data_2LDX
# 
_entry.id   2LDX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LDX         
WWPDB D_1000178298 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1989-04-19 
_pdbx_database_PDB_obs_spr.pdb_id           2LDX 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1LDX 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2LDX 
_pdbx_database_status.recvd_initial_deposition_date   1987-11-25 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Griffith, J.P.' 1 
'Rossmann, M.G.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Characterization of the antigenic sites on the refined 3-A resolution structure of mouse testicular lactate dehydrogenase C4.' 
J.Biol.Chem. 262 13155 13162 1987 JBCHA3 US 0021-9258 0071 ? 2443489 ? 
1       'The Structure of Mouse Testicular Lactate Dehydrogenase Isoenzyme C4 at 2.9 Angstroms Resolution' J.Biol.Chem. 254 7611  
?     1979 JBCHA3 US 0021-9258 0071 ? ?       ? 
2       'A Low-Resolution Study of Testicular Lactate Dehydrogenase Using the Molecular Replacement Technique' J.Mol.Biol.  104 
659   ?     1976 JMOBAK UK 0022-2836 0070 ? ?       ? 
3       'A Crystalline Form of Testes-Specific Lactate Dehydrogenase' J.Mol.Biol.  78  721   ?     1973 JMOBAK UK 0022-2836 0070 ? 
?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hogrefe, H.H.'  1  
primary 'Griffith, J.P.' 2  
primary 'Rossmann, M.G.' 3  
primary 'Goldberg, E.'   4  
1       'Musick, W.D.L.' 5  
1       'Rossmann, M.G.' 6  
2       'Musick, W.D.L.' 7  
2       'Adams, A.D.'    8  
2       'Rossmann, M.G.' 9  
2       'Wheat, T.E.'    10 
2       'Goldberg, E.'   11 
3       'Adams, A.D.'    12 
3       'Adams, M.J.'    13 
3       'Rossmann, M.G.' 14 
# 
_cell.entry_id           2LDX 
_cell.length_a           84.800 
_cell.length_b           76.600 
_cell.length_c           63.900 
_cell.angle_alpha        109.70 
_cell.angle_beta         89.50 
_cell.angle_gamma        96.50 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2LDX 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'APO-LACTATE DEHYDROGENASE' 35866.605 4  1.1.1.27 ? ? ? 
2 water   nat water                       18.015    31 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;STVKEQLIQNLVPEDKLSRCKITVVGVGDVGMACAISILLKGLADELALVDADTDKLRGEALDLQHGSLFLSTPKIVFGK
DYNVSANSKLVIITAGARMVSGQTRLDLLQRNVAIMKAIVPGVIQNSPDCKIIVVTNPVDILTYVVWKISGFPVGRVIGS
GCNLDSARFRYLIGEKLGVNPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDKNKQHWKNVHKQVVEGGYEV
LDMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGESGITDFVKVNMTAEEEGLLKKSAD
TLWNMQKNLEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;STVKEQLIQNLVPEDKLSRCKITVVGVGDVGMACAISILLKGLADELALVDADTDKLRGEALDLQHGSLFLSTPKIVFGK
DYNVSANSKLVIITAGARMVSGQTRLDLLQRNVAIMKAIVPGVIQNSPDCKIIVVTNPVDILTYVVWKISGFPVGRVIGS
GCNLDSARFRYLIGEKLGVNPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDKNKQHWKNVHKQVVEGGYEV
LDMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGESGITDFVKVNMTAEEEGLLKKSAD
TLWNMQKNLEL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   THR n 
1 3   VAL n 
1 4   LYS n 
1 5   GLU n 
1 6   GLN n 
1 7   LEU n 
1 8   ILE n 
1 9   GLN n 
1 10  ASN n 
1 11  LEU n 
1 12  VAL n 
1 13  PRO n 
1 14  GLU n 
1 15  ASP n 
1 16  LYS n 
1 17  LEU n 
1 18  SER n 
1 19  ARG n 
1 20  CYS n 
1 21  LYS n 
1 22  ILE n 
1 23  THR n 
1 24  VAL n 
1 25  VAL n 
1 26  GLY n 
1 27  VAL n 
1 28  GLY n 
1 29  ASP n 
1 30  VAL n 
1 31  GLY n 
1 32  MET n 
1 33  ALA n 
1 34  CYS n 
1 35  ALA n 
1 36  ILE n 
1 37  SER n 
1 38  ILE n 
1 39  LEU n 
1 40  LEU n 
1 41  LYS n 
1 42  GLY n 
1 43  LEU n 
1 44  ALA n 
1 45  ASP n 
1 46  GLU n 
1 47  LEU n 
1 48  ALA n 
1 49  LEU n 
1 50  VAL n 
1 51  ASP n 
1 52  ALA n 
1 53  ASP n 
1 54  THR n 
1 55  ASP n 
1 56  LYS n 
1 57  LEU n 
1 58  ARG n 
1 59  GLY n 
1 60  GLU n 
1 61  ALA n 
1 62  LEU n 
1 63  ASP n 
1 64  LEU n 
1 65  GLN n 
1 66  HIS n 
1 67  GLY n 
1 68  SER n 
1 69  LEU n 
1 70  PHE n 
1 71  LEU n 
1 72  SER n 
1 73  THR n 
1 74  PRO n 
1 75  LYS n 
1 76  ILE n 
1 77  VAL n 
1 78  PHE n 
1 79  GLY n 
1 80  LYS n 
1 81  ASP n 
1 82  TYR n 
1 83  ASN n 
1 84  VAL n 
1 85  SER n 
1 86  ALA n 
1 87  ASN n 
1 88  SER n 
1 89  LYS n 
1 90  LEU n 
1 91  VAL n 
1 92  ILE n 
1 93  ILE n 
1 94  THR n 
1 95  ALA n 
1 96  GLY n 
1 97  ALA n 
1 98  ARG n 
1 99  MET n 
1 100 VAL n 
1 101 SER n 
1 102 GLY n 
1 103 GLN n 
1 104 THR n 
1 105 ARG n 
1 106 LEU n 
1 107 ASP n 
1 108 LEU n 
1 109 LEU n 
1 110 GLN n 
1 111 ARG n 
1 112 ASN n 
1 113 VAL n 
1 114 ALA n 
1 115 ILE n 
1 116 MET n 
1 117 LYS n 
1 118 ALA n 
1 119 ILE n 
1 120 VAL n 
1 121 PRO n 
1 122 GLY n 
1 123 VAL n 
1 124 ILE n 
1 125 GLN n 
1 126 ASN n 
1 127 SER n 
1 128 PRO n 
1 129 ASP n 
1 130 CYS n 
1 131 LYS n 
1 132 ILE n 
1 133 ILE n 
1 134 VAL n 
1 135 VAL n 
1 136 THR n 
1 137 ASN n 
1 138 PRO n 
1 139 VAL n 
1 140 ASP n 
1 141 ILE n 
1 142 LEU n 
1 143 THR n 
1 144 TYR n 
1 145 VAL n 
1 146 VAL n 
1 147 TRP n 
1 148 LYS n 
1 149 ILE n 
1 150 SER n 
1 151 GLY n 
1 152 PHE n 
1 153 PRO n 
1 154 VAL n 
1 155 GLY n 
1 156 ARG n 
1 157 VAL n 
1 158 ILE n 
1 159 GLY n 
1 160 SER n 
1 161 GLY n 
1 162 CYS n 
1 163 ASN n 
1 164 LEU n 
1 165 ASP n 
1 166 SER n 
1 167 ALA n 
1 168 ARG n 
1 169 PHE n 
1 170 ARG n 
1 171 TYR n 
1 172 LEU n 
1 173 ILE n 
1 174 GLY n 
1 175 GLU n 
1 176 LYS n 
1 177 LEU n 
1 178 GLY n 
1 179 VAL n 
1 180 ASN n 
1 181 PRO n 
1 182 THR n 
1 183 SER n 
1 184 CYS n 
1 185 HIS n 
1 186 GLY n 
1 187 TRP n 
1 188 VAL n 
1 189 LEU n 
1 190 GLY n 
1 191 GLU n 
1 192 HIS n 
1 193 GLY n 
1 194 ASP n 
1 195 SER n 
1 196 SER n 
1 197 VAL n 
1 198 PRO n 
1 199 ILE n 
1 200 TRP n 
1 201 SER n 
1 202 GLY n 
1 203 VAL n 
1 204 ASN n 
1 205 VAL n 
1 206 ALA n 
1 207 GLY n 
1 208 VAL n 
1 209 THR n 
1 210 LEU n 
1 211 LYS n 
1 212 SER n 
1 213 LEU n 
1 214 ASN n 
1 215 PRO n 
1 216 ALA n 
1 217 ILE n 
1 218 GLY n 
1 219 THR n 
1 220 ASP n 
1 221 LYS n 
1 222 ASN n 
1 223 LYS n 
1 224 GLN n 
1 225 HIS n 
1 226 TRP n 
1 227 LYS n 
1 228 ASN n 
1 229 VAL n 
1 230 HIS n 
1 231 LYS n 
1 232 GLN n 
1 233 VAL n 
1 234 VAL n 
1 235 GLU n 
1 236 GLY n 
1 237 GLY n 
1 238 TYR n 
1 239 GLU n 
1 240 VAL n 
1 241 LEU n 
1 242 ASP n 
1 243 MET n 
1 244 LYS n 
1 245 GLY n 
1 246 TYR n 
1 247 THR n 
1 248 SER n 
1 249 TRP n 
1 250 ALA n 
1 251 ILE n 
1 252 GLY n 
1 253 LEU n 
1 254 SER n 
1 255 VAL n 
1 256 THR n 
1 257 ASP n 
1 258 LEU n 
1 259 ALA n 
1 260 ARG n 
1 261 SER n 
1 262 ILE n 
1 263 LEU n 
1 264 LYS n 
1 265 ASN n 
1 266 LEU n 
1 267 LYS n 
1 268 ARG n 
1 269 VAL n 
1 270 HIS n 
1 271 PRO n 
1 272 VAL n 
1 273 THR n 
1 274 THR n 
1 275 LEU n 
1 276 VAL n 
1 277 LYS n 
1 278 GLY n 
1 279 PHE n 
1 280 HIS n 
1 281 GLY n 
1 282 ILE n 
1 283 LYS n 
1 284 GLU n 
1 285 GLU n 
1 286 VAL n 
1 287 PHE n 
1 288 LEU n 
1 289 SER n 
1 290 ILE n 
1 291 PRO n 
1 292 CYS n 
1 293 VAL n 
1 294 LEU n 
1 295 GLY n 
1 296 GLU n 
1 297 SER n 
1 298 GLY n 
1 299 ILE n 
1 300 THR n 
1 301 ASP n 
1 302 PHE n 
1 303 VAL n 
1 304 LYS n 
1 305 VAL n 
1 306 ASN n 
1 307 MET n 
1 308 THR n 
1 309 ALA n 
1 310 GLU n 
1 311 GLU n 
1 312 GLU n 
1 313 GLY n 
1 314 LEU n 
1 315 LEU n 
1 316 LYS n 
1 317 LYS n 
1 318 SER n 
1 319 ALA n 
1 320 ASP n 
1 321 THR n 
1 322 LEU n 
1 323 TRP n 
1 324 ASN n 
1 325 MET n 
1 326 GLN n 
1 327 LYS n 
1 328 ASN n 
1 329 LEU n 
1 330 GLU n 
1 331 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LDHC_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00342 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;STVKEQLIQNLVPEDKLSRCKITVVGVGNVGMACAISILLKGLADELALVDADTNKLRGEALDLLHGSLFLSTPKIVFGK
DYNVSANSKLVIITAGARMVSGETRLDLLQRNVAIMKAIVPGIVQNSPDCKIIIVTNPVDILTYVVWKISGFPVGRVIGS
GCNLDSARFRYLIGEKLGVNPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDSDKEHWKNVHKQVVEGGYEV
LNMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGQSGITDFVKVNMTAEEEGLLKKSAD
TLWNMQKDLQL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LDX A 1 ? 331 ? P00342 1 ? 331 ? 1 331 
2 1 2LDX B 1 ? 331 ? P00342 1 ? 331 ? 1 331 
3 1 2LDX C 1 ? 331 ? P00342 1 ? 331 ? 1 331 
4 1 2LDX D 1 ? 331 ? P00342 1 ? 331 ? 1 331 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LDX ASP A 29  ? UNP P00342 ASN 29  CONFLICT 29  1  
1 2LDX ASP A 55  ? UNP P00342 ASN 55  CONFLICT 55  2  
1 2LDX GLN A 65  ? UNP P00342 LEU 65  CONFLICT 65  3  
1 2LDX GLN A 103 ? UNP P00342 GLU 103 CONFLICT 103 4  
1 2LDX VAL A 123 ? UNP P00342 ILE 123 CONFLICT 123 5  
1 2LDX ILE A 124 ? UNP P00342 VAL 124 CONFLICT 124 6  
1 2LDX VAL A 134 ? UNP P00342 ILE 134 CONFLICT 134 7  
1 2LDX LYS A 221 ? UNP P00342 SER 221 CONFLICT 221 8  
1 2LDX ASN A 222 ? UNP P00342 ASP 222 CONFLICT 222 9  
1 2LDX GLN A 224 ? UNP P00342 GLU 224 CONFLICT 224 10 
1 2LDX ASP A 242 ? UNP P00342 ASN 242 CONFLICT 242 11 
1 2LDX GLU A 296 ? UNP P00342 GLN 296 CONFLICT 296 12 
1 2LDX ASN A 328 ? UNP P00342 ASP 328 CONFLICT 328 13 
1 2LDX GLU A 330 ? UNP P00342 GLN 330 CONFLICT 330 14 
2 2LDX ASP B 29  ? UNP P00342 ASN 29  CONFLICT 29  15 
2 2LDX ASP B 55  ? UNP P00342 ASN 55  CONFLICT 55  16 
2 2LDX GLN B 65  ? UNP P00342 LEU 65  CONFLICT 65  17 
2 2LDX GLN B 103 ? UNP P00342 GLU 103 CONFLICT 103 18 
2 2LDX VAL B 123 ? UNP P00342 ILE 123 CONFLICT 123 19 
2 2LDX ILE B 124 ? UNP P00342 VAL 124 CONFLICT 124 20 
2 2LDX VAL B 134 ? UNP P00342 ILE 134 CONFLICT 134 21 
2 2LDX LYS B 221 ? UNP P00342 SER 221 CONFLICT 221 22 
2 2LDX ASN B 222 ? UNP P00342 ASP 222 CONFLICT 222 23 
2 2LDX GLN B 224 ? UNP P00342 GLU 224 CONFLICT 224 24 
2 2LDX ASP B 242 ? UNP P00342 ASN 242 CONFLICT 242 25 
2 2LDX GLU B 296 ? UNP P00342 GLN 296 CONFLICT 296 26 
2 2LDX ASN B 328 ? UNP P00342 ASP 328 CONFLICT 328 27 
2 2LDX GLU B 330 ? UNP P00342 GLN 330 CONFLICT 330 28 
3 2LDX ASP C 29  ? UNP P00342 ASN 29  CONFLICT 29  29 
3 2LDX ASP C 55  ? UNP P00342 ASN 55  CONFLICT 55  30 
3 2LDX GLN C 65  ? UNP P00342 LEU 65  CONFLICT 65  31 
3 2LDX GLN C 103 ? UNP P00342 GLU 103 CONFLICT 103 32 
3 2LDX VAL C 123 ? UNP P00342 ILE 123 CONFLICT 123 33 
3 2LDX ILE C 124 ? UNP P00342 VAL 124 CONFLICT 124 34 
3 2LDX VAL C 134 ? UNP P00342 ILE 134 CONFLICT 134 35 
3 2LDX LYS C 221 ? UNP P00342 SER 221 CONFLICT 221 36 
3 2LDX ASN C 222 ? UNP P00342 ASP 222 CONFLICT 222 37 
3 2LDX GLN C 224 ? UNP P00342 GLU 224 CONFLICT 224 38 
3 2LDX ASP C 242 ? UNP P00342 ASN 242 CONFLICT 242 39 
3 2LDX GLU C 296 ? UNP P00342 GLN 296 CONFLICT 296 40 
3 2LDX ASN C 328 ? UNP P00342 ASP 328 CONFLICT 328 41 
3 2LDX GLU C 330 ? UNP P00342 GLN 330 CONFLICT 330 42 
4 2LDX ASP D 29  ? UNP P00342 ASN 29  CONFLICT 29  43 
4 2LDX ASP D 55  ? UNP P00342 ASN 55  CONFLICT 55  44 
4 2LDX GLN D 65  ? UNP P00342 LEU 65  CONFLICT 65  45 
4 2LDX GLN D 103 ? UNP P00342 GLU 103 CONFLICT 103 46 
4 2LDX VAL D 123 ? UNP P00342 ILE 123 CONFLICT 123 47 
4 2LDX ILE D 124 ? UNP P00342 VAL 124 CONFLICT 124 48 
4 2LDX VAL D 134 ? UNP P00342 ILE 134 CONFLICT 134 49 
4 2LDX LYS D 221 ? UNP P00342 SER 221 CONFLICT 221 50 
4 2LDX ASN D 222 ? UNP P00342 ASP 222 CONFLICT 222 51 
4 2LDX GLN D 224 ? UNP P00342 GLU 224 CONFLICT 224 52 
4 2LDX ASP D 242 ? UNP P00342 ASN 242 CONFLICT 242 53 
4 2LDX GLU D 296 ? UNP P00342 GLN 296 CONFLICT 296 54 
4 2LDX ASN D 328 ? UNP P00342 ASP 328 CONFLICT 328 55 
4 2LDX GLU D 330 ? UNP P00342 GLN 330 CONFLICT 330 56 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2LDX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.51 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 2LDX 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.96 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2560000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10060 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               10091 
_refine_hist.d_res_high                       2.96 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.018 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.039 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.046 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         0.500 1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        0.252 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         0.935 1.000 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        0.539 1.500 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.019 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.143 0.150 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.214 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.213 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      0.252 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        4.4   3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     24.7  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   31.4  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.000000  0.000000 0.000000 0.000000 -1.000000 0.000000 0.000000 0.000000 -1.000000 0.00000 0.00000 0.00000 
2 given ? -1.000000 0.000000 0.000000 0.000000 1.000000  0.000000 0.000000 0.000000 -1.000000 0.00000 0.00000 0.00000 
3 given ? -1.000000 0.000000 0.000000 0.000000 -1.000000 0.000000 0.000000 0.000000 1.000000  0.00000 0.00000 0.00000 
# 
_struct.entry_id                  2LDX 
_struct.title                     
;CHARACTERIZATION OF THE ANTIGENIC SITES ON THE REFINED 3-ANGSTROMS RESOLUTION STRUCTURE OF MOUSE TESTICULAR LACTATE DEHYDROGENASE C4
;
_struct.pdbx_descriptor           'APO-LACTATE DEHYDROGENASE (E.C.1.1.1.27), ISOENZYME C4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LDX 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE(CHOH(D)-NAD(A))' 
_struct_keywords.text            'OXIDOREDUCTASE(CHOH(D)-NAD(A))' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA  THR A 2   ? ILE A 8   ? THR A 2   ILE A 8   1 ? 7  
HELX_P HELX_P2  AB  GLY A 28  ? LEU A 40  ? GLY A 28  LEU A 40  1 ? 13 
HELX_P HELX_P3  AC  ASP A 53  ? GLY A 67  ? ASP A 53  GLY A 67  1 ? 15 
HELX_P HELX_P4  AD  LEU A 109 ? VAL A 120 ? LEU A 109 VAL A 120 1 ? 12 
HELX_P HELX_P5  AE  GLY A 122 ? SER A 127 ? GLY A 122 SER A 127 1 ? 6  
HELX_P HELX_P6  A1F PRO A 138 ? GLY A 151 ? PRO A 138 GLY A 151 1 ? 14 
HELX_P HELX_P7  A2F CYS A 162 ? GLY A 178 ? CYS A 162 GLY A 178 1 ? 17 
HELX_P HELX_P8  A2G TRP A 226 ? GLY A 245 ? TRP A 226 GLY A 245 1 ? 20 
HELX_P HELX_P9  A3G SER A 248 ? LYS A 264 ? SER A 248 LYS A 264 1 ? 17 
HELX_P HELX_P10 AH  THR A 308 ? GLN A 326 ? THR A 308 GLN A 326 1 ? 19 
HELX_P HELX_P11 BA  THR B 2   ? ILE B 8   ? THR B 2   ILE B 8   1 ? 7  
HELX_P HELX_P12 BB  GLY B 28  ? LEU B 40  ? GLY B 28  LEU B 40  1 ? 13 
HELX_P HELX_P13 BC  ASP B 53  ? GLY B 67  ? ASP B 53  GLY B 67  1 ? 15 
HELX_P HELX_P14 BD  LEU B 109 ? VAL B 120 ? LEU B 109 VAL B 120 1 ? 12 
HELX_P HELX_P15 BE  GLY B 122 ? SER B 127 ? GLY B 122 SER B 127 1 ? 6  
HELX_P HELX_P16 B1F PRO B 138 ? GLY B 151 ? PRO B 138 GLY B 151 1 ? 14 
HELX_P HELX_P17 B2F CYS B 162 ? GLY B 178 ? CYS B 162 GLY B 178 1 ? 17 
HELX_P HELX_P18 B2G TRP B 226 ? GLY B 245 ? TRP B 226 GLY B 245 1 ? 20 
HELX_P HELX_P19 B3G SER B 248 ? LYS B 264 ? SER B 248 LYS B 264 1 ? 17 
HELX_P HELX_P20 BH  THR B 308 ? GLN B 326 ? THR B 308 GLN B 326 1 ? 19 
HELX_P HELX_P21 CA  THR C 2   ? ILE C 8   ? THR C 2   ILE C 8   1 ? 7  
HELX_P HELX_P22 CB  GLY C 28  ? LEU C 40  ? GLY C 28  LEU C 40  1 ? 13 
HELX_P HELX_P23 CC  ASP C 53  ? GLY C 67  ? ASP C 53  GLY C 67  1 ? 15 
HELX_P HELX_P24 CD  LEU C 109 ? VAL C 120 ? LEU C 109 VAL C 120 1 ? 12 
HELX_P HELX_P25 CE  GLY C 122 ? SER C 127 ? GLY C 122 SER C 127 1 ? 6  
HELX_P HELX_P26 C1F PRO C 138 ? GLY C 151 ? PRO C 138 GLY C 151 1 ? 14 
HELX_P HELX_P27 C2F CYS C 162 ? GLY C 178 ? CYS C 162 GLY C 178 1 ? 17 
HELX_P HELX_P28 C2G TRP C 226 ? GLY C 245 ? TRP C 226 GLY C 245 1 ? 20 
HELX_P HELX_P29 C3G SER C 248 ? LYS C 264 ? SER C 248 LYS C 264 1 ? 17 
HELX_P HELX_P30 CH  THR C 308 ? GLN C 326 ? THR C 308 GLN C 326 1 ? 19 
HELX_P HELX_P31 DA  THR D 2   ? ILE D 8   ? THR D 2   ILE D 8   1 ? 7  
HELX_P HELX_P32 DB  GLY D 28  ? LEU D 40  ? GLY D 28  LEU D 40  1 ? 13 
HELX_P HELX_P33 DC  ASP D 53  ? GLY D 67  ? ASP D 53  GLY D 67  1 ? 15 
HELX_P HELX_P34 DD  LEU D 109 ? VAL D 120 ? LEU D 109 VAL D 120 1 ? 12 
HELX_P HELX_P35 DE  GLY D 122 ? SER D 127 ? GLY D 122 SER D 127 1 ? 6  
HELX_P HELX_P36 D1F PRO D 138 ? GLY D 151 ? PRO D 138 GLY D 151 1 ? 14 
HELX_P HELX_P37 D2G TRP D 226 ? GLY D 245 ? TRP D 226 GLY D 245 1 ? 20 
HELX_P HELX_P38 D3G SER D 248 ? LYS D 264 ? SER D 248 LYS D 264 1 ? 17 
HELX_P HELX_P39 DH  THR D 308 ? GLN D 326 ? THR D 308 GLN D 326 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 137 A . ? ASN 137 A PRO 138 A ? PRO 138 A 1 11.12 
2 ASN 137 B . ? ASN 137 B PRO 138 B ? PRO 138 B 1 11.12 
3 ASN 137 C . ? ASN 137 C PRO 138 C ? PRO 138 C 1 11.12 
4 ASN 137 D . ? ASN 137 D PRO 138 D ? PRO 138 D 1 11.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
SH1 ? 6 ? 
SH2 ? 2 ? 
SH3 ? 3 ? 
SH4 ? 6 ? 
SH5 ? 2 ? 
SH6 ? 3 ? 
SH7 ? 6 ? 
SH8 ? 2 ? 
SH9 ? 3 ? 
S10 ? 6 ? 
S11 ? 2 ? 
S12 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
SH1 1 2 ? parallel      
SH1 2 3 ? parallel      
SH1 3 4 ? parallel      
SH1 4 5 ? parallel      
SH1 5 6 ? parallel      
SH2 1 2 ? anti-parallel 
SH3 1 2 ? anti-parallel 
SH3 2 3 ? anti-parallel 
SH4 1 2 ? parallel      
SH4 2 3 ? parallel      
SH4 3 4 ? parallel      
SH4 4 5 ? parallel      
SH4 5 6 ? parallel      
SH5 1 2 ? anti-parallel 
SH6 1 2 ? anti-parallel 
SH6 2 3 ? anti-parallel 
SH7 1 2 ? parallel      
SH7 2 3 ? parallel      
SH7 3 4 ? parallel      
SH7 4 5 ? parallel      
SH7 5 6 ? parallel      
SH8 1 2 ? anti-parallel 
SH9 1 2 ? anti-parallel 
SH9 2 3 ? anti-parallel 
S10 1 2 ? parallel      
S10 2 3 ? parallel      
S10 3 4 ? parallel      
S10 4 5 ? parallel      
S10 5 6 ? parallel      
S11 1 2 ? anti-parallel 
S12 1 2 ? anti-parallel 
S12 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
SH1 1 LYS A 75  ? GLY A 79  ? LYS A 75  GLY A 79  
SH1 2 GLU A 46  ? VAL A 50  ? GLU A 46  VAL A 50  
SH1 3 LYS A 21  ? VAL A 25  ? LYS A 21  VAL A 25  
SH1 4 SER A 88  ? ILE A 93  ? SER A 88  ILE A 93  
SH1 5 LYS A 131 ? VAL A 134 ? LYS A 131 VAL A 134 
SH1 6 VAL A 157 ? GLY A 159 ? VAL A 157 GLY A 159 
SH2 1 VAL A 188 ? GLY A 190 ? VAL A 188 GLY A 190 
SH2 2 SER A 196 ? PRO A 198 ? SER A 196 PRO A 198 
SH3 1 ARG A 268 ? LEU A 275 ? ARG A 268 LEU A 275 
SH3 2 PHE A 287 ? GLY A 295 ? PHE A 287 GLY A 295 
SH3 3 GLY A 298 ? PHE A 302 ? GLY A 298 PHE A 302 
SH4 1 LYS B 75  ? GLY B 79  ? LYS B 75  GLY B 79  
SH4 2 GLU B 46  ? VAL B 50  ? GLU B 46  VAL B 50  
SH4 3 LYS B 21  ? VAL B 25  ? LYS B 21  VAL B 25  
SH4 4 SER B 88  ? ILE B 93  ? SER B 88  ILE B 93  
SH4 5 LYS B 131 ? VAL B 134 ? LYS B 131 VAL B 134 
SH4 6 VAL B 157 ? GLY B 159 ? VAL B 157 GLY B 159 
SH5 1 VAL B 188 ? GLY B 190 ? VAL B 188 GLY B 190 
SH5 2 SER B 196 ? PRO B 198 ? SER B 196 PRO B 198 
SH6 1 ARG B 268 ? LEU B 275 ? ARG B 268 LEU B 275 
SH6 2 PHE B 287 ? GLY B 295 ? PHE B 287 GLY B 295 
SH6 3 GLY B 298 ? PHE B 302 ? GLY B 298 PHE B 302 
SH7 1 LYS C 75  ? GLY C 79  ? LYS C 75  GLY C 79  
SH7 2 GLU C 46  ? VAL C 50  ? GLU C 46  VAL C 50  
SH7 3 LYS C 21  ? VAL C 25  ? LYS C 21  VAL C 25  
SH7 4 SER C 88  ? ILE C 93  ? SER C 88  ILE C 93  
SH7 5 LYS C 131 ? VAL C 134 ? LYS C 131 VAL C 134 
SH7 6 VAL C 157 ? GLY C 159 ? VAL C 157 GLY C 159 
SH8 1 VAL C 188 ? GLY C 190 ? VAL C 188 GLY C 190 
SH8 2 SER C 196 ? PRO C 198 ? SER C 196 PRO C 198 
SH9 1 ARG C 268 ? LEU C 275 ? ARG C 268 LEU C 275 
SH9 2 PHE C 287 ? GLY C 295 ? PHE C 287 GLY C 295 
SH9 3 GLY C 298 ? PHE C 302 ? GLY C 298 PHE C 302 
S10 1 LYS D 75  ? GLY D 79  ? LYS D 75  GLY D 79  
S10 2 GLU D 46  ? VAL D 50  ? GLU D 46  VAL D 50  
S10 3 LYS D 21  ? VAL D 25  ? LYS D 21  VAL D 25  
S10 4 SER D 88  ? ILE D 93  ? SER D 88  ILE D 93  
S10 5 LYS D 131 ? VAL D 134 ? LYS D 131 VAL D 134 
S10 6 VAL D 157 ? GLY D 159 ? VAL D 157 GLY D 159 
S11 1 VAL D 188 ? GLY D 190 ? VAL D 188 GLY D 190 
S11 2 SER D 196 ? PRO D 198 ? SER D 196 PRO D 198 
S12 1 ARG D 268 ? LEU D 275 ? ARG D 268 LEU D 275 
S12 2 PHE D 287 ? GLY D 295 ? PHE D 287 GLY D 295 
S12 3 GLY D 298 ? PHE D 302 ? GLY D 298 PHE D 302 
# 
_database_PDB_matrix.entry_id          2LDX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2LDX 
_atom_sites.fract_transf_matrix[1][1]   -0.011874 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.001625 
_atom_sites.fract_transf_matrix[2][2]   0.013845 
_atom_sites.fract_transf_matrix[2][3]   -0.000776 
_atom_sites.fract_transf_matrix[3][1]   -0.000528 
_atom_sites.fract_transf_matrix[3][2]   0.004732 
_atom_sites.fract_transf_matrix[3][3]   -0.015974 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   'RESIDUE PRO 138 IS A CIS-PROLINE.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 1   ? -36.175 4.703   20.012  1.00 23.65 ? 1   SER A N   1 
ATOM   2     C CA  . SER A 1 1   ? -37.076 5.715   19.521  1.00 23.75 ? 1   SER A CA  1 
ATOM   3     C C   . SER A 1 1   ? -36.587 6.356   18.220  1.00 23.75 ? 1   SER A C   1 
ATOM   4     O O   . SER A 1 1   ? -37.378 6.680   17.302  1.00 23.74 ? 1   SER A O   1 
ATOM   5     C CB  . SER A 1 1   ? -37.203 6.817   20.593  1.00 23.79 ? 1   SER A CB  1 
ATOM   6     O OG  . SER A 1 1   ? -35.934 7.503   20.620  1.00 23.83 ? 1   SER A OG  1 
ATOM   7     N N   . THR A 1 2   ? -35.294 6.592   18.178  1.00 23.67 ? 2   THR A N   1 
ATOM   8     C CA  . THR A 1 2   ? -34.505 7.179   17.140  1.00 23.62 ? 2   THR A CA  1 
ATOM   9     C C   . THR A 1 2   ? -33.946 6.178   16.134  1.00 23.58 ? 2   THR A C   1 
ATOM   10    O O   . THR A 1 2   ? -33.671 5.031   16.546  1.00 23.61 ? 2   THR A O   1 
ATOM   11    C CB  . THR A 1 2   ? -33.137 7.803   17.735  1.00 23.70 ? 2   THR A CB  1 
ATOM   12    O OG1 . THR A 1 2   ? -33.478 8.268   19.059  1.00 24.00 ? 2   THR A OG1 1 
ATOM   13    C CG2 . THR A 1 2   ? -32.528 8.847   16.817  1.00 23.73 ? 2   THR A CG2 1 
ATOM   14    N N   . VAL A 1 3   ? -33.539 6.729   14.983  1.00 23.42 ? 3   VAL A N   1 
ATOM   15    C CA  . VAL A 1 3   ? -32.880 5.818   13.996  1.00 23.26 ? 3   VAL A CA  1 
ATOM   16    C C   . VAL A 1 3   ? -31.653 5.239   14.740  1.00 23.20 ? 3   VAL A C   1 
ATOM   17    O O   . VAL A 1 3   ? -31.495 4.015   14.727  1.00 23.10 ? 3   VAL A O   1 
ATOM   18    C CB  . VAL A 1 3   ? -32.623 6.399   12.626  1.00 23.10 ? 3   VAL A CB  1 
ATOM   19    C CG1 . VAL A 1 3   ? -33.117 7.839   12.448  1.00 23.08 ? 3   VAL A CG1 1 
ATOM   20    C CG2 . VAL A 1 3   ? -31.176 6.284   12.134  1.00 23.08 ? 3   VAL A CG2 1 
ATOM   21    N N   . LYS A 1 4   ? -30.880 6.105   15.379  1.00 23.20 ? 4   LYS A N   1 
ATOM   22    C CA  . LYS A 1 4   ? -29.727 5.577   16.130  1.00 23.41 ? 4   LYS A CA  1 
ATOM   23    C C   . LYS A 1 4   ? -30.260 4.424   17.001  1.00 23.74 ? 4   LYS A C   1 
ATOM   24    O O   . LYS A 1 4   ? -29.979 3.265   16.706  1.00 23.81 ? 4   LYS A O   1 
ATOM   25    C CB  . LYS A 1 4   ? -28.936 6.490   17.000  1.00 23.24 ? 4   LYS A CB  1 
ATOM   26    C CG  . LYS A 1 4   ? -27.784 7.261   16.487  1.00 23.14 ? 4   LYS A CG  1 
ATOM   27    C CD  . LYS A 1 4   ? -26.763 6.589   15.658  1.00 23.22 ? 4   LYS A CD  1 
ATOM   28    C CE  . LYS A 1 4   ? -27.159 5.830   14.432  1.00 23.34 ? 4   LYS A CE  1 
ATOM   29    N NZ  . LYS A 1 4   ? -28.356 6.352   13.722  1.00 23.24 ? 4   LYS A NZ  1 
ATOM   30    N N   . GLU A 1 5   ? -31.105 4.839   17.930  1.00 24.02 ? 5   GLU A N   1 
ATOM   31    C CA  . GLU A 1 5   ? -31.680 3.910   18.907  1.00 24.23 ? 5   GLU A CA  1 
ATOM   32    C C   . GLU A 1 5   ? -32.378 2.758   18.222  1.00 24.39 ? 5   GLU A C   1 
ATOM   33    O O   . GLU A 1 5   ? -32.665 1.730   18.867  1.00 24.61 ? 5   GLU A O   1 
ATOM   34    C CB  . GLU A 1 5   ? -32.636 4.629   19.841  1.00 24.30 ? 5   GLU A CB  1 
ATOM   35    C CG  . GLU A 1 5   ? -32.133 5.960   20.431  1.00 24.42 ? 5   GLU A CG  1 
ATOM   36    C CD  . GLU A 1 5   ? -32.896 6.487   21.603  1.00 24.53 ? 5   GLU A CD  1 
ATOM   37    O OE1 . GLU A 1 5   ? -32.415 7.162   22.508  1.00 24.62 ? 5   GLU A OE1 1 
ATOM   38    O OE2 . GLU A 1 5   ? -34.099 6.144   21.599  1.00 24.57 ? 5   GLU A OE2 1 
ATOM   39    N N   . GLN A 1 6   ? -32.501 2.840   16.917  1.00 24.45 ? 6   GLN A N   1 
ATOM   40    C CA  . GLN A 1 6   ? -33.187 1.812   16.137  1.00 24.69 ? 6   GLN A CA  1 
ATOM   41    C C   . GLN A 1 6   ? -32.248 0.986   15.290  1.00 24.93 ? 6   GLN A C   1 
ATOM   42    O O   . GLN A 1 6   ? -32.354 -0.265  15.375  1.00 25.19 ? 6   GLN A O   1 
ATOM   43    C CB  . GLN A 1 6   ? -34.315 2.466   15.330  1.00 24.63 ? 6   GLN A CB  1 
ATOM   44    C CG  . GLN A 1 6   ? -35.601 1.711   15.287  1.00 24.62 ? 6   GLN A CG  1 
ATOM   45    C CD  . GLN A 1 6   ? -36.683 2.265   14.403  1.00 24.64 ? 6   GLN A CD  1 
ATOM   46    O OE1 . GLN A 1 6   ? -37.820 1.758   14.393  1.00 24.45 ? 6   GLN A OE1 1 
ATOM   47    N NE2 . GLN A 1 6   ? -36.377 3.308   13.629  1.00 24.65 ? 6   GLN A NE2 1 
ATOM   48    N N   . LEU A 1 7   ? -31.330 1.563   14.542  1.00 25.10 ? 7   LEU A N   1 
ATOM   49    C CA  . LEU A 1 7   ? -30.436 0.872   13.632  1.00 25.23 ? 7   LEU A CA  1 
ATOM   50    C C   . LEU A 1 7   ? -29.271 0.158   14.291  1.00 25.60 ? 7   LEU A C   1 
ATOM   51    O O   . LEU A 1 7   ? -28.928 -0.941  13.843  1.00 25.57 ? 7   LEU A O   1 
ATOM   52    C CB  . LEU A 1 7   ? -29.917 1.839   12.537  1.00 24.92 ? 7   LEU A CB  1 
ATOM   53    C CG  . LEU A 1 7   ? -29.386 1.184   11.268  1.00 24.70 ? 7   LEU A CG  1 
ATOM   54    C CD1 . LEU A 1 7   ? -29.158 2.233   10.175  1.00 24.68 ? 7   LEU A CD1 1 
ATOM   55    C CD2 . LEU A 1 7   ? -28.053 0.490   11.517  1.00 24.63 ? 7   LEU A CD2 1 
ATOM   56    N N   . ILE A 1 8   ? -28.672 0.760   15.263  1.00 26.42 ? 8   ILE A N   1 
ATOM   57    C CA  . ILE A 1 8   ? -27.463 0.269   15.919  1.00 27.28 ? 8   ILE A CA  1 
ATOM   58    C C   . ILE A 1 8   ? -27.690 -0.219  17.329  1.00 28.14 ? 8   ILE A C   1 
ATOM   59    O O   . ILE A 1 8   ? -28.305 0.474   18.150  1.00 28.13 ? 8   ILE A O   1 
ATOM   60    C CB  . ILE A 1 8   ? -26.402 1.447   15.851  1.00 27.12 ? 8   ILE A CB  1 
ATOM   61    C CG1 . ILE A 1 8   ? -25.907 1.610   14.403  1.00 27.06 ? 8   ILE A CG1 1 
ATOM   62    C CG2 . ILE A 1 8   ? -25.251 1.291   16.871  1.00 27.13 ? 8   ILE A CG2 1 
ATOM   63    C CD1 . ILE A 1 8   ? -24.857 0.562   13.911  1.00 26.91 ? 8   ILE A CD1 1 
ATOM   64    N N   . GLN A 1 9   ? -27.053 -1.347  17.630  1.00 29.37 ? 9   GLN A N   1 
ATOM   65    C CA  . GLN A 1 9   ? -27.129 -1.924  18.966  1.00 30.74 ? 9   GLN A CA  1 
ATOM   66    C C   . GLN A 1 9   ? -25.753 -1.965  19.637  1.00 31.71 ? 9   GLN A C   1 
ATOM   67    O O   . GLN A 1 9   ? -24.864 -2.753  19.313  1.00 31.93 ? 9   GLN A O   1 
ATOM   68    C CB  . GLN A 1 9   ? -27.805 -3.305  19.018  1.00 30.81 ? 9   GLN A CB  1 
ATOM   69    C CG  . GLN A 1 9   ? -27.829 -3.842  20.441  1.00 30.85 ? 9   GLN A CG  1 
ATOM   70    C CD  . GLN A 1 9   ? -29.168 -4.218  20.984  1.00 30.88 ? 9   GLN A CD  1 
ATOM   71    O OE1 . GLN A 1 9   ? -29.510 -3.800  22.097  1.00 30.92 ? 9   GLN A OE1 1 
ATOM   72    N NE2 . GLN A 1 9   ? -29.935 -5.030  20.258  1.00 30.89 ? 9   GLN A NE2 1 
ATOM   73    N N   . ASN A 1 10  ? -25.679 -1.240  20.697  1.00 32.88 ? 10  ASN A N   1 
ATOM   74    C CA  . ASN A 1 10  ? -24.675 -0.972  21.676  1.00 34.04 ? 10  ASN A CA  1 
ATOM   75    C C   . ASN A 1 10  ? -24.268 -2.147  22.550  1.00 34.87 ? 10  ASN A C   1 
ATOM   76    O O   . ASN A 1 10  ? -24.792 -2.260  23.687  1.00 34.84 ? 10  ASN A O   1 
ATOM   77    C CB  . ASN A 1 10  ? -25.278 0.175   22.571  1.00 34.28 ? 10  ASN A CB  1 
ATOM   78    C CG  . ASN A 1 10  ? -26.708 -0.141  23.013  1.00 34.54 ? 10  ASN A CG  1 
ATOM   79    O OD1 . ASN A 1 10  ? -26.975 -0.569  24.152  1.00 34.65 ? 10  ASN A OD1 1 
ATOM   80    N ND2 . ASN A 1 10  ? -27.683 0.074   22.114  1.00 34.53 ? 10  ASN A ND2 1 
ATOM   81    N N   . LEU A 1 11  ? -23.283 -2.935  22.123  1.00 35.91 ? 11  LEU A N   1 
ATOM   82    C CA  . LEU A 1 11  ? -22.801 -4.101  22.867  1.00 36.91 ? 11  LEU A CA  1 
ATOM   83    C C   . LEU A 1 11  ? -22.123 -3.721  24.191  1.00 37.67 ? 11  LEU A C   1 
ATOM   84    O O   . LEU A 1 11  ? -20.906 -3.688  24.343  1.00 37.69 ? 11  LEU A O   1 
ATOM   85    C CB  . LEU A 1 11  ? -21.901 -4.969  21.983  1.00 36.82 ? 11  LEU A CB  1 
ATOM   86    C CG  . LEU A 1 11  ? -21.775 -6.445  22.333  1.00 36.76 ? 11  LEU A CG  1 
ATOM   87    C CD1 . LEU A 1 11  ? -20.828 -7.140  21.353  1.00 36.70 ? 11  LEU A CD1 1 
ATOM   88    C CD2 . LEU A 1 11  ? -21.254 -6.641  23.752  1.00 36.67 ? 11  LEU A CD2 1 
ATOM   89    N N   . VAL A 1 12  ? -22.939 -3.625  25.177  1.00 38.81 ? 12  VAL A N   1 
ATOM   90    C CA  . VAL A 1 12  ? -22.791 -3.281  26.572  1.00 39.95 ? 12  VAL A CA  1 
ATOM   91    C C   . VAL A 1 12  ? -21.383 -2.864  26.935  1.00 40.80 ? 12  VAL A C   1 
ATOM   92    O O   . VAL A 1 12  ? -20.782 -2.041  26.182  1.00 40.93 ? 12  VAL A O   1 
ATOM   93    C CB  . VAL A 1 12  ? -23.583 -4.268  27.457  1.00 40.00 ? 12  VAL A CB  1 
ATOM   94    C CG1 . VAL A 1 12  ? -24.260 -3.543  28.638  1.00 40.06 ? 12  VAL A CG1 1 
ATOM   95    C CG2 . VAL A 1 12  ? -24.602 -5.127  26.749  1.00 40.08 ? 12  VAL A CG2 1 
ATOM   96    N N   . PRO A 1 13  ? -20.884 -3.346  28.056  1.00 41.68 ? 13  PRO A N   1 
ATOM   97    C CA  . PRO A 1 13  ? -19.595 -2.858  28.613  1.00 42.32 ? 13  PRO A CA  1 
ATOM   98    C C   . PRO A 1 13  ? -18.472 -2.889  27.605  1.00 42.86 ? 13  PRO A C   1 
ATOM   99    O O   . PRO A 1 13  ? -18.316 -3.869  26.855  1.00 43.05 ? 13  PRO A O   1 
ATOM   100   C CB  . PRO A 1 13  ? -19.361 -3.714  29.842  1.00 42.24 ? 13  PRO A CB  1 
ATOM   101   C CG  . PRO A 1 13  ? -20.425 -4.783  29.829  1.00 42.17 ? 13  PRO A CG  1 
ATOM   102   C CD  . PRO A 1 13  ? -20.929 -4.826  28.384  1.00 41.93 ? 13  PRO A CD  1 
ATOM   103   N N   . GLU A 1 14  ? -17.664 -1.847  27.617  1.00 43.41 ? 14  GLU A N   1 
ATOM   104   C CA  . GLU A 1 14  ? -16.545 -1.652  26.696  1.00 43.97 ? 14  GLU A CA  1 
ATOM   105   C C   . GLU A 1 14  ? -17.111 -1.196  25.334  1.00 44.11 ? 14  GLU A C   1 
ATOM   106   O O   . GLU A 1 14  ? -17.272 -1.857  24.315  1.00 44.00 ? 14  GLU A O   1 
ATOM   107   C CB  . GLU A 1 14  ? -15.619 -2.823  26.501  1.00 44.23 ? 14  GLU A CB  1 
ATOM   108   C CG  . GLU A 1 14  ? -14.213 -2.545  25.983  1.00 44.60 ? 14  GLU A CG  1 
ATOM   109   C CD  . GLU A 1 14  ? -14.042 -2.029  24.595  1.00 44.81 ? 14  GLU A CD  1 
ATOM   110   O OE1 . GLU A 1 14  ? -13.356 -2.603  23.744  1.00 44.84 ? 14  GLU A OE1 1 
ATOM   111   O OE2 . GLU A 1 14  ? -14.609 -0.922  24.391  1.00 44.83 ? 14  GLU A OE2 1 
ATOM   112   N N   . ASP A 1 15  ? -17.321 0.100   25.379  1.00 44.32 ? 15  ASP A N   1 
ATOM   113   C CA  . ASP A 1 15  ? -17.867 0.966   24.345  1.00 44.33 ? 15  ASP A CA  1 
ATOM   114   C C   . ASP A 1 15  ? -17.089 2.298   24.356  1.00 44.21 ? 15  ASP A C   1 
ATOM   115   O O   . ASP A 1 15  ? -17.690 3.364   24.187  1.00 44.19 ? 15  ASP A O   1 
ATOM   116   C CB  . ASP A 1 15  ? -19.382 1.112   24.563  1.00 44.37 ? 15  ASP A CB  1 
ATOM   117   C CG  . ASP A 1 15  ? -19.731 1.199   26.048  1.00 44.45 ? 15  ASP A CG  1 
ATOM   118   O OD1 . ASP A 1 15  ? -19.618 0.185   26.765  1.00 44.44 ? 15  ASP A OD1 1 
ATOM   119   O OD2 . ASP A 1 15  ? -20.025 2.327   26.485  1.00 44.49 ? 15  ASP A OD2 1 
ATOM   120   N N   . LYS A 1 16  ? -15.782 2.171   24.511  1.00 43.87 ? 16  LYS A N   1 
ATOM   121   C CA  . LYS A 1 16  ? -14.805 3.252   24.589  1.00 43.45 ? 16  LYS A CA  1 
ATOM   122   C C   . LYS A 1 16  ? -13.384 2.645   24.664  1.00 43.04 ? 16  LYS A C   1 
ATOM   123   O O   . LYS A 1 16  ? -13.265 1.546   25.263  1.00 43.10 ? 16  LYS A O   1 
ATOM   124   C CB  . LYS A 1 16  ? -14.990 4.080   25.837  1.00 43.69 ? 16  LYS A CB  1 
ATOM   125   C CG  . LYS A 1 16  ? -16.292 4.624   26.291  1.00 43.97 ? 16  LYS A CG  1 
ATOM   126   C CD  . LYS A 1 16  ? -16.627 6.029   25.864  1.00 44.29 ? 16  LYS A CD  1 
ATOM   127   C CE  . LYS A 1 16  ? -17.307 6.189   24.540  1.00 44.53 ? 16  LYS A CE  1 
ATOM   128   N NZ  . LYS A 1 16  ? -16.489 5.641   23.416  1.00 44.72 ? 16  LYS A NZ  1 
ATOM   129   N N   . LEU A 1 17  ? -12.363 3.336   24.185  1.00 42.22 ? 17  LEU A N   1 
ATOM   130   C CA  . LEU A 1 17  ? -10.963 2.869   24.204  1.00 41.42 ? 17  LEU A CA  1 
ATOM   131   C C   . LEU A 1 17  ? -9.973  4.034   23.965  1.00 40.82 ? 17  LEU A C   1 
ATOM   132   O O   . LEU A 1 17  ? -10.325 5.215   24.109  1.00 40.98 ? 17  LEU A O   1 
ATOM   133   C CB  . LEU A 1 17  ? -10.762 1.773   23.180  1.00 41.38 ? 17  LEU A CB  1 
ATOM   134   C CG  . LEU A 1 17  ? -11.265 0.386   23.126  1.00 41.30 ? 17  LEU A CG  1 
ATOM   135   C CD1 . LEU A 1 17  ? -11.215 -0.336  24.470  1.00 41.33 ? 17  LEU A CD1 1 
ATOM   136   C CD2 . LEU A 1 17  ? -12.705 0.374   22.588  1.00 41.32 ? 17  LEU A CD2 1 
ATOM   137   N N   . SER A 1 18  ? -8.730  3.687   23.626  1.00 39.79 ? 18  SER A N   1 
ATOM   138   C CA  . SER A 1 18  ? -7.671  4.616   23.230  1.00 38.76 ? 18  SER A CA  1 
ATOM   139   C C   . SER A 1 18  ? -6.313  3.914   23.106  1.00 37.92 ? 18  SER A C   1 
ATOM   140   O O   . SER A 1 18  ? -6.209  2.802   23.663  1.00 37.93 ? 18  SER A O   1 
ATOM   141   C CB  . SER A 1 18  ? -7.554  5.796   24.186  1.00 38.89 ? 18  SER A CB  1 
ATOM   142   O OG  . SER A 1 18  ? -6.567  5.591   25.181  1.00 38.98 ? 18  SER A OG  1 
ATOM   143   N N   . ARG A 1 19  ? -5.363  4.481   22.342  1.00 36.75 ? 19  ARG A N   1 
ATOM   144   C CA  . ARG A 1 19  ? -3.993  3.946   22.302  1.00 35.54 ? 19  ARG A CA  1 
ATOM   145   C C   . ARG A 1 19  ? -2.894  4.743   21.630  1.00 34.42 ? 19  ARG A C   1 
ATOM   146   O O   . ARG A 1 19  ? -2.345  5.686   22.282  1.00 34.40 ? 19  ARG A O   1 
ATOM   147   C CB  . ARG A 1 19  ? -3.904  2.468   21.850  1.00 35.73 ? 19  ARG A CB  1 
ATOM   148   C CG  . ARG A 1 19  ? -3.711  1.514   23.050  1.00 35.91 ? 19  ARG A CG  1 
ATOM   149   C CD  . ARG A 1 19  ? -2.404  1.734   23.712  1.00 36.12 ? 19  ARG A CD  1 
ATOM   150   N NE  . ARG A 1 19  ? -2.437  1.567   25.154  1.00 36.31 ? 19  ARG A NE  1 
ATOM   151   C CZ  . ARG A 1 19  ? -1.679  2.287   25.998  1.00 36.38 ? 19  ARG A CZ  1 
ATOM   152   N NH1 . ARG A 1 19  ? -0.818  3.206   25.569  1.00 36.37 ? 19  ARG A NH1 1 
ATOM   153   N NH2 . ARG A 1 19  ? -1.856  2.153   27.316  1.00 36.41 ? 19  ARG A NH2 1 
ATOM   154   N N   . CYS A 1 20  ? -2.539  4.498   20.392  1.00 32.90 ? 20  CYS A N   1 
ATOM   155   C CA  . CYS A 1 20  ? -1.352  5.035   19.713  1.00 31.45 ? 20  CYS A CA  1 
ATOM   156   C C   . CYS A 1 20  ? -1.419  5.993   18.559  1.00 29.97 ? 20  CYS A C   1 
ATOM   157   O O   . CYS A 1 20  ? -1.293  5.641   17.357  1.00 29.75 ? 20  CYS A O   1 
ATOM   158   C CB  . CYS A 1 20  ? -0.561  3.730   19.290  1.00 31.82 ? 20  CYS A CB  1 
ATOM   159   S SG  . CYS A 1 20  ? -1.718  2.297   19.210  1.00 32.63 ? 20  CYS A SG  1 
ATOM   160   N N   . LYS A 1 21  ? -1.330  7.285   18.832  1.00 28.15 ? 21  LYS A N   1 
ATOM   161   C CA  . LYS A 1 21  ? -1.401  8.478   18.063  1.00 26.27 ? 21  LYS A CA  1 
ATOM   162   C C   . LYS A 1 21  ? -0.129  9.071   17.450  1.00 24.76 ? 21  LYS A C   1 
ATOM   163   O O   . LYS A 1 21  ? 0.975   8.827   17.902  1.00 24.65 ? 21  LYS A O   1 
ATOM   164   C CB  . LYS A 1 21  ? -1.820  9.689   18.977  1.00 26.37 ? 21  LYS A CB  1 
ATOM   165   C CG  . LYS A 1 21  ? -3.205  10.250  18.801  1.00 26.34 ? 21  LYS A CG  1 
ATOM   166   C CD  . LYS A 1 21  ? -3.719  10.874  20.099  1.00 26.33 ? 21  LYS A CD  1 
ATOM   167   C CE  . LYS A 1 21  ? -3.263  12.286  20.345  1.00 26.35 ? 21  LYS A CE  1 
ATOM   168   N NZ  . LYS A 1 21  ? -3.619  12.734  21.724  1.00 26.32 ? 21  LYS A NZ  1 
ATOM   169   N N   . ILE A 1 22  ? -0.388  9.991   16.542  1.00 22.89 ? 22  ILE A N   1 
ATOM   170   C CA  . ILE A 1 22  ? 0.548   10.870  15.858  1.00 21.26 ? 22  ILE A CA  1 
ATOM   171   C C   . ILE A 1 22  ? -0.040  12.298  16.069  1.00 20.20 ? 22  ILE A C   1 
ATOM   172   O O   . ILE A 1 22  ? -1.283  12.419  16.093  1.00 20.43 ? 22  ILE A O   1 
ATOM   173   C CB  . ILE A 1 22  ? 0.826   10.583  14.368  1.00 21.15 ? 22  ILE A CB  1 
ATOM   174   C CG1 . ILE A 1 22  ? 1.952   9.550   14.152  1.00 21.10 ? 22  ILE A CG1 1 
ATOM   175   C CG2 . ILE A 1 22  ? 1.202   11.867  13.533  1.00 20.98 ? 22  ILE A CG2 1 
ATOM   176   C CD1 . ILE A 1 22  ? 1.752   8.155   14.738  1.00 21.34 ? 22  ILE A CD1 1 
ATOM   177   N N   . THR A 1 23  ? 0.821   13.268  16.242  1.00 18.42 ? 23  THR A N   1 
ATOM   178   C CA  . THR A 1 23  ? 0.420   14.663  16.458  1.00 16.57 ? 23  THR A CA  1 
ATOM   179   C C   . THR A 1 23  ? 1.377   15.531  15.654  1.00 15.61 ? 23  THR A C   1 
ATOM   180   O O   . THR A 1 23  ? 2.561   15.099  15.574  1.00 15.51 ? 23  THR A O   1 
ATOM   181   C CB  . THR A 1 23  ? 0.455   15.103  17.970  1.00 16.40 ? 23  THR A CB  1 
ATOM   182   O OG1 . THR A 1 23  ? -0.559  14.338  18.677  1.00 15.96 ? 23  THR A OG1 1 
ATOM   183   C CG2 . THR A 1 23  ? 0.312   16.627  18.182  1.00 16.08 ? 23  THR A CG2 1 
ATOM   184   N N   . VAL A 1 24  ? 0.868   16.612  15.086  1.00 14.18 ? 24  VAL A N   1 
ATOM   185   C CA  . VAL A 1 24  ? 1.867   17.490  14.366  1.00 12.90 ? 24  VAL A CA  1 
ATOM   186   C C   . VAL A 1 24  ? 1.603   18.937  14.770  1.00 12.04 ? 24  VAL A C   1 
ATOM   187   O O   . VAL A 1 24  ? 0.485   19.498  14.655  1.00 11.92 ? 24  VAL A O   1 
ATOM   188   C CB  . VAL A 1 24  ? 1.968   17.116  12.898  1.00 12.72 ? 24  VAL A CB  1 
ATOM   189   C CG1 . VAL A 1 24  ? 1.904   15.594  12.644  1.00 12.52 ? 24  VAL A CG1 1 
ATOM   190   C CG2 . VAL A 1 24  ? 0.976   17.797  11.975  1.00 12.68 ? 24  VAL A CG2 1 
ATOM   191   N N   . VAL A 1 25  ? 2.659   19.517  15.363  1.00 10.80 ? 25  VAL A N   1 
ATOM   192   C CA  . VAL A 1 25  ? 2.556   20.929  15.829  1.00 9.51  ? 25  VAL A CA  1 
ATOM   193   C C   . VAL A 1 25  ? 2.728   21.818  14.588  1.00 8.80  ? 25  VAL A C   1 
ATOM   194   O O   . VAL A 1 25  ? 3.723   21.732  13.876  1.00 8.52  ? 25  VAL A O   1 
ATOM   195   C CB  . VAL A 1 25  ? 3.503   21.221  16.986  1.00 9.23  ? 25  VAL A CB  1 
ATOM   196   C CG1 . VAL A 1 25  ? 3.716   22.722  17.212  1.00 9.05  ? 25  VAL A CG1 1 
ATOM   197   C CG2 . VAL A 1 25  ? 3.079   20.559  18.293  1.00 8.89  ? 25  VAL A CG2 1 
ATOM   198   N N   . GLY A 1 26  ? 1.703   22.598  14.349  1.00 8.14  ? 26  GLY A N   1 
ATOM   199   C CA  . GLY A 1 26  ? 1.622   23.554  13.266  1.00 7.49  ? 26  GLY A CA  1 
ATOM   200   C C   . GLY A 1 26  ? 1.526   22.820  11.937  1.00 7.02  ? 26  GLY A C   1 
ATOM   201   O O   . GLY A 1 26  ? 2.248   21.859  11.706  1.00 7.09  ? 26  GLY A O   1 
ATOM   202   N N   . VAL A 1 27  ? 0.690   23.325  11.088  1.00 6.72  ? 27  VAL A N   1 
ATOM   203   C CA  . VAL A 1 27  ? 0.362   22.882  9.762   1.00 6.39  ? 27  VAL A CA  1 
ATOM   204   C C   . VAL A 1 27  ? 0.832   23.870  8.695   1.00 6.26  ? 27  VAL A C   1 
ATOM   205   O O   . VAL A 1 27  ? 0.106   24.129  7.711   1.00 6.19  ? 27  VAL A O   1 
ATOM   206   C CB  . VAL A 1 27  ? -1.184  22.690  9.678   1.00 6.37  ? 27  VAL A CB  1 
ATOM   207   C CG1 . VAL A 1 27  ? -1.671  21.611  10.614  1.00 6.42  ? 27  VAL A CG1 1 
ATOM   208   C CG2 . VAL A 1 27  ? -1.896  24.023  9.850   1.00 6.12  ? 27  VAL A CG2 1 
ATOM   209   N N   . GLY A 1 28  ? 1.961   24.489  8.953   1.00 6.22  ? 28  GLY A N   1 
ATOM   210   C CA  . GLY A 1 28  ? 2.515   25.396  7.865   1.00 6.54  ? 28  GLY A CA  1 
ATOM   211   C C   . GLY A 1 28  ? 2.791   24.377  6.749   1.00 6.72  ? 28  GLY A C   1 
ATOM   212   O O   . GLY A 1 28  ? 3.126   23.242  7.173   1.00 7.09  ? 28  GLY A O   1 
ATOM   213   N N   . ASP A 1 29  ? 2.540   24.664  5.524   1.00 6.69  ? 29  ASP A N   1 
ATOM   214   C CA  . ASP A 1 29  ? 2.784   23.800  4.365   1.00 6.57  ? 29  ASP A CA  1 
ATOM   215   C C   . ASP A 1 29  ? 3.469   22.461  4.713   1.00 5.98  ? 29  ASP A C   1 
ATOM   216   O O   . ASP A 1 29  ? 2.979   21.385  4.305   1.00 5.74  ? 29  ASP A O   1 
ATOM   217   C CB  . ASP A 1 29  ? 3.514   24.517  3.235   1.00 7.28  ? 29  ASP A CB  1 
ATOM   218   C CG  . ASP A 1 29  ? 3.485   26.010  3.172   1.00 8.18  ? 29  ASP A CG  1 
ATOM   219   O OD1 . ASP A 1 29  ? 4.408   26.673  2.611   1.00 8.28  ? 29  ASP A OD1 1 
ATOM   220   O OD2 . ASP A 1 29  ? 2.589   26.674  3.792   1.00 8.82  ? 29  ASP A OD2 1 
ATOM   221   N N   . VAL A 1 30  ? 4.586   22.533  5.376   1.00 5.35  ? 30  VAL A N   1 
ATOM   222   C CA  . VAL A 1 30  ? 5.376   21.420  5.868   1.00 4.87  ? 30  VAL A CA  1 
ATOM   223   C C   . VAL A 1 30  ? 4.638   20.591  6.913   1.00 4.50  ? 30  VAL A C   1 
ATOM   224   O O   . VAL A 1 30  ? 4.477   19.373  6.740   1.00 4.24  ? 30  VAL A O   1 
ATOM   225   C CB  . VAL A 1 30  ? 6.730   21.925  6.433   1.00 4.75  ? 30  VAL A CB  1 
ATOM   226   C CG1 . VAL A 1 30  ? 7.672   20.807  6.840   1.00 4.61  ? 30  VAL A CG1 1 
ATOM   227   C CG2 . VAL A 1 30  ? 7.402   22.858  5.454   1.00 4.91  ? 30  VAL A CG2 1 
ATOM   228   N N   . GLY A 1 31  ? 4.347   21.217  8.028   1.00 4.35  ? 31  GLY A N   1 
ATOM   229   C CA  . GLY A 1 31  ? 3.635   20.573  9.137   1.00 4.53  ? 31  GLY A CA  1 
ATOM   230   C C   . GLY A 1 31  ? 2.524   19.730  8.501   1.00 4.94  ? 31  GLY A C   1 
ATOM   231   O O   . GLY A 1 31  ? 2.278   18.581  8.880   1.00 5.20  ? 31  GLY A O   1 
ATOM   232   N N   . MET A 1 32  ? 2.001   20.286  7.421   1.00 5.00  ? 32  MET A N   1 
ATOM   233   C CA  . MET A 1 32  ? 0.918   19.764  6.641   1.00 5.05  ? 32  MET A CA  1 
ATOM   234   C C   . MET A 1 32  ? 1.187   18.659  5.637   1.00 5.05  ? 32  MET A C   1 
ATOM   235   O O   . MET A 1 32  ? 0.273   17.828  5.413   1.00 5.01  ? 32  MET A O   1 
ATOM   236   C CB  . MET A 1 32  ? 0.277   20.973  5.889   1.00 5.15  ? 32  MET A CB  1 
ATOM   237   C CG  . MET A 1 32  ? -1.196  20.646  5.748   1.00 5.51  ? 32  MET A CG  1 
ATOM   238   S SD  . MET A 1 32  ? -1.801  20.544  7.466   1.00 6.01  ? 32  MET A SD  1 
ATOM   239   C CE  . MET A 1 32  ? -3.568  20.354  7.216   1.00 5.89  ? 32  MET A CE  1 
ATOM   240   N N   . ALA A 1 33  ? 2.246   18.754  4.860   1.00 4.91  ? 33  ALA A N   1 
ATOM   241   C CA  . ALA A 1 33  ? 2.646   17.779  3.860   1.00 4.73  ? 33  ALA A CA  1 
ATOM   242   C C   . ALA A 1 33  ? 3.140   16.509  4.581   1.00 4.70  ? 33  ALA A C   1 
ATOM   243   O O   . ALA A 1 33  ? 3.188   15.412  4.053   1.00 4.89  ? 33  ALA A O   1 
ATOM   244   C CB  . ALA A 1 33  ? 3.811   18.232  2.994   1.00 4.77  ? 33  ALA A CB  1 
ATOM   245   N N   . CYS A 1 34  ? 3.588   16.827  5.760   1.00 4.50  ? 34  CYS A N   1 
ATOM   246   C CA  . CYS A 1 34  ? 4.143   15.787  6.692   1.00 4.01  ? 34  CYS A CA  1 
ATOM   247   C C   . CYS A 1 34  ? 2.914   15.220  7.370   1.00 3.67  ? 34  CYS A C   1 
ATOM   248   O O   . CYS A 1 34  ? 2.949   14.162  8.002   1.00 3.71  ? 34  CYS A O   1 
ATOM   249   C CB  . CYS A 1 34  ? 5.225   16.514  7.373   1.00 4.07  ? 34  CYS A CB  1 
ATOM   250   S SG  . CYS A 1 34  ? 6.018   16.080  8.836   1.00 4.43  ? 34  CYS A SG  1 
ATOM   251   N N   . ALA A 1 35  ? 1.769   15.846  7.096   1.00 3.29  ? 35  ALA A N   1 
ATOM   252   C CA  . ALA A 1 35  ? 0.464   15.361  7.556   1.00 3.06  ? 35  ALA A CA  1 
ATOM   253   C C   . ALA A 1 35  ? -0.136  14.393  6.536   1.00 2.83  ? 35  ALA A C   1 
ATOM   254   O O   . ALA A 1 35  ? -0.045  13.151  6.774   1.00 2.99  ? 35  ALA A O   1 
ATOM   255   C CB  . ALA A 1 35  ? -0.474  16.476  7.914   1.00 3.14  ? 35  ALA A CB  1 
ATOM   256   N N   . ILE A 1 36  ? -0.734  14.868  5.490   1.00 2.44  ? 36  ILE A N   1 
ATOM   257   C CA  . ILE A 1 36  ? -1.353  14.084  4.439   1.00 2.28  ? 36  ILE A CA  1 
ATOM   258   C C   . ILE A 1 36  ? -0.679  12.724  4.192   1.00 2.34  ? 36  ILE A C   1 
ATOM   259   O O   . ILE A 1 36  ? -1.359  11.691  4.032   1.00 2.00  ? 36  ILE A O   1 
ATOM   260   C CB  . ILE A 1 36  ? -1.448  14.874  3.085   1.00 2.14  ? 36  ILE A CB  1 
ATOM   261   C CG1 . ILE A 1 36  ? -2.246  14.057  2.046   1.00 2.16  ? 36  ILE A CG1 1 
ATOM   262   C CG2 . ILE A 1 36  ? -0.043  15.249  2.539   1.00 2.00  ? 36  ILE A CG2 1 
ATOM   263   C CD1 . ILE A 1 36  ? -3.659  13.594  2.469   1.00 2.31  ? 36  ILE A CD1 1 
ATOM   264   N N   . SER A 1 37  ? 0.644   12.794  4.065   1.00 2.37  ? 37  SER A N   1 
ATOM   265   C CA  . SER A 1 37  ? 1.472   11.599  3.833   1.00 2.32  ? 37  SER A CA  1 
ATOM   266   C C   . SER A 1 37  ? 1.425   10.631  4.999   1.00 2.54  ? 37  SER A C   1 
ATOM   267   O O   . SER A 1 37  ? 1.422   9.384   4.760   1.00 2.82  ? 37  SER A O   1 
ATOM   268   C CB  . SER A 1 37  ? 2.902   11.984  3.497   1.00 2.17  ? 37  SER A CB  1 
ATOM   269   O OG  . SER A 1 37  ? 3.498   10.925  2.775   1.00 2.19  ? 37  SER A OG  1 
ATOM   270   N N   . ILE A 1 38  ? 1.463   11.128  6.234   1.00 2.45  ? 38  ILE A N   1 
ATOM   271   C CA  . ILE A 1 38  ? 1.286   10.165  7.360   1.00 2.48  ? 38  ILE A CA  1 
ATOM   272   C C   . ILE A 1 38  ? -0.041  9.441   7.119   1.00 2.45  ? 38  ILE A C   1 
ATOM   273   O O   . ILE A 1 38  ? -0.187  8.265   7.460   1.00 2.17  ? 38  ILE A O   1 
ATOM   274   C CB  . ILE A 1 38  ? 1.504   10.820  8.740   1.00 2.53  ? 38  ILE A CB  1 
ATOM   275   C CG1 . ILE A 1 38  ? 3.048   10.845  9.019   1.00 2.48  ? 38  ILE A CG1 1 
ATOM   276   C CG2 . ILE A 1 38  ? 0.711   10.149  9.893   1.00 2.48  ? 38  ILE A CG2 1 
ATOM   277   C CD1 . ILE A 1 38  ? 3.507   11.511  10.325  1.00 2.37  ? 38  ILE A CD1 1 
ATOM   278   N N   . LEU A 1 39  ? -0.929  10.132  6.407   1.00 2.62  ? 39  LEU A N   1 
ATOM   279   C CA  . LEU A 1 39  ? -2.259  9.579   6.080   1.00 2.76  ? 39  LEU A CA  1 
ATOM   280   C C   . LEU A 1 39  ? -2.210  8.602   4.915   1.00 2.80  ? 39  LEU A C   1 
ATOM   281   O O   . LEU A 1 39  ? -2.833  7.504   4.973   1.00 2.81  ? 39  LEU A O   1 
ATOM   282   C CB  . LEU A 1 39  ? -3.221  10.764  5.942   1.00 2.74  ? 39  LEU A CB  1 
ATOM   283   C CG  . LEU A 1 39  ? -3.349  11.760  7.073   1.00 2.83  ? 39  LEU A CG  1 
ATOM   284   C CD1 . LEU A 1 39  ? -3.684  13.163  6.538   1.00 3.07  ? 39  LEU A CD1 1 
ATOM   285   C CD2 . LEU A 1 39  ? -4.484  11.371  8.011   1.00 2.73  ? 39  LEU A CD2 1 
ATOM   286   N N   . LEU A 1 40  ? -1.472  8.927   3.873   1.00 2.66  ? 40  LEU A N   1 
ATOM   287   C CA  . LEU A 1 40  ? -1.390  8.076   2.650   1.00 2.41  ? 40  LEU A CA  1 
ATOM   288   C C   . LEU A 1 40  ? -0.506  6.890   2.945   1.00 2.47  ? 40  LEU A C   1 
ATOM   289   O O   . LEU A 1 40  ? 0.394   6.444   2.224   1.00 2.57  ? 40  LEU A O   1 
ATOM   290   C CB  . LEU A 1 40  ? -1.034  9.028   1.513   1.00 2.19  ? 40  LEU A CB  1 
ATOM   291   C CG  . LEU A 1 40  ? -2.088  9.958   0.937   1.00 2.06  ? 40  LEU A CG  1 
ATOM   292   C CD1 . LEU A 1 40  ? -2.936  9.311   -0.153  1.00 2.00  ? 40  LEU A CD1 1 
ATOM   293   C CD2 . LEU A 1 40  ? -3.078  10.454  1.988   1.00 2.00  ? 40  LEU A CD2 1 
ATOM   294   N N   . LYS A 1 41  ? -0.761  6.344   4.097   1.00 2.60  ? 41  LYS A N   1 
ATOM   295   C CA  . LYS A 1 41  ? -0.082  5.209   4.749   1.00 2.70  ? 41  LYS A CA  1 
ATOM   296   C C   . LYS A 1 41  ? -0.884  4.942   6.019   1.00 2.82  ? 41  LYS A C   1 
ATOM   297   O O   . LYS A 1 41  ? -1.899  5.678   6.252   1.00 2.98  ? 41  LYS A O   1 
ATOM   298   C CB  . LYS A 1 41  ? 1.380   5.416   5.000   1.00 2.57  ? 41  LYS A CB  1 
ATOM   299   C CG  . LYS A 1 41  ? 2.358   4.689   4.071   1.00 2.64  ? 41  LYS A CG  1 
ATOM   300   C CD  . LYS A 1 41  ? 2.513   3.194   4.442   1.00 2.66  ? 41  LYS A CD  1 
ATOM   301   C CE  . LYS A 1 41  ? 3.784   2.542   3.911   1.00 2.38  ? 41  LYS A CE  1 
ATOM   302   N NZ  . LYS A 1 41  ? 4.218   1.403   4.744   1.00 2.00  ? 41  LYS A NZ  1 
ATOM   303   N N   . GLY A 1 42  ? -0.522  3.922   6.739   1.00 2.88  ? 42  GLY A N   1 
ATOM   304   C CA  . GLY A 1 42  ? -1.367  3.582   7.938   1.00 3.16  ? 42  GLY A CA  1 
ATOM   305   C C   . GLY A 1 42  ? -0.438  3.672   9.116   1.00 3.46  ? 42  GLY A C   1 
ATOM   306   O O   . GLY A 1 42  ? -0.045  2.617   9.661   1.00 3.98  ? 42  GLY A O   1 
ATOM   307   N N   . LEU A 1 43  ? -0.003  4.868   9.400   1.00 3.55  ? 43  LEU A N   1 
ATOM   308   C CA  . LEU A 1 43  ? 0.963   4.966   10.558  1.00 3.87  ? 43  LEU A CA  1 
ATOM   309   C C   . LEU A 1 43  ? 0.128   5.197   11.799  1.00 4.25  ? 43  LEU A C   1 
ATOM   310   O O   . LEU A 1 43  ? 0.358   4.570   12.860  1.00 4.20  ? 43  LEU A O   1 
ATOM   311   C CB  . LEU A 1 43  ? 2.031   5.935   10.078  1.00 3.57  ? 43  LEU A CB  1 
ATOM   312   C CG  . LEU A 1 43  ? 3.110   5.338   9.180   1.00 3.54  ? 43  LEU A CG  1 
ATOM   313   C CD1 . LEU A 1 43  ? 2.566   4.661   7.948   1.00 3.48  ? 43  LEU A CD1 1 
ATOM   314   C CD2 . LEU A 1 43  ? 4.076   6.442   8.712   1.00 3.59  ? 43  LEU A CD2 1 
ATOM   315   N N   . ALA A 1 44  ? -0.993  5.928   11.606  1.00 4.50  ? 44  ALA A N   1 
ATOM   316   C CA  . ALA A 1 44  ? -1.747  6.315   12.803  1.00 4.94  ? 44  ALA A CA  1 
ATOM   317   C C   . ALA A 1 44  ? -3.246  6.303   12.614  1.00 5.35  ? 44  ALA A C   1 
ATOM   318   O O   . ALA A 1 44  ? -3.780  6.797   11.639  1.00 5.21  ? 44  ALA A O   1 
ATOM   319   C CB  . ALA A 1 44  ? -1.209  7.671   13.245  1.00 4.98  ? 44  ALA A CB  1 
ATOM   320   N N   . ASP A 1 45  ? -3.891  5.797   13.642  1.00 5.83  ? 45  ASP A N   1 
ATOM   321   C CA  . ASP A 1 45  ? -5.346  5.652   13.719  1.00 6.44  ? 45  ASP A CA  1 
ATOM   322   C C   . ASP A 1 45  ? -5.956  6.855   14.422  1.00 6.66  ? 45  ASP A C   1 
ATOM   323   O O   . ASP A 1 45  ? -7.202  6.936   14.546  1.00 6.86  ? 45  ASP A O   1 
ATOM   324   C CB  . ASP A 1 45  ? -5.632  4.306   14.409  1.00 6.78  ? 45  ASP A CB  1 
ATOM   325   C CG  . ASP A 1 45  ? -4.786  4.233   15.693  1.00 6.98  ? 45  ASP A CG  1 
ATOM   326   O OD1 . ASP A 1 45  ? -4.419  5.306   16.194  1.00 6.89  ? 45  ASP A OD1 1 
ATOM   327   O OD2 . ASP A 1 45  ? -4.480  3.096   16.092  1.00 7.30  ? 45  ASP A OD2 1 
ATOM   328   N N   . GLU A 1 46  ? -5.109  7.668   15.028  1.00 6.78  ? 46  GLU A N   1 
ATOM   329   C CA  . GLU A 1 46  ? -5.502  8.957   15.626  1.00 6.71  ? 46  GLU A CA  1 
ATOM   330   C C   . GLU A 1 46  ? -4.284  9.872   15.359  1.00 6.64  ? 46  GLU A C   1 
ATOM   331   O O   . GLU A 1 46  ? -3.132  9.520   15.619  1.00 6.42  ? 46  GLU A O   1 
ATOM   332   C CB  . GLU A 1 46  ? -5.866  9.068   17.090  1.00 6.61  ? 46  GLU A CB  1 
ATOM   333   C CG  . GLU A 1 46  ? -6.425  10.372  17.608  1.00 6.62  ? 46  GLU A CG  1 
ATOM   334   C CD  . GLU A 1 46  ? -6.741  10.743  18.987  1.00 6.62  ? 46  GLU A CD  1 
ATOM   335   O OE1 . GLU A 1 46  ? -7.273  10.118  19.884  1.00 6.68  ? 46  GLU A OE1 1 
ATOM   336   O OE2 . GLU A 1 46  ? -6.447  11.939  19.322  1.00 6.52  ? 46  GLU A OE2 1 
ATOM   337   N N   . LEU A 1 47  ? -4.606  10.928  14.673  1.00 6.86  ? 47  LEU A N   1 
ATOM   338   C CA  . LEU A 1 47  ? -3.617  11.970  14.326  1.00 7.09  ? 47  LEU A CA  1 
ATOM   339   C C   . LEU A 1 47  ? -4.262  13.302  14.710  1.00 7.32  ? 47  LEU A C   1 
ATOM   340   O O   . LEU A 1 47  ? -5.283  13.674  14.140  1.00 7.34  ? 47  LEU A O   1 
ATOM   341   C CB  . LEU A 1 47  ? -3.180  11.777  12.900  1.00 6.96  ? 47  LEU A CB  1 
ATOM   342   C CG  . LEU A 1 47  ? -2.486  12.929  12.187  1.00 6.91  ? 47  LEU A CG  1 
ATOM   343   C CD1 . LEU A 1 47  ? -1.628  12.410  11.031  1.00 6.83  ? 47  LEU A CD1 1 
ATOM   344   C CD2 . LEU A 1 47  ? -3.543  13.888  11.640  1.00 6.84  ? 47  LEU A CD2 1 
ATOM   345   N N   . ALA A 1 48  ? -3.709  13.887  15.729  1.00 7.80  ? 48  ALA A N   1 
ATOM   346   C CA  . ALA A 1 48  ? -4.161  15.155  16.308  1.00 8.58  ? 48  ALA A CA  1 
ATOM   347   C C   . ALA A 1 48  ? -3.294  16.290  15.795  1.00 9.27  ? 48  ALA A C   1 
ATOM   348   O O   . ALA A 1 48  ? -2.033  16.145  15.836  1.00 9.86  ? 48  ALA A O   1 
ATOM   349   C CB  . ALA A 1 48  ? -4.097  15.036  17.824  1.00 8.46  ? 48  ALA A CB  1 
ATOM   350   N N   . LEU A 1 49  ? -3.892  17.397  15.407  1.00 9.67  ? 49  LEU A N   1 
ATOM   351   C CA  . LEU A 1 49  ? -3.012  18.473  14.846  1.00 10.46 ? 49  LEU A CA  1 
ATOM   352   C C   . LEU A 1 49  ? -3.136  19.728  15.675  1.00 11.22 ? 49  LEU A C   1 
ATOM   353   O O   . LEU A 1 49  ? -4.186  20.368  15.742  1.00 11.30 ? 49  LEU A O   1 
ATOM   354   C CB  . LEU A 1 49  ? -3.264  18.451  13.363  1.00 10.27 ? 49  LEU A CB  1 
ATOM   355   C CG  . LEU A 1 49  ? -4.515  17.884  12.748  1.00 10.09 ? 49  LEU A CG  1 
ATOM   356   C CD1 . LEU A 1 49  ? -5.652  18.896  12.657  1.00 10.00 ? 49  LEU A CD1 1 
ATOM   357   C CD2 . LEU A 1 49  ? -4.208  17.403  11.333  1.00 10.01 ? 49  LEU A CD2 1 
ATOM   358   N N   . VAL A 1 50  ? -2.036  20.095  16.333  1.00 12.16 ? 50  VAL A N   1 
ATOM   359   C CA  . VAL A 1 50  ? -1.973  21.269  17.208  1.00 13.20 ? 50  VAL A CA  1 
ATOM   360   C C   . VAL A 1 50  ? -1.288  22.467  16.560  1.00 14.30 ? 50  VAL A C   1 
ATOM   361   O O   . VAL A 1 50  ? -0.082  22.461  16.282  1.00 14.55 ? 50  VAL A O   1 
ATOM   362   C CB  . VAL A 1 50  ? -1.363  20.861  18.565  1.00 12.83 ? 50  VAL A CB  1 
ATOM   363   C CG1 . VAL A 1 50  ? -1.147  22.037  19.508  1.00 12.79 ? 50  VAL A CG1 1 
ATOM   364   C CG2 . VAL A 1 50  ? -2.222  19.797  19.224  1.00 12.81 ? 50  VAL A CG2 1 
ATOM   365   N N   . ASP A 1 51  ? -2.054  23.526  16.418  1.00 15.48 ? 51  ASP A N   1 
ATOM   366   C CA  . ASP A 1 51  ? -1.613  24.809  15.837  1.00 16.77 ? 51  ASP A CA  1 
ATOM   367   C C   . ASP A 1 51  ? -2.175  25.943  16.717  1.00 17.69 ? 51  ASP A C   1 
ATOM   368   O O   . ASP A 1 51  ? -3.136  25.687  17.475  1.00 17.90 ? 51  ASP A O   1 
ATOM   369   C CB  . ASP A 1 51  ? -2.060  24.910  14.410  1.00 16.75 ? 51  ASP A CB  1 
ATOM   370   C CG  . ASP A 1 51  ? -1.212  25.689  13.455  1.00 16.76 ? 51  ASP A CG  1 
ATOM   371   O OD1 . ASP A 1 51  ? -0.081  26.066  13.801  1.00 16.99 ? 51  ASP A OD1 1 
ATOM   372   O OD2 . ASP A 1 51  ? -1.664  25.899  12.310  1.00 16.55 ? 51  ASP A OD2 1 
ATOM   373   N N   . ALA A 1 52  ? -1.587  27.115  16.587  1.00 18.62 ? 52  ALA A N   1 
ATOM   374   C CA  . ALA A 1 52  ? -2.019  28.261  17.397  1.00 19.84 ? 52  ALA A CA  1 
ATOM   375   C C   . ALA A 1 52  ? -2.772  29.268  16.528  1.00 20.68 ? 52  ALA A C   1 
ATOM   376   O O   . ALA A 1 52  ? -3.271  30.271  17.064  1.00 21.02 ? 52  ALA A O   1 
ATOM   377   C CB  . ALA A 1 52  ? -0.855  28.997  18.057  1.00 19.81 ? 52  ALA A CB  1 
ATOM   378   N N   . ASP A 1 53  ? -2.778  28.957  15.258  1.00 21.45 ? 53  ASP A N   1 
ATOM   379   C CA  . ASP A 1 53  ? -3.355  29.867  14.230  1.00 21.97 ? 53  ASP A CA  1 
ATOM   380   C C   . ASP A 1 53  ? -4.732  29.286  13.890  1.00 21.84 ? 53  ASP A C   1 
ATOM   381   O O   . ASP A 1 53  ? -5.135  29.058  12.771  1.00 21.72 ? 53  ASP A O   1 
ATOM   382   C CB  . ASP A 1 53  ? -2.376  30.152  13.138  1.00 22.75 ? 53  ASP A CB  1 
ATOM   383   C CG  . ASP A 1 53  ? -1.074  29.411  13.023  1.00 23.57 ? 53  ASP A CG  1 
ATOM   384   O OD1 . ASP A 1 53  ? -0.270  29.664  12.065  1.00 24.00 ? 53  ASP A OD1 1 
ATOM   385   O OD2 . ASP A 1 53  ? -0.691  28.554  13.867  1.00 23.82 ? 53  ASP A OD2 1 
ATOM   386   N N   . THR A 1 54  ? -5.399  29.014  14.977  1.00 21.88 ? 54  THR A N   1 
ATOM   387   C CA  . THR A 1 54  ? -6.737  28.510  15.188  1.00 22.01 ? 54  THR A CA  1 
ATOM   388   C C   . THR A 1 54  ? -7.643  28.507  13.982  1.00 22.20 ? 54  THR A C   1 
ATOM   389   O O   . THR A 1 54  ? -8.472  27.601  13.757  1.00 22.07 ? 54  THR A O   1 
ATOM   390   C CB  . THR A 1 54  ? -7.351  29.392  16.385  1.00 21.88 ? 54  THR A CB  1 
ATOM   391   O OG1 . THR A 1 54  ? -8.537  28.751  16.866  1.00 21.78 ? 54  THR A OG1 1 
ATOM   392   C CG2 . THR A 1 54  ? -7.608  30.854  15.972  1.00 21.89 ? 54  THR A CG2 1 
ATOM   393   N N   . ASP A 1 55  ? -7.536  29.574  13.219  1.00 22.52 ? 55  ASP A N   1 
ATOM   394   C CA  . ASP A 1 55  ? -8.277  29.882  11.995  1.00 22.65 ? 55  ASP A CA  1 
ATOM   395   C C   . ASP A 1 55  ? -7.997  28.775  10.963  1.00 22.20 ? 55  ASP A C   1 
ATOM   396   O O   . ASP A 1 55  ? -8.744  27.789  10.950  1.00 22.28 ? 55  ASP A O   1 
ATOM   397   C CB  . ASP A 1 55  ? -7.977  31.273  11.484  1.00 23.42 ? 55  ASP A CB  1 
ATOM   398   C CG  . ASP A 1 55  ? -8.275  32.517  12.268  1.00 24.00 ? 55  ASP A CG  1 
ATOM   399   O OD1 . ASP A 1 55  ? -7.690  32.845  13.335  1.00 24.22 ? 55  ASP A OD1 1 
ATOM   400   O OD2 . ASP A 1 55  ? -9.104  33.337  11.731  1.00 24.15 ? 55  ASP A OD2 1 
ATOM   401   N N   . LYS A 1 56  ? -6.923  28.911  10.225  1.00 21.64 ? 56  LYS A N   1 
ATOM   402   C CA  . LYS A 1 56  ? -6.462  27.970  9.207   1.00 21.02 ? 56  LYS A CA  1 
ATOM   403   C C   . LYS A 1 56  ? -6.550  26.504  9.645   1.00 20.49 ? 56  LYS A C   1 
ATOM   404   O O   . LYS A 1 56  ? -6.750  25.595  8.816   1.00 20.33 ? 56  LYS A O   1 
ATOM   405   C CB  . LYS A 1 56  ? -5.000  28.230  8.758   1.00 20.90 ? 56  LYS A CB  1 
ATOM   406   C CG  . LYS A 1 56  ? -4.310  27.055  8.121   1.00 20.82 ? 56  LYS A CG  1 
ATOM   407   C CD  . LYS A 1 56  ? -3.192  27.273  7.148   1.00 20.86 ? 56  LYS A CD  1 
ATOM   408   C CE  . LYS A 1 56  ? -2.404  25.971  6.969   1.00 20.89 ? 56  LYS A CE  1 
ATOM   409   N NZ  . LYS A 1 56  ? -1.719  25.879  5.671   1.00 20.94 ? 56  LYS A NZ  1 
ATOM   410   N N   . LEU A 1 57  ? -6.205  26.280  10.903  1.00 19.81 ? 57  LEU A N   1 
ATOM   411   C CA  . LEU A 1 57  ? -6.238  24.904  11.379  1.00 19.16 ? 57  LEU A CA  1 
ATOM   412   C C   . LEU A 1 57  ? -7.624  24.301  11.241  1.00 18.73 ? 57  LEU A C   1 
ATOM   413   O O   . LEU A 1 57  ? -7.735  23.377  10.414  1.00 18.83 ? 57  LEU A O   1 
ATOM   414   C CB  . LEU A 1 57  ? -5.636  24.792  12.765  1.00 19.22 ? 57  LEU A CB  1 
ATOM   415   C CG  . LEU A 1 57  ? -5.004  23.453  13.073  1.00 19.30 ? 57  LEU A CG  1 
ATOM   416   C CD1 . LEU A 1 57  ? -5.850  22.263  12.666  1.00 19.40 ? 57  LEU A CD1 1 
ATOM   417   C CD2 . LEU A 1 57  ? -3.707  23.371  12.270  1.00 19.56 ? 57  LEU A CD2 1 
ATOM   418   N N   . ARG A 1 58  ? -8.613  24.792  11.960  1.00 18.12 ? 58  ARG A N   1 
ATOM   419   C CA  . ARG A 1 58  ? -9.958  24.197  11.929  1.00 17.42 ? 58  ARG A CA  1 
ATOM   420   C C   . ARG A 1 58  ? -10.481 24.212  10.478  1.00 16.57 ? 58  ARG A C   1 
ATOM   421   O O   . ARG A 1 58  ? -11.637 23.810  10.308  1.00 16.41 ? 58  ARG A O   1 
ATOM   422   C CB  . ARG A 1 58  ? -11.002 24.813  12.768  1.00 17.96 ? 58  ARG A CB  1 
ATOM   423   C CG  . ARG A 1 58  ? -11.128 25.290  14.161  1.00 18.45 ? 58  ARG A CG  1 
ATOM   424   C CD  . ARG A 1 58  ? -12.489 25.986  14.335  1.00 18.82 ? 58  ARG A CD  1 
ATOM   425   N NE  . ARG A 1 58  ? -13.477 25.345  15.060  1.00 19.02 ? 58  ARG A NE  1 
ATOM   426   C CZ  . ARG A 1 58  ? -14.045 24.285  15.599  1.00 19.18 ? 58  ARG A CZ  1 
ATOM   427   N NH1 . ARG A 1 58  ? -15.283 24.398  16.252  1.00 19.28 ? 58  ARG A NH1 1 
ATOM   428   N NH2 . ARG A 1 58  ? -13.608 23.036  15.350  1.00 19.11 ? 58  ARG A NH2 1 
ATOM   429   N N   . GLY A 1 59  ? -9.744  24.801  9.594   1.00 15.81 ? 59  GLY A N   1 
ATOM   430   C CA  . GLY A 1 59  ? -10.087 24.853  8.164   1.00 15.15 ? 59  GLY A CA  1 
ATOM   431   C C   . GLY A 1 59  ? -9.455  23.622  7.494   1.00 14.70 ? 59  GLY A C   1 
ATOM   432   O O   . GLY A 1 59  ? -10.108 22.732  6.956   1.00 14.54 ? 59  GLY A O   1 
ATOM   433   N N   . GLU A 1 60  ? -8.138  23.593  7.613   1.00 14.40 ? 60  GLU A N   1 
ATOM   434   C CA  . GLU A 1 60  ? -7.269  22.529  7.116   1.00 13.76 ? 60  GLU A CA  1 
ATOM   435   C C   . GLU A 1 60  ? -7.679  21.194  7.734   1.00 13.08 ? 60  GLU A C   1 
ATOM   436   O O   . GLU A 1 60  ? -7.736  20.201  7.004   1.00 13.03 ? 60  GLU A O   1 
ATOM   437   C CB  . GLU A 1 60  ? -5.795  22.708  7.441   1.00 13.94 ? 60  GLU A CB  1 
ATOM   438   C CG  . GLU A 1 60  ? -4.932  23.702  6.714   1.00 14.05 ? 60  GLU A CG  1 
ATOM   439   C CD  . GLU A 1 60  ? -4.160  23.284  5.518   1.00 14.16 ? 60  GLU A CD  1 
ATOM   440   O OE1 . GLU A 1 60  ? -3.077  23.761  5.188   1.00 14.23 ? 60  GLU A OE1 1 
ATOM   441   O OE2 . GLU A 1 60  ? -4.709  22.389  4.839   1.00 14.26 ? 60  GLU A OE2 1 
ATOM   442   N N   . ALA A 1 61  ? -7.892  21.230  9.030   1.00 12.38 ? 61  ALA A N   1 
ATOM   443   C CA  . ALA A 1 61  ? -8.305  20.030  9.777   1.00 11.98 ? 61  ALA A CA  1 
ATOM   444   C C   . ALA A 1 61  ? -9.571  19.454  9.134   1.00 11.73 ? 61  ALA A C   1 
ATOM   445   O O   . ALA A 1 61  ? -9.556  18.282  8.685   1.00 11.79 ? 61  ALA A O   1 
ATOM   446   C CB  . ALA A 1 61  ? -8.441  20.333  11.245  1.00 11.85 ? 61  ALA A CB  1 
ATOM   447   N N   . LEU A 1 62  ? -10.602 20.282  9.006   1.00 11.08 ? 62  LEU A N   1 
ATOM   448   C CA  . LEU A 1 62  ? -11.886 19.920  8.433   1.00 10.23 ? 62  LEU A CA  1 
ATOM   449   C C   . LEU A 1 62  ? -11.786 19.431  6.995   1.00 9.45  ? 62  LEU A C   1 
ATOM   450   O O   . LEU A 1 62  ? -12.688 18.741  6.517   1.00 9.26  ? 62  LEU A O   1 
ATOM   451   C CB  . LEU A 1 62  ? -12.853 21.121  8.547   1.00 10.45 ? 62  LEU A CB  1 
ATOM   452   C CG  . LEU A 1 62  ? -13.811 21.000  9.728   1.00 10.73 ? 62  LEU A CG  1 
ATOM   453   C CD1 . LEU A 1 62  ? -14.292 22.366  10.199  1.00 10.81 ? 62  LEU A CD1 1 
ATOM   454   C CD2 . LEU A 1 62  ? -15.002 20.138  9.284   1.00 10.72 ? 62  LEU A CD2 1 
ATOM   455   N N   . ASP A 1 63  ? -10.743 19.888  6.357   1.00 8.73  ? 63  ASP A N   1 
ATOM   456   C CA  . ASP A 1 63  ? -10.465 19.492  4.958   1.00 8.22  ? 63  ASP A CA  1 
ATOM   457   C C   . ASP A 1 63  ? -10.126 17.999  5.021   1.00 8.08  ? 63  ASP A C   1 
ATOM   458   O O   . ASP A 1 63  ? -10.796 17.197  4.350   1.00 8.38  ? 63  ASP A O   1 
ATOM   459   C CB  . ASP A 1 63  ? -9.398  20.362  4.342   1.00 7.95  ? 63  ASP A CB  1 
ATOM   460   C CG  . ASP A 1 63  ? -9.328  20.381  2.837   1.00 7.55  ? 63  ASP A CG  1 
ATOM   461   O OD1 . ASP A 1 63  ? -8.496  21.096  2.246   1.00 7.20  ? 63  ASP A OD1 1 
ATOM   462   O OD2 . ASP A 1 63  ? -10.185 19.691  2.251   1.00 7.41  ? 63  ASP A OD2 1 
ATOM   463   N N   . LEU A 1 64  ? -9.163  17.691  5.889   1.00 7.57  ? 64  LEU A N   1 
ATOM   464   C CA  . LEU A 1 64  ? -8.785  16.275  6.076   1.00 7.08  ? 64  LEU A CA  1 
ATOM   465   C C   . LEU A 1 64  ? -10.009 15.484  6.531   1.00 6.98  ? 64  LEU A C   1 
ATOM   466   O O   . LEU A 1 64  ? -10.243 14.388  6.002   1.00 7.07  ? 64  LEU A O   1 
ATOM   467   C CB  . LEU A 1 64  ? -7.575  16.198  6.975   1.00 6.92  ? 64  LEU A CB  1 
ATOM   468   C CG  . LEU A 1 64  ? -6.251  16.724  6.506   1.00 6.94  ? 64  LEU A CG  1 
ATOM   469   C CD1 . LEU A 1 64  ? -5.123  16.442  7.505   1.00 6.98  ? 64  LEU A CD1 1 
ATOM   470   C CD2 . LEU A 1 64  ? -5.857  16.082  5.178   1.00 6.95  ? 64  LEU A CD2 1 
ATOM   471   N N   . GLN A 1 65  ? -10.813 16.079  7.394   1.00 6.93  ? 65  GLN A N   1 
ATOM   472   C CA  . GLN A 1 65  ? -11.984 15.375  7.969   1.00 6.88  ? 65  GLN A CA  1 
ATOM   473   C C   . GLN A 1 65  ? -12.966 15.052  6.864   1.00 6.72  ? 65  GLN A C   1 
ATOM   474   O O   . GLN A 1 65  ? -13.296 13.860  6.697   1.00 6.74  ? 65  GLN A O   1 
ATOM   475   C CB  . GLN A 1 65  ? -12.570 16.071  9.176   1.00 7.11  ? 65  GLN A CB  1 
ATOM   476   C CG  . GLN A 1 65  ? -12.251 15.371  10.478  1.00 7.55  ? 65  GLN A CG  1 
ATOM   477   C CD  . GLN A 1 65  ? -12.538 16.155  11.725  1.00 7.98  ? 65  GLN A CD  1 
ATOM   478   O OE1 . GLN A 1 65  ? -11.831 16.062  12.747  1.00 8.08  ? 65  GLN A OE1 1 
ATOM   479   N NE2 . GLN A 1 65  ? -13.616 16.954  11.756  1.00 8.07  ? 65  GLN A NE2 1 
ATOM   480   N N   . HIS A 1 66  ? -13.342 16.028  6.068   1.00 6.54  ? 66  HIS A N   1 
ATOM   481   C CA  . HIS A 1 66  ? -14.226 15.794  4.934   1.00 6.46  ? 66  HIS A CA  1 
ATOM   482   C C   . HIS A 1 66  ? -13.641 14.639  4.100   1.00 6.58  ? 66  HIS A C   1 
ATOM   483   O O   . HIS A 1 66  ? -14.349 14.022  3.319   1.00 6.62  ? 66  HIS A O   1 
ATOM   484   C CB  . HIS A 1 66  ? -14.393 16.935  3.914   1.00 6.37  ? 66  HIS A CB  1 
ATOM   485   C CG  . HIS A 1 66  ? -15.262 18.064  4.342   1.00 6.28  ? 66  HIS A CG  1 
ATOM   486   N ND1 . HIS A 1 66  ? -15.328 19.263  3.670   1.00 6.27  ? 66  HIS A ND1 1 
ATOM   487   C CD2 . HIS A 1 66  ? -16.072 18.192  5.432   1.00 6.19  ? 66  HIS A CD2 1 
ATOM   488   C CE1 . HIS A 1 66  ? -16.165 20.063  4.313   1.00 6.33  ? 66  HIS A CE1 1 
ATOM   489   N NE2 . HIS A 1 66  ? -16.637 19.419  5.371   1.00 6.34  ? 66  HIS A NE2 1 
ATOM   490   N N   . GLY A 1 67  ? -12.344 14.509  4.217   1.00 6.75  ? 67  GLY A N   1 
ATOM   491   C CA  . GLY A 1 67  ? -11.545 13.554  3.486   1.00 7.00  ? 67  GLY A CA  1 
ATOM   492   C C   . GLY A 1 67  ? -11.628 12.137  3.975   1.00 7.10  ? 67  GLY A C   1 
ATOM   493   O O   . GLY A 1 67  ? -11.217 11.223  3.208   1.00 7.28  ? 67  GLY A O   1 
ATOM   494   N N   . SER A 1 68  ? -12.110 11.941  5.164   1.00 7.20  ? 68  SER A N   1 
ATOM   495   C CA  . SER A 1 68  ? -12.288 10.606  5.742   1.00 7.69  ? 68  SER A CA  1 
ATOM   496   C C   . SER A 1 68  ? -12.371 9.482   4.730   1.00 7.91  ? 68  SER A C   1 
ATOM   497   O O   . SER A 1 68  ? -11.317 8.815   4.599   1.00 8.14  ? 68  SER A O   1 
ATOM   498   C CB  . SER A 1 68  ? -13.483 10.626  6.701   1.00 7.75  ? 68  SER A CB  1 
ATOM   499   O OG  . SER A 1 68  ? -13.049 11.380  7.855   1.00 7.91  ? 68  SER A OG  1 
ATOM   500   N N   . LEU A 1 69  ? -13.421 9.284   4.002   1.00 8.05  ? 69  LEU A N   1 
ATOM   501   C CA  . LEU A 1 69  ? -13.640 8.232   3.029   1.00 8.36  ? 69  LEU A CA  1 
ATOM   502   C C   . LEU A 1 69  ? -12.497 8.073   2.045   1.00 9.00  ? 69  LEU A C   1 
ATOM   503   O O   . LEU A 1 69  ? -12.615 8.315   0.826   1.00 9.13  ? 69  LEU A O   1 
ATOM   504   C CB  . LEU A 1 69  ? -14.995 8.551   2.317   1.00 8.09  ? 69  LEU A CB  1 
ATOM   505   C CG  . LEU A 1 69  ? -15.508 7.576   1.264   1.00 7.64  ? 69  LEU A CG  1 
ATOM   506   C CD1 . LEU A 1 69  ? -16.587 6.660   1.801   1.00 7.46  ? 69  LEU A CD1 1 
ATOM   507   C CD2 . LEU A 1 69  ? -16.075 8.351   0.095   1.00 7.54  ? 69  LEU A CD2 1 
ATOM   508   N N   . PHE A 1 70  ? -11.388 7.564   2.504   1.00 9.67  ? 70  PHE A N   1 
ATOM   509   C CA  . PHE A 1 70  ? -10.136 7.299   1.823   1.00 9.89  ? 70  PHE A CA  1 
ATOM   510   C C   . PHE A 1 70  ? -9.092  6.942   2.902   1.00 10.09 ? 70  PHE A C   1 
ATOM   511   O O   . PHE A 1 70  ? -8.265  6.031   2.652   1.00 10.47 ? 70  PHE A O   1 
ATOM   512   C CB  . PHE A 1 70  ? -9.616  8.418   0.928   1.00 9.89  ? 70  PHE A CB  1 
ATOM   513   C CG  . PHE A 1 70  ? -8.353  8.089   0.190   1.00 10.03 ? 70  PHE A CG  1 
ATOM   514   C CD1 . PHE A 1 70  ? -8.373  8.012   -1.202  1.00 10.33 ? 70  PHE A CD1 1 
ATOM   515   C CD2 . PHE A 1 70  ? -7.146  7.847   0.840   1.00 9.92  ? 70  PHE A CD2 1 
ATOM   516   C CE1 . PHE A 1 70  ? -7.215  7.700   -1.931  1.00 10.39 ? 70  PHE A CE1 1 
ATOM   517   C CE2 . PHE A 1 70  ? -6.005  7.442   0.172   1.00 9.90  ? 70  PHE A CE2 1 
ATOM   518   C CZ  . PHE A 1 70  ? -6.032  7.405   -1.225  1.00 10.19 ? 70  PHE A CZ  1 
ATOM   519   N N   . LEU A 1 71  ? -9.141  7.612   4.004   1.00 10.15 ? 71  LEU A N   1 
ATOM   520   C CA  . LEU A 1 71  ? -8.165  7.350   5.079   1.00 10.77 ? 71  LEU A CA  1 
ATOM   521   C C   . LEU A 1 71  ? -8.432  6.011   5.751   1.00 10.89 ? 71  LEU A C   1 
ATOM   522   O O   . LEU A 1 71  ? -9.565  5.527   5.666   1.00 10.99 ? 71  LEU A O   1 
ATOM   523   C CB  . LEU A 1 71  ? -8.197  8.562   6.003   1.00 11.10 ? 71  LEU A CB  1 
ATOM   524   C CG  . LEU A 1 71  ? -8.301  9.966   5.461   1.00 11.17 ? 71  LEU A CG  1 
ATOM   525   C CD1 . LEU A 1 71  ? -7.848  10.953  6.547   1.00 11.17 ? 71  LEU A CD1 1 
ATOM   526   C CD2 . LEU A 1 71  ? -7.445  10.152  4.208   1.00 11.18 ? 71  LEU A CD2 1 
ATOM   527   N N   . SER A 1 72  ? -7.410  5.463   6.367   1.00 11.14 ? 72  SER A N   1 
ATOM   528   C CA  . SER A 1 72  ? -7.446  4.233   7.152   1.00 11.51 ? 72  SER A CA  1 
ATOM   529   C C   . SER A 1 72  ? -7.094  4.623   8.612   1.00 11.50 ? 72  SER A C   1 
ATOM   530   O O   . SER A 1 72  ? -6.404  3.887   9.317   1.00 11.44 ? 72  SER A O   1 
ATOM   531   C CB  . SER A 1 72  ? -6.492  3.154   6.750   1.00 11.94 ? 72  SER A CB  1 
ATOM   532   O OG  . SER A 1 72  ? -6.841  2.207   5.778   1.00 12.61 ? 72  SER A OG  1 
ATOM   533   N N   . THR A 1 73  ? -7.536  5.787   8.961   1.00 11.61 ? 73  THR A N   1 
ATOM   534   C CA  . THR A 1 73  ? -7.328  6.411   10.272  1.00 11.96 ? 73  THR A CA  1 
ATOM   535   C C   . THR A 1 73  ? -8.616  7.157   10.596  1.00 12.28 ? 73  THR A C   1 
ATOM   536   O O   . THR A 1 73  ? -8.886  8.209   10.000  1.00 12.29 ? 73  THR A O   1 
ATOM   537   C CB  . THR A 1 73  ? -6.041  7.284   10.294  1.00 12.07 ? 73  THR A CB  1 
ATOM   538   O OG1 . THR A 1 73  ? -6.254  8.465   11.146  1.00 12.06 ? 73  THR A OG1 1 
ATOM   539   C CG2 . THR A 1 73  ? -5.475  7.666   8.911   1.00 12.12 ? 73  THR A CG2 1 
ATOM   540   N N   . PRO A 1 74  ? -9.391  6.527   11.460  1.00 12.61 ? 74  PRO A N   1 
ATOM   541   C CA  . PRO A 1 74  ? -10.719 7.018   11.797  1.00 12.88 ? 74  PRO A CA  1 
ATOM   542   C C   . PRO A 1 74  ? -10.717 8.341   12.501  1.00 13.28 ? 74  PRO A C   1 
ATOM   543   O O   . PRO A 1 74  ? -11.526 9.233   12.113  1.00 13.41 ? 74  PRO A O   1 
ATOM   544   C CB  . PRO A 1 74  ? -11.321 5.879   12.637  1.00 12.85 ? 74  PRO A CB  1 
ATOM   545   C CG  . PRO A 1 74  ? -10.146 5.310   13.349  1.00 12.82 ? 74  PRO A CG  1 
ATOM   546   C CD  . PRO A 1 74  ? -8.998  5.389   12.314  1.00 12.73 ? 74  PRO A CD  1 
ATOM   547   N N   . LYS A 1 75  ? -9.813  8.513   13.445  1.00 13.77 ? 75  LYS A N   1 
ATOM   548   C CA  . LYS A 1 75  ? -9.878  9.788   14.262  1.00 14.34 ? 75  LYS A CA  1 
ATOM   549   C C   . LYS A 1 75  ? -8.752  10.726  13.868  1.00 14.51 ? 75  LYS A C   1 
ATOM   550   O O   . LYS A 1 75  ? -7.580  10.360  13.803  1.00 14.46 ? 75  LYS A O   1 
ATOM   551   C CB  . LYS A 1 75  ? -9.943  9.475   15.692  1.00 14.46 ? 75  LYS A CB  1 
ATOM   552   C CG  . LYS A 1 75  ? -9.951  10.321  16.901  1.00 14.50 ? 75  LYS A CG  1 
ATOM   553   C CD  . LYS A 1 75  ? -9.757  9.527   18.206  1.00 14.84 ? 75  LYS A CD  1 
ATOM   554   C CE  . LYS A 1 75  ? -8.836  8.349   18.125  1.00 15.28 ? 75  LYS A CE  1 
ATOM   555   N NZ  . LYS A 1 75  ? -8.174  7.820   19.319  1.00 15.56 ? 75  LYS A NZ  1 
ATOM   556   N N   . ILE A 1 76  ? -9.191  11.934  13.602  1.00 14.89 ? 76  ILE A N   1 
ATOM   557   C CA  . ILE A 1 76  ? -8.415  13.122  13.252  1.00 15.33 ? 76  ILE A CA  1 
ATOM   558   C C   . ILE A 1 76  ? -8.908  14.296  14.099  1.00 15.94 ? 76  ILE A C   1 
ATOM   559   O O   . ILE A 1 76  ? -10.021 14.818  13.901  1.00 15.92 ? 76  ILE A O   1 
ATOM   560   C CB  . ILE A 1 76  ? -8.490  13.364  11.709  1.00 15.02 ? 76  ILE A CB  1 
ATOM   561   C CG1 . ILE A 1 76  ? -7.672  12.222  11.051  1.00 14.99 ? 76  ILE A CG1 1 
ATOM   562   C CG2 . ILE A 1 76  ? -8.039  14.764  11.262  1.00 14.87 ? 76  ILE A CG2 1 
ATOM   563   C CD1 . ILE A 1 76  ? -7.629  12.224  9.512   1.00 15.01 ? 76  ILE A CD1 1 
ATOM   564   N N   . VAL A 1 77  ? -8.110  14.673  15.074  1.00 16.76 ? 77  VAL A N   1 
ATOM   565   C CA  . VAL A 1 77  ? -8.519  15.744  16.010  1.00 17.70 ? 77  VAL A CA  1 
ATOM   566   C C   . VAL A 1 77  ? -7.619  16.954  15.840  1.00 18.44 ? 77  VAL A C   1 
ATOM   567   O O   . VAL A 1 77  ? -6.565  16.888  15.192  1.00 18.57 ? 77  VAL A O   1 
ATOM   568   C CB  . VAL A 1 77  ? -8.646  15.206  17.438  1.00 17.63 ? 77  VAL A CB  1 
ATOM   569   C CG1 . VAL A 1 77  ? -10.106 14.803  17.757  1.00 17.58 ? 77  VAL A CG1 1 
ATOM   570   C CG2 . VAL A 1 77  ? -7.752  14.014  17.754  1.00 17.56 ? 77  VAL A CG2 1 
ATOM   571   N N   . PHE A 1 78  ? -8.095  18.052  16.397  1.00 19.45 ? 78  PHE A N   1 
ATOM   572   C CA  . PHE A 1 78  ? -7.384  19.345  16.369  1.00 20.27 ? 78  PHE A CA  1 
ATOM   573   C C   . PHE A 1 78  ? -7.621  20.125  17.664  1.00 20.55 ? 78  PHE A C   1 
ATOM   574   O O   . PHE A 1 78  ? -8.696  20.119  18.263  1.00 20.49 ? 78  PHE A O   1 
ATOM   575   C CB  . PHE A 1 78  ? -7.703  20.128  15.094  1.00 20.62 ? 78  PHE A CB  1 
ATOM   576   C CG  . PHE A 1 78  ? -7.544  21.609  15.170  1.00 21.18 ? 78  PHE A CG  1 
ATOM   577   C CD1 . PHE A 1 78  ? -6.399  22.200  15.733  1.00 21.27 ? 78  PHE A CD1 1 
ATOM   578   C CD2 . PHE A 1 78  ? -8.502  22.452  14.571  1.00 21.45 ? 78  PHE A CD2 1 
ATOM   579   C CE1 . PHE A 1 78  ? -6.267  23.562  15.881  1.00 21.37 ? 78  PHE A CE1 1 
ATOM   580   C CE2 . PHE A 1 78  ? -8.351  23.848  14.670  1.00 21.55 ? 78  PHE A CE2 1 
ATOM   581   C CZ  . PHE A 1 78  ? -7.247  24.394  15.348  1.00 21.52 ? 78  PHE A CZ  1 
ATOM   582   N N   . GLY A 1 79  ? -6.557  20.801  18.082  1.00 21.01 ? 79  GLY A N   1 
ATOM   583   C CA  . GLY A 1 79  ? -6.527  21.660  19.232  1.00 21.77 ? 79  GLY A CA  1 
ATOM   584   C C   . GLY A 1 79  ? -5.718  22.939  19.080  1.00 22.23 ? 79  GLY A C   1 
ATOM   585   O O   . GLY A 1 79  ? -4.802  23.093  18.293  1.00 22.07 ? 79  GLY A O   1 
ATOM   586   N N   . LYS A 1 80  ? -6.100  23.889  19.912  1.00 22.99 ? 80  LYS A N   1 
ATOM   587   C CA  . LYS A 1 80  ? -5.492  25.215  20.088  1.00 23.61 ? 80  LYS A CA  1 
ATOM   588   C C   . LYS A 1 80  ? -4.459  25.093  21.212  1.00 23.93 ? 80  LYS A C   1 
ATOM   589   O O   . LYS A 1 80  ? -3.606  25.960  21.423  1.00 23.99 ? 80  LYS A O   1 
ATOM   590   C CB  . LYS A 1 80  ? -6.554  26.234  20.426  1.00 23.88 ? 80  LYS A CB  1 
ATOM   591   C CG  . LYS A 1 80  ? -6.210  27.441  21.252  1.00 24.13 ? 80  LYS A CG  1 
ATOM   592   C CD  . LYS A 1 80  ? -5.604  28.590  20.489  1.00 24.31 ? 80  LYS A CD  1 
ATOM   593   C CE  . LYS A 1 80  ? -6.677  29.573  19.977  1.00 24.36 ? 80  LYS A CE  1 
ATOM   594   N NZ  . LYS A 1 80  ? -5.961  30.817  19.536  1.00 24.47 ? 80  LYS A NZ  1 
ATOM   595   N N   . ASP A 1 81  ? -4.629  24.000  21.942  1.00 24.28 ? 81  ASP A N   1 
ATOM   596   C CA  . ASP A 1 81  ? -3.777  23.610  23.057  1.00 24.56 ? 81  ASP A CA  1 
ATOM   597   C C   . ASP A 1 81  ? -3.374  22.121  22.909  1.00 24.48 ? 81  ASP A C   1 
ATOM   598   O O   . ASP A 1 81  ? -3.966  21.294  22.219  1.00 24.28 ? 81  ASP A O   1 
ATOM   599   C CB  . ASP A 1 81  ? -4.406  23.926  24.411  1.00 24.95 ? 81  ASP A CB  1 
ATOM   600   C CG  . ASP A 1 81  ? -3.421  23.795  25.572  1.00 25.16 ? 81  ASP A CG  1 
ATOM   601   O OD1 . ASP A 1 81  ? -2.391  24.501  25.584  1.00 25.19 ? 81  ASP A OD1 1 
ATOM   602   O OD2 . ASP A 1 81  ? -3.725  22.950  26.453  1.00 25.16 ? 81  ASP A OD2 1 
ATOM   603   N N   . TYR A 1 82  ? -2.338  21.843  23.659  1.00 24.47 ? 82  TYR A N   1 
ATOM   604   C CA  . TYR A 1 82  ? -1.610  20.591  23.745  1.00 24.60 ? 82  TYR A CA  1 
ATOM   605   C C   . TYR A 1 82  ? -2.352  19.530  24.512  1.00 24.75 ? 82  TYR A C   1 
ATOM   606   O O   . TYR A 1 82  ? -2.036  18.308  24.483  1.00 24.92 ? 82  TYR A O   1 
ATOM   607   C CB  . TYR A 1 82  ? -0.199  20.913  24.325  1.00 24.57 ? 82  TYR A CB  1 
ATOM   608   C CG  . TYR A 1 82  ? 0.440   22.014  23.485  1.00 24.46 ? 82  TYR A CG  1 
ATOM   609   C CD1 . TYR A 1 82  ? 0.272   23.364  23.801  1.00 24.49 ? 82  TYR A CD1 1 
ATOM   610   C CD2 . TYR A 1 82  ? 1.067   21.689  22.301  1.00 24.43 ? 82  TYR A CD2 1 
ATOM   611   C CE1 . TYR A 1 82  ? 0.813   24.365  22.998  1.00 24.48 ? 82  TYR A CE1 1 
ATOM   612   C CE2 . TYR A 1 82  ? 1.622   22.667  21.490  1.00 24.46 ? 82  TYR A CE2 1 
ATOM   613   C CZ  . TYR A 1 82  ? 1.482   24.005  21.831  1.00 24.50 ? 82  TYR A CZ  1 
ATOM   614   O OH  . TYR A 1 82  ? 2.053   24.920  20.998  1.00 24.51 ? 82  TYR A OH  1 
ATOM   615   N N   . ASN A 1 83  ? -3.408  19.985  25.173  1.00 24.72 ? 83  ASN A N   1 
ATOM   616   C CA  . ASN A 1 83  ? -4.264  19.030  25.895  1.00 24.71 ? 83  ASN A CA  1 
ATOM   617   C C   . ASN A 1 83  ? -4.771  18.008  24.866  1.00 24.45 ? 83  ASN A C   1 
ATOM   618   O O   . ASN A 1 83  ? -5.091  16.852  25.143  1.00 24.41 ? 83  ASN A O   1 
ATOM   619   C CB  . ASN A 1 83  ? -5.384  19.794  26.615  1.00 25.05 ? 83  ASN A CB  1 
ATOM   620   C CG  . ASN A 1 83  ? -5.917  18.821  27.684  1.00 25.38 ? 83  ASN A CG  1 
ATOM   621   O OD1 . ASN A 1 83  ? -6.499  17.788  27.314  1.00 25.37 ? 83  ASN A OD1 1 
ATOM   622   N ND2 . ASN A 1 83  ? -5.472  19.119  28.896  1.00 25.71 ? 83  ASN A ND2 1 
ATOM   623   N N   . VAL A 1 84  ? -4.823  18.515  23.651  1.00 24.08 ? 84  VAL A N   1 
ATOM   624   C CA  . VAL A 1 84  ? -5.372  17.789  22.493  1.00 23.78 ? 84  VAL A CA  1 
ATOM   625   C C   . VAL A 1 84  ? -4.365  16.811  21.924  1.00 23.61 ? 84  VAL A C   1 
ATOM   626   O O   . VAL A 1 84  ? -4.564  16.225  20.852  1.00 23.52 ? 84  VAL A O   1 
ATOM   627   C CB  . VAL A 1 84  ? -5.913  18.865  21.526  1.00 23.76 ? 84  VAL A CB  1 
ATOM   628   C CG1 . VAL A 1 84  ? -6.646  18.303  20.324  1.00 23.76 ? 84  VAL A CG1 1 
ATOM   629   C CG2 . VAL A 1 84  ? -6.812  19.871  22.255  1.00 23.71 ? 84  VAL A CG2 1 
ATOM   630   N N   . SER A 1 85  ? -3.330  16.529  22.704  1.00 23.47 ? 85  SER A N   1 
ATOM   631   C CA  . SER A 1 85  ? -2.217  15.661  22.286  1.00 23.20 ? 85  SER A CA  1 
ATOM   632   C C   . SER A 1 85  ? -2.048  14.472  23.207  1.00 23.03 ? 85  SER A C   1 
ATOM   633   O O   . SER A 1 85  ? -1.187  13.586  22.994  1.00 23.08 ? 85  SER A O   1 
ATOM   634   C CB  . SER A 1 85  ? -0.937  16.510  22.246  1.00 23.23 ? 85  SER A CB  1 
ATOM   635   O OG  . SER A 1 85  ? -0.150  16.198  21.105  1.00 23.25 ? 85  SER A OG  1 
ATOM   636   N N   . ALA A 1 86  ? -2.922  14.398  24.192  1.00 22.69 ? 86  ALA A N   1 
ATOM   637   C CA  . ALA A 1 86  ? -2.854  13.396  25.246  1.00 22.31 ? 86  ALA A CA  1 
ATOM   638   C C   . ALA A 1 86  ? -2.585  11.989  24.733  1.00 22.07 ? 86  ALA A C   1 
ATOM   639   O O   . ALA A 1 86  ? -3.408  11.370  24.056  1.00 22.12 ? 86  ALA A O   1 
ATOM   640   C CB  . ALA A 1 86  ? -4.130  13.413  26.077  1.00 22.31 ? 86  ALA A CB  1 
ATOM   641   N N   . ASN A 1 87  ? -1.420  11.498  25.091  1.00 21.71 ? 87  ASN A N   1 
ATOM   642   C CA  . ASN A 1 87  ? -0.986  10.114  24.873  1.00 21.34 ? 87  ASN A CA  1 
ATOM   643   C C   . ASN A 1 87  ? -0.621  9.802   23.438  1.00 20.78 ? 87  ASN A C   1 
ATOM   644   O O   . ASN A 1 87  ? -0.992  8.732   22.896  1.00 20.84 ? 87  ASN A O   1 
ATOM   645   C CB  . ASN A 1 87  ? -2.031  9.161   25.490  1.00 21.82 ? 87  ASN A CB  1 
ATOM   646   C CG  . ASN A 1 87  ? -2.180  9.425   26.989  1.00 22.29 ? 87  ASN A CG  1 
ATOM   647   O OD1 . ASN A 1 87  ? -1.399  8.897   27.813  1.00 22.47 ? 87  ASN A OD1 1 
ATOM   648   N ND2 . ASN A 1 87  ? -3.169  10.250  27.358  1.00 22.40 ? 87  ASN A ND2 1 
ATOM   649   N N   . SER A 1 88  ? 0.117   10.747  22.856  1.00 19.80 ? 88  SER A N   1 
ATOM   650   C CA  . SER A 1 88  ? 0.654   10.586  21.496  1.00 18.73 ? 88  SER A CA  1 
ATOM   651   C C   . SER A 1 88  ? 1.855   9.638   21.604  1.00 17.79 ? 88  SER A C   1 
ATOM   652   O O   . SER A 1 88  ? 2.477   9.659   22.684  1.00 17.94 ? 88  SER A O   1 
ATOM   653   C CB  . SER A 1 88  ? 1.173   11.879  20.898  1.00 18.83 ? 88  SER A CB  1 
ATOM   654   O OG  . SER A 1 88  ? 0.218   12.610  20.164  1.00 18.89 ? 88  SER A OG  1 
ATOM   655   N N   . LYS A 1 89  ? 2.112   8.906   20.558  1.00 16.53 ? 89  LYS A N   1 
ATOM   656   C CA  . LYS A 1 89  ? 3.351   8.058   20.554  1.00 15.27 ? 89  LYS A CA  1 
ATOM   657   C C   . LYS A 1 89  ? 4.472   8.856   19.886  1.00 14.27 ? 89  LYS A C   1 
ATOM   658   O O   . LYS A 1 89  ? 5.640   8.790   20.317  1.00 14.16 ? 89  LYS A O   1 
ATOM   659   C CB  . LYS A 1 89  ? 3.119   6.699   19.956  1.00 15.28 ? 89  LYS A CB  1 
ATOM   660   C CG  . LYS A 1 89  ? 2.506   5.637   20.870  1.00 15.20 ? 89  LYS A CG  1 
ATOM   661   C CD  . LYS A 1 89  ? 1.170   6.014   21.453  1.00 15.23 ? 89  LYS A CD  1 
ATOM   662   C CE  . LYS A 1 89  ? 0.808   5.274   22.718  1.00 15.20 ? 89  LYS A CE  1 
ATOM   663   N NZ  . LYS A 1 89  ? -0.236  6.027   23.491  1.00 15.12 ? 89  LYS A NZ  1 
ATOM   664   N N   . LEU A 1 90  ? 4.116   9.716   18.949  1.00 13.02 ? 90  LEU A N   1 
ATOM   665   C CA  . LEU A 1 90  ? 5.028   10.533  18.187  1.00 11.92 ? 90  LEU A CA  1 
ATOM   666   C C   . LEU A 1 90  ? 4.489   11.949  17.932  1.00 11.43 ? 90  LEU A C   1 
ATOM   667   O O   . LEU A 1 90  ? 3.436   12.121  17.303  1.00 11.44 ? 90  LEU A O   1 
ATOM   668   C CB  . LEU A 1 90  ? 5.340   9.842   16.843  1.00 11.66 ? 90  LEU A CB  1 
ATOM   669   C CG  . LEU A 1 90  ? 6.387   10.563  15.993  1.00 11.40 ? 90  LEU A CG  1 
ATOM   670   C CD1 . LEU A 1 90  ? 7.719   9.840   16.063  1.00 11.19 ? 90  LEU A CD1 1 
ATOM   671   C CD2 . LEU A 1 90  ? 5.900   10.678  14.554  1.00 11.35 ? 90  LEU A CD2 1 
ATOM   672   N N   . VAL A 1 91  ? 5.290   12.911  18.354  1.00 10.60 ? 91  VAL A N   1 
ATOM   673   C CA  . VAL A 1 91  ? 5.006   14.330  18.177  1.00 10.00 ? 91  VAL A CA  1 
ATOM   674   C C   . VAL A 1 91  ? 6.016   14.934  17.192  1.00 9.62  ? 91  VAL A C   1 
ATOM   675   O O   . VAL A 1 91  ? 7.221   14.736  17.385  1.00 9.64  ? 91  VAL A O   1 
ATOM   676   C CB  . VAL A 1 91  ? 5.005   15.050  19.536  1.00 9.93  ? 91  VAL A CB  1 
ATOM   677   C CG1 . VAL A 1 91  ? 4.582   16.525  19.378  1.00 9.93  ? 91  VAL A CG1 1 
ATOM   678   C CG2 . VAL A 1 91  ? 4.167   14.370  20.575  1.00 9.71  ? 91  VAL A CG2 1 
ATOM   679   N N   . ILE A 1 92  ? 5.528   15.663  16.225  1.00 9.28  ? 92  ILE A N   1 
ATOM   680   C CA  . ILE A 1 92  ? 6.429   16.297  15.225  1.00 9.19  ? 92  ILE A CA  1 
ATOM   681   C C   . ILE A 1 92  ? 6.170   17.801  15.165  1.00 9.44  ? 92  ILE A C   1 
ATOM   682   O O   . ILE A 1 92  ? 5.149   18.387  14.766  1.00 9.45  ? 92  ILE A O   1 
ATOM   683   C CB  . ILE A 1 92  ? 6.475   15.449  13.928  1.00 8.83  ? 92  ILE A CB  1 
ATOM   684   C CG1 . ILE A 1 92  ? 6.851   16.307  12.708  1.00 8.73  ? 92  ILE A CG1 1 
ATOM   685   C CG2 . ILE A 1 92  ? 5.208   14.582  13.670  1.00 8.74  ? 92  ILE A CG2 1 
ATOM   686   C CD1 . ILE A 1 92  ? 5.752   16.942  11.859  1.00 8.61  ? 92  ILE A CD1 1 
ATOM   687   N N   . ILE A 1 93  ? 7.178   18.478  15.705  1.00 9.62  ? 93  ILE A N   1 
ATOM   688   C CA  . ILE A 1 93  ? 7.284   19.913  15.884  1.00 9.87  ? 93  ILE A CA  1 
ATOM   689   C C   . ILE A 1 93  ? 7.631   20.567  14.565  1.00 10.56 ? 93  ILE A C   1 
ATOM   690   O O   . ILE A 1 93  ? 8.714   20.295  14.019  1.00 10.82 ? 93  ILE A O   1 
ATOM   691   C CB  . ILE A 1 93  ? 8.375   20.249  16.996  1.00 9.35  ? 93  ILE A CB  1 
ATOM   692   C CG1 . ILE A 1 93  ? 8.412   19.171  18.065  1.00 9.00  ? 93  ILE A CG1 1 
ATOM   693   C CG2 . ILE A 1 93  ? 8.148   21.687  17.518  1.00 9.37  ? 93  ILE A CG2 1 
ATOM   694   C CD1 . ILE A 1 93  ? 8.740   19.453  19.518  1.00 8.78  ? 93  ILE A CD1 1 
ATOM   695   N N   . THR A 1 94  ? 6.728   21.321  14.010  1.00 11.49 ? 94  THR A N   1 
ATOM   696   C CA  . THR A 1 94  ? 7.010   22.038  12.749  1.00 12.55 ? 94  THR A CA  1 
ATOM   697   C C   . THR A 1 94  ? 6.332   23.397  12.798  1.00 13.24 ? 94  THR A C   1 
ATOM   698   O O   . THR A 1 94  ? 5.397   23.649  12.046  1.00 13.32 ? 94  THR A O   1 
ATOM   699   C CB  . THR A 1 94  ? 6.615   21.197  11.494  1.00 12.65 ? 94  THR A CB  1 
ATOM   700   O OG1 . THR A 1 94  ? 5.148   21.262  11.376  1.00 12.89 ? 94  THR A OG1 1 
ATOM   701   C CG2 . THR A 1 94  ? 7.105   19.752  11.555  1.00 12.64 ? 94  THR A CG2 1 
ATOM   702   N N   . ALA A 1 95  ? 6.755   24.191  13.733  1.00 14.33 ? 95  ALA A N   1 
ATOM   703   C CA  . ALA A 1 95  ? 6.259   25.524  14.019  1.00 15.67 ? 95  ALA A CA  1 
ATOM   704   C C   . ALA A 1 95  ? 7.475   26.387  14.369  1.00 16.82 ? 95  ALA A C   1 
ATOM   705   O O   . ALA A 1 95  ? 8.430   25.926  15.010  1.00 16.87 ? 95  ALA A O   1 
ATOM   706   C CB  . ALA A 1 95  ? 5.220   25.504  15.122  1.00 15.51 ? 95  ALA A CB  1 
ATOM   707   N N   . GLY A 1 96  ? 7.438   27.606  13.859  1.00 18.19 ? 96  GLY A N   1 
ATOM   708   C CA  . GLY A 1 96  ? 8.485   28.548  14.091  1.00 20.02 ? 96  GLY A CA  1 
ATOM   709   C C   . GLY A 1 96  ? 8.522   29.801  13.275  1.00 21.39 ? 96  GLY A C   1 
ATOM   710   O O   . GLY A 1 96  ? 8.034   30.874  13.719  1.00 21.62 ? 96  GLY A O   1 
ATOM   711   N N   . ALA A 1 97  ? 9.111   29.697  12.109  1.00 22.52 ? 97  ALA A N   1 
ATOM   712   C CA  . ALA A 1 97  ? 9.431   30.902  11.288  1.00 23.82 ? 97  ALA A CA  1 
ATOM   713   C C   . ALA A 1 97  ? 10.170  30.296  10.093  1.00 24.78 ? 97  ALA A C   1 
ATOM   714   O O   . ALA A 1 97  ? 11.348  29.927  10.222  1.00 25.13 ? 97  ALA A O   1 
ATOM   715   C CB  . ALA A 1 97  ? 10.313  31.853  12.049  1.00 23.65 ? 97  ALA A CB  1 
ATOM   716   N N   . ARG A 1 98  ? 9.423   30.182  9.025   1.00 25.70 ? 98  ARG A N   1 
ATOM   717   C CA  . ARG A 1 98  ? 9.890   29.445  7.875   1.00 26.55 ? 98  ARG A CA  1 
ATOM   718   C C   . ARG A 1 98  ? 10.328  30.192  6.644   1.00 26.56 ? 98  ARG A C   1 
ATOM   719   O O   . ARG A 1 98  ? 9.471   30.688  5.893   1.00 26.63 ? 98  ARG A O   1 
ATOM   720   C CB  . ARG A 1 98  ? 8.741   28.497  7.418   1.00 27.31 ? 98  ARG A CB  1 
ATOM   721   C CG  . ARG A 1 98  ? 8.830   27.032  7.770   1.00 28.11 ? 98  ARG A CG  1 
ATOM   722   C CD  . ARG A 1 98  ? 7.991   26.714  8.949   1.00 28.75 ? 98  ARG A CD  1 
ATOM   723   N NE  . ARG A 1 98  ? 7.131   25.545  8.729   1.00 29.38 ? 98  ARG A NE  1 
ATOM   724   C CZ  . ARG A 1 98  ? 6.485   24.971  9.757   1.00 29.78 ? 98  ARG A CZ  1 
ATOM   725   N NH1 . ARG A 1 98  ? 6.672   25.470  10.992  1.00 29.97 ? 98  ARG A NH1 1 
ATOM   726   N NH2 . ARG A 1 98  ? 5.607   23.984  9.545   1.00 29.76 ? 98  ARG A NH2 1 
ATOM   727   N N   . MET A 1 99  ? 11.622  30.165  6.407   1.00 26.65 ? 99  MET A N   1 
ATOM   728   C CA  . MET A 1 99  ? 12.171  30.494  5.081   1.00 26.87 ? 99  MET A CA  1 
ATOM   729   C C   . MET A 1 99  ? 11.967  31.925  4.632   1.00 26.71 ? 99  MET A C   1 
ATOM   730   O O   . MET A 1 99  ? 11.024  32.595  5.046   1.00 26.79 ? 99  MET A O   1 
ATOM   731   C CB  . MET A 1 99  ? 11.657  29.486  4.055   1.00 27.32 ? 99  MET A CB  1 
ATOM   732   C CG  . MET A 1 99  ? 10.314  28.905  3.947   1.00 27.69 ? 99  MET A CG  1 
ATOM   733   S SD  . MET A 1 99  ? 10.107  27.370  4.943   1.00 28.08 ? 99  MET A SD  1 
ATOM   734   C CE  . MET A 1 99  ? 8.489   26.797  4.495   1.00 27.81 ? 99  MET A CE  1 
ATOM   735   N N   . VAL A 1 100 ? 12.864  32.358  3.762   1.00 26.42 ? 100 VAL A N   1 
ATOM   736   C CA  . VAL A 1 100 ? 12.911  33.633  3.078   1.00 26.11 ? 100 VAL A CA  1 
ATOM   737   C C   . VAL A 1 100 ? 14.156  33.654  2.148   1.00 26.08 ? 100 VAL A C   1 
ATOM   738   O O   . VAL A 1 100 ? 15.278  33.717  2.647   1.00 26.01 ? 100 VAL A O   1 
ATOM   739   C CB  . VAL A 1 100 ? 12.877  34.897  3.932   1.00 25.90 ? 100 VAL A CB  1 
ATOM   740   C CG1 . VAL A 1 100 ? 13.417  36.157  3.229   1.00 25.74 ? 100 VAL A CG1 1 
ATOM   741   C CG2 . VAL A 1 100 ? 11.471  35.241  4.402   1.00 25.96 ? 100 VAL A CG2 1 
ATOM   742   N N   . SER A 1 101 ? 13.858  33.756  0.872   1.00 26.02 ? 101 SER A N   1 
ATOM   743   C CA  . SER A 1 101 ? 14.873  33.874  -0.185  1.00 25.92 ? 101 SER A CA  1 
ATOM   744   C C   . SER A 1 101 ? 16.019  34.752  0.327   1.00 26.02 ? 101 SER A C   1 
ATOM   745   O O   . SER A 1 101 ? 15.832  35.988  0.402   1.00 26.20 ? 101 SER A O   1 
ATOM   746   C CB  . SER A 1 101 ? 14.293  34.487  -1.447  1.00 25.80 ? 101 SER A CB  1 
ATOM   747   O OG  . SER A 1 101 ? 15.267  35.084  -2.272  1.00 25.52 ? 101 SER A OG  1 
ATOM   748   N N   . GLY A 1 102 ? 17.085  34.082  0.725   1.00 25.85 ? 102 GLY A N   1 
ATOM   749   C CA  . GLY A 1 102 ? 18.286  34.806  1.227   1.00 25.52 ? 102 GLY A CA  1 
ATOM   750   C C   . GLY A 1 102 ? 18.489  34.393  2.683   1.00 25.33 ? 102 GLY A C   1 
ATOM   751   O O   . GLY A 1 102 ? 19.397  33.632  3.048   1.00 25.37 ? 102 GLY A O   1 
ATOM   752   N N   . GLN A 1 103 ? 17.566  34.893  3.473   1.00 25.07 ? 103 GLN A N   1 
ATOM   753   C CA  . GLN A 1 103 ? 17.456  34.683  4.907   1.00 24.74 ? 103 GLN A CA  1 
ATOM   754   C C   . GLN A 1 103 ? 18.096  33.356  5.326   1.00 24.74 ? 103 GLN A C   1 
ATOM   755   O O   . GLN A 1 103 ? 19.153  33.258  5.953   1.00 24.71 ? 103 GLN A O   1 
ATOM   756   C CB  . GLN A 1 103 ? 15.968  34.686  5.312   1.00 24.58 ? 103 GLN A CB  1 
ATOM   757   C CG  . GLN A 1 103 ? 15.641  34.148  6.665   1.00 24.38 ? 103 GLN A CG  1 
ATOM   758   C CD  . GLN A 1 103 ? 15.358  35.188  7.705   1.00 24.31 ? 103 GLN A CD  1 
ATOM   759   O OE1 . GLN A 1 103 ? 14.435  35.048  8.491   1.00 24.20 ? 103 GLN A OE1 1 
ATOM   760   N NE2 . GLN A 1 103 ? 16.126  36.273  7.684   1.00 24.42 ? 103 GLN A NE2 1 
ATOM   761   N N   . THR A 1 104 ? 17.349  32.343  4.905   1.00 24.71 ? 104 THR A N   1 
ATOM   762   C CA  . THR A 1 104 ? 17.587  30.933  5.269   1.00 24.47 ? 104 THR A CA  1 
ATOM   763   C C   . THR A 1 104 ? 19.103  30.740  5.367   1.00 24.42 ? 104 THR A C   1 
ATOM   764   O O   . THR A 1 104 ? 19.921  31.223  4.582   1.00 24.24 ? 104 THR A O   1 
ATOM   765   C CB  . THR A 1 104 ? 16.711  29.938  4.442   1.00 24.23 ? 104 THR A CB  1 
ATOM   766   O OG1 . THR A 1 104 ? 15.377  29.982  5.141   1.00 24.15 ? 104 THR A OG1 1 
ATOM   767   C CG2 . THR A 1 104 ? 17.129  28.487  4.319   1.00 24.01 ? 104 THR A CG2 1 
ATOM   768   N N   . ARG A 1 105 ? 19.405  30.344  6.561   1.00 24.31 ? 105 ARG A N   1 
ATOM   769   C CA  . ARG A 1 105 ? 20.680  29.991  7.161   1.00 24.25 ? 105 ARG A CA  1 
ATOM   770   C C   . ARG A 1 105 ? 20.248  29.518  8.560   1.00 23.86 ? 105 ARG A C   1 
ATOM   771   O O   . ARG A 1 105 ? 19.152  28.857  8.607   1.00 23.75 ? 105 ARG A O   1 
ATOM   772   C CB  . ARG A 1 105 ? 21.738  31.069  7.073   1.00 24.51 ? 105 ARG A CB  1 
ATOM   773   C CG  . ARG A 1 105 ? 22.474  31.064  5.728   1.00 25.19 ? 105 ARG A CG  1 
ATOM   774   C CD  . ARG A 1 105 ? 23.557  32.033  5.559   1.00 25.98 ? 105 ARG A CD  1 
ATOM   775   N NE  . ARG A 1 105 ? 24.221  32.118  4.247   1.00 26.64 ? 105 ARG A NE  1 
ATOM   776   C CZ  . ARG A 1 105 ? 25.556  32.269  4.052   1.00 26.93 ? 105 ARG A CZ  1 
ATOM   777   N NH1 . ARG A 1 105 ? 26.466  32.326  5.044   1.00 26.99 ? 105 ARG A NH1 1 
ATOM   778   N NH2 . ARG A 1 105 ? 26.065  32.470  2.819   1.00 26.91 ? 105 ARG A NH2 1 
ATOM   779   N N   . LEU A 1 106 ? 21.026  29.750  9.579   1.00 23.12 ? 106 LEU A N   1 
ATOM   780   C CA  . LEU A 1 106 ? 20.600  29.368  10.953  1.00 22.29 ? 106 LEU A CA  1 
ATOM   781   C C   . LEU A 1 106 ? 20.161  30.701  11.599  1.00 21.86 ? 106 LEU A C   1 
ATOM   782   O O   . LEU A 1 106 ? 20.490  31.061  12.731  1.00 21.85 ? 106 LEU A O   1 
ATOM   783   C CB  . LEU A 1 106 ? 21.720  28.646  11.629  1.00 22.16 ? 106 LEU A CB  1 
ATOM   784   C CG  . LEU A 1 106 ? 22.866  28.005  10.881  1.00 22.01 ? 106 LEU A CG  1 
ATOM   785   C CD1 . LEU A 1 106 ? 23.876  29.034  10.400  1.00 21.92 ? 106 LEU A CD1 1 
ATOM   786   C CD2 . LEU A 1 106 ? 23.581  27.022  11.819  1.00 22.07 ? 106 LEU A CD2 1 
ATOM   787   N N   . ASP A 1 107 ? 19.527  31.487  10.740  1.00 21.17 ? 107 ASP A N   1 
ATOM   788   C CA  . ASP A 1 107 ? 19.020  32.805  11.097  1.00 20.51 ? 107 ASP A CA  1 
ATOM   789   C C   . ASP A 1 107 ? 17.725  32.645  11.895  1.00 20.04 ? 107 ASP A C   1 
ATOM   790   O O   . ASP A 1 107 ? 17.532  33.381  12.880  1.00 20.22 ? 107 ASP A O   1 
ATOM   791   C CB  . ASP A 1 107 ? 18.824  33.688  9.868   1.00 20.52 ? 107 ASP A CB  1 
ATOM   792   C CG  . ASP A 1 107 ? 20.142  34.231  9.358   1.00 20.67 ? 107 ASP A CG  1 
ATOM   793   O OD1 . ASP A 1 107 ? 20.551  35.361  9.663   1.00 20.73 ? 107 ASP A OD1 1 
ATOM   794   O OD2 . ASP A 1 107 ? 20.792  33.461  8.628   1.00 20.96 ? 107 ASP A OD2 1 
ATOM   795   N N   . LEU A 1 108 ? 16.908  31.717  11.428  1.00 19.19 ? 108 LEU A N   1 
ATOM   796   C CA  . LEU A 1 108 ? 15.582  31.504  12.022  1.00 18.50 ? 108 LEU A CA  1 
ATOM   797   C C   . LEU A 1 108 ? 15.812  30.859  13.387  1.00 18.28 ? 108 LEU A C   1 
ATOM   798   O O   . LEU A 1 108 ? 14.923  30.103  13.820  1.00 18.46 ? 108 LEU A O   1 
ATOM   799   C CB  . LEU A 1 108 ? 14.708  30.702  11.096  1.00 18.34 ? 108 LEU A CB  1 
ATOM   800   C CG  . LEU A 1 108 ? 14.885  30.643  9.612   1.00 18.31 ? 108 LEU A CG  1 
ATOM   801   C CD1 . LEU A 1 108 ? 14.064  29.484  9.001   1.00 18.29 ? 108 LEU A CD1 1 
ATOM   802   C CD2 . LEU A 1 108 ? 14.433  31.931  8.944   1.00 18.30 ? 108 LEU A CD2 1 
ATOM   803   N N   . LEU A 1 109 ? 16.861  31.285  14.064  1.00 17.80 ? 109 LEU A N   1 
ATOM   804   C CA  . LEU A 1 109 ? 17.306  30.626  15.276  1.00 17.53 ? 109 LEU A CA  1 
ATOM   805   C C   . LEU A 1 109 ? 16.980  31.240  16.593  1.00 17.35 ? 109 LEU A C   1 
ATOM   806   O O   . LEU A 1 109 ? 16.393  30.483  17.421  1.00 17.49 ? 109 LEU A O   1 
ATOM   807   C CB  . LEU A 1 109 ? 18.807  30.346  15.053  1.00 17.55 ? 109 LEU A CB  1 
ATOM   808   C CG  . LEU A 1 109 ? 19.593  29.354  15.858  1.00 17.47 ? 109 LEU A CG  1 
ATOM   809   C CD1 . LEU A 1 109 ? 20.205  29.996  17.108  1.00 17.54 ? 109 LEU A CD1 1 
ATOM   810   C CD2 . LEU A 1 109 ? 18.726  28.173  16.298  1.00 17.43 ? 109 LEU A CD2 1 
ATOM   811   N N   . GLN A 1 110 ? 17.450  32.414  16.920  1.00 17.30 ? 110 GLN A N   1 
ATOM   812   C CA  . GLN A 1 110 ? 17.103  32.964  18.273  1.00 17.41 ? 110 GLN A CA  1 
ATOM   813   C C   . GLN A 1 110 ? 15.581  33.099  18.295  1.00 17.06 ? 110 GLN A C   1 
ATOM   814   O O   . GLN A 1 110 ? 14.899  32.888  19.292  1.00 17.10 ? 110 GLN A O   1 
ATOM   815   C CB  . GLN A 1 110 ? 17.869  34.203  18.693  1.00 17.89 ? 110 GLN A CB  1 
ATOM   816   C CG  . GLN A 1 110 ? 18.765  33.818  19.921  1.00 18.38 ? 110 GLN A CG  1 
ATOM   817   C CD  . GLN A 1 110 ? 20.176  34.279  19.648  1.00 18.70 ? 110 GLN A CD  1 
ATOM   818   O OE1 . GLN A 1 110 ? 20.892  33.736  18.806  1.00 18.86 ? 110 GLN A OE1 1 
ATOM   819   N NE2 . GLN A 1 110 ? 20.531  35.324  20.384  1.00 18.93 ? 110 GLN A NE2 1 
ATOM   820   N N   . ARG A 1 111 ? 15.108  33.331  17.099  1.00 16.57 ? 111 ARG A N   1 
ATOM   821   C CA  . ARG A 1 111 ? 13.743  33.464  16.667  1.00 15.85 ? 111 ARG A CA  1 
ATOM   822   C C   . ARG A 1 111 ? 12.889  32.256  17.026  1.00 15.75 ? 111 ARG A C   1 
ATOM   823   O O   . ARG A 1 111 ? 11.740  32.431  17.414  1.00 15.79 ? 111 ARG A O   1 
ATOM   824   C CB  . ARG A 1 111 ? 13.700  33.556  15.114  1.00 15.12 ? 111 ARG A CB  1 
ATOM   825   C CG  . ARG A 1 111 ? 12.260  33.792  14.549  1.00 14.18 ? 111 ARG A CG  1 
ATOM   826   C CD  . ARG A 1 111 ? 12.121  34.824  13.371  1.00 13.48 ? 111 ARG A CD  1 
ATOM   827   N NE  . ARG A 1 111 ? 13.377  35.148  12.686  1.00 12.85 ? 111 ARG A NE  1 
ATOM   828   C CZ  . ARG A 1 111 ? 13.692  34.932  11.381  1.00 12.41 ? 111 ARG A CZ  1 
ATOM   829   N NH1 . ARG A 1 111 ? 12.850  34.361  10.461  1.00 12.16 ? 111 ARG A NH1 1 
ATOM   830   N NH2 . ARG A 1 111 ? 14.866  35.257  10.896  1.00 12.19 ? 111 ARG A NH2 1 
ATOM   831   N N   . ASN A 1 112 ? 13.509  31.105  16.806  1.00 15.81 ? 112 ASN A N   1 
ATOM   832   C CA  . ASN A 1 112 ? 12.780  29.829  17.021  1.00 15.91 ? 112 ASN A CA  1 
ATOM   833   C C   . ASN A 1 112 ? 12.954  29.311  18.411  1.00 16.17 ? 112 ASN A C   1 
ATOM   834   O O   . ASN A 1 112 ? 11.902  28.986  19.024  1.00 16.23 ? 112 ASN A O   1 
ATOM   835   C CB  . ASN A 1 112 ? 13.024  28.906  15.828  1.00 15.61 ? 112 ASN A CB  1 
ATOM   836   C CG  . ASN A 1 112 ? 12.036  29.320  14.728  1.00 15.46 ? 112 ASN A CG  1 
ATOM   837   O OD1 . ASN A 1 112 ? 11.033  29.989  15.019  1.00 15.27 ? 112 ASN A OD1 1 
ATOM   838   N ND2 . ASN A 1 112 ? 12.338  28.985  13.489  1.00 15.51 ? 112 ASN A ND2 1 
ATOM   839   N N   . VAL A 1 113 ? 14.126  29.323  18.981  1.00 16.39 ? 113 VAL A N   1 
ATOM   840   C CA  . VAL A 1 113 ? 14.285  28.845  20.384  1.00 16.60 ? 113 VAL A CA  1 
ATOM   841   C C   . VAL A 1 113 ? 13.128  29.422  21.206  1.00 16.85 ? 113 VAL A C   1 
ATOM   842   O O   . VAL A 1 113 ? 12.527  28.718  22.039  1.00 16.80 ? 113 VAL A O   1 
ATOM   843   C CB  . VAL A 1 113 ? 15.711  29.144  20.833  1.00 16.53 ? 113 VAL A CB  1 
ATOM   844   C CG1 . VAL A 1 113 ? 16.172  30.544  20.440  1.00 16.52 ? 113 VAL A CG1 1 
ATOM   845   C CG2 . VAL A 1 113 ? 15.915  28.873  22.315  1.00 16.49 ? 113 VAL A CG2 1 
ATOM   846   N N   . ALA A 1 114 ? 12.749  30.640  20.818  1.00 17.04 ? 114 ALA A N   1 
ATOM   847   C CA  . ALA A 1 114 ? 11.612  31.354  21.427  1.00 17.19 ? 114 ALA A CA  1 
ATOM   848   C C   . ALA A 1 114 ? 10.372  30.527  21.101  1.00 17.44 ? 114 ALA A C   1 
ATOM   849   O O   . ALA A 1 114 ? 9.743   30.016  22.039  1.00 17.55 ? 114 ALA A O   1 
ATOM   850   C CB  . ALA A 1 114 ? 11.532  32.782  20.981  1.00 17.22 ? 114 ALA A CB  1 
ATOM   851   N N   . ILE A 1 115 ? 10.101  30.348  19.827  1.00 17.77 ? 115 ILE A N   1 
ATOM   852   C CA  . ILE A 1 115 ? 8.988   29.504  19.368  1.00 18.28 ? 115 ILE A CA  1 
ATOM   853   C C   . ILE A 1 115 ? 8.949   28.248  20.252  1.00 18.89 ? 115 ILE A C   1 
ATOM   854   O O   . ILE A 1 115 ? 7.878   27.924  20.790  1.00 19.21 ? 115 ILE A O   1 
ATOM   855   C CB  . ILE A 1 115 ? 9.048   29.178  17.862  1.00 18.10 ? 115 ILE A CB  1 
ATOM   856   C CG1 . ILE A 1 115 ? 7.625   29.004  17.265  1.00 17.95 ? 115 ILE A CG1 1 
ATOM   857   C CG2 . ILE A 1 115 ? 9.855   27.903  17.481  1.00 18.25 ? 115 ILE A CG2 1 
ATOM   858   C CD1 . ILE A 1 115 ? 7.122   30.252  16.503  1.00 17.92 ? 115 ILE A CD1 1 
ATOM   859   N N   . MET A 1 116 ? 10.118  27.686  20.524  1.00 19.42 ? 116 MET A N   1 
ATOM   860   C CA  . MET A 1 116 ? 10.233  26.457  21.308  1.00 19.85 ? 116 MET A CA  1 
ATOM   861   C C   . MET A 1 116 ? 9.857   26.674  22.764  1.00 20.25 ? 116 MET A C   1 
ATOM   862   O O   . MET A 1 116 ? 8.772   26.152  23.097  1.00 20.37 ? 116 MET A O   1 
ATOM   863   C CB  . MET A 1 116 ? 11.564  25.751  21.217  1.00 19.85 ? 116 MET A CB  1 
ATOM   864   C CG  . MET A 1 116 ? 11.963  25.363  19.841  1.00 19.90 ? 116 MET A CG  1 
ATOM   865   S SD  . MET A 1 116 ? 10.506  24.697  18.952  1.00 19.97 ? 116 MET A SD  1 
ATOM   866   C CE  . MET A 1 116 ? 11.416  23.783  17.660  1.00 19.81 ? 116 MET A CE  1 
ATOM   867   N N   . LYS A 1 117 ? 10.687  27.310  23.543  1.00 20.68 ? 117 LYS A N   1 
ATOM   868   C CA  . LYS A 1 117 ? 10.464  27.541  24.965  1.00 21.11 ? 117 LYS A CA  1 
ATOM   869   C C   . LYS A 1 117 ? 8.981   27.404  25.323  1.00 21.31 ? 117 LYS A C   1 
ATOM   870   O O   . LYS A 1 117 ? 8.649   26.831  26.367  1.00 21.52 ? 117 LYS A O   1 
ATOM   871   C CB  . LYS A 1 117 ? 10.928  28.897  25.516  1.00 21.20 ? 117 LYS A CB  1 
ATOM   872   C CG  . LYS A 1 117 ? 10.906  28.910  27.051  1.00 21.39 ? 117 LYS A CG  1 
ATOM   873   C CD  . LYS A 1 117 ? 11.060  30.251  27.698  1.00 21.43 ? 117 LYS A CD  1 
ATOM   874   C CE  . LYS A 1 117 ? 9.752   30.981  27.958  1.00 21.44 ? 117 LYS A CE  1 
ATOM   875   N NZ  . LYS A 1 117 ? 10.049  32.459  28.052  1.00 21.57 ? 117 LYS A NZ  1 
ATOM   876   N N   . ALA A 1 118 ? 8.165   27.982  24.477  1.00 21.43 ? 118 ALA A N   1 
ATOM   877   C CA  . ALA A 1 118 ? 6.723   27.936  24.506  1.00 21.66 ? 118 ALA A CA  1 
ATOM   878   C C   . ALA A 1 118 ? 6.089   26.632  24.028  1.00 21.78 ? 118 ALA A C   1 
ATOM   879   O O   . ALA A 1 118 ? 5.486   25.837  24.776  1.00 21.84 ? 118 ALA A O   1 
ATOM   880   C CB  . ALA A 1 118 ? 6.221   29.101  23.604  1.00 21.67 ? 118 ALA A CB  1 
ATOM   881   N N   . ILE A 1 119 ? 6.159   26.425  22.731  1.00 21.79 ? 119 ILE A N   1 
ATOM   882   C CA  . ILE A 1 119 ? 5.564   25.324  21.987  1.00 21.73 ? 119 ILE A CA  1 
ATOM   883   C C   . ILE A 1 119 ? 5.853   23.943  22.560  1.00 21.82 ? 119 ILE A C   1 
ATOM   884   O O   . ILE A 1 119 ? 4.918   23.226  22.932  1.00 21.57 ? 119 ILE A O   1 
ATOM   885   C CB  . ILE A 1 119 ? 5.974   25.491  20.475  1.00 21.61 ? 119 ILE A CB  1 
ATOM   886   C CG1 . ILE A 1 119 ? 5.145   26.611  19.813  1.00 21.59 ? 119 ILE A CG1 1 
ATOM   887   C CG2 . ILE A 1 119 ? 5.877   24.171  19.662  1.00 21.51 ? 119 ILE A CG2 1 
ATOM   888   C CD1 . ILE A 1 119 ? 5.021   27.995  20.460  1.00 21.39 ? 119 ILE A CD1 1 
ATOM   889   N N   . VAL A 1 120 ? 7.106   23.609  22.550  1.00 22.01 ? 120 VAL A N   1 
ATOM   890   C CA  . VAL A 1 120 ? 7.667   22.262  22.961  1.00 22.17 ? 120 VAL A CA  1 
ATOM   891   C C   . VAL A 1 120 ? 7.242   21.963  24.348  1.00 22.30 ? 120 VAL A C   1 
ATOM   892   O O   . VAL A 1 120 ? 5.978   21.769  24.527  1.00 22.39 ? 120 VAL A O   1 
ATOM   893   C CB  . VAL A 1 120 ? 9.094   22.335  22.381  1.00 22.10 ? 120 VAL A CB  1 
ATOM   894   C CG1 . VAL A 1 120 ? 9.986   23.382  23.024  1.00 22.12 ? 120 VAL A CG1 1 
ATOM   895   C CG2 . VAL A 1 120 ? 9.741   20.971  22.240  1.00 22.09 ? 120 VAL A CG2 1 
ATOM   896   N N   . PRO A 1 121 ? 8.082   21.676  25.287  1.00 22.26 ? 121 PRO A N   1 
ATOM   897   C CA  . PRO A 1 121 ? 7.734   21.523  26.714  1.00 22.24 ? 121 PRO A CA  1 
ATOM   898   C C   . PRO A 1 121 ? 6.412   22.166  27.054  1.00 22.11 ? 121 PRO A C   1 
ATOM   899   O O   . PRO A 1 121 ? 6.287   23.399  27.011  1.00 22.09 ? 121 PRO A O   1 
ATOM   900   C CB  . PRO A 1 121 ? 8.927   22.172  27.400  1.00 22.35 ? 121 PRO A CB  1 
ATOM   901   C CG  . PRO A 1 121 ? 10.058  22.076  26.395  1.00 22.35 ? 121 PRO A CG  1 
ATOM   902   C CD  . PRO A 1 121 ? 9.493   21.282  25.209  1.00 22.22 ? 121 PRO A CD  1 
ATOM   903   N N   . GLY A 1 122 ? 5.517   21.287  27.450  1.00 21.96 ? 122 GLY A N   1 
ATOM   904   C CA  . GLY A 1 122 ? 4.079   21.644  27.628  1.00 21.91 ? 122 GLY A CA  1 
ATOM   905   C C   . GLY A 1 122 ? 3.374   20.510  26.825  1.00 21.88 ? 122 GLY A C   1 
ATOM   906   O O   . GLY A 1 122 ? 2.635   19.726  27.410  1.00 22.21 ? 122 GLY A O   1 
ATOM   907   N N   . VAL A 1 123 ? 3.760   20.394  25.563  1.00 21.59 ? 123 VAL A N   1 
ATOM   908   C CA  . VAL A 1 123 ? 3.326   19.295  24.715  1.00 21.18 ? 123 VAL A CA  1 
ATOM   909   C C   . VAL A 1 123 ? 3.637   17.981  25.482  1.00 21.02 ? 123 VAL A C   1 
ATOM   910   O O   . VAL A 1 123 ? 2.882   17.033  25.511  1.00 21.12 ? 123 VAL A O   1 
ATOM   911   C CB  . VAL A 1 123 ? 3.984   19.245  23.329  1.00 21.14 ? 123 VAL A CB  1 
ATOM   912   C CG1 . VAL A 1 123 ? 4.074   20.587  22.613  1.00 21.11 ? 123 VAL A CG1 1 
ATOM   913   C CG2 . VAL A 1 123 ? 5.351   18.568  23.256  1.00 20.94 ? 123 VAL A CG2 1 
ATOM   914   N N   . ILE A 1 124 ? 4.827   17.997  26.021  1.00 20.85 ? 124 ILE A N   1 
ATOM   915   C CA  . ILE A 1 124 ? 5.427   16.875  26.750  1.00 20.70 ? 124 ILE A CA  1 
ATOM   916   C C   . ILE A 1 124 ? 4.681   16.619  28.038  1.00 20.67 ? 124 ILE A C   1 
ATOM   917   O O   . ILE A 1 124 ? 4.514   15.436  28.417  1.00 20.85 ? 124 ILE A O   1 
ATOM   918   C CB  . ILE A 1 124 ? 6.980   17.054  26.864  1.00 20.59 ? 124 ILE A CB  1 
ATOM   919   C CG1 . ILE A 1 124 ? 7.515   16.931  28.298  1.00 20.47 ? 124 ILE A CG1 1 
ATOM   920   C CG2 . ILE A 1 124 ? 7.487   18.378  26.192  1.00 20.70 ? 124 ILE A CG2 1 
ATOM   921   C CD1 . ILE A 1 124 ? 9.072   17.109  28.398  1.00 20.52 ? 124 ILE A CD1 1 
ATOM   922   N N   . GLN A 1 125 ? 4.220   17.685  28.672  1.00 20.51 ? 125 GLN A N   1 
ATOM   923   C CA  . GLN A 1 125 ? 3.517   17.510  29.962  1.00 20.38 ? 125 GLN A CA  1 
ATOM   924   C C   . GLN A 1 125 ? 2.320   16.596  29.715  1.00 20.30 ? 125 GLN A C   1 
ATOM   925   O O   . GLN A 1 125 ? 1.939   15.828  30.604  1.00 20.45 ? 125 GLN A O   1 
ATOM   926   C CB  . GLN A 1 125 ? 3.151   18.799  30.643  1.00 20.60 ? 125 GLN A CB  1 
ATOM   927   C CG  . GLN A 1 125 ? 2.697   18.567  32.080  1.00 20.92 ? 125 GLN A CG  1 
ATOM   928   C CD  . GLN A 1 125 ? 1.739   19.602  32.606  1.00 21.10 ? 125 GLN A CD  1 
ATOM   929   O OE1 . GLN A 1 125 ? 1.164   19.409  33.682  1.00 21.23 ? 125 GLN A OE1 1 
ATOM   930   N NE2 . GLN A 1 125 ? 1.509   20.689  31.870  1.00 21.17 ? 125 GLN A NE2 1 
ATOM   931   N N   . ASN A 1 126 ? 1.816   16.670  28.509  1.00 20.21 ? 126 ASN A N   1 
ATOM   932   C CA  . ASN A 1 126 ? 0.678   15.851  28.062  1.00 20.21 ? 126 ASN A CA  1 
ATOM   933   C C   . ASN A 1 126 ? 1.124   14.417  27.788  1.00 20.18 ? 126 ASN A C   1 
ATOM   934   O O   . ASN A 1 126 ? 0.709   13.555  28.589  1.00 20.34 ? 126 ASN A O   1 
ATOM   935   C CB  . ASN A 1 126 ? -0.024  16.496  26.872  1.00 20.39 ? 126 ASN A CB  1 
ATOM   936   C CG  . ASN A 1 126 ? -0.478  17.911  27.248  1.00 20.52 ? 126 ASN A CG  1 
ATOM   937   O OD1 . ASN A 1 126 ? -1.598  18.030  27.776  1.00 20.88 ? 126 ASN A OD1 1 
ATOM   938   N ND2 . ASN A 1 126 ? 0.360   18.889  26.977  1.00 20.26 ? 126 ASN A ND2 1 
ATOM   939   N N   . SER A 1 127 ? 1.837   14.193  26.698  1.00 19.98 ? 127 SER A N   1 
ATOM   940   C CA  . SER A 1 127 ? 2.311   12.831  26.380  1.00 19.94 ? 127 SER A CA  1 
ATOM   941   C C   . SER A 1 127 ? 3.743   12.681  26.888  1.00 20.13 ? 127 SER A C   1 
ATOM   942   O O   . SER A 1 127 ? 4.723   12.675  26.121  1.00 20.22 ? 127 SER A O   1 
ATOM   943   C CB  . SER A 1 127 ? 2.134   12.414  24.957  1.00 19.90 ? 127 SER A CB  1 
ATOM   944   O OG  . SER A 1 127 ? 1.645   13.352  24.054  1.00 19.81 ? 127 SER A OG  1 
ATOM   945   N N   . PRO A 1 128 ? 3.788   12.435  28.207  1.00 20.28 ? 128 PRO A N   1 
ATOM   946   C CA  . PRO A 1 128 ? 5.049   12.308  28.926  1.00 20.31 ? 128 PRO A CA  1 
ATOM   947   C C   . PRO A 1 128 ? 6.074   11.360  28.351  1.00 20.31 ? 128 PRO A C   1 
ATOM   948   O O   . PRO A 1 128 ? 7.287   11.655  28.528  1.00 20.49 ? 128 PRO A O   1 
ATOM   949   C CB  . PRO A 1 128 ? 4.600   11.819  30.314  1.00 20.36 ? 128 PRO A CB  1 
ATOM   950   C CG  . PRO A 1 128 ? 3.542   10.800  29.909  1.00 20.35 ? 128 PRO A CG  1 
ATOM   951   C CD  . PRO A 1 128 ? 2.739   11.584  28.884  1.00 20.34 ? 128 PRO A CD  1 
ATOM   952   N N   . ASP A 1 129 ? 5.648   10.248  27.783  1.00 20.06 ? 129 ASP A N   1 
ATOM   953   C CA  . ASP A 1 129 ? 6.552   9.210   27.235  1.00 19.68 ? 129 ASP A CA  1 
ATOM   954   C C   . ASP A 1 129 ? 6.607   9.330   25.703  1.00 19.10 ? 129 ASP A C   1 
ATOM   955   O O   . ASP A 1 129 ? 6.877   8.309   25.029  1.00 18.96 ? 129 ASP A O   1 
ATOM   956   C CB  . ASP A 1 129 ? 6.102   7.813   27.606  1.00 20.15 ? 129 ASP A CB  1 
ATOM   957   C CG  . ASP A 1 129 ? 5.799   7.299   28.953  1.00 20.51 ? 129 ASP A CG  1 
ATOM   958   O OD1 . ASP A 1 129 ? 6.416   7.642   29.995  1.00 20.86 ? 129 ASP A OD1 1 
ATOM   959   O OD2 . ASP A 1 129 ? 4.933   6.356   29.041  1.00 20.37 ? 129 ASP A OD2 1 
ATOM   960   N N   . CYS A 1 130 ? 6.267   10.502  25.202  1.00 18.50 ? 130 CYS A N   1 
ATOM   961   C CA  . CYS A 1 130 ? 6.202   10.719  23.749  1.00 17.85 ? 130 CYS A CA  1 
ATOM   962   C C   . CYS A 1 130 ? 7.606   10.550  23.146  1.00 17.07 ? 130 CYS A C   1 
ATOM   963   O O   . CYS A 1 130 ? 8.629   10.525  23.858  1.00 17.12 ? 130 CYS A O   1 
ATOM   964   C CB  . CYS A 1 130 ? 5.674   12.111  23.392  1.00 18.03 ? 130 CYS A CB  1 
ATOM   965   S SG  . CYS A 1 130 ? 7.099   13.266  23.339  1.00 18.76 ? 130 CYS A SG  1 
ATOM   966   N N   . LYS A 1 131 ? 7.618   10.645  21.840  1.00 15.90 ? 131 LYS A N   1 
ATOM   967   C CA  . LYS A 1 131 ? 8.910   10.559  21.098  1.00 14.89 ? 131 LYS A CA  1 
ATOM   968   C C   . LYS A 1 131 ? 8.890   11.705  20.109  1.00 14.15 ? 131 LYS A C   1 
ATOM   969   O O   . LYS A 1 131 ? 7.884   11.801  19.384  1.00 14.28 ? 131 LYS A O   1 
ATOM   970   C CB  . LYS A 1 131 ? 9.064   9.233   20.421  1.00 14.78 ? 131 LYS A CB  1 
ATOM   971   C CG  . LYS A 1 131 ? 10.188  9.151   19.419  1.00 14.64 ? 131 LYS A CG  1 
ATOM   972   C CD  . LYS A 1 131 ? 10.388  7.717   18.975  1.00 14.88 ? 131 LYS A CD  1 
ATOM   973   C CE  . LYS A 1 131 ? 11.730  7.561   18.292  1.00 15.13 ? 131 LYS A CE  1 
ATOM   974   N NZ  . LYS A 1 131 ? 11.744  7.961   16.880  1.00 15.25 ? 131 LYS A NZ  1 
ATOM   975   N N   . ILE A 1 132 ? 9.940   12.509  20.061  1.00 13.20 ? 132 ILE A N   1 
ATOM   976   C CA  . ILE A 1 132 ? 9.876   13.649  19.166  1.00 12.30 ? 132 ILE A CA  1 
ATOM   977   C C   . ILE A 1 132 ? 10.885  13.642  18.015  1.00 11.75 ? 132 ILE A C   1 
ATOM   978   O O   . ILE A 1 132 ? 12.088  13.455  18.133  1.00 11.53 ? 132 ILE A O   1 
ATOM   979   C CB  . ILE A 1 132 ? 9.940   15.027  19.927  1.00 12.25 ? 132 ILE A CB  1 
ATOM   980   C CG1 . ILE A 1 132 ? 9.384   14.979  21.346  1.00 12.08 ? 132 ILE A CG1 1 
ATOM   981   C CG2 . ILE A 1 132 ? 9.213   16.111  19.048  1.00 12.12 ? 132 ILE A CG2 1 
ATOM   982   C CD1 . ILE A 1 132 ? 9.897   16.114  22.299  1.00 11.84 ? 132 ILE A CD1 1 
ATOM   983   N N   . ILE A 1 133 ? 10.271  13.954  16.886  1.00 11.08 ? 133 ILE A N   1 
ATOM   984   C CA  . ILE A 1 133 ? 10.912  14.239  15.618  1.00 10.51 ? 133 ILE A CA  1 
ATOM   985   C C   . ILE A 1 133 ? 10.849  15.787  15.562  1.00 10.17 ? 133 ILE A C   1 
ATOM   986   O O   . ILE A 1 133 ? 9.777   16.313  15.915  1.00 10.23 ? 133 ILE A O   1 
ATOM   987   C CB  . ILE A 1 133 ? 10.229  13.600  14.384  1.00 10.39 ? 133 ILE A CB  1 
ATOM   988   C CG1 . ILE A 1 133 ? 9.996   12.089  14.593  1.00 10.50 ? 133 ILE A CG1 1 
ATOM   989   C CG2 . ILE A 1 133 ? 11.064  13.853  13.096  1.00 10.37 ? 133 ILE A CG2 1 
ATOM   990   C CD1 . ILE A 1 133 ? 9.147   11.381  13.502  1.00 10.44 ? 133 ILE A CD1 1 
ATOM   991   N N   . VAL A 1 134 ? 11.956  16.414  15.331  1.00 9.78  ? 134 VAL A N   1 
ATOM   992   C CA  . VAL A 1 134 ? 11.979  17.903  15.267  1.00 9.56  ? 134 VAL A CA  1 
ATOM   993   C C   . VAL A 1 134 ? 12.225  18.204  13.801  1.00 9.66  ? 134 VAL A C   1 
ATOM   994   O O   . VAL A 1 134 ? 13.196  17.666  13.225  1.00 9.91  ? 134 VAL A O   1 
ATOM   995   C CB  . VAL A 1 134 ? 12.974  18.469  16.284  1.00 9.43  ? 134 VAL A CB  1 
ATOM   996   C CG1 . VAL A 1 134 ? 13.346  19.929  15.997  1.00 9.40  ? 134 VAL A CG1 1 
ATOM   997   C CG2 . VAL A 1 134 ? 12.545  18.356  17.751  1.00 8.98  ? 134 VAL A CG2 1 
ATOM   998   N N   . VAL A 1 135 ? 11.322  18.929  13.178  1.00 9.60  ? 135 VAL A N   1 
ATOM   999   C CA  . VAL A 1 135 ? 11.490  19.268  11.750  1.00 9.41  ? 135 VAL A CA  1 
ATOM   1000  C C   . VAL A 1 135 ? 11.944  20.713  11.586  1.00 9.91  ? 135 VAL A C   1 
ATOM   1001  O O   . VAL A 1 135 ? 12.794  20.947  10.692  1.00 10.16 ? 135 VAL A O   1 
ATOM   1002  C CB  . VAL A 1 135 ? 10.215  18.939  10.971  1.00 8.97  ? 135 VAL A CB  1 
ATOM   1003  C CG1 . VAL A 1 135 ? 10.439  18.955  9.462   1.00 8.75  ? 135 VAL A CG1 1 
ATOM   1004  C CG2 . VAL A 1 135 ? 9.601   17.633  11.433  1.00 8.87  ? 135 VAL A CG2 1 
ATOM   1005  N N   . THR A 1 136 ? 11.481  21.611  12.452  1.00 10.05 ? 136 THR A N   1 
ATOM   1006  C CA  . THR A 1 136 ? 11.739  23.041  12.326  1.00 10.24 ? 136 THR A CA  1 
ATOM   1007  C C   . THR A 1 136 ? 13.053  23.399  11.703  1.00 10.24 ? 136 THR A C   1 
ATOM   1008  O O   . THR A 1 136 ? 12.712  23.939  10.554  1.00 10.22 ? 136 THR A O   1 
ATOM   1009  C CB  . THR A 1 136 ? 11.419  23.911  13.603  1.00 10.45 ? 136 THR A CB  1 
ATOM   1010  O OG1 . THR A 1 136 ? 12.474  23.556  14.556  1.00 10.93 ? 136 THR A OG1 1 
ATOM   1011  C CG2 . THR A 1 136 ? 10.005  23.692  14.112  1.00 10.35 ? 136 THR A CG2 1 
ATOM   1012  N N   . ASN A 1 137 ? 14.293  23.501  12.218  1.00 10.22 ? 137 ASN A N   1 
ATOM   1013  C CA  . ASN A 1 137 ? 15.346  23.733  11.227  1.00 10.50 ? 137 ASN A CA  1 
ATOM   1014  C C   . ASN A 1 137 ? 16.801  23.669  11.043  1.00 10.61 ? 137 ASN A C   1 
ATOM   1015  O O   . ASN A 1 137 ? 17.172  22.845  10.085  1.00 10.67 ? 137 ASN A O   1 
ATOM   1016  C CB  . ASN A 1 137 ? 15.027  25.233  10.607  1.00 10.40 ? 137 ASN A CB  1 
ATOM   1017  C CG  . ASN A 1 137 ? 15.010  25.018  9.089   1.00 10.42 ? 137 ASN A CG  1 
ATOM   1018  O OD1 . ASN A 1 137 ? 14.308  25.770  8.393   1.00 10.58 ? 137 ASN A OD1 1 
ATOM   1019  N ND2 . ASN A 1 137 ? 15.657  23.993  8.521   1.00 10.25 ? 137 ASN A ND2 1 
ATOM   1020  N N   . PRO A 1 138 ? 17.891  24.065  11.684  1.00 10.67 ? 138 PRO A N   1 
ATOM   1021  C CA  . PRO A 1 138 ? 17.867  24.590  13.100  1.00 10.41 ? 138 PRO A CA  1 
ATOM   1022  C C   . PRO A 1 138 ? 17.534  23.365  13.902  1.00 10.12 ? 138 PRO A C   1 
ATOM   1023  O O   . PRO A 1 138 ? 17.815  23.208  15.066  1.00 10.08 ? 138 PRO A O   1 
ATOM   1024  C CB  . PRO A 1 138 ? 17.160  25.884  12.910  1.00 10.34 ? 138 PRO A CB  1 
ATOM   1025  C CG  . PRO A 1 138 ? 17.905  26.447  11.695  1.00 10.41 ? 138 PRO A CG  1 
ATOM   1026  C CD  . PRO A 1 138 ? 18.627  25.243  11.016  1.00 10.54 ? 138 PRO A CD  1 
ATOM   1027  N N   . VAL A 1 139 ? 17.254  22.311  13.165  1.00 9.76  ? 139 VAL A N   1 
ATOM   1028  C CA  . VAL A 1 139 ? 16.882  20.979  13.533  1.00 9.67  ? 139 VAL A CA  1 
ATOM   1029  C C   . VAL A 1 139 ? 17.915  20.565  14.580  1.00 9.70  ? 139 VAL A C   1 
ATOM   1030  O O   . VAL A 1 139 ? 17.569  20.221  15.696  1.00 9.76  ? 139 VAL A O   1 
ATOM   1031  C CB  . VAL A 1 139 ? 16.810  20.150  12.237  1.00 9.50  ? 139 VAL A CB  1 
ATOM   1032  C CG1 . VAL A 1 139 ? 15.565  20.483  11.446  1.00 9.40  ? 139 VAL A CG1 1 
ATOM   1033  C CG2 . VAL A 1 139 ? 18.034  20.360  11.355  1.00 9.35  ? 139 VAL A CG2 1 
ATOM   1034  N N   . ASP A 1 140 ? 19.149  20.806  14.182  1.00 9.73  ? 140 ASP A N   1 
ATOM   1035  C CA  . ASP A 1 140 ? 20.325  20.490  15.018  1.00 9.79  ? 140 ASP A CA  1 
ATOM   1036  C C   . ASP A 1 140 ? 20.107  21.260  16.326  1.00 9.88  ? 140 ASP A C   1 
ATOM   1037  O O   . ASP A 1 140 ? 19.491  20.782  17.304  1.00 9.80  ? 140 ASP A O   1 
ATOM   1038  C CB  . ASP A 1 140 ? 21.597  20.772  14.244  1.00 9.88  ? 140 ASP A CB  1 
ATOM   1039  C CG  . ASP A 1 140 ? 21.642  20.280  12.807  1.00 10.12 ? 140 ASP A CG  1 
ATOM   1040  O OD1 . ASP A 1 140 ? 21.853  21.089  11.863  1.00 10.03 ? 140 ASP A OD1 1 
ATOM   1041  O OD2 . ASP A 1 140 ? 21.481  19.063  12.534  1.00 9.94  ? 140 ASP A OD2 1 
ATOM   1042  N N   . ILE A 1 141 ? 20.389  22.532  16.248  1.00 10.02 ? 141 ILE A N   1 
ATOM   1043  C CA  . ILE A 1 141 ? 20.323  23.480  17.359  1.00 10.18 ? 141 ILE A CA  1 
ATOM   1044  C C   . ILE A 1 141 ? 19.014  23.463  18.115  1.00 10.39 ? 141 ILE A C   1 
ATOM   1045  O O   . ILE A 1 141 ? 18.977  23.738  19.332  1.00 10.67 ? 141 ILE A O   1 
ATOM   1046  C CB  . ILE A 1 141 ? 20.745  24.916  16.852  1.00 10.05 ? 141 ILE A CB  1 
ATOM   1047  C CG1 . ILE A 1 141 ? 21.720  24.770  15.675  1.00 9.96  ? 141 ILE A CG1 1 
ATOM   1048  C CG2 . ILE A 1 141 ? 21.328  25.724  18.051  1.00 10.16 ? 141 ILE A CG2 1 
ATOM   1049  C CD1 . ILE A 1 141 ? 22.692  25.877  15.308  1.00 9.91  ? 141 ILE A CD1 1 
ATOM   1050  N N   . LEU A 1 142 ? 17.938  23.146  17.472  1.00 10.54 ? 142 LEU A N   1 
ATOM   1051  C CA  . LEU A 1 142 ? 16.573  23.065  18.001  1.00 10.56 ? 142 LEU A CA  1 
ATOM   1052  C C   . LEU A 1 142 ? 16.449  21.732  18.698  1.00 10.92 ? 142 LEU A C   1 
ATOM   1053  O O   . LEU A 1 142 ? 16.067  21.699  19.884  1.00 10.97 ? 142 LEU A O   1 
ATOM   1054  C CB  . LEU A 1 142 ? 15.646  23.427  16.855  1.00 10.47 ? 142 LEU A CB  1 
ATOM   1055  C CG  . LEU A 1 142 ? 15.876  24.792  16.208  1.00 10.40 ? 142 LEU A CG  1 
ATOM   1056  C CD1 . LEU A 1 142 ? 14.881  25.073  15.091  1.00 10.44 ? 142 LEU A CD1 1 
ATOM   1057  C CD2 . LEU A 1 142 ? 15.763  25.899  17.263  1.00 10.55 ? 142 LEU A CD2 1 
ATOM   1058  N N   . THR A 1 143 ? 16.898  20.669  18.042  1.00 11.29 ? 143 THR A N   1 
ATOM   1059  C CA  . THR A 1 143 ? 16.941  19.328  18.658  1.00 11.60 ? 143 THR A CA  1 
ATOM   1060  C C   . THR A 1 143 ? 17.565  19.538  20.057  1.00 12.09 ? 143 THR A C   1 
ATOM   1061  O O   . THR A 1 143 ? 17.016  19.113  21.070  1.00 11.98 ? 143 THR A O   1 
ATOM   1062  C CB  . THR A 1 143 ? 17.694  18.239  17.855  1.00 11.46 ? 143 THR A CB  1 
ATOM   1063  O OG1 . THR A 1 143 ? 16.849  17.733  16.768  1.00 11.41 ? 143 THR A OG1 1 
ATOM   1064  C CG2 . THR A 1 143 ? 18.148  17.025  18.700  1.00 11.68 ? 143 THR A CG2 1 
ATOM   1065  N N   . TYR A 1 144 ? 18.672  20.288  20.013  1.00 12.57 ? 144 TYR A N   1 
ATOM   1066  C CA  . TYR A 1 144 ? 19.432  20.627  21.223  1.00 12.87 ? 144 TYR A CA  1 
ATOM   1067  C C   . TYR A 1 144 ? 18.545  21.399  22.189  1.00 12.98 ? 144 TYR A C   1 
ATOM   1068  O O   . TYR A 1 144 ? 18.375  20.979  23.348  1.00 13.07 ? 144 TYR A O   1 
ATOM   1069  C CB  . TYR A 1 144 ? 20.718  21.367  20.881  1.00 13.17 ? 144 TYR A CB  1 
ATOM   1070  C CG  . TYR A 1 144 ? 21.445  21.957  22.067  1.00 13.63 ? 144 TYR A CG  1 
ATOM   1071  C CD1 . TYR A 1 144 ? 21.366  23.316  22.367  1.00 13.62 ? 144 TYR A CD1 1 
ATOM   1072  C CD2 . TYR A 1 144 ? 22.187  21.135  22.929  1.00 13.87 ? 144 TYR A CD2 1 
ATOM   1073  C CE1 . TYR A 1 144 ? 22.028  23.864  23.454  1.00 13.63 ? 144 TYR A CE1 1 
ATOM   1074  C CE2 . TYR A 1 144 ? 22.824  21.676  24.050  1.00 13.95 ? 144 TYR A CE2 1 
ATOM   1075  C CZ  . TYR A 1 144 ? 22.727  23.045  24.313  1.00 13.76 ? 144 TYR A CZ  1 
ATOM   1076  O OH  . TYR A 1 144 ? 23.370  23.523  25.421  1.00 13.78 ? 144 TYR A OH  1 
ATOM   1077  N N   . VAL A 1 145 ? 18.030  22.510  21.728  1.00 13.20 ? 145 VAL A N   1 
ATOM   1078  C CA  . VAL A 1 145 ? 17.063  23.318  22.511  1.00 13.48 ? 145 VAL A CA  1 
ATOM   1079  C C   . VAL A 1 145 ? 16.025  22.365  23.130  1.00 13.87 ? 145 VAL A C   1 
ATOM   1080  O O   . VAL A 1 145 ? 16.001  22.189  24.345  1.00 13.90 ? 145 VAL A O   1 
ATOM   1081  C CB  . VAL A 1 145 ? 16.424  24.417  21.644  1.00 13.12 ? 145 VAL A CB  1 
ATOM   1082  C CG1 . VAL A 1 145 ? 15.288  25.134  22.346  1.00 12.94 ? 145 VAL A CG1 1 
ATOM   1083  C CG2 . VAL A 1 145 ? 17.427  25.419  21.128  1.00 12.99 ? 145 VAL A CG2 1 
ATOM   1084  N N   . VAL A 1 146 ? 15.249  21.726  22.271  1.00 14.29 ? 146 VAL A N   1 
ATOM   1085  C CA  . VAL A 1 146 ? 14.185  20.836  22.707  1.00 15.01 ? 146 VAL A CA  1 
ATOM   1086  C C   . VAL A 1 146 ? 14.748  19.803  23.686  1.00 15.48 ? 146 VAL A C   1 
ATOM   1087  O O   . VAL A 1 146 ? 14.201  19.638  24.792  1.00 15.50 ? 146 VAL A O   1 
ATOM   1088  C CB  . VAL A 1 146 ? 13.386  20.232  21.550  1.00 15.02 ? 146 VAL A CB  1 
ATOM   1089  C CG1 . VAL A 1 146 ? 12.535  21.249  20.807  1.00 14.97 ? 146 VAL A CG1 1 
ATOM   1090  C CG2 . VAL A 1 146 ? 14.260  19.505  20.558  1.00 15.22 ? 146 VAL A CG2 1 
ATOM   1091  N N   . TRP A 1 147 ? 15.827  19.165  23.282  1.00 16.08 ? 147 TRP A N   1 
ATOM   1092  C CA  . TRP A 1 147 ? 16.467  18.121  24.087  1.00 16.59 ? 147 TRP A CA  1 
ATOM   1093  C C   . TRP A 1 147 ? 16.511  18.601  25.555  1.00 16.92 ? 147 TRP A C   1 
ATOM   1094  O O   . TRP A 1 147 ? 16.068  17.940  26.481  1.00 16.95 ? 147 TRP A O   1 
ATOM   1095  C CB  . TRP A 1 147 ? 17.890  17.756  23.631  1.00 16.61 ? 147 TRP A CB  1 
ATOM   1096  C CG  . TRP A 1 147 ? 18.535  16.775  24.557  1.00 16.75 ? 147 TRP A CG  1 
ATOM   1097  C CD1 . TRP A 1 147 ? 18.045  15.539  24.891  1.00 16.96 ? 147 TRP A CD1 1 
ATOM   1098  C CD2 . TRP A 1 147 ? 19.714  16.951  25.340  1.00 16.77 ? 147 TRP A CD2 1 
ATOM   1099  N NE1 . TRP A 1 147 ? 18.872  14.917  25.801  1.00 16.97 ? 147 TRP A NE1 1 
ATOM   1100  C CE2 . TRP A 1 147 ? 19.893  15.775  26.095  1.00 16.88 ? 147 TRP A CE2 1 
ATOM   1101  C CE3 . TRP A 1 147 ? 20.651  17.970  25.436  1.00 16.78 ? 147 TRP A CE3 1 
ATOM   1102  C CZ2 . TRP A 1 147 ? 20.969  15.590  26.951  1.00 16.89 ? 147 TRP A CZ2 1 
ATOM   1103  C CZ3 . TRP A 1 147 ? 21.733  17.767  26.272  1.00 16.79 ? 147 TRP A CZ3 1 
ATOM   1104  C CH2 . TRP A 1 147 ? 21.883  16.623  27.028  1.00 16.84 ? 147 TRP A CH2 1 
ATOM   1105  N N   . LYS A 1 148 ? 17.131  19.749  25.631  1.00 17.18 ? 148 LYS A N   1 
ATOM   1106  C CA  . LYS A 1 148 ? 17.454  20.534  26.801  1.00 17.36 ? 148 LYS A CA  1 
ATOM   1107  C C   . LYS A 1 148 ? 16.210  20.960  27.570  1.00 17.79 ? 148 LYS A C   1 
ATOM   1108  O O   . LYS A 1 148 ? 16.017  20.684  28.754  1.00 17.87 ? 148 LYS A O   1 
ATOM   1109  C CB  . LYS A 1 148 ? 18.145  21.803  26.299  1.00 17.14 ? 148 LYS A CB  1 
ATOM   1110  C CG  . LYS A 1 148 ? 19.273  22.430  27.015  1.00 16.89 ? 148 LYS A CG  1 
ATOM   1111  C CD  . LYS A 1 148 ? 20.611  21.747  26.751  1.00 16.80 ? 148 LYS A CD  1 
ATOM   1112  C CE  . LYS A 1 148 ? 20.765  20.482  27.590  1.00 16.64 ? 148 LYS A CE  1 
ATOM   1113  N NZ  . LYS A 1 148 ? 22.209  20.188  27.786  1.00 16.57 ? 148 LYS A NZ  1 
ATOM   1114  N N   . ILE A 1 149 ? 15.348  21.619  26.823  1.00 18.32 ? 149 ILE A N   1 
ATOM   1115  C CA  . ILE A 1 149 ? 14.114  22.234  27.300  1.00 18.88 ? 149 ILE A CA  1 
ATOM   1116  C C   . ILE A 1 149 ? 13.094  21.199  27.705  1.00 19.13 ? 149 ILE A C   1 
ATOM   1117  O O   . ILE A 1 149 ? 12.269  21.488  28.601  1.00 19.19 ? 149 ILE A O   1 
ATOM   1118  C CB  . ILE A 1 149 ? 13.627  23.285  26.235  1.00 19.05 ? 149 ILE A CB  1 
ATOM   1119  C CG1 . ILE A 1 149 ? 12.832  24.420  26.950  1.00 19.26 ? 149 ILE A CG1 1 
ATOM   1120  C CG2 . ILE A 1 149 ? 12.853  22.675  25.058  1.00 18.99 ? 149 ILE A CG2 1 
ATOM   1121  C CD1 . ILE A 1 149 ? 13.771  25.383  27.792  1.00 19.31 ? 149 ILE A CD1 1 
ATOM   1122  N N   . SER A 1 150 ? 13.190  20.022  27.115  1.00 19.45 ? 150 SER A N   1 
ATOM   1123  C CA  . SER A 1 150 ? 12.260  18.921  27.448  1.00 19.83 ? 150 SER A CA  1 
ATOM   1124  C C   . SER A 1 150 ? 12.838  18.145  28.632  1.00 20.06 ? 150 SER A C   1 
ATOM   1125  O O   . SER A 1 150 ? 12.240  18.112  29.728  1.00 20.26 ? 150 SER A O   1 
ATOM   1126  C CB  . SER A 1 150 ? 11.995  18.030  26.269  1.00 19.80 ? 150 SER A CB  1 
ATOM   1127  O OG  . SER A 1 150 ? 13.037  17.048  26.188  1.00 20.07 ? 150 SER A OG  1 
ATOM   1128  N N   . GLY A 1 151 ? 13.982  17.539  28.419  1.00 20.20 ? 151 GLY A N   1 
ATOM   1129  C CA  . GLY A 1 151 ? 14.677  16.793  29.458  1.00 20.70 ? 151 GLY A CA  1 
ATOM   1130  C C   . GLY A 1 151 ? 14.492  15.293  29.421  1.00 20.89 ? 151 GLY A C   1 
ATOM   1131  O O   . GLY A 1 151 ? 14.671  14.625  30.477  1.00 21.02 ? 151 GLY A O   1 
ATOM   1132  N N   . PHE A 1 152 ? 14.097  14.769  28.270  1.00 20.87 ? 152 PHE A N   1 
ATOM   1133  C CA  . PHE A 1 152 ? 14.002  13.282  28.186  1.00 20.81 ? 152 PHE A CA  1 
ATOM   1134  C C   . PHE A 1 152 ? 15.180  12.811  27.314  1.00 20.53 ? 152 PHE A C   1 
ATOM   1135  O O   . PHE A 1 152 ? 15.780  13.591  26.586  1.00 20.39 ? 152 PHE A O   1 
ATOM   1136  C CB  . PHE A 1 152 ? 12.682  12.737  27.845  1.00 21.03 ? 152 PHE A CB  1 
ATOM   1137  C CG  . PHE A 1 152 ? 11.653  13.337  26.984  1.00 21.07 ? 152 PHE A CG  1 
ATOM   1138  C CD1 . PHE A 1 152 ? 11.796  13.352  25.604  1.00 21.09 ? 152 PHE A CD1 1 
ATOM   1139  C CD2 . PHE A 1 152 ? 10.441  13.775  27.555  1.00 21.08 ? 152 PHE A CD2 1 
ATOM   1140  C CE1 . PHE A 1 152 ? 10.792  13.877  24.803  1.00 21.22 ? 152 PHE A CE1 1 
ATOM   1141  C CE2 . PHE A 1 152 ? 9.411   14.277  26.762  1.00 21.07 ? 152 PHE A CE2 1 
ATOM   1142  C CZ  . PHE A 1 152 ? 9.602   14.325  25.379  1.00 21.14 ? 152 PHE A CZ  1 
ATOM   1143  N N   . PRO A 1 153 ? 15.501  11.549  27.509  1.00 20.43 ? 153 PRO A N   1 
ATOM   1144  C CA  . PRO A 1 153 ? 16.605  10.889  26.825  1.00 20.27 ? 153 PRO A CA  1 
ATOM   1145  C C   . PRO A 1 153 ? 16.599  11.131  25.340  1.00 20.04 ? 153 PRO A C   1 
ATOM   1146  O O   . PRO A 1 153 ? 15.553  10.925  24.697  1.00 20.20 ? 153 PRO A O   1 
ATOM   1147  C CB  . PRO A 1 153 ? 16.419  9.400   27.110  1.00 20.38 ? 153 PRO A CB  1 
ATOM   1148  C CG  . PRO A 1 153 ? 14.995  9.288   27.623  1.00 20.53 ? 153 PRO A CG  1 
ATOM   1149  C CD  . PRO A 1 153 ? 14.831  10.589  28.430  1.00 20.50 ? 153 PRO A CD  1 
ATOM   1150  N N   . VAL A 1 154 ? 17.707  11.684  24.830  1.00 19.65 ? 154 VAL A N   1 
ATOM   1151  C CA  . VAL A 1 154 ? 17.845  11.681  23.352  1.00 19.08 ? 154 VAL A CA  1 
ATOM   1152  C C   . VAL A 1 154 ? 17.720  10.152  23.050  1.00 18.71 ? 154 VAL A C   1 
ATOM   1153  O O   . VAL A 1 154 ? 18.283  9.342   23.795  1.00 18.72 ? 154 VAL A O   1 
ATOM   1154  C CB  . VAL A 1 154 ? 19.110  12.264  22.794  1.00 19.17 ? 154 VAL A CB  1 
ATOM   1155  C CG1 . VAL A 1 154 ? 20.411  11.646  23.285  1.00 18.96 ? 154 VAL A CG1 1 
ATOM   1156  C CG2 . VAL A 1 154 ? 19.032  12.180  21.257  1.00 19.23 ? 154 VAL A CG2 1 
ATOM   1157  N N   . GLY A 1 155 ? 17.052  9.916   21.987  1.00 18.18 ? 155 GLY A N   1 
ATOM   1158  C CA  . GLY A 1 155 ? 16.610  8.507   21.635  1.00 17.32 ? 155 GLY A CA  1 
ATOM   1159  C C   . GLY A 1 155 ? 15.127  8.912   21.323  1.00 16.85 ? 155 GLY A C   1 
ATOM   1160  O O   . GLY A 1 155 ? 14.712  8.975   20.189  1.00 16.95 ? 155 GLY A O   1 
ATOM   1161  N N   . ARG A 1 156 ? 14.610  9.526   22.389  1.00 16.27 ? 156 ARG A N   1 
ATOM   1162  C CA  . ARG A 1 156 ? 13.224  10.056  22.335  1.00 15.62 ? 156 ARG A CA  1 
ATOM   1163  C C   . ARG A 1 156 ? 13.277  11.302  21.477  1.00 14.97 ? 156 ARG A C   1 
ATOM   1164  O O   . ARG A 1 156 ? 12.671  11.290  20.395  1.00 14.92 ? 156 ARG A O   1 
ATOM   1165  C CB  . ARG A 1 156 ? 12.585  10.210  23.705  1.00 15.70 ? 156 ARG A CB  1 
ATOM   1166  C CG  . ARG A 1 156 ? 12.579  8.886   24.509  1.00 15.60 ? 156 ARG A CG  1 
ATOM   1167  C CD  . ARG A 1 156 ? 11.331  8.620   25.195  1.00 15.68 ? 156 ARG A CD  1 
ATOM   1168  N NE  . ARG A 1 156 ? 11.255  8.839   26.619  1.00 15.92 ? 156 ARG A NE  1 
ATOM   1169  C CZ  . ARG A 1 156 ? 10.295  9.597   27.187  1.00 16.19 ? 156 ARG A CZ  1 
ATOM   1170  N NH1 . ARG A 1 156 ? 9.376   10.262  26.474  1.00 16.17 ? 156 ARG A NH1 1 
ATOM   1171  N NH2 . ARG A 1 156 ? 10.108  9.552   28.516  1.00 16.29 ? 156 ARG A NH2 1 
ATOM   1172  N N   . VAL A 1 157 ? 14.164  12.205  21.795  1.00 14.36 ? 157 VAL A N   1 
ATOM   1173  C CA  . VAL A 1 157 ? 14.298  13.500  21.067  1.00 13.70 ? 157 VAL A CA  1 
ATOM   1174  C C   . VAL A 1 157 ? 15.207  13.420  19.856  1.00 12.87 ? 157 VAL A C   1 
ATOM   1175  O O   . VAL A 1 157 ? 16.449  13.560  19.948  1.00 12.82 ? 157 VAL A O   1 
ATOM   1176  C CB  . VAL A 1 157 ? 14.714  14.548  22.134  1.00 13.80 ? 157 VAL A CB  1 
ATOM   1177  C CG1 . VAL A 1 157 ? 15.129  15.878  21.539  1.00 13.83 ? 157 VAL A CG1 1 
ATOM   1178  C CG2 . VAL A 1 157 ? 13.608  14.714  23.180  1.00 13.70 ? 157 VAL A CG2 1 
ATOM   1179  N N   . ILE A 1 158 ? 14.594  13.336  18.690  1.00 11.89 ? 158 ILE A N   1 
ATOM   1180  C CA  . ILE A 1 158 ? 15.309  13.171  17.428  1.00 11.06 ? 158 ILE A CA  1 
ATOM   1181  C C   . ILE A 1 158 ? 15.024  14.316  16.458  1.00 10.69 ? 158 ILE A C   1 
ATOM   1182  O O   . ILE A 1 158 ? 14.023  15.045  16.604  1.00 10.93 ? 158 ILE A O   1 
ATOM   1183  C CB  . ILE A 1 158 ? 14.990  11.806  16.716  1.00 10.80 ? 158 ILE A CB  1 
ATOM   1184  C CG1 . ILE A 1 158 ? 14.617  10.743  17.749  1.00 10.66 ? 158 ILE A CG1 1 
ATOM   1185  C CG2 . ILE A 1 158 ? 16.164  11.369  15.793  1.00 10.63 ? 158 ILE A CG2 1 
ATOM   1186  C CD1 . ILE A 1 158 ? 14.208  9.385   17.157  1.00 10.74 ? 158 ILE A CD1 1 
ATOM   1187  N N   . GLY A 1 159 ? 15.840  14.358  15.404  1.00 9.83  ? 159 GLY A N   1 
ATOM   1188  C CA  . GLY A 1 159 ? 15.729  15.399  14.425  1.00 8.82  ? 159 GLY A CA  1 
ATOM   1189  C C   . GLY A 1 159 ? 15.965  14.963  13.004  1.00 8.30  ? 159 GLY A C   1 
ATOM   1190  O O   . GLY A 1 159 ? 16.848  14.207  12.631  1.00 8.08  ? 159 GLY A O   1 
ATOM   1191  N N   . SER A 1 160 ? 15.165  15.576  12.163  1.00 8.00  ? 160 SER A N   1 
ATOM   1192  C CA  . SER A 1 160 ? 15.101  15.489  10.729  1.00 7.59  ? 160 SER A CA  1 
ATOM   1193  C C   . SER A 1 160 ? 16.488  15.349  10.119  1.00 7.07  ? 160 SER A C   1 
ATOM   1194  O O   . SER A 1 160 ? 16.622  14.789  9.025   1.00 7.04  ? 160 SER A O   1 
ATOM   1195  C CB  . SER A 1 160 ? 14.475  16.782  10.150  1.00 7.74  ? 160 SER A CB  1 
ATOM   1196  O OG  . SER A 1 160 ? 15.353  17.845  10.514  1.00 7.89  ? 160 SER A OG  1 
ATOM   1197  N N   . GLY A 1 161 ? 17.420  16.016  10.769  1.00 6.56  ? 161 GLY A N   1 
ATOM   1198  C CA  . GLY A 1 161 ? 18.825  15.969  10.332  1.00 6.21  ? 161 GLY A CA  1 
ATOM   1199  C C   . GLY A 1 161 ? 18.955  15.990  8.823   1.00 5.88  ? 161 GLY A C   1 
ATOM   1200  O O   . GLY A 1 161 ? 18.253  16.738  8.137   1.00 5.77  ? 161 GLY A O   1 
ATOM   1201  N N   . CYS A 1 162 ? 19.742  15.052  8.324   1.00 5.80  ? 162 CYS A N   1 
ATOM   1202  C CA  . CYS A 1 162 ? 20.105  14.991  6.893   1.00 5.64  ? 162 CYS A CA  1 
ATOM   1203  C C   . CYS A 1 162 ? 19.435  13.891  6.139   1.00 5.53  ? 162 CYS A C   1 
ATOM   1204  O O   . CYS A 1 162 ? 19.705  13.678  4.920   1.00 5.66  ? 162 CYS A O   1 
ATOM   1205  C CB  . CYS A 1 162 ? 21.652  14.884  6.834   1.00 5.51  ? 162 CYS A CB  1 
ATOM   1206  S SG  . CYS A 1 162 ? 22.293  15.885  8.231   1.00 5.92  ? 162 CYS A SG  1 
ATOM   1207  N N   . ASN A 1 163 ? 18.555  13.187  6.837   1.00 5.09  ? 163 ASN A N   1 
ATOM   1208  C CA  . ASN A 1 163 ? 17.798  12.077  6.190   1.00 4.75  ? 163 ASN A CA  1 
ATOM   1209  C C   . ASN A 1 163 ? 17.389  12.614  4.809   1.00 4.44  ? 163 ASN A C   1 
ATOM   1210  O O   . ASN A 1 163 ? 17.714  12.145  3.746   1.00 4.30  ? 163 ASN A O   1 
ATOM   1211  C CB  . ASN A 1 163 ? 16.668  11.670  7.116   1.00 4.91  ? 163 ASN A CB  1 
ATOM   1212  C CG  . ASN A 1 163 ? 15.893  10.554  6.429   1.00 5.08  ? 163 ASN A CG  1 
ATOM   1213  O OD1 . ASN A 1 163 ? 16.555  9.527   6.203   1.00 5.50  ? 163 ASN A OD1 1 
ATOM   1214  N ND2 . ASN A 1 163 ? 14.686  10.831  6.011   1.00 5.17  ? 163 ASN A ND2 1 
ATOM   1215  N N   . LEU A 1 164 ? 16.885  13.830  4.930   1.00 4.13  ? 164 LEU A N   1 
ATOM   1216  C CA  . LEU A 1 164 ? 16.501  14.757  3.880   1.00 3.61  ? 164 LEU A CA  1 
ATOM   1217  C C   . LEU A 1 164 ? 17.585  14.859  2.807   1.00 3.23  ? 164 LEU A C   1 
ATOM   1218  O O   . LEU A 1 164 ? 17.482  14.263  1.730   1.00 2.82  ? 164 LEU A O   1 
ATOM   1219  C CB  . LEU A 1 164 ? 16.260  16.041  4.675   1.00 3.58  ? 164 LEU A CB  1 
ATOM   1220  C CG  . LEU A 1 164 ? 15.052  16.903  4.482   1.00 3.51  ? 164 LEU A CG  1 
ATOM   1221  C CD1 . LEU A 1 164 ? 15.304  18.243  5.190   1.00 3.39  ? 164 LEU A CD1 1 
ATOM   1222  C CD2 . LEU A 1 164 ? 14.763  17.144  3.007   1.00 3.57  ? 164 LEU A CD2 1 
ATOM   1223  N N   . ASP A 1 165 ? 18.620  15.609  3.110   1.00 3.20  ? 165 ASP A N   1 
ATOM   1224  C CA  . ASP A 1 165 ? 19.823  15.852  2.319   1.00 3.28  ? 165 ASP A CA  1 
ATOM   1225  C C   . ASP A 1 165 ? 20.390  14.623  1.589   1.00 3.21  ? 165 ASP A C   1 
ATOM   1226  O O   . ASP A 1 165 ? 20.613  14.629  0.368   1.00 3.09  ? 165 ASP A O   1 
ATOM   1227  C CB  . ASP A 1 165 ? 20.949  16.442  3.205   1.00 3.19  ? 165 ASP A CB  1 
ATOM   1228  C CG  . ASP A 1 165 ? 20.505  17.740  3.875   1.00 3.20  ? 165 ASP A CG  1 
ATOM   1229  O OD1 . ASP A 1 165 ? 20.137  18.711  3.203   1.00 3.04  ? 165 ASP A OD1 1 
ATOM   1230  O OD2 . ASP A 1 165 ? 20.547  17.689  5.119   1.00 3.19  ? 165 ASP A OD2 1 
ATOM   1231  N N   . SER A 1 166 ? 20.714  13.617  2.395   1.00 3.01  ? 166 SER A N   1 
ATOM   1232  C CA  . SER A 1 166 ? 21.197  12.317  1.926   1.00 2.70  ? 166 SER A CA  1 
ATOM   1233  C C   . SER A 1 166 ? 20.321  11.780  0.790   1.00 2.59  ? 166 SER A C   1 
ATOM   1234  O O   . SER A 1 166 ? 20.792  11.152  -0.158  1.00 2.69  ? 166 SER A O   1 
ATOM   1235  C CB  . SER A 1 166 ? 21.195  11.317  3.074   1.00 2.60  ? 166 SER A CB  1 
ATOM   1236  O OG  . SER A 1 166 ? 21.355  11.972  4.312   1.00 2.29  ? 166 SER A OG  1 
ATOM   1237  N N   . ALA A 1 167 ? 19.032  11.970  0.963   1.00 2.45  ? 167 ALA A N   1 
ATOM   1238  C CA  . ALA A 1 167 ? 18.008  11.574  0.005   1.00 2.27  ? 167 ALA A CA  1 
ATOM   1239  C C   . ALA A 1 167 ? 18.116  12.497  -1.205  1.00 2.23  ? 167 ALA A C   1 
ATOM   1240  O O   . ALA A 1 167 ? 18.117  12.079  -2.365  1.00 2.06  ? 167 ALA A O   1 
ATOM   1241  C CB  . ALA A 1 167 ? 16.638  11.631  0.656   1.00 2.18  ? 167 ALA A CB  1 
ATOM   1242  N N   . ARG A 1 168 ? 18.269  13.769  -0.862  1.00 2.34  ? 168 ARG A N   1 
ATOM   1243  C CA  . ARG A 1 168 ? 18.380  14.831  -1.913  1.00 2.39  ? 168 ARG A CA  1 
ATOM   1244  C C   . ARG A 1 168 ? 19.547  14.453  -2.839  1.00 2.53  ? 168 ARG A C   1 
ATOM   1245  O O   . ARG A 1 168 ? 19.523  14.586  -4.068  1.00 2.36  ? 168 ARG A O   1 
ATOM   1246  C CB  . ARG A 1 168 ? 18.535  16.178  -1.254  1.00 2.16  ? 168 ARG A CB  1 
ATOM   1247  C CG  . ARG A 1 168 ? 17.665  17.308  -1.765  1.00 2.15  ? 168 ARG A CG  1 
ATOM   1248  C CD  . ARG A 1 168 ? 18.109  18.647  -1.267  1.00 2.21  ? 168 ARG A CD  1 
ATOM   1249  N NE  . ARG A 1 168 ? 17.583  19.012  0.042   1.00 2.09  ? 168 ARG A NE  1 
ATOM   1250  C CZ  . ARG A 1 168 ? 16.291  19.320  0.217   1.00 2.00  ? 168 ARG A CZ  1 
ATOM   1251  N NH1 . ARG A 1 168 ? 15.494  19.267  -0.853  1.00 2.08  ? 168 ARG A NH1 1 
ATOM   1252  N NH2 . ARG A 1 168 ? 15.842  19.768  1.364   1.00 2.00  ? 168 ARG A NH2 1 
ATOM   1253  N N   . PHE A 1 169 ? 20.536  13.888  -2.166  1.00 2.59  ? 169 PHE A N   1 
ATOM   1254  C CA  . PHE A 1 169 ? 21.828  13.411  -2.652  1.00 2.54  ? 169 PHE A CA  1 
ATOM   1255  C C   . PHE A 1 169 ? 21.627  12.172  -3.515  1.00 2.65  ? 169 PHE A C   1 
ATOM   1256  O O   . PHE A 1 169 ? 21.822  12.277  -4.744  1.00 2.76  ? 169 PHE A O   1 
ATOM   1257  C CB  . PHE A 1 169 ? 22.775  13.225  -1.481  1.00 2.47  ? 169 PHE A CB  1 
ATOM   1258  C CG  . PHE A 1 169 ? 24.186  12.797  -1.600  1.00 2.46  ? 169 PHE A CG  1 
ATOM   1259  C CD1 . PHE A 1 169 ? 25.102  13.442  -2.432  1.00 2.38  ? 169 PHE A CD1 1 
ATOM   1260  C CD2 . PHE A 1 169 ? 24.667  11.747  -0.789  1.00 2.54  ? 169 PHE A CD2 1 
ATOM   1261  C CE1 . PHE A 1 169 ? 26.437  13.078  -2.465  1.00 2.33  ? 169 PHE A CE1 1 
ATOM   1262  C CE2 . PHE A 1 169 ? 26.014  11.361  -0.765  1.00 2.28  ? 169 PHE A CE2 1 
ATOM   1263  C CZ  . PHE A 1 169 ? 26.884  12.037  -1.636  1.00 2.43  ? 169 PHE A CZ  1 
ATOM   1264  N N   . ARG A 1 170 ? 21.223  11.065  -2.917  1.00 2.65  ? 170 ARG A N   1 
ATOM   1265  C CA  . ARG A 1 170 ? 20.945  9.823   -3.652  1.00 2.65  ? 170 ARG A CA  1 
ATOM   1266  C C   . ARG A 1 170 ? 20.187  10.162  -4.932  1.00 2.91  ? 170 ARG A C   1 
ATOM   1267  O O   . ARG A 1 170 ? 20.366  9.509   -5.950  1.00 2.94  ? 170 ARG A O   1 
ATOM   1268  C CB  . ARG A 1 170 ? 20.169  8.779   -2.875  1.00 2.47  ? 170 ARG A CB  1 
ATOM   1269  C CG  . ARG A 1 170 ? 20.956  7.609   -2.334  1.00 2.23  ? 170 ARG A CG  1 
ATOM   1270  C CD  . ARG A 1 170 ? 20.783  7.331   -0.921  1.00 2.04  ? 170 ARG A CD  1 
ATOM   1271  N NE  . ARG A 1 170 ? 19.881  6.435   -0.382  1.00 2.00  ? 170 ARG A NE  1 
ATOM   1272  C CZ  . ARG A 1 170 ? 19.410  5.246   -0.657  1.00 2.25  ? 170 ARG A CZ  1 
ATOM   1273  N NH1 . ARG A 1 170 ? 19.641  4.439   -1.694  1.00 2.08  ? 170 ARG A NH1 1 
ATOM   1274  N NH2 . ARG A 1 170 ? 18.719  4.631   0.333   1.00 2.70  ? 170 ARG A NH2 1 
ATOM   1275  N N   . TYR A 1 171 ? 19.339  11.174  -4.840  1.00 3.40  ? 171 TYR A N   1 
ATOM   1276  C CA  . TYR A 1 171 ? 18.597  11.605  -6.030  1.00 3.99  ? 171 TYR A CA  1 
ATOM   1277  C C   . TYR A 1 171 ? 19.649  11.981  -7.085  1.00 4.54  ? 171 TYR A C   1 
ATOM   1278  O O   . TYR A 1 171 ? 19.972  11.140  -7.932  1.00 4.73  ? 171 TYR A O   1 
ATOM   1279  C CB  . TYR A 1 171 ? 17.565  12.708  -5.804  1.00 3.97  ? 171 TYR A CB  1 
ATOM   1280  C CG  . TYR A 1 171 ? 17.143  13.474  -7.053  1.00 3.77  ? 171 TYR A CG  1 
ATOM   1281  C CD1 . TYR A 1 171 ? 17.415  14.846  -7.146  1.00 3.70  ? 171 TYR A CD1 1 
ATOM   1282  C CD2 . TYR A 1 171 ? 16.674  12.817  -8.186  1.00 3.54  ? 171 TYR A CD2 1 
ATOM   1283  C CE1 . TYR A 1 171 ? 17.077  15.564  -8.291  1.00 3.62  ? 171 TYR A CE1 1 
ATOM   1284  C CE2 . TYR A 1 171 ? 16.374  13.517  -9.345  1.00 3.45  ? 171 TYR A CE2 1 
ATOM   1285  C CZ  . TYR A 1 171 ? 16.561  14.885  -9.391  1.00 3.48  ? 171 TYR A CZ  1 
ATOM   1286  O OH  . TYR A 1 171 ? 16.239  15.556  -10.527 1.00 3.47  ? 171 TYR A OH  1 
ATOM   1287  N N   . LEU A 1 172 ? 20.111  13.227  -6.991  1.00 4.96  ? 172 LEU A N   1 
ATOM   1288  C CA  . LEU A 1 172 ? 21.060  13.770  -7.953  1.00 5.29  ? 172 LEU A CA  1 
ATOM   1289  C C   . LEU A 1 172 ? 22.042  12.668  -8.410  1.00 5.64  ? 172 LEU A C   1 
ATOM   1290  O O   . LEU A 1 172 ? 22.229  12.431  -9.595  1.00 5.77  ? 172 LEU A O   1 
ATOM   1291  C CB  . LEU A 1 172 ? 21.806  14.958  -7.360  1.00 5.10  ? 172 LEU A CB  1 
ATOM   1292  C CG  . LEU A 1 172 ? 21.215  16.135  -6.684  1.00 4.79  ? 172 LEU A CG  1 
ATOM   1293  C CD1 . LEU A 1 172 ? 22.299  16.962  -5.978  1.00 4.65  ? 172 LEU A CD1 1 
ATOM   1294  C CD2 . LEU A 1 172 ? 20.538  17.055  -7.696  1.00 4.79  ? 172 LEU A CD2 1 
ATOM   1295  N N   . ILE A 1 173 ? 22.669  12.085  -7.412  1.00 6.04  ? 173 ILE A N   1 
ATOM   1296  C CA  . ILE A 1 173 ? 23.700  11.043  -7.621  1.00 6.63  ? 173 ILE A CA  1 
ATOM   1297  C C   . ILE A 1 173 ? 23.226  10.077  -8.697  1.00 7.16  ? 173 ILE A C   1 
ATOM   1298  O O   . ILE A 1 173 ? 23.859  9.915   -9.783  1.00 7.27  ? 173 ILE A O   1 
ATOM   1299  C CB  . ILE A 1 173 ? 24.069  10.489  -6.215  1.00 6.49  ? 173 ILE A CB  1 
ATOM   1300  C CG1 . ILE A 1 173 ? 25.586  10.189  -6.071  1.00 6.36  ? 173 ILE A CG1 1 
ATOM   1301  C CG2 . ILE A 1 173 ? 23.232  9.246   -5.835  1.00 6.69  ? 173 ILE A CG2 1 
ATOM   1302  C CD1 . ILE A 1 173 ? 25.979  9.754   -4.620  1.00 6.26  ? 173 ILE A CD1 1 
ATOM   1303  N N   . GLY A 1 174 ? 22.039  9.532   -8.498  1.00 7.48  ? 174 GLY A N   1 
ATOM   1304  C CA  . GLY A 1 174 ? 21.391  8.598   -9.408  1.00 7.94  ? 174 GLY A CA  1 
ATOM   1305  C C   . GLY A 1 174 ? 20.958  9.260   -10.714 1.00 8.22  ? 174 GLY A C   1 
ATOM   1306  O O   . GLY A 1 174 ? 20.690  8.549   -11.708 1.00 8.12  ? 174 GLY A O   1 
ATOM   1307  N N   . GLU A 1 175 ? 20.842  10.564  -10.685 1.00 8.65  ? 175 GLU A N   1 
ATOM   1308  C CA  . GLU A 1 175 ? 20.421  11.351  -11.877 1.00 9.31  ? 175 GLU A CA  1 
ATOM   1309  C C   . GLU A 1 175 ? 21.496  11.136  -12.933 1.00 9.14  ? 175 GLU A C   1 
ATOM   1310  O O   . GLU A 1 175 ? 21.155  11.147  -14.130 1.00 9.29  ? 175 GLU A O   1 
ATOM   1311  C CB  . GLU A 1 175 ? 20.129  12.807  -11.586 1.00 9.86  ? 175 GLU A CB  1 
ATOM   1312  C CG  . GLU A 1 175 ? 19.704  13.900  -12.485 1.00 10.67 ? 175 GLU A CG  1 
ATOM   1313  C CD  . GLU A 1 175 ? 19.816  15.371  -12.212 1.00 11.40 ? 175 GLU A CD  1 
ATOM   1314  O OE1 . GLU A 1 175 ? 18.884  16.218  -12.169 1.00 11.48 ? 175 GLU A OE1 1 
ATOM   1315  O OE2 . GLU A 1 175 ? 20.995  15.860  -12.129 1.00 11.64 ? 175 GLU A OE2 1 
ATOM   1316  N N   . LYS A 1 176 ? 22.690  10.713  -12.533 1.00 8.87  ? 176 LYS A N   1 
ATOM   1317  C CA  . LYS A 1 176 ? 23.811  10.590  -13.489 1.00 8.80  ? 176 LYS A CA  1 
ATOM   1318  C C   . LYS A 1 176 ? 24.135  9.206   -14.005 1.00 8.49  ? 176 LYS A C   1 
ATOM   1319  O O   . LYS A 1 176 ? 24.593  9.065   -15.179 1.00 8.40  ? 176 LYS A O   1 
ATOM   1320  C CB  . LYS A 1 176 ? 25.077  11.267  -12.891 1.00 8.90  ? 176 LYS A CB  1 
ATOM   1321  C CG  . LYS A 1 176 ? 25.339  12.642  -13.464 1.00 9.03  ? 176 LYS A CG  1 
ATOM   1322  C CD  . LYS A 1 176 ? 25.572  13.758  -12.504 1.00 9.29  ? 176 LYS A CD  1 
ATOM   1323  C CE  . LYS A 1 176 ? 26.755  13.645  -11.572 1.00 9.40  ? 176 LYS A CE  1 
ATOM   1324  N NZ  . LYS A 1 176 ? 26.645  14.614  -10.434 1.00 9.22  ? 176 LYS A NZ  1 
ATOM   1325  N N   . LEU A 1 177 ? 23.997  8.175   -13.193 1.00 7.97  ? 177 LEU A N   1 
ATOM   1326  C CA  . LEU A 1 177 ? 24.268  6.792   -13.558 1.00 7.44  ? 177 LEU A CA  1 
ATOM   1327  C C   . LEU A 1 177 ? 23.092  6.192   -14.347 1.00 7.25  ? 177 LEU A C   1 
ATOM   1328  O O   . LEU A 1 177 ? 23.284  5.342   -15.251 1.00 7.21  ? 177 LEU A O   1 
ATOM   1329  C CB  . LEU A 1 177 ? 24.602  6.010   -12.292 1.00 7.26  ? 177 LEU A CB  1 
ATOM   1330  C CG  . LEU A 1 177 ? 25.588  6.545   -11.301 1.00 7.27  ? 177 LEU A CG  1 
ATOM   1331  C CD1 . LEU A 1 177 ? 25.589  5.742   -9.992  1.00 7.19  ? 177 LEU A CD1 1 
ATOM   1332  C CD2 . LEU A 1 177 ? 27.000  6.485   -11.897 1.00 7.25  ? 177 LEU A CD2 1 
ATOM   1333  N N   . GLY A 1 178 ? 21.907  6.634   -13.952 1.00 6.87  ? 178 GLY A N   1 
ATOM   1334  C CA  . GLY A 1 178 ? 20.637  6.146   -14.554 1.00 6.40  ? 178 GLY A CA  1 
ATOM   1335  C C   . GLY A 1 178 ? 20.244  4.874   -13.760 1.00 5.87  ? 178 GLY A C   1 
ATOM   1336  O O   . GLY A 1 178 ? 19.951  3.834   -14.333 1.00 5.73  ? 178 GLY A O   1 
ATOM   1337  N N   . VAL A 1 179 ? 20.247  5.082   -12.476 1.00 5.45  ? 179 VAL A N   1 
ATOM   1338  C CA  . VAL A 1 179 ? 20.034  4.087   -11.427 1.00 5.00  ? 179 VAL A CA  1 
ATOM   1339  C C   . VAL A 1 179 ? 19.251  4.722   -10.287 1.00 4.89  ? 179 VAL A C   1 
ATOM   1340  O O   . VAL A 1 179 ? 19.638  5.831   -9.855  1.00 4.99  ? 179 VAL A O   1 
ATOM   1341  C CB  . VAL A 1 179 ? 21.461  3.640   -10.997 1.00 4.78  ? 179 VAL A CB  1 
ATOM   1342  C CG1 . VAL A 1 179 ? 21.477  2.935   -9.659  1.00 4.80  ? 179 VAL A CG1 1 
ATOM   1343  C CG2 . VAL A 1 179 ? 22.154  2.861   -12.080 1.00 4.49  ? 179 VAL A CG2 1 
ATOM   1344  N N   . ASN A 1 180 ? 18.360  4.016   -9.705  1.00 4.91  ? 180 ASN A N   1 
ATOM   1345  C CA  . ASN A 1 180 ? 17.421  4.487   -8.635  1.00 5.15  ? 180 ASN A CA  1 
ATOM   1346  C C   . ASN A 1 180 ? 18.151  4.822   -7.360  1.00 5.29  ? 180 ASN A C   1 
ATOM   1347  O O   . ASN A 1 180 ? 19.117  4.172   -6.940  1.00 5.25  ? 180 ASN A O   1 
ATOM   1348  C CB  . ASN A 1 180 ? 16.330  3.443   -8.650  1.00 5.29  ? 180 ASN A CB  1 
ATOM   1349  C CG  . ASN A 1 180 ? 14.913  3.817   -8.432  1.00 5.41  ? 180 ASN A CG  1 
ATOM   1350  O OD1 . ASN A 1 180 ? 14.124  3.015   -7.863  1.00 5.80  ? 180 ASN A OD1 1 
ATOM   1351  N ND2 . ASN A 1 180 ? 14.486  4.991   -8.858  1.00 5.44  ? 180 ASN A ND2 1 
ATOM   1352  N N   . PRO A 1 181 ? 17.693  5.898   -6.715  1.00 5.77  ? 181 PRO A N   1 
ATOM   1353  C CA  . PRO A 1 181 ? 18.327  6.498   -5.542  1.00 6.15  ? 181 PRO A CA  1 
ATOM   1354  C C   . PRO A 1 181 ? 18.248  5.630   -4.310  1.00 6.37  ? 181 PRO A C   1 
ATOM   1355  O O   . PRO A 1 181 ? 18.357  6.116   -3.172  1.00 6.68  ? 181 PRO A O   1 
ATOM   1356  C CB  . PRO A 1 181 ? 17.449  7.764   -5.276  1.00 6.06  ? 181 PRO A CB  1 
ATOM   1357  C CG  . PRO A 1 181 ? 16.066  7.119   -5.440  1.00 6.10  ? 181 PRO A CG  1 
ATOM   1358  C CD  . PRO A 1 181 ? 16.246  6.288   -6.724  1.00 6.09  ? 181 PRO A CD  1 
ATOM   1359  N N   . THR A 1 182 ? 17.663  4.498   -4.551  1.00 6.51  ? 182 THR A N   1 
ATOM   1360  C CA  . THR A 1 182 ? 17.408  3.437   -3.600  1.00 6.44  ? 182 THR A CA  1 
ATOM   1361  C C   . THR A 1 182 ? 18.555  2.417   -3.783  1.00 6.31  ? 182 THR A C   1 
ATOM   1362  O O   . THR A 1 182 ? 18.915  1.717   -2.881  1.00 6.26  ? 182 THR A O   1 
ATOM   1363  C CB  . THR A 1 182 ? 16.043  2.711   -3.922  1.00 6.44  ? 182 THR A CB  1 
ATOM   1364  O OG1 . THR A 1 182 ? 16.315  1.270   -3.711  1.00 6.59  ? 182 THR A OG1 1 
ATOM   1365  C CG2 . THR A 1 182 ? 15.503  2.966   -5.324  1.00 6.18  ? 182 THR A CG2 1 
ATOM   1366  N N   . SER A 1 183 ? 18.894  2.359   -5.046  1.00 6.37  ? 183 SER A N   1 
ATOM   1367  C CA  . SER A 1 183 ? 19.860  1.516   -5.665  1.00 6.67  ? 183 SER A CA  1 
ATOM   1368  C C   . SER A 1 183 ? 21.230  2.146   -5.796  1.00 6.98  ? 183 SER A C   1 
ATOM   1369  O O   . SER A 1 183 ? 22.095  1.497   -6.411  1.00 7.23  ? 183 SER A O   1 
ATOM   1370  C CB  . SER A 1 183 ? 19.334  1.045   -7.032  1.00 6.70  ? 183 SER A CB  1 
ATOM   1371  O OG  . SER A 1 183 ? 19.751  -0.307  -7.223  1.00 7.04  ? 183 SER A OG  1 
ATOM   1372  N N   . CYS A 1 184 ? 21.410  3.365   -5.384  1.00 7.33  ? 184 CYS A N   1 
ATOM   1373  C CA  . CYS A 1 184 ? 22.715  4.034   -5.281  1.00 7.63  ? 184 CYS A CA  1 
ATOM   1374  C C   . CYS A 1 184 ? 22.773  4.362   -3.774  1.00 8.01  ? 184 CYS A C   1 
ATOM   1375  O O   . CYS A 1 184 ? 21.666  4.567   -3.229  1.00 8.17  ? 184 CYS A O   1 
ATOM   1376  C CB  . CYS A 1 184 ? 22.892  5.315   -6.004  1.00 7.77  ? 184 CYS A CB  1 
ATOM   1377  S SG  . CYS A 1 184 ? 22.229  5.494   -7.656  1.00 8.65  ? 184 CYS A SG  1 
ATOM   1378  N N   . HIS A 1 185 ? 23.933  4.408   -3.209  1.00 8.41  ? 185 HIS A N   1 
ATOM   1379  C CA  . HIS A 1 185 ? 23.987  4.716   -1.741  1.00 8.82  ? 185 HIS A CA  1 
ATOM   1380  C C   . HIS A 1 185 ? 25.108  5.722   -1.564  1.00 9.32  ? 185 HIS A C   1 
ATOM   1381  O O   . HIS A 1 185 ? 26.068  5.685   -2.357  1.00 9.34  ? 185 HIS A O   1 
ATOM   1382  C CB  . HIS A 1 185 ? 24.150  3.466   -0.892  1.00 8.82  ? 185 HIS A CB  1 
ATOM   1383  C CG  . HIS A 1 185 ? 23.248  2.348   -1.330  1.00 8.81  ? 185 HIS A CG  1 
ATOM   1384  N ND1 . HIS A 1 185 ? 22.230  1.833   -0.581  1.00 8.87  ? 185 HIS A ND1 1 
ATOM   1385  C CD2 . HIS A 1 185 ? 23.202  1.680   -2.514  1.00 8.78  ? 185 HIS A CD2 1 
ATOM   1386  C CE1 . HIS A 1 185 ? 21.600  0.891   -1.283  1.00 8.82  ? 185 HIS A CE1 1 
ATOM   1387  N NE2 . HIS A 1 185 ? 22.150  0.816   -2.469  1.00 8.70  ? 185 HIS A NE2 1 
ATOM   1388  N N   . GLY A 1 186 ? 24.916  6.616   -0.630  1.00 9.80  ? 186 GLY A N   1 
ATOM   1389  C CA  . GLY A 1 186 ? 25.853  7.712   -0.303  1.00 10.33 ? 186 GLY A CA  1 
ATOM   1390  C C   . GLY A 1 186 ? 25.309  8.369   0.969   1.00 10.79 ? 186 GLY A C   1 
ATOM   1391  O O   . GLY A 1 186 ? 24.066  8.362   1.149   1.00 11.24 ? 186 GLY A O   1 
ATOM   1392  N N   . TRP A 1 187 ? 26.164  8.966   1.751   1.00 10.94 ? 187 TRP A N   1 
ATOM   1393  C CA  . TRP A 1 187 ? 25.753  9.528   3.068   1.00 11.04 ? 187 TRP A CA  1 
ATOM   1394  C C   . TRP A 1 187 ? 26.256  10.954  3.127   1.00 10.80 ? 187 TRP A C   1 
ATOM   1395  O O   . TRP A 1 187 ? 27.328  11.242  2.532   1.00 10.99 ? 187 TRP A O   1 
ATOM   1396  C CB  . TRP A 1 187 ? 26.277  8.577   4.140   1.00 11.75 ? 187 TRP A CB  1 
ATOM   1397  C CG  . TRP A 1 187 ? 25.316  7.999   5.106   1.00 12.70 ? 187 TRP A CG  1 
ATOM   1398  C CD1 . TRP A 1 187 ? 24.993  8.446   6.366   1.00 12.97 ? 187 TRP A CD1 1 
ATOM   1399  C CD2 . TRP A 1 187 ? 24.503  6.815   4.928   1.00 12.97 ? 187 TRP A CD2 1 
ATOM   1400  N NE1 . TRP A 1 187 ? 24.026  7.670   6.958   1.00 13.05 ? 187 TRP A NE1 1 
ATOM   1401  C CE2 . TRP A 1 187 ? 23.697  6.671   6.082   1.00 13.06 ? 187 TRP A CE2 1 
ATOM   1402  C CE3 . TRP A 1 187 ? 24.332  5.940   3.863   1.00 13.04 ? 187 TRP A CE3 1 
ATOM   1403  C CZ2 . TRP A 1 187 ? 22.750  5.664   6.209   1.00 13.05 ? 187 TRP A CZ2 1 
ATOM   1404  C CZ3 . TRP A 1 187 ? 23.392  4.939   3.998   1.00 13.09 ? 187 TRP A CZ3 1 
ATOM   1405  C CH2 . TRP A 1 187 ? 22.624  4.799   5.148   1.00 13.06 ? 187 TRP A CH2 1 
ATOM   1406  N N   . VAL A 1 188 ? 25.452  11.895  3.579   1.00 10.27 ? 188 VAL A N   1 
ATOM   1407  C CA  . VAL A 1 188 ? 25.887  13.286  3.763   1.00 9.89  ? 188 VAL A CA  1 
ATOM   1408  C C   . VAL A 1 188 ? 25.571  13.590  5.232   1.00 9.84  ? 188 VAL A C   1 
ATOM   1409  O O   . VAL A 1 188 ? 24.387  13.380  5.571   1.00 10.11 ? 188 VAL A O   1 
ATOM   1410  C CB  . VAL A 1 188 ? 25.249  14.285  2.814   1.00 9.82  ? 188 VAL A CB  1 
ATOM   1411  C CG1 . VAL A 1 188 ? 25.858  15.707  2.998   1.00 9.73  ? 188 VAL A CG1 1 
ATOM   1412  C CG2 . VAL A 1 188 ? 25.293  13.936  1.352   1.00 9.63  ? 188 VAL A CG2 1 
ATOM   1413  N N   . LEU A 1 189 ? 26.559  13.961  6.009   1.00 9.59  ? 189 LEU A N   1 
ATOM   1414  C CA  . LEU A 1 189 ? 26.259  14.286  7.415   1.00 9.56  ? 189 LEU A CA  1 
ATOM   1415  C C   . LEU A 1 189 ? 26.954  15.583  7.835   1.00 9.66  ? 189 LEU A C   1 
ATOM   1416  O O   . LEU A 1 189 ? 27.392  16.393  7.014   1.00 9.66  ? 189 LEU A O   1 
ATOM   1417  C CB  . LEU A 1 189 ? 26.430  13.102  8.314   1.00 9.58  ? 189 LEU A CB  1 
ATOM   1418  C CG  . LEU A 1 189 ? 27.215  11.853  7.994   1.00 9.57  ? 189 LEU A CG  1 
ATOM   1419  C CD1 . LEU A 1 189 ? 26.493  11.039  6.927   1.00 9.29  ? 189 LEU A CD1 1 
ATOM   1420  C CD2 . LEU A 1 189 ? 28.625  12.232  7.550   1.00 9.42  ? 189 LEU A CD2 1 
ATOM   1421  N N   . GLY A 1 190 ? 27.024  15.720  9.157   1.00 9.66  ? 190 GLY A N   1 
ATOM   1422  C CA  . GLY A 1 190 ? 27.481  17.006  9.720   1.00 9.79  ? 190 GLY A CA  1 
ATOM   1423  C C   . GLY A 1 190 ? 26.171  17.813  9.941   1.00 9.87  ? 190 GLY A C   1 
ATOM   1424  O O   . GLY A 1 190 ? 25.274  17.333  10.641  1.00 9.78  ? 190 GLY A O   1 
ATOM   1425  N N   . GLU A 1 191 ? 26.121  18.949  9.294   1.00 10.02 ? 191 GLU A N   1 
ATOM   1426  C CA  . GLU A 1 191 ? 25.006  19.889  9.390   1.00 10.11 ? 191 GLU A CA  1 
ATOM   1427  C C   . GLU A 1 191 ? 23.987  19.750  8.265   1.00 9.91  ? 191 GLU A C   1 
ATOM   1428  O O   . GLU A 1 191 ? 24.240  19.275  7.166   1.00 9.84  ? 191 GLU A O   1 
ATOM   1429  C CB  . GLU A 1 191 ? 25.513  21.338  9.399   1.00 10.40 ? 191 GLU A CB  1 
ATOM   1430  C CG  . GLU A 1 191 ? 24.525  22.430  8.984   1.00 10.73 ? 191 GLU A CG  1 
ATOM   1431  C CD  . GLU A 1 191 ? 24.857  23.843  9.328   1.00 10.84 ? 191 GLU A CD  1 
ATOM   1432  O OE1 . GLU A 1 191 ? 24.718  24.320  10.442  1.00 10.83 ? 191 GLU A OE1 1 
ATOM   1433  O OE2 . GLU A 1 191 ? 25.273  24.427  8.301   1.00 11.02 ? 191 GLU A OE2 1 
ATOM   1434  N N   . HIS A 1 192 ? 22.789  20.187  8.603   1.00 9.78  ? 192 HIS A N   1 
ATOM   1435  C CA  . HIS A 1 192 ? 21.620  20.235  7.721   1.00 9.77  ? 192 HIS A CA  1 
ATOM   1436  C C   . HIS A 1 192 ? 21.532  21.701  7.264   1.00 9.66  ? 192 HIS A C   1 
ATOM   1437  O O   . HIS A 1 192 ? 20.873  22.534  7.898   1.00 9.50  ? 192 HIS A O   1 
ATOM   1438  C CB  . HIS A 1 192 ? 20.285  19.776  8.346   1.00 9.83  ? 192 HIS A CB  1 
ATOM   1439  C CG  . HIS A 1 192 ? 19.141  20.032  7.419   1.00 9.98  ? 192 HIS A CG  1 
ATOM   1440  N ND1 . HIS A 1 192 ? 18.987  19.377  6.234   1.00 10.15 ? 192 HIS A ND1 1 
ATOM   1441  C CD2 . HIS A 1 192 ? 18.191  20.999  7.438   1.00 10.21 ? 192 HIS A CD2 1 
ATOM   1442  C CE1 . HIS A 1 192 ? 17.973  19.912  5.567   1.00 10.25 ? 192 HIS A CE1 1 
ATOM   1443  N NE2 . HIS A 1 192 ? 17.444  20.883  6.287   1.00 10.28 ? 192 HIS A NE2 1 
ATOM   1444  N N   . GLY A 1 193 ? 22.268  21.933  6.188   1.00 9.70  ? 193 GLY A N   1 
ATOM   1445  C CA  . GLY A 1 193 ? 22.432  23.314  5.688   1.00 9.79  ? 193 GLY A CA  1 
ATOM   1446  C C   . GLY A 1 193 ? 23.675  23.446  4.834   1.00 9.62  ? 193 GLY A C   1 
ATOM   1447  O O   . GLY A 1 193 ? 23.638  22.799  3.765   1.00 9.61  ? 193 GLY A O   1 
ATOM   1448  N N   . ASP A 1 194 ? 24.716  24.139  5.300   1.00 9.54  ? 194 ASP A N   1 
ATOM   1449  C CA  . ASP A 1 194 ? 25.847  24.371  4.363   1.00 9.66  ? 194 ASP A CA  1 
ATOM   1450  C C   . ASP A 1 194 ? 27.156  23.777  4.851   1.00 9.26  ? 194 ASP A C   1 
ATOM   1451  O O   . ASP A 1 194 ? 28.184  24.105  4.229   1.00 9.39  ? 194 ASP A O   1 
ATOM   1452  C CB  . ASP A 1 194 ? 26.090  25.850  4.016   1.00 10.07 ? 194 ASP A CB  1 
ATOM   1453  C CG  . ASP A 1 194 ? 24.842  26.646  3.744   1.00 10.63 ? 194 ASP A CG  1 
ATOM   1454  O OD1 . ASP A 1 194 ? 24.334  26.681  2.613   1.00 10.73 ? 194 ASP A OD1 1 
ATOM   1455  O OD2 . ASP A 1 194 ? 24.336  27.221  4.759   1.00 11.09 ? 194 ASP A OD2 1 
ATOM   1456  N N   . SER A 1 195 ? 27.105  23.094  5.934   1.00 8.85  ? 195 SER A N   1 
ATOM   1457  C CA  . SER A 1 195 ? 28.339  22.523  6.553   1.00 8.35  ? 195 SER A CA  1 
ATOM   1458  C C   . SER A 1 195 ? 28.291  21.032  6.267   1.00 8.04  ? 195 SER A C   1 
ATOM   1459  O O   . SER A 1 195 ? 28.732  20.210  7.068   1.00 8.03  ? 195 SER A O   1 
ATOM   1460  C CB  . SER A 1 195 ? 28.277  22.840  8.038   1.00 8.20  ? 195 SER A CB  1 
ATOM   1461  O OG  . SER A 1 195 ? 27.981  24.206  8.262   1.00 7.97  ? 195 SER A OG  1 
ATOM   1462  N N   . SER A 1 196 ? 27.654  20.749  5.124   1.00 7.66  ? 196 SER A N   1 
ATOM   1463  C CA  . SER A 1 196 ? 27.308  19.336  4.825   1.00 7.03  ? 196 SER A CA  1 
ATOM   1464  C C   . SER A 1 196 ? 28.489  18.629  4.187   1.00 6.52  ? 196 SER A C   1 
ATOM   1465  O O   . SER A 1 196 ? 28.926  18.984  3.109   1.00 6.38  ? 196 SER A O   1 
ATOM   1466  C CB  . SER A 1 196 ? 26.065  19.177  3.988   1.00 6.94  ? 196 SER A CB  1 
ATOM   1467  O OG  . SER A 1 196 ? 24.942  19.610  4.740   1.00 7.12  ? 196 SER A OG  1 
ATOM   1468  N N   . VAL A 1 197 ? 29.081  17.808  5.049   1.00 5.87  ? 197 VAL A N   1 
ATOM   1469  C CA  . VAL A 1 197 ? 30.146  16.935  4.509   1.00 5.27  ? 197 VAL A CA  1 
ATOM   1470  C C   . VAL A 1 197 ? 29.353  15.697  4.085   1.00 4.94  ? 197 VAL A C   1 
ATOM   1471  O O   . VAL A 1 197 ? 28.778  14.988  4.919   1.00 4.85  ? 197 VAL A O   1 
ATOM   1472  C CB  . VAL A 1 197 ? 31.282  16.733  5.476   1.00 5.20  ? 197 VAL A CB  1 
ATOM   1473  C CG1 . VAL A 1 197 ? 30.862  16.274  6.867   1.00 5.33  ? 197 VAL A CG1 1 
ATOM   1474  C CG2 . VAL A 1 197 ? 32.286  15.727  4.894   1.00 5.26  ? 197 VAL A CG2 1 
ATOM   1475  N N   . PRO A 1 198 ? 29.291  15.517  2.770   1.00 4.70  ? 198 PRO A N   1 
ATOM   1476  C CA  . PRO A 1 198 ? 28.779  14.203  2.255   1.00 4.66  ? 198 PRO A CA  1 
ATOM   1477  C C   . PRO A 1 198 ? 29.777  13.206  2.802   1.00 4.80  ? 198 PRO A C   1 
ATOM   1478  O O   . PRO A 1 198 ? 30.677  13.686  3.568   1.00 5.13  ? 198 PRO A O   1 
ATOM   1479  C CB  . PRO A 1 198 ? 28.901  14.393  0.761   1.00 4.56  ? 198 PRO A CB  1 
ATOM   1480  C CG  . PRO A 1 198 ? 30.153  15.232  0.583   1.00 4.26  ? 198 PRO A CG  1 
ATOM   1481  C CD  . PRO A 1 198 ? 30.058  16.226  1.740   1.00 4.48  ? 198 PRO A CD  1 
ATOM   1482  N N   . ILE A 1 199 ? 29.784  11.951  2.463   1.00 4.65  ? 199 ILE A N   1 
ATOM   1483  C CA  . ILE A 1 199 ? 30.950  11.128  2.949   1.00 4.62  ? 199 ILE A CA  1 
ATOM   1484  C C   . ILE A 1 199 ? 31.239  10.083  1.878   1.00 4.52  ? 199 ILE A C   1 
ATOM   1485  O O   . ILE A 1 199 ? 30.868  8.912   1.975   1.00 4.51  ? 199 ILE A O   1 
ATOM   1486  C CB  . ILE A 1 199 ? 30.836  10.717  4.417   1.00 4.74  ? 199 ILE A CB  1 
ATOM   1487  C CG1 . ILE A 1 199 ? 29.482  10.065  4.784   1.00 4.87  ? 199 ILE A CG1 1 
ATOM   1488  C CG2 . ILE A 1 199 ? 31.093  11.867  5.480   1.00 4.66  ? 199 ILE A CG2 1 
ATOM   1489  C CD1 . ILE A 1 199 ? 29.552  9.453   6.248   1.00 5.17  ? 199 ILE A CD1 1 
ATOM   1490  N N   . TRP A 1 200 ? 31.874  10.612  0.822   1.00 4.24  ? 200 TRP A N   1 
ATOM   1491  C CA  . TRP A 1 200 ? 32.301  9.868   -0.347  1.00 3.97  ? 200 TRP A CA  1 
ATOM   1492  C C   . TRP A 1 200 ? 33.021  8.569   0.035   1.00 3.77  ? 200 TRP A C   1 
ATOM   1493  O O   . TRP A 1 200 ? 32.794  7.543   -0.640  1.00 3.78  ? 200 TRP A O   1 
ATOM   1494  C CB  . TRP A 1 200 ? 33.185  10.671  -1.296  1.00 4.00  ? 200 TRP A CB  1 
ATOM   1495  C CG  . TRP A 1 200 ? 32.677  11.915  -1.904  1.00 4.07  ? 200 TRP A CG  1 
ATOM   1496  C CD1 . TRP A 1 200 ? 33.020  13.186  -1.549  1.00 4.15  ? 200 TRP A CD1 1 
ATOM   1497  C CD2 . TRP A 1 200 ? 31.750  12.068  -2.989  1.00 4.16  ? 200 TRP A CD2 1 
ATOM   1498  N NE1 . TRP A 1 200 ? 32.304  14.108  -2.285  1.00 4.21  ? 200 TRP A NE1 1 
ATOM   1499  C CE2 . TRP A 1 200 ? 31.548  13.449  -3.192  1.00 4.12  ? 200 TRP A CE2 1 
ATOM   1500  C CE3 . TRP A 1 200 ? 31.049  11.156  -3.782  1.00 4.27  ? 200 TRP A CE3 1 
ATOM   1501  C CZ2 . TRP A 1 200 ? 30.699  13.949  -4.167  1.00 4.09  ? 200 TRP A CZ2 1 
ATOM   1502  C CZ3 . TRP A 1 200 ? 30.156  11.654  -4.707  1.00 4.17  ? 200 TRP A CZ3 1 
ATOM   1503  C CH2 . TRP A 1 200 ? 30.027  13.019  -4.941  1.00 4.14  ? 200 TRP A CH2 1 
ATOM   1504  N N   . SER A 1 201 ? 33.851  8.592   1.054   1.00 3.48  ? 201 SER A N   1 
ATOM   1505  C CA  . SER A 1 201 ? 34.594  7.384   1.467   1.00 3.20  ? 201 SER A CA  1 
ATOM   1506  C C   . SER A 1 201 ? 33.718  6.154   1.225   1.00 3.37  ? 201 SER A C   1 
ATOM   1507  O O   . SER A 1 201 ? 34.202  5.192   0.600   1.00 3.57  ? 201 SER A O   1 
ATOM   1508  C CB  . SER A 1 201 ? 35.106  7.446   2.871   1.00 2.97  ? 201 SER A CB  1 
ATOM   1509  O OG  . SER A 1 201 ? 34.383  6.738   3.822   1.00 2.72  ? 201 SER A OG  1 
ATOM   1510  N N   . GLY A 1 202 ? 32.430  6.255   1.539   1.00 3.41  ? 202 GLY A N   1 
ATOM   1511  C CA  . GLY A 1 202 ? 31.483  5.186   1.415   1.00 3.59  ? 202 GLY A CA  1 
ATOM   1512  C C   . GLY A 1 202 ? 30.313  5.316   0.501   1.00 3.84  ? 202 GLY A C   1 
ATOM   1513  O O   . GLY A 1 202 ? 29.169  5.228   0.996   1.00 3.71  ? 202 GLY A O   1 
ATOM   1514  N N   . VAL A 1 203 ? 30.502  5.210   -0.798  1.00 4.41  ? 203 VAL A N   1 
ATOM   1515  C CA  . VAL A 1 203 ? 29.435  5.444   -1.797  1.00 5.08  ? 203 VAL A CA  1 
ATOM   1516  C C   . VAL A 1 203 ? 29.314  4.363   -2.846  1.00 5.87  ? 203 VAL A C   1 
ATOM   1517  O O   . VAL A 1 203 ? 29.928  4.435   -3.940  1.00 6.11  ? 203 VAL A O   1 
ATOM   1518  C CB  . VAL A 1 203 ? 29.695  6.875   -2.377  1.00 4.78  ? 203 VAL A CB  1 
ATOM   1519  C CG1 . VAL A 1 203 ? 29.061  7.200   -3.693  1.00 4.53  ? 203 VAL A CG1 1 
ATOM   1520  C CG2 . VAL A 1 203 ? 29.308  7.922   -1.320  1.00 4.74  ? 203 VAL A CG2 1 
ATOM   1521  N N   . ASN A 1 204 ? 28.392  3.437   -2.638  1.00 6.50  ? 204 ASN A N   1 
ATOM   1522  C CA  . ASN A 1 204 ? 28.084  2.310   -3.481  1.00 6.99  ? 204 ASN A CA  1 
ATOM   1523  C C   . ASN A 1 204 ? 27.158  2.678   -4.670  1.00 7.42  ? 204 ASN A C   1 
ATOM   1524  O O   . ASN A 1 204 ? 26.630  3.754   -4.765  1.00 7.48  ? 204 ASN A O   1 
ATOM   1525  C CB  . ASN A 1 204 ? 27.335  1.204   -2.757  1.00 7.04  ? 204 ASN A CB  1 
ATOM   1526  C CG  . ASN A 1 204 ? 27.602  0.963   -1.330  1.00 7.27  ? 204 ASN A CG  1 
ATOM   1527  O OD1 . ASN A 1 204 ? 27.526  -0.225  -0.926  1.00 7.48  ? 204 ASN A OD1 1 
ATOM   1528  N ND2 . ASN A 1 204 ? 27.784  2.005   -0.525  1.00 7.40  ? 204 ASN A ND2 1 
ATOM   1529  N N   . VAL A 1 205 ? 26.820  1.663   -5.370  1.00 8.17  ? 205 VAL A N   1 
ATOM   1530  C CA  . VAL A 1 205 ? 26.003  1.313   -6.457  1.00 9.13  ? 205 VAL A CA  1 
ATOM   1531  C C   . VAL A 1 205 ? 26.271  -0.216  -6.729  1.00 10.04 ? 205 VAL A C   1 
ATOM   1532  O O   . VAL A 1 205 ? 26.572  -0.649  -7.823  1.00 10.08 ? 205 VAL A O   1 
ATOM   1533  C CB  . VAL A 1 205 ? 26.169  2.090   -7.754  1.00 9.01  ? 205 VAL A CB  1 
ATOM   1534  C CG1 . VAL A 1 205 ? 25.106  1.639   -8.786  1.00 8.99  ? 205 VAL A CG1 1 
ATOM   1535  C CG2 . VAL A 1 205 ? 26.143  3.585   -7.628  1.00 9.07  ? 205 VAL A CG2 1 
ATOM   1536  N N   . ALA A 1 206 ? 26.301  -0.931  -5.650  1.00 11.19 ? 206 ALA A N   1 
ATOM   1537  C CA  . ALA A 1 206 ? 26.530  -2.346  -5.437  1.00 12.00 ? 206 ALA A CA  1 
ATOM   1538  C C   . ALA A 1 206 ? 27.022  -2.563  -3.993  1.00 12.73 ? 206 ALA A C   1 
ATOM   1539  O O   . ALA A 1 206 ? 26.159  -2.584  -3.056  1.00 12.84 ? 206 ALA A O   1 
ATOM   1540  C CB  . ALA A 1 206 ? 27.420  -2.982  -6.469  1.00 11.86 ? 206 ALA A CB  1 
ATOM   1541  N N   . GLY A 1 207 ? 28.321  -2.591  -3.775  1.00 13.50 ? 207 GLY A N   1 
ATOM   1542  C CA  . GLY A 1 207 ? 28.828  -2.840  -2.423  1.00 14.75 ? 207 GLY A CA  1 
ATOM   1543  C C   . GLY A 1 207 ? 30.097  -2.100  -2.071  1.00 15.64 ? 207 GLY A C   1 
ATOM   1544  O O   . GLY A 1 207 ? 30.797  -1.546  -2.918  1.00 15.46 ? 207 GLY A O   1 
ATOM   1545  N N   . VAL A 1 208 ? 30.385  -2.133  -0.771  1.00 16.71 ? 208 VAL A N   1 
ATOM   1546  C CA  . VAL A 1 208 ? 31.562  -1.499  -0.189  1.00 17.98 ? 208 VAL A CA  1 
ATOM   1547  C C   . VAL A 1 208 ? 32.794  -2.406  -0.419  1.00 18.66 ? 208 VAL A C   1 
ATOM   1548  O O   . VAL A 1 208 ? 32.888  -3.524  0.124   1.00 18.81 ? 208 VAL A O   1 
ATOM   1549  C CB  . VAL A 1 208 ? 31.436  -1.180  1.311   1.00 18.24 ? 208 VAL A CB  1 
ATOM   1550  C CG1 . VAL A 1 208 ? 32.532  -0.178  1.744   1.00 18.25 ? 208 VAL A CG1 1 
ATOM   1551  C CG2 . VAL A 1 208 ? 30.052  -0.752  1.757   1.00 18.30 ? 208 VAL A CG2 1 
ATOM   1552  N N   . THR A 1 209 ? 33.771  -1.784  -1.039  1.00 19.31 ? 209 THR A N   1 
ATOM   1553  C CA  . THR A 1 209 ? 34.976  -2.499  -1.504  1.00 19.97 ? 209 THR A CA  1 
ATOM   1554  C C   . THR A 1 209 ? 34.537  -3.043  -2.873  1.00 20.51 ? 209 THR A C   1 
ATOM   1555  O O   . THR A 1 209 ? 35.290  -2.949  -3.844  1.00 20.75 ? 209 THR A O   1 
ATOM   1556  C CB  . THR A 1 209 ? 35.577  -3.563  -0.561  1.00 19.96 ? 209 THR A CB  1 
ATOM   1557  O OG1 . THR A 1 209 ? 36.011  -2.831  0.640   1.00 20.09 ? 209 THR A OG1 1 
ATOM   1558  C CG2 . THR A 1 209 ? 36.744  -4.376  -1.168  1.00 19.99 ? 209 THR A CG2 1 
ATOM   1559  N N   . LEU A 1 210 ? 33.280  -3.477  -2.880  1.00 20.96 ? 210 LEU A N   1 
ATOM   1560  C CA  . LEU A 1 210 ? 32.609  -3.887  -4.136  1.00 21.36 ? 210 LEU A CA  1 
ATOM   1561  C C   . LEU A 1 210 ? 32.494  -2.548  -4.890  1.00 21.68 ? 210 LEU A C   1 
ATOM   1562  O O   . LEU A 1 210 ? 33.499  -1.784  -4.939  1.00 21.60 ? 210 LEU A O   1 
ATOM   1563  C CB  . LEU A 1 210 ? 31.326  -4.612  -3.827  1.00 21.33 ? 210 LEU A CB  1 
ATOM   1564  C CG  . LEU A 1 210 ? 30.585  -5.539  -4.749  1.00 21.26 ? 210 LEU A CG  1 
ATOM   1565  C CD1 . LEU A 1 210 ? 29.111  -5.690  -4.331  1.00 21.12 ? 210 LEU A CD1 1 
ATOM   1566  C CD2 . LEU A 1 210 ? 30.602  -5.062  -6.196  1.00 21.25 ? 210 LEU A CD2 1 
ATOM   1567  N N   . LYS A 1 211 ? 31.277  -2.221  -5.319  1.00 22.04 ? 211 LYS A N   1 
ATOM   1568  C CA  . LYS A 1 211 ? 31.147  -0.956  -6.070  1.00 22.39 ? 211 LYS A CA  1 
ATOM   1569  C C   . LYS A 1 211 ? 31.011  0.189   -5.078  1.00 22.75 ? 211 LYS A C   1 
ATOM   1570  O O   . LYS A 1 211 ? 29.972  0.471   -4.511  1.00 23.00 ? 211 LYS A O   1 
ATOM   1571  C CB  . LYS A 1 211 ? 30.123  -0.959  -7.153  1.00 22.40 ? 211 LYS A CB  1 
ATOM   1572  C CG  . LYS A 1 211 ? 30.744  -1.655  -8.402  1.00 22.51 ? 211 LYS A CG  1 
ATOM   1573  C CD  . LYS A 1 211 ? 30.121  -1.047  -9.664  1.00 22.63 ? 211 LYS A CD  1 
ATOM   1574  C CE  . LYS A 1 211 ? 31.078  -1.224  -10.834 1.00 22.64 ? 211 LYS A CE  1 
ATOM   1575  N NZ  . LYS A 1 211 ? 32.361  -0.506  -10.560 1.00 22.48 ? 211 LYS A NZ  1 
ATOM   1576  N N   . SER A 1 212 ? 32.197  0.617   -4.729  1.00 23.04 ? 212 SER A N   1 
ATOM   1577  C CA  . SER A 1 212 ? 32.465  1.847   -3.914  1.00 23.20 ? 212 SER A CA  1 
ATOM   1578  C C   . SER A 1 212 ? 32.702  2.872   -5.011  1.00 23.74 ? 212 SER A C   1 
ATOM   1579  O O   . SER A 1 212 ? 33.250  2.391   -6.062  1.00 24.01 ? 212 SER A O   1 
ATOM   1580  C CB  . SER A 1 212 ? 33.606  1.507   -3.021  1.00 22.78 ? 212 SER A CB  1 
ATOM   1581  O OG  . SER A 1 212 ? 34.274  2.528   -2.402  1.00 22.55 ? 212 SER A OG  1 
ATOM   1582  N N   . LEU A 1 213 ? 32.222  4.097   -4.982  1.00 24.10 ? 213 LEU A N   1 
ATOM   1583  C CA  . LEU A 1 213 ? 32.463  4.976   -6.166  1.00 24.49 ? 213 LEU A CA  1 
ATOM   1584  C C   . LEU A 1 213 ? 33.931  5.366   -6.251  1.00 24.83 ? 213 LEU A C   1 
ATOM   1585  O O   . LEU A 1 213 ? 34.412  5.866   -7.293  1.00 24.88 ? 213 LEU A O   1 
ATOM   1586  C CB  . LEU A 1 213 ? 31.452  6.105   -6.188  1.00 24.42 ? 213 LEU A CB  1 
ATOM   1587  C CG  . LEU A 1 213 ? 30.256  6.027   -7.120  1.00 24.29 ? 213 LEU A CG  1 
ATOM   1588  C CD1 . LEU A 1 213 ? 30.681  6.066   -8.578  1.00 24.11 ? 213 LEU A CD1 1 
ATOM   1589  C CD2 . LEU A 1 213 ? 29.490  4.728   -6.841  1.00 24.41 ? 213 LEU A CD2 1 
ATOM   1590  N N   . ASN A 1 214 ? 34.638  5.031   -5.208  1.00 25.25 ? 214 ASN A N   1 
ATOM   1591  C CA  . ASN A 1 214 ? 36.055  5.354   -4.989  1.00 25.71 ? 214 ASN A CA  1 
ATOM   1592  C C   . ASN A 1 214 ? 37.036  4.620   -5.890  1.00 26.03 ? 214 ASN A C   1 
ATOM   1593  O O   . ASN A 1 214 ? 37.950  5.251   -6.456  1.00 26.02 ? 214 ASN A O   1 
ATOM   1594  C CB  . ASN A 1 214 ? 36.321  5.161   -3.485  1.00 25.65 ? 214 ASN A CB  1 
ATOM   1595  C CG  . ASN A 1 214 ? 37.090  6.198   -2.739  1.00 25.63 ? 214 ASN A CG  1 
ATOM   1596  O OD1 . ASN A 1 214 ? 37.777  5.861   -1.737  1.00 25.54 ? 214 ASN A OD1 1 
ATOM   1597  N ND2 . ASN A 1 214 ? 36.972  7.483   -3.096  1.00 25.62 ? 214 ASN A ND2 1 
ATOM   1598  N N   . PRO A 1 215 ? 36.938  3.307   -5.993  1.00 26.28 ? 215 PRO A N   1 
ATOM   1599  C CA  . PRO A 1 215 ? 37.826  2.472   -6.783  1.00 26.39 ? 215 PRO A CA  1 
ATOM   1600  C C   . PRO A 1 215 ? 37.914  2.853   -8.235  1.00 26.58 ? 215 PRO A C   1 
ATOM   1601  O O   . PRO A 1 215 ? 38.855  2.344   -8.897  1.00 26.75 ? 215 PRO A O   1 
ATOM   1602  C CB  . PRO A 1 215 ? 37.258  1.052   -6.652  1.00 26.39 ? 215 PRO A CB  1 
ATOM   1603  C CG  . PRO A 1 215 ? 35.781  1.345   -6.432  1.00 26.34 ? 215 PRO A CG  1 
ATOM   1604  C CD  . PRO A 1 215 ? 35.888  2.474   -5.361  1.00 26.32 ? 215 PRO A CD  1 
ATOM   1605  N N   . ALA A 1 216 ? 36.969  3.606   -8.731  1.00 26.76 ? 216 ALA A N   1 
ATOM   1606  C CA  . ALA A 1 216 ? 37.020  3.986   -10.175 1.00 27.15 ? 216 ALA A CA  1 
ATOM   1607  C C   . ALA A 1 216 ? 37.347  5.471   -10.229 1.00 27.53 ? 216 ALA A C   1 
ATOM   1608  O O   . ALA A 1 216 ? 37.770  6.035   -11.252 1.00 27.57 ? 216 ALA A O   1 
ATOM   1609  C CB  . ALA A 1 216 ? 35.780  3.520   -10.882 1.00 27.10 ? 216 ALA A CB  1 
ATOM   1610  N N   . ILE A 1 217 ? 37.184  6.097   -9.085  1.00 27.96 ? 217 ILE A N   1 
ATOM   1611  C CA  . ILE A 1 217 ? 37.537  7.469   -8.781  1.00 28.42 ? 217 ILE A CA  1 
ATOM   1612  C C   . ILE A 1 217 ? 37.725  8.444   -9.896  1.00 28.86 ? 217 ILE A C   1 
ATOM   1613  O O   . ILE A 1 217 ? 38.888  8.829   -10.202 1.00 29.13 ? 217 ILE A O   1 
ATOM   1614  C CB  . ILE A 1 217 ? 38.877  7.377   -7.898  1.00 28.38 ? 217 ILE A CB  1 
ATOM   1615  C CG1 . ILE A 1 217 ? 39.217  8.706   -7.245  1.00 28.20 ? 217 ILE A CG1 1 
ATOM   1616  C CG2 . ILE A 1 217 ? 40.081  6.774   -8.689  1.00 28.32 ? 217 ILE A CG2 1 
ATOM   1617  C CD1 . ILE A 1 217 ? 40.340  8.654   -6.157  1.00 28.18 ? 217 ILE A CD1 1 
ATOM   1618  N N   . GLY A 1 218 ? 36.662  8.979   -10.490 1.00 29.27 ? 218 GLY A N   1 
ATOM   1619  C CA  . GLY A 1 218 ? 36.855  10.147  -11.452 1.00 29.74 ? 218 GLY A CA  1 
ATOM   1620  C C   . GLY A 1 218 ? 37.083  11.349  -10.478 1.00 30.14 ? 218 GLY A C   1 
ATOM   1621  O O   . GLY A 1 218 ? 36.781  12.529  -10.611 1.00 30.18 ? 218 GLY A O   1 
ATOM   1622  N N   . THR A 1 219 ? 37.566  10.977  -9.352  1.00 30.44 ? 219 THR A N   1 
ATOM   1623  C CA  . THR A 1 219 ? 37.923  11.400  -8.068  1.00 30.52 ? 219 THR A CA  1 
ATOM   1624  C C   . THR A 1 219 ? 36.646  11.202  -7.196  1.00 30.67 ? 219 THR A C   1 
ATOM   1625  O O   . THR A 1 219 ? 36.195  10.046  -7.102  1.00 30.62 ? 219 THR A O   1 
ATOM   1626  C CB  . THR A 1 219 ? 38.681  12.728  -7.819  1.00 30.35 ? 219 THR A CB  1 
ATOM   1627  O OG1 . THR A 1 219 ? 40.103  12.394  -8.144  1.00 30.27 ? 219 THR A OG1 1 
ATOM   1628  C CG2 . THR A 1 219 ? 38.638  13.265  -6.392  1.00 30.25 ? 219 THR A CG2 1 
ATOM   1629  N N   . ASP A 1 220 ? 36.079  12.254  -6.785  1.00 30.93 ? 220 ASP A N   1 
ATOM   1630  C CA  . ASP A 1 220 ? 34.961  12.394  -5.873  1.00 31.35 ? 220 ASP A CA  1 
ATOM   1631  C C   . ASP A 1 220 ? 35.600  13.170  -4.678  1.00 31.62 ? 220 ASP A C   1 
ATOM   1632  O O   . ASP A 1 220 ? 36.125  12.582  -3.748  1.00 31.72 ? 220 ASP A O   1 
ATOM   1633  C CB  . ASP A 1 220 ? 34.243  11.143  -5.491  1.00 31.36 ? 220 ASP A CB  1 
ATOM   1634  C CG  . ASP A 1 220 ? 33.346  10.536  -6.544  1.00 31.45 ? 220 ASP A CG  1 
ATOM   1635  O OD1 . ASP A 1 220 ? 33.790  9.797   -7.444  1.00 31.57 ? 220 ASP A OD1 1 
ATOM   1636  O OD2 . ASP A 1 220 ? 32.126  10.769  -6.447  1.00 31.32 ? 220 ASP A OD2 1 
ATOM   1637  N N   . LYS A 1 221 ? 35.623  14.470  -4.906  1.00 31.83 ? 221 LYS A N   1 
ATOM   1638  C CA  . LYS A 1 221 ? 36.212  15.492  -4.048  1.00 31.88 ? 221 LYS A CA  1 
ATOM   1639  C C   . LYS A 1 221 ? 37.396  16.140  -4.804  1.00 31.92 ? 221 LYS A C   1 
ATOM   1640  O O   . LYS A 1 221 ? 37.204  17.122  -5.552  1.00 31.88 ? 221 LYS A O   1 
ATOM   1641  C CB  . LYS A 1 221 ? 36.613  15.028  -2.679  1.00 31.93 ? 221 LYS A CB  1 
ATOM   1642  C CG  . LYS A 1 221 ? 37.723  15.721  -1.932  1.00 32.13 ? 221 LYS A CG  1 
ATOM   1643  C CD  . LYS A 1 221 ? 37.261  16.841  -1.036  1.00 32.29 ? 221 LYS A CD  1 
ATOM   1644  C CE  . LYS A 1 221 ? 36.510  16.290  0.185   1.00 32.42 ? 221 LYS A CE  1 
ATOM   1645  N NZ  . LYS A 1 221 ? 37.388  15.293  0.871   1.00 32.31 ? 221 LYS A NZ  1 
ATOM   1646  N N   . ASN A 1 222 ? 38.550  15.562  -4.645  1.00 31.79 ? 222 ASN A N   1 
ATOM   1647  C CA  . ASN A 1 222 ? 39.856  15.950  -5.147  1.00 31.76 ? 222 ASN A CA  1 
ATOM   1648  C C   . ASN A 1 222 ? 39.892  16.149  -6.651  1.00 31.68 ? 222 ASN A C   1 
ATOM   1649  O O   . ASN A 1 222 ? 40.940  16.076  -7.321  1.00 31.50 ? 222 ASN A O   1 
ATOM   1650  C CB  . ASN A 1 222 ? 40.892  14.939  -4.614  1.00 31.82 ? 222 ASN A CB  1 
ATOM   1651  C CG  . ASN A 1 222 ? 42.347  15.169  -4.939  1.00 31.72 ? 222 ASN A CG  1 
ATOM   1652  O OD1 . ASN A 1 222 ? 42.944  14.401  -5.734  1.00 31.64 ? 222 ASN A OD1 1 
ATOM   1653  N ND2 . ASN A 1 222 ? 42.965  16.172  -4.311  1.00 31.56 ? 222 ASN A ND2 1 
ATOM   1654  N N   . LYS A 1 223 ? 38.746  16.423  -7.202  1.00 31.77 ? 223 LYS A N   1 
ATOM   1655  C CA  . LYS A 1 223 ? 38.374  16.758  -8.527  1.00 31.88 ? 223 LYS A CA  1 
ATOM   1656  C C   . LYS A 1 223 ? 37.338  15.828  -9.193  1.00 31.90 ? 223 LYS A C   1 
ATOM   1657  O O   . LYS A 1 223 ? 36.545  15.025  -8.697  1.00 31.75 ? 223 LYS A O   1 
ATOM   1658  C CB  . LYS A 1 223 ? 39.583  16.898  -9.485  1.00 31.92 ? 223 LYS A CB  1 
ATOM   1659  C CG  . LYS A 1 223 ? 40.403  18.135  -9.381  1.00 32.11 ? 223 LYS A CG  1 
ATOM   1660  C CD  . LYS A 1 223 ? 39.659  19.454  -9.482  1.00 32.22 ? 223 LYS A CD  1 
ATOM   1661  C CE  . LYS A 1 223 ? 39.115  19.926  -8.133  1.00 32.29 ? 223 LYS A CE  1 
ATOM   1662  N NZ  . LYS A 1 223 ? 39.334  21.399  -7.975  1.00 32.32 ? 223 LYS A NZ  1 
ATOM   1663  N N   . GLN A 1 224 ? 37.295  16.064  -10.478 1.00 31.83 ? 224 GLN A N   1 
ATOM   1664  C CA  . GLN A 1 224 ? 36.613  15.649  -11.626 1.00 31.46 ? 224 GLN A CA  1 
ATOM   1665  C C   . GLN A 1 224 ? 35.135  15.319  -11.374 1.00 31.15 ? 224 GLN A C   1 
ATOM   1666  O O   . GLN A 1 224 ? 34.642  14.224  -11.390 1.00 31.09 ? 224 GLN A O   1 
ATOM   1667  C CB  . GLN A 1 224 ? 37.359  14.625  -12.487 1.00 31.51 ? 224 GLN A CB  1 
ATOM   1668  C CG  . GLN A 1 224 ? 37.984  15.387  -13.677 1.00 31.60 ? 224 GLN A CG  1 
ATOM   1669  C CD  . GLN A 1 224 ? 36.945  15.642  -14.754 1.00 31.74 ? 224 GLN A CD  1 
ATOM   1670  O OE1 . GLN A 1 224 ? 35.755  15.315  -14.634 1.00 31.80 ? 224 GLN A OE1 1 
ATOM   1671  N NE2 . GLN A 1 224 ? 37.426  16.173  -15.873 1.00 31.65 ? 224 GLN A NE2 1 
ATOM   1672  N N   . HIS A 1 225 ? 34.493  16.452  -11.190 1.00 30.83 ? 225 HIS A N   1 
ATOM   1673  C CA  . HIS A 1 225 ? 33.094  16.765  -11.028 1.00 30.32 ? 225 HIS A CA  1 
ATOM   1674  C C   . HIS A 1 225 ? 32.327  15.658  -10.347 1.00 29.89 ? 225 HIS A C   1 
ATOM   1675  O O   . HIS A 1 225 ? 32.243  14.542  -10.867 1.00 30.07 ? 225 HIS A O   1 
ATOM   1676  C CB  . HIS A 1 225 ? 32.441  17.135  -12.407 1.00 30.38 ? 225 HIS A CB  1 
ATOM   1677  C CG  . HIS A 1 225 ? 33.381  18.027  -13.186 1.00 30.60 ? 225 HIS A CG  1 
ATOM   1678  N ND1 . HIS A 1 225 ? 34.577  17.574  -13.724 1.00 30.67 ? 225 HIS A ND1 1 
ATOM   1679  C CD2 . HIS A 1 225 ? 33.340  19.339  -13.480 1.00 30.62 ? 225 HIS A CD2 1 
ATOM   1680  C CE1 . HIS A 1 225 ? 35.194  18.565  -14.328 1.00 30.55 ? 225 HIS A CE1 1 
ATOM   1681  N NE2 . HIS A 1 225 ? 34.465  19.639  -14.208 1.00 30.55 ? 225 HIS A NE2 1 
ATOM   1682  N N   . TRP A 1 226 ? 31.795  15.972  -9.205  1.00 29.11 ? 226 TRP A N   1 
ATOM   1683  C CA  . TRP A 1 226 ? 31.026  15.110  -8.323  1.00 28.44 ? 226 TRP A CA  1 
ATOM   1684  C C   . TRP A 1 226 ? 30.869  15.952  -7.035  1.00 28.25 ? 226 TRP A C   1 
ATOM   1685  O O   . TRP A 1 226 ? 29.867  15.804  -6.340  1.00 28.51 ? 226 TRP A O   1 
ATOM   1686  C CB  . TRP A 1 226 ? 31.565  13.740  -8.021  1.00 28.06 ? 226 TRP A CB  1 
ATOM   1687  C CG  . TRP A 1 226 ? 31.385  12.631  -8.985  1.00 27.67 ? 226 TRP A CG  1 
ATOM   1688  C CD1 . TRP A 1 226 ? 32.359  12.019  -9.733  1.00 27.54 ? 226 TRP A CD1 1 
ATOM   1689  C CD2 . TRP A 1 226 ? 30.159  11.961  -9.336  1.00 27.49 ? 226 TRP A CD2 1 
ATOM   1690  N NE1 . TRP A 1 226 ? 31.809  11.078  -10.563 1.00 27.46 ? 226 TRP A NE1 1 
ATOM   1691  C CE2 . TRP A 1 226 ? 30.467  10.996  -10.309 1.00 27.36 ? 226 TRP A CE2 1 
ATOM   1692  C CE3 . TRP A 1 226 ? 28.843  12.107  -8.914  1.00 27.46 ? 226 TRP A CE3 1 
ATOM   1693  C CZ2 . TRP A 1 226 ? 29.506  10.180  -10.875 1.00 27.30 ? 226 TRP A CZ2 1 
ATOM   1694  C CZ3 . TRP A 1 226 ? 27.895  11.270  -9.468  1.00 27.48 ? 226 TRP A CZ3 1 
ATOM   1695  C CH2 . TRP A 1 226 ? 28.214  10.313  -10.427 1.00 27.34 ? 226 TRP A CH2 1 
ATOM   1696  N N   . LYS A 1 227 ? 31.872  16.797  -6.831  1.00 27.85 ? 227 LYS A N   1 
ATOM   1697  C CA  . LYS A 1 227 ? 31.826  17.735  -5.685  1.00 27.49 ? 227 LYS A CA  1 
ATOM   1698  C C   . LYS A 1 227 ? 30.468  18.473  -5.829  1.00 27.07 ? 227 LYS A C   1 
ATOM   1699  O O   . LYS A 1 227 ? 29.710  18.714  -4.900  1.00 27.00 ? 227 LYS A O   1 
ATOM   1700  C CB  . LYS A 1 227 ? 32.907  18.760  -5.624  1.00 27.70 ? 227 LYS A CB  1 
ATOM   1701  C CG  . LYS A 1 227 ? 33.565  19.350  -6.822  1.00 27.86 ? 227 LYS A CG  1 
ATOM   1702  C CD  . LYS A 1 227 ? 32.817  19.517  -8.088  1.00 28.06 ? 227 LYS A CD  1 
ATOM   1703  C CE  . LYS A 1 227 ? 32.078  20.783  -8.363  1.00 28.09 ? 227 LYS A CE  1 
ATOM   1704  N NZ  . LYS A 1 227 ? 31.529  20.886  -9.732  1.00 28.09 ? 227 LYS A NZ  1 
ATOM   1705  N N   . ASN A 1 228 ? 30.234  18.693  -7.127  1.00 26.46 ? 228 ASN A N   1 
ATOM   1706  C CA  . ASN A 1 228 ? 29.065  19.417  -7.554  1.00 25.79 ? 228 ASN A CA  1 
ATOM   1707  C C   . ASN A 1 228 ? 27.818  18.677  -7.091  1.00 25.09 ? 228 ASN A C   1 
ATOM   1708  O O   . ASN A 1 228 ? 26.912  19.425  -6.684  1.00 25.27 ? 228 ASN A O   1 
ATOM   1709  C CB  . ASN A 1 228 ? 29.010  19.745  -9.035  1.00 26.15 ? 228 ASN A CB  1 
ATOM   1710  C CG  . ASN A 1 228 ? 28.661  21.232  -9.198  1.00 26.40 ? 228 ASN A CG  1 
ATOM   1711  O OD1 . ASN A 1 228 ? 29.041  21.808  -10.225 1.00 26.54 ? 228 ASN A OD1 1 
ATOM   1712  N ND2 . ASN A 1 228 ? 28.058  21.828  -8.165  1.00 26.51 ? 228 ASN A ND2 1 
ATOM   1713  N N   . VAL A 1 229 ? 27.815  17.364  -7.168  1.00 24.02 ? 229 VAL A N   1 
ATOM   1714  C CA  . VAL A 1 229 ? 26.584  16.665  -6.676  1.00 23.16 ? 229 VAL A CA  1 
ATOM   1715  C C   . VAL A 1 229 ? 26.311  17.267  -5.276  1.00 22.44 ? 229 VAL A C   1 
ATOM   1716  O O   . VAL A 1 229 ? 25.211  17.774  -4.993  1.00 22.29 ? 229 VAL A O   1 
ATOM   1717  C CB  . VAL A 1 229 ? 26.691  15.161  -6.760  1.00 23.21 ? 229 VAL A CB  1 
ATOM   1718  C CG1 . VAL A 1 229 ? 27.180  14.482  -5.476  1.00 23.33 ? 229 VAL A CG1 1 
ATOM   1719  C CG2 . VAL A 1 229 ? 25.385  14.493  -7.191  1.00 23.15 ? 229 VAL A CG2 1 
ATOM   1720  N N   . HIS A 1 230 ? 27.419  17.376  -4.550  1.00 21.45 ? 230 HIS A N   1 
ATOM   1721  C CA  . HIS A 1 230 ? 27.361  17.927  -3.199  1.00 20.73 ? 230 HIS A CA  1 
ATOM   1722  C C   . HIS A 1 230 ? 27.027  19.418  -3.170  1.00 20.28 ? 230 HIS A C   1 
ATOM   1723  O O   . HIS A 1 230 ? 26.309  19.895  -2.257  1.00 19.94 ? 230 HIS A O   1 
ATOM   1724  C CB  . HIS A 1 230 ? 28.657  17.658  -2.403  1.00 20.66 ? 230 HIS A CB  1 
ATOM   1725  C CG  . HIS A 1 230 ? 28.421  18.138  -0.997  1.00 20.52 ? 230 HIS A CG  1 
ATOM   1726  N ND1 . HIS A 1 230 ? 27.362  17.691  -0.263  1.00 20.49 ? 230 HIS A ND1 1 
ATOM   1727  C CD2 . HIS A 1 230 ? 29.008  19.121  -0.299  1.00 20.57 ? 230 HIS A CD2 1 
ATOM   1728  C CE1 . HIS A 1 230 ? 27.354  18.335  0.894   1.00 20.57 ? 230 HIS A CE1 1 
ATOM   1729  N NE2 . HIS A 1 230 ? 28.311  19.236  0.869   1.00 20.55 ? 230 HIS A NE2 1 
ATOM   1730  N N   . LYS A 1 231 ? 27.601  20.149  -4.108  1.00 19.84 ? 231 LYS A N   1 
ATOM   1731  C CA  . LYS A 1 231 ? 27.332  21.599  -4.173  1.00 19.51 ? 231 LYS A CA  1 
ATOM   1732  C C   . LYS A 1 231 ? 25.902  21.829  -4.650  1.00 19.05 ? 231 LYS A C   1 
ATOM   1733  O O   . LYS A 1 231 ? 25.262  22.823  -4.278  1.00 19.11 ? 231 LYS A O   1 
ATOM   1734  C CB  . LYS A 1 231 ? 28.313  22.395  -4.994  1.00 19.62 ? 231 LYS A CB  1 
ATOM   1735  C CG  . LYS A 1 231 ? 29.478  22.885  -4.097  1.00 19.72 ? 231 LYS A CG  1 
ATOM   1736  C CD  . LYS A 1 231 ? 30.583  23.549  -4.861  1.00 20.04 ? 231 LYS A CD  1 
ATOM   1737  C CE  . LYS A 1 231 ? 31.116  22.781  -6.047  1.00 20.20 ? 231 LYS A CE  1 
ATOM   1738  N NZ  . LYS A 1 231 ? 30.840  21.317  -5.906  1.00 20.29 ? 231 LYS A NZ  1 
ATOM   1739  N N   . GLN A 1 232 ? 25.448  20.890  -5.421  1.00 18.41 ? 232 GLN A N   1 
ATOM   1740  C CA  . GLN A 1 232 ? 24.125  20.835  -6.004  1.00 17.83 ? 232 GLN A CA  1 
ATOM   1741  C C   . GLN A 1 232 ? 23.148  20.483  -4.883  1.00 17.41 ? 232 GLN A C   1 
ATOM   1742  O O   . GLN A 1 232 ? 22.036  21.003  -4.884  1.00 17.50 ? 232 GLN A O   1 
ATOM   1743  C CB  . GLN A 1 232 ? 24.034  19.808  -7.120  1.00 18.00 ? 232 GLN A CB  1 
ATOM   1744  C CG  . GLN A 1 232 ? 22.759  19.956  -7.953  1.00 18.34 ? 232 GLN A CG  1 
ATOM   1745  C CD  . GLN A 1 232 ? 22.992  19.374  -9.323  1.00 18.70 ? 232 GLN A CD  1 
ATOM   1746  O OE1 . GLN A 1 232 ? 23.980  19.708  -9.987  1.00 18.89 ? 232 GLN A OE1 1 
ATOM   1747  N NE2 . GLN A 1 232 ? 22.131  18.442  -9.733  1.00 18.97 ? 232 GLN A NE2 1 
ATOM   1748  N N   . VAL A 1 233 ? 23.616  19.623  -4.005  1.00 16.84 ? 233 VAL A N   1 
ATOM   1749  C CA  . VAL A 1 233 ? 22.809  19.177  -2.860  1.00 16.33 ? 233 VAL A CA  1 
ATOM   1750  C C   . VAL A 1 233 ? 22.422  20.391  -2.027  1.00 15.98 ? 233 VAL A C   1 
ATOM   1751  O O   . VAL A 1 233 ? 21.242  20.774  -2.003  1.00 16.03 ? 233 VAL A O   1 
ATOM   1752  C CB  . VAL A 1 233 ? 23.551  18.101  -2.074  1.00 16.45 ? 233 VAL A CB  1 
ATOM   1753  C CG1 . VAL A 1 233 ? 23.069  17.919  -0.644  1.00 16.46 ? 233 VAL A CG1 1 
ATOM   1754  C CG2 . VAL A 1 233 ? 23.504  16.763  -2.818  1.00 16.53 ? 233 VAL A CG2 1 
ATOM   1755  N N   . VAL A 1 234 ? 23.426  20.905  -1.353  1.00 15.63 ? 234 VAL A N   1 
ATOM   1756  C CA  . VAL A 1 234 ? 23.271  22.100  -0.487  1.00 15.29 ? 234 VAL A CA  1 
ATOM   1757  C C   . VAL A 1 234 ? 22.521  23.193  -1.225  1.00 15.10 ? 234 VAL A C   1 
ATOM   1758  O O   . VAL A 1 234 ? 21.344  23.456  -0.839  1.00 15.21 ? 234 VAL A O   1 
ATOM   1759  C CB  . VAL A 1 234 ? 24.637  22.483  0.095   1.00 15.20 ? 234 VAL A CB  1 
ATOM   1760  C CG1 . VAL A 1 234 ? 25.705  22.607  -0.984  1.00 15.23 ? 234 VAL A CG1 1 
ATOM   1761  C CG2 . VAL A 1 234 ? 24.568  23.734  0.946   1.00 15.19 ? 234 VAL A CG2 1 
ATOM   1762  N N   . GLU A 1 235 ? 23.105  23.806  -2.211  1.00 14.86 ? 235 GLU A N   1 
ATOM   1763  C CA  . GLU A 1 235 ? 22.402  24.832  -3.003  1.00 15.04 ? 235 GLU A CA  1 
ATOM   1764  C C   . GLU A 1 235 ? 20.939  24.429  -3.220  1.00 15.10 ? 235 GLU A C   1 
ATOM   1765  O O   . GLU A 1 235 ? 19.991  25.190  -3.022  1.00 14.85 ? 235 GLU A O   1 
ATOM   1766  C CB  . GLU A 1 235 ? 23.028  25.069  -4.347  1.00 15.16 ? 235 GLU A CB  1 
ATOM   1767  C CG  . GLU A 1 235 ? 24.008  26.189  -4.629  1.00 15.37 ? 235 GLU A CG  1 
ATOM   1768  C CD  . GLU A 1 235 ? 23.453  27.497  -5.097  1.00 15.53 ? 235 GLU A CD  1 
ATOM   1769  O OE1 . GLU A 1 235 ? 24.022  28.581  -4.981  1.00 15.57 ? 235 GLU A OE1 1 
ATOM   1770  O OE2 . GLU A 1 235 ? 22.345  27.376  -5.690  1.00 15.64 ? 235 GLU A OE2 1 
ATOM   1771  N N   . GLY A 1 236 ? 20.765  23.182  -3.585  1.00 15.44 ? 236 GLY A N   1 
ATOM   1772  C CA  . GLY A 1 236 ? 19.515  22.519  -3.894  1.00 15.80 ? 236 GLY A CA  1 
ATOM   1773  C C   . GLY A 1 236 ? 18.409  22.820  -2.897  1.00 16.12 ? 236 GLY A C   1 
ATOM   1774  O O   . GLY A 1 236 ? 17.199  22.838  -3.249  1.00 16.17 ? 236 GLY A O   1 
ATOM   1775  N N   . GLY A 1 237 ? 18.824  23.082  -1.664  1.00 16.14 ? 237 GLY A N   1 
ATOM   1776  C CA  . GLY A 1 237 ? 17.792  23.337  -0.602  1.00 16.06 ? 237 GLY A CA  1 
ATOM   1777  C C   . GLY A 1 237 ? 17.205  24.724  -0.887  1.00 15.87 ? 237 GLY A C   1 
ATOM   1778  O O   . GLY A 1 237 ? 16.021  24.945  -0.787  1.00 15.62 ? 237 GLY A O   1 
ATOM   1779  N N   . TYR A 1 238 ? 18.136  25.576  -1.287  1.00 16.06 ? 238 TYR A N   1 
ATOM   1780  C CA  . TYR A 1 238 ? 17.900  27.004  -1.521  1.00 16.04 ? 238 TYR A CA  1 
ATOM   1781  C C   . TYR A 1 238 ? 17.069  27.280  -2.746  1.00 16.34 ? 238 TYR A C   1 
ATOM   1782  O O   . TYR A 1 238 ? 15.995  27.886  -2.603  1.00 16.40 ? 238 TYR A O   1 
ATOM   1783  C CB  . TYR A 1 238 ? 19.251  27.790  -1.485  1.00 15.41 ? 238 TYR A CB  1 
ATOM   1784  C CG  . TYR A 1 238 ? 19.839  27.866  -0.090  1.00 14.87 ? 238 TYR A CG  1 
ATOM   1785  C CD1 . TYR A 1 238 ? 19.030  28.235  0.995   1.00 14.80 ? 238 TYR A CD1 1 
ATOM   1786  C CD2 . TYR A 1 238 ? 21.168  27.611  0.183   1.00 14.67 ? 238 TYR A CD2 1 
ATOM   1787  C CE1 . TYR A 1 238 ? 19.519  28.291  2.281   1.00 14.56 ? 238 TYR A CE1 1 
ATOM   1788  C CE2 . TYR A 1 238 ? 21.677  27.659  1.476   1.00 14.56 ? 238 TYR A CE2 1 
ATOM   1789  C CZ  . TYR A 1 238 ? 20.854  28.022  2.529   1.00 14.46 ? 238 TYR A CZ  1 
ATOM   1790  O OH  . TYR A 1 238 ? 21.349  28.105  3.799   1.00 14.29 ? 238 TYR A OH  1 
ATOM   1791  N N   . GLU A 1 239 ? 17.463  26.765  -3.876  1.00 16.80 ? 239 GLU A N   1 
ATOM   1792  C CA  . GLU A 1 239 ? 16.818  26.936  -5.155  1.00 17.23 ? 239 GLU A CA  1 
ATOM   1793  C C   . GLU A 1 239 ? 15.326  26.640  -5.151  1.00 17.29 ? 239 GLU A C   1 
ATOM   1794  O O   . GLU A 1 239 ? 14.557  27.253  -5.933  1.00 17.36 ? 239 GLU A O   1 
ATOM   1795  C CB  . GLU A 1 239 ? 17.416  25.995  -6.226  1.00 17.53 ? 239 GLU A CB  1 
ATOM   1796  C CG  . GLU A 1 239 ? 17.238  26.509  -7.653  1.00 18.05 ? 239 GLU A CG  1 
ATOM   1797  C CD  . GLU A 1 239 ? 18.317  27.426  -8.139  1.00 18.46 ? 239 GLU A CD  1 
ATOM   1798  O OE1 . GLU A 1 239 ? 19.044  28.111  -7.422  1.00 18.66 ? 239 GLU A OE1 1 
ATOM   1799  O OE2 . GLU A 1 239 ? 18.410  27.376  -9.394  1.00 18.68 ? 239 GLU A OE2 1 
ATOM   1800  N N   . VAL A 1 240 ? 14.928  25.678  -4.331  1.00 17.16 ? 240 VAL A N   1 
ATOM   1801  C CA  . VAL A 1 240 ? 13.544  25.286  -4.205  1.00 16.97 ? 240 VAL A CA  1 
ATOM   1802  C C   . VAL A 1 240 ? 12.677  26.498  -3.777  1.00 16.84 ? 240 VAL A C   1 
ATOM   1803  O O   . VAL A 1 240 ? 11.672  26.847  -4.395  1.00 16.88 ? 240 VAL A O   1 
ATOM   1804  C CB  . VAL A 1 240 ? 13.281  24.223  -3.106  1.00 17.00 ? 240 VAL A CB  1 
ATOM   1805  C CG1 . VAL A 1 240 ? 11.962  23.512  -3.348  1.00 16.89 ? 240 VAL A CG1 1 
ATOM   1806  C CG2 . VAL A 1 240 ? 14.439  23.292  -2.871  1.00 17.42 ? 240 VAL A CG2 1 
ATOM   1807  N N   . LEU A 1 241 ? 13.094  26.936  -2.591  1.00 16.55 ? 241 LEU A N   1 
ATOM   1808  C CA  . LEU A 1 241 ? 12.287  27.968  -1.911  1.00 16.51 ? 241 LEU A CA  1 
ATOM   1809  C C   . LEU A 1 241 ? 12.237  29.189  -2.805  1.00 16.60 ? 241 LEU A C   1 
ATOM   1810  O O   . LEU A 1 241 ? 11.118  29.703  -3.045  1.00 16.83 ? 241 LEU A O   1 
ATOM   1811  C CB  . LEU A 1 241 ? 12.792  28.103  -0.512  1.00 16.40 ? 241 LEU A CB  1 
ATOM   1812  C CG  . LEU A 1 241 ? 13.816  29.123  -0.128  1.00 16.39 ? 241 LEU A CG  1 
ATOM   1813  C CD1 . LEU A 1 241 ? 13.339  30.552  -0.371  1.00 16.34 ? 241 LEU A CD1 1 
ATOM   1814  C CD2 . LEU A 1 241 ? 14.097  28.943  1.374   1.00 16.43 ? 241 LEU A CD2 1 
ATOM   1815  N N   . ASP A 1 242 ? 13.370  29.570  -3.348  1.00 16.48 ? 242 ASP A N   1 
ATOM   1816  C CA  . ASP A 1 242 ? 13.420  30.775  -4.200  1.00 16.58 ? 242 ASP A CA  1 
ATOM   1817  C C   . ASP A 1 242 ? 12.199  30.744  -5.127  1.00 16.79 ? 242 ASP A C   1 
ATOM   1818  O O   . ASP A 1 242 ? 11.447  31.736  -5.130  1.00 17.01 ? 242 ASP A O   1 
ATOM   1819  C CB  . ASP A 1 242 ? 14.726  30.971  -4.918  1.00 16.54 ? 242 ASP A CB  1 
ATOM   1820  C CG  . ASP A 1 242 ? 15.945  31.300  -4.084  1.00 16.46 ? 242 ASP A CG  1 
ATOM   1821  O OD1 . ASP A 1 242 ? 17.064  31.384  -4.631  1.00 16.19 ? 242 ASP A OD1 1 
ATOM   1822  O OD2 . ASP A 1 242 ? 15.780  31.467  -2.848  1.00 16.47 ? 242 ASP A OD2 1 
ATOM   1823  N N   . MET A 1 243 ? 11.858  29.556  -5.573  1.00 17.01 ? 243 MET A N   1 
ATOM   1824  C CA  . MET A 1 243 ? 10.790  29.347  -6.559  1.00 17.08 ? 243 MET A CA  1 
ATOM   1825  C C   . MET A 1 243 ? 9.376   29.081  -6.114  1.00 16.92 ? 243 MET A C   1 
ATOM   1826  O O   . MET A 1 243 ? 8.442   29.762  -6.660  1.00 17.04 ? 243 MET A O   1 
ATOM   1827  C CB  . MET A 1 243 ? 11.287  28.230  -7.542  1.00 17.08 ? 243 MET A CB  1 
ATOM   1828  C CG  . MET A 1 243 ? 12.682  28.610  -7.989  1.00 17.15 ? 243 MET A CG  1 
ATOM   1829  S SD  . MET A 1 243 ? 12.958  28.013  -9.661  1.00 17.40 ? 243 MET A SD  1 
ATOM   1830  C CE  . MET A 1 243 ? 12.992  26.225  -9.397  1.00 17.37 ? 243 MET A CE  1 
ATOM   1831  N N   . LYS A 1 244 ? 9.090   28.064  -5.345  1.00 16.72 ? 244 LYS A N   1 
ATOM   1832  C CA  . LYS A 1 244 ? 7.675   27.807  -4.932  1.00 16.53 ? 244 LYS A CA  1 
ATOM   1833  C C   . LYS A 1 244 ? 7.399   28.670  -3.701  1.00 16.29 ? 244 LYS A C   1 
ATOM   1834  O O   . LYS A 1 244 ? 6.268   28.886  -3.264  1.00 16.02 ? 244 LYS A O   1 
ATOM   1835  C CB  . LYS A 1 244 ? 7.382   26.348  -4.719  1.00 16.65 ? 244 LYS A CB  1 
ATOM   1836  C CG  . LYS A 1 244 ? 8.098   25.682  -3.541  1.00 16.76 ? 244 LYS A CG  1 
ATOM   1837  C CD  . LYS A 1 244 ? 7.782   24.214  -3.467  1.00 16.88 ? 244 LYS A CD  1 
ATOM   1838  C CE  . LYS A 1 244 ? 6.475   23.902  -2.768  1.00 17.01 ? 244 LYS A CE  1 
ATOM   1839  N NZ  . LYS A 1 244 ? 6.141   22.450  -3.003  1.00 17.34 ? 244 LYS A NZ  1 
ATOM   1840  N N   . GLY A 1 245 ? 8.506   29.185  -3.187  1.00 16.18 ? 245 GLY A N   1 
ATOM   1841  C CA  . GLY A 1 245 ? 8.540   30.050  -2.016  1.00 16.07 ? 245 GLY A CA  1 
ATOM   1842  C C   . GLY A 1 245 ? 8.396   29.258  -0.739  1.00 15.95 ? 245 GLY A C   1 
ATOM   1843  O O   . GLY A 1 245 ? 7.587   29.676  0.114   1.00 16.25 ? 245 GLY A O   1 
ATOM   1844  N N   . TYR A 1 246 ? 9.044   28.123  -0.645  1.00 15.71 ? 246 TYR A N   1 
ATOM   1845  C CA  . TYR A 1 246 ? 9.050   27.280  0.548   1.00 15.51 ? 246 TYR A CA  1 
ATOM   1846  C C   . TYR A 1 246 ? 9.516   25.856  0.178   1.00 15.26 ? 246 TYR A C   1 
ATOM   1847  O O   . TYR A 1 246 ? 9.625   25.479  -0.991  1.00 15.28 ? 246 TYR A O   1 
ATOM   1848  C CB  . TYR A 1 246 ? 7.741   27.250  1.320   1.00 15.68 ? 246 TYR A CB  1 
ATOM   1849  C CG  . TYR A 1 246 ? 6.516   26.666  0.701   1.00 15.83 ? 246 TYR A CG  1 
ATOM   1850  C CD1 . TYR A 1 246 ? 6.221   25.299  0.854   1.00 16.01 ? 246 TYR A CD1 1 
ATOM   1851  C CD2 . TYR A 1 246 ? 5.587   27.437  0.000   1.00 15.90 ? 246 TYR A CD2 1 
ATOM   1852  C CE1 . TYR A 1 246 ? 5.048   24.757  0.338   1.00 16.04 ? 246 TYR A CE1 1 
ATOM   1853  C CE2 . TYR A 1 246 ? 4.424   26.898  -0.551  1.00 15.89 ? 246 TYR A CE2 1 
ATOM   1854  C CZ  . TYR A 1 246 ? 4.153   25.555  -0.358  1.00 16.02 ? 246 TYR A CZ  1 
ATOM   1855  O OH  . TYR A 1 246 ? 3.012   25.008  -0.863  1.00 16.19 ? 246 TYR A OH  1 
ATOM   1856  N N   . THR A 1 247 ? 9.750   25.118  1.235   1.00 14.70 ? 247 THR A N   1 
ATOM   1857  C CA  . THR A 1 247 ? 10.239  23.728  1.233   1.00 14.15 ? 247 THR A CA  1 
ATOM   1858  C C   . THR A 1 247 ? 9.168   22.847  1.833   1.00 13.56 ? 247 THR A C   1 
ATOM   1859  O O   . THR A 1 247 ? 9.071   22.788  3.076   1.00 13.62 ? 247 THR A O   1 
ATOM   1860  C CB  . THR A 1 247 ? 11.617  23.754  2.021   1.00 14.34 ? 247 THR A CB  1 
ATOM   1861  O OG1 . THR A 1 247 ? 12.231  22.430  1.950   1.00 14.61 ? 247 THR A OG1 1 
ATOM   1862  C CG2 . THR A 1 247 ? 11.500  24.246  3.474   1.00 14.25 ? 247 THR A CG2 1 
ATOM   1863  N N   . SER A 1 248 ? 8.373   22.150  1.024   1.00 12.75 ? 248 SER A N   1 
ATOM   1864  C CA  . SER A 1 248 ? 7.232   21.370  1.511   1.00 11.83 ? 248 SER A CA  1 
ATOM   1865  C C   . SER A 1 248 ? 7.251   19.866  1.431   1.00 11.00 ? 248 SER A C   1 
ATOM   1866  O O   . SER A 1 248 ? 7.481   19.200  2.436   1.00 11.00 ? 248 SER A O   1 
ATOM   1867  C CB  . SER A 1 248 ? 5.976   21.833  0.709   1.00 11.98 ? 248 SER A CB  1 
ATOM   1868  O OG  . SER A 1 248 ? 6.369   21.677  -0.659  1.00 12.09 ? 248 SER A OG  1 
ATOM   1869  N N   . TRP A 1 249 ? 6.856   19.289  0.321   1.00 10.02 ? 249 TRP A N   1 
ATOM   1870  C CA  . TRP A 1 249 ? 6.704   17.874  0.071   1.00 9.28  ? 249 TRP A CA  1 
ATOM   1871  C C   . TRP A 1 249 ? 7.818   16.995  0.662   1.00 8.67  ? 249 TRP A C   1 
ATOM   1872  O O   . TRP A 1 249 ? 7.624   16.201  1.601   1.00 8.38  ? 249 TRP A O   1 
ATOM   1873  C CB  . TRP A 1 249 ? 6.526   17.602  -1.403  1.00 9.57  ? 249 TRP A CB  1 
ATOM   1874  C CG  . TRP A 1 249 ? 5.451   18.202  -2.199  1.00 9.91  ? 249 TRP A CG  1 
ATOM   1875  C CD1 . TRP A 1 249 ? 5.441   18.288  -3.580  1.00 10.00 ? 249 TRP A CD1 1 
ATOM   1876  C CD2 . TRP A 1 249 ? 4.217   18.807  -1.787  1.00 10.01 ? 249 TRP A CD2 1 
ATOM   1877  N NE1 . TRP A 1 249 ? 4.300   18.904  -4.021  1.00 10.08 ? 249 TRP A NE1 1 
ATOM   1878  C CE2 . TRP A 1 249 ? 3.529   19.228  -2.940  1.00 10.04 ? 249 TRP A CE2 1 
ATOM   1879  C CE3 . TRP A 1 249 ? 3.635   19.011  -0.545  1.00 10.04 ? 249 TRP A CE3 1 
ATOM   1880  C CZ2 . TRP A 1 249 ? 2.267   19.804  -2.888  1.00 9.99  ? 249 TRP A CZ2 1 
ATOM   1881  C CZ3 . TRP A 1 249 ? 2.410   19.640  -0.484  1.00 9.99  ? 249 TRP A CZ3 1 
ATOM   1882  C CH2 . TRP A 1 249 ? 1.728   20.014  -1.637  1.00 9.99  ? 249 TRP A CH2 1 
ATOM   1883  N N   . ALA A 1 250 ? 8.967   17.064  0.022   1.00 7.96  ? 250 ALA A N   1 
ATOM   1884  C CA  . ALA A 1 250 ? 10.179  16.313  0.294   1.00 6.97  ? 250 ALA A CA  1 
ATOM   1885  C C   . ALA A 1 250 ? 10.564  16.303  1.753   1.00 6.50  ? 250 ALA A C   1 
ATOM   1886  O O   . ALA A 1 250 ? 11.238  15.320  2.162   1.00 6.33  ? 250 ALA A O   1 
ATOM   1887  C CB  . ALA A 1 250 ? 11.321  16.817  -0.567  1.00 6.88  ? 250 ALA A CB  1 
ATOM   1888  N N   . ILE A 1 251 ? 10.206  17.359  2.487   1.00 5.99  ? 251 ILE A N   1 
ATOM   1889  C CA  . ILE A 1 251 ? 10.548  17.306  3.942   1.00 5.45  ? 251 ILE A CA  1 
ATOM   1890  C C   . ILE A 1 251 ? 9.588   16.316  4.614   1.00 5.02  ? 251 ILE A C   1 
ATOM   1891  O O   . ILE A 1 251 ? 9.934   15.557  5.531   1.00 4.84  ? 251 ILE A O   1 
ATOM   1892  C CB  . ILE A 1 251 ? 10.604  18.695  4.605   1.00 5.41  ? 251 ILE A CB  1 
ATOM   1893  C CG1 . ILE A 1 251 ? 10.861  18.622  6.130   1.00 5.62  ? 251 ILE A CG1 1 
ATOM   1894  C CG2 . ILE A 1 251 ? 9.319   19.540  4.394   1.00 5.30  ? 251 ILE A CG2 1 
ATOM   1895  C CD1 . ILE A 1 251 ? 11.951  17.652  6.629   1.00 5.83  ? 251 ILE A CD1 1 
ATOM   1896  N N   . GLY A 1 252 ? 8.396   16.326  4.053   1.00 4.53  ? 252 GLY A N   1 
ATOM   1897  C CA  . GLY A 1 252 ? 7.254   15.571  4.604   1.00 4.08  ? 252 GLY A CA  1 
ATOM   1898  C C   . GLY A 1 252 ? 7.584   14.090  4.511   1.00 3.69  ? 252 GLY A C   1 
ATOM   1899  O O   . GLY A 1 252 ? 7.715   13.427  5.527   1.00 3.74  ? 252 GLY A O   1 
ATOM   1900  N N   . LEU A 1 253 ? 7.734   13.693  3.258   1.00 3.27  ? 253 LEU A N   1 
ATOM   1901  C CA  . LEU A 1 253 ? 8.075   12.307  2.908   1.00 2.70  ? 253 LEU A CA  1 
ATOM   1902  C C   . LEU A 1 253 ? 9.208   11.854  3.798   1.00 2.50  ? 253 LEU A C   1 
ATOM   1903  O O   . LEU A 1 253 ? 9.002   10.846  4.513   1.00 2.86  ? 253 LEU A O   1 
ATOM   1904  C CB  . LEU A 1 253 ? 8.298   12.210  1.400   1.00 2.38  ? 253 LEU A CB  1 
ATOM   1905  C CG  . LEU A 1 253 ? 6.991   12.259  0.601   1.00 2.10  ? 253 LEU A CG  1 
ATOM   1906  C CD1 . LEU A 1 253 ? 7.186   13.057  -0.666  1.00 2.30  ? 253 LEU A CD1 1 
ATOM   1907  C CD2 . LEU A 1 253 ? 6.556   10.841  0.280   1.00 2.00  ? 253 LEU A CD2 1 
ATOM   1908  N N   . SER A 1 254 ? 10.260  12.628  3.873   1.00 2.22  ? 254 SER A N   1 
ATOM   1909  C CA  . SER A 1 254 ? 11.400  12.274  4.732   1.00 2.00  ? 254 SER A CA  1 
ATOM   1910  C C   . SER A 1 254 ? 10.934  11.814  6.111   1.00 2.06  ? 254 SER A C   1 
ATOM   1911  O O   . SER A 1 254 ? 11.172  10.680  6.530   1.00 2.24  ? 254 SER A O   1 
ATOM   1912  C CB  . SER A 1 254 ? 12.356  13.435  4.877   1.00 2.00  ? 254 SER A CB  1 
ATOM   1913  O OG  . SER A 1 254 ? 13.111  13.304  6.072   1.00 2.00  ? 254 SER A OG  1 
ATOM   1914  N N   . VAL A 1 255 ? 10.239  12.673  6.801   1.00 2.14  ? 255 VAL A N   1 
ATOM   1915  C CA  . VAL A 1 255 ? 9.812   12.487  8.177   1.00 2.32  ? 255 VAL A CA  1 
ATOM   1916  C C   . VAL A 1 255 ? 9.003   11.221  8.403   1.00 2.46  ? 255 VAL A C   1 
ATOM   1917  O O   . VAL A 1 255 ? 9.066   10.599  9.466   1.00 2.50  ? 255 VAL A O   1 
ATOM   1918  C CB  . VAL A 1 255 ? 8.972   13.728  8.631   1.00 2.44  ? 255 VAL A CB  1 
ATOM   1919  C CG1 . VAL A 1 255 ? 8.410   13.564  10.040  1.00 2.19  ? 255 VAL A CG1 1 
ATOM   1920  C CG2 . VAL A 1 255 ? 9.752   15.024  8.422   1.00 2.43  ? 255 VAL A CG2 1 
ATOM   1921  N N   . THR A 1 256 ? 8.039   11.111  7.484   1.00 2.58  ? 256 THR A N   1 
ATOM   1922  C CA  . THR A 1 256 ? 7.052   10.007  7.551   1.00 2.35  ? 256 THR A CA  1 
ATOM   1923  C C   . THR A 1 256 ? 7.824   8.704   7.416   1.00 2.23  ? 256 THR A C   1 
ATOM   1924  O O   . THR A 1 256 ? 7.394   7.654   7.911   1.00 2.35  ? 256 THR A O   1 
ATOM   1925  C CB  . THR A 1 256 ? 5.869   10.234  6.566   1.00 2.31  ? 256 THR A CB  1 
ATOM   1926  O OG1 . THR A 1 256 ? 5.409   8.904   6.092   1.00 2.41  ? 256 THR A OG1 1 
ATOM   1927  C CG2 . THR A 1 256 ? 6.159   11.160  5.399   1.00 2.22  ? 256 THR A CG2 1 
ATOM   1928  N N   . ASP A 1 257 ? 8.971   8.855   6.795   1.00 2.01  ? 257 ASP A N   1 
ATOM   1929  C CA  . ASP A 1 257 ? 9.918   7.755   6.531   1.00 2.00  ? 257 ASP A CA  1 
ATOM   1930  C C   . ASP A 1 257 ? 10.686  7.476   7.821   1.00 2.00  ? 257 ASP A C   1 
ATOM   1931  O O   . ASP A 1 257 ? 11.178  6.358   8.009   1.00 2.00  ? 257 ASP A O   1 
ATOM   1932  C CB  . ASP A 1 257 ? 10.711  8.101   5.290   1.00 2.01  ? 257 ASP A CB  1 
ATOM   1933  C CG  . ASP A 1 257 ? 11.842  7.161   4.984   1.00 2.30  ? 257 ASP A CG  1 
ATOM   1934  O OD1 . ASP A 1 257 ? 12.952  7.322   5.537   1.00 2.54  ? 257 ASP A OD1 1 
ATOM   1935  O OD2 . ASP A 1 257 ? 11.604  6.239   4.178   1.00 2.39  ? 257 ASP A OD2 1 
ATOM   1936  N N   . LEU A 1 258 ? 10.704  8.461   8.702   1.00 2.00  ? 258 LEU A N   1 
ATOM   1937  C CA  . LEU A 1 258 ? 11.325  8.348   10.019  1.00 2.00  ? 258 LEU A CA  1 
ATOM   1938  C C   . LEU A 1 258 ? 10.301  7.682   10.947  1.00 2.00  ? 258 LEU A C   1 
ATOM   1939  O O   . LEU A 1 258 ? 10.613  6.747   11.660  1.00 2.00  ? 258 LEU A O   1 
ATOM   1940  C CB  . LEU A 1 258 ? 11.804  9.688   10.517  1.00 2.00  ? 258 LEU A CB  1 
ATOM   1941  C CG  . LEU A 1 258 ? 13.207  10.177  10.271  1.00 2.00  ? 258 LEU A CG  1 
ATOM   1942  C CD1 . LEU A 1 258 ? 14.252  9.191   10.781  1.00 2.00  ? 258 LEU A CD1 1 
ATOM   1943  C CD2 . LEU A 1 258 ? 13.461  10.403  8.766   1.00 2.00  ? 258 LEU A CD2 1 
ATOM   1944  N N   . ALA A 1 259 ? 9.092   8.167   10.856  1.00 2.00  ? 259 ALA A N   1 
ATOM   1945  C CA  . ALA A 1 259 ? 7.939   7.663   11.610  1.00 2.00  ? 259 ALA A CA  1 
ATOM   1946  C C   . ALA A 1 259 ? 7.767   6.165   11.355  1.00 2.00  ? 259 ALA A C   1 
ATOM   1947  O O   . ALA A 1 259 ? 7.712   5.344   12.270  1.00 2.00  ? 259 ALA A O   1 
ATOM   1948  C CB  . ALA A 1 259 ? 6.689   8.444   11.189  1.00 2.00  ? 259 ALA A CB  1 
ATOM   1949  N N   . ARG A 1 260 ? 7.646   5.859   10.077  1.00 2.00  ? 260 ARG A N   1 
ATOM   1950  C CA  . ARG A 1 260 ? 7.474   4.550   9.485   1.00 2.00  ? 260 ARG A CA  1 
ATOM   1951  C C   . ARG A 1 260 ? 8.377   3.528   10.171  1.00 2.00  ? 260 ARG A C   1 
ATOM   1952  O O   . ARG A 1 260 ? 7.961   2.426   10.523  1.00 2.00  ? 260 ARG A O   1 
ATOM   1953  C CB  . ARG A 1 260 ? 7.812   4.567   7.996   1.00 2.00  ? 260 ARG A CB  1 
ATOM   1954  C CG  . ARG A 1 260 ? 7.465   3.352   7.176   1.00 2.00  ? 260 ARG A CG  1 
ATOM   1955  C CD  . ARG A 1 260 ? 8.352   2.214   7.395   1.00 2.00  ? 260 ARG A CD  1 
ATOM   1956  N NE  . ARG A 1 260 ? 8.153   1.009   6.648   1.00 2.22  ? 260 ARG A NE  1 
ATOM   1957  C CZ  . ARG A 1 260 ? 8.491   0.666   5.412   1.00 2.21  ? 260 ARG A CZ  1 
ATOM   1958  N NH1 . ARG A 1 260 ? 9.169   1.463   4.576   1.00 2.32  ? 260 ARG A NH1 1 
ATOM   1959  N NH2 . ARG A 1 260 ? 8.010   -0.480  4.902   1.00 2.02  ? 260 ARG A NH2 1 
ATOM   1960  N N   . SER A 1 261 ? 9.609   3.980   10.305  1.00 2.00  ? 261 SER A N   1 
ATOM   1961  C CA  . SER A 1 261 ? 10.693  3.195   10.877  1.00 2.00  ? 261 SER A CA  1 
ATOM   1962  C C   . SER A 1 261 ? 10.477  3.037   12.377  1.00 2.00  ? 261 SER A C   1 
ATOM   1963  O O   . SER A 1 261 ? 10.690  1.945   12.887  1.00 2.00  ? 261 SER A O   1 
ATOM   1964  C CB  . SER A 1 261 ? 12.060  3.823   10.642  1.00 2.00  ? 261 SER A CB  1 
ATOM   1965  O OG  . SER A 1 261 ? 12.562  4.261   11.902  1.00 2.00  ? 261 SER A OG  1 
ATOM   1966  N N   . ILE A 1 262 ? 10.292  4.166   13.025  1.00 2.00  ? 262 ILE A N   1 
ATOM   1967  C CA  . ILE A 1 262 ? 10.013  4.191   14.469  1.00 2.00  ? 262 ILE A CA  1 
ATOM   1968  C C   . ILE A 1 262 ? 8.795   3.299   14.733  1.00 2.00  ? 262 ILE A C   1 
ATOM   1969  O O   . ILE A 1 262 ? 8.964   2.186   15.218  1.00 2.05  ? 262 ILE A O   1 
ATOM   1970  C CB  . ILE A 1 262 ? 9.818   5.645   15.023  1.00 2.00  ? 262 ILE A CB  1 
ATOM   1971  C CG1 . ILE A 1 262 ? 10.845  6.597   14.398  1.00 2.00  ? 262 ILE A CG1 1 
ATOM   1972  C CG2 . ILE A 1 262 ? 9.866   5.683   16.568  1.00 2.00  ? 262 ILE A CG2 1 
ATOM   1973  C CD1 . ILE A 1 262 ? 10.306  8.020   14.108  1.00 2.00  ? 262 ILE A CD1 1 
ATOM   1974  N N   . LEU A 1 263 ? 7.649   3.720   14.296  1.00 2.00  ? 263 LEU A N   1 
ATOM   1975  C CA  . LEU A 1 263 ? 6.379   3.029   14.496  1.00 2.45  ? 263 LEU A CA  1 
ATOM   1976  C C   . LEU A 1 263 ? 6.353   1.540   14.186  1.00 2.53  ? 263 LEU A C   1 
ATOM   1977  O O   . LEU A 1 263 ? 5.898   0.725   15.061  1.00 2.55  ? 263 LEU A O   1 
ATOM   1978  C CB  . LEU A 1 263 ? 5.304   3.913   13.795  1.00 2.46  ? 263 LEU A CB  1 
ATOM   1979  C CG  . LEU A 1 263 ? 4.822   5.204   14.442  1.00 2.44  ? 263 LEU A CG  1 
ATOM   1980  C CD1 . LEU A 1 263 ? 5.143   5.351   15.936  1.00 2.36  ? 263 LEU A CD1 1 
ATOM   1981  C CD2 . LEU A 1 263 ? 5.408   6.425   13.725  1.00 2.47  ? 263 LEU A CD2 1 
ATOM   1982  N N   . LYS A 1 264 ? 6.863   1.086   13.065  1.00 2.46  ? 264 LYS A N   1 
ATOM   1983  C CA  . LYS A 1 264 ? 6.774   -0.346  12.702  1.00 2.47  ? 264 LYS A CA  1 
ATOM   1984  C C   . LYS A 1 264 ? 7.978   -1.110  13.221  1.00 2.56  ? 264 LYS A C   1 
ATOM   1985  O O   . LYS A 1 264 ? 8.264   -2.237  12.764  1.00 2.47  ? 264 LYS A O   1 
ATOM   1986  C CB  . LYS A 1 264 ? 6.676   -0.492  11.197  1.00 2.49  ? 264 LYS A CB  1 
ATOM   1987  C CG  . LYS A 1 264 ? 5.708   0.483   10.554  1.00 2.83  ? 264 LYS A CG  1 
ATOM   1988  C CD  . LYS A 1 264 ? 5.951   0.705   9.081   1.00 3.15  ? 264 LYS A CD  1 
ATOM   1989  C CE  . LYS A 1 264 ? 5.009   -0.089  8.172   1.00 3.23  ? 264 LYS A CE  1 
ATOM   1990  N NZ  . LYS A 1 264 ? 5.600   -0.157  6.789   1.00 3.07  ? 264 LYS A NZ  1 
ATOM   1991  N N   . ASN A 1 265 ? 8.693   -0.458  14.106  1.00 2.59  ? 265 ASN A N   1 
ATOM   1992  C CA  . ASN A 1 265 ? 9.914   -0.912  14.747  1.00 2.60  ? 265 ASN A CA  1 
ATOM   1993  C C   . ASN A 1 265 ? 10.913  -1.498  13.765  1.00 2.83  ? 265 ASN A C   1 
ATOM   1994  O O   . ASN A 1 265 ? 11.576  -2.509  14.105  1.00 3.05  ? 265 ASN A O   1 
ATOM   1995  C CB  . ASN A 1 265 ? 9.629   -1.943  15.865  1.00 2.63  ? 265 ASN A CB  1 
ATOM   1996  C CG  . ASN A 1 265 ? 10.689  -1.883  16.933  1.00 2.64  ? 265 ASN A CG  1 
ATOM   1997  O OD1 . ASN A 1 265 ? 11.397  -0.863  16.971  1.00 3.09  ? 265 ASN A OD1 1 
ATOM   1998  N ND2 . ASN A 1 265 ? 10.857  -2.866  17.788  1.00 2.50  ? 265 ASN A ND2 1 
ATOM   1999  N N   . LEU A 1 266 ? 10.967  -0.939  12.581  1.00 2.89  ? 266 LEU A N   1 
ATOM   2000  C CA  . LEU A 1 266 ? 11.822  -1.399  11.494  1.00 2.93  ? 266 LEU A CA  1 
ATOM   2001  C C   . LEU A 1 266 ? 13.304  -1.534  11.766  1.00 2.97  ? 266 LEU A C   1 
ATOM   2002  O O   . LEU A 1 266 ? 14.023  -2.281  11.036  1.00 3.09  ? 266 LEU A O   1 
ATOM   2003  C CB  . LEU A 1 266 ? 11.535  -0.421  10.337  1.00 2.98  ? 266 LEU A CB  1 
ATOM   2004  C CG  . LEU A 1 266 ? 10.727  -0.971  9.186   1.00 3.25  ? 266 LEU A CG  1 
ATOM   2005  C CD1 . LEU A 1 266 ? 9.348   -1.444  9.638   1.00 3.26  ? 266 LEU A CD1 1 
ATOM   2006  C CD2 . LEU A 1 266 ? 10.637  0.137   8.127   1.00 3.10  ? 266 LEU A CD2 1 
ATOM   2007  N N   . LYS A 1 267 ? 13.805  -0.824  12.744  1.00 2.92  ? 267 LYS A N   1 
ATOM   2008  C CA  . LYS A 1 267 ? 15.233  -0.794  13.085  1.00 2.94  ? 267 LYS A CA  1 
ATOM   2009  C C   . LYS A 1 267 ? 16.069  -0.599  11.818  1.00 2.85  ? 267 LYS A C   1 
ATOM   2010  O O   . LYS A 1 267 ? 17.137  -1.164  11.676  1.00 2.64  ? 267 LYS A O   1 
ATOM   2011  C CB  . LYS A 1 267 ? 15.737  -1.959  13.895  1.00 2.92  ? 267 LYS A CB  1 
ATOM   2012  C CG  . LYS A 1 267 ? 15.243  -1.960  15.364  1.00 2.81  ? 267 LYS A CG  1 
ATOM   2013  C CD  . LYS A 1 267 ? 15.253  -3.388  15.876  1.00 3.09  ? 267 LYS A CD  1 
ATOM   2014  C CE  . LYS A 1 267 ? 16.656  -3.957  16.046  1.00 3.26  ? 267 LYS A CE  1 
ATOM   2015  N NZ  . LYS A 1 267 ? 16.657  -5.410  15.663  1.00 3.41  ? 267 LYS A NZ  1 
ATOM   2016  N N   . ARG A 1 268 ? 15.506  0.244   10.967  1.00 3.15  ? 268 ARG A N   1 
ATOM   2017  C CA  . ARG A 1 268 ? 16.107  0.764   9.745   1.00 3.42  ? 268 ARG A CA  1 
ATOM   2018  C C   . ARG A 1 268 ? 17.049  1.912   10.237  1.00 3.45  ? 268 ARG A C   1 
ATOM   2019  O O   . ARG A 1 268 ? 16.558  2.810   10.958  1.00 3.46  ? 268 ARG A O   1 
ATOM   2020  C CB  . ARG A 1 268 ? 15.211  1.428   8.734   1.00 3.68  ? 268 ARG A CB  1 
ATOM   2021  C CG  . ARG A 1 268 ? 14.542  0.802   7.564   1.00 4.07  ? 268 ARG A CG  1 
ATOM   2022  C CD  . ARG A 1 268 ? 14.308  1.758   6.434   1.00 4.48  ? 268 ARG A CD  1 
ATOM   2023  N NE  . ARG A 1 268 ? 13.081  2.502   6.493   1.00 5.06  ? 268 ARG A NE  1 
ATOM   2024  C CZ  . ARG A 1 268 ? 11.879  2.219   5.961   1.00 5.34  ? 268 ARG A CZ  1 
ATOM   2025  N NH1 . ARG A 1 268 ? 11.618  1.128   5.221   1.00 5.32  ? 268 ARG A NH1 1 
ATOM   2026  N NH2 . ARG A 1 268 ? 10.835  3.047   6.180   1.00 5.18  ? 268 ARG A NH2 1 
ATOM   2027  N N   . VAL A 1 269 ? 18.296  1.779   9.848   1.00 3.39  ? 269 VAL A N   1 
ATOM   2028  C CA  . VAL A 1 269 ? 19.291  2.816   10.218  1.00 3.24  ? 269 VAL A CA  1 
ATOM   2029  C C   . VAL A 1 269 ? 18.975  4.058   9.391   1.00 3.26  ? 269 VAL A C   1 
ATOM   2030  O O   . VAL A 1 269 ? 18.409  3.987   8.280   1.00 3.13  ? 269 VAL A O   1 
ATOM   2031  C CB  . VAL A 1 269 ? 20.711  2.277   10.117  1.00 3.28  ? 269 VAL A CB  1 
ATOM   2032  C CG1 . VAL A 1 269 ? 21.190  2.050   8.694   1.00 3.21  ? 269 VAL A CG1 1 
ATOM   2033  C CG2 . VAL A 1 269 ? 21.671  3.168   10.904  1.00 3.32  ? 269 VAL A CG2 1 
ATOM   2034  N N   . HIS A 1 270 ? 19.349  5.185   9.969   1.00 3.30  ? 270 HIS A N   1 
ATOM   2035  C CA  . HIS A 1 270 ? 19.051  6.518   9.474   1.00 3.15  ? 270 HIS A CA  1 
ATOM   2036  C C   . HIS A 1 270 ? 20.076  7.562   9.879   1.00 3.21  ? 270 HIS A C   1 
ATOM   2037  O O   . HIS A 1 270 ? 20.762  7.430   10.894  1.00 3.09  ? 270 HIS A O   1 
ATOM   2038  C CB  . HIS A 1 270 ? 17.662  7.052   10.031  1.00 2.78  ? 270 HIS A CB  1 
ATOM   2039  C CG  . HIS A 1 270 ? 16.533  6.419   9.290   1.00 2.51  ? 270 HIS A CG  1 
ATOM   2040  N ND1 . HIS A 1 270 ? 16.110  6.850   8.062   1.00 2.51  ? 270 HIS A ND1 1 
ATOM   2041  C CD2 . HIS A 1 270 ? 15.823  5.310   9.551   1.00 2.53  ? 270 HIS A CD2 1 
ATOM   2042  C CE1 . HIS A 1 270 ? 15.161  6.043   7.613   1.00 2.55  ? 270 HIS A CE1 1 
ATOM   2043  N NE2 . HIS A 1 270 ? 14.961  5.099   8.511   1.00 2.53  ? 270 HIS A NE2 1 
ATOM   2044  N N   . PRO A 1 271 ? 20.142  8.556   8.996   1.00 3.36  ? 271 PRO A N   1 
ATOM   2045  C CA  . PRO A 1 271 ? 20.949  9.760   9.309   1.00 3.58  ? 271 PRO A CA  1 
ATOM   2046  C C   . PRO A 1 271 ? 19.926  10.741  9.904   1.00 3.86  ? 271 PRO A C   1 
ATOM   2047  O O   . PRO A 1 271 ? 18.935  11.140  9.291   1.00 3.95  ? 271 PRO A O   1 
ATOM   2048  C CB  . PRO A 1 271 ? 21.592  10.174  8.030   1.00 3.42  ? 271 PRO A CB  1 
ATOM   2049  C CG  . PRO A 1 271 ? 20.730  9.615   6.961   1.00 3.39  ? 271 PRO A CG  1 
ATOM   2050  C CD  . PRO A 1 271 ? 20.072  8.360   7.527   1.00 3.34  ? 271 PRO A CD  1 
ATOM   2051  N N   . VAL A 1 272 ? 20.123  11.008  11.153  1.00 4.12  ? 272 VAL A N   1 
ATOM   2052  C CA  . VAL A 1 272 ? 19.271  11.869  11.974  1.00 4.47  ? 272 VAL A CA  1 
ATOM   2053  C C   . VAL A 1 272 ? 20.184  12.620  12.915  1.00 4.95  ? 272 VAL A C   1 
ATOM   2054  O O   . VAL A 1 272 ? 21.359  12.199  13.012  1.00 5.05  ? 272 VAL A O   1 
ATOM   2055  C CB  . VAL A 1 272 ? 18.261  10.902  12.626  1.00 4.43  ? 272 VAL A CB  1 
ATOM   2056  C CG1 . VAL A 1 272 ? 17.442  10.142  11.587  1.00 4.38  ? 272 VAL A CG1 1 
ATOM   2057  C CG2 . VAL A 1 272 ? 18.918  9.927   13.578  1.00 4.34  ? 272 VAL A CG2 1 
ATOM   2058  N N   . THR A 1 273 ? 19.704  13.637  13.595  1.00 5.52  ? 273 THR A N   1 
ATOM   2059  C CA  . THR A 1 273 ? 20.503  14.397  14.551  1.00 6.08  ? 273 THR A CA  1 
ATOM   2060  C C   . THR A 1 273 ? 20.399  13.852  15.964  1.00 6.69  ? 273 THR A C   1 
ATOM   2061  O O   . THR A 1 273 ? 19.315  13.506  16.439  1.00 6.79  ? 273 THR A O   1 
ATOM   2062  C CB  . THR A 1 273 ? 20.097  15.924  14.558  1.00 5.94  ? 273 THR A CB  1 
ATOM   2063  O OG1 . THR A 1 273 ? 18.686  15.915  14.933  1.00 6.04  ? 273 THR A OG1 1 
ATOM   2064  C CG2 . THR A 1 273 ? 20.354  16.617  13.239  1.00 6.01  ? 273 THR A CG2 1 
ATOM   2065  N N   . THR A 1 274 ? 21.524  13.819  16.632  1.00 7.54  ? 274 THR A N   1 
ATOM   2066  C CA  . THR A 1 274 ? 21.670  13.397  18.001  1.00 8.49  ? 274 THR A CA  1 
ATOM   2067  C C   . THR A 1 274 ? 23.012  13.937  18.517  1.00 9.43  ? 274 THR A C   1 
ATOM   2068  O O   . THR A 1 274 ? 23.779  14.545  17.787  1.00 9.42  ? 274 THR A O   1 
ATOM   2069  C CB  . THR A 1 274 ? 21.583  11.859  18.284  1.00 8.52  ? 274 THR A CB  1 
ATOM   2070  O OG1 . THR A 1 274 ? 22.316  11.159  17.204  1.00 8.45  ? 274 THR A OG1 1 
ATOM   2071  C CG2 . THR A 1 274 ? 20.141  11.372  18.464  1.00 8.48  ? 274 THR A CG2 1 
ATOM   2072  N N   . LEU A 1 275 ? 23.205  13.651  19.776  1.00 10.69 ? 275 LEU A N   1 
ATOM   2073  C CA  . LEU A 1 275 ? 24.350  14.083  20.550  1.00 11.80 ? 275 LEU A CA  1 
ATOM   2074  C C   . LEU A 1 275 ? 25.606  13.330  20.180  1.00 12.82 ? 275 LEU A C   1 
ATOM   2075  O O   . LEU A 1 275 ? 25.774  12.174  20.616  1.00 13.00 ? 275 LEU A O   1 
ATOM   2076  C CB  . LEU A 1 275 ? 23.953  13.895  22.026  1.00 11.68 ? 275 LEU A CB  1 
ATOM   2077  C CG  . LEU A 1 275 ? 24.940  14.310  23.080  1.00 11.67 ? 275 LEU A CG  1 
ATOM   2078  C CD1 . LEU A 1 275 ? 25.403  15.748  22.860  1.00 11.86 ? 275 LEU A CD1 1 
ATOM   2079  C CD2 . LEU A 1 275 ? 24.254  14.240  24.453  1.00 11.72 ? 275 LEU A CD2 1 
ATOM   2080  N N   . VAL A 1 276 ? 26.430  13.982  19.403  1.00 14.24 ? 276 VAL A N   1 
ATOM   2081  C CA  . VAL A 1 276 ? 27.760  13.410  19.053  1.00 15.73 ? 276 VAL A CA  1 
ATOM   2082  C C   . VAL A 1 276 ? 28.763  13.830  20.152  1.00 16.89 ? 276 VAL A C   1 
ATOM   2083  O O   . VAL A 1 276 ? 29.983  13.785  19.986  1.00 16.69 ? 276 VAL A O   1 
ATOM   2084  C CB  . VAL A 1 276 ? 28.153  13.800  17.627  1.00 15.50 ? 276 VAL A CB  1 
ATOM   2085  C CG1 . VAL A 1 276 ? 27.011  13.662  16.632  1.00 15.37 ? 276 VAL A CG1 1 
ATOM   2086  C CG2 . VAL A 1 276 ? 28.765  15.182  17.576  1.00 15.42 ? 276 VAL A CG2 1 
ATOM   2087  N N   . LYS A 1 277 ? 28.195  14.227  21.270  1.00 18.52 ? 277 LYS A N   1 
ATOM   2088  C CA  . LYS A 1 277 ? 28.791  14.694  22.473  1.00 20.01 ? 277 LYS A CA  1 
ATOM   2089  C C   . LYS A 1 277 ? 30.259  14.291  22.634  1.00 20.70 ? 277 LYS A C   1 
ATOM   2090  O O   . LYS A 1 277 ? 30.945  15.152  23.221  1.00 21.20 ? 277 LYS A O   1 
ATOM   2091  C CB  . LYS A 1 277 ? 28.150  14.272  23.798  1.00 20.63 ? 277 LYS A CB  1 
ATOM   2092  C CG  . LYS A 1 277 ? 28.254  12.779  24.150  1.00 21.52 ? 277 LYS A CG  1 
ATOM   2093  C CD  . LYS A 1 277 ? 28.652  12.624  25.622  1.00 22.12 ? 277 LYS A CD  1 
ATOM   2094  C CE  . LYS A 1 277 ? 27.921  11.483  26.325  1.00 22.41 ? 277 LYS A CE  1 
ATOM   2095  N NZ  . LYS A 1 277 ? 27.862  11.794  27.808  1.00 22.71 ? 277 LYS A NZ  1 
ATOM   2096  N N   . GLY A 1 278 ? 30.585  13.060  22.321  1.00 21.13 ? 278 GLY A N   1 
ATOM   2097  C CA  . GLY A 1 278 ? 31.969  12.583  22.503  1.00 21.67 ? 278 GLY A CA  1 
ATOM   2098  C C   . GLY A 1 278 ? 32.306  11.527  21.464  1.00 22.18 ? 278 GLY A C   1 
ATOM   2099  O O   . GLY A 1 278 ? 32.751  10.420  21.820  1.00 22.37 ? 278 GLY A O   1 
ATOM   2100  N N   . PHE A 1 279 ? 32.051  11.817  20.222  1.00 22.56 ? 279 PHE A N   1 
ATOM   2101  C CA  . PHE A 1 279 ? 32.358  10.911  19.094  1.00 23.00 ? 279 PHE A CA  1 
ATOM   2102  C C   . PHE A 1 279 ? 33.423  11.625  18.260  1.00 23.23 ? 279 PHE A C   1 
ATOM   2103  O O   . PHE A 1 279 ? 33.561  12.860  18.383  1.00 23.57 ? 279 PHE A O   1 
ATOM   2104  C CB  . PHE A 1 279 ? 31.143  10.540  18.261  1.00 23.19 ? 279 PHE A CB  1 
ATOM   2105  C CG  . PHE A 1 279 ? 30.477  9.223   18.507  1.00 23.29 ? 279 PHE A CG  1 
ATOM   2106  C CD1 . PHE A 1 279 ? 31.030  8.052   17.946  1.00 23.27 ? 279 PHE A CD1 1 
ATOM   2107  C CD2 . PHE A 1 279 ? 29.303  9.135   19.258  1.00 23.21 ? 279 PHE A CD2 1 
ATOM   2108  C CE1 . PHE A 1 279 ? 30.448  6.817   18.163  1.00 23.25 ? 279 PHE A CE1 1 
ATOM   2109  C CE2 . PHE A 1 279 ? 28.699  7.891   19.471  1.00 23.27 ? 279 PHE A CE2 1 
ATOM   2110  C CZ  . PHE A 1 279 ? 29.271  6.733   18.905  1.00 23.24 ? 279 PHE A CZ  1 
ATOM   2111  N N   . HIS A 1 280 ? 34.123  10.896  17.464  1.00 23.27 ? 280 HIS A N   1 
ATOM   2112  C CA  . HIS A 1 280 ? 35.171  11.391  16.574  1.00 23.41 ? 280 HIS A CA  1 
ATOM   2113  C C   . HIS A 1 280 ? 35.759  12.752  16.891  1.00 23.09 ? 280 HIS A C   1 
ATOM   2114  O O   . HIS A 1 280 ? 35.989  13.634  16.040  1.00 22.82 ? 280 HIS A O   1 
ATOM   2115  C CB  . HIS A 1 280 ? 34.664  11.299  15.100  1.00 23.86 ? 280 HIS A CB  1 
ATOM   2116  C CG  . HIS A 1 280 ? 33.762  12.445  14.769  1.00 24.29 ? 280 HIS A CG  1 
ATOM   2117  N ND1 . HIS A 1 280 ? 34.281  13.622  14.236  1.00 24.47 ? 280 HIS A ND1 1 
ATOM   2118  C CD2 . HIS A 1 280 ? 32.455  12.664  14.985  1.00 24.44 ? 280 HIS A CD2 1 
ATOM   2119  C CE1 . HIS A 1 280 ? 33.289  14.489  14.087  1.00 24.56 ? 280 HIS A CE1 1 
ATOM   2120  N NE2 . HIS A 1 280 ? 32.169  13.925  14.499  1.00 24.56 ? 280 HIS A NE2 1 
ATOM   2121  N N   . GLY A 1 281 ? 36.168  12.941  18.139  1.00 22.93 ? 281 GLY A N   1 
ATOM   2122  C CA  . GLY A 1 281 ? 36.853  14.146  18.594  1.00 22.81 ? 281 GLY A CA  1 
ATOM   2123  C C   . GLY A 1 281 ? 35.947  15.170  19.219  1.00 22.78 ? 281 GLY A C   1 
ATOM   2124  O O   . GLY A 1 281 ? 36.395  15.935  20.112  1.00 22.92 ? 281 GLY A O   1 
ATOM   2125  N N   . ILE A 1 282 ? 34.713  15.237  18.722  1.00 22.55 ? 282 ILE A N   1 
ATOM   2126  C CA  . ILE A 1 282 ? 33.731  16.179  19.302  1.00 22.16 ? 282 ILE A CA  1 
ATOM   2127  C C   . ILE A 1 282 ? 33.479  15.726  20.750  1.00 22.08 ? 282 ILE A C   1 
ATOM   2128  O O   . ILE A 1 282 ? 33.271  14.546  21.017  1.00 21.82 ? 282 ILE A O   1 
ATOM   2129  C CB  . ILE A 1 282 ? 32.445  16.316  18.472  1.00 21.97 ? 282 ILE A CB  1 
ATOM   2130  C CG1 . ILE A 1 282 ? 32.781  16.402  16.964  1.00 21.81 ? 282 ILE A CG1 1 
ATOM   2131  C CG2 . ILE A 1 282 ? 31.586  17.550  18.920  1.00 21.99 ? 282 ILE A CG2 1 
ATOM   2132  C CD1 . ILE A 1 282 ? 31.515  16.223  16.075  1.00 21.74 ? 282 ILE A CD1 1 
ATOM   2133  N N   . LYS A 1 283 ? 33.640  16.706  21.617  1.00 22.12 ? 283 LYS A N   1 
ATOM   2134  C CA  . LYS A 1 283 ? 33.448  16.505  23.058  1.00 22.21 ? 283 LYS A CA  1 
ATOM   2135  C C   . LYS A 1 283 ? 32.802  17.763  23.633  1.00 22.12 ? 283 LYS A C   1 
ATOM   2136  O O   . LYS A 1 283 ? 33.453  18.639  24.230  1.00 22.32 ? 283 LYS A O   1 
ATOM   2137  C CB  . LYS A 1 283 ? 34.740  16.136  23.750  1.00 22.41 ? 283 LYS A CB  1 
ATOM   2138  C CG  . LYS A 1 283 ? 35.452  14.891  23.221  1.00 22.58 ? 283 LYS A CG  1 
ATOM   2139  C CD  . LYS A 1 283 ? 36.668  14.518  24.058  1.00 22.75 ? 283 LYS A CD  1 
ATOM   2140  C CE  . LYS A 1 283 ? 37.854  15.455  23.879  1.00 22.90 ? 283 LYS A CE  1 
ATOM   2141  N NZ  . LYS A 1 283 ? 38.910  15.197  24.914  1.00 22.74 ? 283 LYS A NZ  1 
ATOM   2142  N N   . GLU A 1 284 ? 31.508  17.863  23.397  1.00 21.81 ? 284 GLU A N   1 
ATOM   2143  C CA  . GLU A 1 284 ? 30.687  19.020  23.850  1.00 21.48 ? 284 GLU A CA  1 
ATOM   2144  C C   . GLU A 1 284 ? 29.310  18.815  23.201  1.00 20.97 ? 284 GLU A C   1 
ATOM   2145  O O   . GLU A 1 284 ? 29.278  18.551  21.996  1.00 20.75 ? 284 GLU A O   1 
ATOM   2146  C CB  . GLU A 1 284 ? 31.318  20.321  23.442  1.00 21.78 ? 284 GLU A CB  1 
ATOM   2147  C CG  . GLU A 1 284 ? 31.488  21.502  24.342  1.00 22.12 ? 284 GLU A CG  1 
ATOM   2148  C CD  . GLU A 1 284 ? 32.623  21.684  25.281  1.00 22.23 ? 284 GLU A CD  1 
ATOM   2149  O OE1 . GLU A 1 284 ? 33.675  21.057  25.299  1.00 22.21 ? 284 GLU A OE1 1 
ATOM   2150  O OE2 . GLU A 1 284 ? 32.398  22.618  26.109  1.00 22.23 ? 284 GLU A OE2 1 
ATOM   2151  N N   . GLU A 1 285 ? 28.283  18.781  24.005  1.00 20.33 ? 285 GLU A N   1 
ATOM   2152  C CA  . GLU A 1 285 ? 26.892  18.500  23.758  1.00 19.54 ? 285 GLU A CA  1 
ATOM   2153  C C   . GLU A 1 285 ? 26.311  19.138  22.480  1.00 18.84 ? 285 GLU A C   1 
ATOM   2154  O O   . GLU A 1 285 ? 25.182  19.694  22.416  1.00 18.70 ? 285 GLU A O   1 
ATOM   2155  C CB  . GLU A 1 285 ? 25.980  18.882  24.874  1.00 19.79 ? 285 GLU A CB  1 
ATOM   2156  C CG  . GLU A 1 285 ? 25.878  19.100  26.267  1.00 20.21 ? 285 GLU A CG  1 
ATOM   2157  C CD  . GLU A 1 285 ? 25.624  18.135  27.348  1.00 20.59 ? 285 GLU A CD  1 
ATOM   2158  O OE1 . GLU A 1 285 ? 26.281  18.090  28.399  1.00 21.03 ? 285 GLU A OE1 1 
ATOM   2159  O OE2 . GLU A 1 285 ? 24.670  17.345  27.181  1.00 20.63 ? 285 GLU A OE2 1 
ATOM   2160  N N   . VAL A 1 286 ? 27.045  18.994  21.417  1.00 17.89 ? 286 VAL A N   1 
ATOM   2161  C CA  . VAL A 1 286 ? 26.765  19.344  20.066  1.00 17.05 ? 286 VAL A CA  1 
ATOM   2162  C C   . VAL A 1 286 ? 25.976  18.145  19.453  1.00 16.44 ? 286 VAL A C   1 
ATOM   2163  O O   . VAL A 1 286 ? 26.485  17.025  19.484  1.00 16.45 ? 286 VAL A O   1 
ATOM   2164  C CB  . VAL A 1 286 ? 27.995  19.558  19.168  1.00 17.04 ? 286 VAL A CB  1 
ATOM   2165  C CG1 . VAL A 1 286 ? 27.588  19.746  17.706  1.00 16.92 ? 286 VAL A CG1 1 
ATOM   2166  C CG2 . VAL A 1 286 ? 28.880  20.678  19.654  1.00 17.11 ? 286 VAL A CG2 1 
ATOM   2167  N N   . PHE A 1 287 ? 24.864  18.515  18.918  1.00 15.66 ? 287 PHE A N   1 
ATOM   2168  C CA  . PHE A 1 287 ? 23.950  17.627  18.223  1.00 14.94 ? 287 PHE A CA  1 
ATOM   2169  C C   . PHE A 1 287 ? 24.093  17.984  16.728  1.00 14.68 ? 287 PHE A C   1 
ATOM   2170  O O   . PHE A 1 287 ? 23.880  19.164  16.419  1.00 14.85 ? 287 PHE A O   1 
ATOM   2171  C CB  . PHE A 1 287 ? 22.498  17.776  18.628  1.00 14.65 ? 287 PHE A CB  1 
ATOM   2172  C CG  . PHE A 1 287 ? 22.056  17.296  19.959  1.00 14.51 ? 287 PHE A CG  1 
ATOM   2173  C CD1 . PHE A 1 287 ? 22.503  17.910  21.127  1.00 14.55 ? 287 PHE A CD1 1 
ATOM   2174  C CD2 . PHE A 1 287 ? 21.072  16.312  20.061  1.00 14.44 ? 287 PHE A CD2 1 
ATOM   2175  C CE1 . PHE A 1 287 ? 22.040  17.510  22.367  1.00 14.55 ? 287 PHE A CE1 1 
ATOM   2176  C CE2 . PHE A 1 287 ? 20.605  15.868  21.293  1.00 14.33 ? 287 PHE A CE2 1 
ATOM   2177  C CZ  . PHE A 1 287 ? 21.106  16.471  22.443  1.00 14.44 ? 287 PHE A CZ  1 
ATOM   2178  N N   . LEU A 1 288 ? 24.598  17.070  15.971  1.00 14.18 ? 288 LEU A N   1 
ATOM   2179  C CA  . LEU A 1 288 ? 24.594  17.157  14.488  1.00 13.68 ? 288 LEU A CA  1 
ATOM   2180  C C   . LEU A 1 288 ? 24.082  15.737  14.126  1.00 13.43 ? 288 LEU A C   1 
ATOM   2181  O O   . LEU A 1 288 ? 23.793  14.955  15.073  1.00 13.25 ? 288 LEU A O   1 
ATOM   2182  C CB  . LEU A 1 288 ? 25.839  17.639  13.867  1.00 13.62 ? 288 LEU A CB  1 
ATOM   2183  C CG  . LEU A 1 288 ? 27.133  16.932  13.610  1.00 13.50 ? 288 LEU A CG  1 
ATOM   2184  C CD1 . LEU A 1 288 ? 27.720  16.350  14.886  1.00 13.49 ? 288 LEU A CD1 1 
ATOM   2185  C CD2 . LEU A 1 288 ? 26.967  15.762  12.636  1.00 13.45 ? 288 LEU A CD2 1 
ATOM   2186  N N   . SER A 1 289 ? 24.017  15.448  12.846  1.00 13.12 ? 289 SER A N   1 
ATOM   2187  C CA  . SER A 1 289 ? 23.449  14.138  12.452  1.00 12.78 ? 289 SER A CA  1 
ATOM   2188  C C   . SER A 1 289 ? 24.503  13.114  12.065  1.00 12.39 ? 289 SER A C   1 
ATOM   2189  O O   . SER A 1 289 ? 25.537  13.375  11.431  1.00 12.43 ? 289 SER A O   1 
ATOM   2190  C CB  . SER A 1 289 ? 22.402  14.344  11.365  1.00 12.91 ? 289 SER A CB  1 
ATOM   2191  O OG  . SER A 1 289 ? 22.972  14.027  10.120  1.00 13.27 ? 289 SER A OG  1 
ATOM   2192  N N   . ILE A 1 290 ? 24.141  11.897  12.363  1.00 11.86 ? 290 ILE A N   1 
ATOM   2193  C CA  . ILE A 1 290 ? 24.961  10.680  12.176  1.00 11.59 ? 290 ILE A CA  1 
ATOM   2194  C C   . ILE A 1 290 ? 24.060  9.501   11.903  1.00 11.53 ? 290 ILE A C   1 
ATOM   2195  O O   . ILE A 1 290 ? 22.874  9.463   12.327  1.00 11.78 ? 290 ILE A O   1 
ATOM   2196  C CB  . ILE A 1 290 ? 25.850  10.595  13.478  1.00 11.39 ? 290 ILE A CB  1 
ATOM   2197  C CG1 . ILE A 1 290 ? 27.334  10.779  13.077  1.00 11.37 ? 290 ILE A CG1 1 
ATOM   2198  C CG2 . ILE A 1 290 ? 25.619  9.375   14.379  1.00 11.17 ? 290 ILE A CG2 1 
ATOM   2199  C CD1 . ILE A 1 290 ? 27.783  12.262  12.977  1.00 11.41 ? 290 ILE A CD1 1 
ATOM   2200  N N   . PRO A 1 291 ? 24.574  8.524   11.162  1.00 11.20 ? 291 PRO A N   1 
ATOM   2201  C CA  . PRO A 1 291 ? 23.771  7.305   10.865  1.00 10.83 ? 291 PRO A CA  1 
ATOM   2202  C C   . PRO A 1 291 ? 23.506  6.535   12.143  1.00 10.57 ? 291 PRO A C   1 
ATOM   2203  O O   . PRO A 1 291 ? 24.414  6.065   12.850  1.00 10.55 ? 291 PRO A O   1 
ATOM   2204  C CB  . PRO A 1 291 ? 24.540  6.616   9.784   1.00 10.72 ? 291 PRO A CB  1 
ATOM   2205  C CG  . PRO A 1 291 ? 25.910  7.223   9.799   1.00 10.85 ? 291 PRO A CG  1 
ATOM   2206  C CD  . PRO A 1 291 ? 25.700  8.686   10.218  1.00 10.98 ? 291 PRO A CD  1 
ATOM   2207  N N   . CYS A 1 292 ? 22.237  6.428   12.501  1.00 10.35 ? 292 CYS A N   1 
ATOM   2208  C CA  . CYS A 1 292 ? 21.696  5.773   13.674  1.00 9.97  ? 292 CYS A CA  1 
ATOM   2209  C C   . CYS A 1 292 ? 20.549  4.815   13.287  1.00 9.87  ? 292 CYS A C   1 
ATOM   2210  O O   . CYS A 1 292 ? 19.852  5.017   12.310  1.00 9.59  ? 292 CYS A O   1 
ATOM   2211  C CB  . CYS A 1 292 ? 21.125  6.750   14.694  1.00 9.78  ? 292 CYS A CB  1 
ATOM   2212  S SG  . CYS A 1 292 ? 21.522  8.499   14.494  1.00 9.31  ? 292 CYS A SG  1 
ATOM   2213  N N   . VAL A 1 293 ? 20.357  3.850   14.158  1.00 10.00 ? 293 VAL A N   1 
ATOM   2214  C CA  . VAL A 1 293 ? 19.286  2.852   14.028  1.00 10.00 ? 293 VAL A CA  1 
ATOM   2215  C C   . VAL A 1 293 ? 18.109  3.303   14.924  1.00 10.02 ? 293 VAL A C   1 
ATOM   2216  O O   . VAL A 1 293 ? 18.273  3.565   16.114  1.00 9.75  ? 293 VAL A O   1 
ATOM   2217  C CB  . VAL A 1 293 ? 19.763  1.437   14.335  1.00 10.02 ? 293 VAL A CB  1 
ATOM   2218  C CG1 . VAL A 1 293 ? 18.797  0.366   13.806  1.00 10.07 ? 293 VAL A CG1 1 
ATOM   2219  C CG2 . VAL A 1 293 ? 21.173  1.157   13.845  1.00 10.11 ? 293 VAL A CG2 1 
ATOM   2220  N N   . LEU A 1 294 ? 16.963  3.321   14.271  1.00 10.17 ? 294 LEU A N   1 
ATOM   2221  C CA  . LEU A 1 294 ? 15.689  3.745   14.824  1.00 10.37 ? 294 LEU A CA  1 
ATOM   2222  C C   . LEU A 1 294 ? 14.665  2.621   14.960  1.00 10.55 ? 294 LEU A C   1 
ATOM   2223  O O   . LEU A 1 294 ? 14.426  1.920   13.964  1.00 10.52 ? 294 LEU A O   1 
ATOM   2224  C CB  . LEU A 1 294 ? 15.160  4.841   13.876  1.00 10.26 ? 294 LEU A CB  1 
ATOM   2225  C CG  . LEU A 1 294 ? 16.126  5.876   13.359  1.00 10.33 ? 294 LEU A CG  1 
ATOM   2226  C CD1 . LEU A 1 294 ? 15.392  6.863   12.474  1.00 10.14 ? 294 LEU A CD1 1 
ATOM   2227  C CD2 . LEU A 1 294 ? 16.792  6.626   14.528  1.00 10.33 ? 294 LEU A CD2 1 
ATOM   2228  N N   . GLY A 1 295 ? 14.016  2.577   16.111  1.00 10.74 ? 295 GLY A N   1 
ATOM   2229  C CA  . GLY A 1 295 ? 12.964  1.599   16.403  1.00 11.07 ? 295 GLY A CA  1 
ATOM   2230  C C   . GLY A 1 295 ? 11.926  2.214   17.327  1.00 11.45 ? 295 GLY A C   1 
ATOM   2231  O O   . GLY A 1 295 ? 11.992  3.401   17.647  1.00 11.44 ? 295 GLY A O   1 
ATOM   2232  N N   . GLU A 1 296 ? 10.975  1.440   17.741  1.00 12.04 ? 296 GLU A N   1 
ATOM   2233  C CA  . GLU A 1 296 ? 9.890   1.718   18.651  1.00 12.74 ? 296 GLU A CA  1 
ATOM   2234  C C   . GLU A 1 296 ? 10.298  2.746   19.703  1.00 13.06 ? 296 GLU A C   1 
ATOM   2235  O O   . GLU A 1 296 ? 9.712   3.847   19.808  1.00 13.23 ? 296 GLU A O   1 
ATOM   2236  C CB  . GLU A 1 296 ? 9.479   0.454   19.431  1.00 13.08 ? 296 GLU A CB  1 
ATOM   2237  C CG  . GLU A 1 296 ? 8.022   0.159   19.683  1.00 13.62 ? 296 GLU A CG  1 
ATOM   2238  C CD  . GLU A 1 296 ? 7.575   -0.678  20.828  1.00 13.84 ? 296 GLU A CD  1 
ATOM   2239  O OE1 . GLU A 1 296 ? 8.244   -0.937  21.827  1.00 14.15 ? 296 GLU A OE1 1 
ATOM   2240  O OE2 . GLU A 1 296 ? 6.382   -1.063  20.747  1.00 13.71 ? 296 GLU A OE2 1 
ATOM   2241  N N   . SER A 1 297 ? 11.382  2.423   20.390  1.00 13.19 ? 297 SER A N   1 
ATOM   2242  C CA  . SER A 1 297 ? 11.943  3.158   21.496  1.00 13.27 ? 297 SER A CA  1 
ATOM   2243  C C   . SER A 1 297 ? 12.926  4.273   21.225  1.00 13.43 ? 297 SER A C   1 
ATOM   2244  O O   . SER A 1 297 ? 13.611  4.702   22.221  1.00 13.60 ? 297 SER A O   1 
ATOM   2245  C CB  . SER A 1 297 ? 12.649  2.146   22.451  1.00 13.16 ? 297 SER A CB  1 
ATOM   2246  O OG  . SER A 1 297 ? 13.929  1.889   21.853  1.00 13.21 ? 297 SER A OG  1 
ATOM   2247  N N   . GLY A 1 298 ? 13.056  4.764   20.018  1.00 13.42 ? 298 GLY A N   1 
ATOM   2248  C CA  . GLY A 1 298 ? 13.917  5.946   19.758  1.00 13.33 ? 298 GLY A CA  1 
ATOM   2249  C C   . GLY A 1 298 ? 15.119  5.599   18.904  1.00 13.41 ? 298 GLY A C   1 
ATOM   2250  O O   . GLY A 1 298 ? 15.024  4.932   17.855  1.00 13.35 ? 298 GLY A O   1 
ATOM   2251  N N   . ILE A 1 299 ? 16.216  6.289   19.239  1.00 13.43 ? 299 ILE A N   1 
ATOM   2252  C CA  . ILE A 1 299 ? 17.516  5.921   18.634  1.00 13.36 ? 299 ILE A CA  1 
ATOM   2253  C C   . ILE A 1 299 ? 17.939  4.794   19.605  1.00 13.49 ? 299 ILE A C   1 
ATOM   2254  O O   . ILE A 1 299 ? 17.695  4.955   20.807  1.00 13.56 ? 299 ILE A O   1 
ATOM   2255  C CB  . ILE A 1 299 ? 18.564  7.014   18.474  1.00 13.17 ? 299 ILE A CB  1 
ATOM   2256  C CG1 . ILE A 1 299 ? 17.984  8.221   17.699  1.00 13.08 ? 299 ILE A CG1 1 
ATOM   2257  C CG2 . ILE A 1 299 ? 19.855  6.508   17.753  1.00 13.27 ? 299 ILE A CG2 1 
ATOM   2258  C CD1 . ILE A 1 299 ? 17.207  9.163   18.630  1.00 13.14 ? 299 ILE A CD1 1 
ATOM   2259  N N   . THR A 1 300 ? 18.338  3.716   19.021  1.00 13.76 ? 300 THR A N   1 
ATOM   2260  C CA  . THR A 1 300 ? 18.689  2.510   19.819  1.00 13.91 ? 300 THR A CA  1 
ATOM   2261  C C   . THR A 1 300 ? 20.189  2.513   20.002  1.00 14.01 ? 300 THR A C   1 
ATOM   2262  O O   . THR A 1 300 ? 20.718  2.442   21.097  1.00 13.98 ? 300 THR A O   1 
ATOM   2263  C CB  . THR A 1 300 ? 18.109  1.239   19.107  1.00 13.89 ? 300 THR A CB  1 
ATOM   2264  O OG1 . THR A 1 300 ? 16.969  0.813   19.935  1.00 13.80 ? 300 THR A OG1 1 
ATOM   2265  C CG2 . THR A 1 300 ? 19.112  0.117   18.850  1.00 14.05 ? 300 THR A CG2 1 
ATOM   2266  N N   . ASP A 1 301 ? 20.785  2.730   18.839  1.00 14.34 ? 301 ASP A N   1 
ATOM   2267  C CA  . ASP A 1 301 ? 22.252  2.684   18.693  1.00 14.55 ? 301 ASP A CA  1 
ATOM   2268  C C   . ASP A 1 301 ? 22.666  3.603   17.558  1.00 14.40 ? 301 ASP A C   1 
ATOM   2269  O O   . ASP A 1 301 ? 21.846  4.022   16.733  1.00 14.31 ? 301 ASP A O   1 
ATOM   2270  C CB  . ASP A 1 301 ? 22.650  1.196   18.556  1.00 14.83 ? 301 ASP A CB  1 
ATOM   2271  C CG  . ASP A 1 301 ? 22.298  0.577   17.234  1.00 14.93 ? 301 ASP A CG  1 
ATOM   2272  O OD1 . ASP A 1 301 ? 21.139  0.482   16.823  1.00 15.00 ? 301 ASP A OD1 1 
ATOM   2273  O OD2 . ASP A 1 301 ? 23.259  0.193   16.524  1.00 15.16 ? 301 ASP A OD2 1 
ATOM   2274  N N   . PHE A 1 302 ? 23.939  3.910   17.567  1.00 14.54 ? 302 PHE A N   1 
ATOM   2275  C CA  . PHE A 1 302 ? 24.589  4.818   16.610  1.00 14.70 ? 302 PHE A CA  1 
ATOM   2276  C C   . PHE A 1 302 ? 25.474  3.985   15.661  1.00 14.79 ? 302 PHE A C   1 
ATOM   2277  O O   . PHE A 1 302 ? 25.815  2.835   16.004  1.00 14.79 ? 302 PHE A O   1 
ATOM   2278  C CB  . PHE A 1 302 ? 25.419  5.875   17.318  1.00 14.68 ? 302 PHE A CB  1 
ATOM   2279  C CG  . PHE A 1 302 ? 25.018  6.312   18.684  1.00 14.75 ? 302 PHE A CG  1 
ATOM   2280  C CD1 . PHE A 1 302 ? 25.795  5.942   19.787  1.00 14.69 ? 302 PHE A CD1 1 
ATOM   2281  C CD2 . PHE A 1 302 ? 23.885  7.112   18.889  1.00 14.75 ? 302 PHE A CD2 1 
ATOM   2282  C CE1 . PHE A 1 302 ? 25.467  6.386   21.059  1.00 14.65 ? 302 PHE A CE1 1 
ATOM   2283  C CE2 . PHE A 1 302 ? 23.519  7.538   20.169  1.00 14.60 ? 302 PHE A CE2 1 
ATOM   2284  C CZ  . PHE A 1 302 ? 24.331  7.173   21.248  1.00 14.62 ? 302 PHE A CZ  1 
ATOM   2285  N N   . VAL A 1 303 ? 25.768  4.584   14.523  1.00 14.70 ? 303 VAL A N   1 
ATOM   2286  C CA  . VAL A 1 303 ? 26.686  3.897   13.570  1.00 14.86 ? 303 VAL A CA  1 
ATOM   2287  C C   . VAL A 1 303 ? 27.849  4.889   13.384  1.00 15.18 ? 303 VAL A C   1 
ATOM   2288  O O   . VAL A 1 303 ? 27.700  6.065   13.023  1.00 15.11 ? 303 VAL A O   1 
ATOM   2289  C CB  . VAL A 1 303 ? 26.017  3.335   12.341  1.00 14.74 ? 303 VAL A CB  1 
ATOM   2290  C CG1 . VAL A 1 303 ? 26.097  4.135   11.056  1.00 14.66 ? 303 VAL A CG1 1 
ATOM   2291  C CG2 . VAL A 1 303 ? 26.571  1.936   12.019  1.00 14.73 ? 303 VAL A CG2 1 
ATOM   2292  N N   . LYS A 1 304 ? 28.988  4.364   13.800  1.00 15.43 ? 304 LYS A N   1 
ATOM   2293  C CA  . LYS A 1 304 ? 30.274  5.073   13.780  1.00 15.59 ? 304 LYS A CA  1 
ATOM   2294  C C   . LYS A 1 304 ? 31.047  4.685   12.527  1.00 15.89 ? 304 LYS A C   1 
ATOM   2295  O O   . LYS A 1 304 ? 31.744  3.669   12.395  1.00 15.99 ? 304 LYS A O   1 
ATOM   2296  C CB  . LYS A 1 304 ? 31.034  4.805   15.064  1.00 15.56 ? 304 LYS A CB  1 
ATOM   2297  C CG  . LYS A 1 304 ? 31.029  3.338   15.473  1.00 15.77 ? 304 LYS A CG  1 
ATOM   2298  C CD  . LYS A 1 304 ? 31.117  3.067   16.943  1.00 15.96 ? 304 LYS A CD  1 
ATOM   2299  C CE  . LYS A 1 304 ? 32.513  3.200   17.503  1.00 16.29 ? 304 LYS A CE  1 
ATOM   2300  N NZ  . LYS A 1 304 ? 32.799  4.631   17.867  1.00 16.66 ? 304 LYS A NZ  1 
ATOM   2301  N N   . VAL A 1 305 ? 30.894  5.535   11.546  1.00 16.25 ? 305 VAL A N   1 
ATOM   2302  C CA  . VAL A 1 305 ? 31.478  5.524   10.232  1.00 16.70 ? 305 VAL A CA  1 
ATOM   2303  C C   . VAL A 1 305 ? 32.992  5.796   10.253  1.00 17.13 ? 305 VAL A C   1 
ATOM   2304  O O   . VAL A 1 305 ? 33.546  6.313   11.220  1.00 17.06 ? 305 VAL A O   1 
ATOM   2305  C CB  . VAL A 1 305 ? 30.738  6.603   9.384   1.00 16.55 ? 305 VAL A CB  1 
ATOM   2306  C CG1 . VAL A 1 305 ? 29.216  6.573   9.608   1.00 16.57 ? 305 VAL A CG1 1 
ATOM   2307  C CG2 . VAL A 1 305 ? 31.272  8.005   9.624   1.00 16.50 ? 305 VAL A CG2 1 
ATOM   2308  N N   . ASN A 1 306 ? 33.551  5.645   9.067   1.00 17.77 ? 306 ASN A N   1 
ATOM   2309  C CA  . ASN A 1 306 ? 34.960  5.865   8.752   1.00 18.43 ? 306 ASN A CA  1 
ATOM   2310  C C   . ASN A 1 306 ? 35.165  7.144   7.929   1.00 18.76 ? 306 ASN A C   1 
ATOM   2311  O O   . ASN A 1 306 ? 35.321  7.081   6.694   1.00 18.80 ? 306 ASN A O   1 
ATOM   2312  C CB  . ASN A 1 306 ? 35.545  4.648   8.022   1.00 18.63 ? 306 ASN A CB  1 
ATOM   2313  C CG  . ASN A 1 306 ? 34.830  4.291   6.731   1.00 18.87 ? 306 ASN A CG  1 
ATOM   2314  O OD1 . ASN A 1 306 ? 35.386  3.503   5.933   1.00 19.08 ? 306 ASN A OD1 1 
ATOM   2315  N ND2 . ASN A 1 306 ? 33.630  4.826   6.478   1.00 18.69 ? 306 ASN A ND2 1 
ATOM   2316  N N   . MET A 1 307 ? 35.157  8.280   8.611   1.00 19.22 ? 307 MET A N   1 
ATOM   2317  C CA  . MET A 1 307 ? 35.390  9.545   7.845   1.00 19.75 ? 307 MET A CA  1 
ATOM   2318  C C   . MET A 1 307 ? 36.927  9.525   7.662   1.00 20.06 ? 307 MET A C   1 
ATOM   2319  O O   . MET A 1 307 ? 37.618  8.885   8.489   1.00 20.21 ? 307 MET A O   1 
ATOM   2320  C CB  . MET A 1 307 ? 34.777  10.747  8.439   1.00 20.03 ? 307 MET A CB  1 
ATOM   2321  C CG  . MET A 1 307 ? 33.502  10.661  9.223   1.00 20.18 ? 307 MET A CG  1 
ATOM   2322  S SD  . MET A 1 307 ? 34.087  10.127  10.891  1.00 20.81 ? 307 MET A SD  1 
ATOM   2323  C CE  . MET A 1 307 ? 32.752  10.759  11.926  1.00 20.83 ? 307 MET A CE  1 
ATOM   2324  N N   . THR A 1 308 ? 37.379  9.933   6.486   1.00 20.16 ? 308 THR A N   1 
ATOM   2325  C CA  . THR A 1 308 ? 38.806  10.055  6.184   1.00 19.94 ? 308 THR A CA  1 
ATOM   2326  C C   . THR A 1 308 ? 39.306  11.204  7.074   1.00 19.79 ? 308 THR A C   1 
ATOM   2327  O O   . THR A 1 308 ? 38.468  12.025  7.474   1.00 19.80 ? 308 THR A O   1 
ATOM   2328  C CB  . THR A 1 308 ? 39.197  10.325  4.699   1.00 20.01 ? 308 THR A CB  1 
ATOM   2329  O OG1 . THR A 1 308 ? 40.616  10.800  4.744   1.00 20.19 ? 308 THR A OG1 1 
ATOM   2330  C CG2 . THR A 1 308 ? 38.372  11.330  3.916   1.00 19.83 ? 308 THR A CG2 1 
ATOM   2331  N N   . ALA A 1 309 ? 40.582  11.230  7.311   1.00 19.70 ? 309 ALA A N   1 
ATOM   2332  C CA  . ALA A 1 309 ? 41.216  12.252  8.157   1.00 19.57 ? 309 ALA A CA  1 
ATOM   2333  C C   . ALA A 1 309 ? 40.326  13.488  8.228   1.00 19.37 ? 309 ALA A C   1 
ATOM   2334  O O   . ALA A 1 309 ? 39.677  13.676  9.279   1.00 19.36 ? 309 ALA A O   1 
ATOM   2335  C CB  . ALA A 1 309 ? 42.629  12.541  7.698   1.00 19.59 ? 309 ALA A CB  1 
ATOM   2336  N N   . GLU A 1 310 ? 40.077  14.099  7.089   1.00 19.25 ? 310 GLU A N   1 
ATOM   2337  C CA  . GLU A 1 310 ? 39.265  15.323  7.043   1.00 19.31 ? 310 GLU A CA  1 
ATOM   2338  C C   . GLU A 1 310 ? 37.774  15.082  7.011   1.00 18.84 ? 310 GLU A C   1 
ATOM   2339  O O   . GLU A 1 310 ? 37.031  16.028  7.395   1.00 18.76 ? 310 GLU A O   1 
ATOM   2340  C CB  . GLU A 1 310 ? 39.626  16.253  5.886   1.00 19.88 ? 310 GLU A CB  1 
ATOM   2341  C CG  . GLU A 1 310 ? 38.923  16.013  4.549   1.00 20.46 ? 310 GLU A CG  1 
ATOM   2342  C CD  . GLU A 1 310 ? 39.285  14.741  3.865   1.00 20.86 ? 310 GLU A CD  1 
ATOM   2343  O OE1 . GLU A 1 310 ? 39.203  14.620  2.656   1.00 21.30 ? 310 GLU A OE1 1 
ATOM   2344  O OE2 . GLU A 1 310 ? 39.723  13.832  4.600   1.00 21.09 ? 310 GLU A OE2 1 
ATOM   2345  N N   . GLU A 1 311 ? 37.278  14.015  6.410   1.00 18.29 ? 311 GLU A N   1 
ATOM   2346  C CA  . GLU A 1 311 ? 35.790  13.775  6.544   1.00 17.85 ? 311 GLU A CA  1 
ATOM   2347  C C   . GLU A 1 311 ? 35.509  14.006  8.024   1.00 18.06 ? 311 GLU A C   1 
ATOM   2348  O O   . GLU A 1 311 ? 34.747  14.925  8.393   1.00 18.06 ? 311 GLU A O   1 
ATOM   2349  C CB  . GLU A 1 311 ? 35.378  12.481  5.938   1.00 17.26 ? 311 GLU A CB  1 
ATOM   2350  C CG  . GLU A 1 311 ? 35.361  12.353  4.438   1.00 16.73 ? 311 GLU A CG  1 
ATOM   2351  C CD  . GLU A 1 311 ? 35.136  11.101  3.695   1.00 16.35 ? 311 GLU A CD  1 
ATOM   2352  O OE1 . GLU A 1 311 ? 34.739  10.034  4.111   1.00 16.17 ? 311 GLU A OE1 1 
ATOM   2353  O OE2 . GLU A 1 311 ? 35.395  11.224  2.467   1.00 16.08 ? 311 GLU A OE2 1 
ATOM   2354  N N   . GLU A 1 312 ? 36.419  13.506  8.850   1.00 18.34 ? 312 GLU A N   1 
ATOM   2355  C CA  . GLU A 1 312 ? 36.434  13.677  10.299  1.00 18.62 ? 312 GLU A CA  1 
ATOM   2356  C C   . GLU A 1 312 ? 36.785  15.128  10.646  1.00 18.78 ? 312 GLU A C   1 
ATOM   2357  O O   . GLU A 1 312 ? 36.350  15.701  11.648  1.00 18.76 ? 312 GLU A O   1 
ATOM   2358  C CB  . GLU A 1 312 ? 37.442  12.794  11.002  1.00 18.69 ? 312 GLU A CB  1 
ATOM   2359  C CG  . GLU A 1 312 ? 37.247  12.494  12.490  1.00 18.84 ? 312 GLU A CG  1 
ATOM   2360  C CD  . GLU A 1 312 ? 38.349  11.641  13.085  1.00 18.96 ? 312 GLU A CD  1 
ATOM   2361  O OE1 . GLU A 1 312 ? 38.186  10.525  13.571  1.00 18.93 ? 312 GLU A OE1 1 
ATOM   2362  O OE2 . GLU A 1 312 ? 39.456  12.234  13.040  1.00 18.85 ? 312 GLU A OE2 1 
ATOM   2363  N N   . GLY A 1 313 ? 37.593  15.684  9.781   1.00 19.07 ? 313 GLY A N   1 
ATOM   2364  C CA  . GLY A 1 313 ? 38.050  17.090  9.841   1.00 19.56 ? 313 GLY A CA  1 
ATOM   2365  C C   . GLY A 1 313 ? 36.794  17.966  9.820   1.00 19.98 ? 313 GLY A C   1 
ATOM   2366  O O   . GLY A 1 313 ? 36.379  18.506  10.851  1.00 20.08 ? 313 GLY A O   1 
ATOM   2367  N N   . LEU A 1 314 ? 36.200  18.005  8.642   1.00 20.35 ? 314 LEU A N   1 
ATOM   2368  C CA  . LEU A 1 314 ? 34.963  18.741  8.368   1.00 20.48 ? 314 LEU A CA  1 
ATOM   2369  C C   . LEU A 1 314 ? 33.955  18.479  9.477   1.00 20.65 ? 314 LEU A C   1 
ATOM   2370  O O   . LEU A 1 314 ? 33.561  19.430  10.186  1.00 20.62 ? 314 LEU A O   1 
ATOM   2371  C CB  . LEU A 1 314 ? 34.480  18.386  6.959   1.00 20.35 ? 314 LEU A CB  1 
ATOM   2372  C CG  . LEU A 1 314 ? 35.268  19.077  5.845   1.00 20.31 ? 314 LEU A CG  1 
ATOM   2373  C CD1 . LEU A 1 314 ? 36.565  18.334  5.579   1.00 20.43 ? 314 LEU A CD1 1 
ATOM   2374  C CD2 . LEU A 1 314 ? 34.430  19.133  4.580   1.00 20.31 ? 314 LEU A CD2 1 
ATOM   2375  N N   . LEU A 1 315 ? 33.586  17.215  9.628   1.00 20.81 ? 315 LEU A N   1 
ATOM   2376  C CA  . LEU A 1 315 ? 32.638  16.913  10.729  1.00 21.18 ? 315 LEU A CA  1 
ATOM   2377  C C   . LEU A 1 315 ? 33.123  17.576  12.003  1.00 21.56 ? 315 LEU A C   1 
ATOM   2378  O O   . LEU A 1 315 ? 32.348  18.415  12.536  1.00 21.69 ? 315 LEU A O   1 
ATOM   2379  C CB  . LEU A 1 315 ? 32.320  15.424  10.762  1.00 20.93 ? 315 LEU A CB  1 
ATOM   2380  C CG  . LEU A 1 315 ? 30.809  15.215  10.507  1.00 20.71 ? 315 LEU A CG  1 
ATOM   2381  C CD1 . LEU A 1 315 ? 30.531  13.885  9.893   1.00 20.77 ? 315 LEU A CD1 1 
ATOM   2382  C CD2 . LEU A 1 315 ? 30.156  15.382  11.879  1.00 20.73 ? 315 LEU A CD2 1 
ATOM   2383  N N   . LYS A 1 316 ? 34.369  17.340  12.383  1.00 21.87 ? 316 LYS A N   1 
ATOM   2384  C CA  . LYS A 1 316 ? 34.908  17.966  13.602  1.00 22.22 ? 316 LYS A CA  1 
ATOM   2385  C C   . LYS A 1 316 ? 34.586  19.468  13.608  1.00 22.49 ? 316 LYS A C   1 
ATOM   2386  O O   . LYS A 1 316 ? 34.292  20.038  14.662  1.00 22.46 ? 316 LYS A O   1 
ATOM   2387  C CB  . LYS A 1 316 ? 36.399  17.781  13.750  1.00 22.38 ? 316 LYS A CB  1 
ATOM   2388  C CG  . LYS A 1 316 ? 36.880  16.512  14.397  1.00 22.64 ? 316 LYS A CG  1 
ATOM   2389  C CD  . LYS A 1 316 ? 38.382  16.520  14.728  1.00 22.72 ? 316 LYS A CD  1 
ATOM   2390  C CE  . LYS A 1 316 ? 38.675  15.424  15.760  1.00 22.78 ? 316 LYS A CE  1 
ATOM   2391  N NZ  . LYS A 1 316 ? 40.067  14.928  15.627  1.00 22.79 ? 316 LYS A NZ  1 
ATOM   2392  N N   . LYS A 1 317 ? 34.643  20.071  12.444  1.00 22.78 ? 317 LYS A N   1 
ATOM   2393  C CA  . LYS A 1 317 ? 34.402  21.468  12.172  1.00 23.15 ? 317 LYS A CA  1 
ATOM   2394  C C   . LYS A 1 317 ? 32.956  21.896  12.367  1.00 23.47 ? 317 LYS A C   1 
ATOM   2395  O O   . LYS A 1 317 ? 32.720  22.944  13.028  1.00 23.65 ? 317 LYS A O   1 
ATOM   2396  C CB  . LYS A 1 317 ? 34.814  21.844  10.746  1.00 23.20 ? 317 LYS A CB  1 
ATOM   2397  C CG  . LYS A 1 317 ? 34.394  23.244  10.318  1.00 23.25 ? 317 LYS A CG  1 
ATOM   2398  C CD  . LYS A 1 317 ? 34.298  23.333  8.799   1.00 23.43 ? 317 LYS A CD  1 
ATOM   2399  C CE  . LYS A 1 317 ? 34.077  24.791  8.400   1.00 23.59 ? 317 LYS A CE  1 
ATOM   2400  N NZ  . LYS A 1 317 ? 35.300  25.572  8.783   1.00 23.83 ? 317 LYS A NZ  1 
ATOM   2401  N N   . SER A 1 318 ? 32.031  21.273  11.656  1.00 23.76 ? 318 SER A N   1 
ATOM   2402  C CA  . SER A 1 318 ? 30.600  21.586  11.833  1.00 23.91 ? 318 SER A CA  1 
ATOM   2403  C C   . SER A 1 318 ? 30.366  21.645  13.358  1.00 24.03 ? 318 SER A C   1 
ATOM   2404  O O   . SER A 1 318 ? 30.091  22.694  13.907  1.00 24.08 ? 318 SER A O   1 
ATOM   2405  C CB  . SER A 1 318 ? 29.612  20.595  11.283  1.00 23.88 ? 318 SER A CB  1 
ATOM   2406  O OG  . SER A 1 318 ? 29.344  20.689  9.931   1.00 24.04 ? 318 SER A OG  1 
ATOM   2407  N N   . ALA A 1 319 ? 30.514  20.476  13.918  1.00 24.36 ? 319 ALA A N   1 
ATOM   2408  C CA  . ALA A 1 319 ? 30.343  20.218  15.329  1.00 25.05 ? 319 ALA A CA  1 
ATOM   2409  C C   . ALA A 1 319 ? 30.446  21.538  16.104  1.00 25.56 ? 319 ALA A C   1 
ATOM   2410  O O   . ALA A 1 319 ? 29.506  22.027  16.706  1.00 25.61 ? 319 ALA A O   1 
ATOM   2411  C CB  . ALA A 1 319 ? 31.455  19.297  15.802  1.00 25.19 ? 319 ALA A CB  1 
ATOM   2412  N N   . ASP A 1 320 ? 31.616  22.104  15.880  1.00 26.21 ? 320 ASP A N   1 
ATOM   2413  C CA  . ASP A 1 320 ? 32.044  23.364  16.474  1.00 26.89 ? 320 ASP A CA  1 
ATOM   2414  C C   . ASP A 1 320 ? 31.247  24.545  16.003  1.00 27.22 ? 320 ASP A C   1 
ATOM   2415  O O   . ASP A 1 320 ? 30.771  25.286  16.927  1.00 27.24 ? 320 ASP A O   1 
ATOM   2416  C CB  . ASP A 1 320 ? 33.582  23.446  16.344  1.00 27.19 ? 320 ASP A CB  1 
ATOM   2417  C CG  . ASP A 1 320 ? 34.196  22.644  17.500  1.00 27.54 ? 320 ASP A CG  1 
ATOM   2418  O OD1 . ASP A 1 320 ? 33.515  22.433  18.531  1.00 27.69 ? 320 ASP A OD1 1 
ATOM   2419  O OD2 . ASP A 1 320 ? 35.369  22.235  17.356  1.00 27.68 ? 320 ASP A OD2 1 
ATOM   2420  N N   . THR A 1 321 ? 31.166  24.847  14.719  1.00 27.51 ? 321 THR A N   1 
ATOM   2421  C CA  . THR A 1 321 ? 30.280  25.935  14.264  1.00 27.78 ? 321 THR A CA  1 
ATOM   2422  C C   . THR A 1 321 ? 29.013  25.850  15.156  1.00 28.23 ? 321 THR A C   1 
ATOM   2423  O O   . THR A 1 321 ? 28.808  26.611  16.100  1.00 28.38 ? 321 THR A O   1 
ATOM   2424  C CB  . THR A 1 321 ? 29.806  25.866  12.775  1.00 27.53 ? 321 THR A CB  1 
ATOM   2425  O OG1 . THR A 1 321 ? 30.957  25.708  11.924  1.00 27.37 ? 321 THR A OG1 1 
ATOM   2426  C CG2 . THR A 1 321 ? 28.950  27.095  12.390  1.00 27.49 ? 321 THR A CG2 1 
ATOM   2427  N N   . LEU A 1 322 ? 28.329  24.751  14.881  1.00 28.67 ? 322 LEU A N   1 
ATOM   2428  C CA  . LEU A 1 322 ? 27.116  24.377  15.584  1.00 29.30 ? 322 LEU A CA  1 
ATOM   2429  C C   . LEU A 1 322 ? 27.260  24.622  17.084  1.00 29.71 ? 322 LEU A C   1 
ATOM   2430  O O   . LEU A 1 322 ? 26.275  24.976  17.729  1.00 29.72 ? 322 LEU A O   1 
ATOM   2431  C CB  . LEU A 1 322 ? 26.821  22.906  15.267  1.00 29.39 ? 322 LEU A CB  1 
ATOM   2432  C CG  . LEU A 1 322 ? 25.732  22.534  14.295  1.00 29.41 ? 322 LEU A CG  1 
ATOM   2433  C CD1 . LEU A 1 322 ? 25.728  21.020  14.056  1.00 29.38 ? 322 LEU A CD1 1 
ATOM   2434  C CD2 . LEU A 1 322 ? 24.366  22.953  14.870  1.00 29.43 ? 322 LEU A CD2 1 
ATOM   2435  N N   . TRP A 1 323 ? 28.472  24.443  17.587  1.00 30.33 ? 323 TRP A N   1 
ATOM   2436  C CA  . TRP A 1 323 ? 28.769  24.523  18.993  1.00 30.95 ? 323 TRP A CA  1 
ATOM   2437  C C   . TRP A 1 323 ? 28.692  25.891  19.639  1.00 31.53 ? 323 TRP A C   1 
ATOM   2438  O O   . TRP A 1 323 ? 27.901  25.939  20.634  1.00 31.64 ? 323 TRP A O   1 
ATOM   2439  C CB  . TRP A 1 323 ? 30.128  23.884  19.393  1.00 30.83 ? 323 TRP A CB  1 
ATOM   2440  C CG  . TRP A 1 323 ? 30.423  24.077  20.854  1.00 30.66 ? 323 TRP A CG  1 
ATOM   2441  C CD1 . TRP A 1 323 ? 31.484  24.724  21.408  1.00 30.66 ? 323 TRP A CD1 1 
ATOM   2442  C CD2 . TRP A 1 323 ? 29.494  23.827  21.922  1.00 30.53 ? 323 TRP A CD2 1 
ATOM   2443  N NE1 . TRP A 1 323 ? 31.338  24.765  22.775  1.00 30.66 ? 323 TRP A NE1 1 
ATOM   2444  C CE2 . TRP A 1 323 ? 30.115  24.250  23.111  1.00 30.52 ? 323 TRP A CE2 1 
ATOM   2445  C CE3 . TRP A 1 323 ? 28.233  23.248  21.973  1.00 30.47 ? 323 TRP A CE3 1 
ATOM   2446  C CZ2 . TRP A 1 323 ? 29.515  24.104  24.349  1.00 30.39 ? 323 TRP A CZ2 1 
ATOM   2447  C CZ3 . TRP A 1 323 ? 27.633  23.101  23.207  1.00 30.42 ? 323 TRP A CZ3 1 
ATOM   2448  C CH2 . TRP A 1 323 ? 28.262  23.522  24.371  1.00 30.38 ? 323 TRP A CH2 1 
ATOM   2449  N N   . ASN A 1 324 ? 29.551  26.856  19.290  1.00 32.19 ? 324 ASN A N   1 
ATOM   2450  C CA  . ASN A 1 324 ? 29.446  28.090  20.107  1.00 32.86 ? 324 ASN A CA  1 
ATOM   2451  C C   . ASN A 1 324 ? 27.935  28.467  20.028  1.00 33.05 ? 324 ASN A C   1 
ATOM   2452  O O   . ASN A 1 324 ? 27.396  28.489  21.124  1.00 33.16 ? 324 ASN A O   1 
ATOM   2453  C CB  . ASN A 1 324 ? 30.281  29.316  19.942  1.00 33.28 ? 324 ASN A CB  1 
ATOM   2454  C CG  . ASN A 1 324 ? 30.561  30.000  21.302  1.00 33.50 ? 324 ASN A CG  1 
ATOM   2455  O OD1 . ASN A 1 324 ? 31.193  31.080  21.318  1.00 33.71 ? 324 ASN A OD1 1 
ATOM   2456  N ND2 . ASN A 1 324 ? 30.207  29.336  22.404  1.00 33.36 ? 324 ASN A ND2 1 
ATOM   2457  N N   . MET A 1 325 ? 27.453  28.476  18.806  1.00 33.11 ? 325 MET A N   1 
ATOM   2458  C CA  . MET A 1 325 ? 26.038  28.831  18.570  1.00 33.22 ? 325 MET A CA  1 
ATOM   2459  C C   . MET A 1 325 ? 25.158  28.501  19.782  1.00 33.50 ? 325 MET A C   1 
ATOM   2460  O O   . MET A 1 325 ? 24.388  29.372  20.238  1.00 33.60 ? 325 MET A O   1 
ATOM   2461  C CB  . MET A 1 325 ? 25.534  28.214  17.288  1.00 32.96 ? 325 MET A CB  1 
ATOM   2462  C CG  . MET A 1 325 ? 24.369  29.044  16.772  1.00 32.82 ? 325 MET A CG  1 
ATOM   2463  S SD  . MET A 1 325 ? 25.042  30.078  15.415  1.00 32.74 ? 325 MET A SD  1 
ATOM   2464  C CE  . MET A 1 325 ? 25.196  28.792  14.138  1.00 32.57 ? 325 MET A CE  1 
ATOM   2465  N N   . GLN A 1 326 ? 25.382  27.358  20.370  1.00 33.65 ? 326 GLN A N   1 
ATOM   2466  C CA  . GLN A 1 326 ? 24.754  26.840  21.547  1.00 34.11 ? 326 GLN A CA  1 
ATOM   2467  C C   . GLN A 1 326 ? 25.144  27.449  22.882  1.00 34.77 ? 326 GLN A C   1 
ATOM   2468  O O   . GLN A 1 326 ? 24.754  26.833  23.934  1.00 34.93 ? 326 GLN A O   1 
ATOM   2469  C CB  . GLN A 1 326 ? 24.965  25.300  21.599  1.00 33.81 ? 326 GLN A CB  1 
ATOM   2470  C CG  . GLN A 1 326 ? 24.871  24.637  20.258  1.00 33.36 ? 326 GLN A CG  1 
ATOM   2471  C CD  . GLN A 1 326 ? 24.688  23.144  20.300  1.00 33.07 ? 326 GLN A CD  1 
ATOM   2472  O OE1 . GLN A 1 326 ? 24.467  22.546  21.341  1.00 32.89 ? 326 GLN A OE1 1 
ATOM   2473  N NE2 . GLN A 1 326 ? 24.729  22.569  19.103  1.00 32.91 ? 326 GLN A NE2 1 
ATOM   2474  N N   . LYS A 1 327 ? 25.891  28.510  22.965  1.00 35.50 ? 327 LYS A N   1 
ATOM   2475  C CA  . LYS A 1 327 ? 26.141  29.200  24.269  1.00 36.48 ? 327 LYS A CA  1 
ATOM   2476  C C   . LYS A 1 327 ? 24.804  29.953  24.477  1.00 37.44 ? 327 LYS A C   1 
ATOM   2477  O O   . LYS A 1 327 ? 24.668  31.166  24.307  1.00 37.57 ? 327 LYS A O   1 
ATOM   2478  C CB  . LYS A 1 327 ? 27.321  30.083  24.298  1.00 36.28 ? 327 LYS A CB  1 
ATOM   2479  C CG  . LYS A 1 327 ? 27.345  31.455  23.665  1.00 36.09 ? 327 LYS A CG  1 
ATOM   2480  C CD  . LYS A 1 327 ? 26.895  31.439  22.219  1.00 36.01 ? 327 LYS A CD  1 
ATOM   2481  C CE  . LYS A 1 327 ? 26.586  32.818  21.676  1.00 35.89 ? 327 LYS A CE  1 
ATOM   2482  N NZ  . LYS A 1 327 ? 25.939  32.725  20.340  1.00 35.66 ? 327 LYS A NZ  1 
ATOM   2483  N N   . ASN A 1 328 ? 23.813  29.134  24.859  1.00 38.42 ? 328 ASN A N   1 
ATOM   2484  C CA  . ASN A 1 328 ? 22.428  29.574  24.861  1.00 39.26 ? 328 ASN A CA  1 
ATOM   2485  C C   . ASN A 1 328 ? 21.695  29.783  26.159  1.00 40.13 ? 328 ASN A C   1 
ATOM   2486  O O   . ASN A 1 328 ? 22.095  29.536  27.280  1.00 40.25 ? 328 ASN A O   1 
ATOM   2487  C CB  . ASN A 1 328 ? 21.651  28.583  23.920  1.00 39.06 ? 328 ASN A CB  1 
ATOM   2488  C CG  . ASN A 1 328 ? 21.429  29.216  22.567  1.00 38.84 ? 328 ASN A CG  1 
ATOM   2489  O OD1 . ASN A 1 328 ? 20.495  28.839  21.856  1.00 38.77 ? 328 ASN A OD1 1 
ATOM   2490  N ND2 . ASN A 1 328 ? 22.239  30.199  22.210  1.00 38.91 ? 328 ASN A ND2 1 
ATOM   2491  N N   . LEU A 1 329 ? 20.507  30.300  25.939  1.00 41.17 ? 329 LEU A N   1 
ATOM   2492  C CA  . LEU A 1 329 ? 19.382  30.705  26.722  1.00 42.09 ? 329 LEU A CA  1 
ATOM   2493  C C   . LEU A 1 329 ? 18.746  31.895  25.966  1.00 42.82 ? 329 LEU A C   1 
ATOM   2494  O O   . LEU A 1 329 ? 19.187  32.134  24.816  1.00 42.93 ? 329 LEU A O   1 
ATOM   2495  C CB  . LEU A 1 329 ? 19.749  30.978  28.169  1.00 42.14 ? 329 LEU A CB  1 
ATOM   2496  C CG  . LEU A 1 329 ? 18.653  30.670  29.192  1.00 42.28 ? 329 LEU A CG  1 
ATOM   2497  C CD1 . LEU A 1 329 ? 18.446  29.158  29.341  1.00 42.27 ? 329 LEU A CD1 1 
ATOM   2498  C CD2 . LEU A 1 329 ? 19.029  31.309  30.519  1.00 42.29 ? 329 LEU A CD2 1 
ATOM   2499  N N   . GLU A 1 330 ? 17.730  32.527  26.523  1.00 43.65 ? 330 GLU A N   1 
ATOM   2500  C CA  . GLU A 1 330 ? 17.110  33.685  25.874  1.00 44.37 ? 330 GLU A CA  1 
ATOM   2501  C C   . GLU A 1 330 ? 17.945  34.951  26.096  1.00 44.67 ? 330 GLU A C   1 
ATOM   2502  O O   . GLU A 1 330 ? 17.708  35.994  25.452  1.00 44.72 ? 330 GLU A O   1 
ATOM   2503  C CB  . GLU A 1 330 ? 15.691  34.021  26.339  1.00 44.68 ? 330 GLU A CB  1 
ATOM   2504  C CG  . GLU A 1 330 ? 14.878  34.889  25.367  1.00 45.13 ? 330 GLU A CG  1 
ATOM   2505  C CD  . GLU A 1 330 ? 13.794  35.766  25.893  1.00 45.40 ? 330 GLU A CD  1 
ATOM   2506  O OE1 . GLU A 1 330 ? 12.610  35.449  25.970  1.00 45.50 ? 330 GLU A OE1 1 
ATOM   2507  O OE2 . GLU A 1 330 ? 14.188  36.928  26.208  1.00 45.54 ? 330 GLU A OE2 1 
ATOM   2508  N N   . LEU A 1 331 ? 18.912  34.846  26.990  1.00 44.93 ? 331 LEU A N   1 
ATOM   2509  C CA  . LEU A 1 331 ? 19.830  35.917  27.371  1.00 45.00 ? 331 LEU A CA  1 
ATOM   2510  C C   . LEU A 1 331 ? 20.197  36.784  26.166  1.00 45.01 ? 331 LEU A C   1 
ATOM   2511  O O   . LEU A 1 331 ? 20.372  36.150  25.091  1.00 45.05 ? 331 LEU A O   1 
ATOM   2512  C CB  . LEU A 1 331 ? 21.050  35.282  28.050  1.00 45.06 ? 331 LEU A CB  1 
ATOM   2513  C CG  . LEU A 1 331 ? 21.983  36.166  28.851  1.00 45.23 ? 331 LEU A CG  1 
ATOM   2514  C CD1 . LEU A 1 331 ? 23.049  35.320  29.563  1.00 45.24 ? 331 LEU A CD1 1 
ATOM   2515  C CD2 . LEU A 1 331 ? 22.695  37.189  27.964  1.00 45.16 ? 331 LEU A CD2 1 
ATOM   2516  N N   . SER B 1 1   ? -36.175 -4.703  -20.012 1.00 23.65 ? 1   SER B N   1 
ATOM   2517  C CA  . SER B 1 1   ? -37.076 -5.715  -19.521 1.00 23.75 ? 1   SER B CA  1 
ATOM   2518  C C   . SER B 1 1   ? -36.587 -6.356  -18.220 1.00 23.75 ? 1   SER B C   1 
ATOM   2519  O O   . SER B 1 1   ? -37.378 -6.680  -17.302 1.00 23.74 ? 1   SER B O   1 
ATOM   2520  C CB  . SER B 1 1   ? -37.203 -6.817  -20.593 1.00 23.79 ? 1   SER B CB  1 
ATOM   2521  O OG  . SER B 1 1   ? -35.934 -7.503  -20.620 1.00 23.83 ? 1   SER B OG  1 
ATOM   2522  N N   . THR B 1 2   ? -35.294 -6.592  -18.178 1.00 23.67 ? 2   THR B N   1 
ATOM   2523  C CA  . THR B 1 2   ? -34.505 -7.179  -17.140 1.00 23.62 ? 2   THR B CA  1 
ATOM   2524  C C   . THR B 1 2   ? -33.946 -6.178  -16.134 1.00 23.58 ? 2   THR B C   1 
ATOM   2525  O O   . THR B 1 2   ? -33.671 -5.031  -16.546 1.00 23.61 ? 2   THR B O   1 
ATOM   2526  C CB  . THR B 1 2   ? -33.137 -7.803  -17.735 1.00 23.70 ? 2   THR B CB  1 
ATOM   2527  O OG1 . THR B 1 2   ? -33.478 -8.268  -19.059 1.00 24.00 ? 2   THR B OG1 1 
ATOM   2528  C CG2 . THR B 1 2   ? -32.528 -8.847  -16.817 1.00 23.73 ? 2   THR B CG2 1 
ATOM   2529  N N   . VAL B 1 3   ? -33.539 -6.729  -14.983 1.00 23.42 ? 3   VAL B N   1 
ATOM   2530  C CA  . VAL B 1 3   ? -32.880 -5.818  -13.996 1.00 23.26 ? 3   VAL B CA  1 
ATOM   2531  C C   . VAL B 1 3   ? -31.653 -5.239  -14.740 1.00 23.20 ? 3   VAL B C   1 
ATOM   2532  O O   . VAL B 1 3   ? -31.495 -4.015  -14.727 1.00 23.10 ? 3   VAL B O   1 
ATOM   2533  C CB  . VAL B 1 3   ? -32.623 -6.399  -12.626 1.00 23.10 ? 3   VAL B CB  1 
ATOM   2534  C CG1 . VAL B 1 3   ? -33.117 -7.839  -12.448 1.00 23.08 ? 3   VAL B CG1 1 
ATOM   2535  C CG2 . VAL B 1 3   ? -31.176 -6.284  -12.134 1.00 23.08 ? 3   VAL B CG2 1 
ATOM   2536  N N   . LYS B 1 4   ? -30.880 -6.105  -15.379 1.00 23.20 ? 4   LYS B N   1 
ATOM   2537  C CA  . LYS B 1 4   ? -29.727 -5.577  -16.130 1.00 23.41 ? 4   LYS B CA  1 
ATOM   2538  C C   . LYS B 1 4   ? -30.260 -4.424  -17.001 1.00 23.74 ? 4   LYS B C   1 
ATOM   2539  O O   . LYS B 1 4   ? -29.979 -3.265  -16.706 1.00 23.81 ? 4   LYS B O   1 
ATOM   2540  C CB  . LYS B 1 4   ? -28.936 -6.490  -17.000 1.00 23.24 ? 4   LYS B CB  1 
ATOM   2541  C CG  . LYS B 1 4   ? -27.784 -7.261  -16.487 1.00 23.14 ? 4   LYS B CG  1 
ATOM   2542  C CD  . LYS B 1 4   ? -26.763 -6.589  -15.658 1.00 23.22 ? 4   LYS B CD  1 
ATOM   2543  C CE  . LYS B 1 4   ? -27.159 -5.830  -14.432 1.00 23.34 ? 4   LYS B CE  1 
ATOM   2544  N NZ  . LYS B 1 4   ? -28.356 -6.352  -13.722 1.00 23.24 ? 4   LYS B NZ  1 
ATOM   2545  N N   . GLU B 1 5   ? -31.105 -4.839  -17.930 1.00 24.02 ? 5   GLU B N   1 
ATOM   2546  C CA  . GLU B 1 5   ? -31.680 -3.910  -18.907 1.00 24.23 ? 5   GLU B CA  1 
ATOM   2547  C C   . GLU B 1 5   ? -32.378 -2.758  -18.222 1.00 24.39 ? 5   GLU B C   1 
ATOM   2548  O O   . GLU B 1 5   ? -32.665 -1.730  -18.867 1.00 24.61 ? 5   GLU B O   1 
ATOM   2549  C CB  . GLU B 1 5   ? -32.636 -4.629  -19.841 1.00 24.30 ? 5   GLU B CB  1 
ATOM   2550  C CG  . GLU B 1 5   ? -32.133 -5.960  -20.431 1.00 24.42 ? 5   GLU B CG  1 
ATOM   2551  C CD  . GLU B 1 5   ? -32.896 -6.487  -21.603 1.00 24.53 ? 5   GLU B CD  1 
ATOM   2552  O OE1 . GLU B 1 5   ? -32.415 -7.162  -22.508 1.00 24.62 ? 5   GLU B OE1 1 
ATOM   2553  O OE2 . GLU B 1 5   ? -34.099 -6.144  -21.599 1.00 24.57 ? 5   GLU B OE2 1 
ATOM   2554  N N   . GLN B 1 6   ? -32.501 -2.840  -16.917 1.00 24.45 ? 6   GLN B N   1 
ATOM   2555  C CA  . GLN B 1 6   ? -33.187 -1.812  -16.137 1.00 24.69 ? 6   GLN B CA  1 
ATOM   2556  C C   . GLN B 1 6   ? -32.248 -0.986  -15.290 1.00 24.93 ? 6   GLN B C   1 
ATOM   2557  O O   . GLN B 1 6   ? -32.354 0.265   -15.375 1.00 25.19 ? 6   GLN B O   1 
ATOM   2558  C CB  . GLN B 1 6   ? -34.315 -2.466  -15.330 1.00 24.63 ? 6   GLN B CB  1 
ATOM   2559  C CG  . GLN B 1 6   ? -35.601 -1.711  -15.287 1.00 24.62 ? 6   GLN B CG  1 
ATOM   2560  C CD  . GLN B 1 6   ? -36.683 -2.265  -14.403 1.00 24.64 ? 6   GLN B CD  1 
ATOM   2561  O OE1 . GLN B 1 6   ? -37.820 -1.758  -14.393 1.00 24.45 ? 6   GLN B OE1 1 
ATOM   2562  N NE2 . GLN B 1 6   ? -36.377 -3.308  -13.629 1.00 24.65 ? 6   GLN B NE2 1 
ATOM   2563  N N   . LEU B 1 7   ? -31.330 -1.563  -14.542 1.00 25.10 ? 7   LEU B N   1 
ATOM   2564  C CA  . LEU B 1 7   ? -30.436 -0.872  -13.632 1.00 25.23 ? 7   LEU B CA  1 
ATOM   2565  C C   . LEU B 1 7   ? -29.271 -0.158  -14.291 1.00 25.60 ? 7   LEU B C   1 
ATOM   2566  O O   . LEU B 1 7   ? -28.928 0.941   -13.843 1.00 25.57 ? 7   LEU B O   1 
ATOM   2567  C CB  . LEU B 1 7   ? -29.917 -1.839  -12.537 1.00 24.92 ? 7   LEU B CB  1 
ATOM   2568  C CG  . LEU B 1 7   ? -29.386 -1.184  -11.268 1.00 24.70 ? 7   LEU B CG  1 
ATOM   2569  C CD1 . LEU B 1 7   ? -29.158 -2.233  -10.175 1.00 24.68 ? 7   LEU B CD1 1 
ATOM   2570  C CD2 . LEU B 1 7   ? -28.053 -0.490  -11.517 1.00 24.63 ? 7   LEU B CD2 1 
ATOM   2571  N N   . ILE B 1 8   ? -28.672 -0.760  -15.263 1.00 26.42 ? 8   ILE B N   1 
ATOM   2572  C CA  . ILE B 1 8   ? -27.463 -0.269  -15.919 1.00 27.28 ? 8   ILE B CA  1 
ATOM   2573  C C   . ILE B 1 8   ? -27.690 0.219   -17.329 1.00 28.14 ? 8   ILE B C   1 
ATOM   2574  O O   . ILE B 1 8   ? -28.305 -0.474  -18.150 1.00 28.13 ? 8   ILE B O   1 
ATOM   2575  C CB  . ILE B 1 8   ? -26.402 -1.447  -15.851 1.00 27.12 ? 8   ILE B CB  1 
ATOM   2576  C CG1 . ILE B 1 8   ? -25.907 -1.610  -14.403 1.00 27.06 ? 8   ILE B CG1 1 
ATOM   2577  C CG2 . ILE B 1 8   ? -25.251 -1.291  -16.871 1.00 27.13 ? 8   ILE B CG2 1 
ATOM   2578  C CD1 . ILE B 1 8   ? -24.857 -0.562  -13.911 1.00 26.91 ? 8   ILE B CD1 1 
ATOM   2579  N N   . GLN B 1 9   ? -27.053 1.347   -17.630 1.00 29.37 ? 9   GLN B N   1 
ATOM   2580  C CA  . GLN B 1 9   ? -27.129 1.924   -18.966 1.00 30.74 ? 9   GLN B CA  1 
ATOM   2581  C C   . GLN B 1 9   ? -25.753 1.965   -19.637 1.00 31.71 ? 9   GLN B C   1 
ATOM   2582  O O   . GLN B 1 9   ? -24.864 2.753   -19.313 1.00 31.93 ? 9   GLN B O   1 
ATOM   2583  C CB  . GLN B 1 9   ? -27.805 3.305   -19.018 1.00 30.81 ? 9   GLN B CB  1 
ATOM   2584  C CG  . GLN B 1 9   ? -27.829 3.842   -20.441 1.00 30.85 ? 9   GLN B CG  1 
ATOM   2585  C CD  . GLN B 1 9   ? -29.168 4.218   -20.984 1.00 30.88 ? 9   GLN B CD  1 
ATOM   2586  O OE1 . GLN B 1 9   ? -29.510 3.800   -22.097 1.00 30.92 ? 9   GLN B OE1 1 
ATOM   2587  N NE2 . GLN B 1 9   ? -29.935 5.030   -20.258 1.00 30.89 ? 9   GLN B NE2 1 
ATOM   2588  N N   . ASN B 1 10  ? -25.679 1.240   -20.697 1.00 32.88 ? 10  ASN B N   1 
ATOM   2589  C CA  . ASN B 1 10  ? -24.675 0.972   -21.676 1.00 34.04 ? 10  ASN B CA  1 
ATOM   2590  C C   . ASN B 1 10  ? -24.268 2.147   -22.550 1.00 34.87 ? 10  ASN B C   1 
ATOM   2591  O O   . ASN B 1 10  ? -24.792 2.260   -23.687 1.00 34.84 ? 10  ASN B O   1 
ATOM   2592  C CB  . ASN B 1 10  ? -25.278 -0.175  -22.571 1.00 34.28 ? 10  ASN B CB  1 
ATOM   2593  C CG  . ASN B 1 10  ? -26.708 0.141   -23.013 1.00 34.54 ? 10  ASN B CG  1 
ATOM   2594  O OD1 . ASN B 1 10  ? -26.975 0.569   -24.152 1.00 34.65 ? 10  ASN B OD1 1 
ATOM   2595  N ND2 . ASN B 1 10  ? -27.683 -0.074  -22.114 1.00 34.53 ? 10  ASN B ND2 1 
ATOM   2596  N N   . LEU B 1 11  ? -23.283 2.935   -22.123 1.00 35.91 ? 11  LEU B N   1 
ATOM   2597  C CA  . LEU B 1 11  ? -22.801 4.101   -22.867 1.00 36.91 ? 11  LEU B CA  1 
ATOM   2598  C C   . LEU B 1 11  ? -22.123 3.721   -24.191 1.00 37.67 ? 11  LEU B C   1 
ATOM   2599  O O   . LEU B 1 11  ? -20.906 3.688   -24.343 1.00 37.69 ? 11  LEU B O   1 
ATOM   2600  C CB  . LEU B 1 11  ? -21.901 4.969   -21.983 1.00 36.82 ? 11  LEU B CB  1 
ATOM   2601  C CG  . LEU B 1 11  ? -21.775 6.445   -22.333 1.00 36.76 ? 11  LEU B CG  1 
ATOM   2602  C CD1 . LEU B 1 11  ? -20.828 7.140   -21.353 1.00 36.70 ? 11  LEU B CD1 1 
ATOM   2603  C CD2 . LEU B 1 11  ? -21.254 6.641   -23.752 1.00 36.67 ? 11  LEU B CD2 1 
ATOM   2604  N N   . VAL B 1 12  ? -22.939 3.625   -25.177 1.00 38.81 ? 12  VAL B N   1 
ATOM   2605  C CA  . VAL B 1 12  ? -22.791 3.281   -26.572 1.00 39.95 ? 12  VAL B CA  1 
ATOM   2606  C C   . VAL B 1 12  ? -21.383 2.864   -26.935 1.00 40.80 ? 12  VAL B C   1 
ATOM   2607  O O   . VAL B 1 12  ? -20.782 2.041   -26.182 1.00 40.93 ? 12  VAL B O   1 
ATOM   2608  C CB  . VAL B 1 12  ? -23.583 4.268   -27.457 1.00 40.00 ? 12  VAL B CB  1 
ATOM   2609  C CG1 . VAL B 1 12  ? -24.260 3.543   -28.638 1.00 40.06 ? 12  VAL B CG1 1 
ATOM   2610  C CG2 . VAL B 1 12  ? -24.602 5.127   -26.749 1.00 40.08 ? 12  VAL B CG2 1 
ATOM   2611  N N   . PRO B 1 13  ? -20.884 3.346   -28.056 1.00 41.68 ? 13  PRO B N   1 
ATOM   2612  C CA  . PRO B 1 13  ? -19.595 2.858   -28.613 1.00 42.32 ? 13  PRO B CA  1 
ATOM   2613  C C   . PRO B 1 13  ? -18.472 2.889   -27.605 1.00 42.86 ? 13  PRO B C   1 
ATOM   2614  O O   . PRO B 1 13  ? -18.316 3.869   -26.855 1.00 43.05 ? 13  PRO B O   1 
ATOM   2615  C CB  . PRO B 1 13  ? -19.361 3.714   -29.842 1.00 42.24 ? 13  PRO B CB  1 
ATOM   2616  C CG  . PRO B 1 13  ? -20.425 4.783   -29.829 1.00 42.17 ? 13  PRO B CG  1 
ATOM   2617  C CD  . PRO B 1 13  ? -20.929 4.826   -28.384 1.00 41.93 ? 13  PRO B CD  1 
ATOM   2618  N N   . GLU B 1 14  ? -17.664 1.847   -27.617 1.00 43.41 ? 14  GLU B N   1 
ATOM   2619  C CA  . GLU B 1 14  ? -16.545 1.652   -26.696 1.00 43.97 ? 14  GLU B CA  1 
ATOM   2620  C C   . GLU B 1 14  ? -17.111 1.196   -25.334 1.00 44.11 ? 14  GLU B C   1 
ATOM   2621  O O   . GLU B 1 14  ? -17.272 1.857   -24.315 1.00 44.00 ? 14  GLU B O   1 
ATOM   2622  C CB  . GLU B 1 14  ? -15.619 2.823   -26.501 1.00 44.23 ? 14  GLU B CB  1 
ATOM   2623  C CG  . GLU B 1 14  ? -14.213 2.545   -25.983 1.00 44.60 ? 14  GLU B CG  1 
ATOM   2624  C CD  . GLU B 1 14  ? -14.042 2.029   -24.595 1.00 44.81 ? 14  GLU B CD  1 
ATOM   2625  O OE1 . GLU B 1 14  ? -13.356 2.603   -23.744 1.00 44.84 ? 14  GLU B OE1 1 
ATOM   2626  O OE2 . GLU B 1 14  ? -14.609 0.922   -24.391 1.00 44.83 ? 14  GLU B OE2 1 
ATOM   2627  N N   . ASP B 1 15  ? -17.321 -0.100  -25.379 1.00 44.32 ? 15  ASP B N   1 
ATOM   2628  C CA  . ASP B 1 15  ? -17.867 -0.966  -24.345 1.00 44.33 ? 15  ASP B CA  1 
ATOM   2629  C C   . ASP B 1 15  ? -17.089 -2.298  -24.356 1.00 44.21 ? 15  ASP B C   1 
ATOM   2630  O O   . ASP B 1 15  ? -17.690 -3.364  -24.187 1.00 44.19 ? 15  ASP B O   1 
ATOM   2631  C CB  . ASP B 1 15  ? -19.382 -1.112  -24.563 1.00 44.37 ? 15  ASP B CB  1 
ATOM   2632  C CG  . ASP B 1 15  ? -19.731 -1.199  -26.048 1.00 44.45 ? 15  ASP B CG  1 
ATOM   2633  O OD1 . ASP B 1 15  ? -19.618 -0.185  -26.765 1.00 44.44 ? 15  ASP B OD1 1 
ATOM   2634  O OD2 . ASP B 1 15  ? -20.025 -2.327  -26.485 1.00 44.49 ? 15  ASP B OD2 1 
ATOM   2635  N N   . LYS B 1 16  ? -15.782 -2.171  -24.511 1.00 43.87 ? 16  LYS B N   1 
ATOM   2636  C CA  . LYS B 1 16  ? -14.805 -3.252  -24.589 1.00 43.45 ? 16  LYS B CA  1 
ATOM   2637  C C   . LYS B 1 16  ? -13.384 -2.645  -24.664 1.00 43.04 ? 16  LYS B C   1 
ATOM   2638  O O   . LYS B 1 16  ? -13.265 -1.546  -25.263 1.00 43.10 ? 16  LYS B O   1 
ATOM   2639  C CB  . LYS B 1 16  ? -14.990 -4.080  -25.837 1.00 43.69 ? 16  LYS B CB  1 
ATOM   2640  C CG  . LYS B 1 16  ? -16.292 -4.624  -26.291 1.00 43.97 ? 16  LYS B CG  1 
ATOM   2641  C CD  . LYS B 1 16  ? -16.627 -6.029  -25.864 1.00 44.29 ? 16  LYS B CD  1 
ATOM   2642  C CE  . LYS B 1 16  ? -17.307 -6.189  -24.540 1.00 44.53 ? 16  LYS B CE  1 
ATOM   2643  N NZ  . LYS B 1 16  ? -16.489 -5.641  -23.416 1.00 44.72 ? 16  LYS B NZ  1 
ATOM   2644  N N   . LEU B 1 17  ? -12.363 -3.336  -24.185 1.00 42.22 ? 17  LEU B N   1 
ATOM   2645  C CA  . LEU B 1 17  ? -10.963 -2.869  -24.204 1.00 41.42 ? 17  LEU B CA  1 
ATOM   2646  C C   . LEU B 1 17  ? -9.973  -4.034  -23.965 1.00 40.82 ? 17  LEU B C   1 
ATOM   2647  O O   . LEU B 1 17  ? -10.325 -5.215  -24.109 1.00 40.98 ? 17  LEU B O   1 
ATOM   2648  C CB  . LEU B 1 17  ? -10.762 -1.773  -23.180 1.00 41.38 ? 17  LEU B CB  1 
ATOM   2649  C CG  . LEU B 1 17  ? -11.265 -0.386  -23.126 1.00 41.30 ? 17  LEU B CG  1 
ATOM   2650  C CD1 . LEU B 1 17  ? -11.215 0.336   -24.470 1.00 41.33 ? 17  LEU B CD1 1 
ATOM   2651  C CD2 . LEU B 1 17  ? -12.705 -0.374  -22.588 1.00 41.32 ? 17  LEU B CD2 1 
ATOM   2652  N N   . SER B 1 18  ? -8.730  -3.687  -23.626 1.00 39.79 ? 18  SER B N   1 
ATOM   2653  C CA  . SER B 1 18  ? -7.671  -4.616  -23.230 1.00 38.76 ? 18  SER B CA  1 
ATOM   2654  C C   . SER B 1 18  ? -6.313  -3.914  -23.106 1.00 37.92 ? 18  SER B C   1 
ATOM   2655  O O   . SER B 1 18  ? -6.209  -2.802  -23.663 1.00 37.93 ? 18  SER B O   1 
ATOM   2656  C CB  . SER B 1 18  ? -7.554  -5.796  -24.186 1.00 38.89 ? 18  SER B CB  1 
ATOM   2657  O OG  . SER B 1 18  ? -6.567  -5.591  -25.181 1.00 38.98 ? 18  SER B OG  1 
ATOM   2658  N N   . ARG B 1 19  ? -5.363  -4.481  -22.342 1.00 36.75 ? 19  ARG B N   1 
ATOM   2659  C CA  . ARG B 1 19  ? -3.993  -3.946  -22.302 1.00 35.54 ? 19  ARG B CA  1 
ATOM   2660  C C   . ARG B 1 19  ? -2.894  -4.743  -21.630 1.00 34.42 ? 19  ARG B C   1 
ATOM   2661  O O   . ARG B 1 19  ? -2.345  -5.686  -22.282 1.00 34.40 ? 19  ARG B O   1 
ATOM   2662  C CB  . ARG B 1 19  ? -3.904  -2.468  -21.850 1.00 35.73 ? 19  ARG B CB  1 
ATOM   2663  C CG  . ARG B 1 19  ? -3.711  -1.514  -23.050 1.00 35.91 ? 19  ARG B CG  1 
ATOM   2664  C CD  . ARG B 1 19  ? -2.404  -1.734  -23.712 1.00 36.12 ? 19  ARG B CD  1 
ATOM   2665  N NE  . ARG B 1 19  ? -2.437  -1.567  -25.154 1.00 36.31 ? 19  ARG B NE  1 
ATOM   2666  C CZ  . ARG B 1 19  ? -1.679  -2.287  -25.998 1.00 36.38 ? 19  ARG B CZ  1 
ATOM   2667  N NH1 . ARG B 1 19  ? -0.818  -3.206  -25.569 1.00 36.37 ? 19  ARG B NH1 1 
ATOM   2668  N NH2 . ARG B 1 19  ? -1.856  -2.153  -27.316 1.00 36.41 ? 19  ARG B NH2 1 
ATOM   2669  N N   . CYS B 1 20  ? -2.539  -4.498  -20.392 1.00 32.90 ? 20  CYS B N   1 
ATOM   2670  C CA  . CYS B 1 20  ? -1.352  -5.035  -19.713 1.00 31.45 ? 20  CYS B CA  1 
ATOM   2671  C C   . CYS B 1 20  ? -1.419  -5.993  -18.559 1.00 29.97 ? 20  CYS B C   1 
ATOM   2672  O O   . CYS B 1 20  ? -1.293  -5.641  -17.357 1.00 29.75 ? 20  CYS B O   1 
ATOM   2673  C CB  . CYS B 1 20  ? -0.561  -3.730  -19.290 1.00 31.82 ? 20  CYS B CB  1 
ATOM   2674  S SG  . CYS B 1 20  ? -1.718  -2.297  -19.210 1.00 32.63 ? 20  CYS B SG  1 
ATOM   2675  N N   . LYS B 1 21  ? -1.330  -7.285  -18.832 1.00 28.15 ? 21  LYS B N   1 
ATOM   2676  C CA  . LYS B 1 21  ? -1.401  -8.478  -18.063 1.00 26.27 ? 21  LYS B CA  1 
ATOM   2677  C C   . LYS B 1 21  ? -0.129  -9.071  -17.450 1.00 24.76 ? 21  LYS B C   1 
ATOM   2678  O O   . LYS B 1 21  ? 0.975   -8.827  -17.902 1.00 24.65 ? 21  LYS B O   1 
ATOM   2679  C CB  . LYS B 1 21  ? -1.820  -9.689  -18.977 1.00 26.37 ? 21  LYS B CB  1 
ATOM   2680  C CG  . LYS B 1 21  ? -3.205  -10.250 -18.801 1.00 26.34 ? 21  LYS B CG  1 
ATOM   2681  C CD  . LYS B 1 21  ? -3.719  -10.874 -20.099 1.00 26.33 ? 21  LYS B CD  1 
ATOM   2682  C CE  . LYS B 1 21  ? -3.263  -12.286 -20.345 1.00 26.35 ? 21  LYS B CE  1 
ATOM   2683  N NZ  . LYS B 1 21  ? -3.619  -12.734 -21.724 1.00 26.32 ? 21  LYS B NZ  1 
ATOM   2684  N N   . ILE B 1 22  ? -0.388  -9.991  -16.542 1.00 22.89 ? 22  ILE B N   1 
ATOM   2685  C CA  . ILE B 1 22  ? 0.548   -10.870 -15.858 1.00 21.26 ? 22  ILE B CA  1 
ATOM   2686  C C   . ILE B 1 22  ? -0.040  -12.298 -16.069 1.00 20.20 ? 22  ILE B C   1 
ATOM   2687  O O   . ILE B 1 22  ? -1.283  -12.419 -16.093 1.00 20.43 ? 22  ILE B O   1 
ATOM   2688  C CB  . ILE B 1 22  ? 0.826   -10.583 -14.368 1.00 21.15 ? 22  ILE B CB  1 
ATOM   2689  C CG1 . ILE B 1 22  ? 1.952   -9.550  -14.152 1.00 21.10 ? 22  ILE B CG1 1 
ATOM   2690  C CG2 . ILE B 1 22  ? 1.202   -11.867 -13.533 1.00 20.98 ? 22  ILE B CG2 1 
ATOM   2691  C CD1 . ILE B 1 22  ? 1.752   -8.155  -14.738 1.00 21.34 ? 22  ILE B CD1 1 
ATOM   2692  N N   . THR B 1 23  ? 0.821   -13.268 -16.242 1.00 18.42 ? 23  THR B N   1 
ATOM   2693  C CA  . THR B 1 23  ? 0.420   -14.663 -16.458 1.00 16.57 ? 23  THR B CA  1 
ATOM   2694  C C   . THR B 1 23  ? 1.377   -15.531 -15.654 1.00 15.61 ? 23  THR B C   1 
ATOM   2695  O O   . THR B 1 23  ? 2.561   -15.099 -15.574 1.00 15.51 ? 23  THR B O   1 
ATOM   2696  C CB  . THR B 1 23  ? 0.455   -15.103 -17.970 1.00 16.40 ? 23  THR B CB  1 
ATOM   2697  O OG1 . THR B 1 23  ? -0.559  -14.338 -18.677 1.00 15.96 ? 23  THR B OG1 1 
ATOM   2698  C CG2 . THR B 1 23  ? 0.312   -16.627 -18.182 1.00 16.08 ? 23  THR B CG2 1 
ATOM   2699  N N   . VAL B 1 24  ? 0.868   -16.612 -15.086 1.00 14.18 ? 24  VAL B N   1 
ATOM   2700  C CA  . VAL B 1 24  ? 1.867   -17.490 -14.366 1.00 12.90 ? 24  VAL B CA  1 
ATOM   2701  C C   . VAL B 1 24  ? 1.603   -18.937 -14.770 1.00 12.04 ? 24  VAL B C   1 
ATOM   2702  O O   . VAL B 1 24  ? 0.485   -19.498 -14.655 1.00 11.92 ? 24  VAL B O   1 
ATOM   2703  C CB  . VAL B 1 24  ? 1.968   -17.116 -12.898 1.00 12.72 ? 24  VAL B CB  1 
ATOM   2704  C CG1 . VAL B 1 24  ? 1.904   -15.594 -12.644 1.00 12.52 ? 24  VAL B CG1 1 
ATOM   2705  C CG2 . VAL B 1 24  ? 0.976   -17.797 -11.975 1.00 12.68 ? 24  VAL B CG2 1 
ATOM   2706  N N   . VAL B 1 25  ? 2.659   -19.517 -15.363 1.00 10.80 ? 25  VAL B N   1 
ATOM   2707  C CA  . VAL B 1 25  ? 2.556   -20.929 -15.829 1.00 9.51  ? 25  VAL B CA  1 
ATOM   2708  C C   . VAL B 1 25  ? 2.728   -21.818 -14.588 1.00 8.80  ? 25  VAL B C   1 
ATOM   2709  O O   . VAL B 1 25  ? 3.723   -21.732 -13.876 1.00 8.52  ? 25  VAL B O   1 
ATOM   2710  C CB  . VAL B 1 25  ? 3.503   -21.221 -16.986 1.00 9.23  ? 25  VAL B CB  1 
ATOM   2711  C CG1 . VAL B 1 25  ? 3.716   -22.722 -17.212 1.00 9.05  ? 25  VAL B CG1 1 
ATOM   2712  C CG2 . VAL B 1 25  ? 3.079   -20.559 -18.293 1.00 8.89  ? 25  VAL B CG2 1 
ATOM   2713  N N   . GLY B 1 26  ? 1.703   -22.598 -14.349 1.00 8.14  ? 26  GLY B N   1 
ATOM   2714  C CA  . GLY B 1 26  ? 1.622   -23.554 -13.266 1.00 7.49  ? 26  GLY B CA  1 
ATOM   2715  C C   . GLY B 1 26  ? 1.526   -22.820 -11.937 1.00 7.02  ? 26  GLY B C   1 
ATOM   2716  O O   . GLY B 1 26  ? 2.248   -21.859 -11.706 1.00 7.09  ? 26  GLY B O   1 
ATOM   2717  N N   . VAL B 1 27  ? 0.690   -23.325 -11.088 1.00 6.72  ? 27  VAL B N   1 
ATOM   2718  C CA  . VAL B 1 27  ? 0.362   -22.882 -9.762  1.00 6.39  ? 27  VAL B CA  1 
ATOM   2719  C C   . VAL B 1 27  ? 0.832   -23.870 -8.695  1.00 6.26  ? 27  VAL B C   1 
ATOM   2720  O O   . VAL B 1 27  ? 0.106   -24.129 -7.711  1.00 6.19  ? 27  VAL B O   1 
ATOM   2721  C CB  . VAL B 1 27  ? -1.184  -22.690 -9.678  1.00 6.37  ? 27  VAL B CB  1 
ATOM   2722  C CG1 . VAL B 1 27  ? -1.671  -21.611 -10.614 1.00 6.42  ? 27  VAL B CG1 1 
ATOM   2723  C CG2 . VAL B 1 27  ? -1.896  -24.023 -9.850  1.00 6.12  ? 27  VAL B CG2 1 
ATOM   2724  N N   . GLY B 1 28  ? 1.961   -24.489 -8.953  1.00 6.22  ? 28  GLY B N   1 
ATOM   2725  C CA  . GLY B 1 28  ? 2.515   -25.396 -7.865  1.00 6.54  ? 28  GLY B CA  1 
ATOM   2726  C C   . GLY B 1 28  ? 2.791   -24.377 -6.749  1.00 6.72  ? 28  GLY B C   1 
ATOM   2727  O O   . GLY B 1 28  ? 3.126   -23.242 -7.173  1.00 7.09  ? 28  GLY B O   1 
ATOM   2728  N N   . ASP B 1 29  ? 2.540   -24.664 -5.524  1.00 6.69  ? 29  ASP B N   1 
ATOM   2729  C CA  . ASP B 1 29  ? 2.784   -23.800 -4.365  1.00 6.57  ? 29  ASP B CA  1 
ATOM   2730  C C   . ASP B 1 29  ? 3.469   -22.461 -4.713  1.00 5.98  ? 29  ASP B C   1 
ATOM   2731  O O   . ASP B 1 29  ? 2.979   -21.385 -4.305  1.00 5.74  ? 29  ASP B O   1 
ATOM   2732  C CB  . ASP B 1 29  ? 3.514   -24.517 -3.235  1.00 7.28  ? 29  ASP B CB  1 
ATOM   2733  C CG  . ASP B 1 29  ? 3.485   -26.010 -3.172  1.00 8.18  ? 29  ASP B CG  1 
ATOM   2734  O OD1 . ASP B 1 29  ? 4.408   -26.673 -2.611  1.00 8.28  ? 29  ASP B OD1 1 
ATOM   2735  O OD2 . ASP B 1 29  ? 2.589   -26.674 -3.792  1.00 8.82  ? 29  ASP B OD2 1 
ATOM   2736  N N   . VAL B 1 30  ? 4.586   -22.533 -5.376  1.00 5.35  ? 30  VAL B N   1 
ATOM   2737  C CA  . VAL B 1 30  ? 5.376   -21.420 -5.868  1.00 4.87  ? 30  VAL B CA  1 
ATOM   2738  C C   . VAL B 1 30  ? 4.638   -20.591 -6.913  1.00 4.50  ? 30  VAL B C   1 
ATOM   2739  O O   . VAL B 1 30  ? 4.477   -19.373 -6.740  1.00 4.24  ? 30  VAL B O   1 
ATOM   2740  C CB  . VAL B 1 30  ? 6.730   -21.925 -6.433  1.00 4.75  ? 30  VAL B CB  1 
ATOM   2741  C CG1 . VAL B 1 30  ? 7.672   -20.807 -6.840  1.00 4.61  ? 30  VAL B CG1 1 
ATOM   2742  C CG2 . VAL B 1 30  ? 7.402   -22.858 -5.454  1.00 4.91  ? 30  VAL B CG2 1 
ATOM   2743  N N   . GLY B 1 31  ? 4.347   -21.217 -8.028  1.00 4.35  ? 31  GLY B N   1 
ATOM   2744  C CA  . GLY B 1 31  ? 3.635   -20.573 -9.137  1.00 4.53  ? 31  GLY B CA  1 
ATOM   2745  C C   . GLY B 1 31  ? 2.524   -19.730 -8.501  1.00 4.94  ? 31  GLY B C   1 
ATOM   2746  O O   . GLY B 1 31  ? 2.278   -18.581 -8.880  1.00 5.20  ? 31  GLY B O   1 
ATOM   2747  N N   . MET B 1 32  ? 2.001   -20.286 -7.421  1.00 5.00  ? 32  MET B N   1 
ATOM   2748  C CA  . MET B 1 32  ? 0.918   -19.764 -6.641  1.00 5.05  ? 32  MET B CA  1 
ATOM   2749  C C   . MET B 1 32  ? 1.187   -18.659 -5.637  1.00 5.05  ? 32  MET B C   1 
ATOM   2750  O O   . MET B 1 32  ? 0.273   -17.828 -5.413  1.00 5.01  ? 32  MET B O   1 
ATOM   2751  C CB  . MET B 1 32  ? 0.277   -20.973 -5.889  1.00 5.15  ? 32  MET B CB  1 
ATOM   2752  C CG  . MET B 1 32  ? -1.196  -20.646 -5.748  1.00 5.51  ? 32  MET B CG  1 
ATOM   2753  S SD  . MET B 1 32  ? -1.801  -20.544 -7.466  1.00 6.01  ? 32  MET B SD  1 
ATOM   2754  C CE  . MET B 1 32  ? -3.568  -20.354 -7.216  1.00 5.89  ? 32  MET B CE  1 
ATOM   2755  N N   . ALA B 1 33  ? 2.246   -18.754 -4.860  1.00 4.91  ? 33  ALA B N   1 
ATOM   2756  C CA  . ALA B 1 33  ? 2.646   -17.779 -3.860  1.00 4.73  ? 33  ALA B CA  1 
ATOM   2757  C C   . ALA B 1 33  ? 3.140   -16.509 -4.581  1.00 4.70  ? 33  ALA B C   1 
ATOM   2758  O O   . ALA B 1 33  ? 3.188   -15.412 -4.053  1.00 4.89  ? 33  ALA B O   1 
ATOM   2759  C CB  . ALA B 1 33  ? 3.811   -18.232 -2.994  1.00 4.77  ? 33  ALA B CB  1 
ATOM   2760  N N   . CYS B 1 34  ? 3.588   -16.827 -5.760  1.00 4.50  ? 34  CYS B N   1 
ATOM   2761  C CA  . CYS B 1 34  ? 4.143   -15.787 -6.692  1.00 4.01  ? 34  CYS B CA  1 
ATOM   2762  C C   . CYS B 1 34  ? 2.914   -15.220 -7.370  1.00 3.67  ? 34  CYS B C   1 
ATOM   2763  O O   . CYS B 1 34  ? 2.949   -14.162 -8.002  1.00 3.71  ? 34  CYS B O   1 
ATOM   2764  C CB  . CYS B 1 34  ? 5.225   -16.514 -7.373  1.00 4.07  ? 34  CYS B CB  1 
ATOM   2765  S SG  . CYS B 1 34  ? 6.018   -16.080 -8.836  1.00 4.43  ? 34  CYS B SG  1 
ATOM   2766  N N   . ALA B 1 35  ? 1.769   -15.846 -7.096  1.00 3.29  ? 35  ALA B N   1 
ATOM   2767  C CA  . ALA B 1 35  ? 0.464   -15.361 -7.556  1.00 3.06  ? 35  ALA B CA  1 
ATOM   2768  C C   . ALA B 1 35  ? -0.136  -14.393 -6.536  1.00 2.83  ? 35  ALA B C   1 
ATOM   2769  O O   . ALA B 1 35  ? -0.045  -13.151 -6.774  1.00 2.99  ? 35  ALA B O   1 
ATOM   2770  C CB  . ALA B 1 35  ? -0.474  -16.476 -7.914  1.00 3.14  ? 35  ALA B CB  1 
ATOM   2771  N N   . ILE B 1 36  ? -0.734  -14.868 -5.490  1.00 2.44  ? 36  ILE B N   1 
ATOM   2772  C CA  . ILE B 1 36  ? -1.353  -14.084 -4.439  1.00 2.28  ? 36  ILE B CA  1 
ATOM   2773  C C   . ILE B 1 36  ? -0.679  -12.724 -4.192  1.00 2.34  ? 36  ILE B C   1 
ATOM   2774  O O   . ILE B 1 36  ? -1.359  -11.691 -4.032  1.00 2.00  ? 36  ILE B O   1 
ATOM   2775  C CB  . ILE B 1 36  ? -1.448  -14.874 -3.085  1.00 2.14  ? 36  ILE B CB  1 
ATOM   2776  C CG1 . ILE B 1 36  ? -2.246  -14.057 -2.046  1.00 2.16  ? 36  ILE B CG1 1 
ATOM   2777  C CG2 . ILE B 1 36  ? -0.043  -15.249 -2.539  1.00 2.00  ? 36  ILE B CG2 1 
ATOM   2778  C CD1 . ILE B 1 36  ? -3.659  -13.594 -2.469  1.00 2.31  ? 36  ILE B CD1 1 
ATOM   2779  N N   . SER B 1 37  ? 0.644   -12.794 -4.065  1.00 2.37  ? 37  SER B N   1 
ATOM   2780  C CA  . SER B 1 37  ? 1.472   -11.599 -3.833  1.00 2.32  ? 37  SER B CA  1 
ATOM   2781  C C   . SER B 1 37  ? 1.425   -10.631 -4.999  1.00 2.54  ? 37  SER B C   1 
ATOM   2782  O O   . SER B 1 37  ? 1.422   -9.384  -4.760  1.00 2.82  ? 37  SER B O   1 
ATOM   2783  C CB  . SER B 1 37  ? 2.902   -11.984 -3.497  1.00 2.17  ? 37  SER B CB  1 
ATOM   2784  O OG  . SER B 1 37  ? 3.498   -10.925 -2.775  1.00 2.19  ? 37  SER B OG  1 
ATOM   2785  N N   . ILE B 1 38  ? 1.463   -11.128 -6.234  1.00 2.45  ? 38  ILE B N   1 
ATOM   2786  C CA  . ILE B 1 38  ? 1.286   -10.165 -7.360  1.00 2.48  ? 38  ILE B CA  1 
ATOM   2787  C C   . ILE B 1 38  ? -0.041  -9.441  -7.119  1.00 2.45  ? 38  ILE B C   1 
ATOM   2788  O O   . ILE B 1 38  ? -0.187  -8.265  -7.460  1.00 2.17  ? 38  ILE B O   1 
ATOM   2789  C CB  . ILE B 1 38  ? 1.504   -10.820 -8.740  1.00 2.53  ? 38  ILE B CB  1 
ATOM   2790  C CG1 . ILE B 1 38  ? 3.048   -10.845 -9.019  1.00 2.48  ? 38  ILE B CG1 1 
ATOM   2791  C CG2 . ILE B 1 38  ? 0.711   -10.149 -9.893  1.00 2.48  ? 38  ILE B CG2 1 
ATOM   2792  C CD1 . ILE B 1 38  ? 3.507   -11.511 -10.325 1.00 2.37  ? 38  ILE B CD1 1 
ATOM   2793  N N   . LEU B 1 39  ? -0.929  -10.132 -6.407  1.00 2.62  ? 39  LEU B N   1 
ATOM   2794  C CA  . LEU B 1 39  ? -2.259  -9.579  -6.080  1.00 2.76  ? 39  LEU B CA  1 
ATOM   2795  C C   . LEU B 1 39  ? -2.210  -8.602  -4.915  1.00 2.80  ? 39  LEU B C   1 
ATOM   2796  O O   . LEU B 1 39  ? -2.833  -7.504  -4.973  1.00 2.81  ? 39  LEU B O   1 
ATOM   2797  C CB  . LEU B 1 39  ? -3.221  -10.764 -5.942  1.00 2.74  ? 39  LEU B CB  1 
ATOM   2798  C CG  . LEU B 1 39  ? -3.349  -11.760 -7.073  1.00 2.83  ? 39  LEU B CG  1 
ATOM   2799  C CD1 . LEU B 1 39  ? -3.684  -13.163 -6.538  1.00 3.07  ? 39  LEU B CD1 1 
ATOM   2800  C CD2 . LEU B 1 39  ? -4.484  -11.371 -8.011  1.00 2.73  ? 39  LEU B CD2 1 
ATOM   2801  N N   . LEU B 1 40  ? -1.472  -8.927  -3.873  1.00 2.66  ? 40  LEU B N   1 
ATOM   2802  C CA  . LEU B 1 40  ? -1.390  -8.076  -2.650  1.00 2.41  ? 40  LEU B CA  1 
ATOM   2803  C C   . LEU B 1 40  ? -0.506  -6.890  -2.945  1.00 2.47  ? 40  LEU B C   1 
ATOM   2804  O O   . LEU B 1 40  ? 0.394   -6.444  -2.224  1.00 2.57  ? 40  LEU B O   1 
ATOM   2805  C CB  . LEU B 1 40  ? -1.034  -9.028  -1.513  1.00 2.19  ? 40  LEU B CB  1 
ATOM   2806  C CG  . LEU B 1 40  ? -2.088  -9.958  -0.937  1.00 2.06  ? 40  LEU B CG  1 
ATOM   2807  C CD1 . LEU B 1 40  ? -2.936  -9.311  0.153   1.00 2.00  ? 40  LEU B CD1 1 
ATOM   2808  C CD2 . LEU B 1 40  ? -3.078  -10.454 -1.988  1.00 2.00  ? 40  LEU B CD2 1 
ATOM   2809  N N   . LYS B 1 41  ? -0.761  -6.344  -4.097  1.00 2.60  ? 41  LYS B N   1 
ATOM   2810  C CA  . LYS B 1 41  ? -0.082  -5.209  -4.749  1.00 2.70  ? 41  LYS B CA  1 
ATOM   2811  C C   . LYS B 1 41  ? -0.884  -4.942  -6.019  1.00 2.82  ? 41  LYS B C   1 
ATOM   2812  O O   . LYS B 1 41  ? -1.899  -5.678  -6.252  1.00 2.98  ? 41  LYS B O   1 
ATOM   2813  C CB  . LYS B 1 41  ? 1.380   -5.416  -5.000  1.00 2.57  ? 41  LYS B CB  1 
ATOM   2814  C CG  . LYS B 1 41  ? 2.358   -4.689  -4.071  1.00 2.64  ? 41  LYS B CG  1 
ATOM   2815  C CD  . LYS B 1 41  ? 2.513   -3.194  -4.442  1.00 2.66  ? 41  LYS B CD  1 
ATOM   2816  C CE  . LYS B 1 41  ? 3.784   -2.542  -3.911  1.00 2.38  ? 41  LYS B CE  1 
ATOM   2817  N NZ  . LYS B 1 41  ? 4.218   -1.403  -4.744  1.00 2.00  ? 41  LYS B NZ  1 
ATOM   2818  N N   . GLY B 1 42  ? -0.522  -3.922  -6.739  1.00 2.88  ? 42  GLY B N   1 
ATOM   2819  C CA  . GLY B 1 42  ? -1.367  -3.582  -7.938  1.00 3.16  ? 42  GLY B CA  1 
ATOM   2820  C C   . GLY B 1 42  ? -0.438  -3.672  -9.116  1.00 3.46  ? 42  GLY B C   1 
ATOM   2821  O O   . GLY B 1 42  ? -0.045  -2.617  -9.661  1.00 3.98  ? 42  GLY B O   1 
ATOM   2822  N N   . LEU B 1 43  ? -0.003  -4.868  -9.400  1.00 3.55  ? 43  LEU B N   1 
ATOM   2823  C CA  . LEU B 1 43  ? 0.963   -4.966  -10.558 1.00 3.87  ? 43  LEU B CA  1 
ATOM   2824  C C   . LEU B 1 43  ? 0.128   -5.197  -11.799 1.00 4.25  ? 43  LEU B C   1 
ATOM   2825  O O   . LEU B 1 43  ? 0.358   -4.570  -12.860 1.00 4.20  ? 43  LEU B O   1 
ATOM   2826  C CB  . LEU B 1 43  ? 2.031   -5.935  -10.078 1.00 3.57  ? 43  LEU B CB  1 
ATOM   2827  C CG  . LEU B 1 43  ? 3.110   -5.338  -9.180  1.00 3.54  ? 43  LEU B CG  1 
ATOM   2828  C CD1 . LEU B 1 43  ? 2.566   -4.661  -7.948  1.00 3.48  ? 43  LEU B CD1 1 
ATOM   2829  C CD2 . LEU B 1 43  ? 4.076   -6.442  -8.712  1.00 3.59  ? 43  LEU B CD2 1 
ATOM   2830  N N   . ALA B 1 44  ? -0.993  -5.928  -11.606 1.00 4.50  ? 44  ALA B N   1 
ATOM   2831  C CA  . ALA B 1 44  ? -1.747  -6.315  -12.803 1.00 4.94  ? 44  ALA B CA  1 
ATOM   2832  C C   . ALA B 1 44  ? -3.246  -6.303  -12.614 1.00 5.35  ? 44  ALA B C   1 
ATOM   2833  O O   . ALA B 1 44  ? -3.780  -6.797  -11.639 1.00 5.21  ? 44  ALA B O   1 
ATOM   2834  C CB  . ALA B 1 44  ? -1.209  -7.671  -13.245 1.00 4.98  ? 44  ALA B CB  1 
ATOM   2835  N N   . ASP B 1 45  ? -3.891  -5.797  -13.642 1.00 5.83  ? 45  ASP B N   1 
ATOM   2836  C CA  . ASP B 1 45  ? -5.346  -5.652  -13.719 1.00 6.44  ? 45  ASP B CA  1 
ATOM   2837  C C   . ASP B 1 45  ? -5.956  -6.855  -14.422 1.00 6.66  ? 45  ASP B C   1 
ATOM   2838  O O   . ASP B 1 45  ? -7.202  -6.936  -14.546 1.00 6.86  ? 45  ASP B O   1 
ATOM   2839  C CB  . ASP B 1 45  ? -5.632  -4.306  -14.409 1.00 6.78  ? 45  ASP B CB  1 
ATOM   2840  C CG  . ASP B 1 45  ? -4.786  -4.233  -15.693 1.00 6.98  ? 45  ASP B CG  1 
ATOM   2841  O OD1 . ASP B 1 45  ? -4.419  -5.306  -16.194 1.00 6.89  ? 45  ASP B OD1 1 
ATOM   2842  O OD2 . ASP B 1 45  ? -4.480  -3.096  -16.092 1.00 7.30  ? 45  ASP B OD2 1 
ATOM   2843  N N   . GLU B 1 46  ? -5.109  -7.668  -15.028 1.00 6.78  ? 46  GLU B N   1 
ATOM   2844  C CA  . GLU B 1 46  ? -5.502  -8.957  -15.626 1.00 6.71  ? 46  GLU B CA  1 
ATOM   2845  C C   . GLU B 1 46  ? -4.284  -9.872  -15.359 1.00 6.64  ? 46  GLU B C   1 
ATOM   2846  O O   . GLU B 1 46  ? -3.132  -9.520  -15.619 1.00 6.42  ? 46  GLU B O   1 
ATOM   2847  C CB  . GLU B 1 46  ? -5.866  -9.068  -17.090 1.00 6.61  ? 46  GLU B CB  1 
ATOM   2848  C CG  . GLU B 1 46  ? -6.425  -10.372 -17.608 1.00 6.62  ? 46  GLU B CG  1 
ATOM   2849  C CD  . GLU B 1 46  ? -6.741  -10.743 -18.987 1.00 6.62  ? 46  GLU B CD  1 
ATOM   2850  O OE1 . GLU B 1 46  ? -7.273  -10.118 -19.884 1.00 6.68  ? 46  GLU B OE1 1 
ATOM   2851  O OE2 . GLU B 1 46  ? -6.447  -11.939 -19.322 1.00 6.52  ? 46  GLU B OE2 1 
ATOM   2852  N N   . LEU B 1 47  ? -4.606  -10.928 -14.673 1.00 6.86  ? 47  LEU B N   1 
ATOM   2853  C CA  . LEU B 1 47  ? -3.617  -11.970 -14.326 1.00 7.09  ? 47  LEU B CA  1 
ATOM   2854  C C   . LEU B 1 47  ? -4.262  -13.302 -14.710 1.00 7.32  ? 47  LEU B C   1 
ATOM   2855  O O   . LEU B 1 47  ? -5.283  -13.674 -14.140 1.00 7.34  ? 47  LEU B O   1 
ATOM   2856  C CB  . LEU B 1 47  ? -3.180  -11.777 -12.900 1.00 6.96  ? 47  LEU B CB  1 
ATOM   2857  C CG  . LEU B 1 47  ? -2.486  -12.929 -12.187 1.00 6.91  ? 47  LEU B CG  1 
ATOM   2858  C CD1 . LEU B 1 47  ? -1.628  -12.410 -11.031 1.00 6.83  ? 47  LEU B CD1 1 
ATOM   2859  C CD2 . LEU B 1 47  ? -3.543  -13.888 -11.640 1.00 6.84  ? 47  LEU B CD2 1 
ATOM   2860  N N   . ALA B 1 48  ? -3.709  -13.887 -15.729 1.00 7.80  ? 48  ALA B N   1 
ATOM   2861  C CA  . ALA B 1 48  ? -4.161  -15.155 -16.308 1.00 8.58  ? 48  ALA B CA  1 
ATOM   2862  C C   . ALA B 1 48  ? -3.294  -16.290 -15.795 1.00 9.27  ? 48  ALA B C   1 
ATOM   2863  O O   . ALA B 1 48  ? -2.033  -16.145 -15.836 1.00 9.86  ? 48  ALA B O   1 
ATOM   2864  C CB  . ALA B 1 48  ? -4.097  -15.036 -17.824 1.00 8.46  ? 48  ALA B CB  1 
ATOM   2865  N N   . LEU B 1 49  ? -3.892  -17.397 -15.407 1.00 9.67  ? 49  LEU B N   1 
ATOM   2866  C CA  . LEU B 1 49  ? -3.012  -18.473 -14.846 1.00 10.46 ? 49  LEU B CA  1 
ATOM   2867  C C   . LEU B 1 49  ? -3.136  -19.728 -15.675 1.00 11.22 ? 49  LEU B C   1 
ATOM   2868  O O   . LEU B 1 49  ? -4.186  -20.368 -15.742 1.00 11.30 ? 49  LEU B O   1 
ATOM   2869  C CB  . LEU B 1 49  ? -3.264  -18.451 -13.363 1.00 10.27 ? 49  LEU B CB  1 
ATOM   2870  C CG  . LEU B 1 49  ? -4.515  -17.884 -12.748 1.00 10.09 ? 49  LEU B CG  1 
ATOM   2871  C CD1 . LEU B 1 49  ? -5.652  -18.896 -12.657 1.00 10.00 ? 49  LEU B CD1 1 
ATOM   2872  C CD2 . LEU B 1 49  ? -4.208  -17.403 -11.333 1.00 10.01 ? 49  LEU B CD2 1 
ATOM   2873  N N   . VAL B 1 50  ? -2.036  -20.095 -16.333 1.00 12.16 ? 50  VAL B N   1 
ATOM   2874  C CA  . VAL B 1 50  ? -1.973  -21.269 -17.208 1.00 13.20 ? 50  VAL B CA  1 
ATOM   2875  C C   . VAL B 1 50  ? -1.288  -22.467 -16.560 1.00 14.30 ? 50  VAL B C   1 
ATOM   2876  O O   . VAL B 1 50  ? -0.082  -22.461 -16.282 1.00 14.55 ? 50  VAL B O   1 
ATOM   2877  C CB  . VAL B 1 50  ? -1.363  -20.861 -18.565 1.00 12.83 ? 50  VAL B CB  1 
ATOM   2878  C CG1 . VAL B 1 50  ? -1.147  -22.037 -19.508 1.00 12.79 ? 50  VAL B CG1 1 
ATOM   2879  C CG2 . VAL B 1 50  ? -2.222  -19.797 -19.224 1.00 12.81 ? 50  VAL B CG2 1 
ATOM   2880  N N   . ASP B 1 51  ? -2.054  -23.526 -16.418 1.00 15.48 ? 51  ASP B N   1 
ATOM   2881  C CA  . ASP B 1 51  ? -1.613  -24.809 -15.837 1.00 16.77 ? 51  ASP B CA  1 
ATOM   2882  C C   . ASP B 1 51  ? -2.175  -25.943 -16.717 1.00 17.69 ? 51  ASP B C   1 
ATOM   2883  O O   . ASP B 1 51  ? -3.136  -25.687 -17.475 1.00 17.90 ? 51  ASP B O   1 
ATOM   2884  C CB  . ASP B 1 51  ? -2.060  -24.910 -14.410 1.00 16.75 ? 51  ASP B CB  1 
ATOM   2885  C CG  . ASP B 1 51  ? -1.212  -25.689 -13.455 1.00 16.76 ? 51  ASP B CG  1 
ATOM   2886  O OD1 . ASP B 1 51  ? -0.081  -26.066 -13.801 1.00 16.99 ? 51  ASP B OD1 1 
ATOM   2887  O OD2 . ASP B 1 51  ? -1.664  -25.899 -12.310 1.00 16.55 ? 51  ASP B OD2 1 
ATOM   2888  N N   . ALA B 1 52  ? -1.587  -27.115 -16.587 1.00 18.62 ? 52  ALA B N   1 
ATOM   2889  C CA  . ALA B 1 52  ? -2.019  -28.261 -17.397 1.00 19.84 ? 52  ALA B CA  1 
ATOM   2890  C C   . ALA B 1 52  ? -2.772  -29.268 -16.528 1.00 20.68 ? 52  ALA B C   1 
ATOM   2891  O O   . ALA B 1 52  ? -3.271  -30.271 -17.064 1.00 21.02 ? 52  ALA B O   1 
ATOM   2892  C CB  . ALA B 1 52  ? -0.855  -28.997 -18.057 1.00 19.81 ? 52  ALA B CB  1 
ATOM   2893  N N   . ASP B 1 53  ? -2.778  -28.957 -15.258 1.00 21.45 ? 53  ASP B N   1 
ATOM   2894  C CA  . ASP B 1 53  ? -3.355  -29.867 -14.230 1.00 21.97 ? 53  ASP B CA  1 
ATOM   2895  C C   . ASP B 1 53  ? -4.732  -29.286 -13.890 1.00 21.84 ? 53  ASP B C   1 
ATOM   2896  O O   . ASP B 1 53  ? -5.135  -29.058 -12.771 1.00 21.72 ? 53  ASP B O   1 
ATOM   2897  C CB  . ASP B 1 53  ? -2.376  -30.152 -13.138 1.00 22.75 ? 53  ASP B CB  1 
ATOM   2898  C CG  . ASP B 1 53  ? -1.074  -29.411 -13.023 1.00 23.57 ? 53  ASP B CG  1 
ATOM   2899  O OD1 . ASP B 1 53  ? -0.270  -29.664 -12.065 1.00 24.00 ? 53  ASP B OD1 1 
ATOM   2900  O OD2 . ASP B 1 53  ? -0.691  -28.554 -13.867 1.00 23.82 ? 53  ASP B OD2 1 
ATOM   2901  N N   . THR B 1 54  ? -5.399  -29.014 -14.977 1.00 21.88 ? 54  THR B N   1 
ATOM   2902  C CA  . THR B 1 54  ? -6.737  -28.510 -15.188 1.00 22.01 ? 54  THR B CA  1 
ATOM   2903  C C   . THR B 1 54  ? -7.643  -28.507 -13.982 1.00 22.20 ? 54  THR B C   1 
ATOM   2904  O O   . THR B 1 54  ? -8.472  -27.601 -13.757 1.00 22.07 ? 54  THR B O   1 
ATOM   2905  C CB  . THR B 1 54  ? -7.351  -29.392 -16.385 1.00 21.88 ? 54  THR B CB  1 
ATOM   2906  O OG1 . THR B 1 54  ? -8.537  -28.751 -16.866 1.00 21.78 ? 54  THR B OG1 1 
ATOM   2907  C CG2 . THR B 1 54  ? -7.608  -30.854 -15.972 1.00 21.89 ? 54  THR B CG2 1 
ATOM   2908  N N   . ASP B 1 55  ? -7.536  -29.574 -13.219 1.00 22.52 ? 55  ASP B N   1 
ATOM   2909  C CA  . ASP B 1 55  ? -8.277  -29.882 -11.995 1.00 22.65 ? 55  ASP B CA  1 
ATOM   2910  C C   . ASP B 1 55  ? -7.997  -28.775 -10.963 1.00 22.20 ? 55  ASP B C   1 
ATOM   2911  O O   . ASP B 1 55  ? -8.744  -27.789 -10.950 1.00 22.28 ? 55  ASP B O   1 
ATOM   2912  C CB  . ASP B 1 55  ? -7.977  -31.273 -11.484 1.00 23.42 ? 55  ASP B CB  1 
ATOM   2913  C CG  . ASP B 1 55  ? -8.275  -32.517 -12.268 1.00 24.00 ? 55  ASP B CG  1 
ATOM   2914  O OD1 . ASP B 1 55  ? -7.690  -32.845 -13.335 1.00 24.22 ? 55  ASP B OD1 1 
ATOM   2915  O OD2 . ASP B 1 55  ? -9.104  -33.337 -11.731 1.00 24.15 ? 55  ASP B OD2 1 
ATOM   2916  N N   . LYS B 1 56  ? -6.923  -28.911 -10.225 1.00 21.64 ? 56  LYS B N   1 
ATOM   2917  C CA  . LYS B 1 56  ? -6.462  -27.970 -9.207  1.00 21.02 ? 56  LYS B CA  1 
ATOM   2918  C C   . LYS B 1 56  ? -6.550  -26.504 -9.645  1.00 20.49 ? 56  LYS B C   1 
ATOM   2919  O O   . LYS B 1 56  ? -6.750  -25.595 -8.816  1.00 20.33 ? 56  LYS B O   1 
ATOM   2920  C CB  . LYS B 1 56  ? -5.000  -28.230 -8.758  1.00 20.90 ? 56  LYS B CB  1 
ATOM   2921  C CG  . LYS B 1 56  ? -4.310  -27.055 -8.121  1.00 20.82 ? 56  LYS B CG  1 
ATOM   2922  C CD  . LYS B 1 56  ? -3.192  -27.273 -7.148  1.00 20.86 ? 56  LYS B CD  1 
ATOM   2923  C CE  . LYS B 1 56  ? -2.404  -25.971 -6.969  1.00 20.89 ? 56  LYS B CE  1 
ATOM   2924  N NZ  . LYS B 1 56  ? -1.719  -25.879 -5.671  1.00 20.94 ? 56  LYS B NZ  1 
ATOM   2925  N N   . LEU B 1 57  ? -6.205  -26.280 -10.903 1.00 19.81 ? 57  LEU B N   1 
ATOM   2926  C CA  . LEU B 1 57  ? -6.238  -24.904 -11.379 1.00 19.16 ? 57  LEU B CA  1 
ATOM   2927  C C   . LEU B 1 57  ? -7.624  -24.301 -11.241 1.00 18.73 ? 57  LEU B C   1 
ATOM   2928  O O   . LEU B 1 57  ? -7.735  -23.377 -10.414 1.00 18.83 ? 57  LEU B O   1 
ATOM   2929  C CB  . LEU B 1 57  ? -5.636  -24.792 -12.765 1.00 19.22 ? 57  LEU B CB  1 
ATOM   2930  C CG  . LEU B 1 57  ? -5.004  -23.453 -13.073 1.00 19.30 ? 57  LEU B CG  1 
ATOM   2931  C CD1 . LEU B 1 57  ? -5.850  -22.263 -12.666 1.00 19.40 ? 57  LEU B CD1 1 
ATOM   2932  C CD2 . LEU B 1 57  ? -3.707  -23.371 -12.270 1.00 19.56 ? 57  LEU B CD2 1 
ATOM   2933  N N   . ARG B 1 58  ? -8.613  -24.792 -11.960 1.00 18.12 ? 58  ARG B N   1 
ATOM   2934  C CA  . ARG B 1 58  ? -9.958  -24.197 -11.929 1.00 17.42 ? 58  ARG B CA  1 
ATOM   2935  C C   . ARG B 1 58  ? -10.481 -24.212 -10.478 1.00 16.57 ? 58  ARG B C   1 
ATOM   2936  O O   . ARG B 1 58  ? -11.637 -23.810 -10.308 1.00 16.41 ? 58  ARG B O   1 
ATOM   2937  C CB  . ARG B 1 58  ? -11.002 -24.813 -12.768 1.00 17.96 ? 58  ARG B CB  1 
ATOM   2938  C CG  . ARG B 1 58  ? -11.128 -25.290 -14.161 1.00 18.45 ? 58  ARG B CG  1 
ATOM   2939  C CD  . ARG B 1 58  ? -12.489 -25.986 -14.335 1.00 18.82 ? 58  ARG B CD  1 
ATOM   2940  N NE  . ARG B 1 58  ? -13.477 -25.345 -15.060 1.00 19.02 ? 58  ARG B NE  1 
ATOM   2941  C CZ  . ARG B 1 58  ? -14.045 -24.285 -15.599 1.00 19.18 ? 58  ARG B CZ  1 
ATOM   2942  N NH1 . ARG B 1 58  ? -15.283 -24.398 -16.252 1.00 19.28 ? 58  ARG B NH1 1 
ATOM   2943  N NH2 . ARG B 1 58  ? -13.608 -23.036 -15.350 1.00 19.11 ? 58  ARG B NH2 1 
ATOM   2944  N N   . GLY B 1 59  ? -9.744  -24.801 -9.594  1.00 15.81 ? 59  GLY B N   1 
ATOM   2945  C CA  . GLY B 1 59  ? -10.087 -24.853 -8.164  1.00 15.15 ? 59  GLY B CA  1 
ATOM   2946  C C   . GLY B 1 59  ? -9.455  -23.622 -7.494  1.00 14.70 ? 59  GLY B C   1 
ATOM   2947  O O   . GLY B 1 59  ? -10.108 -22.732 -6.956  1.00 14.54 ? 59  GLY B O   1 
ATOM   2948  N N   . GLU B 1 60  ? -8.138  -23.593 -7.613  1.00 14.40 ? 60  GLU B N   1 
ATOM   2949  C CA  . GLU B 1 60  ? -7.269  -22.529 -7.116  1.00 13.76 ? 60  GLU B CA  1 
ATOM   2950  C C   . GLU B 1 60  ? -7.679  -21.194 -7.734  1.00 13.08 ? 60  GLU B C   1 
ATOM   2951  O O   . GLU B 1 60  ? -7.736  -20.201 -7.004  1.00 13.03 ? 60  GLU B O   1 
ATOM   2952  C CB  . GLU B 1 60  ? -5.795  -22.708 -7.441  1.00 13.94 ? 60  GLU B CB  1 
ATOM   2953  C CG  . GLU B 1 60  ? -4.932  -23.702 -6.714  1.00 14.05 ? 60  GLU B CG  1 
ATOM   2954  C CD  . GLU B 1 60  ? -4.160  -23.284 -5.518  1.00 14.16 ? 60  GLU B CD  1 
ATOM   2955  O OE1 . GLU B 1 60  ? -3.077  -23.761 -5.188  1.00 14.23 ? 60  GLU B OE1 1 
ATOM   2956  O OE2 . GLU B 1 60  ? -4.709  -22.389 -4.839  1.00 14.26 ? 60  GLU B OE2 1 
ATOM   2957  N N   . ALA B 1 61  ? -7.892  -21.230 -9.030  1.00 12.38 ? 61  ALA B N   1 
ATOM   2958  C CA  . ALA B 1 61  ? -8.305  -20.030 -9.777  1.00 11.98 ? 61  ALA B CA  1 
ATOM   2959  C C   . ALA B 1 61  ? -9.571  -19.454 -9.134  1.00 11.73 ? 61  ALA B C   1 
ATOM   2960  O O   . ALA B 1 61  ? -9.556  -18.282 -8.685  1.00 11.79 ? 61  ALA B O   1 
ATOM   2961  C CB  . ALA B 1 61  ? -8.441  -20.333 -11.245 1.00 11.85 ? 61  ALA B CB  1 
ATOM   2962  N N   . LEU B 1 62  ? -10.602 -20.282 -9.006  1.00 11.08 ? 62  LEU B N   1 
ATOM   2963  C CA  . LEU B 1 62  ? -11.886 -19.920 -8.433  1.00 10.23 ? 62  LEU B CA  1 
ATOM   2964  C C   . LEU B 1 62  ? -11.786 -19.431 -6.995  1.00 9.45  ? 62  LEU B C   1 
ATOM   2965  O O   . LEU B 1 62  ? -12.688 -18.741 -6.517  1.00 9.26  ? 62  LEU B O   1 
ATOM   2966  C CB  . LEU B 1 62  ? -12.853 -21.121 -8.547  1.00 10.45 ? 62  LEU B CB  1 
ATOM   2967  C CG  . LEU B 1 62  ? -13.811 -21.000 -9.728  1.00 10.73 ? 62  LEU B CG  1 
ATOM   2968  C CD1 . LEU B 1 62  ? -14.292 -22.366 -10.199 1.00 10.81 ? 62  LEU B CD1 1 
ATOM   2969  C CD2 . LEU B 1 62  ? -15.002 -20.138 -9.284  1.00 10.72 ? 62  LEU B CD2 1 
ATOM   2970  N N   . ASP B 1 63  ? -10.743 -19.888 -6.357  1.00 8.73  ? 63  ASP B N   1 
ATOM   2971  C CA  . ASP B 1 63  ? -10.465 -19.492 -4.958  1.00 8.22  ? 63  ASP B CA  1 
ATOM   2972  C C   . ASP B 1 63  ? -10.126 -17.999 -5.021  1.00 8.08  ? 63  ASP B C   1 
ATOM   2973  O O   . ASP B 1 63  ? -10.796 -17.197 -4.350  1.00 8.38  ? 63  ASP B O   1 
ATOM   2974  C CB  . ASP B 1 63  ? -9.398  -20.362 -4.342  1.00 7.95  ? 63  ASP B CB  1 
ATOM   2975  C CG  . ASP B 1 63  ? -9.328  -20.381 -2.837  1.00 7.55  ? 63  ASP B CG  1 
ATOM   2976  O OD1 . ASP B 1 63  ? -8.496  -21.096 -2.246  1.00 7.20  ? 63  ASP B OD1 1 
ATOM   2977  O OD2 . ASP B 1 63  ? -10.185 -19.691 -2.251  1.00 7.41  ? 63  ASP B OD2 1 
ATOM   2978  N N   . LEU B 1 64  ? -9.163  -17.691 -5.889  1.00 7.57  ? 64  LEU B N   1 
ATOM   2979  C CA  . LEU B 1 64  ? -8.785  -16.275 -6.076  1.00 7.08  ? 64  LEU B CA  1 
ATOM   2980  C C   . LEU B 1 64  ? -10.009 -15.484 -6.531  1.00 6.98  ? 64  LEU B C   1 
ATOM   2981  O O   . LEU B 1 64  ? -10.243 -14.388 -6.002  1.00 7.07  ? 64  LEU B O   1 
ATOM   2982  C CB  . LEU B 1 64  ? -7.575  -16.198 -6.975  1.00 6.92  ? 64  LEU B CB  1 
ATOM   2983  C CG  . LEU B 1 64  ? -6.251  -16.724 -6.506  1.00 6.94  ? 64  LEU B CG  1 
ATOM   2984  C CD1 . LEU B 1 64  ? -5.123  -16.442 -7.505  1.00 6.98  ? 64  LEU B CD1 1 
ATOM   2985  C CD2 . LEU B 1 64  ? -5.857  -16.082 -5.178  1.00 6.95  ? 64  LEU B CD2 1 
ATOM   2986  N N   . GLN B 1 65  ? -10.813 -16.079 -7.394  1.00 6.93  ? 65  GLN B N   1 
ATOM   2987  C CA  . GLN B 1 65  ? -11.984 -15.375 -7.969  1.00 6.88  ? 65  GLN B CA  1 
ATOM   2988  C C   . GLN B 1 65  ? -12.966 -15.052 -6.864  1.00 6.72  ? 65  GLN B C   1 
ATOM   2989  O O   . GLN B 1 65  ? -13.296 -13.860 -6.697  1.00 6.74  ? 65  GLN B O   1 
ATOM   2990  C CB  . GLN B 1 65  ? -12.570 -16.071 -9.176  1.00 7.11  ? 65  GLN B CB  1 
ATOM   2991  C CG  . GLN B 1 65  ? -12.251 -15.371 -10.478 1.00 7.55  ? 65  GLN B CG  1 
ATOM   2992  C CD  . GLN B 1 65  ? -12.538 -16.155 -11.725 1.00 7.98  ? 65  GLN B CD  1 
ATOM   2993  O OE1 . GLN B 1 65  ? -11.831 -16.062 -12.747 1.00 8.08  ? 65  GLN B OE1 1 
ATOM   2994  N NE2 . GLN B 1 65  ? -13.616 -16.954 -11.756 1.00 8.07  ? 65  GLN B NE2 1 
ATOM   2995  N N   . HIS B 1 66  ? -13.342 -16.028 -6.068  1.00 6.54  ? 66  HIS B N   1 
ATOM   2996  C CA  . HIS B 1 66  ? -14.226 -15.794 -4.934  1.00 6.46  ? 66  HIS B CA  1 
ATOM   2997  C C   . HIS B 1 66  ? -13.641 -14.639 -4.100  1.00 6.58  ? 66  HIS B C   1 
ATOM   2998  O O   . HIS B 1 66  ? -14.349 -14.022 -3.319  1.00 6.62  ? 66  HIS B O   1 
ATOM   2999  C CB  . HIS B 1 66  ? -14.393 -16.935 -3.914  1.00 6.37  ? 66  HIS B CB  1 
ATOM   3000  C CG  . HIS B 1 66  ? -15.262 -18.064 -4.342  1.00 6.28  ? 66  HIS B CG  1 
ATOM   3001  N ND1 . HIS B 1 66  ? -15.328 -19.263 -3.670  1.00 6.27  ? 66  HIS B ND1 1 
ATOM   3002  C CD2 . HIS B 1 66  ? -16.072 -18.192 -5.432  1.00 6.19  ? 66  HIS B CD2 1 
ATOM   3003  C CE1 . HIS B 1 66  ? -16.165 -20.063 -4.313  1.00 6.33  ? 66  HIS B CE1 1 
ATOM   3004  N NE2 . HIS B 1 66  ? -16.637 -19.419 -5.371  1.00 6.34  ? 66  HIS B NE2 1 
ATOM   3005  N N   . GLY B 1 67  ? -12.344 -14.509 -4.217  1.00 6.75  ? 67  GLY B N   1 
ATOM   3006  C CA  . GLY B 1 67  ? -11.545 -13.554 -3.486  1.00 7.00  ? 67  GLY B CA  1 
ATOM   3007  C C   . GLY B 1 67  ? -11.628 -12.137 -3.975  1.00 7.10  ? 67  GLY B C   1 
ATOM   3008  O O   . GLY B 1 67  ? -11.217 -11.223 -3.208  1.00 7.28  ? 67  GLY B O   1 
ATOM   3009  N N   . SER B 1 68  ? -12.110 -11.941 -5.164  1.00 7.20  ? 68  SER B N   1 
ATOM   3010  C CA  . SER B 1 68  ? -12.288 -10.606 -5.742  1.00 7.69  ? 68  SER B CA  1 
ATOM   3011  C C   . SER B 1 68  ? -12.371 -9.482  -4.730  1.00 7.91  ? 68  SER B C   1 
ATOM   3012  O O   . SER B 1 68  ? -11.317 -8.815  -4.599  1.00 8.14  ? 68  SER B O   1 
ATOM   3013  C CB  . SER B 1 68  ? -13.483 -10.626 -6.701  1.00 7.75  ? 68  SER B CB  1 
ATOM   3014  O OG  . SER B 1 68  ? -13.049 -11.380 -7.855  1.00 7.91  ? 68  SER B OG  1 
ATOM   3015  N N   . LEU B 1 69  ? -13.421 -9.284  -4.002  1.00 8.05  ? 69  LEU B N   1 
ATOM   3016  C CA  . LEU B 1 69  ? -13.640 -8.232  -3.029  1.00 8.36  ? 69  LEU B CA  1 
ATOM   3017  C C   . LEU B 1 69  ? -12.497 -8.073  -2.045  1.00 9.00  ? 69  LEU B C   1 
ATOM   3018  O O   . LEU B 1 69  ? -12.615 -8.315  -0.826  1.00 9.13  ? 69  LEU B O   1 
ATOM   3019  C CB  . LEU B 1 69  ? -14.995 -8.551  -2.317  1.00 8.09  ? 69  LEU B CB  1 
ATOM   3020  C CG  . LEU B 1 69  ? -15.508 -7.576  -1.264  1.00 7.64  ? 69  LEU B CG  1 
ATOM   3021  C CD1 . LEU B 1 69  ? -16.587 -6.660  -1.801  1.00 7.46  ? 69  LEU B CD1 1 
ATOM   3022  C CD2 . LEU B 1 69  ? -16.075 -8.351  -0.095  1.00 7.54  ? 69  LEU B CD2 1 
ATOM   3023  N N   . PHE B 1 70  ? -11.388 -7.564  -2.504  1.00 9.67  ? 70  PHE B N   1 
ATOM   3024  C CA  . PHE B 1 70  ? -10.136 -7.299  -1.823  1.00 9.89  ? 70  PHE B CA  1 
ATOM   3025  C C   . PHE B 1 70  ? -9.092  -6.942  -2.902  1.00 10.09 ? 70  PHE B C   1 
ATOM   3026  O O   . PHE B 1 70  ? -8.265  -6.031  -2.652  1.00 10.47 ? 70  PHE B O   1 
ATOM   3027  C CB  . PHE B 1 70  ? -9.616  -8.418  -0.928  1.00 9.89  ? 70  PHE B CB  1 
ATOM   3028  C CG  . PHE B 1 70  ? -8.353  -8.089  -0.190  1.00 10.03 ? 70  PHE B CG  1 
ATOM   3029  C CD1 . PHE B 1 70  ? -8.373  -8.012  1.202   1.00 10.33 ? 70  PHE B CD1 1 
ATOM   3030  C CD2 . PHE B 1 70  ? -7.146  -7.847  -0.840  1.00 9.92  ? 70  PHE B CD2 1 
ATOM   3031  C CE1 . PHE B 1 70  ? -7.215  -7.700  1.931   1.00 10.39 ? 70  PHE B CE1 1 
ATOM   3032  C CE2 . PHE B 1 70  ? -6.005  -7.442  -0.172  1.00 9.90  ? 70  PHE B CE2 1 
ATOM   3033  C CZ  . PHE B 1 70  ? -6.032  -7.405  1.225   1.00 10.19 ? 70  PHE B CZ  1 
ATOM   3034  N N   . LEU B 1 71  ? -9.141  -7.612  -4.004  1.00 10.15 ? 71  LEU B N   1 
ATOM   3035  C CA  . LEU B 1 71  ? -8.165  -7.350  -5.079  1.00 10.77 ? 71  LEU B CA  1 
ATOM   3036  C C   . LEU B 1 71  ? -8.432  -6.011  -5.751  1.00 10.89 ? 71  LEU B C   1 
ATOM   3037  O O   . LEU B 1 71  ? -9.565  -5.527  -5.666  1.00 10.99 ? 71  LEU B O   1 
ATOM   3038  C CB  . LEU B 1 71  ? -8.197  -8.562  -6.003  1.00 11.10 ? 71  LEU B CB  1 
ATOM   3039  C CG  . LEU B 1 71  ? -8.301  -9.966  -5.461  1.00 11.17 ? 71  LEU B CG  1 
ATOM   3040  C CD1 . LEU B 1 71  ? -7.848  -10.953 -6.547  1.00 11.17 ? 71  LEU B CD1 1 
ATOM   3041  C CD2 . LEU B 1 71  ? -7.445  -10.152 -4.208  1.00 11.18 ? 71  LEU B CD2 1 
ATOM   3042  N N   . SER B 1 72  ? -7.410  -5.463  -6.367  1.00 11.14 ? 72  SER B N   1 
ATOM   3043  C CA  . SER B 1 72  ? -7.446  -4.233  -7.152  1.00 11.51 ? 72  SER B CA  1 
ATOM   3044  C C   . SER B 1 72  ? -7.094  -4.623  -8.612  1.00 11.50 ? 72  SER B C   1 
ATOM   3045  O O   . SER B 1 72  ? -6.404  -3.887  -9.317  1.00 11.44 ? 72  SER B O   1 
ATOM   3046  C CB  . SER B 1 72  ? -6.492  -3.154  -6.750  1.00 11.94 ? 72  SER B CB  1 
ATOM   3047  O OG  . SER B 1 72  ? -6.841  -2.207  -5.778  1.00 12.61 ? 72  SER B OG  1 
ATOM   3048  N N   . THR B 1 73  ? -7.536  -5.787  -8.961  1.00 11.61 ? 73  THR B N   1 
ATOM   3049  C CA  . THR B 1 73  ? -7.328  -6.411  -10.272 1.00 11.96 ? 73  THR B CA  1 
ATOM   3050  C C   . THR B 1 73  ? -8.616  -7.157  -10.596 1.00 12.28 ? 73  THR B C   1 
ATOM   3051  O O   . THR B 1 73  ? -8.886  -8.209  -10.000 1.00 12.29 ? 73  THR B O   1 
ATOM   3052  C CB  . THR B 1 73  ? -6.041  -7.284  -10.294 1.00 12.07 ? 73  THR B CB  1 
ATOM   3053  O OG1 . THR B 1 73  ? -6.254  -8.465  -11.146 1.00 12.06 ? 73  THR B OG1 1 
ATOM   3054  C CG2 . THR B 1 73  ? -5.475  -7.666  -8.911  1.00 12.12 ? 73  THR B CG2 1 
ATOM   3055  N N   . PRO B 1 74  ? -9.391  -6.527  -11.460 1.00 12.61 ? 74  PRO B N   1 
ATOM   3056  C CA  . PRO B 1 74  ? -10.719 -7.018  -11.797 1.00 12.88 ? 74  PRO B CA  1 
ATOM   3057  C C   . PRO B 1 74  ? -10.717 -8.341  -12.501 1.00 13.28 ? 74  PRO B C   1 
ATOM   3058  O O   . PRO B 1 74  ? -11.526 -9.233  -12.113 1.00 13.41 ? 74  PRO B O   1 
ATOM   3059  C CB  . PRO B 1 74  ? -11.321 -5.879  -12.637 1.00 12.85 ? 74  PRO B CB  1 
ATOM   3060  C CG  . PRO B 1 74  ? -10.146 -5.310  -13.349 1.00 12.82 ? 74  PRO B CG  1 
ATOM   3061  C CD  . PRO B 1 74  ? -8.998  -5.389  -12.314 1.00 12.73 ? 74  PRO B CD  1 
ATOM   3062  N N   . LYS B 1 75  ? -9.813  -8.513  -13.445 1.00 13.77 ? 75  LYS B N   1 
ATOM   3063  C CA  . LYS B 1 75  ? -9.878  -9.788  -14.262 1.00 14.34 ? 75  LYS B CA  1 
ATOM   3064  C C   . LYS B 1 75  ? -8.752  -10.726 -13.868 1.00 14.51 ? 75  LYS B C   1 
ATOM   3065  O O   . LYS B 1 75  ? -7.580  -10.360 -13.803 1.00 14.46 ? 75  LYS B O   1 
ATOM   3066  C CB  . LYS B 1 75  ? -9.943  -9.475  -15.692 1.00 14.46 ? 75  LYS B CB  1 
ATOM   3067  C CG  . LYS B 1 75  ? -9.951  -10.321 -16.901 1.00 14.50 ? 75  LYS B CG  1 
ATOM   3068  C CD  . LYS B 1 75  ? -9.757  -9.527  -18.206 1.00 14.84 ? 75  LYS B CD  1 
ATOM   3069  C CE  . LYS B 1 75  ? -8.836  -8.349  -18.125 1.00 15.28 ? 75  LYS B CE  1 
ATOM   3070  N NZ  . LYS B 1 75  ? -8.174  -7.820  -19.319 1.00 15.56 ? 75  LYS B NZ  1 
ATOM   3071  N N   . ILE B 1 76  ? -9.191  -11.934 -13.602 1.00 14.89 ? 76  ILE B N   1 
ATOM   3072  C CA  . ILE B 1 76  ? -8.415  -13.122 -13.252 1.00 15.33 ? 76  ILE B CA  1 
ATOM   3073  C C   . ILE B 1 76  ? -8.908  -14.296 -14.099 1.00 15.94 ? 76  ILE B C   1 
ATOM   3074  O O   . ILE B 1 76  ? -10.021 -14.818 -13.901 1.00 15.92 ? 76  ILE B O   1 
ATOM   3075  C CB  . ILE B 1 76  ? -8.490  -13.364 -11.709 1.00 15.02 ? 76  ILE B CB  1 
ATOM   3076  C CG1 . ILE B 1 76  ? -7.672  -12.222 -11.051 1.00 14.99 ? 76  ILE B CG1 1 
ATOM   3077  C CG2 . ILE B 1 76  ? -8.039  -14.764 -11.262 1.00 14.87 ? 76  ILE B CG2 1 
ATOM   3078  C CD1 . ILE B 1 76  ? -7.629  -12.224 -9.512  1.00 15.01 ? 76  ILE B CD1 1 
ATOM   3079  N N   . VAL B 1 77  ? -8.110  -14.673 -15.074 1.00 16.76 ? 77  VAL B N   1 
ATOM   3080  C CA  . VAL B 1 77  ? -8.519  -15.744 -16.010 1.00 17.70 ? 77  VAL B CA  1 
ATOM   3081  C C   . VAL B 1 77  ? -7.619  -16.954 -15.840 1.00 18.44 ? 77  VAL B C   1 
ATOM   3082  O O   . VAL B 1 77  ? -6.565  -16.888 -15.192 1.00 18.57 ? 77  VAL B O   1 
ATOM   3083  C CB  . VAL B 1 77  ? -8.646  -15.206 -17.438 1.00 17.63 ? 77  VAL B CB  1 
ATOM   3084  C CG1 . VAL B 1 77  ? -10.106 -14.803 -17.757 1.00 17.58 ? 77  VAL B CG1 1 
ATOM   3085  C CG2 . VAL B 1 77  ? -7.752  -14.014 -17.754 1.00 17.56 ? 77  VAL B CG2 1 
ATOM   3086  N N   . PHE B 1 78  ? -8.095  -18.052 -16.397 1.00 19.45 ? 78  PHE B N   1 
ATOM   3087  C CA  . PHE B 1 78  ? -7.384  -19.345 -16.369 1.00 20.27 ? 78  PHE B CA  1 
ATOM   3088  C C   . PHE B 1 78  ? -7.621  -20.125 -17.664 1.00 20.55 ? 78  PHE B C   1 
ATOM   3089  O O   . PHE B 1 78  ? -8.696  -20.119 -18.263 1.00 20.49 ? 78  PHE B O   1 
ATOM   3090  C CB  . PHE B 1 78  ? -7.703  -20.128 -15.094 1.00 20.62 ? 78  PHE B CB  1 
ATOM   3091  C CG  . PHE B 1 78  ? -7.544  -21.609 -15.170 1.00 21.18 ? 78  PHE B CG  1 
ATOM   3092  C CD1 . PHE B 1 78  ? -6.399  -22.200 -15.733 1.00 21.27 ? 78  PHE B CD1 1 
ATOM   3093  C CD2 . PHE B 1 78  ? -8.502  -22.452 -14.571 1.00 21.45 ? 78  PHE B CD2 1 
ATOM   3094  C CE1 . PHE B 1 78  ? -6.267  -23.562 -15.881 1.00 21.37 ? 78  PHE B CE1 1 
ATOM   3095  C CE2 . PHE B 1 78  ? -8.351  -23.848 -14.670 1.00 21.55 ? 78  PHE B CE2 1 
ATOM   3096  C CZ  . PHE B 1 78  ? -7.247  -24.394 -15.348 1.00 21.52 ? 78  PHE B CZ  1 
ATOM   3097  N N   . GLY B 1 79  ? -6.557  -20.801 -18.082 1.00 21.01 ? 79  GLY B N   1 
ATOM   3098  C CA  . GLY B 1 79  ? -6.527  -21.660 -19.232 1.00 21.77 ? 79  GLY B CA  1 
ATOM   3099  C C   . GLY B 1 79  ? -5.718  -22.939 -19.080 1.00 22.23 ? 79  GLY B C   1 
ATOM   3100  O O   . GLY B 1 79  ? -4.802  -23.093 -18.293 1.00 22.07 ? 79  GLY B O   1 
ATOM   3101  N N   . LYS B 1 80  ? -6.100  -23.889 -19.912 1.00 22.99 ? 80  LYS B N   1 
ATOM   3102  C CA  . LYS B 1 80  ? -5.492  -25.215 -20.088 1.00 23.61 ? 80  LYS B CA  1 
ATOM   3103  C C   . LYS B 1 80  ? -4.459  -25.093 -21.212 1.00 23.93 ? 80  LYS B C   1 
ATOM   3104  O O   . LYS B 1 80  ? -3.606  -25.960 -21.423 1.00 23.99 ? 80  LYS B O   1 
ATOM   3105  C CB  . LYS B 1 80  ? -6.554  -26.234 -20.426 1.00 23.88 ? 80  LYS B CB  1 
ATOM   3106  C CG  . LYS B 1 80  ? -6.210  -27.441 -21.252 1.00 24.13 ? 80  LYS B CG  1 
ATOM   3107  C CD  . LYS B 1 80  ? -5.604  -28.590 -20.489 1.00 24.31 ? 80  LYS B CD  1 
ATOM   3108  C CE  . LYS B 1 80  ? -6.677  -29.573 -19.977 1.00 24.36 ? 80  LYS B CE  1 
ATOM   3109  N NZ  . LYS B 1 80  ? -5.961  -30.817 -19.536 1.00 24.47 ? 80  LYS B NZ  1 
ATOM   3110  N N   . ASP B 1 81  ? -4.629  -24.000 -21.942 1.00 24.28 ? 81  ASP B N   1 
ATOM   3111  C CA  . ASP B 1 81  ? -3.777  -23.610 -23.057 1.00 24.56 ? 81  ASP B CA  1 
ATOM   3112  C C   . ASP B 1 81  ? -3.374  -22.121 -22.909 1.00 24.48 ? 81  ASP B C   1 
ATOM   3113  O O   . ASP B 1 81  ? -3.966  -21.294 -22.219 1.00 24.28 ? 81  ASP B O   1 
ATOM   3114  C CB  . ASP B 1 81  ? -4.406  -23.926 -24.411 1.00 24.95 ? 81  ASP B CB  1 
ATOM   3115  C CG  . ASP B 1 81  ? -3.421  -23.795 -25.572 1.00 25.16 ? 81  ASP B CG  1 
ATOM   3116  O OD1 . ASP B 1 81  ? -2.391  -24.501 -25.584 1.00 25.19 ? 81  ASP B OD1 1 
ATOM   3117  O OD2 . ASP B 1 81  ? -3.725  -22.950 -26.453 1.00 25.16 ? 81  ASP B OD2 1 
ATOM   3118  N N   . TYR B 1 82  ? -2.338  -21.843 -23.659 1.00 24.47 ? 82  TYR B N   1 
ATOM   3119  C CA  . TYR B 1 82  ? -1.610  -20.591 -23.745 1.00 24.60 ? 82  TYR B CA  1 
ATOM   3120  C C   . TYR B 1 82  ? -2.352  -19.530 -24.512 1.00 24.75 ? 82  TYR B C   1 
ATOM   3121  O O   . TYR B 1 82  ? -2.036  -18.308 -24.483 1.00 24.92 ? 82  TYR B O   1 
ATOM   3122  C CB  . TYR B 1 82  ? -0.199  -20.913 -24.325 1.00 24.57 ? 82  TYR B CB  1 
ATOM   3123  C CG  . TYR B 1 82  ? 0.440   -22.014 -23.485 1.00 24.46 ? 82  TYR B CG  1 
ATOM   3124  C CD1 . TYR B 1 82  ? 0.272   -23.364 -23.801 1.00 24.49 ? 82  TYR B CD1 1 
ATOM   3125  C CD2 . TYR B 1 82  ? 1.067   -21.689 -22.301 1.00 24.43 ? 82  TYR B CD2 1 
ATOM   3126  C CE1 . TYR B 1 82  ? 0.813   -24.365 -22.998 1.00 24.48 ? 82  TYR B CE1 1 
ATOM   3127  C CE2 . TYR B 1 82  ? 1.622   -22.667 -21.490 1.00 24.46 ? 82  TYR B CE2 1 
ATOM   3128  C CZ  . TYR B 1 82  ? 1.482   -24.005 -21.831 1.00 24.50 ? 82  TYR B CZ  1 
ATOM   3129  O OH  . TYR B 1 82  ? 2.053   -24.920 -20.998 1.00 24.51 ? 82  TYR B OH  1 
ATOM   3130  N N   . ASN B 1 83  ? -3.408  -19.985 -25.173 1.00 24.72 ? 83  ASN B N   1 
ATOM   3131  C CA  . ASN B 1 83  ? -4.264  -19.030 -25.895 1.00 24.71 ? 83  ASN B CA  1 
ATOM   3132  C C   . ASN B 1 83  ? -4.771  -18.008 -24.866 1.00 24.45 ? 83  ASN B C   1 
ATOM   3133  O O   . ASN B 1 83  ? -5.091  -16.852 -25.143 1.00 24.41 ? 83  ASN B O   1 
ATOM   3134  C CB  . ASN B 1 83  ? -5.384  -19.794 -26.615 1.00 25.05 ? 83  ASN B CB  1 
ATOM   3135  C CG  . ASN B 1 83  ? -5.917  -18.821 -27.684 1.00 25.38 ? 83  ASN B CG  1 
ATOM   3136  O OD1 . ASN B 1 83  ? -6.499  -17.788 -27.314 1.00 25.37 ? 83  ASN B OD1 1 
ATOM   3137  N ND2 . ASN B 1 83  ? -5.472  -19.119 -28.896 1.00 25.71 ? 83  ASN B ND2 1 
ATOM   3138  N N   . VAL B 1 84  ? -4.823  -18.515 -23.651 1.00 24.08 ? 84  VAL B N   1 
ATOM   3139  C CA  . VAL B 1 84  ? -5.372  -17.789 -22.493 1.00 23.78 ? 84  VAL B CA  1 
ATOM   3140  C C   . VAL B 1 84  ? -4.365  -16.811 -21.924 1.00 23.61 ? 84  VAL B C   1 
ATOM   3141  O O   . VAL B 1 84  ? -4.564  -16.225 -20.852 1.00 23.52 ? 84  VAL B O   1 
ATOM   3142  C CB  . VAL B 1 84  ? -5.913  -18.865 -21.526 1.00 23.76 ? 84  VAL B CB  1 
ATOM   3143  C CG1 . VAL B 1 84  ? -6.646  -18.303 -20.324 1.00 23.76 ? 84  VAL B CG1 1 
ATOM   3144  C CG2 . VAL B 1 84  ? -6.812  -19.871 -22.255 1.00 23.71 ? 84  VAL B CG2 1 
ATOM   3145  N N   . SER B 1 85  ? -3.330  -16.529 -22.704 1.00 23.47 ? 85  SER B N   1 
ATOM   3146  C CA  . SER B 1 85  ? -2.217  -15.661 -22.286 1.00 23.20 ? 85  SER B CA  1 
ATOM   3147  C C   . SER B 1 85  ? -2.048  -14.472 -23.207 1.00 23.03 ? 85  SER B C   1 
ATOM   3148  O O   . SER B 1 85  ? -1.187  -13.586 -22.994 1.00 23.08 ? 85  SER B O   1 
ATOM   3149  C CB  . SER B 1 85  ? -0.937  -16.510 -22.246 1.00 23.23 ? 85  SER B CB  1 
ATOM   3150  O OG  . SER B 1 85  ? -0.150  -16.198 -21.105 1.00 23.25 ? 85  SER B OG  1 
ATOM   3151  N N   . ALA B 1 86  ? -2.922  -14.398 -24.192 1.00 22.69 ? 86  ALA B N   1 
ATOM   3152  C CA  . ALA B 1 86  ? -2.854  -13.396 -25.246 1.00 22.31 ? 86  ALA B CA  1 
ATOM   3153  C C   . ALA B 1 86  ? -2.585  -11.989 -24.733 1.00 22.07 ? 86  ALA B C   1 
ATOM   3154  O O   . ALA B 1 86  ? -3.408  -11.370 -24.056 1.00 22.12 ? 86  ALA B O   1 
ATOM   3155  C CB  . ALA B 1 86  ? -4.130  -13.413 -26.077 1.00 22.31 ? 86  ALA B CB  1 
ATOM   3156  N N   . ASN B 1 87  ? -1.420  -11.498 -25.091 1.00 21.71 ? 87  ASN B N   1 
ATOM   3157  C CA  . ASN B 1 87  ? -0.986  -10.114 -24.873 1.00 21.34 ? 87  ASN B CA  1 
ATOM   3158  C C   . ASN B 1 87  ? -0.621  -9.802  -23.438 1.00 20.78 ? 87  ASN B C   1 
ATOM   3159  O O   . ASN B 1 87  ? -0.992  -8.732  -22.896 1.00 20.84 ? 87  ASN B O   1 
ATOM   3160  C CB  . ASN B 1 87  ? -2.031  -9.161  -25.490 1.00 21.82 ? 87  ASN B CB  1 
ATOM   3161  C CG  . ASN B 1 87  ? -2.180  -9.425  -26.989 1.00 22.29 ? 87  ASN B CG  1 
ATOM   3162  O OD1 . ASN B 1 87  ? -1.399  -8.897  -27.813 1.00 22.47 ? 87  ASN B OD1 1 
ATOM   3163  N ND2 . ASN B 1 87  ? -3.169  -10.250 -27.358 1.00 22.40 ? 87  ASN B ND2 1 
ATOM   3164  N N   . SER B 1 88  ? 0.117   -10.747 -22.856 1.00 19.80 ? 88  SER B N   1 
ATOM   3165  C CA  . SER B 1 88  ? 0.654   -10.586 -21.496 1.00 18.73 ? 88  SER B CA  1 
ATOM   3166  C C   . SER B 1 88  ? 1.855   -9.638  -21.604 1.00 17.79 ? 88  SER B C   1 
ATOM   3167  O O   . SER B 1 88  ? 2.477   -9.659  -22.684 1.00 17.94 ? 88  SER B O   1 
ATOM   3168  C CB  . SER B 1 88  ? 1.173   -11.879 -20.898 1.00 18.83 ? 88  SER B CB  1 
ATOM   3169  O OG  . SER B 1 88  ? 0.218   -12.610 -20.164 1.00 18.89 ? 88  SER B OG  1 
ATOM   3170  N N   . LYS B 1 89  ? 2.112   -8.906  -20.558 1.00 16.53 ? 89  LYS B N   1 
ATOM   3171  C CA  . LYS B 1 89  ? 3.351   -8.058  -20.554 1.00 15.27 ? 89  LYS B CA  1 
ATOM   3172  C C   . LYS B 1 89  ? 4.472   -8.856  -19.886 1.00 14.27 ? 89  LYS B C   1 
ATOM   3173  O O   . LYS B 1 89  ? 5.640   -8.790  -20.317 1.00 14.16 ? 89  LYS B O   1 
ATOM   3174  C CB  . LYS B 1 89  ? 3.119   -6.699  -19.956 1.00 15.28 ? 89  LYS B CB  1 
ATOM   3175  C CG  . LYS B 1 89  ? 2.506   -5.637  -20.870 1.00 15.20 ? 89  LYS B CG  1 
ATOM   3176  C CD  . LYS B 1 89  ? 1.170   -6.014  -21.453 1.00 15.23 ? 89  LYS B CD  1 
ATOM   3177  C CE  . LYS B 1 89  ? 0.808   -5.274  -22.718 1.00 15.20 ? 89  LYS B CE  1 
ATOM   3178  N NZ  . LYS B 1 89  ? -0.236  -6.027  -23.491 1.00 15.12 ? 89  LYS B NZ  1 
ATOM   3179  N N   . LEU B 1 90  ? 4.116   -9.716  -18.949 1.00 13.02 ? 90  LEU B N   1 
ATOM   3180  C CA  . LEU B 1 90  ? 5.028   -10.533 -18.187 1.00 11.92 ? 90  LEU B CA  1 
ATOM   3181  C C   . LEU B 1 90  ? 4.489   -11.949 -17.932 1.00 11.43 ? 90  LEU B C   1 
ATOM   3182  O O   . LEU B 1 90  ? 3.436   -12.121 -17.303 1.00 11.44 ? 90  LEU B O   1 
ATOM   3183  C CB  . LEU B 1 90  ? 5.340   -9.842  -16.843 1.00 11.66 ? 90  LEU B CB  1 
ATOM   3184  C CG  . LEU B 1 90  ? 6.387   -10.563 -15.993 1.00 11.40 ? 90  LEU B CG  1 
ATOM   3185  C CD1 . LEU B 1 90  ? 7.719   -9.840  -16.063 1.00 11.19 ? 90  LEU B CD1 1 
ATOM   3186  C CD2 . LEU B 1 90  ? 5.900   -10.678 -14.554 1.00 11.35 ? 90  LEU B CD2 1 
ATOM   3187  N N   . VAL B 1 91  ? 5.290   -12.911 -18.354 1.00 10.60 ? 91  VAL B N   1 
ATOM   3188  C CA  . VAL B 1 91  ? 5.006   -14.330 -18.177 1.00 10.00 ? 91  VAL B CA  1 
ATOM   3189  C C   . VAL B 1 91  ? 6.016   -14.934 -17.192 1.00 9.62  ? 91  VAL B C   1 
ATOM   3190  O O   . VAL B 1 91  ? 7.221   -14.736 -17.385 1.00 9.64  ? 91  VAL B O   1 
ATOM   3191  C CB  . VAL B 1 91  ? 5.005   -15.050 -19.536 1.00 9.93  ? 91  VAL B CB  1 
ATOM   3192  C CG1 . VAL B 1 91  ? 4.582   -16.525 -19.378 1.00 9.93  ? 91  VAL B CG1 1 
ATOM   3193  C CG2 . VAL B 1 91  ? 4.167   -14.370 -20.575 1.00 9.71  ? 91  VAL B CG2 1 
ATOM   3194  N N   . ILE B 1 92  ? 5.528   -15.663 -16.225 1.00 9.28  ? 92  ILE B N   1 
ATOM   3195  C CA  . ILE B 1 92  ? 6.429   -16.297 -15.225 1.00 9.19  ? 92  ILE B CA  1 
ATOM   3196  C C   . ILE B 1 92  ? 6.170   -17.801 -15.165 1.00 9.44  ? 92  ILE B C   1 
ATOM   3197  O O   . ILE B 1 92  ? 5.149   -18.387 -14.766 1.00 9.45  ? 92  ILE B O   1 
ATOM   3198  C CB  . ILE B 1 92  ? 6.475   -15.449 -13.928 1.00 8.83  ? 92  ILE B CB  1 
ATOM   3199  C CG1 . ILE B 1 92  ? 6.851   -16.307 -12.708 1.00 8.73  ? 92  ILE B CG1 1 
ATOM   3200  C CG2 . ILE B 1 92  ? 5.208   -14.582 -13.670 1.00 8.74  ? 92  ILE B CG2 1 
ATOM   3201  C CD1 . ILE B 1 92  ? 5.752   -16.942 -11.859 1.00 8.61  ? 92  ILE B CD1 1 
ATOM   3202  N N   . ILE B 1 93  ? 7.178   -18.478 -15.705 1.00 9.62  ? 93  ILE B N   1 
ATOM   3203  C CA  . ILE B 1 93  ? 7.284   -19.913 -15.884 1.00 9.87  ? 93  ILE B CA  1 
ATOM   3204  C C   . ILE B 1 93  ? 7.631   -20.567 -14.565 1.00 10.56 ? 93  ILE B C   1 
ATOM   3205  O O   . ILE B 1 93  ? 8.714   -20.295 -14.019 1.00 10.82 ? 93  ILE B O   1 
ATOM   3206  C CB  . ILE B 1 93  ? 8.375   -20.249 -16.996 1.00 9.35  ? 93  ILE B CB  1 
ATOM   3207  C CG1 . ILE B 1 93  ? 8.412   -19.171 -18.065 1.00 9.00  ? 93  ILE B CG1 1 
ATOM   3208  C CG2 . ILE B 1 93  ? 8.148   -21.687 -17.518 1.00 9.37  ? 93  ILE B CG2 1 
ATOM   3209  C CD1 . ILE B 1 93  ? 8.740   -19.453 -19.518 1.00 8.78  ? 93  ILE B CD1 1 
ATOM   3210  N N   . THR B 1 94  ? 6.728   -21.321 -14.010 1.00 11.49 ? 94  THR B N   1 
ATOM   3211  C CA  . THR B 1 94  ? 7.010   -22.038 -12.749 1.00 12.55 ? 94  THR B CA  1 
ATOM   3212  C C   . THR B 1 94  ? 6.332   -23.397 -12.798 1.00 13.24 ? 94  THR B C   1 
ATOM   3213  O O   . THR B 1 94  ? 5.397   -23.649 -12.046 1.00 13.32 ? 94  THR B O   1 
ATOM   3214  C CB  . THR B 1 94  ? 6.615   -21.197 -11.494 1.00 12.65 ? 94  THR B CB  1 
ATOM   3215  O OG1 . THR B 1 94  ? 5.148   -21.262 -11.376 1.00 12.89 ? 94  THR B OG1 1 
ATOM   3216  C CG2 . THR B 1 94  ? 7.105   -19.752 -11.555 1.00 12.64 ? 94  THR B CG2 1 
ATOM   3217  N N   . ALA B 1 95  ? 6.755   -24.191 -13.733 1.00 14.33 ? 95  ALA B N   1 
ATOM   3218  C CA  . ALA B 1 95  ? 6.259   -25.524 -14.019 1.00 15.67 ? 95  ALA B CA  1 
ATOM   3219  C C   . ALA B 1 95  ? 7.475   -26.387 -14.369 1.00 16.82 ? 95  ALA B C   1 
ATOM   3220  O O   . ALA B 1 95  ? 8.430   -25.926 -15.010 1.00 16.87 ? 95  ALA B O   1 
ATOM   3221  C CB  . ALA B 1 95  ? 5.220   -25.504 -15.122 1.00 15.51 ? 95  ALA B CB  1 
ATOM   3222  N N   . GLY B 1 96  ? 7.438   -27.606 -13.859 1.00 18.19 ? 96  GLY B N   1 
ATOM   3223  C CA  . GLY B 1 96  ? 8.485   -28.548 -14.091 1.00 20.02 ? 96  GLY B CA  1 
ATOM   3224  C C   . GLY B 1 96  ? 8.522   -29.801 -13.275 1.00 21.39 ? 96  GLY B C   1 
ATOM   3225  O O   . GLY B 1 96  ? 8.034   -30.874 -13.719 1.00 21.62 ? 96  GLY B O   1 
ATOM   3226  N N   . ALA B 1 97  ? 9.111   -29.697 -12.109 1.00 22.52 ? 97  ALA B N   1 
ATOM   3227  C CA  . ALA B 1 97  ? 9.431   -30.902 -11.288 1.00 23.82 ? 97  ALA B CA  1 
ATOM   3228  C C   . ALA B 1 97  ? 10.170  -30.296 -10.093 1.00 24.78 ? 97  ALA B C   1 
ATOM   3229  O O   . ALA B 1 97  ? 11.348  -29.927 -10.222 1.00 25.13 ? 97  ALA B O   1 
ATOM   3230  C CB  . ALA B 1 97  ? 10.313  -31.853 -12.049 1.00 23.65 ? 97  ALA B CB  1 
ATOM   3231  N N   . ARG B 1 98  ? 9.423   -30.182 -9.025  1.00 25.70 ? 98  ARG B N   1 
ATOM   3232  C CA  . ARG B 1 98  ? 9.890   -29.445 -7.875  1.00 26.55 ? 98  ARG B CA  1 
ATOM   3233  C C   . ARG B 1 98  ? 10.328  -30.192 -6.644  1.00 26.56 ? 98  ARG B C   1 
ATOM   3234  O O   . ARG B 1 98  ? 9.471   -30.688 -5.893  1.00 26.63 ? 98  ARG B O   1 
ATOM   3235  C CB  . ARG B 1 98  ? 8.741   -28.497 -7.418  1.00 27.31 ? 98  ARG B CB  1 
ATOM   3236  C CG  . ARG B 1 98  ? 8.830   -27.032 -7.770  1.00 28.11 ? 98  ARG B CG  1 
ATOM   3237  C CD  . ARG B 1 98  ? 7.991   -26.714 -8.949  1.00 28.75 ? 98  ARG B CD  1 
ATOM   3238  N NE  . ARG B 1 98  ? 7.131   -25.545 -8.729  1.00 29.38 ? 98  ARG B NE  1 
ATOM   3239  C CZ  . ARG B 1 98  ? 6.485   -24.971 -9.757  1.00 29.78 ? 98  ARG B CZ  1 
ATOM   3240  N NH1 . ARG B 1 98  ? 6.672   -25.470 -10.992 1.00 29.97 ? 98  ARG B NH1 1 
ATOM   3241  N NH2 . ARG B 1 98  ? 5.607   -23.984 -9.545  1.00 29.76 ? 98  ARG B NH2 1 
ATOM   3242  N N   . MET B 1 99  ? 11.622  -30.165 -6.407  1.00 26.65 ? 99  MET B N   1 
ATOM   3243  C CA  . MET B 1 99  ? 12.171  -30.494 -5.081  1.00 26.87 ? 99  MET B CA  1 
ATOM   3244  C C   . MET B 1 99  ? 11.967  -31.925 -4.632  1.00 26.71 ? 99  MET B C   1 
ATOM   3245  O O   . MET B 1 99  ? 11.024  -32.595 -5.046  1.00 26.79 ? 99  MET B O   1 
ATOM   3246  C CB  . MET B 1 99  ? 11.657  -29.486 -4.055  1.00 27.32 ? 99  MET B CB  1 
ATOM   3247  C CG  . MET B 1 99  ? 10.314  -28.905 -3.947  1.00 27.69 ? 99  MET B CG  1 
ATOM   3248  S SD  . MET B 1 99  ? 10.107  -27.370 -4.943  1.00 28.08 ? 99  MET B SD  1 
ATOM   3249  C CE  . MET B 1 99  ? 8.489   -26.797 -4.495  1.00 27.81 ? 99  MET B CE  1 
ATOM   3250  N N   . VAL B 1 100 ? 12.864  -32.358 -3.762  1.00 26.42 ? 100 VAL B N   1 
ATOM   3251  C CA  . VAL B 1 100 ? 12.911  -33.633 -3.078  1.00 26.11 ? 100 VAL B CA  1 
ATOM   3252  C C   . VAL B 1 100 ? 14.156  -33.654 -2.148  1.00 26.08 ? 100 VAL B C   1 
ATOM   3253  O O   . VAL B 1 100 ? 15.278  -33.717 -2.647  1.00 26.01 ? 100 VAL B O   1 
ATOM   3254  C CB  . VAL B 1 100 ? 12.877  -34.897 -3.932  1.00 25.90 ? 100 VAL B CB  1 
ATOM   3255  C CG1 . VAL B 1 100 ? 13.417  -36.157 -3.229  1.00 25.74 ? 100 VAL B CG1 1 
ATOM   3256  C CG2 . VAL B 1 100 ? 11.471  -35.241 -4.402  1.00 25.96 ? 100 VAL B CG2 1 
ATOM   3257  N N   . SER B 1 101 ? 13.858  -33.756 -0.872  1.00 26.02 ? 101 SER B N   1 
ATOM   3258  C CA  . SER B 1 101 ? 14.873  -33.874 0.185   1.00 25.92 ? 101 SER B CA  1 
ATOM   3259  C C   . SER B 1 101 ? 16.019  -34.752 -0.327  1.00 26.02 ? 101 SER B C   1 
ATOM   3260  O O   . SER B 1 101 ? 15.832  -35.988 -0.402  1.00 26.20 ? 101 SER B O   1 
ATOM   3261  C CB  . SER B 1 101 ? 14.293  -34.487 1.447   1.00 25.80 ? 101 SER B CB  1 
ATOM   3262  O OG  . SER B 1 101 ? 15.267  -35.084 2.272   1.00 25.52 ? 101 SER B OG  1 
ATOM   3263  N N   . GLY B 1 102 ? 17.085  -34.082 -0.725  1.00 25.85 ? 102 GLY B N   1 
ATOM   3264  C CA  . GLY B 1 102 ? 18.286  -34.806 -1.227  1.00 25.52 ? 102 GLY B CA  1 
ATOM   3265  C C   . GLY B 1 102 ? 18.489  -34.393 -2.683  1.00 25.33 ? 102 GLY B C   1 
ATOM   3266  O O   . GLY B 1 102 ? 19.397  -33.632 -3.048  1.00 25.37 ? 102 GLY B O   1 
ATOM   3267  N N   . GLN B 1 103 ? 17.566  -34.893 -3.473  1.00 25.07 ? 103 GLN B N   1 
ATOM   3268  C CA  . GLN B 1 103 ? 17.456  -34.683 -4.907  1.00 24.74 ? 103 GLN B CA  1 
ATOM   3269  C C   . GLN B 1 103 ? 18.096  -33.356 -5.326  1.00 24.74 ? 103 GLN B C   1 
ATOM   3270  O O   . GLN B 1 103 ? 19.153  -33.258 -5.953  1.00 24.71 ? 103 GLN B O   1 
ATOM   3271  C CB  . GLN B 1 103 ? 15.968  -34.686 -5.312  1.00 24.58 ? 103 GLN B CB  1 
ATOM   3272  C CG  . GLN B 1 103 ? 15.641  -34.148 -6.665  1.00 24.38 ? 103 GLN B CG  1 
ATOM   3273  C CD  . GLN B 1 103 ? 15.358  -35.188 -7.705  1.00 24.31 ? 103 GLN B CD  1 
ATOM   3274  O OE1 . GLN B 1 103 ? 14.435  -35.048 -8.491  1.00 24.20 ? 103 GLN B OE1 1 
ATOM   3275  N NE2 . GLN B 1 103 ? 16.126  -36.273 -7.684  1.00 24.42 ? 103 GLN B NE2 1 
ATOM   3276  N N   . THR B 1 104 ? 17.349  -32.343 -4.905  1.00 24.71 ? 104 THR B N   1 
ATOM   3277  C CA  . THR B 1 104 ? 17.587  -30.933 -5.269  1.00 24.47 ? 104 THR B CA  1 
ATOM   3278  C C   . THR B 1 104 ? 19.103  -30.740 -5.367  1.00 24.42 ? 104 THR B C   1 
ATOM   3279  O O   . THR B 1 104 ? 19.921  -31.223 -4.582  1.00 24.24 ? 104 THR B O   1 
ATOM   3280  C CB  . THR B 1 104 ? 16.711  -29.938 -4.442  1.00 24.23 ? 104 THR B CB  1 
ATOM   3281  O OG1 . THR B 1 104 ? 15.377  -29.982 -5.141  1.00 24.15 ? 104 THR B OG1 1 
ATOM   3282  C CG2 . THR B 1 104 ? 17.129  -28.487 -4.319  1.00 24.01 ? 104 THR B CG2 1 
ATOM   3283  N N   . ARG B 1 105 ? 19.405  -30.344 -6.561  1.00 24.31 ? 105 ARG B N   1 
ATOM   3284  C CA  . ARG B 1 105 ? 20.680  -29.991 -7.161  1.00 24.25 ? 105 ARG B CA  1 
ATOM   3285  C C   . ARG B 1 105 ? 20.248  -29.518 -8.560  1.00 23.86 ? 105 ARG B C   1 
ATOM   3286  O O   . ARG B 1 105 ? 19.152  -28.857 -8.607  1.00 23.75 ? 105 ARG B O   1 
ATOM   3287  C CB  . ARG B 1 105 ? 21.738  -31.069 -7.073  1.00 24.51 ? 105 ARG B CB  1 
ATOM   3288  C CG  . ARG B 1 105 ? 22.474  -31.064 -5.728  1.00 25.19 ? 105 ARG B CG  1 
ATOM   3289  C CD  . ARG B 1 105 ? 23.557  -32.033 -5.559  1.00 25.98 ? 105 ARG B CD  1 
ATOM   3290  N NE  . ARG B 1 105 ? 24.221  -32.118 -4.247  1.00 26.64 ? 105 ARG B NE  1 
ATOM   3291  C CZ  . ARG B 1 105 ? 25.556  -32.269 -4.052  1.00 26.93 ? 105 ARG B CZ  1 
ATOM   3292  N NH1 . ARG B 1 105 ? 26.466  -32.326 -5.044  1.00 26.99 ? 105 ARG B NH1 1 
ATOM   3293  N NH2 . ARG B 1 105 ? 26.065  -32.470 -2.819  1.00 26.91 ? 105 ARG B NH2 1 
ATOM   3294  N N   . LEU B 1 106 ? 21.026  -29.750 -9.579  1.00 23.12 ? 106 LEU B N   1 
ATOM   3295  C CA  . LEU B 1 106 ? 20.600  -29.368 -10.953 1.00 22.29 ? 106 LEU B CA  1 
ATOM   3296  C C   . LEU B 1 106 ? 20.161  -30.701 -11.599 1.00 21.86 ? 106 LEU B C   1 
ATOM   3297  O O   . LEU B 1 106 ? 20.490  -31.061 -12.731 1.00 21.85 ? 106 LEU B O   1 
ATOM   3298  C CB  . LEU B 1 106 ? 21.720  -28.646 -11.629 1.00 22.16 ? 106 LEU B CB  1 
ATOM   3299  C CG  . LEU B 1 106 ? 22.866  -28.005 -10.881 1.00 22.01 ? 106 LEU B CG  1 
ATOM   3300  C CD1 . LEU B 1 106 ? 23.876  -29.034 -10.400 1.00 21.92 ? 106 LEU B CD1 1 
ATOM   3301  C CD2 . LEU B 1 106 ? 23.581  -27.022 -11.819 1.00 22.07 ? 106 LEU B CD2 1 
ATOM   3302  N N   . ASP B 1 107 ? 19.527  -31.487 -10.740 1.00 21.17 ? 107 ASP B N   1 
ATOM   3303  C CA  . ASP B 1 107 ? 19.020  -32.805 -11.097 1.00 20.51 ? 107 ASP B CA  1 
ATOM   3304  C C   . ASP B 1 107 ? 17.725  -32.645 -11.895 1.00 20.04 ? 107 ASP B C   1 
ATOM   3305  O O   . ASP B 1 107 ? 17.532  -33.381 -12.880 1.00 20.22 ? 107 ASP B O   1 
ATOM   3306  C CB  . ASP B 1 107 ? 18.824  -33.688 -9.868  1.00 20.52 ? 107 ASP B CB  1 
ATOM   3307  C CG  . ASP B 1 107 ? 20.142  -34.231 -9.358  1.00 20.67 ? 107 ASP B CG  1 
ATOM   3308  O OD1 . ASP B 1 107 ? 20.551  -35.361 -9.663  1.00 20.73 ? 107 ASP B OD1 1 
ATOM   3309  O OD2 . ASP B 1 107 ? 20.792  -33.461 -8.628  1.00 20.96 ? 107 ASP B OD2 1 
ATOM   3310  N N   . LEU B 1 108 ? 16.908  -31.717 -11.428 1.00 19.19 ? 108 LEU B N   1 
ATOM   3311  C CA  . LEU B 1 108 ? 15.582  -31.504 -12.022 1.00 18.50 ? 108 LEU B CA  1 
ATOM   3312  C C   . LEU B 1 108 ? 15.812  -30.859 -13.387 1.00 18.28 ? 108 LEU B C   1 
ATOM   3313  O O   . LEU B 1 108 ? 14.923  -30.103 -13.820 1.00 18.46 ? 108 LEU B O   1 
ATOM   3314  C CB  . LEU B 1 108 ? 14.708  -30.702 -11.096 1.00 18.34 ? 108 LEU B CB  1 
ATOM   3315  C CG  . LEU B 1 108 ? 14.885  -30.643 -9.612  1.00 18.31 ? 108 LEU B CG  1 
ATOM   3316  C CD1 . LEU B 1 108 ? 14.064  -29.484 -9.001  1.00 18.29 ? 108 LEU B CD1 1 
ATOM   3317  C CD2 . LEU B 1 108 ? 14.433  -31.931 -8.944  1.00 18.30 ? 108 LEU B CD2 1 
ATOM   3318  N N   . LEU B 1 109 ? 16.861  -31.285 -14.064 1.00 17.80 ? 109 LEU B N   1 
ATOM   3319  C CA  . LEU B 1 109 ? 17.306  -30.626 -15.276 1.00 17.53 ? 109 LEU B CA  1 
ATOM   3320  C C   . LEU B 1 109 ? 16.980  -31.240 -16.593 1.00 17.35 ? 109 LEU B C   1 
ATOM   3321  O O   . LEU B 1 109 ? 16.393  -30.483 -17.421 1.00 17.49 ? 109 LEU B O   1 
ATOM   3322  C CB  . LEU B 1 109 ? 18.807  -30.346 -15.053 1.00 17.55 ? 109 LEU B CB  1 
ATOM   3323  C CG  . LEU B 1 109 ? 19.593  -29.354 -15.858 1.00 17.47 ? 109 LEU B CG  1 
ATOM   3324  C CD1 . LEU B 1 109 ? 20.205  -29.996 -17.108 1.00 17.54 ? 109 LEU B CD1 1 
ATOM   3325  C CD2 . LEU B 1 109 ? 18.726  -28.173 -16.298 1.00 17.43 ? 109 LEU B CD2 1 
ATOM   3326  N N   . GLN B 1 110 ? 17.450  -32.414 -16.920 1.00 17.30 ? 110 GLN B N   1 
ATOM   3327  C CA  . GLN B 1 110 ? 17.103  -32.964 -18.273 1.00 17.41 ? 110 GLN B CA  1 
ATOM   3328  C C   . GLN B 1 110 ? 15.581  -33.099 -18.295 1.00 17.06 ? 110 GLN B C   1 
ATOM   3329  O O   . GLN B 1 110 ? 14.899  -32.888 -19.292 1.00 17.10 ? 110 GLN B O   1 
ATOM   3330  C CB  . GLN B 1 110 ? 17.869  -34.203 -18.693 1.00 17.89 ? 110 GLN B CB  1 
ATOM   3331  C CG  . GLN B 1 110 ? 18.765  -33.818 -19.921 1.00 18.38 ? 110 GLN B CG  1 
ATOM   3332  C CD  . GLN B 1 110 ? 20.176  -34.279 -19.648 1.00 18.70 ? 110 GLN B CD  1 
ATOM   3333  O OE1 . GLN B 1 110 ? 20.892  -33.736 -18.806 1.00 18.86 ? 110 GLN B OE1 1 
ATOM   3334  N NE2 . GLN B 1 110 ? 20.531  -35.324 -20.384 1.00 18.93 ? 110 GLN B NE2 1 
ATOM   3335  N N   . ARG B 1 111 ? 15.108  -33.331 -17.099 1.00 16.57 ? 111 ARG B N   1 
ATOM   3336  C CA  . ARG B 1 111 ? 13.743  -33.464 -16.667 1.00 15.85 ? 111 ARG B CA  1 
ATOM   3337  C C   . ARG B 1 111 ? 12.889  -32.256 -17.026 1.00 15.75 ? 111 ARG B C   1 
ATOM   3338  O O   . ARG B 1 111 ? 11.740  -32.431 -17.414 1.00 15.79 ? 111 ARG B O   1 
ATOM   3339  C CB  . ARG B 1 111 ? 13.700  -33.556 -15.114 1.00 15.12 ? 111 ARG B CB  1 
ATOM   3340  C CG  . ARG B 1 111 ? 12.260  -33.792 -14.549 1.00 14.18 ? 111 ARG B CG  1 
ATOM   3341  C CD  . ARG B 1 111 ? 12.121  -34.824 -13.371 1.00 13.48 ? 111 ARG B CD  1 
ATOM   3342  N NE  . ARG B 1 111 ? 13.377  -35.148 -12.686 1.00 12.85 ? 111 ARG B NE  1 
ATOM   3343  C CZ  . ARG B 1 111 ? 13.692  -34.932 -11.381 1.00 12.41 ? 111 ARG B CZ  1 
ATOM   3344  N NH1 . ARG B 1 111 ? 12.850  -34.361 -10.461 1.00 12.16 ? 111 ARG B NH1 1 
ATOM   3345  N NH2 . ARG B 1 111 ? 14.866  -35.257 -10.896 1.00 12.19 ? 111 ARG B NH2 1 
ATOM   3346  N N   . ASN B 1 112 ? 13.509  -31.105 -16.806 1.00 15.81 ? 112 ASN B N   1 
ATOM   3347  C CA  . ASN B 1 112 ? 12.780  -29.829 -17.021 1.00 15.91 ? 112 ASN B CA  1 
ATOM   3348  C C   . ASN B 1 112 ? 12.954  -29.311 -18.411 1.00 16.17 ? 112 ASN B C   1 
ATOM   3349  O O   . ASN B 1 112 ? 11.902  -28.986 -19.024 1.00 16.23 ? 112 ASN B O   1 
ATOM   3350  C CB  . ASN B 1 112 ? 13.024  -28.906 -15.828 1.00 15.61 ? 112 ASN B CB  1 
ATOM   3351  C CG  . ASN B 1 112 ? 12.036  -29.320 -14.728 1.00 15.46 ? 112 ASN B CG  1 
ATOM   3352  O OD1 . ASN B 1 112 ? 11.033  -29.989 -15.019 1.00 15.27 ? 112 ASN B OD1 1 
ATOM   3353  N ND2 . ASN B 1 112 ? 12.338  -28.985 -13.489 1.00 15.51 ? 112 ASN B ND2 1 
ATOM   3354  N N   . VAL B 1 113 ? 14.126  -29.323 -18.981 1.00 16.39 ? 113 VAL B N   1 
ATOM   3355  C CA  . VAL B 1 113 ? 14.285  -28.845 -20.384 1.00 16.60 ? 113 VAL B CA  1 
ATOM   3356  C C   . VAL B 1 113 ? 13.128  -29.422 -21.206 1.00 16.85 ? 113 VAL B C   1 
ATOM   3357  O O   . VAL B 1 113 ? 12.527  -28.718 -22.039 1.00 16.80 ? 113 VAL B O   1 
ATOM   3358  C CB  . VAL B 1 113 ? 15.711  -29.144 -20.833 1.00 16.53 ? 113 VAL B CB  1 
ATOM   3359  C CG1 . VAL B 1 113 ? 16.172  -30.544 -20.440 1.00 16.52 ? 113 VAL B CG1 1 
ATOM   3360  C CG2 . VAL B 1 113 ? 15.915  -28.873 -22.315 1.00 16.49 ? 113 VAL B CG2 1 
ATOM   3361  N N   . ALA B 1 114 ? 12.749  -30.640 -20.818 1.00 17.04 ? 114 ALA B N   1 
ATOM   3362  C CA  . ALA B 1 114 ? 11.612  -31.354 -21.427 1.00 17.19 ? 114 ALA B CA  1 
ATOM   3363  C C   . ALA B 1 114 ? 10.372  -30.527 -21.101 1.00 17.44 ? 114 ALA B C   1 
ATOM   3364  O O   . ALA B 1 114 ? 9.743   -30.016 -22.039 1.00 17.55 ? 114 ALA B O   1 
ATOM   3365  C CB  . ALA B 1 114 ? 11.532  -32.782 -20.981 1.00 17.22 ? 114 ALA B CB  1 
ATOM   3366  N N   . ILE B 1 115 ? 10.101  -30.348 -19.827 1.00 17.77 ? 115 ILE B N   1 
ATOM   3367  C CA  . ILE B 1 115 ? 8.988   -29.504 -19.368 1.00 18.28 ? 115 ILE B CA  1 
ATOM   3368  C C   . ILE B 1 115 ? 8.949   -28.248 -20.252 1.00 18.89 ? 115 ILE B C   1 
ATOM   3369  O O   . ILE B 1 115 ? 7.878   -27.924 -20.790 1.00 19.21 ? 115 ILE B O   1 
ATOM   3370  C CB  . ILE B 1 115 ? 9.048   -29.178 -17.862 1.00 18.10 ? 115 ILE B CB  1 
ATOM   3371  C CG1 . ILE B 1 115 ? 7.625   -29.004 -17.265 1.00 17.95 ? 115 ILE B CG1 1 
ATOM   3372  C CG2 . ILE B 1 115 ? 9.855   -27.903 -17.481 1.00 18.25 ? 115 ILE B CG2 1 
ATOM   3373  C CD1 . ILE B 1 115 ? 7.122   -30.252 -16.503 1.00 17.92 ? 115 ILE B CD1 1 
ATOM   3374  N N   . MET B 1 116 ? 10.118  -27.686 -20.524 1.00 19.42 ? 116 MET B N   1 
ATOM   3375  C CA  . MET B 1 116 ? 10.233  -26.457 -21.308 1.00 19.85 ? 116 MET B CA  1 
ATOM   3376  C C   . MET B 1 116 ? 9.857   -26.674 -22.764 1.00 20.25 ? 116 MET B C   1 
ATOM   3377  O O   . MET B 1 116 ? 8.772   -26.152 -23.097 1.00 20.37 ? 116 MET B O   1 
ATOM   3378  C CB  . MET B 1 116 ? 11.564  -25.751 -21.217 1.00 19.85 ? 116 MET B CB  1 
ATOM   3379  C CG  . MET B 1 116 ? 11.963  -25.363 -19.841 1.00 19.90 ? 116 MET B CG  1 
ATOM   3380  S SD  . MET B 1 116 ? 10.506  -24.697 -18.952 1.00 19.97 ? 116 MET B SD  1 
ATOM   3381  C CE  . MET B 1 116 ? 11.416  -23.783 -17.660 1.00 19.81 ? 116 MET B CE  1 
ATOM   3382  N N   . LYS B 1 117 ? 10.687  -27.310 -23.543 1.00 20.68 ? 117 LYS B N   1 
ATOM   3383  C CA  . LYS B 1 117 ? 10.464  -27.541 -24.965 1.00 21.11 ? 117 LYS B CA  1 
ATOM   3384  C C   . LYS B 1 117 ? 8.981   -27.404 -25.323 1.00 21.31 ? 117 LYS B C   1 
ATOM   3385  O O   . LYS B 1 117 ? 8.649   -26.831 -26.367 1.00 21.52 ? 117 LYS B O   1 
ATOM   3386  C CB  . LYS B 1 117 ? 10.928  -28.897 -25.516 1.00 21.20 ? 117 LYS B CB  1 
ATOM   3387  C CG  . LYS B 1 117 ? 10.906  -28.910 -27.051 1.00 21.39 ? 117 LYS B CG  1 
ATOM   3388  C CD  . LYS B 1 117 ? 11.060  -30.251 -27.698 1.00 21.43 ? 117 LYS B CD  1 
ATOM   3389  C CE  . LYS B 1 117 ? 9.752   -30.981 -27.958 1.00 21.44 ? 117 LYS B CE  1 
ATOM   3390  N NZ  . LYS B 1 117 ? 10.049  -32.459 -28.052 1.00 21.57 ? 117 LYS B NZ  1 
ATOM   3391  N N   . ALA B 1 118 ? 8.165   -27.982 -24.477 1.00 21.43 ? 118 ALA B N   1 
ATOM   3392  C CA  . ALA B 1 118 ? 6.723   -27.936 -24.506 1.00 21.66 ? 118 ALA B CA  1 
ATOM   3393  C C   . ALA B 1 118 ? 6.089   -26.632 -24.028 1.00 21.78 ? 118 ALA B C   1 
ATOM   3394  O O   . ALA B 1 118 ? 5.486   -25.837 -24.776 1.00 21.84 ? 118 ALA B O   1 
ATOM   3395  C CB  . ALA B 1 118 ? 6.221   -29.101 -23.604 1.00 21.67 ? 118 ALA B CB  1 
ATOM   3396  N N   . ILE B 1 119 ? 6.159   -26.425 -22.731 1.00 21.79 ? 119 ILE B N   1 
ATOM   3397  C CA  . ILE B 1 119 ? 5.564   -25.324 -21.987 1.00 21.73 ? 119 ILE B CA  1 
ATOM   3398  C C   . ILE B 1 119 ? 5.853   -23.943 -22.560 1.00 21.82 ? 119 ILE B C   1 
ATOM   3399  O O   . ILE B 1 119 ? 4.918   -23.226 -22.932 1.00 21.57 ? 119 ILE B O   1 
ATOM   3400  C CB  . ILE B 1 119 ? 5.974   -25.491 -20.475 1.00 21.61 ? 119 ILE B CB  1 
ATOM   3401  C CG1 . ILE B 1 119 ? 5.145   -26.611 -19.813 1.00 21.59 ? 119 ILE B CG1 1 
ATOM   3402  C CG2 . ILE B 1 119 ? 5.877   -24.171 -19.662 1.00 21.51 ? 119 ILE B CG2 1 
ATOM   3403  C CD1 . ILE B 1 119 ? 5.021   -27.995 -20.460 1.00 21.39 ? 119 ILE B CD1 1 
ATOM   3404  N N   . VAL B 1 120 ? 7.106   -23.609 -22.550 1.00 22.01 ? 120 VAL B N   1 
ATOM   3405  C CA  . VAL B 1 120 ? 7.667   -22.262 -22.961 1.00 22.17 ? 120 VAL B CA  1 
ATOM   3406  C C   . VAL B 1 120 ? 7.242   -21.963 -24.348 1.00 22.30 ? 120 VAL B C   1 
ATOM   3407  O O   . VAL B 1 120 ? 5.978   -21.769 -24.527 1.00 22.39 ? 120 VAL B O   1 
ATOM   3408  C CB  . VAL B 1 120 ? 9.094   -22.335 -22.381 1.00 22.10 ? 120 VAL B CB  1 
ATOM   3409  C CG1 . VAL B 1 120 ? 9.986   -23.382 -23.024 1.00 22.12 ? 120 VAL B CG1 1 
ATOM   3410  C CG2 . VAL B 1 120 ? 9.741   -20.971 -22.240 1.00 22.09 ? 120 VAL B CG2 1 
ATOM   3411  N N   . PRO B 1 121 ? 8.082   -21.676 -25.287 1.00 22.26 ? 121 PRO B N   1 
ATOM   3412  C CA  . PRO B 1 121 ? 7.734   -21.523 -26.714 1.00 22.24 ? 121 PRO B CA  1 
ATOM   3413  C C   . PRO B 1 121 ? 6.412   -22.166 -27.054 1.00 22.11 ? 121 PRO B C   1 
ATOM   3414  O O   . PRO B 1 121 ? 6.287   -23.399 -27.011 1.00 22.09 ? 121 PRO B O   1 
ATOM   3415  C CB  . PRO B 1 121 ? 8.927   -22.172 -27.400 1.00 22.35 ? 121 PRO B CB  1 
ATOM   3416  C CG  . PRO B 1 121 ? 10.058  -22.076 -26.395 1.00 22.35 ? 121 PRO B CG  1 
ATOM   3417  C CD  . PRO B 1 121 ? 9.493   -21.282 -25.209 1.00 22.22 ? 121 PRO B CD  1 
ATOM   3418  N N   . GLY B 1 122 ? 5.517   -21.287 -27.450 1.00 21.96 ? 122 GLY B N   1 
ATOM   3419  C CA  . GLY B 1 122 ? 4.079   -21.644 -27.628 1.00 21.91 ? 122 GLY B CA  1 
ATOM   3420  C C   . GLY B 1 122 ? 3.374   -20.510 -26.825 1.00 21.88 ? 122 GLY B C   1 
ATOM   3421  O O   . GLY B 1 122 ? 2.635   -19.726 -27.410 1.00 22.21 ? 122 GLY B O   1 
ATOM   3422  N N   . VAL B 1 123 ? 3.760   -20.394 -25.563 1.00 21.59 ? 123 VAL B N   1 
ATOM   3423  C CA  . VAL B 1 123 ? 3.326   -19.295 -24.715 1.00 21.18 ? 123 VAL B CA  1 
ATOM   3424  C C   . VAL B 1 123 ? 3.637   -17.981 -25.482 1.00 21.02 ? 123 VAL B C   1 
ATOM   3425  O O   . VAL B 1 123 ? 2.882   -17.033 -25.511 1.00 21.12 ? 123 VAL B O   1 
ATOM   3426  C CB  . VAL B 1 123 ? 3.984   -19.245 -23.329 1.00 21.14 ? 123 VAL B CB  1 
ATOM   3427  C CG1 . VAL B 1 123 ? 4.074   -20.587 -22.613 1.00 21.11 ? 123 VAL B CG1 1 
ATOM   3428  C CG2 . VAL B 1 123 ? 5.351   -18.568 -23.256 1.00 20.94 ? 123 VAL B CG2 1 
ATOM   3429  N N   . ILE B 1 124 ? 4.827   -17.997 -26.021 1.00 20.85 ? 124 ILE B N   1 
ATOM   3430  C CA  . ILE B 1 124 ? 5.427   -16.875 -26.750 1.00 20.70 ? 124 ILE B CA  1 
ATOM   3431  C C   . ILE B 1 124 ? 4.681   -16.619 -28.038 1.00 20.67 ? 124 ILE B C   1 
ATOM   3432  O O   . ILE B 1 124 ? 4.514   -15.436 -28.417 1.00 20.85 ? 124 ILE B O   1 
ATOM   3433  C CB  . ILE B 1 124 ? 6.980   -17.054 -26.864 1.00 20.59 ? 124 ILE B CB  1 
ATOM   3434  C CG1 . ILE B 1 124 ? 7.515   -16.931 -28.298 1.00 20.47 ? 124 ILE B CG1 1 
ATOM   3435  C CG2 . ILE B 1 124 ? 7.487   -18.378 -26.192 1.00 20.70 ? 124 ILE B CG2 1 
ATOM   3436  C CD1 . ILE B 1 124 ? 9.072   -17.109 -28.398 1.00 20.52 ? 124 ILE B CD1 1 
ATOM   3437  N N   . GLN B 1 125 ? 4.220   -17.685 -28.672 1.00 20.51 ? 125 GLN B N   1 
ATOM   3438  C CA  . GLN B 1 125 ? 3.517   -17.510 -29.962 1.00 20.38 ? 125 GLN B CA  1 
ATOM   3439  C C   . GLN B 1 125 ? 2.320   -16.596 -29.715 1.00 20.30 ? 125 GLN B C   1 
ATOM   3440  O O   . GLN B 1 125 ? 1.939   -15.828 -30.604 1.00 20.45 ? 125 GLN B O   1 
ATOM   3441  C CB  . GLN B 1 125 ? 3.151   -18.799 -30.643 1.00 20.60 ? 125 GLN B CB  1 
ATOM   3442  C CG  . GLN B 1 125 ? 2.697   -18.567 -32.080 1.00 20.92 ? 125 GLN B CG  1 
ATOM   3443  C CD  . GLN B 1 125 ? 1.739   -19.602 -32.606 1.00 21.10 ? 125 GLN B CD  1 
ATOM   3444  O OE1 . GLN B 1 125 ? 1.164   -19.409 -33.682 1.00 21.23 ? 125 GLN B OE1 1 
ATOM   3445  N NE2 . GLN B 1 125 ? 1.509   -20.689 -31.870 1.00 21.17 ? 125 GLN B NE2 1 
ATOM   3446  N N   . ASN B 1 126 ? 1.816   -16.670 -28.509 1.00 20.21 ? 126 ASN B N   1 
ATOM   3447  C CA  . ASN B 1 126 ? 0.678   -15.851 -28.062 1.00 20.21 ? 126 ASN B CA  1 
ATOM   3448  C C   . ASN B 1 126 ? 1.124   -14.417 -27.788 1.00 20.18 ? 126 ASN B C   1 
ATOM   3449  O O   . ASN B 1 126 ? 0.709   -13.555 -28.589 1.00 20.34 ? 126 ASN B O   1 
ATOM   3450  C CB  . ASN B 1 126 ? -0.024  -16.496 -26.872 1.00 20.39 ? 126 ASN B CB  1 
ATOM   3451  C CG  . ASN B 1 126 ? -0.478  -17.911 -27.248 1.00 20.52 ? 126 ASN B CG  1 
ATOM   3452  O OD1 . ASN B 1 126 ? -1.598  -18.030 -27.776 1.00 20.88 ? 126 ASN B OD1 1 
ATOM   3453  N ND2 . ASN B 1 126 ? 0.360   -18.889 -26.977 1.00 20.26 ? 126 ASN B ND2 1 
ATOM   3454  N N   . SER B 1 127 ? 1.837   -14.193 -26.698 1.00 19.98 ? 127 SER B N   1 
ATOM   3455  C CA  . SER B 1 127 ? 2.311   -12.831 -26.380 1.00 19.94 ? 127 SER B CA  1 
ATOM   3456  C C   . SER B 1 127 ? 3.743   -12.681 -26.888 1.00 20.13 ? 127 SER B C   1 
ATOM   3457  O O   . SER B 1 127 ? 4.723   -12.675 -26.121 1.00 20.22 ? 127 SER B O   1 
ATOM   3458  C CB  . SER B 1 127 ? 2.134   -12.414 -24.957 1.00 19.90 ? 127 SER B CB  1 
ATOM   3459  O OG  . SER B 1 127 ? 1.645   -13.352 -24.054 1.00 19.81 ? 127 SER B OG  1 
ATOM   3460  N N   . PRO B 1 128 ? 3.788   -12.435 -28.207 1.00 20.28 ? 128 PRO B N   1 
ATOM   3461  C CA  . PRO B 1 128 ? 5.049   -12.308 -28.926 1.00 20.31 ? 128 PRO B CA  1 
ATOM   3462  C C   . PRO B 1 128 ? 6.074   -11.360 -28.351 1.00 20.31 ? 128 PRO B C   1 
ATOM   3463  O O   . PRO B 1 128 ? 7.287   -11.655 -28.528 1.00 20.49 ? 128 PRO B O   1 
ATOM   3464  C CB  . PRO B 1 128 ? 4.600   -11.819 -30.314 1.00 20.36 ? 128 PRO B CB  1 
ATOM   3465  C CG  . PRO B 1 128 ? 3.542   -10.800 -29.909 1.00 20.35 ? 128 PRO B CG  1 
ATOM   3466  C CD  . PRO B 1 128 ? 2.739   -11.584 -28.884 1.00 20.34 ? 128 PRO B CD  1 
ATOM   3467  N N   . ASP B 1 129 ? 5.648   -10.248 -27.783 1.00 20.06 ? 129 ASP B N   1 
ATOM   3468  C CA  . ASP B 1 129 ? 6.552   -9.210  -27.235 1.00 19.68 ? 129 ASP B CA  1 
ATOM   3469  C C   . ASP B 1 129 ? 6.607   -9.330  -25.703 1.00 19.10 ? 129 ASP B C   1 
ATOM   3470  O O   . ASP B 1 129 ? 6.877   -8.309  -25.029 1.00 18.96 ? 129 ASP B O   1 
ATOM   3471  C CB  . ASP B 1 129 ? 6.102   -7.813  -27.606 1.00 20.15 ? 129 ASP B CB  1 
ATOM   3472  C CG  . ASP B 1 129 ? 5.799   -7.299  -28.953 1.00 20.51 ? 129 ASP B CG  1 
ATOM   3473  O OD1 . ASP B 1 129 ? 6.416   -7.642  -29.995 1.00 20.86 ? 129 ASP B OD1 1 
ATOM   3474  O OD2 . ASP B 1 129 ? 4.933   -6.356  -29.041 1.00 20.37 ? 129 ASP B OD2 1 
ATOM   3475  N N   . CYS B 1 130 ? 6.267   -10.502 -25.202 1.00 18.50 ? 130 CYS B N   1 
ATOM   3476  C CA  . CYS B 1 130 ? 6.202   -10.719 -23.749 1.00 17.85 ? 130 CYS B CA  1 
ATOM   3477  C C   . CYS B 1 130 ? 7.606   -10.550 -23.146 1.00 17.07 ? 130 CYS B C   1 
ATOM   3478  O O   . CYS B 1 130 ? 8.629   -10.525 -23.858 1.00 17.12 ? 130 CYS B O   1 
ATOM   3479  C CB  . CYS B 1 130 ? 5.674   -12.111 -23.392 1.00 18.03 ? 130 CYS B CB  1 
ATOM   3480  S SG  . CYS B 1 130 ? 7.099   -13.266 -23.339 1.00 18.76 ? 130 CYS B SG  1 
ATOM   3481  N N   . LYS B 1 131 ? 7.618   -10.645 -21.840 1.00 15.90 ? 131 LYS B N   1 
ATOM   3482  C CA  . LYS B 1 131 ? 8.910   -10.559 -21.098 1.00 14.89 ? 131 LYS B CA  1 
ATOM   3483  C C   . LYS B 1 131 ? 8.890   -11.705 -20.109 1.00 14.15 ? 131 LYS B C   1 
ATOM   3484  O O   . LYS B 1 131 ? 7.884   -11.801 -19.384 1.00 14.28 ? 131 LYS B O   1 
ATOM   3485  C CB  . LYS B 1 131 ? 9.064   -9.233  -20.421 1.00 14.78 ? 131 LYS B CB  1 
ATOM   3486  C CG  . LYS B 1 131 ? 10.188  -9.151  -19.419 1.00 14.64 ? 131 LYS B CG  1 
ATOM   3487  C CD  . LYS B 1 131 ? 10.388  -7.717  -18.975 1.00 14.88 ? 131 LYS B CD  1 
ATOM   3488  C CE  . LYS B 1 131 ? 11.730  -7.561  -18.292 1.00 15.13 ? 131 LYS B CE  1 
ATOM   3489  N NZ  . LYS B 1 131 ? 11.744  -7.961  -16.880 1.00 15.25 ? 131 LYS B NZ  1 
ATOM   3490  N N   . ILE B 1 132 ? 9.940   -12.509 -20.061 1.00 13.20 ? 132 ILE B N   1 
ATOM   3491  C CA  . ILE B 1 132 ? 9.876   -13.649 -19.166 1.00 12.30 ? 132 ILE B CA  1 
ATOM   3492  C C   . ILE B 1 132 ? 10.885  -13.642 -18.015 1.00 11.75 ? 132 ILE B C   1 
ATOM   3493  O O   . ILE B 1 132 ? 12.088  -13.455 -18.133 1.00 11.53 ? 132 ILE B O   1 
ATOM   3494  C CB  . ILE B 1 132 ? 9.940   -15.027 -19.927 1.00 12.25 ? 132 ILE B CB  1 
ATOM   3495  C CG1 . ILE B 1 132 ? 9.384   -14.979 -21.346 1.00 12.08 ? 132 ILE B CG1 1 
ATOM   3496  C CG2 . ILE B 1 132 ? 9.213   -16.111 -19.048 1.00 12.12 ? 132 ILE B CG2 1 
ATOM   3497  C CD1 . ILE B 1 132 ? 9.897   -16.114 -22.299 1.00 11.84 ? 132 ILE B CD1 1 
ATOM   3498  N N   . ILE B 1 133 ? 10.271  -13.954 -16.886 1.00 11.08 ? 133 ILE B N   1 
ATOM   3499  C CA  . ILE B 1 133 ? 10.912  -14.239 -15.618 1.00 10.51 ? 133 ILE B CA  1 
ATOM   3500  C C   . ILE B 1 133 ? 10.849  -15.787 -15.562 1.00 10.17 ? 133 ILE B C   1 
ATOM   3501  O O   . ILE B 1 133 ? 9.777   -16.313 -15.915 1.00 10.23 ? 133 ILE B O   1 
ATOM   3502  C CB  . ILE B 1 133 ? 10.229  -13.600 -14.384 1.00 10.39 ? 133 ILE B CB  1 
ATOM   3503  C CG1 . ILE B 1 133 ? 9.996   -12.089 -14.593 1.00 10.50 ? 133 ILE B CG1 1 
ATOM   3504  C CG2 . ILE B 1 133 ? 11.064  -13.853 -13.096 1.00 10.37 ? 133 ILE B CG2 1 
ATOM   3505  C CD1 . ILE B 1 133 ? 9.147   -11.381 -13.502 1.00 10.44 ? 133 ILE B CD1 1 
ATOM   3506  N N   . VAL B 1 134 ? 11.956  -16.414 -15.331 1.00 9.78  ? 134 VAL B N   1 
ATOM   3507  C CA  . VAL B 1 134 ? 11.979  -17.903 -15.267 1.00 9.56  ? 134 VAL B CA  1 
ATOM   3508  C C   . VAL B 1 134 ? 12.225  -18.204 -13.801 1.00 9.66  ? 134 VAL B C   1 
ATOM   3509  O O   . VAL B 1 134 ? 13.196  -17.666 -13.225 1.00 9.91  ? 134 VAL B O   1 
ATOM   3510  C CB  . VAL B 1 134 ? 12.974  -18.469 -16.284 1.00 9.43  ? 134 VAL B CB  1 
ATOM   3511  C CG1 . VAL B 1 134 ? 13.346  -19.929 -15.997 1.00 9.40  ? 134 VAL B CG1 1 
ATOM   3512  C CG2 . VAL B 1 134 ? 12.545  -18.356 -17.751 1.00 8.98  ? 134 VAL B CG2 1 
ATOM   3513  N N   . VAL B 1 135 ? 11.322  -18.929 -13.178 1.00 9.60  ? 135 VAL B N   1 
ATOM   3514  C CA  . VAL B 1 135 ? 11.490  -19.268 -11.750 1.00 9.41  ? 135 VAL B CA  1 
ATOM   3515  C C   . VAL B 1 135 ? 11.944  -20.713 -11.586 1.00 9.91  ? 135 VAL B C   1 
ATOM   3516  O O   . VAL B 1 135 ? 12.794  -20.947 -10.692 1.00 10.16 ? 135 VAL B O   1 
ATOM   3517  C CB  . VAL B 1 135 ? 10.215  -18.939 -10.971 1.00 8.97  ? 135 VAL B CB  1 
ATOM   3518  C CG1 . VAL B 1 135 ? 10.439  -18.955 -9.462  1.00 8.75  ? 135 VAL B CG1 1 
ATOM   3519  C CG2 . VAL B 1 135 ? 9.601   -17.633 -11.433 1.00 8.87  ? 135 VAL B CG2 1 
ATOM   3520  N N   . THR B 1 136 ? 11.481  -21.611 -12.452 1.00 10.05 ? 136 THR B N   1 
ATOM   3521  C CA  . THR B 1 136 ? 11.739  -23.041 -12.326 1.00 10.24 ? 136 THR B CA  1 
ATOM   3522  C C   . THR B 1 136 ? 13.053  -23.399 -11.703 1.00 10.24 ? 136 THR B C   1 
ATOM   3523  O O   . THR B 1 136 ? 12.712  -23.939 -10.554 1.00 10.22 ? 136 THR B O   1 
ATOM   3524  C CB  . THR B 1 136 ? 11.419  -23.911 -13.603 1.00 10.45 ? 136 THR B CB  1 
ATOM   3525  O OG1 . THR B 1 136 ? 12.474  -23.556 -14.556 1.00 10.93 ? 136 THR B OG1 1 
ATOM   3526  C CG2 . THR B 1 136 ? 10.005  -23.692 -14.112 1.00 10.35 ? 136 THR B CG2 1 
ATOM   3527  N N   . ASN B 1 137 ? 14.293  -23.501 -12.218 1.00 10.22 ? 137 ASN B N   1 
ATOM   3528  C CA  . ASN B 1 137 ? 15.346  -23.733 -11.227 1.00 10.50 ? 137 ASN B CA  1 
ATOM   3529  C C   . ASN B 1 137 ? 16.801  -23.669 -11.043 1.00 10.61 ? 137 ASN B C   1 
ATOM   3530  O O   . ASN B 1 137 ? 17.172  -22.845 -10.085 1.00 10.67 ? 137 ASN B O   1 
ATOM   3531  C CB  . ASN B 1 137 ? 15.027  -25.233 -10.607 1.00 10.40 ? 137 ASN B CB  1 
ATOM   3532  C CG  . ASN B 1 137 ? 15.010  -25.018 -9.089  1.00 10.42 ? 137 ASN B CG  1 
ATOM   3533  O OD1 . ASN B 1 137 ? 14.308  -25.770 -8.393  1.00 10.58 ? 137 ASN B OD1 1 
ATOM   3534  N ND2 . ASN B 1 137 ? 15.657  -23.993 -8.521  1.00 10.25 ? 137 ASN B ND2 1 
ATOM   3535  N N   . PRO B 1 138 ? 17.891  -24.065 -11.684 1.00 10.67 ? 138 PRO B N   1 
ATOM   3536  C CA  . PRO B 1 138 ? 17.867  -24.590 -13.100 1.00 10.41 ? 138 PRO B CA  1 
ATOM   3537  C C   . PRO B 1 138 ? 17.534  -23.365 -13.902 1.00 10.12 ? 138 PRO B C   1 
ATOM   3538  O O   . PRO B 1 138 ? 17.815  -23.208 -15.066 1.00 10.08 ? 138 PRO B O   1 
ATOM   3539  C CB  . PRO B 1 138 ? 17.160  -25.884 -12.910 1.00 10.34 ? 138 PRO B CB  1 
ATOM   3540  C CG  . PRO B 1 138 ? 17.905  -26.447 -11.695 1.00 10.41 ? 138 PRO B CG  1 
ATOM   3541  C CD  . PRO B 1 138 ? 18.627  -25.243 -11.016 1.00 10.54 ? 138 PRO B CD  1 
ATOM   3542  N N   . VAL B 1 139 ? 17.254  -22.311 -13.165 1.00 9.76  ? 139 VAL B N   1 
ATOM   3543  C CA  . VAL B 1 139 ? 16.882  -20.979 -13.533 1.00 9.67  ? 139 VAL B CA  1 
ATOM   3544  C C   . VAL B 1 139 ? 17.915  -20.565 -14.580 1.00 9.70  ? 139 VAL B C   1 
ATOM   3545  O O   . VAL B 1 139 ? 17.569  -20.221 -15.696 1.00 9.76  ? 139 VAL B O   1 
ATOM   3546  C CB  . VAL B 1 139 ? 16.810  -20.150 -12.237 1.00 9.50  ? 139 VAL B CB  1 
ATOM   3547  C CG1 . VAL B 1 139 ? 15.565  -20.483 -11.446 1.00 9.40  ? 139 VAL B CG1 1 
ATOM   3548  C CG2 . VAL B 1 139 ? 18.034  -20.360 -11.355 1.00 9.35  ? 139 VAL B CG2 1 
ATOM   3549  N N   . ASP B 1 140 ? 19.149  -20.806 -14.182 1.00 9.73  ? 140 ASP B N   1 
ATOM   3550  C CA  . ASP B 1 140 ? 20.325  -20.490 -15.018 1.00 9.79  ? 140 ASP B CA  1 
ATOM   3551  C C   . ASP B 1 140 ? 20.107  -21.260 -16.326 1.00 9.88  ? 140 ASP B C   1 
ATOM   3552  O O   . ASP B 1 140 ? 19.491  -20.782 -17.304 1.00 9.80  ? 140 ASP B O   1 
ATOM   3553  C CB  . ASP B 1 140 ? 21.597  -20.772 -14.244 1.00 9.88  ? 140 ASP B CB  1 
ATOM   3554  C CG  . ASP B 1 140 ? 21.642  -20.280 -12.807 1.00 10.12 ? 140 ASP B CG  1 
ATOM   3555  O OD1 . ASP B 1 140 ? 21.853  -21.089 -11.863 1.00 10.03 ? 140 ASP B OD1 1 
ATOM   3556  O OD2 . ASP B 1 140 ? 21.481  -19.063 -12.534 1.00 9.94  ? 140 ASP B OD2 1 
ATOM   3557  N N   . ILE B 1 141 ? 20.389  -22.532 -16.248 1.00 10.02 ? 141 ILE B N   1 
ATOM   3558  C CA  . ILE B 1 141 ? 20.323  -23.480 -17.359 1.00 10.18 ? 141 ILE B CA  1 
ATOM   3559  C C   . ILE B 1 141 ? 19.014  -23.463 -18.115 1.00 10.39 ? 141 ILE B C   1 
ATOM   3560  O O   . ILE B 1 141 ? 18.977  -23.738 -19.332 1.00 10.67 ? 141 ILE B O   1 
ATOM   3561  C CB  . ILE B 1 141 ? 20.745  -24.916 -16.852 1.00 10.05 ? 141 ILE B CB  1 
ATOM   3562  C CG1 . ILE B 1 141 ? 21.720  -24.770 -15.675 1.00 9.96  ? 141 ILE B CG1 1 
ATOM   3563  C CG2 . ILE B 1 141 ? 21.328  -25.724 -18.051 1.00 10.16 ? 141 ILE B CG2 1 
ATOM   3564  C CD1 . ILE B 1 141 ? 22.692  -25.877 -15.308 1.00 9.91  ? 141 ILE B CD1 1 
ATOM   3565  N N   . LEU B 1 142 ? 17.938  -23.146 -17.472 1.00 10.54 ? 142 LEU B N   1 
ATOM   3566  C CA  . LEU B 1 142 ? 16.573  -23.065 -18.001 1.00 10.56 ? 142 LEU B CA  1 
ATOM   3567  C C   . LEU B 1 142 ? 16.449  -21.732 -18.698 1.00 10.92 ? 142 LEU B C   1 
ATOM   3568  O O   . LEU B 1 142 ? 16.067  -21.699 -19.884 1.00 10.97 ? 142 LEU B O   1 
ATOM   3569  C CB  . LEU B 1 142 ? 15.646  -23.427 -16.855 1.00 10.47 ? 142 LEU B CB  1 
ATOM   3570  C CG  . LEU B 1 142 ? 15.876  -24.792 -16.208 1.00 10.40 ? 142 LEU B CG  1 
ATOM   3571  C CD1 . LEU B 1 142 ? 14.881  -25.073 -15.091 1.00 10.44 ? 142 LEU B CD1 1 
ATOM   3572  C CD2 . LEU B 1 142 ? 15.763  -25.899 -17.263 1.00 10.55 ? 142 LEU B CD2 1 
ATOM   3573  N N   . THR B 1 143 ? 16.898  -20.669 -18.042 1.00 11.29 ? 143 THR B N   1 
ATOM   3574  C CA  . THR B 1 143 ? 16.941  -19.328 -18.658 1.00 11.60 ? 143 THR B CA  1 
ATOM   3575  C C   . THR B 1 143 ? 17.565  -19.538 -20.057 1.00 12.09 ? 143 THR B C   1 
ATOM   3576  O O   . THR B 1 143 ? 17.016  -19.113 -21.070 1.00 11.98 ? 143 THR B O   1 
ATOM   3577  C CB  . THR B 1 143 ? 17.694  -18.239 -17.855 1.00 11.46 ? 143 THR B CB  1 
ATOM   3578  O OG1 . THR B 1 143 ? 16.849  -17.733 -16.768 1.00 11.41 ? 143 THR B OG1 1 
ATOM   3579  C CG2 . THR B 1 143 ? 18.148  -17.025 -18.700 1.00 11.68 ? 143 THR B CG2 1 
ATOM   3580  N N   . TYR B 1 144 ? 18.672  -20.288 -20.013 1.00 12.57 ? 144 TYR B N   1 
ATOM   3581  C CA  . TYR B 1 144 ? 19.432  -20.627 -21.223 1.00 12.87 ? 144 TYR B CA  1 
ATOM   3582  C C   . TYR B 1 144 ? 18.545  -21.399 -22.189 1.00 12.98 ? 144 TYR B C   1 
ATOM   3583  O O   . TYR B 1 144 ? 18.375  -20.979 -23.348 1.00 13.07 ? 144 TYR B O   1 
ATOM   3584  C CB  . TYR B 1 144 ? 20.718  -21.367 -20.881 1.00 13.17 ? 144 TYR B CB  1 
ATOM   3585  C CG  . TYR B 1 144 ? 21.445  -21.957 -22.067 1.00 13.63 ? 144 TYR B CG  1 
ATOM   3586  C CD1 . TYR B 1 144 ? 21.366  -23.316 -22.367 1.00 13.62 ? 144 TYR B CD1 1 
ATOM   3587  C CD2 . TYR B 1 144 ? 22.187  -21.135 -22.929 1.00 13.87 ? 144 TYR B CD2 1 
ATOM   3588  C CE1 . TYR B 1 144 ? 22.028  -23.864 -23.454 1.00 13.63 ? 144 TYR B CE1 1 
ATOM   3589  C CE2 . TYR B 1 144 ? 22.824  -21.676 -24.050 1.00 13.95 ? 144 TYR B CE2 1 
ATOM   3590  C CZ  . TYR B 1 144 ? 22.727  -23.045 -24.313 1.00 13.76 ? 144 TYR B CZ  1 
ATOM   3591  O OH  . TYR B 1 144 ? 23.370  -23.523 -25.421 1.00 13.78 ? 144 TYR B OH  1 
ATOM   3592  N N   . VAL B 1 145 ? 18.030  -22.510 -21.728 1.00 13.20 ? 145 VAL B N   1 
ATOM   3593  C CA  . VAL B 1 145 ? 17.063  -23.318 -22.511 1.00 13.48 ? 145 VAL B CA  1 
ATOM   3594  C C   . VAL B 1 145 ? 16.025  -22.365 -23.130 1.00 13.87 ? 145 VAL B C   1 
ATOM   3595  O O   . VAL B 1 145 ? 16.001  -22.189 -24.345 1.00 13.90 ? 145 VAL B O   1 
ATOM   3596  C CB  . VAL B 1 145 ? 16.424  -24.417 -21.644 1.00 13.12 ? 145 VAL B CB  1 
ATOM   3597  C CG1 . VAL B 1 145 ? 15.288  -25.134 -22.346 1.00 12.94 ? 145 VAL B CG1 1 
ATOM   3598  C CG2 . VAL B 1 145 ? 17.427  -25.419 -21.128 1.00 12.99 ? 145 VAL B CG2 1 
ATOM   3599  N N   . VAL B 1 146 ? 15.249  -21.726 -22.271 1.00 14.29 ? 146 VAL B N   1 
ATOM   3600  C CA  . VAL B 1 146 ? 14.185  -20.836 -22.707 1.00 15.01 ? 146 VAL B CA  1 
ATOM   3601  C C   . VAL B 1 146 ? 14.748  -19.803 -23.686 1.00 15.48 ? 146 VAL B C   1 
ATOM   3602  O O   . VAL B 1 146 ? 14.201  -19.638 -24.792 1.00 15.50 ? 146 VAL B O   1 
ATOM   3603  C CB  . VAL B 1 146 ? 13.386  -20.232 -21.550 1.00 15.02 ? 146 VAL B CB  1 
ATOM   3604  C CG1 . VAL B 1 146 ? 12.535  -21.249 -20.807 1.00 14.97 ? 146 VAL B CG1 1 
ATOM   3605  C CG2 . VAL B 1 146 ? 14.260  -19.505 -20.558 1.00 15.22 ? 146 VAL B CG2 1 
ATOM   3606  N N   . TRP B 1 147 ? 15.827  -19.165 -23.282 1.00 16.08 ? 147 TRP B N   1 
ATOM   3607  C CA  . TRP B 1 147 ? 16.467  -18.121 -24.087 1.00 16.59 ? 147 TRP B CA  1 
ATOM   3608  C C   . TRP B 1 147 ? 16.511  -18.601 -25.555 1.00 16.92 ? 147 TRP B C   1 
ATOM   3609  O O   . TRP B 1 147 ? 16.068  -17.940 -26.481 1.00 16.95 ? 147 TRP B O   1 
ATOM   3610  C CB  . TRP B 1 147 ? 17.890  -17.756 -23.631 1.00 16.61 ? 147 TRP B CB  1 
ATOM   3611  C CG  . TRP B 1 147 ? 18.535  -16.775 -24.557 1.00 16.75 ? 147 TRP B CG  1 
ATOM   3612  C CD1 . TRP B 1 147 ? 18.045  -15.539 -24.891 1.00 16.96 ? 147 TRP B CD1 1 
ATOM   3613  C CD2 . TRP B 1 147 ? 19.714  -16.951 -25.340 1.00 16.77 ? 147 TRP B CD2 1 
ATOM   3614  N NE1 . TRP B 1 147 ? 18.872  -14.917 -25.801 1.00 16.97 ? 147 TRP B NE1 1 
ATOM   3615  C CE2 . TRP B 1 147 ? 19.893  -15.775 -26.095 1.00 16.88 ? 147 TRP B CE2 1 
ATOM   3616  C CE3 . TRP B 1 147 ? 20.651  -17.970 -25.436 1.00 16.78 ? 147 TRP B CE3 1 
ATOM   3617  C CZ2 . TRP B 1 147 ? 20.969  -15.590 -26.951 1.00 16.89 ? 147 TRP B CZ2 1 
ATOM   3618  C CZ3 . TRP B 1 147 ? 21.733  -17.767 -26.272 1.00 16.79 ? 147 TRP B CZ3 1 
ATOM   3619  C CH2 . TRP B 1 147 ? 21.883  -16.623 -27.028 1.00 16.84 ? 147 TRP B CH2 1 
ATOM   3620  N N   . LYS B 1 148 ? 17.131  -19.749 -25.631 1.00 17.18 ? 148 LYS B N   1 
ATOM   3621  C CA  . LYS B 1 148 ? 17.454  -20.534 -26.801 1.00 17.36 ? 148 LYS B CA  1 
ATOM   3622  C C   . LYS B 1 148 ? 16.210  -20.960 -27.570 1.00 17.79 ? 148 LYS B C   1 
ATOM   3623  O O   . LYS B 1 148 ? 16.017  -20.684 -28.754 1.00 17.87 ? 148 LYS B O   1 
ATOM   3624  C CB  . LYS B 1 148 ? 18.145  -21.803 -26.299 1.00 17.14 ? 148 LYS B CB  1 
ATOM   3625  C CG  . LYS B 1 148 ? 19.273  -22.430 -27.015 1.00 16.89 ? 148 LYS B CG  1 
ATOM   3626  C CD  . LYS B 1 148 ? 20.611  -21.747 -26.751 1.00 16.80 ? 148 LYS B CD  1 
ATOM   3627  C CE  . LYS B 1 148 ? 20.765  -20.482 -27.590 1.00 16.64 ? 148 LYS B CE  1 
ATOM   3628  N NZ  . LYS B 1 148 ? 22.209  -20.188 -27.786 1.00 16.57 ? 148 LYS B NZ  1 
ATOM   3629  N N   . ILE B 1 149 ? 15.348  -21.619 -26.823 1.00 18.32 ? 149 ILE B N   1 
ATOM   3630  C CA  . ILE B 1 149 ? 14.114  -22.234 -27.300 1.00 18.88 ? 149 ILE B CA  1 
ATOM   3631  C C   . ILE B 1 149 ? 13.094  -21.199 -27.705 1.00 19.13 ? 149 ILE B C   1 
ATOM   3632  O O   . ILE B 1 149 ? 12.269  -21.488 -28.601 1.00 19.19 ? 149 ILE B O   1 
ATOM   3633  C CB  . ILE B 1 149 ? 13.627  -23.285 -26.235 1.00 19.05 ? 149 ILE B CB  1 
ATOM   3634  C CG1 . ILE B 1 149 ? 12.832  -24.420 -26.950 1.00 19.26 ? 149 ILE B CG1 1 
ATOM   3635  C CG2 . ILE B 1 149 ? 12.853  -22.675 -25.058 1.00 18.99 ? 149 ILE B CG2 1 
ATOM   3636  C CD1 . ILE B 1 149 ? 13.771  -25.383 -27.792 1.00 19.31 ? 149 ILE B CD1 1 
ATOM   3637  N N   . SER B 1 150 ? 13.190  -20.022 -27.115 1.00 19.45 ? 150 SER B N   1 
ATOM   3638  C CA  . SER B 1 150 ? 12.260  -18.921 -27.448 1.00 19.83 ? 150 SER B CA  1 
ATOM   3639  C C   . SER B 1 150 ? 12.838  -18.145 -28.632 1.00 20.06 ? 150 SER B C   1 
ATOM   3640  O O   . SER B 1 150 ? 12.240  -18.112 -29.728 1.00 20.26 ? 150 SER B O   1 
ATOM   3641  C CB  . SER B 1 150 ? 11.995  -18.030 -26.269 1.00 19.80 ? 150 SER B CB  1 
ATOM   3642  O OG  . SER B 1 150 ? 13.037  -17.048 -26.188 1.00 20.07 ? 150 SER B OG  1 
ATOM   3643  N N   . GLY B 1 151 ? 13.982  -17.539 -28.419 1.00 20.20 ? 151 GLY B N   1 
ATOM   3644  C CA  . GLY B 1 151 ? 14.677  -16.793 -29.458 1.00 20.70 ? 151 GLY B CA  1 
ATOM   3645  C C   . GLY B 1 151 ? 14.492  -15.293 -29.421 1.00 20.89 ? 151 GLY B C   1 
ATOM   3646  O O   . GLY B 1 151 ? 14.671  -14.625 -30.477 1.00 21.02 ? 151 GLY B O   1 
ATOM   3647  N N   . PHE B 1 152 ? 14.097  -14.769 -28.270 1.00 20.87 ? 152 PHE B N   1 
ATOM   3648  C CA  . PHE B 1 152 ? 14.002  -13.282 -28.186 1.00 20.81 ? 152 PHE B CA  1 
ATOM   3649  C C   . PHE B 1 152 ? 15.180  -12.811 -27.314 1.00 20.53 ? 152 PHE B C   1 
ATOM   3650  O O   . PHE B 1 152 ? 15.780  -13.591 -26.586 1.00 20.39 ? 152 PHE B O   1 
ATOM   3651  C CB  . PHE B 1 152 ? 12.682  -12.737 -27.845 1.00 21.03 ? 152 PHE B CB  1 
ATOM   3652  C CG  . PHE B 1 152 ? 11.653  -13.337 -26.984 1.00 21.07 ? 152 PHE B CG  1 
ATOM   3653  C CD1 . PHE B 1 152 ? 11.796  -13.352 -25.604 1.00 21.09 ? 152 PHE B CD1 1 
ATOM   3654  C CD2 . PHE B 1 152 ? 10.441  -13.775 -27.555 1.00 21.08 ? 152 PHE B CD2 1 
ATOM   3655  C CE1 . PHE B 1 152 ? 10.792  -13.877 -24.803 1.00 21.22 ? 152 PHE B CE1 1 
ATOM   3656  C CE2 . PHE B 1 152 ? 9.411   -14.277 -26.762 1.00 21.07 ? 152 PHE B CE2 1 
ATOM   3657  C CZ  . PHE B 1 152 ? 9.602   -14.325 -25.379 1.00 21.14 ? 152 PHE B CZ  1 
ATOM   3658  N N   . PRO B 1 153 ? 15.501  -11.549 -27.509 1.00 20.43 ? 153 PRO B N   1 
ATOM   3659  C CA  . PRO B 1 153 ? 16.605  -10.889 -26.825 1.00 20.27 ? 153 PRO B CA  1 
ATOM   3660  C C   . PRO B 1 153 ? 16.599  -11.131 -25.340 1.00 20.04 ? 153 PRO B C   1 
ATOM   3661  O O   . PRO B 1 153 ? 15.553  -10.925 -24.697 1.00 20.20 ? 153 PRO B O   1 
ATOM   3662  C CB  . PRO B 1 153 ? 16.419  -9.400  -27.110 1.00 20.38 ? 153 PRO B CB  1 
ATOM   3663  C CG  . PRO B 1 153 ? 14.995  -9.288  -27.623 1.00 20.53 ? 153 PRO B CG  1 
ATOM   3664  C CD  . PRO B 1 153 ? 14.831  -10.589 -28.430 1.00 20.50 ? 153 PRO B CD  1 
ATOM   3665  N N   . VAL B 1 154 ? 17.707  -11.684 -24.830 1.00 19.65 ? 154 VAL B N   1 
ATOM   3666  C CA  . VAL B 1 154 ? 17.845  -11.681 -23.352 1.00 19.08 ? 154 VAL B CA  1 
ATOM   3667  C C   . VAL B 1 154 ? 17.720  -10.152 -23.050 1.00 18.71 ? 154 VAL B C   1 
ATOM   3668  O O   . VAL B 1 154 ? 18.283  -9.342  -23.795 1.00 18.72 ? 154 VAL B O   1 
ATOM   3669  C CB  . VAL B 1 154 ? 19.110  -12.264 -22.794 1.00 19.17 ? 154 VAL B CB  1 
ATOM   3670  C CG1 . VAL B 1 154 ? 20.411  -11.646 -23.285 1.00 18.96 ? 154 VAL B CG1 1 
ATOM   3671  C CG2 . VAL B 1 154 ? 19.032  -12.180 -21.257 1.00 19.23 ? 154 VAL B CG2 1 
ATOM   3672  N N   . GLY B 1 155 ? 17.052  -9.916  -21.987 1.00 18.18 ? 155 GLY B N   1 
ATOM   3673  C CA  . GLY B 1 155 ? 16.610  -8.507  -21.635 1.00 17.32 ? 155 GLY B CA  1 
ATOM   3674  C C   . GLY B 1 155 ? 15.127  -8.912  -21.323 1.00 16.85 ? 155 GLY B C   1 
ATOM   3675  O O   . GLY B 1 155 ? 14.712  -8.975  -20.189 1.00 16.95 ? 155 GLY B O   1 
ATOM   3676  N N   . ARG B 1 156 ? 14.610  -9.526  -22.389 1.00 16.27 ? 156 ARG B N   1 
ATOM   3677  C CA  . ARG B 1 156 ? 13.224  -10.056 -22.335 1.00 15.62 ? 156 ARG B CA  1 
ATOM   3678  C C   . ARG B 1 156 ? 13.277  -11.302 -21.477 1.00 14.97 ? 156 ARG B C   1 
ATOM   3679  O O   . ARG B 1 156 ? 12.671  -11.290 -20.395 1.00 14.92 ? 156 ARG B O   1 
ATOM   3680  C CB  . ARG B 1 156 ? 12.585  -10.210 -23.705 1.00 15.70 ? 156 ARG B CB  1 
ATOM   3681  C CG  . ARG B 1 156 ? 12.579  -8.886  -24.509 1.00 15.60 ? 156 ARG B CG  1 
ATOM   3682  C CD  . ARG B 1 156 ? 11.331  -8.620  -25.195 1.00 15.68 ? 156 ARG B CD  1 
ATOM   3683  N NE  . ARG B 1 156 ? 11.255  -8.839  -26.619 1.00 15.92 ? 156 ARG B NE  1 
ATOM   3684  C CZ  . ARG B 1 156 ? 10.295  -9.597  -27.187 1.00 16.19 ? 156 ARG B CZ  1 
ATOM   3685  N NH1 . ARG B 1 156 ? 9.376   -10.262 -26.474 1.00 16.17 ? 156 ARG B NH1 1 
ATOM   3686  N NH2 . ARG B 1 156 ? 10.108  -9.552  -28.516 1.00 16.29 ? 156 ARG B NH2 1 
ATOM   3687  N N   . VAL B 1 157 ? 14.164  -12.205 -21.795 1.00 14.36 ? 157 VAL B N   1 
ATOM   3688  C CA  . VAL B 1 157 ? 14.298  -13.500 -21.067 1.00 13.70 ? 157 VAL B CA  1 
ATOM   3689  C C   . VAL B 1 157 ? 15.207  -13.420 -19.856 1.00 12.87 ? 157 VAL B C   1 
ATOM   3690  O O   . VAL B 1 157 ? 16.449  -13.560 -19.948 1.00 12.82 ? 157 VAL B O   1 
ATOM   3691  C CB  . VAL B 1 157 ? 14.714  -14.548 -22.134 1.00 13.80 ? 157 VAL B CB  1 
ATOM   3692  C CG1 . VAL B 1 157 ? 15.129  -15.878 -21.539 1.00 13.83 ? 157 VAL B CG1 1 
ATOM   3693  C CG2 . VAL B 1 157 ? 13.608  -14.714 -23.180 1.00 13.70 ? 157 VAL B CG2 1 
ATOM   3694  N N   . ILE B 1 158 ? 14.594  -13.336 -18.690 1.00 11.89 ? 158 ILE B N   1 
ATOM   3695  C CA  . ILE B 1 158 ? 15.309  -13.171 -17.428 1.00 11.06 ? 158 ILE B CA  1 
ATOM   3696  C C   . ILE B 1 158 ? 15.024  -14.316 -16.458 1.00 10.69 ? 158 ILE B C   1 
ATOM   3697  O O   . ILE B 1 158 ? 14.023  -15.045 -16.604 1.00 10.93 ? 158 ILE B O   1 
ATOM   3698  C CB  . ILE B 1 158 ? 14.990  -11.806 -16.716 1.00 10.80 ? 158 ILE B CB  1 
ATOM   3699  C CG1 . ILE B 1 158 ? 14.617  -10.743 -17.749 1.00 10.66 ? 158 ILE B CG1 1 
ATOM   3700  C CG2 . ILE B 1 158 ? 16.164  -11.369 -15.793 1.00 10.63 ? 158 ILE B CG2 1 
ATOM   3701  C CD1 . ILE B 1 158 ? 14.208  -9.385  -17.157 1.00 10.74 ? 158 ILE B CD1 1 
ATOM   3702  N N   . GLY B 1 159 ? 15.840  -14.358 -15.404 1.00 9.83  ? 159 GLY B N   1 
ATOM   3703  C CA  . GLY B 1 159 ? 15.729  -15.399 -14.425 1.00 8.82  ? 159 GLY B CA  1 
ATOM   3704  C C   . GLY B 1 159 ? 15.965  -14.963 -13.004 1.00 8.30  ? 159 GLY B C   1 
ATOM   3705  O O   . GLY B 1 159 ? 16.848  -14.207 -12.631 1.00 8.08  ? 159 GLY B O   1 
ATOM   3706  N N   . SER B 1 160 ? 15.165  -15.576 -12.163 1.00 8.00  ? 160 SER B N   1 
ATOM   3707  C CA  . SER B 1 160 ? 15.101  -15.489 -10.729 1.00 7.59  ? 160 SER B CA  1 
ATOM   3708  C C   . SER B 1 160 ? 16.488  -15.349 -10.119 1.00 7.07  ? 160 SER B C   1 
ATOM   3709  O O   . SER B 1 160 ? 16.622  -14.789 -9.025  1.00 7.04  ? 160 SER B O   1 
ATOM   3710  C CB  . SER B 1 160 ? 14.475  -16.782 -10.150 1.00 7.74  ? 160 SER B CB  1 
ATOM   3711  O OG  . SER B 1 160 ? 15.353  -17.845 -10.514 1.00 7.89  ? 160 SER B OG  1 
ATOM   3712  N N   . GLY B 1 161 ? 17.420  -16.016 -10.769 1.00 6.56  ? 161 GLY B N   1 
ATOM   3713  C CA  . GLY B 1 161 ? 18.825  -15.969 -10.332 1.00 6.21  ? 161 GLY B CA  1 
ATOM   3714  C C   . GLY B 1 161 ? 18.955  -15.990 -8.823  1.00 5.88  ? 161 GLY B C   1 
ATOM   3715  O O   . GLY B 1 161 ? 18.253  -16.738 -8.137  1.00 5.77  ? 161 GLY B O   1 
ATOM   3716  N N   . CYS B 1 162 ? 19.742  -15.052 -8.324  1.00 5.80  ? 162 CYS B N   1 
ATOM   3717  C CA  . CYS B 1 162 ? 20.105  -14.991 -6.893  1.00 5.64  ? 162 CYS B CA  1 
ATOM   3718  C C   . CYS B 1 162 ? 19.435  -13.891 -6.139  1.00 5.53  ? 162 CYS B C   1 
ATOM   3719  O O   . CYS B 1 162 ? 19.705  -13.678 -4.920  1.00 5.66  ? 162 CYS B O   1 
ATOM   3720  C CB  . CYS B 1 162 ? 21.652  -14.884 -6.834  1.00 5.51  ? 162 CYS B CB  1 
ATOM   3721  S SG  . CYS B 1 162 ? 22.293  -15.885 -8.231  1.00 5.92  ? 162 CYS B SG  1 
ATOM   3722  N N   . ASN B 1 163 ? 18.555  -13.187 -6.837  1.00 5.09  ? 163 ASN B N   1 
ATOM   3723  C CA  . ASN B 1 163 ? 17.798  -12.077 -6.190  1.00 4.75  ? 163 ASN B CA  1 
ATOM   3724  C C   . ASN B 1 163 ? 17.389  -12.614 -4.809  1.00 4.44  ? 163 ASN B C   1 
ATOM   3725  O O   . ASN B 1 163 ? 17.714  -12.145 -3.746  1.00 4.30  ? 163 ASN B O   1 
ATOM   3726  C CB  . ASN B 1 163 ? 16.668  -11.670 -7.116  1.00 4.91  ? 163 ASN B CB  1 
ATOM   3727  C CG  . ASN B 1 163 ? 15.893  -10.554 -6.429  1.00 5.08  ? 163 ASN B CG  1 
ATOM   3728  O OD1 . ASN B 1 163 ? 16.555  -9.527  -6.203  1.00 5.50  ? 163 ASN B OD1 1 
ATOM   3729  N ND2 . ASN B 1 163 ? 14.686  -10.831 -6.011  1.00 5.17  ? 163 ASN B ND2 1 
ATOM   3730  N N   . LEU B 1 164 ? 16.885  -13.830 -4.930  1.00 4.13  ? 164 LEU B N   1 
ATOM   3731  C CA  . LEU B 1 164 ? 16.501  -14.757 -3.880  1.00 3.61  ? 164 LEU B CA  1 
ATOM   3732  C C   . LEU B 1 164 ? 17.585  -14.859 -2.807  1.00 3.23  ? 164 LEU B C   1 
ATOM   3733  O O   . LEU B 1 164 ? 17.482  -14.263 -1.730  1.00 2.82  ? 164 LEU B O   1 
ATOM   3734  C CB  . LEU B 1 164 ? 16.260  -16.041 -4.675  1.00 3.58  ? 164 LEU B CB  1 
ATOM   3735  C CG  . LEU B 1 164 ? 15.052  -16.903 -4.482  1.00 3.51  ? 164 LEU B CG  1 
ATOM   3736  C CD1 . LEU B 1 164 ? 15.304  -18.243 -5.190  1.00 3.39  ? 164 LEU B CD1 1 
ATOM   3737  C CD2 . LEU B 1 164 ? 14.763  -17.144 -3.007  1.00 3.57  ? 164 LEU B CD2 1 
ATOM   3738  N N   . ASP B 1 165 ? 18.620  -15.609 -3.110  1.00 3.20  ? 165 ASP B N   1 
ATOM   3739  C CA  . ASP B 1 165 ? 19.823  -15.852 -2.319  1.00 3.28  ? 165 ASP B CA  1 
ATOM   3740  C C   . ASP B 1 165 ? 20.390  -14.623 -1.589  1.00 3.21  ? 165 ASP B C   1 
ATOM   3741  O O   . ASP B 1 165 ? 20.613  -14.629 -0.368  1.00 3.09  ? 165 ASP B O   1 
ATOM   3742  C CB  . ASP B 1 165 ? 20.949  -16.442 -3.205  1.00 3.19  ? 165 ASP B CB  1 
ATOM   3743  C CG  . ASP B 1 165 ? 20.505  -17.740 -3.875  1.00 3.20  ? 165 ASP B CG  1 
ATOM   3744  O OD1 . ASP B 1 165 ? 20.137  -18.711 -3.203  1.00 3.04  ? 165 ASP B OD1 1 
ATOM   3745  O OD2 . ASP B 1 165 ? 20.547  -17.689 -5.119  1.00 3.19  ? 165 ASP B OD2 1 
ATOM   3746  N N   . SER B 1 166 ? 20.714  -13.617 -2.395  1.00 3.01  ? 166 SER B N   1 
ATOM   3747  C CA  . SER B 1 166 ? 21.197  -12.317 -1.926  1.00 2.70  ? 166 SER B CA  1 
ATOM   3748  C C   . SER B 1 166 ? 20.321  -11.780 -0.790  1.00 2.59  ? 166 SER B C   1 
ATOM   3749  O O   . SER B 1 166 ? 20.792  -11.152 0.158   1.00 2.69  ? 166 SER B O   1 
ATOM   3750  C CB  . SER B 1 166 ? 21.195  -11.317 -3.074  1.00 2.60  ? 166 SER B CB  1 
ATOM   3751  O OG  . SER B 1 166 ? 21.355  -11.972 -4.312  1.00 2.29  ? 166 SER B OG  1 
ATOM   3752  N N   . ALA B 1 167 ? 19.032  -11.970 -0.963  1.00 2.45  ? 167 ALA B N   1 
ATOM   3753  C CA  . ALA B 1 167 ? 18.008  -11.574 -0.005  1.00 2.27  ? 167 ALA B CA  1 
ATOM   3754  C C   . ALA B 1 167 ? 18.116  -12.497 1.205   1.00 2.23  ? 167 ALA B C   1 
ATOM   3755  O O   . ALA B 1 167 ? 18.117  -12.079 2.365   1.00 2.06  ? 167 ALA B O   1 
ATOM   3756  C CB  . ALA B 1 167 ? 16.638  -11.631 -0.656  1.00 2.18  ? 167 ALA B CB  1 
ATOM   3757  N N   . ARG B 1 168 ? 18.269  -13.769 0.862   1.00 2.34  ? 168 ARG B N   1 
ATOM   3758  C CA  . ARG B 1 168 ? 18.380  -14.831 1.913   1.00 2.39  ? 168 ARG B CA  1 
ATOM   3759  C C   . ARG B 1 168 ? 19.547  -14.453 2.839   1.00 2.53  ? 168 ARG B C   1 
ATOM   3760  O O   . ARG B 1 168 ? 19.523  -14.586 4.068   1.00 2.36  ? 168 ARG B O   1 
ATOM   3761  C CB  . ARG B 1 168 ? 18.535  -16.178 1.254   1.00 2.16  ? 168 ARG B CB  1 
ATOM   3762  C CG  . ARG B 1 168 ? 17.665  -17.308 1.765   1.00 2.15  ? 168 ARG B CG  1 
ATOM   3763  C CD  . ARG B 1 168 ? 18.109  -18.647 1.267   1.00 2.21  ? 168 ARG B CD  1 
ATOM   3764  N NE  . ARG B 1 168 ? 17.583  -19.012 -0.042  1.00 2.09  ? 168 ARG B NE  1 
ATOM   3765  C CZ  . ARG B 1 168 ? 16.291  -19.320 -0.217  1.00 2.00  ? 168 ARG B CZ  1 
ATOM   3766  N NH1 . ARG B 1 168 ? 15.494  -19.267 0.853   1.00 2.08  ? 168 ARG B NH1 1 
ATOM   3767  N NH2 . ARG B 1 168 ? 15.842  -19.768 -1.364  1.00 2.00  ? 168 ARG B NH2 1 
ATOM   3768  N N   . PHE B 1 169 ? 20.536  -13.888 2.166   1.00 2.59  ? 169 PHE B N   1 
ATOM   3769  C CA  . PHE B 1 169 ? 21.828  -13.411 2.652   1.00 2.54  ? 169 PHE B CA  1 
ATOM   3770  C C   . PHE B 1 169 ? 21.627  -12.172 3.515   1.00 2.65  ? 169 PHE B C   1 
ATOM   3771  O O   . PHE B 1 169 ? 21.822  -12.277 4.744   1.00 2.76  ? 169 PHE B O   1 
ATOM   3772  C CB  . PHE B 1 169 ? 22.775  -13.225 1.481   1.00 2.47  ? 169 PHE B CB  1 
ATOM   3773  C CG  . PHE B 1 169 ? 24.186  -12.797 1.600   1.00 2.46  ? 169 PHE B CG  1 
ATOM   3774  C CD1 . PHE B 1 169 ? 25.102  -13.442 2.432   1.00 2.38  ? 169 PHE B CD1 1 
ATOM   3775  C CD2 . PHE B 1 169 ? 24.667  -11.747 0.789   1.00 2.54  ? 169 PHE B CD2 1 
ATOM   3776  C CE1 . PHE B 1 169 ? 26.437  -13.078 2.465   1.00 2.33  ? 169 PHE B CE1 1 
ATOM   3777  C CE2 . PHE B 1 169 ? 26.014  -11.361 0.765   1.00 2.28  ? 169 PHE B CE2 1 
ATOM   3778  C CZ  . PHE B 1 169 ? 26.884  -12.037 1.636   1.00 2.43  ? 169 PHE B CZ  1 
ATOM   3779  N N   . ARG B 1 170 ? 21.223  -11.065 2.917   1.00 2.65  ? 170 ARG B N   1 
ATOM   3780  C CA  . ARG B 1 170 ? 20.945  -9.823  3.652   1.00 2.65  ? 170 ARG B CA  1 
ATOM   3781  C C   . ARG B 1 170 ? 20.187  -10.162 4.932   1.00 2.91  ? 170 ARG B C   1 
ATOM   3782  O O   . ARG B 1 170 ? 20.366  -9.509  5.950   1.00 2.94  ? 170 ARG B O   1 
ATOM   3783  C CB  . ARG B 1 170 ? 20.169  -8.779  2.875   1.00 2.47  ? 170 ARG B CB  1 
ATOM   3784  C CG  . ARG B 1 170 ? 20.956  -7.609  2.334   1.00 2.23  ? 170 ARG B CG  1 
ATOM   3785  C CD  . ARG B 1 170 ? 20.783  -7.331  0.921   1.00 2.04  ? 170 ARG B CD  1 
ATOM   3786  N NE  . ARG B 1 170 ? 19.881  -6.435  0.382   1.00 2.00  ? 170 ARG B NE  1 
ATOM   3787  C CZ  . ARG B 1 170 ? 19.410  -5.246  0.657   1.00 2.25  ? 170 ARG B CZ  1 
ATOM   3788  N NH1 . ARG B 1 170 ? 19.641  -4.439  1.694   1.00 2.08  ? 170 ARG B NH1 1 
ATOM   3789  N NH2 . ARG B 1 170 ? 18.719  -4.631  -0.333  1.00 2.70  ? 170 ARG B NH2 1 
ATOM   3790  N N   . TYR B 1 171 ? 19.339  -11.174 4.840   1.00 3.40  ? 171 TYR B N   1 
ATOM   3791  C CA  . TYR B 1 171 ? 18.597  -11.605 6.030   1.00 3.99  ? 171 TYR B CA  1 
ATOM   3792  C C   . TYR B 1 171 ? 19.649  -11.981 7.085   1.00 4.54  ? 171 TYR B C   1 
ATOM   3793  O O   . TYR B 1 171 ? 19.972  -11.140 7.932   1.00 4.73  ? 171 TYR B O   1 
ATOM   3794  C CB  . TYR B 1 171 ? 17.565  -12.708 5.804   1.00 3.97  ? 171 TYR B CB  1 
ATOM   3795  C CG  . TYR B 1 171 ? 17.143  -13.474 7.053   1.00 3.77  ? 171 TYR B CG  1 
ATOM   3796  C CD1 . TYR B 1 171 ? 17.415  -14.846 7.146   1.00 3.70  ? 171 TYR B CD1 1 
ATOM   3797  C CD2 . TYR B 1 171 ? 16.674  -12.817 8.186   1.00 3.54  ? 171 TYR B CD2 1 
ATOM   3798  C CE1 . TYR B 1 171 ? 17.077  -15.564 8.291   1.00 3.62  ? 171 TYR B CE1 1 
ATOM   3799  C CE2 . TYR B 1 171 ? 16.374  -13.517 9.345   1.00 3.45  ? 171 TYR B CE2 1 
ATOM   3800  C CZ  . TYR B 1 171 ? 16.561  -14.885 9.391   1.00 3.48  ? 171 TYR B CZ  1 
ATOM   3801  O OH  . TYR B 1 171 ? 16.239  -15.556 10.527  1.00 3.47  ? 171 TYR B OH  1 
ATOM   3802  N N   . LEU B 1 172 ? 20.111  -13.227 6.991   1.00 4.96  ? 172 LEU B N   1 
ATOM   3803  C CA  . LEU B 1 172 ? 21.060  -13.770 7.953   1.00 5.29  ? 172 LEU B CA  1 
ATOM   3804  C C   . LEU B 1 172 ? 22.042  -12.668 8.410   1.00 5.64  ? 172 LEU B C   1 
ATOM   3805  O O   . LEU B 1 172 ? 22.229  -12.431 9.595   1.00 5.77  ? 172 LEU B O   1 
ATOM   3806  C CB  . LEU B 1 172 ? 21.806  -14.958 7.360   1.00 5.10  ? 172 LEU B CB  1 
ATOM   3807  C CG  . LEU B 1 172 ? 21.215  -16.135 6.684   1.00 4.79  ? 172 LEU B CG  1 
ATOM   3808  C CD1 . LEU B 1 172 ? 22.299  -16.962 5.978   1.00 4.65  ? 172 LEU B CD1 1 
ATOM   3809  C CD2 . LEU B 1 172 ? 20.538  -17.055 7.696   1.00 4.79  ? 172 LEU B CD2 1 
ATOM   3810  N N   . ILE B 1 173 ? 22.669  -12.085 7.412   1.00 6.04  ? 173 ILE B N   1 
ATOM   3811  C CA  . ILE B 1 173 ? 23.700  -11.043 7.621   1.00 6.63  ? 173 ILE B CA  1 
ATOM   3812  C C   . ILE B 1 173 ? 23.226  -10.077 8.697   1.00 7.16  ? 173 ILE B C   1 
ATOM   3813  O O   . ILE B 1 173 ? 23.859  -9.915  9.783   1.00 7.27  ? 173 ILE B O   1 
ATOM   3814  C CB  . ILE B 1 173 ? 24.069  -10.489 6.215   1.00 6.49  ? 173 ILE B CB  1 
ATOM   3815  C CG1 . ILE B 1 173 ? 25.586  -10.189 6.071   1.00 6.36  ? 173 ILE B CG1 1 
ATOM   3816  C CG2 . ILE B 1 173 ? 23.232  -9.246  5.835   1.00 6.69  ? 173 ILE B CG2 1 
ATOM   3817  C CD1 . ILE B 1 173 ? 25.979  -9.754  4.620   1.00 6.26  ? 173 ILE B CD1 1 
ATOM   3818  N N   . GLY B 1 174 ? 22.039  -9.532  8.498   1.00 7.48  ? 174 GLY B N   1 
ATOM   3819  C CA  . GLY B 1 174 ? 21.391  -8.598  9.408   1.00 7.94  ? 174 GLY B CA  1 
ATOM   3820  C C   . GLY B 1 174 ? 20.958  -9.260  10.714  1.00 8.22  ? 174 GLY B C   1 
ATOM   3821  O O   . GLY B 1 174 ? 20.690  -8.549  11.708  1.00 8.12  ? 174 GLY B O   1 
ATOM   3822  N N   . GLU B 1 175 ? 20.842  -10.564 10.685  1.00 8.65  ? 175 GLU B N   1 
ATOM   3823  C CA  . GLU B 1 175 ? 20.421  -11.351 11.877  1.00 9.31  ? 175 GLU B CA  1 
ATOM   3824  C C   . GLU B 1 175 ? 21.496  -11.136 12.933  1.00 9.14  ? 175 GLU B C   1 
ATOM   3825  O O   . GLU B 1 175 ? 21.155  -11.147 14.130  1.00 9.29  ? 175 GLU B O   1 
ATOM   3826  C CB  . GLU B 1 175 ? 20.129  -12.807 11.586  1.00 9.86  ? 175 GLU B CB  1 
ATOM   3827  C CG  . GLU B 1 175 ? 19.704  -13.900 12.485  1.00 10.67 ? 175 GLU B CG  1 
ATOM   3828  C CD  . GLU B 1 175 ? 19.816  -15.371 12.212  1.00 11.40 ? 175 GLU B CD  1 
ATOM   3829  O OE1 . GLU B 1 175 ? 18.884  -16.218 12.169  1.00 11.48 ? 175 GLU B OE1 1 
ATOM   3830  O OE2 . GLU B 1 175 ? 20.995  -15.860 12.129  1.00 11.64 ? 175 GLU B OE2 1 
ATOM   3831  N N   . LYS B 1 176 ? 22.690  -10.713 12.533  1.00 8.87  ? 176 LYS B N   1 
ATOM   3832  C CA  . LYS B 1 176 ? 23.811  -10.590 13.489  1.00 8.80  ? 176 LYS B CA  1 
ATOM   3833  C C   . LYS B 1 176 ? 24.135  -9.206  14.005  1.00 8.49  ? 176 LYS B C   1 
ATOM   3834  O O   . LYS B 1 176 ? 24.593  -9.065  15.179  1.00 8.40  ? 176 LYS B O   1 
ATOM   3835  C CB  . LYS B 1 176 ? 25.077  -11.267 12.891  1.00 8.90  ? 176 LYS B CB  1 
ATOM   3836  C CG  . LYS B 1 176 ? 25.339  -12.642 13.464  1.00 9.03  ? 176 LYS B CG  1 
ATOM   3837  C CD  . LYS B 1 176 ? 25.572  -13.758 12.504  1.00 9.29  ? 176 LYS B CD  1 
ATOM   3838  C CE  . LYS B 1 176 ? 26.755  -13.645 11.572  1.00 9.40  ? 176 LYS B CE  1 
ATOM   3839  N NZ  . LYS B 1 176 ? 26.645  -14.614 10.434  1.00 9.22  ? 176 LYS B NZ  1 
ATOM   3840  N N   . LEU B 1 177 ? 23.997  -8.175  13.193  1.00 7.97  ? 177 LEU B N   1 
ATOM   3841  C CA  . LEU B 1 177 ? 24.268  -6.792  13.558  1.00 7.44  ? 177 LEU B CA  1 
ATOM   3842  C C   . LEU B 1 177 ? 23.092  -6.192  14.347  1.00 7.25  ? 177 LEU B C   1 
ATOM   3843  O O   . LEU B 1 177 ? 23.284  -5.342  15.251  1.00 7.21  ? 177 LEU B O   1 
ATOM   3844  C CB  . LEU B 1 177 ? 24.602  -6.010  12.292  1.00 7.26  ? 177 LEU B CB  1 
ATOM   3845  C CG  . LEU B 1 177 ? 25.588  -6.545  11.301  1.00 7.27  ? 177 LEU B CG  1 
ATOM   3846  C CD1 . LEU B 1 177 ? 25.589  -5.742  9.992   1.00 7.19  ? 177 LEU B CD1 1 
ATOM   3847  C CD2 . LEU B 1 177 ? 27.000  -6.485  11.897  1.00 7.25  ? 177 LEU B CD2 1 
ATOM   3848  N N   . GLY B 1 178 ? 21.907  -6.634  13.952  1.00 6.87  ? 178 GLY B N   1 
ATOM   3849  C CA  . GLY B 1 178 ? 20.637  -6.146  14.554  1.00 6.40  ? 178 GLY B CA  1 
ATOM   3850  C C   . GLY B 1 178 ? 20.244  -4.874  13.760  1.00 5.87  ? 178 GLY B C   1 
ATOM   3851  O O   . GLY B 1 178 ? 19.951  -3.834  14.333  1.00 5.73  ? 178 GLY B O   1 
ATOM   3852  N N   . VAL B 1 179 ? 20.247  -5.082  12.476  1.00 5.45  ? 179 VAL B N   1 
ATOM   3853  C CA  . VAL B 1 179 ? 20.034  -4.087  11.427  1.00 5.00  ? 179 VAL B CA  1 
ATOM   3854  C C   . VAL B 1 179 ? 19.251  -4.722  10.287  1.00 4.89  ? 179 VAL B C   1 
ATOM   3855  O O   . VAL B 1 179 ? 19.638  -5.831  9.855   1.00 4.99  ? 179 VAL B O   1 
ATOM   3856  C CB  . VAL B 1 179 ? 21.461  -3.640  10.997  1.00 4.78  ? 179 VAL B CB  1 
ATOM   3857  C CG1 . VAL B 1 179 ? 21.477  -2.935  9.659   1.00 4.80  ? 179 VAL B CG1 1 
ATOM   3858  C CG2 . VAL B 1 179 ? 22.154  -2.861  12.080  1.00 4.49  ? 179 VAL B CG2 1 
ATOM   3859  N N   . ASN B 1 180 ? 18.360  -4.016  9.705   1.00 4.91  ? 180 ASN B N   1 
ATOM   3860  C CA  . ASN B 1 180 ? 17.421  -4.487  8.635   1.00 5.15  ? 180 ASN B CA  1 
ATOM   3861  C C   . ASN B 1 180 ? 18.151  -4.822  7.360   1.00 5.29  ? 180 ASN B C   1 
ATOM   3862  O O   . ASN B 1 180 ? 19.117  -4.172  6.940   1.00 5.25  ? 180 ASN B O   1 
ATOM   3863  C CB  . ASN B 1 180 ? 16.330  -3.443  8.650   1.00 5.29  ? 180 ASN B CB  1 
ATOM   3864  C CG  . ASN B 1 180 ? 14.913  -3.817  8.432   1.00 5.41  ? 180 ASN B CG  1 
ATOM   3865  O OD1 . ASN B 1 180 ? 14.124  -3.015  7.863   1.00 5.80  ? 180 ASN B OD1 1 
ATOM   3866  N ND2 . ASN B 1 180 ? 14.486  -4.991  8.858   1.00 5.44  ? 180 ASN B ND2 1 
ATOM   3867  N N   . PRO B 1 181 ? 17.693  -5.898  6.715   1.00 5.77  ? 181 PRO B N   1 
ATOM   3868  C CA  . PRO B 1 181 ? 18.327  -6.498  5.542   1.00 6.15  ? 181 PRO B CA  1 
ATOM   3869  C C   . PRO B 1 181 ? 18.248  -5.630  4.310   1.00 6.37  ? 181 PRO B C   1 
ATOM   3870  O O   . PRO B 1 181 ? 18.357  -6.116  3.172   1.00 6.68  ? 181 PRO B O   1 
ATOM   3871  C CB  . PRO B 1 181 ? 17.449  -7.764  5.276   1.00 6.06  ? 181 PRO B CB  1 
ATOM   3872  C CG  . PRO B 1 181 ? 16.066  -7.119  5.440   1.00 6.10  ? 181 PRO B CG  1 
ATOM   3873  C CD  . PRO B 1 181 ? 16.246  -6.288  6.724   1.00 6.09  ? 181 PRO B CD  1 
ATOM   3874  N N   . THR B 1 182 ? 17.663  -4.498  4.551   1.00 6.51  ? 182 THR B N   1 
ATOM   3875  C CA  . THR B 1 182 ? 17.408  -3.437  3.600   1.00 6.44  ? 182 THR B CA  1 
ATOM   3876  C C   . THR B 1 182 ? 18.555  -2.417  3.783   1.00 6.31  ? 182 THR B C   1 
ATOM   3877  O O   . THR B 1 182 ? 18.915  -1.717  2.881   1.00 6.26  ? 182 THR B O   1 
ATOM   3878  C CB  . THR B 1 182 ? 16.043  -2.711  3.922   1.00 6.44  ? 182 THR B CB  1 
ATOM   3879  O OG1 . THR B 1 182 ? 16.315  -1.270  3.711   1.00 6.59  ? 182 THR B OG1 1 
ATOM   3880  C CG2 . THR B 1 182 ? 15.503  -2.966  5.324   1.00 6.18  ? 182 THR B CG2 1 
ATOM   3881  N N   . SER B 1 183 ? 18.894  -2.359  5.046   1.00 6.37  ? 183 SER B N   1 
ATOM   3882  C CA  . SER B 1 183 ? 19.860  -1.516  5.665   1.00 6.67  ? 183 SER B CA  1 
ATOM   3883  C C   . SER B 1 183 ? 21.230  -2.146  5.796   1.00 6.98  ? 183 SER B C   1 
ATOM   3884  O O   . SER B 1 183 ? 22.095  -1.497  6.411   1.00 7.23  ? 183 SER B O   1 
ATOM   3885  C CB  . SER B 1 183 ? 19.334  -1.045  7.032   1.00 6.70  ? 183 SER B CB  1 
ATOM   3886  O OG  . SER B 1 183 ? 19.751  0.307   7.223   1.00 7.04  ? 183 SER B OG  1 
ATOM   3887  N N   . CYS B 1 184 ? 21.410  -3.365  5.384   1.00 7.33  ? 184 CYS B N   1 
ATOM   3888  C CA  . CYS B 1 184 ? 22.715  -4.034  5.281   1.00 7.63  ? 184 CYS B CA  1 
ATOM   3889  C C   . CYS B 1 184 ? 22.773  -4.362  3.774   1.00 8.01  ? 184 CYS B C   1 
ATOM   3890  O O   . CYS B 1 184 ? 21.666  -4.567  3.229   1.00 8.17  ? 184 CYS B O   1 
ATOM   3891  C CB  . CYS B 1 184 ? 22.892  -5.315  6.004   1.00 7.77  ? 184 CYS B CB  1 
ATOM   3892  S SG  . CYS B 1 184 ? 22.229  -5.494  7.656   1.00 8.65  ? 184 CYS B SG  1 
ATOM   3893  N N   . HIS B 1 185 ? 23.933  -4.408  3.209   1.00 8.41  ? 185 HIS B N   1 
ATOM   3894  C CA  . HIS B 1 185 ? 23.987  -4.716  1.741   1.00 8.82  ? 185 HIS B CA  1 
ATOM   3895  C C   . HIS B 1 185 ? 25.108  -5.722  1.564   1.00 9.32  ? 185 HIS B C   1 
ATOM   3896  O O   . HIS B 1 185 ? 26.068  -5.685  2.357   1.00 9.34  ? 185 HIS B O   1 
ATOM   3897  C CB  . HIS B 1 185 ? 24.150  -3.466  0.892   1.00 8.82  ? 185 HIS B CB  1 
ATOM   3898  C CG  . HIS B 1 185 ? 23.248  -2.348  1.330   1.00 8.81  ? 185 HIS B CG  1 
ATOM   3899  N ND1 . HIS B 1 185 ? 22.230  -1.833  0.581   1.00 8.87  ? 185 HIS B ND1 1 
ATOM   3900  C CD2 . HIS B 1 185 ? 23.202  -1.680  2.514   1.00 8.78  ? 185 HIS B CD2 1 
ATOM   3901  C CE1 . HIS B 1 185 ? 21.600  -0.891  1.283   1.00 8.82  ? 185 HIS B CE1 1 
ATOM   3902  N NE2 . HIS B 1 185 ? 22.150  -0.816  2.469   1.00 8.70  ? 185 HIS B NE2 1 
ATOM   3903  N N   . GLY B 1 186 ? 24.916  -6.616  0.630   1.00 9.80  ? 186 GLY B N   1 
ATOM   3904  C CA  . GLY B 1 186 ? 25.853  -7.712  0.303   1.00 10.33 ? 186 GLY B CA  1 
ATOM   3905  C C   . GLY B 1 186 ? 25.309  -8.369  -0.969  1.00 10.79 ? 186 GLY B C   1 
ATOM   3906  O O   . GLY B 1 186 ? 24.066  -8.362  -1.149  1.00 11.24 ? 186 GLY B O   1 
ATOM   3907  N N   . TRP B 1 187 ? 26.164  -8.966  -1.751  1.00 10.94 ? 187 TRP B N   1 
ATOM   3908  C CA  . TRP B 1 187 ? 25.753  -9.528  -3.068  1.00 11.04 ? 187 TRP B CA  1 
ATOM   3909  C C   . TRP B 1 187 ? 26.256  -10.954 -3.127  1.00 10.80 ? 187 TRP B C   1 
ATOM   3910  O O   . TRP B 1 187 ? 27.328  -11.242 -2.532  1.00 10.99 ? 187 TRP B O   1 
ATOM   3911  C CB  . TRP B 1 187 ? 26.277  -8.577  -4.140  1.00 11.75 ? 187 TRP B CB  1 
ATOM   3912  C CG  . TRP B 1 187 ? 25.316  -7.999  -5.106  1.00 12.70 ? 187 TRP B CG  1 
ATOM   3913  C CD1 . TRP B 1 187 ? 24.993  -8.446  -6.366  1.00 12.97 ? 187 TRP B CD1 1 
ATOM   3914  C CD2 . TRP B 1 187 ? 24.503  -6.815  -4.928  1.00 12.97 ? 187 TRP B CD2 1 
ATOM   3915  N NE1 . TRP B 1 187 ? 24.026  -7.670  -6.958  1.00 13.05 ? 187 TRP B NE1 1 
ATOM   3916  C CE2 . TRP B 1 187 ? 23.697  -6.671  -6.082  1.00 13.06 ? 187 TRP B CE2 1 
ATOM   3917  C CE3 . TRP B 1 187 ? 24.332  -5.940  -3.863  1.00 13.04 ? 187 TRP B CE3 1 
ATOM   3918  C CZ2 . TRP B 1 187 ? 22.750  -5.664  -6.209  1.00 13.05 ? 187 TRP B CZ2 1 
ATOM   3919  C CZ3 . TRP B 1 187 ? 23.392  -4.939  -3.998  1.00 13.09 ? 187 TRP B CZ3 1 
ATOM   3920  C CH2 . TRP B 1 187 ? 22.624  -4.799  -5.148  1.00 13.06 ? 187 TRP B CH2 1 
ATOM   3921  N N   . VAL B 1 188 ? 25.452  -11.895 -3.579  1.00 10.27 ? 188 VAL B N   1 
ATOM   3922  C CA  . VAL B 1 188 ? 25.887  -13.286 -3.763  1.00 9.89  ? 188 VAL B CA  1 
ATOM   3923  C C   . VAL B 1 188 ? 25.571  -13.590 -5.232  1.00 9.84  ? 188 VAL B C   1 
ATOM   3924  O O   . VAL B 1 188 ? 24.387  -13.380 -5.571  1.00 10.11 ? 188 VAL B O   1 
ATOM   3925  C CB  . VAL B 1 188 ? 25.249  -14.285 -2.814  1.00 9.82  ? 188 VAL B CB  1 
ATOM   3926  C CG1 . VAL B 1 188 ? 25.858  -15.707 -2.998  1.00 9.73  ? 188 VAL B CG1 1 
ATOM   3927  C CG2 . VAL B 1 188 ? 25.293  -13.936 -1.352  1.00 9.63  ? 188 VAL B CG2 1 
ATOM   3928  N N   . LEU B 1 189 ? 26.559  -13.961 -6.009  1.00 9.59  ? 189 LEU B N   1 
ATOM   3929  C CA  . LEU B 1 189 ? 26.259  -14.286 -7.415  1.00 9.56  ? 189 LEU B CA  1 
ATOM   3930  C C   . LEU B 1 189 ? 26.954  -15.583 -7.835  1.00 9.66  ? 189 LEU B C   1 
ATOM   3931  O O   . LEU B 1 189 ? 27.392  -16.393 -7.014  1.00 9.66  ? 189 LEU B O   1 
ATOM   3932  C CB  . LEU B 1 189 ? 26.430  -13.102 -8.314  1.00 9.58  ? 189 LEU B CB  1 
ATOM   3933  C CG  . LEU B 1 189 ? 27.215  -11.853 -7.994  1.00 9.57  ? 189 LEU B CG  1 
ATOM   3934  C CD1 . LEU B 1 189 ? 26.493  -11.039 -6.927  1.00 9.29  ? 189 LEU B CD1 1 
ATOM   3935  C CD2 . LEU B 1 189 ? 28.625  -12.232 -7.550  1.00 9.42  ? 189 LEU B CD2 1 
ATOM   3936  N N   . GLY B 1 190 ? 27.024  -15.720 -9.157  1.00 9.66  ? 190 GLY B N   1 
ATOM   3937  C CA  . GLY B 1 190 ? 27.481  -17.006 -9.720  1.00 9.79  ? 190 GLY B CA  1 
ATOM   3938  C C   . GLY B 1 190 ? 26.171  -17.813 -9.941  1.00 9.87  ? 190 GLY B C   1 
ATOM   3939  O O   . GLY B 1 190 ? 25.274  -17.333 -10.641 1.00 9.78  ? 190 GLY B O   1 
ATOM   3940  N N   . GLU B 1 191 ? 26.121  -18.949 -9.294  1.00 10.02 ? 191 GLU B N   1 
ATOM   3941  C CA  . GLU B 1 191 ? 25.006  -19.889 -9.390  1.00 10.11 ? 191 GLU B CA  1 
ATOM   3942  C C   . GLU B 1 191 ? 23.987  -19.750 -8.265  1.00 9.91  ? 191 GLU B C   1 
ATOM   3943  O O   . GLU B 1 191 ? 24.240  -19.275 -7.166  1.00 9.84  ? 191 GLU B O   1 
ATOM   3944  C CB  . GLU B 1 191 ? 25.513  -21.338 -9.399  1.00 10.40 ? 191 GLU B CB  1 
ATOM   3945  C CG  . GLU B 1 191 ? 24.525  -22.430 -8.984  1.00 10.73 ? 191 GLU B CG  1 
ATOM   3946  C CD  . GLU B 1 191 ? 24.857  -23.843 -9.328  1.00 10.84 ? 191 GLU B CD  1 
ATOM   3947  O OE1 . GLU B 1 191 ? 24.718  -24.320 -10.442 1.00 10.83 ? 191 GLU B OE1 1 
ATOM   3948  O OE2 . GLU B 1 191 ? 25.273  -24.427 -8.301  1.00 11.02 ? 191 GLU B OE2 1 
ATOM   3949  N N   . HIS B 1 192 ? 22.789  -20.187 -8.603  1.00 9.78  ? 192 HIS B N   1 
ATOM   3950  C CA  . HIS B 1 192 ? 21.620  -20.235 -7.721  1.00 9.77  ? 192 HIS B CA  1 
ATOM   3951  C C   . HIS B 1 192 ? 21.532  -21.701 -7.264  1.00 9.66  ? 192 HIS B C   1 
ATOM   3952  O O   . HIS B 1 192 ? 20.873  -22.534 -7.898  1.00 9.50  ? 192 HIS B O   1 
ATOM   3953  C CB  . HIS B 1 192 ? 20.285  -19.776 -8.346  1.00 9.83  ? 192 HIS B CB  1 
ATOM   3954  C CG  . HIS B 1 192 ? 19.141  -20.032 -7.419  1.00 9.98  ? 192 HIS B CG  1 
ATOM   3955  N ND1 . HIS B 1 192 ? 18.987  -19.377 -6.234  1.00 10.15 ? 192 HIS B ND1 1 
ATOM   3956  C CD2 . HIS B 1 192 ? 18.191  -20.999 -7.438  1.00 10.21 ? 192 HIS B CD2 1 
ATOM   3957  C CE1 . HIS B 1 192 ? 17.973  -19.912 -5.567  1.00 10.25 ? 192 HIS B CE1 1 
ATOM   3958  N NE2 . HIS B 1 192 ? 17.444  -20.883 -6.287  1.00 10.28 ? 192 HIS B NE2 1 
ATOM   3959  N N   . GLY B 1 193 ? 22.268  -21.933 -6.188  1.00 9.70  ? 193 GLY B N   1 
ATOM   3960  C CA  . GLY B 1 193 ? 22.432  -23.314 -5.688  1.00 9.79  ? 193 GLY B CA  1 
ATOM   3961  C C   . GLY B 1 193 ? 23.675  -23.446 -4.834  1.00 9.62  ? 193 GLY B C   1 
ATOM   3962  O O   . GLY B 1 193 ? 23.638  -22.799 -3.765  1.00 9.61  ? 193 GLY B O   1 
ATOM   3963  N N   . ASP B 1 194 ? 24.716  -24.139 -5.300  1.00 9.54  ? 194 ASP B N   1 
ATOM   3964  C CA  . ASP B 1 194 ? 25.847  -24.371 -4.363  1.00 9.66  ? 194 ASP B CA  1 
ATOM   3965  C C   . ASP B 1 194 ? 27.156  -23.777 -4.851  1.00 9.26  ? 194 ASP B C   1 
ATOM   3966  O O   . ASP B 1 194 ? 28.184  -24.105 -4.229  1.00 9.39  ? 194 ASP B O   1 
ATOM   3967  C CB  . ASP B 1 194 ? 26.090  -25.850 -4.016  1.00 10.07 ? 194 ASP B CB  1 
ATOM   3968  C CG  . ASP B 1 194 ? 24.842  -26.646 -3.744  1.00 10.63 ? 194 ASP B CG  1 
ATOM   3969  O OD1 . ASP B 1 194 ? 24.334  -26.681 -2.613  1.00 10.73 ? 194 ASP B OD1 1 
ATOM   3970  O OD2 . ASP B 1 194 ? 24.336  -27.221 -4.759  1.00 11.09 ? 194 ASP B OD2 1 
ATOM   3971  N N   . SER B 1 195 ? 27.105  -23.094 -5.934  1.00 8.85  ? 195 SER B N   1 
ATOM   3972  C CA  . SER B 1 195 ? 28.339  -22.523 -6.553  1.00 8.35  ? 195 SER B CA  1 
ATOM   3973  C C   . SER B 1 195 ? 28.291  -21.032 -6.267  1.00 8.04  ? 195 SER B C   1 
ATOM   3974  O O   . SER B 1 195 ? 28.732  -20.210 -7.068  1.00 8.03  ? 195 SER B O   1 
ATOM   3975  C CB  . SER B 1 195 ? 28.277  -22.840 -8.038  1.00 8.20  ? 195 SER B CB  1 
ATOM   3976  O OG  . SER B 1 195 ? 27.981  -24.206 -8.262  1.00 7.97  ? 195 SER B OG  1 
ATOM   3977  N N   . SER B 1 196 ? 27.654  -20.749 -5.124  1.00 7.66  ? 196 SER B N   1 
ATOM   3978  C CA  . SER B 1 196 ? 27.308  -19.336 -4.825  1.00 7.03  ? 196 SER B CA  1 
ATOM   3979  C C   . SER B 1 196 ? 28.489  -18.629 -4.187  1.00 6.52  ? 196 SER B C   1 
ATOM   3980  O O   . SER B 1 196 ? 28.926  -18.984 -3.109  1.00 6.38  ? 196 SER B O   1 
ATOM   3981  C CB  . SER B 1 196 ? 26.065  -19.177 -3.988  1.00 6.94  ? 196 SER B CB  1 
ATOM   3982  O OG  . SER B 1 196 ? 24.942  -19.610 -4.740  1.00 7.12  ? 196 SER B OG  1 
ATOM   3983  N N   . VAL B 1 197 ? 29.081  -17.808 -5.049  1.00 5.87  ? 197 VAL B N   1 
ATOM   3984  C CA  . VAL B 1 197 ? 30.146  -16.935 -4.509  1.00 5.27  ? 197 VAL B CA  1 
ATOM   3985  C C   . VAL B 1 197 ? 29.353  -15.697 -4.085  1.00 4.94  ? 197 VAL B C   1 
ATOM   3986  O O   . VAL B 1 197 ? 28.778  -14.988 -4.919  1.00 4.85  ? 197 VAL B O   1 
ATOM   3987  C CB  . VAL B 1 197 ? 31.282  -16.733 -5.476  1.00 5.20  ? 197 VAL B CB  1 
ATOM   3988  C CG1 . VAL B 1 197 ? 30.862  -16.274 -6.867  1.00 5.33  ? 197 VAL B CG1 1 
ATOM   3989  C CG2 . VAL B 1 197 ? 32.286  -15.727 -4.894  1.00 5.26  ? 197 VAL B CG2 1 
ATOM   3990  N N   . PRO B 1 198 ? 29.291  -15.517 -2.770  1.00 4.70  ? 198 PRO B N   1 
ATOM   3991  C CA  . PRO B 1 198 ? 28.779  -14.203 -2.255  1.00 4.66  ? 198 PRO B CA  1 
ATOM   3992  C C   . PRO B 1 198 ? 29.777  -13.206 -2.802  1.00 4.80  ? 198 PRO B C   1 
ATOM   3993  O O   . PRO B 1 198 ? 30.677  -13.686 -3.568  1.00 5.13  ? 198 PRO B O   1 
ATOM   3994  C CB  . PRO B 1 198 ? 28.901  -14.393 -0.761  1.00 4.56  ? 198 PRO B CB  1 
ATOM   3995  C CG  . PRO B 1 198 ? 30.153  -15.232 -0.583  1.00 4.26  ? 198 PRO B CG  1 
ATOM   3996  C CD  . PRO B 1 198 ? 30.058  -16.226 -1.740  1.00 4.48  ? 198 PRO B CD  1 
ATOM   3997  N N   . ILE B 1 199 ? 29.784  -11.951 -2.463  1.00 4.65  ? 199 ILE B N   1 
ATOM   3998  C CA  . ILE B 1 199 ? 30.950  -11.128 -2.949  1.00 4.62  ? 199 ILE B CA  1 
ATOM   3999  C C   . ILE B 1 199 ? 31.239  -10.083 -1.878  1.00 4.52  ? 199 ILE B C   1 
ATOM   4000  O O   . ILE B 1 199 ? 30.868  -8.912  -1.975  1.00 4.51  ? 199 ILE B O   1 
ATOM   4001  C CB  . ILE B 1 199 ? 30.836  -10.717 -4.417  1.00 4.74  ? 199 ILE B CB  1 
ATOM   4002  C CG1 . ILE B 1 199 ? 29.482  -10.065 -4.784  1.00 4.87  ? 199 ILE B CG1 1 
ATOM   4003  C CG2 . ILE B 1 199 ? 31.093  -11.867 -5.480  1.00 4.66  ? 199 ILE B CG2 1 
ATOM   4004  C CD1 . ILE B 1 199 ? 29.552  -9.453  -6.248  1.00 5.17  ? 199 ILE B CD1 1 
ATOM   4005  N N   . TRP B 1 200 ? 31.874  -10.612 -0.822  1.00 4.24  ? 200 TRP B N   1 
ATOM   4006  C CA  . TRP B 1 200 ? 32.301  -9.868  0.347   1.00 3.97  ? 200 TRP B CA  1 
ATOM   4007  C C   . TRP B 1 200 ? 33.021  -8.569  -0.035  1.00 3.77  ? 200 TRP B C   1 
ATOM   4008  O O   . TRP B 1 200 ? 32.794  -7.543  0.640   1.00 3.78  ? 200 TRP B O   1 
ATOM   4009  C CB  . TRP B 1 200 ? 33.185  -10.671 1.296   1.00 4.00  ? 200 TRP B CB  1 
ATOM   4010  C CG  . TRP B 1 200 ? 32.677  -11.915 1.904   1.00 4.07  ? 200 TRP B CG  1 
ATOM   4011  C CD1 . TRP B 1 200 ? 33.020  -13.186 1.549   1.00 4.15  ? 200 TRP B CD1 1 
ATOM   4012  C CD2 . TRP B 1 200 ? 31.750  -12.068 2.989   1.00 4.16  ? 200 TRP B CD2 1 
ATOM   4013  N NE1 . TRP B 1 200 ? 32.304  -14.108 2.285   1.00 4.21  ? 200 TRP B NE1 1 
ATOM   4014  C CE2 . TRP B 1 200 ? 31.548  -13.449 3.192   1.00 4.12  ? 200 TRP B CE2 1 
ATOM   4015  C CE3 . TRP B 1 200 ? 31.049  -11.156 3.782   1.00 4.27  ? 200 TRP B CE3 1 
ATOM   4016  C CZ2 . TRP B 1 200 ? 30.699  -13.949 4.167   1.00 4.09  ? 200 TRP B CZ2 1 
ATOM   4017  C CZ3 . TRP B 1 200 ? 30.156  -11.654 4.707   1.00 4.17  ? 200 TRP B CZ3 1 
ATOM   4018  C CH2 . TRP B 1 200 ? 30.027  -13.019 4.941   1.00 4.14  ? 200 TRP B CH2 1 
ATOM   4019  N N   . SER B 1 201 ? 33.851  -8.592  -1.054  1.00 3.48  ? 201 SER B N   1 
ATOM   4020  C CA  . SER B 1 201 ? 34.594  -7.384  -1.467  1.00 3.20  ? 201 SER B CA  1 
ATOM   4021  C C   . SER B 1 201 ? 33.718  -6.154  -1.225  1.00 3.37  ? 201 SER B C   1 
ATOM   4022  O O   . SER B 1 201 ? 34.202  -5.192  -0.600  1.00 3.57  ? 201 SER B O   1 
ATOM   4023  C CB  . SER B 1 201 ? 35.106  -7.446  -2.871  1.00 2.97  ? 201 SER B CB  1 
ATOM   4024  O OG  . SER B 1 201 ? 34.383  -6.738  -3.822  1.00 2.72  ? 201 SER B OG  1 
ATOM   4025  N N   . GLY B 1 202 ? 32.430  -6.255  -1.539  1.00 3.41  ? 202 GLY B N   1 
ATOM   4026  C CA  . GLY B 1 202 ? 31.483  -5.186  -1.415  1.00 3.59  ? 202 GLY B CA  1 
ATOM   4027  C C   . GLY B 1 202 ? 30.313  -5.316  -0.501  1.00 3.84  ? 202 GLY B C   1 
ATOM   4028  O O   . GLY B 1 202 ? 29.169  -5.228  -0.996  1.00 3.71  ? 202 GLY B O   1 
ATOM   4029  N N   . VAL B 1 203 ? 30.502  -5.210  0.798   1.00 4.41  ? 203 VAL B N   1 
ATOM   4030  C CA  . VAL B 1 203 ? 29.435  -5.444  1.797   1.00 5.08  ? 203 VAL B CA  1 
ATOM   4031  C C   . VAL B 1 203 ? 29.314  -4.363  2.846   1.00 5.87  ? 203 VAL B C   1 
ATOM   4032  O O   . VAL B 1 203 ? 29.928  -4.435  3.940   1.00 6.11  ? 203 VAL B O   1 
ATOM   4033  C CB  . VAL B 1 203 ? 29.695  -6.875  2.377   1.00 4.78  ? 203 VAL B CB  1 
ATOM   4034  C CG1 . VAL B 1 203 ? 29.061  -7.200  3.693   1.00 4.53  ? 203 VAL B CG1 1 
ATOM   4035  C CG2 . VAL B 1 203 ? 29.308  -7.922  1.320   1.00 4.74  ? 203 VAL B CG2 1 
ATOM   4036  N N   . ASN B 1 204 ? 28.392  -3.437  2.638   1.00 6.50  ? 204 ASN B N   1 
ATOM   4037  C CA  . ASN B 1 204 ? 28.084  -2.310  3.481   1.00 6.99  ? 204 ASN B CA  1 
ATOM   4038  C C   . ASN B 1 204 ? 27.158  -2.678  4.670   1.00 7.42  ? 204 ASN B C   1 
ATOM   4039  O O   . ASN B 1 204 ? 26.630  -3.754  4.765   1.00 7.48  ? 204 ASN B O   1 
ATOM   4040  C CB  . ASN B 1 204 ? 27.335  -1.204  2.757   1.00 7.04  ? 204 ASN B CB  1 
ATOM   4041  C CG  . ASN B 1 204 ? 27.602  -0.963  1.330   1.00 7.27  ? 204 ASN B CG  1 
ATOM   4042  O OD1 . ASN B 1 204 ? 27.526  0.225   0.926   1.00 7.48  ? 204 ASN B OD1 1 
ATOM   4043  N ND2 . ASN B 1 204 ? 27.784  -2.005  0.525   1.00 7.40  ? 204 ASN B ND2 1 
ATOM   4044  N N   . VAL B 1 205 ? 26.820  -1.663  5.370   1.00 8.17  ? 205 VAL B N   1 
ATOM   4045  C CA  . VAL B 1 205 ? 26.003  -1.313  6.457   1.00 9.13  ? 205 VAL B CA  1 
ATOM   4046  C C   . VAL B 1 205 ? 26.271  0.216   6.729   1.00 10.04 ? 205 VAL B C   1 
ATOM   4047  O O   . VAL B 1 205 ? 26.572  0.649   7.823   1.00 10.08 ? 205 VAL B O   1 
ATOM   4048  C CB  . VAL B 1 205 ? 26.169  -2.090  7.754   1.00 9.01  ? 205 VAL B CB  1 
ATOM   4049  C CG1 . VAL B 1 205 ? 25.106  -1.639  8.786   1.00 8.99  ? 205 VAL B CG1 1 
ATOM   4050  C CG2 . VAL B 1 205 ? 26.143  -3.585  7.628   1.00 9.07  ? 205 VAL B CG2 1 
ATOM   4051  N N   . ALA B 1 206 ? 26.301  0.931   5.650   1.00 11.19 ? 206 ALA B N   1 
ATOM   4052  C CA  . ALA B 1 206 ? 26.530  2.346   5.437   1.00 12.00 ? 206 ALA B CA  1 
ATOM   4053  C C   . ALA B 1 206 ? 27.022  2.563   3.993   1.00 12.73 ? 206 ALA B C   1 
ATOM   4054  O O   . ALA B 1 206 ? 26.159  2.584   3.056   1.00 12.84 ? 206 ALA B O   1 
ATOM   4055  C CB  . ALA B 1 206 ? 27.420  2.982   6.469   1.00 11.86 ? 206 ALA B CB  1 
ATOM   4056  N N   . GLY B 1 207 ? 28.321  2.591   3.775   1.00 13.50 ? 207 GLY B N   1 
ATOM   4057  C CA  . GLY B 1 207 ? 28.828  2.840   2.423   1.00 14.75 ? 207 GLY B CA  1 
ATOM   4058  C C   . GLY B 1 207 ? 30.097  2.100   2.071   1.00 15.64 ? 207 GLY B C   1 
ATOM   4059  O O   . GLY B 1 207 ? 30.797  1.546   2.918   1.00 15.46 ? 207 GLY B O   1 
ATOM   4060  N N   . VAL B 1 208 ? 30.385  2.133   0.771   1.00 16.71 ? 208 VAL B N   1 
ATOM   4061  C CA  . VAL B 1 208 ? 31.562  1.499   0.189   1.00 17.98 ? 208 VAL B CA  1 
ATOM   4062  C C   . VAL B 1 208 ? 32.794  2.406   0.419   1.00 18.66 ? 208 VAL B C   1 
ATOM   4063  O O   . VAL B 1 208 ? 32.888  3.524   -0.124  1.00 18.81 ? 208 VAL B O   1 
ATOM   4064  C CB  . VAL B 1 208 ? 31.436  1.180   -1.311  1.00 18.24 ? 208 VAL B CB  1 
ATOM   4065  C CG1 . VAL B 1 208 ? 32.532  0.178   -1.744  1.00 18.25 ? 208 VAL B CG1 1 
ATOM   4066  C CG2 . VAL B 1 208 ? 30.052  0.752   -1.757  1.00 18.30 ? 208 VAL B CG2 1 
ATOM   4067  N N   . THR B 1 209 ? 33.771  1.784   1.039   1.00 19.31 ? 209 THR B N   1 
ATOM   4068  C CA  . THR B 1 209 ? 34.976  2.499   1.504   1.00 19.97 ? 209 THR B CA  1 
ATOM   4069  C C   . THR B 1 209 ? 34.537  3.043   2.873   1.00 20.51 ? 209 THR B C   1 
ATOM   4070  O O   . THR B 1 209 ? 35.290  2.949   3.844   1.00 20.75 ? 209 THR B O   1 
ATOM   4071  C CB  . THR B 1 209 ? 35.577  3.563   0.561   1.00 19.96 ? 209 THR B CB  1 
ATOM   4072  O OG1 . THR B 1 209 ? 36.011  2.831   -0.640  1.00 20.09 ? 209 THR B OG1 1 
ATOM   4073  C CG2 . THR B 1 209 ? 36.744  4.376   1.168   1.00 19.99 ? 209 THR B CG2 1 
ATOM   4074  N N   . LEU B 1 210 ? 33.280  3.477   2.880   1.00 20.96 ? 210 LEU B N   1 
ATOM   4075  C CA  . LEU B 1 210 ? 32.609  3.887   4.136   1.00 21.36 ? 210 LEU B CA  1 
ATOM   4076  C C   . LEU B 1 210 ? 32.494  2.548   4.890   1.00 21.68 ? 210 LEU B C   1 
ATOM   4077  O O   . LEU B 1 210 ? 33.499  1.784   4.939   1.00 21.60 ? 210 LEU B O   1 
ATOM   4078  C CB  . LEU B 1 210 ? 31.326  4.612   3.827   1.00 21.33 ? 210 LEU B CB  1 
ATOM   4079  C CG  . LEU B 1 210 ? 30.585  5.539   4.749   1.00 21.26 ? 210 LEU B CG  1 
ATOM   4080  C CD1 . LEU B 1 210 ? 29.111  5.690   4.331   1.00 21.12 ? 210 LEU B CD1 1 
ATOM   4081  C CD2 . LEU B 1 210 ? 30.602  5.062   6.196   1.00 21.25 ? 210 LEU B CD2 1 
ATOM   4082  N N   . LYS B 1 211 ? 31.277  2.221   5.319   1.00 22.04 ? 211 LYS B N   1 
ATOM   4083  C CA  . LYS B 1 211 ? 31.147  0.956   6.070   1.00 22.39 ? 211 LYS B CA  1 
ATOM   4084  C C   . LYS B 1 211 ? 31.011  -0.189  5.078   1.00 22.75 ? 211 LYS B C   1 
ATOM   4085  O O   . LYS B 1 211 ? 29.972  -0.471  4.511   1.00 23.00 ? 211 LYS B O   1 
ATOM   4086  C CB  . LYS B 1 211 ? 30.123  0.959   7.153   1.00 22.40 ? 211 LYS B CB  1 
ATOM   4087  C CG  . LYS B 1 211 ? 30.744  1.655   8.402   1.00 22.51 ? 211 LYS B CG  1 
ATOM   4088  C CD  . LYS B 1 211 ? 30.121  1.047   9.664   1.00 22.63 ? 211 LYS B CD  1 
ATOM   4089  C CE  . LYS B 1 211 ? 31.078  1.224   10.834  1.00 22.64 ? 211 LYS B CE  1 
ATOM   4090  N NZ  . LYS B 1 211 ? 32.361  0.506   10.560  1.00 22.48 ? 211 LYS B NZ  1 
ATOM   4091  N N   . SER B 1 212 ? 32.197  -0.617  4.729   1.00 23.04 ? 212 SER B N   1 
ATOM   4092  C CA  . SER B 1 212 ? 32.465  -1.847  3.914   1.00 23.20 ? 212 SER B CA  1 
ATOM   4093  C C   . SER B 1 212 ? 32.702  -2.872  5.011   1.00 23.74 ? 212 SER B C   1 
ATOM   4094  O O   . SER B 1 212 ? 33.250  -2.391  6.062   1.00 24.01 ? 212 SER B O   1 
ATOM   4095  C CB  . SER B 1 212 ? 33.606  -1.507  3.021   1.00 22.78 ? 212 SER B CB  1 
ATOM   4096  O OG  . SER B 1 212 ? 34.274  -2.528  2.402   1.00 22.55 ? 212 SER B OG  1 
ATOM   4097  N N   . LEU B 1 213 ? 32.222  -4.097  4.982   1.00 24.10 ? 213 LEU B N   1 
ATOM   4098  C CA  . LEU B 1 213 ? 32.463  -4.976  6.166   1.00 24.49 ? 213 LEU B CA  1 
ATOM   4099  C C   . LEU B 1 213 ? 33.931  -5.366  6.251   1.00 24.83 ? 213 LEU B C   1 
ATOM   4100  O O   . LEU B 1 213 ? 34.412  -5.866  7.293   1.00 24.88 ? 213 LEU B O   1 
ATOM   4101  C CB  . LEU B 1 213 ? 31.452  -6.105  6.188   1.00 24.42 ? 213 LEU B CB  1 
ATOM   4102  C CG  . LEU B 1 213 ? 30.256  -6.027  7.120   1.00 24.29 ? 213 LEU B CG  1 
ATOM   4103  C CD1 . LEU B 1 213 ? 30.681  -6.066  8.578   1.00 24.11 ? 213 LEU B CD1 1 
ATOM   4104  C CD2 . LEU B 1 213 ? 29.490  -4.728  6.841   1.00 24.41 ? 213 LEU B CD2 1 
ATOM   4105  N N   . ASN B 1 214 ? 34.638  -5.031  5.208   1.00 25.25 ? 214 ASN B N   1 
ATOM   4106  C CA  . ASN B 1 214 ? 36.055  -5.354  4.989   1.00 25.71 ? 214 ASN B CA  1 
ATOM   4107  C C   . ASN B 1 214 ? 37.036  -4.620  5.890   1.00 26.03 ? 214 ASN B C   1 
ATOM   4108  O O   . ASN B 1 214 ? 37.950  -5.251  6.456   1.00 26.02 ? 214 ASN B O   1 
ATOM   4109  C CB  . ASN B 1 214 ? 36.321  -5.161  3.485   1.00 25.65 ? 214 ASN B CB  1 
ATOM   4110  C CG  . ASN B 1 214 ? 37.090  -6.198  2.739   1.00 25.63 ? 214 ASN B CG  1 
ATOM   4111  O OD1 . ASN B 1 214 ? 37.777  -5.861  1.737   1.00 25.54 ? 214 ASN B OD1 1 
ATOM   4112  N ND2 . ASN B 1 214 ? 36.972  -7.483  3.096   1.00 25.62 ? 214 ASN B ND2 1 
ATOM   4113  N N   . PRO B 1 215 ? 36.938  -3.307  5.993   1.00 26.28 ? 215 PRO B N   1 
ATOM   4114  C CA  . PRO B 1 215 ? 37.826  -2.472  6.783   1.00 26.39 ? 215 PRO B CA  1 
ATOM   4115  C C   . PRO B 1 215 ? 37.914  -2.853  8.235   1.00 26.58 ? 215 PRO B C   1 
ATOM   4116  O O   . PRO B 1 215 ? 38.855  -2.344  8.897   1.00 26.75 ? 215 PRO B O   1 
ATOM   4117  C CB  . PRO B 1 215 ? 37.258  -1.052  6.652   1.00 26.39 ? 215 PRO B CB  1 
ATOM   4118  C CG  . PRO B 1 215 ? 35.781  -1.345  6.432   1.00 26.34 ? 215 PRO B CG  1 
ATOM   4119  C CD  . PRO B 1 215 ? 35.888  -2.474  5.361   1.00 26.32 ? 215 PRO B CD  1 
ATOM   4120  N N   . ALA B 1 216 ? 36.969  -3.606  8.731   1.00 26.76 ? 216 ALA B N   1 
ATOM   4121  C CA  . ALA B 1 216 ? 37.020  -3.986  10.175  1.00 27.15 ? 216 ALA B CA  1 
ATOM   4122  C C   . ALA B 1 216 ? 37.347  -5.471  10.229  1.00 27.53 ? 216 ALA B C   1 
ATOM   4123  O O   . ALA B 1 216 ? 37.770  -6.035  11.252  1.00 27.57 ? 216 ALA B O   1 
ATOM   4124  C CB  . ALA B 1 216 ? 35.780  -3.520  10.882  1.00 27.10 ? 216 ALA B CB  1 
ATOM   4125  N N   . ILE B 1 217 ? 37.184  -6.097  9.085   1.00 27.96 ? 217 ILE B N   1 
ATOM   4126  C CA  . ILE B 1 217 ? 37.537  -7.469  8.781   1.00 28.42 ? 217 ILE B CA  1 
ATOM   4127  C C   . ILE B 1 217 ? 37.725  -8.444  9.896   1.00 28.86 ? 217 ILE B C   1 
ATOM   4128  O O   . ILE B 1 217 ? 38.888  -8.829  10.202  1.00 29.13 ? 217 ILE B O   1 
ATOM   4129  C CB  . ILE B 1 217 ? 38.877  -7.377  7.898   1.00 28.38 ? 217 ILE B CB  1 
ATOM   4130  C CG1 . ILE B 1 217 ? 39.217  -8.706  7.245   1.00 28.20 ? 217 ILE B CG1 1 
ATOM   4131  C CG2 . ILE B 1 217 ? 40.081  -6.774  8.689   1.00 28.32 ? 217 ILE B CG2 1 
ATOM   4132  C CD1 . ILE B 1 217 ? 40.340  -8.654  6.157   1.00 28.18 ? 217 ILE B CD1 1 
ATOM   4133  N N   . GLY B 1 218 ? 36.662  -8.979  10.490  1.00 29.27 ? 218 GLY B N   1 
ATOM   4134  C CA  . GLY B 1 218 ? 36.855  -10.147 11.452  1.00 29.74 ? 218 GLY B CA  1 
ATOM   4135  C C   . GLY B 1 218 ? 37.083  -11.349 10.478  1.00 30.14 ? 218 GLY B C   1 
ATOM   4136  O O   . GLY B 1 218 ? 36.781  -12.529 10.611  1.00 30.18 ? 218 GLY B O   1 
ATOM   4137  N N   . THR B 1 219 ? 37.566  -10.977 9.352   1.00 30.44 ? 219 THR B N   1 
ATOM   4138  C CA  . THR B 1 219 ? 37.923  -11.400 8.068   1.00 30.52 ? 219 THR B CA  1 
ATOM   4139  C C   . THR B 1 219 ? 36.646  -11.202 7.196   1.00 30.67 ? 219 THR B C   1 
ATOM   4140  O O   . THR B 1 219 ? 36.195  -10.046 7.102   1.00 30.62 ? 219 THR B O   1 
ATOM   4141  C CB  . THR B 1 219 ? 38.681  -12.728 7.819   1.00 30.35 ? 219 THR B CB  1 
ATOM   4142  O OG1 . THR B 1 219 ? 40.103  -12.394 8.144   1.00 30.27 ? 219 THR B OG1 1 
ATOM   4143  C CG2 . THR B 1 219 ? 38.638  -13.265 6.392   1.00 30.25 ? 219 THR B CG2 1 
ATOM   4144  N N   . ASP B 1 220 ? 36.079  -12.254 6.785   1.00 30.93 ? 220 ASP B N   1 
ATOM   4145  C CA  . ASP B 1 220 ? 34.961  -12.394 5.873   1.00 31.35 ? 220 ASP B CA  1 
ATOM   4146  C C   . ASP B 1 220 ? 35.600  -13.170 4.678   1.00 31.62 ? 220 ASP B C   1 
ATOM   4147  O O   . ASP B 1 220 ? 36.125  -12.582 3.748   1.00 31.72 ? 220 ASP B O   1 
ATOM   4148  C CB  . ASP B 1 220 ? 34.243  -11.143 5.491   1.00 31.36 ? 220 ASP B CB  1 
ATOM   4149  C CG  . ASP B 1 220 ? 33.346  -10.536 6.544   1.00 31.45 ? 220 ASP B CG  1 
ATOM   4150  O OD1 . ASP B 1 220 ? 33.790  -9.797  7.444   1.00 31.57 ? 220 ASP B OD1 1 
ATOM   4151  O OD2 . ASP B 1 220 ? 32.126  -10.769 6.447   1.00 31.32 ? 220 ASP B OD2 1 
ATOM   4152  N N   . LYS B 1 221 ? 35.623  -14.470 4.906   1.00 31.83 ? 221 LYS B N   1 
ATOM   4153  C CA  . LYS B 1 221 ? 36.212  -15.492 4.048   1.00 31.88 ? 221 LYS B CA  1 
ATOM   4154  C C   . LYS B 1 221 ? 37.396  -16.140 4.804   1.00 31.92 ? 221 LYS B C   1 
ATOM   4155  O O   . LYS B 1 221 ? 37.204  -17.122 5.552   1.00 31.88 ? 221 LYS B O   1 
ATOM   4156  C CB  . LYS B 1 221 ? 36.613  -15.028 2.679   1.00 31.93 ? 221 LYS B CB  1 
ATOM   4157  C CG  . LYS B 1 221 ? 37.723  -15.721 1.932   1.00 32.13 ? 221 LYS B CG  1 
ATOM   4158  C CD  . LYS B 1 221 ? 37.261  -16.841 1.036   1.00 32.29 ? 221 LYS B CD  1 
ATOM   4159  C CE  . LYS B 1 221 ? 36.510  -16.290 -0.185  1.00 32.42 ? 221 LYS B CE  1 
ATOM   4160  N NZ  . LYS B 1 221 ? 37.388  -15.293 -0.871  1.00 32.31 ? 221 LYS B NZ  1 
ATOM   4161  N N   . ASN B 1 222 ? 38.550  -15.562 4.645   1.00 31.79 ? 222 ASN B N   1 
ATOM   4162  C CA  . ASN B 1 222 ? 39.856  -15.950 5.147   1.00 31.76 ? 222 ASN B CA  1 
ATOM   4163  C C   . ASN B 1 222 ? 39.892  -16.149 6.651   1.00 31.68 ? 222 ASN B C   1 
ATOM   4164  O O   . ASN B 1 222 ? 40.940  -16.076 7.321   1.00 31.50 ? 222 ASN B O   1 
ATOM   4165  C CB  . ASN B 1 222 ? 40.892  -14.939 4.614   1.00 31.82 ? 222 ASN B CB  1 
ATOM   4166  C CG  . ASN B 1 222 ? 42.347  -15.169 4.939   1.00 31.72 ? 222 ASN B CG  1 
ATOM   4167  O OD1 . ASN B 1 222 ? 42.944  -14.401 5.734   1.00 31.64 ? 222 ASN B OD1 1 
ATOM   4168  N ND2 . ASN B 1 222 ? 42.965  -16.172 4.311   1.00 31.56 ? 222 ASN B ND2 1 
ATOM   4169  N N   . LYS B 1 223 ? 38.746  -16.423 7.202   1.00 31.77 ? 223 LYS B N   1 
ATOM   4170  C CA  . LYS B 1 223 ? 38.374  -16.758 8.527   1.00 31.88 ? 223 LYS B CA  1 
ATOM   4171  C C   . LYS B 1 223 ? 37.338  -15.828 9.193   1.00 31.90 ? 223 LYS B C   1 
ATOM   4172  O O   . LYS B 1 223 ? 36.545  -15.025 8.697   1.00 31.75 ? 223 LYS B O   1 
ATOM   4173  C CB  . LYS B 1 223 ? 39.583  -16.898 9.485   1.00 31.92 ? 223 LYS B CB  1 
ATOM   4174  C CG  . LYS B 1 223 ? 40.403  -18.135 9.381   1.00 32.11 ? 223 LYS B CG  1 
ATOM   4175  C CD  . LYS B 1 223 ? 39.659  -19.454 9.482   1.00 32.22 ? 223 LYS B CD  1 
ATOM   4176  C CE  . LYS B 1 223 ? 39.115  -19.926 8.133   1.00 32.29 ? 223 LYS B CE  1 
ATOM   4177  N NZ  . LYS B 1 223 ? 39.334  -21.399 7.975   1.00 32.32 ? 223 LYS B NZ  1 
ATOM   4178  N N   . GLN B 1 224 ? 37.295  -16.064 10.478  1.00 31.83 ? 224 GLN B N   1 
ATOM   4179  C CA  . GLN B 1 224 ? 36.613  -15.649 11.626  1.00 31.46 ? 224 GLN B CA  1 
ATOM   4180  C C   . GLN B 1 224 ? 35.135  -15.319 11.374  1.00 31.15 ? 224 GLN B C   1 
ATOM   4181  O O   . GLN B 1 224 ? 34.642  -14.224 11.390  1.00 31.09 ? 224 GLN B O   1 
ATOM   4182  C CB  . GLN B 1 224 ? 37.359  -14.625 12.487  1.00 31.51 ? 224 GLN B CB  1 
ATOM   4183  C CG  . GLN B 1 224 ? 37.984  -15.387 13.677  1.00 31.60 ? 224 GLN B CG  1 
ATOM   4184  C CD  . GLN B 1 224 ? 36.945  -15.642 14.754  1.00 31.74 ? 224 GLN B CD  1 
ATOM   4185  O OE1 . GLN B 1 224 ? 35.755  -15.315 14.634  1.00 31.80 ? 224 GLN B OE1 1 
ATOM   4186  N NE2 . GLN B 1 224 ? 37.426  -16.173 15.873  1.00 31.65 ? 224 GLN B NE2 1 
ATOM   4187  N N   . HIS B 1 225 ? 34.493  -16.452 11.190  1.00 30.83 ? 225 HIS B N   1 
ATOM   4188  C CA  . HIS B 1 225 ? 33.094  -16.765 11.028  1.00 30.32 ? 225 HIS B CA  1 
ATOM   4189  C C   . HIS B 1 225 ? 32.327  -15.658 10.347  1.00 29.89 ? 225 HIS B C   1 
ATOM   4190  O O   . HIS B 1 225 ? 32.243  -14.542 10.867  1.00 30.07 ? 225 HIS B O   1 
ATOM   4191  C CB  . HIS B 1 225 ? 32.441  -17.135 12.407  1.00 30.38 ? 225 HIS B CB  1 
ATOM   4192  C CG  . HIS B 1 225 ? 33.381  -18.027 13.186  1.00 30.60 ? 225 HIS B CG  1 
ATOM   4193  N ND1 . HIS B 1 225 ? 34.577  -17.574 13.724  1.00 30.67 ? 225 HIS B ND1 1 
ATOM   4194  C CD2 . HIS B 1 225 ? 33.340  -19.339 13.480  1.00 30.62 ? 225 HIS B CD2 1 
ATOM   4195  C CE1 . HIS B 1 225 ? 35.194  -18.565 14.328  1.00 30.55 ? 225 HIS B CE1 1 
ATOM   4196  N NE2 . HIS B 1 225 ? 34.465  -19.639 14.208  1.00 30.55 ? 225 HIS B NE2 1 
ATOM   4197  N N   . TRP B 1 226 ? 31.795  -15.972 9.205   1.00 29.11 ? 226 TRP B N   1 
ATOM   4198  C CA  . TRP B 1 226 ? 31.026  -15.110 8.323   1.00 28.44 ? 226 TRP B CA  1 
ATOM   4199  C C   . TRP B 1 226 ? 30.869  -15.952 7.035   1.00 28.25 ? 226 TRP B C   1 
ATOM   4200  O O   . TRP B 1 226 ? 29.867  -15.804 6.340   1.00 28.51 ? 226 TRP B O   1 
ATOM   4201  C CB  . TRP B 1 226 ? 31.565  -13.740 8.021   1.00 28.06 ? 226 TRP B CB  1 
ATOM   4202  C CG  . TRP B 1 226 ? 31.385  -12.631 8.985   1.00 27.67 ? 226 TRP B CG  1 
ATOM   4203  C CD1 . TRP B 1 226 ? 32.359  -12.019 9.733   1.00 27.54 ? 226 TRP B CD1 1 
ATOM   4204  C CD2 . TRP B 1 226 ? 30.159  -11.961 9.336   1.00 27.49 ? 226 TRP B CD2 1 
ATOM   4205  N NE1 . TRP B 1 226 ? 31.809  -11.078 10.563  1.00 27.46 ? 226 TRP B NE1 1 
ATOM   4206  C CE2 . TRP B 1 226 ? 30.467  -10.996 10.309  1.00 27.36 ? 226 TRP B CE2 1 
ATOM   4207  C CE3 . TRP B 1 226 ? 28.843  -12.107 8.914   1.00 27.46 ? 226 TRP B CE3 1 
ATOM   4208  C CZ2 . TRP B 1 226 ? 29.506  -10.180 10.875  1.00 27.30 ? 226 TRP B CZ2 1 
ATOM   4209  C CZ3 . TRP B 1 226 ? 27.895  -11.270 9.468   1.00 27.48 ? 226 TRP B CZ3 1 
ATOM   4210  C CH2 . TRP B 1 226 ? 28.214  -10.313 10.427  1.00 27.34 ? 226 TRP B CH2 1 
ATOM   4211  N N   . LYS B 1 227 ? 31.872  -16.797 6.831   1.00 27.85 ? 227 LYS B N   1 
ATOM   4212  C CA  . LYS B 1 227 ? 31.826  -17.735 5.685   1.00 27.49 ? 227 LYS B CA  1 
ATOM   4213  C C   . LYS B 1 227 ? 30.468  -18.473 5.829   1.00 27.07 ? 227 LYS B C   1 
ATOM   4214  O O   . LYS B 1 227 ? 29.710  -18.714 4.900   1.00 27.00 ? 227 LYS B O   1 
ATOM   4215  C CB  . LYS B 1 227 ? 32.907  -18.760 5.624   1.00 27.70 ? 227 LYS B CB  1 
ATOM   4216  C CG  . LYS B 1 227 ? 33.565  -19.350 6.822   1.00 27.86 ? 227 LYS B CG  1 
ATOM   4217  C CD  . LYS B 1 227 ? 32.817  -19.517 8.088   1.00 28.06 ? 227 LYS B CD  1 
ATOM   4218  C CE  . LYS B 1 227 ? 32.078  -20.783 8.363   1.00 28.09 ? 227 LYS B CE  1 
ATOM   4219  N NZ  . LYS B 1 227 ? 31.529  -20.886 9.732   1.00 28.09 ? 227 LYS B NZ  1 
ATOM   4220  N N   . ASN B 1 228 ? 30.234  -18.693 7.127   1.00 26.46 ? 228 ASN B N   1 
ATOM   4221  C CA  . ASN B 1 228 ? 29.065  -19.417 7.554   1.00 25.79 ? 228 ASN B CA  1 
ATOM   4222  C C   . ASN B 1 228 ? 27.818  -18.677 7.091   1.00 25.09 ? 228 ASN B C   1 
ATOM   4223  O O   . ASN B 1 228 ? 26.912  -19.425 6.684   1.00 25.27 ? 228 ASN B O   1 
ATOM   4224  C CB  . ASN B 1 228 ? 29.010  -19.745 9.035   1.00 26.15 ? 228 ASN B CB  1 
ATOM   4225  C CG  . ASN B 1 228 ? 28.661  -21.232 9.198   1.00 26.40 ? 228 ASN B CG  1 
ATOM   4226  O OD1 . ASN B 1 228 ? 29.041  -21.808 10.225  1.00 26.54 ? 228 ASN B OD1 1 
ATOM   4227  N ND2 . ASN B 1 228 ? 28.058  -21.828 8.165   1.00 26.51 ? 228 ASN B ND2 1 
ATOM   4228  N N   . VAL B 1 229 ? 27.815  -17.364 7.168   1.00 24.02 ? 229 VAL B N   1 
ATOM   4229  C CA  . VAL B 1 229 ? 26.584  -16.665 6.676   1.00 23.16 ? 229 VAL B CA  1 
ATOM   4230  C C   . VAL B 1 229 ? 26.311  -17.267 5.276   1.00 22.44 ? 229 VAL B C   1 
ATOM   4231  O O   . VAL B 1 229 ? 25.211  -17.774 4.993   1.00 22.29 ? 229 VAL B O   1 
ATOM   4232  C CB  . VAL B 1 229 ? 26.691  -15.161 6.760   1.00 23.21 ? 229 VAL B CB  1 
ATOM   4233  C CG1 . VAL B 1 229 ? 27.180  -14.482 5.476   1.00 23.33 ? 229 VAL B CG1 1 
ATOM   4234  C CG2 . VAL B 1 229 ? 25.385  -14.493 7.191   1.00 23.15 ? 229 VAL B CG2 1 
ATOM   4235  N N   . HIS B 1 230 ? 27.419  -17.376 4.550   1.00 21.45 ? 230 HIS B N   1 
ATOM   4236  C CA  . HIS B 1 230 ? 27.361  -17.927 3.199   1.00 20.73 ? 230 HIS B CA  1 
ATOM   4237  C C   . HIS B 1 230 ? 27.027  -19.418 3.170   1.00 20.28 ? 230 HIS B C   1 
ATOM   4238  O O   . HIS B 1 230 ? 26.309  -19.895 2.257   1.00 19.94 ? 230 HIS B O   1 
ATOM   4239  C CB  . HIS B 1 230 ? 28.657  -17.658 2.403   1.00 20.66 ? 230 HIS B CB  1 
ATOM   4240  C CG  . HIS B 1 230 ? 28.421  -18.138 0.997   1.00 20.52 ? 230 HIS B CG  1 
ATOM   4241  N ND1 . HIS B 1 230 ? 27.362  -17.691 0.263   1.00 20.49 ? 230 HIS B ND1 1 
ATOM   4242  C CD2 . HIS B 1 230 ? 29.008  -19.121 0.299   1.00 20.57 ? 230 HIS B CD2 1 
ATOM   4243  C CE1 . HIS B 1 230 ? 27.354  -18.335 -0.894  1.00 20.57 ? 230 HIS B CE1 1 
ATOM   4244  N NE2 . HIS B 1 230 ? 28.311  -19.236 -0.869  1.00 20.55 ? 230 HIS B NE2 1 
ATOM   4245  N N   . LYS B 1 231 ? 27.601  -20.149 4.108   1.00 19.84 ? 231 LYS B N   1 
ATOM   4246  C CA  . LYS B 1 231 ? 27.332  -21.599 4.173   1.00 19.51 ? 231 LYS B CA  1 
ATOM   4247  C C   . LYS B 1 231 ? 25.902  -21.829 4.650   1.00 19.05 ? 231 LYS B C   1 
ATOM   4248  O O   . LYS B 1 231 ? 25.262  -22.823 4.278   1.00 19.11 ? 231 LYS B O   1 
ATOM   4249  C CB  . LYS B 1 231 ? 28.313  -22.395 4.994   1.00 19.62 ? 231 LYS B CB  1 
ATOM   4250  C CG  . LYS B 1 231 ? 29.478  -22.885 4.097   1.00 19.72 ? 231 LYS B CG  1 
ATOM   4251  C CD  . LYS B 1 231 ? 30.583  -23.549 4.861   1.00 20.04 ? 231 LYS B CD  1 
ATOM   4252  C CE  . LYS B 1 231 ? 31.116  -22.781 6.047   1.00 20.20 ? 231 LYS B CE  1 
ATOM   4253  N NZ  . LYS B 1 231 ? 30.840  -21.317 5.906   1.00 20.29 ? 231 LYS B NZ  1 
ATOM   4254  N N   . GLN B 1 232 ? 25.448  -20.890 5.421   1.00 18.41 ? 232 GLN B N   1 
ATOM   4255  C CA  . GLN B 1 232 ? 24.125  -20.835 6.004   1.00 17.83 ? 232 GLN B CA  1 
ATOM   4256  C C   . GLN B 1 232 ? 23.148  -20.483 4.883   1.00 17.41 ? 232 GLN B C   1 
ATOM   4257  O O   . GLN B 1 232 ? 22.036  -21.003 4.884   1.00 17.50 ? 232 GLN B O   1 
ATOM   4258  C CB  . GLN B 1 232 ? 24.034  -19.808 7.120   1.00 18.00 ? 232 GLN B CB  1 
ATOM   4259  C CG  . GLN B 1 232 ? 22.759  -19.956 7.953   1.00 18.34 ? 232 GLN B CG  1 
ATOM   4260  C CD  . GLN B 1 232 ? 22.992  -19.374 9.323   1.00 18.70 ? 232 GLN B CD  1 
ATOM   4261  O OE1 . GLN B 1 232 ? 23.980  -19.708 9.987   1.00 18.89 ? 232 GLN B OE1 1 
ATOM   4262  N NE2 . GLN B 1 232 ? 22.131  -18.442 9.733   1.00 18.97 ? 232 GLN B NE2 1 
ATOM   4263  N N   . VAL B 1 233 ? 23.616  -19.623 4.005   1.00 16.84 ? 233 VAL B N   1 
ATOM   4264  C CA  . VAL B 1 233 ? 22.809  -19.177 2.860   1.00 16.33 ? 233 VAL B CA  1 
ATOM   4265  C C   . VAL B 1 233 ? 22.422  -20.391 2.027   1.00 15.98 ? 233 VAL B C   1 
ATOM   4266  O O   . VAL B 1 233 ? 21.242  -20.774 2.003   1.00 16.03 ? 233 VAL B O   1 
ATOM   4267  C CB  . VAL B 1 233 ? 23.551  -18.101 2.074   1.00 16.45 ? 233 VAL B CB  1 
ATOM   4268  C CG1 . VAL B 1 233 ? 23.069  -17.919 0.644   1.00 16.46 ? 233 VAL B CG1 1 
ATOM   4269  C CG2 . VAL B 1 233 ? 23.504  -16.763 2.818   1.00 16.53 ? 233 VAL B CG2 1 
ATOM   4270  N N   . VAL B 1 234 ? 23.426  -20.905 1.353   1.00 15.63 ? 234 VAL B N   1 
ATOM   4271  C CA  . VAL B 1 234 ? 23.271  -22.100 0.487   1.00 15.29 ? 234 VAL B CA  1 
ATOM   4272  C C   . VAL B 1 234 ? 22.521  -23.193 1.225   1.00 15.10 ? 234 VAL B C   1 
ATOM   4273  O O   . VAL B 1 234 ? 21.344  -23.456 0.839   1.00 15.21 ? 234 VAL B O   1 
ATOM   4274  C CB  . VAL B 1 234 ? 24.637  -22.483 -0.095  1.00 15.20 ? 234 VAL B CB  1 
ATOM   4275  C CG1 . VAL B 1 234 ? 25.705  -22.607 0.984   1.00 15.23 ? 234 VAL B CG1 1 
ATOM   4276  C CG2 . VAL B 1 234 ? 24.568  -23.734 -0.946  1.00 15.19 ? 234 VAL B CG2 1 
ATOM   4277  N N   . GLU B 1 235 ? 23.105  -23.806 2.211   1.00 14.86 ? 235 GLU B N   1 
ATOM   4278  C CA  . GLU B 1 235 ? 22.402  -24.832 3.003   1.00 15.04 ? 235 GLU B CA  1 
ATOM   4279  C C   . GLU B 1 235 ? 20.939  -24.429 3.220   1.00 15.10 ? 235 GLU B C   1 
ATOM   4280  O O   . GLU B 1 235 ? 19.991  -25.190 3.022   1.00 14.85 ? 235 GLU B O   1 
ATOM   4281  C CB  . GLU B 1 235 ? 23.028  -25.069 4.347   1.00 15.16 ? 235 GLU B CB  1 
ATOM   4282  C CG  . GLU B 1 235 ? 24.008  -26.189 4.629   1.00 15.37 ? 235 GLU B CG  1 
ATOM   4283  C CD  . GLU B 1 235 ? 23.453  -27.497 5.097   1.00 15.53 ? 235 GLU B CD  1 
ATOM   4284  O OE1 . GLU B 1 235 ? 24.022  -28.581 4.981   1.00 15.57 ? 235 GLU B OE1 1 
ATOM   4285  O OE2 . GLU B 1 235 ? 22.345  -27.376 5.690   1.00 15.64 ? 235 GLU B OE2 1 
ATOM   4286  N N   . GLY B 1 236 ? 20.765  -23.182 3.585   1.00 15.44 ? 236 GLY B N   1 
ATOM   4287  C CA  . GLY B 1 236 ? 19.515  -22.519 3.894   1.00 15.80 ? 236 GLY B CA  1 
ATOM   4288  C C   . GLY B 1 236 ? 18.409  -22.820 2.897   1.00 16.12 ? 236 GLY B C   1 
ATOM   4289  O O   . GLY B 1 236 ? 17.199  -22.838 3.249   1.00 16.17 ? 236 GLY B O   1 
ATOM   4290  N N   . GLY B 1 237 ? 18.824  -23.082 1.664   1.00 16.14 ? 237 GLY B N   1 
ATOM   4291  C CA  . GLY B 1 237 ? 17.792  -23.337 0.602   1.00 16.06 ? 237 GLY B CA  1 
ATOM   4292  C C   . GLY B 1 237 ? 17.205  -24.724 0.887   1.00 15.87 ? 237 GLY B C   1 
ATOM   4293  O O   . GLY B 1 237 ? 16.021  -24.945 0.787   1.00 15.62 ? 237 GLY B O   1 
ATOM   4294  N N   . TYR B 1 238 ? 18.136  -25.576 1.287   1.00 16.06 ? 238 TYR B N   1 
ATOM   4295  C CA  . TYR B 1 238 ? 17.900  -27.004 1.521   1.00 16.04 ? 238 TYR B CA  1 
ATOM   4296  C C   . TYR B 1 238 ? 17.069  -27.280 2.746   1.00 16.34 ? 238 TYR B C   1 
ATOM   4297  O O   . TYR B 1 238 ? 15.995  -27.886 2.603   1.00 16.40 ? 238 TYR B O   1 
ATOM   4298  C CB  . TYR B 1 238 ? 19.251  -27.790 1.485   1.00 15.41 ? 238 TYR B CB  1 
ATOM   4299  C CG  . TYR B 1 238 ? 19.839  -27.866 0.090   1.00 14.87 ? 238 TYR B CG  1 
ATOM   4300  C CD1 . TYR B 1 238 ? 19.030  -28.235 -0.995  1.00 14.80 ? 238 TYR B CD1 1 
ATOM   4301  C CD2 . TYR B 1 238 ? 21.168  -27.611 -0.183  1.00 14.67 ? 238 TYR B CD2 1 
ATOM   4302  C CE1 . TYR B 1 238 ? 19.519  -28.291 -2.281  1.00 14.56 ? 238 TYR B CE1 1 
ATOM   4303  C CE2 . TYR B 1 238 ? 21.677  -27.659 -1.476  1.00 14.56 ? 238 TYR B CE2 1 
ATOM   4304  C CZ  . TYR B 1 238 ? 20.854  -28.022 -2.529  1.00 14.46 ? 238 TYR B CZ  1 
ATOM   4305  O OH  . TYR B 1 238 ? 21.349  -28.105 -3.799  1.00 14.29 ? 238 TYR B OH  1 
ATOM   4306  N N   . GLU B 1 239 ? 17.463  -26.765 3.876   1.00 16.80 ? 239 GLU B N   1 
ATOM   4307  C CA  . GLU B 1 239 ? 16.818  -26.936 5.155   1.00 17.23 ? 239 GLU B CA  1 
ATOM   4308  C C   . GLU B 1 239 ? 15.326  -26.640 5.151   1.00 17.29 ? 239 GLU B C   1 
ATOM   4309  O O   . GLU B 1 239 ? 14.557  -27.253 5.933   1.00 17.36 ? 239 GLU B O   1 
ATOM   4310  C CB  . GLU B 1 239 ? 17.416  -25.995 6.226   1.00 17.53 ? 239 GLU B CB  1 
ATOM   4311  C CG  . GLU B 1 239 ? 17.238  -26.509 7.653   1.00 18.05 ? 239 GLU B CG  1 
ATOM   4312  C CD  . GLU B 1 239 ? 18.317  -27.426 8.139   1.00 18.46 ? 239 GLU B CD  1 
ATOM   4313  O OE1 . GLU B 1 239 ? 19.044  -28.111 7.422   1.00 18.66 ? 239 GLU B OE1 1 
ATOM   4314  O OE2 . GLU B 1 239 ? 18.410  -27.376 9.394   1.00 18.68 ? 239 GLU B OE2 1 
ATOM   4315  N N   . VAL B 1 240 ? 14.928  -25.678 4.331   1.00 17.16 ? 240 VAL B N   1 
ATOM   4316  C CA  . VAL B 1 240 ? 13.544  -25.286 4.205   1.00 16.97 ? 240 VAL B CA  1 
ATOM   4317  C C   . VAL B 1 240 ? 12.677  -26.498 3.777   1.00 16.84 ? 240 VAL B C   1 
ATOM   4318  O O   . VAL B 1 240 ? 11.672  -26.847 4.395   1.00 16.88 ? 240 VAL B O   1 
ATOM   4319  C CB  . VAL B 1 240 ? 13.281  -24.223 3.106   1.00 17.00 ? 240 VAL B CB  1 
ATOM   4320  C CG1 . VAL B 1 240 ? 11.962  -23.512 3.348   1.00 16.89 ? 240 VAL B CG1 1 
ATOM   4321  C CG2 . VAL B 1 240 ? 14.439  -23.292 2.871   1.00 17.42 ? 240 VAL B CG2 1 
ATOM   4322  N N   . LEU B 1 241 ? 13.094  -26.936 2.591   1.00 16.55 ? 241 LEU B N   1 
ATOM   4323  C CA  . LEU B 1 241 ? 12.287  -27.968 1.911   1.00 16.51 ? 241 LEU B CA  1 
ATOM   4324  C C   . LEU B 1 241 ? 12.237  -29.189 2.805   1.00 16.60 ? 241 LEU B C   1 
ATOM   4325  O O   . LEU B 1 241 ? 11.118  -29.703 3.045   1.00 16.83 ? 241 LEU B O   1 
ATOM   4326  C CB  . LEU B 1 241 ? 12.792  -28.103 0.512   1.00 16.40 ? 241 LEU B CB  1 
ATOM   4327  C CG  . LEU B 1 241 ? 13.816  -29.123 0.128   1.00 16.39 ? 241 LEU B CG  1 
ATOM   4328  C CD1 . LEU B 1 241 ? 13.339  -30.552 0.371   1.00 16.34 ? 241 LEU B CD1 1 
ATOM   4329  C CD2 . LEU B 1 241 ? 14.097  -28.943 -1.374  1.00 16.43 ? 241 LEU B CD2 1 
ATOM   4330  N N   . ASP B 1 242 ? 13.370  -29.570 3.348   1.00 16.48 ? 242 ASP B N   1 
ATOM   4331  C CA  . ASP B 1 242 ? 13.420  -30.775 4.200   1.00 16.58 ? 242 ASP B CA  1 
ATOM   4332  C C   . ASP B 1 242 ? 12.199  -30.744 5.127   1.00 16.79 ? 242 ASP B C   1 
ATOM   4333  O O   . ASP B 1 242 ? 11.447  -31.736 5.130   1.00 17.01 ? 242 ASP B O   1 
ATOM   4334  C CB  . ASP B 1 242 ? 14.726  -30.971 4.918   1.00 16.54 ? 242 ASP B CB  1 
ATOM   4335  C CG  . ASP B 1 242 ? 15.945  -31.300 4.084   1.00 16.46 ? 242 ASP B CG  1 
ATOM   4336  O OD1 . ASP B 1 242 ? 17.064  -31.384 4.631   1.00 16.19 ? 242 ASP B OD1 1 
ATOM   4337  O OD2 . ASP B 1 242 ? 15.780  -31.467 2.848   1.00 16.47 ? 242 ASP B OD2 1 
ATOM   4338  N N   . MET B 1 243 ? 11.858  -29.556 5.573   1.00 17.01 ? 243 MET B N   1 
ATOM   4339  C CA  . MET B 1 243 ? 10.790  -29.347 6.559   1.00 17.08 ? 243 MET B CA  1 
ATOM   4340  C C   . MET B 1 243 ? 9.376   -29.081 6.114   1.00 16.92 ? 243 MET B C   1 
ATOM   4341  O O   . MET B 1 243 ? 8.442   -29.762 6.660   1.00 17.04 ? 243 MET B O   1 
ATOM   4342  C CB  . MET B 1 243 ? 11.287  -28.230 7.542   1.00 17.08 ? 243 MET B CB  1 
ATOM   4343  C CG  . MET B 1 243 ? 12.682  -28.610 7.989   1.00 17.15 ? 243 MET B CG  1 
ATOM   4344  S SD  . MET B 1 243 ? 12.958  -28.013 9.661   1.00 17.40 ? 243 MET B SD  1 
ATOM   4345  C CE  . MET B 1 243 ? 12.992  -26.225 9.397   1.00 17.37 ? 243 MET B CE  1 
ATOM   4346  N N   . LYS B 1 244 ? 9.090   -28.064 5.345   1.00 16.72 ? 244 LYS B N   1 
ATOM   4347  C CA  . LYS B 1 244 ? 7.675   -27.807 4.932   1.00 16.53 ? 244 LYS B CA  1 
ATOM   4348  C C   . LYS B 1 244 ? 7.399   -28.670 3.701   1.00 16.29 ? 244 LYS B C   1 
ATOM   4349  O O   . LYS B 1 244 ? 6.268   -28.886 3.264   1.00 16.02 ? 244 LYS B O   1 
ATOM   4350  C CB  . LYS B 1 244 ? 7.382   -26.348 4.719   1.00 16.65 ? 244 LYS B CB  1 
ATOM   4351  C CG  . LYS B 1 244 ? 8.098   -25.682 3.541   1.00 16.76 ? 244 LYS B CG  1 
ATOM   4352  C CD  . LYS B 1 244 ? 7.782   -24.214 3.467   1.00 16.88 ? 244 LYS B CD  1 
ATOM   4353  C CE  . LYS B 1 244 ? 6.475   -23.902 2.768   1.00 17.01 ? 244 LYS B CE  1 
ATOM   4354  N NZ  . LYS B 1 244 ? 6.141   -22.450 3.003   1.00 17.34 ? 244 LYS B NZ  1 
ATOM   4355  N N   . GLY B 1 245 ? 8.506   -29.185 3.187   1.00 16.18 ? 245 GLY B N   1 
ATOM   4356  C CA  . GLY B 1 245 ? 8.540   -30.050 2.016   1.00 16.07 ? 245 GLY B CA  1 
ATOM   4357  C C   . GLY B 1 245 ? 8.396   -29.258 0.739   1.00 15.95 ? 245 GLY B C   1 
ATOM   4358  O O   . GLY B 1 245 ? 7.587   -29.676 -0.114  1.00 16.25 ? 245 GLY B O   1 
ATOM   4359  N N   . TYR B 1 246 ? 9.044   -28.123 0.645   1.00 15.71 ? 246 TYR B N   1 
ATOM   4360  C CA  . TYR B 1 246 ? 9.050   -27.280 -0.548  1.00 15.51 ? 246 TYR B CA  1 
ATOM   4361  C C   . TYR B 1 246 ? 9.516   -25.856 -0.178  1.00 15.26 ? 246 TYR B C   1 
ATOM   4362  O O   . TYR B 1 246 ? 9.625   -25.479 0.991   1.00 15.28 ? 246 TYR B O   1 
ATOM   4363  C CB  . TYR B 1 246 ? 7.741   -27.250 -1.320  1.00 15.68 ? 246 TYR B CB  1 
ATOM   4364  C CG  . TYR B 1 246 ? 6.516   -26.666 -0.701  1.00 15.83 ? 246 TYR B CG  1 
ATOM   4365  C CD1 . TYR B 1 246 ? 6.221   -25.299 -0.854  1.00 16.01 ? 246 TYR B CD1 1 
ATOM   4366  C CD2 . TYR B 1 246 ? 5.587   -27.437 0.000   1.00 15.90 ? 246 TYR B CD2 1 
ATOM   4367  C CE1 . TYR B 1 246 ? 5.048   -24.757 -0.338  1.00 16.04 ? 246 TYR B CE1 1 
ATOM   4368  C CE2 . TYR B 1 246 ? 4.424   -26.898 0.551   1.00 15.89 ? 246 TYR B CE2 1 
ATOM   4369  C CZ  . TYR B 1 246 ? 4.153   -25.555 0.358   1.00 16.02 ? 246 TYR B CZ  1 
ATOM   4370  O OH  . TYR B 1 246 ? 3.012   -25.008 0.863   1.00 16.19 ? 246 TYR B OH  1 
ATOM   4371  N N   . THR B 1 247 ? 9.750   -25.118 -1.235  1.00 14.70 ? 247 THR B N   1 
ATOM   4372  C CA  . THR B 1 247 ? 10.239  -23.728 -1.233  1.00 14.15 ? 247 THR B CA  1 
ATOM   4373  C C   . THR B 1 247 ? 9.168   -22.847 -1.833  1.00 13.56 ? 247 THR B C   1 
ATOM   4374  O O   . THR B 1 247 ? 9.071   -22.788 -3.076  1.00 13.62 ? 247 THR B O   1 
ATOM   4375  C CB  . THR B 1 247 ? 11.617  -23.754 -2.021  1.00 14.34 ? 247 THR B CB  1 
ATOM   4376  O OG1 . THR B 1 247 ? 12.231  -22.430 -1.950  1.00 14.61 ? 247 THR B OG1 1 
ATOM   4377  C CG2 . THR B 1 247 ? 11.500  -24.246 -3.474  1.00 14.25 ? 247 THR B CG2 1 
ATOM   4378  N N   . SER B 1 248 ? 8.373   -22.150 -1.024  1.00 12.75 ? 248 SER B N   1 
ATOM   4379  C CA  . SER B 1 248 ? 7.232   -21.370 -1.511  1.00 11.83 ? 248 SER B CA  1 
ATOM   4380  C C   . SER B 1 248 ? 7.251   -19.866 -1.431  1.00 11.00 ? 248 SER B C   1 
ATOM   4381  O O   . SER B 1 248 ? 7.481   -19.200 -2.436  1.00 11.00 ? 248 SER B O   1 
ATOM   4382  C CB  . SER B 1 248 ? 5.976   -21.833 -0.709  1.00 11.98 ? 248 SER B CB  1 
ATOM   4383  O OG  . SER B 1 248 ? 6.369   -21.677 0.659   1.00 12.09 ? 248 SER B OG  1 
ATOM   4384  N N   . TRP B 1 249 ? 6.856   -19.289 -0.321  1.00 10.02 ? 249 TRP B N   1 
ATOM   4385  C CA  . TRP B 1 249 ? 6.704   -17.874 -0.071  1.00 9.28  ? 249 TRP B CA  1 
ATOM   4386  C C   . TRP B 1 249 ? 7.818   -16.995 -0.662  1.00 8.67  ? 249 TRP B C   1 
ATOM   4387  O O   . TRP B 1 249 ? 7.624   -16.201 -1.601  1.00 8.38  ? 249 TRP B O   1 
ATOM   4388  C CB  . TRP B 1 249 ? 6.526   -17.602 1.403   1.00 9.57  ? 249 TRP B CB  1 
ATOM   4389  C CG  . TRP B 1 249 ? 5.451   -18.202 2.199   1.00 9.91  ? 249 TRP B CG  1 
ATOM   4390  C CD1 . TRP B 1 249 ? 5.441   -18.288 3.580   1.00 10.00 ? 249 TRP B CD1 1 
ATOM   4391  C CD2 . TRP B 1 249 ? 4.217   -18.807 1.787   1.00 10.01 ? 249 TRP B CD2 1 
ATOM   4392  N NE1 . TRP B 1 249 ? 4.300   -18.904 4.021   1.00 10.08 ? 249 TRP B NE1 1 
ATOM   4393  C CE2 . TRP B 1 249 ? 3.529   -19.228 2.940   1.00 10.04 ? 249 TRP B CE2 1 
ATOM   4394  C CE3 . TRP B 1 249 ? 3.635   -19.011 0.545   1.00 10.04 ? 249 TRP B CE3 1 
ATOM   4395  C CZ2 . TRP B 1 249 ? 2.267   -19.804 2.888   1.00 9.99  ? 249 TRP B CZ2 1 
ATOM   4396  C CZ3 . TRP B 1 249 ? 2.410   -19.640 0.484   1.00 9.99  ? 249 TRP B CZ3 1 
ATOM   4397  C CH2 . TRP B 1 249 ? 1.728   -20.014 1.637   1.00 9.99  ? 249 TRP B CH2 1 
ATOM   4398  N N   . ALA B 1 250 ? 8.967   -17.064 -0.022  1.00 7.96  ? 250 ALA B N   1 
ATOM   4399  C CA  . ALA B 1 250 ? 10.179  -16.313 -0.294  1.00 6.97  ? 250 ALA B CA  1 
ATOM   4400  C C   . ALA B 1 250 ? 10.564  -16.303 -1.753  1.00 6.50  ? 250 ALA B C   1 
ATOM   4401  O O   . ALA B 1 250 ? 11.238  -15.320 -2.162  1.00 6.33  ? 250 ALA B O   1 
ATOM   4402  C CB  . ALA B 1 250 ? 11.321  -16.817 0.567   1.00 6.88  ? 250 ALA B CB  1 
ATOM   4403  N N   . ILE B 1 251 ? 10.206  -17.359 -2.487  1.00 5.99  ? 251 ILE B N   1 
ATOM   4404  C CA  . ILE B 1 251 ? 10.548  -17.306 -3.942  1.00 5.45  ? 251 ILE B CA  1 
ATOM   4405  C C   . ILE B 1 251 ? 9.588   -16.316 -4.614  1.00 5.02  ? 251 ILE B C   1 
ATOM   4406  O O   . ILE B 1 251 ? 9.934   -15.557 -5.531  1.00 4.84  ? 251 ILE B O   1 
ATOM   4407  C CB  . ILE B 1 251 ? 10.604  -18.695 -4.605  1.00 5.41  ? 251 ILE B CB  1 
ATOM   4408  C CG1 . ILE B 1 251 ? 10.861  -18.622 -6.130  1.00 5.62  ? 251 ILE B CG1 1 
ATOM   4409  C CG2 . ILE B 1 251 ? 9.319   -19.540 -4.394  1.00 5.30  ? 251 ILE B CG2 1 
ATOM   4410  C CD1 . ILE B 1 251 ? 11.951  -17.652 -6.629  1.00 5.83  ? 251 ILE B CD1 1 
ATOM   4411  N N   . GLY B 1 252 ? 8.396   -16.326 -4.053  1.00 4.53  ? 252 GLY B N   1 
ATOM   4412  C CA  . GLY B 1 252 ? 7.254   -15.571 -4.604  1.00 4.08  ? 252 GLY B CA  1 
ATOM   4413  C C   . GLY B 1 252 ? 7.584   -14.090 -4.511  1.00 3.69  ? 252 GLY B C   1 
ATOM   4414  O O   . GLY B 1 252 ? 7.715   -13.427 -5.527  1.00 3.74  ? 252 GLY B O   1 
ATOM   4415  N N   . LEU B 1 253 ? 7.734   -13.693 -3.258  1.00 3.27  ? 253 LEU B N   1 
ATOM   4416  C CA  . LEU B 1 253 ? 8.075   -12.307 -2.908  1.00 2.70  ? 253 LEU B CA  1 
ATOM   4417  C C   . LEU B 1 253 ? 9.208   -11.854 -3.798  1.00 2.50  ? 253 LEU B C   1 
ATOM   4418  O O   . LEU B 1 253 ? 9.002   -10.846 -4.513  1.00 2.86  ? 253 LEU B O   1 
ATOM   4419  C CB  . LEU B 1 253 ? 8.298   -12.210 -1.400  1.00 2.38  ? 253 LEU B CB  1 
ATOM   4420  C CG  . LEU B 1 253 ? 6.991   -12.259 -0.601  1.00 2.10  ? 253 LEU B CG  1 
ATOM   4421  C CD1 . LEU B 1 253 ? 7.186   -13.057 0.666   1.00 2.30  ? 253 LEU B CD1 1 
ATOM   4422  C CD2 . LEU B 1 253 ? 6.556   -10.841 -0.280  1.00 2.00  ? 253 LEU B CD2 1 
ATOM   4423  N N   . SER B 1 254 ? 10.260  -12.628 -3.873  1.00 2.22  ? 254 SER B N   1 
ATOM   4424  C CA  . SER B 1 254 ? 11.400  -12.274 -4.732  1.00 2.00  ? 254 SER B CA  1 
ATOM   4425  C C   . SER B 1 254 ? 10.934  -11.814 -6.111  1.00 2.06  ? 254 SER B C   1 
ATOM   4426  O O   . SER B 1 254 ? 11.172  -10.680 -6.530  1.00 2.24  ? 254 SER B O   1 
ATOM   4427  C CB  . SER B 1 254 ? 12.356  -13.435 -4.877  1.00 2.00  ? 254 SER B CB  1 
ATOM   4428  O OG  . SER B 1 254 ? 13.111  -13.304 -6.072  1.00 2.00  ? 254 SER B OG  1 
ATOM   4429  N N   . VAL B 1 255 ? 10.239  -12.673 -6.801  1.00 2.14  ? 255 VAL B N   1 
ATOM   4430  C CA  . VAL B 1 255 ? 9.812   -12.487 -8.177  1.00 2.32  ? 255 VAL B CA  1 
ATOM   4431  C C   . VAL B 1 255 ? 9.003   -11.221 -8.403  1.00 2.46  ? 255 VAL B C   1 
ATOM   4432  O O   . VAL B 1 255 ? 9.066   -10.599 -9.466  1.00 2.50  ? 255 VAL B O   1 
ATOM   4433  C CB  . VAL B 1 255 ? 8.972   -13.728 -8.631  1.00 2.44  ? 255 VAL B CB  1 
ATOM   4434  C CG1 . VAL B 1 255 ? 8.410   -13.564 -10.040 1.00 2.19  ? 255 VAL B CG1 1 
ATOM   4435  C CG2 . VAL B 1 255 ? 9.752   -15.024 -8.422  1.00 2.43  ? 255 VAL B CG2 1 
ATOM   4436  N N   . THR B 1 256 ? 8.039   -11.111 -7.484  1.00 2.58  ? 256 THR B N   1 
ATOM   4437  C CA  . THR B 1 256 ? 7.052   -10.007 -7.551  1.00 2.35  ? 256 THR B CA  1 
ATOM   4438  C C   . THR B 1 256 ? 7.824   -8.704  -7.416  1.00 2.23  ? 256 THR B C   1 
ATOM   4439  O O   . THR B 1 256 ? 7.394   -7.654  -7.911  1.00 2.35  ? 256 THR B O   1 
ATOM   4440  C CB  . THR B 1 256 ? 5.869   -10.234 -6.566  1.00 2.31  ? 256 THR B CB  1 
ATOM   4441  O OG1 . THR B 1 256 ? 5.409   -8.904  -6.092  1.00 2.41  ? 256 THR B OG1 1 
ATOM   4442  C CG2 . THR B 1 256 ? 6.159   -11.160 -5.399  1.00 2.22  ? 256 THR B CG2 1 
ATOM   4443  N N   . ASP B 1 257 ? 8.971   -8.855  -6.795  1.00 2.01  ? 257 ASP B N   1 
ATOM   4444  C CA  . ASP B 1 257 ? 9.918   -7.755  -6.531  1.00 2.00  ? 257 ASP B CA  1 
ATOM   4445  C C   . ASP B 1 257 ? 10.686  -7.476  -7.821  1.00 2.00  ? 257 ASP B C   1 
ATOM   4446  O O   . ASP B 1 257 ? 11.178  -6.358  -8.009  1.00 2.00  ? 257 ASP B O   1 
ATOM   4447  C CB  . ASP B 1 257 ? 10.711  -8.101  -5.290  1.00 2.01  ? 257 ASP B CB  1 
ATOM   4448  C CG  . ASP B 1 257 ? 11.842  -7.161  -4.984  1.00 2.30  ? 257 ASP B CG  1 
ATOM   4449  O OD1 . ASP B 1 257 ? 12.952  -7.322  -5.537  1.00 2.54  ? 257 ASP B OD1 1 
ATOM   4450  O OD2 . ASP B 1 257 ? 11.604  -6.239  -4.178  1.00 2.39  ? 257 ASP B OD2 1 
ATOM   4451  N N   . LEU B 1 258 ? 10.704  -8.461  -8.702  1.00 2.00  ? 258 LEU B N   1 
ATOM   4452  C CA  . LEU B 1 258 ? 11.325  -8.348  -10.019 1.00 2.00  ? 258 LEU B CA  1 
ATOM   4453  C C   . LEU B 1 258 ? 10.301  -7.682  -10.947 1.00 2.00  ? 258 LEU B C   1 
ATOM   4454  O O   . LEU B 1 258 ? 10.613  -6.747  -11.660 1.00 2.00  ? 258 LEU B O   1 
ATOM   4455  C CB  . LEU B 1 258 ? 11.804  -9.688  -10.517 1.00 2.00  ? 258 LEU B CB  1 
ATOM   4456  C CG  . LEU B 1 258 ? 13.207  -10.177 -10.271 1.00 2.00  ? 258 LEU B CG  1 
ATOM   4457  C CD1 . LEU B 1 258 ? 14.252  -9.191  -10.781 1.00 2.00  ? 258 LEU B CD1 1 
ATOM   4458  C CD2 . LEU B 1 258 ? 13.461  -10.403 -8.766  1.00 2.00  ? 258 LEU B CD2 1 
ATOM   4459  N N   . ALA B 1 259 ? 9.092   -8.167  -10.856 1.00 2.00  ? 259 ALA B N   1 
ATOM   4460  C CA  . ALA B 1 259 ? 7.939   -7.663  -11.610 1.00 2.00  ? 259 ALA B CA  1 
ATOM   4461  C C   . ALA B 1 259 ? 7.767   -6.165  -11.355 1.00 2.00  ? 259 ALA B C   1 
ATOM   4462  O O   . ALA B 1 259 ? 7.712   -5.344  -12.270 1.00 2.00  ? 259 ALA B O   1 
ATOM   4463  C CB  . ALA B 1 259 ? 6.689   -8.444  -11.189 1.00 2.00  ? 259 ALA B CB  1 
ATOM   4464  N N   . ARG B 1 260 ? 7.646   -5.859  -10.077 1.00 2.00  ? 260 ARG B N   1 
ATOM   4465  C CA  . ARG B 1 260 ? 7.474   -4.550  -9.485  1.00 2.00  ? 260 ARG B CA  1 
ATOM   4466  C C   . ARG B 1 260 ? 8.377   -3.528  -10.171 1.00 2.00  ? 260 ARG B C   1 
ATOM   4467  O O   . ARG B 1 260 ? 7.961   -2.426  -10.523 1.00 2.00  ? 260 ARG B O   1 
ATOM   4468  C CB  . ARG B 1 260 ? 7.812   -4.567  -7.996  1.00 2.00  ? 260 ARG B CB  1 
ATOM   4469  C CG  . ARG B 1 260 ? 7.465   -3.352  -7.176  1.00 2.00  ? 260 ARG B CG  1 
ATOM   4470  C CD  . ARG B 1 260 ? 8.352   -2.214  -7.395  1.00 2.00  ? 260 ARG B CD  1 
ATOM   4471  N NE  . ARG B 1 260 ? 8.153   -1.009  -6.648  1.00 2.22  ? 260 ARG B NE  1 
ATOM   4472  C CZ  . ARG B 1 260 ? 8.491   -0.666  -5.412  1.00 2.21  ? 260 ARG B CZ  1 
ATOM   4473  N NH1 . ARG B 1 260 ? 9.169   -1.463  -4.576  1.00 2.32  ? 260 ARG B NH1 1 
ATOM   4474  N NH2 . ARG B 1 260 ? 8.010   0.480   -4.902  1.00 2.02  ? 260 ARG B NH2 1 
ATOM   4475  N N   . SER B 1 261 ? 9.609   -3.980  -10.305 1.00 2.00  ? 261 SER B N   1 
ATOM   4476  C CA  . SER B 1 261 ? 10.693  -3.195  -10.877 1.00 2.00  ? 261 SER B CA  1 
ATOM   4477  C C   . SER B 1 261 ? 10.477  -3.037  -12.377 1.00 2.00  ? 261 SER B C   1 
ATOM   4478  O O   . SER B 1 261 ? 10.690  -1.945  -12.887 1.00 2.00  ? 261 SER B O   1 
ATOM   4479  C CB  . SER B 1 261 ? 12.060  -3.823  -10.642 1.00 2.00  ? 261 SER B CB  1 
ATOM   4480  O OG  . SER B 1 261 ? 12.562  -4.261  -11.902 1.00 2.00  ? 261 SER B OG  1 
ATOM   4481  N N   . ILE B 1 262 ? 10.292  -4.166  -13.025 1.00 2.00  ? 262 ILE B N   1 
ATOM   4482  C CA  . ILE B 1 262 ? 10.013  -4.191  -14.469 1.00 2.00  ? 262 ILE B CA  1 
ATOM   4483  C C   . ILE B 1 262 ? 8.795   -3.299  -14.733 1.00 2.00  ? 262 ILE B C   1 
ATOM   4484  O O   . ILE B 1 262 ? 8.964   -2.186  -15.218 1.00 2.05  ? 262 ILE B O   1 
ATOM   4485  C CB  . ILE B 1 262 ? 9.818   -5.645  -15.023 1.00 2.00  ? 262 ILE B CB  1 
ATOM   4486  C CG1 . ILE B 1 262 ? 10.845  -6.597  -14.398 1.00 2.00  ? 262 ILE B CG1 1 
ATOM   4487  C CG2 . ILE B 1 262 ? 9.866   -5.683  -16.568 1.00 2.00  ? 262 ILE B CG2 1 
ATOM   4488  C CD1 . ILE B 1 262 ? 10.306  -8.020  -14.108 1.00 2.00  ? 262 ILE B CD1 1 
ATOM   4489  N N   . LEU B 1 263 ? 7.649   -3.720  -14.296 1.00 2.00  ? 263 LEU B N   1 
ATOM   4490  C CA  . LEU B 1 263 ? 6.379   -3.029  -14.496 1.00 2.45  ? 263 LEU B CA  1 
ATOM   4491  C C   . LEU B 1 263 ? 6.353   -1.540  -14.186 1.00 2.53  ? 263 LEU B C   1 
ATOM   4492  O O   . LEU B 1 263 ? 5.898   -0.725  -15.061 1.00 2.55  ? 263 LEU B O   1 
ATOM   4493  C CB  . LEU B 1 263 ? 5.304   -3.913  -13.795 1.00 2.46  ? 263 LEU B CB  1 
ATOM   4494  C CG  . LEU B 1 263 ? 4.822   -5.204  -14.442 1.00 2.44  ? 263 LEU B CG  1 
ATOM   4495  C CD1 . LEU B 1 263 ? 5.143   -5.351  -15.936 1.00 2.36  ? 263 LEU B CD1 1 
ATOM   4496  C CD2 . LEU B 1 263 ? 5.408   -6.425  -13.725 1.00 2.47  ? 263 LEU B CD2 1 
ATOM   4497  N N   . LYS B 1 264 ? 6.863   -1.086  -13.065 1.00 2.46  ? 264 LYS B N   1 
ATOM   4498  C CA  . LYS B 1 264 ? 6.774   0.346   -12.702 1.00 2.47  ? 264 LYS B CA  1 
ATOM   4499  C C   . LYS B 1 264 ? 7.978   1.110   -13.221 1.00 2.56  ? 264 LYS B C   1 
ATOM   4500  O O   . LYS B 1 264 ? 8.264   2.237   -12.764 1.00 2.47  ? 264 LYS B O   1 
ATOM   4501  C CB  . LYS B 1 264 ? 6.676   0.492   -11.197 1.00 2.49  ? 264 LYS B CB  1 
ATOM   4502  C CG  . LYS B 1 264 ? 5.708   -0.483  -10.554 1.00 2.83  ? 264 LYS B CG  1 
ATOM   4503  C CD  . LYS B 1 264 ? 5.951   -0.705  -9.081  1.00 3.15  ? 264 LYS B CD  1 
ATOM   4504  C CE  . LYS B 1 264 ? 5.009   0.089   -8.172  1.00 3.23  ? 264 LYS B CE  1 
ATOM   4505  N NZ  . LYS B 1 264 ? 5.600   0.157   -6.789  1.00 3.07  ? 264 LYS B NZ  1 
ATOM   4506  N N   . ASN B 1 265 ? 8.693   0.458   -14.106 1.00 2.59  ? 265 ASN B N   1 
ATOM   4507  C CA  . ASN B 1 265 ? 9.914   0.912   -14.747 1.00 2.60  ? 265 ASN B CA  1 
ATOM   4508  C C   . ASN B 1 265 ? 10.913  1.498   -13.765 1.00 2.83  ? 265 ASN B C   1 
ATOM   4509  O O   . ASN B 1 265 ? 11.576  2.509   -14.105 1.00 3.05  ? 265 ASN B O   1 
ATOM   4510  C CB  . ASN B 1 265 ? 9.629   1.943   -15.865 1.00 2.63  ? 265 ASN B CB  1 
ATOM   4511  C CG  . ASN B 1 265 ? 10.689  1.883   -16.933 1.00 2.64  ? 265 ASN B CG  1 
ATOM   4512  O OD1 . ASN B 1 265 ? 11.397  0.863   -16.971 1.00 3.09  ? 265 ASN B OD1 1 
ATOM   4513  N ND2 . ASN B 1 265 ? 10.857  2.866   -17.788 1.00 2.50  ? 265 ASN B ND2 1 
ATOM   4514  N N   . LEU B 1 266 ? 10.967  0.939   -12.581 1.00 2.89  ? 266 LEU B N   1 
ATOM   4515  C CA  . LEU B 1 266 ? 11.822  1.399   -11.494 1.00 2.93  ? 266 LEU B CA  1 
ATOM   4516  C C   . LEU B 1 266 ? 13.304  1.534   -11.766 1.00 2.97  ? 266 LEU B C   1 
ATOM   4517  O O   . LEU B 1 266 ? 14.023  2.281   -11.036 1.00 3.09  ? 266 LEU B O   1 
ATOM   4518  C CB  . LEU B 1 266 ? 11.535  0.421   -10.337 1.00 2.98  ? 266 LEU B CB  1 
ATOM   4519  C CG  . LEU B 1 266 ? 10.727  0.971   -9.186  1.00 3.25  ? 266 LEU B CG  1 
ATOM   4520  C CD1 . LEU B 1 266 ? 9.348   1.444   -9.638  1.00 3.26  ? 266 LEU B CD1 1 
ATOM   4521  C CD2 . LEU B 1 266 ? 10.637  -0.137  -8.127  1.00 3.10  ? 266 LEU B CD2 1 
ATOM   4522  N N   . LYS B 1 267 ? 13.805  0.824   -12.744 1.00 2.92  ? 267 LYS B N   1 
ATOM   4523  C CA  . LYS B 1 267 ? 15.233  0.794   -13.085 1.00 2.94  ? 267 LYS B CA  1 
ATOM   4524  C C   . LYS B 1 267 ? 16.069  0.599   -11.818 1.00 2.85  ? 267 LYS B C   1 
ATOM   4525  O O   . LYS B 1 267 ? 17.137  1.164   -11.676 1.00 2.64  ? 267 LYS B O   1 
ATOM   4526  C CB  . LYS B 1 267 ? 15.737  1.959   -13.895 1.00 2.92  ? 267 LYS B CB  1 
ATOM   4527  C CG  . LYS B 1 267 ? 15.243  1.960   -15.364 1.00 2.81  ? 267 LYS B CG  1 
ATOM   4528  C CD  . LYS B 1 267 ? 15.253  3.388   -15.876 1.00 3.09  ? 267 LYS B CD  1 
ATOM   4529  C CE  . LYS B 1 267 ? 16.656  3.957   -16.046 1.00 3.26  ? 267 LYS B CE  1 
ATOM   4530  N NZ  . LYS B 1 267 ? 16.657  5.410   -15.663 1.00 3.41  ? 267 LYS B NZ  1 
ATOM   4531  N N   . ARG B 1 268 ? 15.506  -0.244  -10.967 1.00 3.15  ? 268 ARG B N   1 
ATOM   4532  C CA  . ARG B 1 268 ? 16.107  -0.764  -9.745  1.00 3.42  ? 268 ARG B CA  1 
ATOM   4533  C C   . ARG B 1 268 ? 17.049  -1.912  -10.237 1.00 3.45  ? 268 ARG B C   1 
ATOM   4534  O O   . ARG B 1 268 ? 16.558  -2.810  -10.958 1.00 3.46  ? 268 ARG B O   1 
ATOM   4535  C CB  . ARG B 1 268 ? 15.211  -1.428  -8.734  1.00 3.68  ? 268 ARG B CB  1 
ATOM   4536  C CG  . ARG B 1 268 ? 14.542  -0.802  -7.564  1.00 4.07  ? 268 ARG B CG  1 
ATOM   4537  C CD  . ARG B 1 268 ? 14.308  -1.758  -6.434  1.00 4.48  ? 268 ARG B CD  1 
ATOM   4538  N NE  . ARG B 1 268 ? 13.081  -2.502  -6.493  1.00 5.06  ? 268 ARG B NE  1 
ATOM   4539  C CZ  . ARG B 1 268 ? 11.879  -2.219  -5.961  1.00 5.34  ? 268 ARG B CZ  1 
ATOM   4540  N NH1 . ARG B 1 268 ? 11.618  -1.128  -5.221  1.00 5.32  ? 268 ARG B NH1 1 
ATOM   4541  N NH2 . ARG B 1 268 ? 10.835  -3.047  -6.180  1.00 5.18  ? 268 ARG B NH2 1 
ATOM   4542  N N   . VAL B 1 269 ? 18.296  -1.779  -9.848  1.00 3.39  ? 269 VAL B N   1 
ATOM   4543  C CA  . VAL B 1 269 ? 19.291  -2.816  -10.218 1.00 3.24  ? 269 VAL B CA  1 
ATOM   4544  C C   . VAL B 1 269 ? 18.975  -4.058  -9.391  1.00 3.26  ? 269 VAL B C   1 
ATOM   4545  O O   . VAL B 1 269 ? 18.409  -3.987  -8.280  1.00 3.13  ? 269 VAL B O   1 
ATOM   4546  C CB  . VAL B 1 269 ? 20.711  -2.277  -10.117 1.00 3.28  ? 269 VAL B CB  1 
ATOM   4547  C CG1 . VAL B 1 269 ? 21.190  -2.050  -8.694  1.00 3.21  ? 269 VAL B CG1 1 
ATOM   4548  C CG2 . VAL B 1 269 ? 21.671  -3.168  -10.904 1.00 3.32  ? 269 VAL B CG2 1 
ATOM   4549  N N   . HIS B 1 270 ? 19.349  -5.185  -9.969  1.00 3.30  ? 270 HIS B N   1 
ATOM   4550  C CA  . HIS B 1 270 ? 19.051  -6.518  -9.474  1.00 3.15  ? 270 HIS B CA  1 
ATOM   4551  C C   . HIS B 1 270 ? 20.076  -7.562  -9.879  1.00 3.21  ? 270 HIS B C   1 
ATOM   4552  O O   . HIS B 1 270 ? 20.762  -7.430  -10.894 1.00 3.09  ? 270 HIS B O   1 
ATOM   4553  C CB  . HIS B 1 270 ? 17.662  -7.052  -10.031 1.00 2.78  ? 270 HIS B CB  1 
ATOM   4554  C CG  . HIS B 1 270 ? 16.533  -6.419  -9.290  1.00 2.51  ? 270 HIS B CG  1 
ATOM   4555  N ND1 . HIS B 1 270 ? 16.110  -6.850  -8.062  1.00 2.51  ? 270 HIS B ND1 1 
ATOM   4556  C CD2 . HIS B 1 270 ? 15.823  -5.310  -9.551  1.00 2.53  ? 270 HIS B CD2 1 
ATOM   4557  C CE1 . HIS B 1 270 ? 15.161  -6.043  -7.613  1.00 2.55  ? 270 HIS B CE1 1 
ATOM   4558  N NE2 . HIS B 1 270 ? 14.961  -5.099  -8.511  1.00 2.53  ? 270 HIS B NE2 1 
ATOM   4559  N N   . PRO B 1 271 ? 20.142  -8.556  -8.996  1.00 3.36  ? 271 PRO B N   1 
ATOM   4560  C CA  . PRO B 1 271 ? 20.949  -9.760  -9.309  1.00 3.58  ? 271 PRO B CA  1 
ATOM   4561  C C   . PRO B 1 271 ? 19.926  -10.741 -9.904  1.00 3.86  ? 271 PRO B C   1 
ATOM   4562  O O   . PRO B 1 271 ? 18.935  -11.140 -9.291  1.00 3.95  ? 271 PRO B O   1 
ATOM   4563  C CB  . PRO B 1 271 ? 21.592  -10.174 -8.030  1.00 3.42  ? 271 PRO B CB  1 
ATOM   4564  C CG  . PRO B 1 271 ? 20.730  -9.615  -6.961  1.00 3.39  ? 271 PRO B CG  1 
ATOM   4565  C CD  . PRO B 1 271 ? 20.072  -8.360  -7.527  1.00 3.34  ? 271 PRO B CD  1 
ATOM   4566  N N   . VAL B 1 272 ? 20.123  -11.008 -11.153 1.00 4.12  ? 272 VAL B N   1 
ATOM   4567  C CA  . VAL B 1 272 ? 19.271  -11.869 -11.974 1.00 4.47  ? 272 VAL B CA  1 
ATOM   4568  C C   . VAL B 1 272 ? 20.184  -12.620 -12.915 1.00 4.95  ? 272 VAL B C   1 
ATOM   4569  O O   . VAL B 1 272 ? 21.359  -12.199 -13.012 1.00 5.05  ? 272 VAL B O   1 
ATOM   4570  C CB  . VAL B 1 272 ? 18.261  -10.902 -12.626 1.00 4.43  ? 272 VAL B CB  1 
ATOM   4571  C CG1 . VAL B 1 272 ? 17.442  -10.142 -11.587 1.00 4.38  ? 272 VAL B CG1 1 
ATOM   4572  C CG2 . VAL B 1 272 ? 18.918  -9.927  -13.578 1.00 4.34  ? 272 VAL B CG2 1 
ATOM   4573  N N   . THR B 1 273 ? 19.704  -13.637 -13.595 1.00 5.52  ? 273 THR B N   1 
ATOM   4574  C CA  . THR B 1 273 ? 20.503  -14.397 -14.551 1.00 6.08  ? 273 THR B CA  1 
ATOM   4575  C C   . THR B 1 273 ? 20.399  -13.852 -15.964 1.00 6.69  ? 273 THR B C   1 
ATOM   4576  O O   . THR B 1 273 ? 19.315  -13.506 -16.439 1.00 6.79  ? 273 THR B O   1 
ATOM   4577  C CB  . THR B 1 273 ? 20.097  -15.924 -14.558 1.00 5.94  ? 273 THR B CB  1 
ATOM   4578  O OG1 . THR B 1 273 ? 18.686  -15.915 -14.933 1.00 6.04  ? 273 THR B OG1 1 
ATOM   4579  C CG2 . THR B 1 273 ? 20.354  -16.617 -13.239 1.00 6.01  ? 273 THR B CG2 1 
ATOM   4580  N N   . THR B 1 274 ? 21.524  -13.819 -16.632 1.00 7.54  ? 274 THR B N   1 
ATOM   4581  C CA  . THR B 1 274 ? 21.670  -13.397 -18.001 1.00 8.49  ? 274 THR B CA  1 
ATOM   4582  C C   . THR B 1 274 ? 23.012  -13.937 -18.517 1.00 9.43  ? 274 THR B C   1 
ATOM   4583  O O   . THR B 1 274 ? 23.779  -14.545 -17.787 1.00 9.42  ? 274 THR B O   1 
ATOM   4584  C CB  . THR B 1 274 ? 21.583  -11.859 -18.284 1.00 8.52  ? 274 THR B CB  1 
ATOM   4585  O OG1 . THR B 1 274 ? 22.316  -11.159 -17.204 1.00 8.45  ? 274 THR B OG1 1 
ATOM   4586  C CG2 . THR B 1 274 ? 20.141  -11.372 -18.464 1.00 8.48  ? 274 THR B CG2 1 
ATOM   4587  N N   . LEU B 1 275 ? 23.205  -13.651 -19.776 1.00 10.69 ? 275 LEU B N   1 
ATOM   4588  C CA  . LEU B 1 275 ? 24.350  -14.083 -20.550 1.00 11.80 ? 275 LEU B CA  1 
ATOM   4589  C C   . LEU B 1 275 ? 25.606  -13.330 -20.180 1.00 12.82 ? 275 LEU B C   1 
ATOM   4590  O O   . LEU B 1 275 ? 25.774  -12.174 -20.616 1.00 13.00 ? 275 LEU B O   1 
ATOM   4591  C CB  . LEU B 1 275 ? 23.953  -13.895 -22.026 1.00 11.68 ? 275 LEU B CB  1 
ATOM   4592  C CG  . LEU B 1 275 ? 24.940  -14.310 -23.080 1.00 11.67 ? 275 LEU B CG  1 
ATOM   4593  C CD1 . LEU B 1 275 ? 25.403  -15.748 -22.860 1.00 11.86 ? 275 LEU B CD1 1 
ATOM   4594  C CD2 . LEU B 1 275 ? 24.254  -14.240 -24.453 1.00 11.72 ? 275 LEU B CD2 1 
ATOM   4595  N N   . VAL B 1 276 ? 26.430  -13.982 -19.403 1.00 14.24 ? 276 VAL B N   1 
ATOM   4596  C CA  . VAL B 1 276 ? 27.760  -13.410 -19.053 1.00 15.73 ? 276 VAL B CA  1 
ATOM   4597  C C   . VAL B 1 276 ? 28.763  -13.830 -20.152 1.00 16.89 ? 276 VAL B C   1 
ATOM   4598  O O   . VAL B 1 276 ? 29.983  -13.785 -19.986 1.00 16.69 ? 276 VAL B O   1 
ATOM   4599  C CB  . VAL B 1 276 ? 28.153  -13.800 -17.627 1.00 15.50 ? 276 VAL B CB  1 
ATOM   4600  C CG1 . VAL B 1 276 ? 27.011  -13.662 -16.632 1.00 15.37 ? 276 VAL B CG1 1 
ATOM   4601  C CG2 . VAL B 1 276 ? 28.765  -15.182 -17.576 1.00 15.42 ? 276 VAL B CG2 1 
ATOM   4602  N N   . LYS B 1 277 ? 28.195  -14.227 -21.270 1.00 18.52 ? 277 LYS B N   1 
ATOM   4603  C CA  . LYS B 1 277 ? 28.791  -14.694 -22.473 1.00 20.01 ? 277 LYS B CA  1 
ATOM   4604  C C   . LYS B 1 277 ? 30.259  -14.291 -22.634 1.00 20.70 ? 277 LYS B C   1 
ATOM   4605  O O   . LYS B 1 277 ? 30.945  -15.152 -23.221 1.00 21.20 ? 277 LYS B O   1 
ATOM   4606  C CB  . LYS B 1 277 ? 28.150  -14.272 -23.798 1.00 20.63 ? 277 LYS B CB  1 
ATOM   4607  C CG  . LYS B 1 277 ? 28.254  -12.779 -24.150 1.00 21.52 ? 277 LYS B CG  1 
ATOM   4608  C CD  . LYS B 1 277 ? 28.652  -12.624 -25.622 1.00 22.12 ? 277 LYS B CD  1 
ATOM   4609  C CE  . LYS B 1 277 ? 27.921  -11.483 -26.325 1.00 22.41 ? 277 LYS B CE  1 
ATOM   4610  N NZ  . LYS B 1 277 ? 27.862  -11.794 -27.808 1.00 22.71 ? 277 LYS B NZ  1 
ATOM   4611  N N   . GLY B 1 278 ? 30.585  -13.060 -22.321 1.00 21.13 ? 278 GLY B N   1 
ATOM   4612  C CA  . GLY B 1 278 ? 31.969  -12.583 -22.503 1.00 21.67 ? 278 GLY B CA  1 
ATOM   4613  C C   . GLY B 1 278 ? 32.306  -11.527 -21.464 1.00 22.18 ? 278 GLY B C   1 
ATOM   4614  O O   . GLY B 1 278 ? 32.751  -10.420 -21.820 1.00 22.37 ? 278 GLY B O   1 
ATOM   4615  N N   . PHE B 1 279 ? 32.051  -11.817 -20.222 1.00 22.56 ? 279 PHE B N   1 
ATOM   4616  C CA  . PHE B 1 279 ? 32.358  -10.911 -19.094 1.00 23.00 ? 279 PHE B CA  1 
ATOM   4617  C C   . PHE B 1 279 ? 33.423  -11.625 -18.260 1.00 23.23 ? 279 PHE B C   1 
ATOM   4618  O O   . PHE B 1 279 ? 33.561  -12.860 -18.383 1.00 23.57 ? 279 PHE B O   1 
ATOM   4619  C CB  . PHE B 1 279 ? 31.143  -10.540 -18.261 1.00 23.19 ? 279 PHE B CB  1 
ATOM   4620  C CG  . PHE B 1 279 ? 30.477  -9.223  -18.507 1.00 23.29 ? 279 PHE B CG  1 
ATOM   4621  C CD1 . PHE B 1 279 ? 31.030  -8.052  -17.946 1.00 23.27 ? 279 PHE B CD1 1 
ATOM   4622  C CD2 . PHE B 1 279 ? 29.303  -9.135  -19.258 1.00 23.21 ? 279 PHE B CD2 1 
ATOM   4623  C CE1 . PHE B 1 279 ? 30.448  -6.817  -18.163 1.00 23.25 ? 279 PHE B CE1 1 
ATOM   4624  C CE2 . PHE B 1 279 ? 28.699  -7.891  -19.471 1.00 23.27 ? 279 PHE B CE2 1 
ATOM   4625  C CZ  . PHE B 1 279 ? 29.271  -6.733  -18.905 1.00 23.24 ? 279 PHE B CZ  1 
ATOM   4626  N N   . HIS B 1 280 ? 34.123  -10.896 -17.464 1.00 23.27 ? 280 HIS B N   1 
ATOM   4627  C CA  . HIS B 1 280 ? 35.171  -11.391 -16.574 1.00 23.41 ? 280 HIS B CA  1 
ATOM   4628  C C   . HIS B 1 280 ? 35.759  -12.752 -16.891 1.00 23.09 ? 280 HIS B C   1 
ATOM   4629  O O   . HIS B 1 280 ? 35.989  -13.634 -16.040 1.00 22.82 ? 280 HIS B O   1 
ATOM   4630  C CB  . HIS B 1 280 ? 34.664  -11.299 -15.100 1.00 23.86 ? 280 HIS B CB  1 
ATOM   4631  C CG  . HIS B 1 280 ? 33.762  -12.445 -14.769 1.00 24.29 ? 280 HIS B CG  1 
ATOM   4632  N ND1 . HIS B 1 280 ? 34.281  -13.622 -14.236 1.00 24.47 ? 280 HIS B ND1 1 
ATOM   4633  C CD2 . HIS B 1 280 ? 32.455  -12.664 -14.985 1.00 24.44 ? 280 HIS B CD2 1 
ATOM   4634  C CE1 . HIS B 1 280 ? 33.289  -14.489 -14.087 1.00 24.56 ? 280 HIS B CE1 1 
ATOM   4635  N NE2 . HIS B 1 280 ? 32.169  -13.925 -14.499 1.00 24.56 ? 280 HIS B NE2 1 
ATOM   4636  N N   . GLY B 1 281 ? 36.168  -12.941 -18.139 1.00 22.93 ? 281 GLY B N   1 
ATOM   4637  C CA  . GLY B 1 281 ? 36.853  -14.146 -18.594 1.00 22.81 ? 281 GLY B CA  1 
ATOM   4638  C C   . GLY B 1 281 ? 35.947  -15.170 -19.219 1.00 22.78 ? 281 GLY B C   1 
ATOM   4639  O O   . GLY B 1 281 ? 36.395  -15.935 -20.112 1.00 22.92 ? 281 GLY B O   1 
ATOM   4640  N N   . ILE B 1 282 ? 34.713  -15.237 -18.722 1.00 22.55 ? 282 ILE B N   1 
ATOM   4641  C CA  . ILE B 1 282 ? 33.731  -16.179 -19.302 1.00 22.16 ? 282 ILE B CA  1 
ATOM   4642  C C   . ILE B 1 282 ? 33.479  -15.726 -20.750 1.00 22.08 ? 282 ILE B C   1 
ATOM   4643  O O   . ILE B 1 282 ? 33.271  -14.546 -21.017 1.00 21.82 ? 282 ILE B O   1 
ATOM   4644  C CB  . ILE B 1 282 ? 32.445  -16.316 -18.472 1.00 21.97 ? 282 ILE B CB  1 
ATOM   4645  C CG1 . ILE B 1 282 ? 32.781  -16.402 -16.964 1.00 21.81 ? 282 ILE B CG1 1 
ATOM   4646  C CG2 . ILE B 1 282 ? 31.586  -17.550 -18.920 1.00 21.99 ? 282 ILE B CG2 1 
ATOM   4647  C CD1 . ILE B 1 282 ? 31.515  -16.223 -16.075 1.00 21.74 ? 282 ILE B CD1 1 
ATOM   4648  N N   . LYS B 1 283 ? 33.640  -16.706 -21.617 1.00 22.12 ? 283 LYS B N   1 
ATOM   4649  C CA  . LYS B 1 283 ? 33.448  -16.505 -23.058 1.00 22.21 ? 283 LYS B CA  1 
ATOM   4650  C C   . LYS B 1 283 ? 32.802  -17.763 -23.633 1.00 22.12 ? 283 LYS B C   1 
ATOM   4651  O O   . LYS B 1 283 ? 33.453  -18.639 -24.230 1.00 22.32 ? 283 LYS B O   1 
ATOM   4652  C CB  . LYS B 1 283 ? 34.740  -16.136 -23.750 1.00 22.41 ? 283 LYS B CB  1 
ATOM   4653  C CG  . LYS B 1 283 ? 35.452  -14.891 -23.221 1.00 22.58 ? 283 LYS B CG  1 
ATOM   4654  C CD  . LYS B 1 283 ? 36.668  -14.518 -24.058 1.00 22.75 ? 283 LYS B CD  1 
ATOM   4655  C CE  . LYS B 1 283 ? 37.854  -15.455 -23.879 1.00 22.90 ? 283 LYS B CE  1 
ATOM   4656  N NZ  . LYS B 1 283 ? 38.910  -15.197 -24.914 1.00 22.74 ? 283 LYS B NZ  1 
ATOM   4657  N N   . GLU B 1 284 ? 31.508  -17.863 -23.397 1.00 21.81 ? 284 GLU B N   1 
ATOM   4658  C CA  . GLU B 1 284 ? 30.687  -19.020 -23.850 1.00 21.48 ? 284 GLU B CA  1 
ATOM   4659  C C   . GLU B 1 284 ? 29.310  -18.815 -23.201 1.00 20.97 ? 284 GLU B C   1 
ATOM   4660  O O   . GLU B 1 284 ? 29.278  -18.551 -21.996 1.00 20.75 ? 284 GLU B O   1 
ATOM   4661  C CB  . GLU B 1 284 ? 31.318  -20.321 -23.442 1.00 21.78 ? 284 GLU B CB  1 
ATOM   4662  C CG  . GLU B 1 284 ? 31.488  -21.502 -24.342 1.00 22.12 ? 284 GLU B CG  1 
ATOM   4663  C CD  . GLU B 1 284 ? 32.623  -21.684 -25.281 1.00 22.23 ? 284 GLU B CD  1 
ATOM   4664  O OE1 . GLU B 1 284 ? 33.675  -21.057 -25.299 1.00 22.21 ? 284 GLU B OE1 1 
ATOM   4665  O OE2 . GLU B 1 284 ? 32.398  -22.618 -26.109 1.00 22.23 ? 284 GLU B OE2 1 
ATOM   4666  N N   . GLU B 1 285 ? 28.283  -18.781 -24.005 1.00 20.33 ? 285 GLU B N   1 
ATOM   4667  C CA  . GLU B 1 285 ? 26.892  -18.500 -23.758 1.00 19.54 ? 285 GLU B CA  1 
ATOM   4668  C C   . GLU B 1 285 ? 26.311  -19.138 -22.480 1.00 18.84 ? 285 GLU B C   1 
ATOM   4669  O O   . GLU B 1 285 ? 25.182  -19.694 -22.416 1.00 18.70 ? 285 GLU B O   1 
ATOM   4670  C CB  . GLU B 1 285 ? 25.980  -18.882 -24.874 1.00 19.79 ? 285 GLU B CB  1 
ATOM   4671  C CG  . GLU B 1 285 ? 25.878  -19.100 -26.267 1.00 20.21 ? 285 GLU B CG  1 
ATOM   4672  C CD  . GLU B 1 285 ? 25.624  -18.135 -27.348 1.00 20.59 ? 285 GLU B CD  1 
ATOM   4673  O OE1 . GLU B 1 285 ? 26.281  -18.090 -28.399 1.00 21.03 ? 285 GLU B OE1 1 
ATOM   4674  O OE2 . GLU B 1 285 ? 24.670  -17.345 -27.181 1.00 20.63 ? 285 GLU B OE2 1 
ATOM   4675  N N   . VAL B 1 286 ? 27.045  -18.994 -21.417 1.00 17.89 ? 286 VAL B N   1 
ATOM   4676  C CA  . VAL B 1 286 ? 26.765  -19.344 -20.066 1.00 17.05 ? 286 VAL B CA  1 
ATOM   4677  C C   . VAL B 1 286 ? 25.976  -18.145 -19.453 1.00 16.44 ? 286 VAL B C   1 
ATOM   4678  O O   . VAL B 1 286 ? 26.485  -17.025 -19.484 1.00 16.45 ? 286 VAL B O   1 
ATOM   4679  C CB  . VAL B 1 286 ? 27.995  -19.558 -19.168 1.00 17.04 ? 286 VAL B CB  1 
ATOM   4680  C CG1 . VAL B 1 286 ? 27.588  -19.746 -17.706 1.00 16.92 ? 286 VAL B CG1 1 
ATOM   4681  C CG2 . VAL B 1 286 ? 28.880  -20.678 -19.654 1.00 17.11 ? 286 VAL B CG2 1 
ATOM   4682  N N   . PHE B 1 287 ? 24.864  -18.515 -18.918 1.00 15.66 ? 287 PHE B N   1 
ATOM   4683  C CA  . PHE B 1 287 ? 23.950  -17.627 -18.223 1.00 14.94 ? 287 PHE B CA  1 
ATOM   4684  C C   . PHE B 1 287 ? 24.093  -17.984 -16.728 1.00 14.68 ? 287 PHE B C   1 
ATOM   4685  O O   . PHE B 1 287 ? 23.880  -19.164 -16.419 1.00 14.85 ? 287 PHE B O   1 
ATOM   4686  C CB  . PHE B 1 287 ? 22.498  -17.776 -18.628 1.00 14.65 ? 287 PHE B CB  1 
ATOM   4687  C CG  . PHE B 1 287 ? 22.056  -17.296 -19.959 1.00 14.51 ? 287 PHE B CG  1 
ATOM   4688  C CD1 . PHE B 1 287 ? 22.503  -17.910 -21.127 1.00 14.55 ? 287 PHE B CD1 1 
ATOM   4689  C CD2 . PHE B 1 287 ? 21.072  -16.312 -20.061 1.00 14.44 ? 287 PHE B CD2 1 
ATOM   4690  C CE1 . PHE B 1 287 ? 22.040  -17.510 -22.367 1.00 14.55 ? 287 PHE B CE1 1 
ATOM   4691  C CE2 . PHE B 1 287 ? 20.605  -15.868 -21.293 1.00 14.33 ? 287 PHE B CE2 1 
ATOM   4692  C CZ  . PHE B 1 287 ? 21.106  -16.471 -22.443 1.00 14.44 ? 287 PHE B CZ  1 
ATOM   4693  N N   . LEU B 1 288 ? 24.598  -17.070 -15.971 1.00 14.18 ? 288 LEU B N   1 
ATOM   4694  C CA  . LEU B 1 288 ? 24.594  -17.157 -14.488 1.00 13.68 ? 288 LEU B CA  1 
ATOM   4695  C C   . LEU B 1 288 ? 24.082  -15.737 -14.126 1.00 13.43 ? 288 LEU B C   1 
ATOM   4696  O O   . LEU B 1 288 ? 23.793  -14.955 -15.073 1.00 13.25 ? 288 LEU B O   1 
ATOM   4697  C CB  . LEU B 1 288 ? 25.839  -17.639 -13.867 1.00 13.62 ? 288 LEU B CB  1 
ATOM   4698  C CG  . LEU B 1 288 ? 27.133  -16.932 -13.610 1.00 13.50 ? 288 LEU B CG  1 
ATOM   4699  C CD1 . LEU B 1 288 ? 27.720  -16.350 -14.886 1.00 13.49 ? 288 LEU B CD1 1 
ATOM   4700  C CD2 . LEU B 1 288 ? 26.967  -15.762 -12.636 1.00 13.45 ? 288 LEU B CD2 1 
ATOM   4701  N N   . SER B 1 289 ? 24.017  -15.448 -12.846 1.00 13.12 ? 289 SER B N   1 
ATOM   4702  C CA  . SER B 1 289 ? 23.449  -14.138 -12.452 1.00 12.78 ? 289 SER B CA  1 
ATOM   4703  C C   . SER B 1 289 ? 24.503  -13.114 -12.065 1.00 12.39 ? 289 SER B C   1 
ATOM   4704  O O   . SER B 1 289 ? 25.537  -13.375 -11.431 1.00 12.43 ? 289 SER B O   1 
ATOM   4705  C CB  . SER B 1 289 ? 22.402  -14.344 -11.365 1.00 12.91 ? 289 SER B CB  1 
ATOM   4706  O OG  . SER B 1 289 ? 22.972  -14.027 -10.120 1.00 13.27 ? 289 SER B OG  1 
ATOM   4707  N N   . ILE B 1 290 ? 24.141  -11.897 -12.363 1.00 11.86 ? 290 ILE B N   1 
ATOM   4708  C CA  . ILE B 1 290 ? 24.961  -10.680 -12.176 1.00 11.59 ? 290 ILE B CA  1 
ATOM   4709  C C   . ILE B 1 290 ? 24.060  -9.501  -11.903 1.00 11.53 ? 290 ILE B C   1 
ATOM   4710  O O   . ILE B 1 290 ? 22.874  -9.463  -12.327 1.00 11.78 ? 290 ILE B O   1 
ATOM   4711  C CB  . ILE B 1 290 ? 25.850  -10.595 -13.478 1.00 11.39 ? 290 ILE B CB  1 
ATOM   4712  C CG1 . ILE B 1 290 ? 27.334  -10.779 -13.077 1.00 11.37 ? 290 ILE B CG1 1 
ATOM   4713  C CG2 . ILE B 1 290 ? 25.619  -9.375  -14.379 1.00 11.17 ? 290 ILE B CG2 1 
ATOM   4714  C CD1 . ILE B 1 290 ? 27.783  -12.262 -12.977 1.00 11.41 ? 290 ILE B CD1 1 
ATOM   4715  N N   . PRO B 1 291 ? 24.574  -8.524  -11.162 1.00 11.20 ? 291 PRO B N   1 
ATOM   4716  C CA  . PRO B 1 291 ? 23.771  -7.305  -10.865 1.00 10.83 ? 291 PRO B CA  1 
ATOM   4717  C C   . PRO B 1 291 ? 23.506  -6.535  -12.143 1.00 10.57 ? 291 PRO B C   1 
ATOM   4718  O O   . PRO B 1 291 ? 24.414  -6.065  -12.850 1.00 10.55 ? 291 PRO B O   1 
ATOM   4719  C CB  . PRO B 1 291 ? 24.540  -6.616  -9.784  1.00 10.72 ? 291 PRO B CB  1 
ATOM   4720  C CG  . PRO B 1 291 ? 25.910  -7.223  -9.799  1.00 10.85 ? 291 PRO B CG  1 
ATOM   4721  C CD  . PRO B 1 291 ? 25.700  -8.686  -10.218 1.00 10.98 ? 291 PRO B CD  1 
ATOM   4722  N N   . CYS B 1 292 ? 22.237  -6.428  -12.501 1.00 10.35 ? 292 CYS B N   1 
ATOM   4723  C CA  . CYS B 1 292 ? 21.696  -5.773  -13.674 1.00 9.97  ? 292 CYS B CA  1 
ATOM   4724  C C   . CYS B 1 292 ? 20.549  -4.815  -13.287 1.00 9.87  ? 292 CYS B C   1 
ATOM   4725  O O   . CYS B 1 292 ? 19.852  -5.017  -12.310 1.00 9.59  ? 292 CYS B O   1 
ATOM   4726  C CB  . CYS B 1 292 ? 21.125  -6.750  -14.694 1.00 9.78  ? 292 CYS B CB  1 
ATOM   4727  S SG  . CYS B 1 292 ? 21.522  -8.499  -14.494 1.00 9.31  ? 292 CYS B SG  1 
ATOM   4728  N N   . VAL B 1 293 ? 20.357  -3.850  -14.158 1.00 10.00 ? 293 VAL B N   1 
ATOM   4729  C CA  . VAL B 1 293 ? 19.286  -2.852  -14.028 1.00 10.00 ? 293 VAL B CA  1 
ATOM   4730  C C   . VAL B 1 293 ? 18.109  -3.303  -14.924 1.00 10.02 ? 293 VAL B C   1 
ATOM   4731  O O   . VAL B 1 293 ? 18.273  -3.565  -16.114 1.00 9.75  ? 293 VAL B O   1 
ATOM   4732  C CB  . VAL B 1 293 ? 19.763  -1.437  -14.335 1.00 10.02 ? 293 VAL B CB  1 
ATOM   4733  C CG1 . VAL B 1 293 ? 18.797  -0.366  -13.806 1.00 10.07 ? 293 VAL B CG1 1 
ATOM   4734  C CG2 . VAL B 1 293 ? 21.173  -1.157  -13.845 1.00 10.11 ? 293 VAL B CG2 1 
ATOM   4735  N N   . LEU B 1 294 ? 16.963  -3.321  -14.271 1.00 10.17 ? 294 LEU B N   1 
ATOM   4736  C CA  . LEU B 1 294 ? 15.689  -3.745  -14.824 1.00 10.37 ? 294 LEU B CA  1 
ATOM   4737  C C   . LEU B 1 294 ? 14.665  -2.621  -14.960 1.00 10.55 ? 294 LEU B C   1 
ATOM   4738  O O   . LEU B 1 294 ? 14.426  -1.920  -13.964 1.00 10.52 ? 294 LEU B O   1 
ATOM   4739  C CB  . LEU B 1 294 ? 15.160  -4.841  -13.876 1.00 10.26 ? 294 LEU B CB  1 
ATOM   4740  C CG  . LEU B 1 294 ? 16.126  -5.876  -13.359 1.00 10.33 ? 294 LEU B CG  1 
ATOM   4741  C CD1 . LEU B 1 294 ? 15.392  -6.863  -12.474 1.00 10.14 ? 294 LEU B CD1 1 
ATOM   4742  C CD2 . LEU B 1 294 ? 16.792  -6.626  -14.528 1.00 10.33 ? 294 LEU B CD2 1 
ATOM   4743  N N   . GLY B 1 295 ? 14.016  -2.577  -16.111 1.00 10.74 ? 295 GLY B N   1 
ATOM   4744  C CA  . GLY B 1 295 ? 12.964  -1.599  -16.403 1.00 11.07 ? 295 GLY B CA  1 
ATOM   4745  C C   . GLY B 1 295 ? 11.926  -2.214  -17.327 1.00 11.45 ? 295 GLY B C   1 
ATOM   4746  O O   . GLY B 1 295 ? 11.992  -3.401  -17.647 1.00 11.44 ? 295 GLY B O   1 
ATOM   4747  N N   . GLU B 1 296 ? 10.975  -1.440  -17.741 1.00 12.04 ? 296 GLU B N   1 
ATOM   4748  C CA  . GLU B 1 296 ? 9.890   -1.718  -18.651 1.00 12.74 ? 296 GLU B CA  1 
ATOM   4749  C C   . GLU B 1 296 ? 10.298  -2.746  -19.703 1.00 13.06 ? 296 GLU B C   1 
ATOM   4750  O O   . GLU B 1 296 ? 9.712   -3.847  -19.808 1.00 13.23 ? 296 GLU B O   1 
ATOM   4751  C CB  . GLU B 1 296 ? 9.479   -0.454  -19.431 1.00 13.08 ? 296 GLU B CB  1 
ATOM   4752  C CG  . GLU B 1 296 ? 8.022   -0.159  -19.683 1.00 13.62 ? 296 GLU B CG  1 
ATOM   4753  C CD  . GLU B 1 296 ? 7.575   0.678   -20.828 1.00 13.84 ? 296 GLU B CD  1 
ATOM   4754  O OE1 . GLU B 1 296 ? 8.244   0.937   -21.827 1.00 14.15 ? 296 GLU B OE1 1 
ATOM   4755  O OE2 . GLU B 1 296 ? 6.382   1.063   -20.747 1.00 13.71 ? 296 GLU B OE2 1 
ATOM   4756  N N   . SER B 1 297 ? 11.382  -2.423  -20.390 1.00 13.19 ? 297 SER B N   1 
ATOM   4757  C CA  . SER B 1 297 ? 11.943  -3.158  -21.496 1.00 13.27 ? 297 SER B CA  1 
ATOM   4758  C C   . SER B 1 297 ? 12.926  -4.273  -21.225 1.00 13.43 ? 297 SER B C   1 
ATOM   4759  O O   . SER B 1 297 ? 13.611  -4.702  -22.221 1.00 13.60 ? 297 SER B O   1 
ATOM   4760  C CB  . SER B 1 297 ? 12.649  -2.146  -22.451 1.00 13.16 ? 297 SER B CB  1 
ATOM   4761  O OG  . SER B 1 297 ? 13.929  -1.889  -21.853 1.00 13.21 ? 297 SER B OG  1 
ATOM   4762  N N   . GLY B 1 298 ? 13.056  -4.764  -20.018 1.00 13.42 ? 298 GLY B N   1 
ATOM   4763  C CA  . GLY B 1 298 ? 13.917  -5.946  -19.758 1.00 13.33 ? 298 GLY B CA  1 
ATOM   4764  C C   . GLY B 1 298 ? 15.119  -5.599  -18.904 1.00 13.41 ? 298 GLY B C   1 
ATOM   4765  O O   . GLY B 1 298 ? 15.024  -4.932  -17.855 1.00 13.35 ? 298 GLY B O   1 
ATOM   4766  N N   . ILE B 1 299 ? 16.216  -6.289  -19.239 1.00 13.43 ? 299 ILE B N   1 
ATOM   4767  C CA  . ILE B 1 299 ? 17.516  -5.921  -18.634 1.00 13.36 ? 299 ILE B CA  1 
ATOM   4768  C C   . ILE B 1 299 ? 17.939  -4.794  -19.605 1.00 13.49 ? 299 ILE B C   1 
ATOM   4769  O O   . ILE B 1 299 ? 17.695  -4.955  -20.807 1.00 13.56 ? 299 ILE B O   1 
ATOM   4770  C CB  . ILE B 1 299 ? 18.564  -7.014  -18.474 1.00 13.17 ? 299 ILE B CB  1 
ATOM   4771  C CG1 . ILE B 1 299 ? 17.984  -8.221  -17.699 1.00 13.08 ? 299 ILE B CG1 1 
ATOM   4772  C CG2 . ILE B 1 299 ? 19.855  -6.508  -17.753 1.00 13.27 ? 299 ILE B CG2 1 
ATOM   4773  C CD1 . ILE B 1 299 ? 17.207  -9.163  -18.630 1.00 13.14 ? 299 ILE B CD1 1 
ATOM   4774  N N   . THR B 1 300 ? 18.338  -3.716  -19.021 1.00 13.76 ? 300 THR B N   1 
ATOM   4775  C CA  . THR B 1 300 ? 18.689  -2.510  -19.819 1.00 13.91 ? 300 THR B CA  1 
ATOM   4776  C C   . THR B 1 300 ? 20.189  -2.513  -20.002 1.00 14.01 ? 300 THR B C   1 
ATOM   4777  O O   . THR B 1 300 ? 20.718  -2.442  -21.097 1.00 13.98 ? 300 THR B O   1 
ATOM   4778  C CB  . THR B 1 300 ? 18.109  -1.239  -19.107 1.00 13.89 ? 300 THR B CB  1 
ATOM   4779  O OG1 . THR B 1 300 ? 16.969  -0.813  -19.935 1.00 13.80 ? 300 THR B OG1 1 
ATOM   4780  C CG2 . THR B 1 300 ? 19.112  -0.117  -18.850 1.00 14.05 ? 300 THR B CG2 1 
ATOM   4781  N N   . ASP B 1 301 ? 20.785  -2.730  -18.839 1.00 14.34 ? 301 ASP B N   1 
ATOM   4782  C CA  . ASP B 1 301 ? 22.252  -2.684  -18.693 1.00 14.55 ? 301 ASP B CA  1 
ATOM   4783  C C   . ASP B 1 301 ? 22.666  -3.603  -17.558 1.00 14.40 ? 301 ASP B C   1 
ATOM   4784  O O   . ASP B 1 301 ? 21.846  -4.022  -16.733 1.00 14.31 ? 301 ASP B O   1 
ATOM   4785  C CB  . ASP B 1 301 ? 22.650  -1.196  -18.556 1.00 14.83 ? 301 ASP B CB  1 
ATOM   4786  C CG  . ASP B 1 301 ? 22.298  -0.577  -17.234 1.00 14.93 ? 301 ASP B CG  1 
ATOM   4787  O OD1 . ASP B 1 301 ? 21.139  -0.482  -16.823 1.00 15.00 ? 301 ASP B OD1 1 
ATOM   4788  O OD2 . ASP B 1 301 ? 23.259  -0.193  -16.524 1.00 15.16 ? 301 ASP B OD2 1 
ATOM   4789  N N   . PHE B 1 302 ? 23.939  -3.910  -17.567 1.00 14.54 ? 302 PHE B N   1 
ATOM   4790  C CA  . PHE B 1 302 ? 24.589  -4.818  -16.610 1.00 14.70 ? 302 PHE B CA  1 
ATOM   4791  C C   . PHE B 1 302 ? 25.474  -3.985  -15.661 1.00 14.79 ? 302 PHE B C   1 
ATOM   4792  O O   . PHE B 1 302 ? 25.815  -2.835  -16.004 1.00 14.79 ? 302 PHE B O   1 
ATOM   4793  C CB  . PHE B 1 302 ? 25.419  -5.875  -17.318 1.00 14.68 ? 302 PHE B CB  1 
ATOM   4794  C CG  . PHE B 1 302 ? 25.018  -6.312  -18.684 1.00 14.75 ? 302 PHE B CG  1 
ATOM   4795  C CD1 . PHE B 1 302 ? 25.795  -5.942  -19.787 1.00 14.69 ? 302 PHE B CD1 1 
ATOM   4796  C CD2 . PHE B 1 302 ? 23.885  -7.112  -18.889 1.00 14.75 ? 302 PHE B CD2 1 
ATOM   4797  C CE1 . PHE B 1 302 ? 25.467  -6.386  -21.059 1.00 14.65 ? 302 PHE B CE1 1 
ATOM   4798  C CE2 . PHE B 1 302 ? 23.519  -7.538  -20.169 1.00 14.60 ? 302 PHE B CE2 1 
ATOM   4799  C CZ  . PHE B 1 302 ? 24.331  -7.173  -21.248 1.00 14.62 ? 302 PHE B CZ  1 
ATOM   4800  N N   . VAL B 1 303 ? 25.768  -4.584  -14.523 1.00 14.70 ? 303 VAL B N   1 
ATOM   4801  C CA  . VAL B 1 303 ? 26.686  -3.897  -13.570 1.00 14.86 ? 303 VAL B CA  1 
ATOM   4802  C C   . VAL B 1 303 ? 27.849  -4.889  -13.384 1.00 15.18 ? 303 VAL B C   1 
ATOM   4803  O O   . VAL B 1 303 ? 27.700  -6.065  -13.023 1.00 15.11 ? 303 VAL B O   1 
ATOM   4804  C CB  . VAL B 1 303 ? 26.017  -3.335  -12.341 1.00 14.74 ? 303 VAL B CB  1 
ATOM   4805  C CG1 . VAL B 1 303 ? 26.097  -4.135  -11.056 1.00 14.66 ? 303 VAL B CG1 1 
ATOM   4806  C CG2 . VAL B 1 303 ? 26.571  -1.936  -12.019 1.00 14.73 ? 303 VAL B CG2 1 
ATOM   4807  N N   . LYS B 1 304 ? 28.988  -4.364  -13.800 1.00 15.43 ? 304 LYS B N   1 
ATOM   4808  C CA  . LYS B 1 304 ? 30.274  -5.073  -13.780 1.00 15.59 ? 304 LYS B CA  1 
ATOM   4809  C C   . LYS B 1 304 ? 31.047  -4.685  -12.527 1.00 15.89 ? 304 LYS B C   1 
ATOM   4810  O O   . LYS B 1 304 ? 31.744  -3.669  -12.395 1.00 15.99 ? 304 LYS B O   1 
ATOM   4811  C CB  . LYS B 1 304 ? 31.034  -4.805  -15.064 1.00 15.56 ? 304 LYS B CB  1 
ATOM   4812  C CG  . LYS B 1 304 ? 31.029  -3.338  -15.473 1.00 15.77 ? 304 LYS B CG  1 
ATOM   4813  C CD  . LYS B 1 304 ? 31.117  -3.067  -16.943 1.00 15.96 ? 304 LYS B CD  1 
ATOM   4814  C CE  . LYS B 1 304 ? 32.513  -3.200  -17.503 1.00 16.29 ? 304 LYS B CE  1 
ATOM   4815  N NZ  . LYS B 1 304 ? 32.799  -4.631  -17.867 1.00 16.66 ? 304 LYS B NZ  1 
ATOM   4816  N N   . VAL B 1 305 ? 30.894  -5.535  -11.546 1.00 16.25 ? 305 VAL B N   1 
ATOM   4817  C CA  . VAL B 1 305 ? 31.478  -5.524  -10.232 1.00 16.70 ? 305 VAL B CA  1 
ATOM   4818  C C   . VAL B 1 305 ? 32.992  -5.796  -10.253 1.00 17.13 ? 305 VAL B C   1 
ATOM   4819  O O   . VAL B 1 305 ? 33.546  -6.313  -11.220 1.00 17.06 ? 305 VAL B O   1 
ATOM   4820  C CB  . VAL B 1 305 ? 30.738  -6.603  -9.384  1.00 16.55 ? 305 VAL B CB  1 
ATOM   4821  C CG1 . VAL B 1 305 ? 29.216  -6.573  -9.608  1.00 16.57 ? 305 VAL B CG1 1 
ATOM   4822  C CG2 . VAL B 1 305 ? 31.272  -8.005  -9.624  1.00 16.50 ? 305 VAL B CG2 1 
ATOM   4823  N N   . ASN B 1 306 ? 33.551  -5.645  -9.067  1.00 17.77 ? 306 ASN B N   1 
ATOM   4824  C CA  . ASN B 1 306 ? 34.960  -5.865  -8.752  1.00 18.43 ? 306 ASN B CA  1 
ATOM   4825  C C   . ASN B 1 306 ? 35.165  -7.144  -7.929  1.00 18.76 ? 306 ASN B C   1 
ATOM   4826  O O   . ASN B 1 306 ? 35.321  -7.081  -6.694  1.00 18.80 ? 306 ASN B O   1 
ATOM   4827  C CB  . ASN B 1 306 ? 35.545  -4.648  -8.022  1.00 18.63 ? 306 ASN B CB  1 
ATOM   4828  C CG  . ASN B 1 306 ? 34.830  -4.291  -6.731  1.00 18.87 ? 306 ASN B CG  1 
ATOM   4829  O OD1 . ASN B 1 306 ? 35.386  -3.503  -5.933  1.00 19.08 ? 306 ASN B OD1 1 
ATOM   4830  N ND2 . ASN B 1 306 ? 33.630  -4.826  -6.478  1.00 18.69 ? 306 ASN B ND2 1 
ATOM   4831  N N   . MET B 1 307 ? 35.157  -8.280  -8.611  1.00 19.22 ? 307 MET B N   1 
ATOM   4832  C CA  . MET B 1 307 ? 35.390  -9.545  -7.845  1.00 19.75 ? 307 MET B CA  1 
ATOM   4833  C C   . MET B 1 307 ? 36.927  -9.525  -7.662  1.00 20.06 ? 307 MET B C   1 
ATOM   4834  O O   . MET B 1 307 ? 37.618  -8.885  -8.489  1.00 20.21 ? 307 MET B O   1 
ATOM   4835  C CB  . MET B 1 307 ? 34.777  -10.747 -8.439  1.00 20.03 ? 307 MET B CB  1 
ATOM   4836  C CG  . MET B 1 307 ? 33.502  -10.661 -9.223  1.00 20.18 ? 307 MET B CG  1 
ATOM   4837  S SD  . MET B 1 307 ? 34.087  -10.127 -10.891 1.00 20.81 ? 307 MET B SD  1 
ATOM   4838  C CE  . MET B 1 307 ? 32.752  -10.759 -11.926 1.00 20.83 ? 307 MET B CE  1 
ATOM   4839  N N   . THR B 1 308 ? 37.379  -9.933  -6.486  1.00 20.16 ? 308 THR B N   1 
ATOM   4840  C CA  . THR B 1 308 ? 38.806  -10.055 -6.184  1.00 19.94 ? 308 THR B CA  1 
ATOM   4841  C C   . THR B 1 308 ? 39.306  -11.204 -7.074  1.00 19.79 ? 308 THR B C   1 
ATOM   4842  O O   . THR B 1 308 ? 38.468  -12.025 -7.474  1.00 19.80 ? 308 THR B O   1 
ATOM   4843  C CB  . THR B 1 308 ? 39.197  -10.325 -4.699  1.00 20.01 ? 308 THR B CB  1 
ATOM   4844  O OG1 . THR B 1 308 ? 40.616  -10.800 -4.744  1.00 20.19 ? 308 THR B OG1 1 
ATOM   4845  C CG2 . THR B 1 308 ? 38.372  -11.330 -3.916  1.00 19.83 ? 308 THR B CG2 1 
ATOM   4846  N N   . ALA B 1 309 ? 40.582  -11.230 -7.311  1.00 19.70 ? 309 ALA B N   1 
ATOM   4847  C CA  . ALA B 1 309 ? 41.216  -12.252 -8.157  1.00 19.57 ? 309 ALA B CA  1 
ATOM   4848  C C   . ALA B 1 309 ? 40.326  -13.488 -8.228  1.00 19.37 ? 309 ALA B C   1 
ATOM   4849  O O   . ALA B 1 309 ? 39.677  -13.676 -9.279  1.00 19.36 ? 309 ALA B O   1 
ATOM   4850  C CB  . ALA B 1 309 ? 42.629  -12.541 -7.698  1.00 19.59 ? 309 ALA B CB  1 
ATOM   4851  N N   . GLU B 1 310 ? 40.077  -14.099 -7.089  1.00 19.25 ? 310 GLU B N   1 
ATOM   4852  C CA  . GLU B 1 310 ? 39.265  -15.323 -7.043  1.00 19.31 ? 310 GLU B CA  1 
ATOM   4853  C C   . GLU B 1 310 ? 37.774  -15.082 -7.011  1.00 18.84 ? 310 GLU B C   1 
ATOM   4854  O O   . GLU B 1 310 ? 37.031  -16.028 -7.395  1.00 18.76 ? 310 GLU B O   1 
ATOM   4855  C CB  . GLU B 1 310 ? 39.626  -16.253 -5.886  1.00 19.88 ? 310 GLU B CB  1 
ATOM   4856  C CG  . GLU B 1 310 ? 38.923  -16.013 -4.549  1.00 20.46 ? 310 GLU B CG  1 
ATOM   4857  C CD  . GLU B 1 310 ? 39.285  -14.741 -3.865  1.00 20.86 ? 310 GLU B CD  1 
ATOM   4858  O OE1 . GLU B 1 310 ? 39.203  -14.620 -2.656  1.00 21.30 ? 310 GLU B OE1 1 
ATOM   4859  O OE2 . GLU B 1 310 ? 39.723  -13.832 -4.600  1.00 21.09 ? 310 GLU B OE2 1 
ATOM   4860  N N   . GLU B 1 311 ? 37.278  -14.015 -6.410  1.00 18.29 ? 311 GLU B N   1 
ATOM   4861  C CA  . GLU B 1 311 ? 35.790  -13.775 -6.544  1.00 17.85 ? 311 GLU B CA  1 
ATOM   4862  C C   . GLU B 1 311 ? 35.509  -14.006 -8.024  1.00 18.06 ? 311 GLU B C   1 
ATOM   4863  O O   . GLU B 1 311 ? 34.747  -14.925 -8.393  1.00 18.06 ? 311 GLU B O   1 
ATOM   4864  C CB  . GLU B 1 311 ? 35.378  -12.481 -5.938  1.00 17.26 ? 311 GLU B CB  1 
ATOM   4865  C CG  . GLU B 1 311 ? 35.361  -12.353 -4.438  1.00 16.73 ? 311 GLU B CG  1 
ATOM   4866  C CD  . GLU B 1 311 ? 35.136  -11.101 -3.695  1.00 16.35 ? 311 GLU B CD  1 
ATOM   4867  O OE1 . GLU B 1 311 ? 34.739  -10.034 -4.111  1.00 16.17 ? 311 GLU B OE1 1 
ATOM   4868  O OE2 . GLU B 1 311 ? 35.395  -11.224 -2.467  1.00 16.08 ? 311 GLU B OE2 1 
ATOM   4869  N N   . GLU B 1 312 ? 36.419  -13.506 -8.850  1.00 18.34 ? 312 GLU B N   1 
ATOM   4870  C CA  . GLU B 1 312 ? 36.434  -13.677 -10.299 1.00 18.62 ? 312 GLU B CA  1 
ATOM   4871  C C   . GLU B 1 312 ? 36.785  -15.128 -10.646 1.00 18.78 ? 312 GLU B C   1 
ATOM   4872  O O   . GLU B 1 312 ? 36.350  -15.701 -11.648 1.00 18.76 ? 312 GLU B O   1 
ATOM   4873  C CB  . GLU B 1 312 ? 37.442  -12.794 -11.002 1.00 18.69 ? 312 GLU B CB  1 
ATOM   4874  C CG  . GLU B 1 312 ? 37.247  -12.494 -12.490 1.00 18.84 ? 312 GLU B CG  1 
ATOM   4875  C CD  . GLU B 1 312 ? 38.349  -11.641 -13.085 1.00 18.96 ? 312 GLU B CD  1 
ATOM   4876  O OE1 . GLU B 1 312 ? 38.186  -10.525 -13.571 1.00 18.93 ? 312 GLU B OE1 1 
ATOM   4877  O OE2 . GLU B 1 312 ? 39.456  -12.234 -13.040 1.00 18.85 ? 312 GLU B OE2 1 
ATOM   4878  N N   . GLY B 1 313 ? 37.593  -15.684 -9.781  1.00 19.07 ? 313 GLY B N   1 
ATOM   4879  C CA  . GLY B 1 313 ? 38.050  -17.090 -9.841  1.00 19.56 ? 313 GLY B CA  1 
ATOM   4880  C C   . GLY B 1 313 ? 36.794  -17.966 -9.820  1.00 19.98 ? 313 GLY B C   1 
ATOM   4881  O O   . GLY B 1 313 ? 36.379  -18.506 -10.851 1.00 20.08 ? 313 GLY B O   1 
ATOM   4882  N N   . LEU B 1 314 ? 36.200  -18.005 -8.642  1.00 20.35 ? 314 LEU B N   1 
ATOM   4883  C CA  . LEU B 1 314 ? 34.963  -18.741 -8.368  1.00 20.48 ? 314 LEU B CA  1 
ATOM   4884  C C   . LEU B 1 314 ? 33.955  -18.479 -9.477  1.00 20.65 ? 314 LEU B C   1 
ATOM   4885  O O   . LEU B 1 314 ? 33.561  -19.430 -10.186 1.00 20.62 ? 314 LEU B O   1 
ATOM   4886  C CB  . LEU B 1 314 ? 34.480  -18.386 -6.959  1.00 20.35 ? 314 LEU B CB  1 
ATOM   4887  C CG  . LEU B 1 314 ? 35.268  -19.077 -5.845  1.00 20.31 ? 314 LEU B CG  1 
ATOM   4888  C CD1 . LEU B 1 314 ? 36.565  -18.334 -5.579  1.00 20.43 ? 314 LEU B CD1 1 
ATOM   4889  C CD2 . LEU B 1 314 ? 34.430  -19.133 -4.580  1.00 20.31 ? 314 LEU B CD2 1 
ATOM   4890  N N   . LEU B 1 315 ? 33.586  -17.215 -9.628  1.00 20.81 ? 315 LEU B N   1 
ATOM   4891  C CA  . LEU B 1 315 ? 32.638  -16.913 -10.729 1.00 21.18 ? 315 LEU B CA  1 
ATOM   4892  C C   . LEU B 1 315 ? 33.123  -17.576 -12.003 1.00 21.56 ? 315 LEU B C   1 
ATOM   4893  O O   . LEU B 1 315 ? 32.348  -18.415 -12.536 1.00 21.69 ? 315 LEU B O   1 
ATOM   4894  C CB  . LEU B 1 315 ? 32.320  -15.424 -10.762 1.00 20.93 ? 315 LEU B CB  1 
ATOM   4895  C CG  . LEU B 1 315 ? 30.809  -15.215 -10.507 1.00 20.71 ? 315 LEU B CG  1 
ATOM   4896  C CD1 . LEU B 1 315 ? 30.531  -13.885 -9.893  1.00 20.77 ? 315 LEU B CD1 1 
ATOM   4897  C CD2 . LEU B 1 315 ? 30.156  -15.382 -11.879 1.00 20.73 ? 315 LEU B CD2 1 
ATOM   4898  N N   . LYS B 1 316 ? 34.369  -17.340 -12.383 1.00 21.87 ? 316 LYS B N   1 
ATOM   4899  C CA  . LYS B 1 316 ? 34.908  -17.966 -13.602 1.00 22.22 ? 316 LYS B CA  1 
ATOM   4900  C C   . LYS B 1 316 ? 34.586  -19.468 -13.608 1.00 22.49 ? 316 LYS B C   1 
ATOM   4901  O O   . LYS B 1 316 ? 34.292  -20.038 -14.662 1.00 22.46 ? 316 LYS B O   1 
ATOM   4902  C CB  . LYS B 1 316 ? 36.399  -17.781 -13.750 1.00 22.38 ? 316 LYS B CB  1 
ATOM   4903  C CG  . LYS B 1 316 ? 36.880  -16.512 -14.397 1.00 22.64 ? 316 LYS B CG  1 
ATOM   4904  C CD  . LYS B 1 316 ? 38.382  -16.520 -14.728 1.00 22.72 ? 316 LYS B CD  1 
ATOM   4905  C CE  . LYS B 1 316 ? 38.675  -15.424 -15.760 1.00 22.78 ? 316 LYS B CE  1 
ATOM   4906  N NZ  . LYS B 1 316 ? 40.067  -14.928 -15.627 1.00 22.79 ? 316 LYS B NZ  1 
ATOM   4907  N N   . LYS B 1 317 ? 34.643  -20.071 -12.444 1.00 22.78 ? 317 LYS B N   1 
ATOM   4908  C CA  . LYS B 1 317 ? 34.402  -21.468 -12.172 1.00 23.15 ? 317 LYS B CA  1 
ATOM   4909  C C   . LYS B 1 317 ? 32.956  -21.896 -12.367 1.00 23.47 ? 317 LYS B C   1 
ATOM   4910  O O   . LYS B 1 317 ? 32.720  -22.944 -13.028 1.00 23.65 ? 317 LYS B O   1 
ATOM   4911  C CB  . LYS B 1 317 ? 34.814  -21.844 -10.746 1.00 23.20 ? 317 LYS B CB  1 
ATOM   4912  C CG  . LYS B 1 317 ? 34.394  -23.244 -10.318 1.00 23.25 ? 317 LYS B CG  1 
ATOM   4913  C CD  . LYS B 1 317 ? 34.298  -23.333 -8.799  1.00 23.43 ? 317 LYS B CD  1 
ATOM   4914  C CE  . LYS B 1 317 ? 34.077  -24.791 -8.400  1.00 23.59 ? 317 LYS B CE  1 
ATOM   4915  N NZ  . LYS B 1 317 ? 35.300  -25.572 -8.783  1.00 23.83 ? 317 LYS B NZ  1 
ATOM   4916  N N   . SER B 1 318 ? 32.031  -21.273 -11.656 1.00 23.76 ? 318 SER B N   1 
ATOM   4917  C CA  . SER B 1 318 ? 30.600  -21.586 -11.833 1.00 23.91 ? 318 SER B CA  1 
ATOM   4918  C C   . SER B 1 318 ? 30.366  -21.645 -13.358 1.00 24.03 ? 318 SER B C   1 
ATOM   4919  O O   . SER B 1 318 ? 30.091  -22.694 -13.907 1.00 24.08 ? 318 SER B O   1 
ATOM   4920  C CB  . SER B 1 318 ? 29.612  -20.595 -11.283 1.00 23.88 ? 318 SER B CB  1 
ATOM   4921  O OG  . SER B 1 318 ? 29.344  -20.689 -9.931  1.00 24.04 ? 318 SER B OG  1 
ATOM   4922  N N   . ALA B 1 319 ? 30.514  -20.476 -13.918 1.00 24.36 ? 319 ALA B N   1 
ATOM   4923  C CA  . ALA B 1 319 ? 30.343  -20.218 -15.329 1.00 25.05 ? 319 ALA B CA  1 
ATOM   4924  C C   . ALA B 1 319 ? 30.446  -21.538 -16.104 1.00 25.56 ? 319 ALA B C   1 
ATOM   4925  O O   . ALA B 1 319 ? 29.506  -22.027 -16.706 1.00 25.61 ? 319 ALA B O   1 
ATOM   4926  C CB  . ALA B 1 319 ? 31.455  -19.297 -15.802 1.00 25.19 ? 319 ALA B CB  1 
ATOM   4927  N N   . ASP B 1 320 ? 31.616  -22.104 -15.880 1.00 26.21 ? 320 ASP B N   1 
ATOM   4928  C CA  . ASP B 1 320 ? 32.044  -23.364 -16.474 1.00 26.89 ? 320 ASP B CA  1 
ATOM   4929  C C   . ASP B 1 320 ? 31.247  -24.545 -16.003 1.00 27.22 ? 320 ASP B C   1 
ATOM   4930  O O   . ASP B 1 320 ? 30.771  -25.286 -16.927 1.00 27.24 ? 320 ASP B O   1 
ATOM   4931  C CB  . ASP B 1 320 ? 33.582  -23.446 -16.344 1.00 27.19 ? 320 ASP B CB  1 
ATOM   4932  C CG  . ASP B 1 320 ? 34.196  -22.644 -17.500 1.00 27.54 ? 320 ASP B CG  1 
ATOM   4933  O OD1 . ASP B 1 320 ? 33.515  -22.433 -18.531 1.00 27.69 ? 320 ASP B OD1 1 
ATOM   4934  O OD2 . ASP B 1 320 ? 35.369  -22.235 -17.356 1.00 27.68 ? 320 ASP B OD2 1 
ATOM   4935  N N   . THR B 1 321 ? 31.166  -24.847 -14.719 1.00 27.51 ? 321 THR B N   1 
ATOM   4936  C CA  . THR B 1 321 ? 30.280  -25.935 -14.264 1.00 27.78 ? 321 THR B CA  1 
ATOM   4937  C C   . THR B 1 321 ? 29.013  -25.850 -15.156 1.00 28.23 ? 321 THR B C   1 
ATOM   4938  O O   . THR B 1 321 ? 28.808  -26.611 -16.100 1.00 28.38 ? 321 THR B O   1 
ATOM   4939  C CB  . THR B 1 321 ? 29.806  -25.866 -12.775 1.00 27.53 ? 321 THR B CB  1 
ATOM   4940  O OG1 . THR B 1 321 ? 30.957  -25.708 -11.924 1.00 27.37 ? 321 THR B OG1 1 
ATOM   4941  C CG2 . THR B 1 321 ? 28.950  -27.095 -12.390 1.00 27.49 ? 321 THR B CG2 1 
ATOM   4942  N N   . LEU B 1 322 ? 28.329  -24.751 -14.881 1.00 28.67 ? 322 LEU B N   1 
ATOM   4943  C CA  . LEU B 1 322 ? 27.116  -24.377 -15.584 1.00 29.30 ? 322 LEU B CA  1 
ATOM   4944  C C   . LEU B 1 322 ? 27.260  -24.622 -17.084 1.00 29.71 ? 322 LEU B C   1 
ATOM   4945  O O   . LEU B 1 322 ? 26.275  -24.976 -17.729 1.00 29.72 ? 322 LEU B O   1 
ATOM   4946  C CB  . LEU B 1 322 ? 26.821  -22.906 -15.267 1.00 29.39 ? 322 LEU B CB  1 
ATOM   4947  C CG  . LEU B 1 322 ? 25.732  -22.534 -14.295 1.00 29.41 ? 322 LEU B CG  1 
ATOM   4948  C CD1 . LEU B 1 322 ? 25.728  -21.020 -14.056 1.00 29.38 ? 322 LEU B CD1 1 
ATOM   4949  C CD2 . LEU B 1 322 ? 24.366  -22.953 -14.870 1.00 29.43 ? 322 LEU B CD2 1 
ATOM   4950  N N   . TRP B 1 323 ? 28.472  -24.443 -17.587 1.00 30.33 ? 323 TRP B N   1 
ATOM   4951  C CA  . TRP B 1 323 ? 28.769  -24.523 -18.993 1.00 30.95 ? 323 TRP B CA  1 
ATOM   4952  C C   . TRP B 1 323 ? 28.692  -25.891 -19.639 1.00 31.53 ? 323 TRP B C   1 
ATOM   4953  O O   . TRP B 1 323 ? 27.901  -25.939 -20.634 1.00 31.64 ? 323 TRP B O   1 
ATOM   4954  C CB  . TRP B 1 323 ? 30.128  -23.884 -19.393 1.00 30.83 ? 323 TRP B CB  1 
ATOM   4955  C CG  . TRP B 1 323 ? 30.423  -24.077 -20.854 1.00 30.66 ? 323 TRP B CG  1 
ATOM   4956  C CD1 . TRP B 1 323 ? 31.484  -24.724 -21.408 1.00 30.66 ? 323 TRP B CD1 1 
ATOM   4957  C CD2 . TRP B 1 323 ? 29.494  -23.827 -21.922 1.00 30.53 ? 323 TRP B CD2 1 
ATOM   4958  N NE1 . TRP B 1 323 ? 31.338  -24.765 -22.775 1.00 30.66 ? 323 TRP B NE1 1 
ATOM   4959  C CE2 . TRP B 1 323 ? 30.115  -24.250 -23.111 1.00 30.52 ? 323 TRP B CE2 1 
ATOM   4960  C CE3 . TRP B 1 323 ? 28.233  -23.248 -21.973 1.00 30.47 ? 323 TRP B CE3 1 
ATOM   4961  C CZ2 . TRP B 1 323 ? 29.515  -24.104 -24.349 1.00 30.39 ? 323 TRP B CZ2 1 
ATOM   4962  C CZ3 . TRP B 1 323 ? 27.633  -23.101 -23.207 1.00 30.42 ? 323 TRP B CZ3 1 
ATOM   4963  C CH2 . TRP B 1 323 ? 28.262  -23.522 -24.371 1.00 30.38 ? 323 TRP B CH2 1 
ATOM   4964  N N   . ASN B 1 324 ? 29.551  -26.856 -19.290 1.00 32.19 ? 324 ASN B N   1 
ATOM   4965  C CA  . ASN B 1 324 ? 29.446  -28.090 -20.107 1.00 32.86 ? 324 ASN B CA  1 
ATOM   4966  C C   . ASN B 1 324 ? 27.935  -28.467 -20.028 1.00 33.05 ? 324 ASN B C   1 
ATOM   4967  O O   . ASN B 1 324 ? 27.396  -28.489 -21.124 1.00 33.16 ? 324 ASN B O   1 
ATOM   4968  C CB  . ASN B 1 324 ? 30.281  -29.316 -19.942 1.00 33.28 ? 324 ASN B CB  1 
ATOM   4969  C CG  . ASN B 1 324 ? 30.561  -30.000 -21.302 1.00 33.50 ? 324 ASN B CG  1 
ATOM   4970  O OD1 . ASN B 1 324 ? 31.193  -31.080 -21.318 1.00 33.71 ? 324 ASN B OD1 1 
ATOM   4971  N ND2 . ASN B 1 324 ? 30.207  -29.336 -22.404 1.00 33.36 ? 324 ASN B ND2 1 
ATOM   4972  N N   . MET B 1 325 ? 27.453  -28.476 -18.806 1.00 33.11 ? 325 MET B N   1 
ATOM   4973  C CA  . MET B 1 325 ? 26.038  -28.831 -18.570 1.00 33.22 ? 325 MET B CA  1 
ATOM   4974  C C   . MET B 1 325 ? 25.158  -28.501 -19.782 1.00 33.50 ? 325 MET B C   1 
ATOM   4975  O O   . MET B 1 325 ? 24.388  -29.372 -20.238 1.00 33.60 ? 325 MET B O   1 
ATOM   4976  C CB  . MET B 1 325 ? 25.534  -28.214 -17.288 1.00 32.96 ? 325 MET B CB  1 
ATOM   4977  C CG  . MET B 1 325 ? 24.369  -29.044 -16.772 1.00 32.82 ? 325 MET B CG  1 
ATOM   4978  S SD  . MET B 1 325 ? 25.042  -30.078 -15.415 1.00 32.74 ? 325 MET B SD  1 
ATOM   4979  C CE  . MET B 1 325 ? 25.196  -28.792 -14.138 1.00 32.57 ? 325 MET B CE  1 
ATOM   4980  N N   . GLN B 1 326 ? 25.382  -27.358 -20.370 1.00 33.65 ? 326 GLN B N   1 
ATOM   4981  C CA  . GLN B 1 326 ? 24.754  -26.840 -21.547 1.00 34.11 ? 326 GLN B CA  1 
ATOM   4982  C C   . GLN B 1 326 ? 25.144  -27.449 -22.882 1.00 34.77 ? 326 GLN B C   1 
ATOM   4983  O O   . GLN B 1 326 ? 24.754  -26.833 -23.934 1.00 34.93 ? 326 GLN B O   1 
ATOM   4984  C CB  . GLN B 1 326 ? 24.965  -25.300 -21.599 1.00 33.81 ? 326 GLN B CB  1 
ATOM   4985  C CG  . GLN B 1 326 ? 24.871  -24.637 -20.258 1.00 33.36 ? 326 GLN B CG  1 
ATOM   4986  C CD  . GLN B 1 326 ? 24.688  -23.144 -20.300 1.00 33.07 ? 326 GLN B CD  1 
ATOM   4987  O OE1 . GLN B 1 326 ? 24.467  -22.546 -21.341 1.00 32.89 ? 326 GLN B OE1 1 
ATOM   4988  N NE2 . GLN B 1 326 ? 24.729  -22.569 -19.103 1.00 32.91 ? 326 GLN B NE2 1 
ATOM   4989  N N   . LYS B 1 327 ? 25.891  -28.510 -22.965 1.00 35.50 ? 327 LYS B N   1 
ATOM   4990  C CA  . LYS B 1 327 ? 26.141  -29.200 -24.269 1.00 36.48 ? 327 LYS B CA  1 
ATOM   4991  C C   . LYS B 1 327 ? 24.804  -29.953 -24.477 1.00 37.44 ? 327 LYS B C   1 
ATOM   4992  O O   . LYS B 1 327 ? 24.668  -31.166 -24.307 1.00 37.57 ? 327 LYS B O   1 
ATOM   4993  C CB  . LYS B 1 327 ? 27.321  -30.083 -24.298 1.00 36.28 ? 327 LYS B CB  1 
ATOM   4994  C CG  . LYS B 1 327 ? 27.345  -31.455 -23.665 1.00 36.09 ? 327 LYS B CG  1 
ATOM   4995  C CD  . LYS B 1 327 ? 26.895  -31.439 -22.219 1.00 36.01 ? 327 LYS B CD  1 
ATOM   4996  C CE  . LYS B 1 327 ? 26.586  -32.818 -21.676 1.00 35.89 ? 327 LYS B CE  1 
ATOM   4997  N NZ  . LYS B 1 327 ? 25.939  -32.725 -20.340 1.00 35.66 ? 327 LYS B NZ  1 
ATOM   4998  N N   . ASN B 1 328 ? 23.813  -29.134 -24.859 1.00 38.42 ? 328 ASN B N   1 
ATOM   4999  C CA  . ASN B 1 328 ? 22.428  -29.574 -24.861 1.00 39.26 ? 328 ASN B CA  1 
ATOM   5000  C C   . ASN B 1 328 ? 21.695  -29.783 -26.159 1.00 40.13 ? 328 ASN B C   1 
ATOM   5001  O O   . ASN B 1 328 ? 22.095  -29.536 -27.280 1.00 40.25 ? 328 ASN B O   1 
ATOM   5002  C CB  . ASN B 1 328 ? 21.651  -28.583 -23.920 1.00 39.06 ? 328 ASN B CB  1 
ATOM   5003  C CG  . ASN B 1 328 ? 21.429  -29.216 -22.567 1.00 38.84 ? 328 ASN B CG  1 
ATOM   5004  O OD1 . ASN B 1 328 ? 20.495  -28.839 -21.856 1.00 38.77 ? 328 ASN B OD1 1 
ATOM   5005  N ND2 . ASN B 1 328 ? 22.239  -30.199 -22.210 1.00 38.91 ? 328 ASN B ND2 1 
ATOM   5006  N N   . LEU B 1 329 ? 20.507  -30.300 -25.939 1.00 41.17 ? 329 LEU B N   1 
ATOM   5007  C CA  . LEU B 1 329 ? 19.382  -30.705 -26.722 1.00 42.09 ? 329 LEU B CA  1 
ATOM   5008  C C   . LEU B 1 329 ? 18.746  -31.895 -25.966 1.00 42.82 ? 329 LEU B C   1 
ATOM   5009  O O   . LEU B 1 329 ? 19.187  -32.134 -24.816 1.00 42.93 ? 329 LEU B O   1 
ATOM   5010  C CB  . LEU B 1 329 ? 19.749  -30.978 -28.169 1.00 42.14 ? 329 LEU B CB  1 
ATOM   5011  C CG  . LEU B 1 329 ? 18.653  -30.670 -29.192 1.00 42.28 ? 329 LEU B CG  1 
ATOM   5012  C CD1 . LEU B 1 329 ? 18.446  -29.158 -29.341 1.00 42.27 ? 329 LEU B CD1 1 
ATOM   5013  C CD2 . LEU B 1 329 ? 19.029  -31.309 -30.519 1.00 42.29 ? 329 LEU B CD2 1 
ATOM   5014  N N   . GLU B 1 330 ? 17.730  -32.527 -26.523 1.00 43.65 ? 330 GLU B N   1 
ATOM   5015  C CA  . GLU B 1 330 ? 17.110  -33.685 -25.874 1.00 44.37 ? 330 GLU B CA  1 
ATOM   5016  C C   . GLU B 1 330 ? 17.945  -34.951 -26.096 1.00 44.67 ? 330 GLU B C   1 
ATOM   5017  O O   . GLU B 1 330 ? 17.708  -35.994 -25.452 1.00 44.72 ? 330 GLU B O   1 
ATOM   5018  C CB  . GLU B 1 330 ? 15.691  -34.021 -26.339 1.00 44.68 ? 330 GLU B CB  1 
ATOM   5019  C CG  . GLU B 1 330 ? 14.878  -34.889 -25.367 1.00 45.13 ? 330 GLU B CG  1 
ATOM   5020  C CD  . GLU B 1 330 ? 13.794  -35.766 -25.893 1.00 45.40 ? 330 GLU B CD  1 
ATOM   5021  O OE1 . GLU B 1 330 ? 12.610  -35.449 -25.970 1.00 45.50 ? 330 GLU B OE1 1 
ATOM   5022  O OE2 . GLU B 1 330 ? 14.188  -36.928 -26.208 1.00 45.54 ? 330 GLU B OE2 1 
ATOM   5023  N N   . LEU B 1 331 ? 18.912  -34.846 -26.990 1.00 44.93 ? 331 LEU B N   1 
ATOM   5024  C CA  . LEU B 1 331 ? 19.830  -35.917 -27.371 1.00 45.00 ? 331 LEU B CA  1 
ATOM   5025  C C   . LEU B 1 331 ? 20.197  -36.784 -26.166 1.00 45.01 ? 331 LEU B C   1 
ATOM   5026  O O   . LEU B 1 331 ? 20.372  -36.150 -25.091 1.00 45.05 ? 331 LEU B O   1 
ATOM   5027  C CB  . LEU B 1 331 ? 21.050  -35.282 -28.050 1.00 45.06 ? 331 LEU B CB  1 
ATOM   5028  C CG  . LEU B 1 331 ? 21.983  -36.166 -28.851 1.00 45.23 ? 331 LEU B CG  1 
ATOM   5029  C CD1 . LEU B 1 331 ? 23.049  -35.320 -29.563 1.00 45.24 ? 331 LEU B CD1 1 
ATOM   5030  C CD2 . LEU B 1 331 ? 22.695  -37.189 -27.964 1.00 45.16 ? 331 LEU B CD2 1 
ATOM   5031  N N   . SER C 1 1   ? 36.175  4.703   -20.012 1.00 23.65 ? 1   SER C N   1 
ATOM   5032  C CA  . SER C 1 1   ? 37.076  5.715   -19.521 1.00 23.75 ? 1   SER C CA  1 
ATOM   5033  C C   . SER C 1 1   ? 36.587  6.356   -18.220 1.00 23.75 ? 1   SER C C   1 
ATOM   5034  O O   . SER C 1 1   ? 37.378  6.680   -17.302 1.00 23.74 ? 1   SER C O   1 
ATOM   5035  C CB  . SER C 1 1   ? 37.203  6.817   -20.593 1.00 23.79 ? 1   SER C CB  1 
ATOM   5036  O OG  . SER C 1 1   ? 35.934  7.503   -20.620 1.00 23.83 ? 1   SER C OG  1 
ATOM   5037  N N   . THR C 1 2   ? 35.294  6.592   -18.178 1.00 23.67 ? 2   THR C N   1 
ATOM   5038  C CA  . THR C 1 2   ? 34.505  7.179   -17.140 1.00 23.62 ? 2   THR C CA  1 
ATOM   5039  C C   . THR C 1 2   ? 33.946  6.178   -16.134 1.00 23.58 ? 2   THR C C   1 
ATOM   5040  O O   . THR C 1 2   ? 33.671  5.031   -16.546 1.00 23.61 ? 2   THR C O   1 
ATOM   5041  C CB  . THR C 1 2   ? 33.137  7.803   -17.735 1.00 23.70 ? 2   THR C CB  1 
ATOM   5042  O OG1 . THR C 1 2   ? 33.478  8.268   -19.059 1.00 24.00 ? 2   THR C OG1 1 
ATOM   5043  C CG2 . THR C 1 2   ? 32.528  8.847   -16.817 1.00 23.73 ? 2   THR C CG2 1 
ATOM   5044  N N   . VAL C 1 3   ? 33.539  6.729   -14.983 1.00 23.42 ? 3   VAL C N   1 
ATOM   5045  C CA  . VAL C 1 3   ? 32.880  5.818   -13.996 1.00 23.26 ? 3   VAL C CA  1 
ATOM   5046  C C   . VAL C 1 3   ? 31.653  5.239   -14.740 1.00 23.20 ? 3   VAL C C   1 
ATOM   5047  O O   . VAL C 1 3   ? 31.495  4.015   -14.727 1.00 23.10 ? 3   VAL C O   1 
ATOM   5048  C CB  . VAL C 1 3   ? 32.623  6.399   -12.626 1.00 23.10 ? 3   VAL C CB  1 
ATOM   5049  C CG1 . VAL C 1 3   ? 33.117  7.839   -12.448 1.00 23.08 ? 3   VAL C CG1 1 
ATOM   5050  C CG2 . VAL C 1 3   ? 31.176  6.284   -12.134 1.00 23.08 ? 3   VAL C CG2 1 
ATOM   5051  N N   . LYS C 1 4   ? 30.880  6.105   -15.379 1.00 23.20 ? 4   LYS C N   1 
ATOM   5052  C CA  . LYS C 1 4   ? 29.727  5.577   -16.130 1.00 23.41 ? 4   LYS C CA  1 
ATOM   5053  C C   . LYS C 1 4   ? 30.260  4.424   -17.001 1.00 23.74 ? 4   LYS C C   1 
ATOM   5054  O O   . LYS C 1 4   ? 29.979  3.265   -16.706 1.00 23.81 ? 4   LYS C O   1 
ATOM   5055  C CB  . LYS C 1 4   ? 28.936  6.490   -17.000 1.00 23.24 ? 4   LYS C CB  1 
ATOM   5056  C CG  . LYS C 1 4   ? 27.784  7.261   -16.487 1.00 23.14 ? 4   LYS C CG  1 
ATOM   5057  C CD  . LYS C 1 4   ? 26.763  6.589   -15.658 1.00 23.22 ? 4   LYS C CD  1 
ATOM   5058  C CE  . LYS C 1 4   ? 27.159  5.830   -14.432 1.00 23.34 ? 4   LYS C CE  1 
ATOM   5059  N NZ  . LYS C 1 4   ? 28.356  6.352   -13.722 1.00 23.24 ? 4   LYS C NZ  1 
ATOM   5060  N N   . GLU C 1 5   ? 31.105  4.839   -17.930 1.00 24.02 ? 5   GLU C N   1 
ATOM   5061  C CA  . GLU C 1 5   ? 31.680  3.910   -18.907 1.00 24.23 ? 5   GLU C CA  1 
ATOM   5062  C C   . GLU C 1 5   ? 32.378  2.758   -18.222 1.00 24.39 ? 5   GLU C C   1 
ATOM   5063  O O   . GLU C 1 5   ? 32.665  1.730   -18.867 1.00 24.61 ? 5   GLU C O   1 
ATOM   5064  C CB  . GLU C 1 5   ? 32.636  4.629   -19.841 1.00 24.30 ? 5   GLU C CB  1 
ATOM   5065  C CG  . GLU C 1 5   ? 32.133  5.960   -20.431 1.00 24.42 ? 5   GLU C CG  1 
ATOM   5066  C CD  . GLU C 1 5   ? 32.896  6.487   -21.603 1.00 24.53 ? 5   GLU C CD  1 
ATOM   5067  O OE1 . GLU C 1 5   ? 32.415  7.162   -22.508 1.00 24.62 ? 5   GLU C OE1 1 
ATOM   5068  O OE2 . GLU C 1 5   ? 34.099  6.144   -21.599 1.00 24.57 ? 5   GLU C OE2 1 
ATOM   5069  N N   . GLN C 1 6   ? 32.501  2.840   -16.917 1.00 24.45 ? 6   GLN C N   1 
ATOM   5070  C CA  . GLN C 1 6   ? 33.187  1.812   -16.137 1.00 24.69 ? 6   GLN C CA  1 
ATOM   5071  C C   . GLN C 1 6   ? 32.248  0.986   -15.290 1.00 24.93 ? 6   GLN C C   1 
ATOM   5072  O O   . GLN C 1 6   ? 32.354  -0.265  -15.375 1.00 25.19 ? 6   GLN C O   1 
ATOM   5073  C CB  . GLN C 1 6   ? 34.315  2.466   -15.330 1.00 24.63 ? 6   GLN C CB  1 
ATOM   5074  C CG  . GLN C 1 6   ? 35.601  1.711   -15.287 1.00 24.62 ? 6   GLN C CG  1 
ATOM   5075  C CD  . GLN C 1 6   ? 36.683  2.265   -14.403 1.00 24.64 ? 6   GLN C CD  1 
ATOM   5076  O OE1 . GLN C 1 6   ? 37.820  1.758   -14.393 1.00 24.45 ? 6   GLN C OE1 1 
ATOM   5077  N NE2 . GLN C 1 6   ? 36.377  3.308   -13.629 1.00 24.65 ? 6   GLN C NE2 1 
ATOM   5078  N N   . LEU C 1 7   ? 31.330  1.563   -14.542 1.00 25.10 ? 7   LEU C N   1 
ATOM   5079  C CA  . LEU C 1 7   ? 30.436  0.872   -13.632 1.00 25.23 ? 7   LEU C CA  1 
ATOM   5080  C C   . LEU C 1 7   ? 29.271  0.158   -14.291 1.00 25.60 ? 7   LEU C C   1 
ATOM   5081  O O   . LEU C 1 7   ? 28.928  -0.941  -13.843 1.00 25.57 ? 7   LEU C O   1 
ATOM   5082  C CB  . LEU C 1 7   ? 29.917  1.839   -12.537 1.00 24.92 ? 7   LEU C CB  1 
ATOM   5083  C CG  . LEU C 1 7   ? 29.386  1.184   -11.268 1.00 24.70 ? 7   LEU C CG  1 
ATOM   5084  C CD1 . LEU C 1 7   ? 29.158  2.233   -10.175 1.00 24.68 ? 7   LEU C CD1 1 
ATOM   5085  C CD2 . LEU C 1 7   ? 28.053  0.490   -11.517 1.00 24.63 ? 7   LEU C CD2 1 
ATOM   5086  N N   . ILE C 1 8   ? 28.672  0.760   -15.263 1.00 26.42 ? 8   ILE C N   1 
ATOM   5087  C CA  . ILE C 1 8   ? 27.463  0.269   -15.919 1.00 27.28 ? 8   ILE C CA  1 
ATOM   5088  C C   . ILE C 1 8   ? 27.690  -0.219  -17.329 1.00 28.14 ? 8   ILE C C   1 
ATOM   5089  O O   . ILE C 1 8   ? 28.305  0.474   -18.150 1.00 28.13 ? 8   ILE C O   1 
ATOM   5090  C CB  . ILE C 1 8   ? 26.402  1.447   -15.851 1.00 27.12 ? 8   ILE C CB  1 
ATOM   5091  C CG1 . ILE C 1 8   ? 25.907  1.610   -14.403 1.00 27.06 ? 8   ILE C CG1 1 
ATOM   5092  C CG2 . ILE C 1 8   ? 25.251  1.291   -16.871 1.00 27.13 ? 8   ILE C CG2 1 
ATOM   5093  C CD1 . ILE C 1 8   ? 24.857  0.562   -13.911 1.00 26.91 ? 8   ILE C CD1 1 
ATOM   5094  N N   . GLN C 1 9   ? 27.053  -1.347  -17.630 1.00 29.37 ? 9   GLN C N   1 
ATOM   5095  C CA  . GLN C 1 9   ? 27.129  -1.924  -18.966 1.00 30.74 ? 9   GLN C CA  1 
ATOM   5096  C C   . GLN C 1 9   ? 25.753  -1.965  -19.637 1.00 31.71 ? 9   GLN C C   1 
ATOM   5097  O O   . GLN C 1 9   ? 24.864  -2.753  -19.313 1.00 31.93 ? 9   GLN C O   1 
ATOM   5098  C CB  . GLN C 1 9   ? 27.805  -3.305  -19.018 1.00 30.81 ? 9   GLN C CB  1 
ATOM   5099  C CG  . GLN C 1 9   ? 27.829  -3.842  -20.441 1.00 30.85 ? 9   GLN C CG  1 
ATOM   5100  C CD  . GLN C 1 9   ? 29.168  -4.218  -20.984 1.00 30.88 ? 9   GLN C CD  1 
ATOM   5101  O OE1 . GLN C 1 9   ? 29.510  -3.800  -22.097 1.00 30.92 ? 9   GLN C OE1 1 
ATOM   5102  N NE2 . GLN C 1 9   ? 29.935  -5.030  -20.258 1.00 30.89 ? 9   GLN C NE2 1 
ATOM   5103  N N   . ASN C 1 10  ? 25.679  -1.240  -20.697 1.00 32.88 ? 10  ASN C N   1 
ATOM   5104  C CA  . ASN C 1 10  ? 24.675  -0.972  -21.676 1.00 34.04 ? 10  ASN C CA  1 
ATOM   5105  C C   . ASN C 1 10  ? 24.268  -2.147  -22.550 1.00 34.87 ? 10  ASN C C   1 
ATOM   5106  O O   . ASN C 1 10  ? 24.792  -2.260  -23.687 1.00 34.84 ? 10  ASN C O   1 
ATOM   5107  C CB  . ASN C 1 10  ? 25.278  0.175   -22.571 1.00 34.28 ? 10  ASN C CB  1 
ATOM   5108  C CG  . ASN C 1 10  ? 26.708  -0.141  -23.013 1.00 34.54 ? 10  ASN C CG  1 
ATOM   5109  O OD1 . ASN C 1 10  ? 26.975  -0.569  -24.152 1.00 34.65 ? 10  ASN C OD1 1 
ATOM   5110  N ND2 . ASN C 1 10  ? 27.683  0.074   -22.114 1.00 34.53 ? 10  ASN C ND2 1 
ATOM   5111  N N   . LEU C 1 11  ? 23.283  -2.935  -22.123 1.00 35.91 ? 11  LEU C N   1 
ATOM   5112  C CA  . LEU C 1 11  ? 22.801  -4.101  -22.867 1.00 36.91 ? 11  LEU C CA  1 
ATOM   5113  C C   . LEU C 1 11  ? 22.123  -3.721  -24.191 1.00 37.67 ? 11  LEU C C   1 
ATOM   5114  O O   . LEU C 1 11  ? 20.906  -3.688  -24.343 1.00 37.69 ? 11  LEU C O   1 
ATOM   5115  C CB  . LEU C 1 11  ? 21.901  -4.969  -21.983 1.00 36.82 ? 11  LEU C CB  1 
ATOM   5116  C CG  . LEU C 1 11  ? 21.775  -6.445  -22.333 1.00 36.76 ? 11  LEU C CG  1 
ATOM   5117  C CD1 . LEU C 1 11  ? 20.828  -7.140  -21.353 1.00 36.70 ? 11  LEU C CD1 1 
ATOM   5118  C CD2 . LEU C 1 11  ? 21.254  -6.641  -23.752 1.00 36.67 ? 11  LEU C CD2 1 
ATOM   5119  N N   . VAL C 1 12  ? 22.939  -3.625  -25.177 1.00 38.81 ? 12  VAL C N   1 
ATOM   5120  C CA  . VAL C 1 12  ? 22.791  -3.281  -26.572 1.00 39.95 ? 12  VAL C CA  1 
ATOM   5121  C C   . VAL C 1 12  ? 21.383  -2.864  -26.935 1.00 40.80 ? 12  VAL C C   1 
ATOM   5122  O O   . VAL C 1 12  ? 20.782  -2.041  -26.182 1.00 40.93 ? 12  VAL C O   1 
ATOM   5123  C CB  . VAL C 1 12  ? 23.583  -4.268  -27.457 1.00 40.00 ? 12  VAL C CB  1 
ATOM   5124  C CG1 . VAL C 1 12  ? 24.260  -3.543  -28.638 1.00 40.06 ? 12  VAL C CG1 1 
ATOM   5125  C CG2 . VAL C 1 12  ? 24.602  -5.127  -26.749 1.00 40.08 ? 12  VAL C CG2 1 
ATOM   5126  N N   . PRO C 1 13  ? 20.884  -3.346  -28.056 1.00 41.68 ? 13  PRO C N   1 
ATOM   5127  C CA  . PRO C 1 13  ? 19.595  -2.858  -28.613 1.00 42.32 ? 13  PRO C CA  1 
ATOM   5128  C C   . PRO C 1 13  ? 18.472  -2.889  -27.605 1.00 42.86 ? 13  PRO C C   1 
ATOM   5129  O O   . PRO C 1 13  ? 18.316  -3.869  -26.855 1.00 43.05 ? 13  PRO C O   1 
ATOM   5130  C CB  . PRO C 1 13  ? 19.361  -3.714  -29.842 1.00 42.24 ? 13  PRO C CB  1 
ATOM   5131  C CG  . PRO C 1 13  ? 20.425  -4.783  -29.829 1.00 42.17 ? 13  PRO C CG  1 
ATOM   5132  C CD  . PRO C 1 13  ? 20.929  -4.826  -28.384 1.00 41.93 ? 13  PRO C CD  1 
ATOM   5133  N N   . GLU C 1 14  ? 17.664  -1.847  -27.617 1.00 43.41 ? 14  GLU C N   1 
ATOM   5134  C CA  . GLU C 1 14  ? 16.545  -1.652  -26.696 1.00 43.97 ? 14  GLU C CA  1 
ATOM   5135  C C   . GLU C 1 14  ? 17.111  -1.196  -25.334 1.00 44.11 ? 14  GLU C C   1 
ATOM   5136  O O   . GLU C 1 14  ? 17.272  -1.857  -24.315 1.00 44.00 ? 14  GLU C O   1 
ATOM   5137  C CB  . GLU C 1 14  ? 15.619  -2.823  -26.501 1.00 44.23 ? 14  GLU C CB  1 
ATOM   5138  C CG  . GLU C 1 14  ? 14.213  -2.545  -25.983 1.00 44.60 ? 14  GLU C CG  1 
ATOM   5139  C CD  . GLU C 1 14  ? 14.042  -2.029  -24.595 1.00 44.81 ? 14  GLU C CD  1 
ATOM   5140  O OE1 . GLU C 1 14  ? 13.356  -2.603  -23.744 1.00 44.84 ? 14  GLU C OE1 1 
ATOM   5141  O OE2 . GLU C 1 14  ? 14.609  -0.922  -24.391 1.00 44.83 ? 14  GLU C OE2 1 
ATOM   5142  N N   . ASP C 1 15  ? 17.321  0.100   -25.379 1.00 44.32 ? 15  ASP C N   1 
ATOM   5143  C CA  . ASP C 1 15  ? 17.867  0.966   -24.345 1.00 44.33 ? 15  ASP C CA  1 
ATOM   5144  C C   . ASP C 1 15  ? 17.089  2.298   -24.356 1.00 44.21 ? 15  ASP C C   1 
ATOM   5145  O O   . ASP C 1 15  ? 17.690  3.364   -24.187 1.00 44.19 ? 15  ASP C O   1 
ATOM   5146  C CB  . ASP C 1 15  ? 19.382  1.112   -24.563 1.00 44.37 ? 15  ASP C CB  1 
ATOM   5147  C CG  . ASP C 1 15  ? 19.731  1.199   -26.048 1.00 44.45 ? 15  ASP C CG  1 
ATOM   5148  O OD1 . ASP C 1 15  ? 19.618  0.185   -26.765 1.00 44.44 ? 15  ASP C OD1 1 
ATOM   5149  O OD2 . ASP C 1 15  ? 20.025  2.327   -26.485 1.00 44.49 ? 15  ASP C OD2 1 
ATOM   5150  N N   . LYS C 1 16  ? 15.782  2.171   -24.511 1.00 43.87 ? 16  LYS C N   1 
ATOM   5151  C CA  . LYS C 1 16  ? 14.805  3.252   -24.589 1.00 43.45 ? 16  LYS C CA  1 
ATOM   5152  C C   . LYS C 1 16  ? 13.384  2.645   -24.664 1.00 43.04 ? 16  LYS C C   1 
ATOM   5153  O O   . LYS C 1 16  ? 13.265  1.546   -25.263 1.00 43.10 ? 16  LYS C O   1 
ATOM   5154  C CB  . LYS C 1 16  ? 14.990  4.080   -25.837 1.00 43.69 ? 16  LYS C CB  1 
ATOM   5155  C CG  . LYS C 1 16  ? 16.292  4.624   -26.291 1.00 43.97 ? 16  LYS C CG  1 
ATOM   5156  C CD  . LYS C 1 16  ? 16.627  6.029   -25.864 1.00 44.29 ? 16  LYS C CD  1 
ATOM   5157  C CE  . LYS C 1 16  ? 17.307  6.189   -24.540 1.00 44.53 ? 16  LYS C CE  1 
ATOM   5158  N NZ  . LYS C 1 16  ? 16.489  5.641   -23.416 1.00 44.72 ? 16  LYS C NZ  1 
ATOM   5159  N N   . LEU C 1 17  ? 12.363  3.336   -24.185 1.00 42.22 ? 17  LEU C N   1 
ATOM   5160  C CA  . LEU C 1 17  ? 10.963  2.869   -24.204 1.00 41.42 ? 17  LEU C CA  1 
ATOM   5161  C C   . LEU C 1 17  ? 9.973   4.034   -23.965 1.00 40.82 ? 17  LEU C C   1 
ATOM   5162  O O   . LEU C 1 17  ? 10.325  5.215   -24.109 1.00 40.98 ? 17  LEU C O   1 
ATOM   5163  C CB  . LEU C 1 17  ? 10.762  1.773   -23.180 1.00 41.38 ? 17  LEU C CB  1 
ATOM   5164  C CG  . LEU C 1 17  ? 11.265  0.386   -23.126 1.00 41.30 ? 17  LEU C CG  1 
ATOM   5165  C CD1 . LEU C 1 17  ? 11.215  -0.336  -24.470 1.00 41.33 ? 17  LEU C CD1 1 
ATOM   5166  C CD2 . LEU C 1 17  ? 12.705  0.374   -22.588 1.00 41.32 ? 17  LEU C CD2 1 
ATOM   5167  N N   . SER C 1 18  ? 8.730   3.687   -23.626 1.00 39.79 ? 18  SER C N   1 
ATOM   5168  C CA  . SER C 1 18  ? 7.671   4.616   -23.230 1.00 38.76 ? 18  SER C CA  1 
ATOM   5169  C C   . SER C 1 18  ? 6.313   3.914   -23.106 1.00 37.92 ? 18  SER C C   1 
ATOM   5170  O O   . SER C 1 18  ? 6.209   2.802   -23.663 1.00 37.93 ? 18  SER C O   1 
ATOM   5171  C CB  . SER C 1 18  ? 7.554   5.796   -24.186 1.00 38.89 ? 18  SER C CB  1 
ATOM   5172  O OG  . SER C 1 18  ? 6.567   5.591   -25.181 1.00 38.98 ? 18  SER C OG  1 
ATOM   5173  N N   . ARG C 1 19  ? 5.363   4.481   -22.342 1.00 36.75 ? 19  ARG C N   1 
ATOM   5174  C CA  . ARG C 1 19  ? 3.993   3.946   -22.302 1.00 35.54 ? 19  ARG C CA  1 
ATOM   5175  C C   . ARG C 1 19  ? 2.894   4.743   -21.630 1.00 34.42 ? 19  ARG C C   1 
ATOM   5176  O O   . ARG C 1 19  ? 2.345   5.686   -22.282 1.00 34.40 ? 19  ARG C O   1 
ATOM   5177  C CB  . ARG C 1 19  ? 3.904   2.468   -21.850 1.00 35.73 ? 19  ARG C CB  1 
ATOM   5178  C CG  . ARG C 1 19  ? 3.711   1.514   -23.050 1.00 35.91 ? 19  ARG C CG  1 
ATOM   5179  C CD  . ARG C 1 19  ? 2.404   1.734   -23.712 1.00 36.12 ? 19  ARG C CD  1 
ATOM   5180  N NE  . ARG C 1 19  ? 2.437   1.567   -25.154 1.00 36.31 ? 19  ARG C NE  1 
ATOM   5181  C CZ  . ARG C 1 19  ? 1.679   2.287   -25.998 1.00 36.38 ? 19  ARG C CZ  1 
ATOM   5182  N NH1 . ARG C 1 19  ? 0.818   3.206   -25.569 1.00 36.37 ? 19  ARG C NH1 1 
ATOM   5183  N NH2 . ARG C 1 19  ? 1.856   2.153   -27.316 1.00 36.41 ? 19  ARG C NH2 1 
ATOM   5184  N N   . CYS C 1 20  ? 2.539   4.498   -20.392 1.00 32.90 ? 20  CYS C N   1 
ATOM   5185  C CA  . CYS C 1 20  ? 1.352   5.035   -19.713 1.00 31.45 ? 20  CYS C CA  1 
ATOM   5186  C C   . CYS C 1 20  ? 1.419   5.993   -18.559 1.00 29.97 ? 20  CYS C C   1 
ATOM   5187  O O   . CYS C 1 20  ? 1.293   5.641   -17.357 1.00 29.75 ? 20  CYS C O   1 
ATOM   5188  C CB  . CYS C 1 20  ? 0.561   3.730   -19.290 1.00 31.82 ? 20  CYS C CB  1 
ATOM   5189  S SG  . CYS C 1 20  ? 1.718   2.297   -19.210 1.00 32.63 ? 20  CYS C SG  1 
ATOM   5190  N N   . LYS C 1 21  ? 1.330   7.285   -18.832 1.00 28.15 ? 21  LYS C N   1 
ATOM   5191  C CA  . LYS C 1 21  ? 1.401   8.478   -18.063 1.00 26.27 ? 21  LYS C CA  1 
ATOM   5192  C C   . LYS C 1 21  ? 0.129   9.071   -17.450 1.00 24.76 ? 21  LYS C C   1 
ATOM   5193  O O   . LYS C 1 21  ? -0.975  8.827   -17.902 1.00 24.65 ? 21  LYS C O   1 
ATOM   5194  C CB  . LYS C 1 21  ? 1.820   9.689   -18.977 1.00 26.37 ? 21  LYS C CB  1 
ATOM   5195  C CG  . LYS C 1 21  ? 3.205   10.250  -18.801 1.00 26.34 ? 21  LYS C CG  1 
ATOM   5196  C CD  . LYS C 1 21  ? 3.719   10.874  -20.099 1.00 26.33 ? 21  LYS C CD  1 
ATOM   5197  C CE  . LYS C 1 21  ? 3.263   12.286  -20.345 1.00 26.35 ? 21  LYS C CE  1 
ATOM   5198  N NZ  . LYS C 1 21  ? 3.619   12.734  -21.724 1.00 26.32 ? 21  LYS C NZ  1 
ATOM   5199  N N   . ILE C 1 22  ? 0.388   9.991   -16.542 1.00 22.89 ? 22  ILE C N   1 
ATOM   5200  C CA  . ILE C 1 22  ? -0.548  10.870  -15.858 1.00 21.26 ? 22  ILE C CA  1 
ATOM   5201  C C   . ILE C 1 22  ? 0.040   12.298  -16.069 1.00 20.20 ? 22  ILE C C   1 
ATOM   5202  O O   . ILE C 1 22  ? 1.283   12.419  -16.093 1.00 20.43 ? 22  ILE C O   1 
ATOM   5203  C CB  . ILE C 1 22  ? -0.826  10.583  -14.368 1.00 21.15 ? 22  ILE C CB  1 
ATOM   5204  C CG1 . ILE C 1 22  ? -1.952  9.550   -14.152 1.00 21.10 ? 22  ILE C CG1 1 
ATOM   5205  C CG2 . ILE C 1 22  ? -1.202  11.867  -13.533 1.00 20.98 ? 22  ILE C CG2 1 
ATOM   5206  C CD1 . ILE C 1 22  ? -1.752  8.155   -14.738 1.00 21.34 ? 22  ILE C CD1 1 
ATOM   5207  N N   . THR C 1 23  ? -0.821  13.268  -16.242 1.00 18.42 ? 23  THR C N   1 
ATOM   5208  C CA  . THR C 1 23  ? -0.420  14.663  -16.458 1.00 16.57 ? 23  THR C CA  1 
ATOM   5209  C C   . THR C 1 23  ? -1.377  15.531  -15.654 1.00 15.61 ? 23  THR C C   1 
ATOM   5210  O O   . THR C 1 23  ? -2.561  15.099  -15.574 1.00 15.51 ? 23  THR C O   1 
ATOM   5211  C CB  . THR C 1 23  ? -0.455  15.103  -17.970 1.00 16.40 ? 23  THR C CB  1 
ATOM   5212  O OG1 . THR C 1 23  ? 0.559   14.338  -18.677 1.00 15.96 ? 23  THR C OG1 1 
ATOM   5213  C CG2 . THR C 1 23  ? -0.312  16.627  -18.182 1.00 16.08 ? 23  THR C CG2 1 
ATOM   5214  N N   . VAL C 1 24  ? -0.868  16.612  -15.086 1.00 14.18 ? 24  VAL C N   1 
ATOM   5215  C CA  . VAL C 1 24  ? -1.867  17.490  -14.366 1.00 12.90 ? 24  VAL C CA  1 
ATOM   5216  C C   . VAL C 1 24  ? -1.603  18.937  -14.770 1.00 12.04 ? 24  VAL C C   1 
ATOM   5217  O O   . VAL C 1 24  ? -0.485  19.498  -14.655 1.00 11.92 ? 24  VAL C O   1 
ATOM   5218  C CB  . VAL C 1 24  ? -1.968  17.116  -12.898 1.00 12.72 ? 24  VAL C CB  1 
ATOM   5219  C CG1 . VAL C 1 24  ? -1.904  15.594  -12.644 1.00 12.52 ? 24  VAL C CG1 1 
ATOM   5220  C CG2 . VAL C 1 24  ? -0.976  17.797  -11.975 1.00 12.68 ? 24  VAL C CG2 1 
ATOM   5221  N N   . VAL C 1 25  ? -2.659  19.517  -15.363 1.00 10.80 ? 25  VAL C N   1 
ATOM   5222  C CA  . VAL C 1 25  ? -2.556  20.929  -15.829 1.00 9.51  ? 25  VAL C CA  1 
ATOM   5223  C C   . VAL C 1 25  ? -2.728  21.818  -14.588 1.00 8.80  ? 25  VAL C C   1 
ATOM   5224  O O   . VAL C 1 25  ? -3.723  21.732  -13.876 1.00 8.52  ? 25  VAL C O   1 
ATOM   5225  C CB  . VAL C 1 25  ? -3.503  21.221  -16.986 1.00 9.23  ? 25  VAL C CB  1 
ATOM   5226  C CG1 . VAL C 1 25  ? -3.716  22.722  -17.212 1.00 9.05  ? 25  VAL C CG1 1 
ATOM   5227  C CG2 . VAL C 1 25  ? -3.079  20.559  -18.293 1.00 8.89  ? 25  VAL C CG2 1 
ATOM   5228  N N   . GLY C 1 26  ? -1.703  22.598  -14.349 1.00 8.14  ? 26  GLY C N   1 
ATOM   5229  C CA  . GLY C 1 26  ? -1.622  23.554  -13.266 1.00 7.49  ? 26  GLY C CA  1 
ATOM   5230  C C   . GLY C 1 26  ? -1.526  22.820  -11.937 1.00 7.02  ? 26  GLY C C   1 
ATOM   5231  O O   . GLY C 1 26  ? -2.248  21.859  -11.706 1.00 7.09  ? 26  GLY C O   1 
ATOM   5232  N N   . VAL C 1 27  ? -0.690  23.325  -11.088 1.00 6.72  ? 27  VAL C N   1 
ATOM   5233  C CA  . VAL C 1 27  ? -0.362  22.882  -9.762  1.00 6.39  ? 27  VAL C CA  1 
ATOM   5234  C C   . VAL C 1 27  ? -0.832  23.870  -8.695  1.00 6.26  ? 27  VAL C C   1 
ATOM   5235  O O   . VAL C 1 27  ? -0.106  24.129  -7.711  1.00 6.19  ? 27  VAL C O   1 
ATOM   5236  C CB  . VAL C 1 27  ? 1.184   22.690  -9.678  1.00 6.37  ? 27  VAL C CB  1 
ATOM   5237  C CG1 . VAL C 1 27  ? 1.671   21.611  -10.614 1.00 6.42  ? 27  VAL C CG1 1 
ATOM   5238  C CG2 . VAL C 1 27  ? 1.896   24.023  -9.850  1.00 6.12  ? 27  VAL C CG2 1 
ATOM   5239  N N   . GLY C 1 28  ? -1.961  24.489  -8.953  1.00 6.22  ? 28  GLY C N   1 
ATOM   5240  C CA  . GLY C 1 28  ? -2.515  25.396  -7.865  1.00 6.54  ? 28  GLY C CA  1 
ATOM   5241  C C   . GLY C 1 28  ? -2.791  24.377  -6.749  1.00 6.72  ? 28  GLY C C   1 
ATOM   5242  O O   . GLY C 1 28  ? -3.126  23.242  -7.173  1.00 7.09  ? 28  GLY C O   1 
ATOM   5243  N N   . ASP C 1 29  ? -2.540  24.664  -5.524  1.00 6.69  ? 29  ASP C N   1 
ATOM   5244  C CA  . ASP C 1 29  ? -2.784  23.800  -4.365  1.00 6.57  ? 29  ASP C CA  1 
ATOM   5245  C C   . ASP C 1 29  ? -3.469  22.461  -4.713  1.00 5.98  ? 29  ASP C C   1 
ATOM   5246  O O   . ASP C 1 29  ? -2.979  21.385  -4.305  1.00 5.74  ? 29  ASP C O   1 
ATOM   5247  C CB  . ASP C 1 29  ? -3.514  24.517  -3.235  1.00 7.28  ? 29  ASP C CB  1 
ATOM   5248  C CG  . ASP C 1 29  ? -3.485  26.010  -3.172  1.00 8.18  ? 29  ASP C CG  1 
ATOM   5249  O OD1 . ASP C 1 29  ? -4.408  26.673  -2.611  1.00 8.28  ? 29  ASP C OD1 1 
ATOM   5250  O OD2 . ASP C 1 29  ? -2.589  26.674  -3.792  1.00 8.82  ? 29  ASP C OD2 1 
ATOM   5251  N N   . VAL C 1 30  ? -4.586  22.533  -5.376  1.00 5.35  ? 30  VAL C N   1 
ATOM   5252  C CA  . VAL C 1 30  ? -5.376  21.420  -5.868  1.00 4.87  ? 30  VAL C CA  1 
ATOM   5253  C C   . VAL C 1 30  ? -4.638  20.591  -6.913  1.00 4.50  ? 30  VAL C C   1 
ATOM   5254  O O   . VAL C 1 30  ? -4.477  19.373  -6.740  1.00 4.24  ? 30  VAL C O   1 
ATOM   5255  C CB  . VAL C 1 30  ? -6.730  21.925  -6.433  1.00 4.75  ? 30  VAL C CB  1 
ATOM   5256  C CG1 . VAL C 1 30  ? -7.672  20.807  -6.840  1.00 4.61  ? 30  VAL C CG1 1 
ATOM   5257  C CG2 . VAL C 1 30  ? -7.402  22.858  -5.454  1.00 4.91  ? 30  VAL C CG2 1 
ATOM   5258  N N   . GLY C 1 31  ? -4.347  21.217  -8.028  1.00 4.35  ? 31  GLY C N   1 
ATOM   5259  C CA  . GLY C 1 31  ? -3.635  20.573  -9.137  1.00 4.53  ? 31  GLY C CA  1 
ATOM   5260  C C   . GLY C 1 31  ? -2.524  19.730  -8.501  1.00 4.94  ? 31  GLY C C   1 
ATOM   5261  O O   . GLY C 1 31  ? -2.278  18.581  -8.880  1.00 5.20  ? 31  GLY C O   1 
ATOM   5262  N N   . MET C 1 32  ? -2.001  20.286  -7.421  1.00 5.00  ? 32  MET C N   1 
ATOM   5263  C CA  . MET C 1 32  ? -0.918  19.764  -6.641  1.00 5.05  ? 32  MET C CA  1 
ATOM   5264  C C   . MET C 1 32  ? -1.187  18.659  -5.637  1.00 5.05  ? 32  MET C C   1 
ATOM   5265  O O   . MET C 1 32  ? -0.273  17.828  -5.413  1.00 5.01  ? 32  MET C O   1 
ATOM   5266  C CB  . MET C 1 32  ? -0.277  20.973  -5.889  1.00 5.15  ? 32  MET C CB  1 
ATOM   5267  C CG  . MET C 1 32  ? 1.196   20.646  -5.748  1.00 5.51  ? 32  MET C CG  1 
ATOM   5268  S SD  . MET C 1 32  ? 1.801   20.544  -7.466  1.00 6.01  ? 32  MET C SD  1 
ATOM   5269  C CE  . MET C 1 32  ? 3.568   20.354  -7.216  1.00 5.89  ? 32  MET C CE  1 
ATOM   5270  N N   . ALA C 1 33  ? -2.246  18.754  -4.860  1.00 4.91  ? 33  ALA C N   1 
ATOM   5271  C CA  . ALA C 1 33  ? -2.646  17.779  -3.860  1.00 4.73  ? 33  ALA C CA  1 
ATOM   5272  C C   . ALA C 1 33  ? -3.140  16.509  -4.581  1.00 4.70  ? 33  ALA C C   1 
ATOM   5273  O O   . ALA C 1 33  ? -3.188  15.412  -4.053  1.00 4.89  ? 33  ALA C O   1 
ATOM   5274  C CB  . ALA C 1 33  ? -3.811  18.232  -2.994  1.00 4.77  ? 33  ALA C CB  1 
ATOM   5275  N N   . CYS C 1 34  ? -3.588  16.827  -5.760  1.00 4.50  ? 34  CYS C N   1 
ATOM   5276  C CA  . CYS C 1 34  ? -4.143  15.787  -6.692  1.00 4.01  ? 34  CYS C CA  1 
ATOM   5277  C C   . CYS C 1 34  ? -2.914  15.220  -7.370  1.00 3.67  ? 34  CYS C C   1 
ATOM   5278  O O   . CYS C 1 34  ? -2.949  14.162  -8.002  1.00 3.71  ? 34  CYS C O   1 
ATOM   5279  C CB  . CYS C 1 34  ? -5.225  16.514  -7.373  1.00 4.07  ? 34  CYS C CB  1 
ATOM   5280  S SG  . CYS C 1 34  ? -6.018  16.080  -8.836  1.00 4.43  ? 34  CYS C SG  1 
ATOM   5281  N N   . ALA C 1 35  ? -1.769  15.846  -7.096  1.00 3.29  ? 35  ALA C N   1 
ATOM   5282  C CA  . ALA C 1 35  ? -0.464  15.361  -7.556  1.00 3.06  ? 35  ALA C CA  1 
ATOM   5283  C C   . ALA C 1 35  ? 0.136   14.393  -6.536  1.00 2.83  ? 35  ALA C C   1 
ATOM   5284  O O   . ALA C 1 35  ? 0.045   13.151  -6.774  1.00 2.99  ? 35  ALA C O   1 
ATOM   5285  C CB  . ALA C 1 35  ? 0.474   16.476  -7.914  1.00 3.14  ? 35  ALA C CB  1 
ATOM   5286  N N   . ILE C 1 36  ? 0.734   14.868  -5.490  1.00 2.44  ? 36  ILE C N   1 
ATOM   5287  C CA  . ILE C 1 36  ? 1.353   14.084  -4.439  1.00 2.28  ? 36  ILE C CA  1 
ATOM   5288  C C   . ILE C 1 36  ? 0.679   12.724  -4.192  1.00 2.34  ? 36  ILE C C   1 
ATOM   5289  O O   . ILE C 1 36  ? 1.359   11.691  -4.032  1.00 2.00  ? 36  ILE C O   1 
ATOM   5290  C CB  . ILE C 1 36  ? 1.448   14.874  -3.085  1.00 2.14  ? 36  ILE C CB  1 
ATOM   5291  C CG1 . ILE C 1 36  ? 2.246   14.057  -2.046  1.00 2.16  ? 36  ILE C CG1 1 
ATOM   5292  C CG2 . ILE C 1 36  ? 0.043   15.249  -2.539  1.00 2.00  ? 36  ILE C CG2 1 
ATOM   5293  C CD1 . ILE C 1 36  ? 3.659   13.594  -2.469  1.00 2.31  ? 36  ILE C CD1 1 
ATOM   5294  N N   . SER C 1 37  ? -0.644  12.794  -4.065  1.00 2.37  ? 37  SER C N   1 
ATOM   5295  C CA  . SER C 1 37  ? -1.472  11.599  -3.833  1.00 2.32  ? 37  SER C CA  1 
ATOM   5296  C C   . SER C 1 37  ? -1.425  10.631  -4.999  1.00 2.54  ? 37  SER C C   1 
ATOM   5297  O O   . SER C 1 37  ? -1.422  9.384   -4.760  1.00 2.82  ? 37  SER C O   1 
ATOM   5298  C CB  . SER C 1 37  ? -2.902  11.984  -3.497  1.00 2.17  ? 37  SER C CB  1 
ATOM   5299  O OG  . SER C 1 37  ? -3.498  10.925  -2.775  1.00 2.19  ? 37  SER C OG  1 
ATOM   5300  N N   . ILE C 1 38  ? -1.463  11.128  -6.234  1.00 2.45  ? 38  ILE C N   1 
ATOM   5301  C CA  . ILE C 1 38  ? -1.286  10.165  -7.360  1.00 2.48  ? 38  ILE C CA  1 
ATOM   5302  C C   . ILE C 1 38  ? 0.041   9.441   -7.119  1.00 2.45  ? 38  ILE C C   1 
ATOM   5303  O O   . ILE C 1 38  ? 0.187   8.265   -7.460  1.00 2.17  ? 38  ILE C O   1 
ATOM   5304  C CB  . ILE C 1 38  ? -1.504  10.820  -8.740  1.00 2.53  ? 38  ILE C CB  1 
ATOM   5305  C CG1 . ILE C 1 38  ? -3.048  10.845  -9.019  1.00 2.48  ? 38  ILE C CG1 1 
ATOM   5306  C CG2 . ILE C 1 38  ? -0.711  10.149  -9.893  1.00 2.48  ? 38  ILE C CG2 1 
ATOM   5307  C CD1 . ILE C 1 38  ? -3.507  11.511  -10.325 1.00 2.37  ? 38  ILE C CD1 1 
ATOM   5308  N N   . LEU C 1 39  ? 0.929   10.132  -6.407  1.00 2.62  ? 39  LEU C N   1 
ATOM   5309  C CA  . LEU C 1 39  ? 2.259   9.579   -6.080  1.00 2.76  ? 39  LEU C CA  1 
ATOM   5310  C C   . LEU C 1 39  ? 2.210   8.602   -4.915  1.00 2.80  ? 39  LEU C C   1 
ATOM   5311  O O   . LEU C 1 39  ? 2.833   7.504   -4.973  1.00 2.81  ? 39  LEU C O   1 
ATOM   5312  C CB  . LEU C 1 39  ? 3.221   10.764  -5.942  1.00 2.74  ? 39  LEU C CB  1 
ATOM   5313  C CG  . LEU C 1 39  ? 3.349   11.760  -7.073  1.00 2.83  ? 39  LEU C CG  1 
ATOM   5314  C CD1 . LEU C 1 39  ? 3.684   13.163  -6.538  1.00 3.07  ? 39  LEU C CD1 1 
ATOM   5315  C CD2 . LEU C 1 39  ? 4.484   11.371  -8.011  1.00 2.73  ? 39  LEU C CD2 1 
ATOM   5316  N N   . LEU C 1 40  ? 1.472   8.927   -3.873  1.00 2.66  ? 40  LEU C N   1 
ATOM   5317  C CA  . LEU C 1 40  ? 1.390   8.076   -2.650  1.00 2.41  ? 40  LEU C CA  1 
ATOM   5318  C C   . LEU C 1 40  ? 0.506   6.890   -2.945  1.00 2.47  ? 40  LEU C C   1 
ATOM   5319  O O   . LEU C 1 40  ? -0.394  6.444   -2.224  1.00 2.57  ? 40  LEU C O   1 
ATOM   5320  C CB  . LEU C 1 40  ? 1.034   9.028   -1.513  1.00 2.19  ? 40  LEU C CB  1 
ATOM   5321  C CG  . LEU C 1 40  ? 2.088   9.958   -0.937  1.00 2.06  ? 40  LEU C CG  1 
ATOM   5322  C CD1 . LEU C 1 40  ? 2.936   9.311   0.153   1.00 2.00  ? 40  LEU C CD1 1 
ATOM   5323  C CD2 . LEU C 1 40  ? 3.078   10.454  -1.988  1.00 2.00  ? 40  LEU C CD2 1 
ATOM   5324  N N   . LYS C 1 41  ? 0.761   6.344   -4.097  1.00 2.60  ? 41  LYS C N   1 
ATOM   5325  C CA  . LYS C 1 41  ? 0.082   5.209   -4.749  1.00 2.70  ? 41  LYS C CA  1 
ATOM   5326  C C   . LYS C 1 41  ? 0.884   4.942   -6.019  1.00 2.82  ? 41  LYS C C   1 
ATOM   5327  O O   . LYS C 1 41  ? 1.899   5.678   -6.252  1.00 2.98  ? 41  LYS C O   1 
ATOM   5328  C CB  . LYS C 1 41  ? -1.380  5.416   -5.000  1.00 2.57  ? 41  LYS C CB  1 
ATOM   5329  C CG  . LYS C 1 41  ? -2.358  4.689   -4.071  1.00 2.64  ? 41  LYS C CG  1 
ATOM   5330  C CD  . LYS C 1 41  ? -2.513  3.194   -4.442  1.00 2.66  ? 41  LYS C CD  1 
ATOM   5331  C CE  . LYS C 1 41  ? -3.784  2.542   -3.911  1.00 2.38  ? 41  LYS C CE  1 
ATOM   5332  N NZ  . LYS C 1 41  ? -4.218  1.403   -4.744  1.00 2.00  ? 41  LYS C NZ  1 
ATOM   5333  N N   . GLY C 1 42  ? 0.522   3.922   -6.739  1.00 2.88  ? 42  GLY C N   1 
ATOM   5334  C CA  . GLY C 1 42  ? 1.367   3.582   -7.938  1.00 3.16  ? 42  GLY C CA  1 
ATOM   5335  C C   . GLY C 1 42  ? 0.438   3.672   -9.116  1.00 3.46  ? 42  GLY C C   1 
ATOM   5336  O O   . GLY C 1 42  ? 0.045   2.617   -9.661  1.00 3.98  ? 42  GLY C O   1 
ATOM   5337  N N   . LEU C 1 43  ? 0.003   4.868   -9.400  1.00 3.55  ? 43  LEU C N   1 
ATOM   5338  C CA  . LEU C 1 43  ? -0.963  4.966   -10.558 1.00 3.87  ? 43  LEU C CA  1 
ATOM   5339  C C   . LEU C 1 43  ? -0.128  5.197   -11.799 1.00 4.25  ? 43  LEU C C   1 
ATOM   5340  O O   . LEU C 1 43  ? -0.358  4.570   -12.860 1.00 4.20  ? 43  LEU C O   1 
ATOM   5341  C CB  . LEU C 1 43  ? -2.031  5.935   -10.078 1.00 3.57  ? 43  LEU C CB  1 
ATOM   5342  C CG  . LEU C 1 43  ? -3.110  5.338   -9.180  1.00 3.54  ? 43  LEU C CG  1 
ATOM   5343  C CD1 . LEU C 1 43  ? -2.566  4.661   -7.948  1.00 3.48  ? 43  LEU C CD1 1 
ATOM   5344  C CD2 . LEU C 1 43  ? -4.076  6.442   -8.712  1.00 3.59  ? 43  LEU C CD2 1 
ATOM   5345  N N   . ALA C 1 44  ? 0.993   5.928   -11.606 1.00 4.50  ? 44  ALA C N   1 
ATOM   5346  C CA  . ALA C 1 44  ? 1.747   6.315   -12.803 1.00 4.94  ? 44  ALA C CA  1 
ATOM   5347  C C   . ALA C 1 44  ? 3.246   6.303   -12.614 1.00 5.35  ? 44  ALA C C   1 
ATOM   5348  O O   . ALA C 1 44  ? 3.780   6.797   -11.639 1.00 5.21  ? 44  ALA C O   1 
ATOM   5349  C CB  . ALA C 1 44  ? 1.209   7.671   -13.245 1.00 4.98  ? 44  ALA C CB  1 
ATOM   5350  N N   . ASP C 1 45  ? 3.891   5.797   -13.642 1.00 5.83  ? 45  ASP C N   1 
ATOM   5351  C CA  . ASP C 1 45  ? 5.346   5.652   -13.719 1.00 6.44  ? 45  ASP C CA  1 
ATOM   5352  C C   . ASP C 1 45  ? 5.956   6.855   -14.422 1.00 6.66  ? 45  ASP C C   1 
ATOM   5353  O O   . ASP C 1 45  ? 7.202   6.936   -14.546 1.00 6.86  ? 45  ASP C O   1 
ATOM   5354  C CB  . ASP C 1 45  ? 5.632   4.306   -14.409 1.00 6.78  ? 45  ASP C CB  1 
ATOM   5355  C CG  . ASP C 1 45  ? 4.786   4.233   -15.693 1.00 6.98  ? 45  ASP C CG  1 
ATOM   5356  O OD1 . ASP C 1 45  ? 4.419   5.306   -16.194 1.00 6.89  ? 45  ASP C OD1 1 
ATOM   5357  O OD2 . ASP C 1 45  ? 4.480   3.096   -16.092 1.00 7.30  ? 45  ASP C OD2 1 
ATOM   5358  N N   . GLU C 1 46  ? 5.109   7.668   -15.028 1.00 6.78  ? 46  GLU C N   1 
ATOM   5359  C CA  . GLU C 1 46  ? 5.502   8.957   -15.626 1.00 6.71  ? 46  GLU C CA  1 
ATOM   5360  C C   . GLU C 1 46  ? 4.284   9.872   -15.359 1.00 6.64  ? 46  GLU C C   1 
ATOM   5361  O O   . GLU C 1 46  ? 3.132   9.520   -15.619 1.00 6.42  ? 46  GLU C O   1 
ATOM   5362  C CB  . GLU C 1 46  ? 5.866   9.068   -17.090 1.00 6.61  ? 46  GLU C CB  1 
ATOM   5363  C CG  . GLU C 1 46  ? 6.425   10.372  -17.608 1.00 6.62  ? 46  GLU C CG  1 
ATOM   5364  C CD  . GLU C 1 46  ? 6.741   10.743  -18.987 1.00 6.62  ? 46  GLU C CD  1 
ATOM   5365  O OE1 . GLU C 1 46  ? 7.273   10.118  -19.884 1.00 6.68  ? 46  GLU C OE1 1 
ATOM   5366  O OE2 . GLU C 1 46  ? 6.447   11.939  -19.322 1.00 6.52  ? 46  GLU C OE2 1 
ATOM   5367  N N   . LEU C 1 47  ? 4.606   10.928  -14.673 1.00 6.86  ? 47  LEU C N   1 
ATOM   5368  C CA  . LEU C 1 47  ? 3.617   11.970  -14.326 1.00 7.09  ? 47  LEU C CA  1 
ATOM   5369  C C   . LEU C 1 47  ? 4.262   13.302  -14.710 1.00 7.32  ? 47  LEU C C   1 
ATOM   5370  O O   . LEU C 1 47  ? 5.283   13.674  -14.140 1.00 7.34  ? 47  LEU C O   1 
ATOM   5371  C CB  . LEU C 1 47  ? 3.180   11.777  -12.900 1.00 6.96  ? 47  LEU C CB  1 
ATOM   5372  C CG  . LEU C 1 47  ? 2.486   12.929  -12.187 1.00 6.91  ? 47  LEU C CG  1 
ATOM   5373  C CD1 . LEU C 1 47  ? 1.628   12.410  -11.031 1.00 6.83  ? 47  LEU C CD1 1 
ATOM   5374  C CD2 . LEU C 1 47  ? 3.543   13.888  -11.640 1.00 6.84  ? 47  LEU C CD2 1 
ATOM   5375  N N   . ALA C 1 48  ? 3.709   13.887  -15.729 1.00 7.80  ? 48  ALA C N   1 
ATOM   5376  C CA  . ALA C 1 48  ? 4.161   15.155  -16.308 1.00 8.58  ? 48  ALA C CA  1 
ATOM   5377  C C   . ALA C 1 48  ? 3.294   16.290  -15.795 1.00 9.27  ? 48  ALA C C   1 
ATOM   5378  O O   . ALA C 1 48  ? 2.033   16.145  -15.836 1.00 9.86  ? 48  ALA C O   1 
ATOM   5379  C CB  . ALA C 1 48  ? 4.097   15.036  -17.824 1.00 8.46  ? 48  ALA C CB  1 
ATOM   5380  N N   . LEU C 1 49  ? 3.892   17.397  -15.407 1.00 9.67  ? 49  LEU C N   1 
ATOM   5381  C CA  . LEU C 1 49  ? 3.012   18.473  -14.846 1.00 10.46 ? 49  LEU C CA  1 
ATOM   5382  C C   . LEU C 1 49  ? 3.136   19.728  -15.675 1.00 11.22 ? 49  LEU C C   1 
ATOM   5383  O O   . LEU C 1 49  ? 4.186   20.368  -15.742 1.00 11.30 ? 49  LEU C O   1 
ATOM   5384  C CB  . LEU C 1 49  ? 3.264   18.451  -13.363 1.00 10.27 ? 49  LEU C CB  1 
ATOM   5385  C CG  . LEU C 1 49  ? 4.515   17.884  -12.748 1.00 10.09 ? 49  LEU C CG  1 
ATOM   5386  C CD1 . LEU C 1 49  ? 5.652   18.896  -12.657 1.00 10.00 ? 49  LEU C CD1 1 
ATOM   5387  C CD2 . LEU C 1 49  ? 4.208   17.403  -11.333 1.00 10.01 ? 49  LEU C CD2 1 
ATOM   5388  N N   . VAL C 1 50  ? 2.036   20.095  -16.333 1.00 12.16 ? 50  VAL C N   1 
ATOM   5389  C CA  . VAL C 1 50  ? 1.973   21.269  -17.208 1.00 13.20 ? 50  VAL C CA  1 
ATOM   5390  C C   . VAL C 1 50  ? 1.288   22.467  -16.560 1.00 14.30 ? 50  VAL C C   1 
ATOM   5391  O O   . VAL C 1 50  ? 0.082   22.461  -16.282 1.00 14.55 ? 50  VAL C O   1 
ATOM   5392  C CB  . VAL C 1 50  ? 1.363   20.861  -18.565 1.00 12.83 ? 50  VAL C CB  1 
ATOM   5393  C CG1 . VAL C 1 50  ? 1.147   22.037  -19.508 1.00 12.79 ? 50  VAL C CG1 1 
ATOM   5394  C CG2 . VAL C 1 50  ? 2.222   19.797  -19.224 1.00 12.81 ? 50  VAL C CG2 1 
ATOM   5395  N N   . ASP C 1 51  ? 2.054   23.526  -16.418 1.00 15.48 ? 51  ASP C N   1 
ATOM   5396  C CA  . ASP C 1 51  ? 1.613   24.809  -15.837 1.00 16.77 ? 51  ASP C CA  1 
ATOM   5397  C C   . ASP C 1 51  ? 2.175   25.943  -16.717 1.00 17.69 ? 51  ASP C C   1 
ATOM   5398  O O   . ASP C 1 51  ? 3.136   25.687  -17.475 1.00 17.90 ? 51  ASP C O   1 
ATOM   5399  C CB  . ASP C 1 51  ? 2.060   24.910  -14.410 1.00 16.75 ? 51  ASP C CB  1 
ATOM   5400  C CG  . ASP C 1 51  ? 1.212   25.689  -13.455 1.00 16.76 ? 51  ASP C CG  1 
ATOM   5401  O OD1 . ASP C 1 51  ? 0.081   26.066  -13.801 1.00 16.99 ? 51  ASP C OD1 1 
ATOM   5402  O OD2 . ASP C 1 51  ? 1.664   25.899  -12.310 1.00 16.55 ? 51  ASP C OD2 1 
ATOM   5403  N N   . ALA C 1 52  ? 1.587   27.115  -16.587 1.00 18.62 ? 52  ALA C N   1 
ATOM   5404  C CA  . ALA C 1 52  ? 2.019   28.261  -17.397 1.00 19.84 ? 52  ALA C CA  1 
ATOM   5405  C C   . ALA C 1 52  ? 2.772   29.268  -16.528 1.00 20.68 ? 52  ALA C C   1 
ATOM   5406  O O   . ALA C 1 52  ? 3.271   30.271  -17.064 1.00 21.02 ? 52  ALA C O   1 
ATOM   5407  C CB  . ALA C 1 52  ? 0.855   28.997  -18.057 1.00 19.81 ? 52  ALA C CB  1 
ATOM   5408  N N   . ASP C 1 53  ? 2.778   28.957  -15.258 1.00 21.45 ? 53  ASP C N   1 
ATOM   5409  C CA  . ASP C 1 53  ? 3.355   29.867  -14.230 1.00 21.97 ? 53  ASP C CA  1 
ATOM   5410  C C   . ASP C 1 53  ? 4.732   29.286  -13.890 1.00 21.84 ? 53  ASP C C   1 
ATOM   5411  O O   . ASP C 1 53  ? 5.135   29.058  -12.771 1.00 21.72 ? 53  ASP C O   1 
ATOM   5412  C CB  . ASP C 1 53  ? 2.376   30.152  -13.138 1.00 22.75 ? 53  ASP C CB  1 
ATOM   5413  C CG  . ASP C 1 53  ? 1.074   29.411  -13.023 1.00 23.57 ? 53  ASP C CG  1 
ATOM   5414  O OD1 . ASP C 1 53  ? 0.270   29.664  -12.065 1.00 24.00 ? 53  ASP C OD1 1 
ATOM   5415  O OD2 . ASP C 1 53  ? 0.691   28.554  -13.867 1.00 23.82 ? 53  ASP C OD2 1 
ATOM   5416  N N   . THR C 1 54  ? 5.399   29.014  -14.977 1.00 21.88 ? 54  THR C N   1 
ATOM   5417  C CA  . THR C 1 54  ? 6.737   28.510  -15.188 1.00 22.01 ? 54  THR C CA  1 
ATOM   5418  C C   . THR C 1 54  ? 7.643   28.507  -13.982 1.00 22.20 ? 54  THR C C   1 
ATOM   5419  O O   . THR C 1 54  ? 8.472   27.601  -13.757 1.00 22.07 ? 54  THR C O   1 
ATOM   5420  C CB  . THR C 1 54  ? 7.351   29.392  -16.385 1.00 21.88 ? 54  THR C CB  1 
ATOM   5421  O OG1 . THR C 1 54  ? 8.537   28.751  -16.866 1.00 21.78 ? 54  THR C OG1 1 
ATOM   5422  C CG2 . THR C 1 54  ? 7.608   30.854  -15.972 1.00 21.89 ? 54  THR C CG2 1 
ATOM   5423  N N   . ASP C 1 55  ? 7.536   29.574  -13.219 1.00 22.52 ? 55  ASP C N   1 
ATOM   5424  C CA  . ASP C 1 55  ? 8.277   29.882  -11.995 1.00 22.65 ? 55  ASP C CA  1 
ATOM   5425  C C   . ASP C 1 55  ? 7.997   28.775  -10.963 1.00 22.20 ? 55  ASP C C   1 
ATOM   5426  O O   . ASP C 1 55  ? 8.744   27.789  -10.950 1.00 22.28 ? 55  ASP C O   1 
ATOM   5427  C CB  . ASP C 1 55  ? 7.977   31.273  -11.484 1.00 23.42 ? 55  ASP C CB  1 
ATOM   5428  C CG  . ASP C 1 55  ? 8.275   32.517  -12.268 1.00 24.00 ? 55  ASP C CG  1 
ATOM   5429  O OD1 . ASP C 1 55  ? 7.690   32.845  -13.335 1.00 24.22 ? 55  ASP C OD1 1 
ATOM   5430  O OD2 . ASP C 1 55  ? 9.104   33.337  -11.731 1.00 24.15 ? 55  ASP C OD2 1 
ATOM   5431  N N   . LYS C 1 56  ? 6.923   28.911  -10.225 1.00 21.64 ? 56  LYS C N   1 
ATOM   5432  C CA  . LYS C 1 56  ? 6.462   27.970  -9.207  1.00 21.02 ? 56  LYS C CA  1 
ATOM   5433  C C   . LYS C 1 56  ? 6.550   26.504  -9.645  1.00 20.49 ? 56  LYS C C   1 
ATOM   5434  O O   . LYS C 1 56  ? 6.750   25.595  -8.816  1.00 20.33 ? 56  LYS C O   1 
ATOM   5435  C CB  . LYS C 1 56  ? 5.000   28.230  -8.758  1.00 20.90 ? 56  LYS C CB  1 
ATOM   5436  C CG  . LYS C 1 56  ? 4.310   27.055  -8.121  1.00 20.82 ? 56  LYS C CG  1 
ATOM   5437  C CD  . LYS C 1 56  ? 3.192   27.273  -7.148  1.00 20.86 ? 56  LYS C CD  1 
ATOM   5438  C CE  . LYS C 1 56  ? 2.404   25.971  -6.969  1.00 20.89 ? 56  LYS C CE  1 
ATOM   5439  N NZ  . LYS C 1 56  ? 1.719   25.879  -5.671  1.00 20.94 ? 56  LYS C NZ  1 
ATOM   5440  N N   . LEU C 1 57  ? 6.205   26.280  -10.903 1.00 19.81 ? 57  LEU C N   1 
ATOM   5441  C CA  . LEU C 1 57  ? 6.238   24.904  -11.379 1.00 19.16 ? 57  LEU C CA  1 
ATOM   5442  C C   . LEU C 1 57  ? 7.624   24.301  -11.241 1.00 18.73 ? 57  LEU C C   1 
ATOM   5443  O O   . LEU C 1 57  ? 7.735   23.377  -10.414 1.00 18.83 ? 57  LEU C O   1 
ATOM   5444  C CB  . LEU C 1 57  ? 5.636   24.792  -12.765 1.00 19.22 ? 57  LEU C CB  1 
ATOM   5445  C CG  . LEU C 1 57  ? 5.004   23.453  -13.073 1.00 19.30 ? 57  LEU C CG  1 
ATOM   5446  C CD1 . LEU C 1 57  ? 5.850   22.263  -12.666 1.00 19.40 ? 57  LEU C CD1 1 
ATOM   5447  C CD2 . LEU C 1 57  ? 3.707   23.371  -12.270 1.00 19.56 ? 57  LEU C CD2 1 
ATOM   5448  N N   . ARG C 1 58  ? 8.613   24.792  -11.960 1.00 18.12 ? 58  ARG C N   1 
ATOM   5449  C CA  . ARG C 1 58  ? 9.958   24.197  -11.929 1.00 17.42 ? 58  ARG C CA  1 
ATOM   5450  C C   . ARG C 1 58  ? 10.481  24.212  -10.478 1.00 16.57 ? 58  ARG C C   1 
ATOM   5451  O O   . ARG C 1 58  ? 11.637  23.810  -10.308 1.00 16.41 ? 58  ARG C O   1 
ATOM   5452  C CB  . ARG C 1 58  ? 11.002  24.813  -12.768 1.00 17.96 ? 58  ARG C CB  1 
ATOM   5453  C CG  . ARG C 1 58  ? 11.128  25.290  -14.161 1.00 18.45 ? 58  ARG C CG  1 
ATOM   5454  C CD  . ARG C 1 58  ? 12.489  25.986  -14.335 1.00 18.82 ? 58  ARG C CD  1 
ATOM   5455  N NE  . ARG C 1 58  ? 13.477  25.345  -15.060 1.00 19.02 ? 58  ARG C NE  1 
ATOM   5456  C CZ  . ARG C 1 58  ? 14.045  24.285  -15.599 1.00 19.18 ? 58  ARG C CZ  1 
ATOM   5457  N NH1 . ARG C 1 58  ? 15.283  24.398  -16.252 1.00 19.28 ? 58  ARG C NH1 1 
ATOM   5458  N NH2 . ARG C 1 58  ? 13.608  23.036  -15.350 1.00 19.11 ? 58  ARG C NH2 1 
ATOM   5459  N N   . GLY C 1 59  ? 9.744   24.801  -9.594  1.00 15.81 ? 59  GLY C N   1 
ATOM   5460  C CA  . GLY C 1 59  ? 10.087  24.853  -8.164  1.00 15.15 ? 59  GLY C CA  1 
ATOM   5461  C C   . GLY C 1 59  ? 9.455   23.622  -7.494  1.00 14.70 ? 59  GLY C C   1 
ATOM   5462  O O   . GLY C 1 59  ? 10.108  22.732  -6.956  1.00 14.54 ? 59  GLY C O   1 
ATOM   5463  N N   . GLU C 1 60  ? 8.138   23.593  -7.613  1.00 14.40 ? 60  GLU C N   1 
ATOM   5464  C CA  . GLU C 1 60  ? 7.269   22.529  -7.116  1.00 13.76 ? 60  GLU C CA  1 
ATOM   5465  C C   . GLU C 1 60  ? 7.679   21.194  -7.734  1.00 13.08 ? 60  GLU C C   1 
ATOM   5466  O O   . GLU C 1 60  ? 7.736   20.201  -7.004  1.00 13.03 ? 60  GLU C O   1 
ATOM   5467  C CB  . GLU C 1 60  ? 5.795   22.708  -7.441  1.00 13.94 ? 60  GLU C CB  1 
ATOM   5468  C CG  . GLU C 1 60  ? 4.932   23.702  -6.714  1.00 14.05 ? 60  GLU C CG  1 
ATOM   5469  C CD  . GLU C 1 60  ? 4.160   23.284  -5.518  1.00 14.16 ? 60  GLU C CD  1 
ATOM   5470  O OE1 . GLU C 1 60  ? 3.077   23.761  -5.188  1.00 14.23 ? 60  GLU C OE1 1 
ATOM   5471  O OE2 . GLU C 1 60  ? 4.709   22.389  -4.839  1.00 14.26 ? 60  GLU C OE2 1 
ATOM   5472  N N   . ALA C 1 61  ? 7.892   21.230  -9.030  1.00 12.38 ? 61  ALA C N   1 
ATOM   5473  C CA  . ALA C 1 61  ? 8.305   20.030  -9.777  1.00 11.98 ? 61  ALA C CA  1 
ATOM   5474  C C   . ALA C 1 61  ? 9.571   19.454  -9.134  1.00 11.73 ? 61  ALA C C   1 
ATOM   5475  O O   . ALA C 1 61  ? 9.556   18.282  -8.685  1.00 11.79 ? 61  ALA C O   1 
ATOM   5476  C CB  . ALA C 1 61  ? 8.441   20.333  -11.245 1.00 11.85 ? 61  ALA C CB  1 
ATOM   5477  N N   . LEU C 1 62  ? 10.602  20.282  -9.006  1.00 11.08 ? 62  LEU C N   1 
ATOM   5478  C CA  . LEU C 1 62  ? 11.886  19.920  -8.433  1.00 10.23 ? 62  LEU C CA  1 
ATOM   5479  C C   . LEU C 1 62  ? 11.786  19.431  -6.995  1.00 9.45  ? 62  LEU C C   1 
ATOM   5480  O O   . LEU C 1 62  ? 12.688  18.741  -6.517  1.00 9.26  ? 62  LEU C O   1 
ATOM   5481  C CB  . LEU C 1 62  ? 12.853  21.121  -8.547  1.00 10.45 ? 62  LEU C CB  1 
ATOM   5482  C CG  . LEU C 1 62  ? 13.811  21.000  -9.728  1.00 10.73 ? 62  LEU C CG  1 
ATOM   5483  C CD1 . LEU C 1 62  ? 14.292  22.366  -10.199 1.00 10.81 ? 62  LEU C CD1 1 
ATOM   5484  C CD2 . LEU C 1 62  ? 15.002  20.138  -9.284  1.00 10.72 ? 62  LEU C CD2 1 
ATOM   5485  N N   . ASP C 1 63  ? 10.743  19.888  -6.357  1.00 8.73  ? 63  ASP C N   1 
ATOM   5486  C CA  . ASP C 1 63  ? 10.465  19.492  -4.958  1.00 8.22  ? 63  ASP C CA  1 
ATOM   5487  C C   . ASP C 1 63  ? 10.126  17.999  -5.021  1.00 8.08  ? 63  ASP C C   1 
ATOM   5488  O O   . ASP C 1 63  ? 10.796  17.197  -4.350  1.00 8.38  ? 63  ASP C O   1 
ATOM   5489  C CB  . ASP C 1 63  ? 9.398   20.362  -4.342  1.00 7.95  ? 63  ASP C CB  1 
ATOM   5490  C CG  . ASP C 1 63  ? 9.328   20.381  -2.837  1.00 7.55  ? 63  ASP C CG  1 
ATOM   5491  O OD1 . ASP C 1 63  ? 8.496   21.096  -2.246  1.00 7.20  ? 63  ASP C OD1 1 
ATOM   5492  O OD2 . ASP C 1 63  ? 10.185  19.691  -2.251  1.00 7.41  ? 63  ASP C OD2 1 
ATOM   5493  N N   . LEU C 1 64  ? 9.163   17.691  -5.889  1.00 7.57  ? 64  LEU C N   1 
ATOM   5494  C CA  . LEU C 1 64  ? 8.785   16.275  -6.076  1.00 7.08  ? 64  LEU C CA  1 
ATOM   5495  C C   . LEU C 1 64  ? 10.009  15.484  -6.531  1.00 6.98  ? 64  LEU C C   1 
ATOM   5496  O O   . LEU C 1 64  ? 10.243  14.388  -6.002  1.00 7.07  ? 64  LEU C O   1 
ATOM   5497  C CB  . LEU C 1 64  ? 7.575   16.198  -6.975  1.00 6.92  ? 64  LEU C CB  1 
ATOM   5498  C CG  . LEU C 1 64  ? 6.251   16.724  -6.506  1.00 6.94  ? 64  LEU C CG  1 
ATOM   5499  C CD1 . LEU C 1 64  ? 5.123   16.442  -7.505  1.00 6.98  ? 64  LEU C CD1 1 
ATOM   5500  C CD2 . LEU C 1 64  ? 5.857   16.082  -5.178  1.00 6.95  ? 64  LEU C CD2 1 
ATOM   5501  N N   . GLN C 1 65  ? 10.813  16.079  -7.394  1.00 6.93  ? 65  GLN C N   1 
ATOM   5502  C CA  . GLN C 1 65  ? 11.984  15.375  -7.969  1.00 6.88  ? 65  GLN C CA  1 
ATOM   5503  C C   . GLN C 1 65  ? 12.966  15.052  -6.864  1.00 6.72  ? 65  GLN C C   1 
ATOM   5504  O O   . GLN C 1 65  ? 13.296  13.860  -6.697  1.00 6.74  ? 65  GLN C O   1 
ATOM   5505  C CB  . GLN C 1 65  ? 12.570  16.071  -9.176  1.00 7.11  ? 65  GLN C CB  1 
ATOM   5506  C CG  . GLN C 1 65  ? 12.251  15.371  -10.478 1.00 7.55  ? 65  GLN C CG  1 
ATOM   5507  C CD  . GLN C 1 65  ? 12.538  16.155  -11.725 1.00 7.98  ? 65  GLN C CD  1 
ATOM   5508  O OE1 . GLN C 1 65  ? 11.831  16.062  -12.747 1.00 8.08  ? 65  GLN C OE1 1 
ATOM   5509  N NE2 . GLN C 1 65  ? 13.616  16.954  -11.756 1.00 8.07  ? 65  GLN C NE2 1 
ATOM   5510  N N   . HIS C 1 66  ? 13.342  16.028  -6.068  1.00 6.54  ? 66  HIS C N   1 
ATOM   5511  C CA  . HIS C 1 66  ? 14.226  15.794  -4.934  1.00 6.46  ? 66  HIS C CA  1 
ATOM   5512  C C   . HIS C 1 66  ? 13.641  14.639  -4.100  1.00 6.58  ? 66  HIS C C   1 
ATOM   5513  O O   . HIS C 1 66  ? 14.349  14.022  -3.319  1.00 6.62  ? 66  HIS C O   1 
ATOM   5514  C CB  . HIS C 1 66  ? 14.393  16.935  -3.914  1.00 6.37  ? 66  HIS C CB  1 
ATOM   5515  C CG  . HIS C 1 66  ? 15.262  18.064  -4.342  1.00 6.28  ? 66  HIS C CG  1 
ATOM   5516  N ND1 . HIS C 1 66  ? 15.328  19.263  -3.670  1.00 6.27  ? 66  HIS C ND1 1 
ATOM   5517  C CD2 . HIS C 1 66  ? 16.072  18.192  -5.432  1.00 6.19  ? 66  HIS C CD2 1 
ATOM   5518  C CE1 . HIS C 1 66  ? 16.165  20.063  -4.313  1.00 6.33  ? 66  HIS C CE1 1 
ATOM   5519  N NE2 . HIS C 1 66  ? 16.637  19.419  -5.371  1.00 6.34  ? 66  HIS C NE2 1 
ATOM   5520  N N   . GLY C 1 67  ? 12.344  14.509  -4.217  1.00 6.75  ? 67  GLY C N   1 
ATOM   5521  C CA  . GLY C 1 67  ? 11.545  13.554  -3.486  1.00 7.00  ? 67  GLY C CA  1 
ATOM   5522  C C   . GLY C 1 67  ? 11.628  12.137  -3.975  1.00 7.10  ? 67  GLY C C   1 
ATOM   5523  O O   . GLY C 1 67  ? 11.217  11.223  -3.208  1.00 7.28  ? 67  GLY C O   1 
ATOM   5524  N N   . SER C 1 68  ? 12.110  11.941  -5.164  1.00 7.20  ? 68  SER C N   1 
ATOM   5525  C CA  . SER C 1 68  ? 12.288  10.606  -5.742  1.00 7.69  ? 68  SER C CA  1 
ATOM   5526  C C   . SER C 1 68  ? 12.371  9.482   -4.730  1.00 7.91  ? 68  SER C C   1 
ATOM   5527  O O   . SER C 1 68  ? 11.317  8.815   -4.599  1.00 8.14  ? 68  SER C O   1 
ATOM   5528  C CB  . SER C 1 68  ? 13.483  10.626  -6.701  1.00 7.75  ? 68  SER C CB  1 
ATOM   5529  O OG  . SER C 1 68  ? 13.049  11.380  -7.855  1.00 7.91  ? 68  SER C OG  1 
ATOM   5530  N N   . LEU C 1 69  ? 13.421  9.284   -4.002  1.00 8.05  ? 69  LEU C N   1 
ATOM   5531  C CA  . LEU C 1 69  ? 13.640  8.232   -3.029  1.00 8.36  ? 69  LEU C CA  1 
ATOM   5532  C C   . LEU C 1 69  ? 12.497  8.073   -2.045  1.00 9.00  ? 69  LEU C C   1 
ATOM   5533  O O   . LEU C 1 69  ? 12.615  8.315   -0.826  1.00 9.13  ? 69  LEU C O   1 
ATOM   5534  C CB  . LEU C 1 69  ? 14.995  8.551   -2.317  1.00 8.09  ? 69  LEU C CB  1 
ATOM   5535  C CG  . LEU C 1 69  ? 15.508  7.576   -1.264  1.00 7.64  ? 69  LEU C CG  1 
ATOM   5536  C CD1 . LEU C 1 69  ? 16.587  6.660   -1.801  1.00 7.46  ? 69  LEU C CD1 1 
ATOM   5537  C CD2 . LEU C 1 69  ? 16.075  8.351   -0.095  1.00 7.54  ? 69  LEU C CD2 1 
ATOM   5538  N N   . PHE C 1 70  ? 11.388  7.564   -2.504  1.00 9.67  ? 70  PHE C N   1 
ATOM   5539  C CA  . PHE C 1 70  ? 10.136  7.299   -1.823  1.00 9.89  ? 70  PHE C CA  1 
ATOM   5540  C C   . PHE C 1 70  ? 9.092   6.942   -2.902  1.00 10.09 ? 70  PHE C C   1 
ATOM   5541  O O   . PHE C 1 70  ? 8.265   6.031   -2.652  1.00 10.47 ? 70  PHE C O   1 
ATOM   5542  C CB  . PHE C 1 70  ? 9.616   8.418   -0.928  1.00 9.89  ? 70  PHE C CB  1 
ATOM   5543  C CG  . PHE C 1 70  ? 8.353   8.089   -0.190  1.00 10.03 ? 70  PHE C CG  1 
ATOM   5544  C CD1 . PHE C 1 70  ? 8.373   8.012   1.202   1.00 10.33 ? 70  PHE C CD1 1 
ATOM   5545  C CD2 . PHE C 1 70  ? 7.146   7.847   -0.840  1.00 9.92  ? 70  PHE C CD2 1 
ATOM   5546  C CE1 . PHE C 1 70  ? 7.215   7.700   1.931   1.00 10.39 ? 70  PHE C CE1 1 
ATOM   5547  C CE2 . PHE C 1 70  ? 6.005   7.442   -0.172  1.00 9.90  ? 70  PHE C CE2 1 
ATOM   5548  C CZ  . PHE C 1 70  ? 6.032   7.405   1.225   1.00 10.19 ? 70  PHE C CZ  1 
ATOM   5549  N N   . LEU C 1 71  ? 9.141   7.612   -4.004  1.00 10.15 ? 71  LEU C N   1 
ATOM   5550  C CA  . LEU C 1 71  ? 8.165   7.350   -5.079  1.00 10.77 ? 71  LEU C CA  1 
ATOM   5551  C C   . LEU C 1 71  ? 8.432   6.011   -5.751  1.00 10.89 ? 71  LEU C C   1 
ATOM   5552  O O   . LEU C 1 71  ? 9.565   5.527   -5.666  1.00 10.99 ? 71  LEU C O   1 
ATOM   5553  C CB  . LEU C 1 71  ? 8.197   8.562   -6.003  1.00 11.10 ? 71  LEU C CB  1 
ATOM   5554  C CG  . LEU C 1 71  ? 8.301   9.966   -5.461  1.00 11.17 ? 71  LEU C CG  1 
ATOM   5555  C CD1 . LEU C 1 71  ? 7.848   10.953  -6.547  1.00 11.17 ? 71  LEU C CD1 1 
ATOM   5556  C CD2 . LEU C 1 71  ? 7.445   10.152  -4.208  1.00 11.18 ? 71  LEU C CD2 1 
ATOM   5557  N N   . SER C 1 72  ? 7.410   5.463   -6.367  1.00 11.14 ? 72  SER C N   1 
ATOM   5558  C CA  . SER C 1 72  ? 7.446   4.233   -7.152  1.00 11.51 ? 72  SER C CA  1 
ATOM   5559  C C   . SER C 1 72  ? 7.094   4.623   -8.612  1.00 11.50 ? 72  SER C C   1 
ATOM   5560  O O   . SER C 1 72  ? 6.404   3.887   -9.317  1.00 11.44 ? 72  SER C O   1 
ATOM   5561  C CB  . SER C 1 72  ? 6.492   3.154   -6.750  1.00 11.94 ? 72  SER C CB  1 
ATOM   5562  O OG  . SER C 1 72  ? 6.841   2.207   -5.778  1.00 12.61 ? 72  SER C OG  1 
ATOM   5563  N N   . THR C 1 73  ? 7.536   5.787   -8.961  1.00 11.61 ? 73  THR C N   1 
ATOM   5564  C CA  . THR C 1 73  ? 7.328   6.411   -10.272 1.00 11.96 ? 73  THR C CA  1 
ATOM   5565  C C   . THR C 1 73  ? 8.616   7.157   -10.596 1.00 12.28 ? 73  THR C C   1 
ATOM   5566  O O   . THR C 1 73  ? 8.886   8.209   -10.000 1.00 12.29 ? 73  THR C O   1 
ATOM   5567  C CB  . THR C 1 73  ? 6.041   7.284   -10.294 1.00 12.07 ? 73  THR C CB  1 
ATOM   5568  O OG1 . THR C 1 73  ? 6.254   8.465   -11.146 1.00 12.06 ? 73  THR C OG1 1 
ATOM   5569  C CG2 . THR C 1 73  ? 5.475   7.666   -8.911  1.00 12.12 ? 73  THR C CG2 1 
ATOM   5570  N N   . PRO C 1 74  ? 9.391   6.527   -11.460 1.00 12.61 ? 74  PRO C N   1 
ATOM   5571  C CA  . PRO C 1 74  ? 10.719  7.018   -11.797 1.00 12.88 ? 74  PRO C CA  1 
ATOM   5572  C C   . PRO C 1 74  ? 10.717  8.341   -12.501 1.00 13.28 ? 74  PRO C C   1 
ATOM   5573  O O   . PRO C 1 74  ? 11.526  9.233   -12.113 1.00 13.41 ? 74  PRO C O   1 
ATOM   5574  C CB  . PRO C 1 74  ? 11.321  5.879   -12.637 1.00 12.85 ? 74  PRO C CB  1 
ATOM   5575  C CG  . PRO C 1 74  ? 10.146  5.310   -13.349 1.00 12.82 ? 74  PRO C CG  1 
ATOM   5576  C CD  . PRO C 1 74  ? 8.998   5.389   -12.314 1.00 12.73 ? 74  PRO C CD  1 
ATOM   5577  N N   . LYS C 1 75  ? 9.813   8.513   -13.445 1.00 13.77 ? 75  LYS C N   1 
ATOM   5578  C CA  . LYS C 1 75  ? 9.878   9.788   -14.262 1.00 14.34 ? 75  LYS C CA  1 
ATOM   5579  C C   . LYS C 1 75  ? 8.752   10.726  -13.868 1.00 14.51 ? 75  LYS C C   1 
ATOM   5580  O O   . LYS C 1 75  ? 7.580   10.360  -13.803 1.00 14.46 ? 75  LYS C O   1 
ATOM   5581  C CB  . LYS C 1 75  ? 9.943   9.475   -15.692 1.00 14.46 ? 75  LYS C CB  1 
ATOM   5582  C CG  . LYS C 1 75  ? 9.951   10.321  -16.901 1.00 14.50 ? 75  LYS C CG  1 
ATOM   5583  C CD  . LYS C 1 75  ? 9.757   9.527   -18.206 1.00 14.84 ? 75  LYS C CD  1 
ATOM   5584  C CE  . LYS C 1 75  ? 8.836   8.349   -18.125 1.00 15.28 ? 75  LYS C CE  1 
ATOM   5585  N NZ  . LYS C 1 75  ? 8.174   7.820   -19.319 1.00 15.56 ? 75  LYS C NZ  1 
ATOM   5586  N N   . ILE C 1 76  ? 9.191   11.934  -13.602 1.00 14.89 ? 76  ILE C N   1 
ATOM   5587  C CA  . ILE C 1 76  ? 8.415   13.122  -13.252 1.00 15.33 ? 76  ILE C CA  1 
ATOM   5588  C C   . ILE C 1 76  ? 8.908   14.296  -14.099 1.00 15.94 ? 76  ILE C C   1 
ATOM   5589  O O   . ILE C 1 76  ? 10.021  14.818  -13.901 1.00 15.92 ? 76  ILE C O   1 
ATOM   5590  C CB  . ILE C 1 76  ? 8.490   13.364  -11.709 1.00 15.02 ? 76  ILE C CB  1 
ATOM   5591  C CG1 . ILE C 1 76  ? 7.672   12.222  -11.051 1.00 14.99 ? 76  ILE C CG1 1 
ATOM   5592  C CG2 . ILE C 1 76  ? 8.039   14.764  -11.262 1.00 14.87 ? 76  ILE C CG2 1 
ATOM   5593  C CD1 . ILE C 1 76  ? 7.629   12.224  -9.512  1.00 15.01 ? 76  ILE C CD1 1 
ATOM   5594  N N   . VAL C 1 77  ? 8.110   14.673  -15.074 1.00 16.76 ? 77  VAL C N   1 
ATOM   5595  C CA  . VAL C 1 77  ? 8.519   15.744  -16.010 1.00 17.70 ? 77  VAL C CA  1 
ATOM   5596  C C   . VAL C 1 77  ? 7.619   16.954  -15.840 1.00 18.44 ? 77  VAL C C   1 
ATOM   5597  O O   . VAL C 1 77  ? 6.565   16.888  -15.192 1.00 18.57 ? 77  VAL C O   1 
ATOM   5598  C CB  . VAL C 1 77  ? 8.646   15.206  -17.438 1.00 17.63 ? 77  VAL C CB  1 
ATOM   5599  C CG1 . VAL C 1 77  ? 10.106  14.803  -17.757 1.00 17.58 ? 77  VAL C CG1 1 
ATOM   5600  C CG2 . VAL C 1 77  ? 7.752   14.014  -17.754 1.00 17.56 ? 77  VAL C CG2 1 
ATOM   5601  N N   . PHE C 1 78  ? 8.095   18.052  -16.397 1.00 19.45 ? 78  PHE C N   1 
ATOM   5602  C CA  . PHE C 1 78  ? 7.384   19.345  -16.369 1.00 20.27 ? 78  PHE C CA  1 
ATOM   5603  C C   . PHE C 1 78  ? 7.621   20.125  -17.664 1.00 20.55 ? 78  PHE C C   1 
ATOM   5604  O O   . PHE C 1 78  ? 8.696   20.119  -18.263 1.00 20.49 ? 78  PHE C O   1 
ATOM   5605  C CB  . PHE C 1 78  ? 7.703   20.128  -15.094 1.00 20.62 ? 78  PHE C CB  1 
ATOM   5606  C CG  . PHE C 1 78  ? 7.544   21.609  -15.170 1.00 21.18 ? 78  PHE C CG  1 
ATOM   5607  C CD1 . PHE C 1 78  ? 6.399   22.200  -15.733 1.00 21.27 ? 78  PHE C CD1 1 
ATOM   5608  C CD2 . PHE C 1 78  ? 8.502   22.452  -14.571 1.00 21.45 ? 78  PHE C CD2 1 
ATOM   5609  C CE1 . PHE C 1 78  ? 6.267   23.562  -15.881 1.00 21.37 ? 78  PHE C CE1 1 
ATOM   5610  C CE2 . PHE C 1 78  ? 8.351   23.848  -14.670 1.00 21.55 ? 78  PHE C CE2 1 
ATOM   5611  C CZ  . PHE C 1 78  ? 7.247   24.394  -15.348 1.00 21.52 ? 78  PHE C CZ  1 
ATOM   5612  N N   . GLY C 1 79  ? 6.557   20.801  -18.082 1.00 21.01 ? 79  GLY C N   1 
ATOM   5613  C CA  . GLY C 1 79  ? 6.527   21.660  -19.232 1.00 21.77 ? 79  GLY C CA  1 
ATOM   5614  C C   . GLY C 1 79  ? 5.718   22.939  -19.080 1.00 22.23 ? 79  GLY C C   1 
ATOM   5615  O O   . GLY C 1 79  ? 4.802   23.093  -18.293 1.00 22.07 ? 79  GLY C O   1 
ATOM   5616  N N   . LYS C 1 80  ? 6.100   23.889  -19.912 1.00 22.99 ? 80  LYS C N   1 
ATOM   5617  C CA  . LYS C 1 80  ? 5.492   25.215  -20.088 1.00 23.61 ? 80  LYS C CA  1 
ATOM   5618  C C   . LYS C 1 80  ? 4.459   25.093  -21.212 1.00 23.93 ? 80  LYS C C   1 
ATOM   5619  O O   . LYS C 1 80  ? 3.606   25.960  -21.423 1.00 23.99 ? 80  LYS C O   1 
ATOM   5620  C CB  . LYS C 1 80  ? 6.554   26.234  -20.426 1.00 23.88 ? 80  LYS C CB  1 
ATOM   5621  C CG  . LYS C 1 80  ? 6.210   27.441  -21.252 1.00 24.13 ? 80  LYS C CG  1 
ATOM   5622  C CD  . LYS C 1 80  ? 5.604   28.590  -20.489 1.00 24.31 ? 80  LYS C CD  1 
ATOM   5623  C CE  . LYS C 1 80  ? 6.677   29.573  -19.977 1.00 24.36 ? 80  LYS C CE  1 
ATOM   5624  N NZ  . LYS C 1 80  ? 5.961   30.817  -19.536 1.00 24.47 ? 80  LYS C NZ  1 
ATOM   5625  N N   . ASP C 1 81  ? 4.629   24.000  -21.942 1.00 24.28 ? 81  ASP C N   1 
ATOM   5626  C CA  . ASP C 1 81  ? 3.777   23.610  -23.057 1.00 24.56 ? 81  ASP C CA  1 
ATOM   5627  C C   . ASP C 1 81  ? 3.374   22.121  -22.909 1.00 24.48 ? 81  ASP C C   1 
ATOM   5628  O O   . ASP C 1 81  ? 3.966   21.294  -22.219 1.00 24.28 ? 81  ASP C O   1 
ATOM   5629  C CB  . ASP C 1 81  ? 4.406   23.926  -24.411 1.00 24.95 ? 81  ASP C CB  1 
ATOM   5630  C CG  . ASP C 1 81  ? 3.421   23.795  -25.572 1.00 25.16 ? 81  ASP C CG  1 
ATOM   5631  O OD1 . ASP C 1 81  ? 2.391   24.501  -25.584 1.00 25.19 ? 81  ASP C OD1 1 
ATOM   5632  O OD2 . ASP C 1 81  ? 3.725   22.950  -26.453 1.00 25.16 ? 81  ASP C OD2 1 
ATOM   5633  N N   . TYR C 1 82  ? 2.338   21.843  -23.659 1.00 24.47 ? 82  TYR C N   1 
ATOM   5634  C CA  . TYR C 1 82  ? 1.610   20.591  -23.745 1.00 24.60 ? 82  TYR C CA  1 
ATOM   5635  C C   . TYR C 1 82  ? 2.352   19.530  -24.512 1.00 24.75 ? 82  TYR C C   1 
ATOM   5636  O O   . TYR C 1 82  ? 2.036   18.308  -24.483 1.00 24.92 ? 82  TYR C O   1 
ATOM   5637  C CB  . TYR C 1 82  ? 0.199   20.913  -24.325 1.00 24.57 ? 82  TYR C CB  1 
ATOM   5638  C CG  . TYR C 1 82  ? -0.440  22.014  -23.485 1.00 24.46 ? 82  TYR C CG  1 
ATOM   5639  C CD1 . TYR C 1 82  ? -0.272  23.364  -23.801 1.00 24.49 ? 82  TYR C CD1 1 
ATOM   5640  C CD2 . TYR C 1 82  ? -1.067  21.689  -22.301 1.00 24.43 ? 82  TYR C CD2 1 
ATOM   5641  C CE1 . TYR C 1 82  ? -0.813  24.365  -22.998 1.00 24.48 ? 82  TYR C CE1 1 
ATOM   5642  C CE2 . TYR C 1 82  ? -1.622  22.667  -21.490 1.00 24.46 ? 82  TYR C CE2 1 
ATOM   5643  C CZ  . TYR C 1 82  ? -1.482  24.005  -21.831 1.00 24.50 ? 82  TYR C CZ  1 
ATOM   5644  O OH  . TYR C 1 82  ? -2.053  24.920  -20.998 1.00 24.51 ? 82  TYR C OH  1 
ATOM   5645  N N   . ASN C 1 83  ? 3.408   19.985  -25.173 1.00 24.72 ? 83  ASN C N   1 
ATOM   5646  C CA  . ASN C 1 83  ? 4.264   19.030  -25.895 1.00 24.71 ? 83  ASN C CA  1 
ATOM   5647  C C   . ASN C 1 83  ? 4.771   18.008  -24.866 1.00 24.45 ? 83  ASN C C   1 
ATOM   5648  O O   . ASN C 1 83  ? 5.091   16.852  -25.143 1.00 24.41 ? 83  ASN C O   1 
ATOM   5649  C CB  . ASN C 1 83  ? 5.384   19.794  -26.615 1.00 25.05 ? 83  ASN C CB  1 
ATOM   5650  C CG  . ASN C 1 83  ? 5.917   18.821  -27.684 1.00 25.38 ? 83  ASN C CG  1 
ATOM   5651  O OD1 . ASN C 1 83  ? 6.499   17.788  -27.314 1.00 25.37 ? 83  ASN C OD1 1 
ATOM   5652  N ND2 . ASN C 1 83  ? 5.472   19.119  -28.896 1.00 25.71 ? 83  ASN C ND2 1 
ATOM   5653  N N   . VAL C 1 84  ? 4.823   18.515  -23.651 1.00 24.08 ? 84  VAL C N   1 
ATOM   5654  C CA  . VAL C 1 84  ? 5.372   17.789  -22.493 1.00 23.78 ? 84  VAL C CA  1 
ATOM   5655  C C   . VAL C 1 84  ? 4.365   16.811  -21.924 1.00 23.61 ? 84  VAL C C   1 
ATOM   5656  O O   . VAL C 1 84  ? 4.564   16.225  -20.852 1.00 23.52 ? 84  VAL C O   1 
ATOM   5657  C CB  . VAL C 1 84  ? 5.913   18.865  -21.526 1.00 23.76 ? 84  VAL C CB  1 
ATOM   5658  C CG1 . VAL C 1 84  ? 6.646   18.303  -20.324 1.00 23.76 ? 84  VAL C CG1 1 
ATOM   5659  C CG2 . VAL C 1 84  ? 6.812   19.871  -22.255 1.00 23.71 ? 84  VAL C CG2 1 
ATOM   5660  N N   . SER C 1 85  ? 3.330   16.529  -22.704 1.00 23.47 ? 85  SER C N   1 
ATOM   5661  C CA  . SER C 1 85  ? 2.217   15.661  -22.286 1.00 23.20 ? 85  SER C CA  1 
ATOM   5662  C C   . SER C 1 85  ? 2.048   14.472  -23.207 1.00 23.03 ? 85  SER C C   1 
ATOM   5663  O O   . SER C 1 85  ? 1.187   13.586  -22.994 1.00 23.08 ? 85  SER C O   1 
ATOM   5664  C CB  . SER C 1 85  ? 0.937   16.510  -22.246 1.00 23.23 ? 85  SER C CB  1 
ATOM   5665  O OG  . SER C 1 85  ? 0.150   16.198  -21.105 1.00 23.25 ? 85  SER C OG  1 
ATOM   5666  N N   . ALA C 1 86  ? 2.922   14.398  -24.192 1.00 22.69 ? 86  ALA C N   1 
ATOM   5667  C CA  . ALA C 1 86  ? 2.854   13.396  -25.246 1.00 22.31 ? 86  ALA C CA  1 
ATOM   5668  C C   . ALA C 1 86  ? 2.585   11.989  -24.733 1.00 22.07 ? 86  ALA C C   1 
ATOM   5669  O O   . ALA C 1 86  ? 3.408   11.370  -24.056 1.00 22.12 ? 86  ALA C O   1 
ATOM   5670  C CB  . ALA C 1 86  ? 4.130   13.413  -26.077 1.00 22.31 ? 86  ALA C CB  1 
ATOM   5671  N N   . ASN C 1 87  ? 1.420   11.498  -25.091 1.00 21.71 ? 87  ASN C N   1 
ATOM   5672  C CA  . ASN C 1 87  ? 0.986   10.114  -24.873 1.00 21.34 ? 87  ASN C CA  1 
ATOM   5673  C C   . ASN C 1 87  ? 0.621   9.802   -23.438 1.00 20.78 ? 87  ASN C C   1 
ATOM   5674  O O   . ASN C 1 87  ? 0.992   8.732   -22.896 1.00 20.84 ? 87  ASN C O   1 
ATOM   5675  C CB  . ASN C 1 87  ? 2.031   9.161   -25.490 1.00 21.82 ? 87  ASN C CB  1 
ATOM   5676  C CG  . ASN C 1 87  ? 2.180   9.425   -26.989 1.00 22.29 ? 87  ASN C CG  1 
ATOM   5677  O OD1 . ASN C 1 87  ? 1.399   8.897   -27.813 1.00 22.47 ? 87  ASN C OD1 1 
ATOM   5678  N ND2 . ASN C 1 87  ? 3.169   10.250  -27.358 1.00 22.40 ? 87  ASN C ND2 1 
ATOM   5679  N N   . SER C 1 88  ? -0.117  10.747  -22.856 1.00 19.80 ? 88  SER C N   1 
ATOM   5680  C CA  . SER C 1 88  ? -0.654  10.586  -21.496 1.00 18.73 ? 88  SER C CA  1 
ATOM   5681  C C   . SER C 1 88  ? -1.855  9.638   -21.604 1.00 17.79 ? 88  SER C C   1 
ATOM   5682  O O   . SER C 1 88  ? -2.477  9.659   -22.684 1.00 17.94 ? 88  SER C O   1 
ATOM   5683  C CB  . SER C 1 88  ? -1.173  11.879  -20.898 1.00 18.83 ? 88  SER C CB  1 
ATOM   5684  O OG  . SER C 1 88  ? -0.218  12.610  -20.164 1.00 18.89 ? 88  SER C OG  1 
ATOM   5685  N N   . LYS C 1 89  ? -2.112  8.906   -20.558 1.00 16.53 ? 89  LYS C N   1 
ATOM   5686  C CA  . LYS C 1 89  ? -3.351  8.058   -20.554 1.00 15.27 ? 89  LYS C CA  1 
ATOM   5687  C C   . LYS C 1 89  ? -4.472  8.856   -19.886 1.00 14.27 ? 89  LYS C C   1 
ATOM   5688  O O   . LYS C 1 89  ? -5.640  8.790   -20.317 1.00 14.16 ? 89  LYS C O   1 
ATOM   5689  C CB  . LYS C 1 89  ? -3.119  6.699   -19.956 1.00 15.28 ? 89  LYS C CB  1 
ATOM   5690  C CG  . LYS C 1 89  ? -2.506  5.637   -20.870 1.00 15.20 ? 89  LYS C CG  1 
ATOM   5691  C CD  . LYS C 1 89  ? -1.170  6.014   -21.453 1.00 15.23 ? 89  LYS C CD  1 
ATOM   5692  C CE  . LYS C 1 89  ? -0.808  5.274   -22.718 1.00 15.20 ? 89  LYS C CE  1 
ATOM   5693  N NZ  . LYS C 1 89  ? 0.236   6.027   -23.491 1.00 15.12 ? 89  LYS C NZ  1 
ATOM   5694  N N   . LEU C 1 90  ? -4.116  9.716   -18.949 1.00 13.02 ? 90  LEU C N   1 
ATOM   5695  C CA  . LEU C 1 90  ? -5.028  10.533  -18.187 1.00 11.92 ? 90  LEU C CA  1 
ATOM   5696  C C   . LEU C 1 90  ? -4.489  11.949  -17.932 1.00 11.43 ? 90  LEU C C   1 
ATOM   5697  O O   . LEU C 1 90  ? -3.436  12.121  -17.303 1.00 11.44 ? 90  LEU C O   1 
ATOM   5698  C CB  . LEU C 1 90  ? -5.340  9.842   -16.843 1.00 11.66 ? 90  LEU C CB  1 
ATOM   5699  C CG  . LEU C 1 90  ? -6.387  10.563  -15.993 1.00 11.40 ? 90  LEU C CG  1 
ATOM   5700  C CD1 . LEU C 1 90  ? -7.719  9.840   -16.063 1.00 11.19 ? 90  LEU C CD1 1 
ATOM   5701  C CD2 . LEU C 1 90  ? -5.900  10.678  -14.554 1.00 11.35 ? 90  LEU C CD2 1 
ATOM   5702  N N   . VAL C 1 91  ? -5.290  12.911  -18.354 1.00 10.60 ? 91  VAL C N   1 
ATOM   5703  C CA  . VAL C 1 91  ? -5.006  14.330  -18.177 1.00 10.00 ? 91  VAL C CA  1 
ATOM   5704  C C   . VAL C 1 91  ? -6.016  14.934  -17.192 1.00 9.62  ? 91  VAL C C   1 
ATOM   5705  O O   . VAL C 1 91  ? -7.221  14.736  -17.385 1.00 9.64  ? 91  VAL C O   1 
ATOM   5706  C CB  . VAL C 1 91  ? -5.005  15.050  -19.536 1.00 9.93  ? 91  VAL C CB  1 
ATOM   5707  C CG1 . VAL C 1 91  ? -4.582  16.525  -19.378 1.00 9.93  ? 91  VAL C CG1 1 
ATOM   5708  C CG2 . VAL C 1 91  ? -4.167  14.370  -20.575 1.00 9.71  ? 91  VAL C CG2 1 
ATOM   5709  N N   . ILE C 1 92  ? -5.528  15.663  -16.225 1.00 9.28  ? 92  ILE C N   1 
ATOM   5710  C CA  . ILE C 1 92  ? -6.429  16.297  -15.225 1.00 9.19  ? 92  ILE C CA  1 
ATOM   5711  C C   . ILE C 1 92  ? -6.170  17.801  -15.165 1.00 9.44  ? 92  ILE C C   1 
ATOM   5712  O O   . ILE C 1 92  ? -5.149  18.387  -14.766 1.00 9.45  ? 92  ILE C O   1 
ATOM   5713  C CB  . ILE C 1 92  ? -6.475  15.449  -13.928 1.00 8.83  ? 92  ILE C CB  1 
ATOM   5714  C CG1 . ILE C 1 92  ? -6.851  16.307  -12.708 1.00 8.73  ? 92  ILE C CG1 1 
ATOM   5715  C CG2 . ILE C 1 92  ? -5.208  14.582  -13.670 1.00 8.74  ? 92  ILE C CG2 1 
ATOM   5716  C CD1 . ILE C 1 92  ? -5.752  16.942  -11.859 1.00 8.61  ? 92  ILE C CD1 1 
ATOM   5717  N N   . ILE C 1 93  ? -7.178  18.478  -15.705 1.00 9.62  ? 93  ILE C N   1 
ATOM   5718  C CA  . ILE C 1 93  ? -7.284  19.913  -15.884 1.00 9.87  ? 93  ILE C CA  1 
ATOM   5719  C C   . ILE C 1 93  ? -7.631  20.567  -14.565 1.00 10.56 ? 93  ILE C C   1 
ATOM   5720  O O   . ILE C 1 93  ? -8.714  20.295  -14.019 1.00 10.82 ? 93  ILE C O   1 
ATOM   5721  C CB  . ILE C 1 93  ? -8.375  20.249  -16.996 1.00 9.35  ? 93  ILE C CB  1 
ATOM   5722  C CG1 . ILE C 1 93  ? -8.412  19.171  -18.065 1.00 9.00  ? 93  ILE C CG1 1 
ATOM   5723  C CG2 . ILE C 1 93  ? -8.148  21.687  -17.518 1.00 9.37  ? 93  ILE C CG2 1 
ATOM   5724  C CD1 . ILE C 1 93  ? -8.740  19.453  -19.518 1.00 8.78  ? 93  ILE C CD1 1 
ATOM   5725  N N   . THR C 1 94  ? -6.728  21.321  -14.010 1.00 11.49 ? 94  THR C N   1 
ATOM   5726  C CA  . THR C 1 94  ? -7.010  22.038  -12.749 1.00 12.55 ? 94  THR C CA  1 
ATOM   5727  C C   . THR C 1 94  ? -6.332  23.397  -12.798 1.00 13.24 ? 94  THR C C   1 
ATOM   5728  O O   . THR C 1 94  ? -5.397  23.649  -12.046 1.00 13.32 ? 94  THR C O   1 
ATOM   5729  C CB  . THR C 1 94  ? -6.615  21.197  -11.494 1.00 12.65 ? 94  THR C CB  1 
ATOM   5730  O OG1 . THR C 1 94  ? -5.148  21.262  -11.376 1.00 12.89 ? 94  THR C OG1 1 
ATOM   5731  C CG2 . THR C 1 94  ? -7.105  19.752  -11.555 1.00 12.64 ? 94  THR C CG2 1 
ATOM   5732  N N   . ALA C 1 95  ? -6.755  24.191  -13.733 1.00 14.33 ? 95  ALA C N   1 
ATOM   5733  C CA  . ALA C 1 95  ? -6.259  25.524  -14.019 1.00 15.67 ? 95  ALA C CA  1 
ATOM   5734  C C   . ALA C 1 95  ? -7.475  26.387  -14.369 1.00 16.82 ? 95  ALA C C   1 
ATOM   5735  O O   . ALA C 1 95  ? -8.430  25.926  -15.010 1.00 16.87 ? 95  ALA C O   1 
ATOM   5736  C CB  . ALA C 1 95  ? -5.220  25.504  -15.122 1.00 15.51 ? 95  ALA C CB  1 
ATOM   5737  N N   . GLY C 1 96  ? -7.438  27.606  -13.859 1.00 18.19 ? 96  GLY C N   1 
ATOM   5738  C CA  . GLY C 1 96  ? -8.485  28.548  -14.091 1.00 20.02 ? 96  GLY C CA  1 
ATOM   5739  C C   . GLY C 1 96  ? -8.522  29.801  -13.275 1.00 21.39 ? 96  GLY C C   1 
ATOM   5740  O O   . GLY C 1 96  ? -8.034  30.874  -13.719 1.00 21.62 ? 96  GLY C O   1 
ATOM   5741  N N   . ALA C 1 97  ? -9.111  29.697  -12.109 1.00 22.52 ? 97  ALA C N   1 
ATOM   5742  C CA  . ALA C 1 97  ? -9.431  30.902  -11.288 1.00 23.82 ? 97  ALA C CA  1 
ATOM   5743  C C   . ALA C 1 97  ? -10.170 30.296  -10.093 1.00 24.78 ? 97  ALA C C   1 
ATOM   5744  O O   . ALA C 1 97  ? -11.348 29.927  -10.222 1.00 25.13 ? 97  ALA C O   1 
ATOM   5745  C CB  . ALA C 1 97  ? -10.313 31.853  -12.049 1.00 23.65 ? 97  ALA C CB  1 
ATOM   5746  N N   . ARG C 1 98  ? -9.423  30.182  -9.025  1.00 25.70 ? 98  ARG C N   1 
ATOM   5747  C CA  . ARG C 1 98  ? -9.890  29.445  -7.875  1.00 26.55 ? 98  ARG C CA  1 
ATOM   5748  C C   . ARG C 1 98  ? -10.328 30.192  -6.644  1.00 26.56 ? 98  ARG C C   1 
ATOM   5749  O O   . ARG C 1 98  ? -9.471  30.688  -5.893  1.00 26.63 ? 98  ARG C O   1 
ATOM   5750  C CB  . ARG C 1 98  ? -8.741  28.497  -7.418  1.00 27.31 ? 98  ARG C CB  1 
ATOM   5751  C CG  . ARG C 1 98  ? -8.830  27.032  -7.770  1.00 28.11 ? 98  ARG C CG  1 
ATOM   5752  C CD  . ARG C 1 98  ? -7.991  26.714  -8.949  1.00 28.75 ? 98  ARG C CD  1 
ATOM   5753  N NE  . ARG C 1 98  ? -7.131  25.545  -8.729  1.00 29.38 ? 98  ARG C NE  1 
ATOM   5754  C CZ  . ARG C 1 98  ? -6.485  24.971  -9.757  1.00 29.78 ? 98  ARG C CZ  1 
ATOM   5755  N NH1 . ARG C 1 98  ? -6.672  25.470  -10.992 1.00 29.97 ? 98  ARG C NH1 1 
ATOM   5756  N NH2 . ARG C 1 98  ? -5.607  23.984  -9.545  1.00 29.76 ? 98  ARG C NH2 1 
ATOM   5757  N N   . MET C 1 99  ? -11.622 30.165  -6.407  1.00 26.65 ? 99  MET C N   1 
ATOM   5758  C CA  . MET C 1 99  ? -12.171 30.494  -5.081  1.00 26.87 ? 99  MET C CA  1 
ATOM   5759  C C   . MET C 1 99  ? -11.967 31.925  -4.632  1.00 26.71 ? 99  MET C C   1 
ATOM   5760  O O   . MET C 1 99  ? -11.024 32.595  -5.046  1.00 26.79 ? 99  MET C O   1 
ATOM   5761  C CB  . MET C 1 99  ? -11.657 29.486  -4.055  1.00 27.32 ? 99  MET C CB  1 
ATOM   5762  C CG  . MET C 1 99  ? -10.314 28.905  -3.947  1.00 27.69 ? 99  MET C CG  1 
ATOM   5763  S SD  . MET C 1 99  ? -10.107 27.370  -4.943  1.00 28.08 ? 99  MET C SD  1 
ATOM   5764  C CE  . MET C 1 99  ? -8.489  26.797  -4.495  1.00 27.81 ? 99  MET C CE  1 
ATOM   5765  N N   . VAL C 1 100 ? -12.864 32.358  -3.762  1.00 26.42 ? 100 VAL C N   1 
ATOM   5766  C CA  . VAL C 1 100 ? -12.911 33.633  -3.078  1.00 26.11 ? 100 VAL C CA  1 
ATOM   5767  C C   . VAL C 1 100 ? -14.156 33.654  -2.148  1.00 26.08 ? 100 VAL C C   1 
ATOM   5768  O O   . VAL C 1 100 ? -15.278 33.717  -2.647  1.00 26.01 ? 100 VAL C O   1 
ATOM   5769  C CB  . VAL C 1 100 ? -12.877 34.897  -3.932  1.00 25.90 ? 100 VAL C CB  1 
ATOM   5770  C CG1 . VAL C 1 100 ? -13.417 36.157  -3.229  1.00 25.74 ? 100 VAL C CG1 1 
ATOM   5771  C CG2 . VAL C 1 100 ? -11.471 35.241  -4.402  1.00 25.96 ? 100 VAL C CG2 1 
ATOM   5772  N N   . SER C 1 101 ? -13.858 33.756  -0.872  1.00 26.02 ? 101 SER C N   1 
ATOM   5773  C CA  . SER C 1 101 ? -14.873 33.874  0.185   1.00 25.92 ? 101 SER C CA  1 
ATOM   5774  C C   . SER C 1 101 ? -16.019 34.752  -0.327  1.00 26.02 ? 101 SER C C   1 
ATOM   5775  O O   . SER C 1 101 ? -15.832 35.988  -0.402  1.00 26.20 ? 101 SER C O   1 
ATOM   5776  C CB  . SER C 1 101 ? -14.293 34.487  1.447   1.00 25.80 ? 101 SER C CB  1 
ATOM   5777  O OG  . SER C 1 101 ? -15.267 35.084  2.272   1.00 25.52 ? 101 SER C OG  1 
ATOM   5778  N N   . GLY C 1 102 ? -17.085 34.082  -0.725  1.00 25.85 ? 102 GLY C N   1 
ATOM   5779  C CA  . GLY C 1 102 ? -18.286 34.806  -1.227  1.00 25.52 ? 102 GLY C CA  1 
ATOM   5780  C C   . GLY C 1 102 ? -18.489 34.393  -2.683  1.00 25.33 ? 102 GLY C C   1 
ATOM   5781  O O   . GLY C 1 102 ? -19.397 33.632  -3.048  1.00 25.37 ? 102 GLY C O   1 
ATOM   5782  N N   . GLN C 1 103 ? -17.566 34.893  -3.473  1.00 25.07 ? 103 GLN C N   1 
ATOM   5783  C CA  . GLN C 1 103 ? -17.456 34.683  -4.907  1.00 24.74 ? 103 GLN C CA  1 
ATOM   5784  C C   . GLN C 1 103 ? -18.096 33.356  -5.326  1.00 24.74 ? 103 GLN C C   1 
ATOM   5785  O O   . GLN C 1 103 ? -19.153 33.258  -5.953  1.00 24.71 ? 103 GLN C O   1 
ATOM   5786  C CB  . GLN C 1 103 ? -15.968 34.686  -5.312  1.00 24.58 ? 103 GLN C CB  1 
ATOM   5787  C CG  . GLN C 1 103 ? -15.641 34.148  -6.665  1.00 24.38 ? 103 GLN C CG  1 
ATOM   5788  C CD  . GLN C 1 103 ? -15.358 35.188  -7.705  1.00 24.31 ? 103 GLN C CD  1 
ATOM   5789  O OE1 . GLN C 1 103 ? -14.435 35.048  -8.491  1.00 24.20 ? 103 GLN C OE1 1 
ATOM   5790  N NE2 . GLN C 1 103 ? -16.126 36.273  -7.684  1.00 24.42 ? 103 GLN C NE2 1 
ATOM   5791  N N   . THR C 1 104 ? -17.349 32.343  -4.905  1.00 24.71 ? 104 THR C N   1 
ATOM   5792  C CA  . THR C 1 104 ? -17.587 30.933  -5.269  1.00 24.47 ? 104 THR C CA  1 
ATOM   5793  C C   . THR C 1 104 ? -19.103 30.740  -5.367  1.00 24.42 ? 104 THR C C   1 
ATOM   5794  O O   . THR C 1 104 ? -19.921 31.223  -4.582  1.00 24.24 ? 104 THR C O   1 
ATOM   5795  C CB  . THR C 1 104 ? -16.711 29.938  -4.442  1.00 24.23 ? 104 THR C CB  1 
ATOM   5796  O OG1 . THR C 1 104 ? -15.377 29.982  -5.141  1.00 24.15 ? 104 THR C OG1 1 
ATOM   5797  C CG2 . THR C 1 104 ? -17.129 28.487  -4.319  1.00 24.01 ? 104 THR C CG2 1 
ATOM   5798  N N   . ARG C 1 105 ? -19.405 30.344  -6.561  1.00 24.31 ? 105 ARG C N   1 
ATOM   5799  C CA  . ARG C 1 105 ? -20.680 29.991  -7.161  1.00 24.25 ? 105 ARG C CA  1 
ATOM   5800  C C   . ARG C 1 105 ? -20.248 29.518  -8.560  1.00 23.86 ? 105 ARG C C   1 
ATOM   5801  O O   . ARG C 1 105 ? -19.152 28.857  -8.607  1.00 23.75 ? 105 ARG C O   1 
ATOM   5802  C CB  . ARG C 1 105 ? -21.738 31.069  -7.073  1.00 24.51 ? 105 ARG C CB  1 
ATOM   5803  C CG  . ARG C 1 105 ? -22.474 31.064  -5.728  1.00 25.19 ? 105 ARG C CG  1 
ATOM   5804  C CD  . ARG C 1 105 ? -23.557 32.033  -5.559  1.00 25.98 ? 105 ARG C CD  1 
ATOM   5805  N NE  . ARG C 1 105 ? -24.221 32.118  -4.247  1.00 26.64 ? 105 ARG C NE  1 
ATOM   5806  C CZ  . ARG C 1 105 ? -25.556 32.269  -4.052  1.00 26.93 ? 105 ARG C CZ  1 
ATOM   5807  N NH1 . ARG C 1 105 ? -26.466 32.326  -5.044  1.00 26.99 ? 105 ARG C NH1 1 
ATOM   5808  N NH2 . ARG C 1 105 ? -26.065 32.470  -2.819  1.00 26.91 ? 105 ARG C NH2 1 
ATOM   5809  N N   . LEU C 1 106 ? -21.026 29.750  -9.579  1.00 23.12 ? 106 LEU C N   1 
ATOM   5810  C CA  . LEU C 1 106 ? -20.600 29.368  -10.953 1.00 22.29 ? 106 LEU C CA  1 
ATOM   5811  C C   . LEU C 1 106 ? -20.161 30.701  -11.599 1.00 21.86 ? 106 LEU C C   1 
ATOM   5812  O O   . LEU C 1 106 ? -20.490 31.061  -12.731 1.00 21.85 ? 106 LEU C O   1 
ATOM   5813  C CB  . LEU C 1 106 ? -21.720 28.646  -11.629 1.00 22.16 ? 106 LEU C CB  1 
ATOM   5814  C CG  . LEU C 1 106 ? -22.866 28.005  -10.881 1.00 22.01 ? 106 LEU C CG  1 
ATOM   5815  C CD1 . LEU C 1 106 ? -23.876 29.034  -10.400 1.00 21.92 ? 106 LEU C CD1 1 
ATOM   5816  C CD2 . LEU C 1 106 ? -23.581 27.022  -11.819 1.00 22.07 ? 106 LEU C CD2 1 
ATOM   5817  N N   . ASP C 1 107 ? -19.527 31.487  -10.740 1.00 21.17 ? 107 ASP C N   1 
ATOM   5818  C CA  . ASP C 1 107 ? -19.020 32.805  -11.097 1.00 20.51 ? 107 ASP C CA  1 
ATOM   5819  C C   . ASP C 1 107 ? -17.725 32.645  -11.895 1.00 20.04 ? 107 ASP C C   1 
ATOM   5820  O O   . ASP C 1 107 ? -17.532 33.381  -12.880 1.00 20.22 ? 107 ASP C O   1 
ATOM   5821  C CB  . ASP C 1 107 ? -18.824 33.688  -9.868  1.00 20.52 ? 107 ASP C CB  1 
ATOM   5822  C CG  . ASP C 1 107 ? -20.142 34.231  -9.358  1.00 20.67 ? 107 ASP C CG  1 
ATOM   5823  O OD1 . ASP C 1 107 ? -20.551 35.361  -9.663  1.00 20.73 ? 107 ASP C OD1 1 
ATOM   5824  O OD2 . ASP C 1 107 ? -20.792 33.461  -8.628  1.00 20.96 ? 107 ASP C OD2 1 
ATOM   5825  N N   . LEU C 1 108 ? -16.908 31.717  -11.428 1.00 19.19 ? 108 LEU C N   1 
ATOM   5826  C CA  . LEU C 1 108 ? -15.582 31.504  -12.022 1.00 18.50 ? 108 LEU C CA  1 
ATOM   5827  C C   . LEU C 1 108 ? -15.812 30.859  -13.387 1.00 18.28 ? 108 LEU C C   1 
ATOM   5828  O O   . LEU C 1 108 ? -14.923 30.103  -13.820 1.00 18.46 ? 108 LEU C O   1 
ATOM   5829  C CB  . LEU C 1 108 ? -14.708 30.702  -11.096 1.00 18.34 ? 108 LEU C CB  1 
ATOM   5830  C CG  . LEU C 1 108 ? -14.885 30.643  -9.612  1.00 18.31 ? 108 LEU C CG  1 
ATOM   5831  C CD1 . LEU C 1 108 ? -14.064 29.484  -9.001  1.00 18.29 ? 108 LEU C CD1 1 
ATOM   5832  C CD2 . LEU C 1 108 ? -14.433 31.931  -8.944  1.00 18.30 ? 108 LEU C CD2 1 
ATOM   5833  N N   . LEU C 1 109 ? -16.861 31.285  -14.064 1.00 17.80 ? 109 LEU C N   1 
ATOM   5834  C CA  . LEU C 1 109 ? -17.306 30.626  -15.276 1.00 17.53 ? 109 LEU C CA  1 
ATOM   5835  C C   . LEU C 1 109 ? -16.980 31.240  -16.593 1.00 17.35 ? 109 LEU C C   1 
ATOM   5836  O O   . LEU C 1 109 ? -16.393 30.483  -17.421 1.00 17.49 ? 109 LEU C O   1 
ATOM   5837  C CB  . LEU C 1 109 ? -18.807 30.346  -15.053 1.00 17.55 ? 109 LEU C CB  1 
ATOM   5838  C CG  . LEU C 1 109 ? -19.593 29.354  -15.858 1.00 17.47 ? 109 LEU C CG  1 
ATOM   5839  C CD1 . LEU C 1 109 ? -20.205 29.996  -17.108 1.00 17.54 ? 109 LEU C CD1 1 
ATOM   5840  C CD2 . LEU C 1 109 ? -18.726 28.173  -16.298 1.00 17.43 ? 109 LEU C CD2 1 
ATOM   5841  N N   . GLN C 1 110 ? -17.450 32.414  -16.920 1.00 17.30 ? 110 GLN C N   1 
ATOM   5842  C CA  . GLN C 1 110 ? -17.103 32.964  -18.273 1.00 17.41 ? 110 GLN C CA  1 
ATOM   5843  C C   . GLN C 1 110 ? -15.581 33.099  -18.295 1.00 17.06 ? 110 GLN C C   1 
ATOM   5844  O O   . GLN C 1 110 ? -14.899 32.888  -19.292 1.00 17.10 ? 110 GLN C O   1 
ATOM   5845  C CB  . GLN C 1 110 ? -17.869 34.203  -18.693 1.00 17.89 ? 110 GLN C CB  1 
ATOM   5846  C CG  . GLN C 1 110 ? -18.765 33.818  -19.921 1.00 18.38 ? 110 GLN C CG  1 
ATOM   5847  C CD  . GLN C 1 110 ? -20.176 34.279  -19.648 1.00 18.70 ? 110 GLN C CD  1 
ATOM   5848  O OE1 . GLN C 1 110 ? -20.892 33.736  -18.806 1.00 18.86 ? 110 GLN C OE1 1 
ATOM   5849  N NE2 . GLN C 1 110 ? -20.531 35.324  -20.384 1.00 18.93 ? 110 GLN C NE2 1 
ATOM   5850  N N   . ARG C 1 111 ? -15.108 33.331  -17.099 1.00 16.57 ? 111 ARG C N   1 
ATOM   5851  C CA  . ARG C 1 111 ? -13.743 33.464  -16.667 1.00 15.85 ? 111 ARG C CA  1 
ATOM   5852  C C   . ARG C 1 111 ? -12.889 32.256  -17.026 1.00 15.75 ? 111 ARG C C   1 
ATOM   5853  O O   . ARG C 1 111 ? -11.740 32.431  -17.414 1.00 15.79 ? 111 ARG C O   1 
ATOM   5854  C CB  . ARG C 1 111 ? -13.700 33.556  -15.114 1.00 15.12 ? 111 ARG C CB  1 
ATOM   5855  C CG  . ARG C 1 111 ? -12.260 33.792  -14.549 1.00 14.18 ? 111 ARG C CG  1 
ATOM   5856  C CD  . ARG C 1 111 ? -12.121 34.824  -13.371 1.00 13.48 ? 111 ARG C CD  1 
ATOM   5857  N NE  . ARG C 1 111 ? -13.377 35.148  -12.686 1.00 12.85 ? 111 ARG C NE  1 
ATOM   5858  C CZ  . ARG C 1 111 ? -13.692 34.932  -11.381 1.00 12.41 ? 111 ARG C CZ  1 
ATOM   5859  N NH1 . ARG C 1 111 ? -12.850 34.361  -10.461 1.00 12.16 ? 111 ARG C NH1 1 
ATOM   5860  N NH2 . ARG C 1 111 ? -14.866 35.257  -10.896 1.00 12.19 ? 111 ARG C NH2 1 
ATOM   5861  N N   . ASN C 1 112 ? -13.509 31.105  -16.806 1.00 15.81 ? 112 ASN C N   1 
ATOM   5862  C CA  . ASN C 1 112 ? -12.780 29.829  -17.021 1.00 15.91 ? 112 ASN C CA  1 
ATOM   5863  C C   . ASN C 1 112 ? -12.954 29.311  -18.411 1.00 16.17 ? 112 ASN C C   1 
ATOM   5864  O O   . ASN C 1 112 ? -11.902 28.986  -19.024 1.00 16.23 ? 112 ASN C O   1 
ATOM   5865  C CB  . ASN C 1 112 ? -13.024 28.906  -15.828 1.00 15.61 ? 112 ASN C CB  1 
ATOM   5866  C CG  . ASN C 1 112 ? -12.036 29.320  -14.728 1.00 15.46 ? 112 ASN C CG  1 
ATOM   5867  O OD1 . ASN C 1 112 ? -11.033 29.989  -15.019 1.00 15.27 ? 112 ASN C OD1 1 
ATOM   5868  N ND2 . ASN C 1 112 ? -12.338 28.985  -13.489 1.00 15.51 ? 112 ASN C ND2 1 
ATOM   5869  N N   . VAL C 1 113 ? -14.126 29.323  -18.981 1.00 16.39 ? 113 VAL C N   1 
ATOM   5870  C CA  . VAL C 1 113 ? -14.285 28.845  -20.384 1.00 16.60 ? 113 VAL C CA  1 
ATOM   5871  C C   . VAL C 1 113 ? -13.128 29.422  -21.206 1.00 16.85 ? 113 VAL C C   1 
ATOM   5872  O O   . VAL C 1 113 ? -12.527 28.718  -22.039 1.00 16.80 ? 113 VAL C O   1 
ATOM   5873  C CB  . VAL C 1 113 ? -15.711 29.144  -20.833 1.00 16.53 ? 113 VAL C CB  1 
ATOM   5874  C CG1 . VAL C 1 113 ? -16.172 30.544  -20.440 1.00 16.52 ? 113 VAL C CG1 1 
ATOM   5875  C CG2 . VAL C 1 113 ? -15.915 28.873  -22.315 1.00 16.49 ? 113 VAL C CG2 1 
ATOM   5876  N N   . ALA C 1 114 ? -12.749 30.640  -20.818 1.00 17.04 ? 114 ALA C N   1 
ATOM   5877  C CA  . ALA C 1 114 ? -11.612 31.354  -21.427 1.00 17.19 ? 114 ALA C CA  1 
ATOM   5878  C C   . ALA C 1 114 ? -10.372 30.527  -21.101 1.00 17.44 ? 114 ALA C C   1 
ATOM   5879  O O   . ALA C 1 114 ? -9.743  30.016  -22.039 1.00 17.55 ? 114 ALA C O   1 
ATOM   5880  C CB  . ALA C 1 114 ? -11.532 32.782  -20.981 1.00 17.22 ? 114 ALA C CB  1 
ATOM   5881  N N   . ILE C 1 115 ? -10.101 30.348  -19.827 1.00 17.77 ? 115 ILE C N   1 
ATOM   5882  C CA  . ILE C 1 115 ? -8.988  29.504  -19.368 1.00 18.28 ? 115 ILE C CA  1 
ATOM   5883  C C   . ILE C 1 115 ? -8.949  28.248  -20.252 1.00 18.89 ? 115 ILE C C   1 
ATOM   5884  O O   . ILE C 1 115 ? -7.878  27.924  -20.790 1.00 19.21 ? 115 ILE C O   1 
ATOM   5885  C CB  . ILE C 1 115 ? -9.048  29.178  -17.862 1.00 18.10 ? 115 ILE C CB  1 
ATOM   5886  C CG1 . ILE C 1 115 ? -7.625  29.004  -17.265 1.00 17.95 ? 115 ILE C CG1 1 
ATOM   5887  C CG2 . ILE C 1 115 ? -9.855  27.903  -17.481 1.00 18.25 ? 115 ILE C CG2 1 
ATOM   5888  C CD1 . ILE C 1 115 ? -7.122  30.252  -16.503 1.00 17.92 ? 115 ILE C CD1 1 
ATOM   5889  N N   . MET C 1 116 ? -10.118 27.686  -20.524 1.00 19.42 ? 116 MET C N   1 
ATOM   5890  C CA  . MET C 1 116 ? -10.233 26.457  -21.308 1.00 19.85 ? 116 MET C CA  1 
ATOM   5891  C C   . MET C 1 116 ? -9.857  26.674  -22.764 1.00 20.25 ? 116 MET C C   1 
ATOM   5892  O O   . MET C 1 116 ? -8.772  26.152  -23.097 1.00 20.37 ? 116 MET C O   1 
ATOM   5893  C CB  . MET C 1 116 ? -11.564 25.751  -21.217 1.00 19.85 ? 116 MET C CB  1 
ATOM   5894  C CG  . MET C 1 116 ? -11.963 25.363  -19.841 1.00 19.90 ? 116 MET C CG  1 
ATOM   5895  S SD  . MET C 1 116 ? -10.506 24.697  -18.952 1.00 19.97 ? 116 MET C SD  1 
ATOM   5896  C CE  . MET C 1 116 ? -11.416 23.783  -17.660 1.00 19.81 ? 116 MET C CE  1 
ATOM   5897  N N   . LYS C 1 117 ? -10.687 27.310  -23.543 1.00 20.68 ? 117 LYS C N   1 
ATOM   5898  C CA  . LYS C 1 117 ? -10.464 27.541  -24.965 1.00 21.11 ? 117 LYS C CA  1 
ATOM   5899  C C   . LYS C 1 117 ? -8.981  27.404  -25.323 1.00 21.31 ? 117 LYS C C   1 
ATOM   5900  O O   . LYS C 1 117 ? -8.649  26.831  -26.367 1.00 21.52 ? 117 LYS C O   1 
ATOM   5901  C CB  . LYS C 1 117 ? -10.928 28.897  -25.516 1.00 21.20 ? 117 LYS C CB  1 
ATOM   5902  C CG  . LYS C 1 117 ? -10.906 28.910  -27.051 1.00 21.39 ? 117 LYS C CG  1 
ATOM   5903  C CD  . LYS C 1 117 ? -11.060 30.251  -27.698 1.00 21.43 ? 117 LYS C CD  1 
ATOM   5904  C CE  . LYS C 1 117 ? -9.752  30.981  -27.958 1.00 21.44 ? 117 LYS C CE  1 
ATOM   5905  N NZ  . LYS C 1 117 ? -10.049 32.459  -28.052 1.00 21.57 ? 117 LYS C NZ  1 
ATOM   5906  N N   . ALA C 1 118 ? -8.165  27.982  -24.477 1.00 21.43 ? 118 ALA C N   1 
ATOM   5907  C CA  . ALA C 1 118 ? -6.723  27.936  -24.506 1.00 21.66 ? 118 ALA C CA  1 
ATOM   5908  C C   . ALA C 1 118 ? -6.089  26.632  -24.028 1.00 21.78 ? 118 ALA C C   1 
ATOM   5909  O O   . ALA C 1 118 ? -5.486  25.837  -24.776 1.00 21.84 ? 118 ALA C O   1 
ATOM   5910  C CB  . ALA C 1 118 ? -6.221  29.101  -23.604 1.00 21.67 ? 118 ALA C CB  1 
ATOM   5911  N N   . ILE C 1 119 ? -6.159  26.425  -22.731 1.00 21.79 ? 119 ILE C N   1 
ATOM   5912  C CA  . ILE C 1 119 ? -5.564  25.324  -21.987 1.00 21.73 ? 119 ILE C CA  1 
ATOM   5913  C C   . ILE C 1 119 ? -5.853  23.943  -22.560 1.00 21.82 ? 119 ILE C C   1 
ATOM   5914  O O   . ILE C 1 119 ? -4.918  23.226  -22.932 1.00 21.57 ? 119 ILE C O   1 
ATOM   5915  C CB  . ILE C 1 119 ? -5.974  25.491  -20.475 1.00 21.61 ? 119 ILE C CB  1 
ATOM   5916  C CG1 . ILE C 1 119 ? -5.145  26.611  -19.813 1.00 21.59 ? 119 ILE C CG1 1 
ATOM   5917  C CG2 . ILE C 1 119 ? -5.877  24.171  -19.662 1.00 21.51 ? 119 ILE C CG2 1 
ATOM   5918  C CD1 . ILE C 1 119 ? -5.021  27.995  -20.460 1.00 21.39 ? 119 ILE C CD1 1 
ATOM   5919  N N   . VAL C 1 120 ? -7.106  23.609  -22.550 1.00 22.01 ? 120 VAL C N   1 
ATOM   5920  C CA  . VAL C 1 120 ? -7.667  22.262  -22.961 1.00 22.17 ? 120 VAL C CA  1 
ATOM   5921  C C   . VAL C 1 120 ? -7.242  21.963  -24.348 1.00 22.30 ? 120 VAL C C   1 
ATOM   5922  O O   . VAL C 1 120 ? -5.978  21.769  -24.527 1.00 22.39 ? 120 VAL C O   1 
ATOM   5923  C CB  . VAL C 1 120 ? -9.094  22.335  -22.381 1.00 22.10 ? 120 VAL C CB  1 
ATOM   5924  C CG1 . VAL C 1 120 ? -9.986  23.382  -23.024 1.00 22.12 ? 120 VAL C CG1 1 
ATOM   5925  C CG2 . VAL C 1 120 ? -9.741  20.971  -22.240 1.00 22.09 ? 120 VAL C CG2 1 
ATOM   5926  N N   . PRO C 1 121 ? -8.082  21.676  -25.287 1.00 22.26 ? 121 PRO C N   1 
ATOM   5927  C CA  . PRO C 1 121 ? -7.734  21.523  -26.714 1.00 22.24 ? 121 PRO C CA  1 
ATOM   5928  C C   . PRO C 1 121 ? -6.412  22.166  -27.054 1.00 22.11 ? 121 PRO C C   1 
ATOM   5929  O O   . PRO C 1 121 ? -6.287  23.399  -27.011 1.00 22.09 ? 121 PRO C O   1 
ATOM   5930  C CB  . PRO C 1 121 ? -8.927  22.172  -27.400 1.00 22.35 ? 121 PRO C CB  1 
ATOM   5931  C CG  . PRO C 1 121 ? -10.058 22.076  -26.395 1.00 22.35 ? 121 PRO C CG  1 
ATOM   5932  C CD  . PRO C 1 121 ? -9.493  21.282  -25.209 1.00 22.22 ? 121 PRO C CD  1 
ATOM   5933  N N   . GLY C 1 122 ? -5.517  21.287  -27.450 1.00 21.96 ? 122 GLY C N   1 
ATOM   5934  C CA  . GLY C 1 122 ? -4.079  21.644  -27.628 1.00 21.91 ? 122 GLY C CA  1 
ATOM   5935  C C   . GLY C 1 122 ? -3.374  20.510  -26.825 1.00 21.88 ? 122 GLY C C   1 
ATOM   5936  O O   . GLY C 1 122 ? -2.635  19.726  -27.410 1.00 22.21 ? 122 GLY C O   1 
ATOM   5937  N N   . VAL C 1 123 ? -3.760  20.394  -25.563 1.00 21.59 ? 123 VAL C N   1 
ATOM   5938  C CA  . VAL C 1 123 ? -3.326  19.295  -24.715 1.00 21.18 ? 123 VAL C CA  1 
ATOM   5939  C C   . VAL C 1 123 ? -3.637  17.981  -25.482 1.00 21.02 ? 123 VAL C C   1 
ATOM   5940  O O   . VAL C 1 123 ? -2.882  17.033  -25.511 1.00 21.12 ? 123 VAL C O   1 
ATOM   5941  C CB  . VAL C 1 123 ? -3.984  19.245  -23.329 1.00 21.14 ? 123 VAL C CB  1 
ATOM   5942  C CG1 . VAL C 1 123 ? -4.074  20.587  -22.613 1.00 21.11 ? 123 VAL C CG1 1 
ATOM   5943  C CG2 . VAL C 1 123 ? -5.351  18.568  -23.256 1.00 20.94 ? 123 VAL C CG2 1 
ATOM   5944  N N   . ILE C 1 124 ? -4.827  17.997  -26.021 1.00 20.85 ? 124 ILE C N   1 
ATOM   5945  C CA  . ILE C 1 124 ? -5.427  16.875  -26.750 1.00 20.70 ? 124 ILE C CA  1 
ATOM   5946  C C   . ILE C 1 124 ? -4.681  16.619  -28.038 1.00 20.67 ? 124 ILE C C   1 
ATOM   5947  O O   . ILE C 1 124 ? -4.514  15.436  -28.417 1.00 20.85 ? 124 ILE C O   1 
ATOM   5948  C CB  . ILE C 1 124 ? -6.980  17.054  -26.864 1.00 20.59 ? 124 ILE C CB  1 
ATOM   5949  C CG1 . ILE C 1 124 ? -7.515  16.931  -28.298 1.00 20.47 ? 124 ILE C CG1 1 
ATOM   5950  C CG2 . ILE C 1 124 ? -7.487  18.378  -26.192 1.00 20.70 ? 124 ILE C CG2 1 
ATOM   5951  C CD1 . ILE C 1 124 ? -9.072  17.109  -28.398 1.00 20.52 ? 124 ILE C CD1 1 
ATOM   5952  N N   . GLN C 1 125 ? -4.220  17.685  -28.672 1.00 20.51 ? 125 GLN C N   1 
ATOM   5953  C CA  . GLN C 1 125 ? -3.517  17.510  -29.962 1.00 20.38 ? 125 GLN C CA  1 
ATOM   5954  C C   . GLN C 1 125 ? -2.320  16.596  -29.715 1.00 20.30 ? 125 GLN C C   1 
ATOM   5955  O O   . GLN C 1 125 ? -1.939  15.828  -30.604 1.00 20.45 ? 125 GLN C O   1 
ATOM   5956  C CB  . GLN C 1 125 ? -3.151  18.799  -30.643 1.00 20.60 ? 125 GLN C CB  1 
ATOM   5957  C CG  . GLN C 1 125 ? -2.697  18.567  -32.080 1.00 20.92 ? 125 GLN C CG  1 
ATOM   5958  C CD  . GLN C 1 125 ? -1.739  19.602  -32.606 1.00 21.10 ? 125 GLN C CD  1 
ATOM   5959  O OE1 . GLN C 1 125 ? -1.164  19.409  -33.682 1.00 21.23 ? 125 GLN C OE1 1 
ATOM   5960  N NE2 . GLN C 1 125 ? -1.509  20.689  -31.870 1.00 21.17 ? 125 GLN C NE2 1 
ATOM   5961  N N   . ASN C 1 126 ? -1.816  16.670  -28.509 1.00 20.21 ? 126 ASN C N   1 
ATOM   5962  C CA  . ASN C 1 126 ? -0.678  15.851  -28.062 1.00 20.21 ? 126 ASN C CA  1 
ATOM   5963  C C   . ASN C 1 126 ? -1.124  14.417  -27.788 1.00 20.18 ? 126 ASN C C   1 
ATOM   5964  O O   . ASN C 1 126 ? -0.709  13.555  -28.589 1.00 20.34 ? 126 ASN C O   1 
ATOM   5965  C CB  . ASN C 1 126 ? 0.024   16.496  -26.872 1.00 20.39 ? 126 ASN C CB  1 
ATOM   5966  C CG  . ASN C 1 126 ? 0.478   17.911  -27.248 1.00 20.52 ? 126 ASN C CG  1 
ATOM   5967  O OD1 . ASN C 1 126 ? 1.598   18.030  -27.776 1.00 20.88 ? 126 ASN C OD1 1 
ATOM   5968  N ND2 . ASN C 1 126 ? -0.360  18.889  -26.977 1.00 20.26 ? 126 ASN C ND2 1 
ATOM   5969  N N   . SER C 1 127 ? -1.837  14.193  -26.698 1.00 19.98 ? 127 SER C N   1 
ATOM   5970  C CA  . SER C 1 127 ? -2.311  12.831  -26.380 1.00 19.94 ? 127 SER C CA  1 
ATOM   5971  C C   . SER C 1 127 ? -3.743  12.681  -26.888 1.00 20.13 ? 127 SER C C   1 
ATOM   5972  O O   . SER C 1 127 ? -4.723  12.675  -26.121 1.00 20.22 ? 127 SER C O   1 
ATOM   5973  C CB  . SER C 1 127 ? -2.134  12.414  -24.957 1.00 19.90 ? 127 SER C CB  1 
ATOM   5974  O OG  . SER C 1 127 ? -1.645  13.352  -24.054 1.00 19.81 ? 127 SER C OG  1 
ATOM   5975  N N   . PRO C 1 128 ? -3.788  12.435  -28.207 1.00 20.28 ? 128 PRO C N   1 
ATOM   5976  C CA  . PRO C 1 128 ? -5.049  12.308  -28.926 1.00 20.31 ? 128 PRO C CA  1 
ATOM   5977  C C   . PRO C 1 128 ? -6.074  11.360  -28.351 1.00 20.31 ? 128 PRO C C   1 
ATOM   5978  O O   . PRO C 1 128 ? -7.287  11.655  -28.528 1.00 20.49 ? 128 PRO C O   1 
ATOM   5979  C CB  . PRO C 1 128 ? -4.600  11.819  -30.314 1.00 20.36 ? 128 PRO C CB  1 
ATOM   5980  C CG  . PRO C 1 128 ? -3.542  10.800  -29.909 1.00 20.35 ? 128 PRO C CG  1 
ATOM   5981  C CD  . PRO C 1 128 ? -2.739  11.584  -28.884 1.00 20.34 ? 128 PRO C CD  1 
ATOM   5982  N N   . ASP C 1 129 ? -5.648  10.248  -27.783 1.00 20.06 ? 129 ASP C N   1 
ATOM   5983  C CA  . ASP C 1 129 ? -6.552  9.210   -27.235 1.00 19.68 ? 129 ASP C CA  1 
ATOM   5984  C C   . ASP C 1 129 ? -6.607  9.330   -25.703 1.00 19.10 ? 129 ASP C C   1 
ATOM   5985  O O   . ASP C 1 129 ? -6.877  8.309   -25.029 1.00 18.96 ? 129 ASP C O   1 
ATOM   5986  C CB  . ASP C 1 129 ? -6.102  7.813   -27.606 1.00 20.15 ? 129 ASP C CB  1 
ATOM   5987  C CG  . ASP C 1 129 ? -5.799  7.299   -28.953 1.00 20.51 ? 129 ASP C CG  1 
ATOM   5988  O OD1 . ASP C 1 129 ? -6.416  7.642   -29.995 1.00 20.86 ? 129 ASP C OD1 1 
ATOM   5989  O OD2 . ASP C 1 129 ? -4.933  6.356   -29.041 1.00 20.37 ? 129 ASP C OD2 1 
ATOM   5990  N N   . CYS C 1 130 ? -6.267  10.502  -25.202 1.00 18.50 ? 130 CYS C N   1 
ATOM   5991  C CA  . CYS C 1 130 ? -6.202  10.719  -23.749 1.00 17.85 ? 130 CYS C CA  1 
ATOM   5992  C C   . CYS C 1 130 ? -7.606  10.550  -23.146 1.00 17.07 ? 130 CYS C C   1 
ATOM   5993  O O   . CYS C 1 130 ? -8.629  10.525  -23.858 1.00 17.12 ? 130 CYS C O   1 
ATOM   5994  C CB  . CYS C 1 130 ? -5.674  12.111  -23.392 1.00 18.03 ? 130 CYS C CB  1 
ATOM   5995  S SG  . CYS C 1 130 ? -7.099  13.266  -23.339 1.00 18.76 ? 130 CYS C SG  1 
ATOM   5996  N N   . LYS C 1 131 ? -7.618  10.645  -21.840 1.00 15.90 ? 131 LYS C N   1 
ATOM   5997  C CA  . LYS C 1 131 ? -8.910  10.559  -21.098 1.00 14.89 ? 131 LYS C CA  1 
ATOM   5998  C C   . LYS C 1 131 ? -8.890  11.705  -20.109 1.00 14.15 ? 131 LYS C C   1 
ATOM   5999  O O   . LYS C 1 131 ? -7.884  11.801  -19.384 1.00 14.28 ? 131 LYS C O   1 
ATOM   6000  C CB  . LYS C 1 131 ? -9.064  9.233   -20.421 1.00 14.78 ? 131 LYS C CB  1 
ATOM   6001  C CG  . LYS C 1 131 ? -10.188 9.151   -19.419 1.00 14.64 ? 131 LYS C CG  1 
ATOM   6002  C CD  . LYS C 1 131 ? -10.388 7.717   -18.975 1.00 14.88 ? 131 LYS C CD  1 
ATOM   6003  C CE  . LYS C 1 131 ? -11.730 7.561   -18.292 1.00 15.13 ? 131 LYS C CE  1 
ATOM   6004  N NZ  . LYS C 1 131 ? -11.744 7.961   -16.880 1.00 15.25 ? 131 LYS C NZ  1 
ATOM   6005  N N   . ILE C 1 132 ? -9.940  12.509  -20.061 1.00 13.20 ? 132 ILE C N   1 
ATOM   6006  C CA  . ILE C 1 132 ? -9.876  13.649  -19.166 1.00 12.30 ? 132 ILE C CA  1 
ATOM   6007  C C   . ILE C 1 132 ? -10.885 13.642  -18.015 1.00 11.75 ? 132 ILE C C   1 
ATOM   6008  O O   . ILE C 1 132 ? -12.088 13.455  -18.133 1.00 11.53 ? 132 ILE C O   1 
ATOM   6009  C CB  . ILE C 1 132 ? -9.940  15.027  -19.927 1.00 12.25 ? 132 ILE C CB  1 
ATOM   6010  C CG1 . ILE C 1 132 ? -9.384  14.979  -21.346 1.00 12.08 ? 132 ILE C CG1 1 
ATOM   6011  C CG2 . ILE C 1 132 ? -9.213  16.111  -19.048 1.00 12.12 ? 132 ILE C CG2 1 
ATOM   6012  C CD1 . ILE C 1 132 ? -9.897  16.114  -22.299 1.00 11.84 ? 132 ILE C CD1 1 
ATOM   6013  N N   . ILE C 1 133 ? -10.271 13.954  -16.886 1.00 11.08 ? 133 ILE C N   1 
ATOM   6014  C CA  . ILE C 1 133 ? -10.912 14.239  -15.618 1.00 10.51 ? 133 ILE C CA  1 
ATOM   6015  C C   . ILE C 1 133 ? -10.849 15.787  -15.562 1.00 10.17 ? 133 ILE C C   1 
ATOM   6016  O O   . ILE C 1 133 ? -9.777  16.313  -15.915 1.00 10.23 ? 133 ILE C O   1 
ATOM   6017  C CB  . ILE C 1 133 ? -10.229 13.600  -14.384 1.00 10.39 ? 133 ILE C CB  1 
ATOM   6018  C CG1 . ILE C 1 133 ? -9.996  12.089  -14.593 1.00 10.50 ? 133 ILE C CG1 1 
ATOM   6019  C CG2 . ILE C 1 133 ? -11.064 13.853  -13.096 1.00 10.37 ? 133 ILE C CG2 1 
ATOM   6020  C CD1 . ILE C 1 133 ? -9.147  11.381  -13.502 1.00 10.44 ? 133 ILE C CD1 1 
ATOM   6021  N N   . VAL C 1 134 ? -11.956 16.414  -15.331 1.00 9.78  ? 134 VAL C N   1 
ATOM   6022  C CA  . VAL C 1 134 ? -11.979 17.903  -15.267 1.00 9.56  ? 134 VAL C CA  1 
ATOM   6023  C C   . VAL C 1 134 ? -12.225 18.204  -13.801 1.00 9.66  ? 134 VAL C C   1 
ATOM   6024  O O   . VAL C 1 134 ? -13.196 17.666  -13.225 1.00 9.91  ? 134 VAL C O   1 
ATOM   6025  C CB  . VAL C 1 134 ? -12.974 18.469  -16.284 1.00 9.43  ? 134 VAL C CB  1 
ATOM   6026  C CG1 . VAL C 1 134 ? -13.346 19.929  -15.997 1.00 9.40  ? 134 VAL C CG1 1 
ATOM   6027  C CG2 . VAL C 1 134 ? -12.545 18.356  -17.751 1.00 8.98  ? 134 VAL C CG2 1 
ATOM   6028  N N   . VAL C 1 135 ? -11.322 18.929  -13.178 1.00 9.60  ? 135 VAL C N   1 
ATOM   6029  C CA  . VAL C 1 135 ? -11.490 19.268  -11.750 1.00 9.41  ? 135 VAL C CA  1 
ATOM   6030  C C   . VAL C 1 135 ? -11.944 20.713  -11.586 1.00 9.91  ? 135 VAL C C   1 
ATOM   6031  O O   . VAL C 1 135 ? -12.794 20.947  -10.692 1.00 10.16 ? 135 VAL C O   1 
ATOM   6032  C CB  . VAL C 1 135 ? -10.215 18.939  -10.971 1.00 8.97  ? 135 VAL C CB  1 
ATOM   6033  C CG1 . VAL C 1 135 ? -10.439 18.955  -9.462  1.00 8.75  ? 135 VAL C CG1 1 
ATOM   6034  C CG2 . VAL C 1 135 ? -9.601  17.633  -11.433 1.00 8.87  ? 135 VAL C CG2 1 
ATOM   6035  N N   . THR C 1 136 ? -11.481 21.611  -12.452 1.00 10.05 ? 136 THR C N   1 
ATOM   6036  C CA  . THR C 1 136 ? -11.739 23.041  -12.326 1.00 10.24 ? 136 THR C CA  1 
ATOM   6037  C C   . THR C 1 136 ? -13.053 23.399  -11.703 1.00 10.24 ? 136 THR C C   1 
ATOM   6038  O O   . THR C 1 136 ? -12.712 23.939  -10.554 1.00 10.22 ? 136 THR C O   1 
ATOM   6039  C CB  . THR C 1 136 ? -11.419 23.911  -13.603 1.00 10.45 ? 136 THR C CB  1 
ATOM   6040  O OG1 . THR C 1 136 ? -12.474 23.556  -14.556 1.00 10.93 ? 136 THR C OG1 1 
ATOM   6041  C CG2 . THR C 1 136 ? -10.005 23.692  -14.112 1.00 10.35 ? 136 THR C CG2 1 
ATOM   6042  N N   . ASN C 1 137 ? -14.293 23.501  -12.218 1.00 10.22 ? 137 ASN C N   1 
ATOM   6043  C CA  . ASN C 1 137 ? -15.346 23.733  -11.227 1.00 10.50 ? 137 ASN C CA  1 
ATOM   6044  C C   . ASN C 1 137 ? -16.801 23.669  -11.043 1.00 10.61 ? 137 ASN C C   1 
ATOM   6045  O O   . ASN C 1 137 ? -17.172 22.845  -10.085 1.00 10.67 ? 137 ASN C O   1 
ATOM   6046  C CB  . ASN C 1 137 ? -15.027 25.233  -10.607 1.00 10.40 ? 137 ASN C CB  1 
ATOM   6047  C CG  . ASN C 1 137 ? -15.010 25.018  -9.089  1.00 10.42 ? 137 ASN C CG  1 
ATOM   6048  O OD1 . ASN C 1 137 ? -14.308 25.770  -8.393  1.00 10.58 ? 137 ASN C OD1 1 
ATOM   6049  N ND2 . ASN C 1 137 ? -15.657 23.993  -8.521  1.00 10.25 ? 137 ASN C ND2 1 
ATOM   6050  N N   . PRO C 1 138 ? -17.891 24.065  -11.684 1.00 10.67 ? 138 PRO C N   1 
ATOM   6051  C CA  . PRO C 1 138 ? -17.867 24.590  -13.100 1.00 10.41 ? 138 PRO C CA  1 
ATOM   6052  C C   . PRO C 1 138 ? -17.534 23.365  -13.902 1.00 10.12 ? 138 PRO C C   1 
ATOM   6053  O O   . PRO C 1 138 ? -17.815 23.208  -15.066 1.00 10.08 ? 138 PRO C O   1 
ATOM   6054  C CB  . PRO C 1 138 ? -17.160 25.884  -12.910 1.00 10.34 ? 138 PRO C CB  1 
ATOM   6055  C CG  . PRO C 1 138 ? -17.905 26.447  -11.695 1.00 10.41 ? 138 PRO C CG  1 
ATOM   6056  C CD  . PRO C 1 138 ? -18.627 25.243  -11.016 1.00 10.54 ? 138 PRO C CD  1 
ATOM   6057  N N   . VAL C 1 139 ? -17.254 22.311  -13.165 1.00 9.76  ? 139 VAL C N   1 
ATOM   6058  C CA  . VAL C 1 139 ? -16.882 20.979  -13.533 1.00 9.67  ? 139 VAL C CA  1 
ATOM   6059  C C   . VAL C 1 139 ? -17.915 20.565  -14.580 1.00 9.70  ? 139 VAL C C   1 
ATOM   6060  O O   . VAL C 1 139 ? -17.569 20.221  -15.696 1.00 9.76  ? 139 VAL C O   1 
ATOM   6061  C CB  . VAL C 1 139 ? -16.810 20.150  -12.237 1.00 9.50  ? 139 VAL C CB  1 
ATOM   6062  C CG1 . VAL C 1 139 ? -15.565 20.483  -11.446 1.00 9.40  ? 139 VAL C CG1 1 
ATOM   6063  C CG2 . VAL C 1 139 ? -18.034 20.360  -11.355 1.00 9.35  ? 139 VAL C CG2 1 
ATOM   6064  N N   . ASP C 1 140 ? -19.149 20.806  -14.182 1.00 9.73  ? 140 ASP C N   1 
ATOM   6065  C CA  . ASP C 1 140 ? -20.325 20.490  -15.018 1.00 9.79  ? 140 ASP C CA  1 
ATOM   6066  C C   . ASP C 1 140 ? -20.107 21.260  -16.326 1.00 9.88  ? 140 ASP C C   1 
ATOM   6067  O O   . ASP C 1 140 ? -19.491 20.782  -17.304 1.00 9.80  ? 140 ASP C O   1 
ATOM   6068  C CB  . ASP C 1 140 ? -21.597 20.772  -14.244 1.00 9.88  ? 140 ASP C CB  1 
ATOM   6069  C CG  . ASP C 1 140 ? -21.642 20.280  -12.807 1.00 10.12 ? 140 ASP C CG  1 
ATOM   6070  O OD1 . ASP C 1 140 ? -21.853 21.089  -11.863 1.00 10.03 ? 140 ASP C OD1 1 
ATOM   6071  O OD2 . ASP C 1 140 ? -21.481 19.063  -12.534 1.00 9.94  ? 140 ASP C OD2 1 
ATOM   6072  N N   . ILE C 1 141 ? -20.389 22.532  -16.248 1.00 10.02 ? 141 ILE C N   1 
ATOM   6073  C CA  . ILE C 1 141 ? -20.323 23.480  -17.359 1.00 10.18 ? 141 ILE C CA  1 
ATOM   6074  C C   . ILE C 1 141 ? -19.014 23.463  -18.115 1.00 10.39 ? 141 ILE C C   1 
ATOM   6075  O O   . ILE C 1 141 ? -18.977 23.738  -19.332 1.00 10.67 ? 141 ILE C O   1 
ATOM   6076  C CB  . ILE C 1 141 ? -20.745 24.916  -16.852 1.00 10.05 ? 141 ILE C CB  1 
ATOM   6077  C CG1 . ILE C 1 141 ? -21.720 24.770  -15.675 1.00 9.96  ? 141 ILE C CG1 1 
ATOM   6078  C CG2 . ILE C 1 141 ? -21.328 25.724  -18.051 1.00 10.16 ? 141 ILE C CG2 1 
ATOM   6079  C CD1 . ILE C 1 141 ? -22.692 25.877  -15.308 1.00 9.91  ? 141 ILE C CD1 1 
ATOM   6080  N N   . LEU C 1 142 ? -17.938 23.146  -17.472 1.00 10.54 ? 142 LEU C N   1 
ATOM   6081  C CA  . LEU C 1 142 ? -16.573 23.065  -18.001 1.00 10.56 ? 142 LEU C CA  1 
ATOM   6082  C C   . LEU C 1 142 ? -16.449 21.732  -18.698 1.00 10.92 ? 142 LEU C C   1 
ATOM   6083  O O   . LEU C 1 142 ? -16.067 21.699  -19.884 1.00 10.97 ? 142 LEU C O   1 
ATOM   6084  C CB  . LEU C 1 142 ? -15.646 23.427  -16.855 1.00 10.47 ? 142 LEU C CB  1 
ATOM   6085  C CG  . LEU C 1 142 ? -15.876 24.792  -16.208 1.00 10.40 ? 142 LEU C CG  1 
ATOM   6086  C CD1 . LEU C 1 142 ? -14.881 25.073  -15.091 1.00 10.44 ? 142 LEU C CD1 1 
ATOM   6087  C CD2 . LEU C 1 142 ? -15.763 25.899  -17.263 1.00 10.55 ? 142 LEU C CD2 1 
ATOM   6088  N N   . THR C 1 143 ? -16.898 20.669  -18.042 1.00 11.29 ? 143 THR C N   1 
ATOM   6089  C CA  . THR C 1 143 ? -16.941 19.328  -18.658 1.00 11.60 ? 143 THR C CA  1 
ATOM   6090  C C   . THR C 1 143 ? -17.565 19.538  -20.057 1.00 12.09 ? 143 THR C C   1 
ATOM   6091  O O   . THR C 1 143 ? -17.016 19.113  -21.070 1.00 11.98 ? 143 THR C O   1 
ATOM   6092  C CB  . THR C 1 143 ? -17.694 18.239  -17.855 1.00 11.46 ? 143 THR C CB  1 
ATOM   6093  O OG1 . THR C 1 143 ? -16.849 17.733  -16.768 1.00 11.41 ? 143 THR C OG1 1 
ATOM   6094  C CG2 . THR C 1 143 ? -18.148 17.025  -18.700 1.00 11.68 ? 143 THR C CG2 1 
ATOM   6095  N N   . TYR C 1 144 ? -18.672 20.288  -20.013 1.00 12.57 ? 144 TYR C N   1 
ATOM   6096  C CA  . TYR C 1 144 ? -19.432 20.627  -21.223 1.00 12.87 ? 144 TYR C CA  1 
ATOM   6097  C C   . TYR C 1 144 ? -18.545 21.399  -22.189 1.00 12.98 ? 144 TYR C C   1 
ATOM   6098  O O   . TYR C 1 144 ? -18.375 20.979  -23.348 1.00 13.07 ? 144 TYR C O   1 
ATOM   6099  C CB  . TYR C 1 144 ? -20.718 21.367  -20.881 1.00 13.17 ? 144 TYR C CB  1 
ATOM   6100  C CG  . TYR C 1 144 ? -21.445 21.957  -22.067 1.00 13.63 ? 144 TYR C CG  1 
ATOM   6101  C CD1 . TYR C 1 144 ? -21.366 23.316  -22.367 1.00 13.62 ? 144 TYR C CD1 1 
ATOM   6102  C CD2 . TYR C 1 144 ? -22.187 21.135  -22.929 1.00 13.87 ? 144 TYR C CD2 1 
ATOM   6103  C CE1 . TYR C 1 144 ? -22.028 23.864  -23.454 1.00 13.63 ? 144 TYR C CE1 1 
ATOM   6104  C CE2 . TYR C 1 144 ? -22.824 21.676  -24.050 1.00 13.95 ? 144 TYR C CE2 1 
ATOM   6105  C CZ  . TYR C 1 144 ? -22.727 23.045  -24.313 1.00 13.76 ? 144 TYR C CZ  1 
ATOM   6106  O OH  . TYR C 1 144 ? -23.370 23.523  -25.421 1.00 13.78 ? 144 TYR C OH  1 
ATOM   6107  N N   . VAL C 1 145 ? -18.030 22.510  -21.728 1.00 13.20 ? 145 VAL C N   1 
ATOM   6108  C CA  . VAL C 1 145 ? -17.063 23.318  -22.511 1.00 13.48 ? 145 VAL C CA  1 
ATOM   6109  C C   . VAL C 1 145 ? -16.025 22.365  -23.130 1.00 13.87 ? 145 VAL C C   1 
ATOM   6110  O O   . VAL C 1 145 ? -16.001 22.189  -24.345 1.00 13.90 ? 145 VAL C O   1 
ATOM   6111  C CB  . VAL C 1 145 ? -16.424 24.417  -21.644 1.00 13.12 ? 145 VAL C CB  1 
ATOM   6112  C CG1 . VAL C 1 145 ? -15.288 25.134  -22.346 1.00 12.94 ? 145 VAL C CG1 1 
ATOM   6113  C CG2 . VAL C 1 145 ? -17.427 25.419  -21.128 1.00 12.99 ? 145 VAL C CG2 1 
ATOM   6114  N N   . VAL C 1 146 ? -15.249 21.726  -22.271 1.00 14.29 ? 146 VAL C N   1 
ATOM   6115  C CA  . VAL C 1 146 ? -14.185 20.836  -22.707 1.00 15.01 ? 146 VAL C CA  1 
ATOM   6116  C C   . VAL C 1 146 ? -14.748 19.803  -23.686 1.00 15.48 ? 146 VAL C C   1 
ATOM   6117  O O   . VAL C 1 146 ? -14.201 19.638  -24.792 1.00 15.50 ? 146 VAL C O   1 
ATOM   6118  C CB  . VAL C 1 146 ? -13.386 20.232  -21.550 1.00 15.02 ? 146 VAL C CB  1 
ATOM   6119  C CG1 . VAL C 1 146 ? -12.535 21.249  -20.807 1.00 14.97 ? 146 VAL C CG1 1 
ATOM   6120  C CG2 . VAL C 1 146 ? -14.260 19.505  -20.558 1.00 15.22 ? 146 VAL C CG2 1 
ATOM   6121  N N   . TRP C 1 147 ? -15.827 19.165  -23.282 1.00 16.08 ? 147 TRP C N   1 
ATOM   6122  C CA  . TRP C 1 147 ? -16.467 18.121  -24.087 1.00 16.59 ? 147 TRP C CA  1 
ATOM   6123  C C   . TRP C 1 147 ? -16.511 18.601  -25.555 1.00 16.92 ? 147 TRP C C   1 
ATOM   6124  O O   . TRP C 1 147 ? -16.068 17.940  -26.481 1.00 16.95 ? 147 TRP C O   1 
ATOM   6125  C CB  . TRP C 1 147 ? -17.890 17.756  -23.631 1.00 16.61 ? 147 TRP C CB  1 
ATOM   6126  C CG  . TRP C 1 147 ? -18.535 16.775  -24.557 1.00 16.75 ? 147 TRP C CG  1 
ATOM   6127  C CD1 . TRP C 1 147 ? -18.045 15.539  -24.891 1.00 16.96 ? 147 TRP C CD1 1 
ATOM   6128  C CD2 . TRP C 1 147 ? -19.714 16.951  -25.340 1.00 16.77 ? 147 TRP C CD2 1 
ATOM   6129  N NE1 . TRP C 1 147 ? -18.872 14.917  -25.801 1.00 16.97 ? 147 TRP C NE1 1 
ATOM   6130  C CE2 . TRP C 1 147 ? -19.893 15.775  -26.095 1.00 16.88 ? 147 TRP C CE2 1 
ATOM   6131  C CE3 . TRP C 1 147 ? -20.651 17.970  -25.436 1.00 16.78 ? 147 TRP C CE3 1 
ATOM   6132  C CZ2 . TRP C 1 147 ? -20.969 15.590  -26.951 1.00 16.89 ? 147 TRP C CZ2 1 
ATOM   6133  C CZ3 . TRP C 1 147 ? -21.733 17.767  -26.272 1.00 16.79 ? 147 TRP C CZ3 1 
ATOM   6134  C CH2 . TRP C 1 147 ? -21.883 16.623  -27.028 1.00 16.84 ? 147 TRP C CH2 1 
ATOM   6135  N N   . LYS C 1 148 ? -17.131 19.749  -25.631 1.00 17.18 ? 148 LYS C N   1 
ATOM   6136  C CA  . LYS C 1 148 ? -17.454 20.534  -26.801 1.00 17.36 ? 148 LYS C CA  1 
ATOM   6137  C C   . LYS C 1 148 ? -16.210 20.960  -27.570 1.00 17.79 ? 148 LYS C C   1 
ATOM   6138  O O   . LYS C 1 148 ? -16.017 20.684  -28.754 1.00 17.87 ? 148 LYS C O   1 
ATOM   6139  C CB  . LYS C 1 148 ? -18.145 21.803  -26.299 1.00 17.14 ? 148 LYS C CB  1 
ATOM   6140  C CG  . LYS C 1 148 ? -19.273 22.430  -27.015 1.00 16.89 ? 148 LYS C CG  1 
ATOM   6141  C CD  . LYS C 1 148 ? -20.611 21.747  -26.751 1.00 16.80 ? 148 LYS C CD  1 
ATOM   6142  C CE  . LYS C 1 148 ? -20.765 20.482  -27.590 1.00 16.64 ? 148 LYS C CE  1 
ATOM   6143  N NZ  . LYS C 1 148 ? -22.209 20.188  -27.786 1.00 16.57 ? 148 LYS C NZ  1 
ATOM   6144  N N   . ILE C 1 149 ? -15.348 21.619  -26.823 1.00 18.32 ? 149 ILE C N   1 
ATOM   6145  C CA  . ILE C 1 149 ? -14.114 22.234  -27.300 1.00 18.88 ? 149 ILE C CA  1 
ATOM   6146  C C   . ILE C 1 149 ? -13.094 21.199  -27.705 1.00 19.13 ? 149 ILE C C   1 
ATOM   6147  O O   . ILE C 1 149 ? -12.269 21.488  -28.601 1.00 19.19 ? 149 ILE C O   1 
ATOM   6148  C CB  . ILE C 1 149 ? -13.627 23.285  -26.235 1.00 19.05 ? 149 ILE C CB  1 
ATOM   6149  C CG1 . ILE C 1 149 ? -12.832 24.420  -26.950 1.00 19.26 ? 149 ILE C CG1 1 
ATOM   6150  C CG2 . ILE C 1 149 ? -12.853 22.675  -25.058 1.00 18.99 ? 149 ILE C CG2 1 
ATOM   6151  C CD1 . ILE C 1 149 ? -13.771 25.383  -27.792 1.00 19.31 ? 149 ILE C CD1 1 
ATOM   6152  N N   . SER C 1 150 ? -13.190 20.022  -27.115 1.00 19.45 ? 150 SER C N   1 
ATOM   6153  C CA  . SER C 1 150 ? -12.260 18.921  -27.448 1.00 19.83 ? 150 SER C CA  1 
ATOM   6154  C C   . SER C 1 150 ? -12.838 18.145  -28.632 1.00 20.06 ? 150 SER C C   1 
ATOM   6155  O O   . SER C 1 150 ? -12.240 18.112  -29.728 1.00 20.26 ? 150 SER C O   1 
ATOM   6156  C CB  . SER C 1 150 ? -11.995 18.030  -26.269 1.00 19.80 ? 150 SER C CB  1 
ATOM   6157  O OG  . SER C 1 150 ? -13.037 17.048  -26.188 1.00 20.07 ? 150 SER C OG  1 
ATOM   6158  N N   . GLY C 1 151 ? -13.982 17.539  -28.419 1.00 20.20 ? 151 GLY C N   1 
ATOM   6159  C CA  . GLY C 1 151 ? -14.677 16.793  -29.458 1.00 20.70 ? 151 GLY C CA  1 
ATOM   6160  C C   . GLY C 1 151 ? -14.492 15.293  -29.421 1.00 20.89 ? 151 GLY C C   1 
ATOM   6161  O O   . GLY C 1 151 ? -14.671 14.625  -30.477 1.00 21.02 ? 151 GLY C O   1 
ATOM   6162  N N   . PHE C 1 152 ? -14.097 14.769  -28.270 1.00 20.87 ? 152 PHE C N   1 
ATOM   6163  C CA  . PHE C 1 152 ? -14.002 13.282  -28.186 1.00 20.81 ? 152 PHE C CA  1 
ATOM   6164  C C   . PHE C 1 152 ? -15.180 12.811  -27.314 1.00 20.53 ? 152 PHE C C   1 
ATOM   6165  O O   . PHE C 1 152 ? -15.780 13.591  -26.586 1.00 20.39 ? 152 PHE C O   1 
ATOM   6166  C CB  . PHE C 1 152 ? -12.682 12.737  -27.845 1.00 21.03 ? 152 PHE C CB  1 
ATOM   6167  C CG  . PHE C 1 152 ? -11.653 13.337  -26.984 1.00 21.07 ? 152 PHE C CG  1 
ATOM   6168  C CD1 . PHE C 1 152 ? -11.796 13.352  -25.604 1.00 21.09 ? 152 PHE C CD1 1 
ATOM   6169  C CD2 . PHE C 1 152 ? -10.441 13.775  -27.555 1.00 21.08 ? 152 PHE C CD2 1 
ATOM   6170  C CE1 . PHE C 1 152 ? -10.792 13.877  -24.803 1.00 21.22 ? 152 PHE C CE1 1 
ATOM   6171  C CE2 . PHE C 1 152 ? -9.411  14.277  -26.762 1.00 21.07 ? 152 PHE C CE2 1 
ATOM   6172  C CZ  . PHE C 1 152 ? -9.602  14.325  -25.379 1.00 21.14 ? 152 PHE C CZ  1 
ATOM   6173  N N   . PRO C 1 153 ? -15.501 11.549  -27.509 1.00 20.43 ? 153 PRO C N   1 
ATOM   6174  C CA  . PRO C 1 153 ? -16.605 10.889  -26.825 1.00 20.27 ? 153 PRO C CA  1 
ATOM   6175  C C   . PRO C 1 153 ? -16.599 11.131  -25.340 1.00 20.04 ? 153 PRO C C   1 
ATOM   6176  O O   . PRO C 1 153 ? -15.553 10.925  -24.697 1.00 20.20 ? 153 PRO C O   1 
ATOM   6177  C CB  . PRO C 1 153 ? -16.419 9.400   -27.110 1.00 20.38 ? 153 PRO C CB  1 
ATOM   6178  C CG  . PRO C 1 153 ? -14.995 9.288   -27.623 1.00 20.53 ? 153 PRO C CG  1 
ATOM   6179  C CD  . PRO C 1 153 ? -14.831 10.589  -28.430 1.00 20.50 ? 153 PRO C CD  1 
ATOM   6180  N N   . VAL C 1 154 ? -17.707 11.684  -24.830 1.00 19.65 ? 154 VAL C N   1 
ATOM   6181  C CA  . VAL C 1 154 ? -17.845 11.681  -23.352 1.00 19.08 ? 154 VAL C CA  1 
ATOM   6182  C C   . VAL C 1 154 ? -17.720 10.152  -23.050 1.00 18.71 ? 154 VAL C C   1 
ATOM   6183  O O   . VAL C 1 154 ? -18.283 9.342   -23.795 1.00 18.72 ? 154 VAL C O   1 
ATOM   6184  C CB  . VAL C 1 154 ? -19.110 12.264  -22.794 1.00 19.17 ? 154 VAL C CB  1 
ATOM   6185  C CG1 . VAL C 1 154 ? -20.411 11.646  -23.285 1.00 18.96 ? 154 VAL C CG1 1 
ATOM   6186  C CG2 . VAL C 1 154 ? -19.032 12.180  -21.257 1.00 19.23 ? 154 VAL C CG2 1 
ATOM   6187  N N   . GLY C 1 155 ? -17.052 9.916   -21.987 1.00 18.18 ? 155 GLY C N   1 
ATOM   6188  C CA  . GLY C 1 155 ? -16.610 8.507   -21.635 1.00 17.32 ? 155 GLY C CA  1 
ATOM   6189  C C   . GLY C 1 155 ? -15.127 8.912   -21.323 1.00 16.85 ? 155 GLY C C   1 
ATOM   6190  O O   . GLY C 1 155 ? -14.712 8.975   -20.189 1.00 16.95 ? 155 GLY C O   1 
ATOM   6191  N N   . ARG C 1 156 ? -14.610 9.526   -22.389 1.00 16.27 ? 156 ARG C N   1 
ATOM   6192  C CA  . ARG C 1 156 ? -13.224 10.056  -22.335 1.00 15.62 ? 156 ARG C CA  1 
ATOM   6193  C C   . ARG C 1 156 ? -13.277 11.302  -21.477 1.00 14.97 ? 156 ARG C C   1 
ATOM   6194  O O   . ARG C 1 156 ? -12.671 11.290  -20.395 1.00 14.92 ? 156 ARG C O   1 
ATOM   6195  C CB  . ARG C 1 156 ? -12.585 10.210  -23.705 1.00 15.70 ? 156 ARG C CB  1 
ATOM   6196  C CG  . ARG C 1 156 ? -12.579 8.886   -24.509 1.00 15.60 ? 156 ARG C CG  1 
ATOM   6197  C CD  . ARG C 1 156 ? -11.331 8.620   -25.195 1.00 15.68 ? 156 ARG C CD  1 
ATOM   6198  N NE  . ARG C 1 156 ? -11.255 8.839   -26.619 1.00 15.92 ? 156 ARG C NE  1 
ATOM   6199  C CZ  . ARG C 1 156 ? -10.295 9.597   -27.187 1.00 16.19 ? 156 ARG C CZ  1 
ATOM   6200  N NH1 . ARG C 1 156 ? -9.376  10.262  -26.474 1.00 16.17 ? 156 ARG C NH1 1 
ATOM   6201  N NH2 . ARG C 1 156 ? -10.108 9.552   -28.516 1.00 16.29 ? 156 ARG C NH2 1 
ATOM   6202  N N   . VAL C 1 157 ? -14.164 12.205  -21.795 1.00 14.36 ? 157 VAL C N   1 
ATOM   6203  C CA  . VAL C 1 157 ? -14.298 13.500  -21.067 1.00 13.70 ? 157 VAL C CA  1 
ATOM   6204  C C   . VAL C 1 157 ? -15.207 13.420  -19.856 1.00 12.87 ? 157 VAL C C   1 
ATOM   6205  O O   . VAL C 1 157 ? -16.449 13.560  -19.948 1.00 12.82 ? 157 VAL C O   1 
ATOM   6206  C CB  . VAL C 1 157 ? -14.714 14.548  -22.134 1.00 13.80 ? 157 VAL C CB  1 
ATOM   6207  C CG1 . VAL C 1 157 ? -15.129 15.878  -21.539 1.00 13.83 ? 157 VAL C CG1 1 
ATOM   6208  C CG2 . VAL C 1 157 ? -13.608 14.714  -23.180 1.00 13.70 ? 157 VAL C CG2 1 
ATOM   6209  N N   . ILE C 1 158 ? -14.594 13.336  -18.690 1.00 11.89 ? 158 ILE C N   1 
ATOM   6210  C CA  . ILE C 1 158 ? -15.309 13.171  -17.428 1.00 11.06 ? 158 ILE C CA  1 
ATOM   6211  C C   . ILE C 1 158 ? -15.024 14.316  -16.458 1.00 10.69 ? 158 ILE C C   1 
ATOM   6212  O O   . ILE C 1 158 ? -14.023 15.045  -16.604 1.00 10.93 ? 158 ILE C O   1 
ATOM   6213  C CB  . ILE C 1 158 ? -14.990 11.806  -16.716 1.00 10.80 ? 158 ILE C CB  1 
ATOM   6214  C CG1 . ILE C 1 158 ? -14.617 10.743  -17.749 1.00 10.66 ? 158 ILE C CG1 1 
ATOM   6215  C CG2 . ILE C 1 158 ? -16.164 11.369  -15.793 1.00 10.63 ? 158 ILE C CG2 1 
ATOM   6216  C CD1 . ILE C 1 158 ? -14.208 9.385   -17.157 1.00 10.74 ? 158 ILE C CD1 1 
ATOM   6217  N N   . GLY C 1 159 ? -15.840 14.358  -15.404 1.00 9.83  ? 159 GLY C N   1 
ATOM   6218  C CA  . GLY C 1 159 ? -15.729 15.399  -14.425 1.00 8.82  ? 159 GLY C CA  1 
ATOM   6219  C C   . GLY C 1 159 ? -15.965 14.963  -13.004 1.00 8.30  ? 159 GLY C C   1 
ATOM   6220  O O   . GLY C 1 159 ? -16.848 14.207  -12.631 1.00 8.08  ? 159 GLY C O   1 
ATOM   6221  N N   . SER C 1 160 ? -15.165 15.576  -12.163 1.00 8.00  ? 160 SER C N   1 
ATOM   6222  C CA  . SER C 1 160 ? -15.101 15.489  -10.729 1.00 7.59  ? 160 SER C CA  1 
ATOM   6223  C C   . SER C 1 160 ? -16.488 15.349  -10.119 1.00 7.07  ? 160 SER C C   1 
ATOM   6224  O O   . SER C 1 160 ? -16.622 14.789  -9.025  1.00 7.04  ? 160 SER C O   1 
ATOM   6225  C CB  . SER C 1 160 ? -14.475 16.782  -10.150 1.00 7.74  ? 160 SER C CB  1 
ATOM   6226  O OG  . SER C 1 160 ? -15.353 17.845  -10.514 1.00 7.89  ? 160 SER C OG  1 
ATOM   6227  N N   . GLY C 1 161 ? -17.420 16.016  -10.769 1.00 6.56  ? 161 GLY C N   1 
ATOM   6228  C CA  . GLY C 1 161 ? -18.825 15.969  -10.332 1.00 6.21  ? 161 GLY C CA  1 
ATOM   6229  C C   . GLY C 1 161 ? -18.955 15.990  -8.823  1.00 5.88  ? 161 GLY C C   1 
ATOM   6230  O O   . GLY C 1 161 ? -18.253 16.738  -8.137  1.00 5.77  ? 161 GLY C O   1 
ATOM   6231  N N   . CYS C 1 162 ? -19.742 15.052  -8.324  1.00 5.80  ? 162 CYS C N   1 
ATOM   6232  C CA  . CYS C 1 162 ? -20.105 14.991  -6.893  1.00 5.64  ? 162 CYS C CA  1 
ATOM   6233  C C   . CYS C 1 162 ? -19.435 13.891  -6.139  1.00 5.53  ? 162 CYS C C   1 
ATOM   6234  O O   . CYS C 1 162 ? -19.705 13.678  -4.920  1.00 5.66  ? 162 CYS C O   1 
ATOM   6235  C CB  . CYS C 1 162 ? -21.652 14.884  -6.834  1.00 5.51  ? 162 CYS C CB  1 
ATOM   6236  S SG  . CYS C 1 162 ? -22.293 15.885  -8.231  1.00 5.92  ? 162 CYS C SG  1 
ATOM   6237  N N   . ASN C 1 163 ? -18.555 13.187  -6.837  1.00 5.09  ? 163 ASN C N   1 
ATOM   6238  C CA  . ASN C 1 163 ? -17.798 12.077  -6.190  1.00 4.75  ? 163 ASN C CA  1 
ATOM   6239  C C   . ASN C 1 163 ? -17.389 12.614  -4.809  1.00 4.44  ? 163 ASN C C   1 
ATOM   6240  O O   . ASN C 1 163 ? -17.714 12.145  -3.746  1.00 4.30  ? 163 ASN C O   1 
ATOM   6241  C CB  . ASN C 1 163 ? -16.668 11.670  -7.116  1.00 4.91  ? 163 ASN C CB  1 
ATOM   6242  C CG  . ASN C 1 163 ? -15.893 10.554  -6.429  1.00 5.08  ? 163 ASN C CG  1 
ATOM   6243  O OD1 . ASN C 1 163 ? -16.555 9.527   -6.203  1.00 5.50  ? 163 ASN C OD1 1 
ATOM   6244  N ND2 . ASN C 1 163 ? -14.686 10.831  -6.011  1.00 5.17  ? 163 ASN C ND2 1 
ATOM   6245  N N   . LEU C 1 164 ? -16.885 13.830  -4.930  1.00 4.13  ? 164 LEU C N   1 
ATOM   6246  C CA  . LEU C 1 164 ? -16.501 14.757  -3.880  1.00 3.61  ? 164 LEU C CA  1 
ATOM   6247  C C   . LEU C 1 164 ? -17.585 14.859  -2.807  1.00 3.23  ? 164 LEU C C   1 
ATOM   6248  O O   . LEU C 1 164 ? -17.482 14.263  -1.730  1.00 2.82  ? 164 LEU C O   1 
ATOM   6249  C CB  . LEU C 1 164 ? -16.260 16.041  -4.675  1.00 3.58  ? 164 LEU C CB  1 
ATOM   6250  C CG  . LEU C 1 164 ? -15.052 16.903  -4.482  1.00 3.51  ? 164 LEU C CG  1 
ATOM   6251  C CD1 . LEU C 1 164 ? -15.304 18.243  -5.190  1.00 3.39  ? 164 LEU C CD1 1 
ATOM   6252  C CD2 . LEU C 1 164 ? -14.763 17.144  -3.007  1.00 3.57  ? 164 LEU C CD2 1 
ATOM   6253  N N   . ASP C 1 165 ? -18.620 15.609  -3.110  1.00 3.20  ? 165 ASP C N   1 
ATOM   6254  C CA  . ASP C 1 165 ? -19.823 15.852  -2.319  1.00 3.28  ? 165 ASP C CA  1 
ATOM   6255  C C   . ASP C 1 165 ? -20.390 14.623  -1.589  1.00 3.21  ? 165 ASP C C   1 
ATOM   6256  O O   . ASP C 1 165 ? -20.613 14.629  -0.368  1.00 3.09  ? 165 ASP C O   1 
ATOM   6257  C CB  . ASP C 1 165 ? -20.949 16.442  -3.205  1.00 3.19  ? 165 ASP C CB  1 
ATOM   6258  C CG  . ASP C 1 165 ? -20.505 17.740  -3.875  1.00 3.20  ? 165 ASP C CG  1 
ATOM   6259  O OD1 . ASP C 1 165 ? -20.137 18.711  -3.203  1.00 3.04  ? 165 ASP C OD1 1 
ATOM   6260  O OD2 . ASP C 1 165 ? -20.547 17.689  -5.119  1.00 3.19  ? 165 ASP C OD2 1 
ATOM   6261  N N   . SER C 1 166 ? -20.714 13.617  -2.395  1.00 3.01  ? 166 SER C N   1 
ATOM   6262  C CA  . SER C 1 166 ? -21.197 12.317  -1.926  1.00 2.70  ? 166 SER C CA  1 
ATOM   6263  C C   . SER C 1 166 ? -20.321 11.780  -0.790  1.00 2.59  ? 166 SER C C   1 
ATOM   6264  O O   . SER C 1 166 ? -20.792 11.152  0.158   1.00 2.69  ? 166 SER C O   1 
ATOM   6265  C CB  . SER C 1 166 ? -21.195 11.317  -3.074  1.00 2.60  ? 166 SER C CB  1 
ATOM   6266  O OG  . SER C 1 166 ? -21.355 11.972  -4.312  1.00 2.29  ? 166 SER C OG  1 
ATOM   6267  N N   . ALA C 1 167 ? -19.032 11.970  -0.963  1.00 2.45  ? 167 ALA C N   1 
ATOM   6268  C CA  . ALA C 1 167 ? -18.008 11.574  -0.005  1.00 2.27  ? 167 ALA C CA  1 
ATOM   6269  C C   . ALA C 1 167 ? -18.116 12.497  1.205   1.00 2.23  ? 167 ALA C C   1 
ATOM   6270  O O   . ALA C 1 167 ? -18.117 12.079  2.365   1.00 2.06  ? 167 ALA C O   1 
ATOM   6271  C CB  . ALA C 1 167 ? -16.638 11.631  -0.656  1.00 2.18  ? 167 ALA C CB  1 
ATOM   6272  N N   . ARG C 1 168 ? -18.269 13.769  0.862   1.00 2.34  ? 168 ARG C N   1 
ATOM   6273  C CA  . ARG C 1 168 ? -18.380 14.831  1.913   1.00 2.39  ? 168 ARG C CA  1 
ATOM   6274  C C   . ARG C 1 168 ? -19.547 14.453  2.839   1.00 2.53  ? 168 ARG C C   1 
ATOM   6275  O O   . ARG C 1 168 ? -19.523 14.586  4.068   1.00 2.36  ? 168 ARG C O   1 
ATOM   6276  C CB  . ARG C 1 168 ? -18.535 16.178  1.254   1.00 2.16  ? 168 ARG C CB  1 
ATOM   6277  C CG  . ARG C 1 168 ? -17.665 17.308  1.765   1.00 2.15  ? 168 ARG C CG  1 
ATOM   6278  C CD  . ARG C 1 168 ? -18.109 18.647  1.267   1.00 2.21  ? 168 ARG C CD  1 
ATOM   6279  N NE  . ARG C 1 168 ? -17.583 19.012  -0.042  1.00 2.09  ? 168 ARG C NE  1 
ATOM   6280  C CZ  . ARG C 1 168 ? -16.291 19.320  -0.217  1.00 2.00  ? 168 ARG C CZ  1 
ATOM   6281  N NH1 . ARG C 1 168 ? -15.494 19.267  0.853   1.00 2.08  ? 168 ARG C NH1 1 
ATOM   6282  N NH2 . ARG C 1 168 ? -15.842 19.768  -1.364  1.00 2.00  ? 168 ARG C NH2 1 
ATOM   6283  N N   . PHE C 1 169 ? -20.536 13.888  2.166   1.00 2.59  ? 169 PHE C N   1 
ATOM   6284  C CA  . PHE C 1 169 ? -21.828 13.411  2.652   1.00 2.54  ? 169 PHE C CA  1 
ATOM   6285  C C   . PHE C 1 169 ? -21.627 12.172  3.515   1.00 2.65  ? 169 PHE C C   1 
ATOM   6286  O O   . PHE C 1 169 ? -21.822 12.277  4.744   1.00 2.76  ? 169 PHE C O   1 
ATOM   6287  C CB  . PHE C 1 169 ? -22.775 13.225  1.481   1.00 2.47  ? 169 PHE C CB  1 
ATOM   6288  C CG  . PHE C 1 169 ? -24.186 12.797  1.600   1.00 2.46  ? 169 PHE C CG  1 
ATOM   6289  C CD1 . PHE C 1 169 ? -25.102 13.442  2.432   1.00 2.38  ? 169 PHE C CD1 1 
ATOM   6290  C CD2 . PHE C 1 169 ? -24.667 11.747  0.789   1.00 2.54  ? 169 PHE C CD2 1 
ATOM   6291  C CE1 . PHE C 1 169 ? -26.437 13.078  2.465   1.00 2.33  ? 169 PHE C CE1 1 
ATOM   6292  C CE2 . PHE C 1 169 ? -26.014 11.361  0.765   1.00 2.28  ? 169 PHE C CE2 1 
ATOM   6293  C CZ  . PHE C 1 169 ? -26.884 12.037  1.636   1.00 2.43  ? 169 PHE C CZ  1 
ATOM   6294  N N   . ARG C 1 170 ? -21.223 11.065  2.917   1.00 2.65  ? 170 ARG C N   1 
ATOM   6295  C CA  . ARG C 1 170 ? -20.945 9.823   3.652   1.00 2.65  ? 170 ARG C CA  1 
ATOM   6296  C C   . ARG C 1 170 ? -20.187 10.162  4.932   1.00 2.91  ? 170 ARG C C   1 
ATOM   6297  O O   . ARG C 1 170 ? -20.366 9.509   5.950   1.00 2.94  ? 170 ARG C O   1 
ATOM   6298  C CB  . ARG C 1 170 ? -20.169 8.779   2.875   1.00 2.47  ? 170 ARG C CB  1 
ATOM   6299  C CG  . ARG C 1 170 ? -20.956 7.609   2.334   1.00 2.23  ? 170 ARG C CG  1 
ATOM   6300  C CD  . ARG C 1 170 ? -20.783 7.331   0.921   1.00 2.04  ? 170 ARG C CD  1 
ATOM   6301  N NE  . ARG C 1 170 ? -19.881 6.435   0.382   1.00 2.00  ? 170 ARG C NE  1 
ATOM   6302  C CZ  . ARG C 1 170 ? -19.410 5.246   0.657   1.00 2.25  ? 170 ARG C CZ  1 
ATOM   6303  N NH1 . ARG C 1 170 ? -19.641 4.439   1.694   1.00 2.08  ? 170 ARG C NH1 1 
ATOM   6304  N NH2 . ARG C 1 170 ? -18.719 4.631   -0.333  1.00 2.70  ? 170 ARG C NH2 1 
ATOM   6305  N N   . TYR C 1 171 ? -19.339 11.174  4.840   1.00 3.40  ? 171 TYR C N   1 
ATOM   6306  C CA  . TYR C 1 171 ? -18.597 11.605  6.030   1.00 3.99  ? 171 TYR C CA  1 
ATOM   6307  C C   . TYR C 1 171 ? -19.649 11.981  7.085   1.00 4.54  ? 171 TYR C C   1 
ATOM   6308  O O   . TYR C 1 171 ? -19.972 11.140  7.932   1.00 4.73  ? 171 TYR C O   1 
ATOM   6309  C CB  . TYR C 1 171 ? -17.565 12.708  5.804   1.00 3.97  ? 171 TYR C CB  1 
ATOM   6310  C CG  . TYR C 1 171 ? -17.143 13.474  7.053   1.00 3.77  ? 171 TYR C CG  1 
ATOM   6311  C CD1 . TYR C 1 171 ? -17.415 14.846  7.146   1.00 3.70  ? 171 TYR C CD1 1 
ATOM   6312  C CD2 . TYR C 1 171 ? -16.674 12.817  8.186   1.00 3.54  ? 171 TYR C CD2 1 
ATOM   6313  C CE1 . TYR C 1 171 ? -17.077 15.564  8.291   1.00 3.62  ? 171 TYR C CE1 1 
ATOM   6314  C CE2 . TYR C 1 171 ? -16.374 13.517  9.345   1.00 3.45  ? 171 TYR C CE2 1 
ATOM   6315  C CZ  . TYR C 1 171 ? -16.561 14.885  9.391   1.00 3.48  ? 171 TYR C CZ  1 
ATOM   6316  O OH  . TYR C 1 171 ? -16.239 15.556  10.527  1.00 3.47  ? 171 TYR C OH  1 
ATOM   6317  N N   . LEU C 1 172 ? -20.111 13.227  6.991   1.00 4.96  ? 172 LEU C N   1 
ATOM   6318  C CA  . LEU C 1 172 ? -21.060 13.770  7.953   1.00 5.29  ? 172 LEU C CA  1 
ATOM   6319  C C   . LEU C 1 172 ? -22.042 12.668  8.410   1.00 5.64  ? 172 LEU C C   1 
ATOM   6320  O O   . LEU C 1 172 ? -22.229 12.431  9.595   1.00 5.77  ? 172 LEU C O   1 
ATOM   6321  C CB  . LEU C 1 172 ? -21.806 14.958  7.360   1.00 5.10  ? 172 LEU C CB  1 
ATOM   6322  C CG  . LEU C 1 172 ? -21.215 16.135  6.684   1.00 4.79  ? 172 LEU C CG  1 
ATOM   6323  C CD1 . LEU C 1 172 ? -22.299 16.962  5.978   1.00 4.65  ? 172 LEU C CD1 1 
ATOM   6324  C CD2 . LEU C 1 172 ? -20.538 17.055  7.696   1.00 4.79  ? 172 LEU C CD2 1 
ATOM   6325  N N   . ILE C 1 173 ? -22.669 12.085  7.412   1.00 6.04  ? 173 ILE C N   1 
ATOM   6326  C CA  . ILE C 1 173 ? -23.700 11.043  7.621   1.00 6.63  ? 173 ILE C CA  1 
ATOM   6327  C C   . ILE C 1 173 ? -23.226 10.077  8.697   1.00 7.16  ? 173 ILE C C   1 
ATOM   6328  O O   . ILE C 1 173 ? -23.859 9.915   9.783   1.00 7.27  ? 173 ILE C O   1 
ATOM   6329  C CB  . ILE C 1 173 ? -24.069 10.489  6.215   1.00 6.49  ? 173 ILE C CB  1 
ATOM   6330  C CG1 . ILE C 1 173 ? -25.586 10.189  6.071   1.00 6.36  ? 173 ILE C CG1 1 
ATOM   6331  C CG2 . ILE C 1 173 ? -23.232 9.246   5.835   1.00 6.69  ? 173 ILE C CG2 1 
ATOM   6332  C CD1 . ILE C 1 173 ? -25.979 9.754   4.620   1.00 6.26  ? 173 ILE C CD1 1 
ATOM   6333  N N   . GLY C 1 174 ? -22.039 9.532   8.498   1.00 7.48  ? 174 GLY C N   1 
ATOM   6334  C CA  . GLY C 1 174 ? -21.391 8.598   9.408   1.00 7.94  ? 174 GLY C CA  1 
ATOM   6335  C C   . GLY C 1 174 ? -20.958 9.260   10.714  1.00 8.22  ? 174 GLY C C   1 
ATOM   6336  O O   . GLY C 1 174 ? -20.690 8.549   11.708  1.00 8.12  ? 174 GLY C O   1 
ATOM   6337  N N   . GLU C 1 175 ? -20.842 10.564  10.685  1.00 8.65  ? 175 GLU C N   1 
ATOM   6338  C CA  . GLU C 1 175 ? -20.421 11.351  11.877  1.00 9.31  ? 175 GLU C CA  1 
ATOM   6339  C C   . GLU C 1 175 ? -21.496 11.136  12.933  1.00 9.14  ? 175 GLU C C   1 
ATOM   6340  O O   . GLU C 1 175 ? -21.155 11.147  14.130  1.00 9.29  ? 175 GLU C O   1 
ATOM   6341  C CB  . GLU C 1 175 ? -20.129 12.807  11.586  1.00 9.86  ? 175 GLU C CB  1 
ATOM   6342  C CG  . GLU C 1 175 ? -19.704 13.900  12.485  1.00 10.67 ? 175 GLU C CG  1 
ATOM   6343  C CD  . GLU C 1 175 ? -19.816 15.371  12.212  1.00 11.40 ? 175 GLU C CD  1 
ATOM   6344  O OE1 . GLU C 1 175 ? -18.884 16.218  12.169  1.00 11.48 ? 175 GLU C OE1 1 
ATOM   6345  O OE2 . GLU C 1 175 ? -20.995 15.860  12.129  1.00 11.64 ? 175 GLU C OE2 1 
ATOM   6346  N N   . LYS C 1 176 ? -22.690 10.713  12.533  1.00 8.87  ? 176 LYS C N   1 
ATOM   6347  C CA  . LYS C 1 176 ? -23.811 10.590  13.489  1.00 8.80  ? 176 LYS C CA  1 
ATOM   6348  C C   . LYS C 1 176 ? -24.135 9.206   14.005  1.00 8.49  ? 176 LYS C C   1 
ATOM   6349  O O   . LYS C 1 176 ? -24.593 9.065   15.179  1.00 8.40  ? 176 LYS C O   1 
ATOM   6350  C CB  . LYS C 1 176 ? -25.077 11.267  12.891  1.00 8.90  ? 176 LYS C CB  1 
ATOM   6351  C CG  . LYS C 1 176 ? -25.339 12.642  13.464  1.00 9.03  ? 176 LYS C CG  1 
ATOM   6352  C CD  . LYS C 1 176 ? -25.572 13.758  12.504  1.00 9.29  ? 176 LYS C CD  1 
ATOM   6353  C CE  . LYS C 1 176 ? -26.755 13.645  11.572  1.00 9.40  ? 176 LYS C CE  1 
ATOM   6354  N NZ  . LYS C 1 176 ? -26.645 14.614  10.434  1.00 9.22  ? 176 LYS C NZ  1 
ATOM   6355  N N   . LEU C 1 177 ? -23.997 8.175   13.193  1.00 7.97  ? 177 LEU C N   1 
ATOM   6356  C CA  . LEU C 1 177 ? -24.268 6.792   13.558  1.00 7.44  ? 177 LEU C CA  1 
ATOM   6357  C C   . LEU C 1 177 ? -23.092 6.192   14.347  1.00 7.25  ? 177 LEU C C   1 
ATOM   6358  O O   . LEU C 1 177 ? -23.284 5.342   15.251  1.00 7.21  ? 177 LEU C O   1 
ATOM   6359  C CB  . LEU C 1 177 ? -24.602 6.010   12.292  1.00 7.26  ? 177 LEU C CB  1 
ATOM   6360  C CG  . LEU C 1 177 ? -25.588 6.545   11.301  1.00 7.27  ? 177 LEU C CG  1 
ATOM   6361  C CD1 . LEU C 1 177 ? -25.589 5.742   9.992   1.00 7.19  ? 177 LEU C CD1 1 
ATOM   6362  C CD2 . LEU C 1 177 ? -27.000 6.485   11.897  1.00 7.25  ? 177 LEU C CD2 1 
ATOM   6363  N N   . GLY C 1 178 ? -21.907 6.634   13.952  1.00 6.87  ? 178 GLY C N   1 
ATOM   6364  C CA  . GLY C 1 178 ? -20.637 6.146   14.554  1.00 6.40  ? 178 GLY C CA  1 
ATOM   6365  C C   . GLY C 1 178 ? -20.244 4.874   13.760  1.00 5.87  ? 178 GLY C C   1 
ATOM   6366  O O   . GLY C 1 178 ? -19.951 3.834   14.333  1.00 5.73  ? 178 GLY C O   1 
ATOM   6367  N N   . VAL C 1 179 ? -20.247 5.082   12.476  1.00 5.45  ? 179 VAL C N   1 
ATOM   6368  C CA  . VAL C 1 179 ? -20.034 4.087   11.427  1.00 5.00  ? 179 VAL C CA  1 
ATOM   6369  C C   . VAL C 1 179 ? -19.251 4.722   10.287  1.00 4.89  ? 179 VAL C C   1 
ATOM   6370  O O   . VAL C 1 179 ? -19.638 5.831   9.855   1.00 4.99  ? 179 VAL C O   1 
ATOM   6371  C CB  . VAL C 1 179 ? -21.461 3.640   10.997  1.00 4.78  ? 179 VAL C CB  1 
ATOM   6372  C CG1 . VAL C 1 179 ? -21.477 2.935   9.659   1.00 4.80  ? 179 VAL C CG1 1 
ATOM   6373  C CG2 . VAL C 1 179 ? -22.154 2.861   12.080  1.00 4.49  ? 179 VAL C CG2 1 
ATOM   6374  N N   . ASN C 1 180 ? -18.360 4.016   9.705   1.00 4.91  ? 180 ASN C N   1 
ATOM   6375  C CA  . ASN C 1 180 ? -17.421 4.487   8.635   1.00 5.15  ? 180 ASN C CA  1 
ATOM   6376  C C   . ASN C 1 180 ? -18.151 4.822   7.360   1.00 5.29  ? 180 ASN C C   1 
ATOM   6377  O O   . ASN C 1 180 ? -19.117 4.172   6.940   1.00 5.25  ? 180 ASN C O   1 
ATOM   6378  C CB  . ASN C 1 180 ? -16.330 3.443   8.650   1.00 5.29  ? 180 ASN C CB  1 
ATOM   6379  C CG  . ASN C 1 180 ? -14.913 3.817   8.432   1.00 5.41  ? 180 ASN C CG  1 
ATOM   6380  O OD1 . ASN C 1 180 ? -14.124 3.015   7.863   1.00 5.80  ? 180 ASN C OD1 1 
ATOM   6381  N ND2 . ASN C 1 180 ? -14.486 4.991   8.858   1.00 5.44  ? 180 ASN C ND2 1 
ATOM   6382  N N   . PRO C 1 181 ? -17.693 5.898   6.715   1.00 5.77  ? 181 PRO C N   1 
ATOM   6383  C CA  . PRO C 1 181 ? -18.327 6.498   5.542   1.00 6.15  ? 181 PRO C CA  1 
ATOM   6384  C C   . PRO C 1 181 ? -18.248 5.630   4.310   1.00 6.37  ? 181 PRO C C   1 
ATOM   6385  O O   . PRO C 1 181 ? -18.357 6.116   3.172   1.00 6.68  ? 181 PRO C O   1 
ATOM   6386  C CB  . PRO C 1 181 ? -17.449 7.764   5.276   1.00 6.06  ? 181 PRO C CB  1 
ATOM   6387  C CG  . PRO C 1 181 ? -16.066 7.119   5.440   1.00 6.10  ? 181 PRO C CG  1 
ATOM   6388  C CD  . PRO C 1 181 ? -16.246 6.288   6.724   1.00 6.09  ? 181 PRO C CD  1 
ATOM   6389  N N   . THR C 1 182 ? -17.663 4.498   4.551   1.00 6.51  ? 182 THR C N   1 
ATOM   6390  C CA  . THR C 1 182 ? -17.408 3.437   3.600   1.00 6.44  ? 182 THR C CA  1 
ATOM   6391  C C   . THR C 1 182 ? -18.555 2.417   3.783   1.00 6.31  ? 182 THR C C   1 
ATOM   6392  O O   . THR C 1 182 ? -18.915 1.717   2.881   1.00 6.26  ? 182 THR C O   1 
ATOM   6393  C CB  . THR C 1 182 ? -16.043 2.711   3.922   1.00 6.44  ? 182 THR C CB  1 
ATOM   6394  O OG1 . THR C 1 182 ? -16.315 1.270   3.711   1.00 6.59  ? 182 THR C OG1 1 
ATOM   6395  C CG2 . THR C 1 182 ? -15.503 2.966   5.324   1.00 6.18  ? 182 THR C CG2 1 
ATOM   6396  N N   . SER C 1 183 ? -18.894 2.359   5.046   1.00 6.37  ? 183 SER C N   1 
ATOM   6397  C CA  . SER C 1 183 ? -19.860 1.516   5.665   1.00 6.67  ? 183 SER C CA  1 
ATOM   6398  C C   . SER C 1 183 ? -21.230 2.146   5.796   1.00 6.98  ? 183 SER C C   1 
ATOM   6399  O O   . SER C 1 183 ? -22.095 1.497   6.411   1.00 7.23  ? 183 SER C O   1 
ATOM   6400  C CB  . SER C 1 183 ? -19.334 1.045   7.032   1.00 6.70  ? 183 SER C CB  1 
ATOM   6401  O OG  . SER C 1 183 ? -19.751 -0.307  7.223   1.00 7.04  ? 183 SER C OG  1 
ATOM   6402  N N   . CYS C 1 184 ? -21.410 3.365   5.384   1.00 7.33  ? 184 CYS C N   1 
ATOM   6403  C CA  . CYS C 1 184 ? -22.715 4.034   5.281   1.00 7.63  ? 184 CYS C CA  1 
ATOM   6404  C C   . CYS C 1 184 ? -22.773 4.362   3.774   1.00 8.01  ? 184 CYS C C   1 
ATOM   6405  O O   . CYS C 1 184 ? -21.666 4.567   3.229   1.00 8.17  ? 184 CYS C O   1 
ATOM   6406  C CB  . CYS C 1 184 ? -22.892 5.315   6.004   1.00 7.77  ? 184 CYS C CB  1 
ATOM   6407  S SG  . CYS C 1 184 ? -22.229 5.494   7.656   1.00 8.65  ? 184 CYS C SG  1 
ATOM   6408  N N   . HIS C 1 185 ? -23.933 4.408   3.209   1.00 8.41  ? 185 HIS C N   1 
ATOM   6409  C CA  . HIS C 1 185 ? -23.987 4.716   1.741   1.00 8.82  ? 185 HIS C CA  1 
ATOM   6410  C C   . HIS C 1 185 ? -25.108 5.722   1.564   1.00 9.32  ? 185 HIS C C   1 
ATOM   6411  O O   . HIS C 1 185 ? -26.068 5.685   2.357   1.00 9.34  ? 185 HIS C O   1 
ATOM   6412  C CB  . HIS C 1 185 ? -24.150 3.466   0.892   1.00 8.82  ? 185 HIS C CB  1 
ATOM   6413  C CG  . HIS C 1 185 ? -23.248 2.348   1.330   1.00 8.81  ? 185 HIS C CG  1 
ATOM   6414  N ND1 . HIS C 1 185 ? -22.230 1.833   0.581   1.00 8.87  ? 185 HIS C ND1 1 
ATOM   6415  C CD2 . HIS C 1 185 ? -23.202 1.680   2.514   1.00 8.78  ? 185 HIS C CD2 1 
ATOM   6416  C CE1 . HIS C 1 185 ? -21.600 0.891   1.283   1.00 8.82  ? 185 HIS C CE1 1 
ATOM   6417  N NE2 . HIS C 1 185 ? -22.150 0.816   2.469   1.00 8.70  ? 185 HIS C NE2 1 
ATOM   6418  N N   . GLY C 1 186 ? -24.916 6.616   0.630   1.00 9.80  ? 186 GLY C N   1 
ATOM   6419  C CA  . GLY C 1 186 ? -25.853 7.712   0.303   1.00 10.33 ? 186 GLY C CA  1 
ATOM   6420  C C   . GLY C 1 186 ? -25.309 8.369   -0.969  1.00 10.79 ? 186 GLY C C   1 
ATOM   6421  O O   . GLY C 1 186 ? -24.066 8.362   -1.149  1.00 11.24 ? 186 GLY C O   1 
ATOM   6422  N N   . TRP C 1 187 ? -26.164 8.966   -1.751  1.00 10.94 ? 187 TRP C N   1 
ATOM   6423  C CA  . TRP C 1 187 ? -25.753 9.528   -3.068  1.00 11.04 ? 187 TRP C CA  1 
ATOM   6424  C C   . TRP C 1 187 ? -26.256 10.954  -3.127  1.00 10.80 ? 187 TRP C C   1 
ATOM   6425  O O   . TRP C 1 187 ? -27.328 11.242  -2.532  1.00 10.99 ? 187 TRP C O   1 
ATOM   6426  C CB  . TRP C 1 187 ? -26.277 8.577   -4.140  1.00 11.75 ? 187 TRP C CB  1 
ATOM   6427  C CG  . TRP C 1 187 ? -25.316 7.999   -5.106  1.00 12.70 ? 187 TRP C CG  1 
ATOM   6428  C CD1 . TRP C 1 187 ? -24.993 8.446   -6.366  1.00 12.97 ? 187 TRP C CD1 1 
ATOM   6429  C CD2 . TRP C 1 187 ? -24.503 6.815   -4.928  1.00 12.97 ? 187 TRP C CD2 1 
ATOM   6430  N NE1 . TRP C 1 187 ? -24.026 7.670   -6.958  1.00 13.05 ? 187 TRP C NE1 1 
ATOM   6431  C CE2 . TRP C 1 187 ? -23.697 6.671   -6.082  1.00 13.06 ? 187 TRP C CE2 1 
ATOM   6432  C CE3 . TRP C 1 187 ? -24.332 5.940   -3.863  1.00 13.04 ? 187 TRP C CE3 1 
ATOM   6433  C CZ2 . TRP C 1 187 ? -22.750 5.664   -6.209  1.00 13.05 ? 187 TRP C CZ2 1 
ATOM   6434  C CZ3 . TRP C 1 187 ? -23.392 4.939   -3.998  1.00 13.09 ? 187 TRP C CZ3 1 
ATOM   6435  C CH2 . TRP C 1 187 ? -22.624 4.799   -5.148  1.00 13.06 ? 187 TRP C CH2 1 
ATOM   6436  N N   . VAL C 1 188 ? -25.452 11.895  -3.579  1.00 10.27 ? 188 VAL C N   1 
ATOM   6437  C CA  . VAL C 1 188 ? -25.887 13.286  -3.763  1.00 9.89  ? 188 VAL C CA  1 
ATOM   6438  C C   . VAL C 1 188 ? -25.571 13.590  -5.232  1.00 9.84  ? 188 VAL C C   1 
ATOM   6439  O O   . VAL C 1 188 ? -24.387 13.380  -5.571  1.00 10.11 ? 188 VAL C O   1 
ATOM   6440  C CB  . VAL C 1 188 ? -25.249 14.285  -2.814  1.00 9.82  ? 188 VAL C CB  1 
ATOM   6441  C CG1 . VAL C 1 188 ? -25.858 15.707  -2.998  1.00 9.73  ? 188 VAL C CG1 1 
ATOM   6442  C CG2 . VAL C 1 188 ? -25.293 13.936  -1.352  1.00 9.63  ? 188 VAL C CG2 1 
ATOM   6443  N N   . LEU C 1 189 ? -26.559 13.961  -6.009  1.00 9.59  ? 189 LEU C N   1 
ATOM   6444  C CA  . LEU C 1 189 ? -26.259 14.286  -7.415  1.00 9.56  ? 189 LEU C CA  1 
ATOM   6445  C C   . LEU C 1 189 ? -26.954 15.583  -7.835  1.00 9.66  ? 189 LEU C C   1 
ATOM   6446  O O   . LEU C 1 189 ? -27.392 16.393  -7.014  1.00 9.66  ? 189 LEU C O   1 
ATOM   6447  C CB  . LEU C 1 189 ? -26.430 13.102  -8.314  1.00 9.58  ? 189 LEU C CB  1 
ATOM   6448  C CG  . LEU C 1 189 ? -27.215 11.853  -7.994  1.00 9.57  ? 189 LEU C CG  1 
ATOM   6449  C CD1 . LEU C 1 189 ? -26.493 11.039  -6.927  1.00 9.29  ? 189 LEU C CD1 1 
ATOM   6450  C CD2 . LEU C 1 189 ? -28.625 12.232  -7.550  1.00 9.42  ? 189 LEU C CD2 1 
ATOM   6451  N N   . GLY C 1 190 ? -27.024 15.720  -9.157  1.00 9.66  ? 190 GLY C N   1 
ATOM   6452  C CA  . GLY C 1 190 ? -27.481 17.006  -9.720  1.00 9.79  ? 190 GLY C CA  1 
ATOM   6453  C C   . GLY C 1 190 ? -26.171 17.813  -9.941  1.00 9.87  ? 190 GLY C C   1 
ATOM   6454  O O   . GLY C 1 190 ? -25.274 17.333  -10.641 1.00 9.78  ? 190 GLY C O   1 
ATOM   6455  N N   . GLU C 1 191 ? -26.121 18.949  -9.294  1.00 10.02 ? 191 GLU C N   1 
ATOM   6456  C CA  . GLU C 1 191 ? -25.006 19.889  -9.390  1.00 10.11 ? 191 GLU C CA  1 
ATOM   6457  C C   . GLU C 1 191 ? -23.987 19.750  -8.265  1.00 9.91  ? 191 GLU C C   1 
ATOM   6458  O O   . GLU C 1 191 ? -24.240 19.275  -7.166  1.00 9.84  ? 191 GLU C O   1 
ATOM   6459  C CB  . GLU C 1 191 ? -25.513 21.338  -9.399  1.00 10.40 ? 191 GLU C CB  1 
ATOM   6460  C CG  . GLU C 1 191 ? -24.525 22.430  -8.984  1.00 10.73 ? 191 GLU C CG  1 
ATOM   6461  C CD  . GLU C 1 191 ? -24.857 23.843  -9.328  1.00 10.84 ? 191 GLU C CD  1 
ATOM   6462  O OE1 . GLU C 1 191 ? -24.718 24.320  -10.442 1.00 10.83 ? 191 GLU C OE1 1 
ATOM   6463  O OE2 . GLU C 1 191 ? -25.273 24.427  -8.301  1.00 11.02 ? 191 GLU C OE2 1 
ATOM   6464  N N   . HIS C 1 192 ? -22.789 20.187  -8.603  1.00 9.78  ? 192 HIS C N   1 
ATOM   6465  C CA  . HIS C 1 192 ? -21.620 20.235  -7.721  1.00 9.77  ? 192 HIS C CA  1 
ATOM   6466  C C   . HIS C 1 192 ? -21.532 21.701  -7.264  1.00 9.66  ? 192 HIS C C   1 
ATOM   6467  O O   . HIS C 1 192 ? -20.873 22.534  -7.898  1.00 9.50  ? 192 HIS C O   1 
ATOM   6468  C CB  . HIS C 1 192 ? -20.285 19.776  -8.346  1.00 9.83  ? 192 HIS C CB  1 
ATOM   6469  C CG  . HIS C 1 192 ? -19.141 20.032  -7.419  1.00 9.98  ? 192 HIS C CG  1 
ATOM   6470  N ND1 . HIS C 1 192 ? -18.987 19.377  -6.234  1.00 10.15 ? 192 HIS C ND1 1 
ATOM   6471  C CD2 . HIS C 1 192 ? -18.191 20.999  -7.438  1.00 10.21 ? 192 HIS C CD2 1 
ATOM   6472  C CE1 . HIS C 1 192 ? -17.973 19.912  -5.567  1.00 10.25 ? 192 HIS C CE1 1 
ATOM   6473  N NE2 . HIS C 1 192 ? -17.444 20.883  -6.287  1.00 10.28 ? 192 HIS C NE2 1 
ATOM   6474  N N   . GLY C 1 193 ? -22.268 21.933  -6.188  1.00 9.70  ? 193 GLY C N   1 
ATOM   6475  C CA  . GLY C 1 193 ? -22.432 23.314  -5.688  1.00 9.79  ? 193 GLY C CA  1 
ATOM   6476  C C   . GLY C 1 193 ? -23.675 23.446  -4.834  1.00 9.62  ? 193 GLY C C   1 
ATOM   6477  O O   . GLY C 1 193 ? -23.638 22.799  -3.765  1.00 9.61  ? 193 GLY C O   1 
ATOM   6478  N N   . ASP C 1 194 ? -24.716 24.139  -5.300  1.00 9.54  ? 194 ASP C N   1 
ATOM   6479  C CA  . ASP C 1 194 ? -25.847 24.371  -4.363  1.00 9.66  ? 194 ASP C CA  1 
ATOM   6480  C C   . ASP C 1 194 ? -27.156 23.777  -4.851  1.00 9.26  ? 194 ASP C C   1 
ATOM   6481  O O   . ASP C 1 194 ? -28.184 24.105  -4.229  1.00 9.39  ? 194 ASP C O   1 
ATOM   6482  C CB  . ASP C 1 194 ? -26.090 25.850  -4.016  1.00 10.07 ? 194 ASP C CB  1 
ATOM   6483  C CG  . ASP C 1 194 ? -24.842 26.646  -3.744  1.00 10.63 ? 194 ASP C CG  1 
ATOM   6484  O OD1 . ASP C 1 194 ? -24.334 26.681  -2.613  1.00 10.73 ? 194 ASP C OD1 1 
ATOM   6485  O OD2 . ASP C 1 194 ? -24.336 27.221  -4.759  1.00 11.09 ? 194 ASP C OD2 1 
ATOM   6486  N N   . SER C 1 195 ? -27.105 23.094  -5.934  1.00 8.85  ? 195 SER C N   1 
ATOM   6487  C CA  . SER C 1 195 ? -28.339 22.523  -6.553  1.00 8.35  ? 195 SER C CA  1 
ATOM   6488  C C   . SER C 1 195 ? -28.291 21.032  -6.267  1.00 8.04  ? 195 SER C C   1 
ATOM   6489  O O   . SER C 1 195 ? -28.732 20.210  -7.068  1.00 8.03  ? 195 SER C O   1 
ATOM   6490  C CB  . SER C 1 195 ? -28.277 22.840  -8.038  1.00 8.20  ? 195 SER C CB  1 
ATOM   6491  O OG  . SER C 1 195 ? -27.981 24.206  -8.262  1.00 7.97  ? 195 SER C OG  1 
ATOM   6492  N N   . SER C 1 196 ? -27.654 20.749  -5.124  1.00 7.66  ? 196 SER C N   1 
ATOM   6493  C CA  . SER C 1 196 ? -27.308 19.336  -4.825  1.00 7.03  ? 196 SER C CA  1 
ATOM   6494  C C   . SER C 1 196 ? -28.489 18.629  -4.187  1.00 6.52  ? 196 SER C C   1 
ATOM   6495  O O   . SER C 1 196 ? -28.926 18.984  -3.109  1.00 6.38  ? 196 SER C O   1 
ATOM   6496  C CB  . SER C 1 196 ? -26.065 19.177  -3.988  1.00 6.94  ? 196 SER C CB  1 
ATOM   6497  O OG  . SER C 1 196 ? -24.942 19.610  -4.740  1.00 7.12  ? 196 SER C OG  1 
ATOM   6498  N N   . VAL C 1 197 ? -29.081 17.808  -5.049  1.00 5.87  ? 197 VAL C N   1 
ATOM   6499  C CA  . VAL C 1 197 ? -30.146 16.935  -4.509  1.00 5.27  ? 197 VAL C CA  1 
ATOM   6500  C C   . VAL C 1 197 ? -29.353 15.697  -4.085  1.00 4.94  ? 197 VAL C C   1 
ATOM   6501  O O   . VAL C 1 197 ? -28.778 14.988  -4.919  1.00 4.85  ? 197 VAL C O   1 
ATOM   6502  C CB  . VAL C 1 197 ? -31.282 16.733  -5.476  1.00 5.20  ? 197 VAL C CB  1 
ATOM   6503  C CG1 . VAL C 1 197 ? -30.862 16.274  -6.867  1.00 5.33  ? 197 VAL C CG1 1 
ATOM   6504  C CG2 . VAL C 1 197 ? -32.286 15.727  -4.894  1.00 5.26  ? 197 VAL C CG2 1 
ATOM   6505  N N   . PRO C 1 198 ? -29.291 15.517  -2.770  1.00 4.70  ? 198 PRO C N   1 
ATOM   6506  C CA  . PRO C 1 198 ? -28.779 14.203  -2.255  1.00 4.66  ? 198 PRO C CA  1 
ATOM   6507  C C   . PRO C 1 198 ? -29.777 13.206  -2.802  1.00 4.80  ? 198 PRO C C   1 
ATOM   6508  O O   . PRO C 1 198 ? -30.677 13.686  -3.568  1.00 5.13  ? 198 PRO C O   1 
ATOM   6509  C CB  . PRO C 1 198 ? -28.901 14.393  -0.761  1.00 4.56  ? 198 PRO C CB  1 
ATOM   6510  C CG  . PRO C 1 198 ? -30.153 15.232  -0.583  1.00 4.26  ? 198 PRO C CG  1 
ATOM   6511  C CD  . PRO C 1 198 ? -30.058 16.226  -1.740  1.00 4.48  ? 198 PRO C CD  1 
ATOM   6512  N N   . ILE C 1 199 ? -29.784 11.951  -2.463  1.00 4.65  ? 199 ILE C N   1 
ATOM   6513  C CA  . ILE C 1 199 ? -30.950 11.128  -2.949  1.00 4.62  ? 199 ILE C CA  1 
ATOM   6514  C C   . ILE C 1 199 ? -31.239 10.083  -1.878  1.00 4.52  ? 199 ILE C C   1 
ATOM   6515  O O   . ILE C 1 199 ? -30.868 8.912   -1.975  1.00 4.51  ? 199 ILE C O   1 
ATOM   6516  C CB  . ILE C 1 199 ? -30.836 10.717  -4.417  1.00 4.74  ? 199 ILE C CB  1 
ATOM   6517  C CG1 . ILE C 1 199 ? -29.482 10.065  -4.784  1.00 4.87  ? 199 ILE C CG1 1 
ATOM   6518  C CG2 . ILE C 1 199 ? -31.093 11.867  -5.480  1.00 4.66  ? 199 ILE C CG2 1 
ATOM   6519  C CD1 . ILE C 1 199 ? -29.552 9.453   -6.248  1.00 5.17  ? 199 ILE C CD1 1 
ATOM   6520  N N   . TRP C 1 200 ? -31.874 10.612  -0.822  1.00 4.24  ? 200 TRP C N   1 
ATOM   6521  C CA  . TRP C 1 200 ? -32.301 9.868   0.347   1.00 3.97  ? 200 TRP C CA  1 
ATOM   6522  C C   . TRP C 1 200 ? -33.021 8.569   -0.035  1.00 3.77  ? 200 TRP C C   1 
ATOM   6523  O O   . TRP C 1 200 ? -32.794 7.543   0.640   1.00 3.78  ? 200 TRP C O   1 
ATOM   6524  C CB  . TRP C 1 200 ? -33.185 10.671  1.296   1.00 4.00  ? 200 TRP C CB  1 
ATOM   6525  C CG  . TRP C 1 200 ? -32.677 11.915  1.904   1.00 4.07  ? 200 TRP C CG  1 
ATOM   6526  C CD1 . TRP C 1 200 ? -33.020 13.186  1.549   1.00 4.15  ? 200 TRP C CD1 1 
ATOM   6527  C CD2 . TRP C 1 200 ? -31.750 12.068  2.989   1.00 4.16  ? 200 TRP C CD2 1 
ATOM   6528  N NE1 . TRP C 1 200 ? -32.304 14.108  2.285   1.00 4.21  ? 200 TRP C NE1 1 
ATOM   6529  C CE2 . TRP C 1 200 ? -31.548 13.449  3.192   1.00 4.12  ? 200 TRP C CE2 1 
ATOM   6530  C CE3 . TRP C 1 200 ? -31.049 11.156  3.782   1.00 4.27  ? 200 TRP C CE3 1 
ATOM   6531  C CZ2 . TRP C 1 200 ? -30.699 13.949  4.167   1.00 4.09  ? 200 TRP C CZ2 1 
ATOM   6532  C CZ3 . TRP C 1 200 ? -30.156 11.654  4.707   1.00 4.17  ? 200 TRP C CZ3 1 
ATOM   6533  C CH2 . TRP C 1 200 ? -30.027 13.019  4.941   1.00 4.14  ? 200 TRP C CH2 1 
ATOM   6534  N N   . SER C 1 201 ? -33.851 8.592   -1.054  1.00 3.48  ? 201 SER C N   1 
ATOM   6535  C CA  . SER C 1 201 ? -34.594 7.384   -1.467  1.00 3.20  ? 201 SER C CA  1 
ATOM   6536  C C   . SER C 1 201 ? -33.718 6.154   -1.225  1.00 3.37  ? 201 SER C C   1 
ATOM   6537  O O   . SER C 1 201 ? -34.202 5.192   -0.600  1.00 3.57  ? 201 SER C O   1 
ATOM   6538  C CB  . SER C 1 201 ? -35.106 7.446   -2.871  1.00 2.97  ? 201 SER C CB  1 
ATOM   6539  O OG  . SER C 1 201 ? -34.383 6.738   -3.822  1.00 2.72  ? 201 SER C OG  1 
ATOM   6540  N N   . GLY C 1 202 ? -32.430 6.255   -1.539  1.00 3.41  ? 202 GLY C N   1 
ATOM   6541  C CA  . GLY C 1 202 ? -31.483 5.186   -1.415  1.00 3.59  ? 202 GLY C CA  1 
ATOM   6542  C C   . GLY C 1 202 ? -30.313 5.316   -0.501  1.00 3.84  ? 202 GLY C C   1 
ATOM   6543  O O   . GLY C 1 202 ? -29.169 5.228   -0.996  1.00 3.71  ? 202 GLY C O   1 
ATOM   6544  N N   . VAL C 1 203 ? -30.502 5.210   0.798   1.00 4.41  ? 203 VAL C N   1 
ATOM   6545  C CA  . VAL C 1 203 ? -29.435 5.444   1.797   1.00 5.08  ? 203 VAL C CA  1 
ATOM   6546  C C   . VAL C 1 203 ? -29.314 4.363   2.846   1.00 5.87  ? 203 VAL C C   1 
ATOM   6547  O O   . VAL C 1 203 ? -29.928 4.435   3.940   1.00 6.11  ? 203 VAL C O   1 
ATOM   6548  C CB  . VAL C 1 203 ? -29.695 6.875   2.377   1.00 4.78  ? 203 VAL C CB  1 
ATOM   6549  C CG1 . VAL C 1 203 ? -29.061 7.200   3.693   1.00 4.53  ? 203 VAL C CG1 1 
ATOM   6550  C CG2 . VAL C 1 203 ? -29.308 7.922   1.320   1.00 4.74  ? 203 VAL C CG2 1 
ATOM   6551  N N   . ASN C 1 204 ? -28.392 3.437   2.638   1.00 6.50  ? 204 ASN C N   1 
ATOM   6552  C CA  . ASN C 1 204 ? -28.084 2.310   3.481   1.00 6.99  ? 204 ASN C CA  1 
ATOM   6553  C C   . ASN C 1 204 ? -27.158 2.678   4.670   1.00 7.42  ? 204 ASN C C   1 
ATOM   6554  O O   . ASN C 1 204 ? -26.630 3.754   4.765   1.00 7.48  ? 204 ASN C O   1 
ATOM   6555  C CB  . ASN C 1 204 ? -27.335 1.204   2.757   1.00 7.04  ? 204 ASN C CB  1 
ATOM   6556  C CG  . ASN C 1 204 ? -27.602 0.963   1.330   1.00 7.27  ? 204 ASN C CG  1 
ATOM   6557  O OD1 . ASN C 1 204 ? -27.526 -0.225  0.926   1.00 7.48  ? 204 ASN C OD1 1 
ATOM   6558  N ND2 . ASN C 1 204 ? -27.784 2.005   0.525   1.00 7.40  ? 204 ASN C ND2 1 
ATOM   6559  N N   . VAL C 1 205 ? -26.820 1.663   5.370   1.00 8.17  ? 205 VAL C N   1 
ATOM   6560  C CA  . VAL C 1 205 ? -26.003 1.313   6.457   1.00 9.13  ? 205 VAL C CA  1 
ATOM   6561  C C   . VAL C 1 205 ? -26.271 -0.216  6.729   1.00 10.04 ? 205 VAL C C   1 
ATOM   6562  O O   . VAL C 1 205 ? -26.572 -0.649  7.823   1.00 10.08 ? 205 VAL C O   1 
ATOM   6563  C CB  . VAL C 1 205 ? -26.169 2.090   7.754   1.00 9.01  ? 205 VAL C CB  1 
ATOM   6564  C CG1 . VAL C 1 205 ? -25.106 1.639   8.786   1.00 8.99  ? 205 VAL C CG1 1 
ATOM   6565  C CG2 . VAL C 1 205 ? -26.143 3.585   7.628   1.00 9.07  ? 205 VAL C CG2 1 
ATOM   6566  N N   . ALA C 1 206 ? -26.301 -0.931  5.650   1.00 11.19 ? 206 ALA C N   1 
ATOM   6567  C CA  . ALA C 1 206 ? -26.530 -2.346  5.437   1.00 12.00 ? 206 ALA C CA  1 
ATOM   6568  C C   . ALA C 1 206 ? -27.022 -2.563  3.993   1.00 12.73 ? 206 ALA C C   1 
ATOM   6569  O O   . ALA C 1 206 ? -26.159 -2.584  3.056   1.00 12.84 ? 206 ALA C O   1 
ATOM   6570  C CB  . ALA C 1 206 ? -27.420 -2.982  6.469   1.00 11.86 ? 206 ALA C CB  1 
ATOM   6571  N N   . GLY C 1 207 ? -28.321 -2.591  3.775   1.00 13.50 ? 207 GLY C N   1 
ATOM   6572  C CA  . GLY C 1 207 ? -28.828 -2.840  2.423   1.00 14.75 ? 207 GLY C CA  1 
ATOM   6573  C C   . GLY C 1 207 ? -30.097 -2.100  2.071   1.00 15.64 ? 207 GLY C C   1 
ATOM   6574  O O   . GLY C 1 207 ? -30.797 -1.546  2.918   1.00 15.46 ? 207 GLY C O   1 
ATOM   6575  N N   . VAL C 1 208 ? -30.385 -2.133  0.771   1.00 16.71 ? 208 VAL C N   1 
ATOM   6576  C CA  . VAL C 1 208 ? -31.562 -1.499  0.189   1.00 17.98 ? 208 VAL C CA  1 
ATOM   6577  C C   . VAL C 1 208 ? -32.794 -2.406  0.419   1.00 18.66 ? 208 VAL C C   1 
ATOM   6578  O O   . VAL C 1 208 ? -32.888 -3.524  -0.124  1.00 18.81 ? 208 VAL C O   1 
ATOM   6579  C CB  . VAL C 1 208 ? -31.436 -1.180  -1.311  1.00 18.24 ? 208 VAL C CB  1 
ATOM   6580  C CG1 . VAL C 1 208 ? -32.532 -0.178  -1.744  1.00 18.25 ? 208 VAL C CG1 1 
ATOM   6581  C CG2 . VAL C 1 208 ? -30.052 -0.752  -1.757  1.00 18.30 ? 208 VAL C CG2 1 
ATOM   6582  N N   . THR C 1 209 ? -33.771 -1.784  1.039   1.00 19.31 ? 209 THR C N   1 
ATOM   6583  C CA  . THR C 1 209 ? -34.976 -2.499  1.504   1.00 19.97 ? 209 THR C CA  1 
ATOM   6584  C C   . THR C 1 209 ? -34.537 -3.043  2.873   1.00 20.51 ? 209 THR C C   1 
ATOM   6585  O O   . THR C 1 209 ? -35.290 -2.949  3.844   1.00 20.75 ? 209 THR C O   1 
ATOM   6586  C CB  . THR C 1 209 ? -35.577 -3.563  0.561   1.00 19.96 ? 209 THR C CB  1 
ATOM   6587  O OG1 . THR C 1 209 ? -36.011 -2.831  -0.640  1.00 20.09 ? 209 THR C OG1 1 
ATOM   6588  C CG2 . THR C 1 209 ? -36.744 -4.376  1.168   1.00 19.99 ? 209 THR C CG2 1 
ATOM   6589  N N   . LEU C 1 210 ? -33.280 -3.477  2.880   1.00 20.96 ? 210 LEU C N   1 
ATOM   6590  C CA  . LEU C 1 210 ? -32.609 -3.887  4.136   1.00 21.36 ? 210 LEU C CA  1 
ATOM   6591  C C   . LEU C 1 210 ? -32.494 -2.548  4.890   1.00 21.68 ? 210 LEU C C   1 
ATOM   6592  O O   . LEU C 1 210 ? -33.499 -1.784  4.939   1.00 21.60 ? 210 LEU C O   1 
ATOM   6593  C CB  . LEU C 1 210 ? -31.326 -4.612  3.827   1.00 21.33 ? 210 LEU C CB  1 
ATOM   6594  C CG  . LEU C 1 210 ? -30.585 -5.539  4.749   1.00 21.26 ? 210 LEU C CG  1 
ATOM   6595  C CD1 . LEU C 1 210 ? -29.111 -5.690  4.331   1.00 21.12 ? 210 LEU C CD1 1 
ATOM   6596  C CD2 . LEU C 1 210 ? -30.602 -5.062  6.196   1.00 21.25 ? 210 LEU C CD2 1 
ATOM   6597  N N   . LYS C 1 211 ? -31.277 -2.221  5.319   1.00 22.04 ? 211 LYS C N   1 
ATOM   6598  C CA  . LYS C 1 211 ? -31.147 -0.956  6.070   1.00 22.39 ? 211 LYS C CA  1 
ATOM   6599  C C   . LYS C 1 211 ? -31.011 0.189   5.078   1.00 22.75 ? 211 LYS C C   1 
ATOM   6600  O O   . LYS C 1 211 ? -29.972 0.471   4.511   1.00 23.00 ? 211 LYS C O   1 
ATOM   6601  C CB  . LYS C 1 211 ? -30.123 -0.959  7.153   1.00 22.40 ? 211 LYS C CB  1 
ATOM   6602  C CG  . LYS C 1 211 ? -30.744 -1.655  8.402   1.00 22.51 ? 211 LYS C CG  1 
ATOM   6603  C CD  . LYS C 1 211 ? -30.121 -1.047  9.664   1.00 22.63 ? 211 LYS C CD  1 
ATOM   6604  C CE  . LYS C 1 211 ? -31.078 -1.224  10.834  1.00 22.64 ? 211 LYS C CE  1 
ATOM   6605  N NZ  . LYS C 1 211 ? -32.361 -0.506  10.560  1.00 22.48 ? 211 LYS C NZ  1 
ATOM   6606  N N   . SER C 1 212 ? -32.197 0.617   4.729   1.00 23.04 ? 212 SER C N   1 
ATOM   6607  C CA  . SER C 1 212 ? -32.465 1.847   3.914   1.00 23.20 ? 212 SER C CA  1 
ATOM   6608  C C   . SER C 1 212 ? -32.702 2.872   5.011   1.00 23.74 ? 212 SER C C   1 
ATOM   6609  O O   . SER C 1 212 ? -33.250 2.391   6.062   1.00 24.01 ? 212 SER C O   1 
ATOM   6610  C CB  . SER C 1 212 ? -33.606 1.507   3.021   1.00 22.78 ? 212 SER C CB  1 
ATOM   6611  O OG  . SER C 1 212 ? -34.274 2.528   2.402   1.00 22.55 ? 212 SER C OG  1 
ATOM   6612  N N   . LEU C 1 213 ? -32.222 4.097   4.982   1.00 24.10 ? 213 LEU C N   1 
ATOM   6613  C CA  . LEU C 1 213 ? -32.463 4.976   6.166   1.00 24.49 ? 213 LEU C CA  1 
ATOM   6614  C C   . LEU C 1 213 ? -33.931 5.366   6.251   1.00 24.83 ? 213 LEU C C   1 
ATOM   6615  O O   . LEU C 1 213 ? -34.412 5.866   7.293   1.00 24.88 ? 213 LEU C O   1 
ATOM   6616  C CB  . LEU C 1 213 ? -31.452 6.105   6.188   1.00 24.42 ? 213 LEU C CB  1 
ATOM   6617  C CG  . LEU C 1 213 ? -30.256 6.027   7.120   1.00 24.29 ? 213 LEU C CG  1 
ATOM   6618  C CD1 . LEU C 1 213 ? -30.681 6.066   8.578   1.00 24.11 ? 213 LEU C CD1 1 
ATOM   6619  C CD2 . LEU C 1 213 ? -29.490 4.728   6.841   1.00 24.41 ? 213 LEU C CD2 1 
ATOM   6620  N N   . ASN C 1 214 ? -34.638 5.031   5.208   1.00 25.25 ? 214 ASN C N   1 
ATOM   6621  C CA  . ASN C 1 214 ? -36.055 5.354   4.989   1.00 25.71 ? 214 ASN C CA  1 
ATOM   6622  C C   . ASN C 1 214 ? -37.036 4.620   5.890   1.00 26.03 ? 214 ASN C C   1 
ATOM   6623  O O   . ASN C 1 214 ? -37.950 5.251   6.456   1.00 26.02 ? 214 ASN C O   1 
ATOM   6624  C CB  . ASN C 1 214 ? -36.321 5.161   3.485   1.00 25.65 ? 214 ASN C CB  1 
ATOM   6625  C CG  . ASN C 1 214 ? -37.090 6.198   2.739   1.00 25.63 ? 214 ASN C CG  1 
ATOM   6626  O OD1 . ASN C 1 214 ? -37.777 5.861   1.737   1.00 25.54 ? 214 ASN C OD1 1 
ATOM   6627  N ND2 . ASN C 1 214 ? -36.972 7.483   3.096   1.00 25.62 ? 214 ASN C ND2 1 
ATOM   6628  N N   . PRO C 1 215 ? -36.938 3.307   5.993   1.00 26.28 ? 215 PRO C N   1 
ATOM   6629  C CA  . PRO C 1 215 ? -37.826 2.472   6.783   1.00 26.39 ? 215 PRO C CA  1 
ATOM   6630  C C   . PRO C 1 215 ? -37.914 2.853   8.235   1.00 26.58 ? 215 PRO C C   1 
ATOM   6631  O O   . PRO C 1 215 ? -38.855 2.344   8.897   1.00 26.75 ? 215 PRO C O   1 
ATOM   6632  C CB  . PRO C 1 215 ? -37.258 1.052   6.652   1.00 26.39 ? 215 PRO C CB  1 
ATOM   6633  C CG  . PRO C 1 215 ? -35.781 1.345   6.432   1.00 26.34 ? 215 PRO C CG  1 
ATOM   6634  C CD  . PRO C 1 215 ? -35.888 2.474   5.361   1.00 26.32 ? 215 PRO C CD  1 
ATOM   6635  N N   . ALA C 1 216 ? -36.969 3.606   8.731   1.00 26.76 ? 216 ALA C N   1 
ATOM   6636  C CA  . ALA C 1 216 ? -37.020 3.986   10.175  1.00 27.15 ? 216 ALA C CA  1 
ATOM   6637  C C   . ALA C 1 216 ? -37.347 5.471   10.229  1.00 27.53 ? 216 ALA C C   1 
ATOM   6638  O O   . ALA C 1 216 ? -37.770 6.035   11.252  1.00 27.57 ? 216 ALA C O   1 
ATOM   6639  C CB  . ALA C 1 216 ? -35.780 3.520   10.882  1.00 27.10 ? 216 ALA C CB  1 
ATOM   6640  N N   . ILE C 1 217 ? -37.184 6.097   9.085   1.00 27.96 ? 217 ILE C N   1 
ATOM   6641  C CA  . ILE C 1 217 ? -37.537 7.469   8.781   1.00 28.42 ? 217 ILE C CA  1 
ATOM   6642  C C   . ILE C 1 217 ? -37.725 8.444   9.896   1.00 28.86 ? 217 ILE C C   1 
ATOM   6643  O O   . ILE C 1 217 ? -38.888 8.829   10.202  1.00 29.13 ? 217 ILE C O   1 
ATOM   6644  C CB  . ILE C 1 217 ? -38.877 7.377   7.898   1.00 28.38 ? 217 ILE C CB  1 
ATOM   6645  C CG1 . ILE C 1 217 ? -39.217 8.706   7.245   1.00 28.20 ? 217 ILE C CG1 1 
ATOM   6646  C CG2 . ILE C 1 217 ? -40.081 6.774   8.689   1.00 28.32 ? 217 ILE C CG2 1 
ATOM   6647  C CD1 . ILE C 1 217 ? -40.340 8.654   6.157   1.00 28.18 ? 217 ILE C CD1 1 
ATOM   6648  N N   . GLY C 1 218 ? -36.662 8.979   10.490  1.00 29.27 ? 218 GLY C N   1 
ATOM   6649  C CA  . GLY C 1 218 ? -36.855 10.147  11.452  1.00 29.74 ? 218 GLY C CA  1 
ATOM   6650  C C   . GLY C 1 218 ? -37.083 11.349  10.478  1.00 30.14 ? 218 GLY C C   1 
ATOM   6651  O O   . GLY C 1 218 ? -36.781 12.529  10.611  1.00 30.18 ? 218 GLY C O   1 
ATOM   6652  N N   . THR C 1 219 ? -37.566 10.977  9.352   1.00 30.44 ? 219 THR C N   1 
ATOM   6653  C CA  . THR C 1 219 ? -37.923 11.400  8.068   1.00 30.52 ? 219 THR C CA  1 
ATOM   6654  C C   . THR C 1 219 ? -36.646 11.202  7.196   1.00 30.67 ? 219 THR C C   1 
ATOM   6655  O O   . THR C 1 219 ? -36.195 10.046  7.102   1.00 30.62 ? 219 THR C O   1 
ATOM   6656  C CB  . THR C 1 219 ? -38.681 12.728  7.819   1.00 30.35 ? 219 THR C CB  1 
ATOM   6657  O OG1 . THR C 1 219 ? -40.103 12.394  8.144   1.00 30.27 ? 219 THR C OG1 1 
ATOM   6658  C CG2 . THR C 1 219 ? -38.638 13.265  6.392   1.00 30.25 ? 219 THR C CG2 1 
ATOM   6659  N N   . ASP C 1 220 ? -36.079 12.254  6.785   1.00 30.93 ? 220 ASP C N   1 
ATOM   6660  C CA  . ASP C 1 220 ? -34.961 12.394  5.873   1.00 31.35 ? 220 ASP C CA  1 
ATOM   6661  C C   . ASP C 1 220 ? -35.600 13.170  4.678   1.00 31.62 ? 220 ASP C C   1 
ATOM   6662  O O   . ASP C 1 220 ? -36.125 12.582  3.748   1.00 31.72 ? 220 ASP C O   1 
ATOM   6663  C CB  . ASP C 1 220 ? -34.243 11.143  5.491   1.00 31.36 ? 220 ASP C CB  1 
ATOM   6664  C CG  . ASP C 1 220 ? -33.346 10.536  6.544   1.00 31.45 ? 220 ASP C CG  1 
ATOM   6665  O OD1 . ASP C 1 220 ? -33.790 9.797   7.444   1.00 31.57 ? 220 ASP C OD1 1 
ATOM   6666  O OD2 . ASP C 1 220 ? -32.126 10.769  6.447   1.00 31.32 ? 220 ASP C OD2 1 
ATOM   6667  N N   . LYS C 1 221 ? -35.623 14.470  4.906   1.00 31.83 ? 221 LYS C N   1 
ATOM   6668  C CA  . LYS C 1 221 ? -36.212 15.492  4.048   1.00 31.88 ? 221 LYS C CA  1 
ATOM   6669  C C   . LYS C 1 221 ? -37.396 16.140  4.804   1.00 31.92 ? 221 LYS C C   1 
ATOM   6670  O O   . LYS C 1 221 ? -37.204 17.122  5.552   1.00 31.88 ? 221 LYS C O   1 
ATOM   6671  C CB  . LYS C 1 221 ? -36.613 15.028  2.679   1.00 31.93 ? 221 LYS C CB  1 
ATOM   6672  C CG  . LYS C 1 221 ? -37.723 15.721  1.932   1.00 32.13 ? 221 LYS C CG  1 
ATOM   6673  C CD  . LYS C 1 221 ? -37.261 16.841  1.036   1.00 32.29 ? 221 LYS C CD  1 
ATOM   6674  C CE  . LYS C 1 221 ? -36.510 16.290  -0.185  1.00 32.42 ? 221 LYS C CE  1 
ATOM   6675  N NZ  . LYS C 1 221 ? -37.388 15.293  -0.871  1.00 32.31 ? 221 LYS C NZ  1 
ATOM   6676  N N   . ASN C 1 222 ? -38.550 15.562  4.645   1.00 31.79 ? 222 ASN C N   1 
ATOM   6677  C CA  . ASN C 1 222 ? -39.856 15.950  5.147   1.00 31.76 ? 222 ASN C CA  1 
ATOM   6678  C C   . ASN C 1 222 ? -39.892 16.149  6.651   1.00 31.68 ? 222 ASN C C   1 
ATOM   6679  O O   . ASN C 1 222 ? -40.940 16.076  7.321   1.00 31.50 ? 222 ASN C O   1 
ATOM   6680  C CB  . ASN C 1 222 ? -40.892 14.939  4.614   1.00 31.82 ? 222 ASN C CB  1 
ATOM   6681  C CG  . ASN C 1 222 ? -42.347 15.169  4.939   1.00 31.72 ? 222 ASN C CG  1 
ATOM   6682  O OD1 . ASN C 1 222 ? -42.944 14.401  5.734   1.00 31.64 ? 222 ASN C OD1 1 
ATOM   6683  N ND2 . ASN C 1 222 ? -42.965 16.172  4.311   1.00 31.56 ? 222 ASN C ND2 1 
ATOM   6684  N N   . LYS C 1 223 ? -38.746 16.423  7.202   1.00 31.77 ? 223 LYS C N   1 
ATOM   6685  C CA  . LYS C 1 223 ? -38.374 16.758  8.527   1.00 31.88 ? 223 LYS C CA  1 
ATOM   6686  C C   . LYS C 1 223 ? -37.338 15.828  9.193   1.00 31.90 ? 223 LYS C C   1 
ATOM   6687  O O   . LYS C 1 223 ? -36.545 15.025  8.697   1.00 31.75 ? 223 LYS C O   1 
ATOM   6688  C CB  . LYS C 1 223 ? -39.583 16.898  9.485   1.00 31.92 ? 223 LYS C CB  1 
ATOM   6689  C CG  . LYS C 1 223 ? -40.403 18.135  9.381   1.00 32.11 ? 223 LYS C CG  1 
ATOM   6690  C CD  . LYS C 1 223 ? -39.659 19.454  9.482   1.00 32.22 ? 223 LYS C CD  1 
ATOM   6691  C CE  . LYS C 1 223 ? -39.115 19.926  8.133   1.00 32.29 ? 223 LYS C CE  1 
ATOM   6692  N NZ  . LYS C 1 223 ? -39.334 21.399  7.975   1.00 32.32 ? 223 LYS C NZ  1 
ATOM   6693  N N   . GLN C 1 224 ? -37.295 16.064  10.478  1.00 31.83 ? 224 GLN C N   1 
ATOM   6694  C CA  . GLN C 1 224 ? -36.613 15.649  11.626  1.00 31.46 ? 224 GLN C CA  1 
ATOM   6695  C C   . GLN C 1 224 ? -35.135 15.319  11.374  1.00 31.15 ? 224 GLN C C   1 
ATOM   6696  O O   . GLN C 1 224 ? -34.642 14.224  11.390  1.00 31.09 ? 224 GLN C O   1 
ATOM   6697  C CB  . GLN C 1 224 ? -37.359 14.625  12.487  1.00 31.51 ? 224 GLN C CB  1 
ATOM   6698  C CG  . GLN C 1 224 ? -37.984 15.387  13.677  1.00 31.60 ? 224 GLN C CG  1 
ATOM   6699  C CD  . GLN C 1 224 ? -36.945 15.642  14.754  1.00 31.74 ? 224 GLN C CD  1 
ATOM   6700  O OE1 . GLN C 1 224 ? -35.755 15.315  14.634  1.00 31.80 ? 224 GLN C OE1 1 
ATOM   6701  N NE2 . GLN C 1 224 ? -37.426 16.173  15.873  1.00 31.65 ? 224 GLN C NE2 1 
ATOM   6702  N N   . HIS C 1 225 ? -34.493 16.452  11.190  1.00 30.83 ? 225 HIS C N   1 
ATOM   6703  C CA  . HIS C 1 225 ? -33.094 16.765  11.028  1.00 30.32 ? 225 HIS C CA  1 
ATOM   6704  C C   . HIS C 1 225 ? -32.327 15.658  10.347  1.00 29.89 ? 225 HIS C C   1 
ATOM   6705  O O   . HIS C 1 225 ? -32.243 14.542  10.867  1.00 30.07 ? 225 HIS C O   1 
ATOM   6706  C CB  . HIS C 1 225 ? -32.441 17.135  12.407  1.00 30.38 ? 225 HIS C CB  1 
ATOM   6707  C CG  . HIS C 1 225 ? -33.381 18.027  13.186  1.00 30.60 ? 225 HIS C CG  1 
ATOM   6708  N ND1 . HIS C 1 225 ? -34.577 17.574  13.724  1.00 30.67 ? 225 HIS C ND1 1 
ATOM   6709  C CD2 . HIS C 1 225 ? -33.340 19.339  13.480  1.00 30.62 ? 225 HIS C CD2 1 
ATOM   6710  C CE1 . HIS C 1 225 ? -35.194 18.565  14.328  1.00 30.55 ? 225 HIS C CE1 1 
ATOM   6711  N NE2 . HIS C 1 225 ? -34.465 19.639  14.208  1.00 30.55 ? 225 HIS C NE2 1 
ATOM   6712  N N   . TRP C 1 226 ? -31.795 15.972  9.205   1.00 29.11 ? 226 TRP C N   1 
ATOM   6713  C CA  . TRP C 1 226 ? -31.026 15.110  8.323   1.00 28.44 ? 226 TRP C CA  1 
ATOM   6714  C C   . TRP C 1 226 ? -30.869 15.952  7.035   1.00 28.25 ? 226 TRP C C   1 
ATOM   6715  O O   . TRP C 1 226 ? -29.867 15.804  6.340   1.00 28.51 ? 226 TRP C O   1 
ATOM   6716  C CB  . TRP C 1 226 ? -31.565 13.740  8.021   1.00 28.06 ? 226 TRP C CB  1 
ATOM   6717  C CG  . TRP C 1 226 ? -31.385 12.631  8.985   1.00 27.67 ? 226 TRP C CG  1 
ATOM   6718  C CD1 . TRP C 1 226 ? -32.359 12.019  9.733   1.00 27.54 ? 226 TRP C CD1 1 
ATOM   6719  C CD2 . TRP C 1 226 ? -30.159 11.961  9.336   1.00 27.49 ? 226 TRP C CD2 1 
ATOM   6720  N NE1 . TRP C 1 226 ? -31.809 11.078  10.563  1.00 27.46 ? 226 TRP C NE1 1 
ATOM   6721  C CE2 . TRP C 1 226 ? -30.467 10.996  10.309  1.00 27.36 ? 226 TRP C CE2 1 
ATOM   6722  C CE3 . TRP C 1 226 ? -28.843 12.107  8.914   1.00 27.46 ? 226 TRP C CE3 1 
ATOM   6723  C CZ2 . TRP C 1 226 ? -29.506 10.180  10.875  1.00 27.30 ? 226 TRP C CZ2 1 
ATOM   6724  C CZ3 . TRP C 1 226 ? -27.895 11.270  9.468   1.00 27.48 ? 226 TRP C CZ3 1 
ATOM   6725  C CH2 . TRP C 1 226 ? -28.214 10.313  10.427  1.00 27.34 ? 226 TRP C CH2 1 
ATOM   6726  N N   . LYS C 1 227 ? -31.872 16.797  6.831   1.00 27.85 ? 227 LYS C N   1 
ATOM   6727  C CA  . LYS C 1 227 ? -31.826 17.735  5.685   1.00 27.49 ? 227 LYS C CA  1 
ATOM   6728  C C   . LYS C 1 227 ? -30.468 18.473  5.829   1.00 27.07 ? 227 LYS C C   1 
ATOM   6729  O O   . LYS C 1 227 ? -29.710 18.714  4.900   1.00 27.00 ? 227 LYS C O   1 
ATOM   6730  C CB  . LYS C 1 227 ? -32.907 18.760  5.624   1.00 27.70 ? 227 LYS C CB  1 
ATOM   6731  C CG  . LYS C 1 227 ? -33.565 19.350  6.822   1.00 27.86 ? 227 LYS C CG  1 
ATOM   6732  C CD  . LYS C 1 227 ? -32.817 19.517  8.088   1.00 28.06 ? 227 LYS C CD  1 
ATOM   6733  C CE  . LYS C 1 227 ? -32.078 20.783  8.363   1.00 28.09 ? 227 LYS C CE  1 
ATOM   6734  N NZ  . LYS C 1 227 ? -31.529 20.886  9.732   1.00 28.09 ? 227 LYS C NZ  1 
ATOM   6735  N N   . ASN C 1 228 ? -30.234 18.693  7.127   1.00 26.46 ? 228 ASN C N   1 
ATOM   6736  C CA  . ASN C 1 228 ? -29.065 19.417  7.554   1.00 25.79 ? 228 ASN C CA  1 
ATOM   6737  C C   . ASN C 1 228 ? -27.818 18.677  7.091   1.00 25.09 ? 228 ASN C C   1 
ATOM   6738  O O   . ASN C 1 228 ? -26.912 19.425  6.684   1.00 25.27 ? 228 ASN C O   1 
ATOM   6739  C CB  . ASN C 1 228 ? -29.010 19.745  9.035   1.00 26.15 ? 228 ASN C CB  1 
ATOM   6740  C CG  . ASN C 1 228 ? -28.661 21.232  9.198   1.00 26.40 ? 228 ASN C CG  1 
ATOM   6741  O OD1 . ASN C 1 228 ? -29.041 21.808  10.225  1.00 26.54 ? 228 ASN C OD1 1 
ATOM   6742  N ND2 . ASN C 1 228 ? -28.058 21.828  8.165   1.00 26.51 ? 228 ASN C ND2 1 
ATOM   6743  N N   . VAL C 1 229 ? -27.815 17.364  7.168   1.00 24.02 ? 229 VAL C N   1 
ATOM   6744  C CA  . VAL C 1 229 ? -26.584 16.665  6.676   1.00 23.16 ? 229 VAL C CA  1 
ATOM   6745  C C   . VAL C 1 229 ? -26.311 17.267  5.276   1.00 22.44 ? 229 VAL C C   1 
ATOM   6746  O O   . VAL C 1 229 ? -25.211 17.774  4.993   1.00 22.29 ? 229 VAL C O   1 
ATOM   6747  C CB  . VAL C 1 229 ? -26.691 15.161  6.760   1.00 23.21 ? 229 VAL C CB  1 
ATOM   6748  C CG1 . VAL C 1 229 ? -27.180 14.482  5.476   1.00 23.33 ? 229 VAL C CG1 1 
ATOM   6749  C CG2 . VAL C 1 229 ? -25.385 14.493  7.191   1.00 23.15 ? 229 VAL C CG2 1 
ATOM   6750  N N   . HIS C 1 230 ? -27.419 17.376  4.550   1.00 21.45 ? 230 HIS C N   1 
ATOM   6751  C CA  . HIS C 1 230 ? -27.361 17.927  3.199   1.00 20.73 ? 230 HIS C CA  1 
ATOM   6752  C C   . HIS C 1 230 ? -27.027 19.418  3.170   1.00 20.28 ? 230 HIS C C   1 
ATOM   6753  O O   . HIS C 1 230 ? -26.309 19.895  2.257   1.00 19.94 ? 230 HIS C O   1 
ATOM   6754  C CB  . HIS C 1 230 ? -28.657 17.658  2.403   1.00 20.66 ? 230 HIS C CB  1 
ATOM   6755  C CG  . HIS C 1 230 ? -28.421 18.138  0.997   1.00 20.52 ? 230 HIS C CG  1 
ATOM   6756  N ND1 . HIS C 1 230 ? -27.362 17.691  0.263   1.00 20.49 ? 230 HIS C ND1 1 
ATOM   6757  C CD2 . HIS C 1 230 ? -29.008 19.121  0.299   1.00 20.57 ? 230 HIS C CD2 1 
ATOM   6758  C CE1 . HIS C 1 230 ? -27.354 18.335  -0.894  1.00 20.57 ? 230 HIS C CE1 1 
ATOM   6759  N NE2 . HIS C 1 230 ? -28.311 19.236  -0.869  1.00 20.55 ? 230 HIS C NE2 1 
ATOM   6760  N N   . LYS C 1 231 ? -27.601 20.149  4.108   1.00 19.84 ? 231 LYS C N   1 
ATOM   6761  C CA  . LYS C 1 231 ? -27.332 21.599  4.173   1.00 19.51 ? 231 LYS C CA  1 
ATOM   6762  C C   . LYS C 1 231 ? -25.902 21.829  4.650   1.00 19.05 ? 231 LYS C C   1 
ATOM   6763  O O   . LYS C 1 231 ? -25.262 22.823  4.278   1.00 19.11 ? 231 LYS C O   1 
ATOM   6764  C CB  . LYS C 1 231 ? -28.313 22.395  4.994   1.00 19.62 ? 231 LYS C CB  1 
ATOM   6765  C CG  . LYS C 1 231 ? -29.478 22.885  4.097   1.00 19.72 ? 231 LYS C CG  1 
ATOM   6766  C CD  . LYS C 1 231 ? -30.583 23.549  4.861   1.00 20.04 ? 231 LYS C CD  1 
ATOM   6767  C CE  . LYS C 1 231 ? -31.116 22.781  6.047   1.00 20.20 ? 231 LYS C CE  1 
ATOM   6768  N NZ  . LYS C 1 231 ? -30.840 21.317  5.906   1.00 20.29 ? 231 LYS C NZ  1 
ATOM   6769  N N   . GLN C 1 232 ? -25.448 20.890  5.421   1.00 18.41 ? 232 GLN C N   1 
ATOM   6770  C CA  . GLN C 1 232 ? -24.125 20.835  6.004   1.00 17.83 ? 232 GLN C CA  1 
ATOM   6771  C C   . GLN C 1 232 ? -23.148 20.483  4.883   1.00 17.41 ? 232 GLN C C   1 
ATOM   6772  O O   . GLN C 1 232 ? -22.036 21.003  4.884   1.00 17.50 ? 232 GLN C O   1 
ATOM   6773  C CB  . GLN C 1 232 ? -24.034 19.808  7.120   1.00 18.00 ? 232 GLN C CB  1 
ATOM   6774  C CG  . GLN C 1 232 ? -22.759 19.956  7.953   1.00 18.34 ? 232 GLN C CG  1 
ATOM   6775  C CD  . GLN C 1 232 ? -22.992 19.374  9.323   1.00 18.70 ? 232 GLN C CD  1 
ATOM   6776  O OE1 . GLN C 1 232 ? -23.980 19.708  9.987   1.00 18.89 ? 232 GLN C OE1 1 
ATOM   6777  N NE2 . GLN C 1 232 ? -22.131 18.442  9.733   1.00 18.97 ? 232 GLN C NE2 1 
ATOM   6778  N N   . VAL C 1 233 ? -23.616 19.623  4.005   1.00 16.84 ? 233 VAL C N   1 
ATOM   6779  C CA  . VAL C 1 233 ? -22.809 19.177  2.860   1.00 16.33 ? 233 VAL C CA  1 
ATOM   6780  C C   . VAL C 1 233 ? -22.422 20.391  2.027   1.00 15.98 ? 233 VAL C C   1 
ATOM   6781  O O   . VAL C 1 233 ? -21.242 20.774  2.003   1.00 16.03 ? 233 VAL C O   1 
ATOM   6782  C CB  . VAL C 1 233 ? -23.551 18.101  2.074   1.00 16.45 ? 233 VAL C CB  1 
ATOM   6783  C CG1 . VAL C 1 233 ? -23.069 17.919  0.644   1.00 16.46 ? 233 VAL C CG1 1 
ATOM   6784  C CG2 . VAL C 1 233 ? -23.504 16.763  2.818   1.00 16.53 ? 233 VAL C CG2 1 
ATOM   6785  N N   . VAL C 1 234 ? -23.426 20.905  1.353   1.00 15.63 ? 234 VAL C N   1 
ATOM   6786  C CA  . VAL C 1 234 ? -23.271 22.100  0.487   1.00 15.29 ? 234 VAL C CA  1 
ATOM   6787  C C   . VAL C 1 234 ? -22.521 23.193  1.225   1.00 15.10 ? 234 VAL C C   1 
ATOM   6788  O O   . VAL C 1 234 ? -21.344 23.456  0.839   1.00 15.21 ? 234 VAL C O   1 
ATOM   6789  C CB  . VAL C 1 234 ? -24.637 22.483  -0.095  1.00 15.20 ? 234 VAL C CB  1 
ATOM   6790  C CG1 . VAL C 1 234 ? -25.705 22.607  0.984   1.00 15.23 ? 234 VAL C CG1 1 
ATOM   6791  C CG2 . VAL C 1 234 ? -24.568 23.734  -0.946  1.00 15.19 ? 234 VAL C CG2 1 
ATOM   6792  N N   . GLU C 1 235 ? -23.105 23.806  2.211   1.00 14.86 ? 235 GLU C N   1 
ATOM   6793  C CA  . GLU C 1 235 ? -22.402 24.832  3.003   1.00 15.04 ? 235 GLU C CA  1 
ATOM   6794  C C   . GLU C 1 235 ? -20.939 24.429  3.220   1.00 15.10 ? 235 GLU C C   1 
ATOM   6795  O O   . GLU C 1 235 ? -19.991 25.190  3.022   1.00 14.85 ? 235 GLU C O   1 
ATOM   6796  C CB  . GLU C 1 235 ? -23.028 25.069  4.347   1.00 15.16 ? 235 GLU C CB  1 
ATOM   6797  C CG  . GLU C 1 235 ? -24.008 26.189  4.629   1.00 15.37 ? 235 GLU C CG  1 
ATOM   6798  C CD  . GLU C 1 235 ? -23.453 27.497  5.097   1.00 15.53 ? 235 GLU C CD  1 
ATOM   6799  O OE1 . GLU C 1 235 ? -24.022 28.581  4.981   1.00 15.57 ? 235 GLU C OE1 1 
ATOM   6800  O OE2 . GLU C 1 235 ? -22.345 27.376  5.690   1.00 15.64 ? 235 GLU C OE2 1 
ATOM   6801  N N   . GLY C 1 236 ? -20.765 23.182  3.585   1.00 15.44 ? 236 GLY C N   1 
ATOM   6802  C CA  . GLY C 1 236 ? -19.515 22.519  3.894   1.00 15.80 ? 236 GLY C CA  1 
ATOM   6803  C C   . GLY C 1 236 ? -18.409 22.820  2.897   1.00 16.12 ? 236 GLY C C   1 
ATOM   6804  O O   . GLY C 1 236 ? -17.199 22.838  3.249   1.00 16.17 ? 236 GLY C O   1 
ATOM   6805  N N   . GLY C 1 237 ? -18.824 23.082  1.664   1.00 16.14 ? 237 GLY C N   1 
ATOM   6806  C CA  . GLY C 1 237 ? -17.792 23.337  0.602   1.00 16.06 ? 237 GLY C CA  1 
ATOM   6807  C C   . GLY C 1 237 ? -17.205 24.724  0.887   1.00 15.87 ? 237 GLY C C   1 
ATOM   6808  O O   . GLY C 1 237 ? -16.021 24.945  0.787   1.00 15.62 ? 237 GLY C O   1 
ATOM   6809  N N   . TYR C 1 238 ? -18.136 25.576  1.287   1.00 16.06 ? 238 TYR C N   1 
ATOM   6810  C CA  . TYR C 1 238 ? -17.900 27.004  1.521   1.00 16.04 ? 238 TYR C CA  1 
ATOM   6811  C C   . TYR C 1 238 ? -17.069 27.280  2.746   1.00 16.34 ? 238 TYR C C   1 
ATOM   6812  O O   . TYR C 1 238 ? -15.995 27.886  2.603   1.00 16.40 ? 238 TYR C O   1 
ATOM   6813  C CB  . TYR C 1 238 ? -19.251 27.790  1.485   1.00 15.41 ? 238 TYR C CB  1 
ATOM   6814  C CG  . TYR C 1 238 ? -19.839 27.866  0.090   1.00 14.87 ? 238 TYR C CG  1 
ATOM   6815  C CD1 . TYR C 1 238 ? -19.030 28.235  -0.995  1.00 14.80 ? 238 TYR C CD1 1 
ATOM   6816  C CD2 . TYR C 1 238 ? -21.168 27.611  -0.183  1.00 14.67 ? 238 TYR C CD2 1 
ATOM   6817  C CE1 . TYR C 1 238 ? -19.519 28.291  -2.281  1.00 14.56 ? 238 TYR C CE1 1 
ATOM   6818  C CE2 . TYR C 1 238 ? -21.677 27.659  -1.476  1.00 14.56 ? 238 TYR C CE2 1 
ATOM   6819  C CZ  . TYR C 1 238 ? -20.854 28.022  -2.529  1.00 14.46 ? 238 TYR C CZ  1 
ATOM   6820  O OH  . TYR C 1 238 ? -21.349 28.105  -3.799  1.00 14.29 ? 238 TYR C OH  1 
ATOM   6821  N N   . GLU C 1 239 ? -17.463 26.765  3.876   1.00 16.80 ? 239 GLU C N   1 
ATOM   6822  C CA  . GLU C 1 239 ? -16.818 26.936  5.155   1.00 17.23 ? 239 GLU C CA  1 
ATOM   6823  C C   . GLU C 1 239 ? -15.326 26.640  5.151   1.00 17.29 ? 239 GLU C C   1 
ATOM   6824  O O   . GLU C 1 239 ? -14.557 27.253  5.933   1.00 17.36 ? 239 GLU C O   1 
ATOM   6825  C CB  . GLU C 1 239 ? -17.416 25.995  6.226   1.00 17.53 ? 239 GLU C CB  1 
ATOM   6826  C CG  . GLU C 1 239 ? -17.238 26.509  7.653   1.00 18.05 ? 239 GLU C CG  1 
ATOM   6827  C CD  . GLU C 1 239 ? -18.317 27.426  8.139   1.00 18.46 ? 239 GLU C CD  1 
ATOM   6828  O OE1 . GLU C 1 239 ? -19.044 28.111  7.422   1.00 18.66 ? 239 GLU C OE1 1 
ATOM   6829  O OE2 . GLU C 1 239 ? -18.410 27.376  9.394   1.00 18.68 ? 239 GLU C OE2 1 
ATOM   6830  N N   . VAL C 1 240 ? -14.928 25.678  4.331   1.00 17.16 ? 240 VAL C N   1 
ATOM   6831  C CA  . VAL C 1 240 ? -13.544 25.286  4.205   1.00 16.97 ? 240 VAL C CA  1 
ATOM   6832  C C   . VAL C 1 240 ? -12.677 26.498  3.777   1.00 16.84 ? 240 VAL C C   1 
ATOM   6833  O O   . VAL C 1 240 ? -11.672 26.847  4.395   1.00 16.88 ? 240 VAL C O   1 
ATOM   6834  C CB  . VAL C 1 240 ? -13.281 24.223  3.106   1.00 17.00 ? 240 VAL C CB  1 
ATOM   6835  C CG1 . VAL C 1 240 ? -11.962 23.512  3.348   1.00 16.89 ? 240 VAL C CG1 1 
ATOM   6836  C CG2 . VAL C 1 240 ? -14.439 23.292  2.871   1.00 17.42 ? 240 VAL C CG2 1 
ATOM   6837  N N   . LEU C 1 241 ? -13.094 26.936  2.591   1.00 16.55 ? 241 LEU C N   1 
ATOM   6838  C CA  . LEU C 1 241 ? -12.287 27.968  1.911   1.00 16.51 ? 241 LEU C CA  1 
ATOM   6839  C C   . LEU C 1 241 ? -12.237 29.189  2.805   1.00 16.60 ? 241 LEU C C   1 
ATOM   6840  O O   . LEU C 1 241 ? -11.118 29.703  3.045   1.00 16.83 ? 241 LEU C O   1 
ATOM   6841  C CB  . LEU C 1 241 ? -12.792 28.103  0.512   1.00 16.40 ? 241 LEU C CB  1 
ATOM   6842  C CG  . LEU C 1 241 ? -13.816 29.123  0.128   1.00 16.39 ? 241 LEU C CG  1 
ATOM   6843  C CD1 . LEU C 1 241 ? -13.339 30.552  0.371   1.00 16.34 ? 241 LEU C CD1 1 
ATOM   6844  C CD2 . LEU C 1 241 ? -14.097 28.943  -1.374  1.00 16.43 ? 241 LEU C CD2 1 
ATOM   6845  N N   . ASP C 1 242 ? -13.370 29.570  3.348   1.00 16.48 ? 242 ASP C N   1 
ATOM   6846  C CA  . ASP C 1 242 ? -13.420 30.775  4.200   1.00 16.58 ? 242 ASP C CA  1 
ATOM   6847  C C   . ASP C 1 242 ? -12.199 30.744  5.127   1.00 16.79 ? 242 ASP C C   1 
ATOM   6848  O O   . ASP C 1 242 ? -11.447 31.736  5.130   1.00 17.01 ? 242 ASP C O   1 
ATOM   6849  C CB  . ASP C 1 242 ? -14.726 30.971  4.918   1.00 16.54 ? 242 ASP C CB  1 
ATOM   6850  C CG  . ASP C 1 242 ? -15.945 31.300  4.084   1.00 16.46 ? 242 ASP C CG  1 
ATOM   6851  O OD1 . ASP C 1 242 ? -17.064 31.384  4.631   1.00 16.19 ? 242 ASP C OD1 1 
ATOM   6852  O OD2 . ASP C 1 242 ? -15.780 31.467  2.848   1.00 16.47 ? 242 ASP C OD2 1 
ATOM   6853  N N   . MET C 1 243 ? -11.858 29.556  5.573   1.00 17.01 ? 243 MET C N   1 
ATOM   6854  C CA  . MET C 1 243 ? -10.790 29.347  6.559   1.00 17.08 ? 243 MET C CA  1 
ATOM   6855  C C   . MET C 1 243 ? -9.376  29.081  6.114   1.00 16.92 ? 243 MET C C   1 
ATOM   6856  O O   . MET C 1 243 ? -8.442  29.762  6.660   1.00 17.04 ? 243 MET C O   1 
ATOM   6857  C CB  . MET C 1 243 ? -11.287 28.230  7.542   1.00 17.08 ? 243 MET C CB  1 
ATOM   6858  C CG  . MET C 1 243 ? -12.682 28.610  7.989   1.00 17.15 ? 243 MET C CG  1 
ATOM   6859  S SD  . MET C 1 243 ? -12.958 28.013  9.661   1.00 17.40 ? 243 MET C SD  1 
ATOM   6860  C CE  . MET C 1 243 ? -12.992 26.225  9.397   1.00 17.37 ? 243 MET C CE  1 
ATOM   6861  N N   . LYS C 1 244 ? -9.090  28.064  5.345   1.00 16.72 ? 244 LYS C N   1 
ATOM   6862  C CA  . LYS C 1 244 ? -7.675  27.807  4.932   1.00 16.53 ? 244 LYS C CA  1 
ATOM   6863  C C   . LYS C 1 244 ? -7.399  28.670  3.701   1.00 16.29 ? 244 LYS C C   1 
ATOM   6864  O O   . LYS C 1 244 ? -6.268  28.886  3.264   1.00 16.02 ? 244 LYS C O   1 
ATOM   6865  C CB  . LYS C 1 244 ? -7.382  26.348  4.719   1.00 16.65 ? 244 LYS C CB  1 
ATOM   6866  C CG  . LYS C 1 244 ? -8.098  25.682  3.541   1.00 16.76 ? 244 LYS C CG  1 
ATOM   6867  C CD  . LYS C 1 244 ? -7.782  24.214  3.467   1.00 16.88 ? 244 LYS C CD  1 
ATOM   6868  C CE  . LYS C 1 244 ? -6.475  23.902  2.768   1.00 17.01 ? 244 LYS C CE  1 
ATOM   6869  N NZ  . LYS C 1 244 ? -6.141  22.450  3.003   1.00 17.34 ? 244 LYS C NZ  1 
ATOM   6870  N N   . GLY C 1 245 ? -8.506  29.185  3.187   1.00 16.18 ? 245 GLY C N   1 
ATOM   6871  C CA  . GLY C 1 245 ? -8.540  30.050  2.016   1.00 16.07 ? 245 GLY C CA  1 
ATOM   6872  C C   . GLY C 1 245 ? -8.396  29.258  0.739   1.00 15.95 ? 245 GLY C C   1 
ATOM   6873  O O   . GLY C 1 245 ? -7.587  29.676  -0.114  1.00 16.25 ? 245 GLY C O   1 
ATOM   6874  N N   . TYR C 1 246 ? -9.044  28.123  0.645   1.00 15.71 ? 246 TYR C N   1 
ATOM   6875  C CA  . TYR C 1 246 ? -9.050  27.280  -0.548  1.00 15.51 ? 246 TYR C CA  1 
ATOM   6876  C C   . TYR C 1 246 ? -9.516  25.856  -0.178  1.00 15.26 ? 246 TYR C C   1 
ATOM   6877  O O   . TYR C 1 246 ? -9.625  25.479  0.991   1.00 15.28 ? 246 TYR C O   1 
ATOM   6878  C CB  . TYR C 1 246 ? -7.741  27.250  -1.320  1.00 15.68 ? 246 TYR C CB  1 
ATOM   6879  C CG  . TYR C 1 246 ? -6.516  26.666  -0.701  1.00 15.83 ? 246 TYR C CG  1 
ATOM   6880  C CD1 . TYR C 1 246 ? -6.221  25.299  -0.854  1.00 16.01 ? 246 TYR C CD1 1 
ATOM   6881  C CD2 . TYR C 1 246 ? -5.587  27.437  0.000   1.00 15.90 ? 246 TYR C CD2 1 
ATOM   6882  C CE1 . TYR C 1 246 ? -5.048  24.757  -0.338  1.00 16.04 ? 246 TYR C CE1 1 
ATOM   6883  C CE2 . TYR C 1 246 ? -4.424  26.898  0.551   1.00 15.89 ? 246 TYR C CE2 1 
ATOM   6884  C CZ  . TYR C 1 246 ? -4.153  25.555  0.358   1.00 16.02 ? 246 TYR C CZ  1 
ATOM   6885  O OH  . TYR C 1 246 ? -3.012  25.008  0.863   1.00 16.19 ? 246 TYR C OH  1 
ATOM   6886  N N   . THR C 1 247 ? -9.750  25.118  -1.235  1.00 14.70 ? 247 THR C N   1 
ATOM   6887  C CA  . THR C 1 247 ? -10.239 23.728  -1.233  1.00 14.15 ? 247 THR C CA  1 
ATOM   6888  C C   . THR C 1 247 ? -9.168  22.847  -1.833  1.00 13.56 ? 247 THR C C   1 
ATOM   6889  O O   . THR C 1 247 ? -9.071  22.788  -3.076  1.00 13.62 ? 247 THR C O   1 
ATOM   6890  C CB  . THR C 1 247 ? -11.617 23.754  -2.021  1.00 14.34 ? 247 THR C CB  1 
ATOM   6891  O OG1 . THR C 1 247 ? -12.231 22.430  -1.950  1.00 14.61 ? 247 THR C OG1 1 
ATOM   6892  C CG2 . THR C 1 247 ? -11.500 24.246  -3.474  1.00 14.25 ? 247 THR C CG2 1 
ATOM   6893  N N   . SER C 1 248 ? -8.373  22.150  -1.024  1.00 12.75 ? 248 SER C N   1 
ATOM   6894  C CA  . SER C 1 248 ? -7.232  21.370  -1.511  1.00 11.83 ? 248 SER C CA  1 
ATOM   6895  C C   . SER C 1 248 ? -7.251  19.866  -1.431  1.00 11.00 ? 248 SER C C   1 
ATOM   6896  O O   . SER C 1 248 ? -7.481  19.200  -2.436  1.00 11.00 ? 248 SER C O   1 
ATOM   6897  C CB  . SER C 1 248 ? -5.976  21.833  -0.709  1.00 11.98 ? 248 SER C CB  1 
ATOM   6898  O OG  . SER C 1 248 ? -6.369  21.677  0.659   1.00 12.09 ? 248 SER C OG  1 
ATOM   6899  N N   . TRP C 1 249 ? -6.856  19.289  -0.321  1.00 10.02 ? 249 TRP C N   1 
ATOM   6900  C CA  . TRP C 1 249 ? -6.704  17.874  -0.071  1.00 9.28  ? 249 TRP C CA  1 
ATOM   6901  C C   . TRP C 1 249 ? -7.818  16.995  -0.662  1.00 8.67  ? 249 TRP C C   1 
ATOM   6902  O O   . TRP C 1 249 ? -7.624  16.201  -1.601  1.00 8.38  ? 249 TRP C O   1 
ATOM   6903  C CB  . TRP C 1 249 ? -6.526  17.602  1.403   1.00 9.57  ? 249 TRP C CB  1 
ATOM   6904  C CG  . TRP C 1 249 ? -5.451  18.202  2.199   1.00 9.91  ? 249 TRP C CG  1 
ATOM   6905  C CD1 . TRP C 1 249 ? -5.441  18.288  3.580   1.00 10.00 ? 249 TRP C CD1 1 
ATOM   6906  C CD2 . TRP C 1 249 ? -4.217  18.807  1.787   1.00 10.01 ? 249 TRP C CD2 1 
ATOM   6907  N NE1 . TRP C 1 249 ? -4.300  18.904  4.021   1.00 10.08 ? 249 TRP C NE1 1 
ATOM   6908  C CE2 . TRP C 1 249 ? -3.529  19.228  2.940   1.00 10.04 ? 249 TRP C CE2 1 
ATOM   6909  C CE3 . TRP C 1 249 ? -3.635  19.011  0.545   1.00 10.04 ? 249 TRP C CE3 1 
ATOM   6910  C CZ2 . TRP C 1 249 ? -2.267  19.804  2.888   1.00 9.99  ? 249 TRP C CZ2 1 
ATOM   6911  C CZ3 . TRP C 1 249 ? -2.410  19.640  0.484   1.00 9.99  ? 249 TRP C CZ3 1 
ATOM   6912  C CH2 . TRP C 1 249 ? -1.728  20.014  1.637   1.00 9.99  ? 249 TRP C CH2 1 
ATOM   6913  N N   . ALA C 1 250 ? -8.967  17.064  -0.022  1.00 7.96  ? 250 ALA C N   1 
ATOM   6914  C CA  . ALA C 1 250 ? -10.179 16.313  -0.294  1.00 6.97  ? 250 ALA C CA  1 
ATOM   6915  C C   . ALA C 1 250 ? -10.564 16.303  -1.753  1.00 6.50  ? 250 ALA C C   1 
ATOM   6916  O O   . ALA C 1 250 ? -11.238 15.320  -2.162  1.00 6.33  ? 250 ALA C O   1 
ATOM   6917  C CB  . ALA C 1 250 ? -11.321 16.817  0.567   1.00 6.88  ? 250 ALA C CB  1 
ATOM   6918  N N   . ILE C 1 251 ? -10.206 17.359  -2.487  1.00 5.99  ? 251 ILE C N   1 
ATOM   6919  C CA  . ILE C 1 251 ? -10.548 17.306  -3.942  1.00 5.45  ? 251 ILE C CA  1 
ATOM   6920  C C   . ILE C 1 251 ? -9.588  16.316  -4.614  1.00 5.02  ? 251 ILE C C   1 
ATOM   6921  O O   . ILE C 1 251 ? -9.934  15.557  -5.531  1.00 4.84  ? 251 ILE C O   1 
ATOM   6922  C CB  . ILE C 1 251 ? -10.604 18.695  -4.605  1.00 5.41  ? 251 ILE C CB  1 
ATOM   6923  C CG1 . ILE C 1 251 ? -10.861 18.622  -6.130  1.00 5.62  ? 251 ILE C CG1 1 
ATOM   6924  C CG2 . ILE C 1 251 ? -9.319  19.540  -4.394  1.00 5.30  ? 251 ILE C CG2 1 
ATOM   6925  C CD1 . ILE C 1 251 ? -11.951 17.652  -6.629  1.00 5.83  ? 251 ILE C CD1 1 
ATOM   6926  N N   . GLY C 1 252 ? -8.396  16.326  -4.053  1.00 4.53  ? 252 GLY C N   1 
ATOM   6927  C CA  . GLY C 1 252 ? -7.254  15.571  -4.604  1.00 4.08  ? 252 GLY C CA  1 
ATOM   6928  C C   . GLY C 1 252 ? -7.584  14.090  -4.511  1.00 3.69  ? 252 GLY C C   1 
ATOM   6929  O O   . GLY C 1 252 ? -7.715  13.427  -5.527  1.00 3.74  ? 252 GLY C O   1 
ATOM   6930  N N   . LEU C 1 253 ? -7.734  13.693  -3.258  1.00 3.27  ? 253 LEU C N   1 
ATOM   6931  C CA  . LEU C 1 253 ? -8.075  12.307  -2.908  1.00 2.70  ? 253 LEU C CA  1 
ATOM   6932  C C   . LEU C 1 253 ? -9.208  11.854  -3.798  1.00 2.50  ? 253 LEU C C   1 
ATOM   6933  O O   . LEU C 1 253 ? -9.002  10.846  -4.513  1.00 2.86  ? 253 LEU C O   1 
ATOM   6934  C CB  . LEU C 1 253 ? -8.298  12.210  -1.400  1.00 2.38  ? 253 LEU C CB  1 
ATOM   6935  C CG  . LEU C 1 253 ? -6.991  12.259  -0.601  1.00 2.10  ? 253 LEU C CG  1 
ATOM   6936  C CD1 . LEU C 1 253 ? -7.186  13.057  0.666   1.00 2.30  ? 253 LEU C CD1 1 
ATOM   6937  C CD2 . LEU C 1 253 ? -6.556  10.841  -0.280  1.00 2.00  ? 253 LEU C CD2 1 
ATOM   6938  N N   . SER C 1 254 ? -10.260 12.628  -3.873  1.00 2.22  ? 254 SER C N   1 
ATOM   6939  C CA  . SER C 1 254 ? -11.400 12.274  -4.732  1.00 2.00  ? 254 SER C CA  1 
ATOM   6940  C C   . SER C 1 254 ? -10.934 11.814  -6.111  1.00 2.06  ? 254 SER C C   1 
ATOM   6941  O O   . SER C 1 254 ? -11.172 10.680  -6.530  1.00 2.24  ? 254 SER C O   1 
ATOM   6942  C CB  . SER C 1 254 ? -12.356 13.435  -4.877  1.00 2.00  ? 254 SER C CB  1 
ATOM   6943  O OG  . SER C 1 254 ? -13.111 13.304  -6.072  1.00 2.00  ? 254 SER C OG  1 
ATOM   6944  N N   . VAL C 1 255 ? -10.239 12.673  -6.801  1.00 2.14  ? 255 VAL C N   1 
ATOM   6945  C CA  . VAL C 1 255 ? -9.812  12.487  -8.177  1.00 2.32  ? 255 VAL C CA  1 
ATOM   6946  C C   . VAL C 1 255 ? -9.003  11.221  -8.403  1.00 2.46  ? 255 VAL C C   1 
ATOM   6947  O O   . VAL C 1 255 ? -9.066  10.599  -9.466  1.00 2.50  ? 255 VAL C O   1 
ATOM   6948  C CB  . VAL C 1 255 ? -8.972  13.728  -8.631  1.00 2.44  ? 255 VAL C CB  1 
ATOM   6949  C CG1 . VAL C 1 255 ? -8.410  13.564  -10.040 1.00 2.19  ? 255 VAL C CG1 1 
ATOM   6950  C CG2 . VAL C 1 255 ? -9.752  15.024  -8.422  1.00 2.43  ? 255 VAL C CG2 1 
ATOM   6951  N N   . THR C 1 256 ? -8.039  11.111  -7.484  1.00 2.58  ? 256 THR C N   1 
ATOM   6952  C CA  . THR C 1 256 ? -7.052  10.007  -7.551  1.00 2.35  ? 256 THR C CA  1 
ATOM   6953  C C   . THR C 1 256 ? -7.824  8.704   -7.416  1.00 2.23  ? 256 THR C C   1 
ATOM   6954  O O   . THR C 1 256 ? -7.394  7.654   -7.911  1.00 2.35  ? 256 THR C O   1 
ATOM   6955  C CB  . THR C 1 256 ? -5.869  10.234  -6.566  1.00 2.31  ? 256 THR C CB  1 
ATOM   6956  O OG1 . THR C 1 256 ? -5.409  8.904   -6.092  1.00 2.41  ? 256 THR C OG1 1 
ATOM   6957  C CG2 . THR C 1 256 ? -6.159  11.160  -5.399  1.00 2.22  ? 256 THR C CG2 1 
ATOM   6958  N N   . ASP C 1 257 ? -8.971  8.855   -6.795  1.00 2.01  ? 257 ASP C N   1 
ATOM   6959  C CA  . ASP C 1 257 ? -9.918  7.755   -6.531  1.00 2.00  ? 257 ASP C CA  1 
ATOM   6960  C C   . ASP C 1 257 ? -10.686 7.476   -7.821  1.00 2.00  ? 257 ASP C C   1 
ATOM   6961  O O   . ASP C 1 257 ? -11.178 6.358   -8.009  1.00 2.00  ? 257 ASP C O   1 
ATOM   6962  C CB  . ASP C 1 257 ? -10.711 8.101   -5.290  1.00 2.01  ? 257 ASP C CB  1 
ATOM   6963  C CG  . ASP C 1 257 ? -11.842 7.161   -4.984  1.00 2.30  ? 257 ASP C CG  1 
ATOM   6964  O OD1 . ASP C 1 257 ? -12.952 7.322   -5.537  1.00 2.54  ? 257 ASP C OD1 1 
ATOM   6965  O OD2 . ASP C 1 257 ? -11.604 6.239   -4.178  1.00 2.39  ? 257 ASP C OD2 1 
ATOM   6966  N N   . LEU C 1 258 ? -10.704 8.461   -8.702  1.00 2.00  ? 258 LEU C N   1 
ATOM   6967  C CA  . LEU C 1 258 ? -11.325 8.348   -10.019 1.00 2.00  ? 258 LEU C CA  1 
ATOM   6968  C C   . LEU C 1 258 ? -10.301 7.682   -10.947 1.00 2.00  ? 258 LEU C C   1 
ATOM   6969  O O   . LEU C 1 258 ? -10.613 6.747   -11.660 1.00 2.00  ? 258 LEU C O   1 
ATOM   6970  C CB  . LEU C 1 258 ? -11.804 9.688   -10.517 1.00 2.00  ? 258 LEU C CB  1 
ATOM   6971  C CG  . LEU C 1 258 ? -13.207 10.177  -10.271 1.00 2.00  ? 258 LEU C CG  1 
ATOM   6972  C CD1 . LEU C 1 258 ? -14.252 9.191   -10.781 1.00 2.00  ? 258 LEU C CD1 1 
ATOM   6973  C CD2 . LEU C 1 258 ? -13.461 10.403  -8.766  1.00 2.00  ? 258 LEU C CD2 1 
ATOM   6974  N N   . ALA C 1 259 ? -9.092  8.167   -10.856 1.00 2.00  ? 259 ALA C N   1 
ATOM   6975  C CA  . ALA C 1 259 ? -7.939  7.663   -11.610 1.00 2.00  ? 259 ALA C CA  1 
ATOM   6976  C C   . ALA C 1 259 ? -7.767  6.165   -11.355 1.00 2.00  ? 259 ALA C C   1 
ATOM   6977  O O   . ALA C 1 259 ? -7.712  5.344   -12.270 1.00 2.00  ? 259 ALA C O   1 
ATOM   6978  C CB  . ALA C 1 259 ? -6.689  8.444   -11.189 1.00 2.00  ? 259 ALA C CB  1 
ATOM   6979  N N   . ARG C 1 260 ? -7.646  5.859   -10.077 1.00 2.00  ? 260 ARG C N   1 
ATOM   6980  C CA  . ARG C 1 260 ? -7.474  4.550   -9.485  1.00 2.00  ? 260 ARG C CA  1 
ATOM   6981  C C   . ARG C 1 260 ? -8.377  3.528   -10.171 1.00 2.00  ? 260 ARG C C   1 
ATOM   6982  O O   . ARG C 1 260 ? -7.961  2.426   -10.523 1.00 2.00  ? 260 ARG C O   1 
ATOM   6983  C CB  . ARG C 1 260 ? -7.812  4.567   -7.996  1.00 2.00  ? 260 ARG C CB  1 
ATOM   6984  C CG  . ARG C 1 260 ? -7.465  3.352   -7.176  1.00 2.00  ? 260 ARG C CG  1 
ATOM   6985  C CD  . ARG C 1 260 ? -8.352  2.214   -7.395  1.00 2.00  ? 260 ARG C CD  1 
ATOM   6986  N NE  . ARG C 1 260 ? -8.153  1.009   -6.648  1.00 2.22  ? 260 ARG C NE  1 
ATOM   6987  C CZ  . ARG C 1 260 ? -8.491  0.666   -5.412  1.00 2.21  ? 260 ARG C CZ  1 
ATOM   6988  N NH1 . ARG C 1 260 ? -9.169  1.463   -4.576  1.00 2.32  ? 260 ARG C NH1 1 
ATOM   6989  N NH2 . ARG C 1 260 ? -8.010  -0.480  -4.902  1.00 2.02  ? 260 ARG C NH2 1 
ATOM   6990  N N   . SER C 1 261 ? -9.609  3.980   -10.305 1.00 2.00  ? 261 SER C N   1 
ATOM   6991  C CA  . SER C 1 261 ? -10.693 3.195   -10.877 1.00 2.00  ? 261 SER C CA  1 
ATOM   6992  C C   . SER C 1 261 ? -10.477 3.037   -12.377 1.00 2.00  ? 261 SER C C   1 
ATOM   6993  O O   . SER C 1 261 ? -10.690 1.945   -12.887 1.00 2.00  ? 261 SER C O   1 
ATOM   6994  C CB  . SER C 1 261 ? -12.060 3.823   -10.642 1.00 2.00  ? 261 SER C CB  1 
ATOM   6995  O OG  . SER C 1 261 ? -12.562 4.261   -11.902 1.00 2.00  ? 261 SER C OG  1 
ATOM   6996  N N   . ILE C 1 262 ? -10.292 4.166   -13.025 1.00 2.00  ? 262 ILE C N   1 
ATOM   6997  C CA  . ILE C 1 262 ? -10.013 4.191   -14.469 1.00 2.00  ? 262 ILE C CA  1 
ATOM   6998  C C   . ILE C 1 262 ? -8.795  3.299   -14.733 1.00 2.00  ? 262 ILE C C   1 
ATOM   6999  O O   . ILE C 1 262 ? -8.964  2.186   -15.218 1.00 2.05  ? 262 ILE C O   1 
ATOM   7000  C CB  . ILE C 1 262 ? -9.818  5.645   -15.023 1.00 2.00  ? 262 ILE C CB  1 
ATOM   7001  C CG1 . ILE C 1 262 ? -10.845 6.597   -14.398 1.00 2.00  ? 262 ILE C CG1 1 
ATOM   7002  C CG2 . ILE C 1 262 ? -9.866  5.683   -16.568 1.00 2.00  ? 262 ILE C CG2 1 
ATOM   7003  C CD1 . ILE C 1 262 ? -10.306 8.020   -14.108 1.00 2.00  ? 262 ILE C CD1 1 
ATOM   7004  N N   . LEU C 1 263 ? -7.649  3.720   -14.296 1.00 2.00  ? 263 LEU C N   1 
ATOM   7005  C CA  . LEU C 1 263 ? -6.379  3.029   -14.496 1.00 2.45  ? 263 LEU C CA  1 
ATOM   7006  C C   . LEU C 1 263 ? -6.353  1.540   -14.186 1.00 2.53  ? 263 LEU C C   1 
ATOM   7007  O O   . LEU C 1 263 ? -5.898  0.725   -15.061 1.00 2.55  ? 263 LEU C O   1 
ATOM   7008  C CB  . LEU C 1 263 ? -5.304  3.913   -13.795 1.00 2.46  ? 263 LEU C CB  1 
ATOM   7009  C CG  . LEU C 1 263 ? -4.822  5.204   -14.442 1.00 2.44  ? 263 LEU C CG  1 
ATOM   7010  C CD1 . LEU C 1 263 ? -5.143  5.351   -15.936 1.00 2.36  ? 263 LEU C CD1 1 
ATOM   7011  C CD2 . LEU C 1 263 ? -5.408  6.425   -13.725 1.00 2.47  ? 263 LEU C CD2 1 
ATOM   7012  N N   . LYS C 1 264 ? -6.863  1.086   -13.065 1.00 2.46  ? 264 LYS C N   1 
ATOM   7013  C CA  . LYS C 1 264 ? -6.774  -0.346  -12.702 1.00 2.47  ? 264 LYS C CA  1 
ATOM   7014  C C   . LYS C 1 264 ? -7.978  -1.110  -13.221 1.00 2.56  ? 264 LYS C C   1 
ATOM   7015  O O   . LYS C 1 264 ? -8.264  -2.237  -12.764 1.00 2.47  ? 264 LYS C O   1 
ATOM   7016  C CB  . LYS C 1 264 ? -6.676  -0.492  -11.197 1.00 2.49  ? 264 LYS C CB  1 
ATOM   7017  C CG  . LYS C 1 264 ? -5.708  0.483   -10.554 1.00 2.83  ? 264 LYS C CG  1 
ATOM   7018  C CD  . LYS C 1 264 ? -5.951  0.705   -9.081  1.00 3.15  ? 264 LYS C CD  1 
ATOM   7019  C CE  . LYS C 1 264 ? -5.009  -0.089  -8.172  1.00 3.23  ? 264 LYS C CE  1 
ATOM   7020  N NZ  . LYS C 1 264 ? -5.600  -0.157  -6.789  1.00 3.07  ? 264 LYS C NZ  1 
ATOM   7021  N N   . ASN C 1 265 ? -8.693  -0.458  -14.106 1.00 2.59  ? 265 ASN C N   1 
ATOM   7022  C CA  . ASN C 1 265 ? -9.914  -0.912  -14.747 1.00 2.60  ? 265 ASN C CA  1 
ATOM   7023  C C   . ASN C 1 265 ? -10.913 -1.498  -13.765 1.00 2.83  ? 265 ASN C C   1 
ATOM   7024  O O   . ASN C 1 265 ? -11.576 -2.509  -14.105 1.00 3.05  ? 265 ASN C O   1 
ATOM   7025  C CB  . ASN C 1 265 ? -9.629  -1.943  -15.865 1.00 2.63  ? 265 ASN C CB  1 
ATOM   7026  C CG  . ASN C 1 265 ? -10.689 -1.883  -16.933 1.00 2.64  ? 265 ASN C CG  1 
ATOM   7027  O OD1 . ASN C 1 265 ? -11.397 -0.863  -16.971 1.00 3.09  ? 265 ASN C OD1 1 
ATOM   7028  N ND2 . ASN C 1 265 ? -10.857 -2.866  -17.788 1.00 2.50  ? 265 ASN C ND2 1 
ATOM   7029  N N   . LEU C 1 266 ? -10.967 -0.939  -12.581 1.00 2.89  ? 266 LEU C N   1 
ATOM   7030  C CA  . LEU C 1 266 ? -11.822 -1.399  -11.494 1.00 2.93  ? 266 LEU C CA  1 
ATOM   7031  C C   . LEU C 1 266 ? -13.304 -1.534  -11.766 1.00 2.97  ? 266 LEU C C   1 
ATOM   7032  O O   . LEU C 1 266 ? -14.023 -2.281  -11.036 1.00 3.09  ? 266 LEU C O   1 
ATOM   7033  C CB  . LEU C 1 266 ? -11.535 -0.421  -10.337 1.00 2.98  ? 266 LEU C CB  1 
ATOM   7034  C CG  . LEU C 1 266 ? -10.727 -0.971  -9.186  1.00 3.25  ? 266 LEU C CG  1 
ATOM   7035  C CD1 . LEU C 1 266 ? -9.348  -1.444  -9.638  1.00 3.26  ? 266 LEU C CD1 1 
ATOM   7036  C CD2 . LEU C 1 266 ? -10.637 0.137   -8.127  1.00 3.10  ? 266 LEU C CD2 1 
ATOM   7037  N N   . LYS C 1 267 ? -13.805 -0.824  -12.744 1.00 2.92  ? 267 LYS C N   1 
ATOM   7038  C CA  . LYS C 1 267 ? -15.233 -0.794  -13.085 1.00 2.94  ? 267 LYS C CA  1 
ATOM   7039  C C   . LYS C 1 267 ? -16.069 -0.599  -11.818 1.00 2.85  ? 267 LYS C C   1 
ATOM   7040  O O   . LYS C 1 267 ? -17.137 -1.164  -11.676 1.00 2.64  ? 267 LYS C O   1 
ATOM   7041  C CB  . LYS C 1 267 ? -15.737 -1.959  -13.895 1.00 2.92  ? 267 LYS C CB  1 
ATOM   7042  C CG  . LYS C 1 267 ? -15.243 -1.960  -15.364 1.00 2.81  ? 267 LYS C CG  1 
ATOM   7043  C CD  . LYS C 1 267 ? -15.253 -3.388  -15.876 1.00 3.09  ? 267 LYS C CD  1 
ATOM   7044  C CE  . LYS C 1 267 ? -16.656 -3.957  -16.046 1.00 3.26  ? 267 LYS C CE  1 
ATOM   7045  N NZ  . LYS C 1 267 ? -16.657 -5.410  -15.663 1.00 3.41  ? 267 LYS C NZ  1 
ATOM   7046  N N   . ARG C 1 268 ? -15.506 0.244   -10.967 1.00 3.15  ? 268 ARG C N   1 
ATOM   7047  C CA  . ARG C 1 268 ? -16.107 0.764   -9.745  1.00 3.42  ? 268 ARG C CA  1 
ATOM   7048  C C   . ARG C 1 268 ? -17.049 1.912   -10.237 1.00 3.45  ? 268 ARG C C   1 
ATOM   7049  O O   . ARG C 1 268 ? -16.558 2.810   -10.958 1.00 3.46  ? 268 ARG C O   1 
ATOM   7050  C CB  . ARG C 1 268 ? -15.211 1.428   -8.734  1.00 3.68  ? 268 ARG C CB  1 
ATOM   7051  C CG  . ARG C 1 268 ? -14.542 0.802   -7.564  1.00 4.07  ? 268 ARG C CG  1 
ATOM   7052  C CD  . ARG C 1 268 ? -14.308 1.758   -6.434  1.00 4.48  ? 268 ARG C CD  1 
ATOM   7053  N NE  . ARG C 1 268 ? -13.081 2.502   -6.493  1.00 5.06  ? 268 ARG C NE  1 
ATOM   7054  C CZ  . ARG C 1 268 ? -11.879 2.219   -5.961  1.00 5.34  ? 268 ARG C CZ  1 
ATOM   7055  N NH1 . ARG C 1 268 ? -11.618 1.128   -5.221  1.00 5.32  ? 268 ARG C NH1 1 
ATOM   7056  N NH2 . ARG C 1 268 ? -10.835 3.047   -6.180  1.00 5.18  ? 268 ARG C NH2 1 
ATOM   7057  N N   . VAL C 1 269 ? -18.296 1.779   -9.848  1.00 3.39  ? 269 VAL C N   1 
ATOM   7058  C CA  . VAL C 1 269 ? -19.291 2.816   -10.218 1.00 3.24  ? 269 VAL C CA  1 
ATOM   7059  C C   . VAL C 1 269 ? -18.975 4.058   -9.391  1.00 3.26  ? 269 VAL C C   1 
ATOM   7060  O O   . VAL C 1 269 ? -18.409 3.987   -8.280  1.00 3.13  ? 269 VAL C O   1 
ATOM   7061  C CB  . VAL C 1 269 ? -20.711 2.277   -10.117 1.00 3.28  ? 269 VAL C CB  1 
ATOM   7062  C CG1 . VAL C 1 269 ? -21.190 2.050   -8.694  1.00 3.21  ? 269 VAL C CG1 1 
ATOM   7063  C CG2 . VAL C 1 269 ? -21.671 3.168   -10.904 1.00 3.32  ? 269 VAL C CG2 1 
ATOM   7064  N N   . HIS C 1 270 ? -19.349 5.185   -9.969  1.00 3.30  ? 270 HIS C N   1 
ATOM   7065  C CA  . HIS C 1 270 ? -19.051 6.518   -9.474  1.00 3.15  ? 270 HIS C CA  1 
ATOM   7066  C C   . HIS C 1 270 ? -20.076 7.562   -9.879  1.00 3.21  ? 270 HIS C C   1 
ATOM   7067  O O   . HIS C 1 270 ? -20.762 7.430   -10.894 1.00 3.09  ? 270 HIS C O   1 
ATOM   7068  C CB  . HIS C 1 270 ? -17.662 7.052   -10.031 1.00 2.78  ? 270 HIS C CB  1 
ATOM   7069  C CG  . HIS C 1 270 ? -16.533 6.419   -9.290  1.00 2.51  ? 270 HIS C CG  1 
ATOM   7070  N ND1 . HIS C 1 270 ? -16.110 6.850   -8.062  1.00 2.51  ? 270 HIS C ND1 1 
ATOM   7071  C CD2 . HIS C 1 270 ? -15.823 5.310   -9.551  1.00 2.53  ? 270 HIS C CD2 1 
ATOM   7072  C CE1 . HIS C 1 270 ? -15.161 6.043   -7.613  1.00 2.55  ? 270 HIS C CE1 1 
ATOM   7073  N NE2 . HIS C 1 270 ? -14.961 5.099   -8.511  1.00 2.53  ? 270 HIS C NE2 1 
ATOM   7074  N N   . PRO C 1 271 ? -20.142 8.556   -8.996  1.00 3.36  ? 271 PRO C N   1 
ATOM   7075  C CA  . PRO C 1 271 ? -20.949 9.760   -9.309  1.00 3.58  ? 271 PRO C CA  1 
ATOM   7076  C C   . PRO C 1 271 ? -19.926 10.741  -9.904  1.00 3.86  ? 271 PRO C C   1 
ATOM   7077  O O   . PRO C 1 271 ? -18.935 11.140  -9.291  1.00 3.95  ? 271 PRO C O   1 
ATOM   7078  C CB  . PRO C 1 271 ? -21.592 10.174  -8.030  1.00 3.42  ? 271 PRO C CB  1 
ATOM   7079  C CG  . PRO C 1 271 ? -20.730 9.615   -6.961  1.00 3.39  ? 271 PRO C CG  1 
ATOM   7080  C CD  . PRO C 1 271 ? -20.072 8.360   -7.527  1.00 3.34  ? 271 PRO C CD  1 
ATOM   7081  N N   . VAL C 1 272 ? -20.123 11.008  -11.153 1.00 4.12  ? 272 VAL C N   1 
ATOM   7082  C CA  . VAL C 1 272 ? -19.271 11.869  -11.974 1.00 4.47  ? 272 VAL C CA  1 
ATOM   7083  C C   . VAL C 1 272 ? -20.184 12.620  -12.915 1.00 4.95  ? 272 VAL C C   1 
ATOM   7084  O O   . VAL C 1 272 ? -21.359 12.199  -13.012 1.00 5.05  ? 272 VAL C O   1 
ATOM   7085  C CB  . VAL C 1 272 ? -18.261 10.902  -12.626 1.00 4.43  ? 272 VAL C CB  1 
ATOM   7086  C CG1 . VAL C 1 272 ? -17.442 10.142  -11.587 1.00 4.38  ? 272 VAL C CG1 1 
ATOM   7087  C CG2 . VAL C 1 272 ? -18.918 9.927   -13.578 1.00 4.34  ? 272 VAL C CG2 1 
ATOM   7088  N N   . THR C 1 273 ? -19.704 13.637  -13.595 1.00 5.52  ? 273 THR C N   1 
ATOM   7089  C CA  . THR C 1 273 ? -20.503 14.397  -14.551 1.00 6.08  ? 273 THR C CA  1 
ATOM   7090  C C   . THR C 1 273 ? -20.399 13.852  -15.964 1.00 6.69  ? 273 THR C C   1 
ATOM   7091  O O   . THR C 1 273 ? -19.315 13.506  -16.439 1.00 6.79  ? 273 THR C O   1 
ATOM   7092  C CB  . THR C 1 273 ? -20.097 15.924  -14.558 1.00 5.94  ? 273 THR C CB  1 
ATOM   7093  O OG1 . THR C 1 273 ? -18.686 15.915  -14.933 1.00 6.04  ? 273 THR C OG1 1 
ATOM   7094  C CG2 . THR C 1 273 ? -20.354 16.617  -13.239 1.00 6.01  ? 273 THR C CG2 1 
ATOM   7095  N N   . THR C 1 274 ? -21.524 13.819  -16.632 1.00 7.54  ? 274 THR C N   1 
ATOM   7096  C CA  . THR C 1 274 ? -21.670 13.397  -18.001 1.00 8.49  ? 274 THR C CA  1 
ATOM   7097  C C   . THR C 1 274 ? -23.012 13.937  -18.517 1.00 9.43  ? 274 THR C C   1 
ATOM   7098  O O   . THR C 1 274 ? -23.779 14.545  -17.787 1.00 9.42  ? 274 THR C O   1 
ATOM   7099  C CB  . THR C 1 274 ? -21.583 11.859  -18.284 1.00 8.52  ? 274 THR C CB  1 
ATOM   7100  O OG1 . THR C 1 274 ? -22.316 11.159  -17.204 1.00 8.45  ? 274 THR C OG1 1 
ATOM   7101  C CG2 . THR C 1 274 ? -20.141 11.372  -18.464 1.00 8.48  ? 274 THR C CG2 1 
ATOM   7102  N N   . LEU C 1 275 ? -23.205 13.651  -19.776 1.00 10.69 ? 275 LEU C N   1 
ATOM   7103  C CA  . LEU C 1 275 ? -24.350 14.083  -20.550 1.00 11.80 ? 275 LEU C CA  1 
ATOM   7104  C C   . LEU C 1 275 ? -25.606 13.330  -20.180 1.00 12.82 ? 275 LEU C C   1 
ATOM   7105  O O   . LEU C 1 275 ? -25.774 12.174  -20.616 1.00 13.00 ? 275 LEU C O   1 
ATOM   7106  C CB  . LEU C 1 275 ? -23.953 13.895  -22.026 1.00 11.68 ? 275 LEU C CB  1 
ATOM   7107  C CG  . LEU C 1 275 ? -24.940 14.310  -23.080 1.00 11.67 ? 275 LEU C CG  1 
ATOM   7108  C CD1 . LEU C 1 275 ? -25.403 15.748  -22.860 1.00 11.86 ? 275 LEU C CD1 1 
ATOM   7109  C CD2 . LEU C 1 275 ? -24.254 14.240  -24.453 1.00 11.72 ? 275 LEU C CD2 1 
ATOM   7110  N N   . VAL C 1 276 ? -26.430 13.982  -19.403 1.00 14.24 ? 276 VAL C N   1 
ATOM   7111  C CA  . VAL C 1 276 ? -27.760 13.410  -19.053 1.00 15.73 ? 276 VAL C CA  1 
ATOM   7112  C C   . VAL C 1 276 ? -28.763 13.830  -20.152 1.00 16.89 ? 276 VAL C C   1 
ATOM   7113  O O   . VAL C 1 276 ? -29.983 13.785  -19.986 1.00 16.69 ? 276 VAL C O   1 
ATOM   7114  C CB  . VAL C 1 276 ? -28.153 13.800  -17.627 1.00 15.50 ? 276 VAL C CB  1 
ATOM   7115  C CG1 . VAL C 1 276 ? -27.011 13.662  -16.632 1.00 15.37 ? 276 VAL C CG1 1 
ATOM   7116  C CG2 . VAL C 1 276 ? -28.765 15.182  -17.576 1.00 15.42 ? 276 VAL C CG2 1 
ATOM   7117  N N   . LYS C 1 277 ? -28.195 14.227  -21.270 1.00 18.52 ? 277 LYS C N   1 
ATOM   7118  C CA  . LYS C 1 277 ? -28.791 14.694  -22.473 1.00 20.01 ? 277 LYS C CA  1 
ATOM   7119  C C   . LYS C 1 277 ? -30.259 14.291  -22.634 1.00 20.70 ? 277 LYS C C   1 
ATOM   7120  O O   . LYS C 1 277 ? -30.945 15.152  -23.221 1.00 21.20 ? 277 LYS C O   1 
ATOM   7121  C CB  . LYS C 1 277 ? -28.150 14.272  -23.798 1.00 20.63 ? 277 LYS C CB  1 
ATOM   7122  C CG  . LYS C 1 277 ? -28.254 12.779  -24.150 1.00 21.52 ? 277 LYS C CG  1 
ATOM   7123  C CD  . LYS C 1 277 ? -28.652 12.624  -25.622 1.00 22.12 ? 277 LYS C CD  1 
ATOM   7124  C CE  . LYS C 1 277 ? -27.921 11.483  -26.325 1.00 22.41 ? 277 LYS C CE  1 
ATOM   7125  N NZ  . LYS C 1 277 ? -27.862 11.794  -27.808 1.00 22.71 ? 277 LYS C NZ  1 
ATOM   7126  N N   . GLY C 1 278 ? -30.585 13.060  -22.321 1.00 21.13 ? 278 GLY C N   1 
ATOM   7127  C CA  . GLY C 1 278 ? -31.969 12.583  -22.503 1.00 21.67 ? 278 GLY C CA  1 
ATOM   7128  C C   . GLY C 1 278 ? -32.306 11.527  -21.464 1.00 22.18 ? 278 GLY C C   1 
ATOM   7129  O O   . GLY C 1 278 ? -32.751 10.420  -21.820 1.00 22.37 ? 278 GLY C O   1 
ATOM   7130  N N   . PHE C 1 279 ? -32.051 11.817  -20.222 1.00 22.56 ? 279 PHE C N   1 
ATOM   7131  C CA  . PHE C 1 279 ? -32.358 10.911  -19.094 1.00 23.00 ? 279 PHE C CA  1 
ATOM   7132  C C   . PHE C 1 279 ? -33.423 11.625  -18.260 1.00 23.23 ? 279 PHE C C   1 
ATOM   7133  O O   . PHE C 1 279 ? -33.561 12.860  -18.383 1.00 23.57 ? 279 PHE C O   1 
ATOM   7134  C CB  . PHE C 1 279 ? -31.143 10.540  -18.261 1.00 23.19 ? 279 PHE C CB  1 
ATOM   7135  C CG  . PHE C 1 279 ? -30.477 9.223   -18.507 1.00 23.29 ? 279 PHE C CG  1 
ATOM   7136  C CD1 . PHE C 1 279 ? -31.030 8.052   -17.946 1.00 23.27 ? 279 PHE C CD1 1 
ATOM   7137  C CD2 . PHE C 1 279 ? -29.303 9.135   -19.258 1.00 23.21 ? 279 PHE C CD2 1 
ATOM   7138  C CE1 . PHE C 1 279 ? -30.448 6.817   -18.163 1.00 23.25 ? 279 PHE C CE1 1 
ATOM   7139  C CE2 . PHE C 1 279 ? -28.699 7.891   -19.471 1.00 23.27 ? 279 PHE C CE2 1 
ATOM   7140  C CZ  . PHE C 1 279 ? -29.271 6.733   -18.905 1.00 23.24 ? 279 PHE C CZ  1 
ATOM   7141  N N   . HIS C 1 280 ? -34.123 10.896  -17.464 1.00 23.27 ? 280 HIS C N   1 
ATOM   7142  C CA  . HIS C 1 280 ? -35.171 11.391  -16.574 1.00 23.41 ? 280 HIS C CA  1 
ATOM   7143  C C   . HIS C 1 280 ? -35.759 12.752  -16.891 1.00 23.09 ? 280 HIS C C   1 
ATOM   7144  O O   . HIS C 1 280 ? -35.989 13.634  -16.040 1.00 22.82 ? 280 HIS C O   1 
ATOM   7145  C CB  . HIS C 1 280 ? -34.664 11.299  -15.100 1.00 23.86 ? 280 HIS C CB  1 
ATOM   7146  C CG  . HIS C 1 280 ? -33.762 12.445  -14.769 1.00 24.29 ? 280 HIS C CG  1 
ATOM   7147  N ND1 . HIS C 1 280 ? -34.281 13.622  -14.236 1.00 24.47 ? 280 HIS C ND1 1 
ATOM   7148  C CD2 . HIS C 1 280 ? -32.455 12.664  -14.985 1.00 24.44 ? 280 HIS C CD2 1 
ATOM   7149  C CE1 . HIS C 1 280 ? -33.289 14.489  -14.087 1.00 24.56 ? 280 HIS C CE1 1 
ATOM   7150  N NE2 . HIS C 1 280 ? -32.169 13.925  -14.499 1.00 24.56 ? 280 HIS C NE2 1 
ATOM   7151  N N   . GLY C 1 281 ? -36.168 12.941  -18.139 1.00 22.93 ? 281 GLY C N   1 
ATOM   7152  C CA  . GLY C 1 281 ? -36.853 14.146  -18.594 1.00 22.81 ? 281 GLY C CA  1 
ATOM   7153  C C   . GLY C 1 281 ? -35.947 15.170  -19.219 1.00 22.78 ? 281 GLY C C   1 
ATOM   7154  O O   . GLY C 1 281 ? -36.395 15.935  -20.112 1.00 22.92 ? 281 GLY C O   1 
ATOM   7155  N N   . ILE C 1 282 ? -34.713 15.237  -18.722 1.00 22.55 ? 282 ILE C N   1 
ATOM   7156  C CA  . ILE C 1 282 ? -33.731 16.179  -19.302 1.00 22.16 ? 282 ILE C CA  1 
ATOM   7157  C C   . ILE C 1 282 ? -33.479 15.726  -20.750 1.00 22.08 ? 282 ILE C C   1 
ATOM   7158  O O   . ILE C 1 282 ? -33.271 14.546  -21.017 1.00 21.82 ? 282 ILE C O   1 
ATOM   7159  C CB  . ILE C 1 282 ? -32.445 16.316  -18.472 1.00 21.97 ? 282 ILE C CB  1 
ATOM   7160  C CG1 . ILE C 1 282 ? -32.781 16.402  -16.964 1.00 21.81 ? 282 ILE C CG1 1 
ATOM   7161  C CG2 . ILE C 1 282 ? -31.586 17.550  -18.920 1.00 21.99 ? 282 ILE C CG2 1 
ATOM   7162  C CD1 . ILE C 1 282 ? -31.515 16.223  -16.075 1.00 21.74 ? 282 ILE C CD1 1 
ATOM   7163  N N   . LYS C 1 283 ? -33.640 16.706  -21.617 1.00 22.12 ? 283 LYS C N   1 
ATOM   7164  C CA  . LYS C 1 283 ? -33.448 16.505  -23.058 1.00 22.21 ? 283 LYS C CA  1 
ATOM   7165  C C   . LYS C 1 283 ? -32.802 17.763  -23.633 1.00 22.12 ? 283 LYS C C   1 
ATOM   7166  O O   . LYS C 1 283 ? -33.453 18.639  -24.230 1.00 22.32 ? 283 LYS C O   1 
ATOM   7167  C CB  . LYS C 1 283 ? -34.740 16.136  -23.750 1.00 22.41 ? 283 LYS C CB  1 
ATOM   7168  C CG  . LYS C 1 283 ? -35.452 14.891  -23.221 1.00 22.58 ? 283 LYS C CG  1 
ATOM   7169  C CD  . LYS C 1 283 ? -36.668 14.518  -24.058 1.00 22.75 ? 283 LYS C CD  1 
ATOM   7170  C CE  . LYS C 1 283 ? -37.854 15.455  -23.879 1.00 22.90 ? 283 LYS C CE  1 
ATOM   7171  N NZ  . LYS C 1 283 ? -38.910 15.197  -24.914 1.00 22.74 ? 283 LYS C NZ  1 
ATOM   7172  N N   . GLU C 1 284 ? -31.508 17.863  -23.397 1.00 21.81 ? 284 GLU C N   1 
ATOM   7173  C CA  . GLU C 1 284 ? -30.687 19.020  -23.850 1.00 21.48 ? 284 GLU C CA  1 
ATOM   7174  C C   . GLU C 1 284 ? -29.310 18.815  -23.201 1.00 20.97 ? 284 GLU C C   1 
ATOM   7175  O O   . GLU C 1 284 ? -29.278 18.551  -21.996 1.00 20.75 ? 284 GLU C O   1 
ATOM   7176  C CB  . GLU C 1 284 ? -31.318 20.321  -23.442 1.00 21.78 ? 284 GLU C CB  1 
ATOM   7177  C CG  . GLU C 1 284 ? -31.488 21.502  -24.342 1.00 22.12 ? 284 GLU C CG  1 
ATOM   7178  C CD  . GLU C 1 284 ? -32.623 21.684  -25.281 1.00 22.23 ? 284 GLU C CD  1 
ATOM   7179  O OE1 . GLU C 1 284 ? -33.675 21.057  -25.299 1.00 22.21 ? 284 GLU C OE1 1 
ATOM   7180  O OE2 . GLU C 1 284 ? -32.398 22.618  -26.109 1.00 22.23 ? 284 GLU C OE2 1 
ATOM   7181  N N   . GLU C 1 285 ? -28.283 18.781  -24.005 1.00 20.33 ? 285 GLU C N   1 
ATOM   7182  C CA  . GLU C 1 285 ? -26.892 18.500  -23.758 1.00 19.54 ? 285 GLU C CA  1 
ATOM   7183  C C   . GLU C 1 285 ? -26.311 19.138  -22.480 1.00 18.84 ? 285 GLU C C   1 
ATOM   7184  O O   . GLU C 1 285 ? -25.182 19.694  -22.416 1.00 18.70 ? 285 GLU C O   1 
ATOM   7185  C CB  . GLU C 1 285 ? -25.980 18.882  -24.874 1.00 19.79 ? 285 GLU C CB  1 
ATOM   7186  C CG  . GLU C 1 285 ? -25.878 19.100  -26.267 1.00 20.21 ? 285 GLU C CG  1 
ATOM   7187  C CD  . GLU C 1 285 ? -25.624 18.135  -27.348 1.00 20.59 ? 285 GLU C CD  1 
ATOM   7188  O OE1 . GLU C 1 285 ? -26.281 18.090  -28.399 1.00 21.03 ? 285 GLU C OE1 1 
ATOM   7189  O OE2 . GLU C 1 285 ? -24.670 17.345  -27.181 1.00 20.63 ? 285 GLU C OE2 1 
ATOM   7190  N N   . VAL C 1 286 ? -27.045 18.994  -21.417 1.00 17.89 ? 286 VAL C N   1 
ATOM   7191  C CA  . VAL C 1 286 ? -26.765 19.344  -20.066 1.00 17.05 ? 286 VAL C CA  1 
ATOM   7192  C C   . VAL C 1 286 ? -25.976 18.145  -19.453 1.00 16.44 ? 286 VAL C C   1 
ATOM   7193  O O   . VAL C 1 286 ? -26.485 17.025  -19.484 1.00 16.45 ? 286 VAL C O   1 
ATOM   7194  C CB  . VAL C 1 286 ? -27.995 19.558  -19.168 1.00 17.04 ? 286 VAL C CB  1 
ATOM   7195  C CG1 . VAL C 1 286 ? -27.588 19.746  -17.706 1.00 16.92 ? 286 VAL C CG1 1 
ATOM   7196  C CG2 . VAL C 1 286 ? -28.880 20.678  -19.654 1.00 17.11 ? 286 VAL C CG2 1 
ATOM   7197  N N   . PHE C 1 287 ? -24.864 18.515  -18.918 1.00 15.66 ? 287 PHE C N   1 
ATOM   7198  C CA  . PHE C 1 287 ? -23.950 17.627  -18.223 1.00 14.94 ? 287 PHE C CA  1 
ATOM   7199  C C   . PHE C 1 287 ? -24.093 17.984  -16.728 1.00 14.68 ? 287 PHE C C   1 
ATOM   7200  O O   . PHE C 1 287 ? -23.880 19.164  -16.419 1.00 14.85 ? 287 PHE C O   1 
ATOM   7201  C CB  . PHE C 1 287 ? -22.498 17.776  -18.628 1.00 14.65 ? 287 PHE C CB  1 
ATOM   7202  C CG  . PHE C 1 287 ? -22.056 17.296  -19.959 1.00 14.51 ? 287 PHE C CG  1 
ATOM   7203  C CD1 . PHE C 1 287 ? -22.503 17.910  -21.127 1.00 14.55 ? 287 PHE C CD1 1 
ATOM   7204  C CD2 . PHE C 1 287 ? -21.072 16.312  -20.061 1.00 14.44 ? 287 PHE C CD2 1 
ATOM   7205  C CE1 . PHE C 1 287 ? -22.040 17.510  -22.367 1.00 14.55 ? 287 PHE C CE1 1 
ATOM   7206  C CE2 . PHE C 1 287 ? -20.605 15.868  -21.293 1.00 14.33 ? 287 PHE C CE2 1 
ATOM   7207  C CZ  . PHE C 1 287 ? -21.106 16.471  -22.443 1.00 14.44 ? 287 PHE C CZ  1 
ATOM   7208  N N   . LEU C 1 288 ? -24.598 17.070  -15.971 1.00 14.18 ? 288 LEU C N   1 
ATOM   7209  C CA  . LEU C 1 288 ? -24.594 17.157  -14.488 1.00 13.68 ? 288 LEU C CA  1 
ATOM   7210  C C   . LEU C 1 288 ? -24.082 15.737  -14.126 1.00 13.43 ? 288 LEU C C   1 
ATOM   7211  O O   . LEU C 1 288 ? -23.793 14.955  -15.073 1.00 13.25 ? 288 LEU C O   1 
ATOM   7212  C CB  . LEU C 1 288 ? -25.839 17.639  -13.867 1.00 13.62 ? 288 LEU C CB  1 
ATOM   7213  C CG  . LEU C 1 288 ? -27.133 16.932  -13.610 1.00 13.50 ? 288 LEU C CG  1 
ATOM   7214  C CD1 . LEU C 1 288 ? -27.720 16.350  -14.886 1.00 13.49 ? 288 LEU C CD1 1 
ATOM   7215  C CD2 . LEU C 1 288 ? -26.967 15.762  -12.636 1.00 13.45 ? 288 LEU C CD2 1 
ATOM   7216  N N   . SER C 1 289 ? -24.017 15.448  -12.846 1.00 13.12 ? 289 SER C N   1 
ATOM   7217  C CA  . SER C 1 289 ? -23.449 14.138  -12.452 1.00 12.78 ? 289 SER C CA  1 
ATOM   7218  C C   . SER C 1 289 ? -24.503 13.114  -12.065 1.00 12.39 ? 289 SER C C   1 
ATOM   7219  O O   . SER C 1 289 ? -25.537 13.375  -11.431 1.00 12.43 ? 289 SER C O   1 
ATOM   7220  C CB  . SER C 1 289 ? -22.402 14.344  -11.365 1.00 12.91 ? 289 SER C CB  1 
ATOM   7221  O OG  . SER C 1 289 ? -22.972 14.027  -10.120 1.00 13.27 ? 289 SER C OG  1 
ATOM   7222  N N   . ILE C 1 290 ? -24.141 11.897  -12.363 1.00 11.86 ? 290 ILE C N   1 
ATOM   7223  C CA  . ILE C 1 290 ? -24.961 10.680  -12.176 1.00 11.59 ? 290 ILE C CA  1 
ATOM   7224  C C   . ILE C 1 290 ? -24.060 9.501   -11.903 1.00 11.53 ? 290 ILE C C   1 
ATOM   7225  O O   . ILE C 1 290 ? -22.874 9.463   -12.327 1.00 11.78 ? 290 ILE C O   1 
ATOM   7226  C CB  . ILE C 1 290 ? -25.850 10.595  -13.478 1.00 11.39 ? 290 ILE C CB  1 
ATOM   7227  C CG1 . ILE C 1 290 ? -27.334 10.779  -13.077 1.00 11.37 ? 290 ILE C CG1 1 
ATOM   7228  C CG2 . ILE C 1 290 ? -25.619 9.375   -14.379 1.00 11.17 ? 290 ILE C CG2 1 
ATOM   7229  C CD1 . ILE C 1 290 ? -27.783 12.262  -12.977 1.00 11.41 ? 290 ILE C CD1 1 
ATOM   7230  N N   . PRO C 1 291 ? -24.574 8.524   -11.162 1.00 11.20 ? 291 PRO C N   1 
ATOM   7231  C CA  . PRO C 1 291 ? -23.771 7.305   -10.865 1.00 10.83 ? 291 PRO C CA  1 
ATOM   7232  C C   . PRO C 1 291 ? -23.506 6.535   -12.143 1.00 10.57 ? 291 PRO C C   1 
ATOM   7233  O O   . PRO C 1 291 ? -24.414 6.065   -12.850 1.00 10.55 ? 291 PRO C O   1 
ATOM   7234  C CB  . PRO C 1 291 ? -24.540 6.616   -9.784  1.00 10.72 ? 291 PRO C CB  1 
ATOM   7235  C CG  . PRO C 1 291 ? -25.910 7.223   -9.799  1.00 10.85 ? 291 PRO C CG  1 
ATOM   7236  C CD  . PRO C 1 291 ? -25.700 8.686   -10.218 1.00 10.98 ? 291 PRO C CD  1 
ATOM   7237  N N   . CYS C 1 292 ? -22.237 6.428   -12.501 1.00 10.35 ? 292 CYS C N   1 
ATOM   7238  C CA  . CYS C 1 292 ? -21.696 5.773   -13.674 1.00 9.97  ? 292 CYS C CA  1 
ATOM   7239  C C   . CYS C 1 292 ? -20.549 4.815   -13.287 1.00 9.87  ? 292 CYS C C   1 
ATOM   7240  O O   . CYS C 1 292 ? -19.852 5.017   -12.310 1.00 9.59  ? 292 CYS C O   1 
ATOM   7241  C CB  . CYS C 1 292 ? -21.125 6.750   -14.694 1.00 9.78  ? 292 CYS C CB  1 
ATOM   7242  S SG  . CYS C 1 292 ? -21.522 8.499   -14.494 1.00 9.31  ? 292 CYS C SG  1 
ATOM   7243  N N   . VAL C 1 293 ? -20.357 3.850   -14.158 1.00 10.00 ? 293 VAL C N   1 
ATOM   7244  C CA  . VAL C 1 293 ? -19.286 2.852   -14.028 1.00 10.00 ? 293 VAL C CA  1 
ATOM   7245  C C   . VAL C 1 293 ? -18.109 3.303   -14.924 1.00 10.02 ? 293 VAL C C   1 
ATOM   7246  O O   . VAL C 1 293 ? -18.273 3.565   -16.114 1.00 9.75  ? 293 VAL C O   1 
ATOM   7247  C CB  . VAL C 1 293 ? -19.763 1.437   -14.335 1.00 10.02 ? 293 VAL C CB  1 
ATOM   7248  C CG1 . VAL C 1 293 ? -18.797 0.366   -13.806 1.00 10.07 ? 293 VAL C CG1 1 
ATOM   7249  C CG2 . VAL C 1 293 ? -21.173 1.157   -13.845 1.00 10.11 ? 293 VAL C CG2 1 
ATOM   7250  N N   . LEU C 1 294 ? -16.963 3.321   -14.271 1.00 10.17 ? 294 LEU C N   1 
ATOM   7251  C CA  . LEU C 1 294 ? -15.689 3.745   -14.824 1.00 10.37 ? 294 LEU C CA  1 
ATOM   7252  C C   . LEU C 1 294 ? -14.665 2.621   -14.960 1.00 10.55 ? 294 LEU C C   1 
ATOM   7253  O O   . LEU C 1 294 ? -14.426 1.920   -13.964 1.00 10.52 ? 294 LEU C O   1 
ATOM   7254  C CB  . LEU C 1 294 ? -15.160 4.841   -13.876 1.00 10.26 ? 294 LEU C CB  1 
ATOM   7255  C CG  . LEU C 1 294 ? -16.126 5.876   -13.359 1.00 10.33 ? 294 LEU C CG  1 
ATOM   7256  C CD1 . LEU C 1 294 ? -15.392 6.863   -12.474 1.00 10.14 ? 294 LEU C CD1 1 
ATOM   7257  C CD2 . LEU C 1 294 ? -16.792 6.626   -14.528 1.00 10.33 ? 294 LEU C CD2 1 
ATOM   7258  N N   . GLY C 1 295 ? -14.016 2.577   -16.111 1.00 10.74 ? 295 GLY C N   1 
ATOM   7259  C CA  . GLY C 1 295 ? -12.964 1.599   -16.403 1.00 11.07 ? 295 GLY C CA  1 
ATOM   7260  C C   . GLY C 1 295 ? -11.926 2.214   -17.327 1.00 11.45 ? 295 GLY C C   1 
ATOM   7261  O O   . GLY C 1 295 ? -11.992 3.401   -17.647 1.00 11.44 ? 295 GLY C O   1 
ATOM   7262  N N   . GLU C 1 296 ? -10.975 1.440   -17.741 1.00 12.04 ? 296 GLU C N   1 
ATOM   7263  C CA  . GLU C 1 296 ? -9.890  1.718   -18.651 1.00 12.74 ? 296 GLU C CA  1 
ATOM   7264  C C   . GLU C 1 296 ? -10.298 2.746   -19.703 1.00 13.06 ? 296 GLU C C   1 
ATOM   7265  O O   . GLU C 1 296 ? -9.712  3.847   -19.808 1.00 13.23 ? 296 GLU C O   1 
ATOM   7266  C CB  . GLU C 1 296 ? -9.479  0.454   -19.431 1.00 13.08 ? 296 GLU C CB  1 
ATOM   7267  C CG  . GLU C 1 296 ? -8.022  0.159   -19.683 1.00 13.62 ? 296 GLU C CG  1 
ATOM   7268  C CD  . GLU C 1 296 ? -7.575  -0.678  -20.828 1.00 13.84 ? 296 GLU C CD  1 
ATOM   7269  O OE1 . GLU C 1 296 ? -8.244  -0.937  -21.827 1.00 14.15 ? 296 GLU C OE1 1 
ATOM   7270  O OE2 . GLU C 1 296 ? -6.382  -1.063  -20.747 1.00 13.71 ? 296 GLU C OE2 1 
ATOM   7271  N N   . SER C 1 297 ? -11.382 2.423   -20.390 1.00 13.19 ? 297 SER C N   1 
ATOM   7272  C CA  . SER C 1 297 ? -11.943 3.158   -21.496 1.00 13.27 ? 297 SER C CA  1 
ATOM   7273  C C   . SER C 1 297 ? -12.926 4.273   -21.225 1.00 13.43 ? 297 SER C C   1 
ATOM   7274  O O   . SER C 1 297 ? -13.611 4.702   -22.221 1.00 13.60 ? 297 SER C O   1 
ATOM   7275  C CB  . SER C 1 297 ? -12.649 2.146   -22.451 1.00 13.16 ? 297 SER C CB  1 
ATOM   7276  O OG  . SER C 1 297 ? -13.929 1.889   -21.853 1.00 13.21 ? 297 SER C OG  1 
ATOM   7277  N N   . GLY C 1 298 ? -13.056 4.764   -20.018 1.00 13.42 ? 298 GLY C N   1 
ATOM   7278  C CA  . GLY C 1 298 ? -13.917 5.946   -19.758 1.00 13.33 ? 298 GLY C CA  1 
ATOM   7279  C C   . GLY C 1 298 ? -15.119 5.599   -18.904 1.00 13.41 ? 298 GLY C C   1 
ATOM   7280  O O   . GLY C 1 298 ? -15.024 4.932   -17.855 1.00 13.35 ? 298 GLY C O   1 
ATOM   7281  N N   . ILE C 1 299 ? -16.216 6.289   -19.239 1.00 13.43 ? 299 ILE C N   1 
ATOM   7282  C CA  . ILE C 1 299 ? -17.516 5.921   -18.634 1.00 13.36 ? 299 ILE C CA  1 
ATOM   7283  C C   . ILE C 1 299 ? -17.939 4.794   -19.605 1.00 13.49 ? 299 ILE C C   1 
ATOM   7284  O O   . ILE C 1 299 ? -17.695 4.955   -20.807 1.00 13.56 ? 299 ILE C O   1 
ATOM   7285  C CB  . ILE C 1 299 ? -18.564 7.014   -18.474 1.00 13.17 ? 299 ILE C CB  1 
ATOM   7286  C CG1 . ILE C 1 299 ? -17.984 8.221   -17.699 1.00 13.08 ? 299 ILE C CG1 1 
ATOM   7287  C CG2 . ILE C 1 299 ? -19.855 6.508   -17.753 1.00 13.27 ? 299 ILE C CG2 1 
ATOM   7288  C CD1 . ILE C 1 299 ? -17.207 9.163   -18.630 1.00 13.14 ? 299 ILE C CD1 1 
ATOM   7289  N N   . THR C 1 300 ? -18.338 3.716   -19.021 1.00 13.76 ? 300 THR C N   1 
ATOM   7290  C CA  . THR C 1 300 ? -18.689 2.510   -19.819 1.00 13.91 ? 300 THR C CA  1 
ATOM   7291  C C   . THR C 1 300 ? -20.189 2.513   -20.002 1.00 14.01 ? 300 THR C C   1 
ATOM   7292  O O   . THR C 1 300 ? -20.718 2.442   -21.097 1.00 13.98 ? 300 THR C O   1 
ATOM   7293  C CB  . THR C 1 300 ? -18.109 1.239   -19.107 1.00 13.89 ? 300 THR C CB  1 
ATOM   7294  O OG1 . THR C 1 300 ? -16.969 0.813   -19.935 1.00 13.80 ? 300 THR C OG1 1 
ATOM   7295  C CG2 . THR C 1 300 ? -19.112 0.117   -18.850 1.00 14.05 ? 300 THR C CG2 1 
ATOM   7296  N N   . ASP C 1 301 ? -20.785 2.730   -18.839 1.00 14.34 ? 301 ASP C N   1 
ATOM   7297  C CA  . ASP C 1 301 ? -22.252 2.684   -18.693 1.00 14.55 ? 301 ASP C CA  1 
ATOM   7298  C C   . ASP C 1 301 ? -22.666 3.603   -17.558 1.00 14.40 ? 301 ASP C C   1 
ATOM   7299  O O   . ASP C 1 301 ? -21.846 4.022   -16.733 1.00 14.31 ? 301 ASP C O   1 
ATOM   7300  C CB  . ASP C 1 301 ? -22.650 1.196   -18.556 1.00 14.83 ? 301 ASP C CB  1 
ATOM   7301  C CG  . ASP C 1 301 ? -22.298 0.577   -17.234 1.00 14.93 ? 301 ASP C CG  1 
ATOM   7302  O OD1 . ASP C 1 301 ? -21.139 0.482   -16.823 1.00 15.00 ? 301 ASP C OD1 1 
ATOM   7303  O OD2 . ASP C 1 301 ? -23.259 0.193   -16.524 1.00 15.16 ? 301 ASP C OD2 1 
ATOM   7304  N N   . PHE C 1 302 ? -23.939 3.910   -17.567 1.00 14.54 ? 302 PHE C N   1 
ATOM   7305  C CA  . PHE C 1 302 ? -24.589 4.818   -16.610 1.00 14.70 ? 302 PHE C CA  1 
ATOM   7306  C C   . PHE C 1 302 ? -25.474 3.985   -15.661 1.00 14.79 ? 302 PHE C C   1 
ATOM   7307  O O   . PHE C 1 302 ? -25.815 2.835   -16.004 1.00 14.79 ? 302 PHE C O   1 
ATOM   7308  C CB  . PHE C 1 302 ? -25.419 5.875   -17.318 1.00 14.68 ? 302 PHE C CB  1 
ATOM   7309  C CG  . PHE C 1 302 ? -25.018 6.312   -18.684 1.00 14.75 ? 302 PHE C CG  1 
ATOM   7310  C CD1 . PHE C 1 302 ? -25.795 5.942   -19.787 1.00 14.69 ? 302 PHE C CD1 1 
ATOM   7311  C CD2 . PHE C 1 302 ? -23.885 7.112   -18.889 1.00 14.75 ? 302 PHE C CD2 1 
ATOM   7312  C CE1 . PHE C 1 302 ? -25.467 6.386   -21.059 1.00 14.65 ? 302 PHE C CE1 1 
ATOM   7313  C CE2 . PHE C 1 302 ? -23.519 7.538   -20.169 1.00 14.60 ? 302 PHE C CE2 1 
ATOM   7314  C CZ  . PHE C 1 302 ? -24.331 7.173   -21.248 1.00 14.62 ? 302 PHE C CZ  1 
ATOM   7315  N N   . VAL C 1 303 ? -25.768 4.584   -14.523 1.00 14.70 ? 303 VAL C N   1 
ATOM   7316  C CA  . VAL C 1 303 ? -26.686 3.897   -13.570 1.00 14.86 ? 303 VAL C CA  1 
ATOM   7317  C C   . VAL C 1 303 ? -27.849 4.889   -13.384 1.00 15.18 ? 303 VAL C C   1 
ATOM   7318  O O   . VAL C 1 303 ? -27.700 6.065   -13.023 1.00 15.11 ? 303 VAL C O   1 
ATOM   7319  C CB  . VAL C 1 303 ? -26.017 3.335   -12.341 1.00 14.74 ? 303 VAL C CB  1 
ATOM   7320  C CG1 . VAL C 1 303 ? -26.097 4.135   -11.056 1.00 14.66 ? 303 VAL C CG1 1 
ATOM   7321  C CG2 . VAL C 1 303 ? -26.571 1.936   -12.019 1.00 14.73 ? 303 VAL C CG2 1 
ATOM   7322  N N   . LYS C 1 304 ? -28.988 4.364   -13.800 1.00 15.43 ? 304 LYS C N   1 
ATOM   7323  C CA  . LYS C 1 304 ? -30.274 5.073   -13.780 1.00 15.59 ? 304 LYS C CA  1 
ATOM   7324  C C   . LYS C 1 304 ? -31.047 4.685   -12.527 1.00 15.89 ? 304 LYS C C   1 
ATOM   7325  O O   . LYS C 1 304 ? -31.744 3.669   -12.395 1.00 15.99 ? 304 LYS C O   1 
ATOM   7326  C CB  . LYS C 1 304 ? -31.034 4.805   -15.064 1.00 15.56 ? 304 LYS C CB  1 
ATOM   7327  C CG  . LYS C 1 304 ? -31.029 3.338   -15.473 1.00 15.77 ? 304 LYS C CG  1 
ATOM   7328  C CD  . LYS C 1 304 ? -31.117 3.067   -16.943 1.00 15.96 ? 304 LYS C CD  1 
ATOM   7329  C CE  . LYS C 1 304 ? -32.513 3.200   -17.503 1.00 16.29 ? 304 LYS C CE  1 
ATOM   7330  N NZ  . LYS C 1 304 ? -32.799 4.631   -17.867 1.00 16.66 ? 304 LYS C NZ  1 
ATOM   7331  N N   . VAL C 1 305 ? -30.894 5.535   -11.546 1.00 16.25 ? 305 VAL C N   1 
ATOM   7332  C CA  . VAL C 1 305 ? -31.478 5.524   -10.232 1.00 16.70 ? 305 VAL C CA  1 
ATOM   7333  C C   . VAL C 1 305 ? -32.992 5.796   -10.253 1.00 17.13 ? 305 VAL C C   1 
ATOM   7334  O O   . VAL C 1 305 ? -33.546 6.313   -11.220 1.00 17.06 ? 305 VAL C O   1 
ATOM   7335  C CB  . VAL C 1 305 ? -30.738 6.603   -9.384  1.00 16.55 ? 305 VAL C CB  1 
ATOM   7336  C CG1 . VAL C 1 305 ? -29.216 6.573   -9.608  1.00 16.57 ? 305 VAL C CG1 1 
ATOM   7337  C CG2 . VAL C 1 305 ? -31.272 8.005   -9.624  1.00 16.50 ? 305 VAL C CG2 1 
ATOM   7338  N N   . ASN C 1 306 ? -33.551 5.645   -9.067  1.00 17.77 ? 306 ASN C N   1 
ATOM   7339  C CA  . ASN C 1 306 ? -34.960 5.865   -8.752  1.00 18.43 ? 306 ASN C CA  1 
ATOM   7340  C C   . ASN C 1 306 ? -35.165 7.144   -7.929  1.00 18.76 ? 306 ASN C C   1 
ATOM   7341  O O   . ASN C 1 306 ? -35.321 7.081   -6.694  1.00 18.80 ? 306 ASN C O   1 
ATOM   7342  C CB  . ASN C 1 306 ? -35.545 4.648   -8.022  1.00 18.63 ? 306 ASN C CB  1 
ATOM   7343  C CG  . ASN C 1 306 ? -34.830 4.291   -6.731  1.00 18.87 ? 306 ASN C CG  1 
ATOM   7344  O OD1 . ASN C 1 306 ? -35.386 3.503   -5.933  1.00 19.08 ? 306 ASN C OD1 1 
ATOM   7345  N ND2 . ASN C 1 306 ? -33.630 4.826   -6.478  1.00 18.69 ? 306 ASN C ND2 1 
ATOM   7346  N N   . MET C 1 307 ? -35.157 8.280   -8.611  1.00 19.22 ? 307 MET C N   1 
ATOM   7347  C CA  . MET C 1 307 ? -35.390 9.545   -7.845  1.00 19.75 ? 307 MET C CA  1 
ATOM   7348  C C   . MET C 1 307 ? -36.927 9.525   -7.662  1.00 20.06 ? 307 MET C C   1 
ATOM   7349  O O   . MET C 1 307 ? -37.618 8.885   -8.489  1.00 20.21 ? 307 MET C O   1 
ATOM   7350  C CB  . MET C 1 307 ? -34.777 10.747  -8.439  1.00 20.03 ? 307 MET C CB  1 
ATOM   7351  C CG  . MET C 1 307 ? -33.502 10.661  -9.223  1.00 20.18 ? 307 MET C CG  1 
ATOM   7352  S SD  . MET C 1 307 ? -34.087 10.127  -10.891 1.00 20.81 ? 307 MET C SD  1 
ATOM   7353  C CE  . MET C 1 307 ? -32.752 10.759  -11.926 1.00 20.83 ? 307 MET C CE  1 
ATOM   7354  N N   . THR C 1 308 ? -37.379 9.933   -6.486  1.00 20.16 ? 308 THR C N   1 
ATOM   7355  C CA  . THR C 1 308 ? -38.806 10.055  -6.184  1.00 19.94 ? 308 THR C CA  1 
ATOM   7356  C C   . THR C 1 308 ? -39.306 11.204  -7.074  1.00 19.79 ? 308 THR C C   1 
ATOM   7357  O O   . THR C 1 308 ? -38.468 12.025  -7.474  1.00 19.80 ? 308 THR C O   1 
ATOM   7358  C CB  . THR C 1 308 ? -39.197 10.325  -4.699  1.00 20.01 ? 308 THR C CB  1 
ATOM   7359  O OG1 . THR C 1 308 ? -40.616 10.800  -4.744  1.00 20.19 ? 308 THR C OG1 1 
ATOM   7360  C CG2 . THR C 1 308 ? -38.372 11.330  -3.916  1.00 19.83 ? 308 THR C CG2 1 
ATOM   7361  N N   . ALA C 1 309 ? -40.582 11.230  -7.311  1.00 19.70 ? 309 ALA C N   1 
ATOM   7362  C CA  . ALA C 1 309 ? -41.216 12.252  -8.157  1.00 19.57 ? 309 ALA C CA  1 
ATOM   7363  C C   . ALA C 1 309 ? -40.326 13.488  -8.228  1.00 19.37 ? 309 ALA C C   1 
ATOM   7364  O O   . ALA C 1 309 ? -39.677 13.676  -9.279  1.00 19.36 ? 309 ALA C O   1 
ATOM   7365  C CB  . ALA C 1 309 ? -42.629 12.541  -7.698  1.00 19.59 ? 309 ALA C CB  1 
ATOM   7366  N N   . GLU C 1 310 ? -40.077 14.099  -7.089  1.00 19.25 ? 310 GLU C N   1 
ATOM   7367  C CA  . GLU C 1 310 ? -39.265 15.323  -7.043  1.00 19.31 ? 310 GLU C CA  1 
ATOM   7368  C C   . GLU C 1 310 ? -37.774 15.082  -7.011  1.00 18.84 ? 310 GLU C C   1 
ATOM   7369  O O   . GLU C 1 310 ? -37.031 16.028  -7.395  1.00 18.76 ? 310 GLU C O   1 
ATOM   7370  C CB  . GLU C 1 310 ? -39.626 16.253  -5.886  1.00 19.88 ? 310 GLU C CB  1 
ATOM   7371  C CG  . GLU C 1 310 ? -38.923 16.013  -4.549  1.00 20.46 ? 310 GLU C CG  1 
ATOM   7372  C CD  . GLU C 1 310 ? -39.285 14.741  -3.865  1.00 20.86 ? 310 GLU C CD  1 
ATOM   7373  O OE1 . GLU C 1 310 ? -39.203 14.620  -2.656  1.00 21.30 ? 310 GLU C OE1 1 
ATOM   7374  O OE2 . GLU C 1 310 ? -39.723 13.832  -4.600  1.00 21.09 ? 310 GLU C OE2 1 
ATOM   7375  N N   . GLU C 1 311 ? -37.278 14.015  -6.410  1.00 18.29 ? 311 GLU C N   1 
ATOM   7376  C CA  . GLU C 1 311 ? -35.790 13.775  -6.544  1.00 17.85 ? 311 GLU C CA  1 
ATOM   7377  C C   . GLU C 1 311 ? -35.509 14.006  -8.024  1.00 18.06 ? 311 GLU C C   1 
ATOM   7378  O O   . GLU C 1 311 ? -34.747 14.925  -8.393  1.00 18.06 ? 311 GLU C O   1 
ATOM   7379  C CB  . GLU C 1 311 ? -35.378 12.481  -5.938  1.00 17.26 ? 311 GLU C CB  1 
ATOM   7380  C CG  . GLU C 1 311 ? -35.361 12.353  -4.438  1.00 16.73 ? 311 GLU C CG  1 
ATOM   7381  C CD  . GLU C 1 311 ? -35.136 11.101  -3.695  1.00 16.35 ? 311 GLU C CD  1 
ATOM   7382  O OE1 . GLU C 1 311 ? -34.739 10.034  -4.111  1.00 16.17 ? 311 GLU C OE1 1 
ATOM   7383  O OE2 . GLU C 1 311 ? -35.395 11.224  -2.467  1.00 16.08 ? 311 GLU C OE2 1 
ATOM   7384  N N   . GLU C 1 312 ? -36.419 13.506  -8.850  1.00 18.34 ? 312 GLU C N   1 
ATOM   7385  C CA  . GLU C 1 312 ? -36.434 13.677  -10.299 1.00 18.62 ? 312 GLU C CA  1 
ATOM   7386  C C   . GLU C 1 312 ? -36.785 15.128  -10.646 1.00 18.78 ? 312 GLU C C   1 
ATOM   7387  O O   . GLU C 1 312 ? -36.350 15.701  -11.648 1.00 18.76 ? 312 GLU C O   1 
ATOM   7388  C CB  . GLU C 1 312 ? -37.442 12.794  -11.002 1.00 18.69 ? 312 GLU C CB  1 
ATOM   7389  C CG  . GLU C 1 312 ? -37.247 12.494  -12.490 1.00 18.84 ? 312 GLU C CG  1 
ATOM   7390  C CD  . GLU C 1 312 ? -38.349 11.641  -13.085 1.00 18.96 ? 312 GLU C CD  1 
ATOM   7391  O OE1 . GLU C 1 312 ? -38.186 10.525  -13.571 1.00 18.93 ? 312 GLU C OE1 1 
ATOM   7392  O OE2 . GLU C 1 312 ? -39.456 12.234  -13.040 1.00 18.85 ? 312 GLU C OE2 1 
ATOM   7393  N N   . GLY C 1 313 ? -37.593 15.684  -9.781  1.00 19.07 ? 313 GLY C N   1 
ATOM   7394  C CA  . GLY C 1 313 ? -38.050 17.090  -9.841  1.00 19.56 ? 313 GLY C CA  1 
ATOM   7395  C C   . GLY C 1 313 ? -36.794 17.966  -9.820  1.00 19.98 ? 313 GLY C C   1 
ATOM   7396  O O   . GLY C 1 313 ? -36.379 18.506  -10.851 1.00 20.08 ? 313 GLY C O   1 
ATOM   7397  N N   . LEU C 1 314 ? -36.200 18.005  -8.642  1.00 20.35 ? 314 LEU C N   1 
ATOM   7398  C CA  . LEU C 1 314 ? -34.963 18.741  -8.368  1.00 20.48 ? 314 LEU C CA  1 
ATOM   7399  C C   . LEU C 1 314 ? -33.955 18.479  -9.477  1.00 20.65 ? 314 LEU C C   1 
ATOM   7400  O O   . LEU C 1 314 ? -33.561 19.430  -10.186 1.00 20.62 ? 314 LEU C O   1 
ATOM   7401  C CB  . LEU C 1 314 ? -34.480 18.386  -6.959  1.00 20.35 ? 314 LEU C CB  1 
ATOM   7402  C CG  . LEU C 1 314 ? -35.268 19.077  -5.845  1.00 20.31 ? 314 LEU C CG  1 
ATOM   7403  C CD1 . LEU C 1 314 ? -36.565 18.334  -5.579  1.00 20.43 ? 314 LEU C CD1 1 
ATOM   7404  C CD2 . LEU C 1 314 ? -34.430 19.133  -4.580  1.00 20.31 ? 314 LEU C CD2 1 
ATOM   7405  N N   . LEU C 1 315 ? -33.586 17.215  -9.628  1.00 20.81 ? 315 LEU C N   1 
ATOM   7406  C CA  . LEU C 1 315 ? -32.638 16.913  -10.729 1.00 21.18 ? 315 LEU C CA  1 
ATOM   7407  C C   . LEU C 1 315 ? -33.123 17.576  -12.003 1.00 21.56 ? 315 LEU C C   1 
ATOM   7408  O O   . LEU C 1 315 ? -32.348 18.415  -12.536 1.00 21.69 ? 315 LEU C O   1 
ATOM   7409  C CB  . LEU C 1 315 ? -32.320 15.424  -10.762 1.00 20.93 ? 315 LEU C CB  1 
ATOM   7410  C CG  . LEU C 1 315 ? -30.809 15.215  -10.507 1.00 20.71 ? 315 LEU C CG  1 
ATOM   7411  C CD1 . LEU C 1 315 ? -30.531 13.885  -9.893  1.00 20.77 ? 315 LEU C CD1 1 
ATOM   7412  C CD2 . LEU C 1 315 ? -30.156 15.382  -11.879 1.00 20.73 ? 315 LEU C CD2 1 
ATOM   7413  N N   . LYS C 1 316 ? -34.369 17.340  -12.383 1.00 21.87 ? 316 LYS C N   1 
ATOM   7414  C CA  . LYS C 1 316 ? -34.908 17.966  -13.602 1.00 22.22 ? 316 LYS C CA  1 
ATOM   7415  C C   . LYS C 1 316 ? -34.586 19.468  -13.608 1.00 22.49 ? 316 LYS C C   1 
ATOM   7416  O O   . LYS C 1 316 ? -34.292 20.038  -14.662 1.00 22.46 ? 316 LYS C O   1 
ATOM   7417  C CB  . LYS C 1 316 ? -36.399 17.781  -13.750 1.00 22.38 ? 316 LYS C CB  1 
ATOM   7418  C CG  . LYS C 1 316 ? -36.880 16.512  -14.397 1.00 22.64 ? 316 LYS C CG  1 
ATOM   7419  C CD  . LYS C 1 316 ? -38.382 16.520  -14.728 1.00 22.72 ? 316 LYS C CD  1 
ATOM   7420  C CE  . LYS C 1 316 ? -38.675 15.424  -15.760 1.00 22.78 ? 316 LYS C CE  1 
ATOM   7421  N NZ  . LYS C 1 316 ? -40.067 14.928  -15.627 1.00 22.79 ? 316 LYS C NZ  1 
ATOM   7422  N N   . LYS C 1 317 ? -34.643 20.071  -12.444 1.00 22.78 ? 317 LYS C N   1 
ATOM   7423  C CA  . LYS C 1 317 ? -34.402 21.468  -12.172 1.00 23.15 ? 317 LYS C CA  1 
ATOM   7424  C C   . LYS C 1 317 ? -32.956 21.896  -12.367 1.00 23.47 ? 317 LYS C C   1 
ATOM   7425  O O   . LYS C 1 317 ? -32.720 22.944  -13.028 1.00 23.65 ? 317 LYS C O   1 
ATOM   7426  C CB  . LYS C 1 317 ? -34.814 21.844  -10.746 1.00 23.20 ? 317 LYS C CB  1 
ATOM   7427  C CG  . LYS C 1 317 ? -34.394 23.244  -10.318 1.00 23.25 ? 317 LYS C CG  1 
ATOM   7428  C CD  . LYS C 1 317 ? -34.298 23.333  -8.799  1.00 23.43 ? 317 LYS C CD  1 
ATOM   7429  C CE  . LYS C 1 317 ? -34.077 24.791  -8.400  1.00 23.59 ? 317 LYS C CE  1 
ATOM   7430  N NZ  . LYS C 1 317 ? -35.300 25.572  -8.783  1.00 23.83 ? 317 LYS C NZ  1 
ATOM   7431  N N   . SER C 1 318 ? -32.031 21.273  -11.656 1.00 23.76 ? 318 SER C N   1 
ATOM   7432  C CA  . SER C 1 318 ? -30.600 21.586  -11.833 1.00 23.91 ? 318 SER C CA  1 
ATOM   7433  C C   . SER C 1 318 ? -30.366 21.645  -13.358 1.00 24.03 ? 318 SER C C   1 
ATOM   7434  O O   . SER C 1 318 ? -30.091 22.694  -13.907 1.00 24.08 ? 318 SER C O   1 
ATOM   7435  C CB  . SER C 1 318 ? -29.612 20.595  -11.283 1.00 23.88 ? 318 SER C CB  1 
ATOM   7436  O OG  . SER C 1 318 ? -29.344 20.689  -9.931  1.00 24.04 ? 318 SER C OG  1 
ATOM   7437  N N   . ALA C 1 319 ? -30.514 20.476  -13.918 1.00 24.36 ? 319 ALA C N   1 
ATOM   7438  C CA  . ALA C 1 319 ? -30.343 20.218  -15.329 1.00 25.05 ? 319 ALA C CA  1 
ATOM   7439  C C   . ALA C 1 319 ? -30.446 21.538  -16.104 1.00 25.56 ? 319 ALA C C   1 
ATOM   7440  O O   . ALA C 1 319 ? -29.506 22.027  -16.706 1.00 25.61 ? 319 ALA C O   1 
ATOM   7441  C CB  . ALA C 1 319 ? -31.455 19.297  -15.802 1.00 25.19 ? 319 ALA C CB  1 
ATOM   7442  N N   . ASP C 1 320 ? -31.616 22.104  -15.880 1.00 26.21 ? 320 ASP C N   1 
ATOM   7443  C CA  . ASP C 1 320 ? -32.044 23.364  -16.474 1.00 26.89 ? 320 ASP C CA  1 
ATOM   7444  C C   . ASP C 1 320 ? -31.247 24.545  -16.003 1.00 27.22 ? 320 ASP C C   1 
ATOM   7445  O O   . ASP C 1 320 ? -30.771 25.286  -16.927 1.00 27.24 ? 320 ASP C O   1 
ATOM   7446  C CB  . ASP C 1 320 ? -33.582 23.446  -16.344 1.00 27.19 ? 320 ASP C CB  1 
ATOM   7447  C CG  . ASP C 1 320 ? -34.196 22.644  -17.500 1.00 27.54 ? 320 ASP C CG  1 
ATOM   7448  O OD1 . ASP C 1 320 ? -33.515 22.433  -18.531 1.00 27.69 ? 320 ASP C OD1 1 
ATOM   7449  O OD2 . ASP C 1 320 ? -35.369 22.235  -17.356 1.00 27.68 ? 320 ASP C OD2 1 
ATOM   7450  N N   . THR C 1 321 ? -31.166 24.847  -14.719 1.00 27.51 ? 321 THR C N   1 
ATOM   7451  C CA  . THR C 1 321 ? -30.280 25.935  -14.264 1.00 27.78 ? 321 THR C CA  1 
ATOM   7452  C C   . THR C 1 321 ? -29.013 25.850  -15.156 1.00 28.23 ? 321 THR C C   1 
ATOM   7453  O O   . THR C 1 321 ? -28.808 26.611  -16.100 1.00 28.38 ? 321 THR C O   1 
ATOM   7454  C CB  . THR C 1 321 ? -29.806 25.866  -12.775 1.00 27.53 ? 321 THR C CB  1 
ATOM   7455  O OG1 . THR C 1 321 ? -30.957 25.708  -11.924 1.00 27.37 ? 321 THR C OG1 1 
ATOM   7456  C CG2 . THR C 1 321 ? -28.950 27.095  -12.390 1.00 27.49 ? 321 THR C CG2 1 
ATOM   7457  N N   . LEU C 1 322 ? -28.329 24.751  -14.881 1.00 28.67 ? 322 LEU C N   1 
ATOM   7458  C CA  . LEU C 1 322 ? -27.116 24.377  -15.584 1.00 29.30 ? 322 LEU C CA  1 
ATOM   7459  C C   . LEU C 1 322 ? -27.260 24.622  -17.084 1.00 29.71 ? 322 LEU C C   1 
ATOM   7460  O O   . LEU C 1 322 ? -26.275 24.976  -17.729 1.00 29.72 ? 322 LEU C O   1 
ATOM   7461  C CB  . LEU C 1 322 ? -26.821 22.906  -15.267 1.00 29.39 ? 322 LEU C CB  1 
ATOM   7462  C CG  . LEU C 1 322 ? -25.732 22.534  -14.295 1.00 29.41 ? 322 LEU C CG  1 
ATOM   7463  C CD1 . LEU C 1 322 ? -25.728 21.020  -14.056 1.00 29.38 ? 322 LEU C CD1 1 
ATOM   7464  C CD2 . LEU C 1 322 ? -24.366 22.953  -14.870 1.00 29.43 ? 322 LEU C CD2 1 
ATOM   7465  N N   . TRP C 1 323 ? -28.472 24.443  -17.587 1.00 30.33 ? 323 TRP C N   1 
ATOM   7466  C CA  . TRP C 1 323 ? -28.769 24.523  -18.993 1.00 30.95 ? 323 TRP C CA  1 
ATOM   7467  C C   . TRP C 1 323 ? -28.692 25.891  -19.639 1.00 31.53 ? 323 TRP C C   1 
ATOM   7468  O O   . TRP C 1 323 ? -27.901 25.939  -20.634 1.00 31.64 ? 323 TRP C O   1 
ATOM   7469  C CB  . TRP C 1 323 ? -30.128 23.884  -19.393 1.00 30.83 ? 323 TRP C CB  1 
ATOM   7470  C CG  . TRP C 1 323 ? -30.423 24.077  -20.854 1.00 30.66 ? 323 TRP C CG  1 
ATOM   7471  C CD1 . TRP C 1 323 ? -31.484 24.724  -21.408 1.00 30.66 ? 323 TRP C CD1 1 
ATOM   7472  C CD2 . TRP C 1 323 ? -29.494 23.827  -21.922 1.00 30.53 ? 323 TRP C CD2 1 
ATOM   7473  N NE1 . TRP C 1 323 ? -31.338 24.765  -22.775 1.00 30.66 ? 323 TRP C NE1 1 
ATOM   7474  C CE2 . TRP C 1 323 ? -30.115 24.250  -23.111 1.00 30.52 ? 323 TRP C CE2 1 
ATOM   7475  C CE3 . TRP C 1 323 ? -28.233 23.248  -21.973 1.00 30.47 ? 323 TRP C CE3 1 
ATOM   7476  C CZ2 . TRP C 1 323 ? -29.515 24.104  -24.349 1.00 30.39 ? 323 TRP C CZ2 1 
ATOM   7477  C CZ3 . TRP C 1 323 ? -27.633 23.101  -23.207 1.00 30.42 ? 323 TRP C CZ3 1 
ATOM   7478  C CH2 . TRP C 1 323 ? -28.262 23.522  -24.371 1.00 30.38 ? 323 TRP C CH2 1 
ATOM   7479  N N   . ASN C 1 324 ? -29.551 26.856  -19.290 1.00 32.19 ? 324 ASN C N   1 
ATOM   7480  C CA  . ASN C 1 324 ? -29.446 28.090  -20.107 1.00 32.86 ? 324 ASN C CA  1 
ATOM   7481  C C   . ASN C 1 324 ? -27.935 28.467  -20.028 1.00 33.05 ? 324 ASN C C   1 
ATOM   7482  O O   . ASN C 1 324 ? -27.396 28.489  -21.124 1.00 33.16 ? 324 ASN C O   1 
ATOM   7483  C CB  . ASN C 1 324 ? -30.281 29.316  -19.942 1.00 33.28 ? 324 ASN C CB  1 
ATOM   7484  C CG  . ASN C 1 324 ? -30.561 30.000  -21.302 1.00 33.50 ? 324 ASN C CG  1 
ATOM   7485  O OD1 . ASN C 1 324 ? -31.193 31.080  -21.318 1.00 33.71 ? 324 ASN C OD1 1 
ATOM   7486  N ND2 . ASN C 1 324 ? -30.207 29.336  -22.404 1.00 33.36 ? 324 ASN C ND2 1 
ATOM   7487  N N   . MET C 1 325 ? -27.453 28.476  -18.806 1.00 33.11 ? 325 MET C N   1 
ATOM   7488  C CA  . MET C 1 325 ? -26.038 28.831  -18.570 1.00 33.22 ? 325 MET C CA  1 
ATOM   7489  C C   . MET C 1 325 ? -25.158 28.501  -19.782 1.00 33.50 ? 325 MET C C   1 
ATOM   7490  O O   . MET C 1 325 ? -24.388 29.372  -20.238 1.00 33.60 ? 325 MET C O   1 
ATOM   7491  C CB  . MET C 1 325 ? -25.534 28.214  -17.288 1.00 32.96 ? 325 MET C CB  1 
ATOM   7492  C CG  . MET C 1 325 ? -24.369 29.044  -16.772 1.00 32.82 ? 325 MET C CG  1 
ATOM   7493  S SD  . MET C 1 325 ? -25.042 30.078  -15.415 1.00 32.74 ? 325 MET C SD  1 
ATOM   7494  C CE  . MET C 1 325 ? -25.196 28.792  -14.138 1.00 32.57 ? 325 MET C CE  1 
ATOM   7495  N N   . GLN C 1 326 ? -25.382 27.358  -20.370 1.00 33.65 ? 326 GLN C N   1 
ATOM   7496  C CA  . GLN C 1 326 ? -24.754 26.840  -21.547 1.00 34.11 ? 326 GLN C CA  1 
ATOM   7497  C C   . GLN C 1 326 ? -25.144 27.449  -22.882 1.00 34.77 ? 326 GLN C C   1 
ATOM   7498  O O   . GLN C 1 326 ? -24.754 26.833  -23.934 1.00 34.93 ? 326 GLN C O   1 
ATOM   7499  C CB  . GLN C 1 326 ? -24.965 25.300  -21.599 1.00 33.81 ? 326 GLN C CB  1 
ATOM   7500  C CG  . GLN C 1 326 ? -24.871 24.637  -20.258 1.00 33.36 ? 326 GLN C CG  1 
ATOM   7501  C CD  . GLN C 1 326 ? -24.688 23.144  -20.300 1.00 33.07 ? 326 GLN C CD  1 
ATOM   7502  O OE1 . GLN C 1 326 ? -24.467 22.546  -21.341 1.00 32.89 ? 326 GLN C OE1 1 
ATOM   7503  N NE2 . GLN C 1 326 ? -24.729 22.569  -19.103 1.00 32.91 ? 326 GLN C NE2 1 
ATOM   7504  N N   . LYS C 1 327 ? -25.891 28.510  -22.965 1.00 35.50 ? 327 LYS C N   1 
ATOM   7505  C CA  . LYS C 1 327 ? -26.141 29.200  -24.269 1.00 36.48 ? 327 LYS C CA  1 
ATOM   7506  C C   . LYS C 1 327 ? -24.804 29.953  -24.477 1.00 37.44 ? 327 LYS C C   1 
ATOM   7507  O O   . LYS C 1 327 ? -24.668 31.166  -24.307 1.00 37.57 ? 327 LYS C O   1 
ATOM   7508  C CB  . LYS C 1 327 ? -27.321 30.083  -24.298 1.00 36.28 ? 327 LYS C CB  1 
ATOM   7509  C CG  . LYS C 1 327 ? -27.345 31.455  -23.665 1.00 36.09 ? 327 LYS C CG  1 
ATOM   7510  C CD  . LYS C 1 327 ? -26.895 31.439  -22.219 1.00 36.01 ? 327 LYS C CD  1 
ATOM   7511  C CE  . LYS C 1 327 ? -26.586 32.818  -21.676 1.00 35.89 ? 327 LYS C CE  1 
ATOM   7512  N NZ  . LYS C 1 327 ? -25.939 32.725  -20.340 1.00 35.66 ? 327 LYS C NZ  1 
ATOM   7513  N N   . ASN C 1 328 ? -23.813 29.134  -24.859 1.00 38.42 ? 328 ASN C N   1 
ATOM   7514  C CA  . ASN C 1 328 ? -22.428 29.574  -24.861 1.00 39.26 ? 328 ASN C CA  1 
ATOM   7515  C C   . ASN C 1 328 ? -21.695 29.783  -26.159 1.00 40.13 ? 328 ASN C C   1 
ATOM   7516  O O   . ASN C 1 328 ? -22.095 29.536  -27.280 1.00 40.25 ? 328 ASN C O   1 
ATOM   7517  C CB  . ASN C 1 328 ? -21.651 28.583  -23.920 1.00 39.06 ? 328 ASN C CB  1 
ATOM   7518  C CG  . ASN C 1 328 ? -21.429 29.216  -22.567 1.00 38.84 ? 328 ASN C CG  1 
ATOM   7519  O OD1 . ASN C 1 328 ? -20.495 28.839  -21.856 1.00 38.77 ? 328 ASN C OD1 1 
ATOM   7520  N ND2 . ASN C 1 328 ? -22.239 30.199  -22.210 1.00 38.91 ? 328 ASN C ND2 1 
ATOM   7521  N N   . LEU C 1 329 ? -20.507 30.300  -25.939 1.00 41.17 ? 329 LEU C N   1 
ATOM   7522  C CA  . LEU C 1 329 ? -19.382 30.705  -26.722 1.00 42.09 ? 329 LEU C CA  1 
ATOM   7523  C C   . LEU C 1 329 ? -18.746 31.895  -25.966 1.00 42.82 ? 329 LEU C C   1 
ATOM   7524  O O   . LEU C 1 329 ? -19.187 32.134  -24.816 1.00 42.93 ? 329 LEU C O   1 
ATOM   7525  C CB  . LEU C 1 329 ? -19.749 30.978  -28.169 1.00 42.14 ? 329 LEU C CB  1 
ATOM   7526  C CG  . LEU C 1 329 ? -18.653 30.670  -29.192 1.00 42.28 ? 329 LEU C CG  1 
ATOM   7527  C CD1 . LEU C 1 329 ? -18.446 29.158  -29.341 1.00 42.27 ? 329 LEU C CD1 1 
ATOM   7528  C CD2 . LEU C 1 329 ? -19.029 31.309  -30.519 1.00 42.29 ? 329 LEU C CD2 1 
ATOM   7529  N N   . GLU C 1 330 ? -17.730 32.527  -26.523 1.00 43.65 ? 330 GLU C N   1 
ATOM   7530  C CA  . GLU C 1 330 ? -17.110 33.685  -25.874 1.00 44.37 ? 330 GLU C CA  1 
ATOM   7531  C C   . GLU C 1 330 ? -17.945 34.951  -26.096 1.00 44.67 ? 330 GLU C C   1 
ATOM   7532  O O   . GLU C 1 330 ? -17.708 35.994  -25.452 1.00 44.72 ? 330 GLU C O   1 
ATOM   7533  C CB  . GLU C 1 330 ? -15.691 34.021  -26.339 1.00 44.68 ? 330 GLU C CB  1 
ATOM   7534  C CG  . GLU C 1 330 ? -14.878 34.889  -25.367 1.00 45.13 ? 330 GLU C CG  1 
ATOM   7535  C CD  . GLU C 1 330 ? -13.794 35.766  -25.893 1.00 45.40 ? 330 GLU C CD  1 
ATOM   7536  O OE1 . GLU C 1 330 ? -12.610 35.449  -25.970 1.00 45.50 ? 330 GLU C OE1 1 
ATOM   7537  O OE2 . GLU C 1 330 ? -14.188 36.928  -26.208 1.00 45.54 ? 330 GLU C OE2 1 
ATOM   7538  N N   . LEU C 1 331 ? -18.912 34.846  -26.990 1.00 44.93 ? 331 LEU C N   1 
ATOM   7539  C CA  . LEU C 1 331 ? -19.830 35.917  -27.371 1.00 45.00 ? 331 LEU C CA  1 
ATOM   7540  C C   . LEU C 1 331 ? -20.197 36.784  -26.166 1.00 45.01 ? 331 LEU C C   1 
ATOM   7541  O O   . LEU C 1 331 ? -20.372 36.150  -25.091 1.00 45.05 ? 331 LEU C O   1 
ATOM   7542  C CB  . LEU C 1 331 ? -21.050 35.282  -28.050 1.00 45.06 ? 331 LEU C CB  1 
ATOM   7543  C CG  . LEU C 1 331 ? -21.983 36.166  -28.851 1.00 45.23 ? 331 LEU C CG  1 
ATOM   7544  C CD1 . LEU C 1 331 ? -23.049 35.320  -29.563 1.00 45.24 ? 331 LEU C CD1 1 
ATOM   7545  C CD2 . LEU C 1 331 ? -22.695 37.189  -27.964 1.00 45.16 ? 331 LEU C CD2 1 
ATOM   7546  N N   . SER D 1 1   ? 36.175  -4.703  20.012  1.00 23.65 ? 1   SER D N   1 
ATOM   7547  C CA  . SER D 1 1   ? 37.076  -5.715  19.521  1.00 23.75 ? 1   SER D CA  1 
ATOM   7548  C C   . SER D 1 1   ? 36.587  -6.356  18.220  1.00 23.75 ? 1   SER D C   1 
ATOM   7549  O O   . SER D 1 1   ? 37.378  -6.680  17.302  1.00 23.74 ? 1   SER D O   1 
ATOM   7550  C CB  . SER D 1 1   ? 37.203  -6.817  20.593  1.00 23.79 ? 1   SER D CB  1 
ATOM   7551  O OG  . SER D 1 1   ? 35.934  -7.503  20.620  1.00 23.83 ? 1   SER D OG  1 
ATOM   7552  N N   . THR D 1 2   ? 35.294  -6.592  18.178  1.00 23.67 ? 2   THR D N   1 
ATOM   7553  C CA  . THR D 1 2   ? 34.505  -7.179  17.140  1.00 23.62 ? 2   THR D CA  1 
ATOM   7554  C C   . THR D 1 2   ? 33.946  -6.178  16.134  1.00 23.58 ? 2   THR D C   1 
ATOM   7555  O O   . THR D 1 2   ? 33.671  -5.031  16.546  1.00 23.61 ? 2   THR D O   1 
ATOM   7556  C CB  . THR D 1 2   ? 33.137  -7.803  17.735  1.00 23.70 ? 2   THR D CB  1 
ATOM   7557  O OG1 . THR D 1 2   ? 33.478  -8.268  19.059  1.00 24.00 ? 2   THR D OG1 1 
ATOM   7558  C CG2 . THR D 1 2   ? 32.528  -8.847  16.817  1.00 23.73 ? 2   THR D CG2 1 
ATOM   7559  N N   . VAL D 1 3   ? 33.539  -6.729  14.983  1.00 23.42 ? 3   VAL D N   1 
ATOM   7560  C CA  . VAL D 1 3   ? 32.880  -5.818  13.996  1.00 23.26 ? 3   VAL D CA  1 
ATOM   7561  C C   . VAL D 1 3   ? 31.653  -5.239  14.740  1.00 23.20 ? 3   VAL D C   1 
ATOM   7562  O O   . VAL D 1 3   ? 31.495  -4.015  14.727  1.00 23.10 ? 3   VAL D O   1 
ATOM   7563  C CB  . VAL D 1 3   ? 32.623  -6.399  12.626  1.00 23.10 ? 3   VAL D CB  1 
ATOM   7564  C CG1 . VAL D 1 3   ? 33.117  -7.839  12.448  1.00 23.08 ? 3   VAL D CG1 1 
ATOM   7565  C CG2 . VAL D 1 3   ? 31.176  -6.284  12.134  1.00 23.08 ? 3   VAL D CG2 1 
ATOM   7566  N N   . LYS D 1 4   ? 30.880  -6.105  15.379  1.00 23.20 ? 4   LYS D N   1 
ATOM   7567  C CA  . LYS D 1 4   ? 29.727  -5.577  16.130  1.00 23.41 ? 4   LYS D CA  1 
ATOM   7568  C C   . LYS D 1 4   ? 30.260  -4.424  17.001  1.00 23.74 ? 4   LYS D C   1 
ATOM   7569  O O   . LYS D 1 4   ? 29.979  -3.265  16.706  1.00 23.81 ? 4   LYS D O   1 
ATOM   7570  C CB  . LYS D 1 4   ? 28.936  -6.490  17.000  1.00 23.24 ? 4   LYS D CB  1 
ATOM   7571  C CG  . LYS D 1 4   ? 27.784  -7.261  16.487  1.00 23.14 ? 4   LYS D CG  1 
ATOM   7572  C CD  . LYS D 1 4   ? 26.763  -6.589  15.658  1.00 23.22 ? 4   LYS D CD  1 
ATOM   7573  C CE  . LYS D 1 4   ? 27.159  -5.830  14.432  1.00 23.34 ? 4   LYS D CE  1 
ATOM   7574  N NZ  . LYS D 1 4   ? 28.356  -6.352  13.722  1.00 23.24 ? 4   LYS D NZ  1 
ATOM   7575  N N   . GLU D 1 5   ? 31.105  -4.839  17.930  1.00 24.02 ? 5   GLU D N   1 
ATOM   7576  C CA  . GLU D 1 5   ? 31.680  -3.910  18.907  1.00 24.23 ? 5   GLU D CA  1 
ATOM   7577  C C   . GLU D 1 5   ? 32.378  -2.758  18.222  1.00 24.39 ? 5   GLU D C   1 
ATOM   7578  O O   . GLU D 1 5   ? 32.665  -1.730  18.867  1.00 24.61 ? 5   GLU D O   1 
ATOM   7579  C CB  . GLU D 1 5   ? 32.636  -4.629  19.841  1.00 24.30 ? 5   GLU D CB  1 
ATOM   7580  C CG  . GLU D 1 5   ? 32.133  -5.960  20.431  1.00 24.42 ? 5   GLU D CG  1 
ATOM   7581  C CD  . GLU D 1 5   ? 32.896  -6.487  21.603  1.00 24.53 ? 5   GLU D CD  1 
ATOM   7582  O OE1 . GLU D 1 5   ? 32.415  -7.162  22.508  1.00 24.62 ? 5   GLU D OE1 1 
ATOM   7583  O OE2 . GLU D 1 5   ? 34.099  -6.144  21.599  1.00 24.57 ? 5   GLU D OE2 1 
ATOM   7584  N N   . GLN D 1 6   ? 32.501  -2.840  16.917  1.00 24.45 ? 6   GLN D N   1 
ATOM   7585  C CA  . GLN D 1 6   ? 33.187  -1.812  16.137  1.00 24.69 ? 6   GLN D CA  1 
ATOM   7586  C C   . GLN D 1 6   ? 32.248  -0.986  15.290  1.00 24.93 ? 6   GLN D C   1 
ATOM   7587  O O   . GLN D 1 6   ? 32.354  0.265   15.375  1.00 25.19 ? 6   GLN D O   1 
ATOM   7588  C CB  . GLN D 1 6   ? 34.315  -2.466  15.330  1.00 24.63 ? 6   GLN D CB  1 
ATOM   7589  C CG  . GLN D 1 6   ? 35.601  -1.711  15.287  1.00 24.62 ? 6   GLN D CG  1 
ATOM   7590  C CD  . GLN D 1 6   ? 36.683  -2.265  14.403  1.00 24.64 ? 6   GLN D CD  1 
ATOM   7591  O OE1 . GLN D 1 6   ? 37.820  -1.758  14.393  1.00 24.45 ? 6   GLN D OE1 1 
ATOM   7592  N NE2 . GLN D 1 6   ? 36.377  -3.308  13.629  1.00 24.65 ? 6   GLN D NE2 1 
ATOM   7593  N N   . LEU D 1 7   ? 31.330  -1.563  14.542  1.00 25.10 ? 7   LEU D N   1 
ATOM   7594  C CA  . LEU D 1 7   ? 30.436  -0.872  13.632  1.00 25.23 ? 7   LEU D CA  1 
ATOM   7595  C C   . LEU D 1 7   ? 29.271  -0.158  14.291  1.00 25.60 ? 7   LEU D C   1 
ATOM   7596  O O   . LEU D 1 7   ? 28.928  0.941   13.843  1.00 25.57 ? 7   LEU D O   1 
ATOM   7597  C CB  . LEU D 1 7   ? 29.917  -1.839  12.537  1.00 24.92 ? 7   LEU D CB  1 
ATOM   7598  C CG  . LEU D 1 7   ? 29.386  -1.184  11.268  1.00 24.70 ? 7   LEU D CG  1 
ATOM   7599  C CD1 . LEU D 1 7   ? 29.158  -2.233  10.175  1.00 24.68 ? 7   LEU D CD1 1 
ATOM   7600  C CD2 . LEU D 1 7   ? 28.053  -0.490  11.517  1.00 24.63 ? 7   LEU D CD2 1 
ATOM   7601  N N   . ILE D 1 8   ? 28.672  -0.760  15.263  1.00 26.42 ? 8   ILE D N   1 
ATOM   7602  C CA  . ILE D 1 8   ? 27.463  -0.269  15.919  1.00 27.28 ? 8   ILE D CA  1 
ATOM   7603  C C   . ILE D 1 8   ? 27.690  0.219   17.329  1.00 28.14 ? 8   ILE D C   1 
ATOM   7604  O O   . ILE D 1 8   ? 28.305  -0.474  18.150  1.00 28.13 ? 8   ILE D O   1 
ATOM   7605  C CB  . ILE D 1 8   ? 26.402  -1.447  15.851  1.00 27.12 ? 8   ILE D CB  1 
ATOM   7606  C CG1 . ILE D 1 8   ? 25.907  -1.610  14.403  1.00 27.06 ? 8   ILE D CG1 1 
ATOM   7607  C CG2 . ILE D 1 8   ? 25.251  -1.291  16.871  1.00 27.13 ? 8   ILE D CG2 1 
ATOM   7608  C CD1 . ILE D 1 8   ? 24.857  -0.562  13.911  1.00 26.91 ? 8   ILE D CD1 1 
ATOM   7609  N N   . GLN D 1 9   ? 27.053  1.347   17.630  1.00 29.37 ? 9   GLN D N   1 
ATOM   7610  C CA  . GLN D 1 9   ? 27.129  1.924   18.966  1.00 30.74 ? 9   GLN D CA  1 
ATOM   7611  C C   . GLN D 1 9   ? 25.753  1.965   19.637  1.00 31.71 ? 9   GLN D C   1 
ATOM   7612  O O   . GLN D 1 9   ? 24.864  2.753   19.313  1.00 31.93 ? 9   GLN D O   1 
ATOM   7613  C CB  . GLN D 1 9   ? 27.805  3.305   19.018  1.00 30.81 ? 9   GLN D CB  1 
ATOM   7614  C CG  . GLN D 1 9   ? 27.829  3.842   20.441  1.00 30.85 ? 9   GLN D CG  1 
ATOM   7615  C CD  . GLN D 1 9   ? 29.168  4.218   20.984  1.00 30.88 ? 9   GLN D CD  1 
ATOM   7616  O OE1 . GLN D 1 9   ? 29.510  3.800   22.097  1.00 30.92 ? 9   GLN D OE1 1 
ATOM   7617  N NE2 . GLN D 1 9   ? 29.935  5.030   20.258  1.00 30.89 ? 9   GLN D NE2 1 
ATOM   7618  N N   . ASN D 1 10  ? 25.679  1.240   20.697  1.00 32.88 ? 10  ASN D N   1 
ATOM   7619  C CA  . ASN D 1 10  ? 24.675  0.972   21.676  1.00 34.04 ? 10  ASN D CA  1 
ATOM   7620  C C   . ASN D 1 10  ? 24.268  2.147   22.550  1.00 34.87 ? 10  ASN D C   1 
ATOM   7621  O O   . ASN D 1 10  ? 24.792  2.260   23.687  1.00 34.84 ? 10  ASN D O   1 
ATOM   7622  C CB  . ASN D 1 10  ? 25.278  -0.175  22.571  1.00 34.28 ? 10  ASN D CB  1 
ATOM   7623  C CG  . ASN D 1 10  ? 26.708  0.141   23.013  1.00 34.54 ? 10  ASN D CG  1 
ATOM   7624  O OD1 . ASN D 1 10  ? 26.975  0.569   24.152  1.00 34.65 ? 10  ASN D OD1 1 
ATOM   7625  N ND2 . ASN D 1 10  ? 27.683  -0.074  22.114  1.00 34.53 ? 10  ASN D ND2 1 
ATOM   7626  N N   . LEU D 1 11  ? 23.283  2.935   22.123  1.00 35.91 ? 11  LEU D N   1 
ATOM   7627  C CA  . LEU D 1 11  ? 22.801  4.101   22.867  1.00 36.91 ? 11  LEU D CA  1 
ATOM   7628  C C   . LEU D 1 11  ? 22.123  3.721   24.191  1.00 37.67 ? 11  LEU D C   1 
ATOM   7629  O O   . LEU D 1 11  ? 20.906  3.688   24.343  1.00 37.69 ? 11  LEU D O   1 
ATOM   7630  C CB  . LEU D 1 11  ? 21.901  4.969   21.983  1.00 36.82 ? 11  LEU D CB  1 
ATOM   7631  C CG  . LEU D 1 11  ? 21.775  6.445   22.333  1.00 36.76 ? 11  LEU D CG  1 
ATOM   7632  C CD1 . LEU D 1 11  ? 20.828  7.140   21.353  1.00 36.70 ? 11  LEU D CD1 1 
ATOM   7633  C CD2 . LEU D 1 11  ? 21.254  6.641   23.752  1.00 36.67 ? 11  LEU D CD2 1 
ATOM   7634  N N   . VAL D 1 12  ? 22.939  3.625   25.177  1.00 38.81 ? 12  VAL D N   1 
ATOM   7635  C CA  . VAL D 1 12  ? 22.791  3.281   26.572  1.00 39.95 ? 12  VAL D CA  1 
ATOM   7636  C C   . VAL D 1 12  ? 21.383  2.864   26.935  1.00 40.80 ? 12  VAL D C   1 
ATOM   7637  O O   . VAL D 1 12  ? 20.782  2.041   26.182  1.00 40.93 ? 12  VAL D O   1 
ATOM   7638  C CB  . VAL D 1 12  ? 23.583  4.268   27.457  1.00 40.00 ? 12  VAL D CB  1 
ATOM   7639  C CG1 . VAL D 1 12  ? 24.260  3.543   28.638  1.00 40.06 ? 12  VAL D CG1 1 
ATOM   7640  C CG2 . VAL D 1 12  ? 24.602  5.127   26.749  1.00 40.08 ? 12  VAL D CG2 1 
ATOM   7641  N N   . PRO D 1 13  ? 20.884  3.346   28.056  1.00 41.68 ? 13  PRO D N   1 
ATOM   7642  C CA  . PRO D 1 13  ? 19.595  2.858   28.613  1.00 42.32 ? 13  PRO D CA  1 
ATOM   7643  C C   . PRO D 1 13  ? 18.472  2.889   27.605  1.00 42.86 ? 13  PRO D C   1 
ATOM   7644  O O   . PRO D 1 13  ? 18.316  3.869   26.855  1.00 43.05 ? 13  PRO D O   1 
ATOM   7645  C CB  . PRO D 1 13  ? 19.361  3.714   29.842  1.00 42.24 ? 13  PRO D CB  1 
ATOM   7646  C CG  . PRO D 1 13  ? 20.425  4.783   29.829  1.00 42.17 ? 13  PRO D CG  1 
ATOM   7647  C CD  . PRO D 1 13  ? 20.929  4.826   28.384  1.00 41.93 ? 13  PRO D CD  1 
ATOM   7648  N N   . GLU D 1 14  ? 17.664  1.847   27.617  1.00 43.41 ? 14  GLU D N   1 
ATOM   7649  C CA  . GLU D 1 14  ? 16.545  1.652   26.696  1.00 43.97 ? 14  GLU D CA  1 
ATOM   7650  C C   . GLU D 1 14  ? 17.111  1.196   25.334  1.00 44.11 ? 14  GLU D C   1 
ATOM   7651  O O   . GLU D 1 14  ? 17.272  1.857   24.315  1.00 44.00 ? 14  GLU D O   1 
ATOM   7652  C CB  . GLU D 1 14  ? 15.619  2.823   26.501  1.00 44.23 ? 14  GLU D CB  1 
ATOM   7653  C CG  . GLU D 1 14  ? 14.213  2.545   25.983  1.00 44.60 ? 14  GLU D CG  1 
ATOM   7654  C CD  . GLU D 1 14  ? 14.042  2.029   24.595  1.00 44.81 ? 14  GLU D CD  1 
ATOM   7655  O OE1 . GLU D 1 14  ? 13.356  2.603   23.744  1.00 44.84 ? 14  GLU D OE1 1 
ATOM   7656  O OE2 . GLU D 1 14  ? 14.609  0.922   24.391  1.00 44.83 ? 14  GLU D OE2 1 
ATOM   7657  N N   . ASP D 1 15  ? 17.321  -0.100  25.379  1.00 44.32 ? 15  ASP D N   1 
ATOM   7658  C CA  . ASP D 1 15  ? 17.867  -0.966  24.345  1.00 44.33 ? 15  ASP D CA  1 
ATOM   7659  C C   . ASP D 1 15  ? 17.089  -2.298  24.356  1.00 44.21 ? 15  ASP D C   1 
ATOM   7660  O O   . ASP D 1 15  ? 17.690  -3.364  24.187  1.00 44.19 ? 15  ASP D O   1 
ATOM   7661  C CB  . ASP D 1 15  ? 19.382  -1.112  24.563  1.00 44.37 ? 15  ASP D CB  1 
ATOM   7662  C CG  . ASP D 1 15  ? 19.731  -1.199  26.048  1.00 44.45 ? 15  ASP D CG  1 
ATOM   7663  O OD1 . ASP D 1 15  ? 19.618  -0.185  26.765  1.00 44.44 ? 15  ASP D OD1 1 
ATOM   7664  O OD2 . ASP D 1 15  ? 20.025  -2.327  26.485  1.00 44.49 ? 15  ASP D OD2 1 
ATOM   7665  N N   . LYS D 1 16  ? 15.782  -2.171  24.511  1.00 43.87 ? 16  LYS D N   1 
ATOM   7666  C CA  . LYS D 1 16  ? 14.805  -3.252  24.589  1.00 43.45 ? 16  LYS D CA  1 
ATOM   7667  C C   . LYS D 1 16  ? 13.384  -2.645  24.664  1.00 43.04 ? 16  LYS D C   1 
ATOM   7668  O O   . LYS D 1 16  ? 13.265  -1.546  25.263  1.00 43.10 ? 16  LYS D O   1 
ATOM   7669  C CB  . LYS D 1 16  ? 14.990  -4.080  25.837  1.00 43.69 ? 16  LYS D CB  1 
ATOM   7670  C CG  . LYS D 1 16  ? 16.292  -4.624  26.291  1.00 43.97 ? 16  LYS D CG  1 
ATOM   7671  C CD  . LYS D 1 16  ? 16.627  -6.029  25.864  1.00 44.29 ? 16  LYS D CD  1 
ATOM   7672  C CE  . LYS D 1 16  ? 17.307  -6.189  24.540  1.00 44.53 ? 16  LYS D CE  1 
ATOM   7673  N NZ  . LYS D 1 16  ? 16.489  -5.641  23.416  1.00 44.72 ? 16  LYS D NZ  1 
ATOM   7674  N N   . LEU D 1 17  ? 12.363  -3.336  24.185  1.00 42.22 ? 17  LEU D N   1 
ATOM   7675  C CA  . LEU D 1 17  ? 10.963  -2.869  24.204  1.00 41.42 ? 17  LEU D CA  1 
ATOM   7676  C C   . LEU D 1 17  ? 9.973   -4.034  23.965  1.00 40.82 ? 17  LEU D C   1 
ATOM   7677  O O   . LEU D 1 17  ? 10.325  -5.215  24.109  1.00 40.98 ? 17  LEU D O   1 
ATOM   7678  C CB  . LEU D 1 17  ? 10.762  -1.773  23.180  1.00 41.38 ? 17  LEU D CB  1 
ATOM   7679  C CG  . LEU D 1 17  ? 11.265  -0.386  23.126  1.00 41.30 ? 17  LEU D CG  1 
ATOM   7680  C CD1 . LEU D 1 17  ? 11.215  0.336   24.470  1.00 41.33 ? 17  LEU D CD1 1 
ATOM   7681  C CD2 . LEU D 1 17  ? 12.705  -0.374  22.588  1.00 41.32 ? 17  LEU D CD2 1 
ATOM   7682  N N   . SER D 1 18  ? 8.730   -3.687  23.626  1.00 39.79 ? 18  SER D N   1 
ATOM   7683  C CA  . SER D 1 18  ? 7.671   -4.616  23.230  1.00 38.76 ? 18  SER D CA  1 
ATOM   7684  C C   . SER D 1 18  ? 6.313   -3.914  23.106  1.00 37.92 ? 18  SER D C   1 
ATOM   7685  O O   . SER D 1 18  ? 6.209   -2.802  23.663  1.00 37.93 ? 18  SER D O   1 
ATOM   7686  C CB  . SER D 1 18  ? 7.554   -5.796  24.186  1.00 38.89 ? 18  SER D CB  1 
ATOM   7687  O OG  . SER D 1 18  ? 6.567   -5.591  25.181  1.00 38.98 ? 18  SER D OG  1 
ATOM   7688  N N   . ARG D 1 19  ? 5.363   -4.481  22.342  1.00 36.75 ? 19  ARG D N   1 
ATOM   7689  C CA  . ARG D 1 19  ? 3.993   -3.946  22.302  1.00 35.54 ? 19  ARG D CA  1 
ATOM   7690  C C   . ARG D 1 19  ? 2.894   -4.743  21.630  1.00 34.42 ? 19  ARG D C   1 
ATOM   7691  O O   . ARG D 1 19  ? 2.345   -5.686  22.282  1.00 34.40 ? 19  ARG D O   1 
ATOM   7692  C CB  . ARG D 1 19  ? 3.904   -2.468  21.850  1.00 35.73 ? 19  ARG D CB  1 
ATOM   7693  C CG  . ARG D 1 19  ? 3.711   -1.514  23.050  1.00 35.91 ? 19  ARG D CG  1 
ATOM   7694  C CD  . ARG D 1 19  ? 2.404   -1.734  23.712  1.00 36.12 ? 19  ARG D CD  1 
ATOM   7695  N NE  . ARG D 1 19  ? 2.437   -1.567  25.154  1.00 36.31 ? 19  ARG D NE  1 
ATOM   7696  C CZ  . ARG D 1 19  ? 1.679   -2.287  25.998  1.00 36.38 ? 19  ARG D CZ  1 
ATOM   7697  N NH1 . ARG D 1 19  ? 0.818   -3.206  25.569  1.00 36.37 ? 19  ARG D NH1 1 
ATOM   7698  N NH2 . ARG D 1 19  ? 1.856   -2.153  27.316  1.00 36.41 ? 19  ARG D NH2 1 
ATOM   7699  N N   . CYS D 1 20  ? 2.539   -4.498  20.392  1.00 32.90 ? 20  CYS D N   1 
ATOM   7700  C CA  . CYS D 1 20  ? 1.352   -5.035  19.713  1.00 31.45 ? 20  CYS D CA  1 
ATOM   7701  C C   . CYS D 1 20  ? 1.419   -5.993  18.559  1.00 29.97 ? 20  CYS D C   1 
ATOM   7702  O O   . CYS D 1 20  ? 1.293   -5.641  17.357  1.00 29.75 ? 20  CYS D O   1 
ATOM   7703  C CB  . CYS D 1 20  ? 0.561   -3.730  19.290  1.00 31.82 ? 20  CYS D CB  1 
ATOM   7704  S SG  . CYS D 1 20  ? 1.718   -2.297  19.210  1.00 32.63 ? 20  CYS D SG  1 
ATOM   7705  N N   . LYS D 1 21  ? 1.330   -7.285  18.832  1.00 28.15 ? 21  LYS D N   1 
ATOM   7706  C CA  . LYS D 1 21  ? 1.401   -8.478  18.063  1.00 26.27 ? 21  LYS D CA  1 
ATOM   7707  C C   . LYS D 1 21  ? 0.129   -9.071  17.450  1.00 24.76 ? 21  LYS D C   1 
ATOM   7708  O O   . LYS D 1 21  ? -0.975  -8.827  17.902  1.00 24.65 ? 21  LYS D O   1 
ATOM   7709  C CB  . LYS D 1 21  ? 1.820   -9.689  18.977  1.00 26.37 ? 21  LYS D CB  1 
ATOM   7710  C CG  . LYS D 1 21  ? 3.205   -10.250 18.801  1.00 26.34 ? 21  LYS D CG  1 
ATOM   7711  C CD  . LYS D 1 21  ? 3.719   -10.874 20.099  1.00 26.33 ? 21  LYS D CD  1 
ATOM   7712  C CE  . LYS D 1 21  ? 3.263   -12.286 20.345  1.00 26.35 ? 21  LYS D CE  1 
ATOM   7713  N NZ  . LYS D 1 21  ? 3.619   -12.734 21.724  1.00 26.32 ? 21  LYS D NZ  1 
ATOM   7714  N N   . ILE D 1 22  ? 0.388   -9.991  16.542  1.00 22.89 ? 22  ILE D N   1 
ATOM   7715  C CA  . ILE D 1 22  ? -0.548  -10.870 15.858  1.00 21.26 ? 22  ILE D CA  1 
ATOM   7716  C C   . ILE D 1 22  ? 0.040   -12.298 16.069  1.00 20.20 ? 22  ILE D C   1 
ATOM   7717  O O   . ILE D 1 22  ? 1.283   -12.419 16.093  1.00 20.43 ? 22  ILE D O   1 
ATOM   7718  C CB  . ILE D 1 22  ? -0.826  -10.583 14.368  1.00 21.15 ? 22  ILE D CB  1 
ATOM   7719  C CG1 . ILE D 1 22  ? -1.952  -9.550  14.152  1.00 21.10 ? 22  ILE D CG1 1 
ATOM   7720  C CG2 . ILE D 1 22  ? -1.202  -11.867 13.533  1.00 20.98 ? 22  ILE D CG2 1 
ATOM   7721  C CD1 . ILE D 1 22  ? -1.752  -8.155  14.738  1.00 21.34 ? 22  ILE D CD1 1 
ATOM   7722  N N   . THR D 1 23  ? -0.821  -13.268 16.242  1.00 18.42 ? 23  THR D N   1 
ATOM   7723  C CA  . THR D 1 23  ? -0.420  -14.663 16.458  1.00 16.57 ? 23  THR D CA  1 
ATOM   7724  C C   . THR D 1 23  ? -1.377  -15.531 15.654  1.00 15.61 ? 23  THR D C   1 
ATOM   7725  O O   . THR D 1 23  ? -2.561  -15.099 15.574  1.00 15.51 ? 23  THR D O   1 
ATOM   7726  C CB  . THR D 1 23  ? -0.455  -15.103 17.970  1.00 16.40 ? 23  THR D CB  1 
ATOM   7727  O OG1 . THR D 1 23  ? 0.559   -14.338 18.677  1.00 15.96 ? 23  THR D OG1 1 
ATOM   7728  C CG2 . THR D 1 23  ? -0.312  -16.627 18.182  1.00 16.08 ? 23  THR D CG2 1 
ATOM   7729  N N   . VAL D 1 24  ? -0.868  -16.612 15.086  1.00 14.18 ? 24  VAL D N   1 
ATOM   7730  C CA  . VAL D 1 24  ? -1.867  -17.490 14.366  1.00 12.90 ? 24  VAL D CA  1 
ATOM   7731  C C   . VAL D 1 24  ? -1.603  -18.937 14.770  1.00 12.04 ? 24  VAL D C   1 
ATOM   7732  O O   . VAL D 1 24  ? -0.485  -19.498 14.655  1.00 11.92 ? 24  VAL D O   1 
ATOM   7733  C CB  . VAL D 1 24  ? -1.968  -17.116 12.898  1.00 12.72 ? 24  VAL D CB  1 
ATOM   7734  C CG1 . VAL D 1 24  ? -1.904  -15.594 12.644  1.00 12.52 ? 24  VAL D CG1 1 
ATOM   7735  C CG2 . VAL D 1 24  ? -0.976  -17.797 11.975  1.00 12.68 ? 24  VAL D CG2 1 
ATOM   7736  N N   . VAL D 1 25  ? -2.659  -19.517 15.363  1.00 10.80 ? 25  VAL D N   1 
ATOM   7737  C CA  . VAL D 1 25  ? -2.556  -20.929 15.829  1.00 9.51  ? 25  VAL D CA  1 
ATOM   7738  C C   . VAL D 1 25  ? -2.728  -21.818 14.588  1.00 8.80  ? 25  VAL D C   1 
ATOM   7739  O O   . VAL D 1 25  ? -3.723  -21.732 13.876  1.00 8.52  ? 25  VAL D O   1 
ATOM   7740  C CB  . VAL D 1 25  ? -3.503  -21.221 16.986  1.00 9.23  ? 25  VAL D CB  1 
ATOM   7741  C CG1 . VAL D 1 25  ? -3.716  -22.722 17.212  1.00 9.05  ? 25  VAL D CG1 1 
ATOM   7742  C CG2 . VAL D 1 25  ? -3.079  -20.559 18.293  1.00 8.89  ? 25  VAL D CG2 1 
ATOM   7743  N N   . GLY D 1 26  ? -1.703  -22.598 14.349  1.00 8.14  ? 26  GLY D N   1 
ATOM   7744  C CA  . GLY D 1 26  ? -1.622  -23.554 13.266  1.00 7.49  ? 26  GLY D CA  1 
ATOM   7745  C C   . GLY D 1 26  ? -1.526  -22.820 11.937  1.00 7.02  ? 26  GLY D C   1 
ATOM   7746  O O   . GLY D 1 26  ? -2.248  -21.859 11.706  1.00 7.09  ? 26  GLY D O   1 
ATOM   7747  N N   . VAL D 1 27  ? -0.690  -23.325 11.088  1.00 6.72  ? 27  VAL D N   1 
ATOM   7748  C CA  . VAL D 1 27  ? -0.362  -22.882 9.762   1.00 6.39  ? 27  VAL D CA  1 
ATOM   7749  C C   . VAL D 1 27  ? -0.832  -23.870 8.695   1.00 6.26  ? 27  VAL D C   1 
ATOM   7750  O O   . VAL D 1 27  ? -0.106  -24.129 7.711   1.00 6.19  ? 27  VAL D O   1 
ATOM   7751  C CB  . VAL D 1 27  ? 1.184   -22.690 9.678   1.00 6.37  ? 27  VAL D CB  1 
ATOM   7752  C CG1 . VAL D 1 27  ? 1.671   -21.611 10.614  1.00 6.42  ? 27  VAL D CG1 1 
ATOM   7753  C CG2 . VAL D 1 27  ? 1.896   -24.023 9.850   1.00 6.12  ? 27  VAL D CG2 1 
ATOM   7754  N N   . GLY D 1 28  ? -1.961  -24.489 8.953   1.00 6.22  ? 28  GLY D N   1 
ATOM   7755  C CA  . GLY D 1 28  ? -2.515  -25.396 7.865   1.00 6.54  ? 28  GLY D CA  1 
ATOM   7756  C C   . GLY D 1 28  ? -2.791  -24.377 6.749   1.00 6.72  ? 28  GLY D C   1 
ATOM   7757  O O   . GLY D 1 28  ? -3.126  -23.242 7.173   1.00 7.09  ? 28  GLY D O   1 
ATOM   7758  N N   . ASP D 1 29  ? -2.540  -24.664 5.524   1.00 6.69  ? 29  ASP D N   1 
ATOM   7759  C CA  . ASP D 1 29  ? -2.784  -23.800 4.365   1.00 6.57  ? 29  ASP D CA  1 
ATOM   7760  C C   . ASP D 1 29  ? -3.469  -22.461 4.713   1.00 5.98  ? 29  ASP D C   1 
ATOM   7761  O O   . ASP D 1 29  ? -2.979  -21.385 4.305   1.00 5.74  ? 29  ASP D O   1 
ATOM   7762  C CB  . ASP D 1 29  ? -3.514  -24.517 3.235   1.00 7.28  ? 29  ASP D CB  1 
ATOM   7763  C CG  . ASP D 1 29  ? -3.485  -26.010 3.172   1.00 8.18  ? 29  ASP D CG  1 
ATOM   7764  O OD1 . ASP D 1 29  ? -4.408  -26.673 2.611   1.00 8.28  ? 29  ASP D OD1 1 
ATOM   7765  O OD2 . ASP D 1 29  ? -2.589  -26.674 3.792   1.00 8.82  ? 29  ASP D OD2 1 
ATOM   7766  N N   . VAL D 1 30  ? -4.586  -22.533 5.376   1.00 5.35  ? 30  VAL D N   1 
ATOM   7767  C CA  . VAL D 1 30  ? -5.376  -21.420 5.868   1.00 4.87  ? 30  VAL D CA  1 
ATOM   7768  C C   . VAL D 1 30  ? -4.638  -20.591 6.913   1.00 4.50  ? 30  VAL D C   1 
ATOM   7769  O O   . VAL D 1 30  ? -4.477  -19.373 6.740   1.00 4.24  ? 30  VAL D O   1 
ATOM   7770  C CB  . VAL D 1 30  ? -6.730  -21.925 6.433   1.00 4.75  ? 30  VAL D CB  1 
ATOM   7771  C CG1 . VAL D 1 30  ? -7.672  -20.807 6.840   1.00 4.61  ? 30  VAL D CG1 1 
ATOM   7772  C CG2 . VAL D 1 30  ? -7.402  -22.858 5.454   1.00 4.91  ? 30  VAL D CG2 1 
ATOM   7773  N N   . GLY D 1 31  ? -4.347  -21.217 8.028   1.00 4.35  ? 31  GLY D N   1 
ATOM   7774  C CA  . GLY D 1 31  ? -3.635  -20.573 9.137   1.00 4.53  ? 31  GLY D CA  1 
ATOM   7775  C C   . GLY D 1 31  ? -2.524  -19.730 8.501   1.00 4.94  ? 31  GLY D C   1 
ATOM   7776  O O   . GLY D 1 31  ? -2.278  -18.581 8.880   1.00 5.20  ? 31  GLY D O   1 
ATOM   7777  N N   . MET D 1 32  ? -2.001  -20.286 7.421   1.00 5.00  ? 32  MET D N   1 
ATOM   7778  C CA  . MET D 1 32  ? -0.918  -19.764 6.641   1.00 5.05  ? 32  MET D CA  1 
ATOM   7779  C C   . MET D 1 32  ? -1.187  -18.659 5.637   1.00 5.05  ? 32  MET D C   1 
ATOM   7780  O O   . MET D 1 32  ? -0.273  -17.828 5.413   1.00 5.01  ? 32  MET D O   1 
ATOM   7781  C CB  . MET D 1 32  ? -0.277  -20.973 5.889   1.00 5.15  ? 32  MET D CB  1 
ATOM   7782  C CG  . MET D 1 32  ? 1.196   -20.646 5.748   1.00 5.51  ? 32  MET D CG  1 
ATOM   7783  S SD  . MET D 1 32  ? 1.801   -20.544 7.466   1.00 6.01  ? 32  MET D SD  1 
ATOM   7784  C CE  . MET D 1 32  ? 3.568   -20.354 7.216   1.00 5.89  ? 32  MET D CE  1 
ATOM   7785  N N   . ALA D 1 33  ? -2.246  -18.754 4.860   1.00 4.91  ? 33  ALA D N   1 
ATOM   7786  C CA  . ALA D 1 33  ? -2.646  -17.779 3.860   1.00 4.73  ? 33  ALA D CA  1 
ATOM   7787  C C   . ALA D 1 33  ? -3.140  -16.509 4.581   1.00 4.70  ? 33  ALA D C   1 
ATOM   7788  O O   . ALA D 1 33  ? -3.188  -15.412 4.053   1.00 4.89  ? 33  ALA D O   1 
ATOM   7789  C CB  . ALA D 1 33  ? -3.811  -18.232 2.994   1.00 4.77  ? 33  ALA D CB  1 
ATOM   7790  N N   . CYS D 1 34  ? -3.588  -16.827 5.760   1.00 4.50  ? 34  CYS D N   1 
ATOM   7791  C CA  . CYS D 1 34  ? -4.143  -15.787 6.692   1.00 4.01  ? 34  CYS D CA  1 
ATOM   7792  C C   . CYS D 1 34  ? -2.914  -15.220 7.370   1.00 3.67  ? 34  CYS D C   1 
ATOM   7793  O O   . CYS D 1 34  ? -2.949  -14.162 8.002   1.00 3.71  ? 34  CYS D O   1 
ATOM   7794  C CB  . CYS D 1 34  ? -5.225  -16.514 7.373   1.00 4.07  ? 34  CYS D CB  1 
ATOM   7795  S SG  . CYS D 1 34  ? -6.018  -16.080 8.836   1.00 4.43  ? 34  CYS D SG  1 
ATOM   7796  N N   . ALA D 1 35  ? -1.769  -15.846 7.096   1.00 3.29  ? 35  ALA D N   1 
ATOM   7797  C CA  . ALA D 1 35  ? -0.464  -15.361 7.556   1.00 3.06  ? 35  ALA D CA  1 
ATOM   7798  C C   . ALA D 1 35  ? 0.136   -14.393 6.536   1.00 2.83  ? 35  ALA D C   1 
ATOM   7799  O O   . ALA D 1 35  ? 0.045   -13.151 6.774   1.00 2.99  ? 35  ALA D O   1 
ATOM   7800  C CB  . ALA D 1 35  ? 0.474   -16.476 7.914   1.00 3.14  ? 35  ALA D CB  1 
ATOM   7801  N N   . ILE D 1 36  ? 0.734   -14.868 5.490   1.00 2.44  ? 36  ILE D N   1 
ATOM   7802  C CA  . ILE D 1 36  ? 1.353   -14.084 4.439   1.00 2.28  ? 36  ILE D CA  1 
ATOM   7803  C C   . ILE D 1 36  ? 0.679   -12.724 4.192   1.00 2.34  ? 36  ILE D C   1 
ATOM   7804  O O   . ILE D 1 36  ? 1.359   -11.691 4.032   1.00 2.00  ? 36  ILE D O   1 
ATOM   7805  C CB  . ILE D 1 36  ? 1.448   -14.874 3.085   1.00 2.14  ? 36  ILE D CB  1 
ATOM   7806  C CG1 . ILE D 1 36  ? 2.246   -14.057 2.046   1.00 2.16  ? 36  ILE D CG1 1 
ATOM   7807  C CG2 . ILE D 1 36  ? 0.043   -15.249 2.539   1.00 2.00  ? 36  ILE D CG2 1 
ATOM   7808  C CD1 . ILE D 1 36  ? 3.659   -13.594 2.469   1.00 2.31  ? 36  ILE D CD1 1 
ATOM   7809  N N   . SER D 1 37  ? -0.644  -12.794 4.065   1.00 2.37  ? 37  SER D N   1 
ATOM   7810  C CA  . SER D 1 37  ? -1.472  -11.599 3.833   1.00 2.32  ? 37  SER D CA  1 
ATOM   7811  C C   . SER D 1 37  ? -1.425  -10.631 4.999   1.00 2.54  ? 37  SER D C   1 
ATOM   7812  O O   . SER D 1 37  ? -1.422  -9.384  4.760   1.00 2.82  ? 37  SER D O   1 
ATOM   7813  C CB  . SER D 1 37  ? -2.902  -11.984 3.497   1.00 2.17  ? 37  SER D CB  1 
ATOM   7814  O OG  . SER D 1 37  ? -3.498  -10.925 2.775   1.00 2.19  ? 37  SER D OG  1 
ATOM   7815  N N   . ILE D 1 38  ? -1.463  -11.128 6.234   1.00 2.45  ? 38  ILE D N   1 
ATOM   7816  C CA  . ILE D 1 38  ? -1.286  -10.165 7.360   1.00 2.48  ? 38  ILE D CA  1 
ATOM   7817  C C   . ILE D 1 38  ? 0.041   -9.441  7.119   1.00 2.45  ? 38  ILE D C   1 
ATOM   7818  O O   . ILE D 1 38  ? 0.187   -8.265  7.460   1.00 2.17  ? 38  ILE D O   1 
ATOM   7819  C CB  . ILE D 1 38  ? -1.504  -10.820 8.740   1.00 2.53  ? 38  ILE D CB  1 
ATOM   7820  C CG1 . ILE D 1 38  ? -3.048  -10.845 9.019   1.00 2.48  ? 38  ILE D CG1 1 
ATOM   7821  C CG2 . ILE D 1 38  ? -0.711  -10.149 9.893   1.00 2.48  ? 38  ILE D CG2 1 
ATOM   7822  C CD1 . ILE D 1 38  ? -3.507  -11.511 10.325  1.00 2.37  ? 38  ILE D CD1 1 
ATOM   7823  N N   . LEU D 1 39  ? 0.929   -10.132 6.407   1.00 2.62  ? 39  LEU D N   1 
ATOM   7824  C CA  . LEU D 1 39  ? 2.259   -9.579  6.080   1.00 2.76  ? 39  LEU D CA  1 
ATOM   7825  C C   . LEU D 1 39  ? 2.210   -8.602  4.915   1.00 2.80  ? 39  LEU D C   1 
ATOM   7826  O O   . LEU D 1 39  ? 2.833   -7.504  4.973   1.00 2.81  ? 39  LEU D O   1 
ATOM   7827  C CB  . LEU D 1 39  ? 3.221   -10.764 5.942   1.00 2.74  ? 39  LEU D CB  1 
ATOM   7828  C CG  . LEU D 1 39  ? 3.349   -11.760 7.073   1.00 2.83  ? 39  LEU D CG  1 
ATOM   7829  C CD1 . LEU D 1 39  ? 3.684   -13.163 6.538   1.00 3.07  ? 39  LEU D CD1 1 
ATOM   7830  C CD2 . LEU D 1 39  ? 4.484   -11.371 8.011   1.00 2.73  ? 39  LEU D CD2 1 
ATOM   7831  N N   . LEU D 1 40  ? 1.472   -8.927  3.873   1.00 2.66  ? 40  LEU D N   1 
ATOM   7832  C CA  . LEU D 1 40  ? 1.390   -8.076  2.650   1.00 2.41  ? 40  LEU D CA  1 
ATOM   7833  C C   . LEU D 1 40  ? 0.506   -6.890  2.945   1.00 2.47  ? 40  LEU D C   1 
ATOM   7834  O O   . LEU D 1 40  ? -0.394  -6.444  2.224   1.00 2.57  ? 40  LEU D O   1 
ATOM   7835  C CB  . LEU D 1 40  ? 1.034   -9.028  1.513   1.00 2.19  ? 40  LEU D CB  1 
ATOM   7836  C CG  . LEU D 1 40  ? 2.088   -9.958  0.937   1.00 2.06  ? 40  LEU D CG  1 
ATOM   7837  C CD1 . LEU D 1 40  ? 2.936   -9.311  -0.153  1.00 2.00  ? 40  LEU D CD1 1 
ATOM   7838  C CD2 . LEU D 1 40  ? 3.078   -10.454 1.988   1.00 2.00  ? 40  LEU D CD2 1 
ATOM   7839  N N   . LYS D 1 41  ? 0.761   -6.344  4.097   1.00 2.60  ? 41  LYS D N   1 
ATOM   7840  C CA  . LYS D 1 41  ? 0.082   -5.209  4.749   1.00 2.70  ? 41  LYS D CA  1 
ATOM   7841  C C   . LYS D 1 41  ? 0.884   -4.942  6.019   1.00 2.82  ? 41  LYS D C   1 
ATOM   7842  O O   . LYS D 1 41  ? 1.899   -5.678  6.252   1.00 2.98  ? 41  LYS D O   1 
ATOM   7843  C CB  . LYS D 1 41  ? -1.380  -5.416  5.000   1.00 2.57  ? 41  LYS D CB  1 
ATOM   7844  C CG  . LYS D 1 41  ? -2.358  -4.689  4.071   1.00 2.64  ? 41  LYS D CG  1 
ATOM   7845  C CD  . LYS D 1 41  ? -2.513  -3.194  4.442   1.00 2.66  ? 41  LYS D CD  1 
ATOM   7846  C CE  . LYS D 1 41  ? -3.784  -2.542  3.911   1.00 2.38  ? 41  LYS D CE  1 
ATOM   7847  N NZ  . LYS D 1 41  ? -4.218  -1.403  4.744   1.00 2.00  ? 41  LYS D NZ  1 
ATOM   7848  N N   . GLY D 1 42  ? 0.522   -3.922  6.739   1.00 2.88  ? 42  GLY D N   1 
ATOM   7849  C CA  . GLY D 1 42  ? 1.367   -3.582  7.938   1.00 3.16  ? 42  GLY D CA  1 
ATOM   7850  C C   . GLY D 1 42  ? 0.438   -3.672  9.116   1.00 3.46  ? 42  GLY D C   1 
ATOM   7851  O O   . GLY D 1 42  ? 0.045   -2.617  9.661   1.00 3.98  ? 42  GLY D O   1 
ATOM   7852  N N   . LEU D 1 43  ? 0.003   -4.868  9.400   1.00 3.55  ? 43  LEU D N   1 
ATOM   7853  C CA  . LEU D 1 43  ? -0.963  -4.966  10.558  1.00 3.87  ? 43  LEU D CA  1 
ATOM   7854  C C   . LEU D 1 43  ? -0.128  -5.197  11.799  1.00 4.25  ? 43  LEU D C   1 
ATOM   7855  O O   . LEU D 1 43  ? -0.358  -4.570  12.860  1.00 4.20  ? 43  LEU D O   1 
ATOM   7856  C CB  . LEU D 1 43  ? -2.031  -5.935  10.078  1.00 3.57  ? 43  LEU D CB  1 
ATOM   7857  C CG  . LEU D 1 43  ? -3.110  -5.338  9.180   1.00 3.54  ? 43  LEU D CG  1 
ATOM   7858  C CD1 . LEU D 1 43  ? -2.566  -4.661  7.948   1.00 3.48  ? 43  LEU D CD1 1 
ATOM   7859  C CD2 . LEU D 1 43  ? -4.076  -6.442  8.712   1.00 3.59  ? 43  LEU D CD2 1 
ATOM   7860  N N   . ALA D 1 44  ? 0.993   -5.928  11.606  1.00 4.50  ? 44  ALA D N   1 
ATOM   7861  C CA  . ALA D 1 44  ? 1.747   -6.315  12.803  1.00 4.94  ? 44  ALA D CA  1 
ATOM   7862  C C   . ALA D 1 44  ? 3.246   -6.303  12.614  1.00 5.35  ? 44  ALA D C   1 
ATOM   7863  O O   . ALA D 1 44  ? 3.780   -6.797  11.639  1.00 5.21  ? 44  ALA D O   1 
ATOM   7864  C CB  . ALA D 1 44  ? 1.209   -7.671  13.245  1.00 4.98  ? 44  ALA D CB  1 
ATOM   7865  N N   . ASP D 1 45  ? 3.891   -5.797  13.642  1.00 5.83  ? 45  ASP D N   1 
ATOM   7866  C CA  . ASP D 1 45  ? 5.346   -5.652  13.719  1.00 6.44  ? 45  ASP D CA  1 
ATOM   7867  C C   . ASP D 1 45  ? 5.956   -6.855  14.422  1.00 6.66  ? 45  ASP D C   1 
ATOM   7868  O O   . ASP D 1 45  ? 7.202   -6.936  14.546  1.00 6.86  ? 45  ASP D O   1 
ATOM   7869  C CB  . ASP D 1 45  ? 5.632   -4.306  14.409  1.00 6.78  ? 45  ASP D CB  1 
ATOM   7870  C CG  . ASP D 1 45  ? 4.786   -4.233  15.693  1.00 6.98  ? 45  ASP D CG  1 
ATOM   7871  O OD1 . ASP D 1 45  ? 4.419   -5.306  16.194  1.00 6.89  ? 45  ASP D OD1 1 
ATOM   7872  O OD2 . ASP D 1 45  ? 4.480   -3.096  16.092  1.00 7.30  ? 45  ASP D OD2 1 
ATOM   7873  N N   . GLU D 1 46  ? 5.109   -7.668  15.028  1.00 6.78  ? 46  GLU D N   1 
ATOM   7874  C CA  . GLU D 1 46  ? 5.502   -8.957  15.626  1.00 6.71  ? 46  GLU D CA  1 
ATOM   7875  C C   . GLU D 1 46  ? 4.284   -9.872  15.359  1.00 6.64  ? 46  GLU D C   1 
ATOM   7876  O O   . GLU D 1 46  ? 3.132   -9.520  15.619  1.00 6.42  ? 46  GLU D O   1 
ATOM   7877  C CB  . GLU D 1 46  ? 5.866   -9.068  17.090  1.00 6.61  ? 46  GLU D CB  1 
ATOM   7878  C CG  . GLU D 1 46  ? 6.425   -10.372 17.608  1.00 6.62  ? 46  GLU D CG  1 
ATOM   7879  C CD  . GLU D 1 46  ? 6.741   -10.743 18.987  1.00 6.62  ? 46  GLU D CD  1 
ATOM   7880  O OE1 . GLU D 1 46  ? 7.273   -10.118 19.884  1.00 6.68  ? 46  GLU D OE1 1 
ATOM   7881  O OE2 . GLU D 1 46  ? 6.447   -11.939 19.322  1.00 6.52  ? 46  GLU D OE2 1 
ATOM   7882  N N   . LEU D 1 47  ? 4.606   -10.928 14.673  1.00 6.86  ? 47  LEU D N   1 
ATOM   7883  C CA  . LEU D 1 47  ? 3.617   -11.970 14.326  1.00 7.09  ? 47  LEU D CA  1 
ATOM   7884  C C   . LEU D 1 47  ? 4.262   -13.302 14.710  1.00 7.32  ? 47  LEU D C   1 
ATOM   7885  O O   . LEU D 1 47  ? 5.283   -13.674 14.140  1.00 7.34  ? 47  LEU D O   1 
ATOM   7886  C CB  . LEU D 1 47  ? 3.180   -11.777 12.900  1.00 6.96  ? 47  LEU D CB  1 
ATOM   7887  C CG  . LEU D 1 47  ? 2.486   -12.929 12.187  1.00 6.91  ? 47  LEU D CG  1 
ATOM   7888  C CD1 . LEU D 1 47  ? 1.628   -12.410 11.031  1.00 6.83  ? 47  LEU D CD1 1 
ATOM   7889  C CD2 . LEU D 1 47  ? 3.543   -13.888 11.640  1.00 6.84  ? 47  LEU D CD2 1 
ATOM   7890  N N   . ALA D 1 48  ? 3.709   -13.887 15.729  1.00 7.80  ? 48  ALA D N   1 
ATOM   7891  C CA  . ALA D 1 48  ? 4.161   -15.155 16.308  1.00 8.58  ? 48  ALA D CA  1 
ATOM   7892  C C   . ALA D 1 48  ? 3.294   -16.290 15.795  1.00 9.27  ? 48  ALA D C   1 
ATOM   7893  O O   . ALA D 1 48  ? 2.033   -16.145 15.836  1.00 9.86  ? 48  ALA D O   1 
ATOM   7894  C CB  . ALA D 1 48  ? 4.097   -15.036 17.824  1.00 8.46  ? 48  ALA D CB  1 
ATOM   7895  N N   . LEU D 1 49  ? 3.892   -17.397 15.407  1.00 9.67  ? 49  LEU D N   1 
ATOM   7896  C CA  . LEU D 1 49  ? 3.012   -18.473 14.846  1.00 10.46 ? 49  LEU D CA  1 
ATOM   7897  C C   . LEU D 1 49  ? 3.136   -19.728 15.675  1.00 11.22 ? 49  LEU D C   1 
ATOM   7898  O O   . LEU D 1 49  ? 4.186   -20.368 15.742  1.00 11.30 ? 49  LEU D O   1 
ATOM   7899  C CB  . LEU D 1 49  ? 3.264   -18.451 13.363  1.00 10.27 ? 49  LEU D CB  1 
ATOM   7900  C CG  . LEU D 1 49  ? 4.515   -17.884 12.748  1.00 10.09 ? 49  LEU D CG  1 
ATOM   7901  C CD1 . LEU D 1 49  ? 5.652   -18.896 12.657  1.00 10.00 ? 49  LEU D CD1 1 
ATOM   7902  C CD2 . LEU D 1 49  ? 4.208   -17.403 11.333  1.00 10.01 ? 49  LEU D CD2 1 
ATOM   7903  N N   . VAL D 1 50  ? 2.036   -20.095 16.333  1.00 12.16 ? 50  VAL D N   1 
ATOM   7904  C CA  . VAL D 1 50  ? 1.973   -21.269 17.208  1.00 13.20 ? 50  VAL D CA  1 
ATOM   7905  C C   . VAL D 1 50  ? 1.288   -22.467 16.560  1.00 14.30 ? 50  VAL D C   1 
ATOM   7906  O O   . VAL D 1 50  ? 0.082   -22.461 16.282  1.00 14.55 ? 50  VAL D O   1 
ATOM   7907  C CB  . VAL D 1 50  ? 1.363   -20.861 18.565  1.00 12.83 ? 50  VAL D CB  1 
ATOM   7908  C CG1 . VAL D 1 50  ? 1.147   -22.037 19.508  1.00 12.79 ? 50  VAL D CG1 1 
ATOM   7909  C CG2 . VAL D 1 50  ? 2.222   -19.797 19.224  1.00 12.81 ? 50  VAL D CG2 1 
ATOM   7910  N N   . ASP D 1 51  ? 2.054   -23.526 16.418  1.00 15.48 ? 51  ASP D N   1 
ATOM   7911  C CA  . ASP D 1 51  ? 1.613   -24.809 15.837  1.00 16.77 ? 51  ASP D CA  1 
ATOM   7912  C C   . ASP D 1 51  ? 2.175   -25.943 16.717  1.00 17.69 ? 51  ASP D C   1 
ATOM   7913  O O   . ASP D 1 51  ? 3.136   -25.687 17.475  1.00 17.90 ? 51  ASP D O   1 
ATOM   7914  C CB  . ASP D 1 51  ? 2.060   -24.910 14.410  1.00 16.75 ? 51  ASP D CB  1 
ATOM   7915  C CG  . ASP D 1 51  ? 1.212   -25.689 13.455  1.00 16.76 ? 51  ASP D CG  1 
ATOM   7916  O OD1 . ASP D 1 51  ? 0.081   -26.066 13.801  1.00 16.99 ? 51  ASP D OD1 1 
ATOM   7917  O OD2 . ASP D 1 51  ? 1.664   -25.899 12.310  1.00 16.55 ? 51  ASP D OD2 1 
ATOM   7918  N N   . ALA D 1 52  ? 1.587   -27.115 16.587  1.00 18.62 ? 52  ALA D N   1 
ATOM   7919  C CA  . ALA D 1 52  ? 2.019   -28.261 17.397  1.00 19.84 ? 52  ALA D CA  1 
ATOM   7920  C C   . ALA D 1 52  ? 2.772   -29.268 16.528  1.00 20.68 ? 52  ALA D C   1 
ATOM   7921  O O   . ALA D 1 52  ? 3.271   -30.271 17.064  1.00 21.02 ? 52  ALA D O   1 
ATOM   7922  C CB  . ALA D 1 52  ? 0.855   -28.997 18.057  1.00 19.81 ? 52  ALA D CB  1 
ATOM   7923  N N   . ASP D 1 53  ? 2.778   -28.957 15.258  1.00 21.45 ? 53  ASP D N   1 
ATOM   7924  C CA  . ASP D 1 53  ? 3.355   -29.867 14.230  1.00 21.97 ? 53  ASP D CA  1 
ATOM   7925  C C   . ASP D 1 53  ? 4.732   -29.286 13.890  1.00 21.84 ? 53  ASP D C   1 
ATOM   7926  O O   . ASP D 1 53  ? 5.135   -29.058 12.771  1.00 21.72 ? 53  ASP D O   1 
ATOM   7927  C CB  . ASP D 1 53  ? 2.376   -30.152 13.138  1.00 22.75 ? 53  ASP D CB  1 
ATOM   7928  C CG  . ASP D 1 53  ? 1.074   -29.411 13.023  1.00 23.57 ? 53  ASP D CG  1 
ATOM   7929  O OD1 . ASP D 1 53  ? 0.270   -29.664 12.065  1.00 24.00 ? 53  ASP D OD1 1 
ATOM   7930  O OD2 . ASP D 1 53  ? 0.691   -28.554 13.867  1.00 23.82 ? 53  ASP D OD2 1 
ATOM   7931  N N   . THR D 1 54  ? 5.399   -29.014 14.977  1.00 21.88 ? 54  THR D N   1 
ATOM   7932  C CA  . THR D 1 54  ? 6.737   -28.510 15.188  1.00 22.01 ? 54  THR D CA  1 
ATOM   7933  C C   . THR D 1 54  ? 7.643   -28.507 13.982  1.00 22.20 ? 54  THR D C   1 
ATOM   7934  O O   . THR D 1 54  ? 8.472   -27.601 13.757  1.00 22.07 ? 54  THR D O   1 
ATOM   7935  C CB  . THR D 1 54  ? 7.351   -29.392 16.385  1.00 21.88 ? 54  THR D CB  1 
ATOM   7936  O OG1 . THR D 1 54  ? 8.537   -28.751 16.866  1.00 21.78 ? 54  THR D OG1 1 
ATOM   7937  C CG2 . THR D 1 54  ? 7.608   -30.854 15.972  1.00 21.89 ? 54  THR D CG2 1 
ATOM   7938  N N   . ASP D 1 55  ? 7.536   -29.574 13.219  1.00 22.52 ? 55  ASP D N   1 
ATOM   7939  C CA  . ASP D 1 55  ? 8.277   -29.882 11.995  1.00 22.65 ? 55  ASP D CA  1 
ATOM   7940  C C   . ASP D 1 55  ? 7.997   -28.775 10.963  1.00 22.20 ? 55  ASP D C   1 
ATOM   7941  O O   . ASP D 1 55  ? 8.744   -27.789 10.950  1.00 22.28 ? 55  ASP D O   1 
ATOM   7942  C CB  . ASP D 1 55  ? 7.977   -31.273 11.484  1.00 23.42 ? 55  ASP D CB  1 
ATOM   7943  C CG  . ASP D 1 55  ? 8.275   -32.517 12.268  1.00 24.00 ? 55  ASP D CG  1 
ATOM   7944  O OD1 . ASP D 1 55  ? 7.690   -32.845 13.335  1.00 24.22 ? 55  ASP D OD1 1 
ATOM   7945  O OD2 . ASP D 1 55  ? 9.104   -33.337 11.731  1.00 24.15 ? 55  ASP D OD2 1 
ATOM   7946  N N   . LYS D 1 56  ? 6.923   -28.911 10.225  1.00 21.64 ? 56  LYS D N   1 
ATOM   7947  C CA  . LYS D 1 56  ? 6.462   -27.970 9.207   1.00 21.02 ? 56  LYS D CA  1 
ATOM   7948  C C   . LYS D 1 56  ? 6.550   -26.504 9.645   1.00 20.49 ? 56  LYS D C   1 
ATOM   7949  O O   . LYS D 1 56  ? 6.750   -25.595 8.816   1.00 20.33 ? 56  LYS D O   1 
ATOM   7950  C CB  . LYS D 1 56  ? 5.000   -28.230 8.758   1.00 20.90 ? 56  LYS D CB  1 
ATOM   7951  C CG  . LYS D 1 56  ? 4.310   -27.055 8.121   1.00 20.82 ? 56  LYS D CG  1 
ATOM   7952  C CD  . LYS D 1 56  ? 3.192   -27.273 7.148   1.00 20.86 ? 56  LYS D CD  1 
ATOM   7953  C CE  . LYS D 1 56  ? 2.404   -25.971 6.969   1.00 20.89 ? 56  LYS D CE  1 
ATOM   7954  N NZ  . LYS D 1 56  ? 1.719   -25.879 5.671   1.00 20.94 ? 56  LYS D NZ  1 
ATOM   7955  N N   . LEU D 1 57  ? 6.205   -26.280 10.903  1.00 19.81 ? 57  LEU D N   1 
ATOM   7956  C CA  . LEU D 1 57  ? 6.238   -24.904 11.379  1.00 19.16 ? 57  LEU D CA  1 
ATOM   7957  C C   . LEU D 1 57  ? 7.624   -24.301 11.241  1.00 18.73 ? 57  LEU D C   1 
ATOM   7958  O O   . LEU D 1 57  ? 7.735   -23.377 10.414  1.00 18.83 ? 57  LEU D O   1 
ATOM   7959  C CB  . LEU D 1 57  ? 5.636   -24.792 12.765  1.00 19.22 ? 57  LEU D CB  1 
ATOM   7960  C CG  . LEU D 1 57  ? 5.004   -23.453 13.073  1.00 19.30 ? 57  LEU D CG  1 
ATOM   7961  C CD1 . LEU D 1 57  ? 5.850   -22.263 12.666  1.00 19.40 ? 57  LEU D CD1 1 
ATOM   7962  C CD2 . LEU D 1 57  ? 3.707   -23.371 12.270  1.00 19.56 ? 57  LEU D CD2 1 
ATOM   7963  N N   . ARG D 1 58  ? 8.613   -24.792 11.960  1.00 18.12 ? 58  ARG D N   1 
ATOM   7964  C CA  . ARG D 1 58  ? 9.958   -24.197 11.929  1.00 17.42 ? 58  ARG D CA  1 
ATOM   7965  C C   . ARG D 1 58  ? 10.481  -24.212 10.478  1.00 16.57 ? 58  ARG D C   1 
ATOM   7966  O O   . ARG D 1 58  ? 11.637  -23.810 10.308  1.00 16.41 ? 58  ARG D O   1 
ATOM   7967  C CB  . ARG D 1 58  ? 11.002  -24.813 12.768  1.00 17.96 ? 58  ARG D CB  1 
ATOM   7968  C CG  . ARG D 1 58  ? 11.128  -25.290 14.161  1.00 18.45 ? 58  ARG D CG  1 
ATOM   7969  C CD  . ARG D 1 58  ? 12.489  -25.986 14.335  1.00 18.82 ? 58  ARG D CD  1 
ATOM   7970  N NE  . ARG D 1 58  ? 13.477  -25.345 15.060  1.00 19.02 ? 58  ARG D NE  1 
ATOM   7971  C CZ  . ARG D 1 58  ? 14.045  -24.285 15.599  1.00 19.18 ? 58  ARG D CZ  1 
ATOM   7972  N NH1 . ARG D 1 58  ? 15.283  -24.398 16.252  1.00 19.28 ? 58  ARG D NH1 1 
ATOM   7973  N NH2 . ARG D 1 58  ? 13.608  -23.036 15.350  1.00 19.11 ? 58  ARG D NH2 1 
ATOM   7974  N N   . GLY D 1 59  ? 9.744   -24.801 9.594   1.00 15.81 ? 59  GLY D N   1 
ATOM   7975  C CA  . GLY D 1 59  ? 10.087  -24.853 8.164   1.00 15.15 ? 59  GLY D CA  1 
ATOM   7976  C C   . GLY D 1 59  ? 9.455   -23.622 7.494   1.00 14.70 ? 59  GLY D C   1 
ATOM   7977  O O   . GLY D 1 59  ? 10.108  -22.732 6.956   1.00 14.54 ? 59  GLY D O   1 
ATOM   7978  N N   . GLU D 1 60  ? 8.138   -23.593 7.613   1.00 14.40 ? 60  GLU D N   1 
ATOM   7979  C CA  . GLU D 1 60  ? 7.269   -22.529 7.116   1.00 13.76 ? 60  GLU D CA  1 
ATOM   7980  C C   . GLU D 1 60  ? 7.679   -21.194 7.734   1.00 13.08 ? 60  GLU D C   1 
ATOM   7981  O O   . GLU D 1 60  ? 7.736   -20.201 7.004   1.00 13.03 ? 60  GLU D O   1 
ATOM   7982  C CB  . GLU D 1 60  ? 5.795   -22.708 7.441   1.00 13.94 ? 60  GLU D CB  1 
ATOM   7983  C CG  . GLU D 1 60  ? 4.932   -23.702 6.714   1.00 14.05 ? 60  GLU D CG  1 
ATOM   7984  C CD  . GLU D 1 60  ? 4.160   -23.284 5.518   1.00 14.16 ? 60  GLU D CD  1 
ATOM   7985  O OE1 . GLU D 1 60  ? 3.077   -23.761 5.188   1.00 14.23 ? 60  GLU D OE1 1 
ATOM   7986  O OE2 . GLU D 1 60  ? 4.709   -22.389 4.839   1.00 14.26 ? 60  GLU D OE2 1 
ATOM   7987  N N   . ALA D 1 61  ? 7.892   -21.230 9.030   1.00 12.38 ? 61  ALA D N   1 
ATOM   7988  C CA  . ALA D 1 61  ? 8.305   -20.030 9.777   1.00 11.98 ? 61  ALA D CA  1 
ATOM   7989  C C   . ALA D 1 61  ? 9.571   -19.454 9.134   1.00 11.73 ? 61  ALA D C   1 
ATOM   7990  O O   . ALA D 1 61  ? 9.556   -18.282 8.685   1.00 11.79 ? 61  ALA D O   1 
ATOM   7991  C CB  . ALA D 1 61  ? 8.441   -20.333 11.245  1.00 11.85 ? 61  ALA D CB  1 
ATOM   7992  N N   . LEU D 1 62  ? 10.602  -20.282 9.006   1.00 11.08 ? 62  LEU D N   1 
ATOM   7993  C CA  . LEU D 1 62  ? 11.886  -19.920 8.433   1.00 10.23 ? 62  LEU D CA  1 
ATOM   7994  C C   . LEU D 1 62  ? 11.786  -19.431 6.995   1.00 9.45  ? 62  LEU D C   1 
ATOM   7995  O O   . LEU D 1 62  ? 12.688  -18.741 6.517   1.00 9.26  ? 62  LEU D O   1 
ATOM   7996  C CB  . LEU D 1 62  ? 12.853  -21.121 8.547   1.00 10.45 ? 62  LEU D CB  1 
ATOM   7997  C CG  . LEU D 1 62  ? 13.811  -21.000 9.728   1.00 10.73 ? 62  LEU D CG  1 
ATOM   7998  C CD1 . LEU D 1 62  ? 14.292  -22.366 10.199  1.00 10.81 ? 62  LEU D CD1 1 
ATOM   7999  C CD2 . LEU D 1 62  ? 15.002  -20.138 9.284   1.00 10.72 ? 62  LEU D CD2 1 
ATOM   8000  N N   . ASP D 1 63  ? 10.743  -19.888 6.357   1.00 8.73  ? 63  ASP D N   1 
ATOM   8001  C CA  . ASP D 1 63  ? 10.465  -19.492 4.958   1.00 8.22  ? 63  ASP D CA  1 
ATOM   8002  C C   . ASP D 1 63  ? 10.126  -17.999 5.021   1.00 8.08  ? 63  ASP D C   1 
ATOM   8003  O O   . ASP D 1 63  ? 10.796  -17.197 4.350   1.00 8.38  ? 63  ASP D O   1 
ATOM   8004  C CB  . ASP D 1 63  ? 9.398   -20.362 4.342   1.00 7.95  ? 63  ASP D CB  1 
ATOM   8005  C CG  . ASP D 1 63  ? 9.328   -20.381 2.837   1.00 7.55  ? 63  ASP D CG  1 
ATOM   8006  O OD1 . ASP D 1 63  ? 8.496   -21.096 2.246   1.00 7.20  ? 63  ASP D OD1 1 
ATOM   8007  O OD2 . ASP D 1 63  ? 10.185  -19.691 2.251   1.00 7.41  ? 63  ASP D OD2 1 
ATOM   8008  N N   . LEU D 1 64  ? 9.163   -17.691 5.889   1.00 7.57  ? 64  LEU D N   1 
ATOM   8009  C CA  . LEU D 1 64  ? 8.785   -16.275 6.076   1.00 7.08  ? 64  LEU D CA  1 
ATOM   8010  C C   . LEU D 1 64  ? 10.009  -15.484 6.531   1.00 6.98  ? 64  LEU D C   1 
ATOM   8011  O O   . LEU D 1 64  ? 10.243  -14.388 6.002   1.00 7.07  ? 64  LEU D O   1 
ATOM   8012  C CB  . LEU D 1 64  ? 7.575   -16.198 6.975   1.00 6.92  ? 64  LEU D CB  1 
ATOM   8013  C CG  . LEU D 1 64  ? 6.251   -16.724 6.506   1.00 6.94  ? 64  LEU D CG  1 
ATOM   8014  C CD1 . LEU D 1 64  ? 5.123   -16.442 7.505   1.00 6.98  ? 64  LEU D CD1 1 
ATOM   8015  C CD2 . LEU D 1 64  ? 5.857   -16.082 5.178   1.00 6.95  ? 64  LEU D CD2 1 
ATOM   8016  N N   . GLN D 1 65  ? 10.813  -16.079 7.394   1.00 6.93  ? 65  GLN D N   1 
ATOM   8017  C CA  . GLN D 1 65  ? 11.984  -15.375 7.969   1.00 6.88  ? 65  GLN D CA  1 
ATOM   8018  C C   . GLN D 1 65  ? 12.966  -15.052 6.864   1.00 6.72  ? 65  GLN D C   1 
ATOM   8019  O O   . GLN D 1 65  ? 13.296  -13.860 6.697   1.00 6.74  ? 65  GLN D O   1 
ATOM   8020  C CB  . GLN D 1 65  ? 12.570  -16.071 9.176   1.00 7.11  ? 65  GLN D CB  1 
ATOM   8021  C CG  . GLN D 1 65  ? 12.251  -15.371 10.478  1.00 7.55  ? 65  GLN D CG  1 
ATOM   8022  C CD  . GLN D 1 65  ? 12.538  -16.155 11.725  1.00 7.98  ? 65  GLN D CD  1 
ATOM   8023  O OE1 . GLN D 1 65  ? 11.831  -16.062 12.747  1.00 8.08  ? 65  GLN D OE1 1 
ATOM   8024  N NE2 . GLN D 1 65  ? 13.616  -16.954 11.756  1.00 8.07  ? 65  GLN D NE2 1 
ATOM   8025  N N   . HIS D 1 66  ? 13.342  -16.028 6.068   1.00 6.54  ? 66  HIS D N   1 
ATOM   8026  C CA  . HIS D 1 66  ? 14.226  -15.794 4.934   1.00 6.46  ? 66  HIS D CA  1 
ATOM   8027  C C   . HIS D 1 66  ? 13.641  -14.639 4.100   1.00 6.58  ? 66  HIS D C   1 
ATOM   8028  O O   . HIS D 1 66  ? 14.349  -14.022 3.319   1.00 6.62  ? 66  HIS D O   1 
ATOM   8029  C CB  . HIS D 1 66  ? 14.393  -16.935 3.914   1.00 6.37  ? 66  HIS D CB  1 
ATOM   8030  C CG  . HIS D 1 66  ? 15.262  -18.064 4.342   1.00 6.28  ? 66  HIS D CG  1 
ATOM   8031  N ND1 . HIS D 1 66  ? 15.328  -19.263 3.670   1.00 6.27  ? 66  HIS D ND1 1 
ATOM   8032  C CD2 . HIS D 1 66  ? 16.072  -18.192 5.432   1.00 6.19  ? 66  HIS D CD2 1 
ATOM   8033  C CE1 . HIS D 1 66  ? 16.165  -20.063 4.313   1.00 6.33  ? 66  HIS D CE1 1 
ATOM   8034  N NE2 . HIS D 1 66  ? 16.637  -19.419 5.371   1.00 6.34  ? 66  HIS D NE2 1 
ATOM   8035  N N   . GLY D 1 67  ? 12.344  -14.509 4.217   1.00 6.75  ? 67  GLY D N   1 
ATOM   8036  C CA  . GLY D 1 67  ? 11.545  -13.554 3.486   1.00 7.00  ? 67  GLY D CA  1 
ATOM   8037  C C   . GLY D 1 67  ? 11.628  -12.137 3.975   1.00 7.10  ? 67  GLY D C   1 
ATOM   8038  O O   . GLY D 1 67  ? 11.217  -11.223 3.208   1.00 7.28  ? 67  GLY D O   1 
ATOM   8039  N N   . SER D 1 68  ? 12.110  -11.941 5.164   1.00 7.20  ? 68  SER D N   1 
ATOM   8040  C CA  . SER D 1 68  ? 12.288  -10.606 5.742   1.00 7.69  ? 68  SER D CA  1 
ATOM   8041  C C   . SER D 1 68  ? 12.371  -9.482  4.730   1.00 7.91  ? 68  SER D C   1 
ATOM   8042  O O   . SER D 1 68  ? 11.317  -8.815  4.599   1.00 8.14  ? 68  SER D O   1 
ATOM   8043  C CB  . SER D 1 68  ? 13.483  -10.626 6.701   1.00 7.75  ? 68  SER D CB  1 
ATOM   8044  O OG  . SER D 1 68  ? 13.049  -11.380 7.855   1.00 7.91  ? 68  SER D OG  1 
ATOM   8045  N N   . LEU D 1 69  ? 13.421  -9.284  4.002   1.00 8.05  ? 69  LEU D N   1 
ATOM   8046  C CA  . LEU D 1 69  ? 13.640  -8.232  3.029   1.00 8.36  ? 69  LEU D CA  1 
ATOM   8047  C C   . LEU D 1 69  ? 12.497  -8.073  2.045   1.00 9.00  ? 69  LEU D C   1 
ATOM   8048  O O   . LEU D 1 69  ? 12.615  -8.315  0.826   1.00 9.13  ? 69  LEU D O   1 
ATOM   8049  C CB  . LEU D 1 69  ? 14.995  -8.551  2.317   1.00 8.09  ? 69  LEU D CB  1 
ATOM   8050  C CG  . LEU D 1 69  ? 15.508  -7.576  1.264   1.00 7.64  ? 69  LEU D CG  1 
ATOM   8051  C CD1 . LEU D 1 69  ? 16.587  -6.660  1.801   1.00 7.46  ? 69  LEU D CD1 1 
ATOM   8052  C CD2 . LEU D 1 69  ? 16.075  -8.351  0.095   1.00 7.54  ? 69  LEU D CD2 1 
ATOM   8053  N N   . PHE D 1 70  ? 11.388  -7.564  2.504   1.00 9.67  ? 70  PHE D N   1 
ATOM   8054  C CA  . PHE D 1 70  ? 10.136  -7.299  1.823   1.00 9.89  ? 70  PHE D CA  1 
ATOM   8055  C C   . PHE D 1 70  ? 9.092   -6.942  2.902   1.00 10.09 ? 70  PHE D C   1 
ATOM   8056  O O   . PHE D 1 70  ? 8.265   -6.031  2.652   1.00 10.47 ? 70  PHE D O   1 
ATOM   8057  C CB  . PHE D 1 70  ? 9.616   -8.418  0.928   1.00 9.89  ? 70  PHE D CB  1 
ATOM   8058  C CG  . PHE D 1 70  ? 8.353   -8.089  0.190   1.00 10.03 ? 70  PHE D CG  1 
ATOM   8059  C CD1 . PHE D 1 70  ? 8.373   -8.012  -1.202  1.00 10.33 ? 70  PHE D CD1 1 
ATOM   8060  C CD2 . PHE D 1 70  ? 7.146   -7.847  0.840   1.00 9.92  ? 70  PHE D CD2 1 
ATOM   8061  C CE1 . PHE D 1 70  ? 7.215   -7.700  -1.931  1.00 10.39 ? 70  PHE D CE1 1 
ATOM   8062  C CE2 . PHE D 1 70  ? 6.005   -7.442  0.172   1.00 9.90  ? 70  PHE D CE2 1 
ATOM   8063  C CZ  . PHE D 1 70  ? 6.032   -7.405  -1.225  1.00 10.19 ? 70  PHE D CZ  1 
ATOM   8064  N N   . LEU D 1 71  ? 9.141   -7.612  4.004   1.00 10.15 ? 71  LEU D N   1 
ATOM   8065  C CA  . LEU D 1 71  ? 8.165   -7.350  5.079   1.00 10.77 ? 71  LEU D CA  1 
ATOM   8066  C C   . LEU D 1 71  ? 8.432   -6.011  5.751   1.00 10.89 ? 71  LEU D C   1 
ATOM   8067  O O   . LEU D 1 71  ? 9.565   -5.527  5.666   1.00 10.99 ? 71  LEU D O   1 
ATOM   8068  C CB  . LEU D 1 71  ? 8.197   -8.562  6.003   1.00 11.10 ? 71  LEU D CB  1 
ATOM   8069  C CG  . LEU D 1 71  ? 8.301   -9.966  5.461   1.00 11.17 ? 71  LEU D CG  1 
ATOM   8070  C CD1 . LEU D 1 71  ? 7.848   -10.953 6.547   1.00 11.17 ? 71  LEU D CD1 1 
ATOM   8071  C CD2 . LEU D 1 71  ? 7.445   -10.152 4.208   1.00 11.18 ? 71  LEU D CD2 1 
ATOM   8072  N N   . SER D 1 72  ? 7.410   -5.463  6.367   1.00 11.14 ? 72  SER D N   1 
ATOM   8073  C CA  . SER D 1 72  ? 7.446   -4.233  7.152   1.00 11.51 ? 72  SER D CA  1 
ATOM   8074  C C   . SER D 1 72  ? 7.094   -4.623  8.612   1.00 11.50 ? 72  SER D C   1 
ATOM   8075  O O   . SER D 1 72  ? 6.404   -3.887  9.317   1.00 11.44 ? 72  SER D O   1 
ATOM   8076  C CB  . SER D 1 72  ? 6.492   -3.154  6.750   1.00 11.94 ? 72  SER D CB  1 
ATOM   8077  O OG  . SER D 1 72  ? 6.841   -2.207  5.778   1.00 12.61 ? 72  SER D OG  1 
ATOM   8078  N N   . THR D 1 73  ? 7.536   -5.787  8.961   1.00 11.61 ? 73  THR D N   1 
ATOM   8079  C CA  . THR D 1 73  ? 7.328   -6.411  10.272  1.00 11.96 ? 73  THR D CA  1 
ATOM   8080  C C   . THR D 1 73  ? 8.616   -7.157  10.596  1.00 12.28 ? 73  THR D C   1 
ATOM   8081  O O   . THR D 1 73  ? 8.886   -8.209  10.000  1.00 12.29 ? 73  THR D O   1 
ATOM   8082  C CB  . THR D 1 73  ? 6.041   -7.284  10.294  1.00 12.07 ? 73  THR D CB  1 
ATOM   8083  O OG1 . THR D 1 73  ? 6.254   -8.465  11.146  1.00 12.06 ? 73  THR D OG1 1 
ATOM   8084  C CG2 . THR D 1 73  ? 5.475   -7.666  8.911   1.00 12.12 ? 73  THR D CG2 1 
ATOM   8085  N N   . PRO D 1 74  ? 9.391   -6.527  11.460  1.00 12.61 ? 74  PRO D N   1 
ATOM   8086  C CA  . PRO D 1 74  ? 10.719  -7.018  11.797  1.00 12.88 ? 74  PRO D CA  1 
ATOM   8087  C C   . PRO D 1 74  ? 10.717  -8.341  12.501  1.00 13.28 ? 74  PRO D C   1 
ATOM   8088  O O   . PRO D 1 74  ? 11.526  -9.233  12.113  1.00 13.41 ? 74  PRO D O   1 
ATOM   8089  C CB  . PRO D 1 74  ? 11.321  -5.879  12.637  1.00 12.85 ? 74  PRO D CB  1 
ATOM   8090  C CG  . PRO D 1 74  ? 10.146  -5.310  13.349  1.00 12.82 ? 74  PRO D CG  1 
ATOM   8091  C CD  . PRO D 1 74  ? 8.998   -5.389  12.314  1.00 12.73 ? 74  PRO D CD  1 
ATOM   8092  N N   . LYS D 1 75  ? 9.813   -8.513  13.445  1.00 13.77 ? 75  LYS D N   1 
ATOM   8093  C CA  . LYS D 1 75  ? 9.878   -9.788  14.262  1.00 14.34 ? 75  LYS D CA  1 
ATOM   8094  C C   . LYS D 1 75  ? 8.752   -10.726 13.868  1.00 14.51 ? 75  LYS D C   1 
ATOM   8095  O O   . LYS D 1 75  ? 7.580   -10.360 13.803  1.00 14.46 ? 75  LYS D O   1 
ATOM   8096  C CB  . LYS D 1 75  ? 9.943   -9.475  15.692  1.00 14.46 ? 75  LYS D CB  1 
ATOM   8097  C CG  . LYS D 1 75  ? 9.951   -10.321 16.901  1.00 14.50 ? 75  LYS D CG  1 
ATOM   8098  C CD  . LYS D 1 75  ? 9.757   -9.527  18.206  1.00 14.84 ? 75  LYS D CD  1 
ATOM   8099  C CE  . LYS D 1 75  ? 8.836   -8.349  18.125  1.00 15.28 ? 75  LYS D CE  1 
ATOM   8100  N NZ  . LYS D 1 75  ? 8.174   -7.820  19.319  1.00 15.56 ? 75  LYS D NZ  1 
ATOM   8101  N N   . ILE D 1 76  ? 9.191   -11.934 13.602  1.00 14.89 ? 76  ILE D N   1 
ATOM   8102  C CA  . ILE D 1 76  ? 8.415   -13.122 13.252  1.00 15.33 ? 76  ILE D CA  1 
ATOM   8103  C C   . ILE D 1 76  ? 8.908   -14.296 14.099  1.00 15.94 ? 76  ILE D C   1 
ATOM   8104  O O   . ILE D 1 76  ? 10.021  -14.818 13.901  1.00 15.92 ? 76  ILE D O   1 
ATOM   8105  C CB  . ILE D 1 76  ? 8.490   -13.364 11.709  1.00 15.02 ? 76  ILE D CB  1 
ATOM   8106  C CG1 . ILE D 1 76  ? 7.672   -12.222 11.051  1.00 14.99 ? 76  ILE D CG1 1 
ATOM   8107  C CG2 . ILE D 1 76  ? 8.039   -14.764 11.262  1.00 14.87 ? 76  ILE D CG2 1 
ATOM   8108  C CD1 . ILE D 1 76  ? 7.629   -12.224 9.512   1.00 15.01 ? 76  ILE D CD1 1 
ATOM   8109  N N   . VAL D 1 77  ? 8.110   -14.673 15.074  1.00 16.76 ? 77  VAL D N   1 
ATOM   8110  C CA  . VAL D 1 77  ? 8.519   -15.744 16.010  1.00 17.70 ? 77  VAL D CA  1 
ATOM   8111  C C   . VAL D 1 77  ? 7.619   -16.954 15.840  1.00 18.44 ? 77  VAL D C   1 
ATOM   8112  O O   . VAL D 1 77  ? 6.565   -16.888 15.192  1.00 18.57 ? 77  VAL D O   1 
ATOM   8113  C CB  . VAL D 1 77  ? 8.646   -15.206 17.438  1.00 17.63 ? 77  VAL D CB  1 
ATOM   8114  C CG1 . VAL D 1 77  ? 10.106  -14.803 17.757  1.00 17.58 ? 77  VAL D CG1 1 
ATOM   8115  C CG2 . VAL D 1 77  ? 7.752   -14.014 17.754  1.00 17.56 ? 77  VAL D CG2 1 
ATOM   8116  N N   . PHE D 1 78  ? 8.095   -18.052 16.397  1.00 19.45 ? 78  PHE D N   1 
ATOM   8117  C CA  . PHE D 1 78  ? 7.384   -19.345 16.369  1.00 20.27 ? 78  PHE D CA  1 
ATOM   8118  C C   . PHE D 1 78  ? 7.621   -20.125 17.664  1.00 20.55 ? 78  PHE D C   1 
ATOM   8119  O O   . PHE D 1 78  ? 8.696   -20.119 18.263  1.00 20.49 ? 78  PHE D O   1 
ATOM   8120  C CB  . PHE D 1 78  ? 7.703   -20.128 15.094  1.00 20.62 ? 78  PHE D CB  1 
ATOM   8121  C CG  . PHE D 1 78  ? 7.544   -21.609 15.170  1.00 21.18 ? 78  PHE D CG  1 
ATOM   8122  C CD1 . PHE D 1 78  ? 6.399   -22.200 15.733  1.00 21.27 ? 78  PHE D CD1 1 
ATOM   8123  C CD2 . PHE D 1 78  ? 8.502   -22.452 14.571  1.00 21.45 ? 78  PHE D CD2 1 
ATOM   8124  C CE1 . PHE D 1 78  ? 6.267   -23.562 15.881  1.00 21.37 ? 78  PHE D CE1 1 
ATOM   8125  C CE2 . PHE D 1 78  ? 8.351   -23.848 14.670  1.00 21.55 ? 78  PHE D CE2 1 
ATOM   8126  C CZ  . PHE D 1 78  ? 7.247   -24.394 15.348  1.00 21.52 ? 78  PHE D CZ  1 
ATOM   8127  N N   . GLY D 1 79  ? 6.557   -20.801 18.082  1.00 21.01 ? 79  GLY D N   1 
ATOM   8128  C CA  . GLY D 1 79  ? 6.527   -21.660 19.232  1.00 21.77 ? 79  GLY D CA  1 
ATOM   8129  C C   . GLY D 1 79  ? 5.718   -22.939 19.080  1.00 22.23 ? 79  GLY D C   1 
ATOM   8130  O O   . GLY D 1 79  ? 4.802   -23.093 18.293  1.00 22.07 ? 79  GLY D O   1 
ATOM   8131  N N   . LYS D 1 80  ? 6.100   -23.889 19.912  1.00 22.99 ? 80  LYS D N   1 
ATOM   8132  C CA  . LYS D 1 80  ? 5.492   -25.215 20.088  1.00 23.61 ? 80  LYS D CA  1 
ATOM   8133  C C   . LYS D 1 80  ? 4.459   -25.093 21.212  1.00 23.93 ? 80  LYS D C   1 
ATOM   8134  O O   . LYS D 1 80  ? 3.606   -25.960 21.423  1.00 23.99 ? 80  LYS D O   1 
ATOM   8135  C CB  . LYS D 1 80  ? 6.554   -26.234 20.426  1.00 23.88 ? 80  LYS D CB  1 
ATOM   8136  C CG  . LYS D 1 80  ? 6.210   -27.441 21.252  1.00 24.13 ? 80  LYS D CG  1 
ATOM   8137  C CD  . LYS D 1 80  ? 5.604   -28.590 20.489  1.00 24.31 ? 80  LYS D CD  1 
ATOM   8138  C CE  . LYS D 1 80  ? 6.677   -29.573 19.977  1.00 24.36 ? 80  LYS D CE  1 
ATOM   8139  N NZ  . LYS D 1 80  ? 5.961   -30.817 19.536  1.00 24.47 ? 80  LYS D NZ  1 
ATOM   8140  N N   . ASP D 1 81  ? 4.629   -24.000 21.942  1.00 24.28 ? 81  ASP D N   1 
ATOM   8141  C CA  . ASP D 1 81  ? 3.777   -23.610 23.057  1.00 24.56 ? 81  ASP D CA  1 
ATOM   8142  C C   . ASP D 1 81  ? 3.374   -22.121 22.909  1.00 24.48 ? 81  ASP D C   1 
ATOM   8143  O O   . ASP D 1 81  ? 3.966   -21.294 22.219  1.00 24.28 ? 81  ASP D O   1 
ATOM   8144  C CB  . ASP D 1 81  ? 4.406   -23.926 24.411  1.00 24.95 ? 81  ASP D CB  1 
ATOM   8145  C CG  . ASP D 1 81  ? 3.421   -23.795 25.572  1.00 25.16 ? 81  ASP D CG  1 
ATOM   8146  O OD1 . ASP D 1 81  ? 2.391   -24.501 25.584  1.00 25.19 ? 81  ASP D OD1 1 
ATOM   8147  O OD2 . ASP D 1 81  ? 3.725   -22.950 26.453  1.00 25.16 ? 81  ASP D OD2 1 
ATOM   8148  N N   . TYR D 1 82  ? 2.338   -21.843 23.659  1.00 24.47 ? 82  TYR D N   1 
ATOM   8149  C CA  . TYR D 1 82  ? 1.610   -20.591 23.745  1.00 24.60 ? 82  TYR D CA  1 
ATOM   8150  C C   . TYR D 1 82  ? 2.352   -19.530 24.512  1.00 24.75 ? 82  TYR D C   1 
ATOM   8151  O O   . TYR D 1 82  ? 2.036   -18.308 24.483  1.00 24.92 ? 82  TYR D O   1 
ATOM   8152  C CB  . TYR D 1 82  ? 0.199   -20.913 24.325  1.00 24.57 ? 82  TYR D CB  1 
ATOM   8153  C CG  . TYR D 1 82  ? -0.440  -22.014 23.485  1.00 24.46 ? 82  TYR D CG  1 
ATOM   8154  C CD1 . TYR D 1 82  ? -0.272  -23.364 23.801  1.00 24.49 ? 82  TYR D CD1 1 
ATOM   8155  C CD2 . TYR D 1 82  ? -1.067  -21.689 22.301  1.00 24.43 ? 82  TYR D CD2 1 
ATOM   8156  C CE1 . TYR D 1 82  ? -0.813  -24.365 22.998  1.00 24.48 ? 82  TYR D CE1 1 
ATOM   8157  C CE2 . TYR D 1 82  ? -1.622  -22.667 21.490  1.00 24.46 ? 82  TYR D CE2 1 
ATOM   8158  C CZ  . TYR D 1 82  ? -1.482  -24.005 21.831  1.00 24.50 ? 82  TYR D CZ  1 
ATOM   8159  O OH  . TYR D 1 82  ? -2.053  -24.920 20.998  1.00 24.51 ? 82  TYR D OH  1 
ATOM   8160  N N   . ASN D 1 83  ? 3.408   -19.985 25.173  1.00 24.72 ? 83  ASN D N   1 
ATOM   8161  C CA  . ASN D 1 83  ? 4.264   -19.030 25.895  1.00 24.71 ? 83  ASN D CA  1 
ATOM   8162  C C   . ASN D 1 83  ? 4.771   -18.008 24.866  1.00 24.45 ? 83  ASN D C   1 
ATOM   8163  O O   . ASN D 1 83  ? 5.091   -16.852 25.143  1.00 24.41 ? 83  ASN D O   1 
ATOM   8164  C CB  . ASN D 1 83  ? 5.384   -19.794 26.615  1.00 25.05 ? 83  ASN D CB  1 
ATOM   8165  C CG  . ASN D 1 83  ? 5.917   -18.821 27.684  1.00 25.38 ? 83  ASN D CG  1 
ATOM   8166  O OD1 . ASN D 1 83  ? 6.499   -17.788 27.314  1.00 25.37 ? 83  ASN D OD1 1 
ATOM   8167  N ND2 . ASN D 1 83  ? 5.472   -19.119 28.896  1.00 25.71 ? 83  ASN D ND2 1 
ATOM   8168  N N   . VAL D 1 84  ? 4.823   -18.515 23.651  1.00 24.08 ? 84  VAL D N   1 
ATOM   8169  C CA  . VAL D 1 84  ? 5.372   -17.789 22.493  1.00 23.78 ? 84  VAL D CA  1 
ATOM   8170  C C   . VAL D 1 84  ? 4.365   -16.811 21.924  1.00 23.61 ? 84  VAL D C   1 
ATOM   8171  O O   . VAL D 1 84  ? 4.564   -16.225 20.852  1.00 23.52 ? 84  VAL D O   1 
ATOM   8172  C CB  . VAL D 1 84  ? 5.913   -18.865 21.526  1.00 23.76 ? 84  VAL D CB  1 
ATOM   8173  C CG1 . VAL D 1 84  ? 6.646   -18.303 20.324  1.00 23.76 ? 84  VAL D CG1 1 
ATOM   8174  C CG2 . VAL D 1 84  ? 6.812   -19.871 22.255  1.00 23.71 ? 84  VAL D CG2 1 
ATOM   8175  N N   . SER D 1 85  ? 3.330   -16.529 22.704  1.00 23.47 ? 85  SER D N   1 
ATOM   8176  C CA  . SER D 1 85  ? 2.217   -15.661 22.286  1.00 23.20 ? 85  SER D CA  1 
ATOM   8177  C C   . SER D 1 85  ? 2.048   -14.472 23.207  1.00 23.03 ? 85  SER D C   1 
ATOM   8178  O O   . SER D 1 85  ? 1.187   -13.586 22.994  1.00 23.08 ? 85  SER D O   1 
ATOM   8179  C CB  . SER D 1 85  ? 0.937   -16.510 22.246  1.00 23.23 ? 85  SER D CB  1 
ATOM   8180  O OG  . SER D 1 85  ? 0.150   -16.198 21.105  1.00 23.25 ? 85  SER D OG  1 
ATOM   8181  N N   . ALA D 1 86  ? 2.922   -14.398 24.192  1.00 22.69 ? 86  ALA D N   1 
ATOM   8182  C CA  . ALA D 1 86  ? 2.854   -13.396 25.246  1.00 22.31 ? 86  ALA D CA  1 
ATOM   8183  C C   . ALA D 1 86  ? 2.585   -11.989 24.733  1.00 22.07 ? 86  ALA D C   1 
ATOM   8184  O O   . ALA D 1 86  ? 3.408   -11.370 24.056  1.00 22.12 ? 86  ALA D O   1 
ATOM   8185  C CB  . ALA D 1 86  ? 4.130   -13.413 26.077  1.00 22.31 ? 86  ALA D CB  1 
ATOM   8186  N N   . ASN D 1 87  ? 1.420   -11.498 25.091  1.00 21.71 ? 87  ASN D N   1 
ATOM   8187  C CA  . ASN D 1 87  ? 0.986   -10.114 24.873  1.00 21.34 ? 87  ASN D CA  1 
ATOM   8188  C C   . ASN D 1 87  ? 0.621   -9.802  23.438  1.00 20.78 ? 87  ASN D C   1 
ATOM   8189  O O   . ASN D 1 87  ? 0.992   -8.732  22.896  1.00 20.84 ? 87  ASN D O   1 
ATOM   8190  C CB  . ASN D 1 87  ? 2.031   -9.161  25.490  1.00 21.82 ? 87  ASN D CB  1 
ATOM   8191  C CG  . ASN D 1 87  ? 2.180   -9.425  26.989  1.00 22.29 ? 87  ASN D CG  1 
ATOM   8192  O OD1 . ASN D 1 87  ? 1.399   -8.897  27.813  1.00 22.47 ? 87  ASN D OD1 1 
ATOM   8193  N ND2 . ASN D 1 87  ? 3.169   -10.250 27.358  1.00 22.40 ? 87  ASN D ND2 1 
ATOM   8194  N N   . SER D 1 88  ? -0.117  -10.747 22.856  1.00 19.80 ? 88  SER D N   1 
ATOM   8195  C CA  . SER D 1 88  ? -0.654  -10.586 21.496  1.00 18.73 ? 88  SER D CA  1 
ATOM   8196  C C   . SER D 1 88  ? -1.855  -9.638  21.604  1.00 17.79 ? 88  SER D C   1 
ATOM   8197  O O   . SER D 1 88  ? -2.477  -9.659  22.684  1.00 17.94 ? 88  SER D O   1 
ATOM   8198  C CB  . SER D 1 88  ? -1.173  -11.879 20.898  1.00 18.83 ? 88  SER D CB  1 
ATOM   8199  O OG  . SER D 1 88  ? -0.218  -12.610 20.164  1.00 18.89 ? 88  SER D OG  1 
ATOM   8200  N N   . LYS D 1 89  ? -2.112  -8.906  20.558  1.00 16.53 ? 89  LYS D N   1 
ATOM   8201  C CA  . LYS D 1 89  ? -3.351  -8.058  20.554  1.00 15.27 ? 89  LYS D CA  1 
ATOM   8202  C C   . LYS D 1 89  ? -4.472  -8.856  19.886  1.00 14.27 ? 89  LYS D C   1 
ATOM   8203  O O   . LYS D 1 89  ? -5.640  -8.790  20.317  1.00 14.16 ? 89  LYS D O   1 
ATOM   8204  C CB  . LYS D 1 89  ? -3.119  -6.699  19.956  1.00 15.28 ? 89  LYS D CB  1 
ATOM   8205  C CG  . LYS D 1 89  ? -2.506  -5.637  20.870  1.00 15.20 ? 89  LYS D CG  1 
ATOM   8206  C CD  . LYS D 1 89  ? -1.170  -6.014  21.453  1.00 15.23 ? 89  LYS D CD  1 
ATOM   8207  C CE  . LYS D 1 89  ? -0.808  -5.274  22.718  1.00 15.20 ? 89  LYS D CE  1 
ATOM   8208  N NZ  . LYS D 1 89  ? 0.236   -6.027  23.491  1.00 15.12 ? 89  LYS D NZ  1 
ATOM   8209  N N   . LEU D 1 90  ? -4.116  -9.716  18.949  1.00 13.02 ? 90  LEU D N   1 
ATOM   8210  C CA  . LEU D 1 90  ? -5.028  -10.533 18.187  1.00 11.92 ? 90  LEU D CA  1 
ATOM   8211  C C   . LEU D 1 90  ? -4.489  -11.949 17.932  1.00 11.43 ? 90  LEU D C   1 
ATOM   8212  O O   . LEU D 1 90  ? -3.436  -12.121 17.303  1.00 11.44 ? 90  LEU D O   1 
ATOM   8213  C CB  . LEU D 1 90  ? -5.340  -9.842  16.843  1.00 11.66 ? 90  LEU D CB  1 
ATOM   8214  C CG  . LEU D 1 90  ? -6.387  -10.563 15.993  1.00 11.40 ? 90  LEU D CG  1 
ATOM   8215  C CD1 . LEU D 1 90  ? -7.719  -9.840  16.063  1.00 11.19 ? 90  LEU D CD1 1 
ATOM   8216  C CD2 . LEU D 1 90  ? -5.900  -10.678 14.554  1.00 11.35 ? 90  LEU D CD2 1 
ATOM   8217  N N   . VAL D 1 91  ? -5.290  -12.911 18.354  1.00 10.60 ? 91  VAL D N   1 
ATOM   8218  C CA  . VAL D 1 91  ? -5.006  -14.330 18.177  1.00 10.00 ? 91  VAL D CA  1 
ATOM   8219  C C   . VAL D 1 91  ? -6.016  -14.934 17.192  1.00 9.62  ? 91  VAL D C   1 
ATOM   8220  O O   . VAL D 1 91  ? -7.221  -14.736 17.385  1.00 9.64  ? 91  VAL D O   1 
ATOM   8221  C CB  . VAL D 1 91  ? -5.005  -15.050 19.536  1.00 9.93  ? 91  VAL D CB  1 
ATOM   8222  C CG1 . VAL D 1 91  ? -4.582  -16.525 19.378  1.00 9.93  ? 91  VAL D CG1 1 
ATOM   8223  C CG2 . VAL D 1 91  ? -4.167  -14.370 20.575  1.00 9.71  ? 91  VAL D CG2 1 
ATOM   8224  N N   . ILE D 1 92  ? -5.528  -15.663 16.225  1.00 9.28  ? 92  ILE D N   1 
ATOM   8225  C CA  . ILE D 1 92  ? -6.429  -16.297 15.225  1.00 9.19  ? 92  ILE D CA  1 
ATOM   8226  C C   . ILE D 1 92  ? -6.170  -17.801 15.165  1.00 9.44  ? 92  ILE D C   1 
ATOM   8227  O O   . ILE D 1 92  ? -5.149  -18.387 14.766  1.00 9.45  ? 92  ILE D O   1 
ATOM   8228  C CB  . ILE D 1 92  ? -6.475  -15.449 13.928  1.00 8.83  ? 92  ILE D CB  1 
ATOM   8229  C CG1 . ILE D 1 92  ? -6.851  -16.307 12.708  1.00 8.73  ? 92  ILE D CG1 1 
ATOM   8230  C CG2 . ILE D 1 92  ? -5.208  -14.582 13.670  1.00 8.74  ? 92  ILE D CG2 1 
ATOM   8231  C CD1 . ILE D 1 92  ? -5.752  -16.942 11.859  1.00 8.61  ? 92  ILE D CD1 1 
ATOM   8232  N N   . ILE D 1 93  ? -7.178  -18.478 15.705  1.00 9.62  ? 93  ILE D N   1 
ATOM   8233  C CA  . ILE D 1 93  ? -7.284  -19.913 15.884  1.00 9.87  ? 93  ILE D CA  1 
ATOM   8234  C C   . ILE D 1 93  ? -7.631  -20.567 14.565  1.00 10.56 ? 93  ILE D C   1 
ATOM   8235  O O   . ILE D 1 93  ? -8.714  -20.295 14.019  1.00 10.82 ? 93  ILE D O   1 
ATOM   8236  C CB  . ILE D 1 93  ? -8.375  -20.249 16.996  1.00 9.35  ? 93  ILE D CB  1 
ATOM   8237  C CG1 . ILE D 1 93  ? -8.412  -19.171 18.065  1.00 9.00  ? 93  ILE D CG1 1 
ATOM   8238  C CG2 . ILE D 1 93  ? -8.148  -21.687 17.518  1.00 9.37  ? 93  ILE D CG2 1 
ATOM   8239  C CD1 . ILE D 1 93  ? -8.740  -19.453 19.518  1.00 8.78  ? 93  ILE D CD1 1 
ATOM   8240  N N   . THR D 1 94  ? -6.728  -21.321 14.010  1.00 11.49 ? 94  THR D N   1 
ATOM   8241  C CA  . THR D 1 94  ? -7.010  -22.038 12.749  1.00 12.55 ? 94  THR D CA  1 
ATOM   8242  C C   . THR D 1 94  ? -6.332  -23.397 12.798  1.00 13.24 ? 94  THR D C   1 
ATOM   8243  O O   . THR D 1 94  ? -5.397  -23.649 12.046  1.00 13.32 ? 94  THR D O   1 
ATOM   8244  C CB  . THR D 1 94  ? -6.615  -21.197 11.494  1.00 12.65 ? 94  THR D CB  1 
ATOM   8245  O OG1 . THR D 1 94  ? -5.148  -21.262 11.376  1.00 12.89 ? 94  THR D OG1 1 
ATOM   8246  C CG2 . THR D 1 94  ? -7.105  -19.752 11.555  1.00 12.64 ? 94  THR D CG2 1 
ATOM   8247  N N   . ALA D 1 95  ? -6.755  -24.191 13.733  1.00 14.33 ? 95  ALA D N   1 
ATOM   8248  C CA  . ALA D 1 95  ? -6.259  -25.524 14.019  1.00 15.67 ? 95  ALA D CA  1 
ATOM   8249  C C   . ALA D 1 95  ? -7.475  -26.387 14.369  1.00 16.82 ? 95  ALA D C   1 
ATOM   8250  O O   . ALA D 1 95  ? -8.430  -25.926 15.010  1.00 16.87 ? 95  ALA D O   1 
ATOM   8251  C CB  . ALA D 1 95  ? -5.220  -25.504 15.122  1.00 15.51 ? 95  ALA D CB  1 
ATOM   8252  N N   . GLY D 1 96  ? -7.438  -27.606 13.859  1.00 18.19 ? 96  GLY D N   1 
ATOM   8253  C CA  . GLY D 1 96  ? -8.485  -28.548 14.091  1.00 20.02 ? 96  GLY D CA  1 
ATOM   8254  C C   . GLY D 1 96  ? -8.522  -29.801 13.275  1.00 21.39 ? 96  GLY D C   1 
ATOM   8255  O O   . GLY D 1 96  ? -8.034  -30.874 13.719  1.00 21.62 ? 96  GLY D O   1 
ATOM   8256  N N   . ALA D 1 97  ? -9.111  -29.697 12.109  1.00 22.52 ? 97  ALA D N   1 
ATOM   8257  C CA  . ALA D 1 97  ? -9.431  -30.902 11.288  1.00 23.82 ? 97  ALA D CA  1 
ATOM   8258  C C   . ALA D 1 97  ? -10.170 -30.296 10.093  1.00 24.78 ? 97  ALA D C   1 
ATOM   8259  O O   . ALA D 1 97  ? -11.348 -29.927 10.222  1.00 25.13 ? 97  ALA D O   1 
ATOM   8260  C CB  . ALA D 1 97  ? -10.313 -31.853 12.049  1.00 23.65 ? 97  ALA D CB  1 
ATOM   8261  N N   . ARG D 1 98  ? -9.423  -30.182 9.025   1.00 25.70 ? 98  ARG D N   1 
ATOM   8262  C CA  . ARG D 1 98  ? -9.890  -29.445 7.875   1.00 26.55 ? 98  ARG D CA  1 
ATOM   8263  C C   . ARG D 1 98  ? -10.328 -30.192 6.644   1.00 26.56 ? 98  ARG D C   1 
ATOM   8264  O O   . ARG D 1 98  ? -9.471  -30.688 5.893   1.00 26.63 ? 98  ARG D O   1 
ATOM   8265  C CB  . ARG D 1 98  ? -8.741  -28.497 7.418   1.00 27.31 ? 98  ARG D CB  1 
ATOM   8266  C CG  . ARG D 1 98  ? -8.830  -27.032 7.770   1.00 28.11 ? 98  ARG D CG  1 
ATOM   8267  C CD  . ARG D 1 98  ? -7.991  -26.714 8.949   1.00 28.75 ? 98  ARG D CD  1 
ATOM   8268  N NE  . ARG D 1 98  ? -7.131  -25.545 8.729   1.00 29.38 ? 98  ARG D NE  1 
ATOM   8269  C CZ  . ARG D 1 98  ? -6.485  -24.971 9.757   1.00 29.78 ? 98  ARG D CZ  1 
ATOM   8270  N NH1 . ARG D 1 98  ? -6.672  -25.470 10.992  1.00 29.97 ? 98  ARG D NH1 1 
ATOM   8271  N NH2 . ARG D 1 98  ? -5.607  -23.984 9.545   1.00 29.76 ? 98  ARG D NH2 1 
ATOM   8272  N N   . MET D 1 99  ? -11.622 -30.165 6.407   1.00 26.65 ? 99  MET D N   1 
ATOM   8273  C CA  . MET D 1 99  ? -12.171 -30.494 5.081   1.00 26.87 ? 99  MET D CA  1 
ATOM   8274  C C   . MET D 1 99  ? -11.967 -31.925 4.632   1.00 26.71 ? 99  MET D C   1 
ATOM   8275  O O   . MET D 1 99  ? -11.024 -32.595 5.046   1.00 26.79 ? 99  MET D O   1 
ATOM   8276  C CB  . MET D 1 99  ? -11.657 -29.486 4.055   1.00 27.32 ? 99  MET D CB  1 
ATOM   8277  C CG  . MET D 1 99  ? -10.314 -28.905 3.947   1.00 27.69 ? 99  MET D CG  1 
ATOM   8278  S SD  . MET D 1 99  ? -10.107 -27.370 4.943   1.00 28.08 ? 99  MET D SD  1 
ATOM   8279  C CE  . MET D 1 99  ? -8.489  -26.797 4.495   1.00 27.81 ? 99  MET D CE  1 
ATOM   8280  N N   . VAL D 1 100 ? -12.864 -32.358 3.762   1.00 26.42 ? 100 VAL D N   1 
ATOM   8281  C CA  . VAL D 1 100 ? -12.911 -33.633 3.078   1.00 26.11 ? 100 VAL D CA  1 
ATOM   8282  C C   . VAL D 1 100 ? -14.156 -33.654 2.148   1.00 26.08 ? 100 VAL D C   1 
ATOM   8283  O O   . VAL D 1 100 ? -15.278 -33.717 2.647   1.00 26.01 ? 100 VAL D O   1 
ATOM   8284  C CB  . VAL D 1 100 ? -12.877 -34.897 3.932   1.00 25.90 ? 100 VAL D CB  1 
ATOM   8285  C CG1 . VAL D 1 100 ? -13.417 -36.157 3.229   1.00 25.74 ? 100 VAL D CG1 1 
ATOM   8286  C CG2 . VAL D 1 100 ? -11.471 -35.241 4.402   1.00 25.96 ? 100 VAL D CG2 1 
ATOM   8287  N N   . SER D 1 101 ? -13.858 -33.756 0.872   1.00 26.02 ? 101 SER D N   1 
ATOM   8288  C CA  . SER D 1 101 ? -14.873 -33.874 -0.185  1.00 25.92 ? 101 SER D CA  1 
ATOM   8289  C C   . SER D 1 101 ? -16.019 -34.752 0.327   1.00 26.02 ? 101 SER D C   1 
ATOM   8290  O O   . SER D 1 101 ? -15.832 -35.988 0.402   1.00 26.20 ? 101 SER D O   1 
ATOM   8291  C CB  . SER D 1 101 ? -14.293 -34.487 -1.447  1.00 25.80 ? 101 SER D CB  1 
ATOM   8292  O OG  . SER D 1 101 ? -15.267 -35.084 -2.272  1.00 25.52 ? 101 SER D OG  1 
ATOM   8293  N N   . GLY D 1 102 ? -17.085 -34.082 0.725   1.00 25.85 ? 102 GLY D N   1 
ATOM   8294  C CA  . GLY D 1 102 ? -18.286 -34.806 1.227   1.00 25.52 ? 102 GLY D CA  1 
ATOM   8295  C C   . GLY D 1 102 ? -18.489 -34.393 2.683   1.00 25.33 ? 102 GLY D C   1 
ATOM   8296  O O   . GLY D 1 102 ? -19.397 -33.632 3.048   1.00 25.37 ? 102 GLY D O   1 
ATOM   8297  N N   . GLN D 1 103 ? -17.566 -34.893 3.473   1.00 25.07 ? 103 GLN D N   1 
ATOM   8298  C CA  . GLN D 1 103 ? -17.456 -34.683 4.907   1.00 24.74 ? 103 GLN D CA  1 
ATOM   8299  C C   . GLN D 1 103 ? -18.096 -33.356 5.326   1.00 24.74 ? 103 GLN D C   1 
ATOM   8300  O O   . GLN D 1 103 ? -19.153 -33.258 5.953   1.00 24.71 ? 103 GLN D O   1 
ATOM   8301  C CB  . GLN D 1 103 ? -15.968 -34.686 5.312   1.00 24.58 ? 103 GLN D CB  1 
ATOM   8302  C CG  . GLN D 1 103 ? -15.641 -34.148 6.665   1.00 24.38 ? 103 GLN D CG  1 
ATOM   8303  C CD  . GLN D 1 103 ? -15.358 -35.188 7.705   1.00 24.31 ? 103 GLN D CD  1 
ATOM   8304  O OE1 . GLN D 1 103 ? -14.435 -35.048 8.491   1.00 24.20 ? 103 GLN D OE1 1 
ATOM   8305  N NE2 . GLN D 1 103 ? -16.126 -36.273 7.684   1.00 24.42 ? 103 GLN D NE2 1 
ATOM   8306  N N   . THR D 1 104 ? -17.349 -32.343 4.905   1.00 24.71 ? 104 THR D N   1 
ATOM   8307  C CA  . THR D 1 104 ? -17.587 -30.933 5.269   1.00 24.47 ? 104 THR D CA  1 
ATOM   8308  C C   . THR D 1 104 ? -19.103 -30.740 5.367   1.00 24.42 ? 104 THR D C   1 
ATOM   8309  O O   . THR D 1 104 ? -19.921 -31.223 4.582   1.00 24.24 ? 104 THR D O   1 
ATOM   8310  C CB  . THR D 1 104 ? -16.711 -29.938 4.442   1.00 24.23 ? 104 THR D CB  1 
ATOM   8311  O OG1 . THR D 1 104 ? -15.377 -29.982 5.141   1.00 24.15 ? 104 THR D OG1 1 
ATOM   8312  C CG2 . THR D 1 104 ? -17.129 -28.487 4.319   1.00 24.01 ? 104 THR D CG2 1 
ATOM   8313  N N   . ARG D 1 105 ? -19.405 -30.344 6.561   1.00 24.31 ? 105 ARG D N   1 
ATOM   8314  C CA  . ARG D 1 105 ? -20.680 -29.991 7.161   1.00 24.25 ? 105 ARG D CA  1 
ATOM   8315  C C   . ARG D 1 105 ? -20.248 -29.518 8.560   1.00 23.86 ? 105 ARG D C   1 
ATOM   8316  O O   . ARG D 1 105 ? -19.152 -28.857 8.607   1.00 23.75 ? 105 ARG D O   1 
ATOM   8317  C CB  . ARG D 1 105 ? -21.738 -31.069 7.073   1.00 24.51 ? 105 ARG D CB  1 
ATOM   8318  C CG  . ARG D 1 105 ? -22.474 -31.064 5.728   1.00 25.19 ? 105 ARG D CG  1 
ATOM   8319  C CD  . ARG D 1 105 ? -23.557 -32.033 5.559   1.00 25.98 ? 105 ARG D CD  1 
ATOM   8320  N NE  . ARG D 1 105 ? -24.221 -32.118 4.247   1.00 26.64 ? 105 ARG D NE  1 
ATOM   8321  C CZ  . ARG D 1 105 ? -25.556 -32.269 4.052   1.00 26.93 ? 105 ARG D CZ  1 
ATOM   8322  N NH1 . ARG D 1 105 ? -26.466 -32.326 5.044   1.00 26.99 ? 105 ARG D NH1 1 
ATOM   8323  N NH2 . ARG D 1 105 ? -26.065 -32.470 2.819   1.00 26.91 ? 105 ARG D NH2 1 
ATOM   8324  N N   . LEU D 1 106 ? -21.026 -29.750 9.579   1.00 23.12 ? 106 LEU D N   1 
ATOM   8325  C CA  . LEU D 1 106 ? -20.600 -29.368 10.953  1.00 22.29 ? 106 LEU D CA  1 
ATOM   8326  C C   . LEU D 1 106 ? -20.161 -30.701 11.599  1.00 21.86 ? 106 LEU D C   1 
ATOM   8327  O O   . LEU D 1 106 ? -20.490 -31.061 12.731  1.00 21.85 ? 106 LEU D O   1 
ATOM   8328  C CB  . LEU D 1 106 ? -21.720 -28.646 11.629  1.00 22.16 ? 106 LEU D CB  1 
ATOM   8329  C CG  . LEU D 1 106 ? -22.866 -28.005 10.881  1.00 22.01 ? 106 LEU D CG  1 
ATOM   8330  C CD1 . LEU D 1 106 ? -23.876 -29.034 10.400  1.00 21.92 ? 106 LEU D CD1 1 
ATOM   8331  C CD2 . LEU D 1 106 ? -23.581 -27.022 11.819  1.00 22.07 ? 106 LEU D CD2 1 
ATOM   8332  N N   . ASP D 1 107 ? -19.527 -31.487 10.740  1.00 21.17 ? 107 ASP D N   1 
ATOM   8333  C CA  . ASP D 1 107 ? -19.020 -32.805 11.097  1.00 20.51 ? 107 ASP D CA  1 
ATOM   8334  C C   . ASP D 1 107 ? -17.725 -32.645 11.895  1.00 20.04 ? 107 ASP D C   1 
ATOM   8335  O O   . ASP D 1 107 ? -17.532 -33.381 12.880  1.00 20.22 ? 107 ASP D O   1 
ATOM   8336  C CB  . ASP D 1 107 ? -18.824 -33.688 9.868   1.00 20.52 ? 107 ASP D CB  1 
ATOM   8337  C CG  . ASP D 1 107 ? -20.142 -34.231 9.358   1.00 20.67 ? 107 ASP D CG  1 
ATOM   8338  O OD1 . ASP D 1 107 ? -20.551 -35.361 9.663   1.00 20.73 ? 107 ASP D OD1 1 
ATOM   8339  O OD2 . ASP D 1 107 ? -20.792 -33.461 8.628   1.00 20.96 ? 107 ASP D OD2 1 
ATOM   8340  N N   . LEU D 1 108 ? -16.908 -31.717 11.428  1.00 19.19 ? 108 LEU D N   1 
ATOM   8341  C CA  . LEU D 1 108 ? -15.582 -31.504 12.022  1.00 18.50 ? 108 LEU D CA  1 
ATOM   8342  C C   . LEU D 1 108 ? -15.812 -30.859 13.387  1.00 18.28 ? 108 LEU D C   1 
ATOM   8343  O O   . LEU D 1 108 ? -14.923 -30.103 13.820  1.00 18.46 ? 108 LEU D O   1 
ATOM   8344  C CB  . LEU D 1 108 ? -14.708 -30.702 11.096  1.00 18.34 ? 108 LEU D CB  1 
ATOM   8345  C CG  . LEU D 1 108 ? -14.885 -30.643 9.612   1.00 18.31 ? 108 LEU D CG  1 
ATOM   8346  C CD1 . LEU D 1 108 ? -14.064 -29.484 9.001   1.00 18.29 ? 108 LEU D CD1 1 
ATOM   8347  C CD2 . LEU D 1 108 ? -14.433 -31.931 8.944   1.00 18.30 ? 108 LEU D CD2 1 
ATOM   8348  N N   . LEU D 1 109 ? -16.861 -31.285 14.064  1.00 17.80 ? 109 LEU D N   1 
ATOM   8349  C CA  . LEU D 1 109 ? -17.306 -30.626 15.276  1.00 17.53 ? 109 LEU D CA  1 
ATOM   8350  C C   . LEU D 1 109 ? -16.980 -31.240 16.593  1.00 17.35 ? 109 LEU D C   1 
ATOM   8351  O O   . LEU D 1 109 ? -16.393 -30.483 17.421  1.00 17.49 ? 109 LEU D O   1 
ATOM   8352  C CB  . LEU D 1 109 ? -18.807 -30.346 15.053  1.00 17.55 ? 109 LEU D CB  1 
ATOM   8353  C CG  . LEU D 1 109 ? -19.593 -29.354 15.858  1.00 17.47 ? 109 LEU D CG  1 
ATOM   8354  C CD1 . LEU D 1 109 ? -20.205 -29.996 17.108  1.00 17.54 ? 109 LEU D CD1 1 
ATOM   8355  C CD2 . LEU D 1 109 ? -18.726 -28.173 16.298  1.00 17.43 ? 109 LEU D CD2 1 
ATOM   8356  N N   . GLN D 1 110 ? -17.450 -32.414 16.920  1.00 17.30 ? 110 GLN D N   1 
ATOM   8357  C CA  . GLN D 1 110 ? -17.103 -32.964 18.273  1.00 17.41 ? 110 GLN D CA  1 
ATOM   8358  C C   . GLN D 1 110 ? -15.581 -33.099 18.295  1.00 17.06 ? 110 GLN D C   1 
ATOM   8359  O O   . GLN D 1 110 ? -14.899 -32.888 19.292  1.00 17.10 ? 110 GLN D O   1 
ATOM   8360  C CB  . GLN D 1 110 ? -17.869 -34.203 18.693  1.00 17.89 ? 110 GLN D CB  1 
ATOM   8361  C CG  . GLN D 1 110 ? -18.765 -33.818 19.921  1.00 18.38 ? 110 GLN D CG  1 
ATOM   8362  C CD  . GLN D 1 110 ? -20.176 -34.279 19.648  1.00 18.70 ? 110 GLN D CD  1 
ATOM   8363  O OE1 . GLN D 1 110 ? -20.892 -33.736 18.806  1.00 18.86 ? 110 GLN D OE1 1 
ATOM   8364  N NE2 . GLN D 1 110 ? -20.531 -35.324 20.384  1.00 18.93 ? 110 GLN D NE2 1 
ATOM   8365  N N   . ARG D 1 111 ? -15.108 -33.331 17.099  1.00 16.57 ? 111 ARG D N   1 
ATOM   8366  C CA  . ARG D 1 111 ? -13.743 -33.464 16.667  1.00 15.85 ? 111 ARG D CA  1 
ATOM   8367  C C   . ARG D 1 111 ? -12.889 -32.256 17.026  1.00 15.75 ? 111 ARG D C   1 
ATOM   8368  O O   . ARG D 1 111 ? -11.740 -32.431 17.414  1.00 15.79 ? 111 ARG D O   1 
ATOM   8369  C CB  . ARG D 1 111 ? -13.700 -33.556 15.114  1.00 15.12 ? 111 ARG D CB  1 
ATOM   8370  C CG  . ARG D 1 111 ? -12.260 -33.792 14.549  1.00 14.18 ? 111 ARG D CG  1 
ATOM   8371  C CD  . ARG D 1 111 ? -12.121 -34.824 13.371  1.00 13.48 ? 111 ARG D CD  1 
ATOM   8372  N NE  . ARG D 1 111 ? -13.377 -35.148 12.686  1.00 12.85 ? 111 ARG D NE  1 
ATOM   8373  C CZ  . ARG D 1 111 ? -13.692 -34.932 11.381  1.00 12.41 ? 111 ARG D CZ  1 
ATOM   8374  N NH1 . ARG D 1 111 ? -12.850 -34.361 10.461  1.00 12.16 ? 111 ARG D NH1 1 
ATOM   8375  N NH2 . ARG D 1 111 ? -14.866 -35.257 10.896  1.00 12.19 ? 111 ARG D NH2 1 
ATOM   8376  N N   . ASN D 1 112 ? -13.509 -31.105 16.806  1.00 15.81 ? 112 ASN D N   1 
ATOM   8377  C CA  . ASN D 1 112 ? -12.780 -29.829 17.021  1.00 15.91 ? 112 ASN D CA  1 
ATOM   8378  C C   . ASN D 1 112 ? -12.954 -29.311 18.411  1.00 16.17 ? 112 ASN D C   1 
ATOM   8379  O O   . ASN D 1 112 ? -11.902 -28.986 19.024  1.00 16.23 ? 112 ASN D O   1 
ATOM   8380  C CB  . ASN D 1 112 ? -13.024 -28.906 15.828  1.00 15.61 ? 112 ASN D CB  1 
ATOM   8381  C CG  . ASN D 1 112 ? -12.036 -29.320 14.728  1.00 15.46 ? 112 ASN D CG  1 
ATOM   8382  O OD1 . ASN D 1 112 ? -11.033 -29.989 15.019  1.00 15.27 ? 112 ASN D OD1 1 
ATOM   8383  N ND2 . ASN D 1 112 ? -12.338 -28.985 13.489  1.00 15.51 ? 112 ASN D ND2 1 
ATOM   8384  N N   . VAL D 1 113 ? -14.126 -29.323 18.981  1.00 16.39 ? 113 VAL D N   1 
ATOM   8385  C CA  . VAL D 1 113 ? -14.285 -28.845 20.384  1.00 16.60 ? 113 VAL D CA  1 
ATOM   8386  C C   . VAL D 1 113 ? -13.128 -29.422 21.206  1.00 16.85 ? 113 VAL D C   1 
ATOM   8387  O O   . VAL D 1 113 ? -12.527 -28.718 22.039  1.00 16.80 ? 113 VAL D O   1 
ATOM   8388  C CB  . VAL D 1 113 ? -15.711 -29.144 20.833  1.00 16.53 ? 113 VAL D CB  1 
ATOM   8389  C CG1 . VAL D 1 113 ? -16.172 -30.544 20.440  1.00 16.52 ? 113 VAL D CG1 1 
ATOM   8390  C CG2 . VAL D 1 113 ? -15.915 -28.873 22.315  1.00 16.49 ? 113 VAL D CG2 1 
ATOM   8391  N N   . ALA D 1 114 ? -12.749 -30.640 20.818  1.00 17.04 ? 114 ALA D N   1 
ATOM   8392  C CA  . ALA D 1 114 ? -11.612 -31.354 21.427  1.00 17.19 ? 114 ALA D CA  1 
ATOM   8393  C C   . ALA D 1 114 ? -10.372 -30.527 21.101  1.00 17.44 ? 114 ALA D C   1 
ATOM   8394  O O   . ALA D 1 114 ? -9.743  -30.016 22.039  1.00 17.55 ? 114 ALA D O   1 
ATOM   8395  C CB  . ALA D 1 114 ? -11.532 -32.782 20.981  1.00 17.22 ? 114 ALA D CB  1 
ATOM   8396  N N   . ILE D 1 115 ? -10.101 -30.348 19.827  1.00 17.77 ? 115 ILE D N   1 
ATOM   8397  C CA  . ILE D 1 115 ? -8.988  -29.504 19.368  1.00 18.28 ? 115 ILE D CA  1 
ATOM   8398  C C   . ILE D 1 115 ? -8.949  -28.248 20.252  1.00 18.89 ? 115 ILE D C   1 
ATOM   8399  O O   . ILE D 1 115 ? -7.878  -27.924 20.790  1.00 19.21 ? 115 ILE D O   1 
ATOM   8400  C CB  . ILE D 1 115 ? -9.048  -29.178 17.862  1.00 18.10 ? 115 ILE D CB  1 
ATOM   8401  C CG1 . ILE D 1 115 ? -7.625  -29.004 17.265  1.00 17.95 ? 115 ILE D CG1 1 
ATOM   8402  C CG2 . ILE D 1 115 ? -9.855  -27.903 17.481  1.00 18.25 ? 115 ILE D CG2 1 
ATOM   8403  C CD1 . ILE D 1 115 ? -7.122  -30.252 16.503  1.00 17.92 ? 115 ILE D CD1 1 
ATOM   8404  N N   . MET D 1 116 ? -10.118 -27.686 20.524  1.00 19.42 ? 116 MET D N   1 
ATOM   8405  C CA  . MET D 1 116 ? -10.233 -26.457 21.308  1.00 19.85 ? 116 MET D CA  1 
ATOM   8406  C C   . MET D 1 116 ? -9.857  -26.674 22.764  1.00 20.25 ? 116 MET D C   1 
ATOM   8407  O O   . MET D 1 116 ? -8.772  -26.152 23.097  1.00 20.37 ? 116 MET D O   1 
ATOM   8408  C CB  . MET D 1 116 ? -11.564 -25.751 21.217  1.00 19.85 ? 116 MET D CB  1 
ATOM   8409  C CG  . MET D 1 116 ? -11.963 -25.363 19.841  1.00 19.90 ? 116 MET D CG  1 
ATOM   8410  S SD  . MET D 1 116 ? -10.506 -24.697 18.952  1.00 19.97 ? 116 MET D SD  1 
ATOM   8411  C CE  . MET D 1 116 ? -11.416 -23.783 17.660  1.00 19.81 ? 116 MET D CE  1 
ATOM   8412  N N   . LYS D 1 117 ? -10.687 -27.310 23.543  1.00 20.68 ? 117 LYS D N   1 
ATOM   8413  C CA  . LYS D 1 117 ? -10.464 -27.541 24.965  1.00 21.11 ? 117 LYS D CA  1 
ATOM   8414  C C   . LYS D 1 117 ? -8.981  -27.404 25.323  1.00 21.31 ? 117 LYS D C   1 
ATOM   8415  O O   . LYS D 1 117 ? -8.649  -26.831 26.367  1.00 21.52 ? 117 LYS D O   1 
ATOM   8416  C CB  . LYS D 1 117 ? -10.928 -28.897 25.516  1.00 21.20 ? 117 LYS D CB  1 
ATOM   8417  C CG  . LYS D 1 117 ? -10.906 -28.910 27.051  1.00 21.39 ? 117 LYS D CG  1 
ATOM   8418  C CD  . LYS D 1 117 ? -11.060 -30.251 27.698  1.00 21.43 ? 117 LYS D CD  1 
ATOM   8419  C CE  . LYS D 1 117 ? -9.752  -30.981 27.958  1.00 21.44 ? 117 LYS D CE  1 
ATOM   8420  N NZ  . LYS D 1 117 ? -10.049 -32.459 28.052  1.00 21.57 ? 117 LYS D NZ  1 
ATOM   8421  N N   . ALA D 1 118 ? -8.165  -27.982 24.477  1.00 21.43 ? 118 ALA D N   1 
ATOM   8422  C CA  . ALA D 1 118 ? -6.723  -27.936 24.506  1.00 21.66 ? 118 ALA D CA  1 
ATOM   8423  C C   . ALA D 1 118 ? -6.089  -26.632 24.028  1.00 21.78 ? 118 ALA D C   1 
ATOM   8424  O O   . ALA D 1 118 ? -5.486  -25.837 24.776  1.00 21.84 ? 118 ALA D O   1 
ATOM   8425  C CB  . ALA D 1 118 ? -6.221  -29.101 23.604  1.00 21.67 ? 118 ALA D CB  1 
ATOM   8426  N N   . ILE D 1 119 ? -6.159  -26.425 22.731  1.00 21.79 ? 119 ILE D N   1 
ATOM   8427  C CA  . ILE D 1 119 ? -5.564  -25.324 21.987  1.00 21.73 ? 119 ILE D CA  1 
ATOM   8428  C C   . ILE D 1 119 ? -5.853  -23.943 22.560  1.00 21.82 ? 119 ILE D C   1 
ATOM   8429  O O   . ILE D 1 119 ? -4.918  -23.226 22.932  1.00 21.57 ? 119 ILE D O   1 
ATOM   8430  C CB  . ILE D 1 119 ? -5.974  -25.491 20.475  1.00 21.61 ? 119 ILE D CB  1 
ATOM   8431  C CG1 . ILE D 1 119 ? -5.145  -26.611 19.813  1.00 21.59 ? 119 ILE D CG1 1 
ATOM   8432  C CG2 . ILE D 1 119 ? -5.877  -24.171 19.662  1.00 21.51 ? 119 ILE D CG2 1 
ATOM   8433  C CD1 . ILE D 1 119 ? -5.021  -27.995 20.460  1.00 21.39 ? 119 ILE D CD1 1 
ATOM   8434  N N   . VAL D 1 120 ? -7.106  -23.609 22.550  1.00 22.01 ? 120 VAL D N   1 
ATOM   8435  C CA  . VAL D 1 120 ? -7.667  -22.262 22.961  1.00 22.17 ? 120 VAL D CA  1 
ATOM   8436  C C   . VAL D 1 120 ? -7.242  -21.963 24.348  1.00 22.30 ? 120 VAL D C   1 
ATOM   8437  O O   . VAL D 1 120 ? -5.978  -21.769 24.527  1.00 22.39 ? 120 VAL D O   1 
ATOM   8438  C CB  . VAL D 1 120 ? -9.094  -22.335 22.381  1.00 22.10 ? 120 VAL D CB  1 
ATOM   8439  C CG1 . VAL D 1 120 ? -9.986  -23.382 23.024  1.00 22.12 ? 120 VAL D CG1 1 
ATOM   8440  C CG2 . VAL D 1 120 ? -9.741  -20.971 22.240  1.00 22.09 ? 120 VAL D CG2 1 
ATOM   8441  N N   . PRO D 1 121 ? -8.082  -21.676 25.287  1.00 22.26 ? 121 PRO D N   1 
ATOM   8442  C CA  . PRO D 1 121 ? -7.734  -21.523 26.714  1.00 22.24 ? 121 PRO D CA  1 
ATOM   8443  C C   . PRO D 1 121 ? -6.412  -22.166 27.054  1.00 22.11 ? 121 PRO D C   1 
ATOM   8444  O O   . PRO D 1 121 ? -6.287  -23.399 27.011  1.00 22.09 ? 121 PRO D O   1 
ATOM   8445  C CB  . PRO D 1 121 ? -8.927  -22.172 27.400  1.00 22.35 ? 121 PRO D CB  1 
ATOM   8446  C CG  . PRO D 1 121 ? -10.058 -22.076 26.395  1.00 22.35 ? 121 PRO D CG  1 
ATOM   8447  C CD  . PRO D 1 121 ? -9.493  -21.282 25.209  1.00 22.22 ? 121 PRO D CD  1 
ATOM   8448  N N   . GLY D 1 122 ? -5.517  -21.287 27.450  1.00 21.96 ? 122 GLY D N   1 
ATOM   8449  C CA  . GLY D 1 122 ? -4.079  -21.644 27.628  1.00 21.91 ? 122 GLY D CA  1 
ATOM   8450  C C   . GLY D 1 122 ? -3.374  -20.510 26.825  1.00 21.88 ? 122 GLY D C   1 
ATOM   8451  O O   . GLY D 1 122 ? -2.635  -19.726 27.410  1.00 22.21 ? 122 GLY D O   1 
ATOM   8452  N N   . VAL D 1 123 ? -3.760  -20.394 25.563  1.00 21.59 ? 123 VAL D N   1 
ATOM   8453  C CA  . VAL D 1 123 ? -3.326  -19.295 24.715  1.00 21.18 ? 123 VAL D CA  1 
ATOM   8454  C C   . VAL D 1 123 ? -3.637  -17.981 25.482  1.00 21.02 ? 123 VAL D C   1 
ATOM   8455  O O   . VAL D 1 123 ? -2.882  -17.033 25.511  1.00 21.12 ? 123 VAL D O   1 
ATOM   8456  C CB  . VAL D 1 123 ? -3.984  -19.245 23.329  1.00 21.14 ? 123 VAL D CB  1 
ATOM   8457  C CG1 . VAL D 1 123 ? -4.074  -20.587 22.613  1.00 21.11 ? 123 VAL D CG1 1 
ATOM   8458  C CG2 . VAL D 1 123 ? -5.351  -18.568 23.256  1.00 20.94 ? 123 VAL D CG2 1 
ATOM   8459  N N   . ILE D 1 124 ? -4.827  -17.997 26.021  1.00 20.85 ? 124 ILE D N   1 
ATOM   8460  C CA  . ILE D 1 124 ? -5.427  -16.875 26.750  1.00 20.70 ? 124 ILE D CA  1 
ATOM   8461  C C   . ILE D 1 124 ? -4.681  -16.619 28.038  1.00 20.67 ? 124 ILE D C   1 
ATOM   8462  O O   . ILE D 1 124 ? -4.514  -15.436 28.417  1.00 20.85 ? 124 ILE D O   1 
ATOM   8463  C CB  . ILE D 1 124 ? -6.980  -17.054 26.864  1.00 20.59 ? 124 ILE D CB  1 
ATOM   8464  C CG1 . ILE D 1 124 ? -7.515  -16.931 28.298  1.00 20.47 ? 124 ILE D CG1 1 
ATOM   8465  C CG2 . ILE D 1 124 ? -7.487  -18.378 26.192  1.00 20.70 ? 124 ILE D CG2 1 
ATOM   8466  C CD1 . ILE D 1 124 ? -9.072  -17.109 28.398  1.00 20.52 ? 124 ILE D CD1 1 
ATOM   8467  N N   . GLN D 1 125 ? -4.220  -17.685 28.672  1.00 20.51 ? 125 GLN D N   1 
ATOM   8468  C CA  . GLN D 1 125 ? -3.517  -17.510 29.962  1.00 20.38 ? 125 GLN D CA  1 
ATOM   8469  C C   . GLN D 1 125 ? -2.320  -16.596 29.715  1.00 20.30 ? 125 GLN D C   1 
ATOM   8470  O O   . GLN D 1 125 ? -1.939  -15.828 30.604  1.00 20.45 ? 125 GLN D O   1 
ATOM   8471  C CB  . GLN D 1 125 ? -3.151  -18.799 30.643  1.00 20.60 ? 125 GLN D CB  1 
ATOM   8472  C CG  . GLN D 1 125 ? -2.697  -18.567 32.080  1.00 20.92 ? 125 GLN D CG  1 
ATOM   8473  C CD  . GLN D 1 125 ? -1.739  -19.602 32.606  1.00 21.10 ? 125 GLN D CD  1 
ATOM   8474  O OE1 . GLN D 1 125 ? -1.164  -19.409 33.682  1.00 21.23 ? 125 GLN D OE1 1 
ATOM   8475  N NE2 . GLN D 1 125 ? -1.509  -20.689 31.870  1.00 21.17 ? 125 GLN D NE2 1 
ATOM   8476  N N   . ASN D 1 126 ? -1.816  -16.670 28.509  1.00 20.21 ? 126 ASN D N   1 
ATOM   8477  C CA  . ASN D 1 126 ? -0.678  -15.851 28.062  1.00 20.21 ? 126 ASN D CA  1 
ATOM   8478  C C   . ASN D 1 126 ? -1.124  -14.417 27.788  1.00 20.18 ? 126 ASN D C   1 
ATOM   8479  O O   . ASN D 1 126 ? -0.709  -13.555 28.589  1.00 20.34 ? 126 ASN D O   1 
ATOM   8480  C CB  . ASN D 1 126 ? 0.024   -16.496 26.872  1.00 20.39 ? 126 ASN D CB  1 
ATOM   8481  C CG  . ASN D 1 126 ? 0.478   -17.911 27.248  1.00 20.52 ? 126 ASN D CG  1 
ATOM   8482  O OD1 . ASN D 1 126 ? 1.598   -18.030 27.776  1.00 20.88 ? 126 ASN D OD1 1 
ATOM   8483  N ND2 . ASN D 1 126 ? -0.360  -18.889 26.977  1.00 20.26 ? 126 ASN D ND2 1 
ATOM   8484  N N   . SER D 1 127 ? -1.837  -14.193 26.698  1.00 19.98 ? 127 SER D N   1 
ATOM   8485  C CA  . SER D 1 127 ? -2.311  -12.831 26.380  1.00 19.94 ? 127 SER D CA  1 
ATOM   8486  C C   . SER D 1 127 ? -3.743  -12.681 26.888  1.00 20.13 ? 127 SER D C   1 
ATOM   8487  O O   . SER D 1 127 ? -4.723  -12.675 26.121  1.00 20.22 ? 127 SER D O   1 
ATOM   8488  C CB  . SER D 1 127 ? -2.134  -12.414 24.957  1.00 19.90 ? 127 SER D CB  1 
ATOM   8489  O OG  . SER D 1 127 ? -1.645  -13.352 24.054  1.00 19.81 ? 127 SER D OG  1 
ATOM   8490  N N   . PRO D 1 128 ? -3.788  -12.435 28.207  1.00 20.28 ? 128 PRO D N   1 
ATOM   8491  C CA  . PRO D 1 128 ? -5.049  -12.308 28.926  1.00 20.31 ? 128 PRO D CA  1 
ATOM   8492  C C   . PRO D 1 128 ? -6.074  -11.360 28.351  1.00 20.31 ? 128 PRO D C   1 
ATOM   8493  O O   . PRO D 1 128 ? -7.287  -11.655 28.528  1.00 20.49 ? 128 PRO D O   1 
ATOM   8494  C CB  . PRO D 1 128 ? -4.600  -11.819 30.314  1.00 20.36 ? 128 PRO D CB  1 
ATOM   8495  C CG  . PRO D 1 128 ? -3.542  -10.800 29.909  1.00 20.35 ? 128 PRO D CG  1 
ATOM   8496  C CD  . PRO D 1 128 ? -2.739  -11.584 28.884  1.00 20.34 ? 128 PRO D CD  1 
ATOM   8497  N N   . ASP D 1 129 ? -5.648  -10.248 27.783  1.00 20.06 ? 129 ASP D N   1 
ATOM   8498  C CA  . ASP D 1 129 ? -6.552  -9.210  27.235  1.00 19.68 ? 129 ASP D CA  1 
ATOM   8499  C C   . ASP D 1 129 ? -6.607  -9.330  25.703  1.00 19.10 ? 129 ASP D C   1 
ATOM   8500  O O   . ASP D 1 129 ? -6.877  -8.309  25.029  1.00 18.96 ? 129 ASP D O   1 
ATOM   8501  C CB  . ASP D 1 129 ? -6.102  -7.813  27.606  1.00 20.15 ? 129 ASP D CB  1 
ATOM   8502  C CG  . ASP D 1 129 ? -5.799  -7.299  28.953  1.00 20.51 ? 129 ASP D CG  1 
ATOM   8503  O OD1 . ASP D 1 129 ? -6.416  -7.642  29.995  1.00 20.86 ? 129 ASP D OD1 1 
ATOM   8504  O OD2 . ASP D 1 129 ? -4.933  -6.356  29.041  1.00 20.37 ? 129 ASP D OD2 1 
ATOM   8505  N N   . CYS D 1 130 ? -6.267  -10.502 25.202  1.00 18.50 ? 130 CYS D N   1 
ATOM   8506  C CA  . CYS D 1 130 ? -6.202  -10.719 23.749  1.00 17.85 ? 130 CYS D CA  1 
ATOM   8507  C C   . CYS D 1 130 ? -7.606  -10.550 23.146  1.00 17.07 ? 130 CYS D C   1 
ATOM   8508  O O   . CYS D 1 130 ? -8.629  -10.525 23.858  1.00 17.12 ? 130 CYS D O   1 
ATOM   8509  C CB  . CYS D 1 130 ? -5.674  -12.111 23.392  1.00 18.03 ? 130 CYS D CB  1 
ATOM   8510  S SG  . CYS D 1 130 ? -7.099  -13.266 23.339  1.00 18.76 ? 130 CYS D SG  1 
ATOM   8511  N N   . LYS D 1 131 ? -7.618  -10.645 21.840  1.00 15.90 ? 131 LYS D N   1 
ATOM   8512  C CA  . LYS D 1 131 ? -8.910  -10.559 21.098  1.00 14.89 ? 131 LYS D CA  1 
ATOM   8513  C C   . LYS D 1 131 ? -8.890  -11.705 20.109  1.00 14.15 ? 131 LYS D C   1 
ATOM   8514  O O   . LYS D 1 131 ? -7.884  -11.801 19.384  1.00 14.28 ? 131 LYS D O   1 
ATOM   8515  C CB  . LYS D 1 131 ? -9.064  -9.233  20.421  1.00 14.78 ? 131 LYS D CB  1 
ATOM   8516  C CG  . LYS D 1 131 ? -10.188 -9.151  19.419  1.00 14.64 ? 131 LYS D CG  1 
ATOM   8517  C CD  . LYS D 1 131 ? -10.388 -7.717  18.975  1.00 14.88 ? 131 LYS D CD  1 
ATOM   8518  C CE  . LYS D 1 131 ? -11.730 -7.561  18.292  1.00 15.13 ? 131 LYS D CE  1 
ATOM   8519  N NZ  . LYS D 1 131 ? -11.744 -7.961  16.880  1.00 15.25 ? 131 LYS D NZ  1 
ATOM   8520  N N   . ILE D 1 132 ? -9.940  -12.509 20.061  1.00 13.20 ? 132 ILE D N   1 
ATOM   8521  C CA  . ILE D 1 132 ? -9.876  -13.649 19.166  1.00 12.30 ? 132 ILE D CA  1 
ATOM   8522  C C   . ILE D 1 132 ? -10.885 -13.642 18.015  1.00 11.75 ? 132 ILE D C   1 
ATOM   8523  O O   . ILE D 1 132 ? -12.088 -13.455 18.133  1.00 11.53 ? 132 ILE D O   1 
ATOM   8524  C CB  . ILE D 1 132 ? -9.940  -15.027 19.927  1.00 12.25 ? 132 ILE D CB  1 
ATOM   8525  C CG1 . ILE D 1 132 ? -9.384  -14.979 21.346  1.00 12.08 ? 132 ILE D CG1 1 
ATOM   8526  C CG2 . ILE D 1 132 ? -9.213  -16.111 19.048  1.00 12.12 ? 132 ILE D CG2 1 
ATOM   8527  C CD1 . ILE D 1 132 ? -9.897  -16.114 22.299  1.00 11.84 ? 132 ILE D CD1 1 
ATOM   8528  N N   . ILE D 1 133 ? -10.271 -13.954 16.886  1.00 11.08 ? 133 ILE D N   1 
ATOM   8529  C CA  . ILE D 1 133 ? -10.912 -14.239 15.618  1.00 10.51 ? 133 ILE D CA  1 
ATOM   8530  C C   . ILE D 1 133 ? -10.849 -15.787 15.562  1.00 10.17 ? 133 ILE D C   1 
ATOM   8531  O O   . ILE D 1 133 ? -9.777  -16.313 15.915  1.00 10.23 ? 133 ILE D O   1 
ATOM   8532  C CB  . ILE D 1 133 ? -10.229 -13.600 14.384  1.00 10.39 ? 133 ILE D CB  1 
ATOM   8533  C CG1 . ILE D 1 133 ? -9.996  -12.089 14.593  1.00 10.50 ? 133 ILE D CG1 1 
ATOM   8534  C CG2 . ILE D 1 133 ? -11.064 -13.853 13.096  1.00 10.37 ? 133 ILE D CG2 1 
ATOM   8535  C CD1 . ILE D 1 133 ? -9.147  -11.381 13.502  1.00 10.44 ? 133 ILE D CD1 1 
ATOM   8536  N N   . VAL D 1 134 ? -11.956 -16.414 15.331  1.00 9.78  ? 134 VAL D N   1 
ATOM   8537  C CA  . VAL D 1 134 ? -11.979 -17.903 15.267  1.00 9.56  ? 134 VAL D CA  1 
ATOM   8538  C C   . VAL D 1 134 ? -12.225 -18.204 13.801  1.00 9.66  ? 134 VAL D C   1 
ATOM   8539  O O   . VAL D 1 134 ? -13.196 -17.666 13.225  1.00 9.91  ? 134 VAL D O   1 
ATOM   8540  C CB  . VAL D 1 134 ? -12.974 -18.469 16.284  1.00 9.43  ? 134 VAL D CB  1 
ATOM   8541  C CG1 . VAL D 1 134 ? -13.346 -19.929 15.997  1.00 9.40  ? 134 VAL D CG1 1 
ATOM   8542  C CG2 . VAL D 1 134 ? -12.545 -18.356 17.751  1.00 8.98  ? 134 VAL D CG2 1 
ATOM   8543  N N   . VAL D 1 135 ? -11.322 -18.929 13.178  1.00 9.60  ? 135 VAL D N   1 
ATOM   8544  C CA  . VAL D 1 135 ? -11.490 -19.268 11.750  1.00 9.41  ? 135 VAL D CA  1 
ATOM   8545  C C   . VAL D 1 135 ? -11.944 -20.713 11.586  1.00 9.91  ? 135 VAL D C   1 
ATOM   8546  O O   . VAL D 1 135 ? -12.794 -20.947 10.692  1.00 10.16 ? 135 VAL D O   1 
ATOM   8547  C CB  . VAL D 1 135 ? -10.215 -18.939 10.971  1.00 8.97  ? 135 VAL D CB  1 
ATOM   8548  C CG1 . VAL D 1 135 ? -10.439 -18.955 9.462   1.00 8.75  ? 135 VAL D CG1 1 
ATOM   8549  C CG2 . VAL D 1 135 ? -9.601  -17.633 11.433  1.00 8.87  ? 135 VAL D CG2 1 
ATOM   8550  N N   . THR D 1 136 ? -11.481 -21.611 12.452  1.00 10.05 ? 136 THR D N   1 
ATOM   8551  C CA  . THR D 1 136 ? -11.739 -23.041 12.326  1.00 10.24 ? 136 THR D CA  1 
ATOM   8552  C C   . THR D 1 136 ? -13.053 -23.399 11.703  1.00 10.24 ? 136 THR D C   1 
ATOM   8553  O O   . THR D 1 136 ? -12.712 -23.939 10.554  1.00 10.22 ? 136 THR D O   1 
ATOM   8554  C CB  . THR D 1 136 ? -11.419 -23.911 13.603  1.00 10.45 ? 136 THR D CB  1 
ATOM   8555  O OG1 . THR D 1 136 ? -12.474 -23.556 14.556  1.00 10.93 ? 136 THR D OG1 1 
ATOM   8556  C CG2 . THR D 1 136 ? -10.005 -23.692 14.112  1.00 10.35 ? 136 THR D CG2 1 
ATOM   8557  N N   . ASN D 1 137 ? -14.293 -23.501 12.218  1.00 10.22 ? 137 ASN D N   1 
ATOM   8558  C CA  . ASN D 1 137 ? -15.346 -23.733 11.227  1.00 10.50 ? 137 ASN D CA  1 
ATOM   8559  C C   . ASN D 1 137 ? -16.801 -23.669 11.043  1.00 10.61 ? 137 ASN D C   1 
ATOM   8560  O O   . ASN D 1 137 ? -17.172 -22.845 10.085  1.00 10.67 ? 137 ASN D O   1 
ATOM   8561  C CB  . ASN D 1 137 ? -15.027 -25.233 10.607  1.00 10.40 ? 137 ASN D CB  1 
ATOM   8562  C CG  . ASN D 1 137 ? -15.010 -25.018 9.089   1.00 10.42 ? 137 ASN D CG  1 
ATOM   8563  O OD1 . ASN D 1 137 ? -14.308 -25.770 8.393   1.00 10.58 ? 137 ASN D OD1 1 
ATOM   8564  N ND2 . ASN D 1 137 ? -15.657 -23.993 8.521   1.00 10.25 ? 137 ASN D ND2 1 
ATOM   8565  N N   . PRO D 1 138 ? -17.891 -24.065 11.684  1.00 10.67 ? 138 PRO D N   1 
ATOM   8566  C CA  . PRO D 1 138 ? -17.867 -24.590 13.100  1.00 10.41 ? 138 PRO D CA  1 
ATOM   8567  C C   . PRO D 1 138 ? -17.534 -23.365 13.902  1.00 10.12 ? 138 PRO D C   1 
ATOM   8568  O O   . PRO D 1 138 ? -17.815 -23.208 15.066  1.00 10.08 ? 138 PRO D O   1 
ATOM   8569  C CB  . PRO D 1 138 ? -17.160 -25.884 12.910  1.00 10.34 ? 138 PRO D CB  1 
ATOM   8570  C CG  . PRO D 1 138 ? -17.905 -26.447 11.695  1.00 10.41 ? 138 PRO D CG  1 
ATOM   8571  C CD  . PRO D 1 138 ? -18.627 -25.243 11.016  1.00 10.54 ? 138 PRO D CD  1 
ATOM   8572  N N   . VAL D 1 139 ? -17.254 -22.311 13.165  1.00 9.76  ? 139 VAL D N   1 
ATOM   8573  C CA  . VAL D 1 139 ? -16.882 -20.979 13.533  1.00 9.67  ? 139 VAL D CA  1 
ATOM   8574  C C   . VAL D 1 139 ? -17.915 -20.565 14.580  1.00 9.70  ? 139 VAL D C   1 
ATOM   8575  O O   . VAL D 1 139 ? -17.569 -20.221 15.696  1.00 9.76  ? 139 VAL D O   1 
ATOM   8576  C CB  . VAL D 1 139 ? -16.810 -20.150 12.237  1.00 9.50  ? 139 VAL D CB  1 
ATOM   8577  C CG1 . VAL D 1 139 ? -15.565 -20.483 11.446  1.00 9.40  ? 139 VAL D CG1 1 
ATOM   8578  C CG2 . VAL D 1 139 ? -18.034 -20.360 11.355  1.00 9.35  ? 139 VAL D CG2 1 
ATOM   8579  N N   . ASP D 1 140 ? -19.149 -20.806 14.182  1.00 9.73  ? 140 ASP D N   1 
ATOM   8580  C CA  . ASP D 1 140 ? -20.325 -20.490 15.018  1.00 9.79  ? 140 ASP D CA  1 
ATOM   8581  C C   . ASP D 1 140 ? -20.107 -21.260 16.326  1.00 9.88  ? 140 ASP D C   1 
ATOM   8582  O O   . ASP D 1 140 ? -19.491 -20.782 17.304  1.00 9.80  ? 140 ASP D O   1 
ATOM   8583  C CB  . ASP D 1 140 ? -21.597 -20.772 14.244  1.00 9.88  ? 140 ASP D CB  1 
ATOM   8584  C CG  . ASP D 1 140 ? -21.642 -20.280 12.807  1.00 10.12 ? 140 ASP D CG  1 
ATOM   8585  O OD1 . ASP D 1 140 ? -21.853 -21.089 11.863  1.00 10.03 ? 140 ASP D OD1 1 
ATOM   8586  O OD2 . ASP D 1 140 ? -21.481 -19.063 12.534  1.00 9.94  ? 140 ASP D OD2 1 
ATOM   8587  N N   . ILE D 1 141 ? -20.389 -22.532 16.248  1.00 10.02 ? 141 ILE D N   1 
ATOM   8588  C CA  . ILE D 1 141 ? -20.323 -23.480 17.359  1.00 10.18 ? 141 ILE D CA  1 
ATOM   8589  C C   . ILE D 1 141 ? -19.014 -23.463 18.115  1.00 10.39 ? 141 ILE D C   1 
ATOM   8590  O O   . ILE D 1 141 ? -18.977 -23.738 19.332  1.00 10.67 ? 141 ILE D O   1 
ATOM   8591  C CB  . ILE D 1 141 ? -20.745 -24.916 16.852  1.00 10.05 ? 141 ILE D CB  1 
ATOM   8592  C CG1 . ILE D 1 141 ? -21.720 -24.770 15.675  1.00 9.96  ? 141 ILE D CG1 1 
ATOM   8593  C CG2 . ILE D 1 141 ? -21.328 -25.724 18.051  1.00 10.16 ? 141 ILE D CG2 1 
ATOM   8594  C CD1 . ILE D 1 141 ? -22.692 -25.877 15.308  1.00 9.91  ? 141 ILE D CD1 1 
ATOM   8595  N N   . LEU D 1 142 ? -17.938 -23.146 17.472  1.00 10.54 ? 142 LEU D N   1 
ATOM   8596  C CA  . LEU D 1 142 ? -16.573 -23.065 18.001  1.00 10.56 ? 142 LEU D CA  1 
ATOM   8597  C C   . LEU D 1 142 ? -16.449 -21.732 18.698  1.00 10.92 ? 142 LEU D C   1 
ATOM   8598  O O   . LEU D 1 142 ? -16.067 -21.699 19.884  1.00 10.97 ? 142 LEU D O   1 
ATOM   8599  C CB  . LEU D 1 142 ? -15.646 -23.427 16.855  1.00 10.47 ? 142 LEU D CB  1 
ATOM   8600  C CG  . LEU D 1 142 ? -15.876 -24.792 16.208  1.00 10.40 ? 142 LEU D CG  1 
ATOM   8601  C CD1 . LEU D 1 142 ? -14.881 -25.073 15.091  1.00 10.44 ? 142 LEU D CD1 1 
ATOM   8602  C CD2 . LEU D 1 142 ? -15.763 -25.899 17.263  1.00 10.55 ? 142 LEU D CD2 1 
ATOM   8603  N N   . THR D 1 143 ? -16.898 -20.669 18.042  1.00 11.29 ? 143 THR D N   1 
ATOM   8604  C CA  . THR D 1 143 ? -16.941 -19.328 18.658  1.00 11.60 ? 143 THR D CA  1 
ATOM   8605  C C   . THR D 1 143 ? -17.565 -19.538 20.057  1.00 12.09 ? 143 THR D C   1 
ATOM   8606  O O   . THR D 1 143 ? -17.016 -19.113 21.070  1.00 11.98 ? 143 THR D O   1 
ATOM   8607  C CB  . THR D 1 143 ? -17.694 -18.239 17.855  1.00 11.46 ? 143 THR D CB  1 
ATOM   8608  O OG1 . THR D 1 143 ? -16.849 -17.733 16.768  1.00 11.41 ? 143 THR D OG1 1 
ATOM   8609  C CG2 . THR D 1 143 ? -18.148 -17.025 18.700  1.00 11.68 ? 143 THR D CG2 1 
ATOM   8610  N N   . TYR D 1 144 ? -18.672 -20.288 20.013  1.00 12.57 ? 144 TYR D N   1 
ATOM   8611  C CA  . TYR D 1 144 ? -19.432 -20.627 21.223  1.00 12.87 ? 144 TYR D CA  1 
ATOM   8612  C C   . TYR D 1 144 ? -18.545 -21.399 22.189  1.00 12.98 ? 144 TYR D C   1 
ATOM   8613  O O   . TYR D 1 144 ? -18.375 -20.979 23.348  1.00 13.07 ? 144 TYR D O   1 
ATOM   8614  C CB  . TYR D 1 144 ? -20.718 -21.367 20.881  1.00 13.17 ? 144 TYR D CB  1 
ATOM   8615  C CG  . TYR D 1 144 ? -21.445 -21.957 22.067  1.00 13.63 ? 144 TYR D CG  1 
ATOM   8616  C CD1 . TYR D 1 144 ? -21.366 -23.316 22.367  1.00 13.62 ? 144 TYR D CD1 1 
ATOM   8617  C CD2 . TYR D 1 144 ? -22.187 -21.135 22.929  1.00 13.87 ? 144 TYR D CD2 1 
ATOM   8618  C CE1 . TYR D 1 144 ? -22.028 -23.864 23.454  1.00 13.63 ? 144 TYR D CE1 1 
ATOM   8619  C CE2 . TYR D 1 144 ? -22.824 -21.676 24.050  1.00 13.95 ? 144 TYR D CE2 1 
ATOM   8620  C CZ  . TYR D 1 144 ? -22.727 -23.045 24.313  1.00 13.76 ? 144 TYR D CZ  1 
ATOM   8621  O OH  . TYR D 1 144 ? -23.370 -23.523 25.421  1.00 13.78 ? 144 TYR D OH  1 
ATOM   8622  N N   . VAL D 1 145 ? -18.030 -22.510 21.728  1.00 13.20 ? 145 VAL D N   1 
ATOM   8623  C CA  . VAL D 1 145 ? -17.063 -23.318 22.511  1.00 13.48 ? 145 VAL D CA  1 
ATOM   8624  C C   . VAL D 1 145 ? -16.025 -22.365 23.130  1.00 13.87 ? 145 VAL D C   1 
ATOM   8625  O O   . VAL D 1 145 ? -16.001 -22.189 24.345  1.00 13.90 ? 145 VAL D O   1 
ATOM   8626  C CB  . VAL D 1 145 ? -16.424 -24.417 21.644  1.00 13.12 ? 145 VAL D CB  1 
ATOM   8627  C CG1 . VAL D 1 145 ? -15.288 -25.134 22.346  1.00 12.94 ? 145 VAL D CG1 1 
ATOM   8628  C CG2 . VAL D 1 145 ? -17.427 -25.419 21.128  1.00 12.99 ? 145 VAL D CG2 1 
ATOM   8629  N N   . VAL D 1 146 ? -15.249 -21.726 22.271  1.00 14.29 ? 146 VAL D N   1 
ATOM   8630  C CA  . VAL D 1 146 ? -14.185 -20.836 22.707  1.00 15.01 ? 146 VAL D CA  1 
ATOM   8631  C C   . VAL D 1 146 ? -14.748 -19.803 23.686  1.00 15.48 ? 146 VAL D C   1 
ATOM   8632  O O   . VAL D 1 146 ? -14.201 -19.638 24.792  1.00 15.50 ? 146 VAL D O   1 
ATOM   8633  C CB  . VAL D 1 146 ? -13.386 -20.232 21.550  1.00 15.02 ? 146 VAL D CB  1 
ATOM   8634  C CG1 . VAL D 1 146 ? -12.535 -21.249 20.807  1.00 14.97 ? 146 VAL D CG1 1 
ATOM   8635  C CG2 . VAL D 1 146 ? -14.260 -19.505 20.558  1.00 15.22 ? 146 VAL D CG2 1 
ATOM   8636  N N   . TRP D 1 147 ? -15.827 -19.165 23.282  1.00 16.08 ? 147 TRP D N   1 
ATOM   8637  C CA  . TRP D 1 147 ? -16.467 -18.121 24.087  1.00 16.59 ? 147 TRP D CA  1 
ATOM   8638  C C   . TRP D 1 147 ? -16.511 -18.601 25.555  1.00 16.92 ? 147 TRP D C   1 
ATOM   8639  O O   . TRP D 1 147 ? -16.068 -17.940 26.481  1.00 16.95 ? 147 TRP D O   1 
ATOM   8640  C CB  . TRP D 1 147 ? -17.890 -17.756 23.631  1.00 16.61 ? 147 TRP D CB  1 
ATOM   8641  C CG  . TRP D 1 147 ? -18.535 -16.775 24.557  1.00 16.75 ? 147 TRP D CG  1 
ATOM   8642  C CD1 . TRP D 1 147 ? -18.045 -15.539 24.891  1.00 16.96 ? 147 TRP D CD1 1 
ATOM   8643  C CD2 . TRP D 1 147 ? -19.714 -16.951 25.340  1.00 16.77 ? 147 TRP D CD2 1 
ATOM   8644  N NE1 . TRP D 1 147 ? -18.872 -14.917 25.801  1.00 16.97 ? 147 TRP D NE1 1 
ATOM   8645  C CE2 . TRP D 1 147 ? -19.893 -15.775 26.095  1.00 16.88 ? 147 TRP D CE2 1 
ATOM   8646  C CE3 . TRP D 1 147 ? -20.651 -17.970 25.436  1.00 16.78 ? 147 TRP D CE3 1 
ATOM   8647  C CZ2 . TRP D 1 147 ? -20.969 -15.590 26.951  1.00 16.89 ? 147 TRP D CZ2 1 
ATOM   8648  C CZ3 . TRP D 1 147 ? -21.733 -17.767 26.272  1.00 16.79 ? 147 TRP D CZ3 1 
ATOM   8649  C CH2 . TRP D 1 147 ? -21.883 -16.623 27.028  1.00 16.84 ? 147 TRP D CH2 1 
ATOM   8650  N N   . LYS D 1 148 ? -17.131 -19.749 25.631  1.00 17.18 ? 148 LYS D N   1 
ATOM   8651  C CA  . LYS D 1 148 ? -17.454 -20.534 26.801  1.00 17.36 ? 148 LYS D CA  1 
ATOM   8652  C C   . LYS D 1 148 ? -16.210 -20.960 27.570  1.00 17.79 ? 148 LYS D C   1 
ATOM   8653  O O   . LYS D 1 148 ? -16.017 -20.684 28.754  1.00 17.87 ? 148 LYS D O   1 
ATOM   8654  C CB  . LYS D 1 148 ? -18.145 -21.803 26.299  1.00 17.14 ? 148 LYS D CB  1 
ATOM   8655  C CG  . LYS D 1 148 ? -19.273 -22.430 27.015  1.00 16.89 ? 148 LYS D CG  1 
ATOM   8656  C CD  . LYS D 1 148 ? -20.611 -21.747 26.751  1.00 16.80 ? 148 LYS D CD  1 
ATOM   8657  C CE  . LYS D 1 148 ? -20.765 -20.482 27.590  1.00 16.64 ? 148 LYS D CE  1 
ATOM   8658  N NZ  . LYS D 1 148 ? -22.209 -20.188 27.786  1.00 16.57 ? 148 LYS D NZ  1 
ATOM   8659  N N   . ILE D 1 149 ? -15.348 -21.619 26.823  1.00 18.32 ? 149 ILE D N   1 
ATOM   8660  C CA  . ILE D 1 149 ? -14.114 -22.234 27.300  1.00 18.88 ? 149 ILE D CA  1 
ATOM   8661  C C   . ILE D 1 149 ? -13.094 -21.199 27.705  1.00 19.13 ? 149 ILE D C   1 
ATOM   8662  O O   . ILE D 1 149 ? -12.269 -21.488 28.601  1.00 19.19 ? 149 ILE D O   1 
ATOM   8663  C CB  . ILE D 1 149 ? -13.627 -23.285 26.235  1.00 19.05 ? 149 ILE D CB  1 
ATOM   8664  C CG1 . ILE D 1 149 ? -12.832 -24.420 26.950  1.00 19.26 ? 149 ILE D CG1 1 
ATOM   8665  C CG2 . ILE D 1 149 ? -12.853 -22.675 25.058  1.00 18.99 ? 149 ILE D CG2 1 
ATOM   8666  C CD1 . ILE D 1 149 ? -13.771 -25.383 27.792  1.00 19.31 ? 149 ILE D CD1 1 
ATOM   8667  N N   . SER D 1 150 ? -13.190 -20.022 27.115  1.00 19.45 ? 150 SER D N   1 
ATOM   8668  C CA  . SER D 1 150 ? -12.260 -18.921 27.448  1.00 19.83 ? 150 SER D CA  1 
ATOM   8669  C C   . SER D 1 150 ? -12.838 -18.145 28.632  1.00 20.06 ? 150 SER D C   1 
ATOM   8670  O O   . SER D 1 150 ? -12.240 -18.112 29.728  1.00 20.26 ? 150 SER D O   1 
ATOM   8671  C CB  . SER D 1 150 ? -11.995 -18.030 26.269  1.00 19.80 ? 150 SER D CB  1 
ATOM   8672  O OG  . SER D 1 150 ? -13.037 -17.048 26.188  1.00 20.07 ? 150 SER D OG  1 
ATOM   8673  N N   . GLY D 1 151 ? -13.982 -17.539 28.419  1.00 20.20 ? 151 GLY D N   1 
ATOM   8674  C CA  . GLY D 1 151 ? -14.677 -16.793 29.458  1.00 20.70 ? 151 GLY D CA  1 
ATOM   8675  C C   . GLY D 1 151 ? -14.492 -15.293 29.421  1.00 20.89 ? 151 GLY D C   1 
ATOM   8676  O O   . GLY D 1 151 ? -14.671 -14.625 30.477  1.00 21.02 ? 151 GLY D O   1 
ATOM   8677  N N   . PHE D 1 152 ? -14.097 -14.769 28.270  1.00 20.87 ? 152 PHE D N   1 
ATOM   8678  C CA  . PHE D 1 152 ? -14.002 -13.282 28.186  1.00 20.81 ? 152 PHE D CA  1 
ATOM   8679  C C   . PHE D 1 152 ? -15.180 -12.811 27.314  1.00 20.53 ? 152 PHE D C   1 
ATOM   8680  O O   . PHE D 1 152 ? -15.780 -13.591 26.586  1.00 20.39 ? 152 PHE D O   1 
ATOM   8681  C CB  . PHE D 1 152 ? -12.682 -12.737 27.845  1.00 21.03 ? 152 PHE D CB  1 
ATOM   8682  C CG  . PHE D 1 152 ? -11.653 -13.337 26.984  1.00 21.07 ? 152 PHE D CG  1 
ATOM   8683  C CD1 . PHE D 1 152 ? -11.796 -13.352 25.604  1.00 21.09 ? 152 PHE D CD1 1 
ATOM   8684  C CD2 . PHE D 1 152 ? -10.441 -13.775 27.555  1.00 21.08 ? 152 PHE D CD2 1 
ATOM   8685  C CE1 . PHE D 1 152 ? -10.792 -13.877 24.803  1.00 21.22 ? 152 PHE D CE1 1 
ATOM   8686  C CE2 . PHE D 1 152 ? -9.411  -14.277 26.762  1.00 21.07 ? 152 PHE D CE2 1 
ATOM   8687  C CZ  . PHE D 1 152 ? -9.602  -14.325 25.379  1.00 21.14 ? 152 PHE D CZ  1 
ATOM   8688  N N   . PRO D 1 153 ? -15.501 -11.549 27.509  1.00 20.43 ? 153 PRO D N   1 
ATOM   8689  C CA  . PRO D 1 153 ? -16.605 -10.889 26.825  1.00 20.27 ? 153 PRO D CA  1 
ATOM   8690  C C   . PRO D 1 153 ? -16.599 -11.131 25.340  1.00 20.04 ? 153 PRO D C   1 
ATOM   8691  O O   . PRO D 1 153 ? -15.553 -10.925 24.697  1.00 20.20 ? 153 PRO D O   1 
ATOM   8692  C CB  . PRO D 1 153 ? -16.419 -9.400  27.110  1.00 20.38 ? 153 PRO D CB  1 
ATOM   8693  C CG  . PRO D 1 153 ? -14.995 -9.288  27.623  1.00 20.53 ? 153 PRO D CG  1 
ATOM   8694  C CD  . PRO D 1 153 ? -14.831 -10.589 28.430  1.00 20.50 ? 153 PRO D CD  1 
ATOM   8695  N N   . VAL D 1 154 ? -17.707 -11.684 24.830  1.00 19.65 ? 154 VAL D N   1 
ATOM   8696  C CA  . VAL D 1 154 ? -17.845 -11.681 23.352  1.00 19.08 ? 154 VAL D CA  1 
ATOM   8697  C C   . VAL D 1 154 ? -17.720 -10.152 23.050  1.00 18.71 ? 154 VAL D C   1 
ATOM   8698  O O   . VAL D 1 154 ? -18.283 -9.342  23.795  1.00 18.72 ? 154 VAL D O   1 
ATOM   8699  C CB  . VAL D 1 154 ? -19.110 -12.264 22.794  1.00 19.17 ? 154 VAL D CB  1 
ATOM   8700  C CG1 . VAL D 1 154 ? -20.411 -11.646 23.285  1.00 18.96 ? 154 VAL D CG1 1 
ATOM   8701  C CG2 . VAL D 1 154 ? -19.032 -12.180 21.257  1.00 19.23 ? 154 VAL D CG2 1 
ATOM   8702  N N   . GLY D 1 155 ? -17.052 -9.916  21.987  1.00 18.18 ? 155 GLY D N   1 
ATOM   8703  C CA  . GLY D 1 155 ? -16.610 -8.507  21.635  1.00 17.32 ? 155 GLY D CA  1 
ATOM   8704  C C   . GLY D 1 155 ? -15.127 -8.912  21.323  1.00 16.85 ? 155 GLY D C   1 
ATOM   8705  O O   . GLY D 1 155 ? -14.712 -8.975  20.189  1.00 16.95 ? 155 GLY D O   1 
ATOM   8706  N N   . ARG D 1 156 ? -14.610 -9.526  22.389  1.00 16.27 ? 156 ARG D N   1 
ATOM   8707  C CA  . ARG D 1 156 ? -13.224 -10.056 22.335  1.00 15.62 ? 156 ARG D CA  1 
ATOM   8708  C C   . ARG D 1 156 ? -13.277 -11.302 21.477  1.00 14.97 ? 156 ARG D C   1 
ATOM   8709  O O   . ARG D 1 156 ? -12.671 -11.290 20.395  1.00 14.92 ? 156 ARG D O   1 
ATOM   8710  C CB  . ARG D 1 156 ? -12.585 -10.210 23.705  1.00 15.70 ? 156 ARG D CB  1 
ATOM   8711  C CG  . ARG D 1 156 ? -12.579 -8.886  24.509  1.00 15.60 ? 156 ARG D CG  1 
ATOM   8712  C CD  . ARG D 1 156 ? -11.331 -8.620  25.195  1.00 15.68 ? 156 ARG D CD  1 
ATOM   8713  N NE  . ARG D 1 156 ? -11.255 -8.839  26.619  1.00 15.92 ? 156 ARG D NE  1 
ATOM   8714  C CZ  . ARG D 1 156 ? -10.295 -9.597  27.187  1.00 16.19 ? 156 ARG D CZ  1 
ATOM   8715  N NH1 . ARG D 1 156 ? -9.376  -10.262 26.474  1.00 16.17 ? 156 ARG D NH1 1 
ATOM   8716  N NH2 . ARG D 1 156 ? -10.108 -9.552  28.516  1.00 16.29 ? 156 ARG D NH2 1 
ATOM   8717  N N   . VAL D 1 157 ? -14.164 -12.205 21.795  1.00 14.36 ? 157 VAL D N   1 
ATOM   8718  C CA  . VAL D 1 157 ? -14.298 -13.500 21.067  1.00 13.70 ? 157 VAL D CA  1 
ATOM   8719  C C   . VAL D 1 157 ? -15.207 -13.420 19.856  1.00 12.87 ? 157 VAL D C   1 
ATOM   8720  O O   . VAL D 1 157 ? -16.449 -13.560 19.948  1.00 12.82 ? 157 VAL D O   1 
ATOM   8721  C CB  . VAL D 1 157 ? -14.714 -14.548 22.134  1.00 13.80 ? 157 VAL D CB  1 
ATOM   8722  C CG1 . VAL D 1 157 ? -15.129 -15.878 21.539  1.00 13.83 ? 157 VAL D CG1 1 
ATOM   8723  C CG2 . VAL D 1 157 ? -13.608 -14.714 23.180  1.00 13.70 ? 157 VAL D CG2 1 
ATOM   8724  N N   . ILE D 1 158 ? -14.594 -13.336 18.690  1.00 11.89 ? 158 ILE D N   1 
ATOM   8725  C CA  . ILE D 1 158 ? -15.309 -13.171 17.428  1.00 11.06 ? 158 ILE D CA  1 
ATOM   8726  C C   . ILE D 1 158 ? -15.024 -14.316 16.458  1.00 10.69 ? 158 ILE D C   1 
ATOM   8727  O O   . ILE D 1 158 ? -14.023 -15.045 16.604  1.00 10.93 ? 158 ILE D O   1 
ATOM   8728  C CB  . ILE D 1 158 ? -14.990 -11.806 16.716  1.00 10.80 ? 158 ILE D CB  1 
ATOM   8729  C CG1 . ILE D 1 158 ? -14.617 -10.743 17.749  1.00 10.66 ? 158 ILE D CG1 1 
ATOM   8730  C CG2 . ILE D 1 158 ? -16.164 -11.369 15.793  1.00 10.63 ? 158 ILE D CG2 1 
ATOM   8731  C CD1 . ILE D 1 158 ? -14.208 -9.385  17.157  1.00 10.74 ? 158 ILE D CD1 1 
ATOM   8732  N N   . GLY D 1 159 ? -15.840 -14.358 15.404  1.00 9.83  ? 159 GLY D N   1 
ATOM   8733  C CA  . GLY D 1 159 ? -15.729 -15.399 14.425  1.00 8.82  ? 159 GLY D CA  1 
ATOM   8734  C C   . GLY D 1 159 ? -15.965 -14.963 13.004  1.00 8.30  ? 159 GLY D C   1 
ATOM   8735  O O   . GLY D 1 159 ? -16.848 -14.207 12.631  1.00 8.08  ? 159 GLY D O   1 
ATOM   8736  N N   . SER D 1 160 ? -15.165 -15.576 12.163  1.00 8.00  ? 160 SER D N   1 
ATOM   8737  C CA  . SER D 1 160 ? -15.101 -15.489 10.729  1.00 7.59  ? 160 SER D CA  1 
ATOM   8738  C C   . SER D 1 160 ? -16.488 -15.349 10.119  1.00 7.07  ? 160 SER D C   1 
ATOM   8739  O O   . SER D 1 160 ? -16.622 -14.789 9.025   1.00 7.04  ? 160 SER D O   1 
ATOM   8740  C CB  . SER D 1 160 ? -14.475 -16.782 10.150  1.00 7.74  ? 160 SER D CB  1 
ATOM   8741  O OG  . SER D 1 160 ? -15.353 -17.845 10.514  1.00 7.89  ? 160 SER D OG  1 
ATOM   8742  N N   . GLY D 1 161 ? -17.420 -16.016 10.769  1.00 6.56  ? 161 GLY D N   1 
ATOM   8743  C CA  . GLY D 1 161 ? -18.825 -15.969 10.332  1.00 6.21  ? 161 GLY D CA  1 
ATOM   8744  C C   . GLY D 1 161 ? -18.955 -15.990 8.823   1.00 5.88  ? 161 GLY D C   1 
ATOM   8745  O O   . GLY D 1 161 ? -18.253 -16.738 8.137   1.00 5.77  ? 161 GLY D O   1 
ATOM   8746  N N   . CYS D 1 162 ? -19.742 -15.052 8.324   1.00 5.80  ? 162 CYS D N   1 
ATOM   8747  C CA  . CYS D 1 162 ? -20.105 -14.991 6.893   1.00 5.64  ? 162 CYS D CA  1 
ATOM   8748  C C   . CYS D 1 162 ? -19.435 -13.891 6.139   1.00 5.53  ? 162 CYS D C   1 
ATOM   8749  O O   . CYS D 1 162 ? -19.705 -13.678 4.920   1.00 5.66  ? 162 CYS D O   1 
ATOM   8750  C CB  . CYS D 1 162 ? -21.652 -14.884 6.834   1.00 5.51  ? 162 CYS D CB  1 
ATOM   8751  S SG  . CYS D 1 162 ? -22.293 -15.885 8.231   1.00 5.92  ? 162 CYS D SG  1 
ATOM   8752  N N   . ASN D 1 163 ? -18.555 -13.187 6.837   1.00 5.09  ? 163 ASN D N   1 
ATOM   8753  C CA  . ASN D 1 163 ? -17.798 -12.077 6.190   1.00 4.75  ? 163 ASN D CA  1 
ATOM   8754  C C   . ASN D 1 163 ? -17.389 -12.614 4.809   1.00 4.44  ? 163 ASN D C   1 
ATOM   8755  O O   . ASN D 1 163 ? -17.714 -12.145 3.746   1.00 4.30  ? 163 ASN D O   1 
ATOM   8756  C CB  . ASN D 1 163 ? -16.668 -11.670 7.116   1.00 4.91  ? 163 ASN D CB  1 
ATOM   8757  C CG  . ASN D 1 163 ? -15.893 -10.554 6.429   1.00 5.08  ? 163 ASN D CG  1 
ATOM   8758  O OD1 . ASN D 1 163 ? -16.555 -9.527  6.203   1.00 5.50  ? 163 ASN D OD1 1 
ATOM   8759  N ND2 . ASN D 1 163 ? -14.686 -10.831 6.011   1.00 5.17  ? 163 ASN D ND2 1 
ATOM   8760  N N   . LEU D 1 164 ? -16.885 -13.830 4.930   1.00 4.13  ? 164 LEU D N   1 
ATOM   8761  C CA  . LEU D 1 164 ? -16.501 -14.757 3.880   1.00 3.61  ? 164 LEU D CA  1 
ATOM   8762  C C   . LEU D 1 164 ? -17.585 -14.859 2.807   1.00 3.23  ? 164 LEU D C   1 
ATOM   8763  O O   . LEU D 1 164 ? -17.482 -14.263 1.730   1.00 2.82  ? 164 LEU D O   1 
ATOM   8764  C CB  . LEU D 1 164 ? -16.260 -16.041 4.675   1.00 3.58  ? 164 LEU D CB  1 
ATOM   8765  C CG  . LEU D 1 164 ? -15.052 -16.903 4.482   1.00 3.51  ? 164 LEU D CG  1 
ATOM   8766  C CD1 . LEU D 1 164 ? -15.304 -18.243 5.190   1.00 3.39  ? 164 LEU D CD1 1 
ATOM   8767  C CD2 . LEU D 1 164 ? -14.763 -17.144 3.007   1.00 3.57  ? 164 LEU D CD2 1 
ATOM   8768  N N   . ASP D 1 165 ? -18.620 -15.609 3.110   1.00 3.20  ? 165 ASP D N   1 
ATOM   8769  C CA  . ASP D 1 165 ? -19.823 -15.852 2.319   1.00 3.28  ? 165 ASP D CA  1 
ATOM   8770  C C   . ASP D 1 165 ? -20.390 -14.623 1.589   1.00 3.21  ? 165 ASP D C   1 
ATOM   8771  O O   . ASP D 1 165 ? -20.613 -14.629 0.368   1.00 3.09  ? 165 ASP D O   1 
ATOM   8772  C CB  . ASP D 1 165 ? -20.949 -16.442 3.205   1.00 3.19  ? 165 ASP D CB  1 
ATOM   8773  C CG  . ASP D 1 165 ? -20.505 -17.740 3.875   1.00 3.20  ? 165 ASP D CG  1 
ATOM   8774  O OD1 . ASP D 1 165 ? -20.137 -18.711 3.203   1.00 3.04  ? 165 ASP D OD1 1 
ATOM   8775  O OD2 . ASP D 1 165 ? -20.547 -17.689 5.119   1.00 3.19  ? 165 ASP D OD2 1 
ATOM   8776  N N   . SER D 1 166 ? -20.714 -13.617 2.395   1.00 3.01  ? 166 SER D N   1 
ATOM   8777  C CA  . SER D 1 166 ? -21.197 -12.317 1.926   1.00 2.70  ? 166 SER D CA  1 
ATOM   8778  C C   . SER D 1 166 ? -20.321 -11.780 0.790   1.00 2.59  ? 166 SER D C   1 
ATOM   8779  O O   . SER D 1 166 ? -20.792 -11.152 -0.158  1.00 2.69  ? 166 SER D O   1 
ATOM   8780  C CB  . SER D 1 166 ? -21.195 -11.317 3.074   1.00 2.60  ? 166 SER D CB  1 
ATOM   8781  O OG  . SER D 1 166 ? -21.355 -11.972 4.312   1.00 2.29  ? 166 SER D OG  1 
ATOM   8782  N N   . ALA D 1 167 ? -19.032 -11.970 0.963   1.00 2.45  ? 167 ALA D N   1 
ATOM   8783  C CA  . ALA D 1 167 ? -18.008 -11.574 0.005   1.00 2.27  ? 167 ALA D CA  1 
ATOM   8784  C C   . ALA D 1 167 ? -18.116 -12.497 -1.205  1.00 2.23  ? 167 ALA D C   1 
ATOM   8785  O O   . ALA D 1 167 ? -18.117 -12.079 -2.365  1.00 2.06  ? 167 ALA D O   1 
ATOM   8786  C CB  . ALA D 1 167 ? -16.638 -11.631 0.656   1.00 2.18  ? 167 ALA D CB  1 
ATOM   8787  N N   . ARG D 1 168 ? -18.269 -13.769 -0.862  1.00 2.34  ? 168 ARG D N   1 
ATOM   8788  C CA  . ARG D 1 168 ? -18.380 -14.831 -1.913  1.00 2.39  ? 168 ARG D CA  1 
ATOM   8789  C C   . ARG D 1 168 ? -19.547 -14.453 -2.839  1.00 2.53  ? 168 ARG D C   1 
ATOM   8790  O O   . ARG D 1 168 ? -19.523 -14.586 -4.068  1.00 2.36  ? 168 ARG D O   1 
ATOM   8791  C CB  . ARG D 1 168 ? -18.535 -16.178 -1.254  1.00 2.16  ? 168 ARG D CB  1 
ATOM   8792  C CG  . ARG D 1 168 ? -17.665 -17.308 -1.765  1.00 2.15  ? 168 ARG D CG  1 
ATOM   8793  C CD  . ARG D 1 168 ? -18.109 -18.647 -1.267  1.00 2.21  ? 168 ARG D CD  1 
ATOM   8794  N NE  . ARG D 1 168 ? -17.583 -19.012 0.042   1.00 2.09  ? 168 ARG D NE  1 
ATOM   8795  C CZ  . ARG D 1 168 ? -16.291 -19.320 0.217   1.00 2.00  ? 168 ARG D CZ  1 
ATOM   8796  N NH1 . ARG D 1 168 ? -15.494 -19.267 -0.853  1.00 2.08  ? 168 ARG D NH1 1 
ATOM   8797  N NH2 . ARG D 1 168 ? -15.842 -19.768 1.364   1.00 2.00  ? 168 ARG D NH2 1 
ATOM   8798  N N   . PHE D 1 169 ? -20.536 -13.888 -2.166  1.00 2.59  ? 169 PHE D N   1 
ATOM   8799  C CA  . PHE D 1 169 ? -21.828 -13.411 -2.652  1.00 2.54  ? 169 PHE D CA  1 
ATOM   8800  C C   . PHE D 1 169 ? -21.627 -12.172 -3.515  1.00 2.65  ? 169 PHE D C   1 
ATOM   8801  O O   . PHE D 1 169 ? -21.822 -12.277 -4.744  1.00 2.76  ? 169 PHE D O   1 
ATOM   8802  C CB  . PHE D 1 169 ? -22.775 -13.225 -1.481  1.00 2.47  ? 169 PHE D CB  1 
ATOM   8803  C CG  . PHE D 1 169 ? -24.186 -12.797 -1.600  1.00 2.46  ? 169 PHE D CG  1 
ATOM   8804  C CD1 . PHE D 1 169 ? -25.102 -13.442 -2.432  1.00 2.38  ? 169 PHE D CD1 1 
ATOM   8805  C CD2 . PHE D 1 169 ? -24.667 -11.747 -0.789  1.00 2.54  ? 169 PHE D CD2 1 
ATOM   8806  C CE1 . PHE D 1 169 ? -26.437 -13.078 -2.465  1.00 2.33  ? 169 PHE D CE1 1 
ATOM   8807  C CE2 . PHE D 1 169 ? -26.014 -11.361 -0.765  1.00 2.28  ? 169 PHE D CE2 1 
ATOM   8808  C CZ  . PHE D 1 169 ? -26.884 -12.037 -1.636  1.00 2.43  ? 169 PHE D CZ  1 
ATOM   8809  N N   . ARG D 1 170 ? -21.223 -11.065 -2.917  1.00 2.65  ? 170 ARG D N   1 
ATOM   8810  C CA  . ARG D 1 170 ? -20.945 -9.823  -3.652  1.00 2.65  ? 170 ARG D CA  1 
ATOM   8811  C C   . ARG D 1 170 ? -20.187 -10.162 -4.932  1.00 2.91  ? 170 ARG D C   1 
ATOM   8812  O O   . ARG D 1 170 ? -20.366 -9.509  -5.950  1.00 2.94  ? 170 ARG D O   1 
ATOM   8813  C CB  . ARG D 1 170 ? -20.169 -8.779  -2.875  1.00 2.47  ? 170 ARG D CB  1 
ATOM   8814  C CG  . ARG D 1 170 ? -20.956 -7.609  -2.334  1.00 2.23  ? 170 ARG D CG  1 
ATOM   8815  C CD  . ARG D 1 170 ? -20.783 -7.331  -0.921  1.00 2.04  ? 170 ARG D CD  1 
ATOM   8816  N NE  . ARG D 1 170 ? -19.881 -6.435  -0.382  1.00 2.00  ? 170 ARG D NE  1 
ATOM   8817  C CZ  . ARG D 1 170 ? -19.410 -5.246  -0.657  1.00 2.25  ? 170 ARG D CZ  1 
ATOM   8818  N NH1 . ARG D 1 170 ? -19.641 -4.439  -1.694  1.00 2.08  ? 170 ARG D NH1 1 
ATOM   8819  N NH2 . ARG D 1 170 ? -18.719 -4.631  0.333   1.00 2.70  ? 170 ARG D NH2 1 
ATOM   8820  N N   . TYR D 1 171 ? -19.339 -11.174 -4.840  1.00 3.40  ? 171 TYR D N   1 
ATOM   8821  C CA  . TYR D 1 171 ? -18.597 -11.605 -6.030  1.00 3.99  ? 171 TYR D CA  1 
ATOM   8822  C C   . TYR D 1 171 ? -19.649 -11.981 -7.085  1.00 4.54  ? 171 TYR D C   1 
ATOM   8823  O O   . TYR D 1 171 ? -19.972 -11.140 -7.932  1.00 4.73  ? 171 TYR D O   1 
ATOM   8824  C CB  . TYR D 1 171 ? -17.565 -12.708 -5.804  1.00 3.97  ? 171 TYR D CB  1 
ATOM   8825  C CG  . TYR D 1 171 ? -17.143 -13.474 -7.053  1.00 3.77  ? 171 TYR D CG  1 
ATOM   8826  C CD1 . TYR D 1 171 ? -17.415 -14.846 -7.146  1.00 3.70  ? 171 TYR D CD1 1 
ATOM   8827  C CD2 . TYR D 1 171 ? -16.674 -12.817 -8.186  1.00 3.54  ? 171 TYR D CD2 1 
ATOM   8828  C CE1 . TYR D 1 171 ? -17.077 -15.564 -8.291  1.00 3.62  ? 171 TYR D CE1 1 
ATOM   8829  C CE2 . TYR D 1 171 ? -16.374 -13.517 -9.345  1.00 3.45  ? 171 TYR D CE2 1 
ATOM   8830  C CZ  . TYR D 1 171 ? -16.561 -14.885 -9.391  1.00 3.48  ? 171 TYR D CZ  1 
ATOM   8831  O OH  . TYR D 1 171 ? -16.239 -15.556 -10.527 1.00 3.47  ? 171 TYR D OH  1 
ATOM   8832  N N   . LEU D 1 172 ? -20.111 -13.227 -6.991  1.00 4.96  ? 172 LEU D N   1 
ATOM   8833  C CA  . LEU D 1 172 ? -21.060 -13.770 -7.953  1.00 5.29  ? 172 LEU D CA  1 
ATOM   8834  C C   . LEU D 1 172 ? -22.042 -12.668 -8.410  1.00 5.64  ? 172 LEU D C   1 
ATOM   8835  O O   . LEU D 1 172 ? -22.229 -12.431 -9.595  1.00 5.77  ? 172 LEU D O   1 
ATOM   8836  C CB  . LEU D 1 172 ? -21.806 -14.958 -7.360  1.00 5.10  ? 172 LEU D CB  1 
ATOM   8837  C CG  . LEU D 1 172 ? -21.215 -16.135 -6.684  1.00 4.79  ? 172 LEU D CG  1 
ATOM   8838  C CD1 . LEU D 1 172 ? -22.299 -16.962 -5.978  1.00 4.65  ? 172 LEU D CD1 1 
ATOM   8839  C CD2 . LEU D 1 172 ? -20.538 -17.055 -7.696  1.00 4.79  ? 172 LEU D CD2 1 
ATOM   8840  N N   . ILE D 1 173 ? -22.669 -12.085 -7.412  1.00 6.04  ? 173 ILE D N   1 
ATOM   8841  C CA  . ILE D 1 173 ? -23.700 -11.043 -7.621  1.00 6.63  ? 173 ILE D CA  1 
ATOM   8842  C C   . ILE D 1 173 ? -23.226 -10.077 -8.697  1.00 7.16  ? 173 ILE D C   1 
ATOM   8843  O O   . ILE D 1 173 ? -23.859 -9.915  -9.783  1.00 7.27  ? 173 ILE D O   1 
ATOM   8844  C CB  . ILE D 1 173 ? -24.069 -10.489 -6.215  1.00 6.49  ? 173 ILE D CB  1 
ATOM   8845  C CG1 . ILE D 1 173 ? -25.586 -10.189 -6.071  1.00 6.36  ? 173 ILE D CG1 1 
ATOM   8846  C CG2 . ILE D 1 173 ? -23.232 -9.246  -5.835  1.00 6.69  ? 173 ILE D CG2 1 
ATOM   8847  C CD1 . ILE D 1 173 ? -25.979 -9.754  -4.620  1.00 6.26  ? 173 ILE D CD1 1 
ATOM   8848  N N   . GLY D 1 174 ? -22.039 -9.532  -8.498  1.00 7.48  ? 174 GLY D N   1 
ATOM   8849  C CA  . GLY D 1 174 ? -21.391 -8.598  -9.408  1.00 7.94  ? 174 GLY D CA  1 
ATOM   8850  C C   . GLY D 1 174 ? -20.958 -9.260  -10.714 1.00 8.22  ? 174 GLY D C   1 
ATOM   8851  O O   . GLY D 1 174 ? -20.690 -8.549  -11.708 1.00 8.12  ? 174 GLY D O   1 
ATOM   8852  N N   . GLU D 1 175 ? -20.842 -10.564 -10.685 1.00 8.65  ? 175 GLU D N   1 
ATOM   8853  C CA  . GLU D 1 175 ? -20.421 -11.351 -11.877 1.00 9.31  ? 175 GLU D CA  1 
ATOM   8854  C C   . GLU D 1 175 ? -21.496 -11.136 -12.933 1.00 9.14  ? 175 GLU D C   1 
ATOM   8855  O O   . GLU D 1 175 ? -21.155 -11.147 -14.130 1.00 9.29  ? 175 GLU D O   1 
ATOM   8856  C CB  . GLU D 1 175 ? -20.129 -12.807 -11.586 1.00 9.86  ? 175 GLU D CB  1 
ATOM   8857  C CG  . GLU D 1 175 ? -19.704 -13.900 -12.485 1.00 10.67 ? 175 GLU D CG  1 
ATOM   8858  C CD  . GLU D 1 175 ? -19.816 -15.371 -12.212 1.00 11.40 ? 175 GLU D CD  1 
ATOM   8859  O OE1 . GLU D 1 175 ? -18.884 -16.218 -12.169 1.00 11.48 ? 175 GLU D OE1 1 
ATOM   8860  O OE2 . GLU D 1 175 ? -20.995 -15.860 -12.129 1.00 11.64 ? 175 GLU D OE2 1 
ATOM   8861  N N   . LYS D 1 176 ? -22.690 -10.713 -12.533 1.00 8.87  ? 176 LYS D N   1 
ATOM   8862  C CA  . LYS D 1 176 ? -23.811 -10.590 -13.489 1.00 8.80  ? 176 LYS D CA  1 
ATOM   8863  C C   . LYS D 1 176 ? -24.135 -9.206  -14.005 1.00 8.49  ? 176 LYS D C   1 
ATOM   8864  O O   . LYS D 1 176 ? -24.593 -9.065  -15.179 1.00 8.40  ? 176 LYS D O   1 
ATOM   8865  C CB  . LYS D 1 176 ? -25.077 -11.267 -12.891 1.00 8.90  ? 176 LYS D CB  1 
ATOM   8866  C CG  . LYS D 1 176 ? -25.339 -12.642 -13.464 1.00 9.03  ? 176 LYS D CG  1 
ATOM   8867  C CD  . LYS D 1 176 ? -25.572 -13.758 -12.504 1.00 9.29  ? 176 LYS D CD  1 
ATOM   8868  C CE  . LYS D 1 176 ? -26.755 -13.645 -11.572 1.00 9.40  ? 176 LYS D CE  1 
ATOM   8869  N NZ  . LYS D 1 176 ? -26.645 -14.614 -10.434 1.00 9.22  ? 176 LYS D NZ  1 
ATOM   8870  N N   . LEU D 1 177 ? -23.997 -8.175  -13.193 1.00 7.97  ? 177 LEU D N   1 
ATOM   8871  C CA  . LEU D 1 177 ? -24.268 -6.792  -13.558 1.00 7.44  ? 177 LEU D CA  1 
ATOM   8872  C C   . LEU D 1 177 ? -23.092 -6.192  -14.347 1.00 7.25  ? 177 LEU D C   1 
ATOM   8873  O O   . LEU D 1 177 ? -23.284 -5.342  -15.251 1.00 7.21  ? 177 LEU D O   1 
ATOM   8874  C CB  . LEU D 1 177 ? -24.602 -6.010  -12.292 1.00 7.26  ? 177 LEU D CB  1 
ATOM   8875  C CG  . LEU D 1 177 ? -25.588 -6.545  -11.301 1.00 7.27  ? 177 LEU D CG  1 
ATOM   8876  C CD1 . LEU D 1 177 ? -25.589 -5.742  -9.992  1.00 7.19  ? 177 LEU D CD1 1 
ATOM   8877  C CD2 . LEU D 1 177 ? -27.000 -6.485  -11.897 1.00 7.25  ? 177 LEU D CD2 1 
ATOM   8878  N N   . GLY D 1 178 ? -21.907 -6.634  -13.952 1.00 6.87  ? 178 GLY D N   1 
ATOM   8879  C CA  . GLY D 1 178 ? -20.637 -6.146  -14.554 1.00 6.40  ? 178 GLY D CA  1 
ATOM   8880  C C   . GLY D 1 178 ? -20.244 -4.874  -13.760 1.00 5.87  ? 178 GLY D C   1 
ATOM   8881  O O   . GLY D 1 178 ? -19.951 -3.834  -14.333 1.00 5.73  ? 178 GLY D O   1 
ATOM   8882  N N   . VAL D 1 179 ? -20.247 -5.082  -12.476 1.00 5.45  ? 179 VAL D N   1 
ATOM   8883  C CA  . VAL D 1 179 ? -20.034 -4.087  -11.427 1.00 5.00  ? 179 VAL D CA  1 
ATOM   8884  C C   . VAL D 1 179 ? -19.251 -4.722  -10.287 1.00 4.89  ? 179 VAL D C   1 
ATOM   8885  O O   . VAL D 1 179 ? -19.638 -5.831  -9.855  1.00 4.99  ? 179 VAL D O   1 
ATOM   8886  C CB  . VAL D 1 179 ? -21.461 -3.640  -10.997 1.00 4.78  ? 179 VAL D CB  1 
ATOM   8887  C CG1 . VAL D 1 179 ? -21.477 -2.935  -9.659  1.00 4.80  ? 179 VAL D CG1 1 
ATOM   8888  C CG2 . VAL D 1 179 ? -22.154 -2.861  -12.080 1.00 4.49  ? 179 VAL D CG2 1 
ATOM   8889  N N   . ASN D 1 180 ? -18.360 -4.016  -9.705  1.00 4.91  ? 180 ASN D N   1 
ATOM   8890  C CA  . ASN D 1 180 ? -17.421 -4.487  -8.635  1.00 5.15  ? 180 ASN D CA  1 
ATOM   8891  C C   . ASN D 1 180 ? -18.151 -4.822  -7.360  1.00 5.29  ? 180 ASN D C   1 
ATOM   8892  O O   . ASN D 1 180 ? -19.117 -4.172  -6.940  1.00 5.25  ? 180 ASN D O   1 
ATOM   8893  C CB  . ASN D 1 180 ? -16.330 -3.443  -8.650  1.00 5.29  ? 180 ASN D CB  1 
ATOM   8894  C CG  . ASN D 1 180 ? -14.913 -3.817  -8.432  1.00 5.41  ? 180 ASN D CG  1 
ATOM   8895  O OD1 . ASN D 1 180 ? -14.124 -3.015  -7.863  1.00 5.80  ? 180 ASN D OD1 1 
ATOM   8896  N ND2 . ASN D 1 180 ? -14.486 -4.991  -8.858  1.00 5.44  ? 180 ASN D ND2 1 
ATOM   8897  N N   . PRO D 1 181 ? -17.693 -5.898  -6.715  1.00 5.77  ? 181 PRO D N   1 
ATOM   8898  C CA  . PRO D 1 181 ? -18.327 -6.498  -5.542  1.00 6.15  ? 181 PRO D CA  1 
ATOM   8899  C C   . PRO D 1 181 ? -18.248 -5.630  -4.310  1.00 6.37  ? 181 PRO D C   1 
ATOM   8900  O O   . PRO D 1 181 ? -18.357 -6.116  -3.172  1.00 6.68  ? 181 PRO D O   1 
ATOM   8901  C CB  . PRO D 1 181 ? -17.449 -7.764  -5.276  1.00 6.06  ? 181 PRO D CB  1 
ATOM   8902  C CG  . PRO D 1 181 ? -16.066 -7.119  -5.440  1.00 6.10  ? 181 PRO D CG  1 
ATOM   8903  C CD  . PRO D 1 181 ? -16.246 -6.288  -6.724  1.00 6.09  ? 181 PRO D CD  1 
ATOM   8904  N N   . THR D 1 182 ? -17.663 -4.498  -4.551  1.00 6.51  ? 182 THR D N   1 
ATOM   8905  C CA  . THR D 1 182 ? -17.408 -3.437  -3.600  1.00 6.44  ? 182 THR D CA  1 
ATOM   8906  C C   . THR D 1 182 ? -18.555 -2.417  -3.783  1.00 6.31  ? 182 THR D C   1 
ATOM   8907  O O   . THR D 1 182 ? -18.915 -1.717  -2.881  1.00 6.26  ? 182 THR D O   1 
ATOM   8908  C CB  . THR D 1 182 ? -16.043 -2.711  -3.922  1.00 6.44  ? 182 THR D CB  1 
ATOM   8909  O OG1 . THR D 1 182 ? -16.315 -1.270  -3.711  1.00 6.59  ? 182 THR D OG1 1 
ATOM   8910  C CG2 . THR D 1 182 ? -15.503 -2.966  -5.324  1.00 6.18  ? 182 THR D CG2 1 
ATOM   8911  N N   . SER D 1 183 ? -18.894 -2.359  -5.046  1.00 6.37  ? 183 SER D N   1 
ATOM   8912  C CA  . SER D 1 183 ? -19.860 -1.516  -5.665  1.00 6.67  ? 183 SER D CA  1 
ATOM   8913  C C   . SER D 1 183 ? -21.230 -2.146  -5.796  1.00 6.98  ? 183 SER D C   1 
ATOM   8914  O O   . SER D 1 183 ? -22.095 -1.497  -6.411  1.00 7.23  ? 183 SER D O   1 
ATOM   8915  C CB  . SER D 1 183 ? -19.334 -1.045  -7.032  1.00 6.70  ? 183 SER D CB  1 
ATOM   8916  O OG  . SER D 1 183 ? -19.751 0.307   -7.223  1.00 7.04  ? 183 SER D OG  1 
ATOM   8917  N N   . CYS D 1 184 ? -21.410 -3.365  -5.384  1.00 7.33  ? 184 CYS D N   1 
ATOM   8918  C CA  . CYS D 1 184 ? -22.715 -4.034  -5.281  1.00 7.63  ? 184 CYS D CA  1 
ATOM   8919  C C   . CYS D 1 184 ? -22.773 -4.362  -3.774  1.00 8.01  ? 184 CYS D C   1 
ATOM   8920  O O   . CYS D 1 184 ? -21.666 -4.567  -3.229  1.00 8.17  ? 184 CYS D O   1 
ATOM   8921  C CB  . CYS D 1 184 ? -22.892 -5.315  -6.004  1.00 7.77  ? 184 CYS D CB  1 
ATOM   8922  S SG  . CYS D 1 184 ? -22.229 -5.494  -7.656  1.00 8.65  ? 184 CYS D SG  1 
ATOM   8923  N N   . HIS D 1 185 ? -23.933 -4.408  -3.209  1.00 8.41  ? 185 HIS D N   1 
ATOM   8924  C CA  . HIS D 1 185 ? -23.987 -4.716  -1.741  1.00 8.82  ? 185 HIS D CA  1 
ATOM   8925  C C   . HIS D 1 185 ? -25.108 -5.722  -1.564  1.00 9.32  ? 185 HIS D C   1 
ATOM   8926  O O   . HIS D 1 185 ? -26.068 -5.685  -2.357  1.00 9.34  ? 185 HIS D O   1 
ATOM   8927  C CB  . HIS D 1 185 ? -24.150 -3.466  -0.892  1.00 8.82  ? 185 HIS D CB  1 
ATOM   8928  C CG  . HIS D 1 185 ? -23.248 -2.348  -1.330  1.00 8.81  ? 185 HIS D CG  1 
ATOM   8929  N ND1 . HIS D 1 185 ? -22.230 -1.833  -0.581  1.00 8.87  ? 185 HIS D ND1 1 
ATOM   8930  C CD2 . HIS D 1 185 ? -23.202 -1.680  -2.514  1.00 8.78  ? 185 HIS D CD2 1 
ATOM   8931  C CE1 . HIS D 1 185 ? -21.600 -0.891  -1.283  1.00 8.82  ? 185 HIS D CE1 1 
ATOM   8932  N NE2 . HIS D 1 185 ? -22.150 -0.816  -2.469  1.00 8.70  ? 185 HIS D NE2 1 
ATOM   8933  N N   . GLY D 1 186 ? -24.916 -6.616  -0.630  1.00 9.80  ? 186 GLY D N   1 
ATOM   8934  C CA  . GLY D 1 186 ? -25.853 -7.712  -0.303  1.00 10.33 ? 186 GLY D CA  1 
ATOM   8935  C C   . GLY D 1 186 ? -25.309 -8.369  0.969   1.00 10.79 ? 186 GLY D C   1 
ATOM   8936  O O   . GLY D 1 186 ? -24.066 -8.362  1.149   1.00 11.24 ? 186 GLY D O   1 
ATOM   8937  N N   . TRP D 1 187 ? -26.164 -8.966  1.751   1.00 10.94 ? 187 TRP D N   1 
ATOM   8938  C CA  . TRP D 1 187 ? -25.753 -9.528  3.068   1.00 11.04 ? 187 TRP D CA  1 
ATOM   8939  C C   . TRP D 1 187 ? -26.256 -10.954 3.127   1.00 10.80 ? 187 TRP D C   1 
ATOM   8940  O O   . TRP D 1 187 ? -27.328 -11.242 2.532   1.00 10.99 ? 187 TRP D O   1 
ATOM   8941  C CB  . TRP D 1 187 ? -26.277 -8.577  4.140   1.00 11.75 ? 187 TRP D CB  1 
ATOM   8942  C CG  . TRP D 1 187 ? -25.316 -7.999  5.106   1.00 12.70 ? 187 TRP D CG  1 
ATOM   8943  C CD1 . TRP D 1 187 ? -24.993 -8.446  6.366   1.00 12.97 ? 187 TRP D CD1 1 
ATOM   8944  C CD2 . TRP D 1 187 ? -24.503 -6.815  4.928   1.00 12.97 ? 187 TRP D CD2 1 
ATOM   8945  N NE1 . TRP D 1 187 ? -24.026 -7.670  6.958   1.00 13.05 ? 187 TRP D NE1 1 
ATOM   8946  C CE2 . TRP D 1 187 ? -23.697 -6.671  6.082   1.00 13.06 ? 187 TRP D CE2 1 
ATOM   8947  C CE3 . TRP D 1 187 ? -24.332 -5.940  3.863   1.00 13.04 ? 187 TRP D CE3 1 
ATOM   8948  C CZ2 . TRP D 1 187 ? -22.750 -5.664  6.209   1.00 13.05 ? 187 TRP D CZ2 1 
ATOM   8949  C CZ3 . TRP D 1 187 ? -23.392 -4.939  3.998   1.00 13.09 ? 187 TRP D CZ3 1 
ATOM   8950  C CH2 . TRP D 1 187 ? -22.624 -4.799  5.148   1.00 13.06 ? 187 TRP D CH2 1 
ATOM   8951  N N   . VAL D 1 188 ? -25.452 -11.895 3.579   1.00 10.27 ? 188 VAL D N   1 
ATOM   8952  C CA  . VAL D 1 188 ? -25.887 -13.286 3.763   1.00 9.89  ? 188 VAL D CA  1 
ATOM   8953  C C   . VAL D 1 188 ? -25.571 -13.590 5.232   1.00 9.84  ? 188 VAL D C   1 
ATOM   8954  O O   . VAL D 1 188 ? -24.387 -13.380 5.571   1.00 10.11 ? 188 VAL D O   1 
ATOM   8955  C CB  . VAL D 1 188 ? -25.249 -14.285 2.814   1.00 9.82  ? 188 VAL D CB  1 
ATOM   8956  C CG1 . VAL D 1 188 ? -25.858 -15.707 2.998   1.00 9.73  ? 188 VAL D CG1 1 
ATOM   8957  C CG2 . VAL D 1 188 ? -25.293 -13.936 1.352   1.00 9.63  ? 188 VAL D CG2 1 
ATOM   8958  N N   . LEU D 1 189 ? -26.559 -13.961 6.009   1.00 9.59  ? 189 LEU D N   1 
ATOM   8959  C CA  . LEU D 1 189 ? -26.259 -14.286 7.415   1.00 9.56  ? 189 LEU D CA  1 
ATOM   8960  C C   . LEU D 1 189 ? -26.954 -15.583 7.835   1.00 9.66  ? 189 LEU D C   1 
ATOM   8961  O O   . LEU D 1 189 ? -27.392 -16.393 7.014   1.00 9.66  ? 189 LEU D O   1 
ATOM   8962  C CB  . LEU D 1 189 ? -26.430 -13.102 8.314   1.00 9.58  ? 189 LEU D CB  1 
ATOM   8963  C CG  . LEU D 1 189 ? -27.215 -11.853 7.994   1.00 9.57  ? 189 LEU D CG  1 
ATOM   8964  C CD1 . LEU D 1 189 ? -26.493 -11.039 6.927   1.00 9.29  ? 189 LEU D CD1 1 
ATOM   8965  C CD2 . LEU D 1 189 ? -28.625 -12.232 7.550   1.00 9.42  ? 189 LEU D CD2 1 
ATOM   8966  N N   . GLY D 1 190 ? -27.024 -15.720 9.157   1.00 9.66  ? 190 GLY D N   1 
ATOM   8967  C CA  . GLY D 1 190 ? -27.481 -17.006 9.720   1.00 9.79  ? 190 GLY D CA  1 
ATOM   8968  C C   . GLY D 1 190 ? -26.171 -17.813 9.941   1.00 9.87  ? 190 GLY D C   1 
ATOM   8969  O O   . GLY D 1 190 ? -25.274 -17.333 10.641  1.00 9.78  ? 190 GLY D O   1 
ATOM   8970  N N   . GLU D 1 191 ? -26.121 -18.949 9.294   1.00 10.02 ? 191 GLU D N   1 
ATOM   8971  C CA  . GLU D 1 191 ? -25.006 -19.889 9.390   1.00 10.11 ? 191 GLU D CA  1 
ATOM   8972  C C   . GLU D 1 191 ? -23.987 -19.750 8.265   1.00 9.91  ? 191 GLU D C   1 
ATOM   8973  O O   . GLU D 1 191 ? -24.240 -19.275 7.166   1.00 9.84  ? 191 GLU D O   1 
ATOM   8974  C CB  . GLU D 1 191 ? -25.513 -21.338 9.399   1.00 10.40 ? 191 GLU D CB  1 
ATOM   8975  C CG  . GLU D 1 191 ? -24.525 -22.430 8.984   1.00 10.73 ? 191 GLU D CG  1 
ATOM   8976  C CD  . GLU D 1 191 ? -24.857 -23.843 9.328   1.00 10.84 ? 191 GLU D CD  1 
ATOM   8977  O OE1 . GLU D 1 191 ? -24.718 -24.320 10.442  1.00 10.83 ? 191 GLU D OE1 1 
ATOM   8978  O OE2 . GLU D 1 191 ? -25.273 -24.427 8.301   1.00 11.02 ? 191 GLU D OE2 1 
ATOM   8979  N N   . HIS D 1 192 ? -22.789 -20.187 8.603   1.00 9.78  ? 192 HIS D N   1 
ATOM   8980  C CA  . HIS D 1 192 ? -21.620 -20.235 7.721   1.00 9.77  ? 192 HIS D CA  1 
ATOM   8981  C C   . HIS D 1 192 ? -21.532 -21.701 7.264   1.00 9.66  ? 192 HIS D C   1 
ATOM   8982  O O   . HIS D 1 192 ? -20.873 -22.534 7.898   1.00 9.50  ? 192 HIS D O   1 
ATOM   8983  C CB  . HIS D 1 192 ? -20.285 -19.776 8.346   1.00 9.83  ? 192 HIS D CB  1 
ATOM   8984  C CG  . HIS D 1 192 ? -19.141 -20.032 7.419   1.00 9.98  ? 192 HIS D CG  1 
ATOM   8985  N ND1 . HIS D 1 192 ? -18.987 -19.377 6.234   1.00 10.15 ? 192 HIS D ND1 1 
ATOM   8986  C CD2 . HIS D 1 192 ? -18.191 -20.999 7.438   1.00 10.21 ? 192 HIS D CD2 1 
ATOM   8987  C CE1 . HIS D 1 192 ? -17.973 -19.912 5.567   1.00 10.25 ? 192 HIS D CE1 1 
ATOM   8988  N NE2 . HIS D 1 192 ? -17.444 -20.883 6.287   1.00 10.28 ? 192 HIS D NE2 1 
ATOM   8989  N N   . GLY D 1 193 ? -22.268 -21.933 6.188   1.00 9.70  ? 193 GLY D N   1 
ATOM   8990  C CA  . GLY D 1 193 ? -22.432 -23.314 5.688   1.00 9.79  ? 193 GLY D CA  1 
ATOM   8991  C C   . GLY D 1 193 ? -23.675 -23.446 4.834   1.00 9.62  ? 193 GLY D C   1 
ATOM   8992  O O   . GLY D 1 193 ? -23.638 -22.799 3.765   1.00 9.61  ? 193 GLY D O   1 
ATOM   8993  N N   . ASP D 1 194 ? -24.716 -24.139 5.300   1.00 9.54  ? 194 ASP D N   1 
ATOM   8994  C CA  . ASP D 1 194 ? -25.847 -24.371 4.363   1.00 9.66  ? 194 ASP D CA  1 
ATOM   8995  C C   . ASP D 1 194 ? -27.156 -23.777 4.851   1.00 9.26  ? 194 ASP D C   1 
ATOM   8996  O O   . ASP D 1 194 ? -28.184 -24.105 4.229   1.00 9.39  ? 194 ASP D O   1 
ATOM   8997  C CB  . ASP D 1 194 ? -26.090 -25.850 4.016   1.00 10.07 ? 194 ASP D CB  1 
ATOM   8998  C CG  . ASP D 1 194 ? -24.842 -26.646 3.744   1.00 10.63 ? 194 ASP D CG  1 
ATOM   8999  O OD1 . ASP D 1 194 ? -24.334 -26.681 2.613   1.00 10.73 ? 194 ASP D OD1 1 
ATOM   9000  O OD2 . ASP D 1 194 ? -24.336 -27.221 4.759   1.00 11.09 ? 194 ASP D OD2 1 
ATOM   9001  N N   . SER D 1 195 ? -27.105 -23.094 5.934   1.00 8.85  ? 195 SER D N   1 
ATOM   9002  C CA  . SER D 1 195 ? -28.339 -22.523 6.553   1.00 8.35  ? 195 SER D CA  1 
ATOM   9003  C C   . SER D 1 195 ? -28.291 -21.032 6.267   1.00 8.04  ? 195 SER D C   1 
ATOM   9004  O O   . SER D 1 195 ? -28.732 -20.210 7.068   1.00 8.03  ? 195 SER D O   1 
ATOM   9005  C CB  . SER D 1 195 ? -28.277 -22.840 8.038   1.00 8.20  ? 195 SER D CB  1 
ATOM   9006  O OG  . SER D 1 195 ? -27.981 -24.206 8.262   1.00 7.97  ? 195 SER D OG  1 
ATOM   9007  N N   . SER D 1 196 ? -27.654 -20.749 5.124   1.00 7.66  ? 196 SER D N   1 
ATOM   9008  C CA  . SER D 1 196 ? -27.308 -19.336 4.825   1.00 7.03  ? 196 SER D CA  1 
ATOM   9009  C C   . SER D 1 196 ? -28.489 -18.629 4.187   1.00 6.52  ? 196 SER D C   1 
ATOM   9010  O O   . SER D 1 196 ? -28.926 -18.984 3.109   1.00 6.38  ? 196 SER D O   1 
ATOM   9011  C CB  . SER D 1 196 ? -26.065 -19.177 3.988   1.00 6.94  ? 196 SER D CB  1 
ATOM   9012  O OG  . SER D 1 196 ? -24.942 -19.610 4.740   1.00 7.12  ? 196 SER D OG  1 
ATOM   9013  N N   . VAL D 1 197 ? -29.081 -17.808 5.049   1.00 5.87  ? 197 VAL D N   1 
ATOM   9014  C CA  . VAL D 1 197 ? -30.146 -16.935 4.509   1.00 5.27  ? 197 VAL D CA  1 
ATOM   9015  C C   . VAL D 1 197 ? -29.353 -15.697 4.085   1.00 4.94  ? 197 VAL D C   1 
ATOM   9016  O O   . VAL D 1 197 ? -28.778 -14.988 4.919   1.00 4.85  ? 197 VAL D O   1 
ATOM   9017  C CB  . VAL D 1 197 ? -31.282 -16.733 5.476   1.00 5.20  ? 197 VAL D CB  1 
ATOM   9018  C CG1 . VAL D 1 197 ? -30.862 -16.274 6.867   1.00 5.33  ? 197 VAL D CG1 1 
ATOM   9019  C CG2 . VAL D 1 197 ? -32.286 -15.727 4.894   1.00 5.26  ? 197 VAL D CG2 1 
ATOM   9020  N N   . PRO D 1 198 ? -29.291 -15.517 2.770   1.00 4.70  ? 198 PRO D N   1 
ATOM   9021  C CA  . PRO D 1 198 ? -28.779 -14.203 2.255   1.00 4.66  ? 198 PRO D CA  1 
ATOM   9022  C C   . PRO D 1 198 ? -29.777 -13.206 2.802   1.00 4.80  ? 198 PRO D C   1 
ATOM   9023  O O   . PRO D 1 198 ? -30.677 -13.686 3.568   1.00 5.13  ? 198 PRO D O   1 
ATOM   9024  C CB  . PRO D 1 198 ? -28.901 -14.393 0.761   1.00 4.56  ? 198 PRO D CB  1 
ATOM   9025  C CG  . PRO D 1 198 ? -30.153 -15.232 0.583   1.00 4.26  ? 198 PRO D CG  1 
ATOM   9026  C CD  . PRO D 1 198 ? -30.058 -16.226 1.740   1.00 4.48  ? 198 PRO D CD  1 
ATOM   9027  N N   . ILE D 1 199 ? -29.784 -11.951 2.463   1.00 4.65  ? 199 ILE D N   1 
ATOM   9028  C CA  . ILE D 1 199 ? -30.950 -11.128 2.949   1.00 4.62  ? 199 ILE D CA  1 
ATOM   9029  C C   . ILE D 1 199 ? -31.239 -10.083 1.878   1.00 4.52  ? 199 ILE D C   1 
ATOM   9030  O O   . ILE D 1 199 ? -30.868 -8.912  1.975   1.00 4.51  ? 199 ILE D O   1 
ATOM   9031  C CB  . ILE D 1 199 ? -30.836 -10.717 4.417   1.00 4.74  ? 199 ILE D CB  1 
ATOM   9032  C CG1 . ILE D 1 199 ? -29.482 -10.065 4.784   1.00 4.87  ? 199 ILE D CG1 1 
ATOM   9033  C CG2 . ILE D 1 199 ? -31.093 -11.867 5.480   1.00 4.66  ? 199 ILE D CG2 1 
ATOM   9034  C CD1 . ILE D 1 199 ? -29.552 -9.453  6.248   1.00 5.17  ? 199 ILE D CD1 1 
ATOM   9035  N N   . TRP D 1 200 ? -31.874 -10.612 0.822   1.00 4.24  ? 200 TRP D N   1 
ATOM   9036  C CA  . TRP D 1 200 ? -32.301 -9.868  -0.347  1.00 3.97  ? 200 TRP D CA  1 
ATOM   9037  C C   . TRP D 1 200 ? -33.021 -8.569  0.035   1.00 3.77  ? 200 TRP D C   1 
ATOM   9038  O O   . TRP D 1 200 ? -32.794 -7.543  -0.640  1.00 3.78  ? 200 TRP D O   1 
ATOM   9039  C CB  . TRP D 1 200 ? -33.185 -10.671 -1.296  1.00 4.00  ? 200 TRP D CB  1 
ATOM   9040  C CG  . TRP D 1 200 ? -32.677 -11.915 -1.904  1.00 4.07  ? 200 TRP D CG  1 
ATOM   9041  C CD1 . TRP D 1 200 ? -33.020 -13.186 -1.549  1.00 4.15  ? 200 TRP D CD1 1 
ATOM   9042  C CD2 . TRP D 1 200 ? -31.750 -12.068 -2.989  1.00 4.16  ? 200 TRP D CD2 1 
ATOM   9043  N NE1 . TRP D 1 200 ? -32.304 -14.108 -2.285  1.00 4.21  ? 200 TRP D NE1 1 
ATOM   9044  C CE2 . TRP D 1 200 ? -31.548 -13.449 -3.192  1.00 4.12  ? 200 TRP D CE2 1 
ATOM   9045  C CE3 . TRP D 1 200 ? -31.049 -11.156 -3.782  1.00 4.27  ? 200 TRP D CE3 1 
ATOM   9046  C CZ2 . TRP D 1 200 ? -30.699 -13.949 -4.167  1.00 4.09  ? 200 TRP D CZ2 1 
ATOM   9047  C CZ3 . TRP D 1 200 ? -30.156 -11.654 -4.707  1.00 4.17  ? 200 TRP D CZ3 1 
ATOM   9048  C CH2 . TRP D 1 200 ? -30.027 -13.019 -4.941  1.00 4.14  ? 200 TRP D CH2 1 
ATOM   9049  N N   . SER D 1 201 ? -33.851 -8.592  1.054   1.00 3.48  ? 201 SER D N   1 
ATOM   9050  C CA  . SER D 1 201 ? -34.594 -7.384  1.467   1.00 3.20  ? 201 SER D CA  1 
ATOM   9051  C C   . SER D 1 201 ? -33.718 -6.154  1.225   1.00 3.37  ? 201 SER D C   1 
ATOM   9052  O O   . SER D 1 201 ? -34.202 -5.192  0.600   1.00 3.57  ? 201 SER D O   1 
ATOM   9053  C CB  . SER D 1 201 ? -35.106 -7.446  2.871   1.00 2.97  ? 201 SER D CB  1 
ATOM   9054  O OG  . SER D 1 201 ? -34.383 -6.738  3.822   1.00 2.72  ? 201 SER D OG  1 
ATOM   9055  N N   . GLY D 1 202 ? -32.430 -6.255  1.539   1.00 3.41  ? 202 GLY D N   1 
ATOM   9056  C CA  . GLY D 1 202 ? -31.483 -5.186  1.415   1.00 3.59  ? 202 GLY D CA  1 
ATOM   9057  C C   . GLY D 1 202 ? -30.313 -5.316  0.501   1.00 3.84  ? 202 GLY D C   1 
ATOM   9058  O O   . GLY D 1 202 ? -29.169 -5.228  0.996   1.00 3.71  ? 202 GLY D O   1 
ATOM   9059  N N   . VAL D 1 203 ? -30.502 -5.210  -0.798  1.00 4.41  ? 203 VAL D N   1 
ATOM   9060  C CA  . VAL D 1 203 ? -29.435 -5.444  -1.797  1.00 5.08  ? 203 VAL D CA  1 
ATOM   9061  C C   . VAL D 1 203 ? -29.314 -4.363  -2.846  1.00 5.87  ? 203 VAL D C   1 
ATOM   9062  O O   . VAL D 1 203 ? -29.928 -4.435  -3.940  1.00 6.11  ? 203 VAL D O   1 
ATOM   9063  C CB  . VAL D 1 203 ? -29.695 -6.875  -2.377  1.00 4.78  ? 203 VAL D CB  1 
ATOM   9064  C CG1 . VAL D 1 203 ? -29.061 -7.200  -3.693  1.00 4.53  ? 203 VAL D CG1 1 
ATOM   9065  C CG2 . VAL D 1 203 ? -29.308 -7.922  -1.320  1.00 4.74  ? 203 VAL D CG2 1 
ATOM   9066  N N   . ASN D 1 204 ? -28.392 -3.437  -2.638  1.00 6.50  ? 204 ASN D N   1 
ATOM   9067  C CA  . ASN D 1 204 ? -28.084 -2.310  -3.481  1.00 6.99  ? 204 ASN D CA  1 
ATOM   9068  C C   . ASN D 1 204 ? -27.158 -2.678  -4.670  1.00 7.42  ? 204 ASN D C   1 
ATOM   9069  O O   . ASN D 1 204 ? -26.630 -3.754  -4.765  1.00 7.48  ? 204 ASN D O   1 
ATOM   9070  C CB  . ASN D 1 204 ? -27.335 -1.204  -2.757  1.00 7.04  ? 204 ASN D CB  1 
ATOM   9071  C CG  . ASN D 1 204 ? -27.602 -0.963  -1.330  1.00 7.27  ? 204 ASN D CG  1 
ATOM   9072  O OD1 . ASN D 1 204 ? -27.526 0.225   -0.926  1.00 7.48  ? 204 ASN D OD1 1 
ATOM   9073  N ND2 . ASN D 1 204 ? -27.784 -2.005  -0.525  1.00 7.40  ? 204 ASN D ND2 1 
ATOM   9074  N N   . VAL D 1 205 ? -26.820 -1.663  -5.370  1.00 8.17  ? 205 VAL D N   1 
ATOM   9075  C CA  . VAL D 1 205 ? -26.003 -1.313  -6.457  1.00 9.13  ? 205 VAL D CA  1 
ATOM   9076  C C   . VAL D 1 205 ? -26.271 0.216   -6.729  1.00 10.04 ? 205 VAL D C   1 
ATOM   9077  O O   . VAL D 1 205 ? -26.572 0.649   -7.823  1.00 10.08 ? 205 VAL D O   1 
ATOM   9078  C CB  . VAL D 1 205 ? -26.169 -2.090  -7.754  1.00 9.01  ? 205 VAL D CB  1 
ATOM   9079  C CG1 . VAL D 1 205 ? -25.106 -1.639  -8.786  1.00 8.99  ? 205 VAL D CG1 1 
ATOM   9080  C CG2 . VAL D 1 205 ? -26.143 -3.585  -7.628  1.00 9.07  ? 205 VAL D CG2 1 
ATOM   9081  N N   . ALA D 1 206 ? -26.301 0.931   -5.650  1.00 11.19 ? 206 ALA D N   1 
ATOM   9082  C CA  . ALA D 1 206 ? -26.530 2.346   -5.437  1.00 12.00 ? 206 ALA D CA  1 
ATOM   9083  C C   . ALA D 1 206 ? -27.022 2.563   -3.993  1.00 12.73 ? 206 ALA D C   1 
ATOM   9084  O O   . ALA D 1 206 ? -26.159 2.584   -3.056  1.00 12.84 ? 206 ALA D O   1 
ATOM   9085  C CB  . ALA D 1 206 ? -27.420 2.982   -6.469  1.00 11.86 ? 206 ALA D CB  1 
ATOM   9086  N N   . GLY D 1 207 ? -28.321 2.591   -3.775  1.00 13.50 ? 207 GLY D N   1 
ATOM   9087  C CA  . GLY D 1 207 ? -28.828 2.840   -2.423  1.00 14.75 ? 207 GLY D CA  1 
ATOM   9088  C C   . GLY D 1 207 ? -30.097 2.100   -2.071  1.00 15.64 ? 207 GLY D C   1 
ATOM   9089  O O   . GLY D 1 207 ? -30.797 1.546   -2.918  1.00 15.46 ? 207 GLY D O   1 
ATOM   9090  N N   . VAL D 1 208 ? -30.385 2.133   -0.771  1.00 16.71 ? 208 VAL D N   1 
ATOM   9091  C CA  . VAL D 1 208 ? -31.562 1.499   -0.189  1.00 17.98 ? 208 VAL D CA  1 
ATOM   9092  C C   . VAL D 1 208 ? -32.794 2.406   -0.419  1.00 18.66 ? 208 VAL D C   1 
ATOM   9093  O O   . VAL D 1 208 ? -32.888 3.524   0.124   1.00 18.81 ? 208 VAL D O   1 
ATOM   9094  C CB  . VAL D 1 208 ? -31.436 1.180   1.311   1.00 18.24 ? 208 VAL D CB  1 
ATOM   9095  C CG1 . VAL D 1 208 ? -32.532 0.178   1.744   1.00 18.25 ? 208 VAL D CG1 1 
ATOM   9096  C CG2 . VAL D 1 208 ? -30.052 0.752   1.757   1.00 18.30 ? 208 VAL D CG2 1 
ATOM   9097  N N   . THR D 1 209 ? -33.771 1.784   -1.039  1.00 19.31 ? 209 THR D N   1 
ATOM   9098  C CA  . THR D 1 209 ? -34.976 2.499   -1.504  1.00 19.97 ? 209 THR D CA  1 
ATOM   9099  C C   . THR D 1 209 ? -34.537 3.043   -2.873  1.00 20.51 ? 209 THR D C   1 
ATOM   9100  O O   . THR D 1 209 ? -35.290 2.949   -3.844  1.00 20.75 ? 209 THR D O   1 
ATOM   9101  C CB  . THR D 1 209 ? -35.577 3.563   -0.561  1.00 19.96 ? 209 THR D CB  1 
ATOM   9102  O OG1 . THR D 1 209 ? -36.011 2.831   0.640   1.00 20.09 ? 209 THR D OG1 1 
ATOM   9103  C CG2 . THR D 1 209 ? -36.744 4.376   -1.168  1.00 19.99 ? 209 THR D CG2 1 
ATOM   9104  N N   . LEU D 1 210 ? -33.280 3.477   -2.880  1.00 20.96 ? 210 LEU D N   1 
ATOM   9105  C CA  . LEU D 1 210 ? -32.609 3.887   -4.136  1.00 21.36 ? 210 LEU D CA  1 
ATOM   9106  C C   . LEU D 1 210 ? -32.494 2.548   -4.890  1.00 21.68 ? 210 LEU D C   1 
ATOM   9107  O O   . LEU D 1 210 ? -33.499 1.784   -4.939  1.00 21.60 ? 210 LEU D O   1 
ATOM   9108  C CB  . LEU D 1 210 ? -31.326 4.612   -3.827  1.00 21.33 ? 210 LEU D CB  1 
ATOM   9109  C CG  . LEU D 1 210 ? -30.585 5.539   -4.749  1.00 21.26 ? 210 LEU D CG  1 
ATOM   9110  C CD1 . LEU D 1 210 ? -29.111 5.690   -4.331  1.00 21.12 ? 210 LEU D CD1 1 
ATOM   9111  C CD2 . LEU D 1 210 ? -30.602 5.062   -6.196  1.00 21.25 ? 210 LEU D CD2 1 
ATOM   9112  N N   . LYS D 1 211 ? -31.277 2.221   -5.319  1.00 22.04 ? 211 LYS D N   1 
ATOM   9113  C CA  . LYS D 1 211 ? -31.147 0.956   -6.070  1.00 22.39 ? 211 LYS D CA  1 
ATOM   9114  C C   . LYS D 1 211 ? -31.011 -0.189  -5.078  1.00 22.75 ? 211 LYS D C   1 
ATOM   9115  O O   . LYS D 1 211 ? -29.972 -0.471  -4.511  1.00 23.00 ? 211 LYS D O   1 
ATOM   9116  C CB  . LYS D 1 211 ? -30.123 0.959   -7.153  1.00 22.40 ? 211 LYS D CB  1 
ATOM   9117  C CG  . LYS D 1 211 ? -30.744 1.655   -8.402  1.00 22.51 ? 211 LYS D CG  1 
ATOM   9118  C CD  . LYS D 1 211 ? -30.121 1.047   -9.664  1.00 22.63 ? 211 LYS D CD  1 
ATOM   9119  C CE  . LYS D 1 211 ? -31.078 1.224   -10.834 1.00 22.64 ? 211 LYS D CE  1 
ATOM   9120  N NZ  . LYS D 1 211 ? -32.361 0.506   -10.560 1.00 22.48 ? 211 LYS D NZ  1 
ATOM   9121  N N   . SER D 1 212 ? -32.197 -0.617  -4.729  1.00 23.04 ? 212 SER D N   1 
ATOM   9122  C CA  . SER D 1 212 ? -32.465 -1.847  -3.914  1.00 23.20 ? 212 SER D CA  1 
ATOM   9123  C C   . SER D 1 212 ? -32.702 -2.872  -5.011  1.00 23.74 ? 212 SER D C   1 
ATOM   9124  O O   . SER D 1 212 ? -33.250 -2.391  -6.062  1.00 24.01 ? 212 SER D O   1 
ATOM   9125  C CB  . SER D 1 212 ? -33.606 -1.507  -3.021  1.00 22.78 ? 212 SER D CB  1 
ATOM   9126  O OG  . SER D 1 212 ? -34.274 -2.528  -2.402  1.00 22.55 ? 212 SER D OG  1 
ATOM   9127  N N   . LEU D 1 213 ? -32.222 -4.097  -4.982  1.00 24.10 ? 213 LEU D N   1 
ATOM   9128  C CA  . LEU D 1 213 ? -32.463 -4.976  -6.166  1.00 24.49 ? 213 LEU D CA  1 
ATOM   9129  C C   . LEU D 1 213 ? -33.931 -5.366  -6.251  1.00 24.83 ? 213 LEU D C   1 
ATOM   9130  O O   . LEU D 1 213 ? -34.412 -5.866  -7.293  1.00 24.88 ? 213 LEU D O   1 
ATOM   9131  C CB  . LEU D 1 213 ? -31.452 -6.105  -6.188  1.00 24.42 ? 213 LEU D CB  1 
ATOM   9132  C CG  . LEU D 1 213 ? -30.256 -6.027  -7.120  1.00 24.29 ? 213 LEU D CG  1 
ATOM   9133  C CD1 . LEU D 1 213 ? -30.681 -6.066  -8.578  1.00 24.11 ? 213 LEU D CD1 1 
ATOM   9134  C CD2 . LEU D 1 213 ? -29.490 -4.728  -6.841  1.00 24.41 ? 213 LEU D CD2 1 
ATOM   9135  N N   . ASN D 1 214 ? -34.638 -5.031  -5.208  1.00 25.25 ? 214 ASN D N   1 
ATOM   9136  C CA  . ASN D 1 214 ? -36.055 -5.354  -4.989  1.00 25.71 ? 214 ASN D CA  1 
ATOM   9137  C C   . ASN D 1 214 ? -37.036 -4.620  -5.890  1.00 26.03 ? 214 ASN D C   1 
ATOM   9138  O O   . ASN D 1 214 ? -37.950 -5.251  -6.456  1.00 26.02 ? 214 ASN D O   1 
ATOM   9139  C CB  . ASN D 1 214 ? -36.321 -5.161  -3.485  1.00 25.65 ? 214 ASN D CB  1 
ATOM   9140  C CG  . ASN D 1 214 ? -37.090 -6.198  -2.739  1.00 25.63 ? 214 ASN D CG  1 
ATOM   9141  O OD1 . ASN D 1 214 ? -37.777 -5.861  -1.737  1.00 25.54 ? 214 ASN D OD1 1 
ATOM   9142  N ND2 . ASN D 1 214 ? -36.972 -7.483  -3.096  1.00 25.62 ? 214 ASN D ND2 1 
ATOM   9143  N N   . PRO D 1 215 ? -36.938 -3.307  -5.993  1.00 26.28 ? 215 PRO D N   1 
ATOM   9144  C CA  . PRO D 1 215 ? -37.826 -2.472  -6.783  1.00 26.39 ? 215 PRO D CA  1 
ATOM   9145  C C   . PRO D 1 215 ? -37.914 -2.853  -8.235  1.00 26.58 ? 215 PRO D C   1 
ATOM   9146  O O   . PRO D 1 215 ? -38.855 -2.344  -8.897  1.00 26.75 ? 215 PRO D O   1 
ATOM   9147  C CB  . PRO D 1 215 ? -37.258 -1.052  -6.652  1.00 26.39 ? 215 PRO D CB  1 
ATOM   9148  C CG  . PRO D 1 215 ? -35.781 -1.345  -6.432  1.00 26.34 ? 215 PRO D CG  1 
ATOM   9149  C CD  . PRO D 1 215 ? -35.888 -2.474  -5.361  1.00 26.32 ? 215 PRO D CD  1 
ATOM   9150  N N   . ALA D 1 216 ? -36.969 -3.606  -8.731  1.00 26.76 ? 216 ALA D N   1 
ATOM   9151  C CA  . ALA D 1 216 ? -37.020 -3.986  -10.175 1.00 27.15 ? 216 ALA D CA  1 
ATOM   9152  C C   . ALA D 1 216 ? -37.347 -5.471  -10.229 1.00 27.53 ? 216 ALA D C   1 
ATOM   9153  O O   . ALA D 1 216 ? -37.770 -6.035  -11.252 1.00 27.57 ? 216 ALA D O   1 
ATOM   9154  C CB  . ALA D 1 216 ? -35.780 -3.520  -10.882 1.00 27.10 ? 216 ALA D CB  1 
ATOM   9155  N N   . ILE D 1 217 ? -37.184 -6.097  -9.085  1.00 27.96 ? 217 ILE D N   1 
ATOM   9156  C CA  . ILE D 1 217 ? -37.537 -7.469  -8.781  1.00 28.42 ? 217 ILE D CA  1 
ATOM   9157  C C   . ILE D 1 217 ? -37.725 -8.444  -9.896  1.00 28.86 ? 217 ILE D C   1 
ATOM   9158  O O   . ILE D 1 217 ? -38.888 -8.829  -10.202 1.00 29.13 ? 217 ILE D O   1 
ATOM   9159  C CB  . ILE D 1 217 ? -38.877 -7.377  -7.898  1.00 28.38 ? 217 ILE D CB  1 
ATOM   9160  C CG1 . ILE D 1 217 ? -39.217 -8.706  -7.245  1.00 28.20 ? 217 ILE D CG1 1 
ATOM   9161  C CG2 . ILE D 1 217 ? -40.081 -6.774  -8.689  1.00 28.32 ? 217 ILE D CG2 1 
ATOM   9162  C CD1 . ILE D 1 217 ? -40.340 -8.654  -6.157  1.00 28.18 ? 217 ILE D CD1 1 
ATOM   9163  N N   . GLY D 1 218 ? -36.662 -8.979  -10.490 1.00 29.27 ? 218 GLY D N   1 
ATOM   9164  C CA  . GLY D 1 218 ? -36.855 -10.147 -11.452 1.00 29.74 ? 218 GLY D CA  1 
ATOM   9165  C C   . GLY D 1 218 ? -37.083 -11.349 -10.478 1.00 30.14 ? 218 GLY D C   1 
ATOM   9166  O O   . GLY D 1 218 ? -36.781 -12.529 -10.611 1.00 30.18 ? 218 GLY D O   1 
ATOM   9167  N N   . THR D 1 219 ? -37.566 -10.977 -9.352  1.00 30.44 ? 219 THR D N   1 
ATOM   9168  C CA  . THR D 1 219 ? -37.923 -11.400 -8.068  1.00 30.52 ? 219 THR D CA  1 
ATOM   9169  C C   . THR D 1 219 ? -36.646 -11.202 -7.196  1.00 30.67 ? 219 THR D C   1 
ATOM   9170  O O   . THR D 1 219 ? -36.195 -10.046 -7.102  1.00 30.62 ? 219 THR D O   1 
ATOM   9171  C CB  . THR D 1 219 ? -38.681 -12.728 -7.819  1.00 30.35 ? 219 THR D CB  1 
ATOM   9172  O OG1 . THR D 1 219 ? -40.103 -12.394 -8.144  1.00 30.27 ? 219 THR D OG1 1 
ATOM   9173  C CG2 . THR D 1 219 ? -38.638 -13.265 -6.392  1.00 30.25 ? 219 THR D CG2 1 
ATOM   9174  N N   . ASP D 1 220 ? -36.079 -12.254 -6.785  1.00 30.93 ? 220 ASP D N   1 
ATOM   9175  C CA  . ASP D 1 220 ? -34.961 -12.394 -5.873  1.00 31.35 ? 220 ASP D CA  1 
ATOM   9176  C C   . ASP D 1 220 ? -35.600 -13.170 -4.678  1.00 31.62 ? 220 ASP D C   1 
ATOM   9177  O O   . ASP D 1 220 ? -36.125 -12.582 -3.748  1.00 31.72 ? 220 ASP D O   1 
ATOM   9178  C CB  . ASP D 1 220 ? -34.243 -11.143 -5.491  1.00 31.36 ? 220 ASP D CB  1 
ATOM   9179  C CG  . ASP D 1 220 ? -33.346 -10.536 -6.544  1.00 31.45 ? 220 ASP D CG  1 
ATOM   9180  O OD1 . ASP D 1 220 ? -33.790 -9.797  -7.444  1.00 31.57 ? 220 ASP D OD1 1 
ATOM   9181  O OD2 . ASP D 1 220 ? -32.126 -10.769 -6.447  1.00 31.32 ? 220 ASP D OD2 1 
ATOM   9182  N N   . LYS D 1 221 ? -35.623 -14.470 -4.906  1.00 31.83 ? 221 LYS D N   1 
ATOM   9183  C CA  . LYS D 1 221 ? -36.212 -15.492 -4.048  1.00 31.88 ? 221 LYS D CA  1 
ATOM   9184  C C   . LYS D 1 221 ? -37.396 -16.140 -4.804  1.00 31.92 ? 221 LYS D C   1 
ATOM   9185  O O   . LYS D 1 221 ? -37.204 -17.122 -5.552  1.00 31.88 ? 221 LYS D O   1 
ATOM   9186  C CB  . LYS D 1 221 ? -36.613 -15.028 -2.679  1.00 31.93 ? 221 LYS D CB  1 
ATOM   9187  C CG  . LYS D 1 221 ? -37.723 -15.721 -1.932  1.00 32.13 ? 221 LYS D CG  1 
ATOM   9188  C CD  . LYS D 1 221 ? -37.261 -16.841 -1.036  1.00 32.29 ? 221 LYS D CD  1 
ATOM   9189  C CE  . LYS D 1 221 ? -36.510 -16.290 0.185   1.00 32.42 ? 221 LYS D CE  1 
ATOM   9190  N NZ  . LYS D 1 221 ? -37.388 -15.293 0.871   1.00 32.31 ? 221 LYS D NZ  1 
ATOM   9191  N N   . ASN D 1 222 ? -38.550 -15.562 -4.645  1.00 31.79 ? 222 ASN D N   1 
ATOM   9192  C CA  . ASN D 1 222 ? -39.856 -15.950 -5.147  1.00 31.76 ? 222 ASN D CA  1 
ATOM   9193  C C   . ASN D 1 222 ? -39.892 -16.149 -6.651  1.00 31.68 ? 222 ASN D C   1 
ATOM   9194  O O   . ASN D 1 222 ? -40.940 -16.076 -7.321  1.00 31.50 ? 222 ASN D O   1 
ATOM   9195  C CB  . ASN D 1 222 ? -40.892 -14.939 -4.614  1.00 31.82 ? 222 ASN D CB  1 
ATOM   9196  C CG  . ASN D 1 222 ? -42.347 -15.169 -4.939  1.00 31.72 ? 222 ASN D CG  1 
ATOM   9197  O OD1 . ASN D 1 222 ? -42.944 -14.401 -5.734  1.00 31.64 ? 222 ASN D OD1 1 
ATOM   9198  N ND2 . ASN D 1 222 ? -42.965 -16.172 -4.311  1.00 31.56 ? 222 ASN D ND2 1 
ATOM   9199  N N   . LYS D 1 223 ? -38.746 -16.423 -7.202  1.00 31.77 ? 223 LYS D N   1 
ATOM   9200  C CA  . LYS D 1 223 ? -38.374 -16.758 -8.527  1.00 31.88 ? 223 LYS D CA  1 
ATOM   9201  C C   . LYS D 1 223 ? -37.338 -15.828 -9.193  1.00 31.90 ? 223 LYS D C   1 
ATOM   9202  O O   . LYS D 1 223 ? -36.545 -15.025 -8.697  1.00 31.75 ? 223 LYS D O   1 
ATOM   9203  C CB  . LYS D 1 223 ? -39.583 -16.898 -9.485  1.00 31.92 ? 223 LYS D CB  1 
ATOM   9204  C CG  . LYS D 1 223 ? -40.403 -18.135 -9.381  1.00 32.11 ? 223 LYS D CG  1 
ATOM   9205  C CD  . LYS D 1 223 ? -39.659 -19.454 -9.482  1.00 32.22 ? 223 LYS D CD  1 
ATOM   9206  C CE  . LYS D 1 223 ? -39.115 -19.926 -8.133  1.00 32.29 ? 223 LYS D CE  1 
ATOM   9207  N NZ  . LYS D 1 223 ? -39.334 -21.399 -7.975  1.00 32.32 ? 223 LYS D NZ  1 
ATOM   9208  N N   . GLN D 1 224 ? -37.295 -16.064 -10.478 1.00 31.83 ? 224 GLN D N   1 
ATOM   9209  C CA  . GLN D 1 224 ? -36.613 -15.649 -11.626 1.00 31.46 ? 224 GLN D CA  1 
ATOM   9210  C C   . GLN D 1 224 ? -35.135 -15.319 -11.374 1.00 31.15 ? 224 GLN D C   1 
ATOM   9211  O O   . GLN D 1 224 ? -34.642 -14.224 -11.390 1.00 31.09 ? 224 GLN D O   1 
ATOM   9212  C CB  . GLN D 1 224 ? -37.359 -14.625 -12.487 1.00 31.51 ? 224 GLN D CB  1 
ATOM   9213  C CG  . GLN D 1 224 ? -37.984 -15.387 -13.677 1.00 31.60 ? 224 GLN D CG  1 
ATOM   9214  C CD  . GLN D 1 224 ? -36.945 -15.642 -14.754 1.00 31.74 ? 224 GLN D CD  1 
ATOM   9215  O OE1 . GLN D 1 224 ? -35.755 -15.315 -14.634 1.00 31.80 ? 224 GLN D OE1 1 
ATOM   9216  N NE2 . GLN D 1 224 ? -37.426 -16.173 -15.873 1.00 31.65 ? 224 GLN D NE2 1 
ATOM   9217  N N   . HIS D 1 225 ? -34.493 -16.452 -11.190 1.00 30.83 ? 225 HIS D N   1 
ATOM   9218  C CA  . HIS D 1 225 ? -33.094 -16.765 -11.028 1.00 30.32 ? 225 HIS D CA  1 
ATOM   9219  C C   . HIS D 1 225 ? -32.327 -15.658 -10.347 1.00 29.89 ? 225 HIS D C   1 
ATOM   9220  O O   . HIS D 1 225 ? -32.243 -14.542 -10.867 1.00 30.07 ? 225 HIS D O   1 
ATOM   9221  C CB  . HIS D 1 225 ? -32.441 -17.135 -12.407 1.00 30.38 ? 225 HIS D CB  1 
ATOM   9222  C CG  . HIS D 1 225 ? -33.381 -18.027 -13.186 1.00 30.60 ? 225 HIS D CG  1 
ATOM   9223  N ND1 . HIS D 1 225 ? -34.577 -17.574 -13.724 1.00 30.67 ? 225 HIS D ND1 1 
ATOM   9224  C CD2 . HIS D 1 225 ? -33.340 -19.339 -13.480 1.00 30.62 ? 225 HIS D CD2 1 
ATOM   9225  C CE1 . HIS D 1 225 ? -35.194 -18.565 -14.328 1.00 30.55 ? 225 HIS D CE1 1 
ATOM   9226  N NE2 . HIS D 1 225 ? -34.465 -19.639 -14.208 1.00 30.55 ? 225 HIS D NE2 1 
ATOM   9227  N N   . TRP D 1 226 ? -31.795 -15.972 -9.205  1.00 29.11 ? 226 TRP D N   1 
ATOM   9228  C CA  . TRP D 1 226 ? -31.026 -15.110 -8.323  1.00 28.44 ? 226 TRP D CA  1 
ATOM   9229  C C   . TRP D 1 226 ? -30.869 -15.952 -7.035  1.00 28.25 ? 226 TRP D C   1 
ATOM   9230  O O   . TRP D 1 226 ? -29.867 -15.804 -6.340  1.00 28.51 ? 226 TRP D O   1 
ATOM   9231  C CB  . TRP D 1 226 ? -31.565 -13.740 -8.021  1.00 28.06 ? 226 TRP D CB  1 
ATOM   9232  C CG  . TRP D 1 226 ? -31.385 -12.631 -8.985  1.00 27.67 ? 226 TRP D CG  1 
ATOM   9233  C CD1 . TRP D 1 226 ? -32.359 -12.019 -9.733  1.00 27.54 ? 226 TRP D CD1 1 
ATOM   9234  C CD2 . TRP D 1 226 ? -30.159 -11.961 -9.336  1.00 27.49 ? 226 TRP D CD2 1 
ATOM   9235  N NE1 . TRP D 1 226 ? -31.809 -11.078 -10.563 1.00 27.46 ? 226 TRP D NE1 1 
ATOM   9236  C CE2 . TRP D 1 226 ? -30.467 -10.996 -10.309 1.00 27.36 ? 226 TRP D CE2 1 
ATOM   9237  C CE3 . TRP D 1 226 ? -28.843 -12.107 -8.914  1.00 27.46 ? 226 TRP D CE3 1 
ATOM   9238  C CZ2 . TRP D 1 226 ? -29.506 -10.180 -10.875 1.00 27.30 ? 226 TRP D CZ2 1 
ATOM   9239  C CZ3 . TRP D 1 226 ? -27.895 -11.270 -9.468  1.00 27.48 ? 226 TRP D CZ3 1 
ATOM   9240  C CH2 . TRP D 1 226 ? -28.214 -10.313 -10.427 1.00 27.34 ? 226 TRP D CH2 1 
ATOM   9241  N N   . LYS D 1 227 ? -31.872 -16.797 -6.831  1.00 27.85 ? 227 LYS D N   1 
ATOM   9242  C CA  . LYS D 1 227 ? -31.826 -17.735 -5.685  1.00 27.49 ? 227 LYS D CA  1 
ATOM   9243  C C   . LYS D 1 227 ? -30.468 -18.473 -5.829  1.00 27.07 ? 227 LYS D C   1 
ATOM   9244  O O   . LYS D 1 227 ? -29.710 -18.714 -4.900  1.00 27.00 ? 227 LYS D O   1 
ATOM   9245  C CB  . LYS D 1 227 ? -32.907 -18.760 -5.624  1.00 27.70 ? 227 LYS D CB  1 
ATOM   9246  C CG  . LYS D 1 227 ? -33.565 -19.350 -6.822  1.00 27.86 ? 227 LYS D CG  1 
ATOM   9247  C CD  . LYS D 1 227 ? -32.817 -19.517 -8.088  1.00 28.06 ? 227 LYS D CD  1 
ATOM   9248  C CE  . LYS D 1 227 ? -32.078 -20.783 -8.363  1.00 28.09 ? 227 LYS D CE  1 
ATOM   9249  N NZ  . LYS D 1 227 ? -31.529 -20.886 -9.732  1.00 28.09 ? 227 LYS D NZ  1 
ATOM   9250  N N   . ASN D 1 228 ? -30.234 -18.693 -7.127  1.00 26.46 ? 228 ASN D N   1 
ATOM   9251  C CA  . ASN D 1 228 ? -29.065 -19.417 -7.554  1.00 25.79 ? 228 ASN D CA  1 
ATOM   9252  C C   . ASN D 1 228 ? -27.818 -18.677 -7.091  1.00 25.09 ? 228 ASN D C   1 
ATOM   9253  O O   . ASN D 1 228 ? -26.912 -19.425 -6.684  1.00 25.27 ? 228 ASN D O   1 
ATOM   9254  C CB  . ASN D 1 228 ? -29.010 -19.745 -9.035  1.00 26.15 ? 228 ASN D CB  1 
ATOM   9255  C CG  . ASN D 1 228 ? -28.661 -21.232 -9.198  1.00 26.40 ? 228 ASN D CG  1 
ATOM   9256  O OD1 . ASN D 1 228 ? -29.041 -21.808 -10.225 1.00 26.54 ? 228 ASN D OD1 1 
ATOM   9257  N ND2 . ASN D 1 228 ? -28.058 -21.828 -8.165  1.00 26.51 ? 228 ASN D ND2 1 
ATOM   9258  N N   . VAL D 1 229 ? -27.815 -17.364 -7.168  1.00 24.02 ? 229 VAL D N   1 
ATOM   9259  C CA  . VAL D 1 229 ? -26.584 -16.665 -6.676  1.00 23.16 ? 229 VAL D CA  1 
ATOM   9260  C C   . VAL D 1 229 ? -26.311 -17.267 -5.276  1.00 22.44 ? 229 VAL D C   1 
ATOM   9261  O O   . VAL D 1 229 ? -25.211 -17.774 -4.993  1.00 22.29 ? 229 VAL D O   1 
ATOM   9262  C CB  . VAL D 1 229 ? -26.691 -15.161 -6.760  1.00 23.21 ? 229 VAL D CB  1 
ATOM   9263  C CG1 . VAL D 1 229 ? -27.180 -14.482 -5.476  1.00 23.33 ? 229 VAL D CG1 1 
ATOM   9264  C CG2 . VAL D 1 229 ? -25.385 -14.493 -7.191  1.00 23.15 ? 229 VAL D CG2 1 
ATOM   9265  N N   . HIS D 1 230 ? -27.419 -17.376 -4.550  1.00 21.45 ? 230 HIS D N   1 
ATOM   9266  C CA  . HIS D 1 230 ? -27.361 -17.927 -3.199  1.00 20.73 ? 230 HIS D CA  1 
ATOM   9267  C C   . HIS D 1 230 ? -27.027 -19.418 -3.170  1.00 20.28 ? 230 HIS D C   1 
ATOM   9268  O O   . HIS D 1 230 ? -26.309 -19.895 -2.257  1.00 19.94 ? 230 HIS D O   1 
ATOM   9269  C CB  . HIS D 1 230 ? -28.657 -17.658 -2.403  1.00 20.66 ? 230 HIS D CB  1 
ATOM   9270  C CG  . HIS D 1 230 ? -28.421 -18.138 -0.997  1.00 20.52 ? 230 HIS D CG  1 
ATOM   9271  N ND1 . HIS D 1 230 ? -27.362 -17.691 -0.263  1.00 20.49 ? 230 HIS D ND1 1 
ATOM   9272  C CD2 . HIS D 1 230 ? -29.008 -19.121 -0.299  1.00 20.57 ? 230 HIS D CD2 1 
ATOM   9273  C CE1 . HIS D 1 230 ? -27.354 -18.335 0.894   1.00 20.57 ? 230 HIS D CE1 1 
ATOM   9274  N NE2 . HIS D 1 230 ? -28.311 -19.236 0.869   1.00 20.55 ? 230 HIS D NE2 1 
ATOM   9275  N N   . LYS D 1 231 ? -27.601 -20.149 -4.108  1.00 19.84 ? 231 LYS D N   1 
ATOM   9276  C CA  . LYS D 1 231 ? -27.332 -21.599 -4.173  1.00 19.51 ? 231 LYS D CA  1 
ATOM   9277  C C   . LYS D 1 231 ? -25.902 -21.829 -4.650  1.00 19.05 ? 231 LYS D C   1 
ATOM   9278  O O   . LYS D 1 231 ? -25.262 -22.823 -4.278  1.00 19.11 ? 231 LYS D O   1 
ATOM   9279  C CB  . LYS D 1 231 ? -28.313 -22.395 -4.994  1.00 19.62 ? 231 LYS D CB  1 
ATOM   9280  C CG  . LYS D 1 231 ? -29.478 -22.885 -4.097  1.00 19.72 ? 231 LYS D CG  1 
ATOM   9281  C CD  . LYS D 1 231 ? -30.583 -23.549 -4.861  1.00 20.04 ? 231 LYS D CD  1 
ATOM   9282  C CE  . LYS D 1 231 ? -31.116 -22.781 -6.047  1.00 20.20 ? 231 LYS D CE  1 
ATOM   9283  N NZ  . LYS D 1 231 ? -30.840 -21.317 -5.906  1.00 20.29 ? 231 LYS D NZ  1 
ATOM   9284  N N   . GLN D 1 232 ? -25.448 -20.890 -5.421  1.00 18.41 ? 232 GLN D N   1 
ATOM   9285  C CA  . GLN D 1 232 ? -24.125 -20.835 -6.004  1.00 17.83 ? 232 GLN D CA  1 
ATOM   9286  C C   . GLN D 1 232 ? -23.148 -20.483 -4.883  1.00 17.41 ? 232 GLN D C   1 
ATOM   9287  O O   . GLN D 1 232 ? -22.036 -21.003 -4.884  1.00 17.50 ? 232 GLN D O   1 
ATOM   9288  C CB  . GLN D 1 232 ? -24.034 -19.808 -7.120  1.00 18.00 ? 232 GLN D CB  1 
ATOM   9289  C CG  . GLN D 1 232 ? -22.759 -19.956 -7.953  1.00 18.34 ? 232 GLN D CG  1 
ATOM   9290  C CD  . GLN D 1 232 ? -22.992 -19.374 -9.323  1.00 18.70 ? 232 GLN D CD  1 
ATOM   9291  O OE1 . GLN D 1 232 ? -23.980 -19.708 -9.987  1.00 18.89 ? 232 GLN D OE1 1 
ATOM   9292  N NE2 . GLN D 1 232 ? -22.131 -18.442 -9.733  1.00 18.97 ? 232 GLN D NE2 1 
ATOM   9293  N N   . VAL D 1 233 ? -23.616 -19.623 -4.005  1.00 16.84 ? 233 VAL D N   1 
ATOM   9294  C CA  . VAL D 1 233 ? -22.809 -19.177 -2.860  1.00 16.33 ? 233 VAL D CA  1 
ATOM   9295  C C   . VAL D 1 233 ? -22.422 -20.391 -2.027  1.00 15.98 ? 233 VAL D C   1 
ATOM   9296  O O   . VAL D 1 233 ? -21.242 -20.774 -2.003  1.00 16.03 ? 233 VAL D O   1 
ATOM   9297  C CB  . VAL D 1 233 ? -23.551 -18.101 -2.074  1.00 16.45 ? 233 VAL D CB  1 
ATOM   9298  C CG1 . VAL D 1 233 ? -23.069 -17.919 -0.644  1.00 16.46 ? 233 VAL D CG1 1 
ATOM   9299  C CG2 . VAL D 1 233 ? -23.504 -16.763 -2.818  1.00 16.53 ? 233 VAL D CG2 1 
ATOM   9300  N N   . VAL D 1 234 ? -23.426 -20.905 -1.353  1.00 15.63 ? 234 VAL D N   1 
ATOM   9301  C CA  . VAL D 1 234 ? -23.271 -22.100 -0.487  1.00 15.29 ? 234 VAL D CA  1 
ATOM   9302  C C   . VAL D 1 234 ? -22.521 -23.193 -1.225  1.00 15.10 ? 234 VAL D C   1 
ATOM   9303  O O   . VAL D 1 234 ? -21.344 -23.456 -0.839  1.00 15.21 ? 234 VAL D O   1 
ATOM   9304  C CB  . VAL D 1 234 ? -24.637 -22.483 0.095   1.00 15.20 ? 234 VAL D CB  1 
ATOM   9305  C CG1 . VAL D 1 234 ? -25.705 -22.607 -0.984  1.00 15.23 ? 234 VAL D CG1 1 
ATOM   9306  C CG2 . VAL D 1 234 ? -24.568 -23.734 0.946   1.00 15.19 ? 234 VAL D CG2 1 
ATOM   9307  N N   . GLU D 1 235 ? -23.105 -23.806 -2.211  1.00 14.86 ? 235 GLU D N   1 
ATOM   9308  C CA  . GLU D 1 235 ? -22.402 -24.832 -3.003  1.00 15.04 ? 235 GLU D CA  1 
ATOM   9309  C C   . GLU D 1 235 ? -20.939 -24.429 -3.220  1.00 15.10 ? 235 GLU D C   1 
ATOM   9310  O O   . GLU D 1 235 ? -19.991 -25.190 -3.022  1.00 14.85 ? 235 GLU D O   1 
ATOM   9311  C CB  . GLU D 1 235 ? -23.028 -25.069 -4.347  1.00 15.16 ? 235 GLU D CB  1 
ATOM   9312  C CG  . GLU D 1 235 ? -24.008 -26.189 -4.629  1.00 15.37 ? 235 GLU D CG  1 
ATOM   9313  C CD  . GLU D 1 235 ? -23.453 -27.497 -5.097  1.00 15.53 ? 235 GLU D CD  1 
ATOM   9314  O OE1 . GLU D 1 235 ? -24.022 -28.581 -4.981  1.00 15.57 ? 235 GLU D OE1 1 
ATOM   9315  O OE2 . GLU D 1 235 ? -22.345 -27.376 -5.690  1.00 15.64 ? 235 GLU D OE2 1 
ATOM   9316  N N   . GLY D 1 236 ? -20.765 -23.182 -3.585  1.00 15.44 ? 236 GLY D N   1 
ATOM   9317  C CA  . GLY D 1 236 ? -19.515 -22.519 -3.894  1.00 15.80 ? 236 GLY D CA  1 
ATOM   9318  C C   . GLY D 1 236 ? -18.409 -22.820 -2.897  1.00 16.12 ? 236 GLY D C   1 
ATOM   9319  O O   . GLY D 1 236 ? -17.199 -22.838 -3.249  1.00 16.17 ? 236 GLY D O   1 
ATOM   9320  N N   . GLY D 1 237 ? -18.824 -23.082 -1.664  1.00 16.14 ? 237 GLY D N   1 
ATOM   9321  C CA  . GLY D 1 237 ? -17.792 -23.337 -0.602  1.00 16.06 ? 237 GLY D CA  1 
ATOM   9322  C C   . GLY D 1 237 ? -17.205 -24.724 -0.887  1.00 15.87 ? 237 GLY D C   1 
ATOM   9323  O O   . GLY D 1 237 ? -16.021 -24.945 -0.787  1.00 15.62 ? 237 GLY D O   1 
ATOM   9324  N N   . TYR D 1 238 ? -18.136 -25.576 -1.287  1.00 16.06 ? 238 TYR D N   1 
ATOM   9325  C CA  . TYR D 1 238 ? -17.900 -27.004 -1.521  1.00 16.04 ? 238 TYR D CA  1 
ATOM   9326  C C   . TYR D 1 238 ? -17.069 -27.280 -2.746  1.00 16.34 ? 238 TYR D C   1 
ATOM   9327  O O   . TYR D 1 238 ? -15.995 -27.886 -2.603  1.00 16.40 ? 238 TYR D O   1 
ATOM   9328  C CB  . TYR D 1 238 ? -19.251 -27.790 -1.485  1.00 15.41 ? 238 TYR D CB  1 
ATOM   9329  C CG  . TYR D 1 238 ? -19.839 -27.866 -0.090  1.00 14.87 ? 238 TYR D CG  1 
ATOM   9330  C CD1 . TYR D 1 238 ? -19.030 -28.235 0.995   1.00 14.80 ? 238 TYR D CD1 1 
ATOM   9331  C CD2 . TYR D 1 238 ? -21.168 -27.611 0.183   1.00 14.67 ? 238 TYR D CD2 1 
ATOM   9332  C CE1 . TYR D 1 238 ? -19.519 -28.291 2.281   1.00 14.56 ? 238 TYR D CE1 1 
ATOM   9333  C CE2 . TYR D 1 238 ? -21.677 -27.659 1.476   1.00 14.56 ? 238 TYR D CE2 1 
ATOM   9334  C CZ  . TYR D 1 238 ? -20.854 -28.022 2.529   1.00 14.46 ? 238 TYR D CZ  1 
ATOM   9335  O OH  . TYR D 1 238 ? -21.349 -28.105 3.799   1.00 14.29 ? 238 TYR D OH  1 
ATOM   9336  N N   . GLU D 1 239 ? -17.463 -26.765 -3.876  1.00 16.80 ? 239 GLU D N   1 
ATOM   9337  C CA  . GLU D 1 239 ? -16.818 -26.936 -5.155  1.00 17.23 ? 239 GLU D CA  1 
ATOM   9338  C C   . GLU D 1 239 ? -15.326 -26.640 -5.151  1.00 17.29 ? 239 GLU D C   1 
ATOM   9339  O O   . GLU D 1 239 ? -14.557 -27.253 -5.933  1.00 17.36 ? 239 GLU D O   1 
ATOM   9340  C CB  . GLU D 1 239 ? -17.416 -25.995 -6.226  1.00 17.53 ? 239 GLU D CB  1 
ATOM   9341  C CG  . GLU D 1 239 ? -17.238 -26.509 -7.653  1.00 18.05 ? 239 GLU D CG  1 
ATOM   9342  C CD  . GLU D 1 239 ? -18.317 -27.426 -8.139  1.00 18.46 ? 239 GLU D CD  1 
ATOM   9343  O OE1 . GLU D 1 239 ? -19.044 -28.111 -7.422  1.00 18.66 ? 239 GLU D OE1 1 
ATOM   9344  O OE2 . GLU D 1 239 ? -18.410 -27.376 -9.394  1.00 18.68 ? 239 GLU D OE2 1 
ATOM   9345  N N   . VAL D 1 240 ? -14.928 -25.678 -4.331  1.00 17.16 ? 240 VAL D N   1 
ATOM   9346  C CA  . VAL D 1 240 ? -13.544 -25.286 -4.205  1.00 16.97 ? 240 VAL D CA  1 
ATOM   9347  C C   . VAL D 1 240 ? -12.677 -26.498 -3.777  1.00 16.84 ? 240 VAL D C   1 
ATOM   9348  O O   . VAL D 1 240 ? -11.672 -26.847 -4.395  1.00 16.88 ? 240 VAL D O   1 
ATOM   9349  C CB  . VAL D 1 240 ? -13.281 -24.223 -3.106  1.00 17.00 ? 240 VAL D CB  1 
ATOM   9350  C CG1 . VAL D 1 240 ? -11.962 -23.512 -3.348  1.00 16.89 ? 240 VAL D CG1 1 
ATOM   9351  C CG2 . VAL D 1 240 ? -14.439 -23.292 -2.871  1.00 17.42 ? 240 VAL D CG2 1 
ATOM   9352  N N   . LEU D 1 241 ? -13.094 -26.936 -2.591  1.00 16.55 ? 241 LEU D N   1 
ATOM   9353  C CA  . LEU D 1 241 ? -12.287 -27.968 -1.911  1.00 16.51 ? 241 LEU D CA  1 
ATOM   9354  C C   . LEU D 1 241 ? -12.237 -29.189 -2.805  1.00 16.60 ? 241 LEU D C   1 
ATOM   9355  O O   . LEU D 1 241 ? -11.118 -29.703 -3.045  1.00 16.83 ? 241 LEU D O   1 
ATOM   9356  C CB  . LEU D 1 241 ? -12.792 -28.103 -0.512  1.00 16.40 ? 241 LEU D CB  1 
ATOM   9357  C CG  . LEU D 1 241 ? -13.816 -29.123 -0.128  1.00 16.39 ? 241 LEU D CG  1 
ATOM   9358  C CD1 . LEU D 1 241 ? -13.339 -30.552 -0.371  1.00 16.34 ? 241 LEU D CD1 1 
ATOM   9359  C CD2 . LEU D 1 241 ? -14.097 -28.943 1.374   1.00 16.43 ? 241 LEU D CD2 1 
ATOM   9360  N N   . ASP D 1 242 ? -13.370 -29.570 -3.348  1.00 16.48 ? 242 ASP D N   1 
ATOM   9361  C CA  . ASP D 1 242 ? -13.420 -30.775 -4.200  1.00 16.58 ? 242 ASP D CA  1 
ATOM   9362  C C   . ASP D 1 242 ? -12.199 -30.744 -5.127  1.00 16.79 ? 242 ASP D C   1 
ATOM   9363  O O   . ASP D 1 242 ? -11.447 -31.736 -5.130  1.00 17.01 ? 242 ASP D O   1 
ATOM   9364  C CB  . ASP D 1 242 ? -14.726 -30.971 -4.918  1.00 16.54 ? 242 ASP D CB  1 
ATOM   9365  C CG  . ASP D 1 242 ? -15.945 -31.300 -4.084  1.00 16.46 ? 242 ASP D CG  1 
ATOM   9366  O OD1 . ASP D 1 242 ? -17.064 -31.384 -4.631  1.00 16.19 ? 242 ASP D OD1 1 
ATOM   9367  O OD2 . ASP D 1 242 ? -15.780 -31.467 -2.848  1.00 16.47 ? 242 ASP D OD2 1 
ATOM   9368  N N   . MET D 1 243 ? -11.858 -29.556 -5.573  1.00 17.01 ? 243 MET D N   1 
ATOM   9369  C CA  . MET D 1 243 ? -10.790 -29.347 -6.559  1.00 17.08 ? 243 MET D CA  1 
ATOM   9370  C C   . MET D 1 243 ? -9.376  -29.081 -6.114  1.00 16.92 ? 243 MET D C   1 
ATOM   9371  O O   . MET D 1 243 ? -8.442  -29.762 -6.660  1.00 17.04 ? 243 MET D O   1 
ATOM   9372  C CB  . MET D 1 243 ? -11.287 -28.230 -7.542  1.00 17.08 ? 243 MET D CB  1 
ATOM   9373  C CG  . MET D 1 243 ? -12.682 -28.610 -7.989  1.00 17.15 ? 243 MET D CG  1 
ATOM   9374  S SD  . MET D 1 243 ? -12.958 -28.013 -9.661  1.00 17.40 ? 243 MET D SD  1 
ATOM   9375  C CE  . MET D 1 243 ? -12.992 -26.225 -9.397  1.00 17.37 ? 243 MET D CE  1 
ATOM   9376  N N   . LYS D 1 244 ? -9.090  -28.064 -5.345  1.00 16.72 ? 244 LYS D N   1 
ATOM   9377  C CA  . LYS D 1 244 ? -7.675  -27.807 -4.932  1.00 16.53 ? 244 LYS D CA  1 
ATOM   9378  C C   . LYS D 1 244 ? -7.399  -28.670 -3.701  1.00 16.29 ? 244 LYS D C   1 
ATOM   9379  O O   . LYS D 1 244 ? -6.268  -28.886 -3.264  1.00 16.02 ? 244 LYS D O   1 
ATOM   9380  C CB  . LYS D 1 244 ? -7.382  -26.348 -4.719  1.00 16.65 ? 244 LYS D CB  1 
ATOM   9381  C CG  . LYS D 1 244 ? -8.098  -25.682 -3.541  1.00 16.76 ? 244 LYS D CG  1 
ATOM   9382  C CD  . LYS D 1 244 ? -7.782  -24.214 -3.467  1.00 16.88 ? 244 LYS D CD  1 
ATOM   9383  C CE  . LYS D 1 244 ? -6.475  -23.902 -2.768  1.00 17.01 ? 244 LYS D CE  1 
ATOM   9384  N NZ  . LYS D 1 244 ? -6.141  -22.450 -3.003  1.00 17.34 ? 244 LYS D NZ  1 
ATOM   9385  N N   . GLY D 1 245 ? -8.506  -29.185 -3.187  1.00 16.18 ? 245 GLY D N   1 
ATOM   9386  C CA  . GLY D 1 245 ? -8.540  -30.050 -2.016  1.00 16.07 ? 245 GLY D CA  1 
ATOM   9387  C C   . GLY D 1 245 ? -8.396  -29.258 -0.739  1.00 15.95 ? 245 GLY D C   1 
ATOM   9388  O O   . GLY D 1 245 ? -7.587  -29.676 0.114   1.00 16.25 ? 245 GLY D O   1 
ATOM   9389  N N   . TYR D 1 246 ? -9.044  -28.123 -0.645  1.00 15.71 ? 246 TYR D N   1 
ATOM   9390  C CA  . TYR D 1 246 ? -9.050  -27.280 0.548   1.00 15.51 ? 246 TYR D CA  1 
ATOM   9391  C C   . TYR D 1 246 ? -9.516  -25.856 0.178   1.00 15.26 ? 246 TYR D C   1 
ATOM   9392  O O   . TYR D 1 246 ? -9.625  -25.479 -0.991  1.00 15.28 ? 246 TYR D O   1 
ATOM   9393  C CB  . TYR D 1 246 ? -7.741  -27.250 1.320   1.00 15.68 ? 246 TYR D CB  1 
ATOM   9394  C CG  . TYR D 1 246 ? -6.516  -26.666 0.701   1.00 15.83 ? 246 TYR D CG  1 
ATOM   9395  C CD1 . TYR D 1 246 ? -6.221  -25.299 0.854   1.00 16.01 ? 246 TYR D CD1 1 
ATOM   9396  C CD2 . TYR D 1 246 ? -5.587  -27.437 0.000   1.00 15.90 ? 246 TYR D CD2 1 
ATOM   9397  C CE1 . TYR D 1 246 ? -5.048  -24.757 0.338   1.00 16.04 ? 246 TYR D CE1 1 
ATOM   9398  C CE2 . TYR D 1 246 ? -4.424  -26.898 -0.551  1.00 15.89 ? 246 TYR D CE2 1 
ATOM   9399  C CZ  . TYR D 1 246 ? -4.153  -25.555 -0.358  1.00 16.02 ? 246 TYR D CZ  1 
ATOM   9400  O OH  . TYR D 1 246 ? -3.012  -25.008 -0.863  1.00 16.19 ? 246 TYR D OH  1 
ATOM   9401  N N   . THR D 1 247 ? -9.750  -25.118 1.235   1.00 14.70 ? 247 THR D N   1 
ATOM   9402  C CA  . THR D 1 247 ? -10.239 -23.728 1.233   1.00 14.15 ? 247 THR D CA  1 
ATOM   9403  C C   . THR D 1 247 ? -9.168  -22.847 1.833   1.00 13.56 ? 247 THR D C   1 
ATOM   9404  O O   . THR D 1 247 ? -9.071  -22.788 3.076   1.00 13.62 ? 247 THR D O   1 
ATOM   9405  C CB  . THR D 1 247 ? -11.617 -23.754 2.021   1.00 14.34 ? 247 THR D CB  1 
ATOM   9406  O OG1 . THR D 1 247 ? -12.231 -22.430 1.950   1.00 14.61 ? 247 THR D OG1 1 
ATOM   9407  C CG2 . THR D 1 247 ? -11.500 -24.246 3.474   1.00 14.25 ? 247 THR D CG2 1 
ATOM   9408  N N   . SER D 1 248 ? -8.373  -22.150 1.024   1.00 12.75 ? 248 SER D N   1 
ATOM   9409  C CA  . SER D 1 248 ? -7.232  -21.370 1.511   1.00 11.83 ? 248 SER D CA  1 
ATOM   9410  C C   . SER D 1 248 ? -7.251  -19.866 1.431   1.00 11.00 ? 248 SER D C   1 
ATOM   9411  O O   . SER D 1 248 ? -7.481  -19.200 2.436   1.00 11.00 ? 248 SER D O   1 
ATOM   9412  C CB  . SER D 1 248 ? -5.976  -21.833 0.709   1.00 11.98 ? 248 SER D CB  1 
ATOM   9413  O OG  . SER D 1 248 ? -6.369  -21.677 -0.659  1.00 12.09 ? 248 SER D OG  1 
ATOM   9414  N N   . TRP D 1 249 ? -6.856  -19.289 0.321   1.00 10.02 ? 249 TRP D N   1 
ATOM   9415  C CA  . TRP D 1 249 ? -6.704  -17.874 0.071   1.00 9.28  ? 249 TRP D CA  1 
ATOM   9416  C C   . TRP D 1 249 ? -7.818  -16.995 0.662   1.00 8.67  ? 249 TRP D C   1 
ATOM   9417  O O   . TRP D 1 249 ? -7.624  -16.201 1.601   1.00 8.38  ? 249 TRP D O   1 
ATOM   9418  C CB  . TRP D 1 249 ? -6.526  -17.602 -1.403  1.00 9.57  ? 249 TRP D CB  1 
ATOM   9419  C CG  . TRP D 1 249 ? -5.451  -18.202 -2.199  1.00 9.91  ? 249 TRP D CG  1 
ATOM   9420  C CD1 . TRP D 1 249 ? -5.441  -18.288 -3.580  1.00 10.00 ? 249 TRP D CD1 1 
ATOM   9421  C CD2 . TRP D 1 249 ? -4.217  -18.807 -1.787  1.00 10.01 ? 249 TRP D CD2 1 
ATOM   9422  N NE1 . TRP D 1 249 ? -4.300  -18.904 -4.021  1.00 10.08 ? 249 TRP D NE1 1 
ATOM   9423  C CE2 . TRP D 1 249 ? -3.529  -19.228 -2.940  1.00 10.04 ? 249 TRP D CE2 1 
ATOM   9424  C CE3 . TRP D 1 249 ? -3.635  -19.011 -0.545  1.00 10.04 ? 249 TRP D CE3 1 
ATOM   9425  C CZ2 . TRP D 1 249 ? -2.267  -19.804 -2.888  1.00 9.99  ? 249 TRP D CZ2 1 
ATOM   9426  C CZ3 . TRP D 1 249 ? -2.410  -19.640 -0.484  1.00 9.99  ? 249 TRP D CZ3 1 
ATOM   9427  C CH2 . TRP D 1 249 ? -1.728  -20.014 -1.637  1.00 9.99  ? 249 TRP D CH2 1 
ATOM   9428  N N   . ALA D 1 250 ? -8.967  -17.064 0.022   1.00 7.96  ? 250 ALA D N   1 
ATOM   9429  C CA  . ALA D 1 250 ? -10.179 -16.313 0.294   1.00 6.97  ? 250 ALA D CA  1 
ATOM   9430  C C   . ALA D 1 250 ? -10.564 -16.303 1.753   1.00 6.50  ? 250 ALA D C   1 
ATOM   9431  O O   . ALA D 1 250 ? -11.238 -15.320 2.162   1.00 6.33  ? 250 ALA D O   1 
ATOM   9432  C CB  . ALA D 1 250 ? -11.321 -16.817 -0.567  1.00 6.88  ? 250 ALA D CB  1 
ATOM   9433  N N   . ILE D 1 251 ? -10.206 -17.359 2.487   1.00 5.99  ? 251 ILE D N   1 
ATOM   9434  C CA  . ILE D 1 251 ? -10.548 -17.306 3.942   1.00 5.45  ? 251 ILE D CA  1 
ATOM   9435  C C   . ILE D 1 251 ? -9.588  -16.316 4.614   1.00 5.02  ? 251 ILE D C   1 
ATOM   9436  O O   . ILE D 1 251 ? -9.934  -15.557 5.531   1.00 4.84  ? 251 ILE D O   1 
ATOM   9437  C CB  . ILE D 1 251 ? -10.604 -18.695 4.605   1.00 5.41  ? 251 ILE D CB  1 
ATOM   9438  C CG1 . ILE D 1 251 ? -10.861 -18.622 6.130   1.00 5.62  ? 251 ILE D CG1 1 
ATOM   9439  C CG2 . ILE D 1 251 ? -9.319  -19.540 4.394   1.00 5.30  ? 251 ILE D CG2 1 
ATOM   9440  C CD1 . ILE D 1 251 ? -11.951 -17.652 6.629   1.00 5.83  ? 251 ILE D CD1 1 
ATOM   9441  N N   . GLY D 1 252 ? -8.396  -16.326 4.053   1.00 4.53  ? 252 GLY D N   1 
ATOM   9442  C CA  . GLY D 1 252 ? -7.254  -15.571 4.604   1.00 4.08  ? 252 GLY D CA  1 
ATOM   9443  C C   . GLY D 1 252 ? -7.584  -14.090 4.511   1.00 3.69  ? 252 GLY D C   1 
ATOM   9444  O O   . GLY D 1 252 ? -7.715  -13.427 5.527   1.00 3.74  ? 252 GLY D O   1 
ATOM   9445  N N   . LEU D 1 253 ? -7.734  -13.693 3.258   1.00 3.27  ? 253 LEU D N   1 
ATOM   9446  C CA  . LEU D 1 253 ? -8.075  -12.307 2.908   1.00 2.70  ? 253 LEU D CA  1 
ATOM   9447  C C   . LEU D 1 253 ? -9.208  -11.854 3.798   1.00 2.50  ? 253 LEU D C   1 
ATOM   9448  O O   . LEU D 1 253 ? -9.002  -10.846 4.513   1.00 2.86  ? 253 LEU D O   1 
ATOM   9449  C CB  . LEU D 1 253 ? -8.298  -12.210 1.400   1.00 2.38  ? 253 LEU D CB  1 
ATOM   9450  C CG  . LEU D 1 253 ? -6.991  -12.259 0.601   1.00 2.10  ? 253 LEU D CG  1 
ATOM   9451  C CD1 . LEU D 1 253 ? -7.186  -13.057 -0.666  1.00 2.30  ? 253 LEU D CD1 1 
ATOM   9452  C CD2 . LEU D 1 253 ? -6.556  -10.841 0.280   1.00 2.00  ? 253 LEU D CD2 1 
ATOM   9453  N N   . SER D 1 254 ? -10.260 -12.628 3.873   1.00 2.22  ? 254 SER D N   1 
ATOM   9454  C CA  . SER D 1 254 ? -11.400 -12.274 4.732   1.00 2.00  ? 254 SER D CA  1 
ATOM   9455  C C   . SER D 1 254 ? -10.934 -11.814 6.111   1.00 2.06  ? 254 SER D C   1 
ATOM   9456  O O   . SER D 1 254 ? -11.172 -10.680 6.530   1.00 2.24  ? 254 SER D O   1 
ATOM   9457  C CB  . SER D 1 254 ? -12.356 -13.435 4.877   1.00 2.00  ? 254 SER D CB  1 
ATOM   9458  O OG  . SER D 1 254 ? -13.111 -13.304 6.072   1.00 2.00  ? 254 SER D OG  1 
ATOM   9459  N N   . VAL D 1 255 ? -10.239 -12.673 6.801   1.00 2.14  ? 255 VAL D N   1 
ATOM   9460  C CA  . VAL D 1 255 ? -9.812  -12.487 8.177   1.00 2.32  ? 255 VAL D CA  1 
ATOM   9461  C C   . VAL D 1 255 ? -9.003  -11.221 8.403   1.00 2.46  ? 255 VAL D C   1 
ATOM   9462  O O   . VAL D 1 255 ? -9.066  -10.599 9.466   1.00 2.50  ? 255 VAL D O   1 
ATOM   9463  C CB  . VAL D 1 255 ? -8.972  -13.728 8.631   1.00 2.44  ? 255 VAL D CB  1 
ATOM   9464  C CG1 . VAL D 1 255 ? -8.410  -13.564 10.040  1.00 2.19  ? 255 VAL D CG1 1 
ATOM   9465  C CG2 . VAL D 1 255 ? -9.752  -15.024 8.422   1.00 2.43  ? 255 VAL D CG2 1 
ATOM   9466  N N   . THR D 1 256 ? -8.039  -11.111 7.484   1.00 2.58  ? 256 THR D N   1 
ATOM   9467  C CA  . THR D 1 256 ? -7.052  -10.007 7.551   1.00 2.35  ? 256 THR D CA  1 
ATOM   9468  C C   . THR D 1 256 ? -7.824  -8.704  7.416   1.00 2.23  ? 256 THR D C   1 
ATOM   9469  O O   . THR D 1 256 ? -7.394  -7.654  7.911   1.00 2.35  ? 256 THR D O   1 
ATOM   9470  C CB  . THR D 1 256 ? -5.869  -10.234 6.566   1.00 2.31  ? 256 THR D CB  1 
ATOM   9471  O OG1 . THR D 1 256 ? -5.409  -8.904  6.092   1.00 2.41  ? 256 THR D OG1 1 
ATOM   9472  C CG2 . THR D 1 256 ? -6.159  -11.160 5.399   1.00 2.22  ? 256 THR D CG2 1 
ATOM   9473  N N   . ASP D 1 257 ? -8.971  -8.855  6.795   1.00 2.01  ? 257 ASP D N   1 
ATOM   9474  C CA  . ASP D 1 257 ? -9.918  -7.755  6.531   1.00 2.00  ? 257 ASP D CA  1 
ATOM   9475  C C   . ASP D 1 257 ? -10.686 -7.476  7.821   1.00 2.00  ? 257 ASP D C   1 
ATOM   9476  O O   . ASP D 1 257 ? -11.178 -6.358  8.009   1.00 2.00  ? 257 ASP D O   1 
ATOM   9477  C CB  . ASP D 1 257 ? -10.711 -8.101  5.290   1.00 2.01  ? 257 ASP D CB  1 
ATOM   9478  C CG  . ASP D 1 257 ? -11.842 -7.161  4.984   1.00 2.30  ? 257 ASP D CG  1 
ATOM   9479  O OD1 . ASP D 1 257 ? -12.952 -7.322  5.537   1.00 2.54  ? 257 ASP D OD1 1 
ATOM   9480  O OD2 . ASP D 1 257 ? -11.604 -6.239  4.178   1.00 2.39  ? 257 ASP D OD2 1 
ATOM   9481  N N   . LEU D 1 258 ? -10.704 -8.461  8.702   1.00 2.00  ? 258 LEU D N   1 
ATOM   9482  C CA  . LEU D 1 258 ? -11.325 -8.348  10.019  1.00 2.00  ? 258 LEU D CA  1 
ATOM   9483  C C   . LEU D 1 258 ? -10.301 -7.682  10.947  1.00 2.00  ? 258 LEU D C   1 
ATOM   9484  O O   . LEU D 1 258 ? -10.613 -6.747  11.660  1.00 2.00  ? 258 LEU D O   1 
ATOM   9485  C CB  . LEU D 1 258 ? -11.804 -9.688  10.517  1.00 2.00  ? 258 LEU D CB  1 
ATOM   9486  C CG  . LEU D 1 258 ? -13.207 -10.177 10.271  1.00 2.00  ? 258 LEU D CG  1 
ATOM   9487  C CD1 . LEU D 1 258 ? -14.252 -9.191  10.781  1.00 2.00  ? 258 LEU D CD1 1 
ATOM   9488  C CD2 . LEU D 1 258 ? -13.461 -10.403 8.766   1.00 2.00  ? 258 LEU D CD2 1 
ATOM   9489  N N   . ALA D 1 259 ? -9.092  -8.167  10.856  1.00 2.00  ? 259 ALA D N   1 
ATOM   9490  C CA  . ALA D 1 259 ? -7.939  -7.663  11.610  1.00 2.00  ? 259 ALA D CA  1 
ATOM   9491  C C   . ALA D 1 259 ? -7.767  -6.165  11.355  1.00 2.00  ? 259 ALA D C   1 
ATOM   9492  O O   . ALA D 1 259 ? -7.712  -5.344  12.270  1.00 2.00  ? 259 ALA D O   1 
ATOM   9493  C CB  . ALA D 1 259 ? -6.689  -8.444  11.189  1.00 2.00  ? 259 ALA D CB  1 
ATOM   9494  N N   . ARG D 1 260 ? -7.646  -5.859  10.077  1.00 2.00  ? 260 ARG D N   1 
ATOM   9495  C CA  . ARG D 1 260 ? -7.474  -4.550  9.485   1.00 2.00  ? 260 ARG D CA  1 
ATOM   9496  C C   . ARG D 1 260 ? -8.377  -3.528  10.171  1.00 2.00  ? 260 ARG D C   1 
ATOM   9497  O O   . ARG D 1 260 ? -7.961  -2.426  10.523  1.00 2.00  ? 260 ARG D O   1 
ATOM   9498  C CB  . ARG D 1 260 ? -7.812  -4.567  7.996   1.00 2.00  ? 260 ARG D CB  1 
ATOM   9499  C CG  . ARG D 1 260 ? -7.465  -3.352  7.176   1.00 2.00  ? 260 ARG D CG  1 
ATOM   9500  C CD  . ARG D 1 260 ? -8.352  -2.214  7.395   1.00 2.00  ? 260 ARG D CD  1 
ATOM   9501  N NE  . ARG D 1 260 ? -8.153  -1.009  6.648   1.00 2.22  ? 260 ARG D NE  1 
ATOM   9502  C CZ  . ARG D 1 260 ? -8.491  -0.666  5.412   1.00 2.21  ? 260 ARG D CZ  1 
ATOM   9503  N NH1 . ARG D 1 260 ? -9.169  -1.463  4.576   1.00 2.32  ? 260 ARG D NH1 1 
ATOM   9504  N NH2 . ARG D 1 260 ? -8.010  0.480   4.902   1.00 2.02  ? 260 ARG D NH2 1 
ATOM   9505  N N   . SER D 1 261 ? -9.609  -3.980  10.305  1.00 2.00  ? 261 SER D N   1 
ATOM   9506  C CA  . SER D 1 261 ? -10.693 -3.195  10.877  1.00 2.00  ? 261 SER D CA  1 
ATOM   9507  C C   . SER D 1 261 ? -10.477 -3.037  12.377  1.00 2.00  ? 261 SER D C   1 
ATOM   9508  O O   . SER D 1 261 ? -10.690 -1.945  12.887  1.00 2.00  ? 261 SER D O   1 
ATOM   9509  C CB  . SER D 1 261 ? -12.060 -3.823  10.642  1.00 2.00  ? 261 SER D CB  1 
ATOM   9510  O OG  . SER D 1 261 ? -12.562 -4.261  11.902  1.00 2.00  ? 261 SER D OG  1 
ATOM   9511  N N   . ILE D 1 262 ? -10.292 -4.166  13.025  1.00 2.00  ? 262 ILE D N   1 
ATOM   9512  C CA  . ILE D 1 262 ? -10.013 -4.191  14.469  1.00 2.00  ? 262 ILE D CA  1 
ATOM   9513  C C   . ILE D 1 262 ? -8.795  -3.299  14.733  1.00 2.00  ? 262 ILE D C   1 
ATOM   9514  O O   . ILE D 1 262 ? -8.964  -2.186  15.218  1.00 2.05  ? 262 ILE D O   1 
ATOM   9515  C CB  . ILE D 1 262 ? -9.818  -5.645  15.023  1.00 2.00  ? 262 ILE D CB  1 
ATOM   9516  C CG1 . ILE D 1 262 ? -10.845 -6.597  14.398  1.00 2.00  ? 262 ILE D CG1 1 
ATOM   9517  C CG2 . ILE D 1 262 ? -9.866  -5.683  16.568  1.00 2.00  ? 262 ILE D CG2 1 
ATOM   9518  C CD1 . ILE D 1 262 ? -10.306 -8.020  14.108  1.00 2.00  ? 262 ILE D CD1 1 
ATOM   9519  N N   . LEU D 1 263 ? -7.649  -3.720  14.296  1.00 2.00  ? 263 LEU D N   1 
ATOM   9520  C CA  . LEU D 1 263 ? -6.379  -3.029  14.496  1.00 2.45  ? 263 LEU D CA  1 
ATOM   9521  C C   . LEU D 1 263 ? -6.353  -1.540  14.186  1.00 2.53  ? 263 LEU D C   1 
ATOM   9522  O O   . LEU D 1 263 ? -5.898  -0.725  15.061  1.00 2.55  ? 263 LEU D O   1 
ATOM   9523  C CB  . LEU D 1 263 ? -5.304  -3.913  13.795  1.00 2.46  ? 263 LEU D CB  1 
ATOM   9524  C CG  . LEU D 1 263 ? -4.822  -5.204  14.442  1.00 2.44  ? 263 LEU D CG  1 
ATOM   9525  C CD1 . LEU D 1 263 ? -5.143  -5.351  15.936  1.00 2.36  ? 263 LEU D CD1 1 
ATOM   9526  C CD2 . LEU D 1 263 ? -5.408  -6.425  13.725  1.00 2.47  ? 263 LEU D CD2 1 
ATOM   9527  N N   . LYS D 1 264 ? -6.863  -1.086  13.065  1.00 2.46  ? 264 LYS D N   1 
ATOM   9528  C CA  . LYS D 1 264 ? -6.774  0.346   12.702  1.00 2.47  ? 264 LYS D CA  1 
ATOM   9529  C C   . LYS D 1 264 ? -7.978  1.110   13.221  1.00 2.56  ? 264 LYS D C   1 
ATOM   9530  O O   . LYS D 1 264 ? -8.264  2.237   12.764  1.00 2.47  ? 264 LYS D O   1 
ATOM   9531  C CB  . LYS D 1 264 ? -6.676  0.492   11.197  1.00 2.49  ? 264 LYS D CB  1 
ATOM   9532  C CG  . LYS D 1 264 ? -5.708  -0.483  10.554  1.00 2.83  ? 264 LYS D CG  1 
ATOM   9533  C CD  . LYS D 1 264 ? -5.951  -0.705  9.081   1.00 3.15  ? 264 LYS D CD  1 
ATOM   9534  C CE  . LYS D 1 264 ? -5.009  0.089   8.172   1.00 3.23  ? 264 LYS D CE  1 
ATOM   9535  N NZ  . LYS D 1 264 ? -5.600  0.157   6.789   1.00 3.07  ? 264 LYS D NZ  1 
ATOM   9536  N N   . ASN D 1 265 ? -8.693  0.458   14.106  1.00 2.59  ? 265 ASN D N   1 
ATOM   9537  C CA  . ASN D 1 265 ? -9.914  0.912   14.747  1.00 2.60  ? 265 ASN D CA  1 
ATOM   9538  C C   . ASN D 1 265 ? -10.913 1.498   13.765  1.00 2.83  ? 265 ASN D C   1 
ATOM   9539  O O   . ASN D 1 265 ? -11.576 2.509   14.105  1.00 3.05  ? 265 ASN D O   1 
ATOM   9540  C CB  . ASN D 1 265 ? -9.629  1.943   15.865  1.00 2.63  ? 265 ASN D CB  1 
ATOM   9541  C CG  . ASN D 1 265 ? -10.689 1.883   16.933  1.00 2.64  ? 265 ASN D CG  1 
ATOM   9542  O OD1 . ASN D 1 265 ? -11.397 0.863   16.971  1.00 3.09  ? 265 ASN D OD1 1 
ATOM   9543  N ND2 . ASN D 1 265 ? -10.857 2.866   17.788  1.00 2.50  ? 265 ASN D ND2 1 
ATOM   9544  N N   . LEU D 1 266 ? -10.967 0.939   12.581  1.00 2.89  ? 266 LEU D N   1 
ATOM   9545  C CA  . LEU D 1 266 ? -11.822 1.399   11.494  1.00 2.93  ? 266 LEU D CA  1 
ATOM   9546  C C   . LEU D 1 266 ? -13.304 1.534   11.766  1.00 2.97  ? 266 LEU D C   1 
ATOM   9547  O O   . LEU D 1 266 ? -14.023 2.281   11.036  1.00 3.09  ? 266 LEU D O   1 
ATOM   9548  C CB  . LEU D 1 266 ? -11.535 0.421   10.337  1.00 2.98  ? 266 LEU D CB  1 
ATOM   9549  C CG  . LEU D 1 266 ? -10.727 0.971   9.186   1.00 3.25  ? 266 LEU D CG  1 
ATOM   9550  C CD1 . LEU D 1 266 ? -9.348  1.444   9.638   1.00 3.26  ? 266 LEU D CD1 1 
ATOM   9551  C CD2 . LEU D 1 266 ? -10.637 -0.137  8.127   1.00 3.10  ? 266 LEU D CD2 1 
ATOM   9552  N N   . LYS D 1 267 ? -13.805 0.824   12.744  1.00 2.92  ? 267 LYS D N   1 
ATOM   9553  C CA  . LYS D 1 267 ? -15.233 0.794   13.085  1.00 2.94  ? 267 LYS D CA  1 
ATOM   9554  C C   . LYS D 1 267 ? -16.069 0.599   11.818  1.00 2.85  ? 267 LYS D C   1 
ATOM   9555  O O   . LYS D 1 267 ? -17.137 1.164   11.676  1.00 2.64  ? 267 LYS D O   1 
ATOM   9556  C CB  . LYS D 1 267 ? -15.737 1.959   13.895  1.00 2.92  ? 267 LYS D CB  1 
ATOM   9557  C CG  . LYS D 1 267 ? -15.243 1.960   15.364  1.00 2.81  ? 267 LYS D CG  1 
ATOM   9558  C CD  . LYS D 1 267 ? -15.253 3.388   15.876  1.00 3.09  ? 267 LYS D CD  1 
ATOM   9559  C CE  . LYS D 1 267 ? -16.656 3.957   16.046  1.00 3.26  ? 267 LYS D CE  1 
ATOM   9560  N NZ  . LYS D 1 267 ? -16.657 5.410   15.663  1.00 3.41  ? 267 LYS D NZ  1 
ATOM   9561  N N   . ARG D 1 268 ? -15.506 -0.244  10.967  1.00 3.15  ? 268 ARG D N   1 
ATOM   9562  C CA  . ARG D 1 268 ? -16.107 -0.764  9.745   1.00 3.42  ? 268 ARG D CA  1 
ATOM   9563  C C   . ARG D 1 268 ? -17.049 -1.912  10.237  1.00 3.45  ? 268 ARG D C   1 
ATOM   9564  O O   . ARG D 1 268 ? -16.558 -2.810  10.958  1.00 3.46  ? 268 ARG D O   1 
ATOM   9565  C CB  . ARG D 1 268 ? -15.211 -1.428  8.734   1.00 3.68  ? 268 ARG D CB  1 
ATOM   9566  C CG  . ARG D 1 268 ? -14.542 -0.802  7.564   1.00 4.07  ? 268 ARG D CG  1 
ATOM   9567  C CD  . ARG D 1 268 ? -14.308 -1.758  6.434   1.00 4.48  ? 268 ARG D CD  1 
ATOM   9568  N NE  . ARG D 1 268 ? -13.081 -2.502  6.493   1.00 5.06  ? 268 ARG D NE  1 
ATOM   9569  C CZ  . ARG D 1 268 ? -11.879 -2.219  5.961   1.00 5.34  ? 268 ARG D CZ  1 
ATOM   9570  N NH1 . ARG D 1 268 ? -11.618 -1.128  5.221   1.00 5.32  ? 268 ARG D NH1 1 
ATOM   9571  N NH2 . ARG D 1 268 ? -10.835 -3.047  6.180   1.00 5.18  ? 268 ARG D NH2 1 
ATOM   9572  N N   . VAL D 1 269 ? -18.296 -1.779  9.848   1.00 3.39  ? 269 VAL D N   1 
ATOM   9573  C CA  . VAL D 1 269 ? -19.291 -2.816  10.218  1.00 3.24  ? 269 VAL D CA  1 
ATOM   9574  C C   . VAL D 1 269 ? -18.975 -4.058  9.391   1.00 3.26  ? 269 VAL D C   1 
ATOM   9575  O O   . VAL D 1 269 ? -18.409 -3.987  8.280   1.00 3.13  ? 269 VAL D O   1 
ATOM   9576  C CB  . VAL D 1 269 ? -20.711 -2.277  10.117  1.00 3.28  ? 269 VAL D CB  1 
ATOM   9577  C CG1 . VAL D 1 269 ? -21.190 -2.050  8.694   1.00 3.21  ? 269 VAL D CG1 1 
ATOM   9578  C CG2 . VAL D 1 269 ? -21.671 -3.168  10.904  1.00 3.32  ? 269 VAL D CG2 1 
ATOM   9579  N N   . HIS D 1 270 ? -19.349 -5.185  9.969   1.00 3.30  ? 270 HIS D N   1 
ATOM   9580  C CA  . HIS D 1 270 ? -19.051 -6.518  9.474   1.00 3.15  ? 270 HIS D CA  1 
ATOM   9581  C C   . HIS D 1 270 ? -20.076 -7.562  9.879   1.00 3.21  ? 270 HIS D C   1 
ATOM   9582  O O   . HIS D 1 270 ? -20.762 -7.430  10.894  1.00 3.09  ? 270 HIS D O   1 
ATOM   9583  C CB  . HIS D 1 270 ? -17.662 -7.052  10.031  1.00 2.78  ? 270 HIS D CB  1 
ATOM   9584  C CG  . HIS D 1 270 ? -16.533 -6.419  9.290   1.00 2.51  ? 270 HIS D CG  1 
ATOM   9585  N ND1 . HIS D 1 270 ? -16.110 -6.850  8.062   1.00 2.51  ? 270 HIS D ND1 1 
ATOM   9586  C CD2 . HIS D 1 270 ? -15.823 -5.310  9.551   1.00 2.53  ? 270 HIS D CD2 1 
ATOM   9587  C CE1 . HIS D 1 270 ? -15.161 -6.043  7.613   1.00 2.55  ? 270 HIS D CE1 1 
ATOM   9588  N NE2 . HIS D 1 270 ? -14.961 -5.099  8.511   1.00 2.53  ? 270 HIS D NE2 1 
ATOM   9589  N N   . PRO D 1 271 ? -20.142 -8.556  8.996   1.00 3.36  ? 271 PRO D N   1 
ATOM   9590  C CA  . PRO D 1 271 ? -20.949 -9.760  9.309   1.00 3.58  ? 271 PRO D CA  1 
ATOM   9591  C C   . PRO D 1 271 ? -19.926 -10.741 9.904   1.00 3.86  ? 271 PRO D C   1 
ATOM   9592  O O   . PRO D 1 271 ? -18.935 -11.140 9.291   1.00 3.95  ? 271 PRO D O   1 
ATOM   9593  C CB  . PRO D 1 271 ? -21.592 -10.174 8.030   1.00 3.42  ? 271 PRO D CB  1 
ATOM   9594  C CG  . PRO D 1 271 ? -20.730 -9.615  6.961   1.00 3.39  ? 271 PRO D CG  1 
ATOM   9595  C CD  . PRO D 1 271 ? -20.072 -8.360  7.527   1.00 3.34  ? 271 PRO D CD  1 
ATOM   9596  N N   . VAL D 1 272 ? -20.123 -11.008 11.153  1.00 4.12  ? 272 VAL D N   1 
ATOM   9597  C CA  . VAL D 1 272 ? -19.271 -11.869 11.974  1.00 4.47  ? 272 VAL D CA  1 
ATOM   9598  C C   . VAL D 1 272 ? -20.184 -12.620 12.915  1.00 4.95  ? 272 VAL D C   1 
ATOM   9599  O O   . VAL D 1 272 ? -21.359 -12.199 13.012  1.00 5.05  ? 272 VAL D O   1 
ATOM   9600  C CB  . VAL D 1 272 ? -18.261 -10.902 12.626  1.00 4.43  ? 272 VAL D CB  1 
ATOM   9601  C CG1 . VAL D 1 272 ? -17.442 -10.142 11.587  1.00 4.38  ? 272 VAL D CG1 1 
ATOM   9602  C CG2 . VAL D 1 272 ? -18.918 -9.927  13.578  1.00 4.34  ? 272 VAL D CG2 1 
ATOM   9603  N N   . THR D 1 273 ? -19.704 -13.637 13.595  1.00 5.52  ? 273 THR D N   1 
ATOM   9604  C CA  . THR D 1 273 ? -20.503 -14.397 14.551  1.00 6.08  ? 273 THR D CA  1 
ATOM   9605  C C   . THR D 1 273 ? -20.399 -13.852 15.964  1.00 6.69  ? 273 THR D C   1 
ATOM   9606  O O   . THR D 1 273 ? -19.315 -13.506 16.439  1.00 6.79  ? 273 THR D O   1 
ATOM   9607  C CB  . THR D 1 273 ? -20.097 -15.924 14.558  1.00 5.94  ? 273 THR D CB  1 
ATOM   9608  O OG1 . THR D 1 273 ? -18.686 -15.915 14.933  1.00 6.04  ? 273 THR D OG1 1 
ATOM   9609  C CG2 . THR D 1 273 ? -20.354 -16.617 13.239  1.00 6.01  ? 273 THR D CG2 1 
ATOM   9610  N N   . THR D 1 274 ? -21.524 -13.819 16.632  1.00 7.54  ? 274 THR D N   1 
ATOM   9611  C CA  . THR D 1 274 ? -21.670 -13.397 18.001  1.00 8.49  ? 274 THR D CA  1 
ATOM   9612  C C   . THR D 1 274 ? -23.012 -13.937 18.517  1.00 9.43  ? 274 THR D C   1 
ATOM   9613  O O   . THR D 1 274 ? -23.779 -14.545 17.787  1.00 9.42  ? 274 THR D O   1 
ATOM   9614  C CB  . THR D 1 274 ? -21.583 -11.859 18.284  1.00 8.52  ? 274 THR D CB  1 
ATOM   9615  O OG1 . THR D 1 274 ? -22.316 -11.159 17.204  1.00 8.45  ? 274 THR D OG1 1 
ATOM   9616  C CG2 . THR D 1 274 ? -20.141 -11.372 18.464  1.00 8.48  ? 274 THR D CG2 1 
ATOM   9617  N N   . LEU D 1 275 ? -23.205 -13.651 19.776  1.00 10.69 ? 275 LEU D N   1 
ATOM   9618  C CA  . LEU D 1 275 ? -24.350 -14.083 20.550  1.00 11.80 ? 275 LEU D CA  1 
ATOM   9619  C C   . LEU D 1 275 ? -25.606 -13.330 20.180  1.00 12.82 ? 275 LEU D C   1 
ATOM   9620  O O   . LEU D 1 275 ? -25.774 -12.174 20.616  1.00 13.00 ? 275 LEU D O   1 
ATOM   9621  C CB  . LEU D 1 275 ? -23.953 -13.895 22.026  1.00 11.68 ? 275 LEU D CB  1 
ATOM   9622  C CG  . LEU D 1 275 ? -24.940 -14.310 23.080  1.00 11.67 ? 275 LEU D CG  1 
ATOM   9623  C CD1 . LEU D 1 275 ? -25.403 -15.748 22.860  1.00 11.86 ? 275 LEU D CD1 1 
ATOM   9624  C CD2 . LEU D 1 275 ? -24.254 -14.240 24.453  1.00 11.72 ? 275 LEU D CD2 1 
ATOM   9625  N N   . VAL D 1 276 ? -26.430 -13.982 19.403  1.00 14.24 ? 276 VAL D N   1 
ATOM   9626  C CA  . VAL D 1 276 ? -27.760 -13.410 19.053  1.00 15.73 ? 276 VAL D CA  1 
ATOM   9627  C C   . VAL D 1 276 ? -28.763 -13.830 20.152  1.00 16.89 ? 276 VAL D C   1 
ATOM   9628  O O   . VAL D 1 276 ? -29.983 -13.785 19.986  1.00 16.69 ? 276 VAL D O   1 
ATOM   9629  C CB  . VAL D 1 276 ? -28.153 -13.800 17.627  1.00 15.50 ? 276 VAL D CB  1 
ATOM   9630  C CG1 . VAL D 1 276 ? -27.011 -13.662 16.632  1.00 15.37 ? 276 VAL D CG1 1 
ATOM   9631  C CG2 . VAL D 1 276 ? -28.765 -15.182 17.576  1.00 15.42 ? 276 VAL D CG2 1 
ATOM   9632  N N   . LYS D 1 277 ? -28.195 -14.227 21.270  1.00 18.52 ? 277 LYS D N   1 
ATOM   9633  C CA  . LYS D 1 277 ? -28.791 -14.694 22.473  1.00 20.01 ? 277 LYS D CA  1 
ATOM   9634  C C   . LYS D 1 277 ? -30.259 -14.291 22.634  1.00 20.70 ? 277 LYS D C   1 
ATOM   9635  O O   . LYS D 1 277 ? -30.945 -15.152 23.221  1.00 21.20 ? 277 LYS D O   1 
ATOM   9636  C CB  . LYS D 1 277 ? -28.150 -14.272 23.798  1.00 20.63 ? 277 LYS D CB  1 
ATOM   9637  C CG  . LYS D 1 277 ? -28.254 -12.779 24.150  1.00 21.52 ? 277 LYS D CG  1 
ATOM   9638  C CD  . LYS D 1 277 ? -28.652 -12.624 25.622  1.00 22.12 ? 277 LYS D CD  1 
ATOM   9639  C CE  . LYS D 1 277 ? -27.921 -11.483 26.325  1.00 22.41 ? 277 LYS D CE  1 
ATOM   9640  N NZ  . LYS D 1 277 ? -27.862 -11.794 27.808  1.00 22.71 ? 277 LYS D NZ  1 
ATOM   9641  N N   . GLY D 1 278 ? -30.585 -13.060 22.321  1.00 21.13 ? 278 GLY D N   1 
ATOM   9642  C CA  . GLY D 1 278 ? -31.969 -12.583 22.503  1.00 21.67 ? 278 GLY D CA  1 
ATOM   9643  C C   . GLY D 1 278 ? -32.306 -11.527 21.464  1.00 22.18 ? 278 GLY D C   1 
ATOM   9644  O O   . GLY D 1 278 ? -32.751 -10.420 21.820  1.00 22.37 ? 278 GLY D O   1 
ATOM   9645  N N   . PHE D 1 279 ? -32.051 -11.817 20.222  1.00 22.56 ? 279 PHE D N   1 
ATOM   9646  C CA  . PHE D 1 279 ? -32.358 -10.911 19.094  1.00 23.00 ? 279 PHE D CA  1 
ATOM   9647  C C   . PHE D 1 279 ? -33.423 -11.625 18.260  1.00 23.23 ? 279 PHE D C   1 
ATOM   9648  O O   . PHE D 1 279 ? -33.561 -12.860 18.383  1.00 23.57 ? 279 PHE D O   1 
ATOM   9649  C CB  . PHE D 1 279 ? -31.143 -10.540 18.261  1.00 23.19 ? 279 PHE D CB  1 
ATOM   9650  C CG  . PHE D 1 279 ? -30.477 -9.223  18.507  1.00 23.29 ? 279 PHE D CG  1 
ATOM   9651  C CD1 . PHE D 1 279 ? -31.030 -8.052  17.946  1.00 23.27 ? 279 PHE D CD1 1 
ATOM   9652  C CD2 . PHE D 1 279 ? -29.303 -9.135  19.258  1.00 23.21 ? 279 PHE D CD2 1 
ATOM   9653  C CE1 . PHE D 1 279 ? -30.448 -6.817  18.163  1.00 23.25 ? 279 PHE D CE1 1 
ATOM   9654  C CE2 . PHE D 1 279 ? -28.699 -7.891  19.471  1.00 23.27 ? 279 PHE D CE2 1 
ATOM   9655  C CZ  . PHE D 1 279 ? -29.271 -6.733  18.905  1.00 23.24 ? 279 PHE D CZ  1 
ATOM   9656  N N   . HIS D 1 280 ? -34.123 -10.896 17.464  1.00 23.27 ? 280 HIS D N   1 
ATOM   9657  C CA  . HIS D 1 280 ? -35.171 -11.391 16.574  1.00 23.41 ? 280 HIS D CA  1 
ATOM   9658  C C   . HIS D 1 280 ? -35.759 -12.752 16.891  1.00 23.09 ? 280 HIS D C   1 
ATOM   9659  O O   . HIS D 1 280 ? -35.989 -13.634 16.040  1.00 22.82 ? 280 HIS D O   1 
ATOM   9660  C CB  . HIS D 1 280 ? -34.664 -11.299 15.100  1.00 23.86 ? 280 HIS D CB  1 
ATOM   9661  C CG  . HIS D 1 280 ? -33.762 -12.445 14.769  1.00 24.29 ? 280 HIS D CG  1 
ATOM   9662  N ND1 . HIS D 1 280 ? -34.281 -13.622 14.236  1.00 24.47 ? 280 HIS D ND1 1 
ATOM   9663  C CD2 . HIS D 1 280 ? -32.455 -12.664 14.985  1.00 24.44 ? 280 HIS D CD2 1 
ATOM   9664  C CE1 . HIS D 1 280 ? -33.289 -14.489 14.087  1.00 24.56 ? 280 HIS D CE1 1 
ATOM   9665  N NE2 . HIS D 1 280 ? -32.169 -13.925 14.499  1.00 24.56 ? 280 HIS D NE2 1 
ATOM   9666  N N   . GLY D 1 281 ? -36.168 -12.941 18.139  1.00 22.93 ? 281 GLY D N   1 
ATOM   9667  C CA  . GLY D 1 281 ? -36.853 -14.146 18.594  1.00 22.81 ? 281 GLY D CA  1 
ATOM   9668  C C   . GLY D 1 281 ? -35.947 -15.170 19.219  1.00 22.78 ? 281 GLY D C   1 
ATOM   9669  O O   . GLY D 1 281 ? -36.395 -15.935 20.112  1.00 22.92 ? 281 GLY D O   1 
ATOM   9670  N N   . ILE D 1 282 ? -34.713 -15.237 18.722  1.00 22.55 ? 282 ILE D N   1 
ATOM   9671  C CA  . ILE D 1 282 ? -33.731 -16.179 19.302  1.00 22.16 ? 282 ILE D CA  1 
ATOM   9672  C C   . ILE D 1 282 ? -33.479 -15.726 20.750  1.00 22.08 ? 282 ILE D C   1 
ATOM   9673  O O   . ILE D 1 282 ? -33.271 -14.546 21.017  1.00 21.82 ? 282 ILE D O   1 
ATOM   9674  C CB  . ILE D 1 282 ? -32.445 -16.316 18.472  1.00 21.97 ? 282 ILE D CB  1 
ATOM   9675  C CG1 . ILE D 1 282 ? -32.781 -16.402 16.964  1.00 21.81 ? 282 ILE D CG1 1 
ATOM   9676  C CG2 . ILE D 1 282 ? -31.586 -17.550 18.920  1.00 21.99 ? 282 ILE D CG2 1 
ATOM   9677  C CD1 . ILE D 1 282 ? -31.515 -16.223 16.075  1.00 21.74 ? 282 ILE D CD1 1 
ATOM   9678  N N   . LYS D 1 283 ? -33.640 -16.706 21.617  1.00 22.12 ? 283 LYS D N   1 
ATOM   9679  C CA  . LYS D 1 283 ? -33.448 -16.505 23.058  1.00 22.21 ? 283 LYS D CA  1 
ATOM   9680  C C   . LYS D 1 283 ? -32.802 -17.763 23.633  1.00 22.12 ? 283 LYS D C   1 
ATOM   9681  O O   . LYS D 1 283 ? -33.453 -18.639 24.230  1.00 22.32 ? 283 LYS D O   1 
ATOM   9682  C CB  . LYS D 1 283 ? -34.740 -16.136 23.750  1.00 22.41 ? 283 LYS D CB  1 
ATOM   9683  C CG  . LYS D 1 283 ? -35.452 -14.891 23.221  1.00 22.58 ? 283 LYS D CG  1 
ATOM   9684  C CD  . LYS D 1 283 ? -36.668 -14.518 24.058  1.00 22.75 ? 283 LYS D CD  1 
ATOM   9685  C CE  . LYS D 1 283 ? -37.854 -15.455 23.879  1.00 22.90 ? 283 LYS D CE  1 
ATOM   9686  N NZ  . LYS D 1 283 ? -38.910 -15.197 24.914  1.00 22.74 ? 283 LYS D NZ  1 
ATOM   9687  N N   . GLU D 1 284 ? -31.508 -17.863 23.397  1.00 21.81 ? 284 GLU D N   1 
ATOM   9688  C CA  . GLU D 1 284 ? -30.687 -19.020 23.850  1.00 21.48 ? 284 GLU D CA  1 
ATOM   9689  C C   . GLU D 1 284 ? -29.310 -18.815 23.201  1.00 20.97 ? 284 GLU D C   1 
ATOM   9690  O O   . GLU D 1 284 ? -29.278 -18.551 21.996  1.00 20.75 ? 284 GLU D O   1 
ATOM   9691  C CB  . GLU D 1 284 ? -31.318 -20.321 23.442  1.00 21.78 ? 284 GLU D CB  1 
ATOM   9692  C CG  . GLU D 1 284 ? -31.488 -21.502 24.342  1.00 22.12 ? 284 GLU D CG  1 
ATOM   9693  C CD  . GLU D 1 284 ? -32.623 -21.684 25.281  1.00 22.23 ? 284 GLU D CD  1 
ATOM   9694  O OE1 . GLU D 1 284 ? -33.675 -21.057 25.299  1.00 22.21 ? 284 GLU D OE1 1 
ATOM   9695  O OE2 . GLU D 1 284 ? -32.398 -22.618 26.109  1.00 22.23 ? 284 GLU D OE2 1 
ATOM   9696  N N   . GLU D 1 285 ? -28.283 -18.781 24.005  1.00 20.33 ? 285 GLU D N   1 
ATOM   9697  C CA  . GLU D 1 285 ? -26.892 -18.500 23.758  1.00 19.54 ? 285 GLU D CA  1 
ATOM   9698  C C   . GLU D 1 285 ? -26.311 -19.138 22.480  1.00 18.84 ? 285 GLU D C   1 
ATOM   9699  O O   . GLU D 1 285 ? -25.182 -19.694 22.416  1.00 18.70 ? 285 GLU D O   1 
ATOM   9700  C CB  . GLU D 1 285 ? -25.980 -18.882 24.874  1.00 19.79 ? 285 GLU D CB  1 
ATOM   9701  C CG  . GLU D 1 285 ? -25.878 -19.100 26.267  1.00 20.21 ? 285 GLU D CG  1 
ATOM   9702  C CD  . GLU D 1 285 ? -25.624 -18.135 27.348  1.00 20.59 ? 285 GLU D CD  1 
ATOM   9703  O OE1 . GLU D 1 285 ? -26.281 -18.090 28.399  1.00 21.03 ? 285 GLU D OE1 1 
ATOM   9704  O OE2 . GLU D 1 285 ? -24.670 -17.345 27.181  1.00 20.63 ? 285 GLU D OE2 1 
ATOM   9705  N N   . VAL D 1 286 ? -27.045 -18.994 21.417  1.00 17.89 ? 286 VAL D N   1 
ATOM   9706  C CA  . VAL D 1 286 ? -26.765 -19.344 20.066  1.00 17.05 ? 286 VAL D CA  1 
ATOM   9707  C C   . VAL D 1 286 ? -25.976 -18.145 19.453  1.00 16.44 ? 286 VAL D C   1 
ATOM   9708  O O   . VAL D 1 286 ? -26.485 -17.025 19.484  1.00 16.45 ? 286 VAL D O   1 
ATOM   9709  C CB  . VAL D 1 286 ? -27.995 -19.558 19.168  1.00 17.04 ? 286 VAL D CB  1 
ATOM   9710  C CG1 . VAL D 1 286 ? -27.588 -19.746 17.706  1.00 16.92 ? 286 VAL D CG1 1 
ATOM   9711  C CG2 . VAL D 1 286 ? -28.880 -20.678 19.654  1.00 17.11 ? 286 VAL D CG2 1 
ATOM   9712  N N   . PHE D 1 287 ? -24.864 -18.515 18.918  1.00 15.66 ? 287 PHE D N   1 
ATOM   9713  C CA  . PHE D 1 287 ? -23.950 -17.627 18.223  1.00 14.94 ? 287 PHE D CA  1 
ATOM   9714  C C   . PHE D 1 287 ? -24.093 -17.984 16.728  1.00 14.68 ? 287 PHE D C   1 
ATOM   9715  O O   . PHE D 1 287 ? -23.880 -19.164 16.419  1.00 14.85 ? 287 PHE D O   1 
ATOM   9716  C CB  . PHE D 1 287 ? -22.498 -17.776 18.628  1.00 14.65 ? 287 PHE D CB  1 
ATOM   9717  C CG  . PHE D 1 287 ? -22.056 -17.296 19.959  1.00 14.51 ? 287 PHE D CG  1 
ATOM   9718  C CD1 . PHE D 1 287 ? -22.503 -17.910 21.127  1.00 14.55 ? 287 PHE D CD1 1 
ATOM   9719  C CD2 . PHE D 1 287 ? -21.072 -16.312 20.061  1.00 14.44 ? 287 PHE D CD2 1 
ATOM   9720  C CE1 . PHE D 1 287 ? -22.040 -17.510 22.367  1.00 14.55 ? 287 PHE D CE1 1 
ATOM   9721  C CE2 . PHE D 1 287 ? -20.605 -15.868 21.293  1.00 14.33 ? 287 PHE D CE2 1 
ATOM   9722  C CZ  . PHE D 1 287 ? -21.106 -16.471 22.443  1.00 14.44 ? 287 PHE D CZ  1 
ATOM   9723  N N   . LEU D 1 288 ? -24.598 -17.070 15.971  1.00 14.18 ? 288 LEU D N   1 
ATOM   9724  C CA  . LEU D 1 288 ? -24.594 -17.157 14.488  1.00 13.68 ? 288 LEU D CA  1 
ATOM   9725  C C   . LEU D 1 288 ? -24.082 -15.737 14.126  1.00 13.43 ? 288 LEU D C   1 
ATOM   9726  O O   . LEU D 1 288 ? -23.793 -14.955 15.073  1.00 13.25 ? 288 LEU D O   1 
ATOM   9727  C CB  . LEU D 1 288 ? -25.839 -17.639 13.867  1.00 13.62 ? 288 LEU D CB  1 
ATOM   9728  C CG  . LEU D 1 288 ? -27.133 -16.932 13.610  1.00 13.50 ? 288 LEU D CG  1 
ATOM   9729  C CD1 . LEU D 1 288 ? -27.720 -16.350 14.886  1.00 13.49 ? 288 LEU D CD1 1 
ATOM   9730  C CD2 . LEU D 1 288 ? -26.967 -15.762 12.636  1.00 13.45 ? 288 LEU D CD2 1 
ATOM   9731  N N   . SER D 1 289 ? -24.017 -15.448 12.846  1.00 13.12 ? 289 SER D N   1 
ATOM   9732  C CA  . SER D 1 289 ? -23.449 -14.138 12.452  1.00 12.78 ? 289 SER D CA  1 
ATOM   9733  C C   . SER D 1 289 ? -24.503 -13.114 12.065  1.00 12.39 ? 289 SER D C   1 
ATOM   9734  O O   . SER D 1 289 ? -25.537 -13.375 11.431  1.00 12.43 ? 289 SER D O   1 
ATOM   9735  C CB  . SER D 1 289 ? -22.402 -14.344 11.365  1.00 12.91 ? 289 SER D CB  1 
ATOM   9736  O OG  . SER D 1 289 ? -22.972 -14.027 10.120  1.00 13.27 ? 289 SER D OG  1 
ATOM   9737  N N   . ILE D 1 290 ? -24.141 -11.897 12.363  1.00 11.86 ? 290 ILE D N   1 
ATOM   9738  C CA  . ILE D 1 290 ? -24.961 -10.680 12.176  1.00 11.59 ? 290 ILE D CA  1 
ATOM   9739  C C   . ILE D 1 290 ? -24.060 -9.501  11.903  1.00 11.53 ? 290 ILE D C   1 
ATOM   9740  O O   . ILE D 1 290 ? -22.874 -9.463  12.327  1.00 11.78 ? 290 ILE D O   1 
ATOM   9741  C CB  . ILE D 1 290 ? -25.850 -10.595 13.478  1.00 11.39 ? 290 ILE D CB  1 
ATOM   9742  C CG1 . ILE D 1 290 ? -27.334 -10.779 13.077  1.00 11.37 ? 290 ILE D CG1 1 
ATOM   9743  C CG2 . ILE D 1 290 ? -25.619 -9.375  14.379  1.00 11.17 ? 290 ILE D CG2 1 
ATOM   9744  C CD1 . ILE D 1 290 ? -27.783 -12.262 12.977  1.00 11.41 ? 290 ILE D CD1 1 
ATOM   9745  N N   . PRO D 1 291 ? -24.574 -8.524  11.162  1.00 11.20 ? 291 PRO D N   1 
ATOM   9746  C CA  . PRO D 1 291 ? -23.771 -7.305  10.865  1.00 10.83 ? 291 PRO D CA  1 
ATOM   9747  C C   . PRO D 1 291 ? -23.506 -6.535  12.143  1.00 10.57 ? 291 PRO D C   1 
ATOM   9748  O O   . PRO D 1 291 ? -24.414 -6.065  12.850  1.00 10.55 ? 291 PRO D O   1 
ATOM   9749  C CB  . PRO D 1 291 ? -24.540 -6.616  9.784   1.00 10.72 ? 291 PRO D CB  1 
ATOM   9750  C CG  . PRO D 1 291 ? -25.910 -7.223  9.799   1.00 10.85 ? 291 PRO D CG  1 
ATOM   9751  C CD  . PRO D 1 291 ? -25.700 -8.686  10.218  1.00 10.98 ? 291 PRO D CD  1 
ATOM   9752  N N   . CYS D 1 292 ? -22.237 -6.428  12.501  1.00 10.35 ? 292 CYS D N   1 
ATOM   9753  C CA  . CYS D 1 292 ? -21.696 -5.773  13.674  1.00 9.97  ? 292 CYS D CA  1 
ATOM   9754  C C   . CYS D 1 292 ? -20.549 -4.815  13.287  1.00 9.87  ? 292 CYS D C   1 
ATOM   9755  O O   . CYS D 1 292 ? -19.852 -5.017  12.310  1.00 9.59  ? 292 CYS D O   1 
ATOM   9756  C CB  . CYS D 1 292 ? -21.125 -6.750  14.694  1.00 9.78  ? 292 CYS D CB  1 
ATOM   9757  S SG  . CYS D 1 292 ? -21.522 -8.499  14.494  1.00 9.31  ? 292 CYS D SG  1 
ATOM   9758  N N   . VAL D 1 293 ? -20.357 -3.850  14.158  1.00 10.00 ? 293 VAL D N   1 
ATOM   9759  C CA  . VAL D 1 293 ? -19.286 -2.852  14.028  1.00 10.00 ? 293 VAL D CA  1 
ATOM   9760  C C   . VAL D 1 293 ? -18.109 -3.303  14.924  1.00 10.02 ? 293 VAL D C   1 
ATOM   9761  O O   . VAL D 1 293 ? -18.273 -3.565  16.114  1.00 9.75  ? 293 VAL D O   1 
ATOM   9762  C CB  . VAL D 1 293 ? -19.763 -1.437  14.335  1.00 10.02 ? 293 VAL D CB  1 
ATOM   9763  C CG1 . VAL D 1 293 ? -18.797 -0.366  13.806  1.00 10.07 ? 293 VAL D CG1 1 
ATOM   9764  C CG2 . VAL D 1 293 ? -21.173 -1.157  13.845  1.00 10.11 ? 293 VAL D CG2 1 
ATOM   9765  N N   . LEU D 1 294 ? -16.963 -3.321  14.271  1.00 10.17 ? 294 LEU D N   1 
ATOM   9766  C CA  . LEU D 1 294 ? -15.689 -3.745  14.824  1.00 10.37 ? 294 LEU D CA  1 
ATOM   9767  C C   . LEU D 1 294 ? -14.665 -2.621  14.960  1.00 10.55 ? 294 LEU D C   1 
ATOM   9768  O O   . LEU D 1 294 ? -14.426 -1.920  13.964  1.00 10.52 ? 294 LEU D O   1 
ATOM   9769  C CB  . LEU D 1 294 ? -15.160 -4.841  13.876  1.00 10.26 ? 294 LEU D CB  1 
ATOM   9770  C CG  . LEU D 1 294 ? -16.126 -5.876  13.359  1.00 10.33 ? 294 LEU D CG  1 
ATOM   9771  C CD1 . LEU D 1 294 ? -15.392 -6.863  12.474  1.00 10.14 ? 294 LEU D CD1 1 
ATOM   9772  C CD2 . LEU D 1 294 ? -16.792 -6.626  14.528  1.00 10.33 ? 294 LEU D CD2 1 
ATOM   9773  N N   . GLY D 1 295 ? -14.016 -2.577  16.111  1.00 10.74 ? 295 GLY D N   1 
ATOM   9774  C CA  . GLY D 1 295 ? -12.964 -1.599  16.403  1.00 11.07 ? 295 GLY D CA  1 
ATOM   9775  C C   . GLY D 1 295 ? -11.926 -2.214  17.327  1.00 11.45 ? 295 GLY D C   1 
ATOM   9776  O O   . GLY D 1 295 ? -11.992 -3.401  17.647  1.00 11.44 ? 295 GLY D O   1 
ATOM   9777  N N   . GLU D 1 296 ? -10.975 -1.440  17.741  1.00 12.04 ? 296 GLU D N   1 
ATOM   9778  C CA  . GLU D 1 296 ? -9.890  -1.718  18.651  1.00 12.74 ? 296 GLU D CA  1 
ATOM   9779  C C   . GLU D 1 296 ? -10.298 -2.746  19.703  1.00 13.06 ? 296 GLU D C   1 
ATOM   9780  O O   . GLU D 1 296 ? -9.712  -3.847  19.808  1.00 13.23 ? 296 GLU D O   1 
ATOM   9781  C CB  . GLU D 1 296 ? -9.479  -0.454  19.431  1.00 13.08 ? 296 GLU D CB  1 
ATOM   9782  C CG  . GLU D 1 296 ? -8.022  -0.159  19.683  1.00 13.62 ? 296 GLU D CG  1 
ATOM   9783  C CD  . GLU D 1 296 ? -7.575  0.678   20.828  1.00 13.84 ? 296 GLU D CD  1 
ATOM   9784  O OE1 . GLU D 1 296 ? -8.244  0.937   21.827  1.00 14.15 ? 296 GLU D OE1 1 
ATOM   9785  O OE2 . GLU D 1 296 ? -6.382  1.063   20.747  1.00 13.71 ? 296 GLU D OE2 1 
ATOM   9786  N N   . SER D 1 297 ? -11.382 -2.423  20.390  1.00 13.19 ? 297 SER D N   1 
ATOM   9787  C CA  . SER D 1 297 ? -11.943 -3.158  21.496  1.00 13.27 ? 297 SER D CA  1 
ATOM   9788  C C   . SER D 1 297 ? -12.926 -4.273  21.225  1.00 13.43 ? 297 SER D C   1 
ATOM   9789  O O   . SER D 1 297 ? -13.611 -4.702  22.221  1.00 13.60 ? 297 SER D O   1 
ATOM   9790  C CB  . SER D 1 297 ? -12.649 -2.146  22.451  1.00 13.16 ? 297 SER D CB  1 
ATOM   9791  O OG  . SER D 1 297 ? -13.929 -1.889  21.853  1.00 13.21 ? 297 SER D OG  1 
ATOM   9792  N N   . GLY D 1 298 ? -13.056 -4.764  20.018  1.00 13.42 ? 298 GLY D N   1 
ATOM   9793  C CA  . GLY D 1 298 ? -13.917 -5.946  19.758  1.00 13.33 ? 298 GLY D CA  1 
ATOM   9794  C C   . GLY D 1 298 ? -15.119 -5.599  18.904  1.00 13.41 ? 298 GLY D C   1 
ATOM   9795  O O   . GLY D 1 298 ? -15.024 -4.932  17.855  1.00 13.35 ? 298 GLY D O   1 
ATOM   9796  N N   . ILE D 1 299 ? -16.216 -6.289  19.239  1.00 13.43 ? 299 ILE D N   1 
ATOM   9797  C CA  . ILE D 1 299 ? -17.516 -5.921  18.634  1.00 13.36 ? 299 ILE D CA  1 
ATOM   9798  C C   . ILE D 1 299 ? -17.939 -4.794  19.605  1.00 13.49 ? 299 ILE D C   1 
ATOM   9799  O O   . ILE D 1 299 ? -17.695 -4.955  20.807  1.00 13.56 ? 299 ILE D O   1 
ATOM   9800  C CB  . ILE D 1 299 ? -18.564 -7.014  18.474  1.00 13.17 ? 299 ILE D CB  1 
ATOM   9801  C CG1 . ILE D 1 299 ? -17.984 -8.221  17.699  1.00 13.08 ? 299 ILE D CG1 1 
ATOM   9802  C CG2 . ILE D 1 299 ? -19.855 -6.508  17.753  1.00 13.27 ? 299 ILE D CG2 1 
ATOM   9803  C CD1 . ILE D 1 299 ? -17.207 -9.163  18.630  1.00 13.14 ? 299 ILE D CD1 1 
ATOM   9804  N N   . THR D 1 300 ? -18.338 -3.716  19.021  1.00 13.76 ? 300 THR D N   1 
ATOM   9805  C CA  . THR D 1 300 ? -18.689 -2.510  19.819  1.00 13.91 ? 300 THR D CA  1 
ATOM   9806  C C   . THR D 1 300 ? -20.189 -2.513  20.002  1.00 14.01 ? 300 THR D C   1 
ATOM   9807  O O   . THR D 1 300 ? -20.718 -2.442  21.097  1.00 13.98 ? 300 THR D O   1 
ATOM   9808  C CB  . THR D 1 300 ? -18.109 -1.239  19.107  1.00 13.89 ? 300 THR D CB  1 
ATOM   9809  O OG1 . THR D 1 300 ? -16.969 -0.813  19.935  1.00 13.80 ? 300 THR D OG1 1 
ATOM   9810  C CG2 . THR D 1 300 ? -19.112 -0.117  18.850  1.00 14.05 ? 300 THR D CG2 1 
ATOM   9811  N N   . ASP D 1 301 ? -20.785 -2.730  18.839  1.00 14.34 ? 301 ASP D N   1 
ATOM   9812  C CA  . ASP D 1 301 ? -22.252 -2.684  18.693  1.00 14.55 ? 301 ASP D CA  1 
ATOM   9813  C C   . ASP D 1 301 ? -22.666 -3.603  17.558  1.00 14.40 ? 301 ASP D C   1 
ATOM   9814  O O   . ASP D 1 301 ? -21.846 -4.022  16.733  1.00 14.31 ? 301 ASP D O   1 
ATOM   9815  C CB  . ASP D 1 301 ? -22.650 -1.196  18.556  1.00 14.83 ? 301 ASP D CB  1 
ATOM   9816  C CG  . ASP D 1 301 ? -22.298 -0.577  17.234  1.00 14.93 ? 301 ASP D CG  1 
ATOM   9817  O OD1 . ASP D 1 301 ? -21.139 -0.482  16.823  1.00 15.00 ? 301 ASP D OD1 1 
ATOM   9818  O OD2 . ASP D 1 301 ? -23.259 -0.193  16.524  1.00 15.16 ? 301 ASP D OD2 1 
ATOM   9819  N N   . PHE D 1 302 ? -23.939 -3.910  17.567  1.00 14.54 ? 302 PHE D N   1 
ATOM   9820  C CA  . PHE D 1 302 ? -24.589 -4.818  16.610  1.00 14.70 ? 302 PHE D CA  1 
ATOM   9821  C C   . PHE D 1 302 ? -25.474 -3.985  15.661  1.00 14.79 ? 302 PHE D C   1 
ATOM   9822  O O   . PHE D 1 302 ? -25.815 -2.835  16.004  1.00 14.79 ? 302 PHE D O   1 
ATOM   9823  C CB  . PHE D 1 302 ? -25.419 -5.875  17.318  1.00 14.68 ? 302 PHE D CB  1 
ATOM   9824  C CG  . PHE D 1 302 ? -25.018 -6.312  18.684  1.00 14.75 ? 302 PHE D CG  1 
ATOM   9825  C CD1 . PHE D 1 302 ? -25.795 -5.942  19.787  1.00 14.69 ? 302 PHE D CD1 1 
ATOM   9826  C CD2 . PHE D 1 302 ? -23.885 -7.112  18.889  1.00 14.75 ? 302 PHE D CD2 1 
ATOM   9827  C CE1 . PHE D 1 302 ? -25.467 -6.386  21.059  1.00 14.65 ? 302 PHE D CE1 1 
ATOM   9828  C CE2 . PHE D 1 302 ? -23.519 -7.538  20.169  1.00 14.60 ? 302 PHE D CE2 1 
ATOM   9829  C CZ  . PHE D 1 302 ? -24.331 -7.173  21.248  1.00 14.62 ? 302 PHE D CZ  1 
ATOM   9830  N N   . VAL D 1 303 ? -25.768 -4.584  14.523  1.00 14.70 ? 303 VAL D N   1 
ATOM   9831  C CA  . VAL D 1 303 ? -26.686 -3.897  13.570  1.00 14.86 ? 303 VAL D CA  1 
ATOM   9832  C C   . VAL D 1 303 ? -27.849 -4.889  13.384  1.00 15.18 ? 303 VAL D C   1 
ATOM   9833  O O   . VAL D 1 303 ? -27.700 -6.065  13.023  1.00 15.11 ? 303 VAL D O   1 
ATOM   9834  C CB  . VAL D 1 303 ? -26.017 -3.335  12.341  1.00 14.74 ? 303 VAL D CB  1 
ATOM   9835  C CG1 . VAL D 1 303 ? -26.097 -4.135  11.056  1.00 14.66 ? 303 VAL D CG1 1 
ATOM   9836  C CG2 . VAL D 1 303 ? -26.571 -1.936  12.019  1.00 14.73 ? 303 VAL D CG2 1 
ATOM   9837  N N   . LYS D 1 304 ? -28.988 -4.364  13.800  1.00 15.43 ? 304 LYS D N   1 
ATOM   9838  C CA  . LYS D 1 304 ? -30.274 -5.073  13.780  1.00 15.59 ? 304 LYS D CA  1 
ATOM   9839  C C   . LYS D 1 304 ? -31.047 -4.685  12.527  1.00 15.89 ? 304 LYS D C   1 
ATOM   9840  O O   . LYS D 1 304 ? -31.744 -3.669  12.395  1.00 15.99 ? 304 LYS D O   1 
ATOM   9841  C CB  . LYS D 1 304 ? -31.034 -4.805  15.064  1.00 15.56 ? 304 LYS D CB  1 
ATOM   9842  C CG  . LYS D 1 304 ? -31.029 -3.338  15.473  1.00 15.77 ? 304 LYS D CG  1 
ATOM   9843  C CD  . LYS D 1 304 ? -31.117 -3.067  16.943  1.00 15.96 ? 304 LYS D CD  1 
ATOM   9844  C CE  . LYS D 1 304 ? -32.513 -3.200  17.503  1.00 16.29 ? 304 LYS D CE  1 
ATOM   9845  N NZ  . LYS D 1 304 ? -32.799 -4.631  17.867  1.00 16.66 ? 304 LYS D NZ  1 
ATOM   9846  N N   . VAL D 1 305 ? -30.894 -5.535  11.546  1.00 16.25 ? 305 VAL D N   1 
ATOM   9847  C CA  . VAL D 1 305 ? -31.478 -5.524  10.232  1.00 16.70 ? 305 VAL D CA  1 
ATOM   9848  C C   . VAL D 1 305 ? -32.992 -5.796  10.253  1.00 17.13 ? 305 VAL D C   1 
ATOM   9849  O O   . VAL D 1 305 ? -33.546 -6.313  11.220  1.00 17.06 ? 305 VAL D O   1 
ATOM   9850  C CB  . VAL D 1 305 ? -30.738 -6.603  9.384   1.00 16.55 ? 305 VAL D CB  1 
ATOM   9851  C CG1 . VAL D 1 305 ? -29.216 -6.573  9.608   1.00 16.57 ? 305 VAL D CG1 1 
ATOM   9852  C CG2 . VAL D 1 305 ? -31.272 -8.005  9.624   1.00 16.50 ? 305 VAL D CG2 1 
ATOM   9853  N N   . ASN D 1 306 ? -33.551 -5.645  9.067   1.00 17.77 ? 306 ASN D N   1 
ATOM   9854  C CA  . ASN D 1 306 ? -34.960 -5.865  8.752   1.00 18.43 ? 306 ASN D CA  1 
ATOM   9855  C C   . ASN D 1 306 ? -35.165 -7.144  7.929   1.00 18.76 ? 306 ASN D C   1 
ATOM   9856  O O   . ASN D 1 306 ? -35.321 -7.081  6.694   1.00 18.80 ? 306 ASN D O   1 
ATOM   9857  C CB  . ASN D 1 306 ? -35.545 -4.648  8.022   1.00 18.63 ? 306 ASN D CB  1 
ATOM   9858  C CG  . ASN D 1 306 ? -34.830 -4.291  6.731   1.00 18.87 ? 306 ASN D CG  1 
ATOM   9859  O OD1 . ASN D 1 306 ? -35.386 -3.503  5.933   1.00 19.08 ? 306 ASN D OD1 1 
ATOM   9860  N ND2 . ASN D 1 306 ? -33.630 -4.826  6.478   1.00 18.69 ? 306 ASN D ND2 1 
ATOM   9861  N N   . MET D 1 307 ? -35.157 -8.280  8.611   1.00 19.22 ? 307 MET D N   1 
ATOM   9862  C CA  . MET D 1 307 ? -35.390 -9.545  7.845   1.00 19.75 ? 307 MET D CA  1 
ATOM   9863  C C   . MET D 1 307 ? -36.927 -9.525  7.662   1.00 20.06 ? 307 MET D C   1 
ATOM   9864  O O   . MET D 1 307 ? -37.618 -8.885  8.489   1.00 20.21 ? 307 MET D O   1 
ATOM   9865  C CB  . MET D 1 307 ? -34.777 -10.747 8.439   1.00 20.03 ? 307 MET D CB  1 
ATOM   9866  C CG  . MET D 1 307 ? -33.502 -10.661 9.223   1.00 20.18 ? 307 MET D CG  1 
ATOM   9867  S SD  . MET D 1 307 ? -34.087 -10.127 10.891  1.00 20.81 ? 307 MET D SD  1 
ATOM   9868  C CE  . MET D 1 307 ? -32.752 -10.759 11.926  1.00 20.83 ? 307 MET D CE  1 
ATOM   9869  N N   . THR D 1 308 ? -37.379 -9.933  6.486   1.00 20.16 ? 308 THR D N   1 
ATOM   9870  C CA  . THR D 1 308 ? -38.806 -10.055 6.184   1.00 19.94 ? 308 THR D CA  1 
ATOM   9871  C C   . THR D 1 308 ? -39.306 -11.204 7.074   1.00 19.79 ? 308 THR D C   1 
ATOM   9872  O O   . THR D 1 308 ? -38.468 -12.025 7.474   1.00 19.80 ? 308 THR D O   1 
ATOM   9873  C CB  . THR D 1 308 ? -39.197 -10.325 4.699   1.00 20.01 ? 308 THR D CB  1 
ATOM   9874  O OG1 . THR D 1 308 ? -40.616 -10.800 4.744   1.00 20.19 ? 308 THR D OG1 1 
ATOM   9875  C CG2 . THR D 1 308 ? -38.372 -11.330 3.916   1.00 19.83 ? 308 THR D CG2 1 
ATOM   9876  N N   . ALA D 1 309 ? -40.582 -11.230 7.311   1.00 19.70 ? 309 ALA D N   1 
ATOM   9877  C CA  . ALA D 1 309 ? -41.216 -12.252 8.157   1.00 19.57 ? 309 ALA D CA  1 
ATOM   9878  C C   . ALA D 1 309 ? -40.326 -13.488 8.228   1.00 19.37 ? 309 ALA D C   1 
ATOM   9879  O O   . ALA D 1 309 ? -39.677 -13.676 9.279   1.00 19.36 ? 309 ALA D O   1 
ATOM   9880  C CB  . ALA D 1 309 ? -42.629 -12.541 7.698   1.00 19.59 ? 309 ALA D CB  1 
ATOM   9881  N N   . GLU D 1 310 ? -40.077 -14.099 7.089   1.00 19.25 ? 310 GLU D N   1 
ATOM   9882  C CA  . GLU D 1 310 ? -39.265 -15.323 7.043   1.00 19.31 ? 310 GLU D CA  1 
ATOM   9883  C C   . GLU D 1 310 ? -37.774 -15.082 7.011   1.00 18.84 ? 310 GLU D C   1 
ATOM   9884  O O   . GLU D 1 310 ? -37.031 -16.028 7.395   1.00 18.76 ? 310 GLU D O   1 
ATOM   9885  C CB  . GLU D 1 310 ? -39.626 -16.253 5.886   1.00 19.88 ? 310 GLU D CB  1 
ATOM   9886  C CG  . GLU D 1 310 ? -38.923 -16.013 4.549   1.00 20.46 ? 310 GLU D CG  1 
ATOM   9887  C CD  . GLU D 1 310 ? -39.285 -14.741 3.865   1.00 20.86 ? 310 GLU D CD  1 
ATOM   9888  O OE1 . GLU D 1 310 ? -39.203 -14.620 2.656   1.00 21.30 ? 310 GLU D OE1 1 
ATOM   9889  O OE2 . GLU D 1 310 ? -39.723 -13.832 4.600   1.00 21.09 ? 310 GLU D OE2 1 
ATOM   9890  N N   . GLU D 1 311 ? -37.278 -14.015 6.410   1.00 18.29 ? 311 GLU D N   1 
ATOM   9891  C CA  . GLU D 1 311 ? -35.790 -13.775 6.544   1.00 17.85 ? 311 GLU D CA  1 
ATOM   9892  C C   . GLU D 1 311 ? -35.509 -14.006 8.024   1.00 18.06 ? 311 GLU D C   1 
ATOM   9893  O O   . GLU D 1 311 ? -34.747 -14.925 8.393   1.00 18.06 ? 311 GLU D O   1 
ATOM   9894  C CB  . GLU D 1 311 ? -35.378 -12.481 5.938   1.00 17.26 ? 311 GLU D CB  1 
ATOM   9895  C CG  . GLU D 1 311 ? -35.361 -12.353 4.438   1.00 16.73 ? 311 GLU D CG  1 
ATOM   9896  C CD  . GLU D 1 311 ? -35.136 -11.101 3.695   1.00 16.35 ? 311 GLU D CD  1 
ATOM   9897  O OE1 . GLU D 1 311 ? -34.739 -10.034 4.111   1.00 16.17 ? 311 GLU D OE1 1 
ATOM   9898  O OE2 . GLU D 1 311 ? -35.395 -11.224 2.467   1.00 16.08 ? 311 GLU D OE2 1 
ATOM   9899  N N   . GLU D 1 312 ? -36.419 -13.506 8.850   1.00 18.34 ? 312 GLU D N   1 
ATOM   9900  C CA  . GLU D 1 312 ? -36.434 -13.677 10.299  1.00 18.62 ? 312 GLU D CA  1 
ATOM   9901  C C   . GLU D 1 312 ? -36.785 -15.128 10.646  1.00 18.78 ? 312 GLU D C   1 
ATOM   9902  O O   . GLU D 1 312 ? -36.350 -15.701 11.648  1.00 18.76 ? 312 GLU D O   1 
ATOM   9903  C CB  . GLU D 1 312 ? -37.442 -12.794 11.002  1.00 18.69 ? 312 GLU D CB  1 
ATOM   9904  C CG  . GLU D 1 312 ? -37.247 -12.494 12.490  1.00 18.84 ? 312 GLU D CG  1 
ATOM   9905  C CD  . GLU D 1 312 ? -38.349 -11.641 13.085  1.00 18.96 ? 312 GLU D CD  1 
ATOM   9906  O OE1 . GLU D 1 312 ? -38.186 -10.525 13.571  1.00 18.93 ? 312 GLU D OE1 1 
ATOM   9907  O OE2 . GLU D 1 312 ? -39.456 -12.234 13.040  1.00 18.85 ? 312 GLU D OE2 1 
ATOM   9908  N N   . GLY D 1 313 ? -37.593 -15.684 9.781   1.00 19.07 ? 313 GLY D N   1 
ATOM   9909  C CA  . GLY D 1 313 ? -38.050 -17.090 9.841   1.00 19.56 ? 313 GLY D CA  1 
ATOM   9910  C C   . GLY D 1 313 ? -36.794 -17.966 9.820   1.00 19.98 ? 313 GLY D C   1 
ATOM   9911  O O   . GLY D 1 313 ? -36.379 -18.506 10.851  1.00 20.08 ? 313 GLY D O   1 
ATOM   9912  N N   . LEU D 1 314 ? -36.200 -18.005 8.642   1.00 20.35 ? 314 LEU D N   1 
ATOM   9913  C CA  . LEU D 1 314 ? -34.963 -18.741 8.368   1.00 20.48 ? 314 LEU D CA  1 
ATOM   9914  C C   . LEU D 1 314 ? -33.955 -18.479 9.477   1.00 20.65 ? 314 LEU D C   1 
ATOM   9915  O O   . LEU D 1 314 ? -33.561 -19.430 10.186  1.00 20.62 ? 314 LEU D O   1 
ATOM   9916  C CB  . LEU D 1 314 ? -34.480 -18.386 6.959   1.00 20.35 ? 314 LEU D CB  1 
ATOM   9917  C CG  . LEU D 1 314 ? -35.268 -19.077 5.845   1.00 20.31 ? 314 LEU D CG  1 
ATOM   9918  C CD1 . LEU D 1 314 ? -36.565 -18.334 5.579   1.00 20.43 ? 314 LEU D CD1 1 
ATOM   9919  C CD2 . LEU D 1 314 ? -34.430 -19.133 4.580   1.00 20.31 ? 314 LEU D CD2 1 
ATOM   9920  N N   . LEU D 1 315 ? -33.586 -17.215 9.628   1.00 20.81 ? 315 LEU D N   1 
ATOM   9921  C CA  . LEU D 1 315 ? -32.638 -16.913 10.729  1.00 21.18 ? 315 LEU D CA  1 
ATOM   9922  C C   . LEU D 1 315 ? -33.123 -17.576 12.003  1.00 21.56 ? 315 LEU D C   1 
ATOM   9923  O O   . LEU D 1 315 ? -32.348 -18.415 12.536  1.00 21.69 ? 315 LEU D O   1 
ATOM   9924  C CB  . LEU D 1 315 ? -32.320 -15.424 10.762  1.00 20.93 ? 315 LEU D CB  1 
ATOM   9925  C CG  . LEU D 1 315 ? -30.809 -15.215 10.507  1.00 20.71 ? 315 LEU D CG  1 
ATOM   9926  C CD1 . LEU D 1 315 ? -30.531 -13.885 9.893   1.00 20.77 ? 315 LEU D CD1 1 
ATOM   9927  C CD2 . LEU D 1 315 ? -30.156 -15.382 11.879  1.00 20.73 ? 315 LEU D CD2 1 
ATOM   9928  N N   . LYS D 1 316 ? -34.369 -17.340 12.383  1.00 21.87 ? 316 LYS D N   1 
ATOM   9929  C CA  . LYS D 1 316 ? -34.908 -17.966 13.602  1.00 22.22 ? 316 LYS D CA  1 
ATOM   9930  C C   . LYS D 1 316 ? -34.586 -19.468 13.608  1.00 22.49 ? 316 LYS D C   1 
ATOM   9931  O O   . LYS D 1 316 ? -34.292 -20.038 14.662  1.00 22.46 ? 316 LYS D O   1 
ATOM   9932  C CB  . LYS D 1 316 ? -36.399 -17.781 13.750  1.00 22.38 ? 316 LYS D CB  1 
ATOM   9933  C CG  . LYS D 1 316 ? -36.880 -16.512 14.397  1.00 22.64 ? 316 LYS D CG  1 
ATOM   9934  C CD  . LYS D 1 316 ? -38.382 -16.520 14.728  1.00 22.72 ? 316 LYS D CD  1 
ATOM   9935  C CE  . LYS D 1 316 ? -38.675 -15.424 15.760  1.00 22.78 ? 316 LYS D CE  1 
ATOM   9936  N NZ  . LYS D 1 316 ? -40.067 -14.928 15.627  1.00 22.79 ? 316 LYS D NZ  1 
ATOM   9937  N N   . LYS D 1 317 ? -34.643 -20.071 12.444  1.00 22.78 ? 317 LYS D N   1 
ATOM   9938  C CA  . LYS D 1 317 ? -34.402 -21.468 12.172  1.00 23.15 ? 317 LYS D CA  1 
ATOM   9939  C C   . LYS D 1 317 ? -32.956 -21.896 12.367  1.00 23.47 ? 317 LYS D C   1 
ATOM   9940  O O   . LYS D 1 317 ? -32.720 -22.944 13.028  1.00 23.65 ? 317 LYS D O   1 
ATOM   9941  C CB  . LYS D 1 317 ? -34.814 -21.844 10.746  1.00 23.20 ? 317 LYS D CB  1 
ATOM   9942  C CG  . LYS D 1 317 ? -34.394 -23.244 10.318  1.00 23.25 ? 317 LYS D CG  1 
ATOM   9943  C CD  . LYS D 1 317 ? -34.298 -23.333 8.799   1.00 23.43 ? 317 LYS D CD  1 
ATOM   9944  C CE  . LYS D 1 317 ? -34.077 -24.791 8.400   1.00 23.59 ? 317 LYS D CE  1 
ATOM   9945  N NZ  . LYS D 1 317 ? -35.300 -25.572 8.783   1.00 23.83 ? 317 LYS D NZ  1 
ATOM   9946  N N   . SER D 1 318 ? -32.031 -21.273 11.656  1.00 23.76 ? 318 SER D N   1 
ATOM   9947  C CA  . SER D 1 318 ? -30.600 -21.586 11.833  1.00 23.91 ? 318 SER D CA  1 
ATOM   9948  C C   . SER D 1 318 ? -30.366 -21.645 13.358  1.00 24.03 ? 318 SER D C   1 
ATOM   9949  O O   . SER D 1 318 ? -30.091 -22.694 13.907  1.00 24.08 ? 318 SER D O   1 
ATOM   9950  C CB  . SER D 1 318 ? -29.612 -20.595 11.283  1.00 23.88 ? 318 SER D CB  1 
ATOM   9951  O OG  . SER D 1 318 ? -29.344 -20.689 9.931   1.00 24.04 ? 318 SER D OG  1 
ATOM   9952  N N   . ALA D 1 319 ? -30.514 -20.476 13.918  1.00 24.36 ? 319 ALA D N   1 
ATOM   9953  C CA  . ALA D 1 319 ? -30.343 -20.218 15.329  1.00 25.05 ? 319 ALA D CA  1 
ATOM   9954  C C   . ALA D 1 319 ? -30.446 -21.538 16.104  1.00 25.56 ? 319 ALA D C   1 
ATOM   9955  O O   . ALA D 1 319 ? -29.506 -22.027 16.706  1.00 25.61 ? 319 ALA D O   1 
ATOM   9956  C CB  . ALA D 1 319 ? -31.455 -19.297 15.802  1.00 25.19 ? 319 ALA D CB  1 
ATOM   9957  N N   . ASP D 1 320 ? -31.616 -22.104 15.880  1.00 26.21 ? 320 ASP D N   1 
ATOM   9958  C CA  . ASP D 1 320 ? -32.044 -23.364 16.474  1.00 26.89 ? 320 ASP D CA  1 
ATOM   9959  C C   . ASP D 1 320 ? -31.247 -24.545 16.003  1.00 27.22 ? 320 ASP D C   1 
ATOM   9960  O O   . ASP D 1 320 ? -30.771 -25.286 16.927  1.00 27.24 ? 320 ASP D O   1 
ATOM   9961  C CB  . ASP D 1 320 ? -33.582 -23.446 16.344  1.00 27.19 ? 320 ASP D CB  1 
ATOM   9962  C CG  . ASP D 1 320 ? -34.196 -22.644 17.500  1.00 27.54 ? 320 ASP D CG  1 
ATOM   9963  O OD1 . ASP D 1 320 ? -33.515 -22.433 18.531  1.00 27.69 ? 320 ASP D OD1 1 
ATOM   9964  O OD2 . ASP D 1 320 ? -35.369 -22.235 17.356  1.00 27.68 ? 320 ASP D OD2 1 
ATOM   9965  N N   . THR D 1 321 ? -31.166 -24.847 14.719  1.00 27.51 ? 321 THR D N   1 
ATOM   9966  C CA  . THR D 1 321 ? -30.280 -25.935 14.264  1.00 27.78 ? 321 THR D CA  1 
ATOM   9967  C C   . THR D 1 321 ? -29.013 -25.850 15.156  1.00 28.23 ? 321 THR D C   1 
ATOM   9968  O O   . THR D 1 321 ? -28.808 -26.611 16.100  1.00 28.38 ? 321 THR D O   1 
ATOM   9969  C CB  . THR D 1 321 ? -29.806 -25.866 12.775  1.00 27.53 ? 321 THR D CB  1 
ATOM   9970  O OG1 . THR D 1 321 ? -30.957 -25.708 11.924  1.00 27.37 ? 321 THR D OG1 1 
ATOM   9971  C CG2 . THR D 1 321 ? -28.950 -27.095 12.390  1.00 27.49 ? 321 THR D CG2 1 
ATOM   9972  N N   . LEU D 1 322 ? -28.329 -24.751 14.881  1.00 28.67 ? 322 LEU D N   1 
ATOM   9973  C CA  . LEU D 1 322 ? -27.116 -24.377 15.584  1.00 29.30 ? 322 LEU D CA  1 
ATOM   9974  C C   . LEU D 1 322 ? -27.260 -24.622 17.084  1.00 29.71 ? 322 LEU D C   1 
ATOM   9975  O O   . LEU D 1 322 ? -26.275 -24.976 17.729  1.00 29.72 ? 322 LEU D O   1 
ATOM   9976  C CB  . LEU D 1 322 ? -26.821 -22.906 15.267  1.00 29.39 ? 322 LEU D CB  1 
ATOM   9977  C CG  . LEU D 1 322 ? -25.732 -22.534 14.295  1.00 29.41 ? 322 LEU D CG  1 
ATOM   9978  C CD1 . LEU D 1 322 ? -25.728 -21.020 14.056  1.00 29.38 ? 322 LEU D CD1 1 
ATOM   9979  C CD2 . LEU D 1 322 ? -24.366 -22.953 14.870  1.00 29.43 ? 322 LEU D CD2 1 
ATOM   9980  N N   . TRP D 1 323 ? -28.472 -24.443 17.587  1.00 30.33 ? 323 TRP D N   1 
ATOM   9981  C CA  . TRP D 1 323 ? -28.769 -24.523 18.993  1.00 30.95 ? 323 TRP D CA  1 
ATOM   9982  C C   . TRP D 1 323 ? -28.692 -25.891 19.639  1.00 31.53 ? 323 TRP D C   1 
ATOM   9983  O O   . TRP D 1 323 ? -27.901 -25.939 20.634  1.00 31.64 ? 323 TRP D O   1 
ATOM   9984  C CB  . TRP D 1 323 ? -30.128 -23.884 19.393  1.00 30.83 ? 323 TRP D CB  1 
ATOM   9985  C CG  . TRP D 1 323 ? -30.423 -24.077 20.854  1.00 30.66 ? 323 TRP D CG  1 
ATOM   9986  C CD1 . TRP D 1 323 ? -31.484 -24.724 21.408  1.00 30.66 ? 323 TRP D CD1 1 
ATOM   9987  C CD2 . TRP D 1 323 ? -29.494 -23.827 21.922  1.00 30.53 ? 323 TRP D CD2 1 
ATOM   9988  N NE1 . TRP D 1 323 ? -31.338 -24.765 22.775  1.00 30.66 ? 323 TRP D NE1 1 
ATOM   9989  C CE2 . TRP D 1 323 ? -30.115 -24.250 23.111  1.00 30.52 ? 323 TRP D CE2 1 
ATOM   9990  C CE3 . TRP D 1 323 ? -28.233 -23.248 21.973  1.00 30.47 ? 323 TRP D CE3 1 
ATOM   9991  C CZ2 . TRP D 1 323 ? -29.515 -24.104 24.349  1.00 30.39 ? 323 TRP D CZ2 1 
ATOM   9992  C CZ3 . TRP D 1 323 ? -27.633 -23.101 23.207  1.00 30.42 ? 323 TRP D CZ3 1 
ATOM   9993  C CH2 . TRP D 1 323 ? -28.262 -23.522 24.371  1.00 30.38 ? 323 TRP D CH2 1 
ATOM   9994  N N   . ASN D 1 324 ? -29.551 -26.856 19.290  1.00 32.19 ? 324 ASN D N   1 
ATOM   9995  C CA  . ASN D 1 324 ? -29.446 -28.090 20.107  1.00 32.86 ? 324 ASN D CA  1 
ATOM   9996  C C   . ASN D 1 324 ? -27.935 -28.467 20.028  1.00 33.05 ? 324 ASN D C   1 
ATOM   9997  O O   . ASN D 1 324 ? -27.396 -28.489 21.124  1.00 33.16 ? 324 ASN D O   1 
ATOM   9998  C CB  . ASN D 1 324 ? -30.281 -29.316 19.942  1.00 33.28 ? 324 ASN D CB  1 
ATOM   9999  C CG  . ASN D 1 324 ? -30.561 -30.000 21.302  1.00 33.50 ? 324 ASN D CG  1 
ATOM   10000 O OD1 . ASN D 1 324 ? -31.193 -31.080 21.318  1.00 33.71 ? 324 ASN D OD1 1 
ATOM   10001 N ND2 . ASN D 1 324 ? -30.207 -29.336 22.404  1.00 33.36 ? 324 ASN D ND2 1 
ATOM   10002 N N   . MET D 1 325 ? -27.453 -28.476 18.806  1.00 33.11 ? 325 MET D N   1 
ATOM   10003 C CA  . MET D 1 325 ? -26.038 -28.831 18.570  1.00 33.22 ? 325 MET D CA  1 
ATOM   10004 C C   . MET D 1 325 ? -25.158 -28.501 19.782  1.00 33.50 ? 325 MET D C   1 
ATOM   10005 O O   . MET D 1 325 ? -24.388 -29.372 20.238  1.00 33.60 ? 325 MET D O   1 
ATOM   10006 C CB  . MET D 1 325 ? -25.534 -28.214 17.288  1.00 32.96 ? 325 MET D CB  1 
ATOM   10007 C CG  . MET D 1 325 ? -24.369 -29.044 16.772  1.00 32.82 ? 325 MET D CG  1 
ATOM   10008 S SD  . MET D 1 325 ? -25.042 -30.078 15.415  1.00 32.74 ? 325 MET D SD  1 
ATOM   10009 C CE  . MET D 1 325 ? -25.196 -28.792 14.138  1.00 32.57 ? 325 MET D CE  1 
ATOM   10010 N N   . GLN D 1 326 ? -25.382 -27.358 20.370  1.00 33.65 ? 326 GLN D N   1 
ATOM   10011 C CA  . GLN D 1 326 ? -24.754 -26.840 21.547  1.00 34.11 ? 326 GLN D CA  1 
ATOM   10012 C C   . GLN D 1 326 ? -25.144 -27.449 22.882  1.00 34.77 ? 326 GLN D C   1 
ATOM   10013 O O   . GLN D 1 326 ? -24.754 -26.833 23.934  1.00 34.93 ? 326 GLN D O   1 
ATOM   10014 C CB  . GLN D 1 326 ? -24.965 -25.300 21.599  1.00 33.81 ? 326 GLN D CB  1 
ATOM   10015 C CG  . GLN D 1 326 ? -24.871 -24.637 20.258  1.00 33.36 ? 326 GLN D CG  1 
ATOM   10016 C CD  . GLN D 1 326 ? -24.688 -23.144 20.300  1.00 33.07 ? 326 GLN D CD  1 
ATOM   10017 O OE1 . GLN D 1 326 ? -24.467 -22.546 21.341  1.00 32.89 ? 326 GLN D OE1 1 
ATOM   10018 N NE2 . GLN D 1 326 ? -24.729 -22.569 19.103  1.00 32.91 ? 326 GLN D NE2 1 
ATOM   10019 N N   . LYS D 1 327 ? -25.891 -28.510 22.965  1.00 35.50 ? 327 LYS D N   1 
ATOM   10020 C CA  . LYS D 1 327 ? -26.141 -29.200 24.269  1.00 36.48 ? 327 LYS D CA  1 
ATOM   10021 C C   . LYS D 1 327 ? -24.804 -29.953 24.477  1.00 37.44 ? 327 LYS D C   1 
ATOM   10022 O O   . LYS D 1 327 ? -24.668 -31.166 24.307  1.00 37.57 ? 327 LYS D O   1 
ATOM   10023 C CB  . LYS D 1 327 ? -27.321 -30.083 24.298  1.00 36.28 ? 327 LYS D CB  1 
ATOM   10024 C CG  . LYS D 1 327 ? -27.345 -31.455 23.665  1.00 36.09 ? 327 LYS D CG  1 
ATOM   10025 C CD  . LYS D 1 327 ? -26.895 -31.439 22.219  1.00 36.01 ? 327 LYS D CD  1 
ATOM   10026 C CE  . LYS D 1 327 ? -26.586 -32.818 21.676  1.00 35.89 ? 327 LYS D CE  1 
ATOM   10027 N NZ  . LYS D 1 327 ? -25.939 -32.725 20.340  1.00 35.66 ? 327 LYS D NZ  1 
ATOM   10028 N N   . ASN D 1 328 ? -23.813 -29.134 24.859  1.00 38.42 ? 328 ASN D N   1 
ATOM   10029 C CA  . ASN D 1 328 ? -22.428 -29.574 24.861  1.00 39.26 ? 328 ASN D CA  1 
ATOM   10030 C C   . ASN D 1 328 ? -21.695 -29.783 26.159  1.00 40.13 ? 328 ASN D C   1 
ATOM   10031 O O   . ASN D 1 328 ? -22.095 -29.536 27.280  1.00 40.25 ? 328 ASN D O   1 
ATOM   10032 C CB  . ASN D 1 328 ? -21.651 -28.583 23.920  1.00 39.06 ? 328 ASN D CB  1 
ATOM   10033 C CG  . ASN D 1 328 ? -21.429 -29.216 22.567  1.00 38.84 ? 328 ASN D CG  1 
ATOM   10034 O OD1 . ASN D 1 328 ? -20.495 -28.839 21.856  1.00 38.77 ? 328 ASN D OD1 1 
ATOM   10035 N ND2 . ASN D 1 328 ? -22.239 -30.199 22.210  1.00 38.91 ? 328 ASN D ND2 1 
ATOM   10036 N N   . LEU D 1 329 ? -20.507 -30.300 25.939  1.00 41.17 ? 329 LEU D N   1 
ATOM   10037 C CA  . LEU D 1 329 ? -19.382 -30.705 26.722  1.00 42.09 ? 329 LEU D CA  1 
ATOM   10038 C C   . LEU D 1 329 ? -18.746 -31.895 25.966  1.00 42.82 ? 329 LEU D C   1 
ATOM   10039 O O   . LEU D 1 329 ? -19.187 -32.134 24.816  1.00 42.93 ? 329 LEU D O   1 
ATOM   10040 C CB  . LEU D 1 329 ? -19.749 -30.978 28.169  1.00 42.14 ? 329 LEU D CB  1 
ATOM   10041 C CG  . LEU D 1 329 ? -18.653 -30.670 29.192  1.00 42.28 ? 329 LEU D CG  1 
ATOM   10042 C CD1 . LEU D 1 329 ? -18.446 -29.158 29.341  1.00 42.27 ? 329 LEU D CD1 1 
ATOM   10043 C CD2 . LEU D 1 329 ? -19.029 -31.309 30.519  1.00 42.29 ? 329 LEU D CD2 1 
ATOM   10044 N N   . GLU D 1 330 ? -17.730 -32.527 26.523  1.00 43.65 ? 330 GLU D N   1 
ATOM   10045 C CA  . GLU D 1 330 ? -17.110 -33.685 25.874  1.00 44.37 ? 330 GLU D CA  1 
ATOM   10046 C C   . GLU D 1 330 ? -17.945 -34.951 26.096  1.00 44.67 ? 330 GLU D C   1 
ATOM   10047 O O   . GLU D 1 330 ? -17.708 -35.994 25.452  1.00 44.72 ? 330 GLU D O   1 
ATOM   10048 C CB  . GLU D 1 330 ? -15.691 -34.021 26.339  1.00 44.68 ? 330 GLU D CB  1 
ATOM   10049 C CG  . GLU D 1 330 ? -14.878 -34.889 25.367  1.00 45.13 ? 330 GLU D CG  1 
ATOM   10050 C CD  . GLU D 1 330 ? -13.794 -35.766 25.893  1.00 45.40 ? 330 GLU D CD  1 
ATOM   10051 O OE1 . GLU D 1 330 ? -12.610 -35.449 25.970  1.00 45.50 ? 330 GLU D OE1 1 
ATOM   10052 O OE2 . GLU D 1 330 ? -14.188 -36.928 26.208  1.00 45.54 ? 330 GLU D OE2 1 
ATOM   10053 N N   . LEU D 1 331 ? -18.912 -34.846 26.990  1.00 44.93 ? 331 LEU D N   1 
ATOM   10054 C CA  . LEU D 1 331 ? -19.830 -35.917 27.371  1.00 45.00 ? 331 LEU D CA  1 
ATOM   10055 C C   . LEU D 1 331 ? -20.197 -36.784 26.166  1.00 45.01 ? 331 LEU D C   1 
ATOM   10056 O O   . LEU D 1 331 ? -20.372 -36.150 25.091  1.00 45.05 ? 331 LEU D O   1 
ATOM   10057 C CB  . LEU D 1 331 ? -21.050 -35.282 28.050  1.00 45.06 ? 331 LEU D CB  1 
ATOM   10058 C CG  . LEU D 1 331 ? -21.983 -36.166 28.851  1.00 45.23 ? 331 LEU D CG  1 
ATOM   10059 C CD1 . LEU D 1 331 ? -23.049 -35.320 29.563  1.00 45.24 ? 331 LEU D CD1 1 
ATOM   10060 C CD2 . LEU D 1 331 ? -22.695 -37.189 27.964  1.00 45.16 ? 331 LEU D CD2 1 
HETATM 10061 O O   . HOH E 2 .   ? -27.482 2.693   22.531  1.00 39.85 ? 332 HOH A O   1 
HETATM 10062 O O   . HOH E 2 .   ? -39.804 0.645   15.481  1.00 21.00 ? 334 HOH A O   1 
HETATM 10063 O O   . HOH E 2 .   ? 0.081   28.390  9.803   1.00 2.58  ? 337 HOH A O   1 
HETATM 10064 O O   . HOH E 2 .   ? 3.173   29.378  10.419  1.00 28.87 ? 344 HOH A O   1 
HETATM 10065 O O   . HOH E 2 .   ? -0.731  20.465  35.449  1.00 22.03 ? 345 HOH A O   1 
HETATM 10066 O O   . HOH E 2 .   ? 23.739  32.615  22.442  1.00 35.39 ? 346 HOH A O   1 
HETATM 10067 O O   . HOH E 2 .   ? 7.811   5.480   27.754  1.00 31.16 ? 347 HOH A O   1 
HETATM 10068 O O   . HOH E 2 .   ? 18.812  9.035   -13.903 1.00 51.46 ? 350 HOH A O   1 
HETATM 10069 O O   . HOH E 2 .   ? 38.293  11.929  15.954  1.00 30.67 ? 353 HOH A O   1 
HETATM 10070 O O   . HOH E 2 .   ? 40.839  0.830   -9.797  1.00 48.91 ? 355 HOH A O   1 
HETATM 10071 O O   . HOH E 2 .   ? 26.323  23.701  -7.667  1.00 49.04 ? 357 HOH A O   1 
HETATM 10072 O O   . HOH E 2 .   ? 11.491  34.226  -0.862  1.00 13.42 ? 361 HOH A O   1 
HETATM 10073 O O   . HOH E 2 .   ? 30.839  8.930   21.789  1.00 6.06  ? 364 HOH A O   1 
HETATM 10074 O O   . HOH E 2 .   ? 35.145  5.958   20.092  1.00 37.30 ? 365 HOH A O   1 
HETATM 10075 O O   . HOH E 2 .   ? 18.603  24.375  4.650   1.00 2.00  ? 374 HOH A O   1 
HETATM 10076 O O   . HOH E 2 .   ? -36.841 3.965   16.800  1.00 26.50 ? 379 HOH A O   1 
HETATM 10077 O O   . HOH E 2 .   ? -13.028 4.480   21.540  1.00 34.53 ? 385 HOH A O   1 
HETATM 10078 O O   . HOH E 2 .   ? -2.558  33.994  17.414  1.00 38.91 ? 388 HOH A O   1 
HETATM 10079 O O   . HOH E 2 .   ? 1.137   31.459  13.094  1.00 2.00  ? 389 HOH A O   1 
HETATM 10080 O O   . HOH E 2 .   ? -12.489 9.956   -1.008  1.00 2.00  ? 395 HOH A O   1 
HETATM 10081 O O   . HOH E 2 .   ? 9.885   35.677  11.554  1.00 23.89 ? 402 HOH A O   1 
HETATM 10082 O O   . HOH E 2 .   ? 8.722   33.370  2.758   1.00 21.12 ? 406 HOH A O   1 
HETATM 10083 O O   . HOH E 2 .   ? 15.303  22.417  4.065   1.00 2.00  ? 411 HOH A O   1 
HETATM 10084 O O   . HOH E 2 .   ? 23.191  26.907  27.743  1.00 49.04 ? 412 HOH A O   1 
HETATM 10085 O O   . HOH E 2 .   ? 16.939  19.945  31.093  1.00 27.74 ? 413 HOH A O   1 
HETATM 10086 O O   . HOH E 2 .   ? 10.888  34.360  7.420   1.00 22.79 ? 428 HOH A O   1 
HETATM 10087 O O   . HOH E 2 .   ? 19.709  34.151  -5.137  1.00 33.38 ? 433 HOH A O   1 
HETATM 10088 O O   . HOH E 2 .   ? 12.585  26.170  6.167   1.00 17.31 ? 434 HOH A O   1 
HETATM 10089 O O   . HOH E 2 .   ? 30.511  27.359  9.141   1.00 17.91 ? 436 HOH A O   1 
HETATM 10090 O O   . HOH F 2 .   ? -37.544 -5.279  21.394  1.00 38.60 ? 377 HOH D O   1 
HETATM 10091 O O   . HOH F 2 .   ? 4.670   0.096   24.059  1.00 30.45 ? 409 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLN 9   9   9   GLN GLN A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  CYS 20  20  20  CYS CYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  CYS 34  34  34  CYS CYS A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  MET 99  99  99  MET MET A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 GLN 110 110 110 GLN GLN A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 MET 116 116 116 MET MET A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 CYS 130 130 130 CYS CYS A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 TRP 147 147 147 TRP TRP A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ARG 156 156 156 ARG ARG A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 CYS 162 162 162 CYS CYS A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ASN 180 180 180 ASN ASN A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 CYS 184 184 184 CYS CYS A . n 
A 1 185 HIS 185 185 185 HIS HIS A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 TRP 187 187 187 TRP TRP A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 HIS 192 192 192 HIS HIS A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 HIS 225 225 225 HIS HIS A . n 
A 1 226 TRP 226 226 226 TRP TRP A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 GLN 232 232 232 GLN GLN A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 VAL 234 234 234 VAL VAL A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 MET 243 243 243 MET MET A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 TRP 249 249 249 TRP TRP A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 THR 256 256 256 THR THR A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ARG 268 268 268 ARG ARG A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 HIS 270 270 270 HIS HIS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 THR 273 273 273 THR THR A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 PHE 279 279 279 PHE PHE A . n 
A 1 280 HIS 280 280 280 HIS HIS A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 PHE 287 287 287 PHE PHE A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 PRO 291 291 291 PRO PRO A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 GLY 295 295 295 GLY GLY A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ILE 299 299 299 ILE ILE A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 LYS 304 304 304 LYS LYS A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 MET 307 307 307 MET MET A . n 
A 1 308 THR 308 308 308 THR THR A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 GLU 310 310 310 GLU GLU A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 GLY 313 313 313 GLY GLY A . n 
A 1 314 LEU 314 314 314 LEU LEU A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 SER 318 318 318 SER SER A . n 
A 1 319 ALA 319 319 319 ALA ALA A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 TRP 323 323 323 TRP TRP A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 MET 325 325 325 MET MET A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 ASN 328 328 328 ASN ASN A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 LEU 331 331 331 LEU LEU A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   THR 2   2   2   THR THR B . n 
B 1 3   VAL 3   3   3   VAL VAL B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   GLN 9   9   9   GLN GLN B . n 
B 1 10  ASN 10  10  10  ASN ASN B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  PRO 13  13  13  PRO PRO B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  ASP 15  15  15  ASP ASP B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  SER 18  18  18  SER SER B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  CYS 20  20  20  CYS CYS B . n 
B 1 21  LYS 21  21  21  LYS LYS B . n 
B 1 22  ILE 22  22  22  ILE ILE B . n 
B 1 23  THR 23  23  23  THR THR B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  VAL 25  25  25  VAL VAL B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  VAL 27  27  27  VAL VAL B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  ASP 29  29  29  ASP ASP B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  MET 32  32  32  MET MET B . n 
B 1 33  ALA 33  33  33  ALA ALA B . n 
B 1 34  CYS 34  34  34  CYS CYS B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ILE 36  36  36  ILE ILE B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  ILE 38  38  38  ILE ILE B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  LEU 49  49  49  LEU LEU B . n 
B 1 50  VAL 50  50  50  VAL VAL B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  ALA 52  52  52  ALA ALA B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  ARG 58  58  58  ARG ARG B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  ASP 63  63  63  ASP ASP B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  GLN 65  65  65  GLN GLN B . n 
B 1 66  HIS 66  66  66  HIS HIS B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  SER 68  68  68  SER SER B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  THR 73  73  73  THR THR B . n 
B 1 74  PRO 74  74  74  PRO PRO B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  ILE 76  76  76  ILE ILE B . n 
B 1 77  VAL 77  77  77  VAL VAL B . n 
B 1 78  PHE 78  78  78  PHE PHE B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  LYS 80  80  80  LYS LYS B . n 
B 1 81  ASP 81  81  81  ASP ASP B . n 
B 1 82  TYR 82  82  82  TYR TYR B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  THR 94  94  94  THR THR B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ALA 97  97  97  ALA ALA B . n 
B 1 98  ARG 98  98  98  ARG ARG B . n 
B 1 99  MET 99  99  99  MET MET B . n 
B 1 100 VAL 100 100 100 VAL VAL B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 GLN 103 103 103 GLN GLN B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 GLN 110 110 110 GLN GLN B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 MET 116 116 116 MET MET B . n 
B 1 117 LYS 117 117 117 LYS LYS B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 PRO 121 121 121 PRO PRO B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 ILE 124 124 124 ILE ILE B . n 
B 1 125 GLN 125 125 125 GLN GLN B . n 
B 1 126 ASN 126 126 126 ASN ASN B . n 
B 1 127 SER 127 127 127 SER SER B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 CYS 130 130 130 CYS CYS B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 ILE 132 132 132 ILE ILE B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 PRO 138 138 138 PRO PRO B . n 
B 1 139 VAL 139 139 139 VAL VAL B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 VAL 146 146 146 VAL VAL B . n 
B 1 147 TRP 147 147 147 TRP TRP B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 SER 150 150 150 SER SER B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 ARG 156 156 156 ARG ARG B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 ILE 158 158 158 ILE ILE B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 SER 160 160 160 SER SER B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 CYS 162 162 162 CYS CYS B . n 
B 1 163 ASN 163 163 163 ASN ASN B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 ASP 165 165 165 ASP ASP B . n 
B 1 166 SER 166 166 166 SER SER B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 ARG 168 168 168 ARG ARG B . n 
B 1 169 PHE 169 169 169 PHE PHE B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 TYR 171 171 171 TYR TYR B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 ILE 173 173 173 ILE ILE B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 GLU 175 175 175 GLU GLU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 ASN 180 180 180 ASN ASN B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 CYS 184 184 184 CYS CYS B . n 
B 1 185 HIS 185 185 185 HIS HIS B . n 
B 1 186 GLY 186 186 186 GLY GLY B . n 
B 1 187 TRP 187 187 187 TRP TRP B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 GLY 190 190 190 GLY GLY B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 HIS 192 192 192 HIS HIS B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 ASP 194 194 194 ASP ASP B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 PRO 198 198 198 PRO PRO B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 TRP 200 200 200 TRP TRP B . n 
B 1 201 SER 201 201 201 SER SER B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ASN 204 204 204 ASN ASN B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 THR 209 209 209 THR THR B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 SER 212 212 212 SER SER B . n 
B 1 213 LEU 213 213 213 LEU LEU B . n 
B 1 214 ASN 214 214 214 ASN ASN B . n 
B 1 215 PRO 215 215 215 PRO PRO B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 ILE 217 217 217 ILE ILE B . n 
B 1 218 GLY 218 218 218 GLY GLY B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 ASP 220 220 220 ASP ASP B . n 
B 1 221 LYS 221 221 221 LYS LYS B . n 
B 1 222 ASN 222 222 222 ASN ASN B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 HIS 225 225 225 HIS HIS B . n 
B 1 226 TRP 226 226 226 TRP TRP B . n 
B 1 227 LYS 227 227 227 LYS LYS B . n 
B 1 228 ASN 228 228 228 ASN ASN B . n 
B 1 229 VAL 229 229 229 VAL VAL B . n 
B 1 230 HIS 230 230 230 HIS HIS B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 GLN 232 232 232 GLN GLN B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 VAL 234 234 234 VAL VAL B . n 
B 1 235 GLU 235 235 235 GLU GLU B . n 
B 1 236 GLY 236 236 236 GLY GLY B . n 
B 1 237 GLY 237 237 237 GLY GLY B . n 
B 1 238 TYR 238 238 238 TYR TYR B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 VAL 240 240 240 VAL VAL B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 ASP 242 242 242 ASP ASP B . n 
B 1 243 MET 243 243 243 MET MET B . n 
B 1 244 LYS 244 244 244 LYS LYS B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 THR 247 247 247 THR THR B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 TRP 249 249 249 TRP TRP B . n 
B 1 250 ALA 250 250 250 ALA ALA B . n 
B 1 251 ILE 251 251 251 ILE ILE B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 LEU 253 253 253 LEU LEU B . n 
B 1 254 SER 254 254 254 SER SER B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 THR 256 256 256 THR THR B . n 
B 1 257 ASP 257 257 257 ASP ASP B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 ALA 259 259 259 ALA ALA B . n 
B 1 260 ARG 260 260 260 ARG ARG B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 ILE 262 262 262 ILE ILE B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 LYS 264 264 264 LYS LYS B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 LYS 267 267 267 LYS LYS B . n 
B 1 268 ARG 268 268 268 ARG ARG B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 HIS 270 270 270 HIS HIS B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 VAL 272 272 272 VAL VAL B . n 
B 1 273 THR 273 273 273 THR THR B . n 
B 1 274 THR 274 274 274 THR THR B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 VAL 276 276 276 VAL VAL B . n 
B 1 277 LYS 277 277 277 LYS LYS B . n 
B 1 278 GLY 278 278 278 GLY GLY B . n 
B 1 279 PHE 279 279 279 PHE PHE B . n 
B 1 280 HIS 280 280 280 HIS HIS B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 ILE 282 282 282 ILE ILE B . n 
B 1 283 LYS 283 283 283 LYS LYS B . n 
B 1 284 GLU 284 284 284 GLU GLU B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 VAL 286 286 286 VAL VAL B . n 
B 1 287 PHE 287 287 287 PHE PHE B . n 
B 1 288 LEU 288 288 288 LEU LEU B . n 
B 1 289 SER 289 289 289 SER SER B . n 
B 1 290 ILE 290 290 290 ILE ILE B . n 
B 1 291 PRO 291 291 291 PRO PRO B . n 
B 1 292 CYS 292 292 292 CYS CYS B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 LEU 294 294 294 LEU LEU B . n 
B 1 295 GLY 295 295 295 GLY GLY B . n 
B 1 296 GLU 296 296 296 GLU GLU B . n 
B 1 297 SER 297 297 297 SER SER B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 ILE 299 299 299 ILE ILE B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 ASP 301 301 301 ASP ASP B . n 
B 1 302 PHE 302 302 302 PHE PHE B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 LYS 304 304 304 LYS LYS B . n 
B 1 305 VAL 305 305 305 VAL VAL B . n 
B 1 306 ASN 306 306 306 ASN ASN B . n 
B 1 307 MET 307 307 307 MET MET B . n 
B 1 308 THR 308 308 308 THR THR B . n 
B 1 309 ALA 309 309 309 ALA ALA B . n 
B 1 310 GLU 310 310 310 GLU GLU B . n 
B 1 311 GLU 311 311 311 GLU GLU B . n 
B 1 312 GLU 312 312 312 GLU GLU B . n 
B 1 313 GLY 313 313 313 GLY GLY B . n 
B 1 314 LEU 314 314 314 LEU LEU B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 LYS 316 316 316 LYS LYS B . n 
B 1 317 LYS 317 317 317 LYS LYS B . n 
B 1 318 SER 318 318 318 SER SER B . n 
B 1 319 ALA 319 319 319 ALA ALA B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 THR 321 321 321 THR THR B . n 
B 1 322 LEU 322 322 322 LEU LEU B . n 
B 1 323 TRP 323 323 323 TRP TRP B . n 
B 1 324 ASN 324 324 324 ASN ASN B . n 
B 1 325 MET 325 325 325 MET MET B . n 
B 1 326 GLN 326 326 326 GLN GLN B . n 
B 1 327 LYS 327 327 327 LYS LYS B . n 
B 1 328 ASN 328 328 328 ASN ASN B . n 
B 1 329 LEU 329 329 329 LEU LEU B . n 
B 1 330 GLU 330 330 330 GLU GLU B . n 
B 1 331 LEU 331 331 331 LEU LEU B . n 
C 1 1   SER 1   1   1   SER SER C . n 
C 1 2   THR 2   2   2   THR THR C . n 
C 1 3   VAL 3   3   3   VAL VAL C . n 
C 1 4   LYS 4   4   4   LYS LYS C . n 
C 1 5   GLU 5   5   5   GLU GLU C . n 
C 1 6   GLN 6   6   6   GLN GLN C . n 
C 1 7   LEU 7   7   7   LEU LEU C . n 
C 1 8   ILE 8   8   8   ILE ILE C . n 
C 1 9   GLN 9   9   9   GLN GLN C . n 
C 1 10  ASN 10  10  10  ASN ASN C . n 
C 1 11  LEU 11  11  11  LEU LEU C . n 
C 1 12  VAL 12  12  12  VAL VAL C . n 
C 1 13  PRO 13  13  13  PRO PRO C . n 
C 1 14  GLU 14  14  14  GLU GLU C . n 
C 1 15  ASP 15  15  15  ASP ASP C . n 
C 1 16  LYS 16  16  16  LYS LYS C . n 
C 1 17  LEU 17  17  17  LEU LEU C . n 
C 1 18  SER 18  18  18  SER SER C . n 
C 1 19  ARG 19  19  19  ARG ARG C . n 
C 1 20  CYS 20  20  20  CYS CYS C . n 
C 1 21  LYS 21  21  21  LYS LYS C . n 
C 1 22  ILE 22  22  22  ILE ILE C . n 
C 1 23  THR 23  23  23  THR THR C . n 
C 1 24  VAL 24  24  24  VAL VAL C . n 
C 1 25  VAL 25  25  25  VAL VAL C . n 
C 1 26  GLY 26  26  26  GLY GLY C . n 
C 1 27  VAL 27  27  27  VAL VAL C . n 
C 1 28  GLY 28  28  28  GLY GLY C . n 
C 1 29  ASP 29  29  29  ASP ASP C . n 
C 1 30  VAL 30  30  30  VAL VAL C . n 
C 1 31  GLY 31  31  31  GLY GLY C . n 
C 1 32  MET 32  32  32  MET MET C . n 
C 1 33  ALA 33  33  33  ALA ALA C . n 
C 1 34  CYS 34  34  34  CYS CYS C . n 
C 1 35  ALA 35  35  35  ALA ALA C . n 
C 1 36  ILE 36  36  36  ILE ILE C . n 
C 1 37  SER 37  37  37  SER SER C . n 
C 1 38  ILE 38  38  38  ILE ILE C . n 
C 1 39  LEU 39  39  39  LEU LEU C . n 
C 1 40  LEU 40  40  40  LEU LEU C . n 
C 1 41  LYS 41  41  41  LYS LYS C . n 
C 1 42  GLY 42  42  42  GLY GLY C . n 
C 1 43  LEU 43  43  43  LEU LEU C . n 
C 1 44  ALA 44  44  44  ALA ALA C . n 
C 1 45  ASP 45  45  45  ASP ASP C . n 
C 1 46  GLU 46  46  46  GLU GLU C . n 
C 1 47  LEU 47  47  47  LEU LEU C . n 
C 1 48  ALA 48  48  48  ALA ALA C . n 
C 1 49  LEU 49  49  49  LEU LEU C . n 
C 1 50  VAL 50  50  50  VAL VAL C . n 
C 1 51  ASP 51  51  51  ASP ASP C . n 
C 1 52  ALA 52  52  52  ALA ALA C . n 
C 1 53  ASP 53  53  53  ASP ASP C . n 
C 1 54  THR 54  54  54  THR THR C . n 
C 1 55  ASP 55  55  55  ASP ASP C . n 
C 1 56  LYS 56  56  56  LYS LYS C . n 
C 1 57  LEU 57  57  57  LEU LEU C . n 
C 1 58  ARG 58  58  58  ARG ARG C . n 
C 1 59  GLY 59  59  59  GLY GLY C . n 
C 1 60  GLU 60  60  60  GLU GLU C . n 
C 1 61  ALA 61  61  61  ALA ALA C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  ASP 63  63  63  ASP ASP C . n 
C 1 64  LEU 64  64  64  LEU LEU C . n 
C 1 65  GLN 65  65  65  GLN GLN C . n 
C 1 66  HIS 66  66  66  HIS HIS C . n 
C 1 67  GLY 67  67  67  GLY GLY C . n 
C 1 68  SER 68  68  68  SER SER C . n 
C 1 69  LEU 69  69  69  LEU LEU C . n 
C 1 70  PHE 70  70  70  PHE PHE C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  PRO 74  74  74  PRO PRO C . n 
C 1 75  LYS 75  75  75  LYS LYS C . n 
C 1 76  ILE 76  76  76  ILE ILE C . n 
C 1 77  VAL 77  77  77  VAL VAL C . n 
C 1 78  PHE 78  78  78  PHE PHE C . n 
C 1 79  GLY 79  79  79  GLY GLY C . n 
C 1 80  LYS 80  80  80  LYS LYS C . n 
C 1 81  ASP 81  81  81  ASP ASP C . n 
C 1 82  TYR 82  82  82  TYR TYR C . n 
C 1 83  ASN 83  83  83  ASN ASN C . n 
C 1 84  VAL 84  84  84  VAL VAL C . n 
C 1 85  SER 85  85  85  SER SER C . n 
C 1 86  ALA 86  86  86  ALA ALA C . n 
C 1 87  ASN 87  87  87  ASN ASN C . n 
C 1 88  SER 88  88  88  SER SER C . n 
C 1 89  LYS 89  89  89  LYS LYS C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  VAL 91  91  91  VAL VAL C . n 
C 1 92  ILE 92  92  92  ILE ILE C . n 
C 1 93  ILE 93  93  93  ILE ILE C . n 
C 1 94  THR 94  94  94  THR THR C . n 
C 1 95  ALA 95  95  95  ALA ALA C . n 
C 1 96  GLY 96  96  96  GLY GLY C . n 
C 1 97  ALA 97  97  97  ALA ALA C . n 
C 1 98  ARG 98  98  98  ARG ARG C . n 
C 1 99  MET 99  99  99  MET MET C . n 
C 1 100 VAL 100 100 100 VAL VAL C . n 
C 1 101 SER 101 101 101 SER SER C . n 
C 1 102 GLY 102 102 102 GLY GLY C . n 
C 1 103 GLN 103 103 103 GLN GLN C . n 
C 1 104 THR 104 104 104 THR THR C . n 
C 1 105 ARG 105 105 105 ARG ARG C . n 
C 1 106 LEU 106 106 106 LEU LEU C . n 
C 1 107 ASP 107 107 107 ASP ASP C . n 
C 1 108 LEU 108 108 108 LEU LEU C . n 
C 1 109 LEU 109 109 109 LEU LEU C . n 
C 1 110 GLN 110 110 110 GLN GLN C . n 
C 1 111 ARG 111 111 111 ARG ARG C . n 
C 1 112 ASN 112 112 112 ASN ASN C . n 
C 1 113 VAL 113 113 113 VAL VAL C . n 
C 1 114 ALA 114 114 114 ALA ALA C . n 
C 1 115 ILE 115 115 115 ILE ILE C . n 
C 1 116 MET 116 116 116 MET MET C . n 
C 1 117 LYS 117 117 117 LYS LYS C . n 
C 1 118 ALA 118 118 118 ALA ALA C . n 
C 1 119 ILE 119 119 119 ILE ILE C . n 
C 1 120 VAL 120 120 120 VAL VAL C . n 
C 1 121 PRO 121 121 121 PRO PRO C . n 
C 1 122 GLY 122 122 122 GLY GLY C . n 
C 1 123 VAL 123 123 123 VAL VAL C . n 
C 1 124 ILE 124 124 124 ILE ILE C . n 
C 1 125 GLN 125 125 125 GLN GLN C . n 
C 1 126 ASN 126 126 126 ASN ASN C . n 
C 1 127 SER 127 127 127 SER SER C . n 
C 1 128 PRO 128 128 128 PRO PRO C . n 
C 1 129 ASP 129 129 129 ASP ASP C . n 
C 1 130 CYS 130 130 130 CYS CYS C . n 
C 1 131 LYS 131 131 131 LYS LYS C . n 
C 1 132 ILE 132 132 132 ILE ILE C . n 
C 1 133 ILE 133 133 133 ILE ILE C . n 
C 1 134 VAL 134 134 134 VAL VAL C . n 
C 1 135 VAL 135 135 135 VAL VAL C . n 
C 1 136 THR 136 136 136 THR THR C . n 
C 1 137 ASN 137 137 137 ASN ASN C . n 
C 1 138 PRO 138 138 138 PRO PRO C . n 
C 1 139 VAL 139 139 139 VAL VAL C . n 
C 1 140 ASP 140 140 140 ASP ASP C . n 
C 1 141 ILE 141 141 141 ILE ILE C . n 
C 1 142 LEU 142 142 142 LEU LEU C . n 
C 1 143 THR 143 143 143 THR THR C . n 
C 1 144 TYR 144 144 144 TYR TYR C . n 
C 1 145 VAL 145 145 145 VAL VAL C . n 
C 1 146 VAL 146 146 146 VAL VAL C . n 
C 1 147 TRP 147 147 147 TRP TRP C . n 
C 1 148 LYS 148 148 148 LYS LYS C . n 
C 1 149 ILE 149 149 149 ILE ILE C . n 
C 1 150 SER 150 150 150 SER SER C . n 
C 1 151 GLY 151 151 151 GLY GLY C . n 
C 1 152 PHE 152 152 152 PHE PHE C . n 
C 1 153 PRO 153 153 153 PRO PRO C . n 
C 1 154 VAL 154 154 154 VAL VAL C . n 
C 1 155 GLY 155 155 155 GLY GLY C . n 
C 1 156 ARG 156 156 156 ARG ARG C . n 
C 1 157 VAL 157 157 157 VAL VAL C . n 
C 1 158 ILE 158 158 158 ILE ILE C . n 
C 1 159 GLY 159 159 159 GLY GLY C . n 
C 1 160 SER 160 160 160 SER SER C . n 
C 1 161 GLY 161 161 161 GLY GLY C . n 
C 1 162 CYS 162 162 162 CYS CYS C . n 
C 1 163 ASN 163 163 163 ASN ASN C . n 
C 1 164 LEU 164 164 164 LEU LEU C . n 
C 1 165 ASP 165 165 165 ASP ASP C . n 
C 1 166 SER 166 166 166 SER SER C . n 
C 1 167 ALA 167 167 167 ALA ALA C . n 
C 1 168 ARG 168 168 168 ARG ARG C . n 
C 1 169 PHE 169 169 169 PHE PHE C . n 
C 1 170 ARG 170 170 170 ARG ARG C . n 
C 1 171 TYR 171 171 171 TYR TYR C . n 
C 1 172 LEU 172 172 172 LEU LEU C . n 
C 1 173 ILE 173 173 173 ILE ILE C . n 
C 1 174 GLY 174 174 174 GLY GLY C . n 
C 1 175 GLU 175 175 175 GLU GLU C . n 
C 1 176 LYS 176 176 176 LYS LYS C . n 
C 1 177 LEU 177 177 177 LEU LEU C . n 
C 1 178 GLY 178 178 178 GLY GLY C . n 
C 1 179 VAL 179 179 179 VAL VAL C . n 
C 1 180 ASN 180 180 180 ASN ASN C . n 
C 1 181 PRO 181 181 181 PRO PRO C . n 
C 1 182 THR 182 182 182 THR THR C . n 
C 1 183 SER 183 183 183 SER SER C . n 
C 1 184 CYS 184 184 184 CYS CYS C . n 
C 1 185 HIS 185 185 185 HIS HIS C . n 
C 1 186 GLY 186 186 186 GLY GLY C . n 
C 1 187 TRP 187 187 187 TRP TRP C . n 
C 1 188 VAL 188 188 188 VAL VAL C . n 
C 1 189 LEU 189 189 189 LEU LEU C . n 
C 1 190 GLY 190 190 190 GLY GLY C . n 
C 1 191 GLU 191 191 191 GLU GLU C . n 
C 1 192 HIS 192 192 192 HIS HIS C . n 
C 1 193 GLY 193 193 193 GLY GLY C . n 
C 1 194 ASP 194 194 194 ASP ASP C . n 
C 1 195 SER 195 195 195 SER SER C . n 
C 1 196 SER 196 196 196 SER SER C . n 
C 1 197 VAL 197 197 197 VAL VAL C . n 
C 1 198 PRO 198 198 198 PRO PRO C . n 
C 1 199 ILE 199 199 199 ILE ILE C . n 
C 1 200 TRP 200 200 200 TRP TRP C . n 
C 1 201 SER 201 201 201 SER SER C . n 
C 1 202 GLY 202 202 202 GLY GLY C . n 
C 1 203 VAL 203 203 203 VAL VAL C . n 
C 1 204 ASN 204 204 204 ASN ASN C . n 
C 1 205 VAL 205 205 205 VAL VAL C . n 
C 1 206 ALA 206 206 206 ALA ALA C . n 
C 1 207 GLY 207 207 207 GLY GLY C . n 
C 1 208 VAL 208 208 208 VAL VAL C . n 
C 1 209 THR 209 209 209 THR THR C . n 
C 1 210 LEU 210 210 210 LEU LEU C . n 
C 1 211 LYS 211 211 211 LYS LYS C . n 
C 1 212 SER 212 212 212 SER SER C . n 
C 1 213 LEU 213 213 213 LEU LEU C . n 
C 1 214 ASN 214 214 214 ASN ASN C . n 
C 1 215 PRO 215 215 215 PRO PRO C . n 
C 1 216 ALA 216 216 216 ALA ALA C . n 
C 1 217 ILE 217 217 217 ILE ILE C . n 
C 1 218 GLY 218 218 218 GLY GLY C . n 
C 1 219 THR 219 219 219 THR THR C . n 
C 1 220 ASP 220 220 220 ASP ASP C . n 
C 1 221 LYS 221 221 221 LYS LYS C . n 
C 1 222 ASN 222 222 222 ASN ASN C . n 
C 1 223 LYS 223 223 223 LYS LYS C . n 
C 1 224 GLN 224 224 224 GLN GLN C . n 
C 1 225 HIS 225 225 225 HIS HIS C . n 
C 1 226 TRP 226 226 226 TRP TRP C . n 
C 1 227 LYS 227 227 227 LYS LYS C . n 
C 1 228 ASN 228 228 228 ASN ASN C . n 
C 1 229 VAL 229 229 229 VAL VAL C . n 
C 1 230 HIS 230 230 230 HIS HIS C . n 
C 1 231 LYS 231 231 231 LYS LYS C . n 
C 1 232 GLN 232 232 232 GLN GLN C . n 
C 1 233 VAL 233 233 233 VAL VAL C . n 
C 1 234 VAL 234 234 234 VAL VAL C . n 
C 1 235 GLU 235 235 235 GLU GLU C . n 
C 1 236 GLY 236 236 236 GLY GLY C . n 
C 1 237 GLY 237 237 237 GLY GLY C . n 
C 1 238 TYR 238 238 238 TYR TYR C . n 
C 1 239 GLU 239 239 239 GLU GLU C . n 
C 1 240 VAL 240 240 240 VAL VAL C . n 
C 1 241 LEU 241 241 241 LEU LEU C . n 
C 1 242 ASP 242 242 242 ASP ASP C . n 
C 1 243 MET 243 243 243 MET MET C . n 
C 1 244 LYS 244 244 244 LYS LYS C . n 
C 1 245 GLY 245 245 245 GLY GLY C . n 
C 1 246 TYR 246 246 246 TYR TYR C . n 
C 1 247 THR 247 247 247 THR THR C . n 
C 1 248 SER 248 248 248 SER SER C . n 
C 1 249 TRP 249 249 249 TRP TRP C . n 
C 1 250 ALA 250 250 250 ALA ALA C . n 
C 1 251 ILE 251 251 251 ILE ILE C . n 
C 1 252 GLY 252 252 252 GLY GLY C . n 
C 1 253 LEU 253 253 253 LEU LEU C . n 
C 1 254 SER 254 254 254 SER SER C . n 
C 1 255 VAL 255 255 255 VAL VAL C . n 
C 1 256 THR 256 256 256 THR THR C . n 
C 1 257 ASP 257 257 257 ASP ASP C . n 
C 1 258 LEU 258 258 258 LEU LEU C . n 
C 1 259 ALA 259 259 259 ALA ALA C . n 
C 1 260 ARG 260 260 260 ARG ARG C . n 
C 1 261 SER 261 261 261 SER SER C . n 
C 1 262 ILE 262 262 262 ILE ILE C . n 
C 1 263 LEU 263 263 263 LEU LEU C . n 
C 1 264 LYS 264 264 264 LYS LYS C . n 
C 1 265 ASN 265 265 265 ASN ASN C . n 
C 1 266 LEU 266 266 266 LEU LEU C . n 
C 1 267 LYS 267 267 267 LYS LYS C . n 
C 1 268 ARG 268 268 268 ARG ARG C . n 
C 1 269 VAL 269 269 269 VAL VAL C . n 
C 1 270 HIS 270 270 270 HIS HIS C . n 
C 1 271 PRO 271 271 271 PRO PRO C . n 
C 1 272 VAL 272 272 272 VAL VAL C . n 
C 1 273 THR 273 273 273 THR THR C . n 
C 1 274 THR 274 274 274 THR THR C . n 
C 1 275 LEU 275 275 275 LEU LEU C . n 
C 1 276 VAL 276 276 276 VAL VAL C . n 
C 1 277 LYS 277 277 277 LYS LYS C . n 
C 1 278 GLY 278 278 278 GLY GLY C . n 
C 1 279 PHE 279 279 279 PHE PHE C . n 
C 1 280 HIS 280 280 280 HIS HIS C . n 
C 1 281 GLY 281 281 281 GLY GLY C . n 
C 1 282 ILE 282 282 282 ILE ILE C . n 
C 1 283 LYS 283 283 283 LYS LYS C . n 
C 1 284 GLU 284 284 284 GLU GLU C . n 
C 1 285 GLU 285 285 285 GLU GLU C . n 
C 1 286 VAL 286 286 286 VAL VAL C . n 
C 1 287 PHE 287 287 287 PHE PHE C . n 
C 1 288 LEU 288 288 288 LEU LEU C . n 
C 1 289 SER 289 289 289 SER SER C . n 
C 1 290 ILE 290 290 290 ILE ILE C . n 
C 1 291 PRO 291 291 291 PRO PRO C . n 
C 1 292 CYS 292 292 292 CYS CYS C . n 
C 1 293 VAL 293 293 293 VAL VAL C . n 
C 1 294 LEU 294 294 294 LEU LEU C . n 
C 1 295 GLY 295 295 295 GLY GLY C . n 
C 1 296 GLU 296 296 296 GLU GLU C . n 
C 1 297 SER 297 297 297 SER SER C . n 
C 1 298 GLY 298 298 298 GLY GLY C . n 
C 1 299 ILE 299 299 299 ILE ILE C . n 
C 1 300 THR 300 300 300 THR THR C . n 
C 1 301 ASP 301 301 301 ASP ASP C . n 
C 1 302 PHE 302 302 302 PHE PHE C . n 
C 1 303 VAL 303 303 303 VAL VAL C . n 
C 1 304 LYS 304 304 304 LYS LYS C . n 
C 1 305 VAL 305 305 305 VAL VAL C . n 
C 1 306 ASN 306 306 306 ASN ASN C . n 
C 1 307 MET 307 307 307 MET MET C . n 
C 1 308 THR 308 308 308 THR THR C . n 
C 1 309 ALA 309 309 309 ALA ALA C . n 
C 1 310 GLU 310 310 310 GLU GLU C . n 
C 1 311 GLU 311 311 311 GLU GLU C . n 
C 1 312 GLU 312 312 312 GLU GLU C . n 
C 1 313 GLY 313 313 313 GLY GLY C . n 
C 1 314 LEU 314 314 314 LEU LEU C . n 
C 1 315 LEU 315 315 315 LEU LEU C . n 
C 1 316 LYS 316 316 316 LYS LYS C . n 
C 1 317 LYS 317 317 317 LYS LYS C . n 
C 1 318 SER 318 318 318 SER SER C . n 
C 1 319 ALA 319 319 319 ALA ALA C . n 
C 1 320 ASP 320 320 320 ASP ASP C . n 
C 1 321 THR 321 321 321 THR THR C . n 
C 1 322 LEU 322 322 322 LEU LEU C . n 
C 1 323 TRP 323 323 323 TRP TRP C . n 
C 1 324 ASN 324 324 324 ASN ASN C . n 
C 1 325 MET 325 325 325 MET MET C . n 
C 1 326 GLN 326 326 326 GLN GLN C . n 
C 1 327 LYS 327 327 327 LYS LYS C . n 
C 1 328 ASN 328 328 328 ASN ASN C . n 
C 1 329 LEU 329 329 329 LEU LEU C . n 
C 1 330 GLU 330 330 330 GLU GLU C . n 
C 1 331 LEU 331 331 331 LEU LEU C . n 
D 1 1   SER 1   1   1   SER SER D . n 
D 1 2   THR 2   2   2   THR THR D . n 
D 1 3   VAL 3   3   3   VAL VAL D . n 
D 1 4   LYS 4   4   4   LYS LYS D . n 
D 1 5   GLU 5   5   5   GLU GLU D . n 
D 1 6   GLN 6   6   6   GLN GLN D . n 
D 1 7   LEU 7   7   7   LEU LEU D . n 
D 1 8   ILE 8   8   8   ILE ILE D . n 
D 1 9   GLN 9   9   9   GLN GLN D . n 
D 1 10  ASN 10  10  10  ASN ASN D . n 
D 1 11  LEU 11  11  11  LEU LEU D . n 
D 1 12  VAL 12  12  12  VAL VAL D . n 
D 1 13  PRO 13  13  13  PRO PRO D . n 
D 1 14  GLU 14  14  14  GLU GLU D . n 
D 1 15  ASP 15  15  15  ASP ASP D . n 
D 1 16  LYS 16  16  16  LYS LYS D . n 
D 1 17  LEU 17  17  17  LEU LEU D . n 
D 1 18  SER 18  18  18  SER SER D . n 
D 1 19  ARG 19  19  19  ARG ARG D . n 
D 1 20  CYS 20  20  20  CYS CYS D . n 
D 1 21  LYS 21  21  21  LYS LYS D . n 
D 1 22  ILE 22  22  22  ILE ILE D . n 
D 1 23  THR 23  23  23  THR THR D . n 
D 1 24  VAL 24  24  24  VAL VAL D . n 
D 1 25  VAL 25  25  25  VAL VAL D . n 
D 1 26  GLY 26  26  26  GLY GLY D . n 
D 1 27  VAL 27  27  27  VAL VAL D . n 
D 1 28  GLY 28  28  28  GLY GLY D . n 
D 1 29  ASP 29  29  29  ASP ASP D . n 
D 1 30  VAL 30  30  30  VAL VAL D . n 
D 1 31  GLY 31  31  31  GLY GLY D . n 
D 1 32  MET 32  32  32  MET MET D . n 
D 1 33  ALA 33  33  33  ALA ALA D . n 
D 1 34  CYS 34  34  34  CYS CYS D . n 
D 1 35  ALA 35  35  35  ALA ALA D . n 
D 1 36  ILE 36  36  36  ILE ILE D . n 
D 1 37  SER 37  37  37  SER SER D . n 
D 1 38  ILE 38  38  38  ILE ILE D . n 
D 1 39  LEU 39  39  39  LEU LEU D . n 
D 1 40  LEU 40  40  40  LEU LEU D . n 
D 1 41  LYS 41  41  41  LYS LYS D . n 
D 1 42  GLY 42  42  42  GLY GLY D . n 
D 1 43  LEU 43  43  43  LEU LEU D . n 
D 1 44  ALA 44  44  44  ALA ALA D . n 
D 1 45  ASP 45  45  45  ASP ASP D . n 
D 1 46  GLU 46  46  46  GLU GLU D . n 
D 1 47  LEU 47  47  47  LEU LEU D . n 
D 1 48  ALA 48  48  48  ALA ALA D . n 
D 1 49  LEU 49  49  49  LEU LEU D . n 
D 1 50  VAL 50  50  50  VAL VAL D . n 
D 1 51  ASP 51  51  51  ASP ASP D . n 
D 1 52  ALA 52  52  52  ALA ALA D . n 
D 1 53  ASP 53  53  53  ASP ASP D . n 
D 1 54  THR 54  54  54  THR THR D . n 
D 1 55  ASP 55  55  55  ASP ASP D . n 
D 1 56  LYS 56  56  56  LYS LYS D . n 
D 1 57  LEU 57  57  57  LEU LEU D . n 
D 1 58  ARG 58  58  58  ARG ARG D . n 
D 1 59  GLY 59  59  59  GLY GLY D . n 
D 1 60  GLU 60  60  60  GLU GLU D . n 
D 1 61  ALA 61  61  61  ALA ALA D . n 
D 1 62  LEU 62  62  62  LEU LEU D . n 
D 1 63  ASP 63  63  63  ASP ASP D . n 
D 1 64  LEU 64  64  64  LEU LEU D . n 
D 1 65  GLN 65  65  65  GLN GLN D . n 
D 1 66  HIS 66  66  66  HIS HIS D . n 
D 1 67  GLY 67  67  67  GLY GLY D . n 
D 1 68  SER 68  68  68  SER SER D . n 
D 1 69  LEU 69  69  69  LEU LEU D . n 
D 1 70  PHE 70  70  70  PHE PHE D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  SER 72  72  72  SER SER D . n 
D 1 73  THR 73  73  73  THR THR D . n 
D 1 74  PRO 74  74  74  PRO PRO D . n 
D 1 75  LYS 75  75  75  LYS LYS D . n 
D 1 76  ILE 76  76  76  ILE ILE D . n 
D 1 77  VAL 77  77  77  VAL VAL D . n 
D 1 78  PHE 78  78  78  PHE PHE D . n 
D 1 79  GLY 79  79  79  GLY GLY D . n 
D 1 80  LYS 80  80  80  LYS LYS D . n 
D 1 81  ASP 81  81  81  ASP ASP D . n 
D 1 82  TYR 82  82  82  TYR TYR D . n 
D 1 83  ASN 83  83  83  ASN ASN D . n 
D 1 84  VAL 84  84  84  VAL VAL D . n 
D 1 85  SER 85  85  85  SER SER D . n 
D 1 86  ALA 86  86  86  ALA ALA D . n 
D 1 87  ASN 87  87  87  ASN ASN D . n 
D 1 88  SER 88  88  88  SER SER D . n 
D 1 89  LYS 89  89  89  LYS LYS D . n 
D 1 90  LEU 90  90  90  LEU LEU D . n 
D 1 91  VAL 91  91  91  VAL VAL D . n 
D 1 92  ILE 92  92  92  ILE ILE D . n 
D 1 93  ILE 93  93  93  ILE ILE D . n 
D 1 94  THR 94  94  94  THR THR D . n 
D 1 95  ALA 95  95  95  ALA ALA D . n 
D 1 96  GLY 96  96  96  GLY GLY D . n 
D 1 97  ALA 97  97  97  ALA ALA D . n 
D 1 98  ARG 98  98  98  ARG ARG D . n 
D 1 99  MET 99  99  99  MET MET D . n 
D 1 100 VAL 100 100 100 VAL VAL D . n 
D 1 101 SER 101 101 101 SER SER D . n 
D 1 102 GLY 102 102 102 GLY GLY D . n 
D 1 103 GLN 103 103 103 GLN GLN D . n 
D 1 104 THR 104 104 104 THR THR D . n 
D 1 105 ARG 105 105 105 ARG ARG D . n 
D 1 106 LEU 106 106 106 LEU LEU D . n 
D 1 107 ASP 107 107 107 ASP ASP D . n 
D 1 108 LEU 108 108 108 LEU LEU D . n 
D 1 109 LEU 109 109 109 LEU LEU D . n 
D 1 110 GLN 110 110 110 GLN GLN D . n 
D 1 111 ARG 111 111 111 ARG ARG D . n 
D 1 112 ASN 112 112 112 ASN ASN D . n 
D 1 113 VAL 113 113 113 VAL VAL D . n 
D 1 114 ALA 114 114 114 ALA ALA D . n 
D 1 115 ILE 115 115 115 ILE ILE D . n 
D 1 116 MET 116 116 116 MET MET D . n 
D 1 117 LYS 117 117 117 LYS LYS D . n 
D 1 118 ALA 118 118 118 ALA ALA D . n 
D 1 119 ILE 119 119 119 ILE ILE D . n 
D 1 120 VAL 120 120 120 VAL VAL D . n 
D 1 121 PRO 121 121 121 PRO PRO D . n 
D 1 122 GLY 122 122 122 GLY GLY D . n 
D 1 123 VAL 123 123 123 VAL VAL D . n 
D 1 124 ILE 124 124 124 ILE ILE D . n 
D 1 125 GLN 125 125 125 GLN GLN D . n 
D 1 126 ASN 126 126 126 ASN ASN D . n 
D 1 127 SER 127 127 127 SER SER D . n 
D 1 128 PRO 128 128 128 PRO PRO D . n 
D 1 129 ASP 129 129 129 ASP ASP D . n 
D 1 130 CYS 130 130 130 CYS CYS D . n 
D 1 131 LYS 131 131 131 LYS LYS D . n 
D 1 132 ILE 132 132 132 ILE ILE D . n 
D 1 133 ILE 133 133 133 ILE ILE D . n 
D 1 134 VAL 134 134 134 VAL VAL D . n 
D 1 135 VAL 135 135 135 VAL VAL D . n 
D 1 136 THR 136 136 136 THR THR D . n 
D 1 137 ASN 137 137 137 ASN ASN D . n 
D 1 138 PRO 138 138 138 PRO PRO D . n 
D 1 139 VAL 139 139 139 VAL VAL D . n 
D 1 140 ASP 140 140 140 ASP ASP D . n 
D 1 141 ILE 141 141 141 ILE ILE D . n 
D 1 142 LEU 142 142 142 LEU LEU D . n 
D 1 143 THR 143 143 143 THR THR D . n 
D 1 144 TYR 144 144 144 TYR TYR D . n 
D 1 145 VAL 145 145 145 VAL VAL D . n 
D 1 146 VAL 146 146 146 VAL VAL D . n 
D 1 147 TRP 147 147 147 TRP TRP D . n 
D 1 148 LYS 148 148 148 LYS LYS D . n 
D 1 149 ILE 149 149 149 ILE ILE D . n 
D 1 150 SER 150 150 150 SER SER D . n 
D 1 151 GLY 151 151 151 GLY GLY D . n 
D 1 152 PHE 152 152 152 PHE PHE D . n 
D 1 153 PRO 153 153 153 PRO PRO D . n 
D 1 154 VAL 154 154 154 VAL VAL D . n 
D 1 155 GLY 155 155 155 GLY GLY D . n 
D 1 156 ARG 156 156 156 ARG ARG D . n 
D 1 157 VAL 157 157 157 VAL VAL D . n 
D 1 158 ILE 158 158 158 ILE ILE D . n 
D 1 159 GLY 159 159 159 GLY GLY D . n 
D 1 160 SER 160 160 160 SER SER D . n 
D 1 161 GLY 161 161 161 GLY GLY D . n 
D 1 162 CYS 162 162 162 CYS CYS D . n 
D 1 163 ASN 163 163 163 ASN ASN D . n 
D 1 164 LEU 164 164 164 LEU LEU D . n 
D 1 165 ASP 165 165 165 ASP ASP D . n 
D 1 166 SER 166 166 166 SER SER D . n 
D 1 167 ALA 167 167 167 ALA ALA D . n 
D 1 168 ARG 168 168 168 ARG ARG D . n 
D 1 169 PHE 169 169 169 PHE PHE D . n 
D 1 170 ARG 170 170 170 ARG ARG D . n 
D 1 171 TYR 171 171 171 TYR TYR D . n 
D 1 172 LEU 172 172 172 LEU LEU D . n 
D 1 173 ILE 173 173 173 ILE ILE D . n 
D 1 174 GLY 174 174 174 GLY GLY D . n 
D 1 175 GLU 175 175 175 GLU GLU D . n 
D 1 176 LYS 176 176 176 LYS LYS D . n 
D 1 177 LEU 177 177 177 LEU LEU D . n 
D 1 178 GLY 178 178 178 GLY GLY D . n 
D 1 179 VAL 179 179 179 VAL VAL D . n 
D 1 180 ASN 180 180 180 ASN ASN D . n 
D 1 181 PRO 181 181 181 PRO PRO D . n 
D 1 182 THR 182 182 182 THR THR D . n 
D 1 183 SER 183 183 183 SER SER D . n 
D 1 184 CYS 184 184 184 CYS CYS D . n 
D 1 185 HIS 185 185 185 HIS HIS D . n 
D 1 186 GLY 186 186 186 GLY GLY D . n 
D 1 187 TRP 187 187 187 TRP TRP D . n 
D 1 188 VAL 188 188 188 VAL VAL D . n 
D 1 189 LEU 189 189 189 LEU LEU D . n 
D 1 190 GLY 190 190 190 GLY GLY D . n 
D 1 191 GLU 191 191 191 GLU GLU D . n 
D 1 192 HIS 192 192 192 HIS HIS D . n 
D 1 193 GLY 193 193 193 GLY GLY D . n 
D 1 194 ASP 194 194 194 ASP ASP D . n 
D 1 195 SER 195 195 195 SER SER D . n 
D 1 196 SER 196 196 196 SER SER D . n 
D 1 197 VAL 197 197 197 VAL VAL D . n 
D 1 198 PRO 198 198 198 PRO PRO D . n 
D 1 199 ILE 199 199 199 ILE ILE D . n 
D 1 200 TRP 200 200 200 TRP TRP D . n 
D 1 201 SER 201 201 201 SER SER D . n 
D 1 202 GLY 202 202 202 GLY GLY D . n 
D 1 203 VAL 203 203 203 VAL VAL D . n 
D 1 204 ASN 204 204 204 ASN ASN D . n 
D 1 205 VAL 205 205 205 VAL VAL D . n 
D 1 206 ALA 206 206 206 ALA ALA D . n 
D 1 207 GLY 207 207 207 GLY GLY D . n 
D 1 208 VAL 208 208 208 VAL VAL D . n 
D 1 209 THR 209 209 209 THR THR D . n 
D 1 210 LEU 210 210 210 LEU LEU D . n 
D 1 211 LYS 211 211 211 LYS LYS D . n 
D 1 212 SER 212 212 212 SER SER D . n 
D 1 213 LEU 213 213 213 LEU LEU D . n 
D 1 214 ASN 214 214 214 ASN ASN D . n 
D 1 215 PRO 215 215 215 PRO PRO D . n 
D 1 216 ALA 216 216 216 ALA ALA D . n 
D 1 217 ILE 217 217 217 ILE ILE D . n 
D 1 218 GLY 218 218 218 GLY GLY D . n 
D 1 219 THR 219 219 219 THR THR D . n 
D 1 220 ASP 220 220 220 ASP ASP D . n 
D 1 221 LYS 221 221 221 LYS LYS D . n 
D 1 222 ASN 222 222 222 ASN ASN D . n 
D 1 223 LYS 223 223 223 LYS LYS D . n 
D 1 224 GLN 224 224 224 GLN GLN D . n 
D 1 225 HIS 225 225 225 HIS HIS D . n 
D 1 226 TRP 226 226 226 TRP TRP D . n 
D 1 227 LYS 227 227 227 LYS LYS D . n 
D 1 228 ASN 228 228 228 ASN ASN D . n 
D 1 229 VAL 229 229 229 VAL VAL D . n 
D 1 230 HIS 230 230 230 HIS HIS D . n 
D 1 231 LYS 231 231 231 LYS LYS D . n 
D 1 232 GLN 232 232 232 GLN GLN D . n 
D 1 233 VAL 233 233 233 VAL VAL D . n 
D 1 234 VAL 234 234 234 VAL VAL D . n 
D 1 235 GLU 235 235 235 GLU GLU D . n 
D 1 236 GLY 236 236 236 GLY GLY D . n 
D 1 237 GLY 237 237 237 GLY GLY D . n 
D 1 238 TYR 238 238 238 TYR TYR D . n 
D 1 239 GLU 239 239 239 GLU GLU D . n 
D 1 240 VAL 240 240 240 VAL VAL D . n 
D 1 241 LEU 241 241 241 LEU LEU D . n 
D 1 242 ASP 242 242 242 ASP ASP D . n 
D 1 243 MET 243 243 243 MET MET D . n 
D 1 244 LYS 244 244 244 LYS LYS D . n 
D 1 245 GLY 245 245 245 GLY GLY D . n 
D 1 246 TYR 246 246 246 TYR TYR D . n 
D 1 247 THR 247 247 247 THR THR D . n 
D 1 248 SER 248 248 248 SER SER D . n 
D 1 249 TRP 249 249 249 TRP TRP D . n 
D 1 250 ALA 250 250 250 ALA ALA D . n 
D 1 251 ILE 251 251 251 ILE ILE D . n 
D 1 252 GLY 252 252 252 GLY GLY D . n 
D 1 253 LEU 253 253 253 LEU LEU D . n 
D 1 254 SER 254 254 254 SER SER D . n 
D 1 255 VAL 255 255 255 VAL VAL D . n 
D 1 256 THR 256 256 256 THR THR D . n 
D 1 257 ASP 257 257 257 ASP ASP D . n 
D 1 258 LEU 258 258 258 LEU LEU D . n 
D 1 259 ALA 259 259 259 ALA ALA D . n 
D 1 260 ARG 260 260 260 ARG ARG D . n 
D 1 261 SER 261 261 261 SER SER D . n 
D 1 262 ILE 262 262 262 ILE ILE D . n 
D 1 263 LEU 263 263 263 LEU LEU D . n 
D 1 264 LYS 264 264 264 LYS LYS D . n 
D 1 265 ASN 265 265 265 ASN ASN D . n 
D 1 266 LEU 266 266 266 LEU LEU D . n 
D 1 267 LYS 267 267 267 LYS LYS D . n 
D 1 268 ARG 268 268 268 ARG ARG D . n 
D 1 269 VAL 269 269 269 VAL VAL D . n 
D 1 270 HIS 270 270 270 HIS HIS D . n 
D 1 271 PRO 271 271 271 PRO PRO D . n 
D 1 272 VAL 272 272 272 VAL VAL D . n 
D 1 273 THR 273 273 273 THR THR D . n 
D 1 274 THR 274 274 274 THR THR D . n 
D 1 275 LEU 275 275 275 LEU LEU D . n 
D 1 276 VAL 276 276 276 VAL VAL D . n 
D 1 277 LYS 277 277 277 LYS LYS D . n 
D 1 278 GLY 278 278 278 GLY GLY D . n 
D 1 279 PHE 279 279 279 PHE PHE D . n 
D 1 280 HIS 280 280 280 HIS HIS D . n 
D 1 281 GLY 281 281 281 GLY GLY D . n 
D 1 282 ILE 282 282 282 ILE ILE D . n 
D 1 283 LYS 283 283 283 LYS LYS D . n 
D 1 284 GLU 284 284 284 GLU GLU D . n 
D 1 285 GLU 285 285 285 GLU GLU D . n 
D 1 286 VAL 286 286 286 VAL VAL D . n 
D 1 287 PHE 287 287 287 PHE PHE D . n 
D 1 288 LEU 288 288 288 LEU LEU D . n 
D 1 289 SER 289 289 289 SER SER D . n 
D 1 290 ILE 290 290 290 ILE ILE D . n 
D 1 291 PRO 291 291 291 PRO PRO D . n 
D 1 292 CYS 292 292 292 CYS CYS D . n 
D 1 293 VAL 293 293 293 VAL VAL D . n 
D 1 294 LEU 294 294 294 LEU LEU D . n 
D 1 295 GLY 295 295 295 GLY GLY D . n 
D 1 296 GLU 296 296 296 GLU GLU D . n 
D 1 297 SER 297 297 297 SER SER D . n 
D 1 298 GLY 298 298 298 GLY GLY D . n 
D 1 299 ILE 299 299 299 ILE ILE D . n 
D 1 300 THR 300 300 300 THR THR D . n 
D 1 301 ASP 301 301 301 ASP ASP D . n 
D 1 302 PHE 302 302 302 PHE PHE D . n 
D 1 303 VAL 303 303 303 VAL VAL D . n 
D 1 304 LYS 304 304 304 LYS LYS D . n 
D 1 305 VAL 305 305 305 VAL VAL D . n 
D 1 306 ASN 306 306 306 ASN ASN D . n 
D 1 307 MET 307 307 307 MET MET D . n 
D 1 308 THR 308 308 308 THR THR D . n 
D 1 309 ALA 309 309 309 ALA ALA D . n 
D 1 310 GLU 310 310 310 GLU GLU D . n 
D 1 311 GLU 311 311 311 GLU GLU D . n 
D 1 312 GLU 312 312 312 GLU GLU D . n 
D 1 313 GLY 313 313 313 GLY GLY D . n 
D 1 314 LEU 314 314 314 LEU LEU D . n 
D 1 315 LEU 315 315 315 LEU LEU D . n 
D 1 316 LYS 316 316 316 LYS LYS D . n 
D 1 317 LYS 317 317 317 LYS LYS D . n 
D 1 318 SER 318 318 318 SER SER D . n 
D 1 319 ALA 319 319 319 ALA ALA D . n 
D 1 320 ASP 320 320 320 ASP ASP D . n 
D 1 321 THR 321 321 321 THR THR D . n 
D 1 322 LEU 322 322 322 LEU LEU D . n 
D 1 323 TRP 323 323 323 TRP TRP D . n 
D 1 324 ASN 324 324 324 ASN ASN D . n 
D 1 325 MET 325 325 325 MET MET D . n 
D 1 326 GLN 326 326 326 GLN GLN D . n 
D 1 327 LYS 327 327 327 LYS LYS D . n 
D 1 328 ASN 328 328 328 ASN ASN D . n 
D 1 329 LEU 329 329 329 LEU LEU D . n 
D 1 330 GLU 330 330 330 GLU GLU D . n 
D 1 331 LEU 331 331 331 LEU LEU D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1  332 332 HOH HOH A . 
E 2 HOH 2  334 334 HOH HOH A . 
E 2 HOH 3  337 337 HOH HOH A . 
E 2 HOH 4  344 344 HOH HOH A . 
E 2 HOH 5  345 345 HOH HOH A . 
E 2 HOH 6  346 346 HOH HOH A . 
E 2 HOH 7  347 347 HOH HOH A . 
E 2 HOH 8  350 350 HOH HOH A . 
E 2 HOH 9  353 353 HOH HOH A . 
E 2 HOH 10 355 355 HOH HOH A . 
E 2 HOH 11 357 357 HOH HOH A . 
E 2 HOH 12 361 361 HOH HOH A . 
E 2 HOH 13 364 364 HOH HOH A . 
E 2 HOH 14 365 365 HOH HOH A . 
E 2 HOH 15 374 374 HOH HOH A . 
E 2 HOH 16 379 379 HOH HOH A . 
E 2 HOH 17 385 385 HOH HOH A . 
E 2 HOH 18 388 388 HOH HOH A . 
E 2 HOH 19 389 389 HOH HOH A . 
E 2 HOH 20 395 395 HOH HOH A . 
E 2 HOH 21 402 402 HOH HOH A . 
E 2 HOH 22 406 406 HOH HOH A . 
E 2 HOH 23 411 411 HOH HOH A . 
E 2 HOH 24 412 412 HOH HOH A . 
E 2 HOH 25 413 413 HOH HOH A . 
E 2 HOH 26 428 428 HOH HOH A . 
E 2 HOH 27 433 433 HOH HOH A . 
E 2 HOH 28 434 434 HOH HOH A . 
E 2 HOH 29 436 436 HOH HOH A . 
F 2 HOH 1  377 377 HOH HOH D . 
F 2 HOH 2  409 409 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 19540 ? 
1 MORE         -138  ? 
1 'SSA (A^2)'  46680 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1989-04-19 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             PROLSQ 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_entry_details.entry_id             2LDX 
_pdbx_entry_details.compound_details     
;THE SECONDARY STRUCTURE SPECIFICATIONS ARE THOSE PRODUCED
BY PROGRAM *DSSP* OF W. KABSCH AND C. SANDER.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CB  B SER 297 ? ? OE1 C GLU 14  ? ? 1.54 
2  1 OE1 A GLU 14  ? ? CB  D SER 297 ? ? 1.55 
3  1 CB  A SER 297 ? ? OE1 D GLU 14  ? ? 1.55 
4  1 OE1 B GLU 14  ? ? CB  C SER 297 ? ? 1.55 
5  1 OD1 A ASN 204 ? ? OD1 B ASN 204 ? ? 1.91 
6  1 OD1 C ASN 204 ? ? OD1 D ASN 204 ? ? 1.91 
7  1 OG  A SER 297 ? ? OE1 D GLU 14  ? ? 2.10 
8  1 OG  B SER 297 ? ? OE1 C GLU 14  ? ? 2.10 
9  1 OE1 B GLU 14  ? ? OG  C SER 297 ? ? 2.11 
10 1 OE1 A GLU 14  ? ? OG  D SER 297 ? ? 2.11 
11 1 CG  D ARG 19  ? ? O   D HOH 409 ? ? 2.13 
12 1 O   A SER 201 ? ? CB  B THR 209 ? ? 2.13 
13 1 CB  C THR 209 ? ? O   D SER 201 ? ? 2.13 
14 1 CB  A THR 209 ? ? O   B SER 201 ? ? 2.13 
15 1 O   C SER 201 ? ? CB  D THR 209 ? ? 2.13 
16 1 CB  C SER 212 ? ? CG1 D VAL 208 ? ? 2.13 
17 1 CG1 C VAL 208 ? ? CB  D SER 212 ? ? 2.14 
18 1 CG1 A VAL 208 ? ? CB  B SER 212 ? ? 2.14 
19 1 CB  A SER 212 ? ? CG1 B VAL 208 ? ? 2.14 
20 1 O   A THR 209 ? ? OD1 B ASN 306 ? ? 2.17 
21 1 OD1 A ASN 306 ? ? O   B THR 209 ? ? 2.17 
22 1 O   C THR 209 ? ? OD1 D ASN 306 ? ? 2.17 
23 1 OD1 C ASN 306 ? ? O   D THR 209 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 CA  C ARG 111 ? ? 1_555 CD  D GLU 330 ? ? 1_566 0.93 
2  1 CD  C GLU 330 ? ? 1_555 CA  D ARG 111 ? ? 1_566 0.93 
3  1 OE2 C GLU 330 ? ? 1_555 CB  D ARG 111 ? ? 1_566 0.97 
4  1 CB  C ARG 111 ? ? 1_555 OE2 D GLU 330 ? ? 1_566 0.97 
5  1 CA  C ASN 126 ? ? 1_555 O   A HOH 345 ? ? 1_556 1.06 
6  1 CD  C GLU 330 ? ? 1_555 CB  D ARG 111 ? ? 1_566 1.06 
7  1 CB  C ARG 111 ? ? 1_555 CD  D GLU 330 ? ? 1_566 1.06 
8  1 N   C ASN 126 ? ? 1_555 O   A HOH 345 ? ? 1_556 1.15 
9  1 CA  C ARG 111 ? ? 1_555 OE2 D GLU 330 ? ? 1_566 1.19 
10 1 OE2 C GLU 330 ? ? 1_555 CA  D ARG 111 ? ? 1_566 1.19 
11 1 NE2 C GLN 110 ? ? 1_555 NE2 D GLN 110 ? ? 1_566 1.37 
12 1 OE1 C GLU 330 ? ? 1_555 CG  D ARG 111 ? ? 1_566 1.57 
13 1 CG  C ARG 111 ? ? 1_555 OE1 D GLU 330 ? ? 1_566 1.57 
14 1 N   C GLN 110 ? ? 1_555 O   D GLU 330 ? ? 1_566 1.57 
15 1 O   C GLU 330 ? ? 1_555 N   D GLN 110 ? ? 1_566 1.57 
16 1 CB  C ASN 126 ? ? 1_555 O   A HOH 345 ? ? 1_556 1.59 
17 1 OE1 C GLU 330 ? ? 1_555 CB  D ARG 111 ? ? 1_566 1.62 
18 1 CB  C ARG 111 ? ? 1_555 OE1 D GLU 330 ? ? 1_566 1.62 
19 1 OE1 C GLU 330 ? ? 1_555 CA  D ARG 111 ? ? 1_566 1.66 
20 1 CA  C ARG 111 ? ? 1_555 OE1 D GLU 330 ? ? 1_566 1.66 
21 1 OE2 C GLU 330 ? ? 1_555 N   D ARG 111 ? ? 1_566 1.72 
22 1 N   C ARG 111 ? ? 1_555 OE2 D GLU 330 ? ? 1_566 1.73 
23 1 CG  C GLU 330 ? ? 1_555 N   D ARG 111 ? ? 1_566 1.77 
24 1 N   C ARG 111 ? ? 1_555 CG  D GLU 330 ? ? 1_566 1.77 
25 1 CG  C ASN 126 ? ? 1_555 O   A HOH 345 ? ? 1_556 1.85 
26 1 CD  C GLU 330 ? ? 1_555 N   D ARG 111 ? ? 1_566 1.88 
27 1 N   C ARG 111 ? ? 1_555 CD  D GLU 330 ? ? 1_566 1.88 
28 1 CA  C ARG 111 ? ? 1_555 CG  D GLU 330 ? ? 1_566 1.91 
29 1 CG  C GLU 330 ? ? 1_555 CA  D ARG 111 ? ? 1_566 1.91 
30 1 NE2 C GLN 110 ? ? 1_555 CD  D GLN 110 ? ? 1_566 1.93 
31 1 CD  C GLN 110 ? ? 1_555 NE2 D GLN 110 ? ? 1_566 1.93 
32 1 C   C ARG 111 ? ? 1_555 OE2 D GLU 330 ? ? 1_566 1.99 
33 1 OE2 C GLU 330 ? ? 1_555 C   D ARG 111 ? ? 1_566 1.99 
34 1 O   C LEU 331 ? ? 1_555 OE1 D GLN 110 ? ? 1_566 2.07 
35 1 OE1 C GLN 110 ? ? 1_555 O   D LEU 331 ? ? 1_566 2.07 
36 1 CA  C GLN 110 ? ? 1_555 O   D GLU 330 ? ? 1_566 2.13 
37 1 O   C GLU 330 ? ? 1_555 CA  D GLN 110 ? ? 1_566 2.13 
38 1 CD  C GLU 330 ? ? 1_555 CG  D ARG 111 ? ? 1_566 2.14 
39 1 CG  C ARG 111 ? ? 1_555 CD  D GLU 330 ? ? 1_566 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CZ A ARG 58 ? ? NH1 A ARG 58 ? ? 1.404 1.326 0.078 0.013 N 
2 1 CZ B ARG 58 ? ? NH1 B ARG 58 ? ? 1.404 1.326 0.078 0.013 N 
3 1 CZ C ARG 58 ? ? NH1 C ARG 58 ? ? 1.404 1.326 0.078 0.013 N 
4 1 CZ D ARG 58 ? ? NH1 D ARG 58 ? ? 1.404 1.326 0.078 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 CA  A LEU 17  ? ? CB A LEU 17  ? ? CG  A LEU 17  ? ? 131.29 115.30 15.99  2.30 N 
2   1 CB  A CYS 34  ? ? CA A CYS 34  ? ? C   A CYS 34  ? ? 125.10 111.50 13.60  1.20 N 
3   1 CA  A CYS 34  ? ? CB A CYS 34  ? ? SG  A CYS 34  ? ? 127.47 114.20 13.27  1.10 N 
4   1 CB  A LEU 43  ? ? CA A LEU 43  ? ? C   A LEU 43  ? ? 123.32 110.20 13.12  1.90 N 
5   1 OE1 A GLU 46  ? ? CD A GLU 46  ? ? OE2 A GLU 46  ? ? 112.88 123.30 -10.42 1.20 N 
6   1 CG  A GLU 46  ? ? CD A GLU 46  ? ? OE1 A GLU 46  ? ? 131.28 118.30 12.98  2.00 N 
7   1 CB  A LEU 49  ? ? CA A LEU 49  ? ? C   A LEU 49  ? ? 122.68 110.20 12.48  1.90 N 
8   1 CB  A ASP 55  ? ? CG A ASP 55  ? ? OD1 A ASP 55  ? ? 124.47 118.30 6.17   0.90 N 
9   1 CA  A ARG 58  ? ? CB A ARG 58  ? ? CG  A ARG 58  ? ? 137.03 113.40 23.63  2.20 N 
10  1 CD  A ARG 58  ? ? NE A ARG 58  ? ? CZ  A ARG 58  ? ? 153.52 123.60 29.92  1.40 N 
11  1 CA  A LYS 75  ? ? CB A LYS 75  ? ? CG  A LYS 75  ? ? 132.64 113.40 19.24  2.20 N 
12  1 CA  A MET 99  ? ? CB A MET 99  ? ? CG  A MET 99  ? ? 128.23 113.30 14.93  1.70 N 
13  1 NE  A ARG 105 ? ? CZ A ARG 105 ? ? NH1 A ARG 105 ? ? 124.27 120.30 3.97   0.50 N 
14  1 NE  A ARG 111 ? ? CZ A ARG 111 ? ? NH1 A ARG 111 ? ? 124.59 120.30 4.29   0.50 N 
15  1 CB  A VAL 120 ? ? CA A VAL 120 ? ? C   A VAL 120 ? ? 128.85 111.40 17.45  1.90 N 
16  1 CA  A ASP 129 ? ? CB A ASP 129 ? ? CG  A ASP 129 ? ? 127.39 113.40 13.99  2.20 N 
17  1 CB  A ASP 129 ? ? CG A ASP 129 ? ? OD1 A ASP 129 ? ? 124.13 118.30 5.83   0.90 N 
18  1 CA  A THR 136 ? ? C  A THR 136 ? ? O   A THR 136 ? ? 103.54 120.10 -16.56 2.10 N 
19  1 CA  A THR 136 ? ? C  A THR 136 ? ? N   A ASN 137 ? ? 131.83 117.20 14.63  2.20 Y 
20  1 N   A ASN 137 ? ? CA A ASN 137 ? ? C   A ASN 137 ? ? 142.24 111.00 31.24  2.70 N 
21  1 CA  A ASN 137 ? ? C  A ASN 137 ? ? N   A PRO 138 ? ? 137.87 117.10 20.77  2.80 Y 
22  1 O   A ASN 137 ? ? C  A ASN 137 ? ? N   A PRO 138 ? ? 107.89 121.10 -13.21 1.90 Y 
23  1 CA  A PRO 138 ? ? N  A PRO 138 ? ? CD  A PRO 138 ? ? 98.53  111.50 -12.97 1.40 N 
24  1 CB  A PRO 138 ? ? CA A PRO 138 ? ? C   A PRO 138 ? ? 132.29 112.00 20.29  2.50 N 
25  1 N   A GLY 155 ? ? CA A GLY 155 ? ? C   A GLY 155 ? ? 94.69  113.10 -18.41 2.50 N 
26  1 CG  A ARG 170 ? ? CD A ARG 170 ? ? NE  A ARG 170 ? ? 125.63 111.80 13.83  2.10 N 
27  1 CD  A ARG 170 ? ? NE A ARG 170 ? ? CZ  A ARG 170 ? ? 137.98 123.60 14.38  1.40 N 
28  1 NH1 A ARG 170 ? ? CZ A ARG 170 ? ? NH2 A ARG 170 ? ? 112.44 119.40 -6.96  1.10 N 
29  1 NE  A ARG 170 ? ? CZ A ARG 170 ? ? NH1 A ARG 170 ? ? 130.61 120.30 10.31  0.50 N 
30  1 NE  A ARG 170 ? ? CZ A ARG 170 ? ? NH2 A ARG 170 ? ? 116.27 120.30 -4.03  0.50 N 
31  1 CA  A GLU 175 ? ? CB A GLU 175 ? ? CG  A GLU 175 ? ? 130.56 113.40 17.16  2.20 N 
32  1 OE1 A GLU 175 ? ? CD A GLU 175 ? ? OE2 A GLU 175 ? ? 115.00 123.30 -8.30  1.20 N 
33  1 C   A ASN 204 ? ? N  A VAL 205 ? ? CA  A VAL 205 ? ? 140.86 121.70 19.16  2.50 Y 
34  1 C   A GLY 218 ? ? N  A THR 219 ? ? CA  A THR 219 ? ? 144.68 121.70 22.98  2.50 Y 
35  1 N   A THR 219 ? ? CA A THR 219 ? ? CB  A THR 219 ? ? 122.13 110.30 11.83  1.90 N 
36  1 C   A LYS 223 ? ? N  A GLN 224 ? ? CA  A GLN 224 ? ? 140.31 121.70 18.61  2.50 Y 
37  1 NE  A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 123.83 120.30 3.53   0.50 N 
38  1 CA  A ARG 268 ? ? CB A ARG 268 ? ? CG  A ARG 268 ? ? 127.66 113.40 14.26  2.20 N 
39  1 NE  A ARG 268 ? ? CZ A ARG 268 ? ? NH1 A ARG 268 ? ? 124.22 120.30 3.92   0.50 N 
40  1 CA  A GLU 285 ? ? CB A GLU 285 ? ? CG  A GLU 285 ? ? 145.20 113.40 31.80  2.20 N 
41  1 CA  A LEU 288 ? ? CB A LEU 288 ? ? CG  A LEU 288 ? ? 130.45 115.30 15.15  2.30 N 
42  1 N   A ASN 324 ? ? CA A ASN 324 ? ? CB  A ASN 324 ? ? 125.64 110.60 15.04  1.80 N 
43  1 C   A ASN 328 ? ? N  A LEU 329 ? ? CA  A LEU 329 ? ? 137.00 121.70 15.30  2.50 Y 
44  1 CA  B LEU 17  ? ? CB B LEU 17  ? ? CG  B LEU 17  ? ? 131.29 115.30 15.99  2.30 N 
45  1 CB  B CYS 34  ? ? CA B CYS 34  ? ? C   B CYS 34  ? ? 125.10 111.50 13.60  1.20 N 
46  1 CA  B CYS 34  ? ? CB B CYS 34  ? ? SG  B CYS 34  ? ? 127.47 114.20 13.27  1.10 N 
47  1 CB  B LEU 43  ? ? CA B LEU 43  ? ? C   B LEU 43  ? ? 123.32 110.20 13.12  1.90 N 
48  1 OE1 B GLU 46  ? ? CD B GLU 46  ? ? OE2 B GLU 46  ? ? 112.88 123.30 -10.42 1.20 N 
49  1 CG  B GLU 46  ? ? CD B GLU 46  ? ? OE1 B GLU 46  ? ? 131.28 118.30 12.98  2.00 N 
50  1 CB  B LEU 49  ? ? CA B LEU 49  ? ? C   B LEU 49  ? ? 122.68 110.20 12.48  1.90 N 
51  1 CB  B ASP 55  ? ? CG B ASP 55  ? ? OD1 B ASP 55  ? ? 124.47 118.30 6.17   0.90 N 
52  1 CA  B ARG 58  ? ? CB B ARG 58  ? ? CG  B ARG 58  ? ? 137.03 113.40 23.63  2.20 N 
53  1 CD  B ARG 58  ? ? NE B ARG 58  ? ? CZ  B ARG 58  ? ? 153.52 123.60 29.92  1.40 N 
54  1 CA  B LYS 75  ? ? CB B LYS 75  ? ? CG  B LYS 75  ? ? 132.64 113.40 19.24  2.20 N 
55  1 CA  B MET 99  ? ? CB B MET 99  ? ? CG  B MET 99  ? ? 128.23 113.30 14.93  1.70 N 
56  1 NE  B ARG 105 ? ? CZ B ARG 105 ? ? NH1 B ARG 105 ? ? 124.27 120.30 3.97   0.50 N 
57  1 NE  B ARG 111 ? ? CZ B ARG 111 ? ? NH1 B ARG 111 ? ? 124.59 120.30 4.29   0.50 N 
58  1 CB  B VAL 120 ? ? CA B VAL 120 ? ? C   B VAL 120 ? ? 128.85 111.40 17.45  1.90 N 
59  1 CA  B ASP 129 ? ? CB B ASP 129 ? ? CG  B ASP 129 ? ? 127.39 113.40 13.99  2.20 N 
60  1 CB  B ASP 129 ? ? CG B ASP 129 ? ? OD1 B ASP 129 ? ? 124.13 118.30 5.83   0.90 N 
61  1 CA  B THR 136 ? ? C  B THR 136 ? ? O   B THR 136 ? ? 103.54 120.10 -16.56 2.10 N 
62  1 CA  B THR 136 ? ? C  B THR 136 ? ? N   B ASN 137 ? ? 131.83 117.20 14.63  2.20 Y 
63  1 N   B ASN 137 ? ? CA B ASN 137 ? ? C   B ASN 137 ? ? 142.24 111.00 31.24  2.70 N 
64  1 CA  B ASN 137 ? ? C  B ASN 137 ? ? N   B PRO 138 ? ? 137.87 117.10 20.77  2.80 Y 
65  1 O   B ASN 137 ? ? C  B ASN 137 ? ? N   B PRO 138 ? ? 107.89 121.10 -13.21 1.90 Y 
66  1 CA  B PRO 138 ? ? N  B PRO 138 ? ? CD  B PRO 138 ? ? 98.53  111.50 -12.97 1.40 N 
67  1 CB  B PRO 138 ? ? CA B PRO 138 ? ? C   B PRO 138 ? ? 132.29 112.00 20.29  2.50 N 
68  1 N   B GLY 155 ? ? CA B GLY 155 ? ? C   B GLY 155 ? ? 94.69  113.10 -18.41 2.50 N 
69  1 CG  B ARG 170 ? ? CD B ARG 170 ? ? NE  B ARG 170 ? ? 125.63 111.80 13.83  2.10 N 
70  1 CD  B ARG 170 ? ? NE B ARG 170 ? ? CZ  B ARG 170 ? ? 137.98 123.60 14.38  1.40 N 
71  1 NH1 B ARG 170 ? ? CZ B ARG 170 ? ? NH2 B ARG 170 ? ? 112.44 119.40 -6.96  1.10 N 
72  1 NE  B ARG 170 ? ? CZ B ARG 170 ? ? NH1 B ARG 170 ? ? 130.61 120.30 10.31  0.50 N 
73  1 NE  B ARG 170 ? ? CZ B ARG 170 ? ? NH2 B ARG 170 ? ? 116.27 120.30 -4.03  0.50 N 
74  1 CA  B GLU 175 ? ? CB B GLU 175 ? ? CG  B GLU 175 ? ? 130.56 113.40 17.16  2.20 N 
75  1 OE1 B GLU 175 ? ? CD B GLU 175 ? ? OE2 B GLU 175 ? ? 115.00 123.30 -8.30  1.20 N 
76  1 C   B ASN 204 ? ? N  B VAL 205 ? ? CA  B VAL 205 ? ? 140.86 121.70 19.16  2.50 Y 
77  1 C   B GLY 218 ? ? N  B THR 219 ? ? CA  B THR 219 ? ? 144.68 121.70 22.98  2.50 Y 
78  1 N   B THR 219 ? ? CA B THR 219 ? ? CB  B THR 219 ? ? 122.13 110.30 11.83  1.90 N 
79  1 C   B LYS 223 ? ? N  B GLN 224 ? ? CA  B GLN 224 ? ? 140.31 121.70 18.61  2.50 Y 
80  1 NE  B ARG 260 ? ? CZ B ARG 260 ? ? NH1 B ARG 260 ? ? 123.83 120.30 3.53   0.50 N 
81  1 CA  B ARG 268 ? ? CB B ARG 268 ? ? CG  B ARG 268 ? ? 127.66 113.40 14.26  2.20 N 
82  1 NE  B ARG 268 ? ? CZ B ARG 268 ? ? NH1 B ARG 268 ? ? 124.22 120.30 3.92   0.50 N 
83  1 CA  B GLU 285 ? ? CB B GLU 285 ? ? CG  B GLU 285 ? ? 145.20 113.40 31.80  2.20 N 
84  1 CA  B LEU 288 ? ? CB B LEU 288 ? ? CG  B LEU 288 ? ? 130.45 115.30 15.15  2.30 N 
85  1 N   B ASN 324 ? ? CA B ASN 324 ? ? CB  B ASN 324 ? ? 125.64 110.60 15.04  1.80 N 
86  1 C   B ASN 328 ? ? N  B LEU 329 ? ? CA  B LEU 329 ? ? 137.00 121.70 15.30  2.50 Y 
87  1 CA  C LEU 17  ? ? CB C LEU 17  ? ? CG  C LEU 17  ? ? 131.29 115.30 15.99  2.30 N 
88  1 CB  C CYS 34  ? ? CA C CYS 34  ? ? C   C CYS 34  ? ? 125.10 111.50 13.60  1.20 N 
89  1 CA  C CYS 34  ? ? CB C CYS 34  ? ? SG  C CYS 34  ? ? 127.47 114.20 13.27  1.10 N 
90  1 CB  C LEU 43  ? ? CA C LEU 43  ? ? C   C LEU 43  ? ? 123.32 110.20 13.12  1.90 N 
91  1 OE1 C GLU 46  ? ? CD C GLU 46  ? ? OE2 C GLU 46  ? ? 112.88 123.30 -10.42 1.20 N 
92  1 CG  C GLU 46  ? ? CD C GLU 46  ? ? OE1 C GLU 46  ? ? 131.28 118.30 12.98  2.00 N 
93  1 CB  C LEU 49  ? ? CA C LEU 49  ? ? C   C LEU 49  ? ? 122.68 110.20 12.48  1.90 N 
94  1 CB  C ASP 55  ? ? CG C ASP 55  ? ? OD1 C ASP 55  ? ? 124.47 118.30 6.17   0.90 N 
95  1 CA  C ARG 58  ? ? CB C ARG 58  ? ? CG  C ARG 58  ? ? 137.03 113.40 23.63  2.20 N 
96  1 CD  C ARG 58  ? ? NE C ARG 58  ? ? CZ  C ARG 58  ? ? 153.52 123.60 29.92  1.40 N 
97  1 CA  C LYS 75  ? ? CB C LYS 75  ? ? CG  C LYS 75  ? ? 132.64 113.40 19.24  2.20 N 
98  1 CA  C MET 99  ? ? CB C MET 99  ? ? CG  C MET 99  ? ? 128.23 113.30 14.93  1.70 N 
99  1 NE  C ARG 105 ? ? CZ C ARG 105 ? ? NH1 C ARG 105 ? ? 124.27 120.30 3.97   0.50 N 
100 1 NE  C ARG 111 ? ? CZ C ARG 111 ? ? NH1 C ARG 111 ? ? 124.59 120.30 4.29   0.50 N 
101 1 CB  C VAL 120 ? ? CA C VAL 120 ? ? C   C VAL 120 ? ? 128.85 111.40 17.45  1.90 N 
102 1 CA  C ASP 129 ? ? CB C ASP 129 ? ? CG  C ASP 129 ? ? 127.39 113.40 13.99  2.20 N 
103 1 CB  C ASP 129 ? ? CG C ASP 129 ? ? OD1 C ASP 129 ? ? 124.13 118.30 5.83   0.90 N 
104 1 CA  C THR 136 ? ? C  C THR 136 ? ? O   C THR 136 ? ? 103.54 120.10 -16.56 2.10 N 
105 1 CA  C THR 136 ? ? C  C THR 136 ? ? N   C ASN 137 ? ? 131.83 117.20 14.63  2.20 Y 
106 1 N   C ASN 137 ? ? CA C ASN 137 ? ? C   C ASN 137 ? ? 142.24 111.00 31.24  2.70 N 
107 1 CA  C ASN 137 ? ? C  C ASN 137 ? ? N   C PRO 138 ? ? 137.87 117.10 20.77  2.80 Y 
108 1 O   C ASN 137 ? ? C  C ASN 137 ? ? N   C PRO 138 ? ? 107.89 121.10 -13.21 1.90 Y 
109 1 CA  C PRO 138 ? ? N  C PRO 138 ? ? CD  C PRO 138 ? ? 98.53  111.50 -12.97 1.40 N 
110 1 CB  C PRO 138 ? ? CA C PRO 138 ? ? C   C PRO 138 ? ? 132.29 112.00 20.29  2.50 N 
111 1 N   C GLY 155 ? ? CA C GLY 155 ? ? C   C GLY 155 ? ? 94.69  113.10 -18.41 2.50 N 
112 1 CG  C ARG 170 ? ? CD C ARG 170 ? ? NE  C ARG 170 ? ? 125.63 111.80 13.83  2.10 N 
113 1 CD  C ARG 170 ? ? NE C ARG 170 ? ? CZ  C ARG 170 ? ? 137.98 123.60 14.38  1.40 N 
114 1 NH1 C ARG 170 ? ? CZ C ARG 170 ? ? NH2 C ARG 170 ? ? 112.44 119.40 -6.96  1.10 N 
115 1 NE  C ARG 170 ? ? CZ C ARG 170 ? ? NH1 C ARG 170 ? ? 130.61 120.30 10.31  0.50 N 
116 1 NE  C ARG 170 ? ? CZ C ARG 170 ? ? NH2 C ARG 170 ? ? 116.27 120.30 -4.03  0.50 N 
117 1 CA  C GLU 175 ? ? CB C GLU 175 ? ? CG  C GLU 175 ? ? 130.56 113.40 17.16  2.20 N 
118 1 OE1 C GLU 175 ? ? CD C GLU 175 ? ? OE2 C GLU 175 ? ? 115.00 123.30 -8.30  1.20 N 
119 1 C   C ASN 204 ? ? N  C VAL 205 ? ? CA  C VAL 205 ? ? 140.86 121.70 19.16  2.50 Y 
120 1 C   C GLY 218 ? ? N  C THR 219 ? ? CA  C THR 219 ? ? 144.68 121.70 22.98  2.50 Y 
121 1 N   C THR 219 ? ? CA C THR 219 ? ? CB  C THR 219 ? ? 122.13 110.30 11.83  1.90 N 
122 1 C   C LYS 223 ? ? N  C GLN 224 ? ? CA  C GLN 224 ? ? 140.31 121.70 18.61  2.50 Y 
123 1 NE  C ARG 260 ? ? CZ C ARG 260 ? ? NH1 C ARG 260 ? ? 123.83 120.30 3.53   0.50 N 
124 1 CA  C ARG 268 ? ? CB C ARG 268 ? ? CG  C ARG 268 ? ? 127.66 113.40 14.26  2.20 N 
125 1 NE  C ARG 268 ? ? CZ C ARG 268 ? ? NH1 C ARG 268 ? ? 124.22 120.30 3.92   0.50 N 
126 1 CA  C GLU 285 ? ? CB C GLU 285 ? ? CG  C GLU 285 ? ? 145.20 113.40 31.80  2.20 N 
127 1 CA  C LEU 288 ? ? CB C LEU 288 ? ? CG  C LEU 288 ? ? 130.45 115.30 15.15  2.30 N 
128 1 N   C ASN 324 ? ? CA C ASN 324 ? ? CB  C ASN 324 ? ? 125.64 110.60 15.04  1.80 N 
129 1 C   C ASN 328 ? ? N  C LEU 329 ? ? CA  C LEU 329 ? ? 137.00 121.70 15.30  2.50 Y 
130 1 CA  D LEU 17  ? ? CB D LEU 17  ? ? CG  D LEU 17  ? ? 131.29 115.30 15.99  2.30 N 
131 1 CB  D CYS 34  ? ? CA D CYS 34  ? ? C   D CYS 34  ? ? 125.10 111.50 13.60  1.20 N 
132 1 CA  D CYS 34  ? ? CB D CYS 34  ? ? SG  D CYS 34  ? ? 127.47 114.20 13.27  1.10 N 
133 1 CB  D LEU 43  ? ? CA D LEU 43  ? ? C   D LEU 43  ? ? 123.32 110.20 13.12  1.90 N 
134 1 OE1 D GLU 46  ? ? CD D GLU 46  ? ? OE2 D GLU 46  ? ? 112.88 123.30 -10.42 1.20 N 
135 1 CG  D GLU 46  ? ? CD D GLU 46  ? ? OE1 D GLU 46  ? ? 131.28 118.30 12.98  2.00 N 
136 1 CB  D LEU 49  ? ? CA D LEU 49  ? ? C   D LEU 49  ? ? 122.68 110.20 12.48  1.90 N 
137 1 CB  D ASP 55  ? ? CG D ASP 55  ? ? OD1 D ASP 55  ? ? 124.47 118.30 6.17   0.90 N 
138 1 CA  D ARG 58  ? ? CB D ARG 58  ? ? CG  D ARG 58  ? ? 137.03 113.40 23.63  2.20 N 
139 1 CD  D ARG 58  ? ? NE D ARG 58  ? ? CZ  D ARG 58  ? ? 153.52 123.60 29.92  1.40 N 
140 1 CA  D LYS 75  ? ? CB D LYS 75  ? ? CG  D LYS 75  ? ? 132.64 113.40 19.24  2.20 N 
141 1 CA  D MET 99  ? ? CB D MET 99  ? ? CG  D MET 99  ? ? 128.23 113.30 14.93  1.70 N 
142 1 NE  D ARG 105 ? ? CZ D ARG 105 ? ? NH1 D ARG 105 ? ? 124.27 120.30 3.97   0.50 N 
143 1 NE  D ARG 111 ? ? CZ D ARG 111 ? ? NH1 D ARG 111 ? ? 124.59 120.30 4.29   0.50 N 
144 1 CB  D VAL 120 ? ? CA D VAL 120 ? ? C   D VAL 120 ? ? 128.85 111.40 17.45  1.90 N 
145 1 CA  D ASP 129 ? ? CB D ASP 129 ? ? CG  D ASP 129 ? ? 127.39 113.40 13.99  2.20 N 
146 1 CB  D ASP 129 ? ? CG D ASP 129 ? ? OD1 D ASP 129 ? ? 124.13 118.30 5.83   0.90 N 
147 1 CA  D THR 136 ? ? C  D THR 136 ? ? O   D THR 136 ? ? 103.54 120.10 -16.56 2.10 N 
148 1 CA  D THR 136 ? ? C  D THR 136 ? ? N   D ASN 137 ? ? 131.83 117.20 14.63  2.20 Y 
149 1 N   D ASN 137 ? ? CA D ASN 137 ? ? C   D ASN 137 ? ? 142.24 111.00 31.24  2.70 N 
150 1 CA  D ASN 137 ? ? C  D ASN 137 ? ? N   D PRO 138 ? ? 137.87 117.10 20.77  2.80 Y 
151 1 O   D ASN 137 ? ? C  D ASN 137 ? ? N   D PRO 138 ? ? 107.89 121.10 -13.21 1.90 Y 
152 1 CA  D PRO 138 ? ? N  D PRO 138 ? ? CD  D PRO 138 ? ? 98.53  111.50 -12.97 1.40 N 
153 1 CB  D PRO 138 ? ? CA D PRO 138 ? ? C   D PRO 138 ? ? 132.29 112.00 20.29  2.50 N 
154 1 N   D GLY 155 ? ? CA D GLY 155 ? ? C   D GLY 155 ? ? 94.69  113.10 -18.41 2.50 N 
155 1 CG  D ARG 170 ? ? CD D ARG 170 ? ? NE  D ARG 170 ? ? 125.63 111.80 13.83  2.10 N 
156 1 CD  D ARG 170 ? ? NE D ARG 170 ? ? CZ  D ARG 170 ? ? 137.98 123.60 14.38  1.40 N 
157 1 NH1 D ARG 170 ? ? CZ D ARG 170 ? ? NH2 D ARG 170 ? ? 112.44 119.40 -6.96  1.10 N 
158 1 NE  D ARG 170 ? ? CZ D ARG 170 ? ? NH1 D ARG 170 ? ? 130.61 120.30 10.31  0.50 N 
159 1 NE  D ARG 170 ? ? CZ D ARG 170 ? ? NH2 D ARG 170 ? ? 116.27 120.30 -4.03  0.50 N 
160 1 CA  D GLU 175 ? ? CB D GLU 175 ? ? CG  D GLU 175 ? ? 130.56 113.40 17.16  2.20 N 
161 1 OE1 D GLU 175 ? ? CD D GLU 175 ? ? OE2 D GLU 175 ? ? 115.00 123.30 -8.30  1.20 N 
162 1 C   D ASN 204 ? ? N  D VAL 205 ? ? CA  D VAL 205 ? ? 140.86 121.70 19.16  2.50 Y 
163 1 C   D GLY 218 ? ? N  D THR 219 ? ? CA  D THR 219 ? ? 144.68 121.70 22.98  2.50 Y 
164 1 N   D THR 219 ? ? CA D THR 219 ? ? CB  D THR 219 ? ? 122.13 110.30 11.83  1.90 N 
165 1 C   D LYS 223 ? ? N  D GLN 224 ? ? CA  D GLN 224 ? ? 140.31 121.70 18.61  2.50 Y 
166 1 NE  D ARG 260 ? ? CZ D ARG 260 ? ? NH1 D ARG 260 ? ? 123.83 120.30 3.53   0.50 N 
167 1 CA  D ARG 268 ? ? CB D ARG 268 ? ? CG  D ARG 268 ? ? 127.66 113.40 14.26  2.20 N 
168 1 NE  D ARG 268 ? ? CZ D ARG 268 ? ? NH1 D ARG 268 ? ? 124.22 120.30 3.92   0.50 N 
169 1 CA  D GLU 285 ? ? CB D GLU 285 ? ? CG  D GLU 285 ? ? 145.20 113.40 31.80  2.20 N 
170 1 CA  D LEU 288 ? ? CB D LEU 288 ? ? CG  D LEU 288 ? ? 130.45 115.30 15.15  2.30 N 
171 1 N   D ASN 324 ? ? CA D ASN 324 ? ? CB  D ASN 324 ? ? 125.64 110.60 15.04  1.80 N 
172 1 C   D ASN 328 ? ? N  D LEU 329 ? ? CA  D LEU 329 ? ? 137.00 121.70 15.30  2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 GLU A 5   ? ? -55.51  -7.65   
2   1 ASN A 10  ? ? -65.94  88.78   
3   1 LEU A 11  ? ? -66.29  87.75   
4   1 VAL A 12  ? ? 4.31    -136.52 
5   1 GLU A 14  ? ? 76.82   82.79   
6   1 ASP A 15  ? ? -140.55 41.58   
7   1 LEU A 17  ? ? -163.32 -163.55 
8   1 SER A 18  ? ? 171.58  157.84  
9   1 ARG A 19  ? ? -169.25 -96.89  
10  1 ASP A 29  ? ? -3.00   -54.46  
11  1 ALA A 35  ? ? -89.02  -80.56  
12  1 LEU A 40  ? ? -76.03  44.56   
13  1 ASP A 53  ? ? -101.82 48.23   
14  1 THR A 54  ? ? -12.37  -40.23  
15  1 ASP A 55  ? ? -59.97  -85.55  
16  1 ARG A 58  ? ? -58.06  -4.89   
17  1 SER A 68  ? ? -21.75  -74.29  
18  1 LEU A 69  ? ? -49.23  71.32   
19  1 PHE A 70  ? ? 169.63  -38.86  
20  1 ASN A 87  ? ? 74.39   43.82   
21  1 ALA A 97  ? ? 176.63  101.03  
22  1 MET A 99  ? ? 65.18   154.31  
23  1 VAL A 100 ? ? -179.47 116.80  
24  1 SER A 101 ? ? -37.77  101.14  
25  1 GLN A 103 ? ? -26.25  -71.13  
26  1 THR A 104 ? ? -35.13  120.70  
27  1 ARG A 105 ? ? -175.78 -145.54 
28  1 LEU A 108 ? ? -71.46  37.24   
29  1 LEU A 109 ? ? -102.25 -63.27  
30  1 MET A 116 ? ? -68.83  -74.19  
31  1 LYS A 117 ? ? -20.05  -43.67  
32  1 ALA A 118 ? ? -75.95  -72.05  
33  1 VAL A 120 ? ? -56.47  -125.18 
34  1 PRO A 121 ? ? -18.88  116.08  
35  1 ASN A 126 ? ? -75.82  -73.48  
36  1 THR A 136 ? ? -31.70  -83.21  
37  1 ASN A 137 ? ? -163.15 -48.00  
38  1 PRO A 138 ? ? 69.39   -5.97   
39  1 ASP A 140 ? ? -57.42  -78.40  
40  1 SER A 160 ? ? -36.80  -34.86  
41  1 LEU A 164 ? ? -46.90  -78.43  
42  1 TYR A 171 ? ? -58.33  -85.00  
43  1 PRO A 181 ? ? -68.49  1.93    
44  1 PRO A 198 ? ? -61.64  -172.07 
45  1 VAL A 205 ? ? 176.30  44.41   
46  1 ALA A 206 ? ? 156.94  -93.22  
47  1 THR A 209 ? ? 84.83   -39.11  
48  1 LEU A 210 ? ? -67.49  -126.91 
49  1 ILE A 217 ? ? 20.11   78.44   
50  1 THR A 219 ? ? 90.28   -111.59 
51  1 ASP A 220 ? ? 117.00  83.38   
52  1 LYS A 221 ? ? 115.03  -88.82  
53  1 ASN A 222 ? ? -54.27  23.61   
54  1 LYS A 223 ? ? 122.04  -166.55 
55  1 GLN A 224 ? ? 35.77   73.00   
56  1 HIS A 225 ? ? 31.43   117.41  
57  1 TRP A 226 ? ? 170.83  -29.21  
58  1 VAL A 233 ? ? -58.94  -72.04  
59  1 VAL A 234 ? ? -47.88  -70.07  
60  1 TYR A 246 ? ? 162.16  169.59  
61  1 SER A 248 ? ? -112.22 -85.86  
62  1 TRP A 249 ? ? -40.77  -73.68  
63  1 LYS A 277 ? ? -20.01  -43.13  
64  1 HIS A 280 ? ? 19.05   50.69   
65  1 GLU A 284 ? ? 172.47  124.10  
66  1 GLU A 285 ? ? -42.02  46.87   
67  1 ASN A 306 ? ? -107.50 79.68   
68  1 ALA A 309 ? ? -21.99  -61.02  
69  1 ALA A 319 ? ? -19.25  -58.62  
70  1 MET A 325 ? ? -27.52  -42.51  
71  1 LEU A 329 ? ? 147.94  -175.42 
72  1 GLU B 5   ? ? -55.51  -7.65   
73  1 ASN B 10  ? ? -65.94  88.78   
74  1 LEU B 11  ? ? -66.29  87.75   
75  1 VAL B 12  ? ? 4.31    -136.52 
76  1 GLU B 14  ? ? 76.82   82.79   
77  1 ASP B 15  ? ? -140.55 41.58   
78  1 LEU B 17  ? ? -163.32 -163.55 
79  1 SER B 18  ? ? 171.58  157.84  
80  1 ARG B 19  ? ? -169.25 -96.89  
81  1 ASP B 29  ? ? -3.00   -54.46  
82  1 ALA B 35  ? ? -89.02  -80.56  
83  1 LEU B 40  ? ? -76.03  44.56   
84  1 ASP B 53  ? ? -101.82 48.23   
85  1 THR B 54  ? ? -12.37  -40.23  
86  1 ASP B 55  ? ? -59.97  -85.55  
87  1 ARG B 58  ? ? -58.06  -4.89   
88  1 SER B 68  ? ? -21.75  -74.29  
89  1 LEU B 69  ? ? -49.23  71.32   
90  1 PHE B 70  ? ? 169.63  -38.86  
91  1 ASN B 87  ? ? 74.39   43.82   
92  1 ALA B 97  ? ? 176.63  101.03  
93  1 MET B 99  ? ? 65.18   154.31  
94  1 VAL B 100 ? ? -179.47 116.80  
95  1 SER B 101 ? ? -37.77  101.14  
96  1 GLN B 103 ? ? -26.25  -71.13  
97  1 THR B 104 ? ? -35.13  120.70  
98  1 ARG B 105 ? ? -175.78 -145.54 
99  1 LEU B 108 ? ? -71.46  37.24   
100 1 LEU B 109 ? ? -102.25 -63.27  
101 1 MET B 116 ? ? -68.83  -74.19  
102 1 LYS B 117 ? ? -20.05  -43.67  
103 1 ALA B 118 ? ? -75.95  -72.05  
104 1 VAL B 120 ? ? -56.47  -125.18 
105 1 PRO B 121 ? ? -18.88  116.08  
106 1 ASN B 126 ? ? -75.82  -73.48  
107 1 THR B 136 ? ? -31.70  -83.21  
108 1 ASN B 137 ? ? -163.15 -48.00  
109 1 PRO B 138 ? ? 69.39   -5.97   
110 1 ASP B 140 ? ? -57.42  -78.40  
111 1 SER B 160 ? ? -36.80  -34.86  
112 1 LEU B 164 ? ? -46.90  -78.43  
113 1 TYR B 171 ? ? -58.33  -85.00  
114 1 PRO B 181 ? ? -68.49  1.93    
115 1 PRO B 198 ? ? -61.64  -172.07 
116 1 VAL B 205 ? ? 176.30  44.41   
117 1 ALA B 206 ? ? 156.94  -93.22  
118 1 THR B 209 ? ? 84.83   -39.11  
119 1 LEU B 210 ? ? -67.49  -126.91 
120 1 ILE B 217 ? ? 20.11   78.44   
121 1 THR B 219 ? ? 90.28   -111.59 
122 1 ASP B 220 ? ? 117.00  83.38   
123 1 LYS B 221 ? ? 115.03  -88.82  
124 1 ASN B 222 ? ? -54.27  23.61   
125 1 LYS B 223 ? ? 122.04  -166.55 
126 1 GLN B 224 ? ? 35.77   73.00   
127 1 HIS B 225 ? ? 31.43   117.41  
128 1 TRP B 226 ? ? 170.83  -29.21  
129 1 VAL B 233 ? ? -58.94  -72.04  
130 1 VAL B 234 ? ? -47.88  -70.07  
131 1 TYR B 246 ? ? 162.16  169.59  
132 1 SER B 248 ? ? -112.22 -85.86  
133 1 TRP B 249 ? ? -40.77  -73.68  
134 1 LYS B 277 ? ? -20.01  -43.13  
135 1 HIS B 280 ? ? 19.05   50.69   
136 1 GLU B 284 ? ? 172.47  124.10  
137 1 GLU B 285 ? ? -42.02  46.87   
138 1 ASN B 306 ? ? -107.50 79.68   
139 1 ALA B 309 ? ? -21.99  -61.02  
140 1 ALA B 319 ? ? -19.25  -58.62  
141 1 MET B 325 ? ? -27.52  -42.51  
142 1 LEU B 329 ? ? 147.94  -175.42 
143 1 GLU C 5   ? ? -55.51  -7.65   
144 1 ASN C 10  ? ? -65.94  88.78   
145 1 LEU C 11  ? ? -66.29  87.75   
146 1 VAL C 12  ? ? 4.31    -136.52 
147 1 GLU C 14  ? ? 76.82   82.79   
148 1 ASP C 15  ? ? -140.55 41.58   
149 1 LEU C 17  ? ? -163.32 -163.55 
150 1 SER C 18  ? ? 171.58  157.84  
151 1 ARG C 19  ? ? -169.25 -96.89  
152 1 ASP C 29  ? ? -3.00   -54.46  
153 1 ALA C 35  ? ? -89.02  -80.56  
154 1 LEU C 40  ? ? -76.03  44.56   
155 1 ASP C 53  ? ? -101.82 48.23   
156 1 THR C 54  ? ? -12.37  -40.23  
157 1 ASP C 55  ? ? -59.97  -85.55  
158 1 ARG C 58  ? ? -58.06  -4.89   
159 1 SER C 68  ? ? -21.75  -74.29  
160 1 LEU C 69  ? ? -49.23  71.32   
161 1 PHE C 70  ? ? 169.63  -38.86  
162 1 ASN C 87  ? ? 74.39   43.82   
163 1 ALA C 97  ? ? 176.63  101.03  
164 1 MET C 99  ? ? 65.18   154.31  
165 1 VAL C 100 ? ? -179.47 116.80  
166 1 SER C 101 ? ? -37.77  101.14  
167 1 GLN C 103 ? ? -26.25  -71.13  
168 1 THR C 104 ? ? -35.13  120.70  
169 1 ARG C 105 ? ? -175.78 -145.54 
170 1 LEU C 108 ? ? -71.46  37.24   
171 1 LEU C 109 ? ? -102.25 -63.27  
172 1 MET C 116 ? ? -68.83  -74.19  
173 1 LYS C 117 ? ? -20.05  -43.67  
174 1 ALA C 118 ? ? -75.95  -72.05  
175 1 VAL C 120 ? ? -56.47  -125.18 
176 1 PRO C 121 ? ? -18.88  116.08  
177 1 ASN C 126 ? ? -75.82  -73.48  
178 1 THR C 136 ? ? -31.70  -83.21  
179 1 ASN C 137 ? ? -163.15 -48.00  
180 1 PRO C 138 ? ? 69.39   -5.97   
181 1 ASP C 140 ? ? -57.42  -78.40  
182 1 SER C 160 ? ? -36.80  -34.86  
183 1 LEU C 164 ? ? -46.90  -78.43  
184 1 TYR C 171 ? ? -58.33  -85.00  
185 1 PRO C 181 ? ? -68.49  1.93    
186 1 PRO C 198 ? ? -61.64  -172.07 
187 1 VAL C 205 ? ? 176.30  44.41   
188 1 ALA C 206 ? ? 156.94  -93.22  
189 1 THR C 209 ? ? 84.83   -39.11  
190 1 LEU C 210 ? ? -67.49  -126.91 
191 1 ILE C 217 ? ? 20.11   78.44   
192 1 THR C 219 ? ? 90.28   -111.59 
193 1 ASP C 220 ? ? 117.00  83.38   
194 1 LYS C 221 ? ? 115.03  -88.82  
195 1 ASN C 222 ? ? -54.27  23.61   
196 1 LYS C 223 ? ? 122.04  -166.55 
197 1 GLN C 224 ? ? 35.77   73.00   
198 1 HIS C 225 ? ? 31.43   117.41  
199 1 TRP C 226 ? ? 170.83  -29.21  
200 1 VAL C 233 ? ? -58.94  -72.04  
201 1 VAL C 234 ? ? -47.88  -70.07  
202 1 TYR C 246 ? ? 162.16  169.59  
203 1 SER C 248 ? ? -112.22 -85.86  
204 1 TRP C 249 ? ? -40.77  -73.68  
205 1 LYS C 277 ? ? -20.01  -43.13  
206 1 HIS C 280 ? ? 19.05   50.69   
207 1 GLU C 284 ? ? 172.47  124.10  
208 1 GLU C 285 ? ? -42.02  46.87   
209 1 ASN C 306 ? ? -107.50 79.68   
210 1 ALA C 309 ? ? -21.99  -61.02  
211 1 ALA C 319 ? ? -19.25  -58.62  
212 1 MET C 325 ? ? -27.52  -42.51  
213 1 LEU C 329 ? ? 147.94  -175.42 
214 1 GLU D 5   ? ? -55.51  -7.65   
215 1 ASN D 10  ? ? -65.94  88.78   
216 1 LEU D 11  ? ? -66.29  87.75   
217 1 VAL D 12  ? ? 4.31    -136.52 
218 1 GLU D 14  ? ? 76.82   82.79   
219 1 ASP D 15  ? ? -140.55 41.58   
220 1 LEU D 17  ? ? -163.32 -163.55 
221 1 SER D 18  ? ? 171.58  157.84  
222 1 ARG D 19  ? ? -169.25 -96.89  
223 1 ASP D 29  ? ? -3.00   -54.46  
224 1 ALA D 35  ? ? -89.02  -80.56  
225 1 LEU D 40  ? ? -76.03  44.56   
226 1 ASP D 53  ? ? -101.82 48.23   
227 1 THR D 54  ? ? -12.37  -40.23  
228 1 ASP D 55  ? ? -59.97  -85.55  
229 1 ARG D 58  ? ? -58.06  -4.89   
230 1 SER D 68  ? ? -21.75  -74.29  
231 1 LEU D 69  ? ? -49.23  71.32   
232 1 PHE D 70  ? ? 169.63  -38.86  
233 1 ASN D 87  ? ? 74.39   43.82   
234 1 ALA D 97  ? ? 176.63  101.03  
235 1 MET D 99  ? ? 65.18   154.31  
236 1 VAL D 100 ? ? -179.47 116.80  
237 1 SER D 101 ? ? -37.77  101.14  
238 1 GLN D 103 ? ? -26.25  -71.13  
239 1 THR D 104 ? ? -35.13  120.70  
240 1 ARG D 105 ? ? -175.78 -145.54 
241 1 LEU D 108 ? ? -71.46  37.24   
242 1 LEU D 109 ? ? -102.25 -63.27  
243 1 MET D 116 ? ? -68.83  -74.19  
244 1 LYS D 117 ? ? -20.05  -43.67  
245 1 ALA D 118 ? ? -75.95  -72.05  
246 1 VAL D 120 ? ? -56.47  -125.18 
247 1 PRO D 121 ? ? -18.88  116.08  
248 1 ASN D 126 ? ? -75.82  -73.48  
249 1 THR D 136 ? ? -31.70  -83.21  
250 1 ASN D 137 ? ? -163.15 -48.00  
251 1 PRO D 138 ? ? 69.39   -5.97   
252 1 ASP D 140 ? ? -57.42  -78.40  
253 1 SER D 160 ? ? -36.80  -34.86  
254 1 LEU D 164 ? ? -46.90  -78.43  
255 1 TYR D 171 ? ? -58.33  -85.00  
256 1 PRO D 181 ? ? -68.49  1.93    
257 1 PRO D 198 ? ? -61.64  -172.07 
258 1 VAL D 205 ? ? 176.30  44.41   
259 1 ALA D 206 ? ? 156.94  -93.22  
260 1 THR D 209 ? ? 84.83   -39.11  
261 1 LEU D 210 ? ? -67.49  -126.91 
262 1 ILE D 217 ? ? 20.11   78.44   
263 1 THR D 219 ? ? 90.28   -111.59 
264 1 ASP D 220 ? ? 117.00  83.38   
265 1 LYS D 221 ? ? 115.03  -88.82  
266 1 ASN D 222 ? ? -54.27  23.61   
267 1 LYS D 223 ? ? 122.04  -166.55 
268 1 GLN D 224 ? ? 35.77   73.00   
269 1 HIS D 225 ? ? 31.43   117.41  
270 1 TRP D 226 ? ? 170.83  -29.21  
271 1 VAL D 233 ? ? -58.94  -72.04  
272 1 VAL D 234 ? ? -47.88  -70.07  
273 1 TYR D 246 ? ? 162.16  169.59  
274 1 SER D 248 ? ? -112.22 -85.86  
275 1 TRP D 249 ? ? -40.77  -73.68  
276 1 LYS D 277 ? ? -20.01  -43.13  
277 1 HIS D 280 ? ? 19.05   50.69   
278 1 GLU D 284 ? ? 172.47  124.10  
279 1 GLU D 285 ? ? -42.02  46.87   
280 1 ASN D 306 ? ? -107.50 79.68   
281 1 ALA D 309 ? ? -21.99  -61.02  
282 1 ALA D 319 ? ? -19.25  -58.62  
283 1 MET D 325 ? ? -27.52  -42.51  
284 1 LEU D 329 ? ? 147.94  -175.42 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  1 THR A 136 ? ? 10.51  
2  1 PRO A 181 ? ? 10.49  
3  1 GLU A 311 ? ? -11.33 
4  1 THR B 136 ? ? 10.51  
5  1 PRO B 181 ? ? 10.49  
6  1 GLU B 311 ? ? -11.33 
7  1 THR C 136 ? ? 10.51  
8  1 PRO C 181 ? ? 10.49  
9  1 GLU C 311 ? ? -11.33 
10 1 THR D 136 ? ? 10.51  
11 1 PRO D 181 ? ? 10.49  
12 1 GLU D 311 ? ? -11.33 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#