228 ASN A HB2  5  
ATOM   9897  H  HB3  . ASN A 1 74  ? 9.464   -12.740 -0.195  1.00 0.00 ? 228 ASN A HB3  5  
ATOM   9898  H  HD21 . ASN A 1 74  ? 11.422  -13.414 -1.237  1.00 0.00 ? 228 ASN A HD21 5  
ATOM   9899  H  HD22 . ASN A 1 74  ? 12.007  -15.006 -1.169  1.00 0.00 ? 228 ASN A HD22 5  
ATOM   9900  N  N    . LEU A 1 75  ? 7.877   -12.626 3.174   1.00 0.00 ? 229 LEU A N    5  
ATOM   9901  C  CA   . LEU A 1 75  ? 7.398   -11.368 3.820   1.00 0.00 ? 229 LEU A CA   5  
ATOM   9902  C  C    . LEU A 1 75  ? 8.479   -10.768 4.735   1.00 0.00 ? 229 LEU A C    5  
ATOM   9903  O  O    . LEU A 1 75  ? 9.459   -11.416 5.053   1.00 0.00 ? 229 LEU A O    5  
ATOM   9904  C  CB   . LEU A 1 75  ? 6.176   -11.773 4.651   1.00 0.00 ? 229 LEU A CB   5  
ATOM   9905  C  CG   . LEU A 1 75  ? 5.106   -12.396 3.751   1.00 0.00 ? 229 LEU A CG   5  
ATOM   9906  C  CD1  . LEU A 1 75  ? 3.945   -12.904 4.613   1.00 0.00 ? 229 LEU A CD1  5  
ATOM   9907  C  CD2  . LEU A 1 75  ? 4.585   -11.343 2.771   1.00 0.00 ? 229 LEU A CD2  5  
ATOM   9908  H  H    . LEU A 1 75  ? 8.109   -13.402 3.730   1.00 0.00 ? 229 LEU A H    5  
ATOM   9909  H  HA   . LEU A 1 75  ? 7.111   -10.658 3.066   1.00 0.00 ? 229 LEU A HA   5  
ATOM   9910  H  HB2  . LEU A 1 75  ? 6.476   -12.491 5.400   1.00 0.00 ? 229 LEU A HB2  5  
ATOM   9911  H  HB3  . LEU A 1 75  ? 5.769   -10.898 5.134   1.00 0.00 ? 229 LEU A HB3  5  
ATOM   9912  H  HG   . LEU A 1 75  ? 5.533   -13.222 3.201   1.00 0.00 ? 229 LEU A HG   5  
ATOM   9913  H  HD11 . LEU A 1 75  ? 3.572   -13.832 4.204   1.00 0.00 ? 229 LEU A HD11 5  
ATOM   9914  H  HD12 . LEU A 1 75  ? 3.151   -12.170 4.621   1.00 0.00 ? 229 LEU A HD12 5  
ATOM   9915  H  HD13 . LEU A 1 75  ? 4.290   -13.070 5.623   1.00 0.00 ? 229 LEU A HD13 5  
ATOM   9916  H  HD21 . LEU A 1 75  ? 3.537   -11.521 2.573   1.00 0.00 ? 229 LEU A HD21 5  
ATOM   9917  H  HD22 . LEU A 1 75  ? 5.142   -11.403 1.847   1.00 0.00 ? 229 LEU A HD22 5  
ATOM   9918  H  HD23 . LEU A 1 75  ? 4.707   -10.360 3.201   1.00 0.00 ? 229 LEU A HD23 5  
ATOM   9919  N  N    . ILE A 1 76  ? 8.301   -9.535  5.171   1.00 0.00 ? 230 ILE A N    5  
ATOM   9920  C  CA   . ILE A 1 76  ? 9.306   -8.898  6.075   1.00 0.00 ? 230 ILE A CA   5  
ATOM   9921  C  C    . ILE A 1 76  ? 8.656   -8.604  7.434   1.00 0.00 ? 230 ILE A C    5  
ATOM   9922  O  O    . ILE A 1 76  ? 7.978   -7.606  7.590   1.00 0.00 ? 230 ILE A O    5  
ATOM   9923  C  CB   . ILE A 1 76  ? 9.706   -7.593  5.375   1.00 0.00 ? 230 ILE A CB   5  
ATOM   9924  C  CG1  . ILE A 1 76  ? 10.440  -7.925  4.073   1.00 0.00 ? 230 ILE A CG1  5  
ATOM   9925  C  CG2  . ILE A 1 76  ? 10.629  -6.759  6.282   1.00 0.00 ? 230 ILE A CG2  5  
ATOM   9926  C  CD1  . ILE A 1 76  ? 10.748  -6.634  3.312   1.00 0.00 ? 230 ILE A CD1  5  
ATOM   9927  H  H    . ILE A 1 76  ? 7.499   -9.028  4.912   1.00 0.00 ? 230 ILE A H    5  
ATOM   9928  H  HA   . ILE A 1 76  ? 10.166  -9.537  6.196   1.00 0.00 ? 230 ILE A HA   5  
ATOM   9929  H  HB   . ILE A 1 76  ? 8.817   -7.022  5.150   1.00 0.00 ? 230 ILE A HB   5  
ATOM   9930  H  HG12 . ILE A 1 76  ? 11.364  -8.437  4.301   1.00 0.00 ? 230 ILE A HG12 5  
ATOM   9931  H  HG13 . ILE A 1 76  ? 9.818   -8.561  3.462   1.00 0.00 ? 230 ILE A HG13 5  
ATOM   9932  H  HG21 . ILE A 1 76  ? 11.478  -7.356  6.581   1.00 0.00 ? 230 ILE A HG21 5  
ATOM   9933  H  HG22 . ILE A 1 76  ? 10.084  -6.442  7.160   1.00 0.00 ? 230 ILE A HG22 5  
ATOM   9934  H  HG23 . ILE A 1 76  ? 10.974  -5.889  5.741   1.00 0.00 ? 230 ILE A HG23 5  
ATOM   9935  H  HD11 . ILE A 1 76  ? 10.550  -6.780  2.261   1.00 0.00 ? 230 ILE A HD11 5  
ATOM   9936  H  HD12 . ILE A 1 76  ? 11.787  -6.375  3.452   1.00 0.00 ? 230 ILE A HD12 5  
ATOM   9937  H  HD13 . ILE A 1 76  ? 10.123  -5.835  3.689   1.00 0.00 ? 230 ILE A HD13 5  
ATOM   9938  N  N    . CYS A 1 77  ? 8.860   -9.451  8.421   1.00 0.00 ? 231 CYS A N    5  
ATOM   9939  C  CA   . CYS A 1 77  ? 8.241   -9.181  9.768   1.00 0.00 ? 231 CYS A CA   5  
ATOM   9940  C  C    . CYS A 1 77  ? 8.721   -7.821  10.296  1.00 0.00 ? 231 CYS A C    5  
ATOM   9941  O  O    . CYS A 1 77  ? 9.837   -7.412  10.036  1.00 0.00 ? 231 CYS A O    5  
ATOM   9942  C  CB   . CYS A 1 77  ? 8.702   -10.307 10.705  1.00 0.00 ? 231 CYS A CB   5  
ATOM   9943  S  SG   . CYS A 1 77  ? 7.584   -11.722 10.545  1.00 0.00 ? 231 CYS A SG   5  
ATOM   9944  H  H    . CYS A 1 77  ? 9.420   -10.252 8.275   1.00 0.00 ? 231 CYS A H    5  
ATOM   9945  H  HA   . CYS A 1 77  ? 7.163   -9.183  9.686   1.00 0.00 ? 231 CYS A HA   5  
ATOM   9946  H  HB2  . CYS A 1 77  ? 9.706   -10.608 10.438  1.00 0.00 ? 231 CYS A HB2  5  
ATOM   9947  H  HB3  . CYS A 1 77  ? 8.692   -9.954  11.726  1.00 0.00 ? 231 CYS A HB3  5  
ATOM   9948  H  HG   . CYS A 1 77  ? 7.979   -12.466 11.006  1.00 0.00 ? 231 CYS A HG   5  
ATOM   9949  N  N    . CYS A 1 78  ? 7.889   -7.113  11.028  1.00 0.00 ? 232 CYS A N    5  
ATOM   9950  C  CA   . CYS A 1 78  ? 8.311   -5.779  11.556  1.00 0.00 ? 232 CYS A CA   5  
ATOM   9951  C  C    . CYS A 1 78  ? 8.643   -5.877  13.052  1.00 0.00 ? 232 CYS A C    5  
ATOM   9952  O  O    . CYS A 1 78  ? 8.097   -6.704  13.759  1.00 0.00 ? 232 CYS A O    5  
ATOM   9953  C  CB   . CYS A 1 78  ? 7.110   -4.848  11.329  1.00 0.00 ? 232 CYS A CB   5  
ATOM   9954  S  SG   . CYS A 1 78  ? 7.510   -3.174  11.896  1.00 0.00 ? 232 CYS A SG   5  
ATOM   9955  H  H    . CYS A 1 78  ? 6.986   -7.459  11.227  1.00 0.00 ? 232 CYS A H    5  
ATOM   9956  H  HA   . CYS A 1 78  ? 9.166   -5.414  11.008  1.00 0.00 ? 232 CYS A HA   5  
ATOM   9957  H  HB2  . CYS A 1 78  ? 6.872   -4.822  10.275  1.00 0.00 ? 232 CYS A HB2  5  
ATOM   9958  H  HB3  . CYS A 1 78  ? 6.260   -5.221  11.879  1.00 0.00 ? 232 CYS A HB3  5  
ATOM   9959  N  N    . ASP A 1 79  ? 9.525   -5.030  13.542  1.00 0.00 ? 233 ASP A N    5  
ATOM   9960  C  CA   . ASP A 1 79  ? 9.872   -5.074  14.998  1.00 0.00 ? 233 ASP A CA   5  
ATOM   9961  C  C    . ASP A 1 79  ? 9.230   -3.878  15.716  1.00 0.00 ? 233 ASP A C    5  
ATOM   9962  O  O    . ASP A 1 79  ? 9.844   -3.260  16.566  1.00 0.00 ? 233 ASP A O    5  
ATOM   9963  C  CB   . ASP A 1 79  ? 11.400  -4.986  15.061  1.00 0.00 ? 233 ASP A CB   5  
ATOM   9964  C  CG   . ASP A 1 79  ? 12.011  -6.244  14.440  1.00 0.00 ? 233 ASP A CG   5  
ATOM   9965  O  OD1  . ASP A 1 79  ? 11.773  -6.477  13.267  1.00 0.00 ? 233 ASP A OD1  5  
ATOM   9966  O  OD2  . ASP A 1 79  ? 12.707  -6.952  15.149  1.00 0.00 ? 233 ASP A OD2  5  
ATOM   9967  H  H    . ASP A 1 79  ? 9.949   -4.358  12.956  1.00 0.00 ? 233 ASP A H    5  
ATOM   9968  H  HA   . ASP A 1 79  ? 9.536   -6.001  15.436  1.00 0.00 ? 233 ASP A HA   5  
ATOM   9969  H  HB2  . ASP A 1 79  ? 11.734  -4.115  14.514  1.00 0.00 ? 233 ASP A HB2  5  
ATOM   9970  H  HB3  . ASP A 1 79  ? 11.714  -4.906  16.091  1.00 0.00 ? 233 ASP A HB3  5  
ATOM   9971  N  N    . PHE A 1 80  ? 8.000   -3.540  15.380  1.00 0.00 ? 234 PHE A N    5  
ATOM   9972  C  CA   . PHE A 1 80  ? 7.332   -2.380  16.044  1.00 0.00 ? 234 PHE A CA   5  
ATOM   9973  C  C    . PHE A 1 80  ? 5.805   -2.578  16.081  1.00 0.00 ? 234 PHE A C    5  
ATOM   9974  O  O    . PHE A 1 80  ? 5.205   -2.578  17.140  1.00 0.00 ? 234 PHE A O    5  
ATOM   9975  C  CB   . PHE A 1 80  ? 7.687   -1.172  15.173  1.00 0.00 ? 234 PHE A CB   5  
ATOM   9976  C  CG   . PHE A 1 80  ? 9.073   -0.667  15.510  1.00 0.00 ? 234 PHE A CG   5  
ATOM   9977  C  CD1  . PHE A 1 80  ? 9.444   -0.442  16.844  1.00 0.00 ? 234 PHE A CD1  5  
ATOM   9978  C  CD2  . PHE A 1 80  ? 9.986   -0.411  14.479  1.00 0.00 ? 234 PHE A CD2  5  
ATOM   9979  C  CE1  . PHE A 1 80  ? 10.725  0.036   17.142  1.00 0.00 ? 234 PHE A CE1  5  
ATOM   9980  C  CE2  . PHE A 1 80  ? 11.266  0.065   14.779  1.00 0.00 ? 234 PHE A CE2  5  
ATOM   9981  C  CZ   . PHE A 1 80  ? 11.637  0.289   16.110  1.00 0.00 ? 234 PHE A CZ   5  
ATOM   9982  H  H    . PHE A 1 80  ? 7.517   -4.047  14.687  1.00 0.00 ? 234 PHE A H    5  
ATOM   9983  H  HA   . PHE A 1 80  ? 7.720   -2.242  17.041  1.00 0.00 ? 234 PHE A HA   5  
ATOM   9984  H  HB2  . PHE A 1 80  ? 7.658   -1.464  14.135  1.00 0.00 ? 234 PHE A HB2  5  
ATOM   9985  H  HB3  . PHE A 1 80  ? 6.967   -0.386  15.344  1.00 0.00 ? 234 PHE A HB3  5  
ATOM   9986  H  HD1  . PHE A 1 80  ? 8.742   -0.638  17.640  1.00 0.00 ? 234 PHE A HD1  5  
ATOM   9987  H  HD2  . PHE A 1 80  ? 9.704   -0.585  13.453  1.00 0.00 ? 234 PHE A HD2  5  
ATOM   9988  H  HE1  . PHE A 1 80  ? 11.012  0.209   18.169  1.00 0.00 ? 234 PHE A HE1  5  
ATOM   9989  H  HE2  . PHE A 1 80  ? 11.967  0.264   13.981  1.00 0.00 ? 234 PHE A HE2  5  
ATOM   9990  H  HZ   . PHE A 1 80  ? 12.625  0.659   16.340  1.00 0.00 ? 234 PHE A HZ   5  
ATOM   9991  N  N    . CYS A 1 81  ? 5.168   -2.743  14.935  1.00 0.00 ? 235 CYS A N    5  
ATOM   9992  C  CA   . CYS A 1 81  ? 3.672   -2.933  14.934  1.00 0.00 ? 235 CYS A CA   5  
ATOM   9993  C  C    . CYS A 1 81  ? 3.270   -4.426  14.832  1.00 0.00 ? 235 CYS A C    5  
ATOM   9994  O  O    . CYS A 1 81  ? 2.148   -4.731  14.472  1.00 0.00 ? 235 CYS A O    5  
ATOM   9995  C  CB   . CYS A 1 81  ? 3.138   -2.134  13.726  1.00 0.00 ? 235 CYS A CB   5  
ATOM   9996  S  SG   . CYS A 1 81  ? 3.709   -2.855  12.158  1.00 0.00 ? 235 CYS A SG   5  
ATOM   9997  H  H    . CYS A 1 81  ? 5.668   -2.737  14.089  1.00 0.00 ? 235 CYS A H    5  
ATOM   9998  H  HA   . CYS A 1 81  ? 3.261   -2.517  15.840  1.00 0.00 ? 235 CYS A HA   5  
ATOM   9999  H  HB2  . CYS A 1 81  ? 2.059   -2.142  13.745  1.00 0.00 ? 235 CYS A HB2  5  
ATOM   10000 H  HB3  . CYS A 1 81  ? 3.485   -1.112  13.797  1.00 0.00 ? 235 CYS A HB3  5  
ATOM   10001 N  N    . HIS A 1 82  ? 4.151   -5.357  15.157  1.00 0.00 ? 236 HIS A N    5  
ATOM   10002 C  CA   . HIS A 1 82  ? 3.786   -6.814  15.088  1.00 0.00 ? 236 HIS A CA   5  
ATOM   10003 C  C    . HIS A 1 82  ? 3.125   -7.176  13.741  1.00 0.00 ? 236 HIS A C    5  
ATOM   10004 O  O    . HIS A 1 82  ? 2.057   -7.761  13.712  1.00 0.00 ? 236 HIS A O    5  
ATOM   10005 C  CB   . HIS A 1 82  ? 2.801   -7.025  16.240  1.00 0.00 ? 236 HIS A CB   5  
ATOM   10006 C  CG   . HIS A 1 82  ? 3.525   -6.889  17.551  1.00 0.00 ? 236 HIS A CG   5  
ATOM   10007 N  ND1  . HIS A 1 82  ? 3.771   -7.975  18.377  1.00 0.00 ? 236 HIS A ND1  5  
ATOM   10008 C  CD2  . HIS A 1 82  ? 4.064   -5.801  18.193  1.00 0.00 ? 236 HIS A CD2  5  
ATOM   10009 C  CE1  . HIS A 1 82  ? 4.430   -7.522  19.458  1.00 0.00 ? 236 HIS A CE1  5  
ATOM   10010 N  NE2  . HIS A 1 82  ? 4.634   -6.203  19.397  1.00 0.00 ? 236 HIS A NE2  5  
ATOM   10011 H  H    . HIS A 1 82  ? 5.049   -5.108  15.462  1.00 0.00 ? 236 HIS A H    5  
ATOM   10012 H  HA   . HIS A 1 82  ? 4.662   -7.423  15.246  1.00 0.00 ? 236 HIS A HA   5  
ATOM   10013 H  HB2  . HIS A 1 82  ? 2.017   -6.285  16.183  1.00 0.00 ? 236 HIS A HB2  5  
ATOM   10014 H  HB3  . HIS A 1 82  ? 2.370   -8.013  16.168  1.00 0.00 ? 236 HIS A HB3  5  
ATOM   10015 H  HD1  . HIS A 1 82  ? 3.511   -8.904  18.203  1.00 0.00 ? 236 HIS A HD1  5  
ATOM   10016 H  HD2  . HIS A 1 82  ? 4.047   -4.788  17.819  1.00 0.00 ? 236 HIS A HD2  5  
ATOM   10017 H  HE1  . HIS A 1 82  ? 4.754   -8.147  20.277  1.00 0.00 ? 236 HIS A HE1  5  
ATOM   10018 N  N    . ASN A 1 83  ? 3.746   -6.843  12.629  1.00 0.00 ? 237 ASN A N    5  
ATOM   10019 C  CA   . ASN A 1 83  ? 3.141   -7.184  11.301  1.00 0.00 ? 237 ASN A CA   5  
ATOM   10020 C  C    . ASN A 1 83  ? 4.245   -7.390  10.249  1.00 0.00 ? 237 ASN A C    5  
ATOM   10021 O  O    . ASN A 1 83  ? 5.373   -6.985  10.451  1.00 0.00 ? 237 ASN A O    5  
ATOM   10022 C  CB   . ASN A 1 83  ? 2.263   -5.983  10.937  1.00 0.00 ? 237 ASN A CB   5  
ATOM   10023 C  CG   . ASN A 1 83  ? 0.783   -6.353  11.102  1.00 0.00 ? 237 ASN A CG   5  
ATOM   10024 O  OD1  . ASN A 1 83  ? 0.220   -7.025  10.261  1.00 0.00 ? 237 ASN A OD1  5  
ATOM   10025 N  ND2  . ASN A 1 83  ? 0.120   -5.941  12.156  1.00 0.00 ? 237 ASN A ND2  5  
ATOM   10026 H  H    . ASN A 1 83  ? 4.610   -6.375  12.665  1.00 0.00 ? 237 ASN A H    5  
ATOM   10027 H  HA   . ASN A 1 83  ? 2.536   -8.074  11.383  1.00 0.00 ? 237 ASN A HA   5  
ATOM   10028 H  HB2  . ASN A 1 83  ? 2.501   -5.156  11.588  1.00 0.00 ? 237 ASN A HB2  5  
ATOM   10029 H  HB3  . ASN A 1 83  ? 2.448   -5.698  9.912   1.00 0.00 ? 237 ASN A HB3  5  
ATOM   10030 H  HD21 . ASN A 1 83  ? 0.565   -5.397  12.842  1.00 0.00 ? 237 ASN A HD21 5  
ATOM   10031 H  HD22 . ASN A 1 83  ? -0.825  -6.179  12.260  1.00 0.00 ? 237 ASN A HD22 5  
ATOM   10032 N  N    . ALA A 1 84  ? 3.937   -8.020  9.132   1.00 0.00 ? 238 ALA A N    5  
ATOM   10033 C  CA   . ALA A 1 84  ? 4.984   -8.248  8.090   1.00 0.00 ? 238 ALA A CA   5  
ATOM   10034 C  C    . ALA A 1 84  ? 4.459   -7.864  6.695   1.00 0.00 ? 238 ALA A C    5  
ATOM   10035 O  O    . ALA A 1 84  ? 3.301   -8.072  6.388   1.00 0.00 ? 238 ALA A O    5  
ATOM   10036 C  CB   . ALA A 1 84  ? 5.277   -9.747  8.153   1.00 0.00 ? 238 ALA A CB   5  
ATOM   10037 H  H    . ALA A 1 84  ? 3.023   -8.348  8.981   1.00 0.00 ? 238 ALA A H    5  
ATOM   10038 H  HA   . ALA A 1 84  ? 5.878   -7.693  8.328   1.00 0.00 ? 238 ALA A HA   5  
ATOM   10039 H  HB1  . ALA A 1 84  ? 6.335   -9.913  8.020   1.00 0.00 ? 238 ALA A HB1  5  
ATOM   10040 H  HB2  . ALA A 1 84  ? 4.731   -10.255 7.370   1.00 0.00 ? 238 ALA A HB2  5  
ATOM   10041 H  HB3  . ALA A 1 84  ? 4.971   -10.133 9.115   1.00 0.00 ? 238 ALA A HB3  5  
ATOM   10042 N  N    . PHE A 1 85  ? 5.305   -7.325  5.837   1.00 0.00 ? 239 PHE A N    5  
ATOM   10043 C  CA   . PHE A 1 85  ? 4.848   -6.957  4.456   1.00 0.00 ? 239 PHE A CA   5  
ATOM   10044 C  C    . PHE A 1 85  ? 5.422   -7.967  3.454   1.00 0.00 ? 239 PHE A C    5  
ATOM   10045 O  O    . PHE A 1 85  ? 6.198   -8.819  3.831   1.00 0.00 ? 239 PHE A O    5  
ATOM   10046 C  CB   . PHE A 1 85  ? 5.406   -5.555  4.189   1.00 0.00 ? 239 PHE A CB   5  
ATOM   10047 C  CG   . PHE A 1 85  ? 4.444   -4.519  4.717   1.00 0.00 ? 239 PHE A CG   5  
ATOM   10048 C  CD1  . PHE A 1 85  ? 3.363   -4.098  3.932   1.00 0.00 ? 239 PHE A CD1  5  
ATOM   10049 C  CD2  . PHE A 1 85  ? 4.631   -3.981  5.994   1.00 0.00 ? 239 PHE A CD2  5  
ATOM   10050 C  CE1  . PHE A 1 85  ? 2.470   -3.136  4.425   1.00 0.00 ? 239 PHE A CE1  5  
ATOM   10051 C  CE2  . PHE A 1 85  ? 3.739   -3.020  6.488   1.00 0.00 ? 239 PHE A CE2  5  
ATOM   10052 C  CZ   . PHE A 1 85  ? 2.658   -2.599  5.703   1.00 0.00 ? 239 PHE A CZ   5  
ATOM   10053 H  H    . PHE A 1 85  ? 6.245   -7.179  6.094   1.00 0.00 ? 239 PHE A H    5  
ATOM   10054 H  HA   . PHE A 1 85  ? 3.770   -6.946  4.406   1.00 0.00 ? 239 PHE A HA   5  
ATOM   10055 H  HB2  . PHE A 1 85  ? 6.359   -5.447  4.687   1.00 0.00 ? 239 PHE A HB2  5  
ATOM   10056 H  HB3  . PHE A 1 85  ? 5.536   -5.416  3.127   1.00 0.00 ? 239 PHE A HB3  5  
ATOM   10057 H  HD1  . PHE A 1 85  ? 3.219   -4.513  2.945   1.00 0.00 ? 239 PHE A HD1  5  
ATOM   10058 H  HD2  . PHE A 1 85  ? 5.467   -4.305  6.598   1.00 0.00 ? 239 PHE A HD2  5  
ATOM   10059 H  HE1  . PHE A 1 85  ? 1.635   -2.810  3.820   1.00 0.00 ? 239 PHE A HE1  5  
ATOM   10060 H  HE2  . PHE A 1 85  ? 3.883   -2.605  7.474   1.00 0.00 ? 239 PHE A HE2  5  
ATOM   10061 H  HZ   . PHE A 1 85  ? 1.969   -1.857  6.085   1.00 0.00 ? 239 PHE A HZ   5  
ATOM   10062 N  N    . CYS A 1 86  ? 5.057   -7.888  2.187   1.00 0.00 ? 240 CYS A N    5  
ATOM   10063 C  CA   . CYS A 1 86  ? 5.606   -8.868  1.198   1.00 0.00 ? 240 CYS A CA   5  
ATOM   10064 C  C    . CYS A 1 86  ? 6.610   -8.181  0.246   1.00 0.00 ? 240 CYS A C    5  
ATOM   10065 O  O    . CYS A 1 86  ? 6.661   -6.969  0.164   1.00 0.00 ? 240 CYS A O    5  
ATOM   10066 C  CB   . CYS A 1 86  ? 4.377   -9.459  0.462   1.00 0.00 ? 240 CYS A CB   5  
ATOM   10067 S  SG   . CYS A 1 86  ? 3.751   -8.365  -0.851  1.00 0.00 ? 240 CYS A SG   5  
ATOM   10068 H  H    . CYS A 1 86  ? 4.432   -7.196  1.892   1.00 0.00 ? 240 CYS A H    5  
ATOM   10069 H  HA   . CYS A 1 86  ? 6.109   -9.658  1.729   1.00 0.00 ? 240 CYS A HA   5  
ATOM   10070 H  HB2  . CYS A 1 86  ? 4.656   -10.403 0.020   1.00 0.00 ? 240 CYS A HB2  5  
ATOM   10071 H  HB3  . CYS A 1 86  ? 3.592   -9.633  1.182   1.00 0.00 ? 240 CYS A HB3  5  
ATOM   10072 N  N    . LYS A 1 87  ? 7.412   -8.949  -0.464  1.00 0.00 ? 241 LYS A N    5  
ATOM   10073 C  CA   . LYS A 1 87  ? 8.418   -8.324  -1.401  1.00 0.00 ? 241 LYS A CA   5  
ATOM   10074 C  C    . LYS A 1 87  ? 7.720   -7.673  -2.612  1.00 0.00 ? 241 LYS A C    5  
ATOM   10075 O  O    . LYS A 1 87  ? 8.179   -6.666  -3.117  1.00 0.00 ? 241 LYS A O    5  
ATOM   10076 C  CB   . LYS A 1 87  ? 9.340   -9.462  -1.872  1.00 0.00 ? 241 LYS A CB   5  
ATOM   10077 C  CG   . LYS A 1 87  ? 10.459  -8.888  -2.743  1.00 0.00 ? 241 LYS A CG   5  
ATOM   10078 C  CD   . LYS A 1 87  ? 10.053  -8.968  -4.216  1.00 0.00 ? 241 LYS A CD   5  
ATOM   10079 C  CE   . LYS A 1 87  ? 11.299  -9.180  -5.079  1.00 0.00 ? 241 LYS A CE   5  
ATOM   10080 N  NZ   . LYS A 1 87  ? 10.825  -9.968  -6.251  1.00 0.00 ? 241 LYS A NZ   5  
ATOM   10081 H  H    . LYS A 1 87  ? 7.355   -9.932  -0.375  1.00 0.00 ? 241 LYS A H    5  
ATOM   10082 H  HA   . LYS A 1 87  ? 9.000   -7.584  -0.873  1.00 0.00 ? 241 LYS A HA   5  
ATOM   10083 H  HB2  . LYS A 1 87  ? 9.769   -9.958  -1.012  1.00 0.00 ? 241 LYS A HB2  5  
ATOM   10084 H  HB3  . LYS A 1 87  ? 8.768   -10.174 -2.447  1.00 0.00 ? 241 LYS A HB3  5  
ATOM   10085 H  HG2  . LYS A 1 87  ? 10.632  -7.856  -2.472  1.00 0.00 ? 241 LYS A HG2  5  
ATOM   10086 H  HG3  . LYS A 1 87  ? 11.363  -9.457  -2.589  1.00 0.00 ? 241 LYS A HG3  5  
ATOM   10087 H  HD2  . LYS A 1 87  ? 9.371   -9.794  -4.357  1.00 0.00 ? 241 LYS A HD2  5  
ATOM   10088 H  HD3  . LYS A 1 87  ? 9.568   -8.048  -4.507  1.00 0.00 ? 241 LYS A HD3  5  
ATOM   10089 H  HE2  . LYS A 1 87  ? 11.699  -8.228  -5.400  1.00 0.00 ? 241 LYS A HE2  5  
ATOM   10090 H  HE3  . LYS A 1 87  ? 12.043  -9.739  -4.535  1.00 0.00 ? 241 LYS A HE3  5  
ATOM   10091 H  HZ1  . LYS A 1 87  ? 10.186  -9.384  -6.826  1.00 0.00 ? 241 LYS A HZ1  5  
ATOM   10092 H  HZ2  . LYS A 1 87  ? 10.317  -10.814 -5.917  1.00 0.00 ? 241 LYS A HZ2  5  
ATOM   10093 H  HZ3  . LYS A 1 87  ? 11.640  -10.257 -6.828  1.00 0.00 ? 241 LYS A HZ3  5  
ATOM   10094 N  N    . LYS A 1 88  ? 6.625   -8.234  -3.089  1.00 0.00 ? 242 LYS A N    5  
ATOM   10095 C  CA   . LYS A 1 88  ? 5.927   -7.618  -4.281  1.00 0.00 ? 242 LYS A CA   5  
ATOM   10096 C  C    . LYS A 1 88  ? 5.426   -6.187  -3.978  1.00 0.00 ? 242 LYS A C    5  
ATOM   10097 O  O    . LYS A 1 88  ? 5.205   -5.412  -4.892  1.00 0.00 ? 242 LYS A O    5  
ATOM   10098 C  CB   . LYS A 1 88  ? 4.733   -8.529  -4.614  1.00 0.00 ? 242 LYS A CB   5  
ATOM   10099 C  CG   . LYS A 1 88  ? 4.463   -8.488  -6.118  1.00 0.00 ? 242 LYS A CG   5  
ATOM   10100 C  CD   . LYS A 1 88  ? 3.429   -7.402  -6.424  1.00 0.00 ? 242 LYS A CD   5  
ATOM   10101 C  CE   . LYS A 1 88  ? 3.717   -6.797  -7.801  1.00 0.00 ? 242 LYS A CE   5  
ATOM   10102 N  NZ   . LYS A 1 88  ? 2.389   -6.356  -8.311  1.00 0.00 ? 242 LYS A NZ   5  
ATOM   10103 H  H    . LYS A 1 88  ? 6.270   -9.052  -2.671  1.00 0.00 ? 242 LYS A H    5  
ATOM   10104 H  HA   . LYS A 1 88  ? 6.601   -7.594  -5.121  1.00 0.00 ? 242 LYS A HA   5  
ATOM   10105 H  HB2  . LYS A 1 88  ? 4.958   -9.542  -4.315  1.00 0.00 ? 242 LYS A HB2  5  
ATOM   10106 H  HB3  . LYS A 1 88  ? 3.858   -8.183  -4.083  1.00 0.00 ? 242 LYS A HB3  5  
ATOM   10107 H  HG2  . LYS A 1 88  ? 5.382   -8.270  -6.643  1.00 0.00 ? 242 LYS A HG2  5  
ATOM   10108 H  HG3  . LYS A 1 88  ? 4.082   -9.445  -6.443  1.00 0.00 ? 242 LYS A HG3  5  
ATOM   10109 H  HD2  . LYS A 1 88  ? 2.440   -7.836  -6.419  1.00 0.00 ? 242 LYS A HD2  5  
ATOM   10110 H  HD3  . LYS A 1 88  ? 3.488   -6.628  -5.674  1.00 0.00 ? 242 LYS A HD3  5  
ATOM   10111 H  HE2  . LYS A 1 88  ? 4.387   -5.953  -7.706  1.00 0.00 ? 242 LYS A HE2  5  
ATOM   10112 H  HE3  . LYS A 1 88  ? 4.138   -7.541  -8.459  1.00 0.00 ? 242 LYS A HE3  5  
ATOM   10113 H  HZ1  . LYS A 1 88  ? 2.042   -5.563  -7.736  1.00 0.00 ? 242 LYS A HZ1  5  
ATOM   10114 H  HZ2  . LYS A 1 88  ? 1.716   -7.148  -8.254  1.00 0.00 ? 242 LYS A HZ2  5  
ATOM   10115 H  HZ3  . LYS A 1 88  ? 2.482   -6.049  -9.299  1.00 0.00 ? 242 LYS A HZ3  5  
ATOM   10116 N  N    . CYS A 1 89  ? 5.247   -5.818  -2.722  1.00 0.00 ? 243 CYS A N    5  
ATOM   10117 C  CA   . CYS A 1 89  ? 4.762   -4.428  -2.418  1.00 0.00 ? 243 CYS A CA   5  
ATOM   10118 C  C    . CYS A 1 89  ? 5.959   -3.474  -2.312  1.00 0.00 ? 243 CYS A C    5  
ATOM   10119 O  O    . CYS A 1 89  ? 5.908   -2.361  -2.803  1.00 0.00 ? 243 CYS A O    5  
ATOM   10120 C  CB   . CYS A 1 89  ? 4.008   -4.510  -1.078  1.00 0.00 ? 243 CYS A CB   5  
ATOM   10121 S  SG   . CYS A 1 89  ? 2.293   -5.028  -1.365  1.00 0.00 ? 243 CYS A SG   5  
ATOM   10122 H  H    . CYS A 1 89  ? 5.438   -6.440  -1.991  1.00 0.00 ? 243 CYS A H    5  
ATOM   10123 H  HA   . CYS A 1 89  ? 4.095   -4.092  -3.197  1.00 0.00 ? 243 CYS A HA   5  
ATOM   10124 H  HB2  . CYS A 1 89  ? 4.497   -5.228  -0.436  1.00 0.00 ? 243 CYS A HB2  5  
ATOM   10125 H  HB3  . CYS A 1 89  ? 4.016   -3.541  -0.602  1.00 0.00 ? 243 CYS A HB3  5  
ATOM   10126 N  N    . ILE A 1 90  ? 7.047   -3.902  -1.700  1.00 0.00 ? 244 ILE A N    5  
ATOM   10127 C  CA   . ILE A 1 90  ? 8.244   -2.996  -1.610  1.00 0.00 ? 244 ILE A CA   5  
ATOM   10128 C  C    . ILE A 1 90  ? 8.880   -2.873  -3.001  1.00 0.00 ? 244 ILE A C    5  
ATOM   10129 O  O    . ILE A 1 90  ? 9.303   -1.802  -3.394  1.00 0.00 ? 244 ILE A O    5  
ATOM   10130 C  CB   . ILE A 1 90  ? 9.214   -3.634  -0.604  1.00 0.00 ? 244 ILE A CB   5  
ATOM   10131 C  CG1  . ILE A 1 90  ? 8.538   -3.683  0.767   1.00 0.00 ? 244 ILE A CG1  5  
ATOM   10132 C  CG2  . ILE A 1 90  ? 10.492  -2.795  -0.508  1.00 0.00 ? 244 ILE A CG2  5  
ATOM   10133 C  CD1  . ILE A 1 90  ? 9.424   -4.443  1.752   1.00 0.00 ? 244 ILE A CD1  5  
ATOM   10134 H  H    . ILE A 1 90  ? 7.079   -4.815  -1.326  1.00 0.00 ? 244 ILE A H    5  
ATOM   10135 H  HA   . ILE A 1 90  ? 7.940   -2.021  -1.257  1.00 0.00 ? 244 ILE A HA   5  
ATOM   10136 H  HB   . ILE A 1 90  ? 9.461   -4.636  -0.924  1.00 0.00 ? 244 ILE A HB   5  
ATOM   10137 H  HG12 . ILE A 1 90  ? 8.382   -2.674  1.124   1.00 0.00 ? 244 ILE A HG12 5  
ATOM   10138 H  HG13 . ILE A 1 90  ? 7.585   -4.183  0.681   1.00 0.00 ? 244 ILE A HG13 5  
ATOM   10139 H  HG21 . ILE A 1 90  ? 11.100  -2.963  -1.384  1.00 0.00 ? 244 ILE A HG21 5  
ATOM   10140 H  HG22 . ILE A 1 90  ? 11.046  -3.081  0.374   1.00 0.00 ? 244 ILE A HG22 5  
ATOM   10141 H  HG23 . ILE A 1 90  ? 10.231  -1.749  -0.446  1.00 0.00 ? 244 ILE A HG23 5  
ATOM   10142 H  HD11 . ILE A 1 90  ? 10.453  -4.381  1.432   1.00 0.00 ? 244 ILE A HD11 5  
ATOM   10143 H  HD12 . ILE A 1 90  ? 9.119   -5.478  1.785   1.00 0.00 ? 244 ILE A HD12 5  
ATOM   10144 H  HD13 . ILE A 1 90  ? 9.327   -4.007  2.735   1.00 0.00 ? 244 ILE A HD13 5  
ATOM   10145 N  N    . LEU A 1 91  ? 8.932   -3.949  -3.769  1.00 0.00 ? 245 LEU A N    5  
ATOM   10146 C  CA   . LEU A 1 91  ? 9.523   -3.845  -5.151  1.00 0.00 ? 245 LEU A CA   5  
ATOM   10147 C  C    . LEU A 1 91  ? 8.743   -2.795  -5.965  1.00 0.00 ? 245 LEU A C    5  
ATOM   10148 O  O    . LEU A 1 91  ? 9.326   -2.042  -6.723  1.00 0.00 ? 245 LEU A O    5  
ATOM   10149 C  CB   . LEU A 1 91  ? 9.392   -5.237  -5.800  1.00 0.00 ? 245 LEU A CB   5  
ATOM   10150 C  CG   . LEU A 1 91  ? 9.947   -5.206  -7.230  1.00 0.00 ? 245 LEU A CG   5  
ATOM   10151 C  CD1  . LEU A 1 91  ? 11.433  -4.832  -7.207  1.00 0.00 ? 245 LEU A CD1  5  
ATOM   10152 C  CD2  . LEU A 1 91  ? 9.777   -6.588  -7.868  1.00 0.00 ? 245 LEU A CD2  5  
ATOM   10153 H  H    . LEU A 1 91  ? 8.572   -4.805  -3.444  1.00 0.00 ? 245 LEU A H    5  
ATOM   10154 H  HA   . LEU A 1 91  ? 10.559  -3.566  -5.086  1.00 0.00 ? 245 LEU A HA   5  
ATOM   10155 H  HB2  . LEU A 1 91  ? 9.947   -5.957  -5.216  1.00 0.00 ? 245 LEU A HB2  5  
ATOM   10156 H  HB3  . LEU A 1 91  ? 8.351   -5.524  -5.827  1.00 0.00 ? 245 LEU A HB3  5  
ATOM   10157 H  HG   . LEU A 1 91  ? 9.403   -4.473  -7.809  1.00 0.00 ? 245 LEU A HG   5  
ATOM   10158 H  HD11 . LEU A 1 91  ? 11.542  -3.781  -7.428  1.00 0.00 ? 245 LEU A HD11 5  
ATOM   10159 H  HD12 . LEU A 1 91  ? 11.966  -5.413  -7.946  1.00 0.00 ? 245 LEU A HD12 5  
ATOM   10160 H  HD13 . LEU A 1 91  ? 11.840  -5.036  -6.227  1.00 0.00 ? 245 LEU A HD13 5  
ATOM   10161 H  HD21 . LEU A 1 91  ? 8.766   -6.695  -8.231  1.00 0.00 ? 245 LEU A HD21 5  
ATOM   10162 H  HD22 . LEU A 1 91  ? 9.979   -7.351  -7.132  1.00 0.00 ? 245 LEU A HD22 5  
ATOM   10163 H  HD23 . LEU A 1 91  ? 10.468  -6.691  -8.691  1.00 0.00 ? 245 LEU A HD23 5  
ATOM   10164 N  N    . ARG A 1 92  ? 7.433   -2.723  -5.805  1.00 0.00 ? 246 ARG A N    5  
ATOM   10165 C  CA   . ARG A 1 92  ? 6.647   -1.691  -6.572  1.00 0.00 ? 246 ARG A CA   5  
ATOM   10166 C  C    . ARG A 1 92  ? 6.729   -0.304  -5.893  1.00 0.00 ? 246 ARG A C    5  
ATOM   10167 O  O    . ARG A 1 92  ? 6.429   0.697   -6.516  1.00 0.00 ? 246 ARG A O    5  
ATOM   10168 C  CB   . ARG A 1 92  ? 5.192   -2.182  -6.596  1.00 0.00 ? 246 ARG A CB   5  
ATOM   10169 C  CG   . ARG A 1 92  ? 5.056   -3.335  -7.593  1.00 0.00 ? 246 ARG A CG   5  
ATOM   10170 C  CD   . ARG A 1 92  ? 4.696   -2.779  -8.972  1.00 0.00 ? 246 ARG A CD   5  
ATOM   10171 N  NE   . ARG A 1 92  ? 6.008   -2.449  -9.610  1.00 0.00 ? 246 ARG A NE   5  
ATOM   10172 C  CZ   . ARG A 1 92  ? 6.806   -3.398  -10.073 1.00 0.00 ? 246 ARG A CZ   5  
ATOM   10173 N  NH1  . ARG A 1 92  ? 6.479   -4.668  -9.992  1.00 0.00 ? 246 ARG A NH1  5  
ATOM   10174 N  NH2  . ARG A 1 92  ? 7.946   -3.071  -10.626 1.00 0.00 ? 246 ARG A NH2  5  
ATOM   10175 H  H    . ARG A 1 92  ? 6.972   -3.332  -5.173  1.00 0.00 ? 246 ARG A H    5  
ATOM   10176 H  HA   . ARG A 1 92  ? 7.020   -1.626  -7.581  1.00 0.00 ? 246 ARG A HA   5  
ATOM   10177 H  HB2  . ARG A 1 92  ? 4.911   -2.524  -5.610  1.00 0.00 ? 246 ARG A HB2  5  
ATOM   10178 H  HB3  . ARG A 1 92  ? 4.543   -1.374  -6.895  1.00 0.00 ? 246 ARG A HB3  5  
ATOM   10179 H  HG2  . ARG A 1 92  ? 5.994   -3.870  -7.653  1.00 0.00 ? 246 ARG A HG2  5  
ATOM   10180 H  HG3  . ARG A 1 92  ? 4.279   -4.007  -7.264  1.00 0.00 ? 246 ARG A HG3  5  
ATOM   10181 H  HD2  . ARG A 1 92  ? 4.170   -3.525  -9.552  1.00 0.00 ? 246 ARG A HD2  5  
ATOM   10182 H  HD3  . ARG A 1 92  ? 4.099   -1.886  -8.874  1.00 0.00 ? 246 ARG A HD3  5  
ATOM   10183 H  HE   . ARG A 1 92  ? 6.279   -1.508  -9.683  1.00 0.00 ? 246 ARG A HE   5  
ATOM   10184 H  HH11 . ARG A 1 92  ? 5.615   -4.943  -9.575  1.00 0.00 ? 246 ARG A HH11 5  
ATOM   10185 H  HH12 . ARG A 1 92  ? 7.101   -5.364  -10.351 1.00 0.00 ? 246 ARG A HH12 5  
ATOM   10186 H  HH21 . ARG A 1 92  ? 8.210   -2.108  -10.695 1.00 0.00 ? 246 ARG A HH21 5  
ATOM   10187 H  HH22 . ARG A 1 92  ? 8.553   -3.783  -10.979 1.00 0.00 ? 246 ARG A HH22 5  
ATOM   10188 N  N    . ASN A 1 93  ? 7.127   -0.223  -4.633  1.00 0.00 ? 247 ASN A N    5  
ATOM   10189 C  CA   . ASN A 1 93  ? 7.209   1.117   -3.961  1.00 0.00 ? 247 ASN A CA   5  
ATOM   10190 C  C    . ASN A 1 93  ? 8.653   1.644   -3.970  1.00 0.00 ? 247 ASN A C    5  
ATOM   10191 O  O    . ASN A 1 93  ? 8.879   2.818   -4.203  1.00 0.00 ? 247 ASN A O    5  
ATOM   10192 C  CB   . ASN A 1 93  ? 6.731   0.896   -2.520  1.00 0.00 ? 247 ASN A CB   5  
ATOM   10193 C  CG   . ASN A 1 93  ? 6.550   2.252   -1.827  1.00 0.00 ? 247 ASN A CG   5  
ATOM   10194 O  OD1  . ASN A 1 93  ? 5.991   3.166   -2.401  1.00 0.00 ? 247 ASN A OD1  5  
ATOM   10195 N  ND2  . ASN A 1 93  ? 7.000   2.430   -0.608  1.00 0.00 ? 247 ASN A ND2  5  
ATOM   10196 H  H    . ASN A 1 93  ? 7.368   -1.030  -4.132  1.00 0.00 ? 247 ASN A H    5  
ATOM   10197 H  HA   . ASN A 1 93  ? 6.561   1.817   -4.456  1.00 0.00 ? 247 ASN A HA   5  
ATOM   10198 H  HB2  . ASN A 1 93  ? 5.789   0.367   -2.531  1.00 0.00 ? 247 ASN A HB2  5  
ATOM   10199 H  HB3  . ASN A 1 93  ? 7.465   0.315   -1.982  1.00 0.00 ? 247 ASN A HB3  5  
ATOM   10200 H  HD21 . ASN A 1 93  ? 7.454   1.700   -0.134  1.00 0.00 ? 247 ASN A HD21 5  
ATOM   10201 H  HD22 . ASN A 1 93  ? 6.884   3.298   -0.168  1.00 0.00 ? 247 ASN A HD22 5  
ATOM   10202 N  N    . LEU A 1 94  ? 9.631   0.801   -3.714  1.00 0.00 ? 248 LEU A N    5  
ATOM   10203 C  CA   . LEU A 1 94  ? 11.049  1.292   -3.711  1.00 0.00 ? 248 LEU A CA   5  
ATOM   10204 C  C    . LEU A 1 94  ? 12.054  0.230   -4.214  1.00 0.00 ? 248 LEU A C    5  
ATOM   10205 O  O    . LEU A 1 94  ? 13.222  0.290   -3.875  1.00 0.00 ? 248 LEU A O    5  
ATOM   10206 C  CB   . LEU A 1 94  ? 11.342  1.669   -2.251  1.00 0.00 ? 248 LEU A CB   5  
ATOM   10207 C  CG   . LEU A 1 94  ? 11.237  0.440   -1.341  1.00 0.00 ? 248 LEU A CG   5  
ATOM   10208 C  CD1  . LEU A 1 94  ? 12.587  -0.274  -1.284  1.00 0.00 ? 248 LEU A CD1  5  
ATOM   10209 C  CD2  . LEU A 1 94  ? 10.844  0.888   0.070   1.00 0.00 ? 248 LEU A CD2  5  
ATOM   10210 H  H    . LEU A 1 94  ? 9.434   -0.140  -3.524  1.00 0.00 ? 248 LEU A H    5  
ATOM   10211 H  HA   . LEU A 1 94  ? 11.125  2.176   -4.323  1.00 0.00 ? 248 LEU A HA   5  
ATOM   10212 H  HB2  . LEU A 1 94  ? 12.339  2.079   -2.183  1.00 0.00 ? 248 LEU A HB2  5  
ATOM   10213 H  HB3  . LEU A 1 94  ? 10.629  2.414   -1.926  1.00 0.00 ? 248 LEU A HB3  5  
ATOM   10214 H  HG   . LEU A 1 94  ? 10.491  -0.236  -1.724  1.00 0.00 ? 248 LEU A HG   5  
ATOM   10215 H  HD11 . LEU A 1 94  ? 13.381  0.453   -1.358  1.00 0.00 ? 248 LEU A HD11 5  
ATOM   10216 H  HD12 . LEU A 1 94  ? 12.658  -0.972  -2.106  1.00 0.00 ? 248 LEU A HD12 5  
ATOM   10217 H  HD13 . LEU A 1 94  ? 12.673  -0.809  -0.350  1.00 0.00 ? 248 LEU A HD13 5  
ATOM   10218 H  HD21 . LEU A 1 94  ? 11.495  1.687   0.388   1.00 0.00 ? 248 LEU A HD21 5  
ATOM   10219 H  HD22 . LEU A 1 94  ? 10.936  0.055   0.750   1.00 0.00 ? 248 LEU A HD22 5  
ATOM   10220 H  HD23 . LEU A 1 94  ? 9.822   1.237   0.064   1.00 0.00 ? 248 LEU A HD23 5  
ATOM   10221 N  N    . GLY A 1 95  ? 11.640  -0.717  -5.035  1.00 0.00 ? 249 GLY A N    5  
ATOM   10222 C  CA   . GLY A 1 95  ? 12.611  -1.733  -5.553  1.00 0.00 ? 249 GLY A CA   5  
ATOM   10223 C  C    . GLY A 1 95  ? 12.858  -2.829  -4.505  1.00 0.00 ? 249 GLY A C    5  
ATOM   10224 O  O    . GLY A 1 95  ? 12.340  -2.774  -3.406  1.00 0.00 ? 249 GLY A O    5  
ATOM   10225 H  H    . GLY A 1 95  ? 10.705  -0.753  -5.328  1.00 0.00 ? 249 GLY A H    5  
ATOM   10226 H  HA2  . GLY A 1 95  ? 12.213  -2.181  -6.450  1.00 0.00 ? 249 GLY A HA2  5  
ATOM   10227 H  HA3  . GLY A 1 95  ? 13.548  -1.247  -5.782  1.00 0.00 ? 249 GLY A HA3  5  
ATOM   10228 N  N    . ARG A 1 96  ? 13.649  -3.830  -4.843  1.00 0.00 ? 250 ARG A N    5  
ATOM   10229 C  CA   . ARG A 1 96  ? 13.928  -4.935  -3.862  1.00 0.00 ? 250 ARG A CA   5  
ATOM   10230 C  C    . ARG A 1 96  ? 15.290  -4.751  -3.161  1.00 0.00 ? 250 ARG A C    5  
ATOM   10231 O  O    . ARG A 1 96  ? 15.474  -5.224  -2.057  1.00 0.00 ? 250 ARG A O    5  
ATOM   10232 C  CB   . ARG A 1 96  ? 13.933  -6.228  -4.684  1.00 0.00 ? 250 ARG A CB   5  
ATOM   10233 C  CG   . ARG A 1 96  ? 14.062  -7.430  -3.746  1.00 0.00 ? 250 ARG A CG   5  
ATOM   10234 C  CD   . ARG A 1 96  ? 15.537  -7.818  -3.609  1.00 0.00 ? 250 ARG A CD   5  
ATOM   10235 N  NE   . ARG A 1 96  ? 15.727  -8.954  -4.563  1.00 0.00 ? 250 ARG A NE   5  
ATOM   10236 C  CZ   . ARG A 1 96  ? 15.207  -10.148 -4.322  1.00 0.00 ? 250 ARG A CZ   5  
ATOM   10237 N  NH1  . ARG A 1 96  ? 14.504  -10.384 -3.238  1.00 0.00 ? 250 ARG A NH1  5  
ATOM   10238 N  NH2  . ARG A 1 96  ? 15.394  -11.119 -5.180  1.00 0.00 ? 250 ARG A NH2  5  
ATOM   10239 H  H    . ARG A 1 96  ? 14.056  -3.856  -5.740  1.00 0.00 ? 250 ARG A H    5  
ATOM   10240 H  HA   . ARG A 1 96  ? 13.143  -4.979  -3.127  1.00 0.00 ? 250 ARG A HA   5  
ATOM   10241 H  HB2  . ARG A 1 96  ? 13.012  -6.303  -5.243  1.00 0.00 ? 250 ARG A HB2  5  
ATOM   10242 H  HB3  . ARG A 1 96  ? 14.770  -6.214  -5.366  1.00 0.00 ? 250 ARG A HB3  5  
ATOM   10243 H  HG2  . ARG A 1 96  ? 13.666  -7.172  -2.774  1.00 0.00 ? 250 ARG A HG2  5  
ATOM   10244 H  HG3  . ARG A 1 96  ? 13.509  -8.264  -4.151  1.00 0.00 ? 250 ARG A HG3  5  
ATOM   10245 H  HD2  . ARG A 1 96  ? 16.172  -6.985  -3.881  1.00 0.00 ? 250 ARG A HD2  5  
ATOM   10246 H  HD3  . ARG A 1 96  ? 15.749  -8.142  -2.603  1.00 0.00 ? 250 ARG A HD3  5  
ATOM   10247 H  HE   . ARG A 1 96  ? 16.247  -8.807  -5.382  1.00 0.00 ? 250 ARG A HE   5  
ATOM   10248 H  HH11 . ARG A 1 96  ? 14.346  -9.660  -2.569  1.00 0.00 ? 250 ARG A HH11 5  
ATOM   10249 H  HH12 . ARG A 1 96  ? 14.123  -11.295 -3.082  1.00 0.00 ? 250 ARG A HH12 5  
ATOM   10250 H  HH21 . ARG A 1 96  ? 15.926  -10.956 -6.010  1.00 0.00 ? 250 ARG A HH21 5  
ATOM   10251 H  HH22 . ARG A 1 96  ? 15.004  -12.023 -5.004  1.00 0.00 ? 250 ARG A HH22 5  
ATOM   10252 N  N    . LYS A 1 97  ? 16.254  -4.088  -3.785  1.00 0.00 ? 251 LYS A N    5  
ATOM   10253 C  CA   . LYS A 1 97  ? 17.606  -3.909  -3.119  1.00 0.00 ? 251 LYS A CA   5  
ATOM   10254 C  C    . LYS A 1 97  ? 17.439  -3.385  -1.683  1.00 0.00 ? 251 LYS A C    5  
ATOM   10255 O  O    . LYS A 1 97  ? 17.867  -4.023  -0.740  1.00 0.00 ? 251 LYS A O    5  
ATOM   10256 C  CB   . LYS A 1 97  ? 18.384  -2.887  -3.963  1.00 0.00 ? 251 LYS A CB   5  
ATOM   10257 C  CG   . LYS A 1 97  ? 19.839  -2.839  -3.491  1.00 0.00 ? 251 LYS A CG   5  
ATOM   10258 C  CD   . LYS A 1 97  ? 20.465  -1.504  -3.901  1.00 0.00 ? 251 LYS A CD   5  
ATOM   10259 C  CE   . LYS A 1 97  ? 21.983  -1.576  -3.724  1.00 0.00 ? 251 LYS A CE   5  
ATOM   10260 N  NZ   . LYS A 1 97  ? 22.482  -2.240  -4.960  1.00 0.00 ? 251 LYS A NZ   5  
ATOM   10261 H  H    . LYS A 1 97  ? 16.094  -3.725  -4.684  1.00 0.00 ? 251 LYS A H    5  
ATOM   10262 H  HA   . LYS A 1 97  ? 18.135  -4.849  -3.101  1.00 0.00 ? 251 LYS A HA   5  
ATOM   10263 H  HB2  . LYS A 1 97  ? 18.352  -3.181  -5.002  1.00 0.00 ? 251 LYS A HB2  5  
ATOM   10264 H  HB3  . LYS A 1 97  ? 17.938  -1.911  -3.850  1.00 0.00 ? 251 LYS A HB3  5  
ATOM   10265 H  HG2  . LYS A 1 97  ? 19.872  -2.938  -2.416  1.00 0.00 ? 251 LYS A HG2  5  
ATOM   10266 H  HG3  . LYS A 1 97  ? 20.392  -3.647  -3.945  1.00 0.00 ? 251 LYS A HG3  5  
ATOM   10267 H  HD2  . LYS A 1 97  ? 20.231  -1.299  -4.936  1.00 0.00 ? 251 LYS A HD2  5  
ATOM   10268 H  HD3  . LYS A 1 97  ? 20.069  -0.715  -3.279  1.00 0.00 ? 251 LYS A HD3  5  
ATOM   10269 H  HE2  . LYS A 1 97  ? 22.397  -0.581  -3.634  1.00 0.00 ? 251 LYS A HE2  5  
ATOM   10270 H  HE3  . LYS A 1 97  ? 22.233  -2.169  -2.859  1.00 0.00 ? 251 LYS A HE3  5  
ATOM   10271 H  HZ1  . LYS A 1 97  ? 23.522  -2.263  -4.946  1.00 0.00 ? 251 LYS A HZ1  5  
ATOM   10272 H  HZ2  . LYS A 1 97  ? 22.158  -1.709  -5.793  1.00 0.00 ? 251 LYS A HZ2  5  
ATOM   10273 H  HZ3  . LYS A 1 97  ? 22.117  -3.212  -5.003  1.00 0.00 ? 251 LYS A HZ3  5  
ATOM   10274 N  N    . GLU A 1 98  ? 16.800  -2.245  -1.500  1.00 0.00 ? 252 GLU A N    5  
ATOM   10275 C  CA   . GLU A 1 98  ? 16.596  -1.722  -0.098  1.00 0.00 ? 252 GLU A CA   5  
ATOM   10276 C  C    . GLU A 1 98  ? 15.934  -2.807  0.779   1.00 0.00 ? 252 GLU A C    5  
ATOM   10277 O  O    . GLU A 1 98  ? 16.174  -2.876  1.969   1.00 0.00 ? 252 GLU A O    5  
ATOM   10278 C  CB   . GLU A 1 98  ? 15.673  -0.497  -0.206  1.00 0.00 ? 252 GLU A CB   5  
ATOM   10279 C  CG   . GLU A 1 98  ? 16.520  0.773   -0.309  1.00 0.00 ? 252 GLU A CG   5  
ATOM   10280 C  CD   . GLU A 1 98  ? 15.638  1.996   -0.050  1.00 0.00 ? 252 GLU A CD   5  
ATOM   10281 O  OE1  . GLU A 1 98  ? 14.711  2.206   -0.815  1.00 0.00 ? 252 GLU A OE1  5  
ATOM   10282 O  OE2  . GLU A 1 98  ? 15.906  2.702   0.908   1.00 0.00 ? 252 GLU A OE2  5  
ATOM   10283 H  H    . GLU A 1 98  ? 16.445  -1.749  -2.274  1.00 0.00 ? 252 GLU A H    5  
ATOM   10284 H  HA   . GLU A 1 98  ? 17.541  -1.433  0.326   1.00 0.00 ? 252 GLU A HA   5  
ATOM   10285 H  HB2  . GLU A 1 98  ? 15.055  -0.591  -1.087  1.00 0.00 ? 252 GLU A HB2  5  
ATOM   10286 H  HB3  . GLU A 1 98  ? 15.046  -0.440  0.670   1.00 0.00 ? 252 GLU A HB3  5  
ATOM   10287 H  HG2  . GLU A 1 98  ? 17.312  0.737   0.425   1.00 0.00 ? 252 GLU A HG2  5  
ATOM   10288 H  HG3  . GLU A 1 98  ? 16.947  0.843   -1.298  1.00 0.00 ? 252 GLU A HG3  5  
ATOM   10289 N  N    . LEU A 1 99  ? 15.112  -3.662  0.196   1.00 0.00 ? 253 LEU A N    5  
ATOM   10290 C  CA   . LEU A 1 99  ? 14.455  -4.746  1.008   1.00 0.00 ? 253 LEU A CA   5  
ATOM   10291 C  C    . LEU A 1 99  ? 15.519  -5.625  1.692   1.00 0.00 ? 253 LEU A C    5  
ATOM   10292 O  O    . LEU A 1 99  ? 15.309  -6.099  2.792   1.00 0.00 ? 253 LEU A O    5  
ATOM   10293 C  CB   . LEU A 1 99  ? 13.629  -5.588  0.021   1.00 0.00 ? 253 LEU A CB   5  
ATOM   10294 C  CG   . LEU A 1 99  ? 12.476  -6.263  0.760   1.00 0.00 ? 253 LEU A CG   5  
ATOM   10295 C  CD1  . LEU A 1 99  ? 11.398  -6.678  -0.245  1.00 0.00 ? 253 LEU A CD1  5  
ATOM   10296 C  CD2  . LEU A 1 99  ? 12.994  -7.502  1.492   1.00 0.00 ? 253 LEU A CD2  5  
ATOM   10297 H  H    . LEU A 1 99  ? 14.936  -3.595  -0.770  1.00 0.00 ? 253 LEU A H    5  
ATOM   10298 H  HA   . LEU A 1 99  ? 13.802  -4.310  1.748   1.00 0.00 ? 253 LEU A HA   5  
ATOM   10299 H  HB2  . LEU A 1 99  ? 13.235  -4.946  -0.755  1.00 0.00 ? 253 LEU A HB2  5  
ATOM   10300 H  HB3  . LEU A 1 99  ? 14.261  -6.340  -0.425  1.00 0.00 ? 253 LEU A HB3  5  
ATOM   10301 H  HG   . LEU A 1 99  ? 12.053  -5.570  1.472   1.00 0.00 ? 253 LEU A HG   5  
ATOM   10302 H  HD11 . LEU A 1 99  ? 10.548  -7.080  0.285   1.00 0.00 ? 253 LEU A HD11 5  
ATOM   10303 H  HD12 . LEU A 1 99  ? 11.798  -7.431  -0.909  1.00 0.00 ? 253 LEU A HD12 5  
ATOM   10304 H  HD13 . LEU A 1 99  ? 11.090  -5.818  -0.821  1.00 0.00 ? 253 LEU A HD13 5  
ATOM   10305 H  HD21 . LEU A 1 99  ? 13.803  -7.941  0.927   1.00 0.00 ? 253 LEU A HD21 5  
ATOM   10306 H  HD22 . LEU A 1 99  ? 12.195  -8.221  1.594   1.00 0.00 ? 253 LEU A HD22 5  
ATOM   10307 H  HD23 . LEU A 1 99  ? 13.352  -7.218  2.471   1.00 0.00 ? 253 LEU A HD23 5  
ATOM   10308 N  N    . SER A 1 100 ? 16.661  -5.849  1.063   1.00 0.00 ? 254 SER A N    5  
ATOM   10309 C  CA   . SER A 1 100 ? 17.711  -6.704  1.730   1.00 0.00 ? 254 SER A CA   5  
ATOM   10310 C  C    . SER A 1 100 ? 18.188  -6.018  3.017   1.00 0.00 ? 254 SER A C    5  
ATOM   10311 O  O    . SER A 1 100 ? 18.222  -6.630  4.068   1.00 0.00 ? 254 SER A O    5  
ATOM   10312 C  CB   . SER A 1 100 ? 18.873  -6.846  0.736   1.00 0.00 ? 254 SER A CB   5  
ATOM   10313 O  OG   . SER A 1 100 ? 19.519  -8.094  0.946   1.00 0.00 ? 254 SER A OG   5  
ATOM   10314 H  H    . SER A 1 100 ? 16.823  -5.458  0.169   1.00 0.00 ? 254 SER A H    5  
ATOM   10315 H  HA   . SER A 1 100 ? 17.301  -7.674  1.965   1.00 0.00 ? 254 SER A HA   5  
ATOM   10316 H  HB2  . SER A 1 100 ? 18.495  -6.809  -0.272  1.00 0.00 ? 254 SER A HB2  5  
ATOM   10317 H  HB3  . SER A 1 100 ? 19.574  -6.035  0.886   1.00 0.00 ? 254 SER A HB3  5  
ATOM   10318 H  HG   . SER A 1 100 ? 20.365  -8.071  0.492   1.00 0.00 ? 254 SER A HG   5  
ATOM   10319 N  N    . THR A 1 101 ? 18.543  -4.749  2.953   1.00 0.00 ? 255 THR A N    5  
ATOM   10320 C  CA   . THR A 1 101 ? 19.001  -4.041  4.207   1.00 0.00 ? 255 THR A CA   5  
ATOM   10321 C  C    . THR A 1 101 ? 17.914  -4.128  5.292   1.00 0.00 ? 255 THR A C    5  
ATOM   10322 O  O    . THR A 1 101 ? 18.220  -4.204  6.468   1.00 0.00 ? 255 THR A O    5  
ATOM   10323 C  CB   . THR A 1 101 ? 19.252  -2.573  3.823   1.00 0.00 ? 255 THR A CB   5  
ATOM   10324 O  OG1  . THR A 1 101 ? 20.012  -2.522  2.625   1.00 0.00 ? 255 THR A OG1  5  
ATOM   10325 C  CG2  . THR A 1 101 ? 20.019  -1.874  4.947   1.00 0.00 ? 255 THR A CG2  5  
ATOM   10326 H  H    . THR A 1 101 ? 18.498  -4.266  2.093   1.00 0.00 ? 255 THR A H    5  
ATOM   10327 H  HA   . THR A 1 101 ? 19.911  -4.486  4.569   1.00 0.00 ? 255 THR A HA   5  
ATOM   10328 H  HB   . THR A 1 101 ? 18.307  -2.073  3.673   1.00 0.00 ? 255 THR A HB   5  
ATOM   10329 H  HG1  . THR A 1 101 ? 19.928  -1.640  2.258   1.00 0.00 ? 255 THR A HG1  5  
ATOM   10330 H  HG21 . THR A 1 101 ? 19.882  -0.806  4.866   1.00 0.00 ? 255 THR A HG21 5  
ATOM   10331 H  HG22 . THR A 1 101 ? 21.070  -2.110  4.866   1.00 0.00 ? 255 THR A HG22 5  
ATOM   10332 H  HG23 . THR A 1 101 ? 19.646  -2.213  5.902   1.00 0.00 ? 255 THR A HG23 5  
ATOM   10333 N  N    . ILE A 1 102 ? 16.648  -4.131  4.916   1.00 0.00 ? 256 ILE A N    5  
ATOM   10334 C  CA   . ILE A 1 102 ? 15.559  -4.231  5.956   1.00 0.00 ? 256 ILE A CA   5  
ATOM   10335 C  C    . ILE A 1 102 ? 15.759  -5.501  6.810   1.00 0.00 ? 256 ILE A C    5  
ATOM   10336 O  O    . ILE A 1 102 ? 15.459  -5.502  7.989   1.00 0.00 ? 256 ILE A O    5  
ATOM   10337 C  CB   . ILE A 1 102 ? 14.216  -4.290  5.194   1.00 0.00 ? 256 ILE A CB   5  
ATOM   10338 C  CG1  . ILE A 1 102 ? 13.954  -2.939  4.520   1.00 0.00 ? 256 ILE A CG1  5  
ATOM   10339 C  CG2  . ILE A 1 102 ? 13.070  -4.594  6.165   1.00 0.00 ? 256 ILE A CG2  5  
ATOM   10340 C  CD1  . ILE A 1 102 ? 12.718  -3.045  3.623   1.00 0.00 ? 256 ILE A CD1  5  
ATOM   10341 H  H    . ILE A 1 102 ? 16.419  -4.078  3.960   1.00 0.00 ? 256 ILE A H    5  
ATOM   10342 H  HA   . ILE A 1 102 ? 15.581  -3.362  6.589   1.00 0.00 ? 256 ILE A HA   5  
ATOM   10343 H  HB   . ILE A 1 102 ? 14.262  -5.064  4.444   1.00 0.00 ? 256 ILE A HB   5  
ATOM   10344 H  HG12 . ILE A 1 102 ? 13.785  -2.187  5.277   1.00 0.00 ? 256 ILE A HG12 5  
ATOM   10345 H  HG13 . ILE A 1 102 ? 14.806  -2.660  3.921   1.00 0.00 ? 256 ILE A HG13 5  
ATOM   10346 H  HG21 . ILE A 1 102 ? 12.903  -5.660  6.200   1.00 0.00 ? 256 ILE A HG21 5  
ATOM   10347 H  HG22 . ILE A 1 102 ? 12.174  -4.100  5.830   1.00 0.00 ? 256 ILE A HG22 5  
ATOM   10348 H  HG23 . ILE A 1 102 ? 13.334  -4.240  7.148   1.00 0.00 ? 256 ILE A HG23 5  
ATOM   10349 H  HD11 . ILE A 1 102 ? 12.583  -4.072  3.316   1.00 0.00 ? 256 ILE A HD11 5  
ATOM   10350 H  HD12 . ILE A 1 102 ? 12.853  -2.424  2.750   1.00 0.00 ? 256 ILE A HD12 5  
ATOM   10351 H  HD13 . ILE A 1 102 ? 11.847  -2.715  4.169   1.00 0.00 ? 256 ILE A HD13 5  
ATOM   10352 N  N    . MET A 1 103 ? 16.268  -6.574  6.235   1.00 0.00 ? 257 MET A N    5  
ATOM   10353 C  CA   . MET A 1 103 ? 16.477  -7.816  7.049   1.00 0.00 ? 257 MET A CA   5  
ATOM   10354 C  C    . MET A 1 103 ? 17.946  -7.944  7.509   1.00 0.00 ? 257 MET A C    5  
ATOM   10355 O  O    . MET A 1 103 ? 18.408  -9.034  7.790   1.00 0.00 ? 257 MET A O    5  
ATOM   10356 C  CB   . MET A 1 103 ? 16.095  -8.984  6.132   1.00 0.00 ? 257 MET A CB   5  
ATOM   10357 C  CG   . MET A 1 103 ? 14.577  -9.179  6.159   1.00 0.00 ? 257 MET A CG   5  
ATOM   10358 S  SD   . MET A 1 103 ? 14.116  -10.083 7.660   1.00 0.00 ? 257 MET A SD   5  
ATOM   10359 C  CE   . MET A 1 103 ? 12.501  -9.305  7.911   1.00 0.00 ? 257 MET A CE   5  
ATOM   10360 H  H    . MET A 1 103 ? 16.515  -6.560  5.280   1.00 0.00 ? 257 MET A H    5  
ATOM   10361 H  HA   . MET A 1 103 ? 15.825  -7.806  7.908   1.00 0.00 ? 257 MET A HA   5  
ATOM   10362 H  HB2  . MET A 1 103 ? 16.414  -8.767  5.121   1.00 0.00 ? 257 MET A HB2  5  
ATOM   10363 H  HB3  . MET A 1 103 ? 16.579  -9.886  6.475   1.00 0.00 ? 257 MET A HB3  5  
ATOM   10364 H  HG2  . MET A 1 103 ? 14.089  -8.216  6.153   1.00 0.00 ? 257 MET A HG2  5  
ATOM   10365 H  HG3  . MET A 1 103 ? 14.271  -9.744  5.290   1.00 0.00 ? 257 MET A HG3  5  
ATOM   10366 H  HE1  . MET A 1 103 ? 11.921  -9.897  8.608   1.00 0.00 ? 257 MET A HE1  5  
ATOM   10367 H  HE2  . MET A 1 103 ? 11.978  -9.249  6.970   1.00 0.00 ? 257 MET A HE2  5  
ATOM   10368 H  HE3  . MET A 1 103 ? 12.640  -8.308  8.304   1.00 0.00 ? 257 MET A HE3  5  
ATOM   10369 N  N    . ASP A 1 104 ? 18.688  -6.850  7.600   1.00 0.00 ? 258 ASP A N    5  
ATOM   10370 C  CA   . ASP A 1 104 ? 20.116  -6.946  8.055   1.00 0.00 ? 258 ASP A CA   5  
ATOM   10371 C  C    . ASP A 1 104 ? 20.704  -5.543  8.303   1.00 0.00 ? 258 ASP A C    5  
ATOM   10372 O  O    . ASP A 1 104 ? 21.695  -5.168  7.701   1.00 0.00 ? 258 ASP A O    5  
ATOM   10373 C  CB   . ASP A 1 104 ? 20.854  -7.642  6.907   1.00 0.00 ? 258 ASP A CB   5  
ATOM   10374 C  CG   . ASP A 1 104 ? 22.239  -8.083  7.385   1.00 0.00 ? 258 ASP A CG   5  
ATOM   10375 O  OD1  . ASP A 1 104 ? 22.321  -9.116  8.029   1.00 0.00 ? 258 ASP A OD1  5  
ATOM   10376 O  OD2  . ASP A 1 104 ? 23.194  -7.381  7.097   1.00 0.00 ? 258 ASP A OD2  5  
ATOM   10377 H  H    . ASP A 1 104 ? 18.310  -5.971  7.376   1.00 0.00 ? 258 ASP A H    5  
ATOM   10378 H  HA   . ASP A 1 104 ? 20.183  -7.542  8.951   1.00 0.00 ? 258 ASP A HA   5  
ATOM   10379 H  HB2  . ASP A 1 104 ? 20.290  -8.507  6.589   1.00 0.00 ? 258 ASP A HB2  5  
ATOM   10380 H  HB3  . ASP A 1 104 ? 20.962  -6.957  6.080   1.00 0.00 ? 258 ASP A HB3  5  
ATOM   10381 N  N    . GLU A 1 105 ? 20.101  -4.760  9.178   1.00 0.00 ? 259 GLU A N    5  
ATOM   10382 C  CA   . GLU A 1 105 ? 20.634  -3.390  9.440   1.00 0.00 ? 259 GLU A CA   5  
ATOM   10383 C  C    . GLU A 1 105 ? 20.876  -3.174  10.944  1.00 0.00 ? 259 GLU A C    5  
ATOM   10384 O  O    . GLU A 1 105 ? 22.003  -2.989  11.365  1.00 0.00 ? 259 GLU A O    5  
ATOM   10385 C  CB   . GLU A 1 105 ? 19.557  -2.438  8.905   1.00 0.00 ? 259 GLU A CB   5  
ATOM   10386 C  CG   . GLU A 1 105 ? 20.017  -0.988  9.080   1.00 0.00 ? 259 GLU A CG   5  
ATOM   10387 C  CD   . GLU A 1 105 ? 20.684  -0.505  7.791   1.00 0.00 ? 259 GLU A CD   5  
ATOM   10388 O  OE1  . GLU A 1 105 ? 21.796  -0.933  7.527   1.00 0.00 ? 259 GLU A OE1  5  
ATOM   10389 O  OE2  . GLU A 1 105 ? 20.074  0.285   7.090   1.00 0.00 ? 259 GLU A OE2  5  
ATOM   10390 H  H    . GLU A 1 105 ? 19.299  -5.069  9.655   1.00 0.00 ? 259 GLU A H    5  
ATOM   10391 H  HA   . GLU A 1 105 ? 21.549  -3.245  8.898   1.00 0.00 ? 259 GLU A HA   5  
ATOM   10392 H  HB2  . GLU A 1 105 ? 19.393  -2.639  7.856   1.00 0.00 ? 259 GLU A HB2  5  
ATOM   10393 H  HB3  . GLU A 1 105 ? 18.636  -2.589  9.445   1.00 0.00 ? 259 GLU A HB3  5  
ATOM   10394 H  HG2  . GLU A 1 105 ? 19.162  -0.364  9.298   1.00 0.00 ? 259 GLU A HG2  5  
ATOM   10395 H  HG3  . GLU A 1 105 ? 20.723  -0.927  9.893   1.00 0.00 ? 259 GLU A HG3  5  
ATOM   10396 N  N    . ASN A 1 106 ? 19.842  -3.193  11.758  1.00 0.00 ? 260 ASN A N    5  
ATOM   10397 C  CA   . ASN A 1 106 ? 20.047  -2.984  13.228  1.00 0.00 ? 260 ASN A CA   5  
ATOM   10398 C  C    . ASN A 1 106 ? 18.947  -3.695  14.036  1.00 0.00 ? 260 ASN A C    5  
ATOM   10399 O  O    . ASN A 1 106 ? 18.509  -3.200  15.057  1.00 0.00 ? 260 ASN A O    5  
ATOM   10400 C  CB   . ASN A 1 106 ? 19.972  -1.466  13.431  1.00 0.00 ? 260 ASN A CB   5  
ATOM   10401 C  CG   . ASN A 1 106 ? 18.613  -0.938  12.946  1.00 0.00 ? 260 ASN A CG   5  
ATOM   10402 O  OD1  . ASN A 1 106 ? 18.282  -1.069  11.784  1.00 0.00 ? 260 ASN A OD1  5  
ATOM   10403 N  ND2  . ASN A 1 106 ? 17.805  -0.342  13.788  1.00 0.00 ? 260 ASN A ND2  5  
ATOM   10404 H  H    . ASN A 1 106 ? 18.937  -3.343  11.410  1.00 0.00 ? 260 ASN A H    5  
ATOM   10405 H  HA   . ASN A 1 106 ? 21.019  -3.343  13.524  1.00 0.00 ? 260 ASN A HA   5  
ATOM   10406 H  HB2  . ASN A 1 106 ? 20.091  -1.239  14.480  1.00 0.00 ? 260 ASN A HB2  5  
ATOM   10407 H  HB3  . ASN A 1 106 ? 20.760  -0.990  12.868  1.00 0.00 ? 260 ASN A HB3  5  
ATOM   10408 H  HD21 . ASN A 1 106 ? 18.060  -0.230  14.729  1.00 0.00 ? 260 ASN A HD21 5  
ATOM   10409 H  HD22 . ASN A 1 106 ? 16.938  -0.006  13.476  1.00 0.00 ? 260 ASN A HD22 5  
ATOM   10410 N  N    . ASN A 1 107 ? 18.495  -4.854  13.593  1.00 0.00 ? 261 ASN A N    5  
ATOM   10411 C  CA   . ASN A 1 107 ? 17.421  -5.589  14.343  1.00 0.00 ? 261 ASN A CA   5  
ATOM   10412 C  C    . ASN A 1 107 ? 16.222  -4.668  14.673  1.00 0.00 ? 261 ASN A C    5  
ATOM   10413 O  O    . ASN A 1 107 ? 15.557  -4.855  15.673  1.00 0.00 ? 261 ASN A O    5  
ATOM   10414 C  CB   . ASN A 1 107 ? 18.093  -6.069  15.632  1.00 0.00 ? 261 ASN A CB   5  
ATOM   10415 C  CG   . ASN A 1 107 ? 17.523  -7.436  16.029  1.00 0.00 ? 261 ASN A CG   5  
ATOM   10416 O  OD1  . ASN A 1 107 ? 17.879  -8.442  15.449  1.00 0.00 ? 261 ASN A OD1  5  
ATOM   10417 N  ND2  . ASN A 1 107 ? 16.646  -7.522  17.001  1.00 0.00 ? 261 ASN A ND2  5  
ATOM   10418 H  H    . ASN A 1 107 ? 18.858  -5.245  12.764  1.00 0.00 ? 261 ASN A H    5  
ATOM   10419 H  HA   . ASN A 1 107 ? 17.086  -6.441  13.772  1.00 0.00 ? 261 ASN A HA   5  
ATOM   10420 H  HB2  . ASN A 1 107 ? 19.158  -6.154  15.470  1.00 0.00 ? 261 ASN A HB2  5  
ATOM   10421 H  HB3  . ASN A 1 107 ? 17.903  -5.358  16.422  1.00 0.00 ? 261 ASN A HB3  5  
ATOM   10422 H  HD21 . ASN A 1 107 ? 16.351  -6.715  17.477  1.00 0.00 ? 261 ASN A HD21 5  
ATOM   10423 H  HD22 . ASN A 1 107 ? 16.284  -8.397  17.253  1.00 0.00 ? 261 ASN A HD22 5  
ATOM   10424 N  N    . GLN A 1 108 ? 15.939  -3.682  13.842  1.00 0.00 ? 262 GLN A N    5  
ATOM   10425 C  CA   . GLN A 1 108 ? 14.778  -2.768  14.120  1.00 0.00 ? 262 GLN A CA   5  
ATOM   10426 C  C    . GLN A 1 108 ? 14.331  -2.079  12.820  1.00 0.00 ? 262 GLN A C    5  
ATOM   10427 O  O    . GLN A 1 108 ? 14.930  -1.108  12.396  1.00 0.00 ? 262 GLN A O    5  
ATOM   10428 C  CB   . GLN A 1 108 ? 15.307  -1.734  15.118  1.00 0.00 ? 262 GLN A CB   5  
ATOM   10429 C  CG   . GLN A 1 108 ? 14.793  -2.058  16.525  1.00 0.00 ? 262 GLN A CG   5  
ATOM   10430 C  CD   . GLN A 1 108 ? 15.894  -1.772  17.555  1.00 0.00 ? 262 GLN A CD   5  
ATOM   10431 O  OE1  . GLN A 1 108 ? 16.003  -0.667  18.046  1.00 0.00 ? 262 GLN A OE1  5  
ATOM   10432 N  NE2  . GLN A 1 108 ? 16.722  -2.725  17.908  1.00 0.00 ? 262 GLN A NE2  5  
ATOM   10433 H  H    . GLN A 1 108 ? 16.480  -3.544  13.033  1.00 0.00 ? 262 GLN A H    5  
ATOM   10434 H  HA   . GLN A 1 108 ? 13.960  -3.321  14.555  1.00 0.00 ? 262 GLN A HA   5  
ATOM   10435 H  HB2  . GLN A 1 108 ? 16.387  -1.751  15.114  1.00 0.00 ? 262 GLN A HB2  5  
ATOM   10436 H  HB3  . GLN A 1 108 ? 14.961  -0.751  14.832  1.00 0.00 ? 262 GLN A HB3  5  
ATOM   10437 H  HG2  . GLN A 1 108 ? 13.930  -1.445  16.741  1.00 0.00 ? 262 GLN A HG2  5  
ATOM   10438 H  HG3  . GLN A 1 108 ? 14.516  -3.100  16.577  1.00 0.00 ? 262 GLN A HG3  5  
ATOM   10439 H  HE21 . GLN A 1 108 ? 16.643  -3.623  17.517  1.00 0.00 ? 262 GLN A HE21 5  
ATOM   10440 H  HE22 . GLN A 1 108 ? 17.425  -2.541  18.566  1.00 0.00 ? 262 GLN A HE22 5  
ATOM   10441 N  N    . TRP A 1 109 ? 13.305  -2.587  12.170  1.00 0.00 ? 263 TRP A N    5  
ATOM   10442 C  CA   . TRP A 1 109 ? 12.858  -1.967  10.886  1.00 0.00 ? 263 TRP A CA   5  
ATOM   10443 C  C    . TRP A 1 109 ? 11.506  -1.244  11.043  1.00 0.00 ? 263 TRP A C    5  
ATOM   10444 O  O    . TRP A 1 109 ? 10.557  -1.796  11.567  1.00 0.00 ? 263 TRP A O    5  
ATOM   10445 C  CB   . TRP A 1 109 ? 12.723  -3.153  9.913   1.00 0.00 ? 263 TRP A CB   5  
ATOM   10446 C  CG   . TRP A 1 109 ? 12.107  -2.708  8.617   1.00 0.00 ? 263 TRP A CG   5  
ATOM   10447 C  CD1  . TRP A 1 109 ? 12.664  -1.837  7.746   1.00 0.00 ? 263 TRP A CD1  5  
ATOM   10448 C  CD2  . TRP A 1 109 ? 10.828  -3.101  8.041   1.00 0.00 ? 263 TRP A CD2  5  
ATOM   10449 N  NE1  . TRP A 1 109 ? 11.803  -1.662  6.677   1.00 0.00 ? 263 TRP A NE1  5  
ATOM   10450 C  CE2  . TRP A 1 109 ? 10.657  -2.421  6.811   1.00 0.00 ? 263 TRP A CE2  5  
ATOM   10451 C  CE3  . TRP A 1 109 ? 9.809   -3.972  8.464   1.00 0.00 ? 263 TRP A CE3  5  
ATOM   10452 C  CZ2  . TRP A 1 109 ? 9.514   -2.598  6.030   1.00 0.00 ? 263 TRP A CZ2  5  
ATOM   10453 C  CZ3  . TRP A 1 109 ? 8.658   -4.155  7.679   1.00 0.00 ? 263 TRP A CZ3  5  
ATOM   10454 C  CH2  . TRP A 1 109 ? 8.511   -3.468  6.465   1.00 0.00 ? 263 TRP A CH2  5  
ATOM   10455 H  H    . TRP A 1 109 ? 12.844  -3.385  12.512  1.00 0.00 ? 263 TRP A H    5  
ATOM   10456 H  HA   . TRP A 1 109 ? 13.606  -1.283  10.521  1.00 0.00 ? 263 TRP A HA   5  
ATOM   10457 H  HB2  . TRP A 1 109 ? 13.699  -3.569  9.728   1.00 0.00 ? 263 TRP A HB2  5  
ATOM   10458 H  HB3  . TRP A 1 109 ? 12.097  -3.910  10.364  1.00 0.00 ? 263 TRP A HB3  5  
ATOM   10459 H  HD1  . TRP A 1 109 ? 13.621  -1.357  7.866   1.00 0.00 ? 263 TRP A HD1  5  
ATOM   10460 H  HE1  . TRP A 1 109 ? 11.968  -1.077  5.908   1.00 0.00 ? 263 TRP A HE1  5  
ATOM   10461 H  HE3  . TRP A 1 109 ? 9.915   -4.507  9.396   1.00 0.00 ? 263 TRP A HE3  5  
ATOM   10462 H  HZ2  . TRP A 1 109 ? 9.405   -2.067  5.095   1.00 0.00 ? 263 TRP A HZ2  5  
ATOM   10463 H  HZ3  . TRP A 1 109 ? 7.881   -4.826  8.014   1.00 0.00 ? 263 TRP A HZ3  5  
ATOM   10464 H  HH2  . TRP A 1 109 ? 7.624   -3.613  5.865   1.00 0.00 ? 263 TRP A HH2  5  
ATOM   10465 N  N    . TYR A 1 110 ? 11.400  -0.038  10.522  1.00 0.00 ? 264 TYR A N    5  
ATOM   10466 C  CA   . TYR A 1 110 ? 10.089  0.682   10.566  1.00 0.00 ? 264 TYR A CA   5  
ATOM   10467 C  C    . TYR A 1 110 ? 9.370   0.345   9.261   1.00 0.00 ? 264 TYR A C    5  
ATOM   10468 O  O    . TYR A 1 110 ? 10.019  0.016   8.284   1.00 0.00 ? 264 TYR A O    5  
ATOM   10469 C  CB   . TYR A 1 110 ? 10.405  2.179   10.664  1.00 0.00 ? 264 TYR A CB   5  
ATOM   10470 C  CG   . TYR A 1 110 ? 10.325  2.604   12.109  1.00 0.00 ? 264 TYR A CG   5  
ATOM   10471 C  CD1  . TYR A 1 110 ? 9.093   2.973   12.662  1.00 0.00 ? 264 TYR A CD1  5  
ATOM   10472 C  CD2  . TYR A 1 110 ? 11.481  2.620   12.898  1.00 0.00 ? 264 TYR A CD2  5  
ATOM   10473 C  CE1  . TYR A 1 110 ? 9.018   3.362   14.004  1.00 0.00 ? 264 TYR A CE1  5  
ATOM   10474 C  CE2  . TYR A 1 110 ? 11.406  3.006   14.241  1.00 0.00 ? 264 TYR A CE2  5  
ATOM   10475 C  CZ   . TYR A 1 110 ? 10.175  3.379   14.794  1.00 0.00 ? 264 TYR A CZ   5  
ATOM   10476 O  OH   . TYR A 1 110 ? 10.100  3.761   16.118  1.00 0.00 ? 264 TYR A OH   5  
ATOM   10477 H  H    . TYR A 1 110 ? 12.166  0.367   10.051  1.00 0.00 ? 264 TYR A H    5  
ATOM   10478 H  HA   . TYR A 1 110 ? 9.503   0.361   11.416  1.00 0.00 ? 264 TYR A HA   5  
ATOM   10479 H  HB2  . TYR A 1 110 ? 11.399  2.367   10.284  1.00 0.00 ? 264 TYR A HB2  5  
ATOM   10480 H  HB3  . TYR A 1 110 ? 9.685   2.738   10.084  1.00 0.00 ? 264 TYR A HB3  5  
ATOM   10481 H  HD1  . TYR A 1 110 ? 8.201   2.958   12.053  1.00 0.00 ? 264 TYR A HD1  5  
ATOM   10482 H  HD2  . TYR A 1 110 ? 12.430  2.335   12.470  1.00 0.00 ? 264 TYR A HD2  5  
ATOM   10483 H  HE1  . TYR A 1 110 ? 8.068   3.650   14.430  1.00 0.00 ? 264 TYR A HE1  5  
ATOM   10484 H  HE2  . TYR A 1 110 ? 12.297  3.015   14.849  1.00 0.00 ? 264 TYR A HE2  5  
ATOM   10485 H  HH   . TYR A 1 110 ? 10.016  4.716   16.147  1.00 0.00 ? 264 TYR A HH   5  
ATOM   10486 N  N    . CYS A 1 111 ? 8.059   0.378   9.220   1.00 0.00 ? 265 CYS A N    5  
ATOM   10487 C  CA   . CYS A 1 111 ? 7.372   0.003   7.951   1.00 0.00 ? 265 CYS A CA   5  
ATOM   10488 C  C    . CYS A 1 111 ? 6.231   0.992   7.608   1.00 0.00 ? 265 CYS A C    5  
ATOM   10489 O  O    . CYS A 1 111 ? 6.328   2.168   7.905   1.00 0.00 ? 265 CYS A O    5  
ATOM   10490 C  CB   . CYS A 1 111 ? 6.901   -1.446  8.202   1.00 0.00 ? 265 CYS A CB   5  
ATOM   10491 S  SG   . CYS A 1 111 ? 5.468   -1.491  9.311   1.00 0.00 ? 265 CYS A SG   5  
ATOM   10492 H  H    . CYS A 1 111 ? 7.535   0.618   10.014  1.00 0.00 ? 265 CYS A H    5  
ATOM   10493 H  HA   . CYS A 1 111 ? 8.091   0.002   7.146   1.00 0.00 ? 265 CYS A HA   5  
ATOM   10494 H  HB2  . CYS A 1 111 ? 6.631   -1.899  7.260   1.00 0.00 ? 265 CYS A HB2  5  
ATOM   10495 H  HB3  . CYS A 1 111 ? 7.711   -2.009  8.645   1.00 0.00 ? 265 CYS A HB3  5  
ATOM   10496 N  N    . TYR A 1 112 ? 5.168   0.541   6.964   1.00 0.00 ? 266 TYR A N    5  
ATOM   10497 C  CA   . TYR A 1 112 ? 4.059   1.487   6.589   1.00 0.00 ? 266 TYR A CA   5  
ATOM   10498 C  C    . TYR A 1 112 ? 3.001   1.556   7.710   1.00 0.00 ? 266 TYR A C    5  
ATOM   10499 O  O    . TYR A 1 112 ? 2.458   2.611   7.981   1.00 0.00 ? 266 TYR A O    5  
ATOM   10500 C  CB   . TYR A 1 112 ? 3.442   0.930   5.288   1.00 0.00 ? 266 TYR A CB   5  
ATOM   10501 C  CG   . TYR A 1 112 ? 4.528   0.689   4.254   1.00 0.00 ? 266 TYR A CG   5  
ATOM   10502 C  CD1  . TYR A 1 112 ? 4.985   1.742   3.456   1.00 0.00 ? 266 TYR A CD1  5  
ATOM   10503 C  CD2  . TYR A 1 112 ? 5.082   -0.591  4.104   1.00 0.00 ? 266 TYR A CD2  5  
ATOM   10504 C  CE1  . TYR A 1 112 ? 5.991   1.519   2.507   1.00 0.00 ? 266 TYR A CE1  5  
ATOM   10505 C  CE2  . TYR A 1 112 ? 6.089   -0.814  3.157   1.00 0.00 ? 266 TYR A CE2  5  
ATOM   10506 C  CZ   . TYR A 1 112 ? 6.544   0.240   2.358   1.00 0.00 ? 266 TYR A CZ   5  
ATOM   10507 O  OH   . TYR A 1 112 ? 7.536   0.022   1.426   1.00 0.00 ? 266 TYR A OH   5  
ATOM   10508 H  H    . TYR A 1 112 ? 5.104   -0.405  6.714   1.00 0.00 ? 266 TYR A H    5  
ATOM   10509 H  HA   . TYR A 1 112 ? 4.462   2.471   6.405   1.00 0.00 ? 266 TYR A HA   5  
ATOM   10510 H  HB2  . TYR A 1 112 ? 2.940   -0.003  5.501   1.00 0.00 ? 266 TYR A HB2  5  
ATOM   10511 H  HB3  . TYR A 1 112 ? 2.728   1.639   4.897   1.00 0.00 ? 266 TYR A HB3  5  
ATOM   10512 H  HD1  . TYR A 1 112 ? 4.561   2.725   3.569   1.00 0.00 ? 266 TYR A HD1  5  
ATOM   10513 H  HD2  . TYR A 1 112 ? 4.731   -1.407  4.719   1.00 0.00 ? 266 TYR A HD2  5  
ATOM   10514 H  HE1  . TYR A 1 112 ? 6.343   2.333   1.891   1.00 0.00 ? 266 TYR A HE1  5  
ATOM   10515 H  HE2  . TYR A 1 112 ? 6.516   -1.801  3.046   1.00 0.00 ? 266 TYR A HE2  5  
ATOM   10516 H  HH   . TYR A 1 112 ? 8.379   0.019   1.885   1.00 0.00 ? 266 TYR A HH   5  
ATOM   10517 N  N    . ILE A 1 113 ? 2.708   0.452   8.370   1.00 0.00 ? 267 ILE A N    5  
ATOM   10518 C  CA   . ILE A 1 113 ? 1.683   0.492   9.479   1.00 0.00 ? 267 ILE A CA   5  
ATOM   10519 C  C    . ILE A 1 113 ? 2.215   1.349   10.644  1.00 0.00 ? 267 ILE A C    5  
ATOM   10520 O  O    . ILE A 1 113 ? 1.491   2.131   11.228  1.00 0.00 ? 267 ILE A O    5  
ATOM   10521 C  CB   . ILE A 1 113 ? 1.466   -0.960  9.969   1.00 0.00 ? 267 ILE A CB   5  
ATOM   10522 C  CG1  . ILE A 1 113 ? 1.035   -1.880  8.809   1.00 0.00 ? 267 ILE A CG1  5  
ATOM   10523 C  CG2  . ILE A 1 113 ? 0.372   -0.968  11.038  1.00 0.00 ? 267 ILE A CG2  5  
ATOM   10524 C  CD1  . ILE A 1 113 ? -0.245  -1.355  8.146   1.00 0.00 ? 267 ILE A CD1  5  
ATOM   10525 H  H    . ILE A 1 113 ? 3.162   -0.385  8.141   1.00 0.00 ? 267 ILE A H    5  
ATOM   10526 H  HA   . ILE A 1 113 ? 0.758   0.902   9.115   1.00 0.00 ? 267 ILE A HA   5  
ATOM   10527 H  HB   . ILE A 1 113 ? 2.390   -1.330  10.404  1.00 0.00 ? 267 ILE A HB   5  
ATOM   10528 H  HG12 . ILE A 1 113 ? 1.818   -1.936  8.073   1.00 0.00 ? 267 ILE A HG12 5  
ATOM   10529 H  HG13 . ILE A 1 113 ? 0.848   -2.869  9.198   1.00 0.00 ? 267 ILE A HG13 5  
ATOM   10530 H  HG21 . ILE A 1 113 ? -0.545  -0.585  10.616  1.00 0.00 ? 267 ILE A HG21 5  
ATOM   10531 H  HG22 . ILE A 1 113 ? 0.674   -0.346  11.868  1.00 0.00 ? 267 ILE A HG22 5  
ATOM   10532 H  HG23 . ILE A 1 113 ? 0.215   -1.979  11.385  1.00 0.00 ? 267 ILE A HG23 5  
ATOM   10533 H  HD11 . ILE A 1 113 ? -0.042  -1.125  7.111   1.00 0.00 ? 267 ILE A HD11 5  
ATOM   10534 H  HD12 . ILE A 1 113 ? -0.582  -0.464  8.655   1.00 0.00 ? 267 ILE A HD12 5  
ATOM   10535 H  HD13 . ILE A 1 113 ? -1.013  -2.112  8.201   1.00 0.00 ? 267 ILE A HD13 5  
ATOM   10536 N  N    . CYS A 1 114 ? 3.476   1.197   10.986  1.00 0.00 ? 268 CYS A N    5  
ATOM   10537 C  CA   . CYS A 1 114 ? 4.067   1.994   12.120  1.00 0.00 ? 268 CYS A CA   5  
ATOM   10538 C  C    . CYS A 1 114 ? 3.852   3.496   11.886  1.00 0.00 ? 268 CYS A C    5  
ATOM   10539 O  O    . CYS A 1 114 ? 3.392   4.204   12.760  1.00 0.00 ? 268 CYS A O    5  
ATOM   10540 C  CB   . CYS A 1 114 ? 5.572   1.677   12.121  1.00 0.00 ? 268 CYS A CB   5  
ATOM   10541 S  SG   . CYS A 1 114 ? 5.857   0.065   12.892  1.00 0.00 ? 268 CYS A SG   5  
ATOM   10542 H  H    . CYS A 1 114 ? 4.031   0.557   10.501  1.00 0.00 ? 268 CYS A H    5  
ATOM   10543 H  HA   . CYS A 1 114 ? 3.629   1.694   13.059  1.00 0.00 ? 268 CYS A HA   5  
ATOM   10544 H  HB2  . CYS A 1 114 ? 5.935   1.658   11.104  1.00 0.00 ? 268 CYS A HB2  5  
ATOM   10545 H  HB3  . CYS A 1 114 ? 6.098   2.439   12.674  1.00 0.00 ? 268 CYS A HB3  5  
ATOM   10546 N  N    . HIS A 1 115 ? 4.175   3.986   10.705  1.00 0.00 ? 269 HIS A N    5  
ATOM   10547 C  CA   . HIS A 1 115 ? 3.979   5.446   10.414  1.00 0.00 ? 269 HIS A CA   5  
ATOM   10548 C  C    . HIS A 1 115 ? 4.313   5.767   8.946   1.00 0.00 ? 269 HIS A C    5  
ATOM   10549 O  O    . HIS A 1 115 ? 5.016   5.017   8.300   1.00 0.00 ? 269 HIS A O    5  
ATOM   10550 C  CB   . HIS A 1 115 ? 4.920   6.207   11.364  1.00 0.00 ? 269 HIS A CB   5  
ATOM   10551 C  CG   . HIS A 1 115 ? 6.355   5.748   11.218  1.00 0.00 ? 269 HIS A CG   5  
ATOM   10552 N  ND1  . HIS A 1 115 ? 7.374   6.329   11.958  1.00 0.00 ? 269 HIS A ND1  5  
ATOM   10553 C  CD2  . HIS A 1 115 ? 6.967   4.786   10.440  1.00 0.00 ? 269 HIS A CD2  5  
ATOM   10554 C  CE1  . HIS A 1 115 ? 8.525   5.724   11.619  1.00 0.00 ? 269 HIS A CE1  5  
ATOM   10555 N  NE2  . HIS A 1 115 ? 8.335   4.779   10.697  1.00 0.00 ? 269 HIS A NE2  5  
ATOM   10556 H  H    . HIS A 1 115 ? 4.534   3.391   10.007  1.00 0.00 ? 269 HIS A H    5  
ATOM   10557 H  HA   . HIS A 1 115 ? 2.958   5.724   10.624  1.00 0.00 ? 269 HIS A HA   5  
ATOM   10558 H  HB2  . HIS A 1 115 ? 4.866   7.261   11.142  1.00 0.00 ? 269 HIS A HB2  5  
ATOM   10559 H  HB3  . HIS A 1 115 ? 4.600   6.046   12.382  1.00 0.00 ? 269 HIS A HB3  5  
ATOM   10560 H  HD1  . HIS A 1 115 ? 7.272   7.051   12.613  1.00 0.00 ? 269 HIS A HD1  5  
ATOM   10561 H  HD2  . HIS A 1 115 ? 6.472   4.128   9.749   1.00 0.00 ? 269 HIS A HD2  5  
ATOM   10562 H  HE1  . HIS A 1 115 ? 9.485   5.968   12.046  1.00 0.00 ? 269 HIS A HE1  5  
ATOM   10563 N  N    . PRO A 1 116 ? 3.792   6.874   8.458   1.00 0.00 ? 270 PRO A N    5  
ATOM   10564 C  CA   . PRO A 1 116 ? 4.051   7.265   7.051   1.00 0.00 ? 270 PRO A CA   5  
ATOM   10565 C  C    . PRO A 1 116 ? 5.514   7.703   6.880   1.00 0.00 ? 270 PRO A C    5  
ATOM   10566 O  O    . PRO A 1 116 ? 5.796   8.875   6.706   1.00 0.00 ? 270 PRO A O    5  
ATOM   10567 C  CB   . PRO A 1 116 ? 3.096   8.434   6.818   1.00 0.00 ? 270 PRO A CB   5  
ATOM   10568 C  CG   . PRO A 1 116 ? 2.841   9.000   8.178   1.00 0.00 ? 270 PRO A CG   5  
ATOM   10569 C  CD   . PRO A 1 116 ? 2.933   7.853   9.149   1.00 0.00 ? 270 PRO A CD   5  
ATOM   10570 H  HA   . PRO A 1 116 ? 3.814   6.455   6.381   1.00 0.00 ? 270 PRO A HA   5  
ATOM   10571 H  HB2  . PRO A 1 116 ? 3.559   9.175   6.181   1.00 0.00 ? 270 PRO A HB2  5  
ATOM   10572 H  HB3  . PRO A 1 116 ? 2.171   8.086   6.384   1.00 0.00 ? 270 PRO A HB3  5  
ATOM   10573 H  HG2  . PRO A 1 116 ? 3.586   9.747   8.412   1.00 0.00 ? 270 PRO A HG2  5  
ATOM   10574 H  HG3  . PRO A 1 116 ? 1.854   9.433   8.220   1.00 0.00 ? 270 PRO A HG3  5  
ATOM   10575 H  HD2  . PRO A 1 116 ? 3.388   8.176   10.075  1.00 0.00 ? 270 PRO A HD2  5  
ATOM   10576 H  HD3  . PRO A 1 116 ? 1.957   7.428   9.330   1.00 0.00 ? 270 PRO A HD3  5  
ATOM   10577 N  N    . GLU A 1 117 ? 6.450   6.776   6.931   1.00 0.00 ? 271 GLU A N    5  
ATOM   10578 C  CA   . GLU A 1 117 ? 7.887   7.162   6.773   1.00 0.00 ? 271 GLU A CA   5  
ATOM   10579 C  C    . GLU A 1 117 ? 8.410   6.796   5.370   1.00 0.00 ? 271 GLU A C    5  
ATOM   10580 O  O    . GLU A 1 117 ? 8.854   7.674   4.656   1.00 0.00 ? 271 GLU A O    5  
ATOM   10581 C  CB   . GLU A 1 117 ? 8.654   6.415   7.876   1.00 0.00 ? 271 GLU A CB   5  
ATOM   10582 C  CG   . GLU A 1 117 ? 9.039   7.389   8.993   1.00 0.00 ? 271 GLU A CG   5  
ATOM   10583 C  CD   . GLU A 1 117 ? 10.379  6.967   9.600   1.00 0.00 ? 271 GLU A CD   5  
ATOM   10584 O  OE1  . GLU A 1 117 ? 10.579  5.776   9.773   1.00 0.00 ? 271 GLU A OE1  5  
ATOM   10585 O  OE2  . GLU A 1 117 ? 11.182  7.841   9.880   1.00 0.00 ? 271 GLU A OE2  5  
ATOM   10586 H  H    . GLU A 1 117 ? 6.208   5.838   7.074   1.00 0.00 ? 271 GLU A H    5  
ATOM   10587 H  HA   . GLU A 1 117 ? 7.989   8.226   6.923   1.00 0.00 ? 271 GLU A HA   5  
ATOM   10588 H  HB2  . GLU A 1 117 ? 8.028   5.631   8.281   1.00 0.00 ? 271 GLU A HB2  5  
ATOM   10589 H  HB3  . GLU A 1 117 ? 9.549   5.979   7.458   1.00 0.00 ? 271 GLU A HB3  5  
ATOM   10590 H  HG2  . GLU A 1 117 ? 9.125   8.386   8.587   1.00 0.00 ? 271 GLU A HG2  5  
ATOM   10591 H  HG3  . GLU A 1 117 ? 8.279   7.376   9.759   1.00 0.00 ? 271 GLU A HG3  5  
ATOM   10592 N  N    . PRO A 1 118 ? 8.355   5.525   4.990   1.00 0.00 ? 272 PRO A N    5  
ATOM   10593 C  CA   . PRO A 1 118 ? 8.848   5.136   3.650   1.00 0.00 ? 272 PRO A CA   5  
ATOM   10594 C  C    . PRO A 1 118 ? 7.753   5.196   2.558   1.00 0.00 ? 272 PRO A C    5  
ATOM   10595 O  O    . PRO A 1 118 ? 7.885   4.543   1.537   1.00 0.00 ? 272 PRO A O    5  
ATOM   10596 C  CB   . PRO A 1 118 ? 9.291   3.693   3.852   1.00 0.00 ? 272 PRO A CB   5  
ATOM   10597 C  CG   . PRO A 1 118 ? 8.479   3.173   5.004   1.00 0.00 ? 272 PRO A CG   5  
ATOM   10598 C  CD   . PRO A 1 118 ? 7.871   4.352   5.730   1.00 0.00 ? 272 PRO A CD   5  
ATOM   10599 H  HA   . PRO A 1 118 ? 9.692   5.740   3.374   1.00 0.00 ? 272 PRO A HA   5  
ATOM   10600 H  HB2  . PRO A 1 118 ? 9.092   3.114   2.960   1.00 0.00 ? 272 PRO A HB2  5  
ATOM   10601 H  HB3  . PRO A 1 118 ? 10.341  3.654   4.096   1.00 0.00 ? 272 PRO A HB3  5  
ATOM   10602 H  HG2  . PRO A 1 118 ? 7.696   2.528   4.634   1.00 0.00 ? 272 PRO A HG2  5  
ATOM   10603 H  HG3  . PRO A 1 118 ? 9.117   2.624   5.680   1.00 0.00 ? 272 PRO A HG3  5  
ATOM   10604 H  HD2  . PRO A 1 118 ? 6.793   4.294   5.696   1.00 0.00 ? 272 PRO A HD2  5  
ATOM   10605 H  HD3  . PRO A 1 118 ? 8.217   4.372   6.744   1.00 0.00 ? 272 PRO A HD3  5  
ATOM   10606 N  N    . LEU A 1 119 ? 6.688   5.959   2.729   1.00 0.00 ? 273 LEU A N    5  
ATOM   10607 C  CA   . LEU A 1 119 ? 5.641   6.019   1.657   1.00 0.00 ? 273 LEU A CA   5  
ATOM   10608 C  C    . LEU A 1 119 ? 4.929   7.388   1.634   1.00 0.00 ? 273 LEU A C    5  
ATOM   10609 O  O    . LEU A 1 119 ? 3.760   7.465   1.304   1.00 0.00 ? 273 LEU A O    5  
ATOM   10610 C  CB   . LEU A 1 119 ? 4.656   4.869   1.968   1.00 0.00 ? 273 LEU A CB   5  
ATOM   10611 C  CG   . LEU A 1 119 ? 3.763   5.188   3.184   1.00 0.00 ? 273 LEU A CG   5  
ATOM   10612 C  CD1  . LEU A 1 119 ? 2.568   4.225   3.208   1.00 0.00 ? 273 LEU A CD1  5  
ATOM   10613 C  CD2  . LEU A 1 119 ? 4.573   5.034   4.473   1.00 0.00 ? 273 LEU A CD2  5  
ATOM   10614 H  H    . LEU A 1 119 ? 6.581   6.492   3.539   1.00 0.00 ? 273 LEU A H    5  
ATOM   10615 H  HA   . LEU A 1 119 ? 6.101   5.839   0.698   1.00 0.00 ? 273 LEU A HA   5  
ATOM   10616 H  HB2  . LEU A 1 119 ? 4.028   4.702   1.106   1.00 0.00 ? 273 LEU A HB2  5  
ATOM   10617 H  HB3  . LEU A 1 119 ? 5.220   3.970   2.171   1.00 0.00 ? 273 LEU A HB3  5  
ATOM   10618 H  HG   . LEU A 1 119 ? 3.394   6.199   3.110   1.00 0.00 ? 273 LEU A HG   5  
ATOM   10619 H  HD11 . LEU A 1 119 ? 2.428   3.798   2.225   1.00 0.00 ? 273 LEU A HD11 5  
ATOM   10620 H  HD12 . LEU A 1 119 ? 1.678   4.766   3.493   1.00 0.00 ? 273 LEU A HD12 5  
ATOM   10621 H  HD13 . LEU A 1 119 ? 2.751   3.436   3.921   1.00 0.00 ? 273 LEU A HD13 5  
ATOM   10622 H  HD21 . LEU A 1 119 ? 3.951   4.600   5.242   1.00 0.00 ? 273 LEU A HD21 5  
ATOM   10623 H  HD22 . LEU A 1 119 ? 4.922   6.003   4.796   1.00 0.00 ? 273 LEU A HD22 5  
ATOM   10624 H  HD23 . LEU A 1 119 ? 5.419   4.388   4.289   1.00 0.00 ? 273 LEU A HD23 5  
ATOM   10625 N  N    . LEU A 1 120 ? 5.613   8.466   1.967   1.00 0.00 ? 274 LEU A N    5  
ATOM   10626 C  CA   . LEU A 1 120 ? 4.929   9.808   1.936   1.00 0.00 ? 274 LEU A CA   5  
ATOM   10627 C  C    . LEU A 1 120 ? 4.528   10.137  0.494   1.00 0.00 ? 274 LEU A C    5  
ATOM   10628 O  O    . LEU A 1 120 ? 3.426   10.587  0.243   1.00 0.00 ? 274 LEU A O    5  
ATOM   10629 C  CB   . LEU A 1 120 ? 5.933   10.834  2.478   1.00 0.00 ? 274 LEU A CB   5  
ATOM   10630 C  CG   . LEU A 1 120 ? 6.014   10.691  3.998   1.00 0.00 ? 274 LEU A CG   5  
ATOM   10631 C  CD1  . LEU A 1 120 ? 7.143   11.569  4.537   1.00 0.00 ? 274 LEU A CD1  5  
ATOM   10632 C  CD2  . LEU A 1 120 ? 4.682   11.123  4.619   1.00 0.00 ? 274 LEU A CD2  5  
ATOM   10633 H  H    . LEU A 1 120 ? 6.561   8.393   2.222   1.00 0.00 ? 274 LEU A H    5  
ATOM   10634 H  HA   . LEU A 1 120 ? 4.053   9.786   2.561   1.00 0.00 ? 274 LEU A HA   5  
ATOM   10635 H  HB2  . LEU A 1 120 ? 6.905   10.654  2.042   1.00 0.00 ? 274 LEU A HB2  5  
ATOM   10636 H  HB3  . LEU A 1 120 ? 5.602   11.832  2.228   1.00 0.00 ? 274 LEU A HB3  5  
ATOM   10637 H  HG   . LEU A 1 120 ? 6.211   9.659   4.250   1.00 0.00 ? 274 LEU A HG   5  
ATOM   10638 H  HD11 . LEU A 1 120 ? 6.898   11.899  5.535   1.00 0.00 ? 274 LEU A HD11 5  
ATOM   10639 H  HD12 . LEU A 1 120 ? 7.269   12.428  3.895   1.00 0.00 ? 274 LEU A HD12 5  
ATOM   10640 H  HD13 . LEU A 1 120 ? 8.061   10.999  4.561   1.00 0.00 ? 274 LEU A HD13 5  
ATOM   10641 H  HD21 . LEU A 1 120 ? 4.279   11.957  4.063   1.00 0.00 ? 274 LEU A HD21 5  
ATOM   10642 H  HD22 . LEU A 1 120 ? 4.841   11.417  5.645   1.00 0.00 ? 274 LEU A HD22 5  
ATOM   10643 H  HD23 . LEU A 1 120 ? 3.983   10.298  4.586   1.00 0.00 ? 274 LEU A HD23 5  
ATOM   10644 N  N    . ASP A 1 121 ? 5.400   9.886   -0.461  1.00 0.00 ? 275 ASP A N    5  
ATOM   10645 C  CA   . ASP A 1 121 ? 5.028   10.162  -1.896  1.00 0.00 ? 275 ASP A CA   5  
ATOM   10646 C  C    . ASP A 1 121 ? 3.833   9.272   -2.282  1.00 0.00 ? 275 ASP A C    5  
ATOM   10647 O  O    . ASP A 1 121 ? 2.938   9.702   -2.985  1.00 0.00 ? 275 ASP A O    5  
ATOM   10648 C  CB   . ASP A 1 121 ? 6.255   9.808   -2.752  1.00 0.00 ? 275 ASP A CB   5  
ATOM   10649 C  CG   . ASP A 1 121 ? 6.036   10.298  -4.184  1.00 0.00 ? 275 ASP A CG   5  
ATOM   10650 O  OD1  . ASP A 1 121 ? 5.151   9.774   -4.840  1.00 0.00 ? 275 ASP A OD1  5  
ATOM   10651 O  OD2  . ASP A 1 121 ? 6.758   11.189  -4.601  1.00 0.00 ? 275 ASP A OD2  5  
ATOM   10652 H  H    . ASP A 1 121 ? 6.278   9.499   -0.235  1.00 0.00 ? 275 ASP A H    5  
ATOM   10653 H  HA   . ASP A 1 121 ? 4.775   11.204  -2.022  1.00 0.00 ? 275 ASP A HA   5  
ATOM   10654 H  HB2  . ASP A 1 121 ? 7.132   10.283  -2.338  1.00 0.00 ? 275 ASP A HB2  5  
ATOM   10655 H  HB3  . ASP A 1 121 ? 6.394   8.737   -2.757  1.00 0.00 ? 275 ASP A HB3  5  
ATOM   10656 N  N    . LEU A 1 122 ? 3.800   8.038   -1.813  1.00 0.00 ? 276 LEU A N    5  
ATOM   10657 C  CA   . LEU A 1 122 ? 2.637   7.141   -2.148  1.00 0.00 ? 276 LEU A CA   5  
ATOM   10658 C  C    . LEU A 1 122 ? 1.364   7.709   -1.506  1.00 0.00 ? 276 LEU A C    5  
ATOM   10659 O  O    . LEU A 1 122 ? 0.328   7.791   -2.139  1.00 0.00 ? 276 LEU A O    5  
ATOM   10660 C  CB   . LEU A 1 122 ? 2.966   5.758   -1.555  1.00 0.00 ? 276 LEU A CB   5  
ATOM   10661 C  CG   . LEU A 1 122 ? 2.236   4.665   -2.340  1.00 0.00 ? 276 LEU A CG   5  
ATOM   10662 C  CD1  . LEU A 1 122 ? 2.879   4.508   -3.720  1.00 0.00 ? 276 LEU A CD1  5  
ATOM   10663 C  CD2  . LEU A 1 122 ? 2.339   3.340   -1.576  1.00 0.00 ? 276 LEU A CD2  5  
ATOM   10664 H  H    . LEU A 1 122 ? 4.530   7.714   -1.236  1.00 0.00 ? 276 LEU A H    5  
ATOM   10665 H  HA   . LEU A 1 122 ? 2.513   7.073   -3.213  1.00 0.00 ? 276 LEU A HA   5  
ATOM   10666 H  HB2  . LEU A 1 122 ? 4.031   5.588   -1.611  1.00 0.00 ? 276 LEU A HB2  5  
ATOM   10667 H  HB3  . LEU A 1 122 ? 2.652   5.726   -0.523  1.00 0.00 ? 276 LEU A HB3  5  
ATOM   10668 H  HG   . LEU A 1 122 ? 1.197   4.938   -2.456  1.00 0.00 ? 276 LEU A HG   5  
ATOM   10669 H  HD11 . LEU A 1 122 ? 3.358   5.435   -4.002  1.00 0.00 ? 276 LEU A HD11 5  
ATOM   10670 H  HD12 . LEU A 1 122 ? 2.118   4.261   -4.445  1.00 0.00 ? 276 LEU A HD12 5  
ATOM   10671 H  HD13 . LEU A 1 122 ? 3.616   3.719   -3.688  1.00 0.00 ? 276 LEU A HD13 5  
ATOM   10672 H  HD21 . LEU A 1 122 ? 1.425   2.781   -1.703  1.00 0.00 ? 276 LEU A HD21 5  
ATOM   10673 H  HD22 . LEU A 1 122 ? 2.495   3.537   -0.526  1.00 0.00 ? 276 LEU A HD22 5  
ATOM   10674 H  HD23 . LEU A 1 122 ? 3.168   2.763   -1.962  1.00 0.00 ? 276 LEU A HD23 5  
ATOM   10675 N  N    . VAL A 1 123 ? 1.439   8.120   -0.257  1.00 0.00 ? 277 VAL A N    5  
ATOM   10676 C  CA   . VAL A 1 123 ? 0.221   8.708   0.410   1.00 0.00 ? 277 VAL A CA   5  
ATOM   10677 C  C    . VAL A 1 123 ? -0.139  10.029  -0.288  1.00 0.00 ? 277 VAL A C    5  
ATOM   10678 O  O    . VAL A 1 123 ? -1.295  10.299  -0.555  1.00 0.00 ? 277 VAL A O    5  
ATOM   10679 C  CB   . VAL A 1 123 ? 0.605   8.950   1.885   1.00 0.00 ? 277 VAL A CB   5  
ATOM   10680 C  CG1  . VAL A 1 123 ? -0.511  9.709   2.614   1.00 0.00 ? 277 VAL A CG1  5  
ATOM   10681 C  CG2  . VAL A 1 123 ? 0.827   7.598   2.570   1.00 0.00 ? 277 VAL A CG2  5  
ATOM   10682 H  H    . VAL A 1 123 ? 2.295   8.058   0.228   1.00 0.00 ? 277 VAL A H    5  
ATOM   10683 H  HA   . VAL A 1 123 ? -0.603  8.020   0.349   1.00 0.00 ? 277 VAL A HA   5  
ATOM   10684 H  HB   . VAL A 1 123 ? 1.517   9.527   1.928   1.00 0.00 ? 277 VAL A HB   5  
ATOM   10685 H  HG11 . VAL A 1 123 ? -0.290  10.767  2.608   1.00 0.00 ? 277 VAL A HG11 5  
ATOM   10686 H  HG12 . VAL A 1 123 ? -0.579  9.362   3.634   1.00 0.00 ? 277 VAL A HG12 5  
ATOM   10687 H  HG13 . VAL A 1 123 ? -1.451  9.537   2.112   1.00 0.00 ? 277 VAL A HG13 5  
ATOM   10688 H  HG21 . VAL A 1 123 ? 0.239   6.841   2.069   1.00 0.00 ? 277 VAL A HG21 5  
ATOM   10689 H  HG22 . VAL A 1 123 ? 0.525   7.664   3.604   1.00 0.00 ? 277 VAL A HG22 5  
ATOM   10690 H  HG23 . VAL A 1 123 ? 1.872   7.335   2.515   1.00 0.00 ? 277 VAL A HG23 5  
ATOM   10691 N  N    . THR A 1 124 ? 0.844   10.847  -0.597  1.00 0.00 ? 278 THR A N    5  
ATOM   10692 C  CA   . THR A 1 124 ? 0.549   12.150  -1.296  1.00 0.00 ? 278 THR A CA   5  
ATOM   10693 C  C    . THR A 1 124 ? -0.182  11.875  -2.618  1.00 0.00 ? 278 THR A C    5  
ATOM   10694 O  O    . THR A 1 124 ? -1.110  12.579  -2.971  1.00 0.00 ? 278 THR A O    5  
ATOM   10695 C  CB   . THR A 1 124 ? 1.908   12.810  -1.557  1.00 0.00 ? 278 THR A CB   5  
ATOM   10696 O  OG1  . THR A 1 124 ? 2.851   11.806  -1.864  1.00 0.00 ? 278 THR A OG1  5  
ATOM   10697 C  CG2  . THR A 1 124 ? 2.343   13.570  -0.305  1.00 0.00 ? 278 THR A CG2  5  
ATOM   10698 H  H    . THR A 1 124 ? 1.773   10.599  -0.376  1.00 0.00 ? 278 THR A H    5  
ATOM   10699 H  HA   . THR A 1 124 ? -0.053  12.783  -0.662  1.00 0.00 ? 278 THR A HA   5  
ATOM   10700 H  HB   . THR A 1 124 ? 1.837   13.492  -2.383  1.00 0.00 ? 278 THR A HB   5  
ATOM   10701 H  HG1  . THR A 1 124 ? 2.829   11.661  -2.815  1.00 0.00 ? 278 THR A HG1  5  
ATOM   10702 H  HG21 . THR A 1 124 ? 1.468   13.885  0.244   1.00 0.00 ? 278 THR A HG21 5  
ATOM   10703 H  HG22 . THR A 1 124 ? 2.919   14.437  -0.592  1.00 0.00 ? 278 THR A HG22 5  
ATOM   10704 H  HG23 . THR A 1 124 ? 2.946   12.925  0.316   1.00 0.00 ? 278 THR A HG23 5  
ATOM   10705 N  N    . ALA A 1 125 ? 0.210   10.843  -3.346  1.00 0.00 ? 279 ALA A N    5  
ATOM   10706 C  CA   . ALA A 1 125 ? -0.508  10.534  -4.635  1.00 0.00 ? 279 ALA A CA   5  
ATOM   10707 C  C    . ALA A 1 125 ? -1.994  10.253  -4.347  1.00 0.00 ? 279 ALA A C    5  
ATOM   10708 O  O    . ALA A 1 125 ? -2.851  10.569  -5.151  1.00 0.00 ? 279 ALA A O    5  
ATOM   10709 C  CB   . ALA A 1 125 ? 0.163   9.286   -5.231  1.00 0.00 ? 279 ALA A CB   5  
ATOM   10710 H  H    . ALA A 1 125 ? 0.955   10.271  -3.036  1.00 0.00 ? 279 ALA A H    5  
ATOM   10711 H  HA   . ALA A 1 125 ? -0.415  11.363  -5.316  1.00 0.00 ? 279 ALA A HA   5  
ATOM   10712 H  HB1  . ALA A 1 125 ? -0.303  8.400   -4.827  1.00 0.00 ? 279 ALA A HB1  5  
ATOM   10713 H  HB2  . ALA A 1 125 ? 1.213   9.288   -4.981  1.00 0.00 ? 279 ALA A HB2  5  
ATOM   10714 H  HB3  . ALA A 1 125 ? 0.048   9.295   -6.305  1.00 0.00 ? 279 ALA A HB3  5  
ATOM   10715 N  N    . CYS A 1 126 ? -2.310  9.668   -3.206  1.00 0.00 ? 280 CYS A N    5  
ATOM   10716 C  CA   . CYS A 1 126 ? -3.754  9.383   -2.885  1.00 0.00 ? 280 CYS A CA   5  
ATOM   10717 C  C    . CYS A 1 126 ? -4.546  10.697  -2.848  1.00 0.00 ? 280 CYS A C    5  
ATOM   10718 O  O    . CYS A 1 126 ? -5.605  10.795  -3.439  1.00 0.00 ? 280 CYS A O    5  
ATOM   10719 C  CB   . CYS A 1 126 ? -3.773  8.711   -1.496  1.00 0.00 ? 280 CYS A CB   5  
ATOM   10720 S  SG   . CYS A 1 126 ? -5.475  8.314   -1.012  1.00 0.00 ? 280 CYS A SG   5  
ATOM   10721 H  H    . CYS A 1 126 ? -1.604  9.423   -2.567  1.00 0.00 ? 280 CYS A H    5  
ATOM   10722 H  HA   . CYS A 1 126 ? -4.172  8.717   -3.622  1.00 0.00 ? 280 CYS A HA   5  
ATOM   10723 H  HB2  . CYS A 1 126 ? -3.191  7.802   -1.530  1.00 0.00 ? 280 CYS A HB2  5  
ATOM   10724 H  HB3  . CYS A 1 126 ? -3.340  9.383   -0.768  1.00 0.00 ? 280 CYS A HB3  5  
ATOM   10725 H  HG   . CYS A 1 126 ? -5.440  7.701   -0.274  1.00 0.00 ? 280 CYS A HG   5  
ATOM   10726 N  N    . ASN A 1 127 ? -4.051  11.705  -2.159  1.00 0.00 ? 281 ASN A N    5  
ATOM   10727 C  CA   . ASN A 1 127 ? -4.818  13.001  -2.103  1.00 0.00 ? 281 ASN A CA   5  
ATOM   10728 C  C    . ASN A 1 127 ? -4.953  13.595  -3.508  1.00 0.00 ? 281 ASN A C    5  
ATOM   10729 O  O    . ASN A 1 127 ? -6.003  14.091  -3.872  1.00 0.00 ? 281 ASN A O    5  
ATOM   10730 C  CB   . ASN A 1 127 ? -4.027  13.953  -1.193  1.00 0.00 ? 281 ASN A CB   5  
ATOM   10731 C  CG   . ASN A 1 127 ? -4.081  13.445  0.252   1.00 0.00 ? 281 ASN A CG   5  
ATOM   10732 O  OD1  . ASN A 1 127 ? -5.149  13.188  0.773   1.00 0.00 ? 281 ASN A OD1  5  
ATOM   10733 N  ND2  . ASN A 1 127 ? -2.972  13.286  0.933   1.00 0.00 ? 281 ASN A ND2  5  
ATOM   10734 H  H    . ASN A 1 127 ? -3.187  11.607  -1.683  1.00 0.00 ? 281 ASN A H    5  
ATOM   10735 H  HA   . ASN A 1 127 ? -5.796  12.826  -1.692  1.00 0.00 ? 281 ASN A HA   5  
ATOM   10736 H  HB2  . ASN A 1 127 ? -2.998  13.993  -1.523  1.00 0.00 ? 281 ASN A HB2  5  
ATOM   10737 H  HB3  . ASN A 1 127 ? -4.459  14.941  -1.242  1.00 0.00 ? 281 ASN A HB3  5  
ATOM   10738 H  HD21 . ASN A 1 127 ? -2.103  13.490  0.523   1.00 0.00 ? 281 ASN A HD21 5  
ATOM   10739 H  HD22 . ASN A 1 127 ? -3.010  12.961  1.857   1.00 0.00 ? 281 ASN A HD22 5  
ATOM   10740 N  N    . SER A 1 128 ? -3.910  13.546  -4.306  1.00 0.00 ? 282 SER A N    5  
ATOM   10741 C  CA   . SER A 1 128 ? -4.016  14.113  -5.696  1.00 0.00 ? 282 SER A CA   5  
ATOM   10742 C  C    . SER A 1 128 ? -4.897  13.211  -6.573  1.00 0.00 ? 282 SER A C    5  
ATOM   10743 O  O    . SER A 1 128 ? -5.609  13.695  -7.434  1.00 0.00 ? 282 SER A O    5  
ATOM   10744 C  CB   . SER A 1 128 ? -2.589  14.182  -6.260  1.00 0.00 ? 282 SER A CB   5  
ATOM   10745 O  OG   . SER A 1 128 ? -1.969  15.384  -5.819  1.00 0.00 ? 282 SER A OG   5  
ATOM   10746 H  H    . SER A 1 128 ? -3.072  13.131  -3.995  1.00 0.00 ? 282 SER A H    5  
ATOM   10747 H  HA   . SER A 1 128 ? -4.442  15.099  -5.654  1.00 0.00 ? 282 SER A HA   5  
ATOM   10748 H  HB2  . SER A 1 128 ? -2.019  13.339  -5.910  1.00 0.00 ? 282 SER A HB2  5  
ATOM   10749 H  HB3  . SER A 1 128 ? -2.630  14.162  -7.342  1.00 0.00 ? 282 SER A HB3  5  
ATOM   10750 H  HG   . SER A 1 128 ? -1.049  15.360  -6.094  1.00 0.00 ? 282 SER A HG   5  
ATOM   10751 N  N    . VAL A 1 129 ? -4.872  11.909  -6.363  1.00 0.00 ? 283 VAL A N    5  
ATOM   10752 C  CA   . VAL A 1 129 ? -5.736  11.010  -7.201  1.00 0.00 ? 283 VAL A CA   5  
ATOM   10753 C  C    . VAL A 1 129 ? -7.176  11.039  -6.682  1.00 0.00 ? 283 VAL A C    5  
ATOM   10754 O  O    . VAL A 1 129 ? -8.108  11.035  -7.467  1.00 0.00 ? 283 VAL A O    5  
ATOM   10755 C  CB   . VAL A 1 129 ? -5.142  9.594   -7.096  1.00 0.00 ? 283 VAL A CB   5  
ATOM   10756 C  CG1  . VAL A 1 129 ? -5.986  8.609   -7.912  1.00 0.00 ? 283 VAL A CG1  5  
ATOM   10757 C  CG2  . VAL A 1 129 ? -3.711  9.605   -7.639  1.00 0.00 ? 283 VAL A CG2  5  
ATOM   10758 H  H    . VAL A 1 129 ? -4.299  11.531  -5.657  1.00 0.00 ? 283 VAL A H    5  
ATOM   10759 H  HA   . VAL A 1 129 ? -5.721  11.343  -8.223  1.00 0.00 ? 283 VAL A HA   5  
ATOM   10760 H  HB   . VAL A 1 129 ? -5.132  9.287   -6.060  1.00 0.00 ? 283 VAL A HB   5  
ATOM   10761 H  HG11 . VAL A 1 129 ? -6.104  8.983   -8.917  1.00 0.00 ? 283 VAL A HG11 5  
ATOM   10762 H  HG12 . VAL A 1 129 ? -6.958  8.500   -7.452  1.00 0.00 ? 283 VAL A HG12 5  
ATOM   10763 H  HG13 . VAL A 1 129 ? -5.492  7.651   -7.940  1.00 0.00 ? 283 VAL A HG13 5  
ATOM   10764 H  HG21 . VAL A 1 129 ? -3.127  8.853   -7.130  1.00 0.00 ? 283 VAL A HG21 5  
ATOM   10765 H  HG22 . VAL A 1 129 ? -3.270  10.577  -7.472  1.00 0.00 ? 283 VAL A HG22 5  
ATOM   10766 H  HG23 . VAL A 1 129 ? -3.726  9.393   -8.698  1.00 0.00 ? 283 VAL A HG23 5  
ATOM   10767 N  N    . PHE A 1 130 ? -7.379  11.098  -5.383  1.00 0.00 ? 284 PHE A N    5  
ATOM   10768 C  CA   . PHE A 1 130 ? -8.791  11.161  -4.882  1.00 0.00 ? 284 PHE A CA   5  
ATOM   10769 C  C    . PHE A 1 130 ? -9.331  12.587  -5.076  1.00 0.00 ? 284 PHE A C    5  
ATOM   10770 O  O    . PHE A 1 130 ? -10.515 12.769  -5.296  1.00 0.00 ? 284 PHE A O    5  
ATOM   10771 C  CB   . PHE A 1 130 ? -8.793  10.755  -3.396  1.00 0.00 ? 284 PHE A CB   5  
ATOM   10772 C  CG   . PHE A 1 130 ? -9.477  9.413   -3.254  1.00 0.00 ? 284 PHE A CG   5  
ATOM   10773 C  CD1  . PHE A 1 130 ? -10.810 9.265   -3.657  1.00 0.00 ? 284 PHE A CD1  5  
ATOM   10774 C  CD2  . PHE A 1 130 ? -8.778  8.316   -2.736  1.00 0.00 ? 284 PHE A CD2  5  
ATOM   10775 C  CE1  . PHE A 1 130 ? -11.444 8.022   -3.543  1.00 0.00 ? 284 PHE A CE1  5  
ATOM   10776 C  CE2  . PHE A 1 130 ? -9.412  7.073   -2.620  1.00 0.00 ? 284 PHE A CE2  5  
ATOM   10777 C  CZ   . PHE A 1 130 ? -10.745 6.925   -3.024  1.00 0.00 ? 284 PHE A CZ   5  
ATOM   10778 H  H    . PHE A 1 130 ? -6.617  11.130  -4.756  1.00 0.00 ? 284 PHE A H    5  
ATOM   10779 H  HA   . PHE A 1 130 ? -9.396  10.473  -5.453  1.00 0.00 ? 284 PHE A HA   5  
ATOM   10780 H  HB2  . PHE A 1 130 ? -7.781  10.685  -3.032  1.00 0.00 ? 284 PHE A HB2  5  
ATOM   10781 H  HB3  . PHE A 1 130 ? -9.332  11.494  -2.821  1.00 0.00 ? 284 PHE A HB3  5  
ATOM   10782 H  HD1  . PHE A 1 130 ? -11.350 10.110  -4.057  1.00 0.00 ? 284 PHE A HD1  5  
ATOM   10783 H  HD2  . PHE A 1 130 ? -7.750  8.430   -2.426  1.00 0.00 ? 284 PHE A HD2  5  
ATOM   10784 H  HE1  . PHE A 1 130 ? -12.471 7.909   -3.854  1.00 0.00 ? 284 PHE A HE1  5  
ATOM   10785 H  HE2  . PHE A 1 130 ? -8.873  6.227   -2.221  1.00 0.00 ? 284 PHE A HE2  5  
ATOM   10786 H  HZ   . PHE A 1 130 ? -11.234 5.966   -2.938  1.00 0.00 ? 284 PHE A HZ   5  
ATOM   10787 N  N    . GLU A 1 131 ? -8.479  13.606  -5.039  1.00 0.00 ? 285 GLU A N    5  
ATOM   10788 C  CA   . GLU A 1 131 ? -8.993  15.004  -5.276  1.00 0.00 ? 285 GLU A CA   5  
ATOM   10789 C  C    . GLU A 1 131 ? -9.654  15.061  -6.661  1.00 0.00 ? 285 GLU A C    5  
ATOM   10790 O  O    . GLU A 1 131 ? -10.685 15.686  -6.831  1.00 0.00 ? 285 GLU A O    5  
ATOM   10791 C  CB   . GLU A 1 131 ? -7.781  15.949  -5.218  1.00 0.00 ? 285 GLU A CB   5  
ATOM   10792 C  CG   . GLU A 1 131 ? -8.243  17.393  -5.431  1.00 0.00 ? 285 GLU A CG   5  
ATOM   10793 C  CD   . GLU A 1 131 ? -7.278  18.347  -4.726  1.00 0.00 ? 285 GLU A CD   5  
ATOM   10794 O  OE1  . GLU A 1 131 ? -6.107  18.333  -5.069  1.00 0.00 ? 285 GLU A OE1  5  
ATOM   10795 O  OE2  . GLU A 1 131 ? -7.725  19.076  -3.856  1.00 0.00 ? 285 GLU A OE2  5  
ATOM   10796 H  H    . GLU A 1 131 ? -7.519  13.449  -4.888  1.00 0.00 ? 285 GLU A H    5  
ATOM   10797 H  HA   . GLU A 1 131 ? -9.708  15.268  -4.516  1.00 0.00 ? 285 GLU A HA   5  
ATOM   10798 H  HB2  . GLU A 1 131 ? -7.304  15.865  -4.253  1.00 0.00 ? 285 GLU A HB2  5  
ATOM   10799 H  HB3  . GLU A 1 131 ? -7.077  15.682  -5.992  1.00 0.00 ? 285 GLU A HB3  5  
ATOM   10800 H  HG2  . GLU A 1 131 ? -8.261  17.613  -6.488  1.00 0.00 ? 285 GLU A HG2  5  
ATOM   10801 H  HG3  . GLU A 1 131 ? -9.234  17.518  -5.019  1.00 0.00 ? 285 GLU A HG3  5  
ATOM   10802 N  N    . ASN A 1 132 ? -9.091  14.385  -7.649  1.00 0.00 ? 286 ASN A N    5  
ATOM   10803 C  CA   . ASN A 1 132 ? -9.738  14.390  -9.011  1.00 0.00 ? 286 ASN A CA   5  
ATOM   10804 C  C    . ASN A 1 132 ? -11.176 13.837  -8.910  1.00 0.00 ? 286 ASN A C    5  
ATOM   10805 O  O    . ASN A 1 132 ? -12.039 14.214  -9.680  1.00 0.00 ? 286 ASN A O    5  
ATOM   10806 C  CB   . ASN A 1 132 ? -8.884  13.485  -9.914  1.00 0.00 ? 286 ASN A CB   5  
ATOM   10807 C  CG   . ASN A 1 132 ? -9.028  13.937  -11.373 1.00 0.00 ? 286 ASN A CG   5  
ATOM   10808 O  OD1  . ASN A 1 132 ? -10.074 14.413  -11.769 1.00 0.00 ? 286 ASN A OD1  5  
ATOM   10809 N  ND2  . ASN A 1 132 ? -8.018  13.809  -12.200 1.00 0.00 ? 286 ASN A ND2  5  
ATOM   10810 H  H    . ASN A 1 132 ? -8.264  13.862  -7.488  1.00 0.00 ? 286 ASN A H    5  
ATOM   10811 H  HA   . ASN A 1 132 ? -9.756  15.391  -9.407  1.00 0.00 ? 286 ASN A HA   5  
ATOM   10812 H  HB2  . ASN A 1 132 ? -7.849  13.552  -9.616  1.00 0.00 ? 286 ASN A HB2  5  
ATOM   10813 H  HB3  . ASN A 1 132 ? -9.221  12.463  -9.822  1.00 0.00 ? 286 ASN A HB3  5  
ATOM   10814 H  HD21 . ASN A 1 132 ? -7.167  13.426  -11.891 1.00 0.00 ? 286 ASN A HD21 5  
ATOM   10815 H  HD22 . ASN A 1 132 ? -8.111  14.099  -13.131 1.00 0.00 ? 286 ASN A HD22 5  
ATOM   10816 N  N    . LEU A 1 133 ? -11.446 12.951  -7.963  1.00 0.00 ? 287 LEU A N    5  
ATOM   10817 C  CA   . LEU A 1 133 ? -12.842 12.396  -7.825  1.00 0.00 ? 287 LEU A CA   5  
ATOM   10818 C  C    . LEU A 1 133 ? -13.837 13.548  -7.617  1.00 0.00 ? 287 LEU A C    5  
ATOM   10819 O  O    . LEU A 1 133 ? -14.886 13.580  -8.233  1.00 0.00 ? 287 LEU A O    5  
ATOM   10820 C  CB   . LEU A 1 133 ? -12.827 11.487  -6.576  1.00 0.00 ? 287 LEU A CB   5  
ATOM   10821 C  CG   . LEU A 1 133 ? -13.898 10.390  -6.680  1.00 0.00 ? 287 LEU A CG   5  
ATOM   10822 C  CD1  . LEU A 1 133 ? -15.277 11.008  -6.947  1.00 0.00 ? 287 LEU A CD1  5  
ATOM   10823 C  CD2  . LEU A 1 133 ? -13.534 9.431   -7.815  1.00 0.00 ? 287 LEU A CD2  5  
ATOM   10824 H  H    . LEU A 1 133 ? -10.741 12.661  -7.345  1.00 0.00 ? 287 LEU A H    5  
ATOM   10825 H  HA   . LEU A 1 133 ? -13.108 11.824  -8.699  1.00 0.00 ? 287 LEU A HA   5  
ATOM   10826 H  HB2  . LEU A 1 133 ? -11.855 11.023  -6.488  1.00 0.00 ? 287 LEU A HB2  5  
ATOM   10827 H  HB3  . LEU A 1 133 ? -13.012 12.088  -5.700  1.00 0.00 ? 287 LEU A HB3  5  
ATOM   10828 H  HG   . LEU A 1 133 ? -13.932 9.843   -5.750  1.00 0.00 ? 287 LEU A HG   5  
ATOM   10829 H  HD11 . LEU A 1 133 ? -16.047 10.341  -6.586  1.00 0.00 ? 287 LEU A HD11 5  
ATOM   10830 H  HD12 . LEU A 1 133 ? -15.404 11.163  -8.007  1.00 0.00 ? 287 LEU A HD12 5  
ATOM   10831 H  HD13 . LEU A 1 133 ? -15.354 11.954  -6.432  1.00 0.00 ? 287 LEU A HD13 5  
ATOM   10832 H  HD21 . LEU A 1 133 ? -12.488 9.169   -7.742  1.00 0.00 ? 287 LEU A HD21 5  
ATOM   10833 H  HD22 . LEU A 1 133 ? -13.720 9.909   -8.766  1.00 0.00 ? 287 LEU A HD22 5  
ATOM   10834 H  HD23 . LEU A 1 133 ? -14.134 8.538   -7.737  1.00 0.00 ? 287 LEU A HD23 5  
ATOM   10835 N  N    . GLU A 1 134 ? -13.515 14.499  -6.761  1.00 0.00 ? 288 GLU A N    5  
ATOM   10836 C  CA   . GLU A 1 134 ? -14.463 15.649  -6.541  1.00 0.00 ? 288 GLU A CA   5  
ATOM   10837 C  C    . GLU A 1 134 ? -14.589 16.459  -7.836  1.00 0.00 ? 288 GLU A C    5  
ATOM   10838 O  O    . GLU A 1 134 ? -15.676 16.844  -8.225  1.00 0.00 ? 288 GLU A O    5  
ATOM   10839 C  CB   . GLU A 1 134 ? -13.865 16.517  -5.422  1.00 0.00 ? 288 GLU A CB   5  
ATOM   10840 C  CG   . GLU A 1 134 ? -14.088 15.835  -4.072  1.00 0.00 ? 288 GLU A CG   5  
ATOM   10841 C  CD   . GLU A 1 134 ? -13.048 16.337  -3.068  1.00 0.00 ? 288 GLU A CD   5  
ATOM   10842 O  OE1  . GLU A 1 134 ? -13.114 17.500  -2.709  1.00 0.00 ? 288 GLU A OE1  5  
ATOM   10843 O  OE2  . GLU A 1 134 ? -12.204 15.548  -2.676  1.00 0.00 ? 288 GLU A OE2  5  
ATOM   10844 H  H    . GLU A 1 134 ? -12.652 14.458  -6.277  1.00 0.00 ? 288 GLU A H    5  
ATOM   10845 H  HA   . GLU A 1 134 ? -15.429 15.279  -6.246  1.00 0.00 ? 288 GLU A HA   5  
ATOM   10846 H  HB2  . GLU A 1 134 ? -12.805 16.643  -5.593  1.00 0.00 ? 288 GLU A HB2  5  
ATOM   10847 H  HB3  . GLU A 1 134 ? -14.347 17.483  -5.420  1.00 0.00 ? 288 GLU A HB3  5  
ATOM   10848 H  HG2  . GLU A 1 134 ? -15.080 16.068  -3.711  1.00 0.00 ? 288 GLU A HG2  5  
ATOM   10849 H  HG3  . GLU A 1 134 ? -13.988 14.766  -4.186  1.00 0.00 ? 288 GLU A HG3  5  
ATOM   10850 N  N    . GLN A 1 135 ? -13.489 16.706  -8.516  1.00 0.00 ? 289 GLN A N    5  
ATOM   10851 C  CA   . GLN A 1 135 ? -13.574 17.482  -9.805  1.00 0.00 ? 289 GLN A CA   5  
ATOM   10852 C  C    . GLN A 1 135 ? -14.426 16.702  -10.815 1.00 0.00 ? 289 GLN A C    5  
ATOM   10853 O  O    . GLN A 1 135 ? -15.226 17.278  -11.527 1.00 0.00 ? 289 GLN A O    5  
ATOM   10854 C  CB   . GLN A 1 135 ? -12.137 17.640  -10.331 1.00 0.00 ? 289 GLN A CB   5  
ATOM   10855 C  CG   . GLN A 1 135 ? -11.537 18.945  -9.801  1.00 0.00 ? 289 GLN A CG   5  
ATOM   10856 C  CD   . GLN A 1 135 ? -11.398 18.866  -8.275  1.00 0.00 ? 289 GLN A CD   5  
ATOM   10857 O  OE1  . GLN A 1 135 ? -12.388 18.857  -7.569  1.00 0.00 ? 289 GLN A OE1  5  
ATOM   10858 N  NE2  . GLN A 1 135 ? -10.209 18.806  -7.728  1.00 0.00 ? 289 GLN A NE2  5  
ATOM   10859 H  H    . GLN A 1 135 ? -12.622 16.373  -8.186  1.00 0.00 ? 289 GLN A H    5  
ATOM   10860 H  HA   . GLN A 1 135 ? -14.008 18.454  -9.624  1.00 0.00 ? 289 GLN A HA   5  
ATOM   10861 H  HB2  . GLN A 1 135 ? -11.536 16.806  -10.000 1.00 0.00 ? 289 GLN A HB2  5  
ATOM   10862 H  HB3  . GLN A 1 135 ? -12.150 17.667  -11.410 1.00 0.00 ? 289 GLN A HB3  5  
ATOM   10863 H  HG2  . GLN A 1 135 ? -10.563 19.100  -10.244 1.00 0.00 ? 289 GLN A HG2  5  
ATOM   10864 H  HG3  . GLN A 1 135 ? -12.184 19.770  -10.060 1.00 0.00 ? 289 GLN A HG3  5  
ATOM   10865 H  HE21 . GLN A 1 135 ? -9.403  18.813  -8.289  1.00 0.00 ? 289 GLN A HE21 5  
ATOM   10866 H  HE22 . GLN A 1 135 ? -10.123 18.757  -6.753  1.00 0.00 ? 289 GLN A HE22 5  
ATOM   10867 N  N    . LEU A 1 136 ? -14.275 15.389  -10.878 1.00 0.00 ? 290 LEU A N    5  
ATOM   10868 C  CA   . LEU A 1 136 ? -15.105 14.585  -11.852 1.00 0.00 ? 290 LEU A CA   5  
ATOM   10869 C  C    . LEU A 1 136 ? -16.601 14.843  -11.612 1.00 0.00 ? 290 LEU A C    5  
ATOM   10870 O  O    . LEU A 1 136 ? -17.372 14.945  -12.547 1.00 0.00 ? 290 LEU A O    5  
ATOM   10871 C  CB   . LEU A 1 136 ? -14.779 13.106  -11.591 1.00 0.00 ? 290 LEU A CB   5  
ATOM   10872 C  CG   . LEU A 1 136 ? -15.435 12.237  -12.664 1.00 0.00 ? 290 LEU A CG   5  
ATOM   10873 C  CD1  . LEU A 1 136 ? -14.436 11.979  -13.793 1.00 0.00 ? 290 LEU A CD1  5  
ATOM   10874 C  CD2  . LEU A 1 136 ? -15.864 10.903  -12.048 1.00 0.00 ? 290 LEU A CD2  5  
ATOM   10875 H  H    . LEU A 1 136 ? -13.628 14.938  -10.285 1.00 0.00 ? 290 LEU A H    5  
ATOM   10876 H  HA   . LEU A 1 136 ? -14.843 14.845  -12.862 1.00 0.00 ? 290 LEU A HA   5  
ATOM   10877 H  HB2  . LEU A 1 136 ? -13.708 12.965  -11.617 1.00 0.00 ? 290 LEU A HB2  5  
ATOM   10878 H  HB3  . LEU A 1 136 ? -15.156 12.822  -10.620 1.00 0.00 ? 290 LEU A HB3  5  
ATOM   10879 H  HG   . LEU A 1 136 ? -16.301 12.748  -13.061 1.00 0.00 ? 290 LEU A HG   5  
ATOM   10880 H  HD11 . LEU A 1 136 ? -13.529 11.558  -13.382 1.00 0.00 ? 290 LEU A HD11 5  
ATOM   10881 H  HD12 . LEU A 1 136 ? -14.207 12.908  -14.292 1.00 0.00 ? 290 LEU A HD12 5  
ATOM   10882 H  HD13 . LEU A 1 136 ? -14.865 11.286  -14.502 1.00 0.00 ? 290 LEU A HD13 5  
ATOM   10883 H  HD21 . LEU A 1 136 ? -15.765 10.118  -12.783 1.00 0.00 ? 290 LEU A HD21 5  
ATOM   10884 H  HD22 . LEU A 1 136 ? -16.893 10.968  -11.727 1.00 0.00 ? 290 LEU A HD22 5  
ATOM   10885 H  HD23 . LEU A 1 136 ? -15.235 10.681  -11.197 1.00 0.00 ? 290 LEU A HD23 5  
ATOM   10886 N  N    . LEU A 1 137 ? -17.017 14.956  -10.367 1.00 0.00 ? 291 LEU A N    5  
ATOM   10887 C  CA   . LEU A 1 137 ? -18.477 15.216  -10.090 1.00 0.00 ? 291 LEU A CA   5  
ATOM   10888 C  C    . LEU A 1 137 ? -18.920 16.532  -10.753 1.00 0.00 ? 291 LEU A C    5  
ATOM   10889 O  O    . LEU A 1 137 ? -20.038 16.641  -11.222 1.00 0.00 ? 291 LEU A O    5  
ATOM   10890 C  CB   . LEU A 1 137 ? -18.631 15.318  -8.564  1.00 0.00 ? 291 LEU A CB   5  
ATOM   10891 C  CG   . LEU A 1 137 ? -18.942 13.937  -7.987  1.00 0.00 ? 291 LEU A CG   5  
ATOM   10892 C  CD1  . LEU A 1 137 ? -17.664 13.096  -7.955  1.00 0.00 ? 291 LEU A CD1  5  
ATOM   10893 C  CD2  . LEU A 1 137 ? -19.487 14.089  -6.566  1.00 0.00 ? 291 LEU A CD2  5  
ATOM   10894 H  H    . LEU A 1 137 ? -16.372 14.874  -9.624  1.00 0.00 ? 291 LEU A H    5  
ATOM   10895 H  HA   . LEU A 1 137 ? -19.073 14.398  -10.462 1.00 0.00 ? 291 LEU A HA   5  
ATOM   10896 H  HB2  . LEU A 1 137 ? -17.713 15.691  -8.133  1.00 0.00 ? 291 LEU A HB2  5  
ATOM   10897 H  HB3  . LEU A 1 137 ? -19.439 15.995  -8.328  1.00 0.00 ? 291 LEU A HB3  5  
ATOM   10898 H  HG   . LEU A 1 137 ? -19.679 13.446  -8.608  1.00 0.00 ? 291 LEU A HG   5  
ATOM   10899 H  HD11 . LEU A 1 137 ? -17.264 13.009  -8.955  1.00 0.00 ? 291 LEU A HD11 5  
ATOM   10900 H  HD12 . LEU A 1 137 ? -17.890 12.113  -7.571  1.00 0.00 ? 291 LEU A HD12 5  
ATOM   10901 H  HD13 . LEU A 1 137 ? -16.936 13.573  -7.316  1.00 0.00 ? 291 LEU A HD13 5  
ATOM   10902 H  HD21 . LEU A 1 137 ? -18.675 14.010  -5.858  1.00 0.00 ? 291 LEU A HD21 5  
ATOM   10903 H  HD22 . LEU A 1 137 ? -20.210 13.310  -6.372  1.00 0.00 ? 291 LEU A HD22 5  
ATOM   10904 H  HD23 . LEU A 1 137 ? -19.961 15.054  -6.463  1.00 0.00 ? 291 LEU A HD23 5  
ATOM   10905 N  N    . GLN A 1 138 ? -18.061 17.534  -10.799 1.00 0.00 ? 292 GLN A N    5  
ATOM   10906 C  CA   . GLN A 1 138 ? -18.457 18.829  -11.433 1.00 0.00 ? 292 GLN A CA   5  
ATOM   10907 C  C    . GLN A 1 138 ? -17.548 19.155  -12.632 1.00 0.00 ? 292 GLN A C    5  
ATOM   10908 O  O    . GLN A 1 138 ? -17.275 20.311  -12.900 1.00 0.00 ? 292 GLN A O    5  
ATOM   10909 C  CB   . GLN A 1 138 ? -18.284 19.875  -10.332 1.00 0.00 ? 292 GLN A CB   5  
ATOM   10910 C  CG   . GLN A 1 138 ? -19.272 19.590  -9.198  1.00 0.00 ? 292 GLN A CG   5  
ATOM   10911 C  CD   . GLN A 1 138 ? -18.683 20.084  -7.871  1.00 0.00 ? 292 GLN A CD   5  
ATOM   10912 O  OE1  . GLN A 1 138 ? -17.519 19.870  -7.599  1.00 0.00 ? 292 GLN A OE1  5  
ATOM   10913 N  NE2  . GLN A 1 138 ? -19.439 20.740  -7.023  1.00 0.00 ? 292 GLN A NE2  5  
ATOM   10914 H  H    . GLN A 1 138 ? -17.162 17.440  -10.418 1.00 0.00 ? 292 GLN A H    5  
ATOM   10915 H  HA   . GLN A 1 138 ? -19.489 18.793  -11.745 1.00 0.00 ? 292 GLN A HA   5  
ATOM   10916 H  HB2  . GLN A 1 138 ? -17.274 19.830  -9.950  1.00 0.00 ? 292 GLN A HB2  5  
ATOM   10917 H  HB3  . GLN A 1 138 ? -18.475 20.857  -10.735 1.00 0.00 ? 292 GLN A HB3  5  
ATOM   10918 H  HG2  . GLN A 1 138 ? -20.201 20.106  -9.395  1.00 0.00 ? 292 GLN A HG2  5  
ATOM   10919 H  HG3  . GLN A 1 138 ? -19.454 18.528  -9.136  1.00 0.00 ? 292 GLN A HG3  5  
ATOM   10920 H  HE21 . GLN A 1 138 ? -20.381 20.918  -7.232  1.00 0.00 ? 292 GLN A HE21 5  
ATOM   10921 H  HE22 . GLN A 1 138 ? -19.060 21.053  -6.176  1.00 0.00 ? 292 GLN A HE22 5  
ATOM   10922 N  N    . GLN A 1 139 ? -17.081 18.160  -13.363 1.00 0.00 ? 293 GLN A N    5  
ATOM   10923 C  CA   . GLN A 1 139 ? -16.202 18.446  -14.540 1.00 0.00 ? 293 GLN A CA   5  
ATOM   10924 C  C    . GLN A 1 139 ? -16.471 17.435  -15.667 1.00 0.00 ? 293 GLN A C    5  
ATOM   10925 O  O    . GLN A 1 139 ? -15.560 17.028  -16.363 1.00 0.00 ? 293 GLN A O    5  
ATOM   10926 C  CB   . GLN A 1 139 ? -14.773 18.299  -14.019 1.00 0.00 ? 293 GLN A CB   5  
ATOM   10927 C  CG   . GLN A 1 139 ? -13.790 18.825  -15.067 1.00 0.00 ? 293 GLN A CG   5  
ATOM   10928 C  CD   . GLN A 1 139 ? -12.561 19.417  -14.366 1.00 0.00 ? 293 GLN A CD   5  
ATOM   10929 O  OE1  . GLN A 1 139 ? -12.657 20.443  -13.721 1.00 0.00 ? 293 GLN A OE1  5  
ATOM   10930 N  NE2  . GLN A 1 139 ? -11.401 18.814  -14.460 1.00 0.00 ? 293 GLN A NE2  5  
ATOM   10931 H  H    . GLN A 1 139 ? -17.310 17.229  -13.145 1.00 0.00 ? 293 GLN A H    5  
ATOM   10932 H  HA   . GLN A 1 139 ? -16.364 19.453  -14.892 1.00 0.00 ? 293 GLN A HA   5  
ATOM   10933 H  HB2  . GLN A 1 139 ? -14.664 18.865  -13.104 1.00 0.00 ? 293 GLN A HB2  5  
ATOM   10934 H  HB3  . GLN A 1 139 ? -14.566 17.258  -13.825 1.00 0.00 ? 293 GLN A HB3  5  
ATOM   10935 H  HG2  . GLN A 1 139 ? -13.483 18.014  -15.711 1.00 0.00 ? 293 GLN A HG2  5  
ATOM   10936 H  HG3  . GLN A 1 139 ? -14.269 19.592  -15.657 1.00 0.00 ? 293 GLN A HG3  5  
ATOM   10937 H  HE21 . GLN A 1 139 ? -11.311 17.985  -14.977 1.00 0.00 ? 293 GLN A HE21 5  
ATOM   10938 H  HE22 . GLN A 1 139 ? -10.617 19.195  -14.011 1.00 0.00 ? 293 GLN A HE22 5  
ATOM   10939 N  N    . ASN A 1 140 ? -17.710 17.025  -15.858 1.00 0.00 ? 294 ASN A N    5  
ATOM   10940 C  CA   . ASN A 1 140 ? -18.016 16.046  -16.942 1.00 0.00 ? 294 ASN A CA   5  
ATOM   10941 C  C    . ASN A 1 140 ? -19.222 16.528  -17.768 1.00 0.00 ? 294 ASN A C    5  
ATOM   10942 O  O    . ASN A 1 140 ? -20.259 15.890  -17.788 1.00 0.00 ? 294 ASN A O    5  
ATOM   10943 C  CB   . ASN A 1 140 ? -18.344 14.741  -16.215 1.00 0.00 ? 294 ASN A CB   5  
ATOM   10944 C  CG   . ASN A 1 140 ? -18.495 13.608  -17.238 1.00 0.00 ? 294 ASN A CG   5  
ATOM   10945 O  OD1  . ASN A 1 140 ? -17.534 12.935  -17.553 1.00 0.00 ? 294 ASN A OD1  5  
ATOM   10946 N  ND2  . ASN A 1 140 ? -19.665 13.363  -17.775 1.00 0.00 ? 294 ASN A ND2  5  
ATOM   10947 H  H    . ASN A 1 140 ? -18.440 17.361  -15.291 1.00 0.00 ? 294 ASN A H    5  
ATOM   10948 H  HA   . ASN A 1 140 ? -17.155 15.908  -17.578 1.00 0.00 ? 294 ASN A HA   5  
ATOM   10949 H  HB2  . ASN A 1 140 ? -17.546 14.502  -15.526 1.00 0.00 ? 294 ASN A HB2  5  
ATOM   10950 H  HB3  . ASN A 1 140 ? -19.269 14.855  -15.669 1.00 0.00 ? 294 ASN A HB3  5  
ATOM   10951 H  HD21 . ASN A 1 140 ? -20.449 13.901  -17.528 1.00 0.00 ? 294 ASN A HD21 5  
ATOM   10952 H  HD22 . ASN A 1 140 ? -19.759 12.639  -18.428 1.00 0.00 ? 294 ASN A HD22 5  
ATOM   10953 N  N    . LYS A 1 141 ? -19.099 17.651  -18.448 1.00 0.00 ? 295 LYS A N    5  
ATOM   10954 C  CA   . LYS A 1 141 ? -20.243 18.161  -19.263 1.00 0.00 ? 295 LYS A CA   5  
ATOM   10955 C  C    . LYS A 1 141 ? -19.736 18.761  -20.584 1.00 0.00 ? 295 LYS A C    5  
ATOM   10956 O  O    . LYS A 1 141 ? -20.112 18.316  -21.652 1.00 0.00 ? 295 LYS A O    5  
ATOM   10957 C  CB   . LYS A 1 141 ? -20.901 19.236  -18.395 1.00 0.00 ? 295 LYS A CB   5  
ATOM   10958 C  CG   . LYS A 1 141 ? -22.136 19.787  -19.111 1.00 0.00 ? 295 LYS A CG   5  
ATOM   10959 C  CD   . LYS A 1 141 ? -23.166 20.248  -18.076 1.00 0.00 ? 295 LYS A CD   5  
ATOM   10960 C  CE   . LYS A 1 141 ? -24.179 19.129  -17.826 1.00 0.00 ? 295 LYS A CE   5  
ATOM   10961 N  NZ   . LYS A 1 141 ? -23.399 18.044  -17.168 1.00 0.00 ? 295 LYS A NZ   5  
ATOM   10962 H  H    . LYS A 1 141 ? -18.257 18.158  -18.423 1.00 0.00 ? 295 LYS A H    5  
ATOM   10963 H  HA   . LYS A 1 141 ? -20.941 17.372  -19.459 1.00 0.00 ? 295 LYS A HA   5  
ATOM   10964 H  HB2  . LYS A 1 141 ? -21.196 18.802  -17.449 1.00 0.00 ? 295 LYS A HB2  5  
ATOM   10965 H  HB3  . LYS A 1 141 ? -20.202 20.038  -18.219 1.00 0.00 ? 295 LYS A HB3  5  
ATOM   10966 H  HG2  . LYS A 1 141 ? -21.847 20.624  -19.730 1.00 0.00 ? 295 LYS A HG2  5  
ATOM   10967 H  HG3  . LYS A 1 141 ? -22.569 19.014  -19.728 1.00 0.00 ? 295 LYS A HG3  5  
ATOM   10968 H  HD2  . LYS A 1 141 ? -22.662 20.493  -17.152 1.00 0.00 ? 295 LYS A HD2  5  
ATOM   10969 H  HD3  . LYS A 1 141 ? -23.682 21.122  -18.446 1.00 0.00 ? 295 LYS A HD3  5  
ATOM   10970 H  HE2  . LYS A 1 141 ? -24.969 19.478  -17.174 1.00 0.00 ? 295 LYS A HE2  5  
ATOM   10971 H  HE3  . LYS A 1 141 ? -24.588 18.775  -18.760 1.00 0.00 ? 295 LYS A HE3  5  
ATOM   10972 H  HZ1  . LYS A 1 141 ? -24.051 17.318  -16.805 1.00 0.00 ? 295 LYS A HZ1  5  
ATOM   10973 H  HZ2  . LYS A 1 141 ? -22.850 18.443  -16.378 1.00 0.00 ? 295 LYS A HZ2  5  
ATOM   10974 H  HZ3  . LYS A 1 141 ? -22.753 17.613  -17.858 1.00 0.00 ? 295 LYS A HZ3  5  
ATOM   10975 N  N    . LYS A 1 142 ? -18.890 19.766  -20.523 1.00 0.00 ? 296 LYS A N    5  
ATOM   10976 C  CA   . LYS A 1 142 ? -18.368 20.385  -21.779 1.00 0.00 ? 296 LYS A CA   5  
ATOM   10977 C  C    . LYS A 1 142 ? -16.841 20.281  -21.824 1.00 0.00 ? 296 LYS A C    5  
ATOM   10978 O  O    . LYS A 1 142 ? -16.268 19.832  -20.846 1.00 0.00 ? 296 LYS A O    5  
ATOM   10979 C  CB   . LYS A 1 142 ? -18.804 21.850  -21.709 1.00 0.00 ? 296 LYS A CB   5  
ATOM   10980 C  CG   . LYS A 1 142 ? -19.072 22.369  -23.122 1.00 0.00 ? 296 LYS A CG   5  
ATOM   10981 C  CD   . LYS A 1 142 ? -20.166 23.438  -23.074 1.00 0.00 ? 296 LYS A CD   5  
ATOM   10982 C  CE   . LYS A 1 142 ? -20.962 23.415  -24.381 1.00 0.00 ? 296 LYS A CE   5  
ATOM   10983 N  NZ   . LYS A 1 142 ? -21.942 22.307  -24.215 1.00 0.00 ? 296 LYS A NZ   5  
ATOM   10984 O  OXT  . LYS A 1 142 ? -16.272 20.653  -22.837 1.00 0.00 ? 296 LYS A OXT  5  
ATOM   10985 H  H    . LYS A 1 142 ? -18.597 20.114  -19.654 1.00 0.00 ? 296 LYS A H    5  
ATOM   10986 H  HA   . LYS A 1 142 ? -18.805 19.910  -22.642 1.00 0.00 ? 296 LYS A HA   5  
ATOM   10987 H  HB2  . LYS A 1 142 ? -19.705 21.928  -21.118 1.00 0.00 ? 296 LYS A HB2  5  
ATOM   10988 H  HB3  . LYS A 1 142 ? -18.022 22.437  -21.254 1.00 0.00 ? 296 LYS A HB3  5  
ATOM   10989 H  HG2  . LYS A 1 142 ? -18.166 22.798  -23.526 1.00 0.00 ? 296 LYS A HG2  5  
ATOM   10990 H  HG3  . LYS A 1 142 ? -19.397 21.554  -23.751 1.00 0.00 ? 296 LYS A HG3  5  
ATOM   10991 H  HD2  . LYS A 1 142 ? -20.829 23.238  -22.245 1.00 0.00 ? 296 LYS A HD2  5  
ATOM   10992 H  HD3  . LYS A 1 142 ? -19.714 24.411  -22.948 1.00 0.00 ? 296 LYS A HD3  5  
ATOM   10993 H  HE2  . LYS A 1 142 ? -21.473 24.357  -24.525 1.00 0.00 ? 296 LYS A HE2  5  
ATOM   10994 H  HE3  . LYS A 1 142 ? -20.309 23.210  -25.216 1.00 0.00 ? 296 LYS A HE3  5  
ATOM   10995 H  HZ1  . LYS A 1 142 ? -22.487 22.454  -23.342 1.00 0.00 ? 296 LYS A HZ1  5  
ATOM   10996 H  HZ2  . LYS A 1 142 ? -21.435 21.401  -24.160 1.00 0.00 ? 296 LYS A HZ2  5  
ATOM   10997 H  HZ3  . LYS A 1 142 ? -22.591 22.293  -25.026 1.00 0.00 ? 296 LYS A HZ3  5  
HETATM 10998 ZN ZN   . ZN  B 2 .   ? -5.063  -3.053  -5.566  1.00 0.00 ? 1   ZN  A ZN   5  
HETATM 10999 ZN ZN   . ZN  C 2 .   ? 1.890   -7.090  -0.411  1.00 0.00 ? 2   ZN  A ZN   5  
HETATM 11000 ZN ZN   . ZN  D 2 .   ? 5.681   -1.820  11.571  1.00 0.00 ? 3   ZN  A ZN   5  
ATOM   11001 N  N    . GLY A 1 1   ? -7.708  40.920  -17.388 1.00 0.00 ? 155 GLY A N    6  
ATOM   11002 C  CA   . GLY A 1 1   ? -6.348  41.282  -17.879 1.00 0.00 ? 155 GLY A CA   6  
ATOM   11003 C  C    . GLY A 1 1   ? -5.557  40.004  -18.188 1.00 0.00 ? 155 GLY A C    6  
ATOM   11004 O  O    . GLY A 1 1   ? -6.134  38.960  -18.428 1.00 0.00 ? 155 GLY A O    6  
ATOM   11005 H  H1   . GLY A 1 1   ? -8.361  41.710  -17.559 1.00 0.00 ? 155 GLY A H1   6  
ATOM   11006 H  H2   . GLY A 1 1   ? -7.666  40.720  -16.367 1.00 0.00 ? 155 GLY A H2   6  
ATOM   11007 H  H3   . GLY A 1 1   ? -8.047  40.077  -17.892 1.00 0.00 ? 155 GLY A H3   6  
ATOM   11008 H  HA2  . GLY A 1 1   ? -6.438  41.879  -18.776 1.00 0.00 ? 155 GLY A HA2  6  
ATOM   11009 H  HA3  . GLY A 1 1   ? -5.829  41.847  -17.120 1.00 0.00 ? 155 GLY A HA3  6  
ATOM   11010 N  N    . ALA A 1 2   ? -4.241  40.071  -18.187 1.00 0.00 ? 156 ALA A N    6  
ATOM   11011 C  CA   . ALA A 1 2   ? -3.427  38.853  -18.482 1.00 0.00 ? 156 ALA A CA   6  
ATOM   11012 C  C    . ALA A 1 2   ? -2.323  38.684  -17.428 1.00 0.00 ? 156 ALA A C    6  
ATOM   11013 O  O    . ALA A 1 2   ? -1.378  39.452  -17.390 1.00 0.00 ? 156 ALA A O    6  
ATOM   11014 C  CB   . ALA A 1 2   ? -2.819  39.109  -19.861 1.00 0.00 ? 156 ALA A CB   6  
ATOM   11015 H  H    . ALA A 1 2   ? -3.786  40.920  -17.991 1.00 0.00 ? 156 ALA A H    6  
ATOM   11016 H  HA   . ALA A 1 2   ? -4.057  37.978  -18.512 1.00 0.00 ? 156 ALA A HA   6  
ATOM   11017 H  HB1  . ALA A 1 2   ? -3.457  38.680  -20.620 1.00 0.00 ? 156 ALA A HB1  6  
ATOM   11018 H  HB2  . ALA A 1 2   ? -1.841  38.652  -19.912 1.00 0.00 ? 156 ALA A HB2  6  
ATOM   11019 H  HB3  . ALA A 1 2   ? -2.730  40.172  -20.023 1.00 0.00 ? 156 ALA A HB3  6  
ATOM   11020 N  N    . MET A 1 3   ? -2.427  37.688  -16.570 1.00 0.00 ? 157 MET A N    6  
ATOM   11021 C  CA   . MET A 1 3   ? -1.377  37.484  -15.528 1.00 0.00 ? 157 MET A CA   6  
ATOM   11022 C  C    . MET A 1 3   ? -1.007  35.995  -15.432 1.00 0.00 ? 157 MET A C    6  
ATOM   11023 O  O    . MET A 1 3   ? -1.864  35.136  -15.515 1.00 0.00 ? 157 MET A O    6  
ATOM   11024 C  CB   . MET A 1 3   ? -2.015  37.963  -14.224 1.00 0.00 ? 157 MET A CB   6  
ATOM   11025 C  CG   . MET A 1 3   ? -1.626  39.420  -13.969 1.00 0.00 ? 157 MET A CG   6  
ATOM   11026 S  SD   . MET A 1 3   ? -0.039  39.478  -13.103 1.00 0.00 ? 157 MET A SD   6  
ATOM   11027 C  CE   . MET A 1 3   ? 0.949   40.118  -14.477 1.00 0.00 ? 157 MET A CE   6  
ATOM   11028 H  H    . MET A 1 3   ? -3.194  37.074  -16.612 1.00 0.00 ? 157 MET A H    6  
ATOM   11029 H  HA   . MET A 1 3   ? -0.504  38.076  -15.751 1.00 0.00 ? 157 MET A HA   6  
ATOM   11030 H  HB2  . MET A 1 3   ? -3.091  37.885  -14.300 1.00 0.00 ? 157 MET A HB2  6  
ATOM   11031 H  HB3  . MET A 1 3   ? -1.666  37.351  -13.406 1.00 0.00 ? 157 MET A HB3  6  
ATOM   11032 H  HG2  . MET A 1 3   ? -1.540  39.939  -14.913 1.00 0.00 ? 157 MET A HG2  6  
ATOM   11033 H  HG3  . MET A 1 3   ? -2.385  39.895  -13.365 1.00 0.00 ? 157 MET A HG3  6  
ATOM   11034 H  HE1  . MET A 1 3   ? 0.936   41.200  -14.456 1.00 0.00 ? 157 MET A HE1  6  
ATOM   11035 H  HE2  . MET A 1 3   ? 0.532   39.775  -15.411 1.00 0.00 ? 157 MET A HE2  6  
ATOM   11036 H  HE3  . MET A 1 3   ? 1.966   39.762  -14.387 1.00 0.00 ? 157 MET A HE3  6  
ATOM   11037 N  N    . ALA A 1 4   ? 0.261   35.680  -15.258 1.00 0.00 ? 158 ALA A N    6  
ATOM   11038 C  CA   . ALA A 1 4   ? 0.669   34.246  -15.158 1.00 0.00 ? 158 ALA A CA   6  
ATOM   11039 C  C    . ALA A 1 4   ? 1.317   33.971  -13.792 1.00 0.00 ? 158 ALA A C    6  
ATOM   11040 O  O    . ALA A 1 4   ? 1.820   34.875  -13.151 1.00 0.00 ? 158 ALA A O    6  
ATOM   11041 C  CB   . ALA A 1 4   ? 1.685   34.046  -16.284 1.00 0.00 ? 158 ALA A CB   6  
ATOM   11042 H  H    . ALA A 1 4   ? 0.945   36.383  -15.192 1.00 0.00 ? 158 ALA A H    6  
ATOM   11043 H  HA   . ALA A 1 4   ? -0.181  33.601  -15.310 1.00 0.00 ? 158 ALA A HA   6  
ATOM   11044 H  HB1  . ALA A 1 4   ? 1.638   33.025  -16.634 1.00 0.00 ? 158 ALA A HB1  6  
ATOM   11045 H  HB2  . ALA A 1 4   ? 2.678   34.253  -15.913 1.00 0.00 ? 158 ALA A HB2  6  
ATOM   11046 H  HB3  . ALA A 1 4   ? 1.458   34.717  -17.098 1.00 0.00 ? 158 ALA A HB3  6  
ATOM   11047 N  N    . ASP A 1 5   ? 1.310   32.734  -13.338 1.00 0.00 ? 159 ASP A N    6  
ATOM   11048 C  CA   . ASP A 1 5   ? 1.928   32.418  -12.014 1.00 0.00 ? 159 ASP A CA   6  
ATOM   11049 C  C    . ASP A 1 5   ? 2.752   31.123  -12.107 1.00 0.00 ? 159 ASP A C    6  
ATOM   11050 O  O    . ASP A 1 5   ? 2.940   30.582  -13.180 1.00 0.00 ? 159 ASP A O    6  
ATOM   11051 C  CB   . ASP A 1 5   ? 0.748   32.245  -11.050 1.00 0.00 ? 159 ASP A CB   6  
ATOM   11052 C  CG   . ASP A 1 5   ? -0.176  31.126  -11.545 1.00 0.00 ? 159 ASP A CG   6  
ATOM   11053 O  OD1  . ASP A 1 5   ? 0.191   29.972  -11.394 1.00 0.00 ? 159 ASP A OD1  6  
ATOM   11054 O  OD2  . ASP A 1 5   ? -1.232  31.444  -12.066 1.00 0.00 ? 159 ASP A OD2  6  
ATOM   11055 H  H    . ASP A 1 5   ? 0.901   32.012  -13.865 1.00 0.00 ? 159 ASP A H    6  
ATOM   11056 H  HA   . ASP A 1 5   ? 2.551   33.235  -11.688 1.00 0.00 ? 159 ASP A HA   6  
ATOM   11057 H  HB2  . ASP A 1 5   ? 1.122   31.992  -10.068 1.00 0.00 ? 159 ASP A HB2  6  
ATOM   11058 H  HB3  . ASP A 1 5   ? 0.192   33.168  -10.994 1.00 0.00 ? 159 ASP A HB3  6  
ATOM   11059 N  N    . LYS A 1 6   ? 3.247   30.620  -10.993 1.00 0.00 ? 160 LYS A N    6  
ATOM   11060 C  CA   . LYS A 1 6   ? 4.055   29.364  -11.032 1.00 0.00 ? 160 LYS A CA   6  
ATOM   11061 C  C    . LYS A 1 6   ? 3.554   28.378  -9.965  1.00 0.00 ? 160 LYS A C    6  
ATOM   11062 O  O    . LYS A 1 6   ? 3.611   28.659  -8.783  1.00 0.00 ? 160 LYS A O    6  
ATOM   11063 C  CB   . LYS A 1 6   ? 5.487   29.805  -10.725 1.00 0.00 ? 160 LYS A CB   6  
ATOM   11064 C  CG   . LYS A 1 6   ? 6.466   28.737  -11.217 1.00 0.00 ? 160 LYS A CG   6  
ATOM   11065 C  CD   . LYS A 1 6   ? 6.770   27.759  -10.080 1.00 0.00 ? 160 LYS A CD   6  
ATOM   11066 C  CE   . LYS A 1 6   ? 7.085   26.380  -10.664 1.00 0.00 ? 160 LYS A CE   6  
ATOM   11067 N  NZ   . LYS A 1 6   ? 8.005   25.747  -9.680  1.00 0.00 ? 160 LYS A NZ   6  
ATOM   11068 H  H    . LYS A 1 6   ? 3.090   31.067  -10.131 1.00 0.00 ? 160 LYS A H    6  
ATOM   11069 H  HA   . LYS A 1 6   ? 4.009   28.916  -12.012 1.00 0.00 ? 160 LYS A HA   6  
ATOM   11070 H  HB2  . LYS A 1 6   ? 5.690   30.740  -11.224 1.00 0.00 ? 160 LYS A HB2  6  
ATOM   11071 H  HB3  . LYS A 1 6   ? 5.603   29.933  -9.659  1.00 0.00 ? 160 LYS A HB3  6  
ATOM   11072 H  HG2  . LYS A 1 6   ? 6.028   28.202  -12.047 1.00 0.00 ? 160 LYS A HG2  6  
ATOM   11073 H  HG3  . LYS A 1 6   ? 7.382   29.210  -11.536 1.00 0.00 ? 160 LYS A HG3  6  
ATOM   11074 H  HD2  . LYS A 1 6   ? 7.620   28.115  -9.516  1.00 0.00 ? 160 LYS A HD2  6  
ATOM   11075 H  HD3  . LYS A 1 6   ? 5.910   27.685  -9.431  1.00 0.00 ? 160 LYS A HD3  6  
ATOM   11076 H  HE2  . LYS A 1 6   ? 6.178   25.799  -10.764 1.00 0.00 ? 160 LYS A HE2  6  
ATOM   11077 H  HE3  . LYS A 1 6   ? 7.576   26.479  -11.620 1.00 0.00 ? 160 LYS A HE3  6  
ATOM   11078 H  HZ1  . LYS A 1 6   ? 8.221   24.775  -9.981  1.00 0.00 ? 160 LYS A HZ1  6  
ATOM   11079 H  HZ2  . LYS A 1 6   ? 7.550   25.728  -8.744  1.00 0.00 ? 160 LYS A HZ2  6  
ATOM   11080 H  HZ3  . LYS A 1 6   ? 8.887   26.294  -9.627  1.00 0.00 ? 160 LYS A HZ3  6  
ATOM   11081 N  N    . ARG A 1 7   ? 3.062   27.222  -10.369 1.00 0.00 ? 161 ARG A N    6  
ATOM   11082 C  CA   . ARG A 1 7   ? 2.563   26.230  -9.370  1.00 0.00 ? 161 ARG A CA   6  
ATOM   11083 C  C    . ARG A 1 7   ? 3.380   24.933  -9.457  1.00 0.00 ? 161 ARG A C    6  
ATOM   11084 O  O    . ARG A 1 7   ? 4.073   24.570  -8.524  1.00 0.00 ? 161 ARG A O    6  
ATOM   11085 C  CB   . ARG A 1 7   ? 1.105   25.974  -9.759  1.00 0.00 ? 161 ARG A CB   6  
ATOM   11086 C  CG   . ARG A 1 7   ? 0.179   26.794  -8.856  1.00 0.00 ? 161 ARG A CG   6  
ATOM   11087 C  CD   . ARG A 1 7   ? -1.280  26.492  -9.207  1.00 0.00 ? 161 ARG A CD   6  
ATOM   11088 N  NE   . ARG A 1 7   ? -1.720  27.643  -10.053 1.00 0.00 ? 161 ARG A NE   6  
ATOM   11089 C  CZ   . ARG A 1 7   ? -1.988  28.826  -9.521  1.00 0.00 ? 161 ARG A CZ   6  
ATOM   11090 N  NH1  . ARG A 1 7   ? -1.879  29.036  -8.229  1.00 0.00 ? 161 ARG A NH1  6  
ATOM   11091 N  NH2  . ARG A 1 7   ? -2.371  29.809  -10.292 1.00 0.00 ? 161 ARG A NH2  6  
ATOM   11092 H  H    . ARG A 1 7   ? 3.022   27.006  -11.327 1.00 0.00 ? 161 ARG A H    6  
ATOM   11093 H  HA   . ARG A 1 7   ? 2.615   26.637  -8.378  1.00 0.00 ? 161 ARG A HA   6  
ATOM   11094 H  HB2  . ARG A 1 7   ? 0.953   26.264  -10.789 1.00 0.00 ? 161 ARG A HB2  6  
ATOM   11095 H  HB3  . ARG A 1 7   ? 0.882   24.925  -9.643  1.00 0.00 ? 161 ARG A HB3  6  
ATOM   11096 H  HG2  . ARG A 1 7   ? 0.363   26.534  -7.823  1.00 0.00 ? 161 ARG A HG2  6  
ATOM   11097 H  HG3  . ARG A 1 7   ? 0.372   27.845  -9.003  1.00 0.00 ? 161 ARG A HG3  6  
ATOM   11098 H  HD2  . ARG A 1 7   ? -1.351  25.565  -9.761  1.00 0.00 ? 161 ARG A HD2  6  
ATOM   11099 H  HD3  . ARG A 1 7   ? -1.880  26.443  -8.311  1.00 0.00 ? 161 ARG A HD3  6  
ATOM   11100 H  HE   . ARG A 1 7   ? -1.809  27.516  -11.023 1.00 0.00 ? 161 ARG A HE   6  
ATOM   11101 H  HH11 . ARG A 1 7   ? -1.589  28.300  -7.617  1.00 0.00 ? 161 ARG A HH11 6  
ATOM   11102 H  HH12 . ARG A 1 7   ? -2.089  29.938  -7.853  1.00 0.00 ? 161 ARG A HH12 6  
ATOM   11103 H  HH21 . ARG A 1 7   ? -2.459  29.667  -11.277 1.00 0.00 ? 161 ARG A HH21 6  
ATOM   11104 H  HH22 . ARG A 1 7   ? -2.576  30.705  -9.896  1.00 0.00 ? 161 ARG A HH22 6  
ATOM   11105 N  N    . GLY A 1 8   ? 3.306   24.232  -10.566 1.00 0.00 ? 162 GLY A N    6  
ATOM   11106 C  CA   . GLY A 1 8   ? 4.079   22.963  -10.706 1.00 0.00 ? 162 GLY A CA   6  
ATOM   11107 C  C    . GLY A 1 8   ? 3.214   21.911  -11.414 1.00 0.00 ? 162 GLY A C    6  
ATOM   11108 O  O    . GLY A 1 8   ? 3.625   21.332  -12.403 1.00 0.00 ? 162 GLY A O    6  
ATOM   11109 H  H    . GLY A 1 8   ? 2.742   24.540  -11.308 1.00 0.00 ? 162 GLY A H    6  
ATOM   11110 H  HA2  . GLY A 1 8   ? 4.972   23.147  -11.286 1.00 0.00 ? 162 GLY A HA2  6  
ATOM   11111 H  HA3  . GLY A 1 8   ? 4.354   22.599  -9.727  1.00 0.00 ? 162 GLY A HA3  6  
ATOM   11112 N  N    . ASP A 1 9   ? 2.020   21.652  -10.920 1.00 0.00 ? 163 ASP A N    6  
ATOM   11113 C  CA   . ASP A 1 9   ? 1.142   20.636  -11.574 1.00 0.00 ? 163 ASP A CA   6  
ATOM   11114 C  C    . ASP A 1 9   ? -0.152  21.296  -12.076 1.00 0.00 ? 163 ASP A C    6  
ATOM   11115 O  O    . ASP A 1 9   ? -0.789  22.040  -11.354 1.00 0.00 ? 163 ASP A O    6  
ATOM   11116 C  CB   . ASP A 1 9   ? 0.834   19.615  -10.479 1.00 0.00 ? 163 ASP A CB   6  
ATOM   11117 C  CG   . ASP A 1 9   ? 1.855   18.478  -10.538 1.00 0.00 ? 163 ASP A CG   6  
ATOM   11118 O  OD1  . ASP A 1 9   ? 2.953   18.667  -10.044 1.00 0.00 ? 163 ASP A OD1  6  
ATOM   11119 O  OD2  . ASP A 1 9   ? 1.520   17.436  -11.078 1.00 0.00 ? 163 ASP A OD2  6  
ATOM   11120 H  H    . ASP A 1 9   ? 1.698   22.125  -10.120 1.00 0.00 ? 163 ASP A H    6  
ATOM   11121 H  HA   . ASP A 1 9   ? 1.662   20.157  -12.388 1.00 0.00 ? 163 ASP A HA   6  
ATOM   11122 H  HB2  . ASP A 1 9   ? 0.887   20.097  -9.513  1.00 0.00 ? 163 ASP A HB2  6  
ATOM   11123 H  HB3  . ASP A 1 9   ? -0.158  19.215  -10.628 1.00 0.00 ? 163 ASP A HB3  6  
ATOM   11124 N  N    . GLY A 1 10  ? -0.548  21.03