data_2LE4
# 
_entry.id   2LE4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LE4         
RCSB  RCSB102282   
BMRB  17691        
WWPDB D_1000102282 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
17691     BMRB     unspecified . 
GO.103289 TargetDB unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LE4 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-06 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sahu, S.C.'                                       1 
'Markley, J.L.'                                    2 
'Tonelli, M.'                                      3 
'Bahrami, A.'                                      4 
'Eghbalnia, H.R.'                                  5 
'Center for Eukaryotic Structural Genomics (CESG)' 6 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sahu, S.'      1 
primary 'Markley, J.'   2 
primary 'Tonelli, M.'   3 
primary 'Bahrami, A.'   4 
primary 'Eghbalnia, H.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Transcription factor SOX-2' 
_entity.formula_weight             9920.610 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'HMG box DNA binding residues 39-118' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTK
T
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTK
T
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         GO.103289 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ASP n 
1 3  ARG n 
1 4  VAL n 
1 5  LYS n 
1 6  ARG n 
1 7  PRO n 
1 8  MET n 
1 9  ASN n 
1 10 ALA n 
1 11 PHE n 
1 12 MET n 
1 13 VAL n 
1 14 TRP n 
1 15 SER n 
1 16 ARG n 
1 17 GLY n 
1 18 GLN n 
1 19 ARG n 
1 20 ARG n 
1 21 LYS n 
1 22 MET n 
1 23 ALA n 
1 24 GLN n 
1 25 GLU n 
1 26 ASN n 
1 27 PRO n 
1 28 LYS n 
1 29 MET n 
1 30 HIS n 
1 31 ASN n 
1 32 SER n 
1 33 GLU n 
1 34 ILE n 
1 35 SER n 
1 36 LYS n 
1 37 ARG n 
1 38 LEU n 
1 39 GLY n 
1 40 ALA n 
1 41 GLU n 
1 42 TRP n 
1 43 LYS n 
1 44 LEU n 
1 45 LEU n 
1 46 SER n 
1 47 GLU n 
1 48 THR n 
1 49 GLU n 
1 50 LYS n 
1 51 ARG n 
1 52 PRO n 
1 53 PHE n 
1 54 ILE n 
1 55 ASP n 
1 56 GLU n 
1 57 ALA n 
1 58 LYS n 
1 59 ARG n 
1 60 LEU n 
1 61 ARG n 
1 62 ALA n 
1 63 LEU n 
1 64 HIS n 
1 65 MET n 
1 66 LYS n 
1 67 GLU n 
1 68 HIS n 
1 69 PRO n 
1 70 ASP n 
1 71 TYR n 
1 72 LYS n 
1 73 TYR n 
1 74 ARG n 
1 75 PRO n 
1 76 ARG n 
1 77 ARG n 
1 78 LYS n 
1 79 THR n 
1 80 LYS n 
1 81 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SOX2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pEU-HIS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SOX2_HUMAN 
_struct_ref.pdbx_db_accession          P48431 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

;
_struct_ref.pdbx_align_begin           39 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LE4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 81 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P48431 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  118 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       81 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2LE4 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P48431 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY              
1 2 1 3D_13C-separated_NOESY              
1 3 1 '3D_13C-separated_NOESY (AROMATIC)' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM' 
_pdbx_nmr_exptl_sample_conditions.pH                  6.7 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.7 mM [U-100% 13C; U-100% 15N] Sox2, 7 % DTT, 95% H2O, 5% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian Inova' 
# 
_pdbx_nmr_refine.entry_id           2LE4 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            
;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENT. STRUCTURES ARE BASED ON A TOTAL OF 1766 NOE CONSTRAINTS ( 597 INTRA, 423 SEQUENTIAL, 224 MEDIUM and 522 LONG RANGE CONSTRAINTS) AND 197 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LE4 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LE4 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
_pdbx_nmr_software.authors          'Brunger A. T. et.al.' 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             CNS 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LE4 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LE4 
_struct.title                     
'Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2' 
_struct.pdbx_descriptor           'Transcription factor SOX-2' 
_struct.pdbx_model_details        'fewest violations, model 17' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LE4 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, TRANSCRIPTION, CESG' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 9  ? ASN A 26 ? ASN A 9  ASN A 26 1 ? 18 
HELX_P HELX_P2 2 ASN A 31 ? LEU A 44 ? ASN A 31 LEU A 44 1 ? 14 
HELX_P HELX_P3 3 SER A 46 ? LYS A 66 ? SER A 46 LYS A 66 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2LE4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1  ? 2.190   -5.830  -19.128 1.00 0.00 ? 1  SER A N    1  
ATOM 2     C CA   . SER A 1 1  ? 1.264   -5.478  -18.030 1.00 0.00 ? 1  SER A CA   1  
ATOM 3     C C    . SER A 1 1  ? 0.304   -4.391  -18.491 1.00 0.00 ? 1  SER A C    1  
ATOM 4     O O    . SER A 1 1  ? 0.708   -3.251  -18.726 1.00 0.00 ? 1  SER A O    1  
ATOM 5     C CB   . SER A 1 1  ? 2.055   -4.996  -16.815 1.00 0.00 ? 1  SER A CB   1  
ATOM 6     O OG   . SER A 1 1  ? 3.065   -5.927  -16.468 1.00 0.00 ? 1  SER A OG   1  
ATOM 7     H H1   . SER A 1 1  ? 2.721   -4.987  -19.431 1.00 0.00 ? 1  SER A H1   1  
ATOM 8     H H2   . SER A 1 1  ? 1.656   -6.198  -19.944 1.00 0.00 ? 1  SER A H2   1  
ATOM 9     H H3   . SER A 1 1  ? 2.867   -6.560  -18.812 1.00 0.00 ? 1  SER A H3   1  
ATOM 10    H HA   . SER A 1 1  ? 0.700   -6.359  -17.762 1.00 0.00 ? 1  SER A HA   1  
ATOM 11    H HB2  . SER A 1 1  ? 2.518   -4.046  -17.042 1.00 0.00 ? 1  SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1  ? 1.386   -4.879  -15.974 1.00 0.00 ? 1  SER A HB3  1  
ATOM 13    H HG   . SER A 1 1  ? 3.913   -5.638  -16.851 1.00 0.00 ? 1  SER A HG   1  
ATOM 14    N N    . ASP A 1 2  ? -0.963  -4.743  -18.624 1.00 0.00 ? 2  ASP A N    1  
ATOM 15    C CA   . ASP A 1 2  ? -1.965  -3.806  -19.118 1.00 0.00 ? 2  ASP A CA   1  
ATOM 16    C C    . ASP A 1 2  ? -3.156  -3.725  -18.175 1.00 0.00 ? 2  ASP A C    1  
ATOM 17    O O    . ASP A 1 2  ? -4.202  -3.184  -18.538 1.00 0.00 ? 2  ASP A O    1  
ATOM 18    C CB   . ASP A 1 2  ? -2.433  -4.201  -20.522 1.00 0.00 ? 2  ASP A CB   1  
ATOM 19    C CG   . ASP A 1 2  ? -2.972  -5.617  -20.594 1.00 0.00 ? 2  ASP A CG   1  
ATOM 20    O OD1  . ASP A 1 2  ? -2.175  -6.543  -20.848 1.00 0.00 ? 2  ASP A OD1  1  
ATOM 21    O OD2  . ASP A 1 2  ? -4.195  -5.810  -20.413 1.00 0.00 ? 2  ASP A OD2  1  
ATOM 22    H H    . ASP A 1 2  ? -1.238  -5.661  -18.386 1.00 0.00 ? 2  ASP A H    1  
ATOM 23    H HA   . ASP A 1 2  ? -1.502  -2.833  -19.169 1.00 0.00 ? 2  ASP A HA   1  
ATOM 24    H HB2  . ASP A 1 2  ? -3.214  -3.527  -20.833 1.00 0.00 ? 2  ASP A HB2  1  
ATOM 25    H HB3  . ASP A 1 2  ? -1.599  -4.120  -21.206 1.00 0.00 ? 2  ASP A HB3  1  
ATOM 26    N N    . ARG A 1 3  ? -2.999  -4.256  -16.964 1.00 0.00 ? 3  ARG A N    1  
ATOM 27    C CA   . ARG A 1 3  ? -4.061  -4.184  -15.962 1.00 0.00 ? 3  ARG A CA   1  
ATOM 28    C C    . ARG A 1 3  ? -4.434  -2.729  -15.710 1.00 0.00 ? 3  ARG A C    1  
ATOM 29    O O    . ARG A 1 3  ? -3.590  -1.912  -15.327 1.00 0.00 ? 3  ARG A O    1  
ATOM 30    C CB   . ARG A 1 3  ? -3.624  -4.848  -14.652 1.00 0.00 ? 3  ARG A CB   1  
ATOM 31    C CG   . ARG A 1 3  ? -3.239  -6.306  -14.821 1.00 0.00 ? 3  ARG A CG   1  
ATOM 32    C CD   . ARG A 1 3  ? -2.775  -6.931  -13.518 1.00 0.00 ? 3  ARG A CD   1  
ATOM 33    N NE   . ARG A 1 3  ? -3.880  -7.155  -12.588 1.00 0.00 ? 3  ARG A NE   1  
ATOM 34    C CZ   . ARG A 1 3  ? -3.984  -8.237  -11.813 1.00 0.00 ? 3  ARG A CZ   1  
ATOM 35    N NH1  . ARG A 1 3  ? -3.074  -9.202  -11.884 1.00 0.00 ? 3  ARG A NH1  1  
ATOM 36    N NH2  . ARG A 1 3  ? -5.007  -8.360  -10.979 1.00 0.00 ? 3  ARG A NH2  1  
ATOM 37    H H    . ARG A 1 3  ? -2.158  -4.707  -16.745 1.00 0.00 ? 3  ARG A H    1  
ATOM 38    H HA   . ARG A 1 3  ? -4.924  -4.705  -16.353 1.00 0.00 ? 3  ARG A HA   1  
ATOM 39    H HB2  . ARG A 1 3  ? -2.772  -4.314  -14.258 1.00 0.00 ? 3  ARG A HB2  1  
ATOM 40    H HB3  . ARG A 1 3  ? -4.436  -4.791  -13.942 1.00 0.00 ? 3  ARG A HB3  1  
ATOM 41    H HG2  . ARG A 1 3  ? -4.097  -6.851  -15.182 1.00 0.00 ? 3  ARG A HG2  1  
ATOM 42    H HG3  . ARG A 1 3  ? -2.440  -6.372  -15.546 1.00 0.00 ? 3  ARG A HG3  1  
ATOM 43    H HD2  . ARG A 1 3  ? -2.306  -7.879  -13.736 1.00 0.00 ? 3  ARG A HD2  1  
ATOM 44    H HD3  . ARG A 1 3  ? -2.054  -6.274  -13.053 1.00 0.00 ? 3  ARG A HD3  1  
ATOM 45    H HE   . ARG A 1 3  ? -4.575  -6.460  -12.533 1.00 0.00 ? 3  ARG A HE   1  
ATOM 46    H HH11 . ARG A 1 3  ? -2.299  -9.128  -12.526 1.00 0.00 ? 3  ARG A HH11 1  
ATOM 47    H HH12 . ARG A 1 3  ? -3.160  -10.016 -11.297 1.00 0.00 ? 3  ARG A HH12 1  
ATOM 48    H HH21 . ARG A 1 3  ? -5.713  -7.636  -10.929 1.00 0.00 ? 3  ARG A HH21 1  
ATOM 49    H HH22 . ARG A 1 3  ? -5.080  -9.170  -10.389 1.00 0.00 ? 3  ARG A HH22 1  
ATOM 50    N N    . VAL A 1 4  ? -5.701  -2.417  -15.912 1.00 0.00 ? 4  VAL A N    1  
ATOM 51    C CA   . VAL A 1 4  ? -6.165  -1.041  -15.858 1.00 0.00 ? 4  VAL A CA   1  
ATOM 52    C C    . VAL A 1 4  ? -6.360  -0.569  -14.427 1.00 0.00 ? 4  VAL A C    1  
ATOM 53    O O    . VAL A 1 4  ? -6.401  -1.368  -13.489 1.00 0.00 ? 4  VAL A O    1  
ATOM 54    C CB   . VAL A 1 4  ? -7.478  -0.851  -16.640 1.00 0.00 ? 4  VAL A CB   1  
ATOM 55    C CG1  . VAL A 1 4  ? -7.257  -1.107  -18.120 1.00 0.00 ? 4  VAL A CG1  1  
ATOM 56    C CG2  . VAL A 1 4  ? -8.564  -1.765  -16.098 1.00 0.00 ? 4  VAL A CG2  1  
ATOM 57    H H    . VAL A 1 4  ? -6.344  -3.130  -16.106 1.00 0.00 ? 4  VAL A H    1  
ATOM 58    H HA   . VAL A 1 4  ? -5.409  -0.422  -16.321 1.00 0.00 ? 4  VAL A HA   1  
ATOM 59    H HB   . VAL A 1 4  ? -7.801  0.172   -16.518 1.00 0.00 ? 4  VAL A HB   1  
ATOM 60    H HG11 . VAL A 1 4  ? -6.532  -0.406  -18.501 1.00 0.00 ? 4  VAL A HG11 1  
ATOM 61    H HG12 . VAL A 1 4  ? -8.191  -0.986  -18.649 1.00 0.00 ? 4  VAL A HG12 1  
ATOM 62    H HG13 . VAL A 1 4  ? -6.891  -2.114  -18.259 1.00 0.00 ? 4  VAL A HG13 1  
ATOM 63    H HG21 . VAL A 1 4  ? -8.252  -2.793  -16.196 1.00 0.00 ? 4  VAL A HG21 1  
ATOM 64    H HG22 . VAL A 1 4  ? -9.475  -1.611  -16.655 1.00 0.00 ? 4  VAL A HG22 1  
ATOM 65    H HG23 . VAL A 1 4  ? -8.736  -1.539  -15.056 1.00 0.00 ? 4  VAL A HG23 1  
ATOM 66    N N    . LYS A 1 5  ? -6.475  0.737   -14.275 1.00 0.00 ? 5  LYS A N    1  
ATOM 67    C CA   . LYS A 1 5  ? -6.600  1.355   -12.969 1.00 0.00 ? 5  LYS A CA   1  
ATOM 68    C C    . LYS A 1 5  ? -7.743  2.357   -12.989 1.00 0.00 ? 5  LYS A C    1  
ATOM 69    O O    . LYS A 1 5  ? -7.629  3.426   -13.584 1.00 0.00 ? 5  LYS A O    1  
ATOM 70    C CB   . LYS A 1 5  ? -5.279  2.039   -12.604 1.00 0.00 ? 5  LYS A CB   1  
ATOM 71    C CG   . LYS A 1 5  ? -4.085  1.094   -12.659 1.00 0.00 ? 5  LYS A CG   1  
ATOM 72    C CD   . LYS A 1 5  ? -2.770  1.841   -12.784 1.00 0.00 ? 5  LYS A CD   1  
ATOM 73    C CE   . LYS A 1 5  ? -1.599  0.881   -12.950 1.00 0.00 ? 5  LYS A CE   1  
ATOM 74    N NZ   . LYS A 1 5  ? -1.734  0.021   -14.159 1.00 0.00 ? 5  LYS A NZ   1  
ATOM 75    H H    . LYS A 1 5  ? -6.481  1.308   -15.071 1.00 0.00 ? 5  LYS A H    1  
ATOM 76    H HA   . LYS A 1 5  ? -6.816  0.584   -12.247 1.00 0.00 ? 5  LYS A HA   1  
ATOM 77    H HB2  . LYS A 1 5  ? -5.105  2.855   -13.291 1.00 0.00 ? 5  LYS A HB2  1  
ATOM 78    H HB3  . LYS A 1 5  ? -5.355  2.431   -11.602 1.00 0.00 ? 5  LYS A HB3  1  
ATOM 79    H HG2  . LYS A 1 5  ? -4.068  0.506   -11.755 1.00 0.00 ? 5  LYS A HG2  1  
ATOM 80    H HG3  . LYS A 1 5  ? -4.199  0.438   -13.511 1.00 0.00 ? 5  LYS A HG3  1  
ATOM 81    H HD2  . LYS A 1 5  ? -2.814  2.491   -13.644 1.00 0.00 ? 5  LYS A HD2  1  
ATOM 82    H HD3  . LYS A 1 5  ? -2.614  2.432   -11.892 1.00 0.00 ? 5  LYS A HD3  1  
ATOM 83    H HE2  . LYS A 1 5  ? -0.692  1.457   -13.037 1.00 0.00 ? 5  LYS A HE2  1  
ATOM 84    H HE3  . LYS A 1 5  ? -1.540  0.251   -12.073 1.00 0.00 ? 5  LYS A HE3  1  
ATOM 85    H HZ1  . LYS A 1 5  ? -0.928  -0.640  -14.217 1.00 0.00 ? 5  LYS A HZ1  1  
ATOM 86    H HZ2  . LYS A 1 5  ? -1.744  0.611   -15.022 1.00 0.00 ? 5  LYS A HZ2  1  
ATOM 87    H HZ3  . LYS A 1 5  ? -2.616  -0.529  -14.122 1.00 0.00 ? 5  LYS A HZ3  1  
ATOM 88    N N    . ARG A 1 6  ? -8.855  1.990   -12.373 1.00 0.00 ? 6  ARG A N    1  
ATOM 89    C CA   . ARG A 1 6  ? -10.044 2.828   -12.380 1.00 0.00 ? 6  ARG A CA   1  
ATOM 90    C C    . ARG A 1 6  ? -10.302 3.421   -10.998 1.00 0.00 ? 6  ARG A C    1  
ATOM 91    O O    . ARG A 1 6  ? -9.866  2.865   -9.989  1.00 0.00 ? 6  ARG A O    1  
ATOM 92    C CB   . ARG A 1 6  ? -11.265 2.024   -12.838 1.00 0.00 ? 6  ARG A CB   1  
ATOM 93    C CG   . ARG A 1 6  ? -11.603 0.844   -11.938 1.00 0.00 ? 6  ARG A CG   1  
ATOM 94    C CD   . ARG A 1 6  ? -13.001 0.319   -12.215 1.00 0.00 ? 6  ARG A CD   1  
ATOM 95    N NE   . ARG A 1 6  ? -14.017 1.349   -11.996 1.00 0.00 ? 6  ARG A NE   1  
ATOM 96    C CZ   . ARG A 1 6  ? -14.947 1.290   -11.049 1.00 0.00 ? 6  ARG A CZ   1  
ATOM 97    N NH1  . ARG A 1 6  ? -15.008 0.245   -10.231 1.00 0.00 ? 6  ARG A NH1  1  
ATOM 98    N NH2  . ARG A 1 6  ? -15.812 2.285   -10.915 1.00 0.00 ? 6  ARG A NH2  1  
ATOM 99    H H    . ARG A 1 6  ? -8.873  1.142   -11.883 1.00 0.00 ? 6  ARG A H    1  
ATOM 100   H HA   . ARG A 1 6  ? -9.873  3.633   -13.078 1.00 0.00 ? 6  ARG A HA   1  
ATOM 101   H HB2  . ARG A 1 6  ? -12.120 2.681   -12.868 1.00 0.00 ? 6  ARG A HB2  1  
ATOM 102   H HB3  . ARG A 1 6  ? -11.080 1.645   -13.834 1.00 0.00 ? 6  ARG A HB3  1  
ATOM 103   H HG2  . ARG A 1 6  ? -10.891 0.053   -12.115 1.00 0.00 ? 6  ARG A HG2  1  
ATOM 104   H HG3  . ARG A 1 6  ? -11.544 1.162   -10.908 1.00 0.00 ? 6  ARG A HG3  1  
ATOM 105   H HD2  . ARG A 1 6  ? -13.052 -0.017  -13.240 1.00 0.00 ? 6  ARG A HD2  1  
ATOM 106   H HD3  . ARG A 1 6  ? -13.198 -0.513  -11.554 1.00 0.00 ? 6  ARG A HD3  1  
ATOM 107   H HE   . ARG A 1 6  ? -13.997 2.140   -12.592 1.00 0.00 ? 6  ARG A HE   1  
ATOM 108   H HH11 . ARG A 1 6  ? -14.346 -0.511  -10.322 1.00 0.00 ? 6  ARG A HH11 1  
ATOM 109   H HH12 . ARG A 1 6  ? -15.706 0.207   -9.516  1.00 0.00 ? 6  ARG A HH12 1  
ATOM 110   H HH21 . ARG A 1 6  ? -15.759 3.077   -11.529 1.00 0.00 ? 6  ARG A HH21 1  
ATOM 111   H HH22 . ARG A 1 6  ? -16.509 2.255   -10.198 1.00 0.00 ? 6  ARG A HH22 1  
ATOM 112   N N    . PRO A 1 7  ? -11.001 4.565   -10.938 1.00 0.00 ? 7  PRO A N    1  
ATOM 113   C CA   . PRO A 1 7  ? -11.392 5.191   -9.678  1.00 0.00 ? 7  PRO A CA   1  
ATOM 114   C C    . PRO A 1 7  ? -12.598 4.494   -9.052  1.00 0.00 ? 7  PRO A C    1  
ATOM 115   O O    . PRO A 1 7  ? -13.536 4.108   -9.750  1.00 0.00 ? 7  PRO A O    1  
ATOM 116   C CB   . PRO A 1 7  ? -11.758 6.633   -10.074 1.00 0.00 ? 7  PRO A CB   1  
ATOM 117   C CG   . PRO A 1 7  ? -11.443 6.754   -11.531 1.00 0.00 ? 7  PRO A CG   1  
ATOM 118   C CD   . PRO A 1 7  ? -11.453 5.359   -12.084 1.00 0.00 ? 7  PRO A CD   1  
ATOM 119   H HA   . PRO A 1 7  ? -10.575 5.200   -8.971  1.00 0.00 ? 7  PRO A HA   1  
ATOM 120   H HB2  . PRO A 1 7  ? -12.809 6.799   -9.885  1.00 0.00 ? 7  PRO A HB2  1  
ATOM 121   H HB3  . PRO A 1 7  ? -11.172 7.326   -9.487  1.00 0.00 ? 7  PRO A HB3  1  
ATOM 122   H HG2  . PRO A 1 7  ? -12.195 7.355   -12.020 1.00 0.00 ? 7  PRO A HG2  1  
ATOM 123   H HG3  . PRO A 1 7  ? -10.467 7.202   -11.658 1.00 0.00 ? 7  PRO A HG3  1  
ATOM 124   H HD2  . PRO A 1 7  ? -12.452 5.076   -12.385 1.00 0.00 ? 7  PRO A HD2  1  
ATOM 125   H HD3  . PRO A 1 7  ? -10.765 5.272   -12.911 1.00 0.00 ? 7  PRO A HD3  1  
ATOM 126   N N    . MET A 1 8  ? -12.566 4.342   -7.740  1.00 0.00 ? 8  MET A N    1  
ATOM 127   C CA   . MET A 1 8  ? -13.643 3.690   -7.010  1.00 0.00 ? 8  MET A CA   1  
ATOM 128   C C    . MET A 1 8  ? -13.754 4.335   -5.633  1.00 0.00 ? 8  MET A C    1  
ATOM 129   O O    . MET A 1 8  ? -12.897 5.135   -5.264  1.00 0.00 ? 8  MET A O    1  
ATOM 130   C CB   . MET A 1 8  ? -13.373 2.182   -6.892  1.00 0.00 ? 8  MET A CB   1  
ATOM 131   C CG   . MET A 1 8  ? -14.558 1.380   -6.372  1.00 0.00 ? 8  MET A CG   1  
ATOM 132   S SD   . MET A 1 8  ? -16.026 1.559   -7.402  1.00 0.00 ? 8  MET A SD   1  
ATOM 133   C CE   . MET A 1 8  ? -17.201 0.554   -6.497  1.00 0.00 ? 8  MET A CE   1  
ATOM 134   H H    . MET A 1 8  ? -11.799 4.694   -7.236  1.00 0.00 ? 8  MET A H    1  
ATOM 135   H HA   . MET A 1 8  ? -14.565 3.850   -7.550  1.00 0.00 ? 8  MET A HA   1  
ATOM 136   H HB2  . MET A 1 8  ? -13.109 1.799   -7.865  1.00 0.00 ? 8  MET A HB2  1  
ATOM 137   H HB3  . MET A 1 8  ? -12.542 2.030   -6.219  1.00 0.00 ? 8  MET A HB3  1  
ATOM 138   H HG2  . MET A 1 8  ? -14.284 0.336   -6.340  1.00 0.00 ? 8  MET A HG2  1  
ATOM 139   H HG3  . MET A 1 8  ? -14.793 1.718   -5.372  1.00 0.00 ? 8  MET A HG3  1  
ATOM 140   H HE1  . MET A 1 8  ? -16.833 -0.459  -6.430  1.00 0.00 ? 8  MET A HE1  1  
ATOM 141   H HE2  . MET A 1 8  ? -18.151 0.560   -7.011  1.00 0.00 ? 8  MET A HE2  1  
ATOM 142   H HE3  . MET A 1 8  ? -17.327 0.958   -5.503  1.00 0.00 ? 8  MET A HE3  1  
ATOM 143   N N    . ASN A 1 9  ? -14.812 4.032   -4.892  1.00 0.00 ? 9  ASN A N    1  
ATOM 144   C CA   . ASN A 1 9  ? -14.981 4.590   -3.551  1.00 0.00 ? 9  ASN A CA   1  
ATOM 145   C C    . ASN A 1 9  ? -13.926 4.047   -2.578  1.00 0.00 ? 9  ASN A C    1  
ATOM 146   O O    . ASN A 1 9  ? -13.167 3.129   -2.906  1.00 0.00 ? 9  ASN A O    1  
ATOM 147   C CB   . ASN A 1 9  ? -16.404 4.326   -3.017  1.00 0.00 ? 9  ASN A CB   1  
ATOM 148   C CG   . ASN A 1 9  ? -16.649 2.895   -2.562  1.00 0.00 ? 9  ASN A CG   1  
ATOM 149   O OD1  . ASN A 1 9  ? -17.559 2.630   -1.779  1.00 0.00 ? 9  ASN A OD1  1  
ATOM 150   N ND2  . ASN A 1 9  ? -15.812 1.979   -2.998  1.00 0.00 ? 9  ASN A ND2  1  
ATOM 151   H H    . ASN A 1 9  ? -15.502 3.440   -5.258  1.00 0.00 ? 9  ASN A H    1  
ATOM 152   H HA   . ASN A 1 9  ? -14.841 5.659   -3.632  1.00 0.00 ? 9  ASN A HA   1  
ATOM 153   H HB2  . ASN A 1 9  ? -16.581 4.973   -2.174  1.00 0.00 ? 9  ASN A HB2  1  
ATOM 154   H HB3  . ASN A 1 9  ? -17.115 4.561   -3.793  1.00 0.00 ? 9  ASN A HB3  1  
ATOM 155   H HD21 . ASN A 1 9  ? -15.073 2.277   -3.569  1.00 0.00 ? 9  ASN A HD21 1  
ATOM 156   H HD22 . ASN A 1 9  ? -15.965 1.043   -2.744  1.00 0.00 ? 9  ASN A HD22 1  
ATOM 157   N N    . ALA A 1 10 ? -13.944 4.594   -1.376  1.00 0.00 ? 10 ALA A N    1  
ATOM 158   C CA   . ALA A 1 10 ? -12.936 4.351   -0.346  1.00 0.00 ? 10 ALA A CA   1  
ATOM 159   C C    . ALA A 1 10 ? -12.573 2.875   -0.134  1.00 0.00 ? 10 ALA A C    1  
ATOM 160   O O    . ALA A 1 10 ? -11.389 2.537   -0.133  1.00 0.00 ? 10 ALA A O    1  
ATOM 161   C CB   . ALA A 1 10 ? -13.424 4.950   0.959   1.00 0.00 ? 10 ALA A CB   1  
ATOM 162   H H    . ALA A 1 10 ? -14.660 5.220   -1.176  1.00 0.00 ? 10 ALA A H    1  
ATOM 163   H HA   . ALA A 1 10 ? -12.043 4.885   -0.630  1.00 0.00 ? 10 ALA A HA   1  
ATOM 164   H HB1  . ALA A 1 10 ? -12.632 4.915   1.692   1.00 0.00 ? 10 ALA A HB1  1  
ATOM 165   H HB2  . ALA A 1 10 ? -14.274 4.385   1.317   1.00 0.00 ? 10 ALA A HB2  1  
ATOM 166   H HB3  . ALA A 1 10 ? -13.716 5.976   0.795   1.00 0.00 ? 10 ALA A HB3  1  
ATOM 167   N N    . PHE A 1 11 ? -13.568 2.001   0.045   1.00 0.00 ? 11 PHE A N    1  
ATOM 168   C CA   . PHE A 1 11 ? -13.292 0.605   0.430   1.00 0.00 ? 11 PHE A CA   1  
ATOM 169   C C    . PHE A 1 11 ? -12.332 -0.068  -0.544  1.00 0.00 ? 11 PHE A C    1  
ATOM 170   O O    . PHE A 1 11 ? -11.316 -0.645  -0.143  1.00 0.00 ? 11 PHE A O    1  
ATOM 171   C CB   . PHE A 1 11 ? -14.585 -0.216  0.525   1.00 0.00 ? 11 PHE A CB   1  
ATOM 172   C CG   . PHE A 1 11 ? -14.364 -1.601  1.081   1.00 0.00 ? 11 PHE A CG   1  
ATOM 173   C CD1  . PHE A 1 11 ? -14.340 -1.810  2.450   1.00 0.00 ? 11 PHE A CD1  1  
ATOM 174   C CD2  . PHE A 1 11 ? -14.157 -2.685  0.240   1.00 0.00 ? 11 PHE A CD2  1  
ATOM 175   C CE1  . PHE A 1 11 ? -14.120 -3.068  2.974   1.00 0.00 ? 11 PHE A CE1  1  
ATOM 176   C CE2  . PHE A 1 11 ? -13.931 -3.950  0.760   1.00 0.00 ? 11 PHE A CE2  1  
ATOM 177   C CZ   . PHE A 1 11 ? -13.913 -4.139  2.130   1.00 0.00 ? 11 PHE A CZ   1  
ATOM 178   H H    . PHE A 1 11 ? -14.501 2.297   -0.076  1.00 0.00 ? 11 PHE A H    1  
ATOM 179   H HA   . PHE A 1 11 ? -12.827 0.626   1.403   1.00 0.00 ? 11 PHE A HA   1  
ATOM 180   H HB2  . PHE A 1 11 ? -15.285 0.295   1.169   1.00 0.00 ? 11 PHE A HB2  1  
ATOM 181   H HB3  . PHE A 1 11 ? -15.015 -0.317  -0.461  1.00 0.00 ? 11 PHE A HB3  1  
ATOM 182   H HD1  . PHE A 1 11 ? -14.501 -0.973  3.117   1.00 0.00 ? 11 PHE A HD1  1  
ATOM 183   H HD2  . PHE A 1 11 ? -14.172 -2.538  -0.831  1.00 0.00 ? 11 PHE A HD2  1  
ATOM 184   H HE1  . PHE A 1 11 ? -14.108 -3.212  4.043   1.00 0.00 ? 11 PHE A HE1  1  
ATOM 185   H HE2  . PHE A 1 11 ? -13.771 -4.787  0.095   1.00 0.00 ? 11 PHE A HE2  1  
ATOM 186   H HZ   . PHE A 1 11 ? -13.733 -5.124  2.541   1.00 0.00 ? 11 PHE A HZ   1  
ATOM 187   N N    . MET A 1 12 ? -12.643 0.033   -1.821  1.00 0.00 ? 12 MET A N    1  
ATOM 188   C CA   . MET A 1 12 ? -11.828 -0.592  -2.851  1.00 0.00 ? 12 MET A CA   1  
ATOM 189   C C    . MET A 1 12 ? -10.482 0.106   -2.952  1.00 0.00 ? 12 MET A C    1  
ATOM 190   O O    . MET A 1 12 ? -9.446  -0.549  -3.072  1.00 0.00 ? 12 MET A O    1  
ATOM 191   C CB   . MET A 1 12 ? -12.539 -0.583  -4.208  1.00 0.00 ? 12 MET A CB   1  
ATOM 192   C CG   . MET A 1 12 ? -13.755 -1.500  -4.273  1.00 0.00 ? 12 MET A CG   1  
ATOM 193   S SD   . MET A 1 12 ? -15.122 -0.935  -3.243  1.00 0.00 ? 12 MET A SD   1  
ATOM 194   C CE   . MET A 1 12 ? -16.289 -2.277  -3.455  1.00 0.00 ? 12 MET A CE   1  
ATOM 195   H H    . MET A 1 12 ? -13.442 0.541   -2.075  1.00 0.00 ? 12 MET A H    1  
ATOM 196   H HA   . MET A 1 12 ? -11.660 -1.617  -2.554  1.00 0.00 ? 12 MET A HA   1  
ATOM 197   H HB2  . MET A 1 12 ? -12.865 0.423   -4.424  1.00 0.00 ? 12 MET A HB2  1  
ATOM 198   H HB3  . MET A 1 12 ? -11.839 -0.896  -4.970  1.00 0.00 ? 12 MET A HB3  1  
ATOM 199   H HG2  . MET A 1 12 ? -14.094 -1.552  -5.296  1.00 0.00 ? 12 MET A HG2  1  
ATOM 200   H HG3  . MET A 1 12 ? -13.460 -2.484  -3.944  1.00 0.00 ? 12 MET A HG3  1  
ATOM 201   H HE1  . MET A 1 12 ? -15.841 -3.198  -3.117  1.00 0.00 ? 12 MET A HE1  1  
ATOM 202   H HE2  . MET A 1 12 ? -16.546 -2.365  -4.499  1.00 0.00 ? 12 MET A HE2  1  
ATOM 203   H HE3  . MET A 1 12 ? -17.181 -2.076  -2.878  1.00 0.00 ? 12 MET A HE3  1  
ATOM 204   N N    . VAL A 1 13 ? -10.505 1.431   -2.864  1.00 0.00 ? 13 VAL A N    1  
ATOM 205   C CA   . VAL A 1 13 ? -9.291  2.232   -2.935  1.00 0.00 ? 13 VAL A CA   1  
ATOM 206   C C    . VAL A 1 13 ? -8.267  1.767   -1.918  1.00 0.00 ? 13 VAL A C    1  
ATOM 207   O O    . VAL A 1 13 ? -7.132  1.459   -2.270  1.00 0.00 ? 13 VAL A O    1  
ATOM 208   C CB   . VAL A 1 13 ? -9.583  3.720   -2.688  1.00 0.00 ? 13 VAL A CB   1  
ATOM 209   C CG1  . VAL A 1 13 ? -8.290  4.514   -2.627  1.00 0.00 ? 13 VAL A CG1  1  
ATOM 210   C CG2  . VAL A 1 13 ? -10.482 4.260   -3.775  1.00 0.00 ? 13 VAL A CG2  1  
ATOM 211   H H    . VAL A 1 13 ? -11.365 1.884   -2.741  1.00 0.00 ? 13 VAL A H    1  
ATOM 212   H HA   . VAL A 1 13 ? -8.879  2.127   -3.926  1.00 0.00 ? 13 VAL A HA   1  
ATOM 213   H HB   . VAL A 1 13 ? -10.092 3.817   -1.739  1.00 0.00 ? 13 VAL A HB   1  
ATOM 214   H HG11 . VAL A 1 13 ? -7.662  4.124   -1.839  1.00 0.00 ? 13 VAL A HG11 1  
ATOM 215   H HG12 . VAL A 1 13 ? -8.515  5.553   -2.426  1.00 0.00 ? 13 VAL A HG12 1  
ATOM 216   H HG13 . VAL A 1 13 ? -7.773  4.436   -3.572  1.00 0.00 ? 13 VAL A HG13 1  
ATOM 217   H HG21 . VAL A 1 13 ? -11.364 3.642   -3.852  1.00 0.00 ? 13 VAL A HG21 1  
ATOM 218   H HG22 . VAL A 1 13 ? -9.953  4.251   -4.716  1.00 0.00 ? 13 VAL A HG22 1  
ATOM 219   H HG23 . VAL A 1 13 ? -10.772 5.270   -3.532  1.00 0.00 ? 13 VAL A HG23 1  
ATOM 220   N N    . TRP A 1 14 ? -8.681  1.704   -0.662  1.00 0.00 ? 14 TRP A N    1  
ATOM 221   C CA   . TRP A 1 14 ? -7.791  1.299   0.410   1.00 0.00 ? 14 TRP A CA   1  
ATOM 222   C C    . TRP A 1 14 ? -7.304  -0.121  0.174   1.00 0.00 ? 14 TRP A C    1  
ATOM 223   O O    . TRP A 1 14 ? -6.168  -0.456  0.489   1.00 0.00 ? 14 TRP A O    1  
ATOM 224   C CB   . TRP A 1 14 ? -8.509  1.387   1.753   1.00 0.00 ? 14 TRP A CB   1  
ATOM 225   C CG   . TRP A 1 14 ? -7.601  1.731   2.900   1.00 0.00 ? 14 TRP A CG   1  
ATOM 226   C CD1  . TRP A 1 14 ? -6.934  2.907   3.084   1.00 0.00 ? 14 TRP A CD1  1  
ATOM 227   C CD2  . TRP A 1 14 ? -7.278  0.907   4.025   1.00 0.00 ? 14 TRP A CD2  1  
ATOM 228   N NE1  . TRP A 1 14 ? -6.220  2.867   4.257   1.00 0.00 ? 14 TRP A NE1  1  
ATOM 229   C CE2  . TRP A 1 14 ? -6.408  1.648   4.851   1.00 0.00 ? 14 TRP A CE2  1  
ATOM 230   C CE3  . TRP A 1 14 ? -7.633  -0.384  4.415   1.00 0.00 ? 14 TRP A CE3  1  
ATOM 231   C CZ2  . TRP A 1 14 ? -5.897  1.139   6.042   1.00 0.00 ? 14 TRP A CZ2  1  
ATOM 232   C CZ3  . TRP A 1 14 ? -7.124  -0.886  5.597   1.00 0.00 ? 14 TRP A CZ3  1  
ATOM 233   C CH2  . TRP A 1 14 ? -6.263  -0.127  6.396   1.00 0.00 ? 14 TRP A CH2  1  
ATOM 234   H H    . TRP A 1 14 ? -9.613  1.943   -0.451  1.00 0.00 ? 14 TRP A H    1  
ATOM 235   H HA   . TRP A 1 14 ? -6.944  1.970   0.415   1.00 0.00 ? 14 TRP A HA   1  
ATOM 236   H HB2  . TRP A 1 14 ? -9.272  2.148   1.695   1.00 0.00 ? 14 TRP A HB2  1  
ATOM 237   H HB3  . TRP A 1 14 ? -8.974  0.436   1.968   1.00 0.00 ? 14 TRP A HB3  1  
ATOM 238   H HD1  . TRP A 1 14 ? -6.973  3.740   2.401   1.00 0.00 ? 14 TRP A HD1  1  
ATOM 239   H HE1  . TRP A 1 14 ? -5.662  3.600   4.615   1.00 0.00 ? 14 TRP A HE1  1  
ATOM 240   H HE3  . TRP A 1 14 ? -8.297  -0.985  3.813   1.00 0.00 ? 14 TRP A HE3  1  
ATOM 241   H HZ2  . TRP A 1 14 ? -5.232  1.713   6.670   1.00 0.00 ? 14 TRP A HZ2  1  
ATOM 242   H HZ3  . TRP A 1 14 ? -7.390  -1.883  5.914   1.00 0.00 ? 14 TRP A HZ3  1  
ATOM 243   H HH2  . TRP A 1 14 ? -5.888  -0.565  7.309   1.00 0.00 ? 14 TRP A HH2  1  
ATOM 244   N N    . SER A 1 15 ? -8.160  -0.945  -0.419  1.00 0.00 ? 15 SER A N    1  
ATOM 245   C CA   . SER A 1 15 ? -7.809  -2.326  -0.685  1.00 0.00 ? 15 SER A CA   1  
ATOM 246   C C    . SER A 1 15 ? -6.697  -2.405  -1.730  1.00 0.00 ? 15 SER A C    1  
ATOM 247   O O    . SER A 1 15 ? -5.715  -3.121  -1.554  1.00 0.00 ? 15 SER A O    1  
ATOM 248   C CB   . SER A 1 15 ? -9.040  -3.111  -1.150  1.00 0.00 ? 15 SER A CB   1  
ATOM 249   O OG   . SER A 1 15 ? -10.066 -3.081  -0.169  1.00 0.00 ? 15 SER A OG   1  
ATOM 250   H H    . SER A 1 15 ? -9.043  -0.609  -0.698  1.00 0.00 ? 15 SER A H    1  
ATOM 251   H HA   . SER A 1 15 ? -7.448  -2.756  0.234   1.00 0.00 ? 15 SER A HA   1  
ATOM 252   H HB2  . SER A 1 15 ? -9.419  -2.677  -2.062  1.00 0.00 ? 15 SER A HB2  1  
ATOM 253   H HB3  . SER A 1 15 ? -8.760  -4.138  -1.329  1.00 0.00 ? 15 SER A HB3  1  
ATOM 254   H HG   . SER A 1 15 ? -10.399 -2.178  -0.078  1.00 0.00 ? 15 SER A HG   1  
ATOM 255   N N    . ARG A 1 16 ? -6.846  -1.642  -2.804  1.00 0.00 ? 16 ARG A N    1  
ATOM 256   C CA   . ARG A 1 16 ? -5.893  -1.670  -3.904  1.00 0.00 ? 16 ARG A CA   1  
ATOM 257   C C    . ARG A 1 16 ? -4.633  -0.890  -3.549  1.00 0.00 ? 16 ARG A C    1  
ATOM 258   O O    . ARG A 1 16 ? -3.519  -1.378  -3.737  1.00 0.00 ? 16 ARG A O    1  
ATOM 259   C CB   . ARG A 1 16 ? -6.520  -1.092  -5.173  1.00 0.00 ? 16 ARG A CB   1  
ATOM 260   C CG   . ARG A 1 16 ? -7.860  -1.712  -5.560  1.00 0.00 ? 16 ARG A CG   1  
ATOM 261   C CD   . ARG A 1 16 ? -7.756  -3.205  -5.849  1.00 0.00 ? 16 ARG A CD   1  
ATOM 262   N NE   . ARG A 1 16 ? -7.612  -4.012  -4.632  1.00 0.00 ? 16 ARG A NE   1  
ATOM 263   C CZ   . ARG A 1 16 ? -8.443  -5.002  -4.286  1.00 0.00 ? 16 ARG A CZ   1  
ATOM 264   N NH1  . ARG A 1 16 ? -9.496  -5.289  -5.042  1.00 0.00 ? 16 ARG A NH1  1  
ATOM 265   N NH2  . ARG A 1 16 ? -8.226  -5.701  -3.175  1.00 0.00 ? 16 ARG A NH2  1  
ATOM 266   H H    . ARG A 1 16 ? -7.619  -1.033  -2.853  1.00 0.00 ? 16 ARG A H    1  
ATOM 267   H HA   . ARG A 1 16 ? -5.624  -2.699  -4.082  1.00 0.00 ? 16 ARG A HA   1  
ATOM 268   H HB2  . ARG A 1 16 ? -6.672  -0.032  -5.029  1.00 0.00 ? 16 ARG A HB2  1  
ATOM 269   H HB3  . ARG A 1 16 ? -5.834  -1.236  -5.993  1.00 0.00 ? 16 ARG A HB3  1  
ATOM 270   H HG2  . ARG A 1 16 ? -8.556  -1.567  -4.748  1.00 0.00 ? 16 ARG A HG2  1  
ATOM 271   H HG3  . ARG A 1 16 ? -8.230  -1.210  -6.444  1.00 0.00 ? 16 ARG A HG3  1  
ATOM 272   H HD2  . ARG A 1 16 ? -8.647  -3.518  -6.370  1.00 0.00 ? 16 ARG A HD2  1  
ATOM 273   H HD3  . ARG A 1 16 ? -6.896  -3.373  -6.483  1.00 0.00 ? 16 ARG A HD3  1  
ATOM 274   H HE   . ARG A 1 16 ? -6.851  -3.808  -4.048  1.00 0.00 ? 16 ARG A HE   1  
ATOM 275   H HH11 . ARG A 1 16 ? -9.676  -4.766  -5.880  1.00 0.00 ? 16 ARG A HH11 1  
ATOM 276   H HH12 . ARG A 1 16 ? -10.117 -6.032  -4.780  1.00 0.00 ? 16 ARG A HH12 1  
ATOM 277   H HH21 . ARG A 1 16 ? -7.439  -5.493  -2.594  1.00 0.00 ? 16 ARG A HH21 1  
ATOM 278   H HH22 . ARG A 1 16 ? -8.862  -6.441  -2.912  1.00 0.00 ? 16 ARG A HH22 1  
ATOM 279   N N    . GLY A 1 17 ? -4.824  0.313   -3.022  1.00 0.00 ? 17 GLY A N    1  
ATOM 280   C CA   . GLY A 1 17 ? -3.711  1.181   -2.695  1.00 0.00 ? 17 GLY A CA   1  
ATOM 281   C C    . GLY A 1 17 ? -2.810  0.600   -1.629  1.00 0.00 ? 17 GLY A C    1  
ATOM 282   O O    . GLY A 1 17 ? -1.598  0.502   -1.825  1.00 0.00 ? 17 GLY A O    1  
ATOM 283   H H    . GLY A 1 17 ? -5.741  0.619   -2.848  1.00 0.00 ? 17 GLY A H    1  
ATOM 284   H HA2  . GLY A 1 17 ? -3.130  1.352   -3.589  1.00 0.00 ? 17 GLY A HA2  1  
ATOM 285   H HA3  . GLY A 1 17 ? -4.099  2.127   -2.348  1.00 0.00 ? 17 GLY A HA3  1  
ATOM 286   N N    . GLN A 1 18 ? -3.399  0.199   -0.502  1.00 0.00 ? 18 GLN A N    1  
ATOM 287   C CA   . GLN A 1 18 ? -2.625  -0.371  0.594   1.00 0.00 ? 18 GLN A CA   1  
ATOM 288   C C    . GLN A 1 18 ? -1.936  -1.652  0.159   1.00 0.00 ? 18 GLN A C    1  
ATOM 289   O O    . GLN A 1 18 ? -0.781  -1.882  0.506   1.00 0.00 ? 18 GLN A O    1  
ATOM 290   C CB   . GLN A 1 18 ? -3.500  -0.643  1.818   1.00 0.00 ? 18 GLN A CB   1  
ATOM 291   C CG   . GLN A 1 18 ? -3.943  0.613   2.548   1.00 0.00 ? 18 GLN A CG   1  
ATOM 292   C CD   . GLN A 1 18 ? -2.779  1.427   3.081   1.00 0.00 ? 18 GLN A CD   1  
ATOM 293   O OE1  . GLN A 1 18 ? -1.716  0.891   3.391   1.00 0.00 ? 18 GLN A OE1  1  
ATOM 294   N NE2  . GLN A 1 18 ? -2.978  2.729   3.208   1.00 0.00 ? 18 GLN A NE2  1  
ATOM 295   H H    . GLN A 1 18 ? -4.374  0.284   -0.410  1.00 0.00 ? 18 GLN A H    1  
ATOM 296   H HA   . GLN A 1 18 ? -1.868  0.349   0.864   1.00 0.00 ? 18 GLN A HA   1  
ATOM 297   H HB2  . GLN A 1 18 ? -4.383  -1.177  1.501   1.00 0.00 ? 18 GLN A HB2  1  
ATOM 298   H HB3  . GLN A 1 18 ? -2.949  -1.260  2.511   1.00 0.00 ? 18 GLN A HB3  1  
ATOM 299   H HG2  . GLN A 1 18 ? -4.508  1.231   1.863   1.00 0.00 ? 18 GLN A HG2  1  
ATOM 300   H HG3  . GLN A 1 18 ? -4.576  0.329   3.376   1.00 0.00 ? 18 GLN A HG3  1  
ATOM 301   H HE21 . GLN A 1 18 ? -3.853  3.090   2.955   1.00 0.00 ? 18 GLN A HE21 1  
ATOM 302   H HE22 . GLN A 1 18 ? -2.244  3.279   3.556   1.00 0.00 ? 18 GLN A HE22 1  
ATOM 303   N N    . ARG A 1 19 ? -2.641  -2.478  -0.612  1.00 0.00 ? 19 ARG A N    1  
ATOM 304   C CA   . ARG A 1 19 ? -2.061  -3.714  -1.116  1.00 0.00 ? 19 ARG A CA   1  
ATOM 305   C C    . ARG A 1 19 ? -0.839  -3.402  -1.976  1.00 0.00 ? 19 ARG A C    1  
ATOM 306   O O    . ARG A 1 19 ? 0.155   -4.110  -1.921  1.00 0.00 ? 19 ARG A O    1  
ATOM 307   C CB   . ARG A 1 19 ? -3.105  -4.512  -1.911  1.00 0.00 ? 19 ARG A CB   1  
ATOM 308   C CG   . ARG A 1 19 ? -2.758  -5.983  -2.121  1.00 0.00 ? 19 ARG A CG   1  
ATOM 309   C CD   . ARG A 1 19 ? -1.774  -6.191  -3.264  1.00 0.00 ? 19 ARG A CD   1  
ATOM 310   N NE   . ARG A 1 19 ? -1.397  -7.597  -3.411  1.00 0.00 ? 19 ARG A NE   1  
ATOM 311   C CZ   . ARG A 1 19 ? -1.265  -8.217  -4.583  1.00 0.00 ? 19 ARG A CZ   1  
ATOM 312   N NH1  . ARG A 1 19 ? -1.500  -7.570  -5.720  1.00 0.00 ? 19 ARG A NH1  1  
ATOM 313   N NH2  . ARG A 1 19 ? -0.899  -9.490  -4.622  1.00 0.00 ? 19 ARG A NH2  1  
ATOM 314   H H    . ARG A 1 19 ? -3.574  -2.256  -0.837  1.00 0.00 ? 19 ARG A H    1  
ATOM 315   H HA   . ARG A 1 19 ? -1.744  -4.301  -0.266  1.00 0.00 ? 19 ARG A HA   1  
ATOM 316   H HB2  . ARG A 1 19 ? -4.046  -4.465  -1.385  1.00 0.00 ? 19 ARG A HB2  1  
ATOM 317   H HB3  . ARG A 1 19 ? -3.226  -4.052  -2.882  1.00 0.00 ? 19 ARG A HB3  1  
ATOM 318   H HG2  . ARG A 1 19 ? -2.321  -6.369  -1.213  1.00 0.00 ? 19 ARG A HG2  1  
ATOM 319   H HG3  . ARG A 1 19 ? -3.668  -6.527  -2.339  1.00 0.00 ? 19 ARG A HG3  1  
ATOM 320   H HD2  . ARG A 1 19 ? -2.231  -5.852  -4.182  1.00 0.00 ? 19 ARG A HD2  1  
ATOM 321   H HD3  . ARG A 1 19 ? -0.886  -5.608  -3.068  1.00 0.00 ? 19 ARG A HD3  1  
ATOM 322   H HE   . ARG A 1 19 ? -1.224  -8.105  -2.587  1.00 0.00 ? 19 ARG A HE   1  
ATOM 323   H HH11 . ARG A 1 19 ? -1.778  -6.608  -5.705  1.00 0.00 ? 19 ARG A HH11 1  
ATOM 324   H HH12 . ARG A 1 19 ? -1.394  -8.043  -6.600  1.00 0.00 ? 19 ARG A HH12 1  
ATOM 325   H HH21 . ARG A 1 19 ? -0.719  -9.991  -3.767  1.00 0.00 ? 19 ARG A HH21 1  
ATOM 326   H HH22 . ARG A 1 19 ? -0.799  -9.961  -5.510  1.00 0.00 ? 19 ARG A HH22 1  
ATOM 327   N N    . ARG A 1 20 ? -0.910  -2.325  -2.751  1.00 0.00 ? 20 ARG A N    1  
ATOM 328   C CA   . ARG A 1 20 ? 0.197   -1.929  -3.610  1.00 0.00 ? 20 ARG A CA   1  
ATOM 329   C C    . ARG A 1 20 ? 1.363   -1.395  -2.781  1.00 0.00 ? 20 ARG A C    1  
ATOM 330   O O    . ARG A 1 20 ? 2.478   -1.924  -2.849  1.00 0.00 ? 20 ARG A O    1  
ATOM 331   C CB   . ARG A 1 20 ? -0.272  -0.876  -4.639  1.00 0.00 ? 20 ARG A CB   1  
ATOM 332   C CG   . ARG A 1 20 ? 0.826   -0.367  -5.571  1.00 0.00 ? 20 ARG A CG   1  
ATOM 333   C CD   . ARG A 1 20 ? 1.592   0.803   -4.963  1.00 0.00 ? 20 ARG A CD   1  
ATOM 334   N NE   . ARG A 1 20 ? 2.794   1.146   -5.726  1.00 0.00 ? 20 ARG A NE   1  
ATOM 335   C CZ   . ARG A 1 20 ? 3.935   1.555   -5.169  1.00 0.00 ? 20 ARG A CZ   1  
ATOM 336   N NH1  . ARG A 1 20 ? 4.025   1.668   -3.847  1.00 0.00 ? 20 ARG A NH1  1  
ATOM 337   N NH2  . ARG A 1 20 ? 4.978   1.849   -5.936  1.00 0.00 ? 20 ARG A NH2  1  
ATOM 338   H H    . ARG A 1 20 ? -1.728  -1.780  -2.741  1.00 0.00 ? 20 ARG A H    1  
ATOM 339   H HA   . ARG A 1 20 ? 0.529   -2.806  -4.143  1.00 0.00 ? 20 ARG A HA   1  
ATOM 340   H HB2  . ARG A 1 20 ? -1.050  -1.312  -5.247  1.00 0.00 ? 20 ARG A HB2  1  
ATOM 341   H HB3  . ARG A 1 20 ? -0.680  -0.029  -4.106  1.00 0.00 ? 20 ARG A HB3  1  
ATOM 342   H HG2  . ARG A 1 20 ? 1.519   -1.173  -5.766  1.00 0.00 ? 20 ARG A HG2  1  
ATOM 343   H HG3  . ARG A 1 20 ? 0.374   -0.048  -6.499  1.00 0.00 ? 20 ARG A HG3  1  
ATOM 344   H HD2  . ARG A 1 20 ? 0.942   1.663   -4.935  1.00 0.00 ? 20 ARG A HD2  1  
ATOM 345   H HD3  . ARG A 1 20 ? 1.879   0.539   -3.955  1.00 0.00 ? 20 ARG A HD3  1  
ATOM 346   H HE   . ARG A 1 20 ? 2.744   1.074   -6.709  1.00 0.00 ? 20 ARG A HE   1  
ATOM 347   H HH11 . ARG A 1 20 ? 3.238   1.448   -3.272  1.00 0.00 ? 20 ARG A HH11 1  
ATOM 348   H HH12 . ARG A 1 20 ? 4.878   1.987   -3.417  1.00 0.00 ? 20 ARG A HH12 1  
ATOM 349   H HH21 . ARG A 1 20 ? 4.905   1.766   -6.937  1.00 0.00 ? 20 ARG A HH21 1  
ATOM 350   H HH22 . ARG A 1 20 ? 5.839   2.152   -5.524  1.00 0.00 ? 20 ARG A HH22 1  
ATOM 351   N N    . LYS A 1 21 ? 1.105   -0.357  -1.990  1.00 0.00 ? 21 LYS A N    1  
ATOM 352   C CA   . LYS A 1 21 ? 2.169   0.322   -1.259  1.00 0.00 ? 21 LYS A CA   1  
ATOM 353   C C    . LYS A 1 21 ? 2.832   -0.601  -0.237  1.00 0.00 ? 21 LYS A C    1  
ATOM 354   O O    . LYS A 1 21 ? 4.055   -0.643  -0.140  1.00 0.00 ? 21 LYS A O    1  
ATOM 355   C CB   . LYS A 1 21 ? 1.636   1.606   -0.603  1.00 0.00 ? 21 LYS A CB   1  
ATOM 356   C CG   . LYS A 1 21 ? 0.537   1.384   0.429   1.00 0.00 ? 21 LYS A CG   1  
ATOM 357   C CD   . LYS A 1 21 ? -0.397  2.585   0.537   1.00 0.00 ? 21 LYS A CD   1  
ATOM 358   C CE   . LYS A 1 21 ? 0.356   3.880   0.789   1.00 0.00 ? 21 LYS A CE   1  
ATOM 359   N NZ   . LYS A 1 21 ? -0.569  5.037   0.925   1.00 0.00 ? 21 LYS A NZ   1  
ATOM 360   H H    . LYS A 1 21 ? 0.173   -0.038  -1.897  1.00 0.00 ? 21 LYS A H    1  
ATOM 361   H HA   . LYS A 1 21 ? 2.918   0.601   -1.986  1.00 0.00 ? 21 LYS A HA   1  
ATOM 362   H HB2  . LYS A 1 21 ? 2.458   2.107   -0.113  1.00 0.00 ? 21 LYS A HB2  1  
ATOM 363   H HB3  . LYS A 1 21 ? 1.245   2.250   -1.377  1.00 0.00 ? 21 LYS A HB3  1  
ATOM 364   H HG2  . LYS A 1 21 ? -0.042  0.519   0.142   1.00 0.00 ? 21 LYS A HG2  1  
ATOM 365   H HG3  . LYS A 1 21 ? 0.994   1.208   1.393   1.00 0.00 ? 21 LYS A HG3  1  
ATOM 366   H HD2  . LYS A 1 21 ? -0.950  2.681   -0.385  1.00 0.00 ? 21 LYS A HD2  1  
ATOM 367   H HD3  . LYS A 1 21 ? -1.086  2.417   1.353   1.00 0.00 ? 21 LYS A HD3  1  
ATOM 368   H HE2  . LYS A 1 21 ? 0.926   3.778   1.700   1.00 0.00 ? 21 LYS A HE2  1  
ATOM 369   H HE3  . LYS A 1 21 ? 1.027   4.058   -0.039  1.00 0.00 ? 21 LYS A HE3  1  
ATOM 370   H HZ1  . LYS A 1 21 ? -1.277  5.029   0.156   1.00 0.00 ? 21 LYS A HZ1  1  
ATOM 371   H HZ2  . LYS A 1 21 ? -0.035  5.932   0.883   1.00 0.00 ? 21 LYS A HZ2  1  
ATOM 372   H HZ3  . LYS A 1 21 ? -1.066  4.990   1.839   1.00 0.00 ? 21 LYS A HZ3  1  
ATOM 373   N N    . MET A 1 22 ? 2.032   -1.370  0.487   1.00 0.00 ? 22 MET A N    1  
ATOM 374   C CA   . MET A 1 22 ? 2.563   -2.275  1.497   1.00 0.00 ? 22 MET A CA   1  
ATOM 375   C C    . MET A 1 22 ? 3.307   -3.449  0.877   1.00 0.00 ? 22 MET A C    1  
ATOM 376   O O    . MET A 1 22 ? 4.342   -3.850  1.384   1.00 0.00 ? 22 MET A O    1  
ATOM 377   C CB   . MET A 1 22 ? 1.455   -2.766  2.429   1.00 0.00 ? 22 MET A CB   1  
ATOM 378   C CG   . MET A 1 22 ? 1.166   -1.792  3.561   1.00 0.00 ? 22 MET A CG   1  
ATOM 379   S SD   . MET A 1 22 ? 0.134   -2.506  4.855   1.00 0.00 ? 22 MET A SD   1  
ATOM 380   C CE   . MET A 1 22 ? -1.392  -2.764  3.958   1.00 0.00 ? 22 MET A CE   1  
ATOM 381   H H    . MET A 1 22 ? 1.063   -1.330  0.340   1.00 0.00 ? 22 MET A H    1  
ATOM 382   H HA   . MET A 1 22 ? 3.271   -1.714  2.089   1.00 0.00 ? 22 MET A HA   1  
ATOM 383   H HB2  . MET A 1 22 ? 0.550   -2.901  1.855   1.00 0.00 ? 22 MET A HB2  1  
ATOM 384   H HB3  . MET A 1 22 ? 1.746   -3.712  2.855   1.00 0.00 ? 22 MET A HB3  1  
ATOM 385   H HG2  . MET A 1 22 ? 2.103   -1.483  3.999   1.00 0.00 ? 22 MET A HG2  1  
ATOM 386   H HG3  . MET A 1 22 ? 0.660   -0.930  3.152   1.00 0.00 ? 22 MET A HG3  1  
ATOM 387   H HE1  . MET A 1 22 ? -1.213  -3.437  3.131   1.00 0.00 ? 22 MET A HE1  1  
ATOM 388   H HE2  . MET A 1 22 ? -1.752  -1.818  3.581   1.00 0.00 ? 22 MET A HE2  1  
ATOM 389   H HE3  . MET A 1 22 ? -2.130  -3.192  4.620   1.00 0.00 ? 22 MET A HE3  1  
ATOM 390   N N    . ALA A 1 23 ? 2.811   -3.986  -0.229  1.00 0.00 ? 23 ALA A N    1  
ATOM 391   C CA   . ALA A 1 23 ? 3.466   -5.133  -0.859  1.00 0.00 ? 23 ALA A CA   1  
ATOM 392   C C    . ALA A 1 23 ? 4.866   -4.774  -1.346  1.00 0.00 ? 23 ALA A C    1  
ATOM 393   O O    . ALA A 1 23 ? 5.755   -5.627  -1.385  1.00 0.00 ? 23 ALA A O    1  
ATOM 394   C CB   . ALA A 1 23 ? 2.637   -5.669  -2.014  1.00 0.00 ? 23 ALA A CB   1  
ATOM 395   H H    . ALA A 1 23 ? 1.998   -3.612  -0.628  1.00 0.00 ? 23 ALA A H    1  
ATOM 396   H HA   . ALA A 1 23 ? 3.548   -5.914  -0.117  1.00 0.00 ? 23 ALA A HA   1  
ATOM 397   H HB1  . ALA A 1 23 ? 1.656   -5.938  -1.654  1.00 0.00 ? 23 ALA A HB1  1  
ATOM 398   H HB2  . ALA A 1 23 ? 3.120   -6.540  -2.431  1.00 0.00 ? 23 ALA A HB2  1  
ATOM 399   H HB3  . ALA A 1 23 ? 2.545   -4.907  -2.775  1.00 0.00 ? 23 ALA A HB3  1  
ATOM 400   N N    . GLN A 1 24 ? 5.057   -3.521  -1.731  1.00 0.00 ? 24 GLN A N    1  
ATOM 401   C CA   . GLN A 1 24 ? 6.353   -3.067  -2.219  1.00 0.00 ? 24 GLN A CA   1  
ATOM 402   C C    . GLN A 1 24 ? 7.284   -2.686  -1.068  1.00 0.00 ? 24 GLN A C    1  
ATOM 403   O O    . GLN A 1 24 ? 8.495   -2.890  -1.148  1.00 0.00 ? 24 GLN A O    1  
ATOM 404   C CB   . GLN A 1 24 ? 6.172   -1.883  -3.170  1.00 0.00 ? 24 GLN A CB   1  
ATOM 405   C CG   . GLN A 1 24 ? 5.360   -2.224  -4.411  1.00 0.00 ? 24 GLN A CG   1  
ATOM 406   C CD   . GLN A 1 24 ? 5.997   -3.325  -5.238  1.00 0.00 ? 24 GLN A CD   1  
ATOM 407   O OE1  . GLN A 1 24 ? 6.791   -3.061  -6.139  1.00 0.00 ? 24 GLN A OE1  1  
ATOM 408   N NE2  . GLN A 1 24 ? 5.649   -4.567  -4.937  1.00 0.00 ? 24 GLN A NE2  1  
ATOM 409   H H    . GLN A 1 24 ? 4.305   -2.885  -1.695  1.00 0.00 ? 24 GLN A H    1  
ATOM 410   H HA   . GLN A 1 24 ? 6.802   -3.885  -2.766  1.00 0.00 ? 24 GLN A HA   1  
ATOM 411   H HB2  . GLN A 1 24 ? 5.667   -1.089  -2.641  1.00 0.00 ? 24 GLN A HB2  1  
ATOM 412   H HB3  . GLN A 1 24 ? 7.144   -1.535  -3.485  1.00 0.00 ? 24 GLN A HB3  1  
ATOM 413   H HG2  . GLN A 1 24 ? 4.376   -2.546  -4.106  1.00 0.00 ? 24 GLN A HG2  1  
ATOM 414   H HG3  . GLN A 1 24 ? 5.275   -1.339  -5.023  1.00 0.00 ? 24 GLN A HG3  1  
ATOM 415   H HE21 . GLN A 1 24 ? 5.007   -4.706  -4.214  1.00 0.00 ? 24 GLN A HE21 1  
ATOM 416   H HE22 . GLN A 1 24 ? 6.061   -5.306  -5.448  1.00 0.00 ? 24 GLN A HE22 1  
ATOM 417   N N    . GLU A 1 25 ? 6.713   -2.140  -0.001  1.00 0.00 ? 25 GLU A N    1  
ATOM 418   C CA   . GLU A 1 25 ? 7.500   -1.653  1.131   1.00 0.00 ? 25 GLU A CA   1  
ATOM 419   C C    . GLU A 1 25 ? 7.761   -2.759  2.156   1.00 0.00 ? 25 GLU A C    1  
ATOM 420   O O    . GLU A 1 25 ? 8.847   -2.843  2.730   1.00 0.00 ? 25 GLU A O    1  
ATOM 421   C CB   . GLU A 1 25 ? 6.799   -0.451  1.767   1.00 0.00 ? 25 GLU A CB   1  
ATOM 422   C CG   . GLU A 1 25 ? 6.802   0.766   0.853   1.00 0.00 ? 25 GLU A CG   1  
ATOM 423   C CD   . GLU A 1 25 ? 6.028   1.943   1.403   1.00 0.00 ? 25 GLU A CD   1  
ATOM 424   O OE1  . GLU A 1 25 ? 6.498   2.565   2.378   1.00 0.00 ? 25 GLU A OE1  1  
ATOM 425   O OE2  . GLU A 1 25 ? 4.967   2.278   0.832   1.00 0.00 ? 25 GLU A OE2  1  
ATOM 426   H H    . GLU A 1 25 ? 5.736   -2.059  0.029   1.00 0.00 ? 25 GLU A H    1  
ATOM 427   H HA   . GLU A 1 25 ? 8.452   -1.325  0.741   1.00 0.00 ? 25 GLU A HA   1  
ATOM 428   H HB2  . GLU A 1 25 ? 5.771   -0.714  1.985   1.00 0.00 ? 25 GLU A HB2  1  
ATOM 429   H HB3  . GLU A 1 25 ? 7.304   -0.190  2.684   1.00 0.00 ? 25 GLU A HB3  1  
ATOM 430   H HG2  . GLU A 1 25 ? 7.824   1.076   0.699   1.00 0.00 ? 25 GLU A HG2  1  
ATOM 431   H HG3  . GLU A 1 25 ? 6.369   0.481   -0.094  1.00 0.00 ? 25 GLU A HG3  1  
ATOM 432   N N    . ASN A 1 26 ? 6.770   -3.605  2.383   1.00 0.00 ? 26 ASN A N    1  
ATOM 433   C CA   . ASN A 1 26 ? 6.940   -4.789  3.221   1.00 0.00 ? 26 ASN A CA   1  
ATOM 434   C C    . ASN A 1 26 ? 6.539   -6.036  2.434   1.00 0.00 ? 26 ASN A C    1  
ATOM 435   O O    . ASN A 1 26 ? 5.407   -6.516  2.519   1.00 0.00 ? 26 ASN A O    1  
ATOM 436   C CB   . ASN A 1 26 ? 6.156   -4.683  4.540   1.00 0.00 ? 26 ASN A CB   1  
ATOM 437   C CG   . ASN A 1 26 ? 4.810   -3.999  4.395   1.00 0.00 ? 26 ASN A CG   1  
ATOM 438   O OD1  . ASN A 1 26 ? 4.692   -2.786  4.585   1.00 0.00 ? 26 ASN A OD1  1  
ATOM 439   N ND2  . ASN A 1 26 ? 3.785   -4.757  4.050   1.00 0.00 ? 26 ASN A ND2  1  
ATOM 440   H H    . ASN A 1 26 ? 5.895   -3.442  1.961   1.00 0.00 ? 26 ASN A H    1  
ATOM 441   H HA   . ASN A 1 26 ? 7.994   -4.864  3.451   1.00 0.00 ? 26 ASN A HA   1  
ATOM 442   H HB2  . ASN A 1 26 ? 5.987   -5.677  4.926   1.00 0.00 ? 26 ASN A HB2  1  
ATOM 443   H HB3  . ASN A 1 26 ? 6.747   -4.125  5.253   1.00 0.00 ? 26 ASN A HB3  1  
ATOM 444   H HD21 . ASN A 1 26 ? 3.946   -5.716  3.903   1.00 0.00 ? 26 ASN A HD21 1  
ATOM 445   H HD22 . ASN A 1 26 ? 2.916   -4.330  3.941   1.00 0.00 ? 26 ASN A HD22 1  
ATOM 446   N N    . PRO A 1 27 ? 7.498   -6.572  1.662   1.00 0.00 ? 27 PRO A N    1  
ATOM 447   C CA   . PRO A 1 27 ? 7.254   -7.591  0.624   1.00 0.00 ? 27 PRO A CA   1  
ATOM 448   C C    . PRO A 1 27 ? 6.480   -8.822  1.093   1.00 0.00 ? 27 PRO A C    1  
ATOM 449   O O    . PRO A 1 27 ? 5.650   -9.349  0.349   1.00 0.00 ? 27 PRO A O    1  
ATOM 450   C CB   . PRO A 1 27 ? 8.663   -8.001  0.192   1.00 0.00 ? 27 PRO A CB   1  
ATOM 451   C CG   . PRO A 1 27 ? 9.509   -6.818  0.498   1.00 0.00 ? 27 PRO A CG   1  
ATOM 452   C CD   . PRO A 1 27 ? 8.929   -6.218  1.745   1.00 0.00 ? 27 PRO A CD   1  
ATOM 453   H HA   . PRO A 1 27 ? 6.742   -7.163  -0.222  1.00 0.00 ? 27 PRO A HA   1  
ATOM 454   H HB2  . PRO A 1 27 ? 8.975   -8.868  0.754   1.00 0.00 ? 27 PRO A HB2  1  
ATOM 455   H HB3  . PRO A 1 27 ? 8.668   -8.227  -0.864  1.00 0.00 ? 27 PRO A HB3  1  
ATOM 456   H HG2  . PRO A 1 27 ? 10.528  -7.131  0.669   1.00 0.00 ? 27 PRO A HG2  1  
ATOM 457   H HG3  . PRO A 1 27 ? 9.462   -6.110  -0.316  1.00 0.00 ? 27 PRO A HG3  1  
ATOM 458   H HD2  . PRO A 1 27 ? 9.384   -6.657  2.622   1.00 0.00 ? 27 PRO A HD2  1  
ATOM 459   H HD3  . PRO A 1 27 ? 9.061   -5.147  1.745   1.00 0.00 ? 27 PRO A HD3  1  
ATOM 460   N N    . LYS A 1 28 ? 6.735   -9.272  2.317   1.00 0.00 ? 28 LYS A N    1  
ATOM 461   C CA   . LYS A 1 28 ? 6.175   -10.536 2.787   1.00 0.00 ? 28 LYS A CA   1  
ATOM 462   C C    . LYS A 1 28 ? 4.696   -10.415 3.160   1.00 0.00 ? 28 LYS A C    1  
ATOM 463   O O    . LYS A 1 28 ? 4.070   -11.392 3.571   1.00 0.00 ? 28 LYS A O    1  
ATOM 464   C CB   . LYS A 1 28 ? 7.002   -11.095 3.948   1.00 0.00 ? 28 LYS A CB   1  
ATOM 465   C CG   . LYS A 1 28 ? 7.138   -10.173 5.146   1.00 0.00 ? 28 LYS A CG   1  
ATOM 466   C CD   . LYS A 1 28 ? 8.182   -10.712 6.112   1.00 0.00 ? 28 LYS A CD   1  
ATOM 467   C CE   . LYS A 1 28 ? 7.853   -12.131 6.558   1.00 0.00 ? 28 LYS A CE   1  
ATOM 468   N NZ   . LYS A 1 28 ? 9.042   -12.832 7.112   1.00 0.00 ? 28 LYS A NZ   1  
ATOM 469   H H    . LYS A 1 28 ? 7.305   -8.744  2.914   1.00 0.00 ? 28 LYS A H    1  
ATOM 470   H HA   . LYS A 1 28 ? 6.246   -11.231 1.964   1.00 0.00 ? 28 LYS A HA   1  
ATOM 471   H HB2  . LYS A 1 28 ? 6.541   -12.010 4.286   1.00 0.00 ? 28 LYS A HB2  1  
ATOM 472   H HB3  . LYS A 1 28 ? 7.995   -11.322 3.587   1.00 0.00 ? 28 LYS A HB3  1  
ATOM 473   H HG2  . LYS A 1 28 ? 7.440   -9.192  4.805   1.00 0.00 ? 28 LYS A HG2  1  
ATOM 474   H HG3  . LYS A 1 28 ? 6.186   -10.108 5.652   1.00 0.00 ? 28 LYS A HG3  1  
ATOM 475   H HD2  . LYS A 1 28 ? 9.145   -10.712 5.623   1.00 0.00 ? 28 LYS A HD2  1  
ATOM 476   H HD3  . LYS A 1 28 ? 8.219   -10.070 6.982   1.00 0.00 ? 28 LYS A HD3  1  
ATOM 477   H HE2  . LYS A 1 28 ? 7.085   -12.088 7.316   1.00 0.00 ? 28 LYS A HE2  1  
ATOM 478   H HE3  . LYS A 1 28 ? 7.485   -12.687 5.708   1.00 0.00 ? 28 LYS A HE3  1  
ATOM 479   H HZ1  . LYS A 1 28 ? 8.768   -13.773 7.473   1.00 0.00 ? 28 LYS A HZ1  1  
ATOM 480   H HZ2  . LYS A 1 28 ? 9.464   -12.281 7.892   1.00 0.00 ? 28 LYS A HZ2  1  
ATOM 481   H HZ3  . LYS A 1 28 ? 9.763   -12.956 6.367   1.00 0.00 ? 28 LYS A HZ3  1  
ATOM 482   N N    . MET A 1 29 ? 4.141   -9.222  3.012   1.00 0.00 ? 29 MET A N    1  
ATOM 483   C CA   . MET A 1 29 ? 2.701   -9.036  3.101   1.00 0.00 ? 29 MET A CA   1  
ATOM 484   C C    . MET A 1 29 ? 2.186   -8.572  1.748   1.00 0.00 ? 29 MET A C    1  
ATOM 485   O O    . MET A 1 29 ? 2.513   -7.477  1.292   1.00 0.00 ? 29 MET A O    1  
ATOM 486   C CB   . MET A 1 29 ? 2.327   -8.043  4.204   1.00 0.00 ? 29 MET A CB   1  
ATOM 487   C CG   . MET A 1 29 ? 2.301   -8.670  5.590   1.00 0.00 ? 29 MET A CG   1  
ATOM 488   S SD   . MET A 1 29 ? 1.801   -7.516  6.884   1.00 0.00 ? 29 MET A SD   1  
ATOM 489   C CE   . MET A 1 29 ? 3.181   -6.375  6.883   1.00 0.00 ? 29 MET A CE   1  
ATOM 490   H H    . MET A 1 29 ? 4.713   -8.445  2.816   1.00 0.00 ? 29 MET A H    1  
ATOM 491   H HA   . MET A 1 29 ? 2.261   -10.000 3.326   1.00 0.00 ? 29 MET A HA   1  
ATOM 492   H HB2  . MET A 1 29 ? 3.044   -7.235  4.207   1.00 0.00 ? 29 MET A HB2  1  
ATOM 493   H HB3  . MET A 1 29 ? 1.346   -7.643  3.995   1.00 0.00 ? 29 MET A HB3  1  
ATOM 494   H HG2  . MET A 1 29 ? 1.605   -9.494  5.581   1.00 0.00 ? 29 MET A HG2  1  
ATOM 495   H HG3  . MET A 1 29 ? 3.288   -9.041  5.817   1.00 0.00 ? 29 MET A HG3  1  
ATOM 496   H HE1  . MET A 1 29 ? 3.035   -5.632  7.654   1.00 0.00 ? 29 MET A HE1  1  
ATOM 497   H HE2  . MET A 1 29 ? 3.244   -5.888  5.922   1.00 0.00 ? 29 MET A HE2  1  
ATOM 498   H HE3  . MET A 1 29 ? 4.095   -6.918  7.074   1.00 0.00 ? 29 MET A HE3  1  
ATOM 499   N N    . HIS A 1 30 ? 1.385   -9.414  1.106   1.00 0.00 ? 30 HIS A N    1  
ATOM 500   C CA   . HIS A 1 30 ? 1.072   -9.240  -0.315  1.00 0.00 ? 30 HIS A CA   1  
ATOM 501   C C    . HIS A 1 30 ? -0.018  -10.201 -0.773  1.00 0.00 ? 30 HIS A C    1  
ATOM 502   O O    . HIS A 1 30 ? -0.295  -10.320 -1.969  1.00 0.00 ? 30 HIS A O    1  
ATOM 503   C CB   . HIS A 1 30 ? 2.344   -9.450  -1.164  1.00 0.00 ? 30 HIS A CB   1  
ATOM 504   C CG   . HIS A 1 30 ? 3.015   -10.794 -0.980  1.00 0.00 ? 30 HIS A CG   1  
ATOM 505   N ND1  . HIS A 1 30 ? 3.830   -11.370 -1.932  1.00 0.00 ? 30 HIS A ND1  1  
ATOM 506   C CD2  . HIS A 1 30 ? 3.008   -11.660 0.068   1.00 0.00 ? 30 HIS A CD2  1  
ATOM 507   C CE1  . HIS A 1 30 ? 4.290   -12.524 -1.479  1.00 0.00 ? 30 HIS A CE1  1  
ATOM 508   N NE2  . HIS A 1 30 ? 3.805   -12.722 -0.271  1.00 0.00 ? 30 HIS A NE2  1  
ATOM 509   H H    . HIS A 1 30 ? 0.965   -10.159 1.609   1.00 0.00 ? 30 HIS A H    1  
ATOM 510   H HA   . HIS A 1 30 ? 0.721   -8.236  -0.458  1.00 0.00 ? 30 HIS A HA   1  
ATOM 511   H HB2  . HIS A 1 30 ? 2.088   -9.354  -2.207  1.00 0.00 ? 30 HIS A HB2  1  
ATOM 512   H HB3  . HIS A 1 30 ? 3.061   -8.684  -0.907  1.00 0.00 ? 30 HIS A HB3  1  
ATOM 513   H HD1  . HIS A 1 30 ? 4.049   -10.986 -2.817  1.00 0.00 ? 30 HIS A HD1  1  
ATOM 514   H HD2  . HIS A 1 30 ? 2.473   -11.534 0.998   1.00 0.00 ? 30 HIS A HD2  1  
ATOM 515   H HE1  . HIS A 1 30 ? 4.956   -13.190 -2.008  1.00 0.00 ? 30 HIS A HE1  1  
ATOM 516   H HE2  . HIS A 1 30 ? 4.117   -13.420 0.359   1.00 0.00 ? 30 HIS A HE2  1  
ATOM 517   N N    . ASN A 1 31 ? -0.652  -10.856 0.180   1.00 0.00 ? 31 ASN A N    1  
ATOM 518   C CA   . ASN A 1 31 ? -1.593  -11.917 -0.118  1.00 0.00 ? 31 ASN A CA   1  
ATOM 519   C C    . ASN A 1 31 ? -2.803  -11.832 0.813   1.00 0.00 ? 31 ASN A C    1  
ATOM 520   O O    . ASN A 1 31 ? -3.171  -10.745 1.271   1.00 0.00 ? 31 ASN A O    1  
ATOM 521   C CB   . ASN A 1 31 ? -0.896  -13.271 0.022   1.00 0.00 ? 31 ASN A CB   1  
ATOM 522   C CG   . ASN A 1 31 ? -1.458  -14.306 -0.930  1.00 0.00 ? 31 ASN A CG   1  
ATOM 523   O OD1  . ASN A 1 31 ? -2.402  -15.028 -0.603  1.00 0.00 ? 31 ASN A OD1  1  
ATOM 524   N ND2  . ASN A 1 31 ? -0.882  -14.376 -2.118  1.00 0.00 ? 31 ASN A ND2  1  
ATOM 525   H H    . ASN A 1 31 ? -0.491  -10.616 1.125   1.00 0.00 ? 31 ASN A H    1  
ATOM 526   H HA   . ASN A 1 31 ? -1.923  -11.793 -1.138  1.00 0.00 ? 31 ASN A HA   1  
ATOM 527   H HB2  . ASN A 1 31 ? 0.158   -13.153 -0.187  1.00 0.00 ? 31 ASN A HB2  1  
ATOM 528   H HB3  . ASN A 1 31 ? -1.021  -13.631 1.032   1.00 0.00 ? 31 ASN A HB3  1  
ATOM 529   H HD21 . ASN A 1 31 ? -0.137  -13.761 -2.307  1.00 0.00 ? 31 ASN A HD21 1  
ATOM 530   H HD22 . ASN A 1 31 ? -1.216  -15.039 -2.759  1.00 0.00 ? 31 ASN A HD22 1  
ATOM 531   N N    . SER A 1 32 ? -3.431  -12.976 1.066   1.00 0.00 ? 32 SER A N    1  
ATOM 532   C CA   . SER A 1 32 ? -4.623  -13.049 1.898   1.00 0.00 ? 32 SER A CA   1  
ATOM 533   C C    . SER A 1 32 ? -4.414  -12.427 3.284   1.00 0.00 ? 32 SER A C    1  
ATOM 534   O O    . SER A 1 32 ? -5.367  -11.925 3.879   1.00 0.00 ? 32 SER A O    1  
ATOM 535   C CB   . SER A 1 32 ? -5.064  -14.506 2.038   1.00 0.00 ? 32 SER A CB   1  
ATOM 536   O OG   . SER A 1 32 ? -5.330  -15.082 0.768   1.00 0.00 ? 32 SER A OG   1  
ATOM 537   H H    . SER A 1 32 ? -3.079  -13.808 0.675   1.00 0.00 ? 32 SER A H    1  
ATOM 538   H HA   . SER A 1 32 ? -5.405  -12.502 1.394   1.00 0.00 ? 32 SER A HA   1  
ATOM 539   H HB2  . SER A 1 32 ? -4.280  -15.072 2.519   1.00 0.00 ? 32 SER A HB2  1  
ATOM 540   H HB3  . SER A 1 32 ? -5.962  -14.553 2.636   1.00 0.00 ? 32 SER A HB3  1  
ATOM 541   H HG   . SER A 1 32 ? -5.293  -14.399 0.092   1.00 0.00 ? 32 SER A HG   1  
ATOM 542   N N    . GLU A 1 33 ? -3.182  -12.425 3.796   1.00 0.00 ? 33 GLU A N    1  
ATOM 543   C CA   . GLU A 1 33 ? -2.948  -11.879 5.128   1.00 0.00 ? 33 GLU A CA   1  
ATOM 544   C C    . GLU A 1 33 ? -3.207  -10.375 5.117   1.00 0.00 ? 33 GLU A C    1  
ATOM 545   O O    . GLU A 1 33 ? -3.847  -9.844  6.022   1.00 0.00 ? 33 GLU A O    1  
ATOM 546   C CB   . GLU A 1 33 ? -1.540  -12.217 5.658   1.00 0.00 ? 33 GLU A CB   1  
ATOM 547   C CG   . GLU A 1 33 ? -0.383  -11.480 4.991   1.00 0.00 ? 33 GLU A CG   1  
ATOM 548   C CD   . GLU A 1 33 ? -0.273  -11.764 3.513   1.00 0.00 ? 33 GLU A CD   1  
ATOM 549   O OE1  . GLU A 1 33 ? -0.203  -12.949 3.133   1.00 0.00 ? 33 GLU A OE1  1  
ATOM 550   O OE2  . GLU A 1 33 ? -0.268  -10.799 2.729   1.00 0.00 ? 33 GLU A OE2  1  
ATOM 551   H H    . GLU A 1 33 ? -2.425  -12.768 3.267   1.00 0.00 ? 33 GLU A H    1  
ATOM 552   H HA   . GLU A 1 33 ? -3.679  -12.332 5.785   1.00 0.00 ? 33 GLU A HA   1  
ATOM 553   H HB2  . GLU A 1 33 ? -1.509  -11.991 6.713   1.00 0.00 ? 33 GLU A HB2  1  
ATOM 554   H HB3  . GLU A 1 33 ? -1.376  -13.276 5.532   1.00 0.00 ? 33 GLU A HB3  1  
ATOM 555   H HG2  . GLU A 1 33 ? -0.526  -10.417 5.125   1.00 0.00 ? 33 GLU A HG2  1  
ATOM 556   H HG3  . GLU A 1 33 ? 0.539   -11.778 5.469   1.00 0.00 ? 33 GLU A HG3  1  
ATOM 557   N N    . ILE A 1 34 ? -2.750  -9.708  4.062   1.00 0.00 ? 34 ILE A N    1  
ATOM 558   C CA   . ILE A 1 34 ? -3.096  -8.312  3.824   1.00 0.00 ? 34 ILE A CA   1  
ATOM 559   C C    . ILE A 1 34 ? -4.613  -8.140  3.768   1.00 0.00 ? 34 ILE A C    1  
ATOM 560   O O    . ILE A 1 34 ? -5.159  -7.188  4.324   1.00 0.00 ? 34 ILE A O    1  
ATOM 561   C CB   . ILE A 1 34 ? -2.460  -7.785  2.510   1.00 0.00 ? 34 ILE A CB   1  
ATOM 562   C CG1  . ILE A 1 34 ? -0.983  -7.456  2.727   1.00 0.00 ? 34 ILE A CG1  1  
ATOM 563   C CG2  . ILE A 1 34 ? -3.202  -6.562  1.974   1.00 0.00 ? 34 ILE A CG2  1  
ATOM 564   C CD1  . ILE A 1 34 ? -0.746  -6.371  3.757   1.00 0.00 ? 34 ILE A CD1  1  
ATOM 565   H H    . ILE A 1 34 ? -2.147  -10.163 3.433   1.00 0.00 ? 34 ILE A H    1  
ATOM 566   H HA   . ILE A 1 34 ? -2.707  -7.729  4.646   1.00 0.00 ? 34 ILE A HA   1  
ATOM 567   H HB   . ILE A 1 34 ? -2.535  -8.565  1.768   1.00 0.00 ? 34 ILE A HB   1  
ATOM 568   H HG12 . ILE A 1 34 ? -0.469  -8.345  3.058   1.00 0.00 ? 34 ILE A HG12 1  
ATOM 569   H HG13 . ILE A 1 34 ? -0.555  -7.126  1.791   1.00 0.00 ? 34 ILE A HG13 1  
ATOM 570   H HG21 . ILE A 1 34 ? -3.181  -5.776  2.713   1.00 0.00 ? 34 ILE A HG21 1  
ATOM 571   H HG22 . ILE A 1 34 ? -4.226  -6.829  1.760   1.00 0.00 ? 34 ILE A HG22 1  
ATOM 572   H HG23 . ILE A 1 34 ? -2.723  -6.219  1.069   1.00 0.00 ? 34 ILE A HG23 1  
ATOM 573   H HD11 . ILE A 1 34 ? -1.270  -5.474  3.461   1.00 0.00 ? 34 ILE A HD11 1  
ATOM 574   H HD12 . ILE A 1 34 ? 0.313   -6.164  3.827   1.00 0.00 ? 34 ILE A HD12 1  
ATOM 575   H HD13 . ILE A 1 34 ? -1.112  -6.701  4.718   1.00 0.00 ? 34 ILE A HD13 1  
ATOM 576   N N    . SER A 1 35 ? -5.294  -9.086  3.130   1.00 0.00 ? 35 SER A N    1  
ATOM 577   C CA   . SER A 1 35 ? -6.742  -9.012  2.990   1.00 0.00 ? 35 SER A CA   1  
ATOM 578   C C    . SER A 1 35 ? -7.413  -9.109  4.359   1.00 0.00 ? 35 SER A C    1  
ATOM 579   O O    . SER A 1 35 ? -8.435  -8.465  4.613   1.00 0.00 ? 35 SER A O    1  
ATOM 580   C CB   . SER A 1 35 ? -7.238  -10.125 2.068   1.00 0.00 ? 35 SER A CB   1  
ATOM 581   O OG   . SER A 1 35 ? -6.510  -10.125 0.850   1.00 0.00 ? 35 SER A OG   1  
ATOM 582   H H    . SER A 1 35 ? -4.812  -9.868  2.766   1.00 0.00 ? 35 SER A H    1  
ATOM 583   H HA   . SER A 1 35 ? -6.984  -8.055  2.550   1.00 0.00 ? 35 SER A HA   1  
ATOM 584   H HB2  . SER A 1 35 ? -7.103  -11.080 2.554   1.00 0.00 ? 35 SER A HB2  1  
ATOM 585   H HB3  . SER A 1 35 ? -8.285  -9.974  1.851   1.00 0.00 ? 35 SER A HB3  1  
ATOM 586   H HG   . SER A 1 35 ? -5.727  -9.574  0.948   1.00 0.00 ? 35 SER A HG   1  
ATOM 587   N N    . LYS A 1 36 ? -6.806  -9.892  5.249   1.00 0.00 ? 36 LYS A N    1  
ATOM 588   C CA   . LYS A 1 36 ? -7.335  -10.085 6.589   1.00 0.00 ? 36 LYS A CA   1  
ATOM 589   C C    . LYS A 1 36 ? -7.052  -8.836  7.420   1.00 0.00 ? 36 LYS A C    1  
ATOM 590   O O    . LYS A 1 36 ? -7.902  -8.374  8.181   1.00 0.00 ? 36 LYS A O    1  
ATOM 591   C CB   . LYS A 1 36 ? -6.699  -11.332 7.230   1.00 0.00 ? 36 LYS A CB   1  
ATOM 592   C CG   . LYS A 1 36 ? -7.553  -11.999 8.308   1.00 0.00 ? 36 LYS A CG   1  
ATOM 593   C CD   . LYS A 1 36 ? -7.599  -11.196 9.601   1.00 0.00 ? 36 LYS A CD   1  
ATOM 594   C CE   . LYS A 1 36 ? -6.238  -11.138 10.284  1.00 0.00 ? 36 LYS A CE   1  
ATOM 595   N NZ   . LYS A 1 36 ? -5.735  -12.486 10.659  1.00 0.00 ? 36 LYS A NZ   1  
ATOM 596   H H    . LYS A 1 36 ? -5.967  -10.342 4.998   1.00 0.00 ? 36 LYS A H    1  
ATOM 597   H HA   . LYS A 1 36 ? -8.403  -10.226 6.511   1.00 0.00 ? 36 LYS A HA   1  
ATOM 598   H HB2  . LYS A 1 36 ? -6.510  -12.061 6.457   1.00 0.00 ? 36 LYS A HB2  1  
ATOM 599   H HB3  . LYS A 1 36 ? -5.758  -11.046 7.676   1.00 0.00 ? 36 LYS A HB3  1  
ATOM 600   H HG2  . LYS A 1 36 ? -8.560  -12.109 7.936   1.00 0.00 ? 36 LYS A HG2  1  
ATOM 601   H HG3  . LYS A 1 36 ? -7.141  -12.977 8.520   1.00 0.00 ? 36 LYS A HG3  1  
ATOM 602   H HD2  . LYS A 1 36 ? -7.917  -10.190 9.374   1.00 0.00 ? 36 LYS A HD2  1  
ATOM 603   H HD3  . LYS A 1 36 ? -8.308  -11.655 10.273  1.00 0.00 ? 36 LYS A HD3  1  
ATOM 604   H HE2  . LYS A 1 36 ? -5.533  -10.678 9.609   1.00 0.00 ? 36 LYS A HE2  1  
ATOM 605   H HE3  . LYS A 1 36 ? -6.326  -10.535 11.176  1.00 0.00 ? 36 LYS A HE3  1  
ATOM 606   H HZ1  . LYS A 1 36 ? -4.920  -12.398 11.308  1.00 0.00 ? 36 LYS A HZ1  1  
ATOM 607   H HZ2  . LYS A 1 36 ? -5.434  -13.003 9.812   1.00 0.00 ? 36 LYS A HZ2  1  
ATOM 608   H HZ3  . LYS A 1 36 ? -6.488  -13.034 11.136  1.00 0.00 ? 36 LYS A HZ3  1  
ATOM 609   N N    . ARG A 1 37 ? -5.853  -8.288  7.245   1.00 0.00 ? 37 ARG A N    1  
ATOM 610   C CA   . ARG A 1 37 ? -5.452  -7.068  7.936   1.00 0.00 ? 37 ARG A CA   1  
ATOM 611   C C    . ARG A 1 37 ? -6.384  -5.916  7.589   1.00 0.00 ? 37 ARG A C    1  
ATOM 612   O O    . ARG A 1 37 ? -6.959  -5.290  8.471   1.00 0.00 ? 37 ARG A O    1  
ATOM 613   C CB   . ARG A 1 37 ? -4.020  -6.674  7.558   1.00 0.00 ? 37 ARG A CB   1  
ATOM 614   C CG   . ARG A 1 37 ? -2.946  -7.597  8.110   1.00 0.00 ? 37 ARG A CG   1  
ATOM 615   C CD   . ARG A 1 37 ? -2.997  -7.666  9.624   1.00 0.00 ? 37 ARG A CD   1  
ATOM 616   N NE   . ARG A 1 37 ? -1.678  -7.493  10.227  1.00 0.00 ? 37 ARG A NE   1  
ATOM 617   C CZ   . ARG A 1 37 ? -1.320  -8.001  11.406  1.00 0.00 ? 37 ARG A CZ   1  
ATOM 618   N NH1  . ARG A 1 37 ? -2.180  -8.716  12.118  1.00 0.00 ? 37 ARG A NH1  1  
ATOM 619   N NH2  . ARG A 1 37 ? -0.097  -7.779  11.874  1.00 0.00 ? 37 ARG A NH2  1  
ATOM 620   H H    . ARG A 1 37 ? -5.214  -8.724  6.634   1.00 0.00 ? 37 ARG A H    1  
ATOM 621   H HA   . ARG A 1 37 ? -5.500  -7.252  8.996   1.00 0.00 ? 37 ARG A HA   1  
ATOM 622   H HB2  . ARG A 1 37 ? -3.937  -6.670  6.482   1.00 0.00 ? 37 ARG A HB2  1  
ATOM 623   H HB3  . ARG A 1 37 ? -3.828  -5.676  7.925   1.00 0.00 ? 37 ARG A HB3  1  
ATOM 624   H HG2  . ARG A 1 37 ? -3.096  -8.589  7.708   1.00 0.00 ? 37 ARG A HG2  1  
ATOM 625   H HG3  . ARG A 1 37 ? -1.976  -7.228  7.806   1.00 0.00 ? 37 ARG A HG3  1  
ATOM 626   H HD2  . ARG A 1 37 ? -3.652  -6.886  9.985   1.00 0.00 ? 37 ARG A HD2  1  
ATOM 627   H HD3  . ARG A 1 37 ? -3.392  -8.628  9.912   1.00 0.00 ? 37 ARG A HD3  1  
ATOM 628   H HE   . ARG A 1 37 ? -1.019  -6.954  9.727   1.00 0.00 ? 37 ARG A HE   1  
ATOM 629   H HH11 . ARG A 1 37 ? -3.116  -8.874  11.778  1.00 0.00 ? 37 ARG A HH11 1  
ATOM 630   H HH12 . ARG A 1 37 ? -1.897  -9.122  13.000  1.00 0.00 ? 37 ARG A HH12 1  
ATOM 631   H HH21 . ARG A 1 37 ? 0.558   -7.235  11.338  1.00 0.00 ? 37 ARG A HH21 1  
ATOM 632   H HH22 . ARG A 1 37 ? 0.172   -8.132  12.777  1.00 0.00 ? 37 ARG A HH22 1  
ATOM 633   N N    . LEU A 1 38 ? -6.548  -5.663  6.297   1.00 0.00 ? 38 LEU A N    1  
ATOM 634   C CA   . LEU A 1 38 ? -7.317  -4.514  5.832   1.00 0.00 ? 38 LEU A CA   1  
ATOM 635   C C    . LEU A 1 38 ? -8.773  -4.580  6.278   1.00 0.00 ? 38 LEU A C    1  
ATOM 636   O O    . LEU A 1 38 ? -9.351  -3.562  6.656   1.00 0.00 ? 38 LEU A O    1  
ATOM 637   C CB   . LEU A 1 38 ? -7.227  -4.386  4.311   1.00 0.00 ? 38 LEU A CB   1  
ATOM 638   C CG   . LEU A 1 38 ? -6.038  -3.567  3.790   1.00 0.00 ? 38 LEU A CG   1  
ATOM 639   C CD1  . LEU A 1 38 ? -4.715  -4.142  4.262   1.00 0.00 ? 38 LEU A CD1  1  
ATOM 640   C CD2  . LEU A 1 38 ? -6.075  -3.501  2.276   1.00 0.00 ? 38 LEU A CD2  1  
ATOM 641   H H    . LEU A 1 38 ? -6.135  -6.264  5.632   1.00 0.00 ? 38 LEU A H    1  
ATOM 642   H HA   . LEU A 1 38 ? -6.870  -3.635  6.272   1.00 0.00 ? 38 LEU A HA   1  
ATOM 643   H HB2  . LEU A 1 38 ? -7.163  -5.381  3.893   1.00 0.00 ? 38 LEU A HB2  1  
ATOM 644   H HB3  . LEU A 1 38 ? -8.135  -3.924  3.956   1.00 0.00 ? 38 LEU A HB3  1  
ATOM 645   H HG   . LEU A 1 38 ? -6.113  -2.556  4.170   1.00 0.00 ? 38 LEU A HG   1  
ATOM 646   H HD11 . LEU A 1 38 ? -4.671  -4.110  5.341   1.00 0.00 ? 38 LEU A HD11 1  
ATOM 647   H HD12 . LEU A 1 38 ? -3.903  -3.560  3.851   1.00 0.00 ? 38 LEU A HD12 1  
ATOM 648   H HD13 . LEU A 1 38 ? -4.629  -5.166  3.928   1.00 0.00 ? 38 LEU A HD13 1  
ATOM 649   H HD21 . LEU A 1 38 ? -6.994  -3.034  1.963   1.00 0.00 ? 38 LEU A HD21 1  
ATOM 650   H HD22 . LEU A 1 38 ? -6.021  -4.500  1.871   1.00 0.00 ? 38 LEU A HD22 1  
ATOM 651   H HD23 . LEU A 1 38 ? -5.235  -2.923  1.920   1.00 0.00 ? 38 LEU A HD23 1  
ATOM 652   N N    . GLY A 1 39 ? -9.363  -5.770  6.248   1.00 0.00 ? 39 GLY A N    1  
ATOM 653   C CA   . GLY A 1 39 ? -10.728 -5.927  6.715   1.00 0.00 ? 39 GLY A CA   1  
ATOM 654   C C    . GLY A 1 39 ? -10.864 -5.569  8.180   1.00 0.00 ? 39 GLY A C    1  
ATOM 655   O O    . GLY A 1 39 ? -11.789 -4.853  8.575   1.00 0.00 ? 39 GLY A O    1  
ATOM 656   H H    . GLY A 1 39 ? -8.870  -6.545  5.907   1.00 0.00 ? 39 GLY A H    1  
ATOM 657   H HA2  . GLY A 1 39 ? -11.373 -5.284  6.134   1.00 0.00 ? 39 GLY A HA2  1  
ATOM 658   H HA3  . GLY A 1 39 ? -11.034 -6.954  6.573   1.00 0.00 ? 39 GLY A HA3  1  
ATOM 659   N N    . ALA A 1 40 ? -9.923  -6.050  8.985   1.00 0.00 ? 40 ALA A N    1  
ATOM 660   C CA   . ALA A 1 40 ? -9.911  -5.755  10.408  1.00 0.00 ? 40 ALA A CA   1  
ATOM 661   C C    . ALA A 1 40 ? -9.647  -4.272  10.651  1.00 0.00 ? 40 ALA A C    1  
ATOM 662   O O    . ALA A 1 40 ? -10.311 -3.640  11.474  1.00 0.00 ? 40 ALA A O    1  
ATOM 663   C CB   . ALA A 1 40 ? -8.862  -6.604  11.107  1.00 0.00 ? 40 ALA A CB   1  
ATOM 664   H H    . ALA A 1 40 ? -9.214  -6.617  8.609   1.00 0.00 ? 40 ALA A H    1  
ATOM 665   H HA   . ALA A 1 40 ? -10.878 -6.013  10.812  1.00 0.00 ? 40 ALA A HA   1  
ATOM 666   H HB1  . ALA A 1 40 ? -8.890  -6.409  12.169  1.00 0.00 ? 40 ALA A HB1  1  
ATOM 667   H HB2  . ALA A 1 40 ? -7.884  -6.355  10.720  1.00 0.00 ? 40 ALA A HB2  1  
ATOM 668   H HB3  . ALA A 1 40 ? -9.065  -7.648  10.926  1.00 0.00 ? 40 ALA A HB3  1  
ATOM 669   N N    . GLU A 1 41 ? -8.696  -3.717  9.909   1.00 0.00 ? 41 GLU A N    1  
ATOM 670   C CA   . GLU A 1 41 ? -8.329  -2.314  10.063  1.00 0.00 ? 41 GLU A CA   1  
ATOM 671   C C    . GLU A 1 41 ? -9.482  -1.404  9.645   1.00 0.00 ? 41 GLU A C    1  
ATOM 672   O O    . GLU A 1 41 ? -9.670  -0.329  10.212  1.00 0.00 ? 41 GLU A O    1  
ATOM 673   C CB   . GLU A 1 41 ? -7.078  -1.978  9.248   1.00 0.00 ? 41 GLU A CB   1  
ATOM 674   C CG   . GLU A 1 41 ? -5.837  -2.747  9.675   1.00 0.00 ? 41 GLU A CG   1  
ATOM 675   C CD   . GLU A 1 41 ? -5.531  -2.593  11.150  1.00 0.00 ? 41 GLU A CD   1  
ATOM 676   O OE1  . GLU A 1 41 ? -5.185  -1.471  11.579  1.00 0.00 ? 41 GLU A OE1  1  
ATOM 677   O OE2  . GLU A 1 41 ? -5.634  -3.592  11.889  1.00 0.00 ? 41 GLU A OE2  1  
ATOM 678   H H    . GLU A 1 41 ? -8.227  -4.270  9.236   1.00 0.00 ? 41 GLU A H    1  
ATOM 679   H HA   . GLU A 1 41 ? -8.120  -2.143  11.108  1.00 0.00 ? 41 GLU A HA   1  
ATOM 680   H HB2  . GLU A 1 41 ? -7.269  -2.201  8.210   1.00 0.00 ? 41 GLU A HB2  1  
ATOM 681   H HB3  . GLU A 1 41 ? -6.872  -0.924  9.348   1.00 0.00 ? 41 GLU A HB3  1  
ATOM 682   H HG2  . GLU A 1 41 ? -5.986  -3.794  9.460   1.00 0.00 ? 41 GLU A HG2  1  
ATOM 683   H HG3  . GLU A 1 41 ? -4.993  -2.380  9.109   1.00 0.00 ? 41 GLU A HG3  1  
ATOM 684   N N    . TRP A 1 42 ? -10.245 -1.849  8.653   1.00 0.00 ? 42 TRP A N    1  
ATOM 685   C CA   . TRP A 1 42 ? -11.404 -1.104  8.173   1.00 0.00 ? 42 TRP A CA   1  
ATOM 686   C C    . TRP A 1 42 ? -12.462 -0.969  9.259   1.00 0.00 ? 42 TRP A C    1  
ATOM 687   O O    . TRP A 1 42 ? -13.065 0.091   9.424   1.00 0.00 ? 42 TRP A O    1  
ATOM 688   C CB   . TRP A 1 42 ? -12.012 -1.795  6.954   1.00 0.00 ? 42 TRP A CB   1  
ATOM 689   C CG   . TRP A 1 42 ? -11.980 -0.950  5.724   1.00 0.00 ? 42 TRP A CG   1  
ATOM 690   C CD1  . TRP A 1 42 ? -10.996 -0.918  4.782   1.00 0.00 ? 42 TRP A CD1  1  
ATOM 691   C CD2  . TRP A 1 42 ? -12.977 -0.010  5.301   1.00 0.00 ? 42 TRP A CD2  1  
ATOM 692   N NE1  . TRP A 1 42 ? -11.313 -0.013  3.799   1.00 0.00 ? 42 TRP A NE1  1  
ATOM 693   C CE2  . TRP A 1 42 ? -12.527 0.556   4.094   1.00 0.00 ? 42 TRP A CE2  1  
ATOM 694   C CE3  . TRP A 1 42 ? -14.204 0.410   5.821   1.00 0.00 ? 42 TRP A CE3  1  
ATOM 695   C CZ2  . TRP A 1 42 ? -13.259 1.516   3.404   1.00 0.00 ? 42 TRP A CZ2  1  
ATOM 696   C CZ3  . TRP A 1 42 ? -14.931 1.362   5.131   1.00 0.00 ? 42 TRP A CZ3  1  
ATOM 697   C CH2  . TRP A 1 42 ? -14.455 1.904   3.931   1.00 0.00 ? 42 TRP A CH2  1  
ATOM 698   H H    . TRP A 1 42 ? -10.010 -2.700  8.216   1.00 0.00 ? 42 TRP A H    1  
ATOM 699   H HA   . TRP A 1 42 ? -11.069 -0.119  7.886   1.00 0.00 ? 42 TRP A HA   1  
ATOM 700   H HB2  . TRP A 1 42 ? -11.459 -2.700  6.752   1.00 0.00 ? 42 TRP A HB2  1  
ATOM 701   H HB3  . TRP A 1 42 ? -13.041 -2.042  7.166   1.00 0.00 ? 42 TRP A HB3  1  
ATOM 702   H HD1  . TRP A 1 42 ? -10.100 -1.518  4.819   1.00 0.00 ? 42 TRP A HD1  1  
ATOM 703   H HE1  . TRP A 1 42 ? -10.761 0.191   3.014   1.00 0.00 ? 42 TRP A HE1  1  
ATOM 704   H HE3  . TRP A 1 42 ? -14.588 0.001   6.745   1.00 0.00 ? 42 TRP A HE3  1  
ATOM 705   H HZ2  . TRP A 1 42 ? -12.907 1.944   2.476   1.00 0.00 ? 42 TRP A HZ2  1  
ATOM 706   H HZ3  . TRP A 1 42 ? -15.884 1.693   5.516   1.00 0.00 ? 42 TRP A HZ3  1  
ATOM 707   H HH2  . TRP A 1 42 ? -15.055 2.641   3.419   1.00 0.00 ? 42 TRP A HH2  1  
ATOM 708   N N    . LYS A 1 43 ? -12.688 -2.046  10.002  1.00 0.00 ? 43 LYS A N    1  
ATOM 709   C CA   . LYS A 1 43 ? -13.690 -2.029  11.059  1.00 0.00 ? 43 LYS A CA   1  
ATOM 710   C C    . LYS A 1 43 ? -13.275 -1.093  12.193  1.00 0.00 ? 43 LYS A C    1  
ATOM 711   O O    . LYS A 1 43 ? -14.122 -0.482  12.847  1.00 0.00 ? 43 LYS A O    1  
ATOM 712   C CB   . LYS A 1 43 ? -13.938 -3.432  11.592  1.00 0.00 ? 43 LYS A CB   1  
ATOM 713   C CG   . LYS A 1 43 ? -15.117 -3.501  12.544  1.00 0.00 ? 43 LYS A CG   1  
ATOM 714   C CD   . LYS A 1 43 ? -15.513 -4.931  12.811  1.00 0.00 ? 43 LYS A CD   1  
ATOM 715   C CE   . LYS A 1 43 ? -16.522 -5.036  13.944  1.00 0.00 ? 43 LYS A CE   1  
ATOM 716   N NZ   . LYS A 1 43 ? -15.971 -4.547  15.238  1.00 0.00 ? 43 LYS A NZ   1  
ATOM 717   H H    . LYS A 1 43 ? -12.176 -2.870  9.829   1.00 0.00 ? 43 LYS A H    1  
ATOM 718   H HA   . LYS A 1 43 ? -14.608 -1.666  10.636  1.00 0.00 ? 43 LYS A HA   1  
ATOM 719   H HB2  . LYS A 1 43 ? -14.127 -4.095  10.760  1.00 0.00 ? 43 LYS A HB2  1  
ATOM 720   H HB3  . LYS A 1 43 ? -13.059 -3.767  12.118  1.00 0.00 ? 43 LYS A HB3  1  
ATOM 721   H HG2  . LYS A 1 43 ? -14.847 -3.029  13.477  1.00 0.00 ? 43 LYS A HG2  1  
ATOM 722   H HG3  . LYS A 1 43 ? -15.955 -2.979  12.105  1.00 0.00 ? 43 LYS A HG3  1  
ATOM 723   H HD2  . LYS A 1 43 ? -15.949 -5.348  11.914  1.00 0.00 ? 43 LYS A HD2  1  
ATOM 724   H HD3  . LYS A 1 43 ? -14.628 -5.480  13.069  1.00 0.00 ? 43 LYS A HD3  1  
ATOM 725   H HE2  . LYS A 1 43 ? -17.389 -4.446  13.689  1.00 0.00 ? 43 LYS A HE2  1  
ATOM 726   H HE3  . LYS A 1 43 ? -16.811 -6.070  14.052  1.00 0.00 ? 43 LYS A HE3  1  
ATOM 727   H HZ1  . LYS A 1 43 ? -16.591 -4.834  16.024  1.00 0.00 ? 43 LYS A HZ1  1  
ATOM 728   H HZ2  . LYS A 1 43 ? -15.896 -3.507  15.232  1.00 0.00 ? 43 LYS A HZ2  1  
ATOM 729   H HZ3  . LYS A 1 43 ? -15.021 -4.950  15.398  1.00 0.00 ? 43 LYS A HZ3  1  
ATOM 730   N N    . LEU A 1 44 ? -11.972 -0.969  12.405  1.00 0.00 ? 44 LEU A N    1  
ATOM 731   C CA   . LEU A 1 44 ? -11.443 -0.095  13.447  1.00 0.00 ? 44 LEU A CA   1  
ATOM 732   C C    . LEU A 1 44 ? -10.972 1.235   12.856  1.00 0.00 ? 44 LEU A C    1  
ATOM 733   O O    . LEU A 1 44 ? -10.134 1.923   13.446  1.00 0.00 ? 44 LEU A O    1  
ATOM 734   C CB   . LEU A 1 44 ? -10.280 -0.775  14.189  1.00 0.00 ? 44 LEU A CB   1  
ATOM 735   C CG   . LEU A 1 44 ? -10.668 -1.856  15.211  1.00 0.00 ? 44 LEU A CG   1  
ATOM 736   C CD1  . LEU A 1 44 ? -11.691 -1.320  16.196  1.00 0.00 ? 44 LEU A CD1  1  
ATOM 737   C CD2  . LEU A 1 44 ? -11.192 -3.110  14.526  1.00 0.00 ? 44 LEU A CD2  1  
ATOM 738   H H    . LEU A 1 44 ? -11.347 -1.479  11.847  1.00 0.00 ? 44 LEU A H    1  
ATOM 739   H HA   . LEU A 1 44 ? -12.239 0.100   14.150  1.00 0.00 ? 44 LEU A HA   1  
ATOM 740   H HB2  . LEU A 1 44 ? -9.634  -1.229  13.451  1.00 0.00 ? 44 LEU A HB2  1  
ATOM 741   H HB3  . LEU A 1 44 ? -9.720  -0.009  14.706  1.00 0.00 ? 44 LEU A HB3  1  
ATOM 742   H HG   . LEU A 1 44 ? -9.788  -2.131  15.776  1.00 0.00 ? 44 LEU A HG   1  
ATOM 743   H HD11 . LEU A 1 44 ? -11.937 -2.088  16.915  1.00 0.00 ? 44 LEU A HD11 1  
ATOM 744   H HD12 . LEU A 1 44 ? -12.584 -1.027  15.662  1.00 0.00 ? 44 LEU A HD12 1  
ATOM 745   H HD13 . LEU A 1 44 ? -11.281 -0.462  16.708  1.00 0.00 ? 44 LEU A HD13 1  
ATOM 746   H HD21 . LEU A 1 44 ? -10.420 -3.523  13.893  1.00 0.00 ? 44 LEU A HD21 1  
ATOM 747   H HD22 . LEU A 1 44 ? -12.054 -2.860  13.926  1.00 0.00 ? 44 LEU A HD22 1  
ATOM 748   H HD23 . LEU A 1 44 ? -11.472 -3.836  15.275  1.00 0.00 ? 44 LEU A HD23 1  
ATOM 749   N N    . LEU A 1 45 ? -11.526 1.598   11.698  1.00 0.00 ? 45 LEU A N    1  
ATOM 750   C CA   . LEU A 1 45 ? -11.121 2.805   10.982  1.00 0.00 ? 45 LEU A CA   1  
ATOM 751   C C    . LEU A 1 45 ? -11.325 4.055   11.834  1.00 0.00 ? 45 LEU A C    1  
ATOM 752   O O    . LEU A 1 45 ? -12.421 4.313   12.332  1.00 0.00 ? 45 LEU A O    1  
ATOM 753   C CB   . LEU A 1 45 ? -11.904 2.925   9.660   1.00 0.00 ? 45 LEU A CB   1  
ATOM 754   C CG   . LEU A 1 45 ? -11.511 4.086   8.726   1.00 0.00 ? 45 LEU A CG   1  
ATOM 755   C CD1  . LEU A 1 45 ? -12.183 5.388   9.138   1.00 0.00 ? 45 LEU A CD1  1  
ATOM 756   C CD2  . LEU A 1 45 ? -9.997  4.241   8.686   1.00 0.00 ? 45 LEU A CD2  1  
ATOM 757   H H    . LEU A 1 45 ? -12.227 1.032   11.310  1.00 0.00 ? 45 LEU A H    1  
ATOM 758   H HA   . LEU A 1 45 ? -10.071 2.714   10.755  1.00 0.00 ? 45 LEU A HA   1  
ATOM 759   H HB2  . LEU A 1 45 ? -11.780 2.003   9.113   1.00 0.00 ? 45 LEU A HB2  1  
ATOM 760   H HB3  . LEU A 1 45 ? -12.951 3.035   9.903   1.00 0.00 ? 45 LEU A HB3  1  
ATOM 761   H HG   . LEU A 1 45 ? -11.840 3.861   7.729   1.00 0.00 ? 45 LEU A HG   1  
ATOM 762   H HD11 . LEU A 1 45 ? -11.915 6.167   8.440   1.00 0.00 ? 45 LEU A HD11 1  
ATOM 763   H HD12 . LEU A 1 45 ? -11.859 5.665   10.129  1.00 0.00 ? 45 LEU A HD12 1  
ATOM 764   H HD13 . LEU A 1 45 ? -13.256 5.256   9.133   1.00 0.00 ? 45 LEU A HD13 1  
ATOM 765   H HD21 . LEU A 1 45 ? -9.551  3.329   8.317   1.00 0.00 ? 45 LEU A HD21 1  
ATOM 766   H HD22 . LEU A 1 45 ? -9.627  4.443   9.680   1.00 0.00 ? 45 LEU A HD22 1  
ATOM 767   H HD23 . LEU A 1 45 ? -9.737  5.059   8.032   1.00 0.00 ? 45 LEU A HD23 1  
ATOM 768   N N    . SER A 1 46 ? -10.255 4.817   12.002  1.00 0.00 ? 46 SER A N    1  
ATOM 769   C CA   . SER A 1 46 ? -10.333 6.111   12.653  1.00 0.00 ? 46 SER A CA   1  
ATOM 770   C C    . SER A 1 46 ? -10.548 7.204   11.609  1.00 0.00 ? 46 SER A C    1  
ATOM 771   O O    . SER A 1 46 ? -9.961  7.152   10.528  1.00 0.00 ? 46 SER A O    1  
ATOM 772   C CB   . SER A 1 46 ? -9.056  6.376   13.449  1.00 0.00 ? 46 SER A CB   1  
ATOM 773   O OG   . SER A 1 46 ? -8.787  5.308   14.343  1.00 0.00 ? 46 SER A OG   1  
ATOM 774   H H    . SER A 1 46 ? -9.387  4.502   11.669  1.00 0.00 ? 46 SER A H    1  
ATOM 775   H HA   . SER A 1 46 ? -11.176 6.093   13.325  1.00 0.00 ? 46 SER A HA   1  
ATOM 776   H HB2  . SER A 1 46 ? -8.225  6.478   12.767  1.00 0.00 ? 46 SER A HB2  1  
ATOM 777   H HB3  . SER A 1 46 ? -9.173  7.285   14.017  1.00 0.00 ? 46 SER A HB3  1  
ATOM 778   H HG   . SER A 1 46 ? -9.476  4.634   14.253  1.00 0.00 ? 46 SER A HG   1  
ATOM 779   N N    . GLU A 1 47 ? -11.378 8.189   11.940  1.00 0.00 ? 47 GLU A N    1  
ATOM 780   C CA   . GLU A 1 47 ? -11.760 9.257   11.005  1.00 0.00 ? 47 GLU A CA   1  
ATOM 781   C C    . GLU A 1 47 ? -10.560 9.951   10.353  1.00 0.00 ? 47 GLU A C    1  
ATOM 782   O O    . GLU A 1 47 ? -10.666 10.450  9.233   1.00 0.00 ? 47 GLU A O    1  
ATOM 783   C CB   . GLU A 1 47 ? -12.616 10.293  11.733  1.00 0.00 ? 47 GLU A CB   1  
ATOM 784   C CG   . GLU A 1 47 ? -11.977 10.812  13.009  1.00 0.00 ? 47 GLU A CG   1  
ATOM 785   C CD   . GLU A 1 47 ? -12.733 11.973  13.609  1.00 0.00 ? 47 GLU A CD   1  
ATOM 786   O OE1  . GLU A 1 47 ? -13.693 11.735  14.368  1.00 0.00 ? 47 GLU A OE1  1  
ATOM 787   O OE2  . GLU A 1 47 ? -12.361 13.133  13.332  1.00 0.00 ? 47 GLU A OE2  1  
ATOM 788   H H    . GLU A 1 47 ? -11.772 8.193   12.844  1.00 0.00 ? 47 GLU A H    1  
ATOM 789   H HA   . GLU A 1 47 ? -12.356 8.805   10.224  1.00 0.00 ? 47 GLU A HA   1  
ATOM 790   H HB2  . GLU A 1 47 ? -12.787 11.130  11.072  1.00 0.00 ? 47 GLU A HB2  1  
ATOM 791   H HB3  . GLU A 1 47 ? -13.566 9.845   11.987  1.00 0.00 ? 47 GLU A HB3  1  
ATOM 792   H HG2  . GLU A 1 47 ? -11.943 10.013  13.733  1.00 0.00 ? 47 GLU A HG2  1  
ATOM 793   H HG3  . GLU A 1 47 ? -10.970 11.136  12.784  1.00 0.00 ? 47 GLU A HG3  1  
ATOM 794   N N    . THR A 1 48 ? -9.425  9.989   11.043  1.00 0.00 ? 48 THR A N    1  
ATOM 795   C CA   . THR A 1 48 ? -8.224  10.609  10.493  1.00 0.00 ? 48 THR A CA   1  
ATOM 796   C C    . THR A 1 48 ? -7.751  9.853   9.247   1.00 0.00 ? 48 THR A C    1  
ATOM 797   O O    . THR A 1 48 ? -7.191  10.442  8.322   1.00 0.00 ? 48 THR A O    1  
ATOM 798   C CB   . THR A 1 48 ? -7.084  10.686  11.541  1.00 0.00 ? 48 THR A CB   1  
ATOM 799   O OG1  . THR A 1 48 ? -5.960  11.395  11.002  1.00 0.00 ? 48 THR A OG1  1  
ATOM 800   C CG2  . THR A 1 48 ? -6.644  9.299   11.996  1.00 0.00 ? 48 THR A CG2  1  
ATOM 801   H H    . THR A 1 48 ? -9.398  9.601   11.939  1.00 0.00 ? 48 THR A H    1  
ATOM 802   H HA   . THR A 1 48 ? -8.483  11.619  10.202  1.00 0.00 ? 48 THR A HA   1  
ATOM 803   H HB   . THR A 1 48 ? -7.451  11.226  12.402  1.00 0.00 ? 48 THR A HB   1  
ATOM 804   H HG1  . THR A 1 48 ? -5.390  10.778  10.514  1.00 0.00 ? 48 THR A HG1  1  
ATOM 805   H HG21 . THR A 1 48 ? -7.476  8.788   12.458  1.00 0.00 ? 48 THR A HG21 1  
ATOM 806   H HG22 . THR A 1 48 ? -5.840  9.394   12.710  1.00 0.00 ? 48 THR A HG22 1  
ATOM 807   H HG23 . THR A 1 48 ? -6.303  8.733   11.143  1.00 0.00 ? 48 THR A HG23 1  
ATOM 808   N N    . GLU A 1 49 ? -8.010  8.552   9.221   1.00 0.00 ? 49 GLU A N    1  
ATOM 809   C CA   . GLU A 1 49 ? -7.624  7.712   8.099   1.00 0.00 ? 49 GLU A CA   1  
ATOM 810   C C    . GLU A 1 49 ? -8.700  7.716   7.016   1.00 0.00 ? 49 GLU A C    1  
ATOM 811   O O    . GLU A 1 49 ? -8.472  7.223   5.914   1.00 0.00 ? 49 GLU A O    1  
ATOM 812   C CB   . GLU A 1 49 ? -7.343  6.283   8.558   1.00 0.00 ? 49 GLU A CB   1  
ATOM 813   C CG   . GLU A 1 49 ? -6.078  6.146   9.386   1.00 0.00 ? 49 GLU A CG   1  
ATOM 814   C CD   . GLU A 1 49 ? -4.836  6.537   8.610   1.00 0.00 ? 49 GLU A CD   1  
ATOM 815   O OE1  . GLU A 1 49 ? -4.370  5.729   7.778   1.00 0.00 ? 49 GLU A OE1  1  
ATOM 816   O OE2  . GLU A 1 49 ? -4.319  7.649   8.834   1.00 0.00 ? 49 GLU A OE2  1  
ATOM 817   H H    . GLU A 1 49 ? -8.489  8.146   9.976   1.00 0.00 ? 49 GLU A H    1  
ATOM 818   H HA   . GLU A 1 49 ? -6.718  8.127   7.682   1.00 0.00 ? 49 GLU A HA   1  
ATOM 819   H HB2  . GLU A 1 49 ? -8.175  5.937   9.154   1.00 0.00 ? 49 GLU A HB2  1  
ATOM 820   H HB3  . GLU A 1 49 ? -7.247  5.652   7.688   1.00 0.00 ? 49 GLU A HB3  1  
ATOM 821   H HG2  . GLU A 1 49 ? -6.158  6.783   10.254  1.00 0.00 ? 49 GLU A HG2  1  
ATOM 822   H HG3  . GLU A 1 49 ? -5.978  5.118   9.701   1.00 0.00 ? 49 GLU A HG3  1  
ATOM 823   N N    . LYS A 1 50 ? -9.879  8.238   7.345   1.00 0.00 ? 50 LYS A N    1  
ATOM 824   C CA   . LYS A 1 50 ? -10.967 8.369   6.378   1.00 0.00 ? 50 LYS A CA   1  
ATOM 825   C C    . LYS A 1 50 ? -10.551 9.219   5.168   1.00 0.00 ? 50 LYS A C    1  
ATOM 826   O O    . LYS A 1 50 ? -10.834 8.858   4.027   1.00 0.00 ? 50 LYS A O    1  
ATOM 827   C CB   . LYS A 1 50 ? -12.213 8.966   7.048   1.00 0.00 ? 50 LYS A CB   1  
ATOM 828   C CG   . LYS A 1 50 ? -13.486 8.874   6.210   1.00 0.00 ? 50 LYS A CG   1  
ATOM 829   C CD   . LYS A 1 50 ? -13.620 10.017  5.207   1.00 0.00 ? 50 LYS A CD   1  
ATOM 830   C CE   . LYS A 1 50 ? -13.973 11.331  5.890   1.00 0.00 ? 50 LYS A CE   1  
ATOM 831   N NZ   . LYS A 1 50 ? -14.097 12.449  4.916   1.00 0.00 ? 50 LYS A NZ   1  
ATOM 832   H H    . LYS A 1 50 ? -10.033 8.516   8.270   1.00 0.00 ? 50 LYS A H    1  
ATOM 833   H HA   . LYS A 1 50 ? -11.210 7.376   6.031   1.00 0.00 ? 50 LYS A HA   1  
ATOM 834   H HB2  . LYS A 1 50 ? -12.384 8.446   7.977   1.00 0.00 ? 50 LYS A HB2  1  
ATOM 835   H HB3  . LYS A 1 50 ? -12.024 10.007  7.263   1.00 0.00 ? 50 LYS A HB3  1  
ATOM 836   H HG2  . LYS A 1 50 ? -13.473 7.941   5.667   1.00 0.00 ? 50 LYS A HG2  1  
ATOM 837   H HG3  . LYS A 1 50 ? -14.337 8.889   6.872   1.00 0.00 ? 50 LYS A HG3  1  
ATOM 838   H HD2  . LYS A 1 50 ? -12.684 10.136  4.684   1.00 0.00 ? 50 LYS A HD2  1  
ATOM 839   H HD3  . LYS A 1 50 ? -14.399 9.769   4.501   1.00 0.00 ? 50 LYS A HD3  1  
ATOM 840   H HE2  . LYS A 1 50 ? -14.913 11.213  6.409   1.00 0.00 ? 50 LYS A HE2  1  
ATOM 841   H HE3  . LYS A 1 50 ? -13.198 11.570  6.602   1.00 0.00 ? 50 LYS A HE3  1  
ATOM 842   H HZ1  . LYS A 1 50 ? -13.152 12.800  4.649   1.00 0.00 ? 50 LYS A HZ1  1  
ATOM 843   H HZ2  . LYS A 1 50 ? -14.635 13.238  5.338   1.00 0.00 ? 50 LYS A HZ2  1  
ATOM 844   H HZ3  . LYS A 1 50 ? -14.592 12.127  4.055   1.00 0.00 ? 50 LYS A HZ3  1  
ATOM 845   N N    . ARG A 1 51 ? -9.887  10.349  5.411   1.00 0.00 ? 51 ARG A N    1  
ATOM 846   C CA   . ARG A 1 51 ? -9.524  11.252  4.315   1.00 0.00 ? 51 ARG A CA   1  
ATOM 847   C C    . ARG A 1 51 ? -8.586  10.610  3.269   1.00 0.00 ? 51 ARG A C    1  
ATOM 848   O O    . ARG A 1 51 ? -8.825  10.776  2.071   1.00 0.00 ? 51 ARG A O    1  
ATOM 849   C CB   . ARG A 1 51 ? -8.962  12.597  4.817   1.00 0.00 ? 51 ARG A CB   1  
ATOM 850   C CG   . ARG A 1 51 ? -7.884  12.500  5.880   1.00 0.00 ? 51 ARG A CG   1  
ATOM 851   C CD   . ARG A 1 51 ? -7.049  13.768  5.937   1.00 0.00 ? 51 ARG A CD   1  
ATOM 852   N NE   . ARG A 1 51 ? -6.397  14.038  4.653   1.00 0.00 ? 51 ARG A NE   1  
ATOM 853   C CZ   . ARG A 1 51 ? -5.133  13.721  4.376   1.00 0.00 ? 51 ARG A CZ   1  
ATOM 854   N NH1  . ARG A 1 51 ? -4.378  13.110  5.278   1.00 0.00 ? 51 ARG A NH1  1  
ATOM 855   N NH2  . ARG A 1 51 ? -4.626  14.001  3.184   1.00 0.00 ? 51 ARG A NH2  1  
ATOM 856   H H    . ARG A 1 51 ? -9.639  10.576  6.331   1.00 0.00 ? 51 ARG A H    1  
ATOM 857   H HA   . ARG A 1 51 ? -10.450 11.466  3.800   1.00 0.00 ? 51 ARG A HA   1  
ATOM 858   H HB2  . ARG A 1 51 ? -8.547  13.129  3.974   1.00 0.00 ? 51 ARG A HB2  1  
ATOM 859   H HB3  . ARG A 1 51 ? -9.780  13.177  5.221   1.00 0.00 ? 51 ARG A HB3  1  
ATOM 860   H HG2  . ARG A 1 51 ? -8.350  12.344  6.841   1.00 0.00 ? 51 ARG A HG2  1  
ATOM 861   H HG3  . ARG A 1 51 ? -7.239  11.664  5.651   1.00 0.00 ? 51 ARG A HG3  1  
ATOM 862   H HD2  . ARG A 1 51 ? -7.693  14.599  6.185   1.00 0.00 ? 51 ARG A HD2  1  
ATOM 863   H HD3  . ARG A 1 51 ? -6.294  13.655  6.699   1.00 0.00 ? 51 ARG A HD3  1  
ATOM 864   H HE   . ARG A 1 51 ? -6.936  14.485  3.957   1.00 0.00 ? 51 ARG A HE   1  
ATOM 865   H HH11 . ARG A 1 51 ? -4.755  12.876  6.183   1.00 0.00 ? 51 ARG A HH11 1  
ATOM 866   H HH12 . ARG A 1 51 ? -3.421  12.888  5.068   1.00 0.00 ? 51 ARG A HH12 1  
ATOM 867   H HH21 . ARG A 1 51 ? -5.191  14.453  2.491   1.00 0.00 ? 51 ARG A HH21 1  
ATOM 868   H HH22 . ARG A 1 51 ? -3.671  13.755  2.973   1.00 0.00 ? 51 ARG A HH22 1  
ATOM 869   N N    . PRO A 1 52 ? -7.514  9.873   3.658   1.00 0.00 ? 52 PRO A N    1  
ATOM 870   C CA   . PRO A 1 52 ? -6.613  9.250   2.681   1.00 0.00 ? 52 PRO A CA   1  
ATOM 871   C C    . PRO A 1 52 ? -7.281  8.190   1.814   1.00 0.00 ? 52 PRO A C    1  
ATOM 872   O O    . PRO A 1 52 ? -6.725  7.796   0.796   1.00 0.00 ? 52 PRO A O    1  
ATOM 873   C CB   . PRO A 1 52 ? -5.502  8.625   3.528   1.00 0.00 ? 52 PRO A CB   1  
ATOM 874   C CG   . PRO A 1 52 ? -5.599  9.297   4.850   1.00 0.00 ? 52 PRO A CG   1  
ATOM 875   C CD   . PRO A 1 52 ? -7.051  9.620   5.031   1.00 0.00 ? 52 PRO A CD   1  
ATOM 876   H HA   . PRO A 1 52 ? -6.193  9.996   2.027   1.00 0.00 ? 52 PRO A HA   1  
ATOM 877   H HB2  . PRO A 1 52 ? -5.668  7.560   3.613   1.00 0.00 ? 52 PRO A HB2  1  
ATOM 878   H HB3  . PRO A 1 52 ? -4.547  8.808   3.062   1.00 0.00 ? 52 PRO A HB3  1  
ATOM 879   H HG2  . PRO A 1 52 ? -5.264  8.629   5.628   1.00 0.00 ? 52 PRO A HG2  1  
ATOM 880   H HG3  . PRO A 1 52 ? -5.011  10.203  4.848   1.00 0.00 ? 52 PRO A HG3  1  
ATOM 881   H HD2  . PRO A 1 52 ? -7.571  8.779   5.467   1.00 0.00 ? 52 PRO A HD2  1  
ATOM 882   H HD3  . PRO A 1 52 ? -7.168  10.499  5.646   1.00 0.00 ? 52 PRO A HD3  1  
ATOM 883   N N    . PHE A 1 53 ? -8.467  7.733   2.202   1.00 0.00 ? 53 PHE A N    1  
ATOM 884   C CA   . PHE A 1 53 ? -9.254  6.866   1.331   1.00 0.00 ? 53 PHE A CA   1  
ATOM 885   C C    . PHE A 1 53 ? -9.525  7.593   0.029   1.00 0.00 ? 53 PHE A C    1  
ATOM 886   O O    . PHE A 1 53 ? -9.396  7.041   -1.065  1.00 0.00 ? 53 PHE A O    1  
ATOM 887   C CB   . PHE A 1 53 ? -10.601 6.510   1.963   1.00 0.00 ? 53 PHE A CB   1  
ATOM 888   C CG   . PHE A 1 53 ? -10.543 5.469   3.036   1.00 0.00 ? 53 PHE A CG   1  
ATOM 889   C CD1  . PHE A 1 53 ? -10.413 4.134   2.713   1.00 0.00 ? 53 PHE A CD1  1  
ATOM 890   C CD2  . PHE A 1 53 ? -10.642 5.822   4.366   1.00 0.00 ? 53 PHE A CD2  1  
ATOM 891   C CE1  . PHE A 1 53 ? -10.381 3.172   3.702   1.00 0.00 ? 53 PHE A CE1  1  
ATOM 892   C CE2  . PHE A 1 53 ? -10.612 4.866   5.359   1.00 0.00 ? 53 PHE A CE2  1  
ATOM 893   C CZ   . PHE A 1 53 ? -10.480 3.538   5.027   1.00 0.00 ? 53 PHE A CZ   1  
ATOM 894   H H    . PHE A 1 53 ? -8.819  7.981   3.084   1.00 0.00 ? 53 PHE A H    1  
ATOM 895   H HA   . PHE A 1 53 ? -8.691  5.966   1.134   1.00 0.00 ? 53 PHE A HA   1  
ATOM 896   H HB2  . PHE A 1 53 ? -11.030 7.401   2.396   1.00 0.00 ? 53 PHE A HB2  1  
ATOM 897   H HB3  . PHE A 1 53 ? -11.261 6.148   1.187   1.00 0.00 ? 53 PHE A HB3  1  
ATOM 898   H HD1  . PHE A 1 53 ? -10.334 3.843   1.671   1.00 0.00 ? 53 PHE A HD1  1  
ATOM 899   H HD2  . PHE A 1 53 ? -10.744 6.865   4.628   1.00 0.00 ? 53 PHE A HD2  1  
ATOM 900   H HE1  . PHE A 1 53 ? -10.277 2.130   3.436   1.00 0.00 ? 53 PHE A HE1  1  
ATOM 901   H HE2  . PHE A 1 53 ? -10.689 5.159   6.394   1.00 0.00 ? 53 PHE A HE2  1  
ATOM 902   H HZ   . PHE A 1 53 ? -10.458 2.786   5.802   1.00 0.00 ? 53 PHE A HZ   1  
ATOM 903   N N    . ILE A 1 54 ? -9.857  8.863   0.168   1.00 0.00 ? 54 ILE A N    1  
ATOM 904   C CA   . ILE A 1 54 ? -10.283 9.663   -0.956  1.00 0.00 ? 54 ILE A CA   1  
ATOM 905   C C    . ILE A 1 54 ? -9.054  10.166  -1.706  1.00 0.00 ? 54 ILE A C    1  
ATOM 906   O O    . ILE A 1 54 ? -9.039  10.244  -2.932  1.00 0.00 ? 54 ILE A O    1  
ATOM 907   C CB   . ILE A 1 54 ? -11.140 10.866  -0.494  1.00 0.00 ? 54 ILE A CB   1  
ATOM 908   C CG1  . ILE A 1 54 ? -12.320 10.387  0.363   1.00 0.00 ? 54 ILE A CG1  1  
ATOM 909   C CG2  . ILE A 1 54 ? -11.638 11.667  -1.692  1.00 0.00 ? 54 ILE A CG2  1  
ATOM 910   C CD1  . ILE A 1 54 ? -13.294 9.486   -0.374  1.00 0.00 ? 54 ILE A CD1  1  
ATOM 911   H H    . ILE A 1 54 ? -9.760  9.286   1.052   1.00 0.00 ? 54 ILE A H    1  
ATOM 912   H HA   . ILE A 1 54 ? -10.886 9.033   -1.607  1.00 0.00 ? 54 ILE A HA   1  
ATOM 913   H HB   . ILE A 1 54 ? -10.514 11.513  0.102   1.00 0.00 ? 54 ILE A HB   1  
ATOM 914   H HG12 . ILE A 1 54 ? -11.938 9.835   1.209   1.00 0.00 ? 54 ILE A HG12 1  
ATOM 915   H HG13 . ILE A 1 54 ? -12.868 11.247  0.722   1.00 0.00 ? 54 ILE A HG13 1  
ATOM 916   H HG21 . ILE A 1 54 ? -10.795 12.038  -2.256  1.00 0.00 ? 54 ILE A HG21 1  
ATOM 917   H HG22 . ILE A 1 54 ? -12.233 12.497  -1.346  1.00 0.00 ? 54 ILE A HG22 1  
ATOM 918   H HG23 . ILE A 1 54 ? -12.243 11.030  -2.323  1.00 0.00 ? 54 ILE A HG23 1  
ATOM 919   H HD11 . ILE A 1 54 ? -12.780 8.595   -0.705  1.00 0.00 ? 54 ILE A HD11 1  
ATOM 920   H HD12 . ILE A 1 54 ? -13.693 10.009  -1.229  1.00 0.00 ? 54 ILE A HD12 1  
ATOM 921   H HD13 . ILE A 1 54 ? -14.101 9.211   0.288   1.00 0.00 ? 54 ILE A HD13 1  
ATOM 922   N N    . ASP A 1 55 ? -8.013  10.483  -0.940  1.00 0.00 ? 55 ASP A N    1  
ATOM 923   C CA   . ASP A 1 55 ? -6.770  11.012  -1.495  1.00 0.00 ? 55 ASP A CA   1  
ATOM 924   C C    . ASP A 1 55 ? -6.035  9.937   -2.294  1.00 0.00 ? 55 ASP A C    1  
ATOM 925   O O    . ASP A 1 55 ? -5.505  10.206  -3.374  1.00 0.00 ? 55 ASP A O    1  
ATOM 926   C CB   . ASP A 1 55 ? -5.873  11.542  -0.373  1.00 0.00 ? 55 ASP A CB   1  
ATOM 927   C CG   . ASP A 1 55 ? -4.672  12.307  -0.895  1.00 0.00 ? 55 ASP A CG   1  
ATOM 928   O OD1  . ASP A 1 55 ? -3.644  11.673  -1.199  1.00 0.00 ? 55 ASP A OD1  1  
ATOM 929   O OD2  . ASP A 1 55 ? -4.754  13.547  -0.995  1.00 0.00 ? 55 ASP A OD2  1  
ATOM 930   H H    . ASP A 1 55 ? -8.084  10.359  0.030   1.00 0.00 ? 55 ASP A H    1  
ATOM 931   H HA   . ASP A 1 55 ? -7.023  11.825  -2.159  1.00 0.00 ? 55 ASP A HA   1  
ATOM 932   H HB2  . ASP A 1 55 ? -6.447  12.202  0.261   1.00 0.00 ? 55 ASP A HB2  1  
ATOM 933   H HB3  . ASP A 1 55 ? -5.515  10.708  0.215   1.00 0.00 ? 55 ASP A HB3  1  
ATOM 934   N N    . GLU A 1 56 ? -6.020  8.717   -1.758  1.00 0.00 ? 56 GLU A N    1  
ATOM 935   C CA   . GLU A 1 56 ? -5.433  7.575   -2.453  1.00 0.00 ? 56 GLU A CA   1  
ATOM 936   C C    . GLU A 1 56 ? -6.182  7.361   -3.773  1.00 0.00 ? 56 GLU A C    1  
ATOM 937   O O    . GLU A 1 56 ? -5.577  7.076   -4.806  1.00 0.00 ? 56 GLU A O    1  
ATOM 938   C CB   . GLU A 1 56 ? -5.527  6.319   -1.569  1.00 0.00 ? 56 GLU A CB   1  
ATOM 939   C CG   . GLU A 1 56 ? -4.665  5.142   -2.018  1.00 0.00 ? 56 GLU A CG   1  
ATOM 940   C CD   . GLU A 1 56 ? -3.204  5.276   -1.614  1.00 0.00 ? 56 GLU A CD   1  
ATOM 941   O OE1  . GLU A 1 56 ? -2.925  5.691   -0.465  1.00 0.00 ? 56 GLU A OE1  1  
ATOM 942   O OE2  . GLU A 1 56 ? -2.322  4.965   -2.439  1.00 0.00 ? 56 GLU A OE2  1  
ATOM 943   H H    . GLU A 1 56 ? -6.419  8.579   -0.870  1.00 0.00 ? 56 GLU A H    1  
ATOM 944   H HA   . GLU A 1 56 ? -4.394  7.794   -2.657  1.00 0.00 ? 56 GLU A HA   1  
ATOM 945   H HB2  . GLU A 1 56 ? -5.229  6.584   -0.565  1.00 0.00 ? 56 GLU A HB2  1  
ATOM 946   H HB3  . GLU A 1 56 ? -6.556  5.991   -1.548  1.00 0.00 ? 56 GLU A HB3  1  
ATOM 947   H HG2  . GLU A 1 56 ? -5.058  4.237   -1.579  1.00 0.00 ? 56 GLU A HG2  1  
ATOM 948   H HG3  . GLU A 1 56 ? -4.719  5.069   -3.094  1.00 0.00 ? 56 GLU A HG3  1  
ATOM 949   N N    . ALA A 1 57 ? -7.508  7.536   -3.723  1.00 0.00 ? 57 ALA A N    1  
ATOM 950   C CA   . ALA A 1 57 ? -8.354  7.440   -4.912  1.00 0.00 ? 57 ALA A CA   1  
ATOM 951   C C    . ALA A 1 57 ? -7.957  8.472   -5.965  1.00 0.00 ? 57 ALA A C    1  
ATOM 952   O O    . ALA A 1 57 ? -7.945  8.180   -7.162  1.00 0.00 ? 57 ALA A O    1  
ATOM 953   C CB   . ALA A 1 57 ? -9.821  7.625   -4.538  1.00 0.00 ? 57 ALA A CB   1  
ATOM 954   H H    . ALA A 1 57 ? -7.931  7.717   -2.853  1.00 0.00 ? 57 ALA A H    1  
ATOM 955   H HA   . ALA A 1 57 ? -8.236  6.451   -5.328  1.00 0.00 ? 57 ALA A HA   1  
ATOM 956   H HB1  . ALA A 1 57 ? -10.442 7.409   -5.395  1.00 0.00 ? 57 ALA A HB1  1  
ATOM 957   H HB2  . ALA A 1 57 ? -9.986  8.646   -4.223  1.00 0.00 ? 57 ALA A HB2  1  
ATOM 958   H HB3  . ALA A 1 57 ? -10.073 6.957   -3.732  1.00 0.00 ? 57 ALA A HB3  1  
ATOM 959   N N    . LYS A 1 58 ? -7.634  9.680   -5.514  1.00 0.00 ? 58 LYS A N    1  
ATOM 960   C CA   . LYS A 1 58 ? -7.220  10.752  -6.414  1.00 0.00 ? 58 LYS A CA   1  
ATOM 961   C C    . LYS A 1 58 ? -5.947  10.364  -7.155  1.00 0.00 ? 58 LYS A C    1  
ATOM 962   O O    . LYS A 1 58 ? -5.790  10.656  -8.339  1.00 0.00 ? 58 LYS A O    1  
ATOM 963   C CB   . LYS A 1 58 ? -7.001  12.052  -5.636  1.00 0.00 ? 58 LYS A CB   1  
ATOM 964   C CG   . LYS A 1 58 ? -8.250  12.548  -4.924  1.00 0.00 ? 58 LYS A CG   1  
ATOM 965   C CD   . LYS A 1 58 ? -7.957  13.760  -4.056  1.00 0.00 ? 58 LYS A CD   1  
ATOM 966   C CE   . LYS A 1 58 ? -7.496  14.949  -4.883  1.00 0.00 ? 58 LYS A CE   1  
ATOM 967   N NZ   . LYS A 1 58 ? -7.219  16.134  -4.035  1.00 0.00 ? 58 LYS A NZ   1  
ATOM 968   H H    . LYS A 1 58 ? -7.681  9.857   -4.549  1.00 0.00 ? 58 LYS A H    1  
ATOM 969   H HA   . LYS A 1 58 ? -8.008  10.902  -7.136  1.00 0.00 ? 58 LYS A HA   1  
ATOM 970   H HB2  . LYS A 1 58 ? -6.230  11.891  -4.897  1.00 0.00 ? 58 LYS A HB2  1  
ATOM 971   H HB3  . LYS A 1 58 ? -6.674  12.820  -6.322  1.00 0.00 ? 58 LYS A HB3  1  
ATOM 972   H HG2  . LYS A 1 58 ? -8.992  12.817  -5.661  1.00 0.00 ? 58 LYS A HG2  1  
ATOM 973   H HG3  . LYS A 1 58 ? -8.634  11.753  -4.300  1.00 0.00 ? 58 LYS A HG3  1  
ATOM 974   H HD2  . LYS A 1 58 ? -8.855  14.033  -3.524  1.00 0.00 ? 58 LYS A HD2  1  
ATOM 975   H HD3  . LYS A 1 58 ? -7.182  13.503  -3.348  1.00 0.00 ? 58 LYS A HD3  1  
ATOM 976   H HE2  . LYS A 1 58 ? -6.596  14.678  -5.413  1.00 0.00 ? 58 LYS A HE2  1  
ATOM 977   H HE3  . LYS A 1 58 ? -8.270  15.198  -5.594  1.00 0.00 ? 58 LYS A HE3  1  
ATOM 978   H HZ1  . LYS A 1 58 ? -6.406  15.945  -3.408  1.00 0.00 ? 58 LYS A HZ1  1  
ATOM 979   H HZ2  . LYS A 1 58 ? -8.053  16.360  -3.448  1.00 0.00 ? 58 LYS A HZ2  1  
ATOM 980   H HZ3  . LYS A 1 58 ? -6.999  16.957  -4.629  1.00 0.00 ? 58 LYS A HZ3  1  
ATOM 981   N N    . ARG A 1 59 ? -5.051  9.688   -6.446  1.00 0.00 ? 59 ARG A N    1  
ATOM 982   C CA   . ARG A 1 59 ? -3.814  9.200   -7.037  1.00 0.00 ? 59 ARG A CA   1  
ATOM 983   C C    . ARG A 1 59 ? -4.088  8.059   -8.013  1.00 0.00 ? 59 ARG A C    1  
ATOM 984   O O    . ARG A 1 59 ? -3.406  7.925   -9.027  1.00 0.00 ? 59 ARG A O    1  
ATOM 985   C CB   . ARG A 1 59 ? -2.845  8.755   -5.945  1.00 0.00 ? 59 ARG A CB   1  
ATOM 986   C CG   . ARG A 1 59 ? -1.856  9.839   -5.547  1.00 0.00 ? 59 ARG A CG   1  
ATOM 987   C CD   . ARG A 1 59 ? -1.110  9.479   -4.275  1.00 0.00 ? 59 ARG A CD   1  
ATOM 988   N NE   . ARG A 1 59 ? -1.911  9.740   -3.082  1.00 0.00 ? 59 ARG A NE   1  
ATOM 989   C CZ   . ARG A 1 59 ? -2.018  8.902   -2.055  1.00 0.00 ? 59 ARG A CZ   1  
ATOM 990   N NH1  . ARG A 1 59 ? -1.436  7.715   -2.098  1.00 0.00 ? 59 ARG A NH1  1  
ATOM 991   N NH2  . ARG A 1 59 ? -2.713  9.252   -0.985  1.00 0.00 ? 59 ARG A NH2  1  
ATOM 992   H H    . ARG A 1 59 ? -5.229  9.514   -5.497  1.00 0.00 ? 59 ARG A H    1  
ATOM 993   H HA   . ARG A 1 59 ? -3.368  10.022  -7.579  1.00 0.00 ? 59 ARG A HA   1  
ATOM 994   H HB2  . ARG A 1 59 ? -3.411  8.473   -5.070  1.00 0.00 ? 59 ARG A HB2  1  
ATOM 995   H HB3  . ARG A 1 59 ? -2.289  7.900   -6.297  1.00 0.00 ? 59 ARG A HB3  1  
ATOM 996   H HG2  . ARG A 1 59 ? -1.142  9.969   -6.347  1.00 0.00 ? 59 ARG A HG2  1  
ATOM 997   H HG3  . ARG A 1 59 ? -2.394  10.761  -5.390  1.00 0.00 ? 59 ARG A HG3  1  
ATOM 998   H HD2  . ARG A 1 59 ? -0.855  8.429   -4.305  1.00 0.00 ? 59 ARG A HD2  1  
ATOM 999   H HD3  . ARG A 1 59 ? -0.204  10.066  -4.226  1.00 0.00 ? 59 ARG A HD3  1  
ATOM 1000  H HE   . ARG A 1 59 ? -2.379  10.604  -3.038  1.00 0.00 ? 59 ARG A HE   1  
ATOM 1001  H HH11 . ARG A 1 59 ? -0.906  7.439   -2.899  1.00 0.00 ? 59 ARG A HH11 1  
ATOM 1002  H HH12 . ARG A 1 59 ? -1.544  7.071   -1.334  1.00 0.00 ? 59 ARG A HH12 1  
ATOM 1003  H HH21 . ARG A 1 59 ? -3.161  10.161  -0.948  1.00 0.00 ? 59 ARG A HH21 1  
ATOM 1004  H HH22 . ARG A 1 59 ? -2.804  8.620   -0.206  1.00 0.00 ? 59 ARG A HH22 1  
ATOM 1005  N N    . LEU A 1 60 ? -5.094  7.246   -7.711  1.00 0.00 ? 60 LEU A N    1  
ATOM 1006  C CA   . LEU A 1 60 ? -5.503  6.171   -8.613  1.00 0.00 ? 60 LEU A CA   1  
ATOM 1007  C C    . LEU A 1 60 ? -6.034  6.748   -9.920  1.00 0.00 ? 60 LEU A C    1  
ATOM 1008  O O    . LEU A 1 60 ? -5.749  6.234   -11.005 1.00 0.00 ? 60 LEU A O    1  
ATOM 1009  C CB   . LEU A 1 60 ? -6.569  5.286   -7.958  1.00 0.00 ? 60 LEU A CB   1  
ATOM 1010  C CG   . LEU A 1 60 ? -6.119  4.555   -6.692  1.00 0.00 ? 60 LEU A CG   1  
ATOM 1011  C CD1  . LEU A 1 60 ? -7.253  3.712   -6.135  1.00 0.00 ? 60 LEU A CD1  1  
ATOM 1012  C CD2  . LEU A 1 60 ? -4.905  3.683   -6.978  1.00 0.00 ? 60 LEU A CD2  1  
ATOM 1013  H H    . LEU A 1 60 ? -5.564  7.361   -6.856  1.00 0.00 ? 60 LEU A H    1  
ATOM 1014  H HA   . LEU A 1 60 ? -4.632  5.571   -8.828  1.00 0.00 ? 60 LEU A HA   1  
ATOM 1015  H HB2  . LEU A 1 60 ? -7.417  5.908   -7.706  1.00 0.00 ? 60 LEU A HB2  1  
ATOM 1016  H HB3  . LEU A 1 60 ? -6.887  4.548   -8.680  1.00 0.00 ? 60 LEU A HB3  1  
ATOM 1017  H HG   . LEU A 1 60 ? -5.841  5.282   -5.942  1.00 0.00 ? 60 LEU A HG   1  
ATOM 1018  H HD11 . LEU A 1 60 ? -6.924  3.222   -5.230  1.00 0.00 ? 60 LEU A HD11 1  
ATOM 1019  H HD12 . LEU A 1 60 ? -7.540  2.968   -6.863  1.00 0.00 ? 60 LEU A HD12 1  
ATOM 1020  H HD13 . LEU A 1 60 ? -8.099  4.346   -5.915  1.00 0.00 ? 60 LEU A HD13 1  
ATOM 1021  H HD21 . LEU A 1 60 ? -5.160  2.945   -7.723  1.00 0.00 ? 60 LEU A HD21 1  
ATOM 1022  H HD22 . LEU A 1 60 ? -4.599  3.185   -6.069  1.00 0.00 ? 60 LEU A HD22 1  
ATOM 1023  H HD23 . LEU A 1 60 ? -4.095  4.299   -7.342  1.00 0.00 ? 60 LEU A HD23 1  
ATOM 1024  N N    . ARG A 1 61 ? -6.800  7.828   -9.820  1.00 0.00 ? 61 ARG A N    1  
ATOM 1025  C CA   . ARG A 1 61 ? -7.321  8.493   -11.006 1.00 0.00 ? 61 ARG A CA   1  
ATOM 1026  C C    . ARG A 1 61 ? -6.180  9.142   -11.784 1.00 0.00 ? 61 ARG A C    1  
ATOM 1027  O O    . ARG A 1 61 ? -6.237  9.261   -13.008 1.00 0.00 ? 61 ARG A O    1  
ATOM 1028  C CB   . ARG A 1 61 ? -8.367  9.546   -10.631 1.00 0.00 ? 61 ARG A CB   1  
ATOM 1029  C CG   . ARG A 1 61 ? -9.316  9.878   -11.774 1.00 0.00 ? 61 ARG A CG   1  
ATOM 1030  C CD   . ARG A 1 61 ? -10.229 11.052  -11.446 1.00 0.00 ? 61 ARG A CD   1  
ATOM 1031  N NE   . ARG A 1 61 ? -9.517  12.326  -11.480 1.00 0.00 ? 61 ARG A NE   1  
ATOM 1032  C CZ   . ARG A 1 61 ? -9.588  13.188  -12.494 1.00 0.00 ? 61 ARG A CZ   1  
ATOM 1033  N NH1  . ARG A 1 61 ? -10.349 12.920  -13.552 1.00 0.00 ? 61 ARG A NH1  1  
ATOM 1034  N NH2  . ARG A 1 61 ? -8.897  14.317  -12.446 1.00 0.00 ? 61 ARG A NH2  1  
ATOM 1035  H H    . ARG A 1 61 ? -7.025  8.176   -8.928  1.00 0.00 ? 61 ARG A H    1  
ATOM 1036  H HA   . ARG A 1 61 ? -7.783  7.741   -11.629 1.00 0.00 ? 61 ARG A HA   1  
ATOM 1037  H HB2  . ARG A 1 61 ? -8.949  9.177   -9.798  1.00 0.00 ? 61 ARG A HB2  1  
ATOM 1038  H HB3  . ARG A 1 61 ? -7.862  10.453  -10.335 1.00 0.00 ? 61 ARG A HB3  1  
ATOM 1039  H HG2  . ARG A 1 61 ? -8.734  10.128  -12.647 1.00 0.00 ? 61 ARG A HG2  1  
ATOM 1040  H HG3  . ARG A 1 61 ? -9.925  9.010   -11.985 1.00 0.00 ? 61 ARG A HG3  1  
ATOM 1041  H HD2  . ARG A 1 61 ? -11.031 11.082  -12.169 1.00 0.00 ? 61 ARG A HD2  1  
ATOM 1042  H HD3  . ARG A 1 61 ? -10.642 10.908  -10.457 1.00 0.00 ? 61 ARG A HD3  1  
ATOM 1043  H HE   . ARG A 1 61 ? -8.951  12.550  -10.706 1.00 0.00 ? 61 ARG A HE   1  
ATOM 1044  H HH11 . ARG A 1 61 ? -10.878 12.063  -13.597 1.00 0.00 ? 61 ARG A HH11 1  
ATOM 1045  H HH12 . ARG A 1 61 ? -10.405 13.574  -14.314 1.00 0.00 ? 61 ARG A HH12 1  
ATOM 1046  H HH21 . ARG A 1 61 ? -8.324  14.523  -11.644 1.00 0.00 ? 61 ARG A HH21 1  
ATOM 1047  H HH22 . ARG A 1 61 ? -8.933  14.966  -13.217 1.00 0.00 ? 61 ARG A HH22 1  
ATOM 1048  N N    . ALA A 1 62 ? -5.140  9.551   -11.064 1.00 0.00 ? 62 ALA A N    1  
ATOM 1049  C CA   . ALA A 1 62 ? -3.942  10.095  -11.691 1.00 0.00 ? 62 ALA A CA   1  
ATOM 1050  C C    . ALA A 1 62 ? -3.212  8.999   -12.463 1.00 0.00 ? 62 ALA A C    1  
ATOM 1051  O O    . ALA A 1 62 ? -2.648  9.238   -13.528 1.00 0.00 ? 62 ALA A O    1  
ATOM 1052  C CB   . ALA A 1 62 ? -3.029  10.718  -10.646 1.00 0.00 ? 62 ALA A CB   1  
ATOM 1053  H H    . ALA A 1 62 ? -5.183  9.489   -10.084 1.00 0.00 ? 62 ALA A H    1  
ATOM 1054  H HA   . ALA A 1 62 ? -4.248  10.868  -12.383 1.00 0.00 ? 62 ALA A HA   1  
ATOM 1055  H HB1  . ALA A 1 62 ? -3.553  11.519  -10.145 1.00 0.00 ? 62 ALA A HB1  1  
ATOM 1056  H HB2  . ALA A 1 62 ? -2.144  11.110  -11.125 1.00 0.00 ? 62 ALA A HB2  1  
ATOM 1057  H HB3  . ALA A 1 62 ? -2.745  9.968   -9.922  1.00 0.00 ? 62 ALA A HB3  1  
ATOM 1058  N N    . LEU A 1 63 ? -3.243  7.792   -11.924 1.00 0.00 ? 63 LEU A N    1  
ATOM 1059  C CA   . LEU A 1 63 ? -2.684  6.639   -12.607 1.00 0.00 ? 63 LEU A CA   1  
ATOM 1060  C C    . LEU A 1 63 ? -3.478  6.327   -13.853 1.00 0.00 ? 63 LEU A C    1  
ATOM 1061  O O    . LEU A 1 63 ? -2.964  5.722   -14.794 1.00 0.00 ? 63 LEU A O    1  
ATOM 1062  C CB   . LEU A 1 63 ? -2.655  5.421   -11.686 1.00 0.00 ? 63 LEU A CB   1  
ATOM 1063  C CG   . LEU A 1 63 ? -1.839  5.594   -10.404 1.00 0.00 ? 63 LEU A CG   1  
ATOM 1064  C CD1  . LEU A 1 63 ? -1.907  4.331   -9.559  1.00 0.00 ? 63 LEU A CD1  1  
ATOM 1065  C CD2  . LEU A 1 63 ? -0.396  5.944   -10.730 1.00 0.00 ? 63 LEU A CD2  1  
ATOM 1066  H H    . LEU A 1 63 ? -3.641  7.675   -11.039 1.00 0.00 ? 63 LEU A H    1  
ATOM 1067  H HA   . LEU A 1 63 ? -1.688  6.882   -12.905 1.00 0.00 ? 63 LEU A HA   1  
ATOM 1068  H HB2  . LEU A 1 63 ? -3.673  5.179   -11.413 1.00 0.00 ? 63 LEU A HB2  1  
ATOM 1069  H HB3  . LEU A 1 63 ? -2.243  4.590   -12.239 1.00 0.00 ? 63 LEU A HB3  1  
ATOM 1070  H HG   . LEU A 1 63 ? -2.260  6.404   -9.826  1.00 0.00 ? 63 LEU A HG   1  
ATOM 1071  H HD11 . LEU A 1 63 ? -2.936  4.123   -9.305  1.00 0.00 ? 63 LEU A HD11 1  
ATOM 1072  H HD12 . LEU A 1 63 ? -1.334  4.473   -8.655  1.00 0.00 ? 63 LEU A HD12 1  
ATOM 1073  H HD13 . LEU A 1 63 ? -1.499  3.502   -10.118 1.00 0.00 ? 63 LEU A HD13 1  
ATOM 1074  H HD21 . LEU A 1 63 ? 0.155   6.080   -9.812  1.00 0.00 ? 63 LEU A HD21 1  
ATOM 1075  H HD22 . LEU A 1 63 ? -0.369  6.858   -11.304 1.00 0.00 ? 63 LEU A HD22 1  
ATOM 1076  H HD23 . LEU A 1 63 ? 0.049   5.144   -11.303 1.00 0.00 ? 63 LEU A HD23 1  
ATOM 1077  N N    . HIS A 1 64 ? -4.728  6.741   -13.861 1.00 0.00 ? 64 HIS A N    1  
ATOM 1078  C CA   . HIS A 1 64 ? -5.574  6.514   -15.008 1.00 0.00 ? 64 HIS A CA   1  
ATOM 1079  C C    . HIS A 1 64 ? -5.240  7.495   -16.134 1.00 0.00 ? 64 HIS A C    1  
ATOM 1080  O O    . HIS A 1 64 ? -5.296  7.138   -17.309 1.00 0.00 ? 64 HIS A O    1  
ATOM 1081  C CB   . HIS A 1 64 ? -7.053  6.622   -14.615 1.00 0.00 ? 64 HIS A CB   1  
ATOM 1082  C CG   . HIS A 1 64 ? -8.010  6.136   -15.662 1.00 0.00 ? 64 HIS A CG   1  
ATOM 1083  N ND1  . HIS A 1 64 ? -8.527  4.861   -15.661 1.00 0.00 ? 64 HIS A ND1  1  
ATOM 1084  C CD2  . HIS A 1 64 ? -8.576  6.767   -16.718 1.00 0.00 ? 64 HIS A CD2  1  
ATOM 1085  C CE1  . HIS A 1 64 ? -9.364  4.726   -16.672 1.00 0.00 ? 64 HIS A CE1  1  
ATOM 1086  N NE2  . HIS A 1 64 ? -9.416  5.868   -17.329 1.00 0.00 ? 64 HIS A NE2  1  
ATOM 1087  H H    . HIS A 1 64 ? -5.094  7.191   -13.066 1.00 0.00 ? 64 HIS A H    1  
ATOM 1088  H HA   . HIS A 1 64 ? -5.364  5.517   -15.347 1.00 0.00 ? 64 HIS A HA   1  
ATOM 1089  H HB2  . HIS A 1 64 ? -7.221  6.039   -13.722 1.00 0.00 ? 64 HIS A HB2  1  
ATOM 1090  H HB3  . HIS A 1 64 ? -7.285  7.657   -14.408 1.00 0.00 ? 64 HIS A HB3  1  
ATOM 1091  H HD1  . HIS A 1 64 ? -8.306  4.152   -15.012 1.00 0.00 ? 64 HIS A HD1  1  
ATOM 1092  H HD2  . HIS A 1 64 ? -8.394  7.785   -17.028 1.00 0.00 ? 64 HIS A HD2  1  
ATOM 1093  H HE1  . HIS A 1 64 ? -9.916  3.830   -16.918 1.00 0.00 ? 64 HIS A HE1  1  
ATOM 1094  H HE2  . HIS A 1 64 ? -10.125 6.107   -17.976 1.00 0.00 ? 64 HIS A HE2  1  
ATOM 1095  N N    . MET A 1 65 ? -4.883  8.723   -15.771 1.00 0.00 ? 65 MET A N    1  
ATOM 1096  C CA   . MET A 1 65 ? -4.541  9.738   -16.770 1.00 0.00 ? 65 MET A CA   1  
ATOM 1097  C C    . MET A 1 65 ? -3.118  9.535   -17.283 1.00 0.00 ? 65 MET A C    1  
ATOM 1098  O O    . MET A 1 65 ? -2.730  10.100  -18.306 1.00 0.00 ? 65 MET A O    1  
ATOM 1099  C CB   . MET A 1 65 ? -4.753  11.164  -16.228 1.00 0.00 ? 65 MET A CB   1  
ATOM 1100  C CG   . MET A 1 65 ? -3.880  11.547  -15.042 1.00 0.00 ? 65 MET A CG   1  
ATOM 1101  S SD   . MET A 1 65 ? -2.190  11.983  -15.499 1.00 0.00 ? 65 MET A SD   1  
ATOM 1102  C CE   . MET A 1 65 ? -1.498  12.344  -13.887 1.00 0.00 ? 65 MET A CE   1  
ATOM 1103  H H    . MET A 1 65 ? -4.850  8.953   -14.817 1.00 0.00 ? 65 MET A H    1  
ATOM 1104  H HA   . MET A 1 65 ? -5.213  9.591   -17.605 1.00 0.00 ? 65 MET A HA   1  
ATOM 1105  H HB2  . MET A 1 65 ? -4.557  11.866  -17.023 1.00 0.00 ? 65 MET A HB2  1  
ATOM 1106  H HB3  . MET A 1 65 ? -5.788  11.266  -15.928 1.00 0.00 ? 65 MET A HB3  1  
ATOM 1107  H HG2  . MET A 1 65 ? -4.327  12.395  -14.546 1.00 0.00 ? 65 MET A HG2  1  
ATOM 1108  H HG3  . MET A 1 65 ? -3.848  10.712  -14.358 1.00 0.00 ? 65 MET A HG3  1  
ATOM 1109  H HE1  . MET A 1 65 ? -2.045  13.159  -13.435 1.00 0.00 ? 65 MET A HE1  1  
ATOM 1110  H HE2  . MET A 1 65 ? -0.458  12.621  -13.994 1.00 0.00 ? 65 MET A HE2  1  
ATOM 1111  H HE3  . MET A 1 65 ? -1.573  11.468  -13.259 1.00 0.00 ? 65 MET A HE3  1  
ATOM 1112  N N    . LYS A 1 66 ? -2.338  8.728   -16.563 1.00 0.00 ? 66 LYS A N    1  
ATOM 1113  C CA   . LYS A 1 66 ? -1.008  8.335   -17.031 1.00 0.00 ? 66 LYS A CA   1  
ATOM 1114  C C    . LYS A 1 66 ? -1.103  7.422   -18.253 1.00 0.00 ? 66 LYS A C    1  
ATOM 1115  O O    . LYS A 1 66 ? -0.105  7.164   -18.926 1.00 0.00 ? 66 LYS A O    1  
ATOM 1116  C CB   . LYS A 1 66 ? -0.217  7.624   -15.929 1.00 0.00 ? 66 LYS A CB   1  
ATOM 1117  C CG   . LYS A 1 66 ? 0.323   8.550   -14.853 1.00 0.00 ? 66 LYS A CG   1  
ATOM 1118  C CD   . LYS A 1 66 ? 1.339   7.831   -13.982 1.00 0.00 ? 66 LYS A CD   1  
ATOM 1119  C CE   . LYS A 1 66 ? 1.947   8.757   -12.940 1.00 0.00 ? 66 LYS A CE   1  
ATOM 1120  N NZ   . LYS A 1 66 ? 3.079   8.112   -12.224 1.00 0.00 ? 66 LYS A NZ   1  
ATOM 1121  H H    . LYS A 1 66 ? -2.658  8.406   -15.696 1.00 0.00 ? 66 LYS A H    1  
ATOM 1122  H HA   . LYS A 1 66 ? -0.482  9.234   -17.314 1.00 0.00 ? 66 LYS A HA   1  
ATOM 1123  H HB2  . LYS A 1 66 ? -0.860  6.898   -15.455 1.00 0.00 ? 66 LYS A HB2  1  
ATOM 1124  H HB3  . LYS A 1 66 ? 0.618   7.107   -16.381 1.00 0.00 ? 66 LYS A HB3  1  
ATOM 1125  H HG2  . LYS A 1 66 ? 0.803   9.397   -15.324 1.00 0.00 ? 66 LYS A HG2  1  
ATOM 1126  H HG3  . LYS A 1 66 ? -0.494  8.889   -14.237 1.00 0.00 ? 66 LYS A HG3  1  
ATOM 1127  H HD2  . LYS A 1 66 ? 0.849   7.011   -13.479 1.00 0.00 ? 66 LYS A HD2  1  
ATOM 1128  H HD3  . LYS A 1 66 ? 2.129   7.447   -14.611 1.00 0.00 ? 66 LYS A HD3  1  
ATOM 1129  H HE2  . LYS A 1 66 ? 2.303   9.649   -13.433 1.00 0.00 ? 66 LYS A HE2  1  
ATOM 1130  H HE3  . LYS A 1 66 ? 1.184   9.024   -12.224 1.00 0.00 ? 66 LYS A HE3  1  
ATOM 1131  H HZ1  . LYS A 1 66 ? 2.770   7.219   -11.783 1.00 0.00 ? 66 LYS A HZ1  1  
ATOM 1132  H HZ2  . LYS A 1 66 ? 3.442   8.747   -11.478 1.00 0.00 ? 66 LYS A HZ2  1  
ATOM 1133  H HZ3  . LYS A 1 66 ? 3.854   7.904   -12.892 1.00 0.00 ? 66 LYS A HZ3  1  
ATOM 1134  N N    . GLU A 1 67 ? -2.300  6.921   -18.517 1.00 0.00 ? 67 GLU A N    1  
ATOM 1135  C CA   . GLU A 1 67 ? -2.553  6.096   -19.685 1.00 0.00 ? 67 GLU A CA   1  
ATOM 1136  C C    . GLU A 1 67 ? -3.169  6.964   -20.782 1.00 0.00 ? 67 GLU A C    1  
ATOM 1137  O O    . GLU A 1 67 ? -3.558  8.102   -20.522 1.00 0.00 ? 67 GLU A O    1  
ATOM 1138  C CB   . GLU A 1 67 ? -3.476  4.929   -19.295 1.00 0.00 ? 67 GLU A CB   1  
ATOM 1139  C CG   . GLU A 1 67 ? -3.743  3.920   -20.405 1.00 0.00 ? 67 GLU A CG   1  
ATOM 1140  C CD   . GLU A 1 67 ? -2.482  3.484   -21.121 1.00 0.00 ? 67 GLU A CD   1  
ATOM 1141  O OE1  . GLU A 1 67 ? -1.603  2.879   -20.484 1.00 0.00 ? 67 GLU A OE1  1  
ATOM 1142  O OE2  . GLU A 1 67 ? -2.361  3.769   -22.332 1.00 0.00 ? 67 GLU A OE2  1  
ATOM 1143  H H    . GLU A 1 67 ? -3.042  7.123   -17.911 1.00 0.00 ? 67 GLU A H    1  
ATOM 1144  H HA   . GLU A 1 67 ? -1.610  5.705   -20.035 1.00 0.00 ? 67 GLU A HA   1  
ATOM 1145  H HB2  . GLU A 1 67 ? -3.029  4.399   -18.467 1.00 0.00 ? 67 GLU A HB2  1  
ATOM 1146  H HB3  . GLU A 1 67 ? -4.424  5.335   -18.974 1.00 0.00 ? 67 GLU A HB3  1  
ATOM 1147  H HG2  . GLU A 1 67 ? -4.211  3.048   -19.974 1.00 0.00 ? 67 GLU A HG2  1  
ATOM 1148  H HG3  . GLU A 1 67 ? -4.412  4.369   -21.124 1.00 0.00 ? 67 GLU A HG3  1  
ATOM 1149  N N    . HIS A 1 68 ? -3.235  6.441   -22.003 1.00 0.00 ? 68 HIS A N    1  
ATOM 1150  C CA   . HIS A 1 68 ? -3.777  7.195   -23.128 1.00 0.00 ? 68 HIS A CA   1  
ATOM 1151  C C    . HIS A 1 68 ? -5.191  7.684   -22.814 1.00 0.00 ? 68 HIS A C    1  
ATOM 1152  O O    . HIS A 1 68 ? -5.964  6.984   -22.151 1.00 0.00 ? 68 HIS A O    1  
ATOM 1153  C CB   . HIS A 1 68 ? -3.784  6.339   -24.410 1.00 0.00 ? 68 HIS A CB   1  
ATOM 1154  C CG   . HIS A 1 68 ? -4.779  5.211   -24.405 1.00 0.00 ? 68 HIS A CG   1  
ATOM 1155  N ND1  . HIS A 1 68 ? -4.528  3.986   -23.828 1.00 0.00 ? 68 HIS A ND1  1  
ATOM 1156  C CD2  . HIS A 1 68 ? -6.029  5.125   -24.923 1.00 0.00 ? 68 HIS A CD2  1  
ATOM 1157  C CE1  . HIS A 1 68 ? -5.577  3.200   -23.985 1.00 0.00 ? 68 HIS A CE1  1  
ATOM 1158  N NE2  . HIS A 1 68 ? -6.502  3.868   -24.647 1.00 0.00 ? 68 HIS A NE2  1  
ATOM 1159  H H    . HIS A 1 68 ? -2.909  5.525   -22.151 1.00 0.00 ? 68 HIS A H    1  
ATOM 1160  H HA   . HIS A 1 68 ? -3.140  8.054   -23.285 1.00 0.00 ? 68 HIS A HA   1  
ATOM 1161  H HB2  . HIS A 1 68 ? -4.013  6.974   -25.251 1.00 0.00 ? 68 HIS A HB2  1  
ATOM 1162  H HB3  . HIS A 1 68 ? -2.800  5.912   -24.550 1.00 0.00 ? 68 HIS A HB3  1  
ATOM 1163  H HD1  . HIS A 1 68 ? -3.696  3.730   -23.357 1.00 0.00 ? 68 HIS A HD1  1  
ATOM 1164  H HD2  . HIS A 1 68 ? -6.556  5.906   -25.455 1.00 0.00 ? 68 HIS A HD2  1  
ATOM 1165  H HE1  . HIS A 1 68 ? -5.660  2.181   -23.638 1.00 0.00 ? 68 HIS A HE1  1  
ATOM 1166  H HE2  . HIS A 1 68 ? -7.448  3.584   -24.739 1.00 0.00 ? 68 HIS A HE2  1  
ATOM 1167  N N    . PRO A 1 69 ? -5.547  8.886   -23.279 1.00 0.00 ? 69 PRO A N    1  
ATOM 1168  C CA   . PRO A 1 69 ? -6.875  9.456   -23.051 1.00 0.00 ? 69 PRO A CA   1  
ATOM 1169  C C    . PRO A 1 69 ? -7.947  8.767   -23.888 1.00 0.00 ? 69 PRO A C    1  
ATOM 1170  O O    . PRO A 1 69 ? -7.660  7.839   -24.644 1.00 0.00 ? 69 PRO A O    1  
ATOM 1171  C CB   . PRO A 1 69 ? -6.716  10.912  -23.485 1.00 0.00 ? 69 PRO A CB   1  
ATOM 1172  C CG   . PRO A 1 69 ? -5.619  10.885  -24.492 1.00 0.00 ? 69 PRO A CG   1  
ATOM 1173  C CD   . PRO A 1 69 ? -4.683  9.789   -24.061 1.00 0.00 ? 69 PRO A CD   1  
ATOM 1174  H HA   . PRO A 1 69 ? -7.152  9.414   -22.008 1.00 0.00 ? 69 PRO A HA   1  
ATOM 1175  H HB2  . PRO A 1 69 ? -7.643  11.264  -23.915 1.00 0.00 ? 69 PRO A HB2  1  
ATOM 1176  H HB3  . PRO A 1 69 ? -6.455  11.522  -22.632 1.00 0.00 ? 69 PRO A HB3  1  
ATOM 1177  H HG2  . PRO A 1 69 ? -6.027  10.666  -25.468 1.00 0.00 ? 69 PRO A HG2  1  
ATOM 1178  H HG3  . PRO A 1 69 ? -5.107  11.836  -24.503 1.00 0.00 ? 69 PRO A HG3  1  
ATOM 1179  H HD2  . PRO A 1 69 ? -4.277  9.282   -24.923 1.00 0.00 ? 69 PRO A HD2  1  
ATOM 1180  H HD3  . PRO A 1 69 ? -3.888  10.189  -23.448 1.00 0.00 ? 69 PRO A HD3  1  
ATOM 1181  N N    . ASP A 1 70 ? -9.176  9.251   -23.778 1.00 0.00 ? 70 ASP A N    1  
ATOM 1182  C CA   . ASP A 1 70 ? -10.304 8.661   -24.492 1.00 0.00 ? 70 ASP A CA   1  
ATOM 1183  C C    . ASP A 1 70 ? -10.398 9.221   -25.909 1.00 0.00 ? 70 ASP A C    1  
ATOM 1184  O O    . ASP A 1 70 ? -11.470 9.244   -26.509 1.00 0.00 ? 70 ASP A O    1  
ATOM 1185  C CB   . ASP A 1 70 ? -11.614 8.918   -23.734 1.00 0.00 ? 70 ASP A CB   1  
ATOM 1186  C CG   . ASP A 1 70 ? -12.044 10.371  -23.765 1.00 0.00 ? 70 ASP A CG   1  
ATOM 1187  O OD1  . ASP A 1 70 ? -11.226 11.250  -23.420 1.00 0.00 ? 70 ASP A OD1  1  
ATOM 1188  O OD2  . ASP A 1 70 ? -13.207 10.641  -24.130 1.00 0.00 ? 70 ASP A OD2  1  
ATOM 1189  H H    . ASP A 1 70 ? -9.335  10.032  -23.207 1.00 0.00 ? 70 ASP A H    1  
ATOM 1190  H HA   . ASP A 1 70 ? -10.137 7.594   -24.549 1.00 0.00 ? 70 ASP A HA   1  
ATOM 1191  H HB2  . ASP A 1 70 ? -12.398 8.324   -24.179 1.00 0.00 ? 70 ASP A HB2  1  
ATOM 1192  H HB3  . ASP A 1 70 ? -11.489 8.621   -22.703 1.00 0.00 ? 70 ASP A HB3  1  
ATOM 1193  N N    . TYR A 1 71 ? -9.262  9.685   -26.427 1.00 0.00 ? 71 TYR A N    1  
ATOM 1194  C CA   . TYR A 1 71 ? -9.177  10.245  -27.775 1.00 0.00 ? 71 TYR A CA   1  
ATOM 1195  C C    . TYR A 1 71 ? -9.737  9.252   -28.796 1.00 0.00 ? 71 TYR A C    1  
ATOM 1196  O O    . TYR A 1 71 ? -9.246  8.131   -28.924 1.00 0.00 ? 71 TYR A O    1  
ATOM 1197  C CB   . TYR A 1 71 ? -7.718  10.591  -28.103 1.00 0.00 ? 71 TYR A CB   1  
ATOM 1198  C CG   . TYR A 1 71 ? -7.542  11.434  -29.347 1.00 0.00 ? 71 TYR A CG   1  
ATOM 1199  C CD1  . TYR A 1 71 ? -7.919  12.772  -29.354 1.00 0.00 ? 71 TYR A CD1  1  
ATOM 1200  C CD2  . TYR A 1 71 ? -6.989  10.901  -30.507 1.00 0.00 ? 71 TYR A CD2  1  
ATOM 1201  C CE1  . TYR A 1 71 ? -7.757  13.554  -30.480 1.00 0.00 ? 71 TYR A CE1  1  
ATOM 1202  C CE2  . TYR A 1 71 ? -6.822  11.679  -31.638 1.00 0.00 ? 71 TYR A CE2  1  
ATOM 1203  C CZ   . TYR A 1 71 ? -7.205  13.004  -31.619 1.00 0.00 ? 71 TYR A CZ   1  
ATOM 1204  O OH   . TYR A 1 71 ? -7.037  13.781  -32.742 1.00 0.00 ? 71 TYR A OH   1  
ATOM 1205  H H    . TYR A 1 71 ? -8.447  9.636   -25.888 1.00 0.00 ? 71 TYR A H    1  
ATOM 1206  H HA   . TYR A 1 71 ? -9.770  11.148  -27.798 1.00 0.00 ? 71 TYR A HA   1  
ATOM 1207  H HB2  . TYR A 1 71 ? -7.290  11.137  -27.275 1.00 0.00 ? 71 TYR A HB2  1  
ATOM 1208  H HB3  . TYR A 1 71 ? -7.165  9.675   -28.244 1.00 0.00 ? 71 TYR A HB3  1  
ATOM 1209  H HD1  . TYR A 1 71 ? -8.347  13.201  -28.459 1.00 0.00 ? 71 TYR A HD1  1  
ATOM 1210  H HD2  . TYR A 1 71 ? -6.688  9.863   -30.520 1.00 0.00 ? 71 TYR A HD2  1  
ATOM 1211  H HE1  . TYR A 1 71 ? -8.058  14.592  -30.466 1.00 0.00 ? 71 TYR A HE1  1  
ATOM 1212  H HE2  . TYR A 1 71 ? -6.388  11.247  -32.531 1.00 0.00 ? 71 TYR A HE2  1  
ATOM 1213  H HH   . TYR A 1 71 ? -6.712  14.647  -32.484 1.00 0.00 ? 71 TYR A HH   1  
ATOM 1214  N N    . LYS A 1 72 ? -10.768 9.676   -29.515 1.00 0.00 ? 72 LYS A N    1  
ATOM 1215  C CA   . LYS A 1 72 ? -11.523 8.777   -30.376 1.00 0.00 ? 72 LYS A CA   1  
ATOM 1216  C C    . LYS A 1 72 ? -11.177 8.962   -31.839 1.00 0.00 ? 72 LYS A C    1  
ATOM 1217  O O    . LYS A 1 72 ? -10.150 9.553   -32.185 1.00 0.00 ? 72 LYS A O    1  
ATOM 1218  C CB   . LYS A 1 72 ? -13.023 8.994   -30.153 1.00 0.00 ? 72 LYS A CB   1  
ATOM 1219  C CG   . LYS A 1 72 ? -13.450 8.773   -28.713 1.00 0.00 ? 72 LYS A CG   1  
ATOM 1220  C CD   . LYS A 1 72 ? -14.852 9.287   -28.448 1.00 0.00 ? 72 LYS A CD   1  
ATOM 1221  C CE   . LYS A 1 72 ? -15.200 9.204   -26.970 1.00 0.00 ? 72 LYS A CE   1  
ATOM 1222  N NZ   . LYS A 1 72 ? -16.535 9.787   -26.678 1.00 0.00 ? 72 LYS A NZ   1  
ATOM 1223  H H    . LYS A 1 72 ? -11.025 10.619  -29.470 1.00 0.00 ? 72 LYS A H    1  
ATOM 1224  H HA   . LYS A 1 72 ? -11.273 7.768   -30.105 1.00 0.00 ? 72 LYS A HA   1  
ATOM 1225  H HB2  . LYS A 1 72 ? -13.274 10.007  -30.433 1.00 0.00 ? 72 LYS A HB2  1  
ATOM 1226  H HB3  . LYS A 1 72 ? -13.573 8.307   -30.780 1.00 0.00 ? 72 LYS A HB3  1  
ATOM 1227  H HG2  . LYS A 1 72 ? -13.422 7.715   -28.500 1.00 0.00 ? 72 LYS A HG2  1  
ATOM 1228  H HG3  . LYS A 1 72 ? -12.758 9.289   -28.063 1.00 0.00 ? 72 LYS A HG3  1  
ATOM 1229  H HD2  . LYS A 1 72 ? -14.913 10.318  -28.767 1.00 0.00 ? 72 LYS A HD2  1  
ATOM 1230  H HD3  . LYS A 1 72 ? -15.557 8.692   -29.009 1.00 0.00 ? 72 LYS A HD3  1  
ATOM 1231  H HE2  . LYS A 1 72 ? -15.199 8.166   -26.672 1.00 0.00 ? 72 LYS A HE2  1  
ATOM 1232  H HE3  . LYS A 1 72 ? -14.451 9.740   -26.407 1.00 0.00 ? 72 LYS A HE3  1  
ATOM 1233  H HZ1  . LYS A 1 72 ? -16.730 9.741   -25.654 1.00 0.00 ? 72 LYS A HZ1  1  
ATOM 1234  H HZ2  . LYS A 1 72 ? -17.276 9.254   -27.185 1.00 0.00 ? 72 LYS A HZ2  1  
ATOM 1235  H HZ3  . LYS A 1 72 ? -16.571 10.783  -26.984 1.00 0.00 ? 72 LYS A HZ3  1  
ATOM 1236  N N    . TYR A 1 73 ? -12.036 8.417   -32.685 1.00 0.00 ? 73 TYR A N    1  
ATOM 1237  C CA   . TYR A 1 73 ? -11.828 8.424   -34.119 1.00 0.00 ? 73 TYR A CA   1  
ATOM 1238  C C    . TYR A 1 73 ? -11.700 9.841   -34.643 1.00 0.00 ? 73 TYR A C    1  
ATOM 1239  O O    . TYR A 1 73 ? -12.619 10.654  -34.510 1.00 0.00 ? 73 TYR A O    1  
ATOM 1240  C CB   . TYR A 1 73 ? -12.973 7.691   -34.821 1.00 0.00 ? 73 TYR A CB   1  
ATOM 1241  C CG   . TYR A 1 73 ? -13.054 6.224   -34.457 1.00 0.00 ? 73 TYR A CG   1  
ATOM 1242  C CD1  . TYR A 1 73 ? -13.655 5.813   -33.275 1.00 0.00 ? 73 TYR A CD1  1  
ATOM 1243  C CD2  . TYR A 1 73 ? -12.521 5.250   -35.294 1.00 0.00 ? 73 TYR A CD2  1  
ATOM 1244  C CE1  . TYR A 1 73 ? -13.725 4.475   -32.935 1.00 0.00 ? 73 TYR A CE1  1  
ATOM 1245  C CE2  . TYR A 1 73 ? -12.590 3.910   -34.960 1.00 0.00 ? 73 TYR A CE2  1  
ATOM 1246  C CZ   . TYR A 1 73 ? -13.192 3.529   -33.780 1.00 0.00 ? 73 TYR A CZ   1  
ATOM 1247  O OH   . TYR A 1 73 ? -13.261 2.196   -33.441 1.00 0.00 ? 73 TYR A OH   1  
ATOM 1248  H H    . TYR A 1 73 ? -12.849 8.005   -32.328 1.00 0.00 ? 73 TYR A H    1  
ATOM 1249  H HA   . TYR A 1 73 ? -10.906 7.900   -34.318 1.00 0.00 ? 73 TYR A HA   1  
ATOM 1250  H HB2  . TYR A 1 73 ? -13.910 8.153   -34.548 1.00 0.00 ? 73 TYR A HB2  1  
ATOM 1251  H HB3  . TYR A 1 73 ? -12.837 7.764   -35.890 1.00 0.00 ? 73 TYR A HB3  1  
ATOM 1252  H HD1  . TYR A 1 73 ? -14.072 6.557   -32.615 1.00 0.00 ? 73 TYR A HD1  1  
ATOM 1253  H HD2  . TYR A 1 73 ? -12.050 5.550   -36.218 1.00 0.00 ? 73 TYR A HD2  1  
ATOM 1254  H HE1  . TYR A 1 73 ? -14.199 4.178   -32.012 1.00 0.00 ? 73 TYR A HE1  1  
ATOM 1255  H HE2  . TYR A 1 73 ? -12.172 3.168   -35.623 1.00 0.00 ? 73 TYR A HE2  1  
ATOM 1256  H HH   . TYR A 1 73 ? -14.112 2.018   -33.009 1.00 0.00 ? 73 TYR A HH   1  
ATOM 1257  N N    . ARG A 1 74 ? -10.526 10.124  -35.185 1.00 0.00 ? 74 ARG A N    1  
ATOM 1258  C CA   . ARG A 1 74 ? -10.234 11.400  -35.836 1.00 0.00 ? 74 ARG A CA   1  
ATOM 1259  C C    . ARG A 1 74 ? -11.361 11.825  -36.780 1.00 0.00 ? 74 ARG A C    1  
ATOM 1260  O O    . ARG A 1 74 ? -11.967 10.987  -37.450 1.00 0.00 ? 74 ARG A O    1  
ATOM 1261  C CB   . ARG A 1 74 ? -8.926  11.290  -36.632 1.00 0.00 ? 74 ARG A CB   1  
ATOM 1262  C CG   . ARG A 1 74 ? -8.892  10.096  -37.584 1.00 0.00 ? 74 ARG A CG   1  
ATOM 1263  C CD   . ARG A 1 74 ? -7.671  10.119  -38.493 1.00 0.00 ? 74 ARG A CD   1  
ATOM 1264  N NE   . ARG A 1 74 ? -7.537  8.881   -39.266 1.00 0.00 ? 74 ARG A NE   1  
ATOM 1265  C CZ   . ARG A 1 74 ? -7.111  8.823   -40.529 1.00 0.00 ? 74 ARG A CZ   1  
ATOM 1266  N NH1  . ARG A 1 74 ? -6.852  9.934   -41.202 1.00 0.00 ? 74 ARG A NH1  1  
ATOM 1267  N NH2  . ARG A 1 74 ? -6.967  7.650   -41.132 1.00 0.00 ? 74 ARG A NH2  1  
ATOM 1268  H H    . ARG A 1 74 ? -9.815  9.454   -35.110 1.00 0.00 ? 74 ARG A H    1  
ATOM 1269  H HA   . ARG A 1 74 ? -10.115 12.150  -35.069 1.00 0.00 ? 74 ARG A HA   1  
ATOM 1270  H HB2  . ARG A 1 74 ? -8.795  12.190  -37.211 1.00 0.00 ? 74 ARG A HB2  1  
ATOM 1271  H HB3  . ARG A 1 74 ? -8.102  11.194  -35.940 1.00 0.00 ? 74 ARG A HB3  1  
ATOM 1272  H HG2  . ARG A 1 74 ? -8.873  9.187   -37.003 1.00 0.00 ? 74 ARG A HG2  1  
ATOM 1273  H HG3  . ARG A 1 74 ? -9.783  10.113  -38.194 1.00 0.00 ? 74 ARG A HG3  1  
ATOM 1274  H HD2  . ARG A 1 74 ? -7.764  10.950  -39.177 1.00 0.00 ? 74 ARG A HD2  1  
ATOM 1275  H HD3  . ARG A 1 74 ? -6.789  10.251  -37.883 1.00 0.00 ? 74 ARG A HD3  1  
ATOM 1276  H HE   . ARG A 1 74 ? -7.760  8.034   -38.802 1.00 0.00 ? 74 ARG A HE   1  
ATOM 1277  H HH11 . ARG A 1 74 ? -6.974  10.827  -40.769 1.00 0.00 ? 74 ARG A HH11 1  
ATOM 1278  H HH12 . ARG A 1 74 ? -6.538  9.881   -42.160 1.00 0.00 ? 74 ARG A HH12 1  
ATOM 1279  H HH21 . ARG A 1 74 ? -7.180  6.797   -40.643 1.00 0.00 ? 74 ARG A HH21 1  
ATOM 1280  H HH22 . ARG A 1 74 ? -6.636  7.611   -42.083 1.00 0.00 ? 74 ARG A HH22 1  
ATOM 1281  N N    . PRO A 1 75 ? -11.638 13.139  -36.855 1.00 0.00 ? 75 PRO A N    1  
ATOM 1282  C CA   . PRO A 1 75 ? -12.669 13.682  -37.744 1.00 0.00 ? 75 PRO A CA   1  
ATOM 1283  C C    . PRO A 1 75 ? -12.325 13.438  -39.209 1.00 0.00 ? 75 PRO A C    1  
ATOM 1284  O O    . PRO A 1 75 ? -13.167 13.003  -39.994 1.00 0.00 ? 75 PRO A O    1  
ATOM 1285  C CB   . PRO A 1 75 ? -12.666 15.187  -37.436 1.00 0.00 ? 75 PRO A CB   1  
ATOM 1286  C CG   . PRO A 1 75 ? -11.971 15.319  -36.124 1.00 0.00 ? 75 PRO A CG   1  
ATOM 1287  C CD   . PRO A 1 75 ? -10.976 14.197  -36.072 1.00 0.00 ? 75 PRO A CD   1  
ATOM 1288  H HA   . PRO A 1 75 ? -13.643 13.264  -37.527 1.00 0.00 ? 75 PRO A HA   1  
ATOM 1289  H HB2  . PRO A 1 75 ? -12.135 15.715  -38.216 1.00 0.00 ? 75 PRO A HB2  1  
ATOM 1290  H HB3  . PRO A 1 75 ? -13.682 15.547  -37.380 1.00 0.00 ? 75 PRO A HB3  1  
ATOM 1291  H HG2  . PRO A 1 75 ? -11.465 16.271  -36.070 1.00 0.00 ? 75 PRO A HG2  1  
ATOM 1292  H HG3  . PRO A 1 75 ? -12.684 15.224  -35.321 1.00 0.00 ? 75 PRO A HG3  1  
ATOM 1293  H HD2  . PRO A 1 75 ? -10.044 14.495  -36.532 1.00 0.00 ? 75 PRO A HD2  1  
ATOM 1294  H HD3  . PRO A 1 75 ? -10.815 13.878  -35.054 1.00 0.00 ? 75 PRO A HD3  1  
ATOM 1295  N N    . ARG A 1 76 ? -11.080 13.739  -39.561 1.00 0.00 ? 76 ARG A N    1  
ATOM 1296  C CA   . ARG A 1 76 ? -10.549 13.468  -40.890 1.00 0.00 ? 76 ARG A CA   1  
ATOM 1297  C C    . ARG A 1 76 ? -9.060  13.167  -40.792 1.00 0.00 ? 76 ARG A C    1  
ATOM 1298  O O    . ARG A 1 76 ? -8.590  12.147  -41.290 1.00 0.00 ? 76 ARG A O    1  
ATOM 1299  C CB   . ARG A 1 76 ? -10.810 14.647  -41.834 1.00 0.00 ? 76 ARG A CB   1  
ATOM 1300  C CG   . ARG A 1 76 ? -12.176 14.597  -42.505 1.00 0.00 ? 76 ARG A CG   1  
ATOM 1301  C CD   . ARG A 1 76 ? -12.574 15.944  -43.081 1.00 0.00 ? 76 ARG A CD   1  
ATOM 1302  N NE   . ARG A 1 76 ? -12.876 16.910  -42.023 1.00 0.00 ? 76 ARG A NE   1  
ATOM 1303  C CZ   . ARG A 1 76 ? -12.634 18.215  -42.105 1.00 0.00 ? 76 ARG A CZ   1  
ATOM 1304  N NH1  . ARG A 1 76 ? -12.161 18.735  -43.227 1.00 0.00 ? 76 ARG A NH1  1  
ATOM 1305  N NH2  . ARG A 1 76 ? -12.896 19.008  -41.070 1.00 0.00 ? 76 ARG A NH2  1  
ATOM 1306  H H    . ARG A 1 76 ? -10.493 14.158  -38.896 1.00 0.00 ? 76 ARG A H    1  
ATOM 1307  H HA   . ARG A 1 76 ? -11.052 12.591  -41.275 1.00 0.00 ? 76 ARG A HA   1  
ATOM 1308  H HB2  . ARG A 1 76 ? -10.743 15.567  -41.272 1.00 0.00 ? 76 ARG A HB2  1  
ATOM 1309  H HB3  . ARG A 1 76 ? -10.054 14.652  -42.606 1.00 0.00 ? 76 ARG A HB3  1  
ATOM 1310  H HG2  . ARG A 1 76 ? -12.148 13.872  -43.303 1.00 0.00 ? 76 ARG A HG2  1  
ATOM 1311  H HG3  . ARG A 1 76 ? -12.913 14.298  -41.774 1.00 0.00 ? 76 ARG A HG3  1  
ATOM 1312  H HD2  . ARG A 1 76 ? -11.761 16.321  -43.683 1.00 0.00 ? 76 ARG A HD2  1  
ATOM 1313  H HD3  . ARG A 1 76 ? -13.451 15.813  -43.699 1.00 0.00 ? 76 ARG A HD3  1  
ATOM 1314  H HE   . ARG A 1 76 ? -13.277 16.552  -41.194 1.00 0.00 ? 76 ARG A HE   1  
ATOM 1315  H HH11 . ARG A 1 76 ? -11.989 18.150  -44.027 1.00 0.00 ? 76 ARG A HH11 1  
ATOM 1316  H HH12 . ARG A 1 76 ? -11.969 19.723  -43.282 1.00 0.00 ? 76 ARG A HH12 1  
ATOM 1317  H HH21 . ARG A 1 76 ? -13.283 18.627  -40.220 1.00 0.00 ? 76 ARG A HH21 1  
ATOM 1318  H HH22 . ARG A 1 76 ? -12.700 19.994  -41.128 1.00 0.00 ? 76 ARG A HH22 1  
ATOM 1319  N N    . ARG A 1 77 ? -8.320  14.048  -40.129 1.00 0.00 ? 77 ARG A N    1  
ATOM 1320  C CA   . ARG A 1 77 ? -6.905  13.812  -39.871 1.00 0.00 ? 77 ARG A CA   1  
ATOM 1321  C C    . ARG A 1 77 ? -6.594  14.072  -38.400 1.00 0.00 ? 77 ARG A C    1  
ATOM 1322  O O    . ARG A 1 77 ? -7.324  14.797  -37.722 1.00 0.00 ? 77 ARG A O    1  
ATOM 1323  C CB   . ARG A 1 77 ? -6.027  14.707  -40.758 1.00 0.00 ? 77 ARG A CB   1  
ATOM 1324  C CG   . ARG A 1 77 ? -5.947  16.153  -40.290 1.00 0.00 ? 77 ARG A CG   1  
ATOM 1325  C CD   . ARG A 1 77 ? -5.082  16.999  -41.215 1.00 0.00 ? 77 ARG A CD   1  
ATOM 1326  N NE   . ARG A 1 77 ? -3.788  16.371  -41.504 1.00 0.00 ? 77 ARG A NE   1  
ATOM 1327  C CZ   . ARG A 1 77 ? -2.621  17.019  -41.513 1.00 0.00 ? 77 ARG A CZ   1  
ATOM 1328  N NH1  . ARG A 1 77 ? -2.545  18.283  -41.112 1.00 0.00 ? 77 ARG A NH1  1  
ATOM 1329  N NH2  . ARG A 1 77 ? -1.521  16.383  -41.890 1.00 0.00 ? 77 ARG A NH2  1  
ATOM 1330  H H    . ARG A 1 77 ? -8.733  14.890  -39.816 1.00 0.00 ? 77 ARG A H    1  
ATOM 1331  H HA   . ARG A 1 77 ? -6.694  12.777  -40.094 1.00 0.00 ? 77 ARG A HA   1  
ATOM 1332  H HB2  . ARG A 1 77 ? -5.026  14.305  -40.775 1.00 0.00 ? 77 ARG A HB2  1  
ATOM 1333  H HB3  . ARG A 1 77 ? -6.427  14.700  -41.762 1.00 0.00 ? 77 ARG A HB3  1  
ATOM 1334  H HG2  . ARG A 1 77 ? -6.944  16.568  -40.267 1.00 0.00 ? 77 ARG A HG2  1  
ATOM 1335  H HG3  . ARG A 1 77 ? -5.524  16.175  -39.296 1.00 0.00 ? 77 ARG A HG3  1  
ATOM 1336  H HD2  . ARG A 1 77 ? -5.613  17.147  -42.143 1.00 0.00 ? 77 ARG A HD2  1  
ATOM 1337  H HD3  . ARG A 1 77 ? -4.910  17.956  -40.745 1.00 0.00 ? 77 ARG A HD3  1  
ATOM 1338  H HE   . ARG A 1 77 ? -3.794  15.416  -41.741 1.00 0.00 ? 77 ARG A HE   1  
ATOM 1339  H HH11 . ARG A 1 77 ? -3.372  18.767  -40.795 1.00 0.00 ? 77 ARG A HH11 1  
ATOM 1340  H HH12 . ARG A 1 77 ? -1.658  18.761  -41.100 1.00 0.00 ? 77 ARG A HH12 1  
ATOM 1341  H HH21 . ARG A 1 77 ? -1.567  15.413  -42.157 1.00 0.00 ? 77 ARG A HH21 1  
ATOM 1342  H HH22 . ARG A 1 77 ? -0.638  16.873  -41.929 1.00 0.00 ? 77 ARG A HH22 1  
ATOM 1343  N N    . LYS A 1 78 ? -5.524  13.473  -37.900 1.00 0.00 ? 78 LYS A N    1  
ATOM 1344  C CA   . LYS A 1 78 ? -5.078  13.740  -36.543 1.00 0.00 ? 78 LYS A CA   1  
ATOM 1345  C C    . LYS A 1 78 ? -3.564  13.923  -36.513 1.00 0.00 ? 78 LYS A C    1  
ATOM 1346  O O    . LYS A 1 78 ? -2.817  13.124  -37.077 1.00 0.00 ? 78 LYS A O    1  
ATOM 1347  C CB   . LYS A 1 78 ? -5.519  12.630  -35.578 1.00 0.00 ? 78 LYS A CB   1  
ATOM 1348  C CG   . LYS A 1 78 ? -4.978  11.249  -35.904 1.00 0.00 ? 78 LYS A CG   1  
ATOM 1349  C CD   . LYS A 1 78 ? -5.362  10.250  -34.822 1.00 0.00 ? 78 LYS A CD   1  
ATOM 1350  C CE   . LYS A 1 78 ? -4.795  8.867   -35.097 1.00 0.00 ? 78 LYS A CE   1  
ATOM 1351  N NZ   . LYS A 1 78 ? -5.079  7.924   -33.983 1.00 0.00 ? 78 LYS A NZ   1  
ATOM 1352  H H    . LYS A 1 78 ? -5.019  12.838  -38.459 1.00 0.00 ? 78 LYS A H    1  
ATOM 1353  H HA   . LYS A 1 78 ? -5.536  14.667  -36.232 1.00 0.00 ? 78 LYS A HA   1  
ATOM 1354  H HB2  . LYS A 1 78 ? -5.191  12.886  -34.583 1.00 0.00 ? 78 LYS A HB2  1  
ATOM 1355  H HB3  . LYS A 1 78 ? -6.598  12.575  -35.585 1.00 0.00 ? 78 LYS A HB3  1  
ATOM 1356  H HG2  . LYS A 1 78 ? -5.387  10.923  -36.849 1.00 0.00 ? 78 LYS A HG2  1  
ATOM 1357  H HG3  . LYS A 1 78 ? -3.902  11.299  -35.971 1.00 0.00 ? 78 LYS A HG3  1  
ATOM 1358  H HD2  . LYS A 1 78 ? -4.981  10.597  -33.875 1.00 0.00 ? 78 LYS A HD2  1  
ATOM 1359  H HD3  . LYS A 1 78 ? -6.441  10.185  -34.774 1.00 0.00 ? 78 LYS A HD3  1  
ATOM 1360  H HE2  . LYS A 1 78 ? -5.236  8.483   -36.004 1.00 0.00 ? 78 LYS A HE2  1  
ATOM 1361  H HE3  . LYS A 1 78 ? -3.726  8.950   -35.224 1.00 0.00 ? 78 LYS A HE3  1  
ATOM 1362  H HZ1  . LYS A 1 78 ? -6.105  7.758   -33.904 1.00 0.00 ? 78 LYS A HZ1  1  
ATOM 1363  H HZ2  . LYS A 1 78 ? -4.728  8.319   -33.082 1.00 0.00 ? 78 LYS A HZ2  1  
ATOM 1364  H HZ3  . LYS A 1 78 ? -4.602  7.012   -34.153 1.00 0.00 ? 78 LYS A HZ3  1  
ATOM 1365  N N    . THR A 1 79 ? -3.122  14.989  -35.860 1.00 0.00 ? 79 THR A N    1  
ATOM 1366  C CA   . THR A 1 79 ? -1.705  15.318  -35.789 1.00 0.00 ? 79 THR A CA   1  
ATOM 1367  C C    . THR A 1 79 ? -1.067  14.689  -34.550 1.00 0.00 ? 79 THR A C    1  
ATOM 1368  O O    . THR A 1 79 ? -0.135  15.233  -33.958 1.00 0.00 ? 79 THR A O    1  
ATOM 1369  C CB   . THR A 1 79 ? -1.511  16.844  -35.768 1.00 0.00 ? 79 THR A CB   1  
ATOM 1370  O OG1  . THR A 1 79 ? -2.474  17.459  -36.636 1.00 0.00 ? 79 THR A OG1  1  
ATOM 1371  C CG2  . THR A 1 79 ? -0.112  17.218  -36.239 1.00 0.00 ? 79 THR A CG2  1  
ATOM 1372  H H    . THR A 1 79 ? -3.771  15.581  -35.418 1.00 0.00 ? 79 THR A H    1  
ATOM 1373  H HA   . THR A 1 79 ? -1.224  14.925  -36.674 1.00 0.00 ? 79 THR A HA   1  
ATOM 1374  H HB   . THR A 1 79 ? -1.652  17.206  -34.762 1.00 0.00 ? 79 THR A HB   1  
ATOM 1375  H HG1  . THR A 1 79 ? -3.366  17.158  -36.397 1.00 0.00 ? 79 THR A HG1  1  
ATOM 1376  H HG21 . THR A 1 79 ? 0.024   16.885  -37.256 1.00 0.00 ? 79 THR A HG21 1  
ATOM 1377  H HG22 . THR A 1 79 ? 0.622   16.741  -35.604 1.00 0.00 ? 79 THR A HG22 1  
ATOM 1378  H HG23 . THR A 1 79 ? 0.010   18.291  -36.190 1.00 0.00 ? 79 THR A HG23 1  
ATOM 1379  N N    . LYS A 1 80 ? -1.586  13.534  -34.171 1.00 0.00 ? 80 LYS A N    1  
ATOM 1380  C CA   . LYS A 1 80 ? -1.042  12.759  -33.068 1.00 0.00 ? 80 LYS A CA   1  
ATOM 1381  C C    . LYS A 1 80 ? -1.372  11.294  -33.304 1.00 0.00 ? 80 LYS A C    1  
ATOM 1382  O O    . LYS A 1 80 ? -1.946  10.619  -32.452 1.00 0.00 ? 80 LYS A O    1  
ATOM 1383  C CB   . LYS A 1 80 ? -1.613  13.242  -31.727 1.00 0.00 ? 80 LYS A CB   1  
ATOM 1384  C CG   . LYS A 1 80 ? -0.852  12.721  -30.512 1.00 0.00 ? 80 LYS A CG   1  
ATOM 1385  C CD   . LYS A 1 80 ? -1.418  13.274  -29.214 1.00 0.00 ? 80 LYS A CD   1  
ATOM 1386  C CE   . LYS A 1 80 ? -0.599  12.821  -28.014 1.00 0.00 ? 80 LYS A CE   1  
ATOM 1387  N NZ   . LYS A 1 80 ? -1.115  13.392  -26.743 1.00 0.00 ? 80 LYS A NZ   1  
ATOM 1388  H H    . LYS A 1 80 ? -2.355  13.183  -34.663 1.00 0.00 ? 80 LYS A H    1  
ATOM 1389  H HA   . LYS A 1 80 ? 0.032   12.883  -33.070 1.00 0.00 ? 80 LYS A HA   1  
ATOM 1390  H HB2  . LYS A 1 80 ? -1.583  14.322  -31.706 1.00 0.00 ? 80 LYS A HB2  1  
ATOM 1391  H HB3  . LYS A 1 80 ? -2.640  12.918  -31.651 1.00 0.00 ? 80 LYS A HB3  1  
ATOM 1392  H HG2  . LYS A 1 80 ? -0.922  11.644  -30.488 1.00 0.00 ? 80 LYS A HG2  1  
ATOM 1393  H HG3  . LYS A 1 80 ? 0.184   13.014  -30.593 1.00 0.00 ? 80 LYS A HG3  1  
ATOM 1394  H HD2  . LYS A 1 80 ? -1.407  14.352  -29.258 1.00 0.00 ? 80 LYS A HD2  1  
ATOM 1395  H HD3  . LYS A 1 80 ? -2.434  12.926  -29.098 1.00 0.00 ? 80 LYS A HD3  1  
ATOM 1396  H HE2  . LYS A 1 80 ? -0.634  11.744  -27.955 1.00 0.00 ? 80 LYS A HE2  1  
ATOM 1397  H HE3  . LYS A 1 80 ? 0.424   13.141  -28.154 1.00 0.00 ? 80 LYS A HE3  1  
ATOM 1398  H HZ1  . LYS A 1 80 ? -0.488  13.132  -25.951 1.00 0.00 ? 80 LYS A HZ1  1  
ATOM 1399  H HZ2  . LYS A 1 80 ? -2.073  13.030  -26.545 1.00 0.00 ? 80 LYS A HZ2  1  
ATOM 1400  H HZ3  . LYS A 1 80 ? -1.159  14.432  -26.806 1.00 0.00 ? 80 LYS A HZ3  1  
ATOM 1401  N N    . THR A 1 81 ? -1.020  10.822  -34.487 1.00 0.00 ? 81 THR A N    1  
ATOM 1402  C CA   . THR A 1 81 ? -1.379  9.486   -34.915 1.00 0.00 ? 81 THR A CA   1  
ATOM 1403  C C    . THR A 1 81 ? -0.451  8.441   -34.294 1.00 0.00 ? 81 THR A C    1  
ATOM 1404  O O    . THR A 1 81 ? -0.944  7.612   -33.498 1.00 0.00 ? 81 THR A O    1  
ATOM 1405  C CB   . THR A 1 81 ? -1.396  9.383   -36.461 1.00 0.00 ? 81 THR A CB   1  
ATOM 1406  O OG1  . THR A 1 81 ? -1.737  8.056   -36.875 1.00 0.00 ? 81 THR A OG1  1  
ATOM 1407  C CG2  . THR A 1 81 ? -0.060  9.786   -37.068 1.00 0.00 ? 81 THR A CG2  1  
ATOM 1408  O OXT  . THR A 1 81 ? 0.767   8.480   -34.557 1.00 0.00 ? 81 THR A OXT  1  
ATOM 1409  H H    . THR A 1 81 ? -0.476  11.386  -35.083 1.00 0.00 ? 81 THR A H    1  
ATOM 1410  H HA   . THR A 1 81 ? -2.384  9.296   -34.562 1.00 0.00 ? 81 THR A HA   1  
ATOM 1411  H HB   . THR A 1 81 ? -2.152  10.061  -36.833 1.00 0.00 ? 81 THR A HB   1  
ATOM 1412  H HG1  . THR A 1 81 ? -1.062  7.727   -37.493 1.00 0.00 ? 81 THR A HG1  1  
ATOM 1413  H HG21 . THR A 1 81 ? 0.713   9.125   -36.704 1.00 0.00 ? 81 THR A HG21 1  
ATOM 1414  H HG22 . THR A 1 81 ? 0.171   10.802  -36.786 1.00 0.00 ? 81 THR A HG22 1  
ATOM 1415  H HG23 . THR A 1 81 ? -0.119  9.715   -38.144 1.00 0.00 ? 81 THR A HG23 1  
ATOM 1416  N N    . SER A 1 1  ? -11.804 -1.172  -25.585 1.00 0.00 ? 1  SER A N    2  
ATOM 1417  C CA   . SER A 1 1  ? -12.389 -0.920  -24.252 1.00 0.00 ? 1  SER A CA   2  
ATOM 1418  C C    . SER A 1 1  ? -11.490 0.015   -23.448 1.00 0.00 ? 1  SER A C    2  
ATOM 1419  O O    . SER A 1 1  ? -11.472 -0.026  -22.215 1.00 0.00 ? 1  SER A O    2  
ATOM 1420  C CB   . SER A 1 1  ? -12.571 -2.249  -23.512 1.00 0.00 ? 1  SER A CB   2  
ATOM 1421  O OG   . SER A 1 1  ? -13.309 -3.176  -24.298 1.00 0.00 ? 1  SER A OG   2  
ATOM 1422  H H1   . SER A 1 1  ? -12.350 -1.906  -26.085 1.00 0.00 ? 1  SER A H1   2  
ATOM 1423  H H2   . SER A 1 1  ? -10.817 -1.492  -25.489 1.00 0.00 ? 1  SER A H2   2  
ATOM 1424  H H3   . SER A 1 1  ? -11.821 -0.298  -26.156 1.00 0.00 ? 1  SER A H3   2  
ATOM 1425  H HA   . SER A 1 1  ? -13.353 -0.450  -24.385 1.00 0.00 ? 1  SER A HA   2  
ATOM 1426  H HB2  . SER A 1 1  ? -11.601 -2.673  -23.296 1.00 0.00 ? 1  SER A HB2  2  
ATOM 1427  H HB3  . SER A 1 1  ? -13.103 -2.075  -22.589 1.00 0.00 ? 1  SER A HB3  2  
ATOM 1428  H HG   . SER A 1 1  ? -12.688 -3.774  -24.749 1.00 0.00 ? 1  SER A HG   2  
ATOM 1429  N N    . ASP A 1 2  ? -10.768 0.883   -24.147 1.00 0.00 ? 2  ASP A N    2  
ATOM 1430  C CA   . ASP A 1 2  ? -9.799  1.758   -23.502 1.00 0.00 ? 2  ASP A CA   2  
ATOM 1431  C C    . ASP A 1 2  ? -10.490 3.005   -22.966 1.00 0.00 ? 2  ASP A C    2  
ATOM 1432  O O    . ASP A 1 2  ? -10.705 3.970   -23.699 1.00 0.00 ? 2  ASP A O    2  
ATOM 1433  C CB   . ASP A 1 2  ? -8.694  2.148   -24.484 1.00 0.00 ? 2  ASP A CB   2  
ATOM 1434  C CG   . ASP A 1 2  ? -7.490  2.761   -23.795 1.00 0.00 ? 2  ASP A CG   2  
ATOM 1435  O OD1  . ASP A 1 2  ? -7.488  3.985   -23.540 1.00 0.00 ? 2  ASP A OD1  2  
ATOM 1436  O OD2  . ASP A 1 2  ? -6.532  2.019   -23.503 1.00 0.00 ? 2  ASP A OD2  2  
ATOM 1437  H H    . ASP A 1 2  ? -10.902 0.954   -25.117 1.00 0.00 ? 2  ASP A H    2  
ATOM 1438  H HA   . ASP A 1 2  ? -9.361  1.217   -22.675 1.00 0.00 ? 2  ASP A HA   2  
ATOM 1439  H HB2  . ASP A 1 2  ? -8.369  1.267   -25.017 1.00 0.00 ? 2  ASP A HB2  2  
ATOM 1440  H HB3  . ASP A 1 2  ? -9.086  2.866   -25.189 1.00 0.00 ? 2  ASP A HB3  2  
ATOM 1441  N N    . ARG A 1 3  ? -10.868 2.966   -21.698 1.00 0.00 ? 3  ARG A N    2  
ATOM 1442  C CA   . ARG A 1 3  ? -11.553 4.090   -21.069 1.00 0.00 ? 3  ARG A CA   2  
ATOM 1443  C C    . ARG A 1 3  ? -10.984 4.370   -19.679 1.00 0.00 ? 3  ARG A C    2  
ATOM 1444  O O    . ARG A 1 3  ? -10.244 3.552   -19.125 1.00 0.00 ? 3  ARG A O    2  
ATOM 1445  C CB   . ARG A 1 3  ? -13.059 3.809   -20.985 1.00 0.00 ? 3  ARG A CB   2  
ATOM 1446  C CG   . ARG A 1 3  ? -13.407 2.580   -20.163 1.00 0.00 ? 3  ARG A CG   2  
ATOM 1447  C CD   . ARG A 1 3  ? -14.888 2.245   -20.251 1.00 0.00 ? 3  ARG A CD   2  
ATOM 1448  N NE   . ARG A 1 3  ? -15.293 1.901   -21.614 1.00 0.00 ? 3  ARG A NE   2  
ATOM 1449  C CZ   . ARG A 1 3  ? -16.417 1.254   -21.919 1.00 0.00 ? 3  ARG A CZ   2  
ATOM 1450  N NH1  . ARG A 1 3  ? -17.254 0.874   -20.963 1.00 0.00 ? 3  ARG A NH1  2  
ATOM 1451  N NH2  . ARG A 1 3  ? -16.705 0.983   -23.187 1.00 0.00 ? 3  ARG A NH2  2  
ATOM 1452  H H    . ARG A 1 3  ? -10.689 2.160   -21.171 1.00 0.00 ? 3  ARG A H    2  
ATOM 1453  H HA   . ARG A 1 3  ? -11.395 4.961   -21.686 1.00 0.00 ? 3  ARG A HA   2  
ATOM 1454  H HB2  . ARG A 1 3  ? -13.549 4.662   -20.542 1.00 0.00 ? 3  ARG A HB2  2  
ATOM 1455  H HB3  . ARG A 1 3  ? -13.442 3.665   -21.986 1.00 0.00 ? 3  ARG A HB3  2  
ATOM 1456  H HG2  . ARG A 1 3  ? -12.838 1.740   -20.534 1.00 0.00 ? 3  ARG A HG2  2  
ATOM 1457  H HG3  . ARG A 1 3  ? -13.148 2.765   -19.130 1.00 0.00 ? 3  ARG A HG3  2  
ATOM 1458  H HD2  . ARG A 1 3  ? -15.092 1.406   -19.602 1.00 0.00 ? 3  ARG A HD2  2  
ATOM 1459  H HD3  . ARG A 1 3  ? -15.457 3.102   -19.920 1.00 0.00 ? 3  ARG A HD3  2  
ATOM 1460  H HE   . ARG A 1 3  ? -14.686 2.170   -22.348 1.00 0.00 ? 3  ARG A HE   2  
ATOM 1461  H HH11 . ARG A 1 3  ? -17.048 1.070   -19.995 1.00 0.00 ? 3  ARG A HH11 2  
ATOM 1462  H HH12 . ARG A 1 3  ? -18.102 0.392   -21.203 1.00 0.00 ? 3  ARG A HH12 2  
ATOM 1463  H HH21 . ARG A 1 3  ? -16.077 1.261   -23.919 1.00 0.00 ? 3  ARG A HH21 2  
ATOM 1464  H HH22 . ARG A 1 3  ? -17.554 0.492   -23.419 1.00 0.00 ? 3  ARG A HH22 2  
ATOM 1465  N N    . VAL A 1 4  ? -11.325 5.526   -19.122 1.00 0.00 ? 4  VAL A N    2  
ATOM 1466  C CA   . VAL A 1 4  ? -10.860 5.899   -17.792 1.00 0.00 ? 4  VAL A CA   2  
ATOM 1467  C C    . VAL A 1 4  ? -11.909 5.552   -16.739 1.00 0.00 ? 4  VAL A C    2  
ATOM 1468  O O    . VAL A 1 4  ? -13.039 5.192   -17.072 1.00 0.00 ? 4  VAL A O    2  
ATOM 1469  C CB   . VAL A 1 4  ? -10.513 7.403   -17.703 1.00 0.00 ? 4  VAL A CB   2  
ATOM 1470  C CG1  . VAL A 1 4  ? -9.355  7.743   -18.632 1.00 0.00 ? 4  VAL A CG1  2  
ATOM 1471  C CG2  . VAL A 1 4  ? -11.730 8.258   -18.025 1.00 0.00 ? 4  VAL A CG2  2  
ATOM 1472  H H    . VAL A 1 4  ? -11.913 6.144   -19.616 1.00 0.00 ? 4  VAL A H    2  
ATOM 1473  H HA   . VAL A 1 4  ? -9.963  5.333   -17.587 1.00 0.00 ? 4  VAL A HA   2  
ATOM 1474  H HB   . VAL A 1 4  ? -10.207 7.619   -16.690 1.00 0.00 ? 4  VAL A HB   2  
ATOM 1475  H HG11 . VAL A 1 4  ? -9.125  8.794   -18.551 1.00 0.00 ? 4  VAL A HG11 2  
ATOM 1476  H HG12 . VAL A 1 4  ? -9.629  7.511   -19.651 1.00 0.00 ? 4  VAL A HG12 2  
ATOM 1477  H HG13 . VAL A 1 4  ? -8.487  7.162   -18.352 1.00 0.00 ? 4  VAL A HG13 2  
ATOM 1478  H HG21 . VAL A 1 4  ? -12.076 8.030   -19.022 1.00 0.00 ? 4  VAL A HG21 2  
ATOM 1479  H HG22 . VAL A 1 4  ? -11.463 9.302   -17.967 1.00 0.00 ? 4  VAL A HG22 2  
ATOM 1480  H HG23 . VAL A 1 4  ? -12.516 8.046   -17.315 1.00 0.00 ? 4  VAL A HG23 2  
ATOM 1481  N N    . LYS A 1 5  ? -11.533 5.638   -15.472 1.00 0.00 ? 5  LYS A N    2  
ATOM 1482  C CA   . LYS A 1 5  ? -12.434 5.284   -14.382 1.00 0.00 ? 5  LYS A CA   2  
ATOM 1483  C C    . LYS A 1 5  ? -12.417 6.361   -13.307 1.00 0.00 ? 5  LYS A C    2  
ATOM 1484  O O    . LYS A 1 5  ? -11.638 7.311   -13.381 1.00 0.00 ? 5  LYS A O    2  
ATOM 1485  C CB   . LYS A 1 5  ? -12.061 3.925   -13.761 1.00 0.00 ? 5  LYS A CB   2  
ATOM 1486  C CG   . LYS A 1 5  ? -12.334 2.722   -14.659 1.00 0.00 ? 5  LYS A CG   2  
ATOM 1487  C CD   . LYS A 1 5  ? -11.220 2.503   -15.673 1.00 0.00 ? 5  LYS A CD   2  
ATOM 1488  C CE   . LYS A 1 5  ? -11.590 1.437   -16.690 1.00 0.00 ? 5  LYS A CE   2  
ATOM 1489  N NZ   . LYS A 1 5  ? -11.998 0.167   -16.034 1.00 0.00 ? 5  LYS A NZ   2  
ATOM 1490  H H    . LYS A 1 5  ? -10.634 5.962   -15.258 1.00 0.00 ? 5  LYS A H    2  
ATOM 1491  H HA   . LYS A 1 5  ? -13.434 5.219   -14.788 1.00 0.00 ? 5  LYS A HA   2  
ATOM 1492  H HB2  . LYS A 1 5  ? -11.007 3.932   -13.528 1.00 0.00 ? 5  LYS A HB2  2  
ATOM 1493  H HB3  . LYS A 1 5  ? -12.621 3.798   -12.846 1.00 0.00 ? 5  LYS A HB3  2  
ATOM 1494  H HG2  . LYS A 1 5  ? -12.419 1.839   -14.042 1.00 0.00 ? 5  LYS A HG2  2  
ATOM 1495  H HG3  . LYS A 1 5  ? -13.264 2.883   -15.188 1.00 0.00 ? 5  LYS A HG3  2  
ATOM 1496  H HD2  . LYS A 1 5  ? -11.031 3.431   -16.191 1.00 0.00 ? 5  LYS A HD2  2  
ATOM 1497  H HD3  . LYS A 1 5  ? -10.327 2.191   -15.150 1.00 0.00 ? 5  LYS A HD3  2  
ATOM 1498  H HE2  . LYS A 1 5  ? -12.409 1.800   -17.293 1.00 0.00 ? 5  LYS A HE2  2  
ATOM 1499  H HE3  . LYS A 1 5  ? -10.735 1.248   -17.324 1.00 0.00 ? 5  LYS A HE3  2  
ATOM 1500  H HZ1  . LYS A 1 5  ? -12.940 0.268   -15.607 1.00 0.00 ? 5  LYS A HZ1  2  
ATOM 1501  H HZ2  . LYS A 1 5  ? -11.316 -0.087  -15.292 1.00 0.00 ? 5  LYS A HZ2  2  
ATOM 1502  H HZ3  . LYS A 1 5  ? -12.026 -0.603  -16.737 1.00 0.00 ? 5  LYS A HZ3  2  
ATOM 1503  N N    . ARG A 1 6  ? -13.292 6.214   -12.322 1.00 0.00 ? 6  ARG A N    2  
ATOM 1504  C CA   . ARG A 1 6  ? -13.372 7.157   -11.218 1.00 0.00 ? 6  ARG A CA   2  
ATOM 1505  C C    . ARG A 1 6  ? -12.864 6.510   -9.935  1.00 0.00 ? 6  ARG A C    2  
ATOM 1506  O O    . ARG A 1 6  ? -12.949 5.291   -9.778  1.00 0.00 ? 6  ARG A O    2  
ATOM 1507  C CB   . ARG A 1 6  ? -14.814 7.638   -11.027 1.00 0.00 ? 6  ARG A CB   2  
ATOM 1508  C CG   . ARG A 1 6  ? -15.391 8.343   -12.243 1.00 0.00 ? 6  ARG A CG   2  
ATOM 1509  C CD   . ARG A 1 6  ? -14.510 9.495   -12.691 1.00 0.00 ? 6  ARG A CD   2  
ATOM 1510  N NE   . ARG A 1 6  ? -15.119 10.252  -13.777 1.00 0.00 ? 6  ARG A NE   2  
ATOM 1511  C CZ   . ARG A 1 6  ? -14.589 10.380  -14.994 1.00 0.00 ? 6  ARG A CZ   2  
ATOM 1512  N NH1  . ARG A 1 6  ? -13.441 9.783   -15.291 1.00 0.00 ? 6  ARG A NH1  2  
ATOM 1513  N NH2  . ARG A 1 6  ? -15.210 11.102  -15.914 1.00 0.00 ? 6  ARG A NH2  2  
ATOM 1514  H H    . ARG A 1 6  ? -13.890 5.439   -12.326 1.00 0.00 ? 6  ARG A H    2  
ATOM 1515  H HA   . ARG A 1 6  ? -12.744 8.004   -11.453 1.00 0.00 ? 6  ARG A HA   2  
ATOM 1516  H HB2  . ARG A 1 6  ? -15.440 6.787   -10.802 1.00 0.00 ? 6  ARG A HB2  2  
ATOM 1517  H HB3  . ARG A 1 6  ? -14.845 8.324   -10.193 1.00 0.00 ? 6  ARG A HB3  2  
ATOM 1518  H HG2  . ARG A 1 6  ? -15.475 7.633   -13.053 1.00 0.00 ? 6  ARG A HG2  2  
ATOM 1519  H HG3  . ARG A 1 6  ? -16.371 8.726   -11.994 1.00 0.00 ? 6  ARG A HG3  2  
ATOM 1520  H HD2  . ARG A 1 6  ? -14.348 10.153  -11.850 1.00 0.00 ? 6  ARG A HD2  2  
ATOM 1521  H HD3  . ARG A 1 6  ? -13.562 9.098   -13.025 1.00 0.00 ? 6  ARG A HD3  2  
ATOM 1522  H HE   . ARG A 1 6  ? -15.983 10.698  -13.582 1.00 0.00 ? 6  ARG A HE   2  
ATOM 1523  H HH11 . ARG A 1 6  ? -12.965 9.234   -14.601 1.00 0.00 ? 6  ARG A HH11 2  
ATOM 1524  H HH12 . ARG A 1 6  ? -13.049 9.880   -16.209 1.00 0.00 ? 6  ARG A HH12 2  
ATOM 1525  H HH21 . ARG A 1 6  ? -16.083 11.561  -15.698 1.00 0.00 ? 6  ARG A HH21 2  
ATOM 1526  H HH22 . ARG A 1 6  ? -14.812 11.192  -16.838 1.00 0.00 ? 6  ARG A HH22 2  
ATOM 1527  N N    . PRO A 1 7  ? -12.311 7.314   -9.016  1.00 0.00 ? 7  PRO A N    2  
ATOM 1528  C CA   . PRO A 1 7  ? -11.852 6.831   -7.709  1.00 0.00 ? 7  PRO A CA   2  
ATOM 1529  C C    . PRO A 1 7  ? -13.006 6.290   -6.861  1.00 0.00 ? 7  PRO A C    2  
ATOM 1530  O O    . PRO A 1 7  ? -13.994 6.983   -6.620  1.00 0.00 ? 7  PRO A O    2  
ATOM 1531  C CB   . PRO A 1 7  ? -11.243 8.079   -7.053  1.00 0.00 ? 7  PRO A CB   2  
ATOM 1532  C CG   . PRO A 1 7  ? -11.007 9.036   -8.173  1.00 0.00 ? 7  PRO A CG   2  
ATOM 1533  C CD   . PRO A 1 7  ? -12.084 8.757   -9.176  1.00 0.00 ? 7  PRO A CD   2  
ATOM 1534  H HA   . PRO A 1 7  ? -11.092 6.068   -7.811  1.00 0.00 ? 7  PRO A HA   2  
ATOM 1535  H HB2  . PRO A 1 7  ? -11.938 8.480   -6.330  1.00 0.00 ? 7  PRO A HB2  2  
ATOM 1536  H HB3  . PRO A 1 7  ? -10.318 7.815   -6.562  1.00 0.00 ? 7  PRO A HB3  2  
ATOM 1537  H HG2  . PRO A 1 7  ? -11.085 10.052  -7.814  1.00 0.00 ? 7  PRO A HG2  2  
ATOM 1538  H HG3  . PRO A 1 7  ? -10.033 8.864   -8.610  1.00 0.00 ? 7  PRO A HG3  2  
ATOM 1539  H HD2  . PRO A 1 7  ? -12.975 9.318   -8.939  1.00 0.00 ? 7  PRO A HD2  2  
ATOM 1540  H HD3  . PRO A 1 7  ? -11.742 8.986   -10.174 1.00 0.00 ? 7  PRO A HD3  2  
ATOM 1541  N N    . MET A 1 8  ? -12.869 5.046   -6.425  1.00 0.00 ? 8  MET A N    2  
ATOM 1542  C CA   . MET A 1 8  ? -13.879 4.398   -5.598  1.00 0.00 ? 8  MET A CA   2  
ATOM 1543  C C    . MET A 1 8  ? -13.721 4.828   -4.138  1.00 0.00 ? 8  MET A C    2  
ATOM 1544  O O    . MET A 1 8  ? -12.752 5.496   -3.791  1.00 0.00 ? 8  MET A O    2  
ATOM 1545  C CB   . MET A 1 8  ? -13.771 2.875   -5.746  1.00 0.00 ? 8  MET A CB   2  
ATOM 1546  C CG   . MET A 1 8  ? -14.901 2.098   -5.086  1.00 0.00 ? 8  MET A CG   2  
ATOM 1547  S SD   . MET A 1 8  ? -16.533 2.656   -5.604  1.00 0.00 ? 8  MET A SD   2  
ATOM 1548  C CE   . MET A 1 8  ? -17.585 1.496   -4.732  1.00 0.00 ? 8  MET A CE   2  
ATOM 1549  H H    . MET A 1 8  ? -12.062 4.550   -6.664  1.00 0.00 ? 8  MET A H    2  
ATOM 1550  H HA   . MET A 1 8  ? -14.849 4.716   -5.949  1.00 0.00 ? 8  MET A HA   2  
ATOM 1551  H HB2  . MET A 1 8  ? -13.764 2.631   -6.797  1.00 0.00 ? 8  MET A HB2  2  
ATOM 1552  H HB3  . MET A 1 8  ? -12.838 2.549   -5.306  1.00 0.00 ? 8  MET A HB3  2  
ATOM 1553  H HG2  . MET A 1 8  ? -14.800 1.055   -5.343  1.00 0.00 ? 8  MET A HG2  2  
ATOM 1554  H HG3  . MET A 1 8  ? -14.821 2.212   -4.015  1.00 0.00 ? 8  MET A HG3  2  
ATOM 1555  H HE1  . MET A 1 8  ? -17.346 0.489   -5.043  1.00 0.00 ? 8  MET A HE1  2  
ATOM 1556  H HE2  . MET A 1 8  ? -18.620 1.705   -4.959  1.00 0.00 ? 8  MET A HE2  2  
ATOM 1557  H HE3  . MET A 1 8  ? -17.424 1.593   -3.670  1.00 0.00 ? 8  MET A HE3  2  
ATOM 1558  N N    . ASN A 1 9  ? -14.697 4.490   -3.300  1.00 0.00 ? 9  ASN A N    2  
ATOM 1559  C CA   . ASN A 1 9  ? -14.661 4.846   -1.884  1.00 0.00 ? 9  ASN A CA   2  
ATOM 1560  C C    . ASN A 1 9  ? -13.526 4.140   -1.132  1.00 0.00 ? 9  ASN A C    2  
ATOM 1561  O O    . ASN A 1 9  ? -13.042 3.082   -1.551  1.00 0.00 ? 9  ASN A O    2  
ATOM 1562  C CB   . ASN A 1 9  ? -16.014 4.557   -1.216  1.00 0.00 ? 9  ASN A CB   2  
ATOM 1563  C CG   . ASN A 1 9  ? -16.521 3.136   -1.417  1.00 0.00 ? 9  ASN A CG   2  
ATOM 1564  O OD1  . ASN A 1 9  ? -17.724 2.904   -1.483  1.00 0.00 ? 9  ASN A OD1  2  
ATOM 1565  N ND2  . ASN A 1 9  ? -15.621 2.179   -1.503  1.00 0.00 ? 9  ASN A ND2  2  
ATOM 1566  H H    . ASN A 1 9  ? -15.468 3.999   -3.643  1.00 0.00 ? 9  ASN A H    2  
ATOM 1567  H HA   . ASN A 1 9  ? -14.481 5.910   -1.833  1.00 0.00 ? 9  ASN A HA   2  
ATOM 1568  H HB2  . ASN A 1 9  ? -15.925 4.733   -0.156  1.00 0.00 ? 9  ASN A HB2  2  
ATOM 1569  H HB3  . ASN A 1 9  ? -16.747 5.230   -1.621  1.00 0.00 ? 9  ASN A HB3  2  
ATOM 1570  H HD21 . ASN A 1 9  ? -14.677 2.438   -1.431  1.00 0.00 ? 9  ASN A HD21 2  
ATOM 1571  H HD22 . ASN A 1 9  ? -15.931 1.258   -1.632  1.00 0.00 ? 9  ASN A HD22 2  
ATOM 1572  N N    . ALA A 1 10 ? -13.165 4.727   0.001   1.00 0.00 ? 10 ALA A N    2  
ATOM 1573  C CA   . ALA A 1 10 ? -12.011 4.334   0.818   1.00 0.00 ? 10 ALA A CA   2  
ATOM 1574  C C    . ALA A 1 10 ? -11.842 2.828   1.068   1.00 0.00 ? 10 ALA A C    2  
ATOM 1575  O O    . ALA A 1 10 ? -10.708 2.356   1.058   1.00 0.00 ? 10 ALA A O    2  
ATOM 1576  C CB   . ALA A 1 10 ? -12.078 5.056   2.151   1.00 0.00 ? 10 ALA A CB   2  
ATOM 1577  H H    . ALA A 1 10 ? -13.665 5.528   0.278   1.00 0.00 ? 10 ALA A H    2  
ATOM 1578  H HA   . ALA A 1 10 ? -11.127 4.690   0.311   1.00 0.00 ? 10 ALA A HA   2  
ATOM 1579  H HB1  . ALA A 1 10 ? -12.167 6.120   1.978   1.00 0.00 ? 10 ALA A HB1  2  
ATOM 1580  H HB2  . ALA A 1 10 ? -11.178 4.857   2.713   1.00 0.00 ? 10 ALA A HB2  2  
ATOM 1581  H HB3  . ALA A 1 10 ? -12.936 4.708   2.708   1.00 0.00 ? 10 ALA A HB3  2  
ATOM 1582  N N    . PHE A 1 11 ? -12.910 2.064   1.315   1.00 0.00 ? 11 PHE A N    2  
ATOM 1583  C CA   . PHE A 1 11 ? -12.722 0.634   1.605   1.00 0.00 ? 11 PHE A CA   2  
ATOM 1584  C C    . PHE A 1 11 ? -12.074 -0.066  0.422   1.00 0.00 ? 11 PHE A C    2  
ATOM 1585  O O    . PHE A 1 11 ? -11.074 -0.770  0.569   1.00 0.00 ? 11 PHE A O    2  
ATOM 1586  C CB   . PHE A 1 11 ? -14.032 -0.080  1.951   1.00 0.00 ? 11 PHE A CB   2  
ATOM 1587  C CG   . PHE A 1 11 ? -13.803 -1.501  2.403   1.00 0.00 ? 11 PHE A CG   2  
ATOM 1588  C CD1  . PHE A 1 11 ? -13.369 -1.761  3.693   1.00 0.00 ? 11 PHE A CD1  2  
ATOM 1589  C CD2  . PHE A 1 11 ? -13.996 -2.570  1.540   1.00 0.00 ? 11 PHE A CD2  2  
ATOM 1590  C CE1  . PHE A 1 11 ? -13.129 -3.053  4.116   1.00 0.00 ? 11 PHE A CE1  2  
ATOM 1591  C CE2  . PHE A 1 11 ? -13.761 -3.869  1.959   1.00 0.00 ? 11 PHE A CE2  2  
ATOM 1592  C CZ   . PHE A 1 11 ? -13.324 -4.109  3.251   1.00 0.00 ? 11 PHE A CZ   2  
ATOM 1593  H H    . PHE A 1 11 ? -13.811 2.454   1.312   1.00 0.00 ? 11 PHE A H    2  
ATOM 1594  H HA   . PHE A 1 11 ? -12.054 0.561   2.452   1.00 0.00 ? 11 PHE A HA   2  
ATOM 1595  H HB2  . PHE A 1 11 ? -14.531 0.453   2.747   1.00 0.00 ? 11 PHE A HB2  2  
ATOM 1596  H HB3  . PHE A 1 11 ? -14.668 -0.104  1.077   1.00 0.00 ? 11 PHE A HB3  2  
ATOM 1597  H HD1  . PHE A 1 11 ? -13.215 -0.936  4.375   1.00 0.00 ? 11 PHE A HD1  2  
ATOM 1598  H HD2  . PHE A 1 11 ? -14.336 -2.382  0.531   1.00 0.00 ? 11 PHE A HD2  2  
ATOM 1599  H HE1  . PHE A 1 11 ? -12.790 -3.237  5.124   1.00 0.00 ? 11 PHE A HE1  2  
ATOM 1600  H HE2  . PHE A 1 11 ? -13.916 -4.692  1.277   1.00 0.00 ? 11 PHE A HE2  2  
ATOM 1601  H HZ   . PHE A 1 11 ? -13.131 -5.121  3.583   1.00 0.00 ? 11 PHE A HZ   2  
ATOM 1602  N N    . MET A 1 12 ? -12.637 0.154   -0.755  1.00 0.00 ? 12 MET A N    2  
ATOM 1603  C CA   . MET A 1 12 ? -12.085 -0.416  -1.975  1.00 0.00 ? 12 MET A CA   2  
ATOM 1604  C C    . MET A 1 12 ? -10.727 0.201   -2.256  1.00 0.00 ? 12 MET A C    2  
ATOM 1605  O O    . MET A 1 12 ? -9.817  -0.468  -2.749  1.00 0.00 ? 12 MET A O    2  
ATOM 1606  C CB   . MET A 1 12 ? -13.026 -0.194  -3.161  1.00 0.00 ? 12 MET A CB   2  
ATOM 1607  C CG   . MET A 1 12 ? -14.340 -0.958  -3.070  1.00 0.00 ? 12 MET A CG   2  
ATOM 1608  S SD   . MET A 1 12 ? -14.226 -2.670  -3.648  1.00 0.00 ? 12 MET A SD   2  
ATOM 1609  C CE   . MET A 1 12 ? -13.285 -3.462  -2.342  1.00 0.00 ? 12 MET A CE   2  
ATOM 1610  H H    . MET A 1 12 ? -13.437 0.716   -0.800  1.00 0.00 ? 12 MET A H    2  
ATOM 1611  H HA   . MET A 1 12 ? -11.958 -1.474  -1.815  1.00 0.00 ? 12 MET A HA   2  
ATOM 1612  H HB2  . MET A 1 12 ? -13.253 0.860   -3.233  1.00 0.00 ? 12 MET A HB2  2  
ATOM 1613  H HB3  . MET A 1 12 ? -12.521 -0.504  -4.064  1.00 0.00 ? 12 MET A HB3  2  
ATOM 1614  H HG2  . MET A 1 12 ? -14.661 -0.967  -2.039  1.00 0.00 ? 12 MET A HG2  2  
ATOM 1615  H HG3  . MET A 1 12 ? -15.079 -0.441  -3.665  1.00 0.00 ? 12 MET A HG3  2  
ATOM 1616  H HE1  . MET A 1 12 ? -12.262 -3.120  -2.379  1.00 0.00 ? 12 MET A HE1  2  
ATOM 1617  H HE2  . MET A 1 12 ? -13.308 -4.533  -2.482  1.00 0.00 ? 12 MET A HE2  2  
ATOM 1618  H HE3  . MET A 1 12 ? -13.716 -3.211  -1.384  1.00 0.00 ? 12 MET A HE3  2  
ATOM 1619  N N    . VAL A 1 13 ? -10.596 1.478   -1.911  1.00 0.00 ? 13 VAL A N    2  
ATOM 1620  C CA   . VAL A 1 13 ? -9.334  2.185   -2.050  1.00 0.00 ? 13 VAL A CA   2  
ATOM 1621  C C    . VAL A 1 13 ? -8.245  1.496   -1.263  1.00 0.00 ? 13 VAL A C    2  
ATOM 1622  O O    . VAL A 1 13 ? -7.137  1.354   -1.734  1.00 0.00 ? 13 VAL A O    2  
ATOM 1623  C CB   . VAL A 1 13 ? -9.416  3.643   -1.573  1.00 0.00 ? 13 VAL A CB   2  
ATOM 1624  C CG1  . VAL A 1 13 ? -8.047  4.286   -1.627  1.00 0.00 ? 13 VAL A CG1  2  
ATOM 1625  C CG2  . VAL A 1 13 ? -10.389 4.429   -2.418  1.00 0.00 ? 13 VAL A CG2  2  
ATOM 1626  H H    . VAL A 1 13 ? -11.371 1.956   -1.554  1.00 0.00 ? 13 VAL A H    2  
ATOM 1627  H HA   . VAL A 1 13 ? -9.064  2.183   -3.096  1.00 0.00 ? 13 VAL A HA   2  
ATOM 1628  H HB   . VAL A 1 13 ? -9.758  3.655   -0.542  1.00 0.00 ? 13 VAL A HB   2  
ATOM 1629  H HG11 . VAL A 1 13 ? -8.121  5.314   -1.302  1.00 0.00 ? 13 VAL A HG11 2  
ATOM 1630  H HG12 . VAL A 1 13 ? -7.676  4.255   -2.640  1.00 0.00 ? 13 VAL A HG12 2  
ATOM 1631  H HG13 . VAL A 1 13 ? -7.370  3.749   -0.977  1.00 0.00 ? 13 VAL A HG13 2  
ATOM 1632  H HG21 . VAL A 1 13 ? -11.369 3.975   -2.357  1.00 0.00 ? 13 VAL A HG21 2  
ATOM 1633  H HG22 . VAL A 1 13 ? -10.055 4.427   -3.444  1.00 0.00 ? 13 VAL A HG22 2  
ATOM 1634  H HG23 . VAL A 1 13 ? -10.441 5.446   -2.058  1.00 0.00 ? 13 VAL A HG23 2  
ATOM 1635  N N    . TRP A 1 14 ? -8.550  1.072   -0.058  1.00 0.00 ? 14 TRP A N    2  
ATOM 1636  C CA   . TRP A 1 14 ? -7.545  0.419   0.744   1.00 0.00 ? 14 TRP A CA   2  
ATOM 1637  C C    . TRP A 1 14 ? -7.238  -0.961  0.193   1.00 0.00 ? 14 TRP A C    2  
ATOM 1638  O O    . TRP A 1 14 ? -6.126  -1.446  0.314   1.00 0.00 ? 14 TRP A O    2  
ATOM 1639  C CB   . TRP A 1 14 ? -7.950  0.363   2.213   1.00 0.00 ? 14 TRP A CB   2  
ATOM 1640  C CG   . TRP A 1 14 ? -6.922  1.000   3.096   1.00 0.00 ? 14 TRP A CG   2  
ATOM 1641  C CD1  . TRP A 1 14 ? -6.129  2.067   2.779   1.00 0.00 ? 14 TRP A CD1  2  
ATOM 1642  C CD2  . TRP A 1 14 ? -6.575  0.624   4.431   1.00 0.00 ? 14 TRP A CD2  2  
ATOM 1643  N NE1  . TRP A 1 14 ? -5.302  2.368   3.832   1.00 0.00 ? 14 TRP A NE1  2  
ATOM 1644  C CE2  . TRP A 1 14 ? -5.556  1.501   4.858   1.00 0.00 ? 14 TRP A CE2  2  
ATOM 1645  C CE3  . TRP A 1 14 ? -7.022  -0.364  5.308   1.00 0.00 ? 14 TRP A CE3  2  
ATOM 1646  C CZ2  . TRP A 1 14 ? -4.983  1.415   6.120   1.00 0.00 ? 14 TRP A CZ2  2  
ATOM 1647  C CZ3  . TRP A 1 14 ? -6.450  -0.449  6.563   1.00 0.00 ? 14 TRP A CZ3  2  
ATOM 1648  C CH2  . TRP A 1 14 ? -5.440  0.437   6.958   1.00 0.00 ? 14 TRP A CH2  2  
ATOM 1649  H H    . TRP A 1 14 ? -9.455  1.211   0.301   1.00 0.00 ? 14 TRP A H    2  
ATOM 1650  H HA   . TRP A 1 14 ? -6.646  1.012   0.658   1.00 0.00 ? 14 TRP A HA   2  
ATOM 1651  H HB2  . TRP A 1 14 ? -8.887  0.886   2.347   1.00 0.00 ? 14 TRP A HB2  2  
ATOM 1652  H HB3  . TRP A 1 14 ? -8.066  -0.667  2.515   1.00 0.00 ? 14 TRP A HB3  2  
ATOM 1653  H HD1  . TRP A 1 14 ? -6.155  2.583   1.832   1.00 0.00 ? 14 TRP A HD1  2  
ATOM 1654  H HE1  . TRP A 1 14 ? -4.639  3.091   3.846   1.00 0.00 ? 14 TRP A HE1  2  
ATOM 1655  H HE3  . TRP A 1 14 ? -7.802  -1.055  5.019   1.00 0.00 ? 14 TRP A HE3  2  
ATOM 1656  H HZ2  . TRP A 1 14 ? -4.201  2.088   6.438   1.00 0.00 ? 14 TRP A HZ2  2  
ATOM 1657  H HZ3  . TRP A 1 14 ? -6.785  -1.207  7.257   1.00 0.00 ? 14 TRP A HZ3  2  
ATOM 1658  H HH2  . TRP A 1 14 ? -5.019  0.333   7.943   1.00 0.00 ? 14 TRP A HH2  2  
ATOM 1659  N N    . SER A 1 15 ? -8.199  -1.583  -0.459  1.00 0.00 ? 15 SER A N    2  
ATOM 1660  C CA   . SER A 1 15 ? -7.933  -2.873  -1.049  1.00 0.00 ? 15 SER A CA   2  
ATOM 1661  C C    . SER A 1 15 ? -6.949  -2.712  -2.212  1.00 0.00 ? 15 SER A C    2  
ATOM 1662  O O    . SER A 1 15 ? -5.826  -3.222  -2.176  1.00 0.00 ? 15 SER A O    2  
ATOM 1663  C CB   . SER A 1 15 ? -9.239  -3.505  -1.530  1.00 0.00 ? 15 SER A CB   2  
ATOM 1664  O OG   . SER A 1 15 ? -10.220 -3.491  -0.504  1.00 0.00 ? 15 SER A OG   2  
ATOM 1665  H H    . SER A 1 15 ? -9.084  -1.163  -0.561  1.00 0.00 ? 15 SER A H    2  
ATOM 1666  H HA   . SER A 1 15 ? -7.487  -3.504  -0.292  1.00 0.00 ? 15 SER A HA   2  
ATOM 1667  H HB2  . SER A 1 15 ? -9.614  -2.949  -2.375  1.00 0.00 ? 15 SER A HB2  2  
ATOM 1668  H HB3  . SER A 1 15 ? -9.054  -4.527  -1.825  1.00 0.00 ? 15 SER A HB3  2  
ATOM 1669  H HG   . SER A 1 15 ? -9.823  -3.185  0.319   1.00 0.00 ? 15 SER A HG   2  
ATOM 1670  N N    . ARG A 1 16 ? -7.344  -1.929  -3.204  1.00 0.00 ? 16 ARG A N    2  
ATOM 1671  C CA   . ARG A 1 16 ? -6.558  -1.783  -4.424  1.00 0.00 ? 16 ARG A CA   2  
ATOM 1672  C C    . ARG A 1 16 ? -5.387  -0.819  -4.224  1.00 0.00 ? 16 ARG A C    2  
ATOM 1673  O O    . ARG A 1 16 ? -4.262  -1.084  -4.653  1.00 0.00 ? 16 ARG A O    2  
ATOM 1674  C CB   . ARG A 1 16 ? -7.466  -1.303  -5.562  1.00 0.00 ? 16 ARG A CB   2  
ATOM 1675  C CG   . ARG A 1 16 ? -8.772  -2.084  -5.645  1.00 0.00 ? 16 ARG A CG   2  
ATOM 1676  C CD   . ARG A 1 16 ? -9.677  -1.599  -6.768  1.00 0.00 ? 16 ARG A CD   2  
ATOM 1677  N NE   . ARG A 1 16 ? -9.223  -2.048  -8.083  1.00 0.00 ? 16 ARG A NE   2  
ATOM 1678  C CZ   . ARG A 1 16 ? -9.904  -2.908  -8.847  1.00 0.00 ? 16 ARG A CZ   2  
ATOM 1679  N NH1  . ARG A 1 16 ? -11.023 -3.462  -8.392  1.00 0.00 ? 16 ARG A NH1  2  
ATOM 1680  N NH2  . ARG A 1 16 ? -9.454  -3.235  -10.053 1.00 0.00 ? 16 ARG A NH2  2  
ATOM 1681  H H    . ARG A 1 16 ? -8.183  -1.418  -3.107  1.00 0.00 ? 16 ARG A H    2  
ATOM 1682  H HA   . ARG A 1 16 ? -6.165  -2.756  -4.681  1.00 0.00 ? 16 ARG A HA   2  
ATOM 1683  H HB2  . ARG A 1 16 ? -7.700  -0.260  -5.405  1.00 0.00 ? 16 ARG A HB2  2  
ATOM 1684  H HB3  . ARG A 1 16 ? -6.942  -1.411  -6.500  1.00 0.00 ? 16 ARG A HB3  2  
ATOM 1685  H HG2  . ARG A 1 16 ? -8.543  -3.125  -5.813  1.00 0.00 ? 16 ARG A HG2  2  
ATOM 1686  H HG3  . ARG A 1 16 ? -9.297  -1.981  -4.706  1.00 0.00 ? 16 ARG A HG3  2  
ATOM 1687  H HD2  . ARG A 1 16 ? -10.675 -1.975  -6.597  1.00 0.00 ? 16 ARG A HD2  2  
ATOM 1688  H HD3  . ARG A 1 16 ? -9.694  -0.519  -6.754  1.00 0.00 ? 16 ARG A HD3  2  
ATOM 1689  H HE   . ARG A 1 16 ? -8.378  -1.680  -8.418  1.00 0.00 ? 16 ARG A HE   2  
ATOM 1690  H HH11 . ARG A 1 16 ? -11.361 -3.240  -7.477  1.00 0.00 ? 16 ARG A HH11 2  
ATOM 1691  H HH12 . ARG A 1 16 ? -11.533 -4.117  -8.962  1.00 0.00 ? 16 ARG A HH12 2  
ATOM 1692  H HH21 . ARG A 1 16 ? -8.604  -2.843  -10.398 1.00 0.00 ? 16 ARG A HH21 2  
ATOM 1693  H HH22 . ARG A 1 16 ? -9.977  -3.884  -10.629 1.00 0.00 ? 16 ARG A HH22 2  
ATOM 1694  N N    . GLY A 1 17 ? -5.660  0.278   -3.543  1.00 0.00 ? 17 GLY A N    2  
ATOM 1695  C CA   . GLY A 1 17 ? -4.694  1.347   -3.396  1.00 0.00 ? 17 GLY A CA   2  
ATOM 1696  C C    . GLY A 1 17 ? -3.680  1.087   -2.305  1.00 0.00 ? 17 GLY A C    2  
ATOM 1697  O O    . GLY A 1 17 ? -2.504  1.409   -2.467  1.00 0.00 ? 17 GLY A O    2  
ATOM 1698  H H    . GLY A 1 17 ? -6.533  0.365   -3.099  1.00 0.00 ? 17 GLY A H    2  
ATOM 1699  H HA2  . GLY A 1 17 ? -4.171  1.474   -4.334  1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1700  H HA3  . GLY A 1 17 ? -5.223  2.262   -3.167  1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1701  N N    . GLN A 1 18 ? -4.108  0.498   -1.187  1.00 0.00 ? 18 GLN A N    2  
ATOM 1702  C CA   . GLN A 1 18 ? -3.159  0.189   -0.132  1.00 0.00 ? 18 GLN A CA   2  
ATOM 1703  C C    . GLN A 1 18 ? -2.269  -0.943  -0.613  1.00 0.00 ? 18 GLN A C    2  
ATOM 1704  O O    . GLN A 1 18 ? -1.084  -0.953  -0.326  1.00 0.00 ? 18 GLN A O    2  
ATOM 1705  C CB   . GLN A 1 18 ? -3.856  -0.165  1.188   1.00 0.00 ? 18 GLN A CB   2  
ATOM 1706  C CG   . GLN A 1 18 ? -3.077  0.208   2.449   1.00 0.00 ? 18 GLN A CG   2  
ATOM 1707  C CD   . GLN A 1 18 ? -1.827  -0.621  2.665   1.00 0.00 ? 18 GLN A CD   2  
ATOM 1708  O OE1  . GLN A 1 18 ? -1.761  -1.782  2.276   1.00 0.00 ? 18 GLN A OE1  2  
ATOM 1709  N NE2  . GLN A 1 18 ? -0.833  -0.036  3.311   1.00 0.00 ? 18 GLN A NE2  2  
ATOM 1710  H H    . GLN A 1 18 ? -5.058  0.269   -1.075  1.00 0.00 ? 18 GLN A H    2  
ATOM 1711  H HA   . GLN A 1 18 ? -2.545  1.067   0.019   1.00 0.00 ? 18 GLN A HA   2  
ATOM 1712  H HB2  . GLN A 1 18 ? -4.804  0.346   1.224   1.00 0.00 ? 18 GLN A HB2  2  
ATOM 1713  H HB3  . GLN A 1 18 ? -4.035  -1.231  1.210   1.00 0.00 ? 18 GLN A HB3  2  
ATOM 1714  H HG2  . GLN A 1 18 ? -2.791  1.245   2.386   1.00 0.00 ? 18 GLN A HG2  2  
ATOM 1715  H HG3  . GLN A 1 18 ? -3.726  0.074   3.304   1.00 0.00 ? 18 GLN A HG3  2  
ATOM 1716  H HE21 . GLN A 1 18 ? -0.956  0.887   3.614   1.00 0.00 ? 18 GLN A HE21 2  
ATOM 1717  H HE22 . GLN A 1 18 ? -0.012  -0.550  3.459   1.00 0.00 ? 18 GLN A HE22 2  
ATOM 1718  N N    . ARG A 1 19 ? -2.823  -1.880  -1.392  1.00 0.00 ? 19 ARG A N    2  
ATOM 1719  C CA   . ARG A 1 19 ? -1.979  -2.878  -2.040  1.00 0.00 ? 19 ARG A CA   2  
ATOM 1720  C C    . ARG A 1 19 ? -0.953  -2.204  -2.949  1.00 0.00 ? 19 ARG A C    2  
ATOM 1721  O O    . ARG A 1 19 ? 0.168   -2.686  -3.089  1.00 0.00 ? 19 ARG A O    2  
ATOM 1722  C CB   . ARG A 1 19 ? -2.805  -3.893  -2.837  1.00 0.00 ? 19 ARG A CB   2  
ATOM 1723  C CG   . ARG A 1 19 ? -3.345  -5.037  -1.992  1.00 0.00 ? 19 ARG A CG   2  
ATOM 1724  C CD   . ARG A 1 19 ? -4.028  -6.096  -2.846  1.00 0.00 ? 19 ARG A CD   2  
ATOM 1725  N NE   . ARG A 1 19 ? -5.266  -5.603  -3.450  1.00 0.00 ? 19 ARG A NE   2  
ATOM 1726  C CZ   . ARG A 1 19 ? -5.859  -6.163  -4.507  1.00 0.00 ? 19 ARG A CZ   2  
ATOM 1727  N NH1  . ARG A 1 19 ? -5.302  -7.207  -5.113  1.00 0.00 ? 19 ARG A NH1  2  
ATOM 1728  N NH2  . ARG A 1 19 ? -7.007  -5.672  -4.961  1.00 0.00 ? 19 ARG A NH2  2  
ATOM 1729  H H    . ARG A 1 19 ? -3.802  -1.908  -1.516  1.00 0.00 ? 19 ARG A H    2  
ATOM 1730  H HA   . ARG A 1 19 ? -1.445  -3.401  -1.261  1.00 0.00 ? 19 ARG A HA   2  
ATOM 1731  H HB2  . ARG A 1 19 ? -3.643  -3.381  -3.289  1.00 0.00 ? 19 ARG A HB2  2  
ATOM 1732  H HB3  . ARG A 1 19 ? -2.188  -4.311  -3.617  1.00 0.00 ? 19 ARG A HB3  2  
ATOM 1733  H HG2  . ARG A 1 19 ? -2.528  -5.493  -1.455  1.00 0.00 ? 19 ARG A HG2  2  
ATOM 1734  H HG3  . ARG A 1 19 ? -4.062  -4.640  -1.287  1.00 0.00 ? 19 ARG A HG3  2  
ATOM 1735  H HD2  . ARG A 1 19 ? -3.352  -6.397  -3.633  1.00 0.00 ? 19 ARG A HD2  2  
ATOM 1736  H HD3  . ARG A 1 19 ? -4.258  -6.949  -2.224  1.00 0.00 ? 19 ARG A HD3  2  
ATOM 1737  H HE   . ARG A 1 19 ? -5.683  -4.813  -3.029  1.00 0.00 ? 19 ARG A HE   2  
ATOM 1738  H HH11 . ARG A 1 19 ? -4.435  -7.579  -4.780  1.00 0.00 ? 19 ARG A HH11 2  
ATOM 1739  H HH12 . ARG A 1 19 ? -5.745  -7.625  -5.918  1.00 0.00 ? 19 ARG A HH12 2  
ATOM 1740  H HH21 . ARG A 1 19 ? -7.435  -4.887  -4.516  1.00 0.00 ? 19 ARG A HH21 2  
ATOM 1741  H HH22 . ARG A 1 19 ? -7.456  -6.093  -5.766  1.00 0.00 ? 19 ARG A HH22 2  
ATOM 1742  N N    . ARG A 1 20 ? -1.334  -1.078  -3.551  1.00 0.00 ? 20 ARG A N    2  
ATOM 1743  C CA   . ARG A 1 20 ? -0.413  -0.321  -4.389  1.00 0.00 ? 20 ARG A CA   2  
ATOM 1744  C C    . ARG A 1 20 ? 0.722   0.289   -3.559  1.00 0.00 ? 20 ARG A C    2  
ATOM 1745  O O    . ARG A 1 20 ? 1.894   -0.014  -3.814  1.00 0.00 ? 20 ARG A O    2  
ATOM 1746  C CB   . ARG A 1 20 ? -1.168  0.758   -5.181  1.00 0.00 ? 20 ARG A CB   2  
ATOM 1747  C CG   . ARG A 1 20 ? -0.275  1.762   -5.905  1.00 0.00 ? 20 ARG A CG   2  
ATOM 1748  C CD   . ARG A 1 20 ? 0.867   1.093   -6.657  1.00 0.00 ? 20 ARG A CD   2  
ATOM 1749  N NE   . ARG A 1 20 ? 0.414   0.049   -7.579  1.00 0.00 ? 20 ARG A NE   2  
ATOM 1750  C CZ   . ARG A 1 20 ? 0.973   -1.159  -7.655  1.00 0.00 ? 20 ARG A CZ   2  
ATOM 1751  N NH1  . ARG A 1 20 ? 1.932   -1.501  -6.802  1.00 0.00 ? 20 ARG A NH1  2  
ATOM 1752  N NH2  . ARG A 1 20 ? 0.560   -2.031  -8.566  1.00 0.00 ? 20 ARG A NH2  2  
ATOM 1753  H H    . ARG A 1 20 ? -2.255  -0.755  -3.433  1.00 0.00 ? 20 ARG A H    2  
ATOM 1754  H HA   . ARG A 1 20 ? 0.022   -1.017  -5.090  1.00 0.00 ? 20 ARG A HA   2  
ATOM 1755  H HB2  . ARG A 1 20 ? -1.789  0.272   -5.918  1.00 0.00 ? 20 ARG A HB2  2  
ATOM 1756  H HB3  . ARG A 1 20 ? -1.804  1.304   -4.498  1.00 0.00 ? 20 ARG A HB3  2  
ATOM 1757  H HG2  . ARG A 1 20 ? -0.874  2.315   -6.611  1.00 0.00 ? 20 ARG A HG2  2  
ATOM 1758  H HG3  . ARG A 1 20 ? 0.140   2.445   -5.176  1.00 0.00 ? 20 ARG A HG3  2  
ATOM 1759  H HD2  . ARG A 1 20 ? 1.395   1.847   -7.223  1.00 0.00 ? 20 ARG A HD2  2  
ATOM 1760  H HD3  . ARG A 1 20 ? 1.542   0.654   -5.936  1.00 0.00 ? 20 ARG A HD3  2  
ATOM 1761  H HE   . ARG A 1 20 ? -0.319  0.272   -8.190  1.00 0.00 ? 20 ARG A HE   2  
ATOM 1762  H HH11 . ARG A 1 20 ? 2.232   -0.855  -6.101  1.00 0.00 ? 20 ARG A HH11 2  
ATOM 1763  H HH12 . ARG A 1 20 ? 2.367   -2.412  -6.862  1.00 0.00 ? 20 ARG A HH12 2  
ATOM 1764  H HH21 . ARG A 1 20 ? -0.170  -1.787  -9.206  1.00 0.00 ? 20 ARG A HH21 2  
ATOM 1765  H HH22 . ARG A 1 20 ? 0.973   -2.951  -8.615  1.00 0.00 ? 20 ARG A HH22 2  
ATOM 1766  N N    . LYS A 1 21 ? 0.397   1.137   -2.575  1.00 0.00 ? 21 LYS A N    2  
ATOM 1767  C CA   . LYS A 1 21 ? 1.438   1.684   -1.696  1.00 0.00 ? 21 LYS A CA   2  
ATOM 1768  C C    . LYS A 1 21 ? 2.236   0.562   -1.006  1.00 0.00 ? 21 LYS A C    2  
ATOM 1769  O O    . LYS A 1 21 ? 3.462   0.585   -1.009  1.00 0.00 ? 21 LYS A O    2  
ATOM 1770  C CB   . LYS A 1 21 ? 0.837   2.651   -0.661  1.00 0.00 ? 21 LYS A CB   2  
ATOM 1771  C CG   . LYS A 1 21 ? -0.146  2.012   0.307   1.00 0.00 ? 21 LYS A CG   2  
ATOM 1772  C CD   . LYS A 1 21 ? -0.759  3.028   1.264   1.00 0.00 ? 21 LYS A CD   2  
ATOM 1773  C CE   . LYS A 1 21 ? 0.202   3.469   2.365   1.00 0.00 ? 21 LYS A CE   2  
ATOM 1774  N NZ   . LYS A 1 21 ? 1.371   4.226   1.847   1.00 0.00 ? 21 LYS A NZ   2  
ATOM 1775  H H    . LYS A 1 21 ? -0.547  1.444   -2.470  1.00 0.00 ? 21 LYS A H    2  
ATOM 1776  H HA   . LYS A 1 21 ? 2.120   2.239   -2.324  1.00 0.00 ? 21 LYS A HA   2  
ATOM 1777  H HB2  . LYS A 1 21 ? 1.642   3.080   -0.083  1.00 0.00 ? 21 LYS A HB2  2  
ATOM 1778  H HB3  . LYS A 1 21 ? 0.324   3.443   -1.185  1.00 0.00 ? 21 LYS A HB3  2  
ATOM 1779  H HG2  . LYS A 1 21 ? -0.938  1.548   -0.260  1.00 0.00 ? 21 LYS A HG2  2  
ATOM 1780  H HG3  . LYS A 1 21 ? 0.372   1.260   0.883   1.00 0.00 ? 21 LYS A HG3  2  
ATOM 1781  H HD2  . LYS A 1 21 ? -1.053  3.899   0.699   1.00 0.00 ? 21 LYS A HD2  2  
ATOM 1782  H HD3  . LYS A 1 21 ? -1.634  2.587   1.721   1.00 0.00 ? 21 LYS A HD3  2  
ATOM 1783  H HE2  . LYS A 1 21 ? -0.335  4.099   3.059   1.00 0.00 ? 21 LYS A HE2  2  
ATOM 1784  H HE3  . LYS A 1 21 ? 0.555   2.590   2.885   1.00 0.00 ? 21 LYS A HE3  2  
ATOM 1785  H HZ1  . LYS A 1 21 ? 1.894   4.659   2.638   1.00 0.00 ? 21 LYS A HZ1  2  
ATOM 1786  H HZ2  . LYS A 1 21 ? 1.057   4.981   1.197   1.00 0.00 ? 21 LYS A HZ2  2  
ATOM 1787  H HZ3  . LYS A 1 21 ? 2.017   3.584   1.337   1.00 0.00 ? 21 LYS A HZ3  2  
ATOM 1788  N N    . MET A 1 22 ? 1.537   -0.435  -0.465  1.00 0.00 ? 22 MET A N    2  
ATOM 1789  C CA   . MET A 1 22 ? 2.171   -1.546  0.255   1.00 0.00 ? 22 MET A CA   2  
ATOM 1790  C C    . MET A 1 22 ? 3.228   -2.238  -0.601  1.00 0.00 ? 22 MET A C    2  
ATOM 1791  O O    . MET A 1 22 ? 4.351   -2.448  -0.154  1.00 0.00 ? 22 MET A O    2  
ATOM 1792  C CB   . MET A 1 22 ? 1.117   -2.577  0.681   1.00 0.00 ? 22 MET A CB   2  
ATOM 1793  C CG   . MET A 1 22 ? 1.683   -3.764  1.449   1.00 0.00 ? 22 MET A CG   2  
ATOM 1794  S SD   . MET A 1 22 ? 2.091   -3.374  3.164   1.00 0.00 ? 22 MET A SD   2  
ATOM 1795  C CE   . MET A 1 22 ? 0.460   -3.322  3.907   1.00 0.00 ? 22 MET A CE   2  
ATOM 1796  H H    . MET A 1 22 ? 0.560   -0.425  -0.546  1.00 0.00 ? 22 MET A H    2  
ATOM 1797  H HA   . MET A 1 22 ? 2.645   -1.143  1.140   1.00 0.00 ? 22 MET A HA   2  
ATOM 1798  H HB2  . MET A 1 22 ? 0.387   -2.088  1.309   1.00 0.00 ? 22 MET A HB2  2  
ATOM 1799  H HB3  . MET A 1 22 ? 0.624   -2.951  -0.203  1.00 0.00 ? 22 MET A HB3  2  
ATOM 1800  H HG2  . MET A 1 22 ? 0.952   -4.558  1.442   1.00 0.00 ? 22 MET A HG2  2  
ATOM 1801  H HG3  . MET A 1 22 ? 2.580   -4.102  0.950   1.00 0.00 ? 22 MET A HG3  2  
ATOM 1802  H HE1  . MET A 1 22 ? 0.550   -3.068  4.954   1.00 0.00 ? 22 MET A HE1  2  
ATOM 1803  H HE2  . MET A 1 22 ? -0.013  -4.288  3.810   1.00 0.00 ? 22 MET A HE2  2  
ATOM 1804  H HE3  . MET A 1 22 ? -0.141  -2.575  3.406   1.00 0.00 ? 22 MET A HE3  2  
ATOM 1805  N N    . ALA A 1 23 ? 2.869   -2.582  -1.833  1.00 0.00 ? 23 ALA A N    2  
ATOM 1806  C CA   . ALA A 1 23 ? 3.769   -3.318  -2.714  1.00 0.00 ? 23 ALA A CA   2  
ATOM 1807  C C    . ALA A 1 23 ? 4.985   -2.481  -3.110  1.00 0.00 ? 23 ALA A C    2  
ATOM 1808  O O    . ALA A 1 23 ? 6.058   -3.019  -3.384  1.00 0.00 ? 23 ALA A O    2  
ATOM 1809  C CB   . ALA A 1 23 ? 3.030   -3.789  -3.955  1.00 0.00 ? 23 ALA A CB   2  
ATOM 1810  H H    . ALA A 1 23 ? 1.969   -2.342  -2.156  1.00 0.00 ? 23 ALA A H    2  
ATOM 1811  H HA   . ALA A 1 23 ? 4.111   -4.193  -2.178  1.00 0.00 ? 23 ALA A HA   2  
ATOM 1812  H HB1  . ALA A 1 23 ? 3.696   -4.376  -4.571  1.00 0.00 ? 23 ALA A HB1  2  
ATOM 1813  H HB2  . ALA A 1 23 ? 2.682   -2.933  -4.514  1.00 0.00 ? 23 ALA A HB2  2  
ATOM 1814  H HB3  . ALA A 1 23 ? 2.184   -4.395  -3.663  1.00 0.00 ? 23 ALA A HB3  2  
ATOM 1815  N N    . GLN A 1 24 ? 4.819   -1.167  -3.147  1.00 0.00 ? 24 GLN A N    2  
ATOM 1816  C CA   . GLN A 1 24 ? 5.920   -0.280  -3.503  1.00 0.00 ? 24 GLN A CA   2  
ATOM 1817  C C    . GLN A 1 24 ? 6.804   0.012   -2.292  1.00 0.00 ? 24 GLN A C    2  
ATOM 1818  O O    . GLN A 1 24 ? 7.974   0.371   -2.435  1.00 0.00 ? 24 GLN A O    2  
ATOM 1819  C CB   . GLN A 1 24 ? 5.381   1.024   -4.093  1.00 0.00 ? 24 GLN A CB   2  
ATOM 1820  C CG   . GLN A 1 24 ? 4.625   0.836   -5.401  1.00 0.00 ? 24 GLN A CG   2  
ATOM 1821  C CD   . GLN A 1 24 ? 5.497   0.286   -6.513  1.00 0.00 ? 24 GLN A CD   2  
ATOM 1822  O OE1  . GLN A 1 24 ? 6.110   1.040   -7.269  1.00 0.00 ? 24 GLN A OE1  2  
ATOM 1823  N NE2  . GLN A 1 24 ? 5.554   -1.032  -6.628  1.00 0.00 ? 24 GLN A NE2  2  
ATOM 1824  H H    . GLN A 1 24 ? 3.936   -0.786  -2.931  1.00 0.00 ? 24 GLN A H    2  
ATOM 1825  H HA   . GLN A 1 24 ? 6.515   -0.781  -4.250  1.00 0.00 ? 24 GLN A HA   2  
ATOM 1826  H HB2  . GLN A 1 24 ? 4.711   1.479   -3.379  1.00 0.00 ? 24 GLN A HB2  2  
ATOM 1827  H HB3  . GLN A 1 24 ? 6.208   1.695   -4.274  1.00 0.00 ? 24 GLN A HB3  2  
ATOM 1828  H HG2  . GLN A 1 24 ? 3.808   0.149   -5.233  1.00 0.00 ? 24 GLN A HG2  2  
ATOM 1829  H HG3  . GLN A 1 24 ? 4.229   1.792   -5.713  1.00 0.00 ? 24 GLN A HG3  2  
ATOM 1830  H HE21 . GLN A 1 24 ? 5.034   -1.576  -6.002  1.00 0.00 ? 24 GLN A HE21 2  
ATOM 1831  H HE22 . GLN A 1 24 ? 6.128   -1.413  -7.332  1.00 0.00 ? 24 GLN A HE22 2  
ATOM 1832  N N    . GLU A 1 25 ? 6.243   -0.154  -1.105  1.00 0.00 ? 25 GLU A N    2  
ATOM 1833  C CA   . GLU A 1 25 ? 6.962   0.143   0.127   1.00 0.00 ? 25 GLU A CA   2  
ATOM 1834  C C    . GLU A 1 25 ? 7.584   -1.115  0.732   1.00 0.00 ? 25 GLU A C    2  
ATOM 1835  O O    . GLU A 1 25 ? 8.765   -1.125  1.082   1.00 0.00 ? 25 GLU A O    2  
ATOM 1836  C CB   . GLU A 1 25 ? 6.023   0.811   1.132   1.00 0.00 ? 25 GLU A CB   2  
ATOM 1837  C CG   . GLU A 1 25 ? 5.513   2.160   0.657   1.00 0.00 ? 25 GLU A CG   2  
ATOM 1838  C CD   . GLU A 1 25 ? 4.559   2.808   1.635   1.00 0.00 ? 25 GLU A CD   2  
ATOM 1839  O OE1  . GLU A 1 25 ? 3.352   2.506   1.589   1.00 0.00 ? 25 GLU A OE1  2  
ATOM 1840  O OE2  . GLU A 1 25 ? 5.010   3.647   2.443   1.00 0.00 ? 25 GLU A OE2  2  
ATOM 1841  H H    . GLU A 1 25 ? 5.315   -0.472  -1.055  1.00 0.00 ? 25 GLU A H    2  
ATOM 1842  H HA   . GLU A 1 25 ? 7.755   0.834   -0.119  1.00 0.00 ? 25 GLU A HA   2  
ATOM 1843  H HB2  . GLU A 1 25 ? 5.171   0.165   1.301   1.00 0.00 ? 25 GLU A HB2  2  
ATOM 1844  H HB3  . GLU A 1 25 ? 6.550   0.955   2.063   1.00 0.00 ? 25 GLU A HB3  2  
ATOM 1845  H HG2  . GLU A 1 25 ? 6.356   2.817   0.514   1.00 0.00 ? 25 GLU A HG2  2  
ATOM 1846  H HG3  . GLU A 1 25 ? 5.002   2.023   -0.285  1.00 0.00 ? 25 GLU A HG3  2  
ATOM 1847  N N    . ASN A 1 26 ? 6.790   -2.172  0.847   1.00 0.00 ? 26 ASN A N    2  
ATOM 1848  C CA   . ASN A 1 26 ? 7.241   -3.424  1.452   1.00 0.00 ? 26 ASN A CA   2  
ATOM 1849  C C    . ASN A 1 26 ? 6.285   -4.571  1.115   1.00 0.00 ? 26 ASN A C    2  
ATOM 1850  O O    . ASN A 1 26 ? 5.387   -4.902  1.890   1.00 0.00 ? 26 ASN A O    2  
ATOM 1851  C CB   . ASN A 1 26 ? 7.408   -3.271  2.981   1.00 0.00 ? 26 ASN A CB   2  
ATOM 1852  C CG   . ASN A 1 26 ? 6.301   -2.459  3.656   1.00 0.00 ? 26 ASN A CG   2  
ATOM 1853  O OD1  . ASN A 1 26 ? 6.565   -1.704  4.594   1.00 0.00 ? 26 ASN A OD1  2  
ATOM 1854  N ND2  . ASN A 1 26 ? 5.064   -2.626  3.219   1.00 0.00 ? 26 ASN A ND2  2  
ATOM 1855  H H    . ASN A 1 26 ? 5.865   -2.112  0.508   1.00 0.00 ? 26 ASN A H    2  
ATOM 1856  H HA   . ASN A 1 26 ? 8.206   -3.657  1.024   1.00 0.00 ? 26 ASN A HA   2  
ATOM 1857  H HB2  . ASN A 1 26 ? 7.422   -4.253  3.429   1.00 0.00 ? 26 ASN A HB2  2  
ATOM 1858  H HB3  . ASN A 1 26 ? 8.352   -2.783  3.178   1.00 0.00 ? 26 ASN A HB3  2  
ATOM 1859  H HD21 . ASN A 1 26 ? 4.912   -3.269  2.490   1.00 0.00 ? 26 ASN A HD21 2  
ATOM 1860  H HD22 . ASN A 1 26 ? 4.344   -2.106  3.638   1.00 0.00 ? 26 ASN A HD22 2  
ATOM 1861  N N    . PRO A 1 27 ? 6.460   -5.185  -0.063  1.00 0.00 ? 27 PRO A N    2  
ATOM 1862  C CA   . PRO A 1 27 ? 5.559   -6.233  -0.550  1.00 0.00 ? 27 PRO A CA   2  
ATOM 1863  C C    . PRO A 1 27 ? 5.831   -7.602  0.079   1.00 0.00 ? 27 PRO A C    2  
ATOM 1864  O O    . PRO A 1 27 ? 6.191   -8.557  -0.617  1.00 0.00 ? 27 PRO A O    2  
ATOM 1865  C CB   . PRO A 1 27 ? 5.860   -6.265  -2.045  1.00 0.00 ? 27 PRO A CB   2  
ATOM 1866  C CG   . PRO A 1 27 ? 7.291   -5.867  -2.150  1.00 0.00 ? 27 PRO A CG   2  
ATOM 1867  C CD   . PRO A 1 27 ? 7.550   -4.905  -1.019  1.00 0.00 ? 27 PRO A CD   2  
ATOM 1868  H HA   . PRO A 1 27 ? 4.522   -5.967  -0.396  1.00 0.00 ? 27 PRO A HA   2  
ATOM 1869  H HB2  . PRO A 1 27 ? 5.697   -7.264  -2.425  1.00 0.00 ? 27 PRO A HB2  2  
ATOM 1870  H HB3  . PRO A 1 27 ? 5.218   -5.567  -2.561  1.00 0.00 ? 27 PRO A HB3  2  
ATOM 1871  H HG2  . PRO A 1 27 ? 7.922   -6.739  -2.050  1.00 0.00 ? 27 PRO A HG2  2  
ATOM 1872  H HG3  . PRO A 1 27 ? 7.468   -5.383  -3.098  1.00 0.00 ? 27 PRO A HG3  2  
ATOM 1873  H HD2  . PRO A 1 27 ? 8.512   -5.102  -0.571  1.00 0.00 ? 27 PRO A HD2  2  
ATOM 1874  H HD3  . PRO A 1 27 ? 7.500   -3.885  -1.374  1.00 0.00 ? 27 PRO A HD3  2  
ATOM 1875  N N    . LYS A 1 28 ? 5.649   -7.696  1.389   1.00 0.00 ? 28 LYS A N    2  
ATOM 1876  C CA   . LYS A 1 28 ? 5.769   -8.968  2.093   1.00 0.00 ? 28 LYS A CA   2  
ATOM 1877  C C    . LYS A 1 28 ? 4.390   -9.543  2.397   1.00 0.00 ? 28 LYS A C    2  
ATOM 1878  O O    . LYS A 1 28 ? 4.218   -10.756 2.517   1.00 0.00 ? 28 LYS A O    2  
ATOM 1879  C CB   . LYS A 1 28 ? 6.569   -8.802  3.390   1.00 0.00 ? 28 LYS A CB   2  
ATOM 1880  C CG   . LYS A 1 28 ? 8.073   -8.945  3.213   1.00 0.00 ? 28 LYS A CG   2  
ATOM 1881  C CD   . LYS A 1 28 ? 8.441   -10.334 2.714   1.00 0.00 ? 28 LYS A CD   2  
ATOM 1882  C CE   . LYS A 1 28 ? 9.919   -10.637 2.909   1.00 0.00 ? 28 LYS A CE   2  
ATOM 1883  N NZ   . LYS A 1 28 ? 10.799  -9.717  2.142   1.00 0.00 ? 28 LYS A NZ   2  
ATOM 1884  H H    . LYS A 1 28 ? 5.434   -6.883  1.898   1.00 0.00 ? 28 LYS A H    2  
ATOM 1885  H HA   . LYS A 1 28 ? 6.294   -9.654  1.445   1.00 0.00 ? 28 LYS A HA   2  
ATOM 1886  H HB2  . LYS A 1 28 ? 6.372   -7.821  3.797   1.00 0.00 ? 28 LYS A HB2  2  
ATOM 1887  H HB3  . LYS A 1 28 ? 6.241   -9.547  4.100   1.00 0.00 ? 28 LYS A HB3  2  
ATOM 1888  H HG2  . LYS A 1 28 ? 8.414   -8.213  2.496   1.00 0.00 ? 28 LYS A HG2  2  
ATOM 1889  H HG3  . LYS A 1 28 ? 8.557   -8.774  4.164   1.00 0.00 ? 28 LYS A HG3  2  
ATOM 1890  H HD2  . LYS A 1 28 ? 7.861   -11.066 3.255   1.00 0.00 ? 28 LYS A HD2  2  
ATOM 1891  H HD3  . LYS A 1 28 ? 8.208   -10.397 1.660   1.00 0.00 ? 28 LYS A HD3  2  
ATOM 1892  H HE2  . LYS A 1 28 ? 10.153  -10.548 3.959   1.00 0.00 ? 28 LYS A HE2  2  
ATOM 1893  H HE3  . LYS A 1 28 ? 10.107  -11.651 2.587   1.00 0.00 ? 28 LYS A HE3  2  
ATOM 1894  H HZ1  . LYS A 1 28 ? 11.800  -9.957  2.316   1.00 0.00 ? 28 LYS A HZ1  2  
ATOM 1895  H HZ2  . LYS A 1 28 ? 10.635  -8.727  2.433   1.00 0.00 ? 28 LYS A HZ2  2  
ATOM 1896  H HZ3  . LYS A 1 28 ? 10.610  -9.802  1.119   1.00 0.00 ? 28 LYS A HZ3  2  
ATOM 1897  N N    . MET A 1 29 ? 3.404   -8.664  2.519   1.00 0.00 ? 29 MET A N    2  
ATOM 1898  C CA   . MET A 1 29 ? 2.034   -9.080  2.777   1.00 0.00 ? 29 MET A CA   2  
ATOM 1899  C C    . MET A 1 29 ? 1.377   -9.519  1.474   1.00 0.00 ? 29 MET A C    2  
ATOM 1900  O O    . MET A 1 29 ? 1.382   -8.783  0.489   1.00 0.00 ? 29 MET A O    2  
ATOM 1901  C CB   . MET A 1 29 ? 1.231   -7.939  3.417   1.00 0.00 ? 29 MET A CB   2  
ATOM 1902  C CG   . MET A 1 29 ? 1.782   -7.453  4.754   1.00 0.00 ? 29 MET A CG   2  
ATOM 1903  S SD   . MET A 1 29 ? 3.365   -6.596  4.595   1.00 0.00 ? 29 MET A SD   2  
ATOM 1904  C CE   . MET A 1 29 ? 3.682   -6.145  6.298   1.00 0.00 ? 29 MET A CE   2  
ATOM 1905  H H    . MET A 1 29 ? 3.606   -7.708  2.440   1.00 0.00 ? 29 MET A H    2  
ATOM 1906  H HA   . MET A 1 29 ? 2.063   -9.920  3.456   1.00 0.00 ? 29 MET A HA   2  
ATOM 1907  H HB2  . MET A 1 29 ? 1.215   -7.101  2.736   1.00 0.00 ? 29 MET A HB2  2  
ATOM 1908  H HB3  . MET A 1 29 ? 0.217   -8.277  3.575   1.00 0.00 ? 29 MET A HB3  2  
ATOM 1909  H HG2  . MET A 1 29 ? 1.068   -6.776  5.197   1.00 0.00 ? 29 MET A HG2  2  
ATOM 1910  H HG3  . MET A 1 29 ? 1.913   -8.307  5.403   1.00 0.00 ? 29 MET A HG3  2  
ATOM 1911  H HE1  . MET A 1 29 ? 3.724   -7.037  6.905   1.00 0.00 ? 29 MET A HE1  2  
ATOM 1912  H HE2  . MET A 1 29 ? 2.887   -5.505  6.653   1.00 0.00 ? 29 MET A HE2  2  
ATOM 1913  H HE3  . MET A 1 29 ? 4.624   -5.620  6.364   1.00 0.00 ? 29 MET A HE3  2  
ATOM 1914  N N    . HIS A 1 30 ? 0.823   -10.723 1.459   1.00 0.00 ? 30 HIS A N    2  
ATOM 1915  C CA   . HIS A 1 30 ? 0.259   -11.273 0.233   1.00 0.00 ? 30 HIS A CA   2  
ATOM 1916  C C    . HIS A 1 30 ? -1.230  -11.578 0.377   1.00 0.00 ? 30 HIS A C    2  
ATOM 1917  O O    . HIS A 1 30 ? -1.631  -12.339 1.255   1.00 0.00 ? 30 HIS A O    2  
ATOM 1918  C CB   . HIS A 1 30 ? 1.010   -12.540 -0.186  1.00 0.00 ? 30 HIS A CB   2  
ATOM 1919  C CG   . HIS A 1 30 ? 2.430   -12.296 -0.596  1.00 0.00 ? 30 HIS A CG   2  
ATOM 1920  N ND1  . HIS A 1 30 ? 2.783   -11.792 -1.829  1.00 0.00 ? 30 HIS A ND1  2  
ATOM 1921  C CD2  . HIS A 1 30 ? 3.592   -12.492 0.072   1.00 0.00 ? 30 HIS A CD2  2  
ATOM 1922  C CE1  . HIS A 1 30 ? 4.097   -11.683 -1.897  1.00 0.00 ? 30 HIS A CE1  2  
ATOM 1923  N NE2  . HIS A 1 30 ? 4.610   -12.102 -0.758  1.00 0.00 ? 30 HIS A NE2  2  
ATOM 1924  H H    . HIS A 1 30 ? 0.793   -11.250 2.285   1.00 0.00 ? 30 HIS A H    2  
ATOM 1925  H HA   . HIS A 1 30 ? 0.381   -10.529 -0.540  1.00 0.00 ? 30 HIS A HA   2  
ATOM 1926  H HB2  . HIS A 1 30 ? 1.019   -13.233 0.641   1.00 0.00 ? 30 HIS A HB2  2  
ATOM 1927  H HB3  . HIS A 1 30 ? 0.496   -12.993 -1.021  1.00 0.00 ? 30 HIS A HB3  2  
ATOM 1928  H HD1  . HIS A 1 30 ? 2.159   -11.546 -2.556  1.00 0.00 ? 30 HIS A HD1  2  
ATOM 1929  H HD2  . HIS A 1 30 ? 3.696   -12.881 1.075   1.00 0.00 ? 30 HIS A HD2  2  
ATOM 1930  H HE1  . HIS A 1 30 ? 4.657   -11.317 -2.746  1.00 0.00 ? 30 HIS A HE1  2  
ATOM 1931  H HE2  . HIS A 1 30 ? 5.575   -12.258 -0.593  1.00 0.00 ? 30 HIS A HE2  2  
ATOM 1932  N N    . ASN A 1 31 ? -2.021  -10.939 -0.488  1.00 0.00 ? 31 ASN A N    2  
ATOM 1933  C CA   . ASN A 1 31 ? -3.470  -11.181 -0.643  1.00 0.00 ? 31 ASN A CA   2  
ATOM 1934  C C    . ASN A 1 31 ? -4.242  -11.276 0.678   1.00 0.00 ? 31 ASN A C    2  
ATOM 1935  O O    . ASN A 1 31 ? -4.742  -10.267 1.183   1.00 0.00 ? 31 ASN A O    2  
ATOM 1936  C CB   . ASN A 1 31 ? -3.724  -12.445 -1.474  1.00 0.00 ? 31 ASN A CB   2  
ATOM 1937  C CG   . ASN A 1 31 ? -3.335  -12.274 -2.929  1.00 0.00 ? 31 ASN A CG   2  
ATOM 1938  O OD1  . ASN A 1 31 ? -4.117  -11.771 -3.732  1.00 0.00 ? 31 ASN A OD1  2  
ATOM 1939  N ND2  . ASN A 1 31 ? -2.139  -12.714 -3.288  1.00 0.00 ? 31 ASN A ND2  2  
ATOM 1940  H H    . ASN A 1 31 ? -1.611  -10.261 -1.064  1.00 0.00 ? 31 ASN A H    2  
ATOM 1941  H HA   . ASN A 1 31 ? -3.865  -10.340 -1.192  1.00 0.00 ? 31 ASN A HA   2  
ATOM 1942  H HB2  . ASN A 1 31 ? -3.150  -13.260 -1.061  1.00 0.00 ? 31 ASN A HB2  2  
ATOM 1943  H HB3  . ASN A 1 31 ? -4.775  -12.691 -1.428  1.00 0.00 ? 31 ASN A HB3  2  
ATOM 1944  H HD21 . ASN A 1 31 ? -1.568  -13.134 -2.604  1.00 0.00 ? 31 ASN A HD21 2  
ATOM 1945  H HD22 . ASN A 1 31 ? -1.870  -12.605 -4.227  1.00 0.00 ? 31 ASN A HD22 2  
ATOM 1946  N N    . SER A 1 32 ? -4.313  -12.478 1.241   1.00 0.00 ? 32 SER A N    2  
ATOM 1947  C CA   . SER A 1 32 ? -5.120  -12.733 2.426   1.00 0.00 ? 32 SER A CA   2  
ATOM 1948  C C    . SER A 1 32 ? -4.589  -11.964 3.627   1.00 0.00 ? 32 SER A C    2  
ATOM 1949  O O    . SER A 1 32 ? -5.360  -11.416 4.413   1.00 0.00 ? 32 SER A O    2  
ATOM 1950  C CB   . SER A 1 32 ? -5.144  -14.233 2.710   1.00 0.00 ? 32 SER A CB   2  
ATOM 1951  O OG   . SER A 1 32 ? -3.887  -14.819 2.400   1.00 0.00 ? 32 SER A OG   2  
ATOM 1952  H H    . SER A 1 32 ? -3.797  -13.217 0.856   1.00 0.00 ? 32 SER A H    2  
ATOM 1953  H HA   . SER A 1 32 ? -6.127  -12.400 2.220   1.00 0.00 ? 32 SER A HA   2  
ATOM 1954  H HB2  . SER A 1 32 ? -5.361  -14.400 3.754   1.00 0.00 ? 32 SER A HB2  2  
ATOM 1955  H HB3  . SER A 1 32 ? -5.903  -14.702 2.104   1.00 0.00 ? 32 SER A HB3  2  
ATOM 1956  H HG   . SER A 1 32 ? -3.491  -15.193 3.208   1.00 0.00 ? 32 SER A HG   2  
ATOM 1957  N N    . GLU A 1 33 ? -3.270  -11.901 3.739   1.00 0.00 ? 33 GLU A N    2  
ATOM 1958  C CA   . GLU A 1 33 ? -2.620  -11.198 4.836   1.00 0.00 ? 33 GLU A CA   2  
ATOM 1959  C C    . GLU A 1 33 ? -3.108  -9.759  4.896   1.00 0.00 ? 33 GLU A C    2  
ATOM 1960  O O    . GLU A 1 33 ? -3.549  -9.281  5.944   1.00 0.00 ? 33 GLU A O    2  
ATOM 1961  C CB   . GLU A 1 33 ? -1.102  -11.223 4.651   1.00 0.00 ? 33 GLU A CB   2  
ATOM 1962  C CG   . GLU A 1 33 ? -0.510  -12.621 4.646   1.00 0.00 ? 33 GLU A CG   2  
ATOM 1963  C CD   . GLU A 1 33 ? -0.656  -13.310 5.985   1.00 0.00 ? 33 GLU A CD   2  
ATOM 1964  O OE1  . GLU A 1 33 ? -0.073  -12.817 6.967   1.00 0.00 ? 33 GLU A OE1  2  
ATOM 1965  O OE2  . GLU A 1 33 ? -1.344  -14.347 6.059   1.00 0.00 ? 33 GLU A OE2  2  
ATOM 1966  H H    . GLU A 1 33 ? -2.717  -12.337 3.055   1.00 0.00 ? 33 GLU A H    2  
ATOM 1967  H HA   . GLU A 1 33 ? -2.879  -11.697 5.759   1.00 0.00 ? 33 GLU A HA   2  
ATOM 1968  H HB2  . GLU A 1 33 ? -0.858  -10.748 3.712   1.00 0.00 ? 33 GLU A HB2  2  
ATOM 1969  H HB3  . GLU A 1 33 ? -0.645  -10.663 5.454   1.00 0.00 ? 33 GLU A HB3  2  
ATOM 1970  H HG2  . GLU A 1 33 ? -1.015  -13.212 3.897   1.00 0.00 ? 33 GLU A HG2  2  
ATOM 1971  H HG3  . GLU A 1 33 ? 0.540   -12.554 4.404   1.00 0.00 ? 33 GLU A HG3  2  
ATOM 1972  N N    . ILE A 1 34 ? -3.050  -9.092  3.750   1.00 0.00 ? 34 ILE A N    2  
ATOM 1973  C CA   . ILE A 1 34 ? -3.490  -7.710  3.631   1.00 0.00 ? 34 ILE A CA   2  
ATOM 1974  C C    . ILE A 1 34 ? -4.966  -7.590  3.986   1.00 0.00 ? 34 ILE A C    2  
ATOM 1975  O O    . ILE A 1 34 ? -5.385  -6.632  4.626   1.00 0.00 ? 34 ILE A O    2  
ATOM 1976  C CB   . ILE A 1 34 ? -3.262  -7.178  2.198   1.00 0.00 ? 34 ILE A CB   2  
ATOM 1977  C CG1  . ILE A 1 34 ? -1.793  -7.345  1.798   1.00 0.00 ? 34 ILE A CG1  2  
ATOM 1978  C CG2  . ILE A 1 34 ? -3.679  -5.716  2.093   1.00 0.00 ? 34 ILE A CG2  2  
ATOM 1979  C CD1  . ILE A 1 34 ? -1.492  -6.931  0.372   1.00 0.00 ? 34 ILE A CD1  2  
ATOM 1980  H H    . ILE A 1 34 ? -2.710  -9.549  2.954   1.00 0.00 ? 34 ILE A H    2  
ATOM 1981  H HA   . ILE A 1 34 ? -2.909  -7.112  4.320   1.00 0.00 ? 34 ILE A HA   2  
ATOM 1982  H HB   . ILE A 1 34 ? -3.877  -7.752  1.524   1.00 0.00 ? 34 ILE A HB   2  
ATOM 1983  H HG12 . ILE A 1 34 ? -1.177  -6.742  2.450   1.00 0.00 ? 34 ILE A HG12 2  
ATOM 1984  H HG13 . ILE A 1 34 ? -1.515  -8.383  1.908   1.00 0.00 ? 34 ILE A HG13 2  
ATOM 1985  H HG21 . ILE A 1 34 ? -3.494  -5.361  1.091   1.00 0.00 ? 34 ILE A HG21 2  
ATOM 1986  H HG22 . ILE A 1 34 ? -3.108  -5.127  2.795   1.00 0.00 ? 34 ILE A HG22 2  
ATOM 1987  H HG23 . ILE A 1 34 ? -4.732  -5.625  2.319   1.00 0.00 ? 34 ILE A HG23 2  
ATOM 1988  H HD11 . ILE A 1 34 ? -0.449  -7.104  0.160   1.00 0.00 ? 34 ILE A HD11 2  
ATOM 1989  H HD12 . ILE A 1 34 ? -1.717  -5.881  0.247   1.00 0.00 ? 34 ILE A HD12 2  
ATOM 1990  H HD13 . ILE A 1 34 ? -2.097  -7.511  -0.310  1.00 0.00 ? 34 ILE A HD13 2  
ATOM 1991  N N    . SER A 1 35 ? -5.741  -8.594  3.608   1.00 0.00 ? 35 SER A N    2  
ATOM 1992  C CA   . SER A 1 35 ? -7.177  -8.551  3.822   1.00 0.00 ? 35 SER A CA   2  
ATOM 1993  C C    . SER A 1 35 ? -7.511  -8.732  5.302   1.00 0.00 ? 35 SER A C    2  
ATOM 1994  O O    . SER A 1 35 ? -8.461  -8.138  5.815   1.00 0.00 ? 35 SER A O    2  
ATOM 1995  C CB   . SER A 1 35 ? -7.857  -9.633  2.984   1.00 0.00 ? 35 SER A CB   2  
ATOM 1996  O OG   . SER A 1 35 ? -7.493  -9.520  1.617   1.00 0.00 ? 35 SER A OG   2  
ATOM 1997  H H    . SER A 1 35 ? -5.336  -9.391  3.194   1.00 0.00 ? 35 SER A H    2  
ATOM 1998  H HA   . SER A 1 35 ? -7.532  -7.583  3.501   1.00 0.00 ? 35 SER A HA   2  
ATOM 1999  H HB2  . SER A 1 35 ? -7.556  -10.604 3.345   1.00 0.00 ? 35 SER A HB2  2  
ATOM 2000  H HB3  . SER A 1 35 ? -8.929  -9.531  3.070   1.00 0.00 ? 35 SER A HB3  2  
ATOM 2001  H HG   . SER A 1 35 ? -6.541  -9.639  1.526   1.00 0.00 ? 35 SER A HG   2  
ATOM 2002  N N    . LYS A 1 36 ? -6.693  -9.519  5.993   1.00 0.00 ? 36 LYS A N    2  
ATOM 2003  C CA   . LYS A 1 36 ? -6.960  -9.872  7.379   1.00 0.00 ? 36 LYS A CA   2  
ATOM 2004  C C    . LYS A 1 36 ? -6.640  -8.716  8.313   1.00 0.00 ? 36 LYS A C    2  
ATOM 2005  O O    . LYS A 1 36 ? -7.489  -8.289  9.094   1.00 0.00 ? 36 LYS A O    2  
ATOM 2006  C CB   . LYS A 1 36 ? -6.148  -11.111 7.770   1.00 0.00 ? 36 LYS A CB   2  
ATOM 2007  C CG   . LYS A 1 36 ? -6.675  -12.396 7.154   1.00 0.00 ? 36 LYS A CG   2  
ATOM 2008  C CD   . LYS A 1 36 ? -8.068  -12.715 7.667   1.00 0.00 ? 36 LYS A CD   2  
ATOM 2009  C CE   . LYS A 1 36 ? -8.688  -13.891 6.929   1.00 0.00 ? 36 LYS A CE   2  
ATOM 2010  N NZ   . LYS A 1 36 ? -10.015 -14.262 7.492   1.00 0.00 ? 36 LYS A NZ   2  
ATOM 2011  H H    . LYS A 1 36 ? -5.874  -9.857  5.562   1.00 0.00 ? 36 LYS A H    2  
ATOM 2012  H HA   . LYS A 1 36 ? -8.012  -10.104 7.463   1.00 0.00 ? 36 LYS A HA   2  
ATOM 2013  H HB2  . LYS A 1 36 ? -5.127  -10.973 7.445   1.00 0.00 ? 36 LYS A HB2  2  
ATOM 2014  H HB3  . LYS A 1 36 ? -6.165  -11.217 8.843   1.00 0.00 ? 36 LYS A HB3  2  
ATOM 2015  H HG2  . LYS A 1 36 ? -6.712  -12.282 6.081   1.00 0.00 ? 36 LYS A HG2  2  
ATOM 2016  H HG3  . LYS A 1 36 ? -6.010  -13.209 7.411   1.00 0.00 ? 36 LYS A HG3  2  
ATOM 2017  H HD2  . LYS A 1 36 ? -8.007  -12.954 8.718   1.00 0.00 ? 36 LYS A HD2  2  
ATOM 2018  H HD3  . LYS A 1 36 ? -8.695  -11.847 7.530   1.00 0.00 ? 36 LYS A HD3  2  
ATOM 2019  H HE2  . LYS A 1 36 ? -8.809  -13.625 5.890   1.00 0.00 ? 36 LYS A HE2  2  
ATOM 2020  H HE3  . LYS A 1 36 ? -8.024  -14.740 7.008   1.00 0.00 ? 36 LYS A HE3  2  
ATOM 2021  H HZ1  . LYS A 1 36 ? -9.897  -14.640 8.459   1.00 0.00 ? 36 LYS A HZ1  2  
ATOM 2022  H HZ2  . LYS A 1 36 ? -10.462 -14.997 6.901   1.00 0.00 ? 36 LYS A HZ2  2  
ATOM 2023  H HZ3  . LYS A 1 36 ? -10.640 -13.429 7.531   1.00 0.00 ? 36 LYS A HZ3  2  
ATOM 2024  N N    . ARG A 1 37 ? -5.426  -8.200  8.210   1.00 0.00 ? 37 ARG A N    2  
ATOM 2025  C CA   . ARG A 1 37 ? -4.973  -7.147  9.107   1.00 0.00 ? 37 ARG A CA   2  
ATOM 2026  C C    . ARG A 1 37 ? -5.683  -5.829  8.820   1.00 0.00 ? 37 ARG A C    2  
ATOM 2027  O O    . ARG A 1 37 ? -6.221  -5.198  9.730   1.00 0.00 ? 37 ARG A O    2  
ATOM 2028  C CB   . ARG A 1 37 ? -3.454  -6.979  9.010   1.00 0.00 ? 37 ARG A CB   2  
ATOM 2029  C CG   . ARG A 1 37 ? -2.683  -8.161  9.576   1.00 0.00 ? 37 ARG A CG   2  
ATOM 2030  C CD   . ARG A 1 37 ? -1.190  -8.035  9.323   1.00 0.00 ? 37 ARG A CD   2  
ATOM 2031  N NE   . ARG A 1 37 ? -0.435  -9.141  9.921   1.00 0.00 ? 37 ARG A NE   2  
ATOM 2032  C CZ   . ARG A 1 37 ? -0.109  -10.261 9.275   1.00 0.00 ? 37 ARG A CZ   2  
ATOM 2033  N NH1  . ARG A 1 37 ? -0.529  -10.460 8.032   1.00 0.00 ? 37 ARG A NH1  2  
ATOM 2034  N NH2  . ARG A 1 37 ? 0.627   -11.186 9.875   1.00 0.00 ? 37 ARG A NH2  2  
ATOM 2035  H H    . ARG A 1 37 ? -4.821  -8.533  7.512   1.00 0.00 ? 37 ARG A H    2  
ATOM 2036  H HA   . ARG A 1 37 ? -5.217  -7.452  10.111  1.00 0.00 ? 37 ARG A HA   2  
ATOM 2037  H HB2  . ARG A 1 37 ? -3.181  -6.860  7.972   1.00 0.00 ? 37 ARG A HB2  2  
ATOM 2038  H HB3  . ARG A 1 37 ? -3.164  -6.093  9.556   1.00 0.00 ? 37 ARG A HB3  2  
ATOM 2039  H HG2  . ARG A 1 37 ? -2.852  -8.210  10.642  1.00 0.00 ? 37 ARG A HG2  2  
ATOM 2040  H HG3  . ARG A 1 37 ? -3.042  -9.068  9.113   1.00 0.00 ? 37 ARG A HG3  2  
ATOM 2041  H HD2  . ARG A 1 37 ? -1.017  -8.028  8.257   1.00 0.00 ? 37 ARG A HD2  2  
ATOM 2042  H HD3  . ARG A 1 37 ? -0.845  -7.105  9.750   1.00 0.00 ? 37 ARG A HD3  2  
ATOM 2043  H HE   . ARG A 1 37 ? -0.134  -9.028  10.856  1.00 0.00 ? 37 ARG A HE   2  
ATOM 2044  H HH11 . ARG A 1 37 ? -1.087  -9.771  7.573   1.00 0.00 ? 37 ARG A HH11 2  
ATOM 2045  H HH12 . ARG A 1 37 ? -0.292  -11.321 7.548   1.00 0.00 ? 37 ARG A HH12 2  
ATOM 2046  H HH21 . ARG A 1 37 ? 0.946   -11.049 10.821  1.00 0.00 ? 37 ARG A HH21 2  
ATOM 2047  H HH22 . ARG A 1 37 ? 0.875   -12.032 9.386   1.00 0.00 ? 37 ARG A HH22 2  
ATOM 2048  N N    . LEU A 1 38 ? -5.718  -5.440  7.550   1.00 0.00 ? 38 LEU A N    2  
ATOM 2049  C CA   . LEU A 1 38 ? -6.280  -4.151  7.159   1.00 0.00 ? 38 LEU A CA   2  
ATOM 2050  C C    . LEU A 1 38 ? -7.796  -4.123  7.329   1.00 0.00 ? 38 LEU A C    2  
ATOM 2051  O O    . LEU A 1 38 ? -8.353  -3.119  7.761   1.00 0.00 ? 38 LEU A O    2  
ATOM 2052  C CB   . LEU A 1 38 ? -5.911  -3.813  5.713   1.00 0.00 ? 38 LEU A CB   2  
ATOM 2053  C CG   . LEU A 1 38 ? -4.494  -3.265  5.495   1.00 0.00 ? 38 LEU A CG   2  
ATOM 2054  C CD1  . LEU A 1 38 ? -3.435  -4.302  5.829   1.00 0.00 ? 38 LEU A CD1  2  
ATOM 2055  C CD2  . LEU A 1 38 ? -4.340  -2.796  4.061   1.00 0.00 ? 38 LEU A CD2  2  
ATOM 2056  H H    . LEU A 1 38 ? -5.363  -6.034  6.856   1.00 0.00 ? 38 LEU A H    2  
ATOM 2057  H HA   . LEU A 1 38 ? -5.850  -3.402  7.807   1.00 0.00 ? 38 LEU A HA   2  
ATOM 2058  H HB2  . LEU A 1 38 ? -6.020  -4.707  5.118   1.00 0.00 ? 38 LEU A HB2  2  
ATOM 2059  H HB3  . LEU A 1 38 ? -6.612  -3.076  5.351   1.00 0.00 ? 38 LEU A HB3  2  
ATOM 2060  H HG   . LEU A 1 38 ? -4.340  -2.412  6.141   1.00 0.00 ? 38 LEU A HG   2  
ATOM 2061  H HD11 . LEU A 1 38 ? -2.457  -3.887  5.645   1.00 0.00 ? 38 LEU A HD11 2  
ATOM 2062  H HD12 . LEU A 1 38 ? -3.578  -5.176  5.211   1.00 0.00 ? 38 LEU A HD12 2  
ATOM 2063  H HD13 . LEU A 1 38 ? -3.518  -4.578  6.869   1.00 0.00 ? 38 LEU A HD13 2  
ATOM 2064  H HD21 . LEU A 1 38 ? -3.351  -2.382  3.921   1.00 0.00 ? 38 LEU A HD21 2  
ATOM 2065  H HD22 . LEU A 1 38 ? -5.080  -2.040  3.850   1.00 0.00 ? 38 LEU A HD22 2  
ATOM 2066  H HD23 . LEU A 1 38 ? -4.478  -3.632  3.392   1.00 0.00 ? 38 LEU A HD23 2  
ATOM 2067  N N    . GLY A 1 39 ? -8.460  -5.226  7.002   1.00 0.00 ? 39 GLY A N    2  
ATOM 2068  C CA   . GLY A 1 39 ? -9.903  -5.278  7.107   1.00 0.00 ? 39 GLY A CA   2  
ATOM 2069  C C    . GLY A 1 39 ? -10.357 -5.217  8.547   1.00 0.00 ? 39 GLY A C    2  
ATOM 2070  O O    . GLY A 1 39 ? -11.347 -4.556  8.874   1.00 0.00 ? 39 GLY A O    2  
ATOM 2071  H H    . GLY A 1 39 ? -7.970  -6.015  6.705   1.00 0.00 ? 39 GLY A H    2  
ATOM 2072  H HA2  . GLY A 1 39 ? -10.326 -4.441  6.569   1.00 0.00 ? 39 GLY A HA2  2  
ATOM 2073  H HA3  . GLY A 1 39 ? -10.258 -6.196  6.663   1.00 0.00 ? 39 GLY A HA3  2  
ATOM 2074  N N    . ALA A 1 40 ? -9.617  -5.897  9.416   1.00 0.00 ? 40 ALA A N    2  
ATOM 2075  C CA   . ALA A 1 40 ? -9.923  -5.904  10.835  1.00 0.00 ? 40 ALA A CA   2  
ATOM 2076  C C    . ALA A 1 40 ? -9.823  -4.500  11.415  1.00 0.00 ? 40 ALA A C    2  
ATOM 2077  O O    . ALA A 1 40 ? -10.715 -4.058  12.138  1.00 0.00 ? 40 ALA A O    2  
ATOM 2078  C CB   . ALA A 1 40 ? -8.993  -6.856  11.573  1.00 0.00 ? 40 ALA A CB   2  
ATOM 2079  H H    . ALA A 1 40 ? -8.844  -6.414  9.090   1.00 0.00 ? 40 ALA A H    2  
ATOM 2080  H HA   . ALA A 1 40 ? -10.935 -6.262  10.956  1.00 0.00 ? 40 ALA A HA   2  
ATOM 2081  H HB1  . ALA A 1 40 ? -9.114  -7.854  11.177  1.00 0.00 ? 40 ALA A HB1  2  
ATOM 2082  H HB2  . ALA A 1 40 ? -9.237  -6.855  12.626  1.00 0.00 ? 40 ALA A HB2  2  
ATOM 2083  H HB3  . ALA A 1 40 ? -7.970  -6.536  11.439  1.00 0.00 ? 40 ALA A HB3  2  
ATOM 2084  N N    . GLU A 1 41 ? -8.752  -3.794  11.078  1.00 0.00 ? 41 GLU A N    2  
ATOM 2085  C CA   . GLU A 1 41 ? -8.533  -2.461  11.627  1.00 0.00 ? 41 GLU A CA   2  
ATOM 2086  C C    . GLU A 1 41 ? -9.403  -1.420  10.919  1.00 0.00 ? 41 GLU A C    2  
ATOM 2087  O O    . GLU A 1 41 ? -9.737  -0.383  11.496  1.00 0.00 ? 41 GLU A O    2  
ATOM 2088  C CB   . GLU A 1 41 ? -7.049  -2.077  11.579  1.00 0.00 ? 41 GLU A CB   2  
ATOM 2089  C CG   . GLU A 1 41 ? -6.423  -2.097  10.196  1.00 0.00 ? 41 GLU A CG   2  
ATOM 2090  C CD   . GLU A 1 41 ? -4.945  -1.758  10.237  1.00 0.00 ? 41 GLU A CD   2  
ATOM 2091  O OE1  . GLU A 1 41 ? -4.139  -2.642  10.596  1.00 0.00 ? 41 GLU A OE1  2  
ATOM 2092  O OE2  . GLU A 1 41 ? -4.588  -0.602  9.930   1.00 0.00 ? 41 GLU A OE2  2  
ATOM 2093  H H    . GLU A 1 41 ? -8.102  -4.173  10.436  1.00 0.00 ? 41 GLU A H    2  
ATOM 2094  H HA   . GLU A 1 41 ? -8.840  -2.496  12.664  1.00 0.00 ? 41 GLU A HA   2  
ATOM 2095  H HB2  . GLU A 1 41 ? -6.939  -1.081  11.978  1.00 0.00 ? 41 GLU A HB2  2  
ATOM 2096  H HB3  . GLU A 1 41 ? -6.496  -2.762  12.206  1.00 0.00 ? 41 GLU A HB3  2  
ATOM 2097  H HG2  . GLU A 1 41 ? -6.541  -3.084  9.772   1.00 0.00 ? 41 GLU A HG2  2  
ATOM 2098  H HG3  . GLU A 1 41 ? -6.926  -1.374  9.573   1.00 0.00 ? 41 GLU A HG3  2  
ATOM 2099  N N    . TRP A 1 42 ? -9.783  -1.708  9.675   1.00 0.00 ? 42 TRP A N    2  
ATOM 2100  C CA   . TRP A 1 42 ? -10.669 -0.829  8.918   1.00 0.00 ? 42 TRP A CA   2  
ATOM 2101  C C    . TRP A 1 42 ? -12.032 -0.747  9.593   1.00 0.00 ? 42 TRP A C    2  
ATOM 2102  O O    . TRP A 1 42 ? -12.693 0.289   9.561   1.00 0.00 ? 42 TRP A O    2  
ATOM 2103  C CB   . TRP A 1 42 ? -10.835 -1.332  7.481   1.00 0.00 ? 42 TRP A CB   2  
ATOM 2104  C CG   . TRP A 1 42 ? -11.181 -0.250  6.503   1.00 0.00 ? 42 TRP A CG   2  
ATOM 2105  C CD1  . TRP A 1 42 ? -10.302 0.449   5.732   1.00 0.00 ? 42 TRP A CD1  2  
ATOM 2106  C CD2  . TRP A 1 42 ? -12.486 0.261   6.187   1.00 0.00 ? 42 TRP A CD2  2  
ATOM 2107  N NE1  . TRP A 1 42 ? -10.974 1.354   4.952   1.00 0.00 ? 42 TRP A NE1  2  
ATOM 2108  C CE2  . TRP A 1 42 ? -12.312 1.264   5.213   1.00 0.00 ? 42 TRP A CE2  2  
ATOM 2109  C CE3  . TRP A 1 42 ? -13.783 -0.028  6.628   1.00 0.00 ? 42 TRP A CE3  2  
ATOM 2110  C CZ2  . TRP A 1 42 ? -13.380 1.977   4.676   1.00 0.00 ? 42 TRP A CZ2  2  
ATOM 2111  C CZ3  . TRP A 1 42 ? -14.845 0.681   6.088   1.00 0.00 ? 42 TRP A CZ3  2  
ATOM 2112  C CH2  . TRP A 1 42 ? -14.635 1.674   5.121   1.00 0.00 ? 42 TRP A CH2  2  
ATOM 2113  H H    . TRP A 1 42 ? -9.439  -2.524  9.246   1.00 0.00 ? 42 TRP A H    2  
ATOM 2114  H HA   . TRP A 1 42 ? -10.225 0.156   8.900   1.00 0.00 ? 42 TRP A HA   2  
ATOM 2115  H HB2  . TRP A 1 42 ? -9.911  -1.790  7.158   1.00 0.00 ? 42 TRP A HB2  2  
ATOM 2116  H HB3  . TRP A 1 42 ? -11.623 -2.070  7.456   1.00 0.00 ? 42 TRP A HB3  2  
ATOM 2117  H HD1  . TRP A 1 42 ? -9.232  0.297   5.741   1.00 0.00 ? 42 TRP A HD1  2  
ATOM 2118  H HE1  . TRP A 1 42 ? -10.557 1.969   4.311   1.00 0.00 ? 42 TRP A HE1  2  
ATOM 2119  H HE3  . TRP A 1 42 ? -13.963 -0.792  7.371   1.00 0.00 ? 42 TRP A HE3  2  
ATOM 2120  H HZ2  . TRP A 1 42 ? -13.236 2.744   3.928   1.00 0.00 ? 42 TRP A HZ2  2  
ATOM 2121  H HZ3  . TRP A 1 42 ? -15.853 0.474   6.418   1.00 0.00 ? 42 TRP A HZ3  2  
ATOM 2122  H HH2  . TRP A 1 42 ? -15.490 2.202   4.724   1.00 0.00 ? 42 TRP A HH2  2  
ATOM 2123  N N    . LYS A 1 43 ? -12.440 -1.845  10.223  1.00 0.00 ? 43 LYS A N    2  
ATOM 2124  C CA   . LYS A 1 43 ? -13.707 -1.888  10.952  1.00 0.00 ? 43 LYS A CA   2  
ATOM 2125  C C    . LYS A 1 43 ? -13.752 -0.850  12.078  1.00 0.00 ? 43 LYS A C    2  
ATOM 2126  O O    . LYS A 1 43 ? -14.824 -0.521  12.587  1.00 0.00 ? 43 LYS A O    2  
ATOM 2127  C CB   . LYS A 1 43 ? -13.949 -3.279  11.518  1.00 0.00 ? 43 LYS A CB   2  
ATOM 2128  C CG   . LYS A 1 43 ? -14.269 -4.283  10.434  1.00 0.00 ? 43 LYS A CG   2  
ATOM 2129  C CD   . LYS A 1 43 ? -14.741 -5.598  11.003  1.00 0.00 ? 43 LYS A CD   2  
ATOM 2130  C CE   . LYS A 1 43 ? -13.625 -6.340  11.720  1.00 0.00 ? 43 LYS A CE   2  
ATOM 2131  N NZ   . LYS A 1 43 ? -14.079 -7.659  12.237  1.00 0.00 ? 43 LYS A NZ   2  
ATOM 2132  H H    . LYS A 1 43 ? -11.881 -2.655  10.185  1.00 0.00 ? 43 LYS A H    2  
ATOM 2133  H HA   . LYS A 1 43 ? -14.496 -1.677  10.247  1.00 0.00 ? 43 LYS A HA   2  
ATOM 2134  H HB2  . LYS A 1 43 ? -13.063 -3.607  12.041  1.00 0.00 ? 43 LYS A HB2  2  
ATOM 2135  H HB3  . LYS A 1 43 ? -14.781 -3.242  12.208  1.00 0.00 ? 43 LYS A HB3  2  
ATOM 2136  H HG2  . LYS A 1 43 ? -15.045 -3.878  9.803   1.00 0.00 ? 43 LYS A HG2  2  
ATOM 2137  H HG3  . LYS A 1 43 ? -13.379 -4.454  9.848   1.00 0.00 ? 43 LYS A HG3  2  
ATOM 2138  H HD2  . LYS A 1 43 ? -15.544 -5.410  11.702  1.00 0.00 ? 43 LYS A HD2  2  
ATOM 2139  H HD3  . LYS A 1 43 ? -15.105 -6.199  10.191  1.00 0.00 ? 43 LYS A HD3  2  
ATOM 2140  H HE2  . LYS A 1 43 ? -12.808 -6.495  11.030  1.00 0.00 ? 43 LYS A HE2  2  
ATOM 2141  H HE3  . LYS A 1 43 ? -13.285 -5.737  12.549  1.00 0.00 ? 43 LYS A HE3  2  
ATOM 2142  H HZ1  . LYS A 1 43 ? -14.888 -7.536  12.886  1.00 0.00 ? 43 LYS A HZ1  2  
ATOM 2143  H HZ2  . LYS A 1 43 ? -13.302 -8.129  12.753  1.00 0.00 ? 43 LYS A HZ2  2  
ATOM 2144  H HZ3  . LYS A 1 43 ? -14.372 -8.276  11.447  1.00 0.00 ? 43 LYS A HZ3  2  
ATOM 2145  N N    . LEU A 1 44 ? -12.584 -0.339  12.459  1.00 0.00 ? 44 LEU A N    2  
ATOM 2146  C CA   . LEU A 1 44 ? -12.485 0.652   13.525  1.00 0.00 ? 44 LEU A CA   2  
ATOM 2147  C C    . LEU A 1 44 ? -12.087 2.017   12.961  1.00 0.00 ? 44 LEU A C    2  
ATOM 2148  O O    . LEU A 1 44 ? -11.633 2.895   13.699  1.00 0.00 ? 44 LEU A O    2  
ATOM 2149  C CB   . LEU A 1 44 ? -11.462 0.214   14.583  1.00 0.00 ? 44 LEU A CB   2  
ATOM 2150  C CG   . LEU A 1 44 ? -11.883 -0.952  15.491  1.00 0.00 ? 44 LEU A CG   2  
ATOM 2151  C CD1  . LEU A 1 44 ? -11.855 -2.277  14.744  1.00 0.00 ? 44 LEU A CD1  2  
ATOM 2152  C CD2  . LEU A 1 44 ? -10.988 -1.017  16.719  1.00 0.00 ? 44 LEU A CD2  2  
ATOM 2153  H H    . LEU A 1 44 ? -11.762 -0.630  12.005  1.00 0.00 ? 44 LEU A H    2  
ATOM 2154  H HA   . LEU A 1 44 ? -13.457 0.734   13.990  1.00 0.00 ? 44 LEU A HA   2  
ATOM 2155  H HB2  . LEU A 1 44 ? -10.553 -0.069  14.074  1.00 0.00 ? 44 LEU A HB2  2  
ATOM 2156  H HB3  . LEU A 1 44 ? -11.246 1.066   15.212  1.00 0.00 ? 44 LEU A HB3  2  
ATOM 2157  H HG   . LEU A 1 44 ? -12.896 -0.785  15.829  1.00 0.00 ? 44 LEU A HG   2  
ATOM 2158  H HD11 . LEU A 1 44 ? -12.540 -2.233  13.909  1.00 0.00 ? 44 LEU A HD11 2  
ATOM 2159  H HD12 . LEU A 1 44 ? -12.149 -3.072  15.412  1.00 0.00 ? 44 LEU A HD12 2  
ATOM 2160  H HD13 . LEU A 1 44 ? -10.856 -2.464  14.380  1.00 0.00 ? 44 LEU A HD13 2  
ATOM 2161  H HD21 . LEU A 1 44 ? -9.968  -1.203  16.412  1.00 0.00 ? 44 LEU A HD21 2  
ATOM 2162  H HD22 . LEU A 1 44 ? -11.322 -1.818  17.363  1.00 0.00 ? 44 LEU A HD22 2  
ATOM 2163  H HD23 . LEU A 1 44 ? -11.039 -0.080  17.253  1.00 0.00 ? 44 LEU A HD23 2  
ATOM 2164  N N    . LEU A 1 45 ? -12.258 2.196   11.659  1.00 0.00 ? 45 LEU A N    2  
ATOM 2165  C CA   . LEU A 1 45 ? -11.874 3.442   11.001  1.00 0.00 ? 45 LEU A CA   2  
ATOM 2166  C C    . LEU A 1 45 ? -12.905 4.542   11.239  1.00 0.00 ? 45 LEU A C    2  
ATOM 2167  O O    . LEU A 1 45 ? -14.098 4.356   11.000  1.00 0.00 ? 45 LEU A O    2  
ATOM 2168  C CB   . LEU A 1 45 ? -11.705 3.226   9.495   1.00 0.00 ? 45 LEU A CB   2  
ATOM 2169  C CG   . LEU A 1 45 ? -11.316 4.476   8.701   1.00 0.00 ? 45 LEU A CG   2  
ATOM 2170  C CD1  . LEU A 1 45 ? -9.910  4.924   9.067   1.00 0.00 ? 45 LEU A CD1  2  
ATOM 2171  C CD2  . LEU A 1 45 ? -11.431 4.218   7.206   1.00 0.00 ? 45 LEU A CD2  2  
ATOM 2172  H H    . LEU A 1 45 ? -12.653 1.474   11.122  1.00 0.00 ? 45 LEU A H    2  
ATOM 2173  H HA   . LEU A 1 45 ? -10.928 3.757   11.417  1.00 0.00 ? 45 LEU A HA   2  
ATOM 2174  H HB2  . LEU A 1 45 ? -10.942 2.475   9.344   1.00 0.00 ? 45 LEU A HB2  2  
ATOM 2175  H HB3  . LEU A 1 45 ? -12.637 2.853   9.100   1.00 0.00 ? 45 LEU A HB3  2  
ATOM 2176  H HG   . LEU A 1 45 ? -11.995 5.278   8.954   1.00 0.00 ? 45 LEU A HG   2  
ATOM 2177  H HD11 . LEU A 1 45 ? -9.208  4.136   8.837   1.00 0.00 ? 45 LEU A HD11 2  
ATOM 2178  H HD12 . LEU A 1 45 ? -9.866  5.150   10.122  1.00 0.00 ? 45 LEU A HD12 2  
ATOM 2179  H HD13 . LEU A 1 45 ? -9.657  5.807   8.499   1.00 0.00 ? 45 LEU A HD13 2  
ATOM 2180  H HD21 . LEU A 1 45 ? -11.175 5.117   6.665   1.00 0.00 ? 45 LEU A HD21 2  
ATOM 2181  H HD22 . LEU A 1 45 ? -12.444 3.932   6.967   1.00 0.00 ? 45 LEU A HD22 2  
ATOM 2182  H HD23 . LEU A 1 45 ? -10.757 3.424   6.924   1.00 0.00 ? 45 LEU A HD23 2  
ATOM 2183  N N    . SER A 1 46 ? -12.435 5.683   11.719  1.00 0.00 ? 46 SER A N    2  
ATOM 2184  C CA   . SER A 1 46 ? -13.273 6.862   11.833  1.00 0.00 ? 46 SER A CA   2  
ATOM 2185  C C    . SER A 1 46 ? -13.143 7.699   10.560  1.00 0.00 ? 46 SER A C    2  
ATOM 2186  O O    . SER A 1 46 ? -12.104 7.665   9.898   1.00 0.00 ? 46 SER A O    2  
ATOM 2187  C CB   . SER A 1 46 ? -12.873 7.665   13.070  1.00 0.00 ? 46 SER A CB   2  
ATOM 2188  O OG   . SER A 1 46 ? -12.919 6.850   14.234  1.00 0.00 ? 46 SER A OG   2  
ATOM 2189  H H    . SER A 1 46 ? -11.494 5.737   11.996  1.00 0.00 ? 46 SER A H    2  
ATOM 2190  H HA   . SER A 1 46 ? -14.299 6.537   11.935  1.00 0.00 ? 46 SER A HA   2  
ATOM 2191  H HB2  . SER A 1 46 ? -11.867 8.040   12.946  1.00 0.00 ? 46 SER A HB2  2  
ATOM 2192  H HB3  . SER A 1 46 ? -13.553 8.494   13.197  1.00 0.00 ? 46 SER A HB3  2  
ATOM 2193  H HG   . SER A 1 46 ? -12.673 5.947   14.000  1.00 0.00 ? 46 SER A HG   2  
ATOM 2194  N N    . GLU A 1 47 ? -14.185 8.447   10.212  1.00 0.00 ? 47 GLU A N    2  
ATOM 2195  C CA   . GLU A 1 47 ? -14.208 9.178   8.949   1.00 0.00 ? 47 GLU A CA   2  
ATOM 2196  C C    . GLU A 1 47 ? -13.180 10.310  8.933   1.00 0.00 ? 47 GLU A C    2  
ATOM 2197  O O    . GLU A 1 47 ? -12.753 10.752  7.866   1.00 0.00 ? 47 GLU A O    2  
ATOM 2198  C CB   . GLU A 1 47 ? -15.607 9.714   8.644   1.00 0.00 ? 47 GLU A CB   2  
ATOM 2199  C CG   . GLU A 1 47 ? -16.118 10.743  9.629   1.00 0.00 ? 47 GLU A CG   2  
ATOM 2200  C CD   . GLU A 1 47 ? -17.465 11.289  9.217   1.00 0.00 ? 47 GLU A CD   2  
ATOM 2201  O OE1  . GLU A 1 47 ? -17.527 12.030  8.216   1.00 0.00 ? 47 GLU A OE1  2  
ATOM 2202  O OE2  . GLU A 1 47 ? -18.475 10.959  9.872   1.00 0.00 ? 47 GLU A OE2  2  
ATOM 2203  H H    . GLU A 1 47 ? -14.957 8.511   10.820  1.00 0.00 ? 47 GLU A H    2  
ATOM 2204  H HA   . GLU A 1 47 ? -13.939 8.476   8.173   1.00 0.00 ? 47 GLU A HA   2  
ATOM 2205  H HB2  . GLU A 1 47 ? -15.596 10.167  7.665   1.00 0.00 ? 47 GLU A HB2  2  
ATOM 2206  H HB3  . GLU A 1 47 ? -16.299 8.884   8.634   1.00 0.00 ? 47 GLU A HB3  2  
ATOM 2207  H HG2  . GLU A 1 47 ? -16.212 10.282  10.601  1.00 0.00 ? 47 GLU A HG2  2  
ATOM 2208  H HG3  . GLU A 1 47 ? -15.412 11.558  9.679   1.00 0.00 ? 47 GLU A HG3  2  
ATOM 2209  N N    . THR A 1 48 ? -12.792 10.784  10.108  1.00 0.00 ? 48 THR A N    2  
ATOM 2210  C CA   . THR A 1 48 ? -11.740 11.792  10.210  1.00 0.00 ? 48 THR A CA   2  
ATOM 2211  C C    . THR A 1 48 ? -10.394 11.208  9.750   1.00 0.00 ? 48 THR A C    2  
ATOM 2212  O O    . THR A 1 48 ? -9.550  11.912  9.189   1.00 0.00 ? 48 THR A O    2  
ATOM 2213  C CB   . THR A 1 48 ? -11.630 12.349  11.653  1.00 0.00 ? 48 THR A CB   2  
ATOM 2214  O OG1  . THR A 1 48 ? -10.621 13.364  11.721  1.00 0.00 ? 48 THR A OG1  2  
ATOM 2215  C CG2  . THR A 1 48 ? -11.308 11.247  12.653  1.00 0.00 ? 48 THR A CG2  2  
ATOM 2216  H H    . THR A 1 48 ? -13.228 10.461  10.926  1.00 0.00 ? 48 THR A H    2  
ATOM 2217  H HA   . THR A 1 48 ? -12.006 12.608  9.551   1.00 0.00 ? 48 THR A HA   2  
ATOM 2218  H HB   . THR A 1 48 ? -12.579 12.787  11.924  1.00 0.00 ? 48 THR A HB   2  
ATOM 2219  H HG1  . THR A 1 48 ? -11.031 14.217  11.889  1.00 0.00 ? 48 THR A HG1  2  
ATOM 2220  H HG21 . THR A 1 48 ? -11.281 11.661  13.650  1.00 0.00 ? 48 THR A HG21 2  
ATOM 2221  H HG22 . THR A 1 48 ? -10.347 10.815  12.414  1.00 0.00 ? 48 THR A HG22 2  
ATOM 2222  H HG23 . THR A 1 48 ? -12.068 10.481  12.600  1.00 0.00 ? 48 THR A HG23 2  
ATOM 2223  N N    . GLU A 1 49 ? -10.227 9.903   9.953   1.00 0.00 ? 49 GLU A N    2  
ATOM 2224  C CA   . GLU A 1 49 ? -9.012  9.191   9.563   1.00 0.00 ? 49 GLU A CA   2  
ATOM 2225  C C    . GLU A 1 49 ? -9.096  8.747   8.101   1.00 0.00 ? 49 GLU A C    2  
ATOM 2226  O O    . GLU A 1 49 ? -8.115  8.300   7.517   1.00 0.00 ? 49 GLU A O    2  
ATOM 2227  C CB   . GLU A 1 49 ? -8.795  7.984   10.474  1.00 0.00 ? 49 GLU A CB   2  
ATOM 2228  C CG   . GLU A 1 49 ? -8.637  8.358   11.938  1.00 0.00 ? 49 GLU A CG   2  
ATOM 2229  C CD   . GLU A 1 49 ? -8.684  7.157   12.859  1.00 0.00 ? 49 GLU A CD   2  
ATOM 2230  O OE1  . GLU A 1 49 ? -7.622  6.551   13.120  1.00 0.00 ? 49 GLU A OE1  2  
ATOM 2231  O OE2  . GLU A 1 49 ? -9.789  6.820   13.336  1.00 0.00 ? 49 GLU A OE2  2  
ATOM 2232  H H    . GLU A 1 49 ? -10.949 9.398   10.380  1.00 0.00 ? 49 GLU A H    2  
ATOM 2233  H HA   . GLU A 1 49 ? -8.180  9.869   9.674   1.00 0.00 ? 49 GLU A HA   2  
ATOM 2234  H HB2  . GLU A 1 49 ? -9.640  7.317   10.381  1.00 0.00 ? 49 GLU A HB2  2  
ATOM 2235  H HB3  . GLU A 1 49 ? -7.901  7.467   10.157  1.00 0.00 ? 49 GLU A HB3  2  
ATOM 2236  H HG2  . GLU A 1 49 ? -7.686  8.852   12.071  1.00 0.00 ? 49 GLU A HG2  2  
ATOM 2237  H HG3  . GLU A 1 49 ? -9.434  9.035   12.211  1.00 0.00 ? 49 GLU A HG3  2  
ATOM 2238  N N    . LYS A 1 50 ? -10.293 8.857   7.539   1.00 0.00 ? 50 LYS A N    2  
ATOM 2239  C CA   . LYS A 1 50 ? -10.578 8.451   6.159   1.00 0.00 ? 50 LYS A CA   2  
ATOM 2240  C C    . LYS A 1 50 ? -9.805  9.301   5.135   1.00 0.00 ? 50 LYS A C    2  
ATOM 2241  O O    . LYS A 1 50 ? -9.728  8.952   3.960   1.00 0.00 ? 50 LYS A O    2  
ATOM 2242  C CB   . LYS A 1 50 ? -12.087 8.588   5.915   1.00 0.00 ? 50 LYS A CB   2  
ATOM 2243  C CG   . LYS A 1 50 ? -12.579 8.060   4.577   1.00 0.00 ? 50 LYS A CG   2  
ATOM 2244  C CD   . LYS A 1 50 ? -13.989 8.550   4.279   1.00 0.00 ? 50 LYS A CD   2  
ATOM 2245  C CE   . LYS A 1 50 ? -14.969 8.160   5.378   1.00 0.00 ? 50 LYS A CE   2  
ATOM 2246  N NZ   . LYS A 1 50 ? -16.283 8.840   5.227   1.00 0.00 ? 50 LYS A NZ   2  
ATOM 2247  H H    . LYS A 1 50 ? -11.022 9.230   8.073   1.00 0.00 ? 50 LYS A H    2  
ATOM 2248  H HA   . LYS A 1 50 ? -10.296 7.416   6.044   1.00 0.00 ? 50 LYS A HA   2  
ATOM 2249  H HB2  . LYS A 1 50 ? -12.610 8.055   6.695   1.00 0.00 ? 50 LYS A HB2  2  
ATOM 2250  H HB3  . LYS A 1 50 ? -12.349 9.636   5.979   1.00 0.00 ? 50 LYS A HB3  2  
ATOM 2251  H HG2  . LYS A 1 50 ? -11.914 8.401   3.799   1.00 0.00 ? 50 LYS A HG2  2  
ATOM 2252  H HG3  . LYS A 1 50 ? -12.580 6.981   4.606   1.00 0.00 ? 50 LYS A HG3  2  
ATOM 2253  H HD2  . LYS A 1 50 ? -13.972 9.626   4.191   1.00 0.00 ? 50 LYS A HD2  2  
ATOM 2254  H HD3  . LYS A 1 50 ? -14.317 8.116   3.346   1.00 0.00 ? 50 LYS A HD3  2  
ATOM 2255  H HE2  . LYS A 1 50 ? -15.120 7.090   5.343   1.00 0.00 ? 50 LYS A HE2  2  
ATOM 2256  H HE3  . LYS A 1 50 ? -14.541 8.430   6.333   1.00 0.00 ? 50 LYS A HE3  2  
ATOM 2257  H HZ1  . LYS A 1 50 ? -16.167 9.876   5.302   1.00 0.00 ? 50 LYS A HZ1  2  
ATOM 2258  H HZ2  . LYS A 1 50 ? -16.938 8.523   5.977   1.00 0.00 ? 50 LYS A HZ2  2  
ATOM 2259  H HZ3  . LYS A 1 50 ? -16.707 8.613   4.300   1.00 0.00 ? 50 LYS A HZ3  2  
ATOM 2260  N N    . ARG A 1 51 ? -9.239  10.411  5.596   1.00 0.00 ? 51 ARG A N    2  
ATOM 2261  C CA   . ARG A 1 51 ? -8.604  11.397  4.716   1.00 0.00 ? 51 ARG A CA   2  
ATOM 2262  C C    . ARG A 1 51 ? -7.534  10.793  3.787   1.00 0.00 ? 51 ARG A C    2  
ATOM 2263  O O    . ARG A 1 51 ? -7.634  10.947  2.571   1.00 0.00 ? 51 ARG A O    2  
ATOM 2264  C CB   . ARG A 1 51 ? -8.002  12.535  5.553   1.00 0.00 ? 51 ARG A CB   2  
ATOM 2265  C CG   . ARG A 1 51 ? -7.501  13.716  4.737   1.00 0.00 ? 51 ARG A CG   2  
ATOM 2266  C CD   . ARG A 1 51 ? -8.649  14.474  4.087   1.00 0.00 ? 51 ARG A CD   2  
ATOM 2267  N NE   . ARG A 1 51 ? -8.181  15.642  3.342   1.00 0.00 ? 51 ARG A NE   2  
ATOM 2268  C CZ   . ARG A 1 51 ? -8.948  16.685  3.022   1.00 0.00 ? 51 ARG A CZ   2  
ATOM 2269  N NH1  . ARG A 1 51 ? -10.220 16.725  3.408   1.00 0.00 ? 51 ARG A NH1  2  
ATOM 2270  N NH2  . ARG A 1 51 ? -8.435  17.697  2.335   1.00 0.00 ? 51 ARG A NH2  2  
ATOM 2271  H H    . ARG A 1 51 ? -9.240  10.573  6.561   1.00 0.00 ? 51 ARG A H    2  
ATOM 2272  H HA   . ARG A 1 51 ? -9.380  11.810  4.090   1.00 0.00 ? 51 ARG A HA   2  
ATOM 2273  H HB2  . ARG A 1 51 ? -8.753  12.897  6.240   1.00 0.00 ? 51 ARG A HB2  2  
ATOM 2274  H HB3  . ARG A 1 51 ? -7.171  12.143  6.120   1.00 0.00 ? 51 ARG A HB3  2  
ATOM 2275  H HG2  . ARG A 1 51 ? -6.962  14.387  5.389   1.00 0.00 ? 51 ARG A HG2  2  
ATOM 2276  H HG3  . ARG A 1 51 ? -6.839  13.351  3.966   1.00 0.00 ? 51 ARG A HG3  2  
ATOM 2277  H HD2  . ARG A 1 51 ? -9.162  13.810  3.409   1.00 0.00 ? 51 ARG A HD2  2  
ATOM 2278  H HD3  . ARG A 1 51 ? -9.332  14.799  4.860   1.00 0.00 ? 51 ARG A HD3  2  
ATOM 2279  H HE   . ARG A 1 51 ? -7.232  15.646  3.060   1.00 0.00 ? 51 ARG A HE   2  
ATOM 2280  H HH11 . ARG A 1 51 ? -10.607 15.971  3.945   1.00 0.00 ? 51 ARG A HH11 2  
ATOM 2281  H HH12 . ARG A 1 51 ? -10.804 17.516  3.168   1.00 0.00 ? 51 ARG A HH12 2  
ATOM 2282  H HH21 . ARG A 1 51 ? -7.471  17.683  2.062   1.00 0.00 ? 51 ARG A HH21 2  
ATOM 2283  H HH22 . ARG A 1 51 ? -9.014  18.481  2.075   1.00 0.00 ? 51 ARG A HH22 2  
ATOM 2284  N N    . PRO A 1 52 ? -6.493  10.109  4.314   1.00 0.00 ? 52 PRO A N    2  
ATOM 2285  C CA   . PRO A 1 52 ? -5.416  9.572   3.469   1.00 0.00 ? 52 PRO A CA   2  
ATOM 2286  C C    . PRO A 1 52 ? -5.894  8.465   2.540   1.00 0.00 ? 52 PRO A C    2  
ATOM 2287  O O    . PRO A 1 52 ? -5.251  8.162   1.535   1.00 0.00 ? 52 PRO A O    2  
ATOM 2288  C CB   . PRO A 1 52 ? -4.392  9.035   4.472   1.00 0.00 ? 52 PRO A CB   2  
ATOM 2289  C CG   . PRO A 1 52 ? -5.181  8.766   5.705   1.00 0.00 ? 52 PRO A CG   2  
ATOM 2290  C CD   . PRO A 1 52 ? -6.259  9.815   5.740   1.00 0.00 ? 52 PRO A CD   2  
ATOM 2291  H HA   . PRO A 1 52 ? -4.972  10.351  2.872   1.00 0.00 ? 52 PRO A HA   2  
ATOM 2292  H HB2  . PRO A 1 52 ? -3.944  8.132   4.082   1.00 0.00 ? 52 PRO A HB2  2  
ATOM 2293  H HB3  . PRO A 1 52 ? -3.628  9.777   4.646   1.00 0.00 ? 52 PRO A HB3  2  
ATOM 2294  H HG2  . PRO A 1 52 ? -5.616  7.780   5.653   1.00 0.00 ? 52 PRO A HG2  2  
ATOM 2295  H HG3  . PRO A 1 52 ? -4.545  8.852   6.574   1.00 0.00 ? 52 PRO A HG3  2  
ATOM 2296  H HD2  . PRO A 1 52 ? -7.151  9.422   6.203   1.00 0.00 ? 52 PRO A HD2  2  
ATOM 2297  H HD3  . PRO A 1 52 ? -5.915  10.693  6.266   1.00 0.00 ? 52 PRO A HD3  2  
ATOM 2298  N N    . PHE A 1 53 ? -7.034  7.879   2.870   1.00 0.00 ? 53 PHE A N    2  
ATOM 2299  C CA   . PHE A 1 53 ? -7.652  6.886   2.010   1.00 0.00 ? 53 PHE A CA   2  
ATOM 2300  C C    . PHE A 1 53 ? -8.026  7.526   0.689   1.00 0.00 ? 53 PHE A C    2  
ATOM 2301  O O    . PHE A 1 53 ? -7.954  6.905   -0.371  1.00 0.00 ? 53 PHE A O    2  
ATOM 2302  C CB   . PHE A 1 53 ? -8.901  6.306   2.670   1.00 0.00 ? 53 PHE A CB   2  
ATOM 2303  C CG   . PHE A 1 53 ? -8.614  5.443   3.859   1.00 0.00 ? 53 PHE A CG   2  
ATOM 2304  C CD1  . PHE A 1 53 ? -8.111  5.989   5.031   1.00 0.00 ? 53 PHE A CD1  2  
ATOM 2305  C CD2  . PHE A 1 53 ? -8.854  4.086   3.805   1.00 0.00 ? 53 PHE A CD2  2  
ATOM 2306  C CE1  . PHE A 1 53 ? -7.848  5.193   6.125   1.00 0.00 ? 53 PHE A CE1  2  
ATOM 2307  C CE2  . PHE A 1 53 ? -8.593  3.284   4.899   1.00 0.00 ? 53 PHE A CE2  2  
ATOM 2308  C CZ   . PHE A 1 53 ? -8.089  3.838   6.060   1.00 0.00 ? 53 PHE A CZ   2  
ATOM 2309  H H    . PHE A 1 53 ? -7.475  8.130   3.708   1.00 0.00 ? 53 PHE A H    2  
ATOM 2310  H HA   . PHE A 1 53 ? -6.937  6.094   1.834   1.00 0.00 ? 53 PHE A HA   2  
ATOM 2311  H HB2  . PHE A 1 53 ? -9.530  7.120   2.997   1.00 0.00 ? 53 PHE A HB2  2  
ATOM 2312  H HB3  . PHE A 1 53 ? -9.437  5.712   1.946   1.00 0.00 ? 53 PHE A HB3  2  
ATOM 2313  H HD1  . PHE A 1 53 ? -7.922  7.050   5.080   1.00 0.00 ? 53 PHE A HD1  2  
ATOM 2314  H HD2  . PHE A 1 53 ? -9.249  3.649   2.892   1.00 0.00 ? 53 PHE A HD2  2  
ATOM 2315  H HE1  . PHE A 1 53 ? -7.457  5.630   7.033   1.00 0.00 ? 53 PHE A HE1  2  
ATOM 2316  H HE2  . PHE A 1 53 ? -8.781  2.222   4.847   1.00 0.00 ? 53 PHE A HE2  2  
ATOM 2317  H HZ   . PHE A 1 53 ? -7.884  3.211   6.914   1.00 0.00 ? 53 PHE A HZ   2  
ATOM 2318  N N    . ILE A 1 54 ? -8.383  8.798   0.753   1.00 0.00 ? 54 ILE A N    2  
ATOM 2319  C CA   . ILE A 1 54 ? -8.796  9.507   -0.437  1.00 0.00 ? 54 ILE A CA   2  
ATOM 2320  C C    . ILE A 1 54 ? -7.587  9.658   -1.370  1.00 0.00 ? 54 ILE A C    2  
ATOM 2321  O O    . ILE A 1 54 ? -7.716  9.669   -2.593  1.00 0.00 ? 54 ILE A O    2  
ATOM 2322  C CB   . ILE A 1 54 ? -9.370  10.903  -0.096  1.00 0.00 ? 54 ILE A CB   2  
ATOM 2323  C CG1  . ILE A 1 54 ? -10.524 10.783  0.908   1.00 0.00 ? 54 ILE A CG1  2  
ATOM 2324  C CG2  . ILE A 1 54 ? -9.834  11.622  -1.356  1.00 0.00 ? 54 ILE A CG2  2  
ATOM 2325  C CD1  . ILE A 1 54 ? -11.678 9.933   0.419   1.00 0.00 ? 54 ILE A CD1  2  
ATOM 2326  H H    . ILE A 1 54 ? -8.329  9.281   1.619   1.00 0.00 ? 54 ILE A H    2  
ATOM 2327  H HA   . ILE A 1 54 ? -9.577  8.917   -0.924  1.00 0.00 ? 54 ILE A HA   2  
ATOM 2328  H HB   . ILE A 1 54 ? -8.579  11.489  0.350   1.00 0.00 ? 54 ILE A HB   2  
ATOM 2329  H HG12 . ILE A 1 54 ? -10.153 10.339  1.818   1.00 0.00 ? 54 ILE A HG12 2  
ATOM 2330  H HG13 . ILE A 1 54 ? -10.907 11.770  1.125   1.00 0.00 ? 54 ILE A HG13 2  
ATOM 2331  H HG21 . ILE A 1 54 ? -10.196 12.606  -1.096  1.00 0.00 ? 54 ILE A HG21 2  
ATOM 2332  H HG22 . ILE A 1 54 ? -10.629 11.057  -1.819  1.00 0.00 ? 54 ILE A HG22 2  
ATOM 2333  H HG23 . ILE A 1 54 ? -9.007  11.712  -2.044  1.00 0.00 ? 54 ILE A HG23 2  
ATOM 2334  H HD11 . ILE A 1 54 ? -12.086 10.364  -0.483  1.00 0.00 ? 54 ILE A HD11 2  
ATOM 2335  H HD12 . ILE A 1 54 ? -12.445 9.895   1.179   1.00 0.00 ? 54 ILE A HD12 2  
ATOM 2336  H HD13 . ILE A 1 54 ? -11.326 8.934   0.214   1.00 0.00 ? 54 ILE A HD13 2  
ATOM 2337  N N    . ASP A 1 55 ? -6.403  9.758   -0.762  1.00 0.00 ? 55 ASP A N    2  
ATOM 2338  C CA   . ASP A 1 55 ? -5.157  9.984   -1.498  1.00 0.00 ? 55 ASP A CA   2  
ATOM 2339  C C    . ASP A 1 55 ? -4.696  8.733   -2.253  1.00 0.00 ? 55 ASP A C    2  
ATOM 2340  O O    . ASP A 1 55 ? -4.240  8.831   -3.393  1.00 0.00 ? 55 ASP A O    2  
ATOM 2341  C CB   . ASP A 1 55 ? -4.057  10.456  -0.551  1.00 0.00 ? 55 ASP A CB   2  
ATOM 2342  C CG   . ASP A 1 55 ? -2.783  10.804  -1.290  1.00 0.00 ? 55 ASP A CG   2  
ATOM 2343  O OD1  . ASP A 1 55 ? -2.835  11.684  -2.174  1.00 0.00 ? 55 ASP A OD1  2  
ATOM 2344  O OD2  . ASP A 1 55 ? -1.726  10.223  -0.972  1.00 0.00 ? 55 ASP A OD2  2  
ATOM 2345  H H    . ASP A 1 55 ? -6.364  9.667   0.213   1.00 0.00 ? 55 ASP A H    2  
ATOM 2346  H HA   . ASP A 1 55 ? -5.347  10.765  -2.218  1.00 0.00 ? 55 ASP A HA   2  
ATOM 2347  H HB2  . ASP A 1 55 ? -4.395  11.333  -0.020  1.00 0.00 ? 55 ASP A HB2  2  
ATOM 2348  H HB3  . ASP A 1 55 ? -3.837  9.671   0.158   1.00 0.00 ? 55 ASP A HB3  2  
ATOM 2349  N N    . GLU A 1 56 ? -4.802  7.564   -1.619  1.00 0.00 ? 56 GLU A N    2  
ATOM 2350  C CA   . GLU A 1 56 ? -4.540  6.292   -2.304  1.00 0.00 ? 56 GLU A CA   2  
ATOM 2351  C C    . GLU A 1 56 ? -5.419  6.203   -3.552  1.00 0.00 ? 56 GLU A C    2  
ATOM 2352  O O    . GLU A 1 56 ? -4.995  5.709   -4.599  1.00 0.00 ? 56 GLU A O    2  
ATOM 2353  C CB   . GLU A 1 56 ? -4.824  5.112   -1.378  1.00 0.00 ? 56 GLU A CB   2  
ATOM 2354  C CG   . GLU A 1 56 ? -3.982  5.115   -0.111  1.00 0.00 ? 56 GLU A CG   2  
ATOM 2355  C CD   . GLU A 1 56 ? -2.508  5.343   -0.391  1.00 0.00 ? 56 GLU A CD   2  
ATOM 2356  O OE1  . GLU A 1 56 ? -1.967  4.711   -1.317  1.00 0.00 ? 56 GLU A OE1  2  
ATOM 2357  O OE2  . GLU A 1 56 ? -1.883  6.148   0.335   1.00 0.00 ? 56 GLU A OE2  2  
ATOM 2358  H H    . GLU A 1 56 ? -5.051  7.554   -0.668  1.00 0.00 ? 56 GLU A H    2  
ATOM 2359  H HA   . GLU A 1 56 ? -3.492  6.253   -2.603  1.00 0.00 ? 56 GLU A HA   2  
ATOM 2360  H HB2  . GLU A 1 56 ? -5.865  5.134   -1.094  1.00 0.00 ? 56 GLU A HB2  2  
ATOM 2361  H HB3  . GLU A 1 56 ? -4.625  4.196   -1.914  1.00 0.00 ? 56 GLU A HB3  2  
ATOM 2362  H HG2  . GLU A 1 56 ? -4.337  5.901   0.540   1.00 0.00 ? 56 GLU A HG2  2  
ATOM 2363  H HG3  . GLU A 1 56 ? -4.095  4.161   0.383   1.00 0.00 ? 56 GLU A HG3  2  
ATOM 2364  N N    . ALA A 1 57 ? -6.647  6.715   -3.431  1.00 0.00 ? 57 ALA A N    2  
ATOM 2365  C CA   . ALA A 1 57 ? -7.572  6.775   -4.560  1.00 0.00 ? 57 ALA A CA   2  
ATOM 2366  C C    . ALA A 1 57 ? -7.075  7.740   -5.637  1.00 0.00 ? 57 ALA A C    2  
ATOM 2367  O O    . ALA A 1 57 ? -7.225  7.474   -6.832  1.00 0.00 ? 57 ALA A O    2  
ATOM 2368  C CB   . ALA A 1 57 ? -8.963  7.177   -4.094  1.00 0.00 ? 57 ALA A CB   2  
ATOM 2369  H H    . ALA A 1 57 ? -6.941  7.045   -2.550  1.00 0.00 ? 57 ALA A H    2  
ATOM 2370  H HA   . ALA A 1 57 ? -7.637  5.784   -4.985  1.00 0.00 ? 57 ALA A HA   2  
ATOM 2371  H HB1  . ALA A 1 57 ? -9.288  6.507   -3.313  1.00 0.00 ? 57 ALA A HB1  2  
ATOM 2372  H HB2  . ALA A 1 57 ? -9.651  7.124   -4.927  1.00 0.00 ? 57 ALA A HB2  2  
ATOM 2373  H HB3  . ALA A 1 57 ? -8.938  8.188   -3.713  1.00 0.00 ? 57 ALA A HB3  2  
ATOM 2374  N N    . LYS A 1 58 ? -6.485  8.859   -5.216  1.00 0.00 ? 58 LYS A N    2  
ATOM 2375  C CA   . LYS A 1 58 ? -5.913  9.825   -6.154  1.00 0.00 ? 58 LYS A CA   2  
ATOM 2376  C C    . LYS A 1 58 ? -4.821  9.157   -6.976  1.00 0.00 ? 58 LYS A C    2  
ATOM 2377  O O    . LYS A 1 58 ? -4.770  9.294   -8.200  1.00 0.00 ? 58 LYS A O    2  
ATOM 2378  C CB   . LYS A 1 58 ? -5.307  11.025  -5.421  1.00 0.00 ? 58 LYS A CB   2  
ATOM 2379  C CG   . LYS A 1 58 ? -6.265  11.756  -4.499  1.00 0.00 ? 58 LYS A CG   2  
ATOM 2380  C CD   . LYS A 1 58 ? -5.568  12.922  -3.817  1.00 0.00 ? 58 LYS A CD   2  
ATOM 2381  C CE   . LYS A 1 58 ? -6.429  13.538  -2.734  1.00 0.00 ? 58 LYS A CE   2  
ATOM 2382  N NZ   . LYS A 1 58 ? -5.767  14.715  -2.115  1.00 0.00 ? 58 LYS A NZ   2  
ATOM 2383  H H    . LYS A 1 58 ? -6.430  9.036   -4.251  1.00 0.00 ? 58 LYS A H    2  
ATOM 2384  H HA   . LYS A 1 58 ? -6.698  10.164  -6.812  1.00 0.00 ? 58 LYS A HA   2  
ATOM 2385  H HB2  . LYS A 1 58 ? -4.474  10.680  -4.827  1.00 0.00 ? 58 LYS A HB2  2  
ATOM 2386  H HB3  . LYS A 1 58 ? -4.943  11.729  -6.154  1.00 0.00 ? 58 LYS A HB3  2  
ATOM 2387  H HG2  . LYS A 1 58 ? -7.096  12.132  -5.078  1.00 0.00 ? 58 LYS A HG2  2  
ATOM 2388  H HG3  . LYS A 1 58 ? -6.622  11.070  -3.747  1.00 0.00 ? 58 LYS A HG3  2  
ATOM 2389  H HD2  . LYS A 1 58 ? -4.651  12.566  -3.369  1.00 0.00 ? 58 LYS A HD2  2  
ATOM 2390  H HD3  . LYS A 1 58 ? -5.341  13.675  -4.555  1.00 0.00 ? 58 LYS A HD3  2  
ATOM 2391  H HE2  . LYS A 1 58 ? -7.368  13.850  -3.169  1.00 0.00 ? 58 LYS A HE2  2  
ATOM 2392  H HE3  . LYS A 1 58 ? -6.614  12.797  -1.971  1.00 0.00 ? 58 LYS A HE3  2  
ATOM 2393  H HZ1  . LYS A 1 58 ? -4.815  14.457  -1.772  1.00 0.00 ? 58 LYS A HZ1  2  
ATOM 2394  H HZ2  . LYS A 1 58 ? -6.333  15.065  -1.312  1.00 0.00 ? 58 LYS A HZ2  2  
ATOM 2395  H HZ3  . LYS A 1 58 ? -5.672  15.483  -2.817  1.00 0.00 ? 58 LYS A HZ3  2  
ATOM 2396  N N    . ARG A 1 59 ? -3.952  8.430   -6.279  1.00 0.00 ? 59 ARG A N    2  
ATOM 2397  C CA   . ARG A 1 59 ? -2.877  7.689   -6.922  1.00 0.00 ? 59 ARG A CA   2  
ATOM 2398  C C    . ARG A 1 59 ? -3.438  6.709   -7.945  1.00 0.00 ? 59 ARG A C    2  
ATOM 2399  O O    . ARG A 1 59 ? -2.901  6.578   -9.045  1.00 0.00 ? 59 ARG A O    2  
ATOM 2400  C CB   . ARG A 1 59 ? -2.035  6.941   -5.882  1.00 0.00 ? 59 ARG A CB   2  
ATOM 2401  C CG   . ARG A 1 59 ? -0.758  7.666   -5.472  1.00 0.00 ? 59 ARG A CG   2  
ATOM 2402  C CD   . ARG A 1 59 ? -1.035  8.995   -4.786  1.00 0.00 ? 59 ARG A CD   2  
ATOM 2403  N NE   . ARG A 1 59 ? 0.199   9.748   -4.551  1.00 0.00 ? 59 ARG A NE   2  
ATOM 2404  C CZ   . ARG A 1 59 ? 0.242   11.054  -4.282  1.00 0.00 ? 59 ARG A CZ   2  
ATOM 2405  N NH1  . ARG A 1 59 ? -0.877  11.740  -4.090  1.00 0.00 ? 59 ARG A NH1  2  
ATOM 2406  N NH2  . ARG A 1 59 ? 1.408   11.674  -4.171  1.00 0.00 ? 59 ARG A NH2  2  
ATOM 2407  H H    . ARG A 1 59 ? -4.041  8.394   -5.299  1.00 0.00 ? 59 ARG A H    2  
ATOM 2408  H HA   . ARG A 1 59 ? -2.247  8.403   -7.435  1.00 0.00 ? 59 ARG A HA   2  
ATOM 2409  H HB2  . ARG A 1 59 ? -2.634  6.789   -4.997  1.00 0.00 ? 59 ARG A HB2  2  
ATOM 2410  H HB3  . ARG A 1 59 ? -1.762  5.979   -6.289  1.00 0.00 ? 59 ARG A HB3  2  
ATOM 2411  H HG2  . ARG A 1 59 ? -0.207  7.033   -4.791  1.00 0.00 ? 59 ARG A HG2  2  
ATOM 2412  H HG3  . ARG A 1 59 ? -0.162  7.844   -6.355  1.00 0.00 ? 59 ARG A HG3  2  
ATOM 2413  H HD2  . ARG A 1 59 ? -1.691  9.581   -5.413  1.00 0.00 ? 59 ARG A HD2  2  
ATOM 2414  H HD3  . ARG A 1 59 ? -1.517  8.807   -3.837  1.00 0.00 ? 59 ARG A HD3  2  
ATOM 2415  H HE   . ARG A 1 59 ? 1.046   9.255   -4.627  1.00 0.00 ? 59 ARG A HE   2  
ATOM 2416  H HH11 . ARG A 1 59 ? -1.767  11.283  -4.139  1.00 0.00 ? 59 ARG A HH11 2  
ATOM 2417  H HH12 . ARG A 1 59 ? -0.834  12.722  -3.885  1.00 0.00 ? 59 ARG A HH12 2  
ATOM 2418  H HH21 . ARG A 1 59 ? 2.271   11.163  -4.289  1.00 0.00 ? 59 ARG A HH21 2  
ATOM 2419  H HH22 . ARG A 1 59 ? 1.436   12.661  -3.969  1.00 0.00 ? 59 ARG A HH22 2  
ATOM 2420  N N    . LEU A 1 60 ? -4.523  6.032   -7.584  1.00 0.00 ? 60 LEU A N    2  
ATOM 2421  C CA   . LEU A 1 60 ? -5.174  5.094   -8.489  1.00 0.00 ? 60 LEU A CA   2  
ATOM 2422  C C    . LEU A 1 60 ? -5.587  5.788   -9.781  1.00 0.00 ? 60 LEU A C    2  
ATOM 2423  O O    . LEU A 1 60 ? -5.302  5.295   -10.874 1.00 0.00 ? 60 LEU A O    2  
ATOM 2424  C CB   . LEU A 1 60 ? -6.403  4.459   -7.834  1.00 0.00 ? 60 LEU A CB   2  
ATOM 2425  C CG   . LEU A 1 60 ? -6.125  3.621   -6.588  1.00 0.00 ? 60 LEU A CG   2  
ATOM 2426  C CD1  . LEU A 1 60 ? -7.416  3.027   -6.047  1.00 0.00 ? 60 LEU A CD1  2  
ATOM 2427  C CD2  . LEU A 1 60 ? -5.122  2.521   -6.897  1.00 0.00 ? 60 LEU A CD2  2  
ATOM 2428  H H    . LEU A 1 60 ? -4.894  6.165   -6.683  1.00 0.00 ? 60 LEU A H    2  
ATOM 2429  H HA   . LEU A 1 60 ? -4.461  4.319   -8.727  1.00 0.00 ? 60 LEU A HA   2  
ATOM 2430  H HB2  . LEU A 1 60 ? -7.088  5.251   -7.561  1.00 0.00 ? 60 LEU A HB2  2  
ATOM 2431  H HB3  . LEU A 1 60 ? -6.885  3.827   -8.564  1.00 0.00 ? 60 LEU A HB3  2  
ATOM 2432  H HG   . LEU A 1 60 ? -5.706  4.258   -5.822  1.00 0.00 ? 60 LEU A HG   2  
ATOM 2433  H HD11 . LEU A 1 60 ? -8.101  3.823   -5.800  1.00 0.00 ? 60 LEU A HD11 2  
ATOM 2434  H HD12 . LEU A 1 60 ? -7.204  2.446   -5.160  1.00 0.00 ? 60 LEU A HD12 2  
ATOM 2435  H HD13 . LEU A 1 60 ? -7.858  2.390   -6.797  1.00 0.00 ? 60 LEU A HD13 2  
ATOM 2436  H HD21 . LEU A 1 60 ? -4.936  1.940   -6.005  1.00 0.00 ? 60 LEU A HD21 2  
ATOM 2437  H HD22 . LEU A 1 60 ? -4.198  2.963   -7.237  1.00 0.00 ? 60 LEU A HD22 2  
ATOM 2438  H HD23 . LEU A 1 60 ? -5.519  1.879   -7.669  1.00 0.00 ? 60 LEU A HD23 2  
ATOM 2439  N N    . ARG A 1 61 ? -6.243  6.937   -9.651  1.00 0.00 ? 61 ARG A N    2  
ATOM 2440  C CA   . ARG A 1 61 ? -6.698  7.684   -10.813 1.00 0.00 ? 61 ARG A CA   2  
ATOM 2441  C C    . ARG A 1 61 ? -5.521  8.134   -11.668 1.00 0.00 ? 61 ARG A C    2  
ATOM 2442  O O    . ARG A 1 61 ? -5.504  7.895   -12.866 1.00 0.00 ? 61 ARG A O    2  
ATOM 2443  C CB   . ARG A 1 61 ? -7.526  8.910   -10.408 1.00 0.00 ? 61 ARG A CB   2  
ATOM 2444  C CG   . ARG A 1 61 ? -8.012  9.713   -11.610 1.00 0.00 ? 61 ARG A CG   2  
ATOM 2445  C CD   . ARG A 1 61 ? -7.686  11.195  -11.479 1.00 0.00 ? 61 ARG A CD   2  
ATOM 2446  N NE   . ARG A 1 61 ? -8.609  11.898  -10.587 1.00 0.00 ? 61 ARG A NE   2  
ATOM 2447  C CZ   . ARG A 1 61 ? -8.296  13.013  -9.919  1.00 0.00 ? 61 ARG A CZ   2  
ATOM 2448  N NH1  . ARG A 1 61 ? -7.067  13.517  -9.988  1.00 0.00 ? 61 ARG A NH1  2  
ATOM 2449  N NH2  . ARG A 1 61 ? -9.217  13.621  -9.178  1.00 0.00 ? 61 ARG A NH2  2  
ATOM 2450  H H    . ARG A 1 61 ? -6.420  7.291   -8.752  1.00 0.00 ? 61 ARG A H    2  
ATOM 2451  H HA   . ARG A 1 61 ? -7.317  7.023   -11.403 1.00 0.00 ? 61 ARG A HA   2  
ATOM 2452  H HB2  . ARG A 1 61 ? -8.388  8.582   -9.845  1.00 0.00 ? 61 ARG A HB2  2  
ATOM 2453  H HB3  . ARG A 1 61 ? -6.921  9.554   -9.788  1.00 0.00 ? 61 ARG A HB3  2  
ATOM 2454  H HG2  . ARG A 1 61 ? -7.534  9.331   -12.500 1.00 0.00 ? 61 ARG A HG2  2  
ATOM 2455  H HG3  . ARG A 1 61 ? -9.081  9.596   -11.698 1.00 0.00 ? 61 ARG A HG3  2  
ATOM 2456  H HD2  . ARG A 1 61 ? -6.684  11.295  -11.091 1.00 0.00 ? 61 ARG A HD2  2  
ATOM 2457  H HD3  . ARG A 1 61 ? -7.737  11.646  -12.459 1.00 0.00 ? 61 ARG A HD3  2  
ATOM 2458  H HE   . ARG A 1 61 ? -9.518  11.534  -10.507 1.00 0.00 ? 61 ARG A HE   2  
ATOM 2459  H HH11 . ARG A 1 61 ? -6.360  13.065  -10.548 1.00 0.00 ? 61 ARG A HH11 2  
ATOM 2460  H HH12 . ARG A 1 61 ? -6.835  14.359  -9.483  1.00 0.00 ? 61 ARG A HH12 2  
ATOM 2461  H HH21 . ARG A 1 61 ? -10.143 13.251  -9.118  1.00 0.00 ? 61 ARG A HH21 2  
ATOM 2462  H HH22 . ARG A 1 61 ? -8.985  14.472  -8.677  1.00 0.00 ? 61 ARG A HH22 2  
ATOM 2463  N N    . ALA A 1 62 ? -4.539  8.775   -11.040 1.00 0.00 ? 62 ALA A N    2  
ATOM 2464  C CA   . ALA A 1 62 ? -3.399  9.340   -11.761 1.00 0.00 ? 62 ALA A CA   2  
ATOM 2465  C C    . ALA A 1 62 ? -2.660  8.277   -12.570 1.00 0.00 ? 62 ALA A C    2  
ATOM 2466  O O    . ALA A 1 62 ? -2.389  8.456   -13.762 1.00 0.00 ? 62 ALA A O    2  
ATOM 2467  C CB   . ALA A 1 62 ? -2.446  10.020  -10.788 1.00 0.00 ? 62 ALA A CB   2  
ATOM 2468  H H    . ALA A 1 62 ? -4.580  8.872   -10.060 1.00 0.00 ? 62 ALA A H    2  
ATOM 2469  H HA   . ALA A 1 62 ? -3.777  10.092  -12.437 1.00 0.00 ? 62 ALA A HA   2  
ATOM 2470  H HB1  . ALA A 1 62 ? -2.054  9.286   -10.099 1.00 0.00 ? 62 ALA A HB1  2  
ATOM 2471  H HB2  . ALA A 1 62 ? -2.977  10.783  -10.240 1.00 0.00 ? 62 ALA A HB2  2  
ATOM 2472  H HB3  . ALA A 1 62 ? -1.632  10.469  -11.338 1.00 0.00 ? 62 ALA A HB3  2  
ATOM 2473  N N    . LEU A 1 63 ? -2.373  7.154   -11.933 1.00 0.00 ? 63 LEU A N    2  
ATOM 2474  C CA   . LEU A 1 63 ? -1.608  6.102   -12.566 1.00 0.00 ? 63 LEU A CA   2  
ATOM 2475  C C    . LEU A 1 63 ? -2.413  5.473   -13.673 1.00 0.00 ? 63 LEU A C    2  
ATOM 2476  O O    . LEU A 1 63 ? -1.908  5.237   -14.765 1.00 0.00 ? 63 LEU A O    2  
ATOM 2477  C CB   . LEU A 1 63 ? -1.194  5.035   -11.548 1.00 0.00 ? 63 LEU A CB   2  
ATOM 2478  C CG   . LEU A 1 63 ? -0.390  5.549   -10.350 1.00 0.00 ? 63 LEU A CG   2  
ATOM 2479  C CD1  . LEU A 1 63 ? -0.012  4.401   -9.426  1.00 0.00 ? 63 LEU A CD1  2  
ATOM 2480  C CD2  . LEU A 1 63 ? 0.854   6.296   -10.812 1.00 0.00 ? 63 LEU A CD2  2  
ATOM 2481  H H    . LEU A 1 63 ? -2.700  7.022   -11.025 1.00 0.00 ? 63 LEU A H    2  
ATOM 2482  H HA   . LEU A 1 63 ? -0.731  6.540   -12.993 1.00 0.00 ? 63 LEU A HA   2  
ATOM 2483  H HB2  . LEU A 1 63 ? -2.090  4.561   -11.174 1.00 0.00 ? 63 LEU A HB2  2  
ATOM 2484  H HB3  . LEU A 1 63 ? -0.599  4.294   -12.061 1.00 0.00 ? 63 LEU A HB3  2  
ATOM 2485  H HG   . LEU A 1 63 ? -1.006  6.238   -9.787  1.00 0.00 ? 63 LEU A HG   2  
ATOM 2486  H HD11 . LEU A 1 63 ? -0.910  3.932   -9.053  1.00 0.00 ? 63 LEU A HD11 2  
ATOM 2487  H HD12 . LEU A 1 63 ? 0.568   4.781   -8.599  1.00 0.00 ? 63 LEU A HD12 2  
ATOM 2488  H HD13 . LEU A 1 63 ? 0.572   3.675   -9.973  1.00 0.00 ? 63 LEU A HD13 2  
ATOM 2489  H HD21 . LEU A 1 63 ? 0.561   7.130   -11.433 1.00 0.00 ? 63 LEU A HD21 2  
ATOM 2490  H HD22 . LEU A 1 63 ? 1.486   5.629   -11.381 1.00 0.00 ? 63 LEU A HD22 2  
ATOM 2491  H HD23 . LEU A 1 63 ? 1.395   6.659   -9.953  1.00 0.00 ? 63 LEU A HD23 2  
ATOM 2492  N N    . HIS A 1 64 ? -3.671  5.217   -13.393 1.00 0.00 ? 64 HIS A N    2  
ATOM 2493  C CA   . HIS A 1 64 ? -4.502  4.502   -14.328 1.00 0.00 ? 64 HIS A CA   2  
ATOM 2494  C C    . HIS A 1 64 ? -5.076  5.394   -15.421 1.00 0.00 ? 64 HIS A C    2  
ATOM 2495  O O    . HIS A 1 64 ? -5.502  4.895   -16.460 1.00 0.00 ? 64 HIS A O    2  
ATOM 2496  C CB   . HIS A 1 64 ? -5.587  3.727   -13.593 1.00 0.00 ? 64 HIS A CB   2  
ATOM 2497  C CG   . HIS A 1 64 ? -5.026  2.551   -12.856 1.00 0.00 ? 64 HIS A CG   2  
ATOM 2498  N ND1  . HIS A 1 64 ? -4.299  1.560   -13.479 1.00 0.00 ? 64 HIS A ND1  2  
ATOM 2499  C CD2  . HIS A 1 64 ? -5.029  2.242   -11.542 1.00 0.00 ? 64 HIS A CD2  2  
ATOM 2500  C CE1  . HIS A 1 64 ? -3.883  0.694   -12.576 1.00 0.00 ? 64 HIS A CE1  2  
ATOM 2501  N NE2  . HIS A 1 64 ? -4.306  1.084   -11.387 1.00 0.00 ? 64 HIS A NE2  2  
ATOM 2502  H H    . HIS A 1 64 ? -4.051  5.525   -12.539 1.00 0.00 ? 64 HIS A H    2  
ATOM 2503  H HA   . HIS A 1 64 ? -3.848  3.791   -14.806 1.00 0.00 ? 64 HIS A HA   2  
ATOM 2504  H HB2  . HIS A 1 64 ? -6.065  4.378   -12.875 1.00 0.00 ? 64 HIS A HB2  2  
ATOM 2505  H HB3  . HIS A 1 64 ? -6.314  3.371   -14.298 1.00 0.00 ? 64 HIS A HB3  2  
ATOM 2506  H HD1  . HIS A 1 64 ? -4.092  1.515   -14.441 1.00 0.00 ? 64 HIS A HD1  2  
ATOM 2507  H HD2  . HIS A 1 64 ? -5.513  2.803   -10.755 1.00 0.00 ? 64 HIS A HD2  2  
ATOM 2508  H HE1  . HIS A 1 64 ? -3.290  -0.188  -12.775 1.00 0.00 ? 64 HIS A HE1  2  
ATOM 2509  H HE2  . HIS A 1 64 ? -3.873  0.816   -10.541 1.00 0.00 ? 64 HIS A HE2  2  
ATOM 2510  N N    . MET A 1 65 ? -5.099  6.702   -15.203 1.00 0.00 ? 65 MET A N    2  
ATOM 2511  C CA   . MET A 1 65 ? -5.495  7.621   -16.262 1.00 0.00 ? 65 MET A CA   2  
ATOM 2512  C C    . MET A 1 65 ? -4.376  7.690   -17.291 1.00 0.00 ? 65 MET A C    2  
ATOM 2513  O O    . MET A 1 65 ? -4.612  7.943   -18.472 1.00 0.00 ? 65 MET A O    2  
ATOM 2514  C CB   . MET A 1 65 ? -5.831  9.017   -15.711 1.00 0.00 ? 65 MET A CB   2  
ATOM 2515  C CG   . MET A 1 65 ? -4.624  9.820   -15.252 1.00 0.00 ? 65 MET A CG   2  
ATOM 2516  S SD   . MET A 1 65 ? -5.076  11.345  -14.397 1.00 0.00 ? 65 MET A SD   2  
ATOM 2517  C CE   . MET A 1 65 ? -5.998  12.196  -15.676 1.00 0.00 ? 65 MET A CE   2  
ATOM 2518  H H    . MET A 1 65 ? -4.864  7.055   -14.315 1.00 0.00 ? 65 MET A H    2  
ATOM 2519  H HA   . MET A 1 65 ? -6.375  7.208   -16.740 1.00 0.00 ? 65 MET A HA   2  
ATOM 2520  H HB2  . MET A 1 65 ? -6.336  9.580   -16.481 1.00 0.00 ? 65 MET A HB2  2  
ATOM 2521  H HB3  . MET A 1 65 ? -6.499  8.904   -14.870 1.00 0.00 ? 65 MET A HB3  2  
ATOM 2522  H HG2  . MET A 1 65 ? -4.041  9.209   -14.579 1.00 0.00 ? 65 MET A HG2  2  
ATOM 2523  H HG3  . MET A 1 65 ? -4.026  10.070  -16.115 1.00 0.00 ? 65 MET A HG3  2  
ATOM 2524  H HE1  . MET A 1 65 ? -5.360  12.358  -16.532 1.00 0.00 ? 65 MET A HE1  2  
ATOM 2525  H HE2  . MET A 1 65 ? -6.341  13.147  -15.298 1.00 0.00 ? 65 MET A HE2  2  
ATOM 2526  H HE3  . MET A 1 65 ? -6.846  11.596  -15.967 1.00 0.00 ? 65 MET A HE3  2  
ATOM 2527  N N    . LYS A 1 66 ? -3.152  7.443   -16.831 1.00 0.00 ? 66 LYS A N    2  
ATOM 2528  C CA   . LYS A 1 66 ? -2.018  7.316   -17.733 1.00 0.00 ? 66 LYS A CA   2  
ATOM 2529  C C    . LYS A 1 66 ? -1.933  5.900   -18.303 1.00 0.00 ? 66 LYS A C    2  
ATOM 2530  O O    . LYS A 1 66 ? -1.976  5.705   -19.521 1.00 0.00 ? 66 LYS A O    2  
ATOM 2531  C CB   . LYS A 1 66 ? -0.718  7.659   -17.006 1.00 0.00 ? 66 LYS A CB   2  
ATOM 2532  C CG   . LYS A 1 66 ? -0.640  9.103   -16.552 1.00 0.00 ? 66 LYS A CG   2  
ATOM 2533  C CD   . LYS A 1 66 ? 0.678   9.391   -15.854 1.00 0.00 ? 66 LYS A CD   2  
ATOM 2534  C CE   . LYS A 1 66 ? 0.822   10.866  -15.524 1.00 0.00 ? 66 LYS A CE   2  
ATOM 2535  N NZ   . LYS A 1 66 ? 0.825   11.708  -16.750 1.00 0.00 ? 66 LYS A NZ   2  
ATOM 2536  H H    . LYS A 1 66 ? -3.005  7.366   -15.855 1.00 0.00 ? 66 LYS A H    2  
ATOM 2537  H HA   . LYS A 1 66 ? -2.160  8.013   -18.546 1.00 0.00 ? 66 LYS A HA   2  
ATOM 2538  H HB2  . LYS A 1 66 ? -0.628  7.027   -16.135 1.00 0.00 ? 66 LYS A HB2  2  
ATOM 2539  H HB3  . LYS A 1 66 ? 0.115   7.467   -17.667 1.00 0.00 ? 66 LYS A HB3  2  
ATOM 2540  H HG2  . LYS A 1 66 ? -0.728  9.746   -17.415 1.00 0.00 ? 66 LYS A HG2  2  
ATOM 2541  H HG3  . LYS A 1 66 ? -1.451  9.301   -15.868 1.00 0.00 ? 66 LYS A HG3  2  
ATOM 2542  H HD2  . LYS A 1 66 ? 0.723   8.823   -14.939 1.00 0.00 ? 66 LYS A HD2  2  
ATOM 2543  H HD3  . LYS A 1 66 ? 1.489   9.097   -16.505 1.00 0.00 ? 66 LYS A HD3  2  
ATOM 2544  H HE2  . LYS A 1 66 ? -0.001  11.165  -14.893 1.00 0.00 ? 66 LYS A HE2  2  
ATOM 2545  H HE3  . LYS A 1 66 ? 1.753   11.015  -14.994 1.00 0.00 ? 66 LYS A HE3  2  
ATOM 2546  H HZ1  . LYS A 1 66 ? 1.625   11.447  -17.362 1.00 0.00 ? 66 LYS A HZ1  2  
ATOM 2547  H HZ2  . LYS A 1 66 ? 0.918   12.714  -16.493 1.00 0.00 ? 66 LYS A HZ2  2  
ATOM 2548  H HZ3  . LYS A 1 66 ? -0.063  11.579  -17.282 1.00 0.00 ? 66 LYS A HZ3  2  
ATOM 2549  N N    . GLU A 1 67 ? -1.839  4.918   -17.417 1.00 0.00 ? 67 GLU A N    2  
ATOM 2550  C CA   . GLU A 1 67 ? -1.630  3.533   -17.816 1.00 0.00 ? 67 GLU A CA   2  
ATOM 2551  C C    . GLU A 1 67 ? -2.775  2.643   -17.329 1.00 0.00 ? 67 GLU A C    2  
ATOM 2552  O O    . GLU A 1 67 ? -3.044  2.552   -16.128 1.00 0.00 ? 67 GLU A O    2  
ATOM 2553  C CB   . GLU A 1 67 ? -0.294  3.041   -17.250 1.00 0.00 ? 67 GLU A CB   2  
ATOM 2554  C CG   . GLU A 1 67 ? 0.145   1.686   -17.775 1.00 0.00 ? 67 GLU A CG   2  
ATOM 2555  C CD   . GLU A 1 67 ? 0.275   1.674   -19.280 1.00 0.00 ? 67 GLU A CD   2  
ATOM 2556  O OE1  . GLU A 1 67 ? 0.988   2.543   -19.828 1.00 0.00 ? 67 GLU A OE1  2  
ATOM 2557  O OE2  . GLU A 1 67 ? -0.337  0.797   -19.926 1.00 0.00 ? 67 GLU A OE2  2  
ATOM 2558  H H    . GLU A 1 67 ? -1.907  5.129   -16.457 1.00 0.00 ? 67 GLU A H    2  
ATOM 2559  H HA   . GLU A 1 67 ? -1.591  3.495   -18.894 1.00 0.00 ? 67 GLU A HA   2  
ATOM 2560  H HB2  . GLU A 1 67 ? 0.472   3.759   -17.503 1.00 0.00 ? 67 GLU A HB2  2  
ATOM 2561  H HB3  . GLU A 1 67 ? -0.373  2.979   -16.175 1.00 0.00 ? 67 GLU A HB3  2  
ATOM 2562  H HG2  . GLU A 1 67 ? 1.103   1.439   -17.343 1.00 0.00 ? 67 GLU A HG2  2  
ATOM 2563  H HG3  . GLU A 1 67 ? -0.584  0.944   -17.483 1.00 0.00 ? 67 GLU A HG3  2  
ATOM 2564  N N    . HIS A 1 68 ? -3.451  1.994   -18.267 1.00 0.00 ? 68 HIS A N    2  
ATOM 2565  C CA   . HIS A 1 68 ? -4.551  1.100   -17.930 1.00 0.00 ? 68 HIS A CA   2  
ATOM 2566  C C    . HIS A 1 68 ? -4.698  -0.006  -18.971 1.00 0.00 ? 68 HIS A C    2  
ATOM 2567  O O    . HIS A 1 68 ? -4.495  0.220   -20.162 1.00 0.00 ? 68 HIS A O    2  
ATOM 2568  C CB   . HIS A 1 68 ? -5.870  1.881   -17.800 1.00 0.00 ? 68 HIS A CB   2  
ATOM 2569  C CG   . HIS A 1 68 ? -6.203  2.749   -18.982 1.00 0.00 ? 68 HIS A CG   2  
ATOM 2570  N ND1  . HIS A 1 68 ? -6.014  4.114   -18.987 1.00 0.00 ? 68 HIS A ND1  2  
ATOM 2571  C CD2  . HIS A 1 68 ? -6.723  2.441   -20.192 1.00 0.00 ? 68 HIS A CD2  2  
ATOM 2572  C CE1  . HIS A 1 68 ? -6.403  4.606   -20.148 1.00 0.00 ? 68 HIS A CE1  2  
ATOM 2573  N NE2  . HIS A 1 68 ? -6.836  3.613   -20.899 1.00 0.00 ? 68 HIS A NE2  2  
ATOM 2574  H H    . HIS A 1 68 ? -3.194  2.106   -19.215 1.00 0.00 ? 68 HIS A H    2  
ATOM 2575  H HA   . HIS A 1 68 ? -4.322  0.646   -16.976 1.00 0.00 ? 68 HIS A HA   2  
ATOM 2576  H HB2  . HIS A 1 68 ? -6.680  1.179   -17.673 1.00 0.00 ? 68 HIS A HB2  2  
ATOM 2577  H HB3  . HIS A 1 68 ? -5.814  2.515   -16.928 1.00 0.00 ? 68 HIS A HB3  2  
ATOM 2578  H HD1  . HIS A 1 68 ? -5.653  4.646   -18.240 1.00 0.00 ? 68 HIS A HD1  2  
ATOM 2579  H HD2  . HIS A 1 68 ? -6.992  1.454   -20.543 1.00 0.00 ? 68 HIS A HD2  2  
ATOM 2580  H HE1  . HIS A 1 68 ? -6.364  5.647   -20.438 1.00 0.00 ? 68 HIS A HE1  2  
ATOM 2581  H HE2  . HIS A 1 68 ? -7.002  3.673   -21.874 1.00 0.00 ? 68 HIS A HE2  2  
ATOM 2582  N N    . PRO A 1 69 ? -5.044  -1.220  -18.521 1.00 0.00 ? 69 PRO A N    2  
ATOM 2583  C CA   . PRO A 1 69 ? -5.314  -2.355  -19.398 1.00 0.00 ? 69 PRO A CA   2  
ATOM 2584  C C    . PRO A 1 69 ? -6.775  -2.396  -19.853 1.00 0.00 ? 69 PRO A C    2  
ATOM 2585  O O    . PRO A 1 69 ? -7.514  -1.424  -19.692 1.00 0.00 ? 69 PRO A O    2  
ATOM 2586  C CB   . PRO A 1 69 ? -4.989  -3.572  -18.515 1.00 0.00 ? 69 PRO A CB   2  
ATOM 2587  C CG   . PRO A 1 69 ? -4.641  -3.024  -17.159 1.00 0.00 ? 69 PRO A CG   2  
ATOM 2588  C CD   . PRO A 1 69 ? -5.148  -1.613  -17.122 1.00 0.00 ? 69 PRO A CD   2  
ATOM 2589  H HA   . PRO A 1 69 ? -4.669  -2.350  -20.264 1.00 0.00 ? 69 PRO A HA   2  
ATOM 2590  H HB2  . PRO A 1 69 ? -5.853  -4.219  -18.466 1.00 0.00 ? 69 PRO A HB2  2  
ATOM 2591  H HB3  . PRO A 1 69 ? -4.157  -4.112  -18.943 1.00 0.00 ? 69 PRO A HB3  2  
ATOM 2592  H HG2  . PRO A 1 69 ? -5.121  -3.612  -16.392 1.00 0.00 ? 69 PRO A HG2  2  
ATOM 2593  H HG3  . PRO A 1 69 ? -3.569  -3.037  -17.025 1.00 0.00 ? 69 PRO A HG3  2  
ATOM 2594  H HD2  . PRO A 1 69 ? -6.174  -1.582  -16.783 1.00 0.00 ? 69 PRO A HD2  2  
ATOM 2595  H HD3  . PRO A 1 69 ? -4.519  -0.996  -16.497 1.00 0.00 ? 69 PRO A HD3  2  
ATOM 2596  N N    . ASP A 1 70 ? -7.193  -3.538  -20.395 1.00 0.00 ? 70 ASP A N    2  
ATOM 2597  C CA   . ASP A 1 70 ? -8.535  -3.688  -20.960 1.00 0.00 ? 70 ASP A CA   2  
ATOM 2598  C C    . ASP A 1 70 ? -9.577  -4.068  -19.909 1.00 0.00 ? 70 ASP A C    2  
ATOM 2599  O O    . ASP A 1 70 ? -10.665 -4.532  -20.253 1.00 0.00 ? 70 ASP A O    2  
ATOM 2600  C CB   . ASP A 1 70 ? -8.530  -4.739  -22.072 1.00 0.00 ? 70 ASP A CB   2  
ATOM 2601  C CG   . ASP A 1 70 ? -7.945  -4.224  -23.369 1.00 0.00 ? 70 ASP A CG   2  
ATOM 2602  O OD1  . ASP A 1 70 ? -6.710  -4.052  -23.444 1.00 0.00 ? 70 ASP A OD1  2  
ATOM 2603  O OD2  . ASP A 1 70 ? -8.722  -3.984  -24.316 1.00 0.00 ? 70 ASP A OD2  2  
ATOM 2604  H H    . ASP A 1 70 ? -6.574  -4.300  -20.434 1.00 0.00 ? 70 ASP A H    2  
ATOM 2605  H HA   . ASP A 1 70 ? -8.815  -2.738  -21.386 1.00 0.00 ? 70 ASP A HA   2  
ATOM 2606  H HB2  . ASP A 1 70 ? -7.945  -5.587  -21.751 1.00 0.00 ? 70 ASP A HB2  2  
ATOM 2607  H HB3  . ASP A 1 70 ? -9.546  -5.056  -22.258 1.00 0.00 ? 70 ASP A HB3  2  
ATOM 2608  N N    . TYR A 1 71 ? -9.257  -3.868  -18.636 1.00 0.00 ? 71 TYR A N    2  
ATOM 2609  C CA   . TYR A 1 71 ? -10.230 -4.106  -17.572 1.00 0.00 ? 71 TYR A CA   2  
ATOM 2610  C C    . TYR A 1 71 ? -11.363 -3.092  -17.681 1.00 0.00 ? 71 TYR A C    2  
ATOM 2611  O O    . TYR A 1 71 ? -11.164 -1.894  -17.480 1.00 0.00 ? 71 TYR A O    2  
ATOM 2612  C CB   . TYR A 1 71 ? -9.571  -4.026  -16.192 1.00 0.00 ? 71 TYR A CB   2  
ATOM 2613  C CG   . TYR A 1 71 ? -8.596  -5.150  -15.910 1.00 0.00 ? 71 TYR A CG   2  
ATOM 2614  C CD1  . TYR A 1 71 ? -9.043  -6.388  -15.466 1.00 0.00 ? 71 TYR A CD1  2  
ATOM 2615  C CD2  . TYR A 1 71 ? -7.231  -4.974  -16.083 1.00 0.00 ? 71 TYR A CD2  2  
ATOM 2616  C CE1  . TYR A 1 71 ? -8.155  -7.416  -15.203 1.00 0.00 ? 71 TYR A CE1  2  
ATOM 2617  C CE2  . TYR A 1 71 ? -6.337  -5.996  -15.823 1.00 0.00 ? 71 TYR A CE2  2  
ATOM 2618  C CZ   . TYR A 1 71 ? -6.803  -7.216  -15.383 1.00 0.00 ? 71 TYR A CZ   2  
ATOM 2619  O OH   . TYR A 1 71 ? -5.912  -8.237  -15.120 1.00 0.00 ? 71 TYR A OH   2  
ATOM 2620  H H    . TYR A 1 71 ? -8.363  -3.542  -18.412 1.00 0.00 ? 71 TYR A H    2  
ATOM 2621  H HA   . TYR A 1 71 ? -10.637 -5.096  -17.713 1.00 0.00 ? 71 TYR A HA   2  
ATOM 2622  H HB2  . TYR A 1 71 ? -9.032  -3.094  -16.115 1.00 0.00 ? 71 TYR A HB2  2  
ATOM 2623  H HB3  . TYR A 1 71 ? -10.341 -4.054  -15.434 1.00 0.00 ? 71 TYR A HB3  2  
ATOM 2624  H HD1  . TYR A 1 71 ? -10.102 -6.545  -15.327 1.00 0.00 ? 71 TYR A HD1  2  
ATOM 2625  H HD2  . TYR A 1 71 ? -6.866  -4.018  -16.428 1.00 0.00 ? 71 TYR A HD2  2  
ATOM 2626  H HE1  . TYR A 1 71 ? -8.523  -8.371  -14.860 1.00 0.00 ? 71 TYR A HE1  2  
ATOM 2627  H HE2  . TYR A 1 71 ? -5.278  -5.838  -15.966 1.00 0.00 ? 71 TYR A HE2  2  
ATOM 2628  H HH   . TYR A 1 71 ? -5.128  -7.874  -14.673 1.00 0.00 ? 71 TYR A HH   2  
ATOM 2629  N N    . LYS A 1 72 ? -12.553 -3.579  -17.990 1.00 0.00 ? 72 LYS A N    2  
ATOM 2630  C CA   . LYS A 1 72 ? -13.667 -2.710  -18.343 1.00 0.00 ? 72 LYS A CA   2  
ATOM 2631  C C    . LYS A 1 72 ? -14.663 -2.570  -17.200 1.00 0.00 ? 72 LYS A C    2  
ATOM 2632  O O    . LYS A 1 72 ? -15.714 -1.945  -17.350 1.00 0.00 ? 72 LYS A O    2  
ATOM 2633  C CB   . LYS A 1 72 ? -14.353 -3.237  -19.606 1.00 0.00 ? 72 LYS A CB   2  
ATOM 2634  C CG   . LYS A 1 72 ? -14.755 -4.701  -19.522 1.00 0.00 ? 72 LYS A CG   2  
ATOM 2635  C CD   . LYS A 1 72 ? -14.970 -5.284  -20.907 1.00 0.00 ? 72 LYS A CD   2  
ATOM 2636  C CE   . LYS A 1 72 ? -15.357 -6.752  -20.845 1.00 0.00 ? 72 LYS A CE   2  
ATOM 2637  N NZ   . LYS A 1 72 ? -15.294 -7.388  -22.183 1.00 0.00 ? 72 LYS A NZ   2  
ATOM 2638  H H    . LYS A 1 72 ? -12.691 -4.555  -17.971 1.00 0.00 ? 72 LYS A H    2  
ATOM 2639  H HA   . LYS A 1 72 ? -13.259 -1.736  -18.555 1.00 0.00 ? 72 LYS A HA   2  
ATOM 2640  H HB2  . LYS A 1 72 ? -15.243 -2.653  -19.789 1.00 0.00 ? 72 LYS A HB2  2  
ATOM 2641  H HB3  . LYS A 1 72 ? -13.679 -3.120  -20.442 1.00 0.00 ? 72 LYS A HB3  2  
ATOM 2642  H HG2  . LYS A 1 72 ? -13.972 -5.255  -19.026 1.00 0.00 ? 72 LYS A HG2  2  
ATOM 2643  H HG3  . LYS A 1 72 ? -15.673 -4.783  -18.958 1.00 0.00 ? 72 LYS A HG3  2  
ATOM 2644  H HD2  . LYS A 1 72 ? -15.759 -4.735  -21.398 1.00 0.00 ? 72 LYS A HD2  2  
ATOM 2645  H HD3  . LYS A 1 72 ? -14.054 -5.187  -21.474 1.00 0.00 ? 72 LYS A HD3  2  
ATOM 2646  H HE2  . LYS A 1 72 ? -14.676 -7.264  -20.181 1.00 0.00 ? 72 LYS A HE2  2  
ATOM 2647  H HE3  . LYS A 1 72 ? -16.363 -6.833  -20.463 1.00 0.00 ? 72 LYS A HE3  2  
ATOM 2648  H HZ1  . LYS A 1 72 ? -14.300 -7.501  -22.483 1.00 0.00 ? 72 LYS A HZ1  2  
ATOM 2649  H HZ2  . LYS A 1 72 ? -15.792 -6.800  -22.886 1.00 0.00 ? 72 LYS A HZ2  2  
ATOM 2650  H HZ3  . LYS A 1 72 ? -15.742 -8.328  -22.157 1.00 0.00 ? 72 LYS A HZ3  2  
ATOM 2651  N N    . TYR A 1 73 ? -14.327 -3.141  -16.058 1.00 0.00 ? 73 TYR A N    2  
ATOM 2652  C CA   . TYR A 1 73 ? -15.146 -2.985  -14.870 1.00 0.00 ? 73 TYR A CA   2  
ATOM 2653  C C    . TYR A 1 73 ? -14.859 -1.661  -14.178 1.00 0.00 ? 73 TYR A C    2  
ATOM 2654  O O    . TYR A 1 73 ? -13.728 -1.395  -13.766 1.00 0.00 ? 73 TYR A O    2  
ATOM 2655  C CB   . TYR A 1 73 ? -14.911 -4.135  -13.892 1.00 0.00 ? 73 TYR A CB   2  
ATOM 2656  C CG   . TYR A 1 73 ? -15.920 -5.252  -14.006 1.00 0.00 ? 73 TYR A CG   2  
ATOM 2657  C CD1  . TYR A 1 73 ? -17.167 -5.143  -13.407 1.00 0.00 ? 73 TYR A CD1  2  
ATOM 2658  C CD2  . TYR A 1 73 ? -15.623 -6.416  -14.696 1.00 0.00 ? 73 TYR A CD2  2  
ATOM 2659  C CE1  . TYR A 1 73 ? -18.096 -6.162  -13.498 1.00 0.00 ? 73 TYR A CE1  2  
ATOM 2660  C CE2  . TYR A 1 73 ? -16.545 -7.444  -14.792 1.00 0.00 ? 73 TYR A CE2  2  
ATOM 2661  C CZ   . TYR A 1 73 ? -17.780 -7.312  -14.189 1.00 0.00 ? 73 TYR A CZ   2  
ATOM 2662  O OH   . TYR A 1 73 ? -18.699 -8.335  -14.276 1.00 0.00 ? 73 TYR A OH   2  
ATOM 2663  H H    . TYR A 1 73 ? -13.512 -3.685  -16.014 1.00 0.00 ? 73 TYR A H    2  
ATOM 2664  H HA   . TYR A 1 73 ? -16.181 -2.997  -15.181 1.00 0.00 ? 73 TYR A HA   2  
ATOM 2665  H HB2  . TYR A 1 73 ? -13.934 -4.556  -14.070 1.00 0.00 ? 73 TYR A HB2  2  
ATOM 2666  H HB3  . TYR A 1 73 ? -14.953 -3.753  -12.882 1.00 0.00 ? 73 TYR A HB3  2  
ATOM 2667  H HD1  . TYR A 1 73 ? -17.411 -4.241  -12.866 1.00 0.00 ? 73 TYR A HD1  2  
ATOM 2668  H HD2  . TYR A 1 73 ? -14.655 -6.515  -15.166 1.00 0.00 ? 73 TYR A HD2  2  
ATOM 2669  H HE1  . TYR A 1 73 ? -19.060 -6.055  -13.025 1.00 0.00 ? 73 TYR A HE1  2  
ATOM 2670  H HE2  . TYR A 1 73 ? -16.295 -8.343  -15.333 1.00 0.00 ? 73 TYR A HE2  2  
ATOM 2671  H HH   . TYR A 1 73 ? -19.534 -7.991  -14.638 1.00 0.00 ? 73 TYR A HH   2  
ATOM 2672  N N    . ARG A 1 74 ? -15.871 -0.812  -14.112 1.00 0.00 ? 74 ARG A N    2  
ATOM 2673  C CA   . ARG A 1 74 ? -15.816 0.382   -13.284 1.00 0.00 ? 74 ARG A CA   2  
ATOM 2674  C C    . ARG A 1 74 ? -16.927 0.320   -12.242 1.00 0.00 ? 74 ARG A C    2  
ATOM 2675  O O    . ARG A 1 74 ? -17.911 -0.397  -12.431 1.00 0.00 ? 74 ARG A O    2  
ATOM 2676  C CB   . ARG A 1 74 ? -15.965 1.659   -14.120 1.00 0.00 ? 74 ARG A CB   2  
ATOM 2677  C CG   . ARG A 1 74 ? -17.344 1.842   -14.735 1.00 0.00 ? 74 ARG A CG   2  
ATOM 2678  C CD   . ARG A 1 74 ? -17.637 3.310   -14.998 1.00 0.00 ? 74 ARG A CD   2  
ATOM 2679  N NE   . ARG A 1 74 ? -18.939 3.509   -15.631 1.00 0.00 ? 74 ARG A NE   2  
ATOM 2680  C CZ   . ARG A 1 74 ? -20.045 3.883   -14.980 1.00 0.00 ? 74 ARG A CZ   2  
ATOM 2681  N NH1  . ARG A 1 74 ? -20.037 4.031   -13.661 1.00 0.00 ? 74 ARG A NH1  2  
ATOM 2682  N NH2  . ARG A 1 74 ? -21.168 4.088   -15.650 1.00 0.00 ? 74 ARG A NH2  2  
ATOM 2683  H H    . ARG A 1 74 ? -16.685 -0.999  -14.625 1.00 0.00 ? 74 ARG A H    2  
ATOM 2684  H HA   . ARG A 1 74 ? -14.860 0.394   -12.778 1.00 0.00 ? 74 ARG A HA   2  
ATOM 2685  H HB2  . ARG A 1 74 ? -15.762 2.512   -13.490 1.00 0.00 ? 74 ARG A HB2  2  
ATOM 2686  H HB3  . ARG A 1 74 ? -15.240 1.638   -14.921 1.00 0.00 ? 74 ARG A HB3  2  
ATOM 2687  H HG2  . ARG A 1 74 ? -17.387 1.303   -15.670 1.00 0.00 ? 74 ARG A HG2  2  
ATOM 2688  H HG3  . ARG A 1 74 ? -18.087 1.450   -14.055 1.00 0.00 ? 74 ARG A HG3  2  
ATOM 2689  H HD2  . ARG A 1 74 ? -17.623 3.840   -14.057 1.00 0.00 ? 74 ARG A HD2  2  
ATOM 2690  H HD3  . ARG A 1 74 ? -16.868 3.707   -15.644 1.00 0.00 ? 74 ARG A HD3  2  
ATOM 2691  H HE   . ARG A 1 74 ? -18.988 3.375   -16.605 1.00 0.00 ? 74 ARG A HE   2  
ATOM 2692  H HH11 . ARG A 1 74 ? -19.199 3.857   -13.132 1.00 0.00 ? 74 ARG A HH11 2  
ATOM 2693  H HH12 . ARG A 1 74 ? -20.869 4.324   -13.182 1.00 0.00 ? 74 ARG A HH12 2  
ATOM 2694  H HH21 . ARG A 1 74 ? -21.190 3.969   -16.648 1.00 0.00 ? 74 ARG A HH21 2  
ATOM 2695  H HH22 . ARG A 1 74 ? -22.007 4.360   -15.160 1.00 0.00 ? 74 ARG A HH22 2  
ATOM 2696  N N    . PRO A 1 75 ? -16.781 1.036   -11.122 1.00 0.00 ? 75 PRO A N    2  
ATOM 2697  C CA   . PRO A 1 75 ? -17.874 1.199   -10.166 1.00 0.00 ? 75 PRO A CA   2  
ATOM 2698  C C    . PRO A 1 75 ? -19.000 2.024   -10.781 1.00 0.00 ? 75 PRO A C    2  
ATOM 2699  O O    . PRO A 1 75 ? -18.740 3.027   -11.453 1.00 0.00 ? 75 PRO A O    2  
ATOM 2700  C CB   . PRO A 1 75 ? -17.229 1.945   -8.995  1.00 0.00 ? 75 PRO A CB   2  
ATOM 2701  C CG   . PRO A 1 75 ? -16.025 2.609   -9.573  1.00 0.00 ? 75 PRO A CG   2  
ATOM 2702  C CD   . PRO A 1 75 ? -15.551 1.720   -10.687 1.00 0.00 ? 75 PRO A CD   2  
ATOM 2703  H HA   . PRO A 1 75 ? -18.259 0.245   -9.834  1.00 0.00 ? 75 PRO A HA   2  
ATOM 2704  H HB2  . PRO A 1 75 ? -17.929 2.668   -8.600  1.00 0.00 ? 75 PRO A HB2  2  
ATOM 2705  H HB3  . PRO A 1 75 ? -16.958 1.242   -8.222  1.00 0.00 ? 75 PRO A HB3  2  
ATOM 2706  H HG2  . PRO A 1 75 ? -16.293 3.581   -9.961  1.00 0.00 ? 75 PRO A HG2  2  
ATOM 2707  H HG3  . PRO A 1 75 ? -15.258 2.704   -8.817  1.00 0.00 ? 75 PRO A HG3  2  
ATOM 2708  H HD2  . PRO A 1 75 ? -15.135 2.310   -11.490 1.00 0.00 ? 75 PRO A HD2  2  
ATOM 2709  H HD3  . PRO A 1 75 ? -14.823 1.011   -10.322 1.00 0.00 ? 75 PRO A HD3  2  
ATOM 2710  N N    . ARG A 1 76 ? -20.240 1.595   -10.584 1.00 0.00 ? 76 ARG A N    2  
ATOM 2711  C CA   . ARG A 1 76 ? -21.375 2.287   -11.183 1.00 0.00 ? 76 ARG A CA   2  
ATOM 2712  C C    . ARG A 1 76 ? -21.655 3.602   -10.463 1.00 0.00 ? 76 ARG A C    2  
ATOM 2713  O O    . ARG A 1 76 ? -21.172 4.655   -10.882 1.00 0.00 ? 76 ARG A O    2  
ATOM 2714  C CB   . ARG A 1 76 ? -22.622 1.401   -11.191 1.00 0.00 ? 76 ARG A CB   2  
ATOM 2715  C CG   . ARG A 1 76 ? -23.843 2.072   -11.808 1.00 0.00 ? 76 ARG A CG   2  
ATOM 2716  C CD   . ARG A 1 76 ? -25.062 1.162   -11.781 1.00 0.00 ? 76 ARG A CD   2  
ATOM 2717  N NE   . ARG A 1 76 ? -24.885 -0.018  -12.620 1.00 0.00 ? 76 ARG A NE   2  
ATOM 2718  C CZ   . ARG A 1 76 ? -25.357 -0.117  -13.864 1.00 0.00 ? 76 ARG A CZ   2  
ATOM 2719  N NH1  . ARG A 1 76 ? -26.020 0.896   -14.407 1.00 0.00 ? 76 ARG A NH1  2  
ATOM 2720  N NH2  . ARG A 1 76 ? -25.165 -1.231  -14.562 1.00 0.00 ? 76 ARG A NH2  2  
ATOM 2721  H H    . ARG A 1 76 ? -20.395 0.800   -10.030 1.00 0.00 ? 76 ARG A H    2  
ATOM 2722  H HA   . ARG A 1 76 ? -21.107 2.514   -12.206 1.00 0.00 ? 76 ARG A HA   2  
ATOM 2723  H HB2  . ARG A 1 76 ? -22.408 0.504   -11.752 1.00 0.00 ? 76 ARG A HB2  2  
ATOM 2724  H HB3  . ARG A 1 76 ? -22.861 1.129   -10.172 1.00 0.00 ? 76 ARG A HB3  2  
ATOM 2725  H HG2  . ARG A 1 76 ? -24.069 2.971   -11.253 1.00 0.00 ? 76 ARG A HG2  2  
ATOM 2726  H HG3  . ARG A 1 76 ? -23.621 2.330   -12.834 1.00 0.00 ? 76 ARG A HG3  2  
ATOM 2727  H HD2  . ARG A 1 76 ? -25.236 0.845   -10.763 1.00 0.00 ? 76 ARG A HD2  2  
ATOM 2728  H HD3  . ARG A 1 76 ? -25.920 1.717   -12.133 1.00 0.00 ? 76 ARG A HD3  2  
ATOM 2729  H HE   . ARG A 1 76 ? -24.403 -0.783  -12.229 1.00 0.00 ? 76 ARG A HE   2  
ATOM 2730  H HH11 . ARG A 1 76 ? -26.172 1.738   -13.882 1.00 0.00 ? 76 ARG A HH11 2  
ATOM 2731  H HH12 . ARG A 1 76 ? -26.368 0.830   -15.350 1.00 0.00 ? 76 ARG A HH12 2  
ATOM 2732  H HH21 . ARG A 1 76 ? -24.663 -2.008  -14.151 1.00 0.00 ? 76 ARG A HH21 2  
ATOM 2733  H HH22 . ARG A 1 76 ? -25.520 -1.309  -15.501 1.00 0.00 ? 76 ARG A HH22 2  
ATOM 2734  N N    . ARG A 1 77 ? -22.424 3.544   -9.381  1.00 0.00 ? 77 ARG A N    2  
ATOM 2735  C CA   . ARG A 1 77 ? -22.763 4.740   -8.620  1.00 0.00 ? 77 ARG A CA   2  
ATOM 2736  C C    . ARG A 1 77 ? -23.084 4.402   -7.172  1.00 0.00 ? 77 ARG A C    2  
ATOM 2737  O O    . ARG A 1 77 ? -23.901 3.526   -6.892  1.00 0.00 ? 77 ARG A O    2  
ATOM 2738  C CB   . ARG A 1 77 ? -23.971 5.472   -9.228  1.00 0.00 ? 77 ARG A CB   2  
ATOM 2739  C CG   . ARG A 1 77 ? -23.646 6.314   -10.451 1.00 0.00 ? 77 ARG A CG   2  
ATOM 2740  C CD   . ARG A 1 77 ? -24.861 7.090   -10.935 1.00 0.00 ? 77 ARG A CD   2  
ATOM 2741  N NE   . ARG A 1 77 ? -24.536 7.971   -12.055 1.00 0.00 ? 77 ARG A NE   2  
ATOM 2742  C CZ   . ARG A 1 77 ? -25.295 8.992   -12.453 1.00 0.00 ? 77 ARG A CZ   2  
ATOM 2743  N NH1  . ARG A 1 77 ? -26.454 9.243   -11.855 1.00 0.00 ? 77 ARG A NH1  2  
ATOM 2744  N NH2  . ARG A 1 77 ? -24.897 9.761   -13.461 1.00 0.00 ? 77 ARG A NH2  2  
ATOM 2745  H H    . ARG A 1 77 ? -22.779 2.674   -9.089  1.00 0.00 ? 77 ARG A H    2  
ATOM 2746  H HA   . ARG A 1 77 ? -21.909 5.399   -8.641  1.00 0.00 ? 77 ARG A HA   2  
ATOM 2747  H HB2  . ARG A 1 77 ? -24.713 4.740   -9.512  1.00 0.00 ? 77 ARG A HB2  2  
ATOM 2748  H HB3  . ARG A 1 77 ? -24.394 6.121   -8.477  1.00 0.00 ? 77 ARG A HB3  2  
ATOM 2749  H HG2  . ARG A 1 77 ? -22.865 7.013   -10.195 1.00 0.00 ? 77 ARG A HG2  2  
ATOM 2750  H HG3  . ARG A 1 77 ? -23.305 5.664   -11.243 1.00 0.00 ? 77 ARG A HG3  2  
ATOM 2751  H HD2  . ARG A 1 77 ? -25.622 6.389   -11.247 1.00 0.00 ? 77 ARG A HD2  2  
ATOM 2752  H HD3  . ARG A 1 77 ? -25.240 7.685   -10.117 1.00 0.00 ? 77 ARG A HD3  2  
ATOM 2753  H HE   . ARG A 1 77 ? -23.688 7.794   -12.533 1.00 0.00 ? 77 ARG A HE   2  
ATOM 2754  H HH11 . ARG A 1 77 ? -26.771 8.665   -11.097 1.00 0.00 ? 77 ARG A HH11 2  
ATOM 2755  H HH12 . ARG A 1 77 ? -27.024 10.022  -12.160 1.00 0.00 ? 77 ARG A HH12 2  
ATOM 2756  H HH21 . ARG A 1 77 ? -24.028 9.575   -13.923 1.00 0.00 ? 77 ARG A HH21 2  
ATOM 2757  H HH22 . ARG A 1 77 ? -25.464 10.538  -13.764 1.00 0.00 ? 77 ARG A HH22 2  
ATOM 2758  N N    . LYS A 1 78 ? -22.425 5.083   -6.253  1.00 0.00 ? 78 LYS A N    2  
ATOM 2759  C CA   . LYS A 1 78 ? -22.860 5.082   -4.871  1.00 0.00 ? 78 LYS A CA   2  
ATOM 2760  C C    . LYS A 1 78 ? -23.376 6.469   -4.521  1.00 0.00 ? 78 LYS A C    2  
ATOM 2761  O O    . LYS A 1 78 ? -22.696 7.266   -3.874  1.00 0.00 ? 78 LYS A O    2  
ATOM 2762  C CB   . LYS A 1 78 ? -21.748 4.650   -3.905  1.00 0.00 ? 78 LYS A CB   2  
ATOM 2763  C CG   . LYS A 1 78 ? -22.193 4.686   -2.446  1.00 0.00 ? 78 LYS A CG   2  
ATOM 2764  C CD   . LYS A 1 78 ? -21.120 4.190   -1.493  1.00 0.00 ? 78 LYS A CD   2  
ATOM 2765  C CE   . LYS A 1 78 ? -20.973 2.679   -1.548  1.00 0.00 ? 78 LYS A CE   2  
ATOM 2766  N NZ   . LYS A 1 78 ? -20.066 2.179   -0.483  1.00 0.00 ? 78 LYS A NZ   2  
ATOM 2767  H H    . LYS A 1 78 ? -21.634 5.600   -6.510  1.00 0.00 ? 78 LYS A H    2  
ATOM 2768  H HA   . LYS A 1 78 ? -23.683 4.385   -4.793  1.00 0.00 ? 78 LYS A HA   2  
ATOM 2769  H HB2  . LYS A 1 78 ? -21.445 3.642   -4.147  1.00 0.00 ? 78 LYS A HB2  2  
ATOM 2770  H HB3  . LYS A 1 78 ? -20.904 5.313   -4.020  1.00 0.00 ? 78 LYS A HB3  2  
ATOM 2771  H HG2  . LYS A 1 78 ? -22.443 5.703   -2.187  1.00 0.00 ? 78 LYS A HG2  2  
ATOM 2772  H HG3  . LYS A 1 78 ? -23.070 4.065   -2.339  1.00 0.00 ? 78 LYS A HG3  2  
ATOM 2773  H HD2  . LYS A 1 78 ? -20.177 4.642   -1.762  1.00 0.00 ? 78 LYS A HD2  2  
ATOM 2774  H HD3  . LYS A 1 78 ? -21.385 4.481   -0.488  1.00 0.00 ? 78 LYS A HD3  2  
ATOM 2775  H HE2  . LYS A 1 78 ? -21.948 2.231   -1.421  1.00 0.00 ? 78 LYS A HE2  2  
ATOM 2776  H HE3  . LYS A 1 78 ? -20.573 2.404   -2.511  1.00 0.00 ? 78 LYS A HE3  2  
ATOM 2777  H HZ1  . LYS A 1 78 ? -19.112 2.578   -0.610  1.00 0.00 ? 78 LYS A HZ1  2  
ATOM 2778  H HZ2  . LYS A 1 78 ? -20.000 1.139   -0.526  1.00 0.00 ? 78 LYS A HZ2  2  
ATOM 2779  H HZ3  . LYS A 1 78 ? -20.424 2.457   0.456   1.00 0.00 ? 78 LYS A HZ3  2  
ATOM 2780  N N    . THR A 1 79 ? -24.562 6.773   -5.013  1.00 0.00 ? 79 THR A N    2  
ATOM 2781  C CA   . THR A 1 79 ? -25.184 8.049   -4.749  1.00 0.00 ? 79 THR A CA   2  
ATOM 2782  C C    . THR A 1 79 ? -26.083 7.938   -3.524  1.00 0.00 ? 79 THR A C    2  
ATOM 2783  O O    . THR A 1 79 ? -27.286 7.689   -3.633  1.00 0.00 ? 79 THR A O    2  
ATOM 2784  C CB   . THR A 1 79 ? -25.988 8.536   -5.969  1.00 0.00 ? 79 THR A CB   2  
ATOM 2785  O OG1  . THR A 1 79 ? -25.164 8.464   -7.144  1.00 0.00 ? 79 THR A OG1  2  
ATOM 2786  C CG2  . THR A 1 79 ? -26.468 9.969   -5.774  1.00 0.00 ? 79 THR A CG2  2  
ATOM 2787  H H    . THR A 1 79 ? -25.036 6.116   -5.567  1.00 0.00 ? 79 THR A H    2  
ATOM 2788  H HA   . THR A 1 79 ? -24.399 8.766   -4.546  1.00 0.00 ? 79 THR A HA   2  
ATOM 2789  H HB   . THR A 1 79 ? -26.848 7.895   -6.099  1.00 0.00 ? 79 THR A HB   2  
ATOM 2790  H HG1  . THR A 1 79 ? -24.239 8.517   -6.888  1.00 0.00 ? 79 THR A HG1  2  
ATOM 2791  H HG21 . THR A 1 79 ? -25.617 10.618  -5.630  1.00 0.00 ? 79 THR A HG21 2  
ATOM 2792  H HG22 . THR A 1 79 ? -27.109 10.018  -4.906  1.00 0.00 ? 79 THR A HG22 2  
ATOM 2793  H HG23 . THR A 1 79 ? -27.019 10.285  -6.646  1.00 0.00 ? 79 THR A HG23 2  
ATOM 2794  N N    . LYS A 1 80 ? -25.476 8.074   -2.357  1.00 0.00 ? 80 LYS A N    2  
ATOM 2795  C CA   . LYS A 1 80 ? -26.201 7.963   -1.109  1.00 0.00 ? 80 LYS A CA   2  
ATOM 2796  C C    . LYS A 1 80 ? -26.821 9.302   -0.759  1.00 0.00 ? 80 LYS A C    2  
ATOM 2797  O O    . LYS A 1 80 ? -26.137 10.325  -0.727  1.00 0.00 ? 80 LYS A O    2  
ATOM 2798  C CB   . LYS A 1 80 ? -25.266 7.482   0.010   1.00 0.00 ? 80 LYS A CB   2  
ATOM 2799  C CG   . LYS A 1 80 ? -25.965 7.173   1.332   1.00 0.00 ? 80 LYS A CG   2  
ATOM 2800  C CD   . LYS A 1 80 ? -26.139 8.413   2.202   1.00 0.00 ? 80 LYS A CD   2  
ATOM 2801  C CE   . LYS A 1 80 ? -26.989 8.123   3.430   1.00 0.00 ? 80 LYS A CE   2  
ATOM 2802  N NZ   . LYS A 1 80 ? -28.411 7.869   3.075   1.00 0.00 ? 80 LYS A NZ   2  
ATOM 2803  H H    . LYS A 1 80 ? -24.514 8.263   -2.336  1.00 0.00 ? 80 LYS A H    2  
ATOM 2804  H HA   . LYS A 1 80 ? -26.991 7.239   -1.246  1.00 0.00 ? 80 LYS A HA   2  
ATOM 2805  H HB2  . LYS A 1 80 ? -24.765 6.586   -0.321  1.00 0.00 ? 80 LYS A HB2  2  
ATOM 2806  H HB3  . LYS A 1 80 ? -24.527 8.248   0.192   1.00 0.00 ? 80 LYS A HB3  2  
ATOM 2807  H HG2  . LYS A 1 80 ? -26.939 6.759   1.121   1.00 0.00 ? 80 LYS A HG2  2  
ATOM 2808  H HG3  . LYS A 1 80 ? -25.377 6.446   1.872   1.00 0.00 ? 80 LYS A HG3  2  
ATOM 2809  H HD2  . LYS A 1 80 ? -25.166 8.754   2.522   1.00 0.00 ? 80 LYS A HD2  2  
ATOM 2810  H HD3  . LYS A 1 80 ? -26.618 9.185   1.617   1.00 0.00 ? 80 LYS A HD3  2  
ATOM 2811  H HE2  . LYS A 1 80 ? -26.591 7.251   3.929   1.00 0.00 ? 80 LYS A HE2  2  
ATOM 2812  H HE3  . LYS A 1 80 ? -26.937 8.972   4.097   1.00 0.00 ? 80 LYS A HE3  2  
ATOM 2813  H HZ1  . LYS A 1 80 ? -28.474 7.125   2.346   1.00 0.00 ? 80 LYS A HZ1  2  
ATOM 2814  H HZ2  . LYS A 1 80 ? -28.854 8.742   2.703   1.00 0.00 ? 80 LYS A HZ2  2  
ATOM 2815  H HZ3  . LYS A 1 80 ? -28.944 7.558   3.918   1.00 0.00 ? 80 LYS A HZ3  2  
ATOM 2816  N N    . THR A 1 81 ? -28.120 9.297   -0.538  1.00 0.00 ? 81 THR A N    2  
ATOM 2817  C CA   . THR A 1 81 ? -28.828 10.489  -0.121  1.00 0.00 ? 81 THR A CA   2  
ATOM 2818  C C    . THR A 1 81 ? -29.936 10.102  0.851   1.00 0.00 ? 81 THR A C    2  
ATOM 2819  O O    . THR A 1 81 ? -31.066 9.832   0.398   1.00 0.00 ? 81 THR A O    2  
ATOM 2820  C CB   . THR A 1 81 ? -29.417 11.245  -1.332  1.00 0.00 ? 81 THR A CB   2  
ATOM 2821  O OG1  . THR A 1 81 ? -28.402 11.405  -2.337  1.00 0.00 ? 81 THR A OG1  2  
ATOM 2822  C CG2  . THR A 1 81 ? -29.941 12.615  -0.920  1.00 0.00 ? 81 THR A CG2  2  
ATOM 2823  O OXT  . THR A 1 81 ? -29.649 10.016  2.061   1.00 0.00 ? 81 THR A OXT  2  
ATOM 2824  H H    . THR A 1 81 ? -28.623 8.464   -0.662  1.00 0.00 ? 81 THR A H    2  
ATOM 2825  H HA   . THR A 1 81 ? -28.127 11.140  0.385   1.00 0.00 ? 81 THR A HA   2  
ATOM 2826  H HB   . THR A 1 81 ? -30.233 10.666  -1.739  1.00 0.00 ? 81 THR A HB   2  
ATOM 2827  H HG1  . THR A 1 81 ? -27.550 11.131  -1.967  1.00 0.00 ? 81 THR A HG1  2  
ATOM 2828  H HG21 . THR A 1 81 ? -30.721 12.496  -0.182  1.00 0.00 ? 81 THR A HG21 2  
ATOM 2829  H HG22 . THR A 1 81 ? -30.337 13.125  -1.785  1.00 0.00 ? 81 THR A HG22 2  
ATOM 2830  H HG23 . THR A 1 81 ? -29.134 13.198  -0.497  1.00 0.00 ? 81 THR A HG23 2  
ATOM 2831  N N    . SER A 1 1  ? 1.045   -5.367  -17.188 1.00 0.00 ? 1  SER A N    3  
ATOM 2832  C CA   . SER A 1 1  ? 0.220   -6.193  -18.097 1.00 0.00 ? 1  SER A CA   3  
ATOM 2833  C C    . SER A 1 1  ? -1.213  -5.662  -18.193 1.00 0.00 ? 1  SER A C    3  
ATOM 2834  O O    . SER A 1 1  ? -2.151  -6.433  -18.396 1.00 0.00 ? 1  SER A O    3  
ATOM 2835  C CB   . SER A 1 1  ? 0.220   -7.646  -17.604 1.00 0.00 ? 1  SER A CB   3  
ATOM 2836  O OG   . SER A 1 1  ? -0.122  -7.730  -16.225 1.00 0.00 ? 1  SER A OG   3  
ATOM 2837  H H1   . SER A 1 1  ? 1.098   -4.387  -17.534 1.00 0.00 ? 1  SER A H1   3  
ATOM 2838  H H2   . SER A 1 1  ? 2.011   -5.753  -17.133 1.00 0.00 ? 1  SER A H2   3  
ATOM 2839  H H3   . SER A 1 1  ? 0.632   -5.369  -16.231 1.00 0.00 ? 1  SER A H3   3  
ATOM 2840  H HA   . SER A 1 1  ? 0.666   -6.159  -19.080 1.00 0.00 ? 1  SER A HA   3  
ATOM 2841  H HB2  . SER A 1 1  ? -0.498  -8.216  -18.173 1.00 0.00 ? 1  SER A HB2  3  
ATOM 2842  H HB3  . SER A 1 1  ? 1.204   -8.069  -17.743 1.00 0.00 ? 1  SER A HB3  3  
ATOM 2843  H HG   . SER A 1 1  ? -0.488  -8.610  -16.041 1.00 0.00 ? 1  SER A HG   3  
ATOM 2844  N N    . ASP A 1 2  ? -1.368  -4.339  -18.069 1.00 0.00 ? 2  ASP A N    3  
ATOM 2845  C CA   . ASP A 1 2  ? -2.679  -3.677  -18.169 1.00 0.00 ? 2  ASP A CA   3  
ATOM 2846  C C    . ASP A 1 2  ? -3.640  -4.133  -17.080 1.00 0.00 ? 2  ASP A C    3  
ATOM 2847  O O    . ASP A 1 2  ? -4.340  -5.138  -17.228 1.00 0.00 ? 2  ASP A O    3  
ATOM 2848  C CB   . ASP A 1 2  ? -3.332  -3.902  -19.541 1.00 0.00 ? 2  ASP A CB   3  
ATOM 2849  C CG   . ASP A 1 2  ? -2.928  -2.868  -20.571 1.00 0.00 ? 2  ASP A CG   3  
ATOM 2850  O OD1  . ASP A 1 2  ? -1.917  -3.084  -21.274 1.00 0.00 ? 2  ASP A OD1  3  
ATOM 2851  O OD2  . ASP A 1 2  ? -3.632  -1.843  -20.699 1.00 0.00 ? 2  ASP A OD2  3  
ATOM 2852  H H    . ASP A 1 2  ? -0.578  -3.783  -17.901 1.00 0.00 ? 2  ASP A H    3  
ATOM 2853  H HA   . ASP A 1 2  ? -2.507  -2.619  -18.045 1.00 0.00 ? 2  ASP A HA   3  
ATOM 2854  H HB2  . ASP A 1 2  ? -3.047  -4.874  -19.911 1.00 0.00 ? 2  ASP A HB2  3  
ATOM 2855  H HB3  . ASP A 1 2  ? -4.406  -3.869  -19.429 1.00 0.00 ? 2  ASP A HB3  3  
ATOM 2856  N N    . ARG A 1 3  ? -3.658  -3.399  -15.978 1.00 0.00 ? 3  ARG A N    3  
ATOM 2857  C CA   . ARG A 1 3  ? -4.642  -3.613  -14.927 1.00 0.00 ? 3  ARG A CA   3  
ATOM 2858  C C    . ARG A 1 3  ? -5.598  -2.430  -14.878 1.00 0.00 ? 3  ARG A C    3  
ATOM 2859  O O    . ARG A 1 3  ? -5.170  -1.287  -14.754 1.00 0.00 ? 3  ARG A O    3  
ATOM 2860  C CB   . ARG A 1 3  ? -3.960  -3.809  -13.568 1.00 0.00 ? 3  ARG A CB   3  
ATOM 2861  C CG   . ARG A 1 3  ? -3.225  -5.135  -13.449 1.00 0.00 ? 3  ARG A CG   3  
ATOM 2862  C CD   . ARG A 1 3  ? -4.194  -6.311  -13.496 1.00 0.00 ? 3  ARG A CD   3  
ATOM 2863  N NE   . ARG A 1 3  ? -4.982  -6.433  -12.264 1.00 0.00 ? 3  ARG A NE   3  
ATOM 2864  C CZ   . ARG A 1 3  ? -6.309  -6.588  -12.230 1.00 0.00 ? 3  ARG A CZ   3  
ATOM 2865  N NH1  . ARG A 1 3  ? -7.021  -6.551  -13.347 1.00 0.00 ? 3  ARG A NH1  3  
ATOM 2866  N NH2  . ARG A 1 3  ? -6.927  -6.773  -11.070 1.00 0.00 ? 3  ARG A NH2  3  
ATOM 2867  H H    . ARG A 1 3  ? -2.987  -2.685  -15.869 1.00 0.00 ? 3  ARG A H    3  
ATOM 2868  H HA   . ARG A 1 3  ? -5.201  -4.505  -15.174 1.00 0.00 ? 3  ARG A HA   3  
ATOM 2869  H HB2  . ARG A 1 3  ? -3.247  -3.011  -13.417 1.00 0.00 ? 3  ARG A HB2  3  
ATOM 2870  H HB3  . ARG A 1 3  ? -4.709  -3.764  -12.792 1.00 0.00 ? 3  ARG A HB3  3  
ATOM 2871  H HG2  . ARG A 1 3  ? -2.526  -5.225  -14.267 1.00 0.00 ? 3  ARG A HG2  3  
ATOM 2872  H HG3  . ARG A 1 3  ? -2.690  -5.159  -12.510 1.00 0.00 ? 3  ARG A HG3  3  
ATOM 2873  H HD2  . ARG A 1 3  ? -4.869  -6.172  -14.329 1.00 0.00 ? 3  ARG A HD2  3  
ATOM 2874  H HD3  . ARG A 1 3  ? -3.631  -7.221  -13.641 1.00 0.00 ? 3  ARG A HD3  3  
ATOM 2875  H HE   . ARG A 1 3  ? -4.486  -6.430  -11.413 1.00 0.00 ? 3  ARG A HE   3  
ATOM 2876  H HH11 . ARG A 1 3  ? -6.566  -6.403  -14.235 1.00 0.00 ? 3  ARG A HH11 3  
ATOM 2877  H HH12 . ARG A 1 3  ? -8.018  -6.670  -13.317 1.00 0.00 ? 3  ARG A HH12 3  
ATOM 2878  H HH21 . ARG A 1 3  ? -6.397  -6.794  -10.215 1.00 0.00 ? 3  ARG A HH21 3  
ATOM 2879  H HH22 . ARG A 1 3  ? -7.927  -6.902  -11.043 1.00 0.00 ? 3  ARG A HH22 3  
ATOM 2880  N N    . VAL A 1 4  ? -6.887  -2.708  -14.996 1.00 0.00 ? 4  VAL A N    3  
ATOM 2881  C CA   . VAL A 1 4  ? -7.895  -1.656  -15.017 1.00 0.00 ? 4  VAL A CA   3  
ATOM 2882  C C    . VAL A 1 4  ? -8.029  -0.987  -13.648 1.00 0.00 ? 4  VAL A C    3  
ATOM 2883  O O    . VAL A 1 4  ? -8.390  -1.625  -12.657 1.00 0.00 ? 4  VAL A O    3  
ATOM 2884  C CB   . VAL A 1 4  ? -9.268  -2.190  -15.484 1.00 0.00 ? 4  VAL A CB   3  
ATOM 2885  C CG1  . VAL A 1 4  ? -9.222  -2.536  -16.961 1.00 0.00 ? 4  VAL A CG1  3  
ATOM 2886  C CG2  . VAL A 1 4  ? -9.695  -3.408  -14.673 1.00 0.00 ? 4  VAL A CG2  3  
ATOM 2887  H H    . VAL A 1 4  ? -7.170  -3.644  -15.072 1.00 0.00 ? 4  VAL A H    3  
ATOM 2888  H HA   . VAL A 1 4  ? -7.571  -0.910  -15.730 1.00 0.00 ? 4  VAL A HA   3  
ATOM 2889  H HB   . VAL A 1 4  ? -10.004 -1.414  -15.341 1.00 0.00 ? 4  VAL A HB   3  
ATOM 2890  H HG11 . VAL A 1 4  ? -10.184 -2.918  -17.270 1.00 0.00 ? 4  VAL A HG11 3  
ATOM 2891  H HG12 . VAL A 1 4  ? -8.464  -3.285  -17.133 1.00 0.00 ? 4  VAL A HG12 3  
ATOM 2892  H HG13 . VAL A 1 4  ? -8.988  -1.648  -17.529 1.00 0.00 ? 4  VAL A HG13 3  
ATOM 2893  H HG21 . VAL A 1 4  ? -10.653 -3.761  -15.028 1.00 0.00 ? 4  VAL A HG21 3  
ATOM 2894  H HG22 . VAL A 1 4  ? -9.774  -3.135  -13.633 1.00 0.00 ? 4  VAL A HG22 3  
ATOM 2895  H HG23 . VAL A 1 4  ? -8.958  -4.190  -14.787 1.00 0.00 ? 4  VAL A HG23 3  
ATOM 2896  N N    . LYS A 1 5  ? -7.714  0.301   -13.596 1.00 0.00 ? 5  LYS A N    3  
ATOM 2897  C CA   . LYS A 1 5  ? -7.810  1.058   -12.356 1.00 0.00 ? 5  LYS A CA   3  
ATOM 2898  C C    . LYS A 1 5  ? -9.086  1.887   -12.354 1.00 0.00 ? 5  LYS A C    3  
ATOM 2899  O O    . LYS A 1 5  ? -9.263  2.765   -13.203 1.00 0.00 ? 5  LYS A O    3  
ATOM 2900  C CB   . LYS A 1 5  ? -6.605  1.993   -12.171 1.00 0.00 ? 5  LYS A CB   3  
ATOM 2901  C CG   . LYS A 1 5  ? -5.272  1.408   -12.615 1.00 0.00 ? 5  LYS A CG   3  
ATOM 2902  C CD   . LYS A 1 5  ? -4.927  1.850   -14.031 1.00 0.00 ? 5  LYS A CD   3  
ATOM 2903  C CE   . LYS A 1 5  ? -3.573  1.327   -14.482 1.00 0.00 ? 5  LYS A CE   3  
ATOM 2904  N NZ   . LYS A 1 5  ? -3.143  1.946   -15.766 1.00 0.00 ? 5  LYS A NZ   3  
ATOM 2905  H H    . LYS A 1 5  ? -7.410  0.752   -14.408 1.00 0.00 ? 5  LYS A H    3  
ATOM 2906  H HA   . LYS A 1 5  ? -7.846  0.355   -11.536 1.00 0.00 ? 5  LYS A HA   3  
ATOM 2907  H HB2  . LYS A 1 5  ? -6.778  2.894   -12.738 1.00 0.00 ? 5  LYS A HB2  3  
ATOM 2908  H HB3  . LYS A 1 5  ? -6.526  2.251   -11.124 1.00 0.00 ? 5  LYS A HB3  3  
ATOM 2909  H HG2  . LYS A 1 5  ? -4.501  1.746   -11.939 1.00 0.00 ? 5  LYS A HG2  3  
ATOM 2910  H HG3  . LYS A 1 5  ? -5.334  0.330   -12.587 1.00 0.00 ? 5  LYS A HG3  3  
ATOM 2911  H HD2  . LYS A 1 5  ? -5.684  1.479   -14.705 1.00 0.00 ? 5  LYS A HD2  3  
ATOM 2912  H HD3  . LYS A 1 5  ? -4.915  2.931   -14.064 1.00 0.00 ? 5  LYS A HD3  3  
ATOM 2913  H HE2  . LYS A 1 5  ? -2.842  1.555   -13.720 1.00 0.00 ? 5  LYS A HE2  3  
ATOM 2914  H HE3  . LYS A 1 5  ? -3.638  0.258   -14.611 1.00 0.00 ? 5  LYS A HE3  3  
ATOM 2915  H HZ1  . LYS A 1 5  ? -2.903  2.948   -15.619 1.00 0.00 ? 5  LYS A HZ1  3  
ATOM 2916  H HZ2  . LYS A 1 5  ? -3.911  1.887   -16.473 1.00 0.00 ? 5  LYS A HZ2  3  
ATOM 2917  H HZ3  . LYS A 1 5  ? -2.303  1.453   -16.141 1.00 0.00 ? 5  LYS A HZ3  3  
ATOM 2918  N N    . ARG A 1 6  ? -9.974  1.598   -11.419 1.00 0.00 ? 6  ARG A N    3  
ATOM 2919  C CA   . ARG A 1 6  ? -11.205 2.358   -11.286 1.00 0.00 ? 6  ARG A CA   3  
ATOM 2920  C C    . ARG A 1 6  ? -11.176 3.212   -10.026 1.00 0.00 ? 6  ARG A C    3  
ATOM 2921  O O    . ARG A 1 6  ? -10.672 2.778   -8.989  1.00 0.00 ? 6  ARG A O    3  
ATOM 2922  C CB   . ARG A 1 6  ? -12.407 1.413   -11.238 1.00 0.00 ? 6  ARG A CB   3  
ATOM 2923  C CG   . ARG A 1 6  ? -12.798 0.851   -12.593 1.00 0.00 ? 6  ARG A CG   3  
ATOM 2924  C CD   . ARG A 1 6  ? -13.357 1.938   -13.494 1.00 0.00 ? 6  ARG A CD   3  
ATOM 2925  N NE   . ARG A 1 6  ? -13.880 1.399   -14.747 1.00 0.00 ? 6  ARG A NE   3  
ATOM 2926  C CZ   . ARG A 1 6  ? -15.039 1.770   -15.291 1.00 0.00 ? 6  ARG A CZ   3  
ATOM 2927  N NH1  . ARG A 1 6  ? -15.826 2.645   -14.671 1.00 0.00 ? 6  ARG A NH1  3  
ATOM 2928  N NH2  . ARG A 1 6  ? -15.417 1.249   -16.452 1.00 0.00 ? 6  ARG A NH2  3  
ATOM 2929  H H    . ARG A 1 6  ? -9.792  0.862   -10.795 1.00 0.00 ? 6  ARG A H    3  
ATOM 2930  H HA   . ARG A 1 6  ? -11.295 3.003   -12.146 1.00 0.00 ? 6  ARG A HA   3  
ATOM 2931  H HB2  . ARG A 1 6  ? -12.176 0.586   -10.583 1.00 0.00 ? 6  ARG A HB2  3  
ATOM 2932  H HB3  . ARG A 1 6  ? -13.254 1.950   -10.839 1.00 0.00 ? 6  ARG A HB3  3  
ATOM 2933  H HG2  . ARG A 1 6  ? -11.924 0.422   -13.061 1.00 0.00 ? 6  ARG A HG2  3  
ATOM 2934  H HG3  . ARG A 1 6  ? -13.548 0.088   -12.453 1.00 0.00 ? 6  ARG A HG3  3  
ATOM 2935  H HD2  . ARG A 1 6  ? -14.153 2.446   -12.972 1.00 0.00 ? 6  ARG A HD2  3  
ATOM 2936  H HD3  . ARG A 1 6  ? -12.569 2.643   -13.718 1.00 0.00 ? 6  ARG A HD3  3  
ATOM 2937  H HE   . ARG A 1 6  ? -13.330 0.722   -15.216 1.00 0.00 ? 6  ARG A HE   3  
ATOM 2938  H HH11 . ARG A 1 6  ? -15.553 3.029   -13.783 1.00 0.00 ? 6  ARG A HH11 3  
ATOM 2939  H HH12 . ARG A 1 6  ? -16.696 2.928   -15.084 1.00 0.00 ? 6  ARG A HH12 3  
ATOM 2940  H HH21 . ARG A 1 6  ? -14.830 0.580   -16.918 1.00 0.00 ? 6  ARG A HH21 3  
ATOM 2941  H HH22 . ARG A 1 6  ? -16.297 1.515   -16.865 1.00 0.00 ? 6  ARG A HH22 3  
ATOM 2942  N N    . PRO A 1 7  ? -11.728 4.432   -10.096 1.00 0.00 ? 7  PRO A N    3  
ATOM 2943  C CA   . PRO A 1 7  ? -11.869 5.308   -8.941  1.00 0.00 ? 7  PRO A CA   3  
ATOM 2944  C C    . PRO A 1 7  ? -13.089 4.918   -8.116  1.00 0.00 ? 7  PRO A C    3  
ATOM 2945  O O    . PRO A 1 7  ? -14.229 5.215   -8.483  1.00 0.00 ? 7  PRO A O    3  
ATOM 2946  C CB   . PRO A 1 7  ? -12.048 6.708   -9.552  1.00 0.00 ? 7  PRO A CB   3  
ATOM 2947  C CG   . PRO A 1 7  ? -11.978 6.526   -11.040 1.00 0.00 ? 7  PRO A CG   3  
ATOM 2948  C CD   . PRO A 1 7  ? -12.242 5.072   -11.307 1.00 0.00 ? 7  PRO A CD   3  
ATOM 2949  H HA   . PRO A 1 7  ? -10.985 5.287   -8.315  1.00 0.00 ? 7  PRO A HA   3  
ATOM 2950  H HB2  . PRO A 1 7  ? -13.004 7.111   -9.252  1.00 0.00 ? 7  PRO A HB2  3  
ATOM 2951  H HB3  . PRO A 1 7  ? -11.258 7.355   -9.201  1.00 0.00 ? 7  PRO A HB3  3  
ATOM 2952  H HG2  . PRO A 1 7  ? -12.730 7.136   -11.518 1.00 0.00 ? 7  PRO A HG2  3  
ATOM 2953  H HG3  . PRO A 1 7  ? -10.995 6.798   -11.394 1.00 0.00 ? 7  PRO A HG3  3  
ATOM 2954  H HD2  . PRO A 1 7  ? -13.301 4.891   -11.423 1.00 0.00 ? 7  PRO A HD2  3  
ATOM 2955  H HD3  . PRO A 1 7  ? -11.700 4.740   -12.181 1.00 0.00 ? 7  PRO A HD3  3  
ATOM 2956  N N    . MET A 1 8  ? -12.843 4.231   -7.020  1.00 0.00 ? 8  MET A N    3  
ATOM 2957  C CA   . MET A 1 8  ? -13.908 3.690   -6.194  1.00 0.00 ? 8  MET A CA   3  
ATOM 2958  C C    . MET A 1 8  ? -13.906 4.379   -4.838  1.00 0.00 ? 8  MET A C    3  
ATOM 2959  O O    . MET A 1 8  ? -13.020 5.179   -4.553  1.00 0.00 ? 8  MET A O    3  
ATOM 2960  C CB   . MET A 1 8  ? -13.722 2.176   -6.030  1.00 0.00 ? 8  MET A CB   3  
ATOM 2961  C CG   . MET A 1 8  ? -14.975 1.449   -5.570  1.00 0.00 ? 8  MET A CG   3  
ATOM 2962  S SD   . MET A 1 8  ? -16.326 1.586   -6.758  1.00 0.00 ? 8  MET A SD   3  
ATOM 2963  C CE   . MET A 1 8  ? -17.598 0.619   -5.944  1.00 0.00 ? 8  MET A CE   3  
ATOM 2964  H H    . MET A 1 8  ? -11.911 4.089   -6.748  1.00 0.00 ? 8  MET A H    3  
ATOM 2965  H HA   . MET A 1 8  ? -14.850 3.884   -6.687  1.00 0.00 ? 8  MET A HA   3  
ATOM 2966  H HB2  . MET A 1 8  ? -13.420 1.759   -6.980  1.00 0.00 ? 8  MET A HB2  3  
ATOM 2967  H HB3  . MET A 1 8  ? -12.942 1.999   -5.304  1.00 0.00 ? 8  MET A HB3  3  
ATOM 2968  H HG2  . MET A 1 8  ? -14.741 0.403   -5.434  1.00 0.00 ? 8  MET A HG2  3  
ATOM 2969  H HG3  . MET A 1 8  ? -15.295 1.871   -4.629  1.00 0.00 ? 8  MET A HG3  3  
ATOM 2970  H HE1  . MET A 1 8  ? -17.259 -0.400  -5.828  1.00 0.00 ? 8  MET A HE1  3  
ATOM 2971  H HE2  . MET A 1 8  ? -18.498 0.633   -6.542  1.00 0.00 ? 8  MET A HE2  3  
ATOM 2972  H HE3  . MET A 1 8  ? -17.805 1.044   -4.972  1.00 0.00 ? 8  MET A HE3  3  
ATOM 2973  N N    . ASN A 1 9  ? -14.930 4.128   -4.039  1.00 0.00 ? 9  ASN A N    3  
ATOM 2974  C CA   . ASN A 1 9  ? -14.970 4.616   -2.669  1.00 0.00 ? 9  ASN A CA   3  
ATOM 2975  C C    . ASN A 1 9  ? -13.819 4.024   -1.852  1.00 0.00 ? 9  ASN A C    3  
ATOM 2976  O O    . ASN A 1 9  ? -13.326 2.931   -2.147  1.00 0.00 ? 9  ASN A O    3  
ATOM 2977  C CB   . ASN A 1 9  ? -16.317 4.275   -2.024  1.00 0.00 ? 9  ASN A CB   3  
ATOM 2978  C CG   . ASN A 1 9  ? -16.630 2.794   -2.060  1.00 0.00 ? 9  ASN A CG   3  
ATOM 2979  O OD1  . ASN A 1 9  ? -17.156 2.285   -3.049  1.00 0.00 ? 9  ASN A OD1  3  
ATOM 2980  N ND2  . ASN A 1 9  ? -16.338 2.105   -0.974  1.00 0.00 ? 9  ASN A ND2  3  
ATOM 2981  H H    . ASN A 1 9  ? -15.685 3.605   -4.377  1.00 0.00 ? 9  ASN A H    3  
ATOM 2982  H HA   . ASN A 1 9  ? -14.857 5.691   -2.700  1.00 0.00 ? 9  ASN A HA   3  
ATOM 2983  H HB2  . ASN A 1 9  ? -16.302 4.592   -0.991  1.00 0.00 ? 9  ASN A HB2  3  
ATOM 2984  H HB3  . ASN A 1 9  ? -17.101 4.800   -2.544  1.00 0.00 ? 9  ASN A HB3  3  
ATOM 2985  H HD21 . ASN A 1 9  ? -15.941 2.590   -0.213  1.00 0.00 ? 9  ASN A HD21 3  
ATOM 2986  H HD22 . ASN A 1 9  ? -16.525 1.138   -0.970  1.00 0.00 ? 9  ASN A HD22 3  
ATOM 2987  N N    . ALA A 1 10 ? -13.425 4.758   -0.816  1.00 0.00 ? 10 ALA A N    3  
ATOM 2988  C CA   . ALA A 1 10 ? -12.263 4.446   0.018   1.00 0.00 ? 10 ALA A CA   3  
ATOM 2989  C C    . ALA A 1 10 ? -12.135 2.976   0.449   1.00 0.00 ? 10 ALA A C    3  
ATOM 2990  O O    . ALA A 1 10 ? -11.019 2.476   0.538   1.00 0.00 ? 10 ALA A O    3  
ATOM 2991  C CB   . ALA A 1 10 ? -12.301 5.333   1.253   1.00 0.00 ? 10 ALA A CB   3  
ATOM 2992  H H    . ALA A 1 10 ? -13.899 5.593   -0.635  1.00 0.00 ? 10 ALA A H    3  
ATOM 2993  H HA   . ALA A 1 10 ? -11.380 4.715   -0.542  1.00 0.00 ? 10 ALA A HA   3  
ATOM 2994  H HB1  . ALA A 1 10 ? -13.203 5.133   1.811   1.00 0.00 ? 10 ALA A HB1  3  
ATOM 2995  H HB2  . ALA A 1 10 ? -12.286 6.369   0.951   1.00 0.00 ? 10 ALA A HB2  3  
ATOM 2996  H HB3  . ALA A 1 10 ? -11.442 5.127   1.873   1.00 0.00 ? 10 ALA A HB3  3  
ATOM 2997  N N    . PHE A 1 11 ? -13.235 2.276   0.724   1.00 0.00 ? 11 PHE A N    3  
ATOM 2998  C CA   . PHE A 1 11 ? -13.126 0.890   1.208   1.00 0.00 ? 11 PHE A CA   3  
ATOM 2999  C C    . PHE A 1 11 ? -12.405 -0.004  0.194   1.00 0.00 ? 11 PHE A C    3  
ATOM 3000  O O    . PHE A 1 11 ? -11.421 -0.675  0.526   1.00 0.00 ? 11 PHE A O    3  
ATOM 3001  C CB   . PHE A 1 11 ? -14.503 0.301   1.526   1.00 0.00 ? 11 PHE A CB   3  
ATOM 3002  C CG   . PHE A 1 11 ? -14.432 -1.098  2.081   1.00 0.00 ? 11 PHE A CG   3  
ATOM 3003  C CD1  . PHE A 1 11 ? -14.028 -1.315  3.389   1.00 0.00 ? 11 PHE A CD1  3  
ATOM 3004  C CD2  . PHE A 1 11 ? -14.753 -2.191  1.294   1.00 0.00 ? 11 PHE A CD2  3  
ATOM 3005  C CE1  . PHE A 1 11 ? -13.945 -2.594  3.903   1.00 0.00 ? 11 PHE A CE1  3  
ATOM 3006  C CE2  . PHE A 1 11 ? -14.675 -3.474  1.804   1.00 0.00 ? 11 PHE A CE2  3  
ATOM 3007  C CZ   . PHE A 1 11 ? -14.268 -3.676  3.111   1.00 0.00 ? 11 PHE A CZ   3  
ATOM 3008  H H    . PHE A 1 11 ? -14.116 2.691   0.616   1.00 0.00 ? 11 PHE A H    3  
ATOM 3009  H HA   . PHE A 1 11 ? -12.540 0.911   2.116   1.00 0.00 ? 11 PHE A HA   3  
ATOM 3010  H HB2  . PHE A 1 11 ? -14.996 0.925   2.257   1.00 0.00 ? 11 PHE A HB2  3  
ATOM 3011  H HB3  . PHE A 1 11 ? -15.096 0.274   0.623   1.00 0.00 ? 11 PHE A HB3  3  
ATOM 3012  H HD1  . PHE A 1 11 ? -13.776 -0.468  4.012   1.00 0.00 ? 11 PHE A HD1  3  
ATOM 3013  H HD2  . PHE A 1 11 ? -15.070 -2.035  0.274   1.00 0.00 ? 11 PHE A HD2  3  
ATOM 3014  H HE1  . PHE A 1 11 ? -13.630 -2.747  4.925   1.00 0.00 ? 11 PHE A HE1  3  
ATOM 3015  H HE2  . PHE A 1 11 ? -14.928 -4.319  1.180   1.00 0.00 ? 11 PHE A HE2  3  
ATOM 3016  H HZ   . PHE A 1 11 ? -14.201 -4.677  3.511   1.00 0.00 ? 11 PHE A HZ   3  
ATOM 3017  N N    . MET A 1 12 ? -12.866 0.014   -1.048  1.00 0.00 ? 12 MET A N    3  
ATOM 3018  C CA   . MET A 1 12 ? -12.230 -0.773  -2.092  1.00 0.00 ? 12 MET A CA   3  
ATOM 3019  C C    . MET A 1 12 ? -10.867 -0.185  -2.395  1.00 0.00 ? 12 MET A C    3  
ATOM 3020  O O    . MET A 1 12 ? -9.896  -0.909  -2.646  1.00 0.00 ? 12 MET A O    3  
ATOM 3021  C CB   . MET A 1 12 ? -13.085 -0.808  -3.363  1.00 0.00 ? 12 MET A CB   3  
ATOM 3022  C CG   . MET A 1 12 ? -14.382 -1.592  -3.216  1.00 0.00 ? 12 MET A CG   3  
ATOM 3023  S SD   . MET A 1 12 ? -15.583 -0.787  -2.135  1.00 0.00 ? 12 MET A SD   3  
ATOM 3024  C CE   . MET A 1 12 ? -16.908 -1.991  -2.152  1.00 0.00 ? 12 MET A CE   3  
ATOM 3025  H H    . MET A 1 12 ? -13.648 0.562   -1.266  1.00 0.00 ? 12 MET A H    3  
ATOM 3026  H HA   . MET A 1 12 ? -12.104 -1.779  -1.720  1.00 0.00 ? 12 MET A HA   3  
ATOM 3027  H HB2  . MET A 1 12 ? -13.335 0.206   -3.639  1.00 0.00 ? 12 MET A HB2  3  
ATOM 3028  H HB3  . MET A 1 12 ? -12.506 -1.254  -4.158  1.00 0.00 ? 12 MET A HB3  3  
ATOM 3029  H HG2  . MET A 1 12 ? -14.827 -1.709  -4.194  1.00 0.00 ? 12 MET A HG2  3  
ATOM 3030  H HG3  . MET A 1 12 ? -14.152 -2.567  -2.811  1.00 0.00 ? 12 MET A HG3  3  
ATOM 3031  H HE1  . MET A 1 12 ? -17.725 -1.636  -1.541  1.00 0.00 ? 12 MET A HE1  3  
ATOM 3032  H HE2  . MET A 1 12 ? -16.547 -2.930  -1.762  1.00 0.00 ? 12 MET A HE2  3  
ATOM 3033  H HE3  . MET A 1 12 ? -17.253 -2.133  -3.166  1.00 0.00 ? 12 MET A HE3  3  
ATOM 3034  N N    . VAL A 1 13 ? -10.805 1.140   -2.335  1.00 0.00 ? 13 VAL A N    3  
ATOM 3035  C CA   . VAL A 1 13 ? -9.575  1.872   -2.552  1.00 0.00 ? 13 VAL A CA   3  
ATOM 3036  C C    . VAL A 1 13 ? -8.489  1.385   -1.632  1.00 0.00 ? 13 VAL A C    3  
ATOM 3037  O O    . VAL A 1 13 ? -7.380  1.163   -2.062  1.00 0.00 ? 13 VAL A O    3  
ATOM 3038  C CB   . VAL A 1 13 ? -9.737  3.380   -2.311  1.00 0.00 ? 13 VAL A CB   3  
ATOM 3039  C CG1  . VAL A 1 13 ? -8.382  4.060   -2.386  1.00 0.00 ? 13 VAL A CG1  3  
ATOM 3040  C CG2  . VAL A 1 13 ? -10.673 3.977   -3.334  1.00 0.00 ? 13 VAL A CG2  3  
ATOM 3041  H H    . VAL A 1 13 ? -11.619 1.637   -2.132  1.00 0.00 ? 13 VAL A H    3  
ATOM 3042  H HA   . VAL A 1 13 ? -9.268  1.722   -3.576  1.00 0.00 ? 13 VAL A HA   3  
ATOM 3043  H HB   . VAL A 1 13 ? -10.151 3.538   -1.316  1.00 0.00 ? 13 VAL A HB   3  
ATOM 3044  H HG11 . VAL A 1 13 ? -8.480  5.094   -2.087  1.00 0.00 ? 13 VAL A HG11 3  
ATOM 3045  H HG12 . VAL A 1 13 ? -8.013  4.012   -3.400  1.00 0.00 ? 13 VAL A HG12 3  
ATOM 3046  H HG13 . VAL A 1 13 ? -7.691  3.558   -1.726  1.00 0.00 ? 13 VAL A HG13 3  
ATOM 3047  H HG21 . VAL A 1 13 ? -10.824 5.024   -3.117  1.00 0.00 ? 13 VAL A HG21 3  
ATOM 3048  H HG22 . VAL A 1 13 ? -11.621 3.462   -3.297  1.00 0.00 ? 13 VAL A HG22 3  
ATOM 3049  H HG23 . VAL A 1 13 ? -10.243 3.871   -4.319  1.00 0.00 ? 13 VAL A HG23 3  
ATOM 3050  N N    . TRP A 1 14 ? -8.807  1.229   -0.366  1.00 0.00 ? 14 TRP A N    3  
ATOM 3051  C CA   . TRP A 1 14 ? -7.803  0.842   0.588   1.00 0.00 ? 14 TRP A CA   3  
ATOM 3052  C C    . TRP A 1 14 ? -7.397  -0.599  0.372   1.00 0.00 ? 14 TRP A C    3  
ATOM 3053  O O    . TRP A 1 14 ? -6.267  -0.965  0.635   1.00 0.00 ? 14 TRP A O    3  
ATOM 3054  C CB   . TRP A 1 14 ? -8.277  1.053   2.015   1.00 0.00 ? 14 TRP A CB   3  
ATOM 3055  C CG   . TRP A 1 14 ? -7.135  1.273   2.955   1.00 0.00 ? 14 TRP A CG   3  
ATOM 3056  C CD1  . TRP A 1 14 ? -6.069  2.098   2.751   1.00 0.00 ? 14 TRP A CD1  3  
ATOM 3057  C CD2  . TRP A 1 14 ? -6.941  0.677   4.241   1.00 0.00 ? 14 TRP A CD2  3  
ATOM 3058  N NE1  . TRP A 1 14 ? -5.215  2.039   3.820   1.00 0.00 ? 14 TRP A NE1  3  
ATOM 3059  C CE2  . TRP A 1 14 ? -5.728  1.176   4.750   1.00 0.00 ? 14 TRP A CE2  3  
ATOM 3060  C CE3  . TRP A 1 14 ? -7.674  -0.227  5.012   1.00 0.00 ? 14 TRP A CE3  3  
ATOM 3061  C CZ2  . TRP A 1 14 ? -5.229  0.797   5.990   1.00 0.00 ? 14 TRP A CZ2  3  
ATOM 3062  C CZ3  . TRP A 1 14 ? -7.175  -0.606  6.242   1.00 0.00 ? 14 TRP A CZ3  3  
ATOM 3063  C CH2  . TRP A 1 14 ? -5.963  -0.093  6.721   1.00 0.00 ? 14 TRP A CH2  3  
ATOM 3064  H H    . TRP A 1 14 ? -9.730  1.390   -0.068  1.00 0.00 ? 14 TRP A H    3  
ATOM 3065  H HA   . TRP A 1 14 ? -6.940  1.465   0.416   1.00 0.00 ? 14 TRP A HA   3  
ATOM 3066  H HB2  . TRP A 1 14 ? -8.920  1.921   2.052   1.00 0.00 ? 14 TRP A HB2  3  
ATOM 3067  H HB3  . TRP A 1 14 ? -8.826  0.183   2.345   1.00 0.00 ? 14 TRP A HB3  3  
ATOM 3068  H HD1  . TRP A 1 14 ? -5.925  2.695   1.863   1.00 0.00 ? 14 TRP A HD1  3  
ATOM 3069  H HE1  . TRP A 1 14 ? -4.371  2.530   3.904   1.00 0.00 ? 14 TRP A HE1  3  
ATOM 3070  H HE3  . TRP A 1 14 ? -8.610  -0.632  4.659   1.00 0.00 ? 14 TRP A HE3  3  
ATOM 3071  H HZ2  . TRP A 1 14 ? -4.295  1.183   6.376   1.00 0.00 ? 14 TRP A HZ2  3  
ATOM 3072  H HZ3  . TRP A 1 14 ? -7.727  -1.304  6.854   1.00 0.00 ? 14 TRP A HZ3  3  
ATOM 3073  H HH2  . TRP A 1 14 ? -5.610  -0.417  7.686   1.00 0.00 ? 14 TRP A HH2  3  
ATOM 3074  N N    . SER A 1 15 ? -8.299  -1.416  -0.140  1.00 0.00 ? 15 SER A N    3  
ATOM 3075  C CA   . SER A 1 15 ? -7.949  -2.796  -0.412  1.00 0.00 ? 15 SER A CA   3  
ATOM 3076  C C    . SER A 1 15 ? -6.838  -2.842  -1.467  1.00 0.00 ? 15 SER A C    3  
ATOM 3077  O O    . SER A 1 15 ? -5.735  -3.341  -1.217  1.00 0.00 ? 15 SER A O    3  
ATOM 3078  C CB   . SER A 1 15 ? -9.181  -3.582  -0.882  1.00 0.00 ? 15 SER A CB   3  
ATOM 3079  O OG   . SER A 1 15 ? -8.906  -4.972  -0.955  1.00 0.00 ? 15 SER A OG   3  
ATOM 3080  H H    . SER A 1 15 ? -9.208  -1.086  -0.343  1.00 0.00 ? 15 SER A H    3  
ATOM 3081  H HA   . SER A 1 15 ? -7.579  -3.230  0.505   1.00 0.00 ? 15 SER A HA   3  
ATOM 3082  H HB2  . SER A 1 15 ? -9.991  -3.425  -0.186  1.00 0.00 ? 15 SER A HB2  3  
ATOM 3083  H HB3  . SER A 1 15 ? -9.474  -3.233  -1.861  1.00 0.00 ? 15 SER A HB3  3  
ATOM 3084  H HG   . SER A 1 15 ? -8.347  -5.222  -0.213  1.00 0.00 ? 15 SER A HG   3  
ATOM 3085  N N    . ARG A 1 16 ? -7.115  -2.259  -2.627  1.00 0.00 ? 16 ARG A N    3  
ATOM 3086  C CA   . ARG A 1 16 ? -6.173  -2.302  -3.743  1.00 0.00 ? 16 ARG A CA   3  
ATOM 3087  C C    . ARG A 1 16 ? -5.054  -1.270  -3.579  1.00 0.00 ? 16 ARG A C    3  
ATOM 3088  O O    . ARG A 1 16 ? -3.937  -1.465  -4.053  1.00 0.00 ? 16 ARG A O    3  
ATOM 3089  C CB   . ARG A 1 16 ? -6.922  -2.103  -5.064  1.00 0.00 ? 16 ARG A CB   3  
ATOM 3090  C CG   . ARG A 1 16 ? -7.943  -3.205  -5.319  1.00 0.00 ? 16 ARG A CG   3  
ATOM 3091  C CD   . ARG A 1 16 ? -8.716  -3.006  -6.613  1.00 0.00 ? 16 ARG A CD   3  
ATOM 3092  N NE   . ARG A 1 16 ? -9.656  -4.105  -6.840  1.00 0.00 ? 16 ARG A NE   3  
ATOM 3093  C CZ   . ARG A 1 16 ? -10.430 -4.237  -7.916  1.00 0.00 ? 16 ARG A CZ   3  
ATOM 3094  N NH1  . ARG A 1 16 ? -10.424 -3.314  -8.873  1.00 0.00 ? 16 ARG A NH1  3  
ATOM 3095  N NH2  . ARG A 1 16 ? -11.221 -5.299  -8.023  1.00 0.00 ? 16 ARG A NH2  3  
ATOM 3096  H H    . ARG A 1 16 ? -7.973  -1.773  -2.731  1.00 0.00 ? 16 ARG A H    3  
ATOM 3097  H HA   . ARG A 1 16 ? -5.728  -3.286  -3.747  1.00 0.00 ? 16 ARG A HA   3  
ATOM 3098  H HB2  . ARG A 1 16 ? -7.438  -1.155  -5.036  1.00 0.00 ? 16 ARG A HB2  3  
ATOM 3099  H HB3  . ARG A 1 16 ? -6.211  -2.099  -5.878  1.00 0.00 ? 16 ARG A HB3  3  
ATOM 3100  H HG2  . ARG A 1 16 ? -7.425  -4.149  -5.369  1.00 0.00 ? 16 ARG A HG2  3  
ATOM 3101  H HG3  . ARG A 1 16 ? -8.644  -3.226  -4.495  1.00 0.00 ? 16 ARG A HG3  3  
ATOM 3102  H HD2  . ARG A 1 16 ? -9.264  -2.077  -6.554  1.00 0.00 ? 16 ARG A HD2  3  
ATOM 3103  H HD3  . ARG A 1 16 ? -8.019  -2.962  -7.438  1.00 0.00 ? 16 ARG A HD3  3  
ATOM 3104  H HE   . ARG A 1 16 ? -9.704  -4.806  -6.141  1.00 0.00 ? 16 ARG A HE   3  
ATOM 3105  H HH11 . ARG A 1 16 ? -9.838  -2.504  -8.792  1.00 0.00 ? 16 ARG A HH11 3  
ATOM 3106  H HH12 . ARG A 1 16 ? -11.006 -3.426  -9.690  1.00 0.00 ? 16 ARG A HH12 3  
ATOM 3107  H HH21 . ARG A 1 16 ? -11.233 -5.989  -7.294  1.00 0.00 ? 16 ARG A HH21 3  
ATOM 3108  H HH22 . ARG A 1 16 ? -11.808 -5.418  -8.830  1.00 0.00 ? 16 ARG A HH22 3  
ATOM 3109  N N    . GLY A 1 17 ? -5.369  -0.190  -2.886  1.00 0.00 ? 17 GLY A N    3  
ATOM 3110  C CA   . GLY A 1 17 ? -4.440  0.911   -2.697  1.00 0.00 ? 17 GLY A CA   3  
ATOM 3111  C C    . GLY A 1 17 ? -3.451  0.662   -1.578  1.00 0.00 ? 17 GLY A C    3  
ATOM 3112  O O    . GLY A 1 17 ? -2.267  0.955   -1.724  1.00 0.00 ? 17 GLY A O    3  
ATOM 3113  H H    . GLY A 1 17 ? -6.266  -0.128  -2.489  1.00 0.00 ? 17 GLY A H    3  
ATOM 3114  H HA2  . GLY A 1 17 ? -3.893  1.069   -3.616  1.00 0.00 ? 17 GLY A HA2  3  
ATOM 3115  H HA3  . GLY A 1 17 ? -5.003  1.805   -2.472  1.00 0.00 ? 17 GLY A HA3  3  
ATOM 3116  N N    . GLN A 1 18 ? -3.924  0.122   -0.454  1.00 0.00 ? 18 GLN A N    3  
ATOM 3117  C CA   . GLN A 1 18 ? -3.023  -0.260  0.626   1.00 0.00 ? 18 GLN A CA   3  
ATOM 3118  C C    . GLN A 1 18 ? -2.118  -1.367  0.121   1.00 0.00 ? 18 GLN A C    3  
ATOM 3119  O O    . GLN A 1 18 ? -0.972  -1.469  0.530   1.00 0.00 ? 18 GLN A O    3  
ATOM 3120  C CB   . GLN A 1 18 ? -3.796  -0.707  1.874   1.00 0.00 ? 18 GLN A CB   3  
ATOM 3121  C CG   . GLN A 1 18 ? -2.931  -1.014  3.091   1.00 0.00 ? 18 GLN A CG   3  
ATOM 3122  C CD   . GLN A 1 18 ? -2.134  0.183   3.577   1.00 0.00 ? 18 GLN A CD   3  
ATOM 3123  O OE1  . GLN A 1 18 ? -2.546  1.332   3.418   1.00 0.00 ? 18 GLN A OE1  3  
ATOM 3124  N NE2  . GLN A 1 18 ? -0.988  -0.079  4.187   1.00 0.00 ? 18 GLN A NE2  3  
ATOM 3125  H H    . GLN A 1 18 ? -4.892  -0.021  -0.350  1.00 0.00 ? 18 GLN A H    3  
ATOM 3126  H HA   . GLN A 1 18 ? -2.416  0.600   0.870   1.00 0.00 ? 18 GLN A HA   3  
ATOM 3127  H HB2  . GLN A 1 18 ? -4.490  0.074   2.147   1.00 0.00 ? 18 GLN A HB2  3  
ATOM 3128  H HB3  . GLN A 1 18 ? -4.358  -1.597  1.628   1.00 0.00 ? 18 GLN A HB3  3  
ATOM 3129  H HG2  . GLN A 1 18 ? -3.572  -1.345  3.895   1.00 0.00 ? 18 GLN A HG2  3  
ATOM 3130  H HG3  . GLN A 1 18 ? -2.245  -1.805  2.836   1.00 0.00 ? 18 GLN A HG3  3  
ATOM 3131  H HE21 . GLN A 1 18 ? -0.721  -1.017  4.294   1.00 0.00 ? 18 GLN A HE21 3  
ATOM 3132  H HE22 . GLN A 1 18 ? -0.454  0.674   4.507   1.00 0.00 ? 18 GLN A HE22 3  
ATOM 3133  N N    . ARG A 1 19 ? -2.646  -2.188  -0.790  1.00 0.00 ? 19 ARG A N    3  
ATOM 3134  C CA   . ARG A 1 19 ? -1.832  -3.162  -1.505  1.00 0.00 ? 19 ARG A CA   3  
ATOM 3135  C C    . ARG A 1 19 ? -0.773  -2.459  -2.365  1.00 0.00 ? 19 ARG A C    3  
ATOM 3136  O O    . ARG A 1 19 ? 0.369   -2.925  -2.458  1.00 0.00 ? 19 ARG A O    3  
ATOM 3137  C CB   . ARG A 1 19 ? -2.724  -4.058  -2.376  1.00 0.00 ? 19 ARG A CB   3  
ATOM 3138  C CG   . ARG A 1 19 ? -1.959  -4.983  -3.312  1.00 0.00 ? 19 ARG A CG   3  
ATOM 3139  C CD   . ARG A 1 19 ? -1.001  -5.892  -2.555  1.00 0.00 ? 19 ARG A CD   3  
ATOM 3140  N NE   . ARG A 1 19 ? -0.213  -6.726  -3.464  1.00 0.00 ? 19 ARG A NE   3  
ATOM 3141  C CZ   . ARG A 1 19 ? 1.062   -6.494  -3.774  1.00 0.00 ? 19 ARG A CZ   3  
ATOM 3142  N NH1  . ARG A 1 19 ? 1.686   -5.424  -3.298  1.00 0.00 ? 19 ARG A NH1  3  
ATOM 3143  N NH2  . ARG A 1 19 ? 1.708   -7.325  -4.580  1.00 0.00 ? 19 ARG A NH2  3  
ATOM 3144  H H    . ARG A 1 19 ? -3.617  -2.148  -0.970  1.00 0.00 ? 19 ARG A H    3  
ATOM 3145  H HA   . ARG A 1 19 ? -1.330  -3.774  -0.773  1.00 0.00 ? 19 ARG A HA   3  
ATOM 3146  H HB2  . ARG A 1 19 ? -3.336  -4.668  -1.729  1.00 0.00 ? 19 ARG A HB2  3  
ATOM 3147  H HB3  . ARG A 1 19 ? -3.369  -3.431  -2.976  1.00 0.00 ? 19 ARG A HB3  3  
ATOM 3148  H HG2  . ARG A 1 19 ? -2.665  -5.594  -3.853  1.00 0.00 ? 19 ARG A HG2  3  
ATOM 3149  H HG3  . ARG A 1 19 ? -1.393  -4.382  -4.010  1.00 0.00 ? 19 ARG A HG3  3  
ATOM 3150  H HD2  . ARG A 1 19 ? -0.329  -5.280  -1.970  1.00 0.00 ? 19 ARG A HD2  3  
ATOM 3151  H HD3  . ARG A 1 19 ? -1.572  -6.531  -1.898  1.00 0.00 ? 19 ARG A HD3  3  
ATOM 3152  H HE   . ARG A 1 19 ? -0.660  -7.511  -3.860  1.00 0.00 ? 19 ARG A HE   3  
ATOM 3153  H HH11 . ARG A 1 19 ? 1.202   -4.778  -2.701  1.00 0.00 ? 19 ARG A HH11 3  
ATOM 3154  H HH12 . ARG A 1 19 ? 2.646   -5.255  -3.539  1.00 0.00 ? 19 ARG A HH12 3  
ATOM 3155  H HH21 . ARG A 1 19 ? 1.235   -8.131  -4.961  1.00 0.00 ? 19 ARG A HH21 3  
ATOM 3156  H HH22 . ARG A 1 19 ? 2.674   -7.149  -4.823  1.00 0.00 ? 19 ARG A HH22 3  
ATOM 3157  N N    . ARG A 1 20 ? -1.147  -1.335  -2.974  1.00 0.00 ? 20 ARG A N    3  
ATOM 3158  C CA   . ARG A 1 20 ? -0.229  -0.589  -3.829  1.00 0.00 ? 20 ARG A CA   3  
ATOM 3159  C C    . ARG A 1 20 ? 0.878   0.069   -3.006  1.00 0.00 ? 20 ARG A C    3  
ATOM 3160  O O    . ARG A 1 20 ? 2.062   -0.235  -3.200  1.00 0.00 ? 20 ARG A O    3  
ATOM 3161  C CB   . ARG A 1 20 ? -0.973  0.491   -4.619  1.00 0.00 ? 20 ARG A CB   3  
ATOM 3162  C CG   . ARG A 1 20 ? -0.038  1.372   -5.426  1.00 0.00 ? 20 ARG A CG   3  
ATOM 3163  C CD   . ARG A 1 20 ? -0.579  2.782   -5.586  1.00 0.00 ? 20 ARG A CD   3  
ATOM 3164  N NE   . ARG A 1 20 ? 0.484   3.706   -5.974  1.00 0.00 ? 20 ARG A NE   3  
ATOM 3165  C CZ   . ARG A 1 20 ? 1.112   4.514   -5.118  1.00 0.00 ? 20 ARG A CZ   3  
ATOM 3166  N NH1  . ARG A 1 20 ? 0.691   4.624   -3.859  1.00 0.00 ? 20 ARG A NH1  3  
ATOM 3167  N NH2  . ARG A 1 20 ? 2.147   5.235   -5.533  1.00 0.00 ? 20 ARG A NH2  3  
ATOM 3168  H H    . ARG A 1 20 ? -2.061  -0.999  -2.843  1.00 0.00 ? 20 ARG A H    3  
ATOM 3169  H HA   . ARG A 1 20 ? 0.217   -1.284  -4.521  1.00 0.00 ? 20 ARG A HA   3  
ATOM 3170  H HB2  . ARG A 1 20 ? -1.667  0.015   -5.297  1.00 0.00 ? 20 ARG A HB2  3  
ATOM 3171  H HB3  . ARG A 1 20 ? -1.521  1.116   -3.930  1.00 0.00 ? 20 ARG A HB3  3  
ATOM 3172  H HG2  . ARG A 1 20 ? 0.915   1.420   -4.921  1.00 0.00 ? 20 ARG A HG2  3  
ATOM 3173  H HG3  . ARG A 1 20 ? 0.094   0.932   -6.405  1.00 0.00 ? 20 ARG A HG3  3  
ATOM 3174  H HD2  . ARG A 1 20 ? -1.344  2.780   -6.349  1.00 0.00 ? 20 ARG A HD2  3  
ATOM 3175  H HD3  . ARG A 1 20 ? -1.003  3.103   -4.645  1.00 0.00 ? 20 ARG A HD3  3  
ATOM 3176  H HE   . ARG A 1 20 ? 0.777   3.689   -6.913  1.00 0.00 ? 20 ARG A HE   3  
ATOM 3177  H HH11 . ARG A 1 20 ? -0.116  4.098   -3.540  1.00 0.00 ? 20 ARG A HH11 3  
ATOM 3178  H HH12 . ARG A 1 20 ? 1.171   5.224   -3.217  1.00 0.00 ? 20 ARG A HH12 3  
ATOM 3179  H HH21 . ARG A 1 20 ? 2.455   5.170   -6.491  1.00 0.00 ? 20 ARG A HH21 3  
ATOM 3180  H HH22 . ARG A 1 20 ? 2.640   5.839   -4.889  1.00 0.00 ? 20 ARG A HH22 3  
ATOM 3181  N N    . LYS A 1 21 ? 0.507   0.961   -2.080  1.00 0.00 ? 21 LYS A N    3  
ATOM 3182  C CA   . LYS A 1 21 ? 1.498   1.563   -1.195  1.00 0.00 ? 21 LYS A CA   3  
ATOM 3183  C C    . LYS A 1 21 ? 2.285   0.498   -0.426  1.00 0.00 ? 21 LYS A C    3  
ATOM 3184  O O    . LYS A 1 21 ? 3.452   0.703   -0.116  1.00 0.00 ? 21 LYS A O    3  
ATOM 3185  C CB   . LYS A 1 21 ? 0.864   2.547   -0.212  1.00 0.00 ? 21 LYS A CB   3  
ATOM 3186  C CG   . LYS A 1 21 ? -0.118  1.922   0.763   1.00 0.00 ? 21 LYS A CG   3  
ATOM 3187  C CD   . LYS A 1 21 ? -0.125  2.639   2.111   1.00 0.00 ? 21 LYS A CD   3  
ATOM 3188  C CE   . LYS A 1 21 ? -0.672  4.061   2.032   1.00 0.00 ? 21 LYS A CE   3  
ATOM 3189  N NZ   . LYS A 1 21 ? 0.261   4.996   1.347   1.00 0.00 ? 21 LYS A NZ   3  
ATOM 3190  H H    . LYS A 1 21 ? -0.445  1.270   -2.038  1.00 0.00 ? 21 LYS A H    3  
ATOM 3191  H HA   . LYS A 1 21 ? 2.192   2.106   -1.821  1.00 0.00 ? 21 LYS A HA   3  
ATOM 3192  H HB2  . LYS A 1 21 ? 1.651   3.019   0.360   1.00 0.00 ? 21 LYS A HB2  3  
ATOM 3193  H HB3  . LYS A 1 21 ? 0.342   3.307   -0.775  1.00 0.00 ? 21 LYS A HB3  3  
ATOM 3194  H HG2  . LYS A 1 21 ? -1.109  1.973   0.341   1.00 0.00 ? 21 LYS A HG2  3  
ATOM 3195  H HG3  . LYS A 1 21 ? 0.156   0.887   0.917   1.00 0.00 ? 21 LYS A HG3  3  
ATOM 3196  H HD2  . LYS A 1 21 ? -0.738  2.076   2.797   1.00 0.00 ? 21 LYS A HD2  3  
ATOM 3197  H HD3  . LYS A 1 21 ? 0.888   2.676   2.488   1.00 0.00 ? 21 LYS A HD3  3  
ATOM 3198  H HE2  . LYS A 1 21 ? -1.605  4.042   1.488   1.00 0.00 ? 21 LYS A HE2  3  
ATOM 3199  H HE3  . LYS A 1 21 ? -0.851  4.417   3.037   1.00 0.00 ? 21 LYS A HE3  3  
ATOM 3200  H HZ1  . LYS A 1 21 ? 0.176   5.950   1.756   1.00 0.00 ? 21 LYS A HZ1  3  
ATOM 3201  H HZ2  . LYS A 1 21 ? 0.038   5.040   0.325   1.00 0.00 ? 21 LYS A HZ2  3  
ATOM 3202  H HZ3  . LYS A 1 21 ? 1.247   4.667   1.463   1.00 0.00 ? 21 LYS A HZ3  3  
ATOM 3203  N N    . MET A 1 22 ? 1.652   -0.639  -0.131  1.00 0.00 ? 22 MET A N    3  
ATOM 3204  C CA   . MET A 1 22 ? 2.330   -1.747  0.547   1.00 0.00 ? 22 MET A CA   3  
ATOM 3205  C C    . MET A 1 22 ? 3.580   -2.150  -0.218  1.00 0.00 ? 22 MET A C    3  
ATOM 3206  O O    . MET A 1 22 ? 4.662   -2.238  0.350   1.00 0.00 ? 22 MET A O    3  
ATOM 3207  C CB   . MET A 1 22 ? 1.410   -2.965  0.652   1.00 0.00 ? 22 MET A CB   3  
ATOM 3208  C CG   . MET A 1 22 ? 1.940   -4.063  1.555   1.00 0.00 ? 22 MET A CG   3  
ATOM 3209  S SD   . MET A 1 22 ? 1.875   -3.608  3.297   1.00 0.00 ? 22 MET A SD   3  
ATOM 3210  C CE   . MET A 1 22 ? 0.106   -3.484  3.559   1.00 0.00 ? 22 MET A CE   3  
ATOM 3211  H H    . MET A 1 22 ? 0.704   -0.729  -0.357  1.00 0.00 ? 22 MET A H    3  
ATOM 3212  H HA   . MET A 1 22 ? 2.607   -1.421  1.539   1.00 0.00 ? 22 MET A HA   3  
ATOM 3213  H HB2  . MET A 1 22 ? 0.454   -2.646  1.038   1.00 0.00 ? 22 MET A HB2  3  
ATOM 3214  H HB3  . MET A 1 22 ? 1.268   -3.379  -0.336  1.00 0.00 ? 22 MET A HB3  3  
ATOM 3215  H HG2  . MET A 1 22 ? 1.344   -4.953  1.407   1.00 0.00 ? 22 MET A HG2  3  
ATOM 3216  H HG3  . MET A 1 22 ? 2.966   -4.271  1.289   1.00 0.00 ? 22 MET A HG3  3  
ATOM 3217  H HE1  . MET A 1 22 ? -0.088  -3.203  4.584   1.00 0.00 ? 22 MET A HE1  3  
ATOM 3218  H HE2  . MET A 1 22 ? -0.356  -4.438  3.355   1.00 0.00 ? 22 MET A HE2  3  
ATOM 3219  H HE3  . MET A 1 22 ? -0.304  -2.736  2.897   1.00 0.00 ? 22 MET A HE3  3  
ATOM 3220  N N    . ALA A 1 23 ? 3.418   -2.375  -1.517  1.00 0.00 ? 23 ALA A N    3  
ATOM 3221  C CA   . ALA A 1 23 ? 4.523   -2.803  -2.367  1.00 0.00 ? 23 ALA A CA   3  
ATOM 3222  C C    . ALA A 1 23 ? 5.619   -1.746  -2.416  1.00 0.00 ? 23 ALA A C    3  
ATOM 3223  O O    . ALA A 1 23 ? 6.798   -2.064  -2.559  1.00 0.00 ? 23 ALA A O    3  
ATOM 3224  C CB   . ALA A 1 23 ? 4.021   -3.104  -3.770  1.00 0.00 ? 23 ALA A CB   3  
ATOM 3225  H H    . ALA A 1 23 ? 2.530   -2.241  -1.918  1.00 0.00 ? 23 ALA A H    3  
ATOM 3226  H HA   . ALA A 1 23 ? 4.927   -3.714  -1.952  1.00 0.00 ? 23 ALA A HA   3  
ATOM 3227  H HB1  . ALA A 1 23 ? 3.244   -3.853  -3.723  1.00 0.00 ? 23 ALA A HB1  3  
ATOM 3228  H HB2  . ALA A 1 23 ? 4.838   -3.471  -4.375  1.00 0.00 ? 23 ALA A HB2  3  
ATOM 3229  H HB3  . ALA A 1 23 ? 3.624   -2.202  -4.211  1.00 0.00 ? 23 ALA A HB3  3  
ATOM 3230  N N    . GLN A 1 24 ? 5.220   -0.489  -2.298  1.00 0.00 ? 24 GLN A N    3  
ATOM 3231  C CA   . GLN A 1 24 ? 6.166   0.619   -2.328  1.00 0.00 ? 24 GLN A CA   3  
ATOM 3232  C C    . GLN A 1 24 ? 6.865   0.807   -0.978  1.00 0.00 ? 24 GLN A C    3  
ATOM 3233  O O    . GLN A 1 24 ? 8.077   1.031   -0.921  1.00 0.00 ? 24 GLN A O    3  
ATOM 3234  C CB   . GLN A 1 24 ? 5.445   1.912   -2.720  1.00 0.00 ? 24 GLN A CB   3  
ATOM 3235  C CG   . GLN A 1 24 ? 4.881   1.893   -4.129  1.00 0.00 ? 24 GLN A CG   3  
ATOM 3236  C CD   . GLN A 1 24 ? 5.967   1.863   -5.189  1.00 0.00 ? 24 GLN A CD   3  
ATOM 3237  O OE1  . GLN A 1 24 ? 6.419   2.905   -5.662  1.00 0.00 ? 24 GLN A OE1  3  
ATOM 3238  N NE2  . GLN A 1 24 ? 6.394   0.669   -5.567  1.00 0.00 ? 24 GLN A NE2  3  
ATOM 3239  H H    . GLN A 1 24 ? 4.258   -0.300  -2.196  1.00 0.00 ? 24 GLN A H    3  
ATOM 3240  H HA   . GLN A 1 24 ? 6.912   0.397   -3.077  1.00 0.00 ? 24 GLN A HA   3  
ATOM 3241  H HB2  . GLN A 1 24 ? 4.630   2.079   -2.033  1.00 0.00 ? 24 GLN A HB2  3  
ATOM 3242  H HB3  . GLN A 1 24 ? 6.141   2.736   -2.646  1.00 0.00 ? 24 GLN A HB3  3  
ATOM 3243  H HG2  . GLN A 1 24 ? 4.263   1.016   -4.240  1.00 0.00 ? 24 GLN A HG2  3  
ATOM 3244  H HG3  . GLN A 1 24 ? 4.279   2.779   -4.274  1.00 0.00 ? 24 GLN A HG3  3  
ATOM 3245  H HE21 . GLN A 1 24 ? 5.989   -0.122  -5.156  1.00 0.00 ? 24 GLN A HE21 3  
ATOM 3246  H HE22 . GLN A 1 24 ? 7.116   0.624   -6.236  1.00 0.00 ? 24 GLN A HE22 3  
ATOM 3247  N N    . GLU A 1 25 ? 6.102   0.706   0.104   1.00 0.00 ? 25 GLU A N    3  
ATOM 3248  C CA   . GLU A 1 25 ? 6.598   1.057   1.431   1.00 0.00 ? 25 GLU A CA   3  
ATOM 3249  C C    . GLU A 1 25 ? 7.158   -0.143  2.204   1.00 0.00 ? 25 GLU A C    3  
ATOM 3250  O O    . GLU A 1 25 ? 8.271   -0.072  2.726   1.00 0.00 ? 25 GLU A O    3  
ATOM 3251  C CB   . GLU A 1 25 ? 5.482   1.740   2.231   1.00 0.00 ? 25 GLU A CB   3  
ATOM 3252  C CG   . GLU A 1 25 ? 5.095   3.106   1.671   1.00 0.00 ? 25 GLU A CG   3  
ATOM 3253  C CD   . GLU A 1 25 ? 3.956   3.769   2.423   1.00 0.00 ? 25 GLU A CD   3  
ATOM 3254  O OE1  . GLU A 1 25 ? 4.152   4.146   3.597   1.00 0.00 ? 25 GLU A OE1  3  
ATOM 3255  O OE2  . GLU A 1 25 ? 2.866   3.943   1.833   1.00 0.00 ? 25 GLU A OE2  3  
ATOM 3256  H H    . GLU A 1 25 ? 5.174   0.397   0.007   1.00 0.00 ? 25 GLU A H    3  
ATOM 3257  H HA   . GLU A 1 25 ? 7.398   1.768   1.294   1.00 0.00 ? 25 GLU A HA   3  
ATOM 3258  H HB2  . GLU A 1 25 ? 4.604   1.106   2.219   1.00 0.00 ? 25 GLU A HB2  3  
ATOM 3259  H HB3  . GLU A 1 25 ? 5.811   1.871   3.252   1.00 0.00 ? 25 GLU A HB3  3  
ATOM 3260  H HG2  . GLU A 1 25 ? 5.957   3.753   1.720   1.00 0.00 ? 25 GLU A HG2  3  
ATOM 3261  H HG3  . GLU A 1 25 ? 4.801   2.983   0.638   1.00 0.00 ? 25 GLU A HG3  3  
ATOM 3262  N N    . ASN A 1 26 ? 6.410   -1.240  2.277   1.00 0.00 ? 26 ASN A N    3  
ATOM 3263  C CA   . ASN A 1 26 ? 6.833   -2.391  3.081   1.00 0.00 ? 26 ASN A CA   3  
ATOM 3264  C C    . ASN A 1 26 ? 6.077   -3.672  2.712   1.00 0.00 ? 26 ASN A C    3  
ATOM 3265  O O    . ASN A 1 26 ? 5.103   -4.046  3.358   1.00 0.00 ? 26 ASN A O    3  
ATOM 3266  C CB   . ASN A 1 26 ? 6.697   -2.092  4.589   1.00 0.00 ? 26 ASN A CB   3  
ATOM 3267  C CG   . ASN A 1 26 ? 5.388   -1.403  4.988   1.00 0.00 ? 26 ASN A CG   3  
ATOM 3268  O OD1  . ASN A 1 26 ? 5.373   -0.580  5.903   1.00 0.00 ? 26 ASN A OD1  3  
ATOM 3269  N ND2  . ASN A 1 26 ? 4.282   -1.750  4.344   1.00 0.00 ? 26 ASN A ND2  3  
ATOM 3270  H H    . ASN A 1 26 ? 5.568   -1.287  1.771   1.00 0.00 ? 26 ASN A H    3  
ATOM 3271  H HA   . ASN A 1 26 ? 7.878   -2.553  2.866   1.00 0.00 ? 26 ASN A HA   3  
ATOM 3272  H HB2  . ASN A 1 26 ? 6.761   -3.021  5.134   1.00 0.00 ? 26 ASN A HB2  3  
ATOM 3273  H HB3  . ASN A 1 26 ? 7.516   -1.454  4.890   1.00 0.00 ? 26 ASN A HB3  3  
ATOM 3274  H HD21 . ASN A 1 26 ? 4.347   -2.438  3.646   1.00 0.00 ? 26 ASN A HD21 3  
ATOM 3275  H HD22 . ASN A 1 26 ? 3.443   -1.309  4.592   1.00 0.00 ? 26 ASN A HD22 3  
ATOM 3276  N N    . PRO A 1 27 ? 6.513   -4.366  1.655   1.00 0.00 ? 27 PRO A N    3  
ATOM 3277  C CA   . PRO A 1 27 ? 5.873   -5.589  1.202   1.00 0.00 ? 27 PRO A CA   3  
ATOM 3278  C C    . PRO A 1 27 ? 6.508   -6.849  1.796   1.00 0.00 ? 27 PRO A C    3  
ATOM 3279  O O    . PRO A 1 27 ? 7.374   -7.472  1.174   1.00 0.00 ? 27 PRO A O    3  
ATOM 3280  C CB   . PRO A 1 27 ? 6.086   -5.538  -0.311  1.00 0.00 ? 27 PRO A CB   3  
ATOM 3281  C CG   . PRO A 1 27 ? 7.296   -4.670  -0.529  1.00 0.00 ? 27 PRO A CG   3  
ATOM 3282  C CD   . PRO A 1 27 ? 7.642   -4.012  0.791   1.00 0.00 ? 27 PRO A CD   3  
ATOM 3283  H HA   . PRO A 1 27 ? 4.815   -5.583  1.418   1.00 0.00 ? 27 PRO A HA   3  
ATOM 3284  H HB2  . PRO A 1 27 ? 6.249   -6.539  -0.684  1.00 0.00 ? 27 PRO A HB2  3  
ATOM 3285  H HB3  . PRO A 1 27 ? 5.211   -5.114  -0.784  1.00 0.00 ? 27 PRO A HB3  3  
ATOM 3286  H HG2  . PRO A 1 27 ? 8.123   -5.280  -0.865  1.00 0.00 ? 27 PRO A HG2  3  
ATOM 3287  H HG3  . PRO A 1 27 ? 7.071   -3.917  -1.272  1.00 0.00 ? 27 PRO A HG3  3  
ATOM 3288  H HD2  . PRO A 1 27 ? 8.568   -4.411  1.182   1.00 0.00 ? 27 PRO A HD2  3  
ATOM 3289  H HD3  . PRO A 1 27 ? 7.715   -2.940  0.671   1.00 0.00 ? 27 PRO A HD3  3  
ATOM 3290  N N    . LYS A 1 28 ? 6.106   -7.203  3.013   1.00 0.00 ? 28 LYS A N    3  
ATOM 3291  C CA   . LYS A 1 28 ? 6.594   -8.432  3.637   1.00 0.00 ? 28 LYS A CA   3  
ATOM 3292  C C    . LYS A 1 28 ? 5.548   -9.538  3.610   1.00 0.00 ? 28 LYS A C    3  
ATOM 3293  O O    . LYS A 1 28 ? 5.888   -10.720 3.567   1.00 0.00 ? 28 LYS A O    3  
ATOM 3294  C CB   . LYS A 1 28 ? 7.006   -8.191  5.092   1.00 0.00 ? 28 LYS A CB   3  
ATOM 3295  C CG   . LYS A 1 28 ? 8.319   -7.452  5.267   1.00 0.00 ? 28 LYS A CG   3  
ATOM 3296  C CD   . LYS A 1 28 ? 8.817   -7.592  6.695   1.00 0.00 ? 28 LYS A CD   3  
ATOM 3297  C CE   . LYS A 1 28 ? 10.156  -6.912  6.902   1.00 0.00 ? 28 LYS A CE   3  
ATOM 3298  N NZ   . LYS A 1 28 ? 10.695  -7.171  8.262   1.00 0.00 ? 28 LYS A NZ   3  
ATOM 3299  H H    . LYS A 1 28 ? 5.478   -6.627  3.501   1.00 0.00 ? 28 LYS A H    3  
ATOM 3300  H HA   . LYS A 1 28 ? 7.460   -8.761  3.081   1.00 0.00 ? 28 LYS A HA   3  
ATOM 3301  H HB2  . LYS A 1 28 ? 6.232   -7.614  5.576   1.00 0.00 ? 28 LYS A HB2  3  
ATOM 3302  H HB3  . LYS A 1 28 ? 7.088   -9.147  5.588   1.00 0.00 ? 28 LYS A HB3  3  
ATOM 3303  H HG2  . LYS A 1 28 ? 9.054   -7.870  4.594   1.00 0.00 ? 28 LYS A HG2  3  
ATOM 3304  H HG3  . LYS A 1 28 ? 8.172   -6.406  5.045   1.00 0.00 ? 28 LYS A HG3  3  
ATOM 3305  H HD2  . LYS A 1 28 ? 8.095   -7.146  7.362   1.00 0.00 ? 28 LYS A HD2  3  
ATOM 3306  H HD3  . LYS A 1 28 ? 8.917   -8.644  6.926   1.00 0.00 ? 28 LYS A HD3  3  
ATOM 3307  H HE2  . LYS A 1 28 ? 10.854  -7.289  6.169   1.00 0.00 ? 28 LYS A HE2  3  
ATOM 3308  H HE3  . LYS A 1 28 ? 10.032  -5.847  6.767   1.00 0.00 ? 28 LYS A HE3  3  
ATOM 3309  H HZ1  . LYS A 1 28 ? 9.956   -6.995  8.980   1.00 0.00 ? 28 LYS A HZ1  3  
ATOM 3310  H HZ2  . LYS A 1 28 ? 11.503  -6.543  8.451   1.00 0.00 ? 28 LYS A HZ2  3  
ATOM 3311  H HZ3  . LYS A 1 28 ? 11.013  -8.161  8.342   1.00 0.00 ? 28 LYS A HZ3  3  
ATOM 3312  N N    . MET A 1 29 ? 4.281   -9.153  3.624   1.00 0.00 ? 29 MET A N    3  
ATOM 3313  C CA   . MET A 1 29 ? 3.194   -10.111 3.766   1.00 0.00 ? 29 MET A CA   3  
ATOM 3314  C C    . MET A 1 29 ? 2.349   -10.208 2.503   1.00 0.00 ? 29 MET A C    3  
ATOM 3315  O O    . MET A 1 29 ? 2.396   -9.332  1.639   1.00 0.00 ? 29 MET A O    3  
ATOM 3316  C CB   . MET A 1 29 ? 2.307   -9.767  4.973   1.00 0.00 ? 29 MET A CB   3  
ATOM 3317  C CG   . MET A 1 29 ? 1.928   -8.297  5.099   1.00 0.00 ? 29 MET A CG   3  
ATOM 3318  S SD   . MET A 1 29 ? 3.296   -7.272  5.686   1.00 0.00 ? 29 MET A SD   3  
ATOM 3319  C CE   . MET A 1 29 ? 2.475   -5.699  5.925   1.00 0.00 ? 29 MET A CE   3  
ATOM 3320  H H    . MET A 1 29 ? 4.071   -8.202  3.539   1.00 0.00 ? 29 MET A H    3  
ATOM 3321  H HA   . MET A 1 29 ? 3.645   -11.077 3.941   1.00 0.00 ? 29 MET A HA   3  
ATOM 3322  H HB2  . MET A 1 29 ? 1.396   -10.339 4.903   1.00 0.00 ? 29 MET A HB2  3  
ATOM 3323  H HB3  . MET A 1 29 ? 2.828   -10.056 5.875   1.00 0.00 ? 29 MET A HB3  3  
ATOM 3324  H HG2  . MET A 1 29 ? 1.614   -7.934  4.130   1.00 0.00 ? 29 MET A HG2  3  
ATOM 3325  H HG3  . MET A 1 29 ? 1.108   -8.211  5.796   1.00 0.00 ? 29 MET A HG3  3  
ATOM 3326  H HE1  . MET A 1 29 ? 2.082   -5.353  4.981   1.00 0.00 ? 29 MET A HE1  3  
ATOM 3327  H HE2  . MET A 1 29 ? 3.184   -4.978  6.306   1.00 0.00 ? 29 MET A HE2  3  
ATOM 3328  H HE3  . MET A 1 29 ? 1.667   -5.818  6.630   1.00 0.00 ? 29 MET A HE3  3  
ATOM 3329  N N    . HIS A 1 30 ? 1.575   -11.282 2.417   1.00 0.00 ? 30 HIS A N    3  
ATOM 3330  C CA   . HIS A 1 30 ? 0.764   -11.563 1.240   1.00 0.00 ? 30 HIS A CA   3  
ATOM 3331  C C    . HIS A 1 30 ? -0.508  -10.724 1.242   1.00 0.00 ? 30 HIS A C    3  
ATOM 3332  O O    . HIS A 1 30 ? -0.912  -10.193 2.281   1.00 0.00 ? 30 HIS A O    3  
ATOM 3333  C CB   . HIS A 1 30 ? 0.404   -13.049 1.186   1.00 0.00 ? 30 HIS A CB   3  
ATOM 3334  C CG   . HIS A 1 30 ? 1.588   -13.963 1.117   1.00 0.00 ? 30 HIS A CG   3  
ATOM 3335  N ND1  . HIS A 1 30 ? 1.753   -15.040 1.957   1.00 0.00 ? 30 HIS A ND1  3  
ATOM 3336  C CD2  . HIS A 1 30 ? 2.661   -13.960 0.295   1.00 0.00 ? 30 HIS A CD2  3  
ATOM 3337  C CE1  . HIS A 1 30 ? 2.878   -15.662 1.656   1.00 0.00 ? 30 HIS A CE1  3  
ATOM 3338  N NE2  . HIS A 1 30 ? 3.450   -15.028 0.648   1.00 0.00 ? 30 HIS A NE2  3  
ATOM 3339  H H    . HIS A 1 30 ? 1.542   -11.903 3.178   1.00 0.00 ? 30 HIS A H    3  
ATOM 3340  H HA   . HIS A 1 30 ? 1.347   -11.309 0.368   1.00 0.00 ? 30 HIS A HA   3  
ATOM 3341  H HB2  . HIS A 1 30 ? -0.160  -13.305 2.069   1.00 0.00 ? 30 HIS A HB2  3  
ATOM 3342  H HB3  . HIS A 1 30 ? -0.207  -13.231 0.314   1.00 0.00 ? 30 HIS A HB3  3  
ATOM 3343  H HD1  . HIS A 1 30 ? 1.123   -15.321 2.668   1.00 0.00 ? 30 HIS A HD1  3  
ATOM 3344  H HD2  . HIS A 1 30 ? 2.855   -13.257 -0.502  1.00 0.00 ? 30 HIS A HD2  3  
ATOM 3345  H HE1  . HIS A 1 30 ? 3.261   -16.545 2.149   1.00 0.00 ? 30 HIS A HE1  3  
ATOM 3346  H HE2  . HIS A 1 30 ? 4.198   -15.382 0.112   1.00 0.00 ? 30 HIS A HE2  3  
ATOM 3347  N N    . ASN A 1 31 ? -1.160  -10.629 0.084   1.00 0.00 ? 31 ASN A N    3  
ATOM 3348  C CA   . ASN A 1 31 ? -2.343  -9.787  -0.054  1.00 0.00 ? 31 ASN A CA   3  
ATOM 3349  C C    . ASN A 1 31 ? -3.530  -10.392 0.691   1.00 0.00 ? 31 ASN A C    3  
ATOM 3350  O O    . ASN A 1 31 ? -4.457  -9.679  1.074   1.00 0.00 ? 31 ASN A O    3  
ATOM 3351  C CB   . ASN A 1 31 ? -2.704  -9.551  -1.531  1.00 0.00 ? 31 ASN A CB   3  
ATOM 3352  C CG   . ASN A 1 31 ? -3.238  -10.793 -2.224  1.00 0.00 ? 31 ASN A CG   3  
ATOM 3353  O OD1  . ASN A 1 31 ? -4.432  -11.084 -2.165  1.00 0.00 ? 31 ASN A OD1  3  
ATOM 3354  N ND2  . ASN A 1 31 ? -2.366  -11.512 -2.913  1.00 0.00 ? 31 ASN A ND2  3  
ATOM 3355  H H    . ASN A 1 31 ? -0.849  -11.154 -0.685  1.00 0.00 ? 31 ASN A H    3  
ATOM 3356  H HA   . ASN A 1 31 ? -2.110  -8.834  0.399   1.00 0.00 ? 31 ASN A HA   3  
ATOM 3357  H HB2  . ASN A 1 31 ? -3.458  -8.783  -1.590  1.00 0.00 ? 31 ASN A HB2  3  
ATOM 3358  H HB3  . ASN A 1 31 ? -1.821  -9.220  -2.059  1.00 0.00 ? 31 ASN A HB3  3  
ATOM 3359  H HD21 . ASN A 1 31 ? -1.437  -11.211 -2.947  1.00 0.00 ? 31 ASN A HD21 3  
ATOM 3360  H HD22 . ASN A 1 31 ? -2.687  -12.338 -3.349  1.00 0.00 ? 31 ASN A HD22 3  
ATOM 3361  N N    . SER A 1 32 ? -3.489  -11.702 0.906   1.00 0.00 ? 32 SER A N    3  
ATOM 3362  C CA   . SER A 1 32 ? -4.530  -12.387 1.657   1.00 0.00 ? 32 SER A CA   3  
ATOM 3363  C C    . SER A 1 32 ? -4.568  -11.877 3.096   1.00 0.00 ? 32 SER A C    3  
ATOM 3364  O O    . SER A 1 32 ? -5.633  -11.539 3.624   1.00 0.00 ? 32 SER A O    3  
ATOM 3365  C CB   . SER A 1 32 ? -4.278  -13.894 1.631   1.00 0.00 ? 32 SER A CB   3  
ATOM 3366  O OG   . SER A 1 32 ? -2.945  -14.186 2.021   1.00 0.00 ? 32 SER A OG   3  
ATOM 3367  H H    . SER A 1 32 ? -2.741  -12.230 0.537   1.00 0.00 ? 32 SER A H    3  
ATOM 3368  H HA   . SER A 1 32 ? -5.478  -12.179 1.183   1.00 0.00 ? 32 SER A HA   3  
ATOM 3369  H HB2  . SER A 1 32 ? -4.957  -14.381 2.315   1.00 0.00 ? 32 SER A HB2  3  
ATOM 3370  H HB3  . SER A 1 32 ? -4.438  -14.268 0.632   1.00 0.00 ? 32 SER A HB3  3  
ATOM 3371  H HG   . SER A 1 32 ? -2.803  -15.139 1.983   1.00 0.00 ? 32 SER A HG   3  
ATOM 3372  N N    . GLU A 1 33 ? -3.395  -11.801 3.715   1.00 0.00 ? 33 GLU A N    3  
ATOM 3373  C CA   . GLU A 1 33 ? -3.265  -11.279 5.070   1.00 0.00 ? 33 GLU A CA   3  
ATOM 3374  C C    . GLU A 1 33 ? -3.687  -9.822  5.088   1.00 0.00 ? 33 GLU A C    3  
ATOM 3375  O O    . GLU A 1 33 ? -4.448  -9.393  5.955   1.00 0.00 ? 33 GLU A O    3  
ATOM 3376  C CB   . GLU A 1 33 ? -1.818  -11.407 5.555   1.00 0.00 ? 33 GLU A CB   3  
ATOM 3377  C CG   . GLU A 1 33 ? -1.623  -10.995 7.006   1.00 0.00 ? 33 GLU A CG   3  
ATOM 3378  C CD   . GLU A 1 33 ? -0.164  -10.869 7.390   1.00 0.00 ? 33 GLU A CD   3  
ATOM 3379  O OE1  . GLU A 1 33 ? 0.627   -11.769 7.046   1.00 0.00 ? 33 GLU A OE1  3  
ATOM 3380  O OE2  . GLU A 1 33 ? 0.197   -9.867  8.052   1.00 0.00 ? 33 GLU A OE2  3  
ATOM 3381  H H    . GLU A 1 33 ? -2.592  -12.106 3.243   1.00 0.00 ? 33 GLU A H    3  
ATOM 3382  H HA   . GLU A 1 33 ? -3.921  -11.844 5.722   1.00 0.00 ? 33 GLU A HA   3  
ATOM 3383  H HB2  . GLU A 1 33 ? -1.507  -12.436 5.450   1.00 0.00 ? 33 GLU A HB2  3  
ATOM 3384  H HB3  . GLU A 1 33 ? -1.187  -10.784 4.938   1.00 0.00 ? 33 GLU A HB3  3  
ATOM 3385  H HG2  . GLU A 1 33 ? -2.102  -10.040 7.164   1.00 0.00 ? 33 GLU A HG2  3  
ATOM 3386  H HG3  . GLU A 1 33 ? -2.082  -11.736 7.644   1.00 0.00 ? 33 GLU A HG3  3  
ATOM 3387  N N    . ILE A 1 34 ? -3.209  -9.082  4.091   1.00 0.00 ? 34 ILE A N    3  
ATOM 3388  C CA   . ILE A 1 34 ? -3.566  -7.680  3.927   1.00 0.00 ? 34 ILE A CA   3  
ATOM 3389  C C    . ILE A 1 34 ? -5.083  -7.513  3.920   1.00 0.00 ? 34 ILE A C    3  
ATOM 3390  O O    . ILE A 1 34 ? -5.612  -6.573  4.503   1.00 0.00 ? 34 ILE A O    3  
ATOM 3391  C CB   . ILE A 1 34 ? -2.969  -7.101  2.618   1.00 0.00 ? 34 ILE A CB   3  
ATOM 3392  C CG1  . ILE A 1 34 ? -1.439  -7.136  2.676   1.00 0.00 ? 34 ILE A CG1  3  
ATOM 3393  C CG2  . ILE A 1 34 ? -3.459  -5.680  2.374   1.00 0.00 ? 34 ILE A CG2  3  
ATOM 3394  C CD1  . ILE A 1 34 ? -0.766  -6.669  1.402   1.00 0.00 ? 34 ILE A CD1  3  
ATOM 3395  H H    . ILE A 1 34 ? -2.592  -9.496  3.447   1.00 0.00 ? 34 ILE A H    3  
ATOM 3396  H HA   . ILE A 1 34 ? -3.155  -7.131  4.762   1.00 0.00 ? 34 ILE A HA   3  
ATOM 3397  H HB   . ILE A 1 34 ? -3.303  -7.716  1.796   1.00 0.00 ? 34 ILE A HB   3  
ATOM 3398  H HG12 . ILE A 1 34 ? -1.104  -6.496  3.478   1.00 0.00 ? 34 ILE A HG12 3  
ATOM 3399  H HG13 . ILE A 1 34 ? -1.116  -8.148  2.871   1.00 0.00 ? 34 ILE A HG13 3  
ATOM 3400  H HG21 . ILE A 1 34 ? -4.536  -5.676  2.308   1.00 0.00 ? 34 ILE A HG21 3  
ATOM 3401  H HG22 . ILE A 1 34 ? -3.038  -5.307  1.451   1.00 0.00 ? 34 ILE A HG22 3  
ATOM 3402  H HG23 . ILE A 1 34 ? -3.148  -5.047  3.192   1.00 0.00 ? 34 ILE A HG23 3  
ATOM 3403  H HD11 . ILE A 1 34 ? -1.075  -7.298  0.581   1.00 0.00 ? 34 ILE A HD11 3  
ATOM 3404  H HD12 . ILE A 1 34 ? 0.306   -6.727  1.519   1.00 0.00 ? 34 ILE A HD12 3  
ATOM 3405  H HD13 . ILE A 1 34 ? -1.049  -5.646  1.198   1.00 0.00 ? 34 ILE A HD13 3  
ATOM 3406  N N    . SER A 1 35 ? -5.782  -8.464  3.312   1.00 0.00 ? 35 SER A N    3  
ATOM 3407  C CA   . SER A 1 35 ? -7.232  -8.379  3.204   1.00 0.00 ? 35 SER A CA   3  
ATOM 3408  C C    . SER A 1 35 ? -7.882  -8.496  4.583   1.00 0.00 ? 35 SER A C    3  
ATOM 3409  O O    . SER A 1 35 ? -8.801  -7.748  4.920   1.00 0.00 ? 35 SER A O    3  
ATOM 3410  C CB   . SER A 1 35 ? -7.758  -9.477  2.276   1.00 0.00 ? 35 SER A CB   3  
ATOM 3411  O OG   . SER A 1 35 ? -7.139  -9.409  1.000   1.00 0.00 ? 35 SER A OG   3  
ATOM 3412  H H    . SER A 1 35 ? -5.313  -9.252  2.950   1.00 0.00 ? 35 SER A H    3  
ATOM 3413  H HA   . SER A 1 35 ? -7.478  -7.415  2.784   1.00 0.00 ? 35 SER A HA   3  
ATOM 3414  H HB2  . SER A 1 35 ? -7.552  -10.442 2.712   1.00 0.00 ? 35 SER A HB2  3  
ATOM 3415  H HB3  . SER A 1 35 ? -8.824  -9.358  2.152   1.00 0.00 ? 35 SER A HB3  3  
ATOM 3416  H HG   . SER A 1 35 ? -6.208  -9.167  1.108   1.00 0.00 ? 35 SER A HG   3  
ATOM 3417  N N    . LYS A 1 36 ? -7.368  -9.412  5.393   1.00 0.00 ? 36 LYS A N    3  
ATOM 3418  C CA   . LYS A 1 36 ? -7.935  -9.666  6.709   1.00 0.00 ? 36 LYS A CA   3  
ATOM 3419  C C    . LYS A 1 36 ? -7.563  -8.565  7.690   1.00 0.00 ? 36 LYS A C    3  
ATOM 3420  O O    . LYS A 1 36 ? -8.364  -8.178  8.541   1.00 0.00 ? 36 LYS A O    3  
ATOM 3421  C CB   . LYS A 1 36 ? -7.480  -11.031 7.229   1.00 0.00 ? 36 LYS A CB   3  
ATOM 3422  C CG   . LYS A 1 36 ? -8.206  -12.191 6.566   1.00 0.00 ? 36 LYS A CG   3  
ATOM 3423  C CD   . LYS A 1 36 ? -9.716  -12.011 6.642   1.00 0.00 ? 36 LYS A CD   3  
ATOM 3424  C CE   . LYS A 1 36 ? -10.451 -13.113 5.895   1.00 0.00 ? 36 LYS A CE   3  
ATOM 3425  N NZ   . LYS A 1 36 ? -11.910 -12.836 5.794   1.00 0.00 ? 36 LYS A NZ   3  
ATOM 3426  H H    . LYS A 1 36 ? -6.576  -9.917  5.104   1.00 0.00 ? 36 LYS A H    3  
ATOM 3427  H HA   . LYS A 1 36 ? -9.010  -9.677  6.602   1.00 0.00 ? 36 LYS A HA   3  
ATOM 3428  H HB2  . LYS A 1 36 ? -6.422  -11.140 7.039   1.00 0.00 ? 36 LYS A HB2  3  
ATOM 3429  H HB3  . LYS A 1 36 ? -7.652  -11.081 8.290   1.00 0.00 ? 36 LYS A HB3  3  
ATOM 3430  H HG2  . LYS A 1 36 ? -7.909  -12.245 5.529   1.00 0.00 ? 36 LYS A HG2  3  
ATOM 3431  H HG3  . LYS A 1 36 ? -7.934  -13.108 7.069   1.00 0.00 ? 36 LYS A HG3  3  
ATOM 3432  H HD2  . LYS A 1 36 ? -10.018 -12.030 7.678   1.00 0.00 ? 36 LYS A HD2  3  
ATOM 3433  H HD3  . LYS A 1 36 ? -9.977  -11.058 6.206   1.00 0.00 ? 36 LYS A HD3  3  
ATOM 3434  H HE2  . LYS A 1 36 ? -10.040 -13.191 4.900   1.00 0.00 ? 36 LYS A HE2  3  
ATOM 3435  H HE3  . LYS A 1 36 ? -10.304 -14.045 6.419   1.00 0.00 ? 36 LYS A HE3  3  
ATOM 3436  H HZ1  . LYS A 1 36 ? -12.384 -13.600 5.267   1.00 0.00 ? 36 LYS A HZ1  3  
ATOM 3437  H HZ2  . LYS A 1 36 ? -12.071 -11.934 5.293   1.00 0.00 ? 36 LYS A HZ2  3  
ATOM 3438  H HZ3  . LYS A 1 36 ? -12.334 -12.772 6.745   1.00 0.00 ? 36 LYS A HZ3  3  
ATOM 3439  N N    . ARG A 1 37 ? -6.350  -8.054  7.560   1.00 0.00 ? 37 ARG A N    3  
ATOM 3440  C CA   . ARG A 1 37 ? -5.884  -6.981  8.422   1.00 0.00 ? 37 ARG A CA   3  
ATOM 3441  C C    . ARG A 1 37 ? -6.645  -5.695  8.136   1.00 0.00 ? 37 ARG A C    3  
ATOM 3442  O O    . ARG A 1 37 ? -7.060  -5.000  9.057   1.00 0.00 ? 37 ARG A O    3  
ATOM 3443  C CB   . ARG A 1 37 ? -4.384  -6.761  8.236   1.00 0.00 ? 37 ARG A CB   3  
ATOM 3444  C CG   . ARG A 1 37 ? -3.552  -7.975  8.600   1.00 0.00 ? 37 ARG A CG   3  
ATOM 3445  C CD   . ARG A 1 37 ? -2.072  -7.707  8.420   1.00 0.00 ? 37 ARG A CD   3  
ATOM 3446  N NE   . ARG A 1 37 ? -1.592  -6.656  9.312   1.00 0.00 ? 37 ARG A NE   3  
ATOM 3447  C CZ   . ARG A 1 37 ? -0.333  -6.549  9.724   1.00 0.00 ? 37 ARG A CZ   3  
ATOM 3448  N NH1  . ARG A 1 37 ? 0.575   -7.442  9.349   1.00 0.00 ? 37 ARG A NH1  3  
ATOM 3449  N NH2  . ARG A 1 37 ? 0.011   -5.549  10.526  1.00 0.00 ? 37 ARG A NH2  3  
ATOM 3450  H H    . ARG A 1 37 ? -5.748  -8.414  6.871   1.00 0.00 ? 37 ARG A H    3  
ATOM 3451  H HA   . ARG A 1 37 ? -6.071  -7.274  9.443   1.00 0.00 ? 37 ARG A HA   3  
ATOM 3452  H HB2  . ARG A 1 37 ? -4.190  -6.511  7.203   1.00 0.00 ? 37 ARG A HB2  3  
ATOM 3453  H HB3  . ARG A 1 37 ? -4.072  -5.939  8.860   1.00 0.00 ? 37 ARG A HB3  3  
ATOM 3454  H HG2  . ARG A 1 37 ? -3.740  -8.232  9.631   1.00 0.00 ? 37 ARG A HG2  3  
ATOM 3455  H HG3  . ARG A 1 37 ? -3.840  -8.799  7.963   1.00 0.00 ? 37 ARG A HG3  3  
ATOM 3456  H HD2  . ARG A 1 37 ? -1.528  -8.616  8.627   1.00 0.00 ? 37 ARG A HD2  3  
ATOM 3457  H HD3  . ARG A 1 37 ? -1.895  -7.408  7.397   1.00 0.00 ? 37 ARG A HD3  3  
ATOM 3458  H HE   . ARG A 1 37 ? -2.254  -5.987  9.623   1.00 0.00 ? 37 ARG A HE   3  
ATOM 3459  H HH11 . ARG A 1 37 ? 0.315   -8.214  8.749   1.00 0.00 ? 37 ARG A HH11 3  
ATOM 3460  H HH12 . ARG A 1 37 ? 1.532   -7.355  9.656   1.00 0.00 ? 37 ARG A HH12 3  
ATOM 3461  H HH21 . ARG A 1 37 ? -0.677  -4.878  10.814  1.00 0.00 ? 37 ARG A HH21 3  
ATOM 3462  H HH22 . ARG A 1 37 ? 0.956   -5.464  10.857  1.00 0.00 ? 37 ARG A HH22 3  
ATOM 3463  N N    . LEU A 1 38 ? -6.848  -5.400  6.857   1.00 0.00 ? 38 LEU A N    3  
ATOM 3464  C CA   . LEU A 1 38 ? -7.557  -4.195  6.446   1.00 0.00 ? 38 LEU A CA   3  
ATOM 3465  C C    . LEU A 1 38 ? -8.984  -4.182  6.992   1.00 0.00 ? 38 LEU A C    3  
ATOM 3466  O O    . LEU A 1 38 ? -9.484  -3.137  7.406   1.00 0.00 ? 38 LEU A O    3  
ATOM 3467  C CB   . LEU A 1 38 ? -7.561  -4.076  4.920   1.00 0.00 ? 38 LEU A CB   3  
ATOM 3468  C CG   . LEU A 1 38 ? -6.434  -3.222  4.318   1.00 0.00 ? 38 LEU A CG   3  
ATOM 3469  C CD1  . LEU A 1 38 ? -5.078  -3.605  4.891   1.00 0.00 ? 38 LEU A CD1  3  
ATOM 3470  C CD2  . LEU A 1 38 ? -6.425  -3.361  2.807   1.00 0.00 ? 38 LEU A CD2  3  
ATOM 3471  H H    . LEU A 1 38 ? -6.509  -6.011  6.165   1.00 0.00 ? 38 LEU A H    3  
ATOM 3472  H HA   . LEU A 1 38 ? -7.027  -3.350  6.857   1.00 0.00 ? 38 LEU A HA   3  
ATOM 3473  H HB2  . LEU A 1 38 ? -7.489  -5.072  4.505   1.00 0.00 ? 38 LEU A HB2  3  
ATOM 3474  H HB3  . LEU A 1 38 ? -8.506  -3.648  4.616   1.00 0.00 ? 38 LEU A HB3  3  
ATOM 3475  H HG   . LEU A 1 38 ? -6.612  -2.183  4.557   1.00 0.00 ? 38 LEU A HG   3  
ATOM 3476  H HD11 . LEU A 1 38 ? -4.870  -4.640  4.664   1.00 0.00 ? 38 LEU A HD11 3  
ATOM 3477  H HD12 . LEU A 1 38 ? -5.089  -3.467  5.963   1.00 0.00 ? 38 LEU A HD12 3  
ATOM 3478  H HD13 . LEU A 1 38 ? -4.312  -2.980  4.455   1.00 0.00 ? 38 LEU A HD13 3  
ATOM 3479  H HD21 . LEU A 1 38 ? -7.359  -2.999  2.407   1.00 0.00 ? 38 LEU A HD21 3  
ATOM 3480  H HD22 . LEU A 1 38 ? -6.298  -4.399  2.541   1.00 0.00 ? 38 LEU A HD22 3  
ATOM 3481  H HD23 . LEU A 1 38 ? -5.609  -2.782  2.397   1.00 0.00 ? 38 LEU A HD23 3  
ATOM 3482  N N    . GLY A 1 39 ? -9.627  -5.344  6.999   1.00 0.00 ? 39 GLY A N    3  
ATOM 3483  C CA   . GLY A 1 39 ? -10.954 -5.452  7.579   1.00 0.00 ? 39 GLY A CA   3  
ATOM 3484  C C    . GLY A 1 39 ? -10.958 -5.111  9.057   1.00 0.00 ? 39 GLY A C    3  
ATOM 3485  O O    . GLY A 1 39 ? -11.826 -4.375  9.534   1.00 0.00 ? 39 GLY A O    3  
ATOM 3486  H H    . GLY A 1 39 ? -9.205  -6.132  6.598   1.00 0.00 ? 39 GLY A H    3  
ATOM 3487  H HA2  . GLY A 1 39 ? -11.617 -4.773  7.061   1.00 0.00 ? 39 GLY A HA2  3  
ATOM 3488  H HA3  . GLY A 1 39 ? -11.313 -6.462  7.451   1.00 0.00 ? 39 GLY A HA3  3  
ATOM 3489  N N    . ALA A 1 40 ? -9.973  -5.634  9.781   1.00 0.00 ? 40 ALA A N    3  
ATOM 3490  C CA   . ALA A 1 40 ? -9.835  -5.353  11.203  1.00 0.00 ? 40 ALA A CA   3  
ATOM 3491  C C    . ALA A 1 40 ? -9.523  -3.876  11.439  1.00 0.00 ? 40 ALA A C    3  
ATOM 3492  O O    . ALA A 1 40 ? -10.030 -3.269  12.388  1.00 0.00 ? 40 ALA A O    3  
ATOM 3493  C CB   . ALA A 1 40 ? -8.751  -6.228  11.814  1.00 0.00 ? 40 ALA A CB   3  
ATOM 3494  H H    . ALA A 1 40 ? -9.324  -6.231  9.346   1.00 0.00 ? 40 ALA A H    3  
ATOM 3495  H HA   . ALA A 1 40 ? -10.774 -5.594  11.682  1.00 0.00 ? 40 ALA A HA   3  
ATOM 3496  H HB1  . ALA A 1 40 ? -7.807  -6.012  11.337  1.00 0.00 ? 40 ALA A HB1  3  
ATOM 3497  H HB2  . ALA A 1 40 ? -9.000  -7.269  11.667  1.00 0.00 ? 40 ALA A HB2  3  
ATOM 3498  H HB3  . ALA A 1 40 ? -8.675  -6.021  12.871  1.00 0.00 ? 40 ALA A HB3  3  
ATOM 3499  N N    . GLU A 1 41 ? -8.700  -3.304  10.562  1.00 0.00 ? 41 GLU A N    3  
ATOM 3500  C CA   . GLU A 1 41 ? -8.339  -1.891  10.652  1.00 0.00 ? 41 GLU A CA   3  
ATOM 3501  C C    . GLU A 1 41 ? -9.571  -1.014  10.438  1.00 0.00 ? 41 GLU A C    3  
ATOM 3502  O O    . GLU A 1 41 ? -9.810  -0.076  11.194  1.00 0.00 ? 41 GLU A O    3  
ATOM 3503  C CB   . GLU A 1 41 ? -7.269  -1.533  9.612   1.00 0.00 ? 41 GLU A CB   3  
ATOM 3504  C CG   . GLU A 1 41 ? -5.956  -2.287  9.767   1.00 0.00 ? 41 GLU A CG   3  
ATOM 3505  C CD   . GLU A 1 41 ? -5.182  -1.893  11.007  1.00 0.00 ? 41 GLU A CD   3  
ATOM 3506  O OE1  . GLU A 1 41 ? -4.418  -0.904  10.945  1.00 0.00 ? 41 GLU A OE1  3  
ATOM 3507  O OE2  . GLU A 1 41 ? -5.318  -2.574  12.037  1.00 0.00 ? 41 GLU A OE2  3  
ATOM 3508  H H    . GLU A 1 41 ? -8.319  -3.852  9.835   1.00 0.00 ? 41 GLU A H    3  
ATOM 3509  H HA   . GLU A 1 41 ? -7.947  -1.712  11.641  1.00 0.00 ? 41 GLU A HA   3  
ATOM 3510  H HB2  . GLU A 1 41 ? -7.662  -1.741  8.629   1.00 0.00 ? 41 GLU A HB2  3  
ATOM 3511  H HB3  . GLU A 1 41 ? -7.060  -0.474  9.684   1.00 0.00 ? 41 GLU A HB3  3  
ATOM 3512  H HG2  . GLU A 1 41 ? -6.171  -3.344  9.820   1.00 0.00 ? 41 GLU A HG2  3  
ATOM 3513  H HG3  . GLU A 1 41 ? -5.342  -2.092  8.898   1.00 0.00 ? 41 GLU A HG3  3  
ATOM 3514  N N    . TRP A 1 42 ? -10.355 -1.343  9.412   1.00 0.00 ? 42 TRP A N    3  
ATOM 3515  C CA   . TRP A 1 42 ? -11.559 -0.587  9.075   1.00 0.00 ? 42 TRP A CA   3  
ATOM 3516  C C    . TRP A 1 42 ? -12.541 -0.558  10.242  1.00 0.00 ? 42 TRP A C    3  
ATOM 3517  O O    . TRP A 1 42 ? -13.219 0.446   10.457  1.00 0.00 ? 42 TRP A O    3  
ATOM 3518  C CB   . TRP A 1 42 ? -12.224 -1.164  7.821   1.00 0.00 ? 42 TRP A CB   3  
ATOM 3519  C CG   . TRP A 1 42 ? -13.448 -0.407  7.403   1.00 0.00 ? 42 TRP A CG   3  
ATOM 3520  C CD1  . TRP A 1 42 ? -14.678 -0.503  7.966   1.00 0.00 ? 42 TRP A CD1  3  
ATOM 3521  C CD2  . TRP A 1 42 ? -13.563 0.559   6.351   1.00 0.00 ? 42 TRP A CD2  3  
ATOM 3522  N NE1  . TRP A 1 42 ? -15.561 0.333   7.334   1.00 0.00 ? 42 TRP A NE1  3  
ATOM 3523  C CE2  . TRP A 1 42 ? -14.900 0.999   6.335   1.00 0.00 ? 42 TRP A CE2  3  
ATOM 3524  C CE3  . TRP A 1 42 ? -12.668 1.095   5.418   1.00 0.00 ? 42 TRP A CE3  3  
ATOM 3525  C CZ2  . TRP A 1 42 ? -15.365 1.948   5.427   1.00 0.00 ? 42 TRP A CZ2  3  
ATOM 3526  C CZ3  . TRP A 1 42 ? -13.133 2.038   4.517   1.00 0.00 ? 42 TRP A CZ3  3  
ATOM 3527  C CH2  . TRP A 1 42 ? -14.468 2.455   4.528   1.00 0.00 ? 42 TRP A CH2  3  
ATOM 3528  H H    . TRP A 1 42 ? -10.111 -2.121  8.859   1.00 0.00 ? 42 TRP A H    3  
ATOM 3529  H HA   . TRP A 1 42 ? -11.268 0.425   8.867   1.00 0.00 ? 42 TRP A HA   3  
ATOM 3530  H HB2  . TRP A 1 42 ? -11.519 -1.134  7.004   1.00 0.00 ? 42 TRP A HB2  3  
ATOM 3531  H HB3  . TRP A 1 42 ? -12.511 -2.187  8.011   1.00 0.00 ? 42 TRP A HB3  3  
ATOM 3532  H HD1  . TRP A 1 42 ? -14.901 -1.147  8.798   1.00 0.00 ? 42 TRP A HD1  3  
ATOM 3533  H HE1  . TRP A 1 42 ? -16.514 0.434   7.559   1.00 0.00 ? 42 TRP A HE1  3  
ATOM 3534  H HE3  . TRP A 1 42 ? -11.635 0.783   5.393   1.00 0.00 ? 42 TRP A HE3  3  
ATOM 3535  H HZ2  . TRP A 1 42 ? -16.394 2.280   5.421   1.00 0.00 ? 42 TRP A HZ2  3  
ATOM 3536  H HZ3  . TRP A 1 42 ? -12.457 2.463   3.789   1.00 0.00 ? 42 TRP A HZ3  3  
ATOM 3537  H HH2  . TRP A 1 42 ? -14.785 3.192   3.805   1.00 0.00 ? 42 TRP A HH2  3  
ATOM 3538  N N    . LYS A 1 43 ? -12.605 -1.642  11.005  1.00 0.00 ? 43 LYS A N    3  
ATOM 3539  C CA   . LYS A 1 43 ? -13.523 -1.714  12.136  1.00 0.00 ? 43 LYS A CA   3  
ATOM 3540  C C    . LYS A 1 43 ? -13.218 -0.609  13.156  1.00 0.00 ? 43 LYS A C    3  
ATOM 3541  O O    . LYS A 1 43 ? -14.122 -0.081  13.806  1.00 0.00 ? 43 LYS A O    3  
ATOM 3542  C CB   . LYS A 1 43 ? -13.439 -3.084  12.811  1.00 0.00 ? 43 LYS A CB   3  
ATOM 3543  C CG   . LYS A 1 43 ? -14.679 -3.438  13.617  1.00 0.00 ? 43 LYS A CG   3  
ATOM 3544  C CD   . LYS A 1 43 ? -15.879 -3.665  12.708  1.00 0.00 ? 43 LYS A CD   3  
ATOM 3545  C CE   . LYS A 1 43 ? -17.149 -3.924  13.505  1.00 0.00 ? 43 LYS A CE   3  
ATOM 3546  N NZ   . LYS A 1 43 ? -17.597 -2.718  14.249  1.00 0.00 ? 43 LYS A NZ   3  
ATOM 3547  H H    . LYS A 1 43 ? -12.034 -2.416  10.794  1.00 0.00 ? 43 LYS A H    3  
ATOM 3548  H HA   . LYS A 1 43 ? -14.524 -1.570  11.759  1.00 0.00 ? 43 LYS A HA   3  
ATOM 3549  H HB2  . LYS A 1 43 ? -13.302 -3.840  12.053  1.00 0.00 ? 43 LYS A HB2  3  
ATOM 3550  H HB3  . LYS A 1 43 ? -12.588 -3.094  13.478  1.00 0.00 ? 43 LYS A HB3  3  
ATOM 3551  H HG2  . LYS A 1 43 ? -14.489 -4.339  14.181  1.00 0.00 ? 43 LYS A HG2  3  
ATOM 3552  H HG3  . LYS A 1 43 ? -14.900 -2.626  14.293  1.00 0.00 ? 43 LYS A HG3  3  
ATOM 3553  H HD2  . LYS A 1 43 ? -16.027 -2.789  12.096  1.00 0.00 ? 43 LYS A HD2  3  
ATOM 3554  H HD3  . LYS A 1 43 ? -15.682 -4.519  12.077  1.00 0.00 ? 43 LYS A HD3  3  
ATOM 3555  H HE2  . LYS A 1 43 ? -17.930 -4.226  12.825  1.00 0.00 ? 43 LYS A HE2  3  
ATOM 3556  H HE3  . LYS A 1 43 ? -16.960 -4.723  14.210  1.00 0.00 ? 43 LYS A HE3  3  
ATOM 3557  H HZ1  . LYS A 1 43 ? -18.482 -2.923  14.765  1.00 0.00 ? 43 LYS A HZ1  3  
ATOM 3558  H HZ2  . LYS A 1 43 ? -17.769 -1.930  13.589  1.00 0.00 ? 43 LYS A HZ2  3  
ATOM 3559  H HZ3  . LYS A 1 43 ? -16.869 -2.425  14.938  1.00 0.00 ? 43 LYS A HZ3  3  
ATOM 3560  N N    . LEU A 1 44 ? -11.946 -0.247  13.274  1.00 0.00 ? 44 LEU A N    3  
ATOM 3561  C CA   . LEU A 1 44 ? -11.527 0.782   14.218  1.00 0.00 ? 44 LEU A CA   3  
ATOM 3562  C C    . LEU A 1 44 ? -11.331 2.123   13.516  1.00 0.00 ? 44 LEU A C    3  
ATOM 3563  O O    . LEU A 1 44 ? -11.158 3.153   14.168  1.00 0.00 ? 44 LEU A O    3  
ATOM 3564  C CB   . LEU A 1 44 ? -10.221 0.373   14.905  1.00 0.00 ? 44 LEU A CB   3  
ATOM 3565  C CG   . LEU A 1 44 ? -10.254 -0.966  15.643  1.00 0.00 ? 44 LEU A CG   3  
ATOM 3566  C CD1  . LEU A 1 44 ? -8.904  -1.247  16.284  1.00 0.00 ? 44 LEU A CD1  3  
ATOM 3567  C CD2  . LEU A 1 44 ? -11.357 -0.965  16.690  1.00 0.00 ? 44 LEU A CD2  3  
ATOM 3568  H H    . LEU A 1 44 ? -11.270 -0.680  12.707  1.00 0.00 ? 44 LEU A H    3  
ATOM 3569  H HA   . LEU A 1 44 ? -12.302 0.885   14.964  1.00 0.00 ? 44 LEU A HA   3  
ATOM 3570  H HB2  . LEU A 1 44 ? -9.446  0.323   14.154  1.00 0.00 ? 44 LEU A HB2  3  
ATOM 3571  H HB3  . LEU A 1 44 ? -9.958  1.141   15.616  1.00 0.00 ? 44 LEU A HB3  3  
ATOM 3572  H HG   . LEU A 1 44 ? -10.461 -1.757  14.935  1.00 0.00 ? 44 LEU A HG   3  
ATOM 3573  H HD11 . LEU A 1 44 ? -8.685  -0.482  17.014  1.00 0.00 ? 44 LEU A HD11 3  
ATOM 3574  H HD12 . LEU A 1 44 ? -8.138  -1.248  15.523  1.00 0.00 ? 44 LEU A HD12 3  
ATOM 3575  H HD13 . LEU A 1 44 ? -8.929  -2.212  16.771  1.00 0.00 ? 44 LEU A HD13 3  
ATOM 3576  H HD21 . LEU A 1 44 ? -12.310 -0.792  16.210  1.00 0.00 ? 44 LEU A HD21 3  
ATOM 3577  H HD22 . LEU A 1 44 ? -11.168 -0.183  17.411  1.00 0.00 ? 44 LEU A HD22 3  
ATOM 3578  H HD23 . LEU A 1 44 ? -11.377 -1.920  17.193  1.00 0.00 ? 44 LEU A HD23 3  
ATOM 3579  N N    . LEU A 1 45 ? -11.379 2.095   12.189  1.00 0.00 ? 45 LEU A N    3  
ATOM 3580  C CA   . LEU A 1 45 ? -11.090 3.264   11.366  1.00 0.00 ? 45 LEU A CA   3  
ATOM 3581  C C    . LEU A 1 45 ? -12.016 4.435   11.671  1.00 0.00 ? 45 LEU A C    3  
ATOM 3582  O O    . LEU A 1 45 ? -13.238 4.327   11.538  1.00 0.00 ? 45 LEU A O    3  
ATOM 3583  C CB   . LEU A 1 45 ? -11.228 2.907   9.887   1.00 0.00 ? 45 LEU A CB   3  
ATOM 3584  C CG   . LEU A 1 45 ? -11.005 4.071   8.926   1.00 0.00 ? 45 LEU A CG   3  
ATOM 3585  C CD1  . LEU A 1 45 ? -9.521  4.381   8.802   1.00 0.00 ? 45 LEU A CD1  3  
ATOM 3586  C CD2  . LEU A 1 45 ? -11.620 3.769   7.572   1.00 0.00 ? 45 LEU A CD2  3  
ATOM 3587  H H    . LEU A 1 45 ? -11.615 1.255   11.746  1.00 0.00 ? 45 LEU A H    3  
ATOM 3588  H HA   . LEU A 1 45 ? -10.071 3.563   11.557  1.00 0.00 ? 45 LEU A HA   3  
ATOM 3589  H HB2  . LEU A 1 45 ? -10.513 2.130   9.656   1.00 0.00 ? 45 LEU A HB2  3  
ATOM 3590  H HB3  . LEU A 1 45 ? -12.223 2.519   9.723   1.00 0.00 ? 45 LEU A HB3  3  
ATOM 3591  H HG   . LEU A 1 45 ? -11.492 4.949   9.325   1.00 0.00 ? 45 LEU A HG   3  
ATOM 3592  H HD11 . LEU A 1 45 ? -9.002  3.516   8.414   1.00 0.00 ? 45 LEU A HD11 3  
ATOM 3593  H HD12 . LEU A 1 45 ? -9.123  4.629   9.777   1.00 0.00 ? 45 LEU A HD12 3  
ATOM 3594  H HD13 . LEU A 1 45 ? -9.380  5.215   8.132   1.00 0.00 ? 45 LEU A HD13 3  
ATOM 3595  H HD21 . LEU A 1 45 ? -11.473 4.612   6.913   1.00 0.00 ? 45 LEU A HD21 3  
ATOM 3596  H HD22 . LEU A 1 45 ? -12.677 3.587   7.691   1.00 0.00 ? 45 LEU A HD22 3  
ATOM 3597  H HD23 . LEU A 1 45 ? -11.148 2.893   7.150   1.00 0.00 ? 45 LEU A HD23 3  
ATOM 3598  N N    . SER A 1 46 ? -11.428 5.549   12.075  1.00 0.00 ? 46 SER A N    3  
ATOM 3599  C CA   . SER A 1 46 ? -12.166 6.791   12.212  1.00 0.00 ? 46 SER A CA   3  
ATOM 3600  C C    . SER A 1 46 ? -12.085 7.588   10.907  1.00 0.00 ? 46 SER A C    3  
ATOM 3601  O O    . SER A 1 46 ? -11.306 7.252   10.012  1.00 0.00 ? 46 SER A O    3  
ATOM 3602  C CB   . SER A 1 46 ? -11.632 7.609   13.391  1.00 0.00 ? 46 SER A CB   3  
ATOM 3603  O OG   . SER A 1 46 ? -10.234 7.812   13.288  1.00 0.00 ? 46 SER A OG   3  
ATOM 3604  H H    . SER A 1 46 ? -10.464 5.532   12.286  1.00 0.00 ? 46 SER A H    3  
ATOM 3605  H HA   . SER A 1 46 ? -13.199 6.540   12.398  1.00 0.00 ? 46 SER A HA   3  
ATOM 3606  H HB2  . SER A 1 46 ? -12.120 8.571   13.410  1.00 0.00 ? 46 SER A HB2  3  
ATOM 3607  H HB3  . SER A 1 46 ? -11.839 7.083   14.312  1.00 0.00 ? 46 SER A HB3  3  
ATOM 3608  H HG   . SER A 1 46 ? -9.794  6.967   13.092  1.00 0.00 ? 46 SER A HG   3  
ATOM 3609  N N    . GLU A 1 47 ? -12.882 8.641   10.799  1.00 0.00 ? 47 GLU A N    3  
ATOM 3610  C CA   . GLU A 1 47 ? -12.951 9.429   9.569   1.00 0.00 ? 47 GLU A CA   3  
ATOM 3611  C C    . GLU A 1 47 ? -11.689 10.266  9.340   1.00 0.00 ? 47 GLU A C    3  
ATOM 3612  O O    . GLU A 1 47 ? -11.339 10.561  8.199   1.00 0.00 ? 47 GLU A O    3  
ATOM 3613  C CB   . GLU A 1 47 ? -14.209 10.312  9.556   1.00 0.00 ? 47 GLU A CB   3  
ATOM 3614  C CG   . GLU A 1 47 ? -14.716 10.727  10.934  1.00 0.00 ? 47 GLU A CG   3  
ATOM 3615  C CD   . GLU A 1 47 ? -13.714 11.540  11.723  1.00 0.00 ? 47 GLU A CD   3  
ATOM 3616  O OE1  . GLU A 1 47 ? -12.894 10.939  12.448  1.00 0.00 ? 47 GLU A OE1  3  
ATOM 3617  O OE2  . GLU A 1 47 ? -13.740 12.782  11.624  1.00 0.00 ? 47 GLU A OE2  3  
ATOM 3618  H H    . GLU A 1 47 ? -13.432 8.905   11.566  1.00 0.00 ? 47 GLU A H    3  
ATOM 3619  H HA   . GLU A 1 47 ? -13.025 8.723   8.752   1.00 0.00 ? 47 GLU A HA   3  
ATOM 3620  H HB2  . GLU A 1 47 ? -13.994 11.209  8.996   1.00 0.00 ? 47 GLU A HB2  3  
ATOM 3621  H HB3  . GLU A 1 47 ? -15.002 9.773   9.054   1.00 0.00 ? 47 GLU A HB3  3  
ATOM 3622  H HG2  . GLU A 1 47 ? -15.610 11.320  10.809  1.00 0.00 ? 47 GLU A HG2  3  
ATOM 3623  H HG3  . GLU A 1 47 ? -14.958 9.835   11.495  1.00 0.00 ? 47 GLU A HG3  3  
ATOM 3624  N N    . THR A 1 48 ? -10.998 10.633  10.409  1.00 0.00 ? 48 THR A N    3  
ATOM 3625  C CA   . THR A 1 48 ? -9.746  11.365  10.279  1.00 0.00 ? 48 THR A CA   3  
ATOM 3626  C C    . THR A 1 48 ? -8.673  10.471  9.655   1.00 0.00 ? 48 THR A C    3  
ATOM 3627  O O    . THR A 1 48 ? -7.802  10.937  8.918   1.00 0.00 ? 48 THR A O    3  
ATOM 3628  C CB   . THR A 1 48 ? -9.261  11.915  11.644  1.00 0.00 ? 48 THR A CB   3  
ATOM 3629  O OG1  . THR A 1 48 ? -8.041  12.651  11.486  1.00 0.00 ? 48 THR A OG1  3  
ATOM 3630  C CG2  . THR A 1 48 ? -9.051  10.795  12.657  1.00 0.00 ? 48 THR A CG2  3  
ATOM 3631  H H    . THR A 1 48 ? -11.347 10.425  11.305  1.00 0.00 ? 48 THR A H    3  
ATOM 3632  H HA   . THR A 1 48 ? -9.924  12.205  9.622   1.00 0.00 ? 48 THR A HA   3  
ATOM 3633  H HB   . THR A 1 48 ? -10.020 12.581  12.028  1.00 0.00 ? 48 THR A HB   3  
ATOM 3634  H HG1  . THR A 1 48 ? -7.285  12.040  11.557  1.00 0.00 ? 48 THR A HG1  3  
ATOM 3635  H HG21 . THR A 1 48 ? -8.726  11.216  13.596  1.00 0.00 ? 48 THR A HG21 3  
ATOM 3636  H HG22 . THR A 1 48 ? -8.300  10.111  12.288  1.00 0.00 ? 48 THR A HG22 3  
ATOM 3637  H HG23 . THR A 1 48 ? -9.980  10.262  12.803  1.00 0.00 ? 48 THR A HG23 3  
ATOM 3638  N N    . GLU A 1 49 ? -8.776  9.175   9.924   1.00 0.00 ? 49 GLU A N    3  
ATOM 3639  C CA   . GLU A 1 49 ? -7.843  8.190   9.391   1.00 0.00 ? 49 GLU A CA   3  
ATOM 3640  C C    . GLU A 1 49 ? -8.248  7.786   7.979   1.00 0.00 ? 49 GLU A C    3  
ATOM 3641  O O    . GLU A 1 49 ? -7.493  7.136   7.262   1.00 0.00 ? 49 GLU A O    3  
ATOM 3642  C CB   . GLU A 1 49 ? -7.805  6.959   10.292  1.00 0.00 ? 49 GLU A CB   3  
ATOM 3643  C CG   . GLU A 1 49 ? -7.466  7.280   11.733  1.00 0.00 ? 49 GLU A CG   3  
ATOM 3644  C CD   . GLU A 1 49 ? -7.617  6.083   12.641  1.00 0.00 ? 49 GLU A CD   3  
ATOM 3645  O OE1  . GLU A 1 49 ? -8.771  5.671   12.891  1.00 0.00 ? 49 GLU A OE1  3  
ATOM 3646  O OE2  . GLU A 1 49 ? -6.590  5.566   13.125  1.00 0.00 ? 49 GLU A OE2  3  
ATOM 3647  H H    . GLU A 1 49 ? -9.506  8.869   10.504  1.00 0.00 ? 49 GLU A H    3  
ATOM 3648  H HA   . GLU A 1 49 ? -6.861  8.637   9.362   1.00 0.00 ? 49 GLU A HA   3  
ATOM 3649  H HB2  . GLU A 1 49 ? -8.773  6.477   10.269  1.00 0.00 ? 49 GLU A HB2  3  
ATOM 3650  H HB3  . GLU A 1 49 ? -7.062  6.273   9.914   1.00 0.00 ? 49 GLU A HB3  3  
ATOM 3651  H HG2  . GLU A 1 49 ? -6.443  7.623   11.782  1.00 0.00 ? 49 GLU A HG2  3  
ATOM 3652  H HG3  . GLU A 1 49 ? -8.125  8.063   12.080  1.00 0.00 ? 49 GLU A HG3  3  
ATOM 3653  N N    . LYS A 1 50 ? -9.461  8.168   7.603   1.00 0.00 ? 50 LYS A N    3  
ATOM 3654  C CA   . LYS A 1 50 ? -10.011 7.834   6.295   1.00 0.00 ? 50 LYS A CA   3  
ATOM 3655  C C    . LYS A 1 50 ? -9.324  8.637   5.184   1.00 0.00 ? 50 LYS A C    3  
ATOM 3656  O O    . LYS A 1 50 ? -9.459  8.320   4.005   1.00 0.00 ? 50 LYS A O    3  
ATOM 3657  C CB   . LYS A 1 50 ? -11.518 8.105   6.276   1.00 0.00 ? 50 LYS A CB   3  
ATOM 3658  C CG   . LYS A 1 50 ? -12.231 7.584   5.038   1.00 0.00 ? 50 LYS A CG   3  
ATOM 3659  C CD   . LYS A 1 50 ? -13.664 8.083   4.969   1.00 0.00 ? 50 LYS A CD   3  
ATOM 3660  C CE   . LYS A 1 50 ? -14.485 7.632   6.169   1.00 0.00 ? 50 LYS A CE   3  
ATOM 3661  N NZ   . LYS A 1 50 ? -15.838 8.244   6.172   1.00 0.00 ? 50 LYS A NZ   3  
ATOM 3662  H H    . LYS A 1 50 ? -10.006 8.689   8.226   1.00 0.00 ? 50 LYS A H    3  
ATOM 3663  H HA   . LYS A 1 50 ? -9.843  6.784   6.124   1.00 0.00 ? 50 LYS A HA   3  
ATOM 3664  H HB2  . LYS A 1 50 ? -11.968 7.642   7.141   1.00 0.00 ? 50 LYS A HB2  3  
ATOM 3665  H HB3  . LYS A 1 50 ? -11.678 9.172   6.329   1.00 0.00 ? 50 LYS A HB3  3  
ATOM 3666  H HG2  . LYS A 1 50 ? -11.700 7.919   4.160   1.00 0.00 ? 50 LYS A HG2  3  
ATOM 3667  H HG3  . LYS A 1 50 ? -12.237 6.505   5.066   1.00 0.00 ? 50 LYS A HG3  3  
ATOM 3668  H HD2  . LYS A 1 50 ? -13.655 9.162   4.939   1.00 0.00 ? 50 LYS A HD2  3  
ATOM 3669  H HD3  . LYS A 1 50 ? -14.123 7.703   4.067   1.00 0.00 ? 50 LYS A HD3  3  
ATOM 3670  H HE2  . LYS A 1 50 ? -14.587 6.557   6.135   1.00 0.00 ? 50 LYS A HE2  3  
ATOM 3671  H HE3  . LYS A 1 50 ? -13.966 7.916   7.073   1.00 0.00 ? 50 LYS A HE3  3  
ATOM 3672  H HZ1  . LYS A 1 50 ? -16.355 7.976   5.306   1.00 0.00 ? 50 LYS A HZ1  3  
ATOM 3673  H HZ2  . LYS A 1 50 ? -15.759 9.283   6.207   1.00 0.00 ? 50 LYS A HZ2  3  
ATOM 3674  H HZ3  . LYS A 1 50 ? -16.379 7.922   7.003   1.00 0.00 ? 50 LYS A HZ3  3  
ATOM 3675  N N    . ARG A 1 51 ? -8.588  9.679   5.567   1.00 0.00 ? 51 ARG A N    3  
ATOM 3676  C CA   . ARG A 1 51 ? -7.944  10.569  4.598   1.00 0.00 ? 51 ARG A CA   3  
ATOM 3677  C C    . ARG A 1 51 ? -7.017  9.824   3.617   1.00 0.00 ? 51 ARG A C    3  
ATOM 3678  O O    . ARG A 1 51 ? -7.208  9.941   2.408   1.00 0.00 ? 51 ARG A O    3  
ATOM 3679  C CB   . ARG A 1 51 ? -7.182  11.696  5.316   1.00 0.00 ? 51 ARG A CB   3  
ATOM 3680  C CG   . ARG A 1 51 ? -6.245  12.476  4.405   1.00 0.00 ? 51 ARG A CG   3  
ATOM 3681  C CD   . ARG A 1 51 ? -6.999  13.180  3.291   1.00 0.00 ? 51 ARG A CD   3  
ATOM 3682  N NE   . ARG A 1 51 ? -6.177  13.334  2.092   1.00 0.00 ? 51 ARG A NE   3  
ATOM 3683  C CZ   . ARG A 1 51 ? -6.348  14.291  1.184   1.00 0.00 ? 51 ARG A CZ   3  
ATOM 3684  N NH1  . ARG A 1 51 ? -7.273  15.225  1.368   1.00 0.00 ? 51 ARG A NH1  3  
ATOM 3685  N NH2  . ARG A 1 51 ? -5.587  14.313  0.096   1.00 0.00 ? 51 ARG A NH2  3  
ATOM 3686  H H    . ARG A 1 51 ? -8.474  9.855   6.524   1.00 0.00 ? 51 ARG A H    3  
ATOM 3687  H HA   . ARG A 1 51 ? -8.736  11.018  4.016   1.00 0.00 ? 51 ARG A HA   3  
ATOM 3688  H HB2  . ARG A 1 51 ? -7.899  12.386  5.734   1.00 0.00 ? 51 ARG A HB2  3  
ATOM 3689  H HB3  . ARG A 1 51 ? -6.600  11.270  6.117   1.00 0.00 ? 51 ARG A HB3  3  
ATOM 3690  H HG2  . ARG A 1 51 ? -5.719  13.214  4.993   1.00 0.00 ? 51 ARG A HG2  3  
ATOM 3691  H HG3  . ARG A 1 51 ? -5.535  11.790  3.967   1.00 0.00 ? 51 ARG A HG3  3  
ATOM 3692  H HD2  . ARG A 1 51 ? -7.876  12.600  3.045   1.00 0.00 ? 51 ARG A HD2  3  
ATOM 3693  H HD3  . ARG A 1 51 ? -7.300  14.157  3.638   1.00 0.00 ? 51 ARG A HD3  3  
ATOM 3694  H HE   . ARG A 1 51 ? -5.465  12.652  1.940   1.00 0.00 ? 51 ARG A HE   3  
ATOM 3695  H HH11 . ARG A 1 51 ? -7.842  15.214  2.191   1.00 0.00 ? 51 ARG A HH11 3  
ATOM 3696  H HH12 . ARG A 1 51 ? -7.409  15.949  0.678   1.00 0.00 ? 51 ARG A HH12 3  
ATOM 3697  H HH21 . ARG A 1 51 ? -4.878  13.597  -0.044  1.00 0.00 ? 51 ARG A HH21 3  
ATOM 3698  H HH22 . ARG A 1 51 ? -5.711  15.031  -0.592  1.00 0.00 ? 51 ARG A HH22 3  
ATOM 3699  N N    . PRO A 1 52 ? -6.005  9.059   4.093   1.00 0.00 ? 52 PRO A N    3  
ATOM 3700  C CA   . PRO A 1 52 ? -5.042  8.401   3.197   1.00 0.00 ? 52 PRO A CA   3  
ATOM 3701  C C    . PRO A 1 52 ? -5.688  7.407   2.240   1.00 0.00 ? 52 PRO A C    3  
ATOM 3702  O O    . PRO A 1 52 ? -5.085  7.027   1.232   1.00 0.00 ? 52 PRO A O    3  
ATOM 3703  C CB   . PRO A 1 52 ? -4.073  7.686   4.145   1.00 0.00 ? 52 PRO A CB   3  
ATOM 3704  C CG   . PRO A 1 52 ? -4.251  8.367   5.459   1.00 0.00 ? 52 PRO A CG   3  
ATOM 3705  C CD   . PRO A 1 52 ? -5.688  8.793   5.507   1.00 0.00 ? 52 PRO A CD   3  
ATOM 3706  H HA   . PRO A 1 52 ? -4.509  9.132   2.613   1.00 0.00 ? 52 PRO A HA   3  
ATOM 3707  H HB2  . PRO A 1 52 ? -4.332  6.640   4.204   1.00 0.00 ? 52 PRO A HB2  3  
ATOM 3708  H HB3  . PRO A 1 52 ? -3.063  7.794   3.781   1.00 0.00 ? 52 PRO A HB3  3  
ATOM 3709  H HG2  . PRO A 1 52 ? -4.038  7.677   6.263   1.00 0.00 ? 52 PRO A HG2  3  
ATOM 3710  H HG3  . PRO A 1 52 ? -3.603  9.227   5.519   1.00 0.00 ? 52 PRO A HG3  3  
ATOM 3711  H HD2  . PRO A 1 52 ? -6.305  7.998   5.899   1.00 0.00 ? 52 PRO A HD2  3  
ATOM 3712  H HD3  . PRO A 1 52 ? -5.795  9.685   6.103   1.00 0.00 ? 52 PRO A HD3  3  
ATOM 3713  N N    . PHE A 1 53 ? -6.907  6.991   2.555   1.00 0.00 ? 53 PHE A N    3  
ATOM 3714  C CA   . PHE A 1 53 ? -7.696  6.184   1.638   1.00 0.00 ? 53 PHE A CA   3  
ATOM 3715  C C    . PHE A 1 53 ? -7.890  6.941   0.344   1.00 0.00 ? 53 PHE A C    3  
ATOM 3716  O O    . PHE A 1 53 ? -7.777  6.391   -0.745  1.00 0.00 ? 53 PHE A O    3  
ATOM 3717  C CB   . PHE A 1 53 ? -9.072  5.892   2.220   1.00 0.00 ? 53 PHE A CB   3  
ATOM 3718  C CG   . PHE A 1 53 ? -9.093  4.887   3.324   1.00 0.00 ? 53 PHE A CG   3  
ATOM 3719  C CD1  . PHE A 1 53 ? -8.422  5.111   4.513   1.00 0.00 ? 53 PHE A CD1  3  
ATOM 3720  C CD2  . PHE A 1 53 ? -9.812  3.721   3.172   1.00 0.00 ? 53 PHE A CD2  3  
ATOM 3721  C CE1  . PHE A 1 53 ? -8.469  4.184   5.532   1.00 0.00 ? 53 PHE A CE1  3  
ATOM 3722  C CE2  . PHE A 1 53 ? -9.864  2.787   4.186   1.00 0.00 ? 53 PHE A CE2  3  
ATOM 3723  C CZ   . PHE A 1 53 ? -9.191  3.019   5.369   1.00 0.00 ? 53 PHE A CZ   3  
ATOM 3724  H H    . PHE A 1 53 ? -7.289  7.243   3.421   1.00 0.00 ? 53 PHE A H    3  
ATOM 3725  H HA   . PHE A 1 53 ? -7.174  5.261   1.448   1.00 0.00 ? 53 PHE A HA   3  
ATOM 3726  H HB2  . PHE A 1 53 ? -9.486  6.810   2.609   1.00 0.00 ? 53 PHE A HB2  3  
ATOM 3727  H HB3  . PHE A 1 53 ? -9.712  5.529   1.428   1.00 0.00 ? 53 PHE A HB3  3  
ATOM 3728  H HD1  . PHE A 1 53 ? -7.858  6.023   4.639   1.00 0.00 ? 53 PHE A HD1  3  
ATOM 3729  H HD2  . PHE A 1 53 ? -10.332 3.538   2.233   1.00 0.00 ? 53 PHE A HD2  3  
ATOM 3730  H HE1  . PHE A 1 53 ? -7.940  4.369   6.457   1.00 0.00 ? 53 PHE A HE1  3  
ATOM 3731  H HE2  . PHE A 1 53 ? -10.427 1.877   4.054   1.00 0.00 ? 53 PHE A HE2  3  
ATOM 3732  H HZ   . PHE A 1 53 ? -9.230  2.291   6.165   1.00 0.00 ? 53 PHE A HZ   3  
ATOM 3733  N N    . ILE A 1 54 ? -8.143  8.227   0.481   1.00 0.00 ? 54 ILE A N    3  
ATOM 3734  C CA   . ILE A 1 54 ? -8.505  9.042   -0.656  1.00 0.00 ? 54 ILE A CA   3  
ATOM 3735  C C    . ILE A 1 54 ? -7.261  9.290   -1.510  1.00 0.00 ? 54 ILE A C    3  
ATOM 3736  O O    . ILE A 1 54 ? -7.335  9.399   -2.732  1.00 0.00 ? 54 ILE A O    3  
ATOM 3737  C CB   . ILE A 1 54 ? -9.111  10.393  -0.210  1.00 0.00 ? 54 ILE A CB   3  
ATOM 3738  C CG1  . ILE A 1 54 ? -10.329 10.159  0.691   1.00 0.00 ? 54 ILE A CG1  3  
ATOM 3739  C CG2  . ILE A 1 54 ? -9.495  11.245  -1.414  1.00 0.00 ? 54 ILE A CG2  3  
ATOM 3740  C CD1  . ILE A 1 54 ? -11.439 9.364   0.030   1.00 0.00 ? 54 ILE A CD1  3  
ATOM 3741  H H    . ILE A 1 54 ? -8.031  8.652   1.371   1.00 0.00 ? 54 ILE A H    3  
ATOM 3742  H HA   . ILE A 1 54 ? -9.257  8.495   -1.234  1.00 0.00 ? 54 ILE A HA   3  
ATOM 3743  H HB   . ILE A 1 54 ? -8.360  10.930  0.350   1.00 0.00 ? 54 ILE A HB   3  
ATOM 3744  H HG12 . ILE A 1 54 ? -10.017 9.617   1.573   1.00 0.00 ? 54 ILE A HG12 3  
ATOM 3745  H HG13 . ILE A 1 54 ? -10.737 11.114  0.987   1.00 0.00 ? 54 ILE A HG13 3  
ATOM 3746  H HG21 . ILE A 1 54 ? -8.621  11.419  -2.024  1.00 0.00 ? 54 ILE A HG21 3  
ATOM 3747  H HG22 . ILE A 1 54 ? -9.888  12.191  -1.074  1.00 0.00 ? 54 ILE A HG22 3  
ATOM 3748  H HG23 . ILE A 1 54 ? -10.245 10.729  -1.996  1.00 0.00 ? 54 ILE A HG23 3  
ATOM 3749  H HD11 . ILE A 1 54 ? -11.067 8.389   -0.252  1.00 0.00 ? 54 ILE A HD11 3  
ATOM 3750  H HD12 . ILE A 1 54 ? -11.783 9.887   -0.851  1.00 0.00 ? 54 ILE A HD12 3  
ATOM 3751  H HD13 . ILE A 1 54 ? -12.259 9.248   0.722   1.00 0.00 ? 54 ILE A HD13 3  
ATOM 3752  N N    . ASP A 1 55 ? -6.110  9.356   -0.843  1.00 0.00 ? 55 ASP A N    3  
ATOM 3753  C CA   . ASP A 1 55 ? -4.842  9.649   -1.507  1.00 0.00 ? 55 ASP A CA   3  
ATOM 3754  C C    . ASP A 1 55 ? -4.383  8.488   -2.389  1.00 0.00 ? 55 ASP A C    3  
ATOM 3755  O O    . ASP A 1 55 ? -3.962  8.709   -3.527  1.00 0.00 ? 55 ASP A O    3  
ATOM 3756  C CB   . ASP A 1 55 ? -3.765  10.013  -0.479  1.00 0.00 ? 55 ASP A CB   3  
ATOM 3757  C CG   . ASP A 1 55 ? -4.034  11.355  0.178   1.00 0.00 ? 55 ASP A CG   3  
ATOM 3758  O OD1  . ASP A 1 55 ? -3.826  12.401  -0.479  1.00 0.00 ? 55 ASP A OD1  3  
ATOM 3759  O OD2  . ASP A 1 55 ? -4.477  11.377  1.343   1.00 0.00 ? 55 ASP A OD2  3  
ATOM 3760  H H    . ASP A 1 55 ? -6.114  9.201   0.126   1.00 0.00 ? 55 ASP A H    3  
ATOM 3761  H HA   . ASP A 1 55 ? -5.009  10.506  -2.142  1.00 0.00 ? 55 ASP A HA   3  
ATOM 3762  H HB2  . ASP A 1 55 ? -3.737  9.255   0.290   1.00 0.00 ? 55 ASP A HB2  3  
ATOM 3763  H HB3  . ASP A 1 55 ? -2.803  10.057  -0.971  1.00 0.00 ? 55 ASP A HB3  3  
ATOM 3764  N N    . GLU A 1 56 ? -4.462  7.256   -1.874  1.00 0.00 ? 56 GLU A N    3  
ATOM 3765  C CA   . GLU A 1 56 ? -4.212  6.066   -2.699  1.00 0.00 ? 56 GLU A CA   3  
ATOM 3766  C C    . GLU A 1 56 ? -5.168  6.061   -3.897  1.00 0.00 ? 56 GLU A C    3  
ATOM 3767  O O    . GLU A 1 56 ? -4.793  5.679   -5.005  1.00 0.00 ? 56 GLU A O    3  
ATOM 3768  C CB   . GLU A 1 56 ? -4.376  4.780   -1.887  1.00 0.00 ? 56 GLU A CB   3  
ATOM 3769  C CG   . GLU A 1 56 ? -3.227  4.523   -0.923  1.00 0.00 ? 56 GLU A CG   3  
ATOM 3770  C CD   . GLU A 1 56 ? -1.863  4.570   -1.596  1.00 0.00 ? 56 GLU A CD   3  
ATOM 3771  O OE1  . GLU A 1 56 ? -1.673  3.918   -2.644  1.00 0.00 ? 56 GLU A OE1  3  
ATOM 3772  O OE2  . GLU A 1 56 ? -0.968  5.273   -1.076  1.00 0.00 ? 56 GLU A OE2  3  
ATOM 3773  H H    . GLU A 1 56 ? -4.693  7.145   -0.926  1.00 0.00 ? 56 GLU A H    3  
ATOM 3774  H HA   . GLU A 1 56 ? -3.187  6.103   -3.063  1.00 0.00 ? 56 GLU A HA   3  
ATOM 3775  H HB2  . GLU A 1 56 ? -5.293  4.840   -1.317  1.00 0.00 ? 56 GLU A HB2  3  
ATOM 3776  H HB3  . GLU A 1 56 ? -4.441  3.943   -2.568  1.00 0.00 ? 56 GLU A HB3  3  
ATOM 3777  H HG2  . GLU A 1 56 ? -3.252  5.276   -0.151  1.00 0.00 ? 56 GLU A HG2  3  
ATOM 3778  H HG3  . GLU A 1 56 ? -3.358  3.548   -0.477  1.00 0.00 ? 56 GLU A HG3  3  
ATOM 3779  N N    . ALA A 1 57 ? -6.400  6.523   -3.664  1.00 0.00 ? 57 ALA A N    3  
ATOM 3780  C CA   . ALA A 1 57 ? -7.414  6.616   -4.722  1.00 0.00 ? 57 ALA A CA   3  
ATOM 3781  C C    . ALA A 1 57 ? -6.990  7.567   -5.838  1.00 0.00 ? 57 ALA A C    3  
ATOM 3782  O O    . ALA A 1 57 ? -7.164  7.261   -7.020  1.00 0.00 ? 57 ALA A O    3  
ATOM 3783  C CB   . ALA A 1 57 ? -8.749  7.069   -4.147  1.00 0.00 ? 57 ALA A CB   3  
ATOM 3784  H H    . ALA A 1 57 ? -6.639  6.797   -2.750  1.00 0.00 ? 57 ALA A H    3  
ATOM 3785  H HA   . ALA A 1 57 ? -7.548  5.628   -5.137  1.00 0.00 ? 57 ALA A HA   3  
ATOM 3786  H HB1  . ALA A 1 57 ? -9.053  6.397   -3.361  1.00 0.00 ? 57 ALA A HB1  3  
ATOM 3787  H HB2  . ALA A 1 57 ? -9.495  7.069   -4.928  1.00 0.00 ? 57 ALA A HB2  3  
ATOM 3788  H HB3  . ALA A 1 57 ? -8.648  8.067   -3.747  1.00 0.00 ? 57 ALA A HB3  3  
ATOM 3789  N N    . LYS A 1 58 ? -6.449  8.727   -5.465  1.00 0.00 ? 58 LYS A N    3  
ATOM 3790  C CA   . LYS A 1 58 ? -5.966  9.701   -6.448  1.00 0.00 ? 58 LYS A CA   3  
ATOM 3791  C C    . LYS A 1 58 ? -4.918  9.052   -7.335  1.00 0.00 ? 58 LYS A C    3  
ATOM 3792  O O    . LYS A 1 58 ? -4.883  9.256   -8.550  1.00 0.00 ? 58 LYS A O    3  
ATOM 3793  C CB   . LYS A 1 58 ? -5.327  10.913  -5.763  1.00 0.00 ? 58 LYS A CB   3  
ATOM 3794  C CG   . LYS A 1 58 ? -6.137  11.504  -4.621  1.00 0.00 ? 58 LYS A CG   3  
ATOM 3795  C CD   . LYS A 1 58 ? -5.402  12.661  -3.956  1.00 0.00 ? 58 LYS A CD   3  
ATOM 3796  C CE   . LYS A 1 58 ? -3.935  12.326  -3.707  1.00 0.00 ? 58 LYS A CE   3  
ATOM 3797  N NZ   . LYS A 1 58 ? -3.262  13.338  -2.852  1.00 0.00 ? 58 LYS A NZ   3  
ATOM 3798  H H    . LYS A 1 58 ? -6.378  8.935   -4.507  1.00 0.00 ? 58 LYS A H    3  
ATOM 3799  H HA   . LYS A 1 58 ? -6.800  10.023  -7.052  1.00 0.00 ? 58 LYS A HA   3  
ATOM 3800  H HB2  . LYS A 1 58 ? -4.366  10.620  -5.372  1.00 0.00 ? 58 LYS A HB2  3  
ATOM 3801  H HB3  . LYS A 1 58 ? -5.179  11.686  -6.504  1.00 0.00 ? 58 LYS A HB3  3  
ATOM 3802  H HG2  . LYS A 1 58 ? -7.078  11.867  -5.010  1.00 0.00 ? 58 LYS A HG2  3  
ATOM 3803  H HG3  . LYS A 1 58 ? -6.322  10.733  -3.886  1.00 0.00 ? 58 LYS A HG3  3  
ATOM 3804  H HD2  . LYS A 1 58 ? -5.459  13.528  -4.599  1.00 0.00 ? 58 LYS A HD2  3  
ATOM 3805  H HD3  . LYS A 1 58 ? -5.878  12.882  -3.012  1.00 0.00 ? 58 LYS A HD3  3  
ATOM 3806  H HE2  . LYS A 1 58 ? -3.877  11.366  -3.219  1.00 0.00 ? 58 LYS A HE2  3  
ATOM 3807  H HE3  . LYS A 1 58 ? -3.425  12.274  -4.657  1.00 0.00 ? 58 LYS A HE3  3  
ATOM 3808  H HZ1  . LYS A 1 58 ? -2.229  13.237  -2.920  1.00 0.00 ? 58 LYS A HZ1  3  
ATOM 3809  H HZ2  . LYS A 1 58 ? -3.546  13.207  -1.855  1.00 0.00 ? 58 LYS A HZ2  3  
ATOM 3810  H HZ3  . LYS A 1 58 ? -3.529  14.303  -3.153  1.00 0.00 ? 58 LYS A HZ3  3  
ATOM 3811  N N    . ARG A 1 59 ? -4.075  8.255   -6.700  1.00 0.00 ? 59 ARG A N    3  
ATOM 3812  C CA   . ARG A 1 59 ? -2.981  7.587   -7.376  1.00 0.00 ? 59 ARG A CA   3  
ATOM 3813  C C    . ARG A 1 59 ? -3.501  6.536   -8.347  1.00 0.00 ? 59 ARG A C    3  
ATOM 3814  O O    . ARG A 1 59 ? -2.987  6.407   -9.455  1.00 0.00 ? 59 ARG A O    3  
ATOM 3815  C CB   . ARG A 1 59 ? -2.043  6.987   -6.331  1.00 0.00 ? 59 ARG A CB   3  
ATOM 3816  C CG   . ARG A 1 59 ? -1.365  8.074   -5.520  1.00 0.00 ? 59 ARG A CG   3  
ATOM 3817  C CD   . ARG A 1 59 ? -0.704  7.562   -4.255  1.00 0.00 ? 59 ARG A CD   3  
ATOM 3818  N NE   . ARG A 1 59 ? 0.016   8.648   -3.596  1.00 0.00 ? 59 ARG A NE   3  
ATOM 3819  C CZ   . ARG A 1 59 ? 0.436   8.639   -2.328  1.00 0.00 ? 59 ARG A CZ   3  
ATOM 3820  N NH1  . ARG A 1 59 ? 0.206   7.604   -1.531  1.00 0.00 ? 59 ARG A NH1  3  
ATOM 3821  N NH2  . ARG A 1 59 ? 1.080   9.697   -1.853  1.00 0.00 ? 59 ARG A NH2  3  
ATOM 3822  H H    . ARG A 1 59 ? -4.200  8.109   -5.736  1.00 0.00 ? 59 ARG A H    3  
ATOM 3823  H HA   . ARG A 1 59 ? -2.437  8.336   -7.933  1.00 0.00 ? 59 ARG A HA   3  
ATOM 3824  H HB2  . ARG A 1 59 ? -2.610  6.351   -5.664  1.00 0.00 ? 59 ARG A HB2  3  
ATOM 3825  H HB3  . ARG A 1 59 ? -1.283  6.402   -6.825  1.00 0.00 ? 59 ARG A HB3  3  
ATOM 3826  H HG2  . ARG A 1 59 ? -0.613  8.541   -6.134  1.00 0.00 ? 59 ARG A HG2  3  
ATOM 3827  H HG3  . ARG A 1 59 ? -2.109  8.811   -5.248  1.00 0.00 ? 59 ARG A HG3  3  
ATOM 3828  H HD2  . ARG A 1 59 ? -1.462  7.177   -3.589  1.00 0.00 ? 59 ARG A HD2  3  
ATOM 3829  H HD3  . ARG A 1 59 ? -0.006  6.779   -4.510  1.00 0.00 ? 59 ARG A HD3  3  
ATOM 3830  H HE   . ARG A 1 59 ? 0.194   9.450   -4.142  1.00 0.00 ? 59 ARG A HE   3  
ATOM 3831  H HH11 . ARG A 1 59 ? -0.302  6.797   -1.864  1.00 0.00 ? 59 ARG A HH11 3  
ATOM 3832  H HH12 . ARG A 1 59 ? 0.541   7.616   -0.581  1.00 0.00 ? 59 ARG A HH12 3  
ATOM 3833  H HH21 . ARG A 1 59 ? 1.242   10.492  -2.446  1.00 0.00 ? 59 ARG A HH21 3  
ATOM 3834  H HH22 . ARG A 1 59 ? 1.397   9.717   -0.895  1.00 0.00 ? 59 ARG A HH22 3  
ATOM 3835  N N    . LEU A 1 60 ? -4.538  5.813   -7.942  1.00 0.00 ? 60 LEU A N    3  
ATOM 3836  C CA   . LEU A 1 60 ? -5.184  4.844   -8.825  1.00 0.00 ? 60 LEU A CA   3  
ATOM 3837  C C    . LEU A 1 60 ? -5.790  5.556   -10.031 1.00 0.00 ? 60 LEU A C    3  
ATOM 3838  O O    . LEU A 1 60 ? -5.649  5.111   -11.176 1.00 0.00 ? 60 LEU A O    3  
ATOM 3839  C CB   . LEU A 1 60 ? -6.284  4.079   -8.083  1.00 0.00 ? 60 LEU A CB   3  
ATOM 3840  C CG   . LEU A 1 60 ? -5.846  3.374   -6.796  1.00 0.00 ? 60 LEU A CG   3  
ATOM 3841  C CD1  . LEU A 1 60 ? -7.012  2.616   -6.181  1.00 0.00 ? 60 LEU A CD1  3  
ATOM 3842  C CD2  . LEU A 1 60 ? -4.674  2.439   -7.063  1.00 0.00 ? 60 LEU A CD2  3  
ATOM 3843  H H    . LEU A 1 60 ? -4.874  5.928   -7.026  1.00 0.00 ? 60 LEU A H    3  
ATOM 3844  H HA   . LEU A 1 60 ? -4.432  4.147   -9.166  1.00 0.00 ? 60 LEU A HA   3  
ATOM 3845  H HB2  . LEU A 1 60 ? -7.069  4.777   -7.837  1.00 0.00 ? 60 LEU A HB2  3  
ATOM 3846  H HB3  . LEU A 1 60 ? -6.684  3.335   -8.753  1.00 0.00 ? 60 LEU A HB3  3  
ATOM 3847  H HG   . LEU A 1 60 ? -5.525  4.119   -6.083  1.00 0.00 ? 60 LEU A HG   3  
ATOM 3848  H HD11 . LEU A 1 60 ? -7.385  1.894   -6.891  1.00 0.00 ? 60 LEU A HD11 3  
ATOM 3849  H HD12 . LEU A 1 60 ? -7.799  3.311   -5.927  1.00 0.00 ? 60 LEU A HD12 3  
ATOM 3850  H HD13 . LEU A 1 60 ? -6.679  2.107   -5.289  1.00 0.00 ? 60 LEU A HD13 3  
ATOM 3851  H HD21 . LEU A 1 60 ? -4.382  1.955   -6.142  1.00 0.00 ? 60 LEU A HD21 3  
ATOM 3852  H HD22 . LEU A 1 60 ? -3.841  3.007   -7.450  1.00 0.00 ? 60 LEU A HD22 3  
ATOM 3853  H HD23 . LEU A 1 60 ? -4.967  1.691   -7.784  1.00 0.00 ? 60 LEU A HD23 3  
ATOM 3854  N N    . ARG A 1 61 ? -6.455  6.675   -9.756  1.00 0.00 ? 61 ARG A N    3  
ATOM 3855  C CA   . ARG A 1 61 ? -7.083  7.482   -10.795 1.00 0.00 ? 61 ARG A CA   3  
ATOM 3856  C C    . ARG A 1 61 ? -6.049  7.935   -11.821 1.00 0.00 ? 61 ARG A C    3  
ATOM 3857  O O    . ARG A 1 61 ? -6.258  7.804   -13.025 1.00 0.00 ? 61 ARG A O    3  
ATOM 3858  C CB   . ARG A 1 61 ? -7.778  8.703   -10.179 1.00 0.00 ? 61 ARG A CB   3  
ATOM 3859  C CG   . ARG A 1 61 ? -8.535  9.551   -11.192 1.00 0.00 ? 61 ARG A CG   3  
ATOM 3860  C CD   . ARG A 1 61 ? -9.074  10.835  -10.574 1.00 0.00 ? 61 ARG A CD   3  
ATOM 3861  N NE   . ARG A 1 61 ? -9.978  10.576  -9.454  1.00 0.00 ? 61 ARG A NE   3  
ATOM 3862  C CZ   . ARG A 1 61 ? -11.082 11.280  -9.204  1.00 0.00 ? 61 ARG A CZ   3  
ATOM 3863  N NH1  . ARG A 1 61 ? -11.434 12.285  -9.993  1.00 0.00 ? 61 ARG A NH1  3  
ATOM 3864  N NH2  . ARG A 1 61 ? -11.828 10.980  -8.155  1.00 0.00 ? 61 ARG A NH2  3  
ATOM 3865  H H    . ARG A 1 61 ? -6.526  6.965   -8.818  1.00 0.00 ? 61 ARG A H    3  
ATOM 3866  H HA   . ARG A 1 61 ? -7.822  6.868   -11.291 1.00 0.00 ? 61 ARG A HA   3  
ATOM 3867  H HB2  . ARG A 1 61 ? -8.480  8.364   -9.431  1.00 0.00 ? 61 ARG A HB2  3  
ATOM 3868  H HB3  . ARG A 1 61 ? -7.032  9.324   -9.706  1.00 0.00 ? 61 ARG A HB3  3  
ATOM 3869  H HG2  . ARG A 1 61 ? -7.867  9.807   -12.000 1.00 0.00 ? 61 ARG A HG2  3  
ATOM 3870  H HG3  . ARG A 1 61 ? -9.365  8.974   -11.581 1.00 0.00 ? 61 ARG A HG3  3  
ATOM 3871  H HD2  . ARG A 1 61 ? -8.243  11.427  -10.221 1.00 0.00 ? 61 ARG A HD2  3  
ATOM 3872  H HD3  . ARG A 1 61 ? -9.609  11.388  -11.333 1.00 0.00 ? 61 ARG A HD3  3  
ATOM 3873  H HE   . ARG A 1 61 ? -9.743  9.837   -8.846  1.00 0.00 ? 61 ARG A HE   3  
ATOM 3874  H HH11 . ARG A 1 61 ? -10.876 12.522  -10.788 1.00 0.00 ? 61 ARG A HH11 3  
ATOM 3875  H HH12 . ARG A 1 61 ? -12.268 12.819  -9.787  1.00 0.00 ? 61 ARG A HH12 3  
ATOM 3876  H HH21 . ARG A 1 61 ? -11.561 10.223  -7.546  1.00 0.00 ? 61 ARG A HH21 3  
ATOM 3877  H HH22 . ARG A 1 61 ? -12.662 11.503  -7.958  1.00 0.00 ? 61 ARG A HH22 3  
ATOM 3878  N N    . ALA A 1 62 ? -4.927  8.449   -11.329 1.00 0.00 ? 62 ALA A N    3  
ATOM 3879  C CA   . ALA A 1 62 ? -3.862  8.952   -12.192 1.00 0.00 ? 62 ALA A CA   3  
ATOM 3880  C C    . ALA A 1 62 ? -3.289  7.845   -13.069 1.00 0.00 ? 62 ALA A C    3  
ATOM 3881  O O    . ALA A 1 62 ? -2.966  8.071   -14.237 1.00 0.00 ? 62 ALA A O    3  
ATOM 3882  C CB   . ALA A 1 62 ? -2.762  9.584   -11.353 1.00 0.00 ? 62 ALA A CB   3  
ATOM 3883  H H    . ALA A 1 62 ? -4.809  8.492   -10.353 1.00 0.00 ? 62 ALA A H    3  
ATOM 3884  H HA   . ALA A 1 62 ? -4.283  9.719   -12.827 1.00 0.00 ? 62 ALA A HA   3  
ATOM 3885  H HB1  . ALA A 1 62 ? -2.323  8.834   -10.713 1.00 0.00 ? 62 ALA A HB1  3  
ATOM 3886  H HB2  . ALA A 1 62 ? -3.183  10.375  -10.747 1.00 0.00 ? 62 ALA A HB2  3  
ATOM 3887  H HB3  . ALA A 1 62 ? -2.003  9.994   -12.003 1.00 0.00 ? 62 ALA A HB3  3  
ATOM 3888  N N    . LEU A 1 63 ? -3.182  6.648   -12.508 1.00 0.00 ? 63 LEU A N    3  
ATOM 3889  C CA   . LEU A 1 63 ? -2.657  5.502   -13.233 1.00 0.00 ? 63 LEU A CA   3  
ATOM 3890  C C    . LEU A 1 63 ? -3.502  5.187   -14.451 1.00 0.00 ? 63 LEU A C    3  
ATOM 3891  O O    . LEU A 1 63 ? -2.977  4.793   -15.490 1.00 0.00 ? 63 LEU A O    3  
ATOM 3892  C CB   . LEU A 1 63 ? -2.563  4.274   -12.324 1.00 0.00 ? 63 LEU A CB   3  
ATOM 3893  C CG   . LEU A 1 63 ? -1.601  4.405   -11.140 1.00 0.00 ? 63 LEU A CG   3  
ATOM 3894  C CD1  . LEU A 1 63 ? -1.614  3.136   -10.302 1.00 0.00 ? 63 LEU A CD1  3  
ATOM 3895  C CD2  . LEU A 1 63 ? -0.190  4.711   -11.620 1.00 0.00 ? 63 LEU A CD2  3  
ATOM 3896  H H    . LEU A 1 63 ? -3.454  6.537   -11.575 1.00 0.00 ? 63 LEU A H    3  
ATOM 3897  H HA   . LEU A 1 63 ? -1.675  5.756   -13.575 1.00 0.00 ? 63 LEU A HA   3  
ATOM 3898  H HB2  . LEU A 1 63 ? -3.550  4.063   -11.939 1.00 0.00 ? 63 LEU A HB2  3  
ATOM 3899  H HB3  . LEU A 1 63 ? -2.244  3.435   -12.925 1.00 0.00 ? 63 LEU A HB3  3  
ATOM 3900  H HG   . LEU A 1 63 ? -1.926  5.222   -10.511 1.00 0.00 ? 63 LEU A HG   3  
ATOM 3901  H HD11 . LEU A 1 63 ? -1.323  2.296   -10.916 1.00 0.00 ? 63 LEU A HD11 3  
ATOM 3902  H HD12 . LEU A 1 63 ? -2.607  2.971   -9.914  1.00 0.00 ? 63 LEU A HD12 3  
ATOM 3903  H HD13 . LEU A 1 63 ? -0.918  3.240   -9.482  1.00 0.00 ? 63 LEU A HD13 3  
ATOM 3904  H HD21 . LEU A 1 63 ? 0.466   4.813   -10.767 1.00 0.00 ? 63 LEU A HD21 3  
ATOM 3905  H HD22 . LEU A 1 63 ? -0.193  5.634   -12.181 1.00 0.00 ? 63 LEU A HD22 3  
ATOM 3906  H HD23 . LEU A 1 63 ? 0.160   3.907   -12.249 1.00 0.00 ? 63 LEU A HD23 3  
ATOM 3907  N N    . HIS A 1 64 ? -4.809  5.316   -14.326 1.00 0.00 ? 64 HIS A N    3  
ATOM 3908  C CA   . HIS A 1 64 ? -5.666  5.118   -15.481 1.00 0.00 ? 64 HIS A CA   3  
ATOM 3909  C C    . HIS A 1 64 ? -5.739  6.386   -16.332 1.00 0.00 ? 64 HIS A C    3  
ATOM 3910  O O    . HIS A 1 64 ? -5.959  6.329   -17.538 1.00 0.00 ? 64 HIS A O    3  
ATOM 3911  C CB   . HIS A 1 64 ? -7.069  4.674   -15.063 1.00 0.00 ? 64 HIS A CB   3  
ATOM 3912  C CG   . HIS A 1 64 ? -7.907  4.183   -16.207 1.00 0.00 ? 64 HIS A CG   3  
ATOM 3913  N ND1  . HIS A 1 64 ? -8.760  4.997   -16.922 1.00 0.00 ? 64 HIS A ND1  3  
ATOM 3914  C CD2  . HIS A 1 64 ? -8.017  2.953   -16.761 1.00 0.00 ? 64 HIS A CD2  3  
ATOM 3915  C CE1  . HIS A 1 64 ? -9.357  4.289   -17.861 1.00 0.00 ? 64 HIS A CE1  3  
ATOM 3916  N NE2  . HIS A 1 64 ? -8.923  3.048   -17.786 1.00 0.00 ? 64 HIS A NE2  3  
ATOM 3917  H H    . HIS A 1 64 ? -5.200  5.543   -13.449 1.00 0.00 ? 64 HIS A H    3  
ATOM 3918  H HA   . HIS A 1 64 ? -5.207  4.341   -16.069 1.00 0.00 ? 64 HIS A HA   3  
ATOM 3919  H HB2  . HIS A 1 64 ? -6.988  3.873   -14.345 1.00 0.00 ? 64 HIS A HB2  3  
ATOM 3920  H HB3  . HIS A 1 64 ? -7.582  5.510   -14.608 1.00 0.00 ? 64 HIS A HB3  3  
ATOM 3921  H HD1  . HIS A 1 64 ? -8.905  5.954   -16.767 1.00 0.00 ? 64 HIS A HD1  3  
ATOM 3922  H HD2  . HIS A 1 64 ? -7.493  2.060   -16.447 1.00 0.00 ? 64 HIS A HD2  3  
ATOM 3923  H HE1  . HIS A 1 64 ? -10.076 4.664   -18.573 1.00 0.00 ? 64 HIS A HE1  3  
ATOM 3924  H HE2  . HIS A 1 64 ? -9.107  2.346   -18.450 1.00 0.00 ? 64 HIS A HE2  3  
ATOM 3925  N N    . MET A 1 65 ? -5.555  7.527   -15.685 1.00 0.00 ? 65 MET A N    3  
ATOM 3926  C CA   . MET A 1 65 ? -5.697  8.824   -16.343 1.00 0.00 ? 65 MET A CA   3  
ATOM 3927  C C    . MET A 1 65 ? -4.524  9.105   -17.276 1.00 0.00 ? 65 MET A C    3  
ATOM 3928  O O    . MET A 1 65 ? -4.636  9.916   -18.193 1.00 0.00 ? 65 MET A O    3  
ATOM 3929  C CB   . MET A 1 65 ? -5.816  9.933   -15.293 1.00 0.00 ? 65 MET A CB   3  
ATOM 3930  C CG   . MET A 1 65 ? -6.125  11.308  -15.871 1.00 0.00 ? 65 MET A CG   3  
ATOM 3931  S SD   . MET A 1 65 ? -6.289  12.578  -14.595 1.00 0.00 ? 65 MET A SD   3  
ATOM 3932  C CE   . MET A 1 65 ? -4.640  12.568  -13.895 1.00 0.00 ? 65 MET A CE   3  
ATOM 3933  H H    . MET A 1 65 ? -5.323  7.501   -14.733 1.00 0.00 ? 65 MET A H    3  
ATOM 3934  H HA   . MET A 1 65 ? -6.605  8.798   -16.926 1.00 0.00 ? 65 MET A HA   3  
ATOM 3935  H HB2  . MET A 1 65 ? -6.604  9.673   -14.603 1.00 0.00 ? 65 MET A HB2  3  
ATOM 3936  H HB3  . MET A 1 65 ? -4.885  9.996   -14.749 1.00 0.00 ? 65 MET A HB3  3  
ATOM 3937  H HG2  . MET A 1 65 ? -5.324  11.590  -16.540 1.00 0.00 ? 65 MET A HG2  3  
ATOM 3938  H HG3  . MET A 1 65 ? -7.050  11.251  -16.424 1.00 0.00 ? 65 MET A HG3  3  
ATOM 3939  H HE1  . MET A 1 65 ? -3.922  12.836  -14.657 1.00 0.00 ? 65 MET A HE1  3  
ATOM 3940  H HE2  . MET A 1 65 ? -4.416  11.580  -13.520 1.00 0.00 ? 65 MET A HE2  3  
ATOM 3941  H HE3  . MET A 1 65 ? -4.589  13.281  -13.085 1.00 0.00 ? 65 MET A HE3  3  
ATOM 3942  N N    . LYS A 1 66 ? -3.399  8.437   -17.045 1.00 0.00 ? 66 LYS A N    3  
ATOM 3943  C CA   . LYS A 1 66 ? -2.228  8.621   -17.900 1.00 0.00 ? 66 LYS A CA   3  
ATOM 3944  C C    . LYS A 1 66 ? -2.372  7.856   -19.214 1.00 0.00 ? 66 LYS A C    3  
ATOM 3945  O O    . LYS A 1 66 ? -1.517  7.953   -20.097 1.00 0.00 ? 66 LYS A O    3  
ATOM 3946  C CB   . LYS A 1 66 ? -0.940  8.210   -17.162 1.00 0.00 ? 66 LYS A CB   3  
ATOM 3947  C CG   . LYS A 1 66 ? -0.878  6.746   -16.730 1.00 0.00 ? 66 LYS A CG   3  
ATOM 3948  C CD   . LYS A 1 66 ? -0.516  5.818   -17.883 1.00 0.00 ? 66 LYS A CD   3  
ATOM 3949  C CE   . LYS A 1 66 ? -0.455  4.367   -17.441 1.00 0.00 ? 66 LYS A CE   3  
ATOM 3950  N NZ   . LYS A 1 66 ? -0.165  3.447   -18.575 1.00 0.00 ? 66 LYS A NZ   3  
ATOM 3951  H H    . LYS A 1 66 ? -3.347  7.830   -16.271 1.00 0.00 ? 66 LYS A H    3  
ATOM 3952  H HA   . LYS A 1 66 ? -2.166  9.673   -18.133 1.00 0.00 ? 66 LYS A HA   3  
ATOM 3953  H HB2  . LYS A 1 66 ? -0.099  8.400   -17.811 1.00 0.00 ? 66 LYS A HB2  3  
ATOM 3954  H HB3  . LYS A 1 66 ? -0.840  8.826   -16.279 1.00 0.00 ? 66 LYS A HB3  3  
ATOM 3955  H HG2  . LYS A 1 66 ? -0.133  6.645   -15.956 1.00 0.00 ? 66 LYS A HG2  3  
ATOM 3956  H HG3  . LYS A 1 66 ? -1.844  6.460   -16.338 1.00 0.00 ? 66 LYS A HG3  3  
ATOM 3957  H HD2  . LYS A 1 66 ? -1.262  5.915   -18.658 1.00 0.00 ? 66 LYS A HD2  3  
ATOM 3958  H HD3  . LYS A 1 66 ? 0.448   6.107   -18.272 1.00 0.00 ? 66 LYS A HD3  3  
ATOM 3959  H HE2  . LYS A 1 66 ? 0.323   4.263   -16.698 1.00 0.00 ? 66 LYS A HE2  3  
ATOM 3960  H HE3  . LYS A 1 66 ? -1.405  4.096   -17.003 1.00 0.00 ? 66 LYS A HE3  3  
ATOM 3961  H HZ1  . LYS A 1 66 ? 0.687   3.766   -19.086 1.00 0.00 ? 66 LYS A HZ1  3  
ATOM 3962  H HZ2  . LYS A 1 66 ? -0.964  3.432   -19.238 1.00 0.00 ? 66 LYS A HZ2  3  
ATOM 3963  H HZ3  . LYS A 1 66 ? -0.002  2.481   -18.218 1.00 0.00 ? 66 LYS A HZ3  3  
ATOM 3964  N N    . GLU A 1 67 ? -3.455  7.102   -19.343 1.00 0.00 ? 67 GLU A N    3  
ATOM 3965  C CA   . GLU A 1 67 ? -3.684  6.291   -20.529 1.00 0.00 ? 67 GLU A CA   3  
ATOM 3966  C C    . GLU A 1 67 ? -4.412  7.106   -21.596 1.00 0.00 ? 67 GLU A C    3  
ATOM 3967  O O    . GLU A 1 67 ? -4.964  8.156   -21.290 1.00 0.00 ? 67 GLU A O    3  
ATOM 3968  C CB   . GLU A 1 67 ? -4.473  5.030   -20.161 1.00 0.00 ? 67 GLU A CB   3  
ATOM 3969  C CG   . GLU A 1 67 ? -3.712  4.109   -19.217 1.00 0.00 ? 67 GLU A CG   3  
ATOM 3970  C CD   . GLU A 1 67 ? -4.516  2.898   -18.782 1.00 0.00 ? 67 GLU A CD   3  
ATOM 3971  O OE1  . GLU A 1 67 ? -4.786  2.020   -19.626 1.00 0.00 ? 67 GLU A OE1  3  
ATOM 3972  O OE2  . GLU A 1 67 ? -4.866  2.810   -17.585 1.00 0.00 ? 67 GLU A OE2  3  
ATOM 3973  H H    . GLU A 1 67 ? -4.129  7.109   -18.632 1.00 0.00 ? 67 GLU A H    3  
ATOM 3974  H HA   . GLU A 1 67 ? -2.718  5.998   -20.915 1.00 0.00 ? 67 GLU A HA   3  
ATOM 3975  H HB2  . GLU A 1 67 ? -5.397  5.320   -19.682 1.00 0.00 ? 67 GLU A HB2  3  
ATOM 3976  H HB3  . GLU A 1 67 ? -4.698  4.481   -21.064 1.00 0.00 ? 67 GLU A HB3  3  
ATOM 3977  H HG2  . GLU A 1 67 ? -2.817  3.766   -19.715 1.00 0.00 ? 67 GLU A HG2  3  
ATOM 3978  H HG3  . GLU A 1 67 ? -3.435  4.671   -18.336 1.00 0.00 ? 67 GLU A HG3  3  
ATOM 3979  N N    . HIS A 1 68 ? -4.407  6.585   -22.832 1.00 0.00 ? 68 HIS A N    3  
ATOM 3980  C CA   . HIS A 1 68 ? -4.954  7.262   -24.029 1.00 0.00 ? 68 HIS A CA   3  
ATOM 3981  C C    . HIS A 1 68 ? -6.316  7.922   -23.792 1.00 0.00 ? 68 HIS A C    3  
ATOM 3982  O O    . HIS A 1 68 ? -7.360  7.280   -23.946 1.00 0.00 ? 68 HIS A O    3  
ATOM 3983  C CB   . HIS A 1 68 ? -5.049  6.274   -25.197 1.00 0.00 ? 68 HIS A CB   3  
ATOM 3984  C CG   . HIS A 1 68 ? -4.148  6.627   -26.346 1.00 0.00 ? 68 HIS A CG   3  
ATOM 3985  N ND1  . HIS A 1 68 ? -4.569  6.651   -27.657 1.00 0.00 ? 68 HIS A ND1  3  
ATOM 3986  C CD2  . HIS A 1 68 ? -2.843  6.979   -26.368 1.00 0.00 ? 68 HIS A CD2  3  
ATOM 3987  C CE1  . HIS A 1 68 ? -3.563  7.006   -28.433 1.00 0.00 ? 68 HIS A CE1  3  
ATOM 3988  N NE2  . HIS A 1 68 ? -2.501  7.214   -27.676 1.00 0.00 ? 68 HIS A NE2  3  
ATOM 3989  H H    . HIS A 1 68 ? -4.015  5.698   -22.947 1.00 0.00 ? 68 HIS A H    3  
ATOM 3990  H HA   . HIS A 1 68 ? -4.254  8.036   -24.304 1.00 0.00 ? 68 HIS A HA   3  
ATOM 3991  H HB2  . HIS A 1 68 ? -4.778  5.289   -24.848 1.00 0.00 ? 68 HIS A HB2  3  
ATOM 3992  H HB3  . HIS A 1 68 ? -6.067  6.255   -25.562 1.00 0.00 ? 68 HIS A HB3  3  
ATOM 3993  H HD1  . HIS A 1 68 ? -5.483  6.444   -27.976 1.00 0.00 ? 68 HIS A HD1  3  
ATOM 3994  H HD2  . HIS A 1 68 ? -2.186  7.050   -25.513 1.00 0.00 ? 68 HIS A HD2  3  
ATOM 3995  H HE1  . HIS A 1 68 ? -3.599  7.103   -29.508 1.00 0.00 ? 68 HIS A HE1  3  
ATOM 3996  H HE2  . HIS A 1 68 ? -1.705  7.721   -27.963 1.00 0.00 ? 68 HIS A HE2  3  
ATOM 3997  N N    . PRO A 1 69 ? -6.308  9.219   -23.415 1.00 0.00 ? 69 PRO A N    3  
ATOM 3998  C CA   . PRO A 1 69 ? -7.500  9.941   -22.940 1.00 0.00 ? 69 PRO A CA   3  
ATOM 3999  C C    . PRO A 1 69 ? -8.516  10.241  -24.041 1.00 0.00 ? 69 PRO A C    3  
ATOM 4000  O O    . PRO A 1 69 ? -9.589  10.783  -23.776 1.00 0.00 ? 69 PRO A O    3  
ATOM 4001  C CB   . PRO A 1 69 ? -6.920  11.242  -22.387 1.00 0.00 ? 69 PRO A CB   3  
ATOM 4002  C CG   . PRO A 1 69 ? -5.693  11.471  -23.193 1.00 0.00 ? 69 PRO A CG   3  
ATOM 4003  C CD   . PRO A 1 69 ? -5.123  10.106  -23.465 1.00 0.00 ? 69 PRO A CD   3  
ATOM 4004  H HA   . PRO A 1 69 ? -7.990  9.402   -22.143 1.00 0.00 ? 69 PRO A HA   3  
ATOM 4005  H HB2  . PRO A 1 69 ? -7.634  12.042  -22.515 1.00 0.00 ? 69 PRO A HB2  3  
ATOM 4006  H HB3  . PRO A 1 69 ? -6.687  11.122  -21.341 1.00 0.00 ? 69 PRO A HB3  3  
ATOM 4007  H HG2  . PRO A 1 69 ? -5.949  11.964  -24.121 1.00 0.00 ? 69 PRO A HG2  3  
ATOM 4008  H HG3  . PRO A 1 69 ? -4.989  12.067  -22.631 1.00 0.00 ? 69 PRO A HG3  3  
ATOM 4009  H HD2  . PRO A 1 69 ? -4.661  10.077  -24.442 1.00 0.00 ? 69 PRO A HD2  3  
ATOM 4010  H HD3  . PRO A 1 69 ? -4.410  9.836   -22.701 1.00 0.00 ? 69 PRO A HD3  3  
ATOM 4011  N N    . ASP A 1 70 ? -8.176  9.893   -25.271 1.00 0.00 ? 70 ASP A N    3  
ATOM 4012  C CA   . ASP A 1 70 ? -9.046  10.140  -26.414 1.00 0.00 ? 70 ASP A CA   3  
ATOM 4013  C C    . ASP A 1 70 ? -10.082 9.027   -26.569 1.00 0.00 ? 70 ASP A C    3  
ATOM 4014  O O    . ASP A 1 70 ? -10.607 8.803   -27.660 1.00 0.00 ? 70 ASP A O    3  
ATOM 4015  C CB   . ASP A 1 70 ? -8.211  10.258  -27.693 1.00 0.00 ? 70 ASP A CB   3  
ATOM 4016  C CG   . ASP A 1 70 ? -7.446  8.990   -28.002 1.00 0.00 ? 70 ASP A CG   3  
ATOM 4017  O OD1  . ASP A 1 70 ? -6.495  8.675   -27.259 1.00 0.00 ? 70 ASP A OD1  3  
ATOM 4018  O OD2  . ASP A 1 70 ? -7.794  8.299   -28.984 1.00 0.00 ? 70 ASP A OD2  3  
ATOM 4019  H H    . ASP A 1 70 ? -7.313  9.447   -25.419 1.00 0.00 ? 70 ASP A H    3  
ATOM 4020  H HA   . ASP A 1 70 ? -9.561  11.073  -26.243 1.00 0.00 ? 70 ASP A HA   3  
ATOM 4021  H HB2  . ASP A 1 70 ? -8.866  10.472  -28.525 1.00 0.00 ? 70 ASP A HB2  3  
ATOM 4022  H HB3  . ASP A 1 70 ? -7.504  11.066  -27.578 1.00 0.00 ? 70 ASP A HB3  3  
ATOM 4023  N N    . TYR A 1 71 ? -10.380 8.334   -25.473 1.00 0.00 ? 71 TYR A N    3  
ATOM 4024  C CA   . TYR A 1 71 ? -11.372 7.268   -25.500 1.00 0.00 ? 71 TYR A CA   3  
ATOM 4025  C C    . TYR A 1 71 ? -12.777 7.826   -25.732 1.00 0.00 ? 71 TYR A C    3  
ATOM 4026  O O    . TYR A 1 71 ? -12.999 9.034   -25.652 1.00 0.00 ? 71 TYR A O    3  
ATOM 4027  C CB   . TYR A 1 71 ? -11.333 6.416   -24.226 1.00 0.00 ? 71 TYR A CB   3  
ATOM 4028  C CG   . TYR A 1 71 ? -11.217 7.207   -22.948 1.00 0.00 ? 71 TYR A CG   3  
ATOM 4029  C CD1  . TYR A 1 71 ? -12.339 7.693   -22.293 1.00 0.00 ? 71 TYR A CD1  3  
ATOM 4030  C CD2  . TYR A 1 71 ? -9.977  7.459   -22.398 1.00 0.00 ? 71 TYR A CD2  3  
ATOM 4031  C CE1  . TYR A 1 71 ? -12.220 8.411   -21.118 1.00 0.00 ? 71 TYR A CE1  3  
ATOM 4032  C CE2  . TYR A 1 71 ? -9.847  8.169   -21.230 1.00 0.00 ? 71 TYR A CE2  3  
ATOM 4033  C CZ   . TYR A 1 71 ? -10.970 8.648   -20.591 1.00 0.00 ? 71 TYR A CZ   3  
ATOM 4034  O OH   . TYR A 1 71 ? -10.847 9.354   -19.416 1.00 0.00 ? 71 TYR A OH   3  
ATOM 4035  H H    . TYR A 1 71 ? -9.933  8.553   -24.632 1.00 0.00 ? 71 TYR A H    3  
ATOM 4036  H HA   . TYR A 1 71 ? -11.120 6.635   -26.331 1.00 0.00 ? 71 TYR A HA   3  
ATOM 4037  H HB2  . TYR A 1 71 ? -12.240 5.833   -24.169 1.00 0.00 ? 71 TYR A HB2  3  
ATOM 4038  H HB3  . TYR A 1 71 ? -10.487 5.745   -24.280 1.00 0.00 ? 71 TYR A HB3  3  
ATOM 4039  H HD1  . TYR A 1 71 ? -13.318 7.504   -22.710 1.00 0.00 ? 71 TYR A HD1  3  
ATOM 4040  H HD2  . TYR A 1 71 ? -9.096  7.087   -22.901 1.00 0.00 ? 71 TYR A HD2  3  
ATOM 4041  H HE1  . TYR A 1 71 ? -13.103 8.783   -20.621 1.00 0.00 ? 71 TYR A HE1  3  
ATOM 4042  H HE2  . TYR A 1 71 ? -8.868  8.352   -20.827 1.00 0.00 ? 71 TYR A HE2  3  
ATOM 4043  H HH   . TYR A 1 71 ? -10.192 10.047  -19.525 1.00 0.00 ? 71 TYR A HH   3  
ATOM 4044  N N    . LYS A 1 72 ? -13.727 6.935   -25.992 1.00 0.00 ? 72 LYS A N    3  
ATOM 4045  C CA   . LYS A 1 72 ? -15.070 7.336   -26.408 1.00 0.00 ? 72 LYS A CA   3  
ATOM 4046  C C    . LYS A 1 72 ? -15.927 7.846   -25.250 1.00 0.00 ? 72 LYS A C    3  
ATOM 4047  O O    . LYS A 1 72 ? -17.083 8.224   -25.451 1.00 0.00 ? 72 LYS A O    3  
ATOM 4048  C CB   . LYS A 1 72 ? -15.767 6.179   -27.130 1.00 0.00 ? 72 LYS A CB   3  
ATOM 4049  C CG   . LYS A 1 72 ? -15.778 4.869   -26.353 1.00 0.00 ? 72 LYS A CG   3  
ATOM 4050  C CD   . LYS A 1 72 ? -16.307 3.731   -27.210 1.00 0.00 ? 72 LYS A CD   3  
ATOM 4051  C CE   . LYS A 1 72 ? -15.417 3.492   -28.418 1.00 0.00 ? 72 LYS A CE   3  
ATOM 4052  N NZ   . LYS A 1 72 ? -16.031 2.546   -29.383 1.00 0.00 ? 72 LYS A NZ   3  
ATOM 4053  H H    . LYS A 1 72 ? -13.519 5.981   -25.907 1.00 0.00 ? 72 LYS A H    3  
ATOM 4054  H HA   . LYS A 1 72 ? -14.954 8.147   -27.111 1.00 0.00 ? 72 LYS A HA   3  
ATOM 4055  H HB2  . LYS A 1 72 ? -16.791 6.460   -27.327 1.00 0.00 ? 72 LYS A HB2  3  
ATOM 4056  H HB3  . LYS A 1 72 ? -15.265 6.009   -28.071 1.00 0.00 ? 72 LYS A HB3  3  
ATOM 4057  H HG2  . LYS A 1 72 ? -14.772 4.636   -26.044 1.00 0.00 ? 72 LYS A HG2  3  
ATOM 4058  H HG3  . LYS A 1 72 ? -16.411 4.979   -25.483 1.00 0.00 ? 72 LYS A HG3  3  
ATOM 4059  H HD2  . LYS A 1 72 ? -16.343 2.830   -26.615 1.00 0.00 ? 72 LYS A HD2  3  
ATOM 4060  H HD3  . LYS A 1 72 ? -17.301 3.979   -27.550 1.00 0.00 ? 72 LYS A HD3  3  
ATOM 4061  H HE2  . LYS A 1 72 ? -15.244 4.435   -28.914 1.00 0.00 ? 72 LYS A HE2  3  
ATOM 4062  H HE3  . LYS A 1 72 ? -14.475 3.085   -28.081 1.00 0.00 ? 72 LYS A HE3  3  
ATOM 4063  H HZ1  . LYS A 1 72 ? -16.974 2.891   -29.672 1.00 0.00 ? 72 LYS A HZ1  3  
ATOM 4064  H HZ2  . LYS A 1 72 ? -16.136 1.603   -28.953 1.00 0.00 ? 72 LYS A HZ2  3  
ATOM 4065  H HZ3  . LYS A 1 72 ? -15.434 2.460   -30.232 1.00 0.00 ? 72 LYS A HZ3  3  
ATOM 4066  N N    . TYR A 1 73 ? -15.374 7.865   -24.048 1.00 0.00 ? 73 TYR A N    3  
ATOM 4067  C CA   . TYR A 1 73 ? -16.059 8.499   -22.933 1.00 0.00 ? 73 TYR A CA   3  
ATOM 4068  C C    . TYR A 1 73 ? -15.795 9.997   -22.985 1.00 0.00 ? 73 TYR A C    3  
ATOM 4069  O O    . TYR A 1 73 ? -14.670 10.447  -22.785 1.00 0.00 ? 73 TYR A O    3  
ATOM 4070  C CB   . TYR A 1 73 ? -15.607 7.924   -21.588 1.00 0.00 ? 73 TYR A CB   3  
ATOM 4071  C CG   . TYR A 1 73 ? -15.833 6.436   -21.449 1.00 0.00 ? 73 TYR A CG   3  
ATOM 4072  C CD1  . TYR A 1 73 ? -17.064 5.869   -21.747 1.00 0.00 ? 73 TYR A CD1  3  
ATOM 4073  C CD2  . TYR A 1 73 ? -14.814 5.602   -21.009 1.00 0.00 ? 73 TYR A CD2  3  
ATOM 4074  C CE1  . TYR A 1 73 ? -17.273 4.511   -21.612 1.00 0.00 ? 73 TYR A CE1  3  
ATOM 4075  C CE2  . TYR A 1 73 ? -15.014 4.244   -20.873 1.00 0.00 ? 73 TYR A CE2  3  
ATOM 4076  C CZ   . TYR A 1 73 ? -16.245 3.704   -21.175 1.00 0.00 ? 73 TYR A CZ   3  
ATOM 4077  O OH   . TYR A 1 73 ? -16.448 2.354   -21.040 1.00 0.00 ? 73 TYR A OH   3  
ATOM 4078  H H    . TYR A 1 73 ? -14.493 7.466   -23.914 1.00 0.00 ? 73 TYR A H    3  
ATOM 4079  H HA   . TYR A 1 73 ? -17.119 8.326   -23.058 1.00 0.00 ? 73 TYR A HA   3  
ATOM 4080  H HB2  . TYR A 1 73 ? -14.551 8.107   -21.463 1.00 0.00 ? 73 TYR A HB2  3  
ATOM 4081  H HB3  . TYR A 1 73 ? -16.149 8.416   -20.795 1.00 0.00 ? 73 TYR A HB3  3  
ATOM 4082  H HD1  . TYR A 1 73 ? -17.866 6.506   -22.090 1.00 0.00 ? 73 TYR A HD1  3  
ATOM 4083  H HD2  . TYR A 1 73 ? -13.851 6.029   -20.773 1.00 0.00 ? 73 TYR A HD2  3  
ATOM 4084  H HE1  . TYR A 1 73 ? -18.239 4.086   -21.849 1.00 0.00 ? 73 TYR A HE1  3  
ATOM 4085  H HE2  . TYR A 1 73 ? -14.210 3.611   -20.530 1.00 0.00 ? 73 TYR A HE2  3  
ATOM 4086  H HH   . TYR A 1 73 ? -16.908 2.017   -21.830 1.00 0.00 ? 73 TYR A HH   3  
ATOM 4087  N N    . ARG A 1 74 ? -16.835 10.760  -23.266 1.00 0.00 ? 74 ARG A N    3  
ATOM 4088  C CA   . ARG A 1 74 ? -16.679 12.175  -23.552 1.00 0.00 ? 74 ARG A CA   3  
ATOM 4089  C C    . ARG A 1 74 ? -17.401 13.040  -22.529 1.00 0.00 ? 74 ARG A C    3  
ATOM 4090  O O    . ARG A 1 74 ? -18.477 12.681  -22.037 1.00 0.00 ? 74 ARG A O    3  
ATOM 4091  C CB   . ARG A 1 74 ? -17.212 12.465  -24.954 1.00 0.00 ? 74 ARG A CB   3  
ATOM 4092  C CG   . ARG A 1 74 ? -16.359 11.864  -26.062 1.00 0.00 ? 74 ARG A CG   3  
ATOM 4093  C CD   . ARG A 1 74 ? -17.199 11.486  -27.269 1.00 0.00 ? 74 ARG A CD   3  
ATOM 4094  N NE   . ARG A 1 74 ? -18.047 10.327  -26.991 1.00 0.00 ? 74 ARG A NE   3  
ATOM 4095  C CZ   . ARG A 1 74 ? -19.149 10.025  -27.675 1.00 0.00 ? 74 ARG A CZ   3  
ATOM 4096  N NH1  . ARG A 1 74 ? -19.561 10.802  -28.664 1.00 0.00 ? 74 ARG A NH1  3  
ATOM 4097  N NH2  . ARG A 1 74 ? -19.840 8.934   -27.376 1.00 0.00 ? 74 ARG A NH2  3  
ATOM 4098  H H    . ARG A 1 74 ? -17.739 10.367  -23.264 1.00 0.00 ? 74 ARG A H    3  
ATOM 4099  H HA   . ARG A 1 74 ? -15.625 12.407  -23.523 1.00 0.00 ? 74 ARG A HA   3  
ATOM 4100  H HB2  . ARG A 1 74 ? -18.211 12.061  -25.036 1.00 0.00 ? 74 ARG A HB2  3  
ATOM 4101  H HB3  . ARG A 1 74 ? -17.252 13.534  -25.097 1.00 0.00 ? 74 ARG A HB3  3  
ATOM 4102  H HG2  . ARG A 1 74 ? -15.617 12.587  -26.367 1.00 0.00 ? 74 ARG A HG2  3  
ATOM 4103  H HG3  . ARG A 1 74 ? -15.868 10.978  -25.686 1.00 0.00 ? 74 ARG A HG3  3  
ATOM 4104  H HD2  . ARG A 1 74 ? -17.824 12.326  -27.535 1.00 0.00 ? 74 ARG A HD2  3  
ATOM 4105  H HD3  . ARG A 1 74 ? -16.540 11.251  -28.092 1.00 0.00 ? 74 ARG A HD3  3  
ATOM 4106  H HE   . ARG A 1 74 ? -17.766 9.729   -26.256 1.00 0.00 ? 74 ARG A HE   3  
ATOM 4107  H HH11 . ARG A 1 74 ? -19.046 11.634  -28.912 1.00 0.00 ? 74 ARG A HH11 3  
ATOM 4108  H HH12 . ARG A 1 74 ? -20.396 10.560  -29.180 1.00 0.00 ? 74 ARG A HH12 3  
ATOM 4109  H HH21 . ARG A 1 74 ? -19.538 8.330   -26.636 1.00 0.00 ? 74 ARG A HH21 3  
ATOM 4110  H HH22 . ARG A 1 74 ? -20.671 8.710   -27.897 1.00 0.00 ? 74 ARG A HH22 3  
ATOM 4111  N N    . PRO A 1 75 ? -16.805 14.193  -22.193 1.00 0.00 ? 75 PRO A N    3  
ATOM 4112  C CA   . PRO A 1 75 ? -17.428 15.198  -21.338 1.00 0.00 ? 75 PRO A CA   3  
ATOM 4113  C C    . PRO A 1 75 ? -18.481 15.985  -22.103 1.00 0.00 ? 75 PRO A C    3  
ATOM 4114  O O    . PRO A 1 75 ? -18.493 15.985  -23.336 1.00 0.00 ? 75 PRO A O    3  
ATOM 4115  C CB   . PRO A 1 75 ? -16.263 16.119  -20.931 1.00 0.00 ? 75 PRO A CB   3  
ATOM 4116  C CG   . PRO A 1 75 ? -15.024 15.467  -21.457 1.00 0.00 ? 75 PRO A CG   3  
ATOM 4117  C CD   . PRO A 1 75 ? -15.461 14.608  -22.605 1.00 0.00 ? 75 PRO A CD   3  
ATOM 4118  H HA   . PRO A 1 75 ? -17.872 14.756  -20.460 1.00 0.00 ? 75 PRO A HA   3  
ATOM 4119  H HB2  . PRO A 1 75 ? -16.406 17.096  -21.370 1.00 0.00 ? 75 PRO A HB2  3  
ATOM 4120  H HB3  . PRO A 1 75 ? -16.233 16.205  -19.857 1.00 0.00 ? 75 PRO A HB3  3  
ATOM 4121  H HG2  . PRO A 1 75 ? -14.329 16.221  -21.797 1.00 0.00 ? 75 PRO A HG2  3  
ATOM 4122  H HG3  . PRO A 1 75 ? -14.573 14.861  -20.685 1.00 0.00 ? 75 PRO A HG3  3  
ATOM 4123  H HD2  . PRO A 1 75 ? -15.495 15.185  -23.517 1.00 0.00 ? 75 PRO A HD2  3  
ATOM 4124  H HD3  . PRO A 1 75 ? -14.810 13.755  -22.715 1.00 0.00 ? 75 PRO A HD3  3  
ATOM 4125  N N    . ARG A 1 76 ? -19.363 16.647  -21.382 1.00 0.00 ? 76 ARG A N    3  
ATOM 4126  C CA   . ARG A 1 76 ? -20.422 17.410  -22.013 1.00 0.00 ? 76 ARG A CA   3  
ATOM 4127  C C    . ARG A 1 76 ? -20.102 18.896  -22.002 1.00 0.00 ? 76 ARG A C    3  
ATOM 4128  O O    . ARG A 1 76 ? -19.575 19.423  -21.015 1.00 0.00 ? 76 ARG A O    3  
ATOM 4129  C CB   . ARG A 1 76 ? -21.754 17.159  -21.311 1.00 0.00 ? 76 ARG A CB   3  
ATOM 4130  C CG   . ARG A 1 76 ? -22.130 15.692  -21.237 1.00 0.00 ? 76 ARG A CG   3  
ATOM 4131  C CD   . ARG A 1 76 ? -23.495 15.501  -20.606 1.00 0.00 ? 76 ARG A CD   3  
ATOM 4132  N NE   . ARG A 1 76 ? -24.568 16.004  -21.456 1.00 0.00 ? 76 ARG A NE   3  
ATOM 4133  C CZ   . ARG A 1 76 ? -25.850 15.713  -21.278 1.00 0.00 ? 76 ARG A CZ   3  
ATOM 4134  N NH1  . ARG A 1 76 ? -26.228 14.971  -20.239 1.00 0.00 ? 76 ARG A NH1  3  
ATOM 4135  N NH2  . ARG A 1 76 ? -26.755 16.184  -22.124 1.00 0.00 ? 76 ARG A NH2  3  
ATOM 4136  H H    . ARG A 1 76 ? -19.300 16.623  -20.399 1.00 0.00 ? 76 ARG A H    3  
ATOM 4137  H HA   . ARG A 1 76 ? -20.499 17.080  -23.037 1.00 0.00 ? 76 ARG A HA   3  
ATOM 4138  H HB2  . ARG A 1 76 ? -21.700 17.546  -20.304 1.00 0.00 ? 76 ARG A HB2  3  
ATOM 4139  H HB3  . ARG A 1 76 ? -22.533 17.680  -21.845 1.00 0.00 ? 76 ARG A HB3  3  
ATOM 4140  H HG2  . ARG A 1 76 ? -22.151 15.285  -22.236 1.00 0.00 ? 76 ARG A HG2  3  
ATOM 4141  H HG3  . ARG A 1 76 ? -21.391 15.168  -20.648 1.00 0.00 ? 76 ARG A HG3  3  
ATOM 4142  H HD2  . ARG A 1 76 ? -23.653 14.446  -20.435 1.00 0.00 ? 76 ARG A HD2  3  
ATOM 4143  H HD3  . ARG A 1 76 ? -23.517 16.026  -19.663 1.00 0.00 ? 76 ARG A HD3  3  
ATOM 4144  H HE   . ARG A 1 76 ? -24.315 16.586  -22.216 1.00 0.00 ? 76 ARG A HE   3  
ATOM 4145  H HH11 . ARG A 1 76 ? -25.543 14.631  -19.583 1.00 0.00 ? 76 ARG A HH11 3  
ATOM 4146  H HH12 . ARG A 1 76 ? -27.201 14.738  -20.103 1.00 0.00 ? 76 ARG A HH12 3  
ATOM 4147  H HH21 . ARG A 1 76 ? -26.467 16.763  -22.896 1.00 0.00 ? 76 ARG A HH21 3  
ATOM 4148  H HH22 . ARG A 1 76 ? -27.729 15.959  -22.005 1.00 0.00 ? 76 ARG A HH22 3  
ATOM 4149  N N    . ARG A 1 77 ? -20.405 19.564  -23.104 1.00 0.00 ? 77 ARG A N    3  
ATOM 4150  C CA   . ARG A 1 77 ? -20.228 21.002  -23.194 1.00 0.00 ? 77 ARG A CA   3  
ATOM 4151  C C    . ARG A 1 77 ? -21.275 21.719  -22.362 1.00 0.00 ? 77 ARG A C    3  
ATOM 4152  O O    . ARG A 1 77 ? -22.475 21.506  -22.538 1.00 0.00 ? 77 ARG A O    3  
ATOM 4153  C CB   . ARG A 1 77 ? -20.317 21.476  -24.645 1.00 0.00 ? 77 ARG A CB   3  
ATOM 4154  C CG   . ARG A 1 77 ? -19.107 21.114  -25.489 1.00 0.00 ? 77 ARG A CG   3  
ATOM 4155  C CD   . ARG A 1 77 ? -19.234 21.668  -26.899 1.00 0.00 ? 77 ARG A CD   3  
ATOM 4156  N NE   . ARG A 1 77 ? -19.547 23.101  -26.895 1.00 0.00 ? 77 ARG A NE   3  
ATOM 4157  C CZ   . ARG A 1 77 ? -19.250 23.936  -27.890 1.00 0.00 ? 77 ARG A CZ   3  
ATOM 4158  N NH1  . ARG A 1 77 ? -18.578 23.503  -28.948 1.00 0.00 ? 77 ARG A NH1  3  
ATOM 4159  N NH2  . ARG A 1 77 ? -19.610 25.212  -27.816 1.00 0.00 ? 77 ARG A NH2  3  
ATOM 4160  H H    . ARG A 1 77 ? -20.762 19.073  -23.883 1.00 0.00 ? 77 ARG A H    3  
ATOM 4161  H HA   . ARG A 1 77 ? -19.250 21.242  -22.805 1.00 0.00 ? 77 ARG A HA   3  
ATOM 4162  H HB2  . ARG A 1 77 ? -21.191 21.035  -25.101 1.00 0.00 ? 77 ARG A HB2  3  
ATOM 4163  H HB3  . ARG A 1 77 ? -20.425 22.551  -24.652 1.00 0.00 ? 77 ARG A HB3  3  
ATOM 4164  H HG2  . ARG A 1 77 ? -18.220 21.524  -25.029 1.00 0.00 ? 77 ARG A HG2  3  
ATOM 4165  H HG3  . ARG A 1 77 ? -19.026 20.038  -25.540 1.00 0.00 ? 77 ARG A HG3  3  
ATOM 4166  H HD2  . ARG A 1 77 ? -18.301 21.514  -27.418 1.00 0.00 ? 77 ARG A HD2  3  
ATOM 4167  H HD3  . ARG A 1 77 ? -20.024 21.138  -27.411 1.00 0.00 ? 77 ARG A HD3  3  
ATOM 4168  H HE   . ARG A 1 77 ? -20.021 23.454  -26.112 1.00 0.00 ? 77 ARG A HE   3  
ATOM 4169  H HH11 . ARG A 1 77 ? -18.286 22.539  -29.006 1.00 0.00 ? 77 ARG A HH11 3  
ATOM 4170  H HH12 . ARG A 1 77 ? -18.352 24.138  -29.701 1.00 0.00 ? 77 ARG A HH12 3  
ATOM 4171  H HH21 . ARG A 1 77 ? -20.105 25.554  -27.004 1.00 0.00 ? 77 ARG A HH21 3  
ATOM 4172  H HH22 . ARG A 1 77 ? -19.400 25.840  -28.568 1.00 0.00 ? 77 ARG A HH22 3  
ATOM 4173  N N    . LYS A 1 78 ? -20.811 22.554  -21.448 1.00 0.00 ? 78 LYS A N    3  
ATOM 4174  C CA   . LYS A 1 78 ? -21.699 23.369  -20.639 1.00 0.00 ? 78 LYS A CA   3  
ATOM 4175  C C    . LYS A 1 78 ? -22.303 24.486  -21.486 1.00 0.00 ? 78 LYS A C    3  
ATOM 4176  O O    . LYS A 1 78 ? -21.665 25.510  -21.743 1.00 0.00 ? 78 LYS A O    3  
ATOM 4177  C CB   . LYS A 1 78 ? -20.954 23.937  -19.422 1.00 0.00 ? 78 LYS A CB   3  
ATOM 4178  C CG   . LYS A 1 78 ? -19.596 24.546  -19.754 1.00 0.00 ? 78 LYS A CG   3  
ATOM 4179  C CD   . LYS A 1 78 ? -18.892 25.070  -18.508 1.00 0.00 ? 78 LYS A CD   3  
ATOM 4180  C CE   . LYS A 1 78 ? -19.628 26.254  -17.902 1.00 0.00 ? 78 LYS A CE   3  
ATOM 4181  N NZ   . LYS A 1 78 ? -19.722 27.393  -18.853 1.00 0.00 ? 78 LYS A NZ   3  
ATOM 4182  H H    . LYS A 1 78 ? -19.844 22.626  -21.315 1.00 0.00 ? 78 LYS A H    3  
ATOM 4183  H HA   . LYS A 1 78 ? -22.497 22.731  -20.292 1.00 0.00 ? 78 LYS A HA   3  
ATOM 4184  H HB2  . LYS A 1 78 ? -21.565 24.705  -18.970 1.00 0.00 ? 78 LYS A HB2  3  
ATOM 4185  H HB3  . LYS A 1 78 ? -20.803 23.143  -18.704 1.00 0.00 ? 78 LYS A HB3  3  
ATOM 4186  H HG2  . LYS A 1 78 ? -18.978 23.789  -20.213 1.00 0.00 ? 78 LYS A HG2  3  
ATOM 4187  H HG3  . LYS A 1 78 ? -19.742 25.363  -20.445 1.00 0.00 ? 78 LYS A HG3  3  
ATOM 4188  H HD2  . LYS A 1 78 ? -18.838 24.278  -17.775 1.00 0.00 ? 78 LYS A HD2  3  
ATOM 4189  H HD3  . LYS A 1 78 ? -17.893 25.380  -18.777 1.00 0.00 ? 78 LYS A HD3  3  
ATOM 4190  H HE2  . LYS A 1 78 ? -20.624 25.941  -17.630 1.00 0.00 ? 78 LYS A HE2  3  
ATOM 4191  H HE3  . LYS A 1 78 ? -19.099 26.578  -17.017 1.00 0.00 ? 78 LYS A HE3  3  
ATOM 4192  H HZ1  . LYS A 1 78 ? -20.273 27.118  -19.691 1.00 0.00 ? 78 LYS A HZ1  3  
ATOM 4193  H HZ2  . LYS A 1 78 ? -18.768 27.690  -19.157 1.00 0.00 ? 78 LYS A HZ2  3  
ATOM 4194  H HZ3  . LYS A 1 78 ? -20.194 28.204  -18.397 1.00 0.00 ? 78 LYS A HZ3  3  
ATOM 4195  N N    . THR A 1 79 ? -23.517 24.252  -21.963 1.00 0.00 ? 79 THR A N    3  
ATOM 4196  C CA   . THR A 1 79 ? -24.238 25.228  -22.767 1.00 0.00 ? 79 THR A CA   3  
ATOM 4197  C C    . THR A 1 79 ? -24.627 26.436  -21.909 1.00 0.00 ? 79 THR A C    3  
ATOM 4198  O O    . THR A 1 79 ? -24.509 26.389  -20.680 1.00 0.00 ? 79 THR A O    3  
ATOM 4199  C CB   . THR A 1 79 ? -25.496 24.579  -23.387 1.00 0.00 ? 79 THR A CB   3  
ATOM 4200  O OG1  . THR A 1 79 ? -25.174 23.256  -23.826 1.00 0.00 ? 79 THR A OG1  3  
ATOM 4201  C CG2  . THR A 1 79 ? -26.021 25.379  -24.575 1.00 0.00 ? 79 THR A CG2  3  
ATOM 4202  H H    . THR A 1 79 ? -23.937 23.385  -21.784 1.00 0.00 ? 79 THR A H    3  
ATOM 4203  H HA   . THR A 1 79 ? -23.590 25.555  -23.567 1.00 0.00 ? 79 THR A HA   3  
ATOM 4204  H HB   . THR A 1 79 ? -26.267 24.528  -22.633 1.00 0.00 ? 79 THR A HB   3  
ATOM 4205  H HG1  . THR A 1 79 ? -25.988 22.785  -24.055 1.00 0.00 ? 79 THR A HG1  3  
ATOM 4206  H HG21 . THR A 1 79 ? -26.829 24.837  -25.042 1.00 0.00 ? 79 THR A HG21 3  
ATOM 4207  H HG22 . THR A 1 79 ? -25.225 25.523  -25.291 1.00 0.00 ? 79 THR A HG22 3  
ATOM 4208  H HG23 . THR A 1 79 ? -26.382 26.338  -24.236 1.00 0.00 ? 79 THR A HG23 3  
ATOM 4209  N N    . LYS A 1 80 ? -25.076 27.508  -22.563 1.00 0.00 ? 80 LYS A N    3  
ATOM 4210  C CA   . LYS A 1 80 ? -25.418 28.762  -21.895 1.00 0.00 ? 80 LYS A CA   3  
ATOM 4211  C C    . LYS A 1 80 ? -24.137 29.433  -21.410 1.00 0.00 ? 80 LYS A C    3  
ATOM 4212  O O    . LYS A 1 80 ? -23.767 29.362  -20.238 1.00 0.00 ? 80 LYS A O    3  
ATOM 4213  C CB   . LYS A 1 80 ? -26.428 28.536  -20.751 1.00 0.00 ? 80 LYS A CB   3  
ATOM 4214  C CG   . LYS A 1 80 ? -27.136 29.797  -20.258 1.00 0.00 ? 80 LYS A CG   3  
ATOM 4215  C CD   . LYS A 1 80 ? -26.327 30.543  -19.207 1.00 0.00 ? 80 LYS A CD   3  
ATOM 4216  C CE   . LYS A 1 80 ? -27.086 31.740  -18.658 1.00 0.00 ? 80 LYS A CE   3  
ATOM 4217  N NZ   . LYS A 1 80 ? -27.245 32.820  -19.666 1.00 0.00 ? 80 LYS A NZ   3  
ATOM 4218  H H    . LYS A 1 80 ? -25.166 27.459  -23.536 1.00 0.00 ? 80 LYS A H    3  
ATOM 4219  H HA   . LYS A 1 80 ? -25.872 29.404  -22.637 1.00 0.00 ? 80 LYS A HA   3  
ATOM 4220  H HB2  . LYS A 1 80 ? -27.181 27.842  -21.090 1.00 0.00 ? 80 LYS A HB2  3  
ATOM 4221  H HB3  . LYS A 1 80 ? -25.904 28.096  -19.914 1.00 0.00 ? 80 LYS A HB3  3  
ATOM 4222  H HG2  . LYS A 1 80 ? -27.303 30.454  -21.098 1.00 0.00 ? 80 LYS A HG2  3  
ATOM 4223  H HG3  . LYS A 1 80 ? -28.087 29.515  -19.829 1.00 0.00 ? 80 LYS A HG3  3  
ATOM 4224  H HD2  . LYS A 1 80 ? -26.105 29.869  -18.395 1.00 0.00 ? 80 LYS A HD2  3  
ATOM 4225  H HD3  . LYS A 1 80 ? -25.406 30.886  -19.655 1.00 0.00 ? 80 LYS A HD3  3  
ATOM 4226  H HE2  . LYS A 1 80 ? -28.064 31.411  -18.341 1.00 0.00 ? 80 LYS A HE2  3  
ATOM 4227  H HE3  . LYS A 1 80 ? -26.548 32.130  -17.807 1.00 0.00 ? 80 LYS A HE3  3  
ATOM 4228  H HZ1  . LYS A 1 80 ? -27.730 32.459  -20.515 1.00 0.00 ? 80 LYS A HZ1  3  
ATOM 4229  H HZ2  . LYS A 1 80 ? -26.312 33.194  -19.943 1.00 0.00 ? 80 LYS A HZ2  3  
ATOM 4230  H HZ3  . LYS A 1 80 ? -27.811 33.602  -19.265 1.00 0.00 ? 80 LYS A HZ3  3  
ATOM 4231  N N    . THR A 1 81 ? -23.428 30.013  -22.361 1.00 0.00 ? 81 THR A N    3  
ATOM 4232  C CA   . THR A 1 81 ? -22.200 30.740  -22.104 1.00 0.00 ? 81 THR A CA   3  
ATOM 4233  C C    . THR A 1 81 ? -21.955 31.715  -23.254 1.00 0.00 ? 81 THR A C    3  
ATOM 4234  O O    . THR A 1 81 ? -22.167 32.928  -23.063 1.00 0.00 ? 81 THR A O    3  
ATOM 4235  C CB   . THR A 1 81 ? -20.987 29.788  -21.957 1.00 0.00 ? 81 THR A CB   3  
ATOM 4236  O OG1  . THR A 1 81 ? -21.214 28.855  -20.887 1.00 0.00 ? 81 THR A OG1  3  
ATOM 4237  C CG2  . THR A 1 81 ? -19.709 30.568  -21.682 1.00 0.00 ? 81 THR A CG2  3  
ATOM 4238  O OXT  . THR A 1 81 ? -21.619 31.250  -24.365 1.00 0.00 ? 81 THR A OXT  3  
ATOM 4239  H H    . THR A 1 81 ? -23.747 29.952  -23.290 1.00 0.00 ? 81 THR A H    3  
ATOM 4240  H HA   . THR A 1 81 ? -22.322 31.297  -21.186 1.00 0.00 ? 81 THR A HA   3  
ATOM 4241  H HB   . THR A 1 81 ? -20.864 29.240  -22.880 1.00 0.00 ? 81 THR A HB   3  
ATOM 4242  H HG1  . THR A 1 81 ? -22.162 28.815  -20.691 1.00 0.00 ? 81 THR A HG1  3  
ATOM 4243  H HG21 . THR A 1 81 ? -19.515 31.239  -22.506 1.00 0.00 ? 81 THR A HG21 3  
ATOM 4244  H HG22 . THR A 1 81 ? -18.884 29.881  -21.574 1.00 0.00 ? 81 THR A HG22 3  
ATOM 4245  H HG23 . THR A 1 81 ? -19.825 31.138  -20.771 1.00 0.00 ? 81 THR A HG23 3  
ATOM 4246  N N    . SER A 1 1  ? -10.385 8.308   -23.385 1.00 0.00 ? 1  SER A N    4  
ATOM 4247  C CA   . SER A 1 1  ? -10.803 9.726   -23.381 1.00 0.00 ? 1  SER A CA   4  
ATOM 4248  C C    . SER A 1 1  ? -12.242 9.840   -22.888 1.00 0.00 ? 1  SER A C    4  
ATOM 4249  O O    . SER A 1 1  ? -13.017 10.673  -23.360 1.00 0.00 ? 1  SER A O    4  
ATOM 4250  C CB   . SER A 1 1  ? -10.681 10.295  -24.793 1.00 0.00 ? 1  SER A CB   4  
ATOM 4251  O OG   . SER A 1 1  ? -9.388  10.055  -25.324 1.00 0.00 ? 1  SER A OG   4  
ATOM 4252  H H1   . SER A 1 1  ? -10.350 7.938   -22.414 1.00 0.00 ? 1  SER A H1   4  
ATOM 4253  H H2   . SER A 1 1  ? -9.446  8.211   -23.822 1.00 0.00 ? 1  SER A H2   4  
ATOM 4254  H H3   . SER A 1 1  ? -11.064 7.741   -23.932 1.00 0.00 ? 1  SER A H3   4  
ATOM 4255  H HA   . SER A 1 1  ? -10.154 10.277  -22.713 1.00 0.00 ? 1  SER A HA   4  
ATOM 4256  H HB2  . SER A 1 1  ? -11.414 9.826   -25.434 1.00 0.00 ? 1  SER A HB2  4  
ATOM 4257  H HB3  . SER A 1 1  ? -10.855 11.360  -24.768 1.00 0.00 ? 1  SER A HB3  4  
ATOM 4258  H HG   . SER A 1 1  ? -9.467  9.506   -26.123 1.00 0.00 ? 1  SER A HG   4  
ATOM 4259  N N    . ASP A 1 2  ? -12.585 9.002   -21.925 1.00 0.00 ? 2  ASP A N    4  
ATOM 4260  C CA   . ASP A 1 2  ? -13.947 8.900   -21.436 1.00 0.00 ? 2  ASP A CA   4  
ATOM 4261  C C    . ASP A 1 2  ? -13.944 8.316   -20.027 1.00 0.00 ? 2  ASP A C    4  
ATOM 4262  O O    . ASP A 1 2  ? -12.952 8.445   -19.304 1.00 0.00 ? 2  ASP A O    4  
ATOM 4263  C CB   . ASP A 1 2  ? -14.783 8.034   -22.385 1.00 0.00 ? 2  ASP A CB   4  
ATOM 4264  C CG   . ASP A 1 2  ? -14.167 6.674   -22.620 1.00 0.00 ? 2  ASP A CG   4  
ATOM 4265  O OD1  . ASP A 1 2  ? -13.170 6.588   -23.366 1.00 0.00 ? 2  ASP A OD1  4  
ATOM 4266  O OD2  . ASP A 1 2  ? -14.667 5.695   -22.045 1.00 0.00 ? 2  ASP A OD2  4  
ATOM 4267  H H    . ASP A 1 2  ? -11.893 8.433   -21.516 1.00 0.00 ? 2  ASP A H    4  
ATOM 4268  H HA   . ASP A 1 2  ? -14.365 9.895   -21.403 1.00 0.00 ? 2  ASP A HA   4  
ATOM 4269  H HB2  . ASP A 1 2  ? -15.767 7.893   -21.961 1.00 0.00 ? 2  ASP A HB2  4  
ATOM 4270  H HB3  . ASP A 1 2  ? -14.876 8.539   -23.336 1.00 0.00 ? 2  ASP A HB3  4  
ATOM 4271  N N    . ARG A 1 3  ? -15.044 7.680   -19.640 1.00 0.00 ? 3  ARG A N    4  
ATOM 4272  C CA   . ARG A 1 3  ? -15.213 7.191   -18.274 1.00 0.00 ? 3  ARG A CA   4  
ATOM 4273  C C    . ARG A 1 3  ? -14.211 6.088   -17.933 1.00 0.00 ? 3  ARG A C    4  
ATOM 4274  O O    . ARG A 1 3  ? -14.087 5.088   -18.638 1.00 0.00 ? 3  ARG A O    4  
ATOM 4275  C CB   . ARG A 1 3  ? -16.656 6.712   -18.021 1.00 0.00 ? 3  ARG A CB   4  
ATOM 4276  C CG   . ARG A 1 3  ? -17.063 5.410   -18.713 1.00 0.00 ? 3  ARG A CG   4  
ATOM 4277  C CD   . ARG A 1 3  ? -17.096 5.543   -20.228 1.00 0.00 ? 3  ARG A CD   4  
ATOM 4278  N NE   . ARG A 1 3  ? -17.958 4.538   -20.852 1.00 0.00 ? 3  ARG A NE   4  
ATOM 4279  C CZ   . ARG A 1 3  ? -17.849 4.136   -22.121 1.00 0.00 ? 3  ARG A CZ   4  
ATOM 4280  N NH1  . ARG A 1 3  ? -16.811 4.517   -22.857 1.00 0.00 ? 3  ARG A NH1  4  
ATOM 4281  N NH2  . ARG A 1 3  ? -18.754 3.311   -22.637 1.00 0.00 ? 3  ARG A NH2  4  
ATOM 4282  H H    . ARG A 1 3  ? -15.750 7.517   -20.296 1.00 0.00 ? 3  ARG A H    4  
ATOM 4283  H HA   . ARG A 1 3  ? -15.019 8.026   -17.617 1.00 0.00 ? 3  ARG A HA   4  
ATOM 4284  H HB2  . ARG A 1 3  ? -16.787 6.574   -16.960 1.00 0.00 ? 3  ARG A HB2  4  
ATOM 4285  H HB3  . ARG A 1 3  ? -17.333 7.487   -18.351 1.00 0.00 ? 3  ARG A HB3  4  
ATOM 4286  H HG2  . ARG A 1 3  ? -16.354 4.639   -18.448 1.00 0.00 ? 3  ARG A HG2  4  
ATOM 4287  H HG3  . ARG A 1 3  ? -18.045 5.128   -18.364 1.00 0.00 ? 3  ARG A HG3  4  
ATOM 4288  H HD2  . ARG A 1 3  ? -17.466 6.525   -20.481 1.00 0.00 ? 3  ARG A HD2  4  
ATOM 4289  H HD3  . ARG A 1 3  ? -16.091 5.429   -20.609 1.00 0.00 ? 3  ARG A HD3  4  
ATOM 4290  H HE   . ARG A 1 3  ? -18.694 4.173   -20.297 1.00 0.00 ? 3  ARG A HE   4  
ATOM 4291  H HH11 . ARG A 1 3  ? -16.089 5.107   -22.455 1.00 0.00 ? 3  ARG A HH11 4  
ATOM 4292  H HH12 . ARG A 1 3  ? -16.736 4.241   -23.816 1.00 0.00 ? 3  ARG A HH12 4  
ATOM 4293  H HH21 . ARG A 1 3  ? -19.525 2.988   -22.072 1.00 0.00 ? 3  ARG A HH21 4  
ATOM 4294  H HH22 . ARG A 1 3  ? -18.680 3.008   -23.587 1.00 0.00 ? 3  ARG A HH22 4  
ATOM 4295  N N    . VAL A 1 4  ? -13.486 6.305   -16.848 1.00 0.00 ? 4  VAL A N    4  
ATOM 4296  C CA   . VAL A 1 4  ? -12.545 5.325   -16.332 1.00 0.00 ? 4  VAL A CA   4  
ATOM 4297  C C    . VAL A 1 4  ? -12.880 5.016   -14.880 1.00 0.00 ? 4  VAL A C    4  
ATOM 4298  O O    . VAL A 1 4  ? -13.963 5.361   -14.402 1.00 0.00 ? 4  VAL A O    4  
ATOM 4299  C CB   . VAL A 1 4  ? -11.086 5.828   -16.431 1.00 0.00 ? 4  VAL A CB   4  
ATOM 4300  C CG1  . VAL A 1 4  ? -10.657 5.963   -17.885 1.00 0.00 ? 4  VAL A CG1  4  
ATOM 4301  C CG2  . VAL A 1 4  ? -10.916 7.155   -15.699 1.00 0.00 ? 4  VAL A CG2  4  
ATOM 4302  H H    . VAL A 1 4  ? -13.587 7.154   -16.377 1.00 0.00 ? 4  VAL A H    4  
ATOM 4303  H HA   . VAL A 1 4  ? -12.641 4.418   -16.914 1.00 0.00 ? 4  VAL A HA   4  
ATOM 4304  H HB   . VAL A 1 4  ? -10.443 5.098   -15.959 1.00 0.00 ? 4  VAL A HB   4  
ATOM 4305  H HG11 . VAL A 1 4  ? -9.646  6.340   -17.929 1.00 0.00 ? 4  VAL A HG11 4  
ATOM 4306  H HG12 . VAL A 1 4  ? -11.319 6.647   -18.396 1.00 0.00 ? 4  VAL A HG12 4  
ATOM 4307  H HG13 . VAL A 1 4  ? -10.701 4.996   -18.363 1.00 0.00 ? 4  VAL A HG13 4  
ATOM 4308  H HG21 . VAL A 1 4  ? -11.544 7.905   -16.159 1.00 0.00 ? 4  VAL A HG21 4  
ATOM 4309  H HG22 . VAL A 1 4  ? -9.885  7.467   -15.753 1.00 0.00 ? 4  VAL A HG22 4  
ATOM 4310  H HG23 . VAL A 1 4  ? -11.202 7.033   -14.663 1.00 0.00 ? 4  VAL A HG23 4  
ATOM 4311  N N    . LYS A 1 5  ? -11.960 4.366   -14.186 1.00 0.00 ? 5  LYS A N    4  
ATOM 4312  C CA   . LYS A 1 5  ? -12.174 4.009   -12.794 1.00 0.00 ? 5  LYS A CA   4  
ATOM 4313  C C    . LYS A 1 5  ? -12.210 5.250   -11.914 1.00 0.00 ? 5  LYS A C    4  
ATOM 4314  O O    . LYS A 1 5  ? -11.352 6.129   -12.013 1.00 0.00 ? 5  LYS A O    4  
ATOM 4315  C CB   . LYS A 1 5  ? -11.103 3.027   -12.328 1.00 0.00 ? 5  LYS A CB   4  
ATOM 4316  C CG   . LYS A 1 5  ? -11.177 1.702   -13.066 1.00 0.00 ? 5  LYS A CG   4  
ATOM 4317  C CD   . LYS A 1 5  ? -12.550 1.069   -12.901 1.00 0.00 ? 5  LYS A CD   4  
ATOM 4318  C CE   . LYS A 1 5  ? -12.783 -0.053  -13.897 1.00 0.00 ? 5  LYS A CE   4  
ATOM 4319  N NZ   . LYS A 1 5  ? -14.101 -0.713  -13.684 1.00 0.00 ? 5  LYS A NZ   4  
ATOM 4320  H H    . LYS A 1 5  ? -11.117 4.125   -14.616 1.00 0.00 ? 5  LYS A H    4  
ATOM 4321  H HA   . LYS A 1 5  ? -13.136 3.521   -12.733 1.00 0.00 ? 5  LYS A HA   4  
ATOM 4322  H HB2  . LYS A 1 5  ? -10.128 3.462   -12.497 1.00 0.00 ? 5  LYS A HB2  4  
ATOM 4323  H HB3  . LYS A 1 5  ? -11.231 2.839   -11.271 1.00 0.00 ? 5  LYS A HB3  4  
ATOM 4324  H HG2  . LYS A 1 5  ? -10.991 1.873   -14.117 1.00 0.00 ? 5  LYS A HG2  4  
ATOM 4325  H HG3  . LYS A 1 5  ? -10.429 1.032   -12.668 1.00 0.00 ? 5  LYS A HG3  4  
ATOM 4326  H HD2  . LYS A 1 5  ? -12.632 0.670   -11.901 1.00 0.00 ? 5  LYS A HD2  4  
ATOM 4327  H HD3  . LYS A 1 5  ? -13.304 1.831   -13.048 1.00 0.00 ? 5  LYS A HD3  4  
ATOM 4328  H HE2  . LYS A 1 5  ? -12.755 0.358   -14.895 1.00 0.00 ? 5  LYS A HE2  4  
ATOM 4329  H HE3  . LYS A 1 5  ? -11.997 -0.782  -13.789 1.00 0.00 ? 5  LYS A HE3  4  
ATOM 4330  H HZ1  . LYS A 1 5  ? -14.176 -1.066  -12.705 1.00 0.00 ? 5  LYS A HZ1  4  
ATOM 4331  H HZ2  . LYS A 1 5  ? -14.215 -1.509  -14.339 1.00 0.00 ? 5  LYS A HZ2  4  
ATOM 4332  H HZ3  . LYS A 1 5  ? -14.873 -0.032  -13.851 1.00 0.00 ? 5  LYS A HZ3  4  
ATOM 4333  N N    . ARG A 1 6  ? -13.224 5.309   -11.070 1.00 0.00 ? 6  ARG A N    4  
ATOM 4334  C CA   . ARG A 1 6  ? -13.476 6.473   -10.240 1.00 0.00 ? 6  ARG A CA   4  
ATOM 4335  C C    . ARG A 1 6  ? -12.687 6.401   -8.944  1.00 0.00 ? 6  ARG A C    4  
ATOM 4336  O O    . ARG A 1 6  ? -12.295 5.315   -8.508  1.00 0.00 ? 6  ARG A O    4  
ATOM 4337  C CB   . ARG A 1 6  ? -14.966 6.550   -9.895  1.00 0.00 ? 6  ARG A CB   4  
ATOM 4338  C CG   . ARG A 1 6  ? -15.886 6.629   -11.098 1.00 0.00 ? 6  ARG A CG   4  
ATOM 4339  C CD   . ARG A 1 6  ? -15.725 7.944   -11.838 1.00 0.00 ? 6  ARG A CD   4  
ATOM 4340  N NE   . ARG A 1 6  ? -16.725 8.096   -12.889 1.00 0.00 ? 6  ARG A NE   4  
ATOM 4341  C CZ   . ARG A 1 6  ? -17.581 9.114   -12.954 1.00 0.00 ? 6  ARG A CZ   4  
ATOM 4342  N NH1  . ARG A 1 6  ? -17.557 10.065  -12.027 1.00 0.00 ? 6  ARG A NH1  4  
ATOM 4343  N NH2  . ARG A 1 6  ? -18.470 9.180   -13.937 1.00 0.00 ? 6  ARG A NH2  4  
ATOM 4344  H H    . ARG A 1 6  ? -13.821 4.537   -10.995 1.00 0.00 ? 6  ARG A H    4  
ATOM 4345  H HA   . ARG A 1 6  ? -13.189 7.357   -10.788 1.00 0.00 ? 6  ARG A HA   4  
ATOM 4346  H HB2  . ARG A 1 6  ? -15.234 5.674   -9.326  1.00 0.00 ? 6  ARG A HB2  4  
ATOM 4347  H HB3  . ARG A 1 6  ? -15.134 7.426   -9.284  1.00 0.00 ? 6  ARG A HB3  4  
ATOM 4348  H HG2  . ARG A 1 6  ? -15.653 5.818   -11.770 1.00 0.00 ? 6  ARG A HG2  4  
ATOM 4349  H HG3  . ARG A 1 6  ? -16.910 6.540   -10.761 1.00 0.00 ? 6  ARG A HG3  4  
ATOM 4350  H HD2  . ARG A 1 6  ? -15.829 8.755   -11.134 1.00 0.00 ? 6  ARG A HD2  4  
ATOM 4351  H HD3  . ARG A 1 6  ? -14.740 7.975   -12.283 1.00 0.00 ? 6  ARG A HD3  4  
ATOM 4352  H HE   . ARG A 1 6  ? -16.763 7.389   -13.582 1.00 0.00 ? 6  ARG A HE   4  
ATOM 4353  H HH11 . ARG A 1 6  ? -16.897 10.019  -11.278 1.00 0.00 ? 6  ARG A HH11 4  
ATOM 4354  H HH12 . ARG A 1 6  ? -18.214 10.833  -12.068 1.00 0.00 ? 6  ARG A HH12 4  
ATOM 4355  H HH21 . ARG A 1 6  ? -18.502 8.461   -14.634 1.00 0.00 ? 6  ARG A HH21 4  
ATOM 4356  H HH22 . ARG A 1 6  ? -19.115 9.946   -13.982 1.00 0.00 ? 6  ARG A HH22 4  
ATOM 4357  N N    . PRO A 1 7  ? -12.430 7.558   -8.315  1.00 0.00 ? 7  PRO A N    4  
ATOM 4358  C CA   . PRO A 1 7  ? -11.977 7.604   -6.932  1.00 0.00 ? 7  PRO A CA   4  
ATOM 4359  C C    . PRO A 1 7  ? -13.098 7.118   -6.015  1.00 0.00 ? 7  PRO A C    4  
ATOM 4360  O O    . PRO A 1 7  ? -13.955 7.895   -5.586  1.00 0.00 ? 7  PRO A O    4  
ATOM 4361  C CB   . PRO A 1 7  ? -11.667 9.088   -6.683  1.00 0.00 ? 7  PRO A CB   4  
ATOM 4362  C CG   . PRO A 1 7  ? -11.623 9.717   -8.037  1.00 0.00 ? 7  PRO A CG   4  
ATOM 4363  C CD   . PRO A 1 7  ? -12.543 8.900   -8.901  1.00 0.00 ? 7  PRO A CD   4  
ATOM 4364  H HA   . PRO A 1 7  ? -11.087 7.003   -6.777  1.00 0.00 ? 7  PRO A HA   4  
ATOM 4365  H HB2  . PRO A 1 7  ? -12.447 9.522   -6.075  1.00 0.00 ? 7  PRO A HB2  4  
ATOM 4366  H HB3  . PRO A 1 7  ? -10.717 9.179   -6.177  1.00 0.00 ? 7  PRO A HB3  4  
ATOM 4367  H HG2  . PRO A 1 7  ? -11.973 10.738  -7.980  1.00 0.00 ? 7  PRO A HG2  4  
ATOM 4368  H HG3  . PRO A 1 7  ? -10.615 9.685   -8.427  1.00 0.00 ? 7  PRO A HG3  4  
ATOM 4369  H HD2  . PRO A 1 7  ? -13.554 9.270   -8.829  1.00 0.00 ? 7  PRO A HD2  4  
ATOM 4370  H HD3  . PRO A 1 7  ? -12.205 8.906   -9.926  1.00 0.00 ? 7  PRO A HD3  4  
ATOM 4371  N N    . MET A 1 8  ? -13.110 5.814   -5.788  1.00 0.00 ? 8  MET A N    4  
ATOM 4372  C CA   . MET A 1 8  ? -14.171 5.146   -5.045  1.00 0.00 ? 8  MET A CA   4  
ATOM 4373  C C    . MET A 1 8  ? -14.127 5.532   -3.568  1.00 0.00 ? 8  MET A C    4  
ATOM 4374  O O    . MET A 1 8  ? -13.219 6.232   -3.129  1.00 0.00 ? 8  MET A O    4  
ATOM 4375  C CB   . MET A 1 8  ? -14.036 3.629   -5.215  1.00 0.00 ? 8  MET A CB   4  
ATOM 4376  C CG   . MET A 1 8  ? -15.301 2.859   -4.878  1.00 0.00 ? 8  MET A CG   4  
ATOM 4377  S SD   . MET A 1 8  ? -16.697 3.346   -5.910  1.00 0.00 ? 8  MET A SD   4  
ATOM 4378  C CE   . MET A 1 8  ? -17.983 2.274   -5.270  1.00 0.00 ? 8  MET A CE   4  
ATOM 4379  H H    . MET A 1 8  ? -12.373 5.274   -6.140  1.00 0.00 ? 8  MET A H    4  
ATOM 4380  H HA   . MET A 1 8  ? -15.115 5.462   -5.458  1.00 0.00 ? 8  MET A HA   4  
ATOM 4381  H HB2  . MET A 1 8  ? -13.776 3.416   -6.242  1.00 0.00 ? 8  MET A HB2  4  
ATOM 4382  H HB3  . MET A 1 8  ? -13.243 3.275   -4.572  1.00 0.00 ? 8  MET A HB3  4  
ATOM 4383  H HG2  . MET A 1 8  ? -15.114 1.806   -5.022  1.00 0.00 ? 8  MET A HG2  4  
ATOM 4384  H HG3  . MET A 1 8  ? -15.552 3.041   -3.844  1.00 0.00 ? 8  MET A HG3  4  
ATOM 4385  H HE1  . MET A 1 8  ? -17.686 1.242   -5.394  1.00 0.00 ? 8  MET A HE1  4  
ATOM 4386  H HE2  . MET A 1 8  ? -18.904 2.450   -5.808  1.00 0.00 ? 8  MET A HE2  4  
ATOM 4387  H HE3  . MET A 1 8  ? -18.135 2.480   -4.221  1.00 0.00 ? 8  MET A HE3  4  
ATOM 4388  N N    . ASN A 1 9  ? -15.148 5.135   -2.822  1.00 0.00 ? 9  ASN A N    4  
ATOM 4389  C CA   . ASN A 1 9  ? -15.162 5.343   -1.384  1.00 0.00 ? 9  ASN A CA   4  
ATOM 4390  C C    . ASN A 1 9  ? -13.972 4.644   -0.726  1.00 0.00 ? 9  ASN A C    4  
ATOM 4391  O O    . ASN A 1 9  ? -13.497 3.606   -1.202  1.00 0.00 ? 9  ASN A O    4  
ATOM 4392  C CB   . ASN A 1 9  ? -16.483 4.858   -0.776  1.00 0.00 ? 9  ASN A CB   4  
ATOM 4393  C CG   . ASN A 1 9  ? -16.739 3.381   -0.996  1.00 0.00 ? 9  ASN A CG   4  
ATOM 4394  O OD1  . ASN A 1 9  ? -17.273 2.978   -2.027  1.00 0.00 ? 9  ASN A OD1  4  
ATOM 4395  N ND2  . ASN A 1 9  ? -16.395 2.575   -0.015  1.00 0.00 ? 9  ASN A ND2  4  
ATOM 4396  H H    . ASN A 1 9  ? -15.909 4.695   -3.247  1.00 0.00 ? 9  ASN A H    4  
ATOM 4397  H HA   . ASN A 1 9  ? -15.071 6.405   -1.209  1.00 0.00 ? 9  ASN A HA   4  
ATOM 4398  H HB2  . ASN A 1 9  ? -16.467 5.041   0.287   1.00 0.00 ? 9  ASN A HB2  4  
ATOM 4399  H HB3  . ASN A 1 9  ? -17.296 5.412   -1.214  1.00 0.00 ? 9  ASN A HB3  4  
ATOM 4400  H HD21 . ASN A 1 9  ? -15.998 2.975   0.793   1.00 0.00 ? 9  ASN A HD21 4  
ATOM 4401  H HD22 . ASN A 1 9  ? -16.562 1.616   -0.122  1.00 0.00 ? 9  ASN A HD22 4  
ATOM 4402  N N    . ALA A 1 10 ? -13.528 5.224   0.382   1.00 0.00 ? 10 ALA A N    4  
ATOM 4403  C CA   . ALA A 1 10 ? -12.302 4.840   1.075   1.00 0.00 ? 10 ALA A CA   4  
ATOM 4404  C C    . ALA A 1 10 ? -12.094 3.327   1.259   1.00 0.00 ? 10 ALA A C    4  
ATOM 4405  O O    . ALA A 1 10 ? -10.978 2.854   1.081   1.00 0.00 ? 10 ALA A O    4  
ATOM 4406  C CB   . ALA A 1 10 ? -12.280 5.523   2.431   1.00 0.00 ? 10 ALA A CB   4  
ATOM 4407  H H    . ALA A 1 10 ? -14.019 5.997   0.722   1.00 0.00 ? 10 ALA A H    4  
ATOM 4408  H HA   . ALA A 1 10 ? -11.473 5.231   0.507   1.00 0.00 ? 10 ALA A HA   4  
ATOM 4409  H HB1  . ALA A 1 10 ? -12.438 6.584   2.304   1.00 0.00 ? 10 ALA A HB1  4  
ATOM 4410  H HB2  . ALA A 1 10 ? -11.322 5.357   2.902   1.00 0.00 ? 10 ALA A HB2  4  
ATOM 4411  H HB3  . ALA A 1 10 ? -13.061 5.113   3.053   1.00 0.00 ? 10 ALA A HB3  4  
ATOM 4412  N N    . PHE A 1 11 ? -13.130 2.566   1.614   1.00 0.00 ? 11 PHE A N    4  
ATOM 4413  C CA   . PHE A 1 11 ? -12.943 1.136   1.908   1.00 0.00 ? 11 PHE A CA   4  
ATOM 4414  C C    . PHE A 1 11 ? -12.401 0.369   0.699   1.00 0.00 ? 11 PHE A C    4  
ATOM 4415  O O    . PHE A 1 11 ? -11.399 -0.352  0.800   1.00 0.00 ? 11 PHE A O    4  
ATOM 4416  C CB   . PHE A 1 11 ? -14.251 0.491   2.380   1.00 0.00 ? 11 PHE A CB   4  
ATOM 4417  C CG   . PHE A 1 11 ? -14.082 -0.943  2.810   1.00 0.00 ? 11 PHE A CG   4  
ATOM 4418  C CD1  . PHE A 1 11 ? -13.244 -1.263  3.862   1.00 0.00 ? 11 PHE A CD1  4  
ATOM 4419  C CD2  . PHE A 1 11 ? -14.753 -1.967  2.159   1.00 0.00 ? 11 PHE A CD2  4  
ATOM 4420  C CE1  . PHE A 1 11 ? -13.074 -2.573  4.262   1.00 0.00 ? 11 PHE A CE1  4  
ATOM 4421  C CE2  . PHE A 1 11 ? -14.589 -3.283  2.554   1.00 0.00 ? 11 PHE A CE2  4  
ATOM 4422  C CZ   . PHE A 1 11 ? -13.747 -3.585  3.610   1.00 0.00 ? 11 PHE A CZ   4  
ATOM 4423  H H    . PHE A 1 11 ? -14.024 2.969   1.695   1.00 0.00 ? 11 PHE A H    4  
ATOM 4424  H HA   . PHE A 1 11 ? -12.219 1.066   2.706   1.00 0.00 ? 11 PHE A HA   4  
ATOM 4425  H HB2  . PHE A 1 11 ? -14.638 1.047   3.221   1.00 0.00 ? 11 PHE A HB2  4  
ATOM 4426  H HB3  . PHE A 1 11 ? -14.969 0.515   1.576   1.00 0.00 ? 11 PHE A HB3  4  
ATOM 4427  H HD1  . PHE A 1 11 ? -12.718 -0.472  4.376   1.00 0.00 ? 11 PHE A HD1  4  
ATOM 4428  H HD2  . PHE A 1 11 ? -15.410 -1.729  1.336   1.00 0.00 ? 11 PHE A HD2  4  
ATOM 4429  H HE1  . PHE A 1 11 ? -12.414 -2.806  5.086   1.00 0.00 ? 11 PHE A HE1  4  
ATOM 4430  H HE2  . PHE A 1 11 ? -15.119 -4.071  2.041   1.00 0.00 ? 11 PHE A HE2  4  
ATOM 4431  H HZ   . PHE A 1 11 ? -13.611 -4.612  3.923   1.00 0.00 ? 11 PHE A HZ   4  
ATOM 4432  N N    . MET A 1 12 ? -13.045 0.543   -0.448  1.00 0.00 ? 12 MET A N    4  
ATOM 4433  C CA   . MET A 1 12 ? -12.610 -0.134  -1.661  1.00 0.00 ? 12 MET A CA   4  
ATOM 4434  C C    . MET A 1 12 ? -11.259 0.411   -2.086  1.00 0.00 ? 12 MET A C    4  
ATOM 4435  O O    . MET A 1 12 ? -10.382 -0.329  -2.536  1.00 0.00 ? 12 MET A O    4  
ATOM 4436  C CB   . MET A 1 12 ? -13.638 0.040   -2.781  1.00 0.00 ? 12 MET A CB   4  
ATOM 4437  C CG   . MET A 1 12 ? -14.971 -0.629  -2.486  1.00 0.00 ? 12 MET A CG   4  
ATOM 4438  S SD   . MET A 1 12 ? -16.160 -0.448  -3.830  1.00 0.00 ? 12 MET A SD   4  
ATOM 4439  C CE   . MET A 1 12 ? -15.306 -1.280  -5.168  1.00 0.00 ? 12 MET A CE   4  
ATOM 4440  H H    . MET A 1 12 ? -13.814 1.147   -0.479  1.00 0.00 ? 12 MET A H    4  
ATOM 4441  H HA   . MET A 1 12 ? -12.508 -1.185  -1.433  1.00 0.00 ? 12 MET A HA   4  
ATOM 4442  H HB2  . MET A 1 12 ? -13.813 1.095   -2.930  1.00 0.00 ? 12 MET A HB2  4  
ATOM 4443  H HB3  . MET A 1 12 ? -13.239 -0.382  -3.692  1.00 0.00 ? 12 MET A HB3  4  
ATOM 4444  H HG2  . MET A 1 12 ? -14.800 -1.682  -2.317  1.00 0.00 ? 12 MET A HG2  4  
ATOM 4445  H HG3  . MET A 1 12 ? -15.389 -0.186  -1.594  1.00 0.00 ? 12 MET A HG3  4  
ATOM 4446  H HE1  . MET A 1 12 ? -14.375 -0.772  -5.372  1.00 0.00 ? 12 MET A HE1  4  
ATOM 4447  H HE2  . MET A 1 12 ? -15.925 -1.266  -6.052  1.00 0.00 ? 12 MET A HE2  4  
ATOM 4448  H HE3  . MET A 1 12 ? -15.103 -2.302  -4.885  1.00 0.00 ? 12 MET A HE3  4  
ATOM 4449  N N    . VAL A 1 13 ? -11.094 1.714   -1.900  1.00 0.00 ? 13 VAL A N    4  
ATOM 4450  C CA   . VAL A 1 13 ? -9.841  2.384   -2.177  1.00 0.00 ? 13 VAL A CA   4  
ATOM 4451  C C    . VAL A 1 13 ? -8.718  1.751   -1.407  1.00 0.00 ? 13 VAL A C    4  
ATOM 4452  O O    . VAL A 1 13 ? -7.705  1.402   -1.973  1.00 0.00 ? 13 VAL A O    4  
ATOM 4453  C CB   . VAL A 1 13 ? -9.882  3.868   -1.793  1.00 0.00 ? 13 VAL A CB   4  
ATOM 4454  C CG1  . VAL A 1 13 ? -8.509  4.486   -1.968  1.00 0.00 ? 13 VAL A CG1  4  
ATOM 4455  C CG2  . VAL A 1 13 ? -10.896 4.600   -2.636  1.00 0.00 ? 13 VAL A CG2  4  
ATOM 4456  H H    . VAL A 1 13 ? -11.841 2.236   -1.558  1.00 0.00 ? 13 VAL A H    4  
ATOM 4457  H HA   . VAL A 1 13 ? -9.639  2.309   -3.234  1.00 0.00 ? 13 VAL A HA   4  
ATOM 4458  H HB   . VAL A 1 13 ? -10.168 3.950   -0.743  1.00 0.00 ? 13 VAL A HB   4  
ATOM 4459  H HG11 . VAL A 1 13 ? -7.794  3.951   -1.362  1.00 0.00 ? 13 VAL A HG11 4  
ATOM 4460  H HG12 . VAL A 1 13 ? -8.538  5.521   -1.659  1.00 0.00 ? 13 VAL A HG12 4  
ATOM 4461  H HG13 . VAL A 1 13 ? -8.218  4.429   -3.007  1.00 0.00 ? 13 VAL A HG13 4  
ATOM 4462  H HG21 . VAL A 1 13 ? -10.944 5.633   -2.324  1.00 0.00 ? 13 VAL A HG21 4  
ATOM 4463  H HG22 . VAL A 1 13 ? -11.865 4.143   -2.509  1.00 0.00 ? 13 VAL A HG22 4  
ATOM 4464  H HG23 . VAL A 1 13 ? -10.606 4.549   -3.675  1.00 0.00 ? 13 VAL A HG23 4  
ATOM 4465  N N    . TRP A 1 14 ? -8.906  1.602   -0.114  1.00 0.00 ? 14 TRP A N    4  
ATOM 4466  C CA   . TRP A 1 14 ? -7.858  1.089   0.734   1.00 0.00 ? 14 TRP A CA   4  
ATOM 4467  C C    . TRP A 1 14 ? -7.476  -0.320  0.309   1.00 0.00 ? 14 TRP A C    4  
ATOM 4468  O O    . TRP A 1 14 ? -6.345  -0.740  0.493   1.00 0.00 ? 14 TRP A O    4  
ATOM 4469  C CB   . TRP A 1 14 ? -8.274  1.120   2.197   1.00 0.00 ? 14 TRP A CB   4  
ATOM 4470  C CG   . TRP A 1 14 ? -7.107  1.285   3.114   1.00 0.00 ? 14 TRP A CG   4  
ATOM 4471  C CD1  . TRP A 1 14 ? -6.051  2.133   2.945   1.00 0.00 ? 14 TRP A CD1  4  
ATOM 4472  C CD2  . TRP A 1 14 ? -6.882  0.608   4.350   1.00 0.00 ? 14 TRP A CD2  4  
ATOM 4473  N NE1  . TRP A 1 14 ? -5.172  2.003   3.987   1.00 0.00 ? 14 TRP A NE1  4  
ATOM 4474  C CE2  . TRP A 1 14 ? -5.659  1.072   4.861   1.00 0.00 ? 14 TRP A CE2  4  
ATOM 4475  C CE3  . TRP A 1 14 ? -7.591  -0.352  5.066   1.00 0.00 ? 14 TRP A CE3  4  
ATOM 4476  C CZ2  . TRP A 1 14 ? -5.131  0.608   6.058   1.00 0.00 ? 14 TRP A CZ2  4  
ATOM 4477  C CZ3  . TRP A 1 14 ? -7.066  -0.812  6.253   1.00 0.00 ? 14 TRP A CZ3  4  
ATOM 4478  C CH2  . TRP A 1 14 ? -5.846  -0.331  6.737   1.00 0.00 ? 14 TRP A CH2  4  
ATOM 4479  H H    . TRP A 1 14 ? -9.771  1.851   0.283   1.00 0.00 ? 14 TRP A H    4  
ATOM 4480  H HA   . TRP A 1 14 ? -6.997  1.729   0.605   1.00 0.00 ? 14 TRP A HA   4  
ATOM 4481  H HB2  . TRP A 1 14 ? -8.951  1.946   2.360   1.00 0.00 ? 14 TRP A HB2  4  
ATOM 4482  H HB3  . TRP A 1 14 ? -8.770  0.193   2.447   1.00 0.00 ? 14 TRP A HB3  4  
ATOM 4483  H HD1  . TRP A 1 14 ? -5.932  2.796   2.100   1.00 0.00 ? 14 TRP A HD1  4  
ATOM 4484  H HE1  . TRP A 1 14 ? -4.329  2.498   4.088   1.00 0.00 ? 14 TRP A HE1  4  
ATOM 4485  H HE3  . TRP A 1 14 ? -8.535  -0.734  4.709   1.00 0.00 ? 14 TRP A HE3  4  
ATOM 4486  H HZ2  . TRP A 1 14 ? -4.189  0.967   6.444   1.00 0.00 ? 14 TRP A HZ2  4  
ATOM 4487  H HZ3  . TRP A 1 14 ? -7.602  -1.554  6.825   1.00 0.00 ? 14 TRP A HZ3  4  
ATOM 4488  H HH2  . TRP A 1 14 ? -5.473  -0.727  7.662   1.00 0.00 ? 14 TRP A HH2  4  
ATOM 4489  N N    . SER A 1 15 ? -8.411  -1.048  -0.280  1.00 0.00 ? 15 SER A N    4  
ATOM 4490  C CA   . SER A 1 15 ? -8.077  -2.361  -0.791  1.00 0.00 ? 15 SER A CA   4  
ATOM 4491  C C    . SER A 1 15 ? -7.032  -2.246  -1.906  1.00 0.00 ? 15 SER A C    4  
ATOM 4492  O O    . SER A 1 15 ? -5.916  -2.765  -1.787  1.00 0.00 ? 15 SER A O    4  
ATOM 4493  C CB   . SER A 1 15 ? -9.337  -3.071  -1.287  1.00 0.00 ? 15 SER A CB   4  
ATOM 4494  O OG   . SER A 1 15 ? -10.284 -3.216  -0.235  1.00 0.00 ? 15 SER A OG   4  
ATOM 4495  H H    . SER A 1 15 ? -9.327  -0.694  -0.379  1.00 0.00 ? 15 SER A H    4  
ATOM 4496  H HA   . SER A 1 15 ? -7.650  -2.930  0.021   1.00 0.00 ? 15 SER A HA   4  
ATOM 4497  H HB2  . SER A 1 15 ? -9.785  -2.498  -2.085  1.00 0.00 ? 15 SER A HB2  4  
ATOM 4498  H HB3  . SER A 1 15 ? -9.072  -4.053  -1.654  1.00 0.00 ? 15 SER A HB3  4  
ATOM 4499  H HG   . SER A 1 15 ? -10.335 -2.394  0.269   1.00 0.00 ? 15 SER A HG   4  
ATOM 4500  N N    . ARG A 1 16 ? -7.362  -1.502  -2.958  1.00 0.00 ? 16 ARG A N    4  
ATOM 4501  C CA   . ARG A 1 16 ? -6.481  -1.415  -4.123  1.00 0.00 ? 16 ARG A CA   4  
ATOM 4502  C C    . ARG A 1 16 ? -5.307  -0.461  -3.889  1.00 0.00 ? 16 ARG A C    4  
ATOM 4503  O O    . ARG A 1 16 ? -4.171  -0.764  -4.245  1.00 0.00 ? 16 ARG A O    4  
ATOM 4504  C CB   . ARG A 1 16 ? -7.267  -0.984  -5.364  1.00 0.00 ? 16 ARG A CB   4  
ATOM 4505  C CG   . ARG A 1 16 ? -8.294  -2.008  -5.821  1.00 0.00 ? 16 ARG A CG   4  
ATOM 4506  C CD   . ARG A 1 16 ? -8.892  -1.627  -7.166  1.00 0.00 ? 16 ARG A CD   4  
ATOM 4507  N NE   . ARG A 1 16 ? -9.842  -2.626  -7.657  1.00 0.00 ? 16 ARG A NE   4  
ATOM 4508  C CZ   . ARG A 1 16 ? -9.860  -3.080  -8.913  1.00 0.00 ? 16 ARG A CZ   4  
ATOM 4509  N NH1  . ARG A 1 16 ? -8.923  -2.701  -9.775  1.00 0.00 ? 16 ARG A NH1  4  
ATOM 4510  N NH2  . ARG A 1 16 ? -10.796 -3.934  -9.299  1.00 0.00 ? 16 ARG A NH2  4  
ATOM 4511  H H    . ARG A 1 16 ? -8.206  -0.982  -2.940  1.00 0.00 ? 16 ARG A H    4  
ATOM 4512  H HA   . ARG A 1 16 ? -6.082  -2.403  -4.298  1.00 0.00 ? 16 ARG A HA   4  
ATOM 4513  H HB2  . ARG A 1 16 ? -7.783  -0.063  -5.146  1.00 0.00 ? 16 ARG A HB2  4  
ATOM 4514  H HB3  . ARG A 1 16 ? -6.576  -0.816  -6.174  1.00 0.00 ? 16 ARG A HB3  4  
ATOM 4515  H HG2  . ARG A 1 16 ? -7.812  -2.971  -5.910  1.00 0.00 ? 16 ARG A HG2  4  
ATOM 4516  H HG3  . ARG A 1 16 ? -9.082  -2.065  -5.087  1.00 0.00 ? 16 ARG A HG3  4  
ATOM 4517  H HD2  . ARG A 1 16 ? -9.403  -0.681  -7.062  1.00 0.00 ? 16 ARG A HD2  4  
ATOM 4518  H HD3  . ARG A 1 16 ? -8.091  -1.524  -7.882  1.00 0.00 ? 16 ARG A HD3  4  
ATOM 4519  H HE   . ARG A 1 16 ? -10.525 -2.955  -7.023  1.00 0.00 ? 16 ARG A HE   4  
ATOM 4520  H HH11 . ARG A 1 16 ? -8.190  -2.077  -9.490  1.00 0.00 ? 16 ARG A HH11 4  
ATOM 4521  H HH12 . ARG A 1 16 ? -8.947  -3.039  -10.726 1.00 0.00 ? 16 ARG A HH12 4  
ATOM 4522  H HH21 . ARG A 1 16 ? -11.494 -4.247  -8.650  1.00 0.00 ? 16 ARG A HH21 4  
ATOM 4523  H HH22 . ARG A 1 16 ? -10.817 -4.263  -10.246 1.00 0.00 ? 16 ARG A HH22 4  
ATOM 4524  N N    . GLY A 1 17 ? -5.598  0.678   -3.286  1.00 0.00 ? 17 GLY A N    4  
ATOM 4525  C CA   . GLY A 1 17 ? -4.613  1.724   -3.088  1.00 0.00 ? 17 GLY A CA   4  
ATOM 4526  C C    . GLY A 1 17 ? -3.601  1.404   -2.007  1.00 0.00 ? 17 GLY A C    4  
ATOM 4527  O O    . GLY A 1 17 ? -2.406  1.641   -2.193  1.00 0.00 ? 17 GLY A O    4  
ATOM 4528  H H    . GLY A 1 17 ? -6.510  0.815   -2.960  1.00 0.00 ? 17 GLY A H    4  
ATOM 4529  H HA2  . GLY A 1 17 ? -4.087  1.884   -4.017  1.00 0.00 ? 17 GLY A HA2  4  
ATOM 4530  H HA3  . GLY A 1 17 ? -5.127  2.636   -2.821  1.00 0.00 ? 17 GLY A HA3  4  
ATOM 4531  N N    . GLN A 1 18 ? -4.060  0.867   -0.877  1.00 0.00 ? 18 GLN A N    4  
ATOM 4532  C CA   . GLN A 1 18 ? -3.140  0.470   0.179   1.00 0.00 ? 18 GLN A CA   4  
ATOM 4533  C C    . GLN A 1 18 ? -2.287  -0.676  -0.327  1.00 0.00 ? 18 GLN A C    4  
ATOM 4534  O O    . GLN A 1 18 ? -1.099  -0.737  -0.040  1.00 0.00 ? 18 GLN A O    4  
ATOM 4535  C CB   . GLN A 1 18 ? -3.880  0.074   1.464   1.00 0.00 ? 18 GLN A CB   4  
ATOM 4536  C CG   . GLN A 1 18 ? -2.978  -0.268  2.645   1.00 0.00 ? 18 GLN A CG   4  
ATOM 4537  C CD   . GLN A 1 18 ? -2.052  0.869   3.031   1.00 0.00 ? 18 GLN A CD   4  
ATOM 4538  O OE1  . GLN A 1 18 ? -2.394  2.042   2.886   1.00 0.00 ? 18 GLN A OE1  4  
ATOM 4539  N NE2  . GLN A 1 18 ? -0.871  0.528   3.521   1.00 0.00 ? 18 GLN A NE2  4  
ATOM 4540  H H    . GLN A 1 18 ? -5.025  0.732   -0.755  1.00 0.00 ? 18 GLN A H    4  
ATOM 4541  H HA   . GLN A 1 18 ? -2.495  1.316   0.386   1.00 0.00 ? 18 GLN A HA   4  
ATOM 4542  H HB2  . GLN A 1 18 ? -4.519  0.892   1.760   1.00 0.00 ? 18 GLN A HB2  4  
ATOM 4543  H HB3  . GLN A 1 18 ? -4.496  -0.788  1.253   1.00 0.00 ? 18 GLN A HB3  4  
ATOM 4544  H HG2  . GLN A 1 18 ? -3.605  -0.498  3.495   1.00 0.00 ? 18 GLN A HG2  4  
ATOM 4545  H HG3  . GLN A 1 18 ? -2.385  -1.133  2.400   1.00 0.00 ? 18 GLN A HG3  4  
ATOM 4546  H HE21 . GLN A 1 18 ? -0.664  -0.425  3.609   1.00 0.00 ? 18 GLN A HE21 4  
ATOM 4547  H HE22 . GLN A 1 18 ? -0.247  1.245   3.783   1.00 0.00 ? 18 GLN A HE22 4  
ATOM 4548  N N    . ARG A 1 19 ? -2.888  -1.572  -1.113  1.00 0.00 ? 19 ARG A N    4  
ATOM 4549  C CA   . ARG A 1 19 ? -2.115  -2.622  -1.751  1.00 0.00 ? 19 ARG A CA   4  
ATOM 4550  C C    . ARG A 1 19 ? -1.102  -2.011  -2.722  1.00 0.00 ? 19 ARG A C    4  
ATOM 4551  O O    . ARG A 1 19 ? 0.018   -2.492  -2.835  1.00 0.00 ? 19 ARG A O    4  
ATOM 4552  C CB   . ARG A 1 19 ? -3.020  -3.616  -2.482  1.00 0.00 ? 19 ARG A CB   4  
ATOM 4553  C CG   . ARG A 1 19 ? -2.274  -4.842  -2.988  1.00 0.00 ? 19 ARG A CG   4  
ATOM 4554  C CD   . ARG A 1 19 ? -3.224  -5.926  -3.474  1.00 0.00 ? 19 ARG A CD   4  
ATOM 4555  N NE   . ARG A 1 19 ? -3.917  -5.560  -4.711  1.00 0.00 ? 19 ARG A NE   4  
ATOM 4556  C CZ   . ARG A 1 19 ? -4.763  -6.370  -5.354  1.00 0.00 ? 19 ARG A CZ   4  
ATOM 4557  N NH1  . ARG A 1 19 ? -5.037  -7.573  -4.865  1.00 0.00 ? 19 ARG A NH1  4  
ATOM 4558  N NH2  . ARG A 1 19 ? -5.333  -5.982  -6.490  1.00 0.00 ? 19 ARG A NH2  4  
ATOM 4559  H H    . ARG A 1 19 ? -3.865  -1.533  -1.251  1.00 0.00 ? 19 ARG A H    4  
ATOM 4560  H HA   . ARG A 1 19 ? -1.575  -3.150  -0.974  1.00 0.00 ? 19 ARG A HA   4  
ATOM 4561  H HB2  . ARG A 1 19 ? -3.798  -3.945  -1.808  1.00 0.00 ? 19 ARG A HB2  4  
ATOM 4562  H HB3  . ARG A 1 19 ? -3.472  -3.121  -3.329  1.00 0.00 ? 19 ARG A HB3  4  
ATOM 4563  H HG2  . ARG A 1 19 ? -1.635  -4.546  -3.806  1.00 0.00 ? 19 ARG A HG2  4  
ATOM 4564  H HG3  . ARG A 1 19 ? -1.669  -5.238  -2.183  1.00 0.00 ? 19 ARG A HG3  4  
ATOM 4565  H HD2  . ARG A 1 19 ? -2.658  -6.830  -3.645  1.00 0.00 ? 19 ARG A HD2  4  
ATOM 4566  H HD3  . ARG A 1 19 ? -3.958  -6.108  -2.704  1.00 0.00 ? 19 ARG A HD3  4  
ATOM 4567  H HE   . ARG A 1 19 ? -3.736  -4.671  -5.082  1.00 0.00 ? 19 ARG A HE   4  
ATOM 4568  H HH11 . ARG A 1 19 ? -4.612  -7.880  -4.013  1.00 0.00 ? 19 ARG A HH11 4  
ATOM 4569  H HH12 . ARG A 1 19 ? -5.678  -8.181  -5.349  1.00 0.00 ? 19 ARG A HH12 4  
ATOM 4570  H HH21 . ARG A 1 19 ? -5.136  -5.076  -6.877  1.00 0.00 ? 19 ARG A HH21 4  
ATOM 4571  H HH22 . ARG A 1 19 ? -5.962  -6.602  -6.972  1.00 0.00 ? 19 ARG A HH22 4  
ATOM 4572  N N    . ARG A 1 20 ? -1.496  -0.935  -3.407  1.00 0.00 ? 20 ARG A N    4  
ATOM 4573  C CA   . ARG A 1 20 ? -0.600  -0.258  -4.345  1.00 0.00 ? 20 ARG A CA   4  
ATOM 4574  C C    . ARG A 1 20 ? 0.609   0.345   -3.629  1.00 0.00 ? 20 ARG A C    4  
ATOM 4575  O O    . ARG A 1 20 ? 1.745   -0.025  -3.921  1.00 0.00 ? 20 ARG A O    4  
ATOM 4576  C CB   . ARG A 1 20 ? -1.340  0.841   -5.118  1.00 0.00 ? 20 ARG A CB   4  
ATOM 4577  C CG   . ARG A 1 20 ? -1.805  0.441   -6.516  1.00 0.00 ? 20 ARG A CG   4  
ATOM 4578  C CD   . ARG A 1 20 ? -0.629  0.166   -7.445  1.00 0.00 ? 20 ARG A CD   4  
ATOM 4579  N NE   . ARG A 1 20 ? -0.984  0.326   -8.860  1.00 0.00 ? 20 ARG A NE   4  
ATOM 4580  C CZ   . ARG A 1 20 ? -0.269  -0.170  -9.876  1.00 0.00 ? 20 ARG A CZ   4  
ATOM 4581  N NH1  . ARG A 1 20 ? 0.765   -0.970  -9.640  1.00 0.00 ? 20 ARG A NH1  4  
ATOM 4582  N NH2  . ARG A 1 20 ? -0.606  0.111   -11.131 1.00 0.00 ? 20 ARG A NH2  4  
ATOM 4583  H H    . ARG A 1 20 ? -2.408  -0.595  -3.281  1.00 0.00 ? 20 ARG A H    4  
ATOM 4584  H HA   . ARG A 1 20 ? -0.247  -0.996  -5.049  1.00 0.00 ? 20 ARG A HA   4  
ATOM 4585  H HB2  . ARG A 1 20 ? -2.208  1.139   -4.548  1.00 0.00 ? 20 ARG A HB2  4  
ATOM 4586  H HB3  . ARG A 1 20 ? -0.681  1.694   -5.215  1.00 0.00 ? 20 ARG A HB3  4  
ATOM 4587  H HG2  . ARG A 1 20 ? -2.407  -0.452  -6.443  1.00 0.00 ? 20 ARG A HG2  4  
ATOM 4588  H HG3  . ARG A 1 20 ? -2.398  1.244   -6.930  1.00 0.00 ? 20 ARG A HG3  4  
ATOM 4589  H HD2  . ARG A 1 20 ? 0.166   0.854   -7.208  1.00 0.00 ? 20 ARG A HD2  4  
ATOM 4590  H HD3  . ARG A 1 20 ? -0.288  -0.847  -7.283  1.00 0.00 ? 20 ARG A HD3  4  
ATOM 4591  H HE   . ARG A 1 20 ? -1.774  0.871   -9.065  1.00 0.00 ? 20 ARG A HE   4  
ATOM 4592  H HH11 . ARG A 1 20 ? 1.020   -1.211  -8.701  1.00 0.00 ? 20 ARG A HH11 4  
ATOM 4593  H HH12 . ARG A 1 20 ? 1.303   -1.344  -10.410 1.00 0.00 ? 20 ARG A HH12 4  
ATOM 4594  H HH21 . ARG A 1 20 ? -1.406  0.700   -11.332 1.00 0.00 ? 20 ARG A HH21 4  
ATOM 4595  H HH22 . ARG A 1 20 ? -0.058  -0.250  -11.895 1.00 0.00 ? 20 ARG A HH22 4  
ATOM 4596  N N    . LYS A 1 21 ? 0.378   1.262   -2.687  1.00 0.00 ? 21 LYS A N    4  
ATOM 4597  C CA   . LYS A 1 21 ? 1.491   1.871   -1.955  1.00 0.00 ? 21 LYS A CA   4  
ATOM 4598  C C    . LYS A 1 21 ? 2.321   0.827   -1.185  1.00 0.00 ? 21 LYS A C    4  
ATOM 4599  O O    . LYS A 1 21 ? 3.549   0.881   -1.190  1.00 0.00 ? 21 LYS A O    4  
ATOM 4600  C CB   . LYS A 1 21 ? 0.976   2.955   -1.006  1.00 0.00 ? 21 LYS A CB   4  
ATOM 4601  C CG   . LYS A 1 21 ? 0.146   2.430   0.155   1.00 0.00 ? 21 LYS A CG   4  
ATOM 4602  C CD   . LYS A 1 21 ? -0.481  3.563   0.947   1.00 0.00 ? 21 LYS A CD   4  
ATOM 4603  C CE   . LYS A 1 21 ? 0.539   4.622   1.333   1.00 0.00 ? 21 LYS A CE   4  
ATOM 4604  N NZ   . LYS A 1 21 ? -0.085  5.739   2.087   1.00 0.00 ? 21 LYS A NZ   4  
ATOM 4605  H H    . LYS A 1 21 ? -0.555  1.581   -2.514  1.00 0.00 ? 21 LYS A H    4  
ATOM 4606  H HA   . LYS A 1 21 ? 2.136   2.336   -2.685  1.00 0.00 ? 21 LYS A HA   4  
ATOM 4607  H HB2  . LYS A 1 21 ? 1.821   3.490   -0.598  1.00 0.00 ? 21 LYS A HB2  4  
ATOM 4608  H HB3  . LYS A 1 21 ? 0.367   3.646   -1.569  1.00 0.00 ? 21 LYS A HB3  4  
ATOM 4609  H HG2  . LYS A 1 21 ? -0.640  1.801   -0.234  1.00 0.00 ? 21 LYS A HG2  4  
ATOM 4610  H HG3  . LYS A 1 21 ? 0.782   1.852   0.810   1.00 0.00 ? 21 LYS A HG3  4  
ATOM 4611  H HD2  . LYS A 1 21 ? -1.248  4.025   0.345   1.00 0.00 ? 21 LYS A HD2  4  
ATOM 4612  H HD3  . LYS A 1 21 ? -0.924  3.159   1.846   1.00 0.00 ? 21 LYS A HD3  4  
ATOM 4613  H HE2  . LYS A 1 21 ? 1.299   4.164   1.948   1.00 0.00 ? 21 LYS A HE2  4  
ATOM 4614  H HE3  . LYS A 1 21 ? 0.992   5.013   0.434   1.00 0.00 ? 21 LYS A HE3  4  
ATOM 4615  H HZ1  . LYS A 1 21 ? -0.334  5.429   3.045   1.00 0.00 ? 21 LYS A HZ1  4  
ATOM 4616  H HZ2  . LYS A 1 21 ? -0.955  6.058   1.600   1.00 0.00 ? 21 LYS A HZ2  4  
ATOM 4617  H HZ3  . LYS A 1 21 ? 0.576   6.544   2.152   1.00 0.00 ? 21 LYS A HZ3  4  
ATOM 4618  N N    . MET A 1 22 ? 1.649   -0.133  -0.557  1.00 0.00 ? 22 MET A N    4  
ATOM 4619  C CA   . MET A 1 22 ? 2.315   -1.134  0.275   1.00 0.00 ? 22 MET A CA   4  
ATOM 4620  C C    . MET A 1 22 ? 3.149   -2.105  -0.558  1.00 0.00 ? 22 MET A C    4  
ATOM 4621  O O    . MET A 1 22 ? 4.253   -2.463  -0.161  1.00 0.00 ? 22 MET A O    4  
ATOM 4622  C CB   . MET A 1 22 ? 1.274   -1.893  1.100   1.00 0.00 ? 22 MET A CB   4  
ATOM 4623  C CG   . MET A 1 22 ? 1.849   -2.929  2.050   1.00 0.00 ? 22 MET A CG   4  
ATOM 4624  S SD   . MET A 1 22 ? 0.619   -3.538  3.220   1.00 0.00 ? 22 MET A SD   4  
ATOM 4625  C CE   . MET A 1 22 ? -0.671  -4.086  2.104   1.00 0.00 ? 22 MET A CE   4  
ATOM 4626  H H    . MET A 1 22 ? 0.675   -0.165  -0.646  1.00 0.00 ? 22 MET A H    4  
ATOM 4627  H HA   . MET A 1 22 ? 2.979   -0.615  0.957   1.00 0.00 ? 22 MET A HA   4  
ATOM 4628  H HB2  . MET A 1 22 ? 0.710   -1.180  1.684   1.00 0.00 ? 22 MET A HB2  4  
ATOM 4629  H HB3  . MET A 1 22 ? 0.599   -2.396  0.423   1.00 0.00 ? 22 MET A HB3  4  
ATOM 4630  H HG2  . MET A 1 22 ? 2.220   -3.762  1.472   1.00 0.00 ? 22 MET A HG2  4  
ATOM 4631  H HG3  . MET A 1 22 ? 2.661   -2.482  2.600   1.00 0.00 ? 22 MET A HG3  4  
ATOM 4632  H HE1  . MET A 1 22 ? -0.292  -4.877  1.476   1.00 0.00 ? 22 MET A HE1  4  
ATOM 4633  H HE2  . MET A 1 22 ? -0.991  -3.257  1.487   1.00 0.00 ? 22 MET A HE2  4  
ATOM 4634  H HE3  . MET A 1 22 ? -1.511  -4.450  2.677   1.00 0.00 ? 22 MET A HE3  4  
ATOM 4635  N N    . ALA A 1 23 ? 2.640   -2.518  -1.715  1.00 0.00 ? 23 ALA A N    4  
ATOM 4636  C CA   . ALA A 1 23 ? 3.367   -3.458  -2.566  1.00 0.00 ? 23 ALA A CA   4  
ATOM 4637  C C    . ALA A 1 23 ? 4.579   -2.793  -3.205  1.00 0.00 ? 23 ALA A C    4  
ATOM 4638  O O    . ALA A 1 23 ? 5.549   -3.458  -3.560  1.00 0.00 ? 23 ALA A O    4  
ATOM 4639  C CB   . ALA A 1 23 ? 2.458   -4.034  -3.638  1.00 0.00 ? 23 ALA A CB   4  
ATOM 4640  H H    . ALA A 1 23 ? 1.759   -2.188  -2.002  1.00 0.00 ? 23 ALA A H    4  
ATOM 4641  H HA   . ALA A 1 23 ? 3.708   -4.272  -1.941  1.00 0.00 ? 23 ALA A HA   4  
ATOM 4642  H HB1  . ALA A 1 23 ? 2.994   -4.787  -4.199  1.00 0.00 ? 23 ALA A HB1  4  
ATOM 4643  H HB2  . ALA A 1 23 ? 2.143   -3.245  -4.305  1.00 0.00 ? 23 ALA A HB2  4  
ATOM 4644  H HB3  . ALA A 1 23 ? 1.593   -4.481  -3.173  1.00 0.00 ? 23 ALA A HB3  4  
ATOM 4645  N N    . GLN A 1 24 ? 4.515   -1.478  -3.360  1.00 0.00 ? 24 GLN A N    4  
ATOM 4646  C CA   . GLN A 1 24 ? 5.637   -0.724  -3.903  1.00 0.00 ? 24 GLN A CA   4  
ATOM 4647  C C    . GLN A 1 24 ? 6.689   -0.469  -2.829  1.00 0.00 ? 24 GLN A C    4  
ATOM 4648  O O    . GLN A 1 24 ? 7.863   -0.271  -3.132  1.00 0.00 ? 24 GLN A O    4  
ATOM 4649  C CB   . GLN A 1 24 ? 5.153   0.603   -4.494  1.00 0.00 ? 24 GLN A CB   4  
ATOM 4650  C CG   . GLN A 1 24 ? 4.933   0.569   -6.002  1.00 0.00 ? 24 GLN A CG   4  
ATOM 4651  C CD   . GLN A 1 24 ? 4.036   -0.571  -6.454  1.00 0.00 ? 24 GLN A CD   4  
ATOM 4652  O OE1  . GLN A 1 24 ? 4.505   -1.665  -6.760  1.00 0.00 ? 24 GLN A OE1  4  
ATOM 4653  N NE2  . GLN A 1 24 ? 2.740   -0.321  -6.499  1.00 0.00 ? 24 GLN A NE2  4  
ATOM 4654  H H    . GLN A 1 24 ? 3.692   -1.003  -3.108  1.00 0.00 ? 24 GLN A H    4  
ATOM 4655  H HA   . GLN A 1 24 ? 6.080   -1.317  -4.690  1.00 0.00 ? 24 GLN A HA   4  
ATOM 4656  H HB2  . GLN A 1 24 ? 4.218   0.871   -4.023  1.00 0.00 ? 24 GLN A HB2  4  
ATOM 4657  H HB3  . GLN A 1 24 ? 5.884   1.368   -4.277  1.00 0.00 ? 24 GLN A HB3  4  
ATOM 4658  H HG2  . GLN A 1 24 ? 4.480   1.501   -6.307  1.00 0.00 ? 24 GLN A HG2  4  
ATOM 4659  H HG3  . GLN A 1 24 ? 5.893   0.466   -6.489  1.00 0.00 ? 24 GLN A HG3  4  
ATOM 4660  H HE21 . GLN A 1 24 ? 2.434   0.574   -6.246  1.00 0.00 ? 24 GLN A HE21 4  
ATOM 4661  H HE22 . GLN A 1 24 ? 2.138   -1.048  -6.772  1.00 0.00 ? 24 GLN A HE22 4  
ATOM 4662  N N    . GLU A 1 25 ? 6.266   -0.485  -1.578  1.00 0.00 ? 25 GLU A N    4  
ATOM 4663  C CA   . GLU A 1 25 ? 7.168   -0.221  -0.468  1.00 0.00 ? 25 GLU A CA   4  
ATOM 4664  C C    . GLU A 1 25 ? 7.718   -1.516  0.130   1.00 0.00 ? 25 GLU A C    4  
ATOM 4665  O O    . GLU A 1 25 ? 8.927   -1.658  0.320   1.00 0.00 ? 25 GLU A O    4  
ATOM 4666  C CB   . GLU A 1 25 ? 6.454   0.595   0.611   1.00 0.00 ? 25 GLU A CB   4  
ATOM 4667  C CG   . GLU A 1 25 ? 6.172   2.031   0.202   1.00 0.00 ? 25 GLU A CG   4  
ATOM 4668  C CD   . GLU A 1 25 ? 5.731   2.892   1.368   1.00 0.00 ? 25 GLU A CD   4  
ATOM 4669  O OE1  . GLU A 1 25 ? 4.534   2.863   1.719   1.00 0.00 ? 25 GLU A OE1  4  
ATOM 4670  O OE2  . GLU A 1 25 ? 6.584   3.607   1.940   1.00 0.00 ? 25 GLU A OE2  4  
ATOM 4671  H H    . GLU A 1 25 ? 5.323   -0.672  -1.395  1.00 0.00 ? 25 GLU A H    4  
ATOM 4672  H HA   . GLU A 1 25 ? 7.994   0.359   -0.851  1.00 0.00 ? 25 GLU A HA   4  
ATOM 4673  H HB2  . GLU A 1 25 ? 5.508   0.117   0.835   1.00 0.00 ? 25 GLU A HB2  4  
ATOM 4674  H HB3  . GLU A 1 25 ? 7.065   0.607   1.502   1.00 0.00 ? 25 GLU A HB3  4  
ATOM 4675  H HG2  . GLU A 1 25 ? 7.072   2.454   -0.218  1.00 0.00 ? 25 GLU A HG2  4  
ATOM 4676  H HG3  . GLU A 1 25 ? 5.392   2.033   -0.544  1.00 0.00 ? 25 GLU A HG3  4  
ATOM 4677  N N    . ASN A 1 26 ? 6.831   -2.456  0.415   1.00 0.00 ? 26 ASN A N    4  
ATOM 4678  C CA   . ASN A 1 26 ? 7.204   -3.700  1.088   1.00 0.00 ? 26 ASN A CA   4  
ATOM 4679  C C    . ASN A 1 26 ? 6.280   -4.848  0.676   1.00 0.00 ? 26 ASN A C    4  
ATOM 4680  O O    . ASN A 1 26 ? 5.283   -5.133  1.346   1.00 0.00 ? 26 ASN A O    4  
ATOM 4681  C CB   . ASN A 1 26 ? 7.173   -3.519  2.616   1.00 0.00 ? 26 ASN A CB   4  
ATOM 4682  C CG   . ASN A 1 26 ? 6.136   -2.500  3.064   1.00 0.00 ? 26 ASN A CG   4  
ATOM 4683  O OD1  . ASN A 1 26 ? 6.450   -1.327  3.271   1.00 0.00 ? 26 ASN A OD1  4  
ATOM 4684  N ND2  . ASN A 1 26 ? 4.893   -2.927  3.191   1.00 0.00 ? 26 ASN A ND2  4  
ATOM 4685  H H    . ASN A 1 26 ? 5.888   -2.317  0.161   1.00 0.00 ? 26 ASN A H    4  
ATOM 4686  H HA   . ASN A 1 26 ? 8.211   -3.946  0.787   1.00 0.00 ? 26 ASN A HA   4  
ATOM 4687  H HB2  . ASN A 1 26 ? 6.941   -4.467  3.079   1.00 0.00 ? 26 ASN A HB2  4  
ATOM 4688  H HB3  . ASN A 1 26 ? 8.145   -3.190  2.953   1.00 0.00 ? 26 ASN A HB3  4  
ATOM 4689  H HD21 . ASN A 1 26 ? 4.704   -3.871  2.996   1.00 0.00 ? 26 ASN A HD21 4  
ATOM 4690  H HD22 . ASN A 1 26 ? 4.207   -2.278  3.456   1.00 0.00 ? 26 ASN A HD22 4  
ATOM 4691  N N    . PRO A 1 27 ? 6.592   -5.513  -0.447  1.00 0.00 ? 27 PRO A N    4  
ATOM 4692  C CA   . PRO A 1 27 ? 5.772   -6.591  -0.975  1.00 0.00 ? 27 PRO A CA   4  
ATOM 4693  C C    . PRO A 1 27 ? 6.154   -7.964  -0.422  1.00 0.00 ? 27 PRO A C    4  
ATOM 4694  O O    . PRO A 1 27 ? 6.843   -8.744  -1.081  1.00 0.00 ? 27 PRO A O    4  
ATOM 4695  C CB   . PRO A 1 27 ? 6.049   -6.514  -2.475  1.00 0.00 ? 27 PRO A CB   4  
ATOM 4696  C CG   . PRO A 1 27 ? 7.450   -5.998  -2.585  1.00 0.00 ? 27 PRO A CG   4  
ATOM 4697  C CD   . PRO A 1 27 ? 7.760   -5.253  -1.305  1.00 0.00 ? 27 PRO A CD   4  
ATOM 4698  H HA   . PRO A 1 27 ? 4.722   -6.414  -0.793  1.00 0.00 ? 27 PRO A HA   4  
ATOM 4699  H HB2  . PRO A 1 27 ? 5.954   -7.499  -2.910  1.00 0.00 ? 27 PRO A HB2  4  
ATOM 4700  H HB3  . PRO A 1 27 ? 5.346   -5.841  -2.939  1.00 0.00 ? 27 PRO A HB3  4  
ATOM 4701  H HG2  . PRO A 1 27 ? 8.133   -6.827  -2.707  1.00 0.00 ? 27 PRO A HG2  4  
ATOM 4702  H HG3  . PRO A 1 27 ? 7.523   -5.331  -3.431  1.00 0.00 ? 27 PRO A HG3  4  
ATOM 4703  H HD2  . PRO A 1 27 ? 8.661   -5.641  -0.854  1.00 0.00 ? 27 PRO A HD2  4  
ATOM 4704  H HD3  . PRO A 1 27 ? 7.864   -4.196  -1.503  1.00 0.00 ? 27 PRO A HD3  4  
ATOM 4705  N N    . LYS A 1 28 ? 5.741   -8.241  0.807   1.00 0.00 ? 28 LYS A N    4  
ATOM 4706  C CA   . LYS A 1 28 ? 5.910   -9.574  1.374   1.00 0.00 ? 28 LYS A CA   4  
ATOM 4707  C C    . LYS A 1 28 ? 4.570   -10.308 1.360   1.00 0.00 ? 28 LYS A C    4  
ATOM 4708  O O    . LYS A 1 28 ? 4.510   -11.529 1.222   1.00 0.00 ? 28 LYS A O    4  
ATOM 4709  C CB   . LYS A 1 28 ? 6.456   -9.473  2.809   1.00 0.00 ? 28 LYS A CB   4  
ATOM 4710  C CG   . LYS A 1 28 ? 7.028   -10.772 3.380   1.00 0.00 ? 28 LYS A CG   4  
ATOM 4711  C CD   . LYS A 1 28 ? 5.947   -11.767 3.780   1.00 0.00 ? 28 LYS A CD   4  
ATOM 4712  C CE   . LYS A 1 28 ? 6.549   -13.041 4.348   1.00 0.00 ? 28 LYS A CE   4  
ATOM 4713  N NZ   . LYS A 1 28 ? 5.512   -14.067 4.640   1.00 0.00 ? 28 LYS A NZ   4  
ATOM 4714  H H    . LYS A 1 28 ? 5.332   -7.532  1.347   1.00 0.00 ? 28 LYS A H    4  
ATOM 4715  H HA   . LYS A 1 28 ? 6.616   -10.112 0.758   1.00 0.00 ? 28 LYS A HA   4  
ATOM 4716  H HB2  . LYS A 1 28 ? 7.239   -8.731  2.829   1.00 0.00 ? 28 LYS A HB2  4  
ATOM 4717  H HB3  . LYS A 1 28 ? 5.655   -9.147  3.457   1.00 0.00 ? 28 LYS A HB3  4  
ATOM 4718  H HG2  . LYS A 1 28 ? 7.658   -11.232 2.634   1.00 0.00 ? 28 LYS A HG2  4  
ATOM 4719  H HG3  . LYS A 1 28 ? 7.621   -10.534 4.252   1.00 0.00 ? 28 LYS A HG3  4  
ATOM 4720  H HD2  . LYS A 1 28 ? 5.314   -11.316 4.530   1.00 0.00 ? 28 LYS A HD2  4  
ATOM 4721  H HD3  . LYS A 1 28 ? 5.358   -12.013 2.910   1.00 0.00 ? 28 LYS A HD3  4  
ATOM 4722  H HE2  . LYS A 1 28 ? 7.249   -13.443 3.630   1.00 0.00 ? 28 LYS A HE2  4  
ATOM 4723  H HE3  . LYS A 1 28 ? 7.071   -12.799 5.262   1.00 0.00 ? 28 LYS A HE3  4  
ATOM 4724  H HZ1  . LYS A 1 28 ? 5.149   -14.482 3.752   1.00 0.00 ? 28 LYS A HZ1  4  
ATOM 4725  H HZ2  . LYS A 1 28 ? 4.717   -13.642 5.161   1.00 0.00 ? 28 LYS A HZ2  4  
ATOM 4726  H HZ3  . LYS A 1 28 ? 5.919   -14.829 5.221   1.00 0.00 ? 28 LYS A HZ3  4  
ATOM 4727  N N    . MET A 1 29 ? 3.496   -9.543  1.453   1.00 0.00 ? 29 MET A N    4  
ATOM 4728  C CA   . MET A 1 29 ? 2.160   -10.110 1.539   1.00 0.00 ? 29 MET A CA   4  
ATOM 4729  C C    . MET A 1 29 ? 1.459   -10.034 0.191   1.00 0.00 ? 29 MET A C    4  
ATOM 4730  O O    . MET A 1 29 ? 1.681   -9.094  -0.574  1.00 0.00 ? 29 MET A O    4  
ATOM 4731  C CB   . MET A 1 29 ? 1.353   -9.387  2.619   1.00 0.00 ? 29 MET A CB   4  
ATOM 4732  C CG   . MET A 1 29 ? 1.276   -7.877  2.445   1.00 0.00 ? 29 MET A CG   4  
ATOM 4733  S SD   . MET A 1 29 ? 0.511   -7.059  3.861   1.00 0.00 ? 29 MET A SD   4  
ATOM 4734  C CE   . MET A 1 29 ? 1.677   -7.470  5.156   1.00 0.00 ? 29 MET A CE   4  
ATOM 4735  H H    . MET A 1 29 ? 3.600   -8.571  1.449   1.00 0.00 ? 29 MET A H    4  
ATOM 4736  H HA   . MET A 1 29 ? 2.262   -11.150 1.817   1.00 0.00 ? 29 MET A HA   4  
ATOM 4737  H HB2  . MET A 1 29 ? 0.345   -9.774  2.612   1.00 0.00 ? 29 MET A HB2  4  
ATOM 4738  H HB3  . MET A 1 29 ? 1.800   -9.594  3.581   1.00 0.00 ? 29 MET A HB3  4  
ATOM 4739  H HG2  . MET A 1 29 ? 2.277   -7.490  2.318   1.00 0.00 ? 29 MET A HG2  4  
ATOM 4740  H HG3  . MET A 1 29 ? 0.695   -7.659  1.562   1.00 0.00 ? 29 MET A HG3  4  
ATOM 4741  H HE1  . MET A 1 29 ? 1.722   -8.542  5.276   1.00 0.00 ? 29 MET A HE1  4  
ATOM 4742  H HE2  . MET A 1 29 ? 1.357   -7.019  6.083   1.00 0.00 ? 29 MET A HE2  4  
ATOM 4743  H HE3  . MET A 1 29 ? 2.657   -7.097  4.892   1.00 0.00 ? 29 MET A HE3  4  
ATOM 4744  N N    . HIS A 1 30 ? 0.620   -11.023 -0.100  1.00 0.00 ? 30 HIS A N    4  
ATOM 4745  C CA   . HIS A 1 30 ? -0.014  -11.112 -1.409  1.00 0.00 ? 30 HIS A CA   4  
ATOM 4746  C C    . HIS A 1 30 ? -1.508  -10.804 -1.318  1.00 0.00 ? 30 HIS A C    4  
ATOM 4747  O O    . HIS A 1 30 ? -1.975  -9.820  -1.894  1.00 0.00 ? 30 HIS A O    4  
ATOM 4748  C CB   . HIS A 1 30 ? 0.213   -12.503 -2.014  1.00 0.00 ? 30 HIS A CB   4  
ATOM 4749  C CG   . HIS A 1 30 ? 0.066   -12.551 -3.504  1.00 0.00 ? 30 HIS A CG   4  
ATOM 4750  N ND1  . HIS A 1 30 ? 0.713   -13.480 -4.289  1.00 0.00 ? 30 HIS A ND1  4  
ATOM 4751  C CD2  . HIS A 1 30 ? -0.659  -11.785 -4.354  1.00 0.00 ? 30 HIS A CD2  4  
ATOM 4752  C CE1  . HIS A 1 30 ? 0.390   -13.285 -5.554  1.00 0.00 ? 30 HIS A CE1  4  
ATOM 4753  N NE2  . HIS A 1 30 ? -0.439  -12.263 -5.620  1.00 0.00 ? 30 HIS A NE2  4  
ATOM 4754  H H    . HIS A 1 30 ? 0.420   -11.703 0.581   1.00 0.00 ? 30 HIS A H    4  
ATOM 4755  H HA   . HIS A 1 30 ? 0.448   -10.375 -2.048  1.00 0.00 ? 30 HIS A HA   4  
ATOM 4756  H HB2  . HIS A 1 30 ? 1.211   -12.832 -1.774  1.00 0.00 ? 30 HIS A HB2  4  
ATOM 4757  H HB3  . HIS A 1 30 ? -0.498  -13.196 -1.585  1.00 0.00 ? 30 HIS A HB3  4  
ATOM 4758  H HD1  . HIS A 1 30 ? 1.335   -14.176 -3.967  1.00 0.00 ? 30 HIS A HD1  4  
ATOM 4759  H HD2  . HIS A 1 30 ? -1.296  -10.954 -4.085  1.00 0.00 ? 30 HIS A HD2  4  
ATOM 4760  H HE1  . HIS A 1 30 ? 0.740   -13.870 -6.392  1.00 0.00 ? 30 HIS A HE1  4  
ATOM 4761  H HE2  . HIS A 1 30 ? -0.752  -11.836 -6.457  1.00 0.00 ? 30 HIS A HE2  4  
ATOM 4762  N N    . ASN A 1 31 ? -2.260  -11.643 -0.612  1.00 0.00 ? 31 ASN A N    4  
ATOM 4763  C CA   . ASN A 1 31 ? -3.699  -11.437 -0.479  1.00 0.00 ? 31 ASN A CA   4  
ATOM 4764  C C    . ASN A 1 31 ? -4.155  -11.616 0.962   1.00 0.00 ? 31 ASN A C    4  
ATOM 4765  O O    . ASN A 1 31 ? -4.832  -10.752 1.523   1.00 0.00 ? 31 ASN A O    4  
ATOM 4766  C CB   . ASN A 1 31 ? -4.499  -12.406 -1.360  1.00 0.00 ? 31 ASN A CB   4  
ATOM 4767  C CG   . ASN A 1 31 ? -4.115  -12.345 -2.822  1.00 0.00 ? 31 ASN A CG   4  
ATOM 4768  O OD1  . ASN A 1 31 ? -4.551  -11.460 -3.558  1.00 0.00 ? 31 ASN A OD1  4  
ATOM 4769  N ND2  . ASN A 1 31 ? -3.331  -13.314 -3.269  1.00 0.00 ? 31 ASN A ND2  4  
ATOM 4770  H H    . ASN A 1 31 ? -1.837  -12.420 -0.172  1.00 0.00 ? 31 ASN A H    4  
ATOM 4771  H HA   . ASN A 1 31 ? -3.918  -10.427 -0.787  1.00 0.00 ? 31 ASN A HA   4  
ATOM 4772  H HB2  . ASN A 1 31 ? -4.333  -13.414 -1.010  1.00 0.00 ? 31 ASN A HB2  4  
ATOM 4773  H HB3  . ASN A 1 31 ? -5.549  -12.171 -1.271  1.00 0.00 ? 31 ASN A HB3  4  
ATOM 4774  H HD21 . ASN A 1 31 ? -3.043  -14.012 -2.629  1.00 0.00 ? 31 ASN A HD21 4  
ATOM 4775  H HD22 . ASN A 1 31 ? -3.077  -13.307 -4.219  1.00 0.00 ? 31 ASN A HD22 4  
ATOM 4776  N N    . SER A 1 32 ? -3.778  -12.744 1.557   1.00 0.00 ? 32 SER A N    4  
ATOM 4777  C CA   . SER A 1 32 ? -4.302  -13.137 2.858   1.00 0.00 ? 32 SER A CA   4  
ATOM 4778  C C    . SER A 1 32 ? -3.947  -12.128 3.944   1.00 0.00 ? 32 SER A C    4  
ATOM 4779  O O    . SER A 1 32 ? -4.817  -11.656 4.671   1.00 0.00 ? 32 SER A O    4  
ATOM 4780  C CB   . SER A 1 32 ? -3.763  -14.517 3.234   1.00 0.00 ? 32 SER A CB   4  
ATOM 4781  O OG   . SER A 1 32 ? -3.989  -15.451 2.188   1.00 0.00 ? 32 SER A OG   4  
ATOM 4782  H H    . SER A 1 32 ? -3.122  -13.326 1.111   1.00 0.00 ? 32 SER A H    4  
ATOM 4783  H HA   . SER A 1 32 ? -5.376  -13.194 2.777   1.00 0.00 ? 32 SER A HA   4  
ATOM 4784  H HB2  . SER A 1 32 ? -2.700  -14.449 3.416   1.00 0.00 ? 32 SER A HB2  4  
ATOM 4785  H HB3  . SER A 1 32 ? -4.261  -14.865 4.127   1.00 0.00 ? 32 SER A HB3  4  
ATOM 4786  H HG   . SER A 1 32 ? -3.138  -15.831 1.911   1.00 0.00 ? 32 SER A HG   4  
ATOM 4787  N N    . GLU A 1 33 ? -2.681  -11.756 4.016   1.00 0.00 ? 33 GLU A N    4  
ATOM 4788  C CA   . GLU A 1 33 ? -2.213  -10.877 5.074   1.00 0.00 ? 33 GLU A CA   4  
ATOM 4789  C C    . GLU A 1 33 ? -2.866  -9.512  4.941   1.00 0.00 ? 33 GLU A C    4  
ATOM 4790  O O    . GLU A 1 33 ? -3.325  -8.928  5.925   1.00 0.00 ? 33 GLU A O    4  
ATOM 4791  C CB   . GLU A 1 33 ? -0.689  -10.744 5.042   1.00 0.00 ? 33 GLU A CB   4  
ATOM 4792  C CG   . GLU A 1 33 ? 0.042   -12.077 4.987   1.00 0.00 ? 33 GLU A CG   4  
ATOM 4793  C CD   . GLU A 1 33 ? 0.382   -12.513 3.572   1.00 0.00 ? 33 GLU A CD   4  
ATOM 4794  O OE1  . GLU A 1 33 ? -0.524  -12.543 2.714   1.00 0.00 ? 33 GLU A OE1  4  
ATOM 4795  O OE2  . GLU A 1 33 ? 1.567   -12.808 3.308   1.00 0.00 ? 33 GLU A OE2  4  
ATOM 4796  H H    . GLU A 1 33 ? -2.044  -12.073 3.336   1.00 0.00 ? 33 GLU A H    4  
ATOM 4797  H HA   . GLU A 1 33 ? -2.508  -11.311 6.018   1.00 0.00 ? 33 GLU A HA   4  
ATOM 4798  H HB2  . GLU A 1 33 ? -0.409  -10.169 4.171   1.00 0.00 ? 33 GLU A HB2  4  
ATOM 4799  H HB3  . GLU A 1 33 ? -0.366  -10.217 5.928   1.00 0.00 ? 33 GLU A HB3  4  
ATOM 4800  H HG2  . GLU A 1 33 ? 0.959   -11.994 5.552   1.00 0.00 ? 33 GLU A HG2  4  
ATOM 4801  H HG3  . GLU A 1 33 ? -0.588  -12.831 5.438   1.00 0.00 ? 33 GLU A HG3  4  
ATOM 4802  N N    . ILE A 1 34 ? -2.933  -9.035  3.704   1.00 0.00 ? 34 ILE A N    4  
ATOM 4803  C CA   . ILE A 1 34 ? -3.548  -7.750  3.409   1.00 0.00 ? 34 ILE A CA   4  
ATOM 4804  C C    . ILE A 1 34 ? -5.000  -7.735  3.870   1.00 0.00 ? 34 ILE A C    4  
ATOM 4805  O O    . ILE A 1 34 ? -5.472  -6.749  4.431   1.00 0.00 ? 34 ILE A O    4  
ATOM 4806  C CB   . ILE A 1 34 ? -3.486  -7.421  1.897   1.00 0.00 ? 34 ILE A CB   4  
ATOM 4807  C CG1  . ILE A 1 34 ? -2.040  -7.491  1.400   1.00 0.00 ? 34 ILE A CG1  4  
ATOM 4808  C CG2  . ILE A 1 34 ? -4.077  -6.044  1.625   1.00 0.00 ? 34 ILE A CG2  4  
ATOM 4809  C CD1  . ILE A 1 34 ? -1.877  -7.169  -0.070  1.00 0.00 ? 34 ILE A CD1  4  
ATOM 4810  H H    . ILE A 1 34 ? -2.560  -9.565  2.970   1.00 0.00 ? 34 ILE A H    4  
ATOM 4811  H HA   . ILE A 1 34 ? -3.003  -6.990  3.947   1.00 0.00 ? 34 ILE A HA   4  
ATOM 4812  H HB   . ILE A 1 34 ? -4.076  -8.148  1.364   1.00 0.00 ? 34 ILE A HB   4  
ATOM 4813  H HG12 . ILE A 1 34 ? -1.441  -6.787  1.958   1.00 0.00 ? 34 ILE A HG12 4  
ATOM 4814  H HG13 . ILE A 1 34 ? -1.658  -8.489  1.565   1.00 0.00 ? 34 ILE A HG13 4  
ATOM 4815  H HG21 . ILE A 1 34 ? -4.045  -5.841  0.565   1.00 0.00 ? 34 ILE A HG21 4  
ATOM 4816  H HG22 . ILE A 1 34 ? -3.502  -5.297  2.152   1.00 0.00 ? 34 ILE A HG22 4  
ATOM 4817  H HG23 . ILE A 1 34 ? -5.101  -6.017  1.970   1.00 0.00 ? 34 ILE A HG23 4  
ATOM 4818  H HD11 . ILE A 1 34 ? -2.254  -6.175  -0.264  1.00 0.00 ? 34 ILE A HD11 4  
ATOM 4819  H HD12 . ILE A 1 34 ? -2.428  -7.884  -0.660  1.00 0.00 ? 34 ILE A HD12 4  
ATOM 4820  H HD13 . ILE A 1 34 ? -0.829  -7.213  -0.334  1.00 0.00 ? 34 ILE A HD13 4  
ATOM 4821  N N    . SER A 1 35 ? -5.699  -8.847  3.684   1.00 0.00 ? 35 SER A N    4  
ATOM 4822  C CA   . SER A 1 35 ? -7.111  -8.893  4.029   1.00 0.00 ? 35 SER A CA   4  
ATOM 4823  C C    . SER A 1 35 ? -7.301  -8.954  5.544   1.00 0.00 ? 35 SER A C    4  
ATOM 4824  O O    . SER A 1 35 ? -8.288  -8.433  6.075   1.00 0.00 ? 35 SER A O    4  
ATOM 4825  C CB   . SER A 1 35 ? -7.819  -10.053 3.317   1.00 0.00 ? 35 SER A CB   4  
ATOM 4826  O OG   . SER A 1 35 ? -6.987  -11.195 3.215   1.00 0.00 ? 35 SER A OG   4  
ATOM 4827  H H    . SER A 1 35 ? -5.250  -9.662  3.348   1.00 0.00 ? 35 SER A H    4  
ATOM 4828  H HA   . SER A 1 35 ? -7.547  -7.968  3.680   1.00 0.00 ? 35 SER A HA   4  
ATOM 4829  H HB2  . SER A 1 35 ? -8.706  -10.322 3.870   1.00 0.00 ? 35 SER A HB2  4  
ATOM 4830  H HB3  . SER A 1 35 ? -8.097  -9.740  2.321   1.00 0.00 ? 35 SER A HB3  4  
ATOM 4831  H HG   . SER A 1 35 ? -6.335  -11.056 2.516   1.00 0.00 ? 35 SER A HG   4  
ATOM 4832  N N    . LYS A 1 36 ? -6.335  -9.552  6.241   1.00 0.00 ? 36 LYS A N    4  
ATOM 4833  C CA   . LYS A 1 36 ? -6.415  -9.686  7.693   1.00 0.00 ? 36 LYS A CA   4  
ATOM 4834  C C    . LYS A 1 36 ? -6.298  -8.318  8.356   1.00 0.00 ? 36 LYS A C    4  
ATOM 4835  O O    . LYS A 1 36 ? -7.122  -7.947  9.195   1.00 0.00 ? 36 LYS A O    4  
ATOM 4836  C CB   . LYS A 1 36 ? -5.309  -10.611 8.222   1.00 0.00 ? 36 LYS A CB   4  
ATOM 4837  C CG   . LYS A 1 36 ? -5.324  -12.007 7.622   1.00 0.00 ? 36 LYS A CG   4  
ATOM 4838  C CD   . LYS A 1 36 ? -6.616  -12.744 7.925   1.00 0.00 ? 36 LYS A CD   4  
ATOM 4839  C CE   . LYS A 1 36 ? -6.620  -14.124 7.290   1.00 0.00 ? 36 LYS A CE   4  
ATOM 4840  N NZ   . LYS A 1 36 ? -7.840  -14.894 7.636   1.00 0.00 ? 36 LYS A NZ   4  
ATOM 4841  H H    . LYS A 1 36 ? -5.541  -9.895  5.770   1.00 0.00 ? 36 LYS A H    4  
ATOM 4842  H HA   . LYS A 1 36 ? -7.379  -10.111 7.935   1.00 0.00 ? 36 LYS A HA   4  
ATOM 4843  H HB2  . LYS A 1 36 ? -4.348  -10.163 8.008   1.00 0.00 ? 36 LYS A HB2  4  
ATOM 4844  H HB3  . LYS A 1 36 ? -5.420  -10.703 9.292   1.00 0.00 ? 36 LYS A HB3  4  
ATOM 4845  H HG2  . LYS A 1 36 ? -5.212  -11.928 6.551   1.00 0.00 ? 36 LYS A HG2  4  
ATOM 4846  H HG3  . LYS A 1 36 ? -4.497  -12.571 8.029   1.00 0.00 ? 36 LYS A HG3  4  
ATOM 4847  H HD2  . LYS A 1 36 ? -6.720  -12.850 8.995   1.00 0.00 ? 36 LYS A HD2  4  
ATOM 4848  H HD3  . LYS A 1 36 ? -7.446  -12.174 7.534   1.00 0.00 ? 36 LYS A HD3  4  
ATOM 4849  H HE2  . LYS A 1 36 ? -6.569  -14.012 6.217   1.00 0.00 ? 36 LYS A HE2  4  
ATOM 4850  H HE3  . LYS A 1 36 ? -5.751  -14.667 7.634   1.00 0.00 ? 36 LYS A HE3  4  
ATOM 4851  H HZ1  . LYS A 1 36 ? -8.689  -14.423 7.252   1.00 0.00 ? 36 LYS A HZ1  4  
ATOM 4852  H HZ2  . LYS A 1 36 ? -7.937  -14.963 8.674   1.00 0.00 ? 36 LYS A HZ2  4  
ATOM 4853  H HZ3  . LYS A 1 36 ? -7.782  -15.858 7.245   1.00 0.00 ? 36 LYS A HZ3  4  
ATOM 4854  N N    . ARG A 1 37 ? -5.274  -7.569  7.957   1.00 0.00 ? 37 ARG A N    4  
ATOM 4855  C CA   . ARG A 1 37 ? -5.022  -6.255  8.531   1.00 0.00 ? 37 ARG A CA   4  
ATOM 4856  C C    . ARG A 1 37 ? -6.168  -5.303  8.224   1.00 0.00 ? 37 ARG A C    4  
ATOM 4857  O O    . ARG A 1 37 ? -6.745  -4.705  9.126   1.00 0.00 ? 37 ARG A O    4  
ATOM 4858  C CB   . ARG A 1 37 ? -3.721  -5.650  7.999   1.00 0.00 ? 37 ARG A CB   4  
ATOM 4859  C CG   . ARG A 1 37 ? -2.476  -6.469  8.297   1.00 0.00 ? 37 ARG A CG   4  
ATOM 4860  C CD   . ARG A 1 37 ? -1.214  -5.688  7.949   1.00 0.00 ? 37 ARG A CD   4  
ATOM 4861  N NE   . ARG A 1 37 ? -0.954  -4.601  8.901   1.00 0.00 ? 37 ARG A NE   4  
ATOM 4862  C CZ   . ARG A 1 37 ? -1.142  -3.304  8.643   1.00 0.00 ? 37 ARG A CZ   4  
ATOM 4863  N NH1  . ARG A 1 37 ? -1.597  -2.911  7.460   1.00 0.00 ? 37 ARG A NH1  4  
ATOM 4864  N NH2  . ARG A 1 37 ? -0.863  -2.397  9.573   1.00 0.00 ? 37 ARG A NH2  4  
ATOM 4865  H H    . ARG A 1 37 ? -4.674  -7.912  7.261   1.00 0.00 ? 37 ARG A H    4  
ATOM 4866  H HA   . ARG A 1 37 ? -4.944  -6.369  9.602   1.00 0.00 ? 37 ARG A HA   4  
ATOM 4867  H HB2  . ARG A 1 37 ? -3.801  -5.546  6.927   1.00 0.00 ? 37 ARG A HB2  4  
ATOM 4868  H HB3  . ARG A 1 37 ? -3.593  -4.670  8.435   1.00 0.00 ? 37 ARG A HB3  4  
ATOM 4869  H HG2  . ARG A 1 37 ? -2.460  -6.715  9.347   1.00 0.00 ? 37 ARG A HG2  4  
ATOM 4870  H HG3  . ARG A 1 37 ? -2.502  -7.376  7.711   1.00 0.00 ? 37 ARG A HG3  4  
ATOM 4871  H HD2  . ARG A 1 37 ? -0.374  -6.368  7.956   1.00 0.00 ? 37 ARG A HD2  4  
ATOM 4872  H HD3  . ARG A 1 37 ? -1.329  -5.269  6.959   1.00 0.00 ? 37 ARG A HD3  4  
ATOM 4873  H HE   . ARG A 1 37 ? -0.607  -4.857  9.792   1.00 0.00 ? 37 ARG A HE   4  
ATOM 4874  H HH11 . ARG A 1 37 ? -1.802  -3.585  6.752   1.00 0.00 ? 37 ARG A HH11 4  
ATOM 4875  H HH12 . ARG A 1 37 ? -1.733  -1.927  7.272   1.00 0.00 ? 37 ARG A HH12 4  
ATOM 4876  H HH21 . ARG A 1 37 ? -0.502  -2.682  10.467  1.00 0.00 ? 37 ARG A HH21 4  
ATOM 4877  H HH22 . ARG A 1 37 ? -1.025  -1.423  9.395   1.00 0.00 ? 37 ARG A HH22 4  
ATOM 4878  N N    . LEU A 1 38 ? -6.503  -5.191  6.945   1.00 0.00 ? 38 LEU A N    4  
ATOM 4879  C CA   . LEU A 1 38 ? -7.474  -4.200  6.486   1.00 0.00 ? 38 LEU A CA   4  
ATOM 4880  C C    . LEU A 1 38 ? -8.832  -4.369  7.164   1.00 0.00 ? 38 LEU A C    4  
ATOM 4881  O O    . LEU A 1 38 ? -9.477  -3.382  7.524   1.00 0.00 ? 38 LEU A O    4  
ATOM 4882  C CB   . LEU A 1 38 ? -7.622  -4.255  4.962   1.00 0.00 ? 38 LEU A CB   4  
ATOM 4883  C CG   . LEU A 1 38 ? -6.654  -3.356  4.177   1.00 0.00 ? 38 LEU A CG   4  
ATOM 4884  C CD1  . LEU A 1 38 ? -5.201  -3.721  4.453   1.00 0.00 ? 38 LEU A CD1  4  
ATOM 4885  C CD2  . LEU A 1 38 ? -6.950  -3.434  2.687   1.00 0.00 ? 38 LEU A CD2  4  
ATOM 4886  H H    . LEU A 1 38 ? -6.092  -5.796  6.289   1.00 0.00 ? 38 LEU A H    4  
ATOM 4887  H HA   . LEU A 1 38 ? -7.080  -3.231  6.753   1.00 0.00 ? 38 LEU A HA   4  
ATOM 4888  H HB2  . LEU A 1 38 ? -7.471  -5.277  4.641   1.00 0.00 ? 38 LEU A HB2  4  
ATOM 4889  H HB3  . LEU A 1 38 ? -8.632  -3.963  4.710   1.00 0.00 ? 38 LEU A HB3  4  
ATOM 4890  H HG   . LEU A 1 38 ? -6.799  -2.330  4.493   1.00 0.00 ? 38 LEU A HG   4  
ATOM 4891  H HD11 . LEU A 1 38 ? -4.552  -3.081  3.874   1.00 0.00 ? 38 LEU A HD11 4  
ATOM 4892  H HD12 . LEU A 1 38 ? -5.029  -4.751  4.176   1.00 0.00 ? 38 LEU A HD12 4  
ATOM 4893  H HD13 . LEU A 1 38 ? -4.990  -3.591  5.504   1.00 0.00 ? 38 LEU A HD13 4  
ATOM 4894  H HD21 . LEU A 1 38 ? -6.299  -2.755  2.156   1.00 0.00 ? 38 LEU A HD21 4  
ATOM 4895  H HD22 . LEU A 1 38 ? -7.978  -3.158  2.509   1.00 0.00 ? 38 LEU A HD22 4  
ATOM 4896  H HD23 . LEU A 1 38 ? -6.781  -4.442  2.338   1.00 0.00 ? 38 LEU A HD23 4  
ATOM 4897  N N    . GLY A 1 39 ? -9.256  -5.612  7.352   1.00 0.00 ? 39 GLY A N    4  
ATOM 4898  C CA   . GLY A 1 39 ? -10.517 -5.871  8.022   1.00 0.00 ? 39 GLY A CA   4  
ATOM 4899  C C    . GLY A 1 39 ? -10.481 -5.453  9.480   1.00 0.00 ? 39 GLY A C    4  
ATOM 4900  O O    . GLY A 1 39 ? -11.403 -4.797  9.971   1.00 0.00 ? 39 GLY A O    4  
ATOM 4901  H H    . GLY A 1 39 ? -8.710  -6.360  7.037   1.00 0.00 ? 39 GLY A H    4  
ATOM 4902  H HA2  . GLY A 1 39 ? -11.302 -5.325  7.519   1.00 0.00 ? 39 GLY A HA2  4  
ATOM 4903  H HA3  . GLY A 1 39 ? -10.734 -6.927  7.966   1.00 0.00 ? 39 GLY A HA3  4  
ATOM 4904  N N    . ALA A 1 40 ? -9.401  -5.815  10.165  1.00 0.00 ? 40 ALA A N    4  
ATOM 4905  C CA   . ALA A 1 40 ? -9.247  -5.499  11.580  1.00 0.00 ? 40 ALA A CA   4  
ATOM 4906  C C    . ALA A 1 40 ? -9.096  -3.996  11.797  1.00 0.00 ? 40 ALA A C    4  
ATOM 4907  O O    . ALA A 1 40 ? -9.640  -3.442  12.755  1.00 0.00 ? 40 ALA A O    4  
ATOM 4908  C CB   . ALA A 1 40 ? -8.052  -6.243  12.160  1.00 0.00 ? 40 ALA A CB   4  
ATOM 4909  H H    . ALA A 1 40 ? -8.685  -6.307  9.704   1.00 0.00 ? 40 ALA A H    4  
ATOM 4910  H HA   . ALA A 1 40 ? -10.134 -5.839  12.095  1.00 0.00 ? 40 ALA A HA   4  
ATOM 4911  H HB1  . ALA A 1 40 ? -7.968  -6.021  13.214  1.00 0.00 ? 40 ALA A HB1  4  
ATOM 4912  H HB2  . ALA A 1 40 ? -7.151  -5.931  11.653  1.00 0.00 ? 40 ALA A HB2  4  
ATOM 4913  H HB3  . ALA A 1 40 ? -8.190  -7.307  12.029  1.00 0.00 ? 40 ALA A HB3  4  
ATOM 4914  N N    . GLU A 1 41 ? -8.367  -3.347  10.896  1.00 0.00 ? 41 GLU A N    4  
ATOM 4915  C CA   . GLU A 1 41 ? -8.134  -1.910  10.991  1.00 0.00 ? 41 GLU A CA   4  
ATOM 4916  C C    . GLU A 1 41 ? -9.437  -1.137  10.824  1.00 0.00 ? 41 GLU A C    4  
ATOM 4917  O O    . GLU A 1 41 ? -9.753  -0.259  11.625  1.00 0.00 ? 41 GLU A O    4  
ATOM 4918  C CB   . GLU A 1 41 ? -7.128  -1.449  9.931   1.00 0.00 ? 41 GLU A CB   4  
ATOM 4919  C CG   . GLU A 1 41 ? -5.729  -2.025  10.100  1.00 0.00 ? 41 GLU A CG   4  
ATOM 4920  C CD   . GLU A 1 41 ? -5.077  -1.626  11.405  1.00 0.00 ? 41 GLU A CD   4  
ATOM 4921  O OE1  . GLU A 1 41 ? -4.707  -0.443  11.554  1.00 0.00 ? 41 GLU A OE1  4  
ATOM 4922  O OE2  . GLU A 1 41 ? -4.920  -2.498  12.287  1.00 0.00 ? 41 GLU A OE2  4  
ATOM 4923  H H    . GLU A 1 41 ? -7.972  -3.850  10.145  1.00 0.00 ? 41 GLU A H    4  
ATOM 4924  H HA   . GLU A 1 41 ? -7.731  -1.703  11.971  1.00 0.00 ? 41 GLU A HA   4  
ATOM 4925  H HB2  . GLU A 1 41 ? -7.494  -1.740  8.958   1.00 0.00 ? 41 GLU A HB2  4  
ATOM 4926  H HB3  . GLU A 1 41 ? -7.055  -0.372  9.968   1.00 0.00 ? 41 GLU A HB3  4  
ATOM 4927  H HG2  . GLU A 1 41 ? -5.792  -3.102  10.067  1.00 0.00 ? 41 GLU A HG2  4  
ATOM 4928  H HG3  . GLU A 1 41 ? -5.109  -1.679  9.286   1.00 0.00 ? 41 GLU A HG3  4  
ATOM 4929  N N    . TRP A 1 42 ? -10.201 -1.484  9.793   1.00 0.00 ? 42 TRP A N    4  
ATOM 4930  C CA   . TRP A 1 42 ? -11.428 -0.759  9.479   1.00 0.00 ? 42 TRP A CA   4  
ATOM 4931  C C    . TRP A 1 42 ? -12.462 -0.901  10.593  1.00 0.00 ? 42 TRP A C    4  
ATOM 4932  O O    . TRP A 1 42 ? -13.227 0.028   10.857  1.00 0.00 ? 42 TRP A O    4  
ATOM 4933  C CB   . TRP A 1 42 ? -12.008 -1.227  8.145   1.00 0.00 ? 42 TRP A CB   4  
ATOM 4934  C CG   . TRP A 1 42 ? -13.186 -0.414  7.713   1.00 0.00 ? 42 TRP A CG   4  
ATOM 4935  C CD1  . TRP A 1 42 ? -14.455 -0.530  8.182   1.00 0.00 ? 42 TRP A CD1  4  
ATOM 4936  C CD2  . TRP A 1 42 ? -13.206 0.645   6.752   1.00 0.00 ? 42 TRP A CD2  4  
ATOM 4937  N NE1  . TRP A 1 42 ? -15.270 0.388   7.575   1.00 0.00 ? 42 TRP A NE1  4  
ATOM 4938  C CE2  . TRP A 1 42 ? -14.530 1.121   6.689   1.00 0.00 ? 42 TRP A CE2  4  
ATOM 4939  C CE3  . TRP A 1 42 ? -12.240 1.237   5.936   1.00 0.00 ? 42 TRP A CE3  4  
ATOM 4940  C CZ2  . TRP A 1 42 ? -14.910 2.159   5.845   1.00 0.00 ? 42 TRP A CZ2  4  
ATOM 4941  C CZ3  . TRP A 1 42 ? -12.619 2.269   5.100   1.00 0.00 ? 42 TRP A CZ3  4  
ATOM 4942  C CH2  . TRP A 1 42 ? -13.943 2.721   5.060   1.00 0.00 ? 42 TRP A CH2  4  
ATOM 4943  H H    . TRP A 1 42 ? -9.933  -2.243  9.229   1.00 0.00 ? 42 TRP A H    4  
ATOM 4944  H HA   . TRP A 1 42 ? -11.177 0.280   9.391   1.00 0.00 ? 42 TRP A HA   4  
ATOM 4945  H HB2  . TRP A 1 42 ? -11.249 -1.151  7.380   1.00 0.00 ? 42 TRP A HB2  4  
ATOM 4946  H HB3  . TRP A 1 42 ? -12.324 -2.256  8.234   1.00 0.00 ? 42 TRP A HB3  4  
ATOM 4947  H HD1  . TRP A 1 42 ? -14.750 -1.240  8.933   1.00 0.00 ? 42 TRP A HD1  4  
ATOM 4948  H HE1  . TRP A 1 42 ? -16.233 0.499   7.752   1.00 0.00 ? 42 TRP A HE1  4  
ATOM 4949  H HE3  . TRP A 1 42 ? -11.213 0.902   5.950   1.00 0.00 ? 42 TRP A HE3  4  
ATOM 4950  H HZ2  . TRP A 1 42 ? -15.926 2.520   5.803   1.00 0.00 ? 42 TRP A HZ2  4  
ATOM 4951  H HZ3  . TRP A 1 42 ? -11.885 2.739   4.461   1.00 0.00 ? 42 TRP A HZ3  4  
ATOM 4952  H HH2  . TRP A 1 42 ? -14.195 3.530   4.388   1.00 0.00 ? 42 TRP A HH2  4  
ATOM 4953  N N    . LYS A 1 43 ? -12.477 -2.049  11.257  1.00 0.00 ? 43 LYS A N    4  
ATOM 4954  C CA   . LYS A 1 43 ? -13.447 -2.297  12.321  1.00 0.00 ? 43 LYS A CA   4  
ATOM 4955  C C    . LYS A 1 43 ? -13.357 -1.258  13.437  1.00 0.00 ? 43 LYS A C    4  
ATOM 4956  O O    . LYS A 1 43 ? -14.345 -0.979  14.115  1.00 0.00 ? 43 LYS A O    4  
ATOM 4957  C CB   . LYS A 1 43 ? -13.274 -3.700  12.879  1.00 0.00 ? 43 LYS A CB   4  
ATOM 4958  C CG   . LYS A 1 43 ? -13.927 -4.753  12.007  1.00 0.00 ? 43 LYS A CG   4  
ATOM 4959  C CD   . LYS A 1 43 ? -13.645 -6.141  12.522  1.00 0.00 ? 43 LYS A CD   4  
ATOM 4960  C CE   . LYS A 1 43 ? -14.379 -7.196  11.706  1.00 0.00 ? 43 LYS A CE   4  
ATOM 4961  N NZ   . LYS A 1 43 ? -15.855 -7.021  11.775  1.00 0.00 ? 43 LYS A NZ   4  
ATOM 4962  H H    . LYS A 1 43 ? -11.827 -2.749  11.023  1.00 0.00 ? 43 LYS A H    4  
ATOM 4963  H HA   . LYS A 1 43 ? -14.425 -2.239  11.877  1.00 0.00 ? 43 LYS A HA   4  
ATOM 4964  H HB2  . LYS A 1 43 ? -12.219 -3.920  12.955  1.00 0.00 ? 43 LYS A HB2  4  
ATOM 4965  H HB3  . LYS A 1 43 ? -13.720 -3.746  13.861  1.00 0.00 ? 43 LYS A HB3  4  
ATOM 4966  H HG2  . LYS A 1 43 ? -14.994 -4.592  12.001  1.00 0.00 ? 43 LYS A HG2  4  
ATOM 4967  H HG3  . LYS A 1 43 ? -13.542 -4.665  11.001  1.00 0.00 ? 43 LYS A HG3  4  
ATOM 4968  H HD2  . LYS A 1 43 ? -12.587 -6.315  12.455  1.00 0.00 ? 43 LYS A HD2  4  
ATOM 4969  H HD3  . LYS A 1 43 ? -13.961 -6.204  13.551  1.00 0.00 ? 43 LYS A HD3  4  
ATOM 4970  H HE2  . LYS A 1 43 ? -14.065 -7.119  10.679  1.00 0.00 ? 43 LYS A HE2  4  
ATOM 4971  H HE3  . LYS A 1 43 ? -14.121 -8.172  12.091  1.00 0.00 ? 43 LYS A HE3  4  
ATOM 4972  H HZ1  . LYS A 1 43 ? -16.172 -7.029  12.771  1.00 0.00 ? 43 LYS A HZ1  4  
ATOM 4973  H HZ2  . LYS A 1 43 ? -16.335 -7.795  11.264  1.00 0.00 ? 43 LYS A HZ2  4  
ATOM 4974  H HZ3  . LYS A 1 43 ? -16.134 -6.114  11.339  1.00 0.00 ? 43 LYS A HZ3  4  
ATOM 4975  N N    . LEU A 1 44 ? -12.180 -0.677  13.621  1.00 0.00 ? 44 LEU A N    4  
ATOM 4976  C CA   . LEU A 1 44 ? -11.987 0.349   14.637  1.00 0.00 ? 44 LEU A CA   4  
ATOM 4977  C C    . LEU A 1 44 ? -11.595 1.679   13.996  1.00 0.00 ? 44 LEU A C    4  
ATOM 4978  O O    . LEU A 1 44 ? -11.070 2.566   14.669  1.00 0.00 ? 44 LEU A O    4  
ATOM 4979  C CB   . LEU A 1 44 ? -10.919 -0.072  15.656  1.00 0.00 ? 44 LEU A CB   4  
ATOM 4980  C CG   . LEU A 1 44 ? -11.342 -1.140  16.674  1.00 0.00 ? 44 LEU A CG   4  
ATOM 4981  C CD1  . LEU A 1 44 ? -11.452 -2.512  16.024  1.00 0.00 ? 44 LEU A CD1  4  
ATOM 4982  C CD2  . LEU A 1 44 ? -10.363 -1.172  17.838  1.00 0.00 ? 44 LEU A CD2  4  
ATOM 4983  H H    . LEU A 1 44 ? -11.421 -0.939  13.054  1.00 0.00 ? 44 LEU A H    4  
ATOM 4984  H HA   . LEU A 1 44 ? -12.928 0.479   15.151  1.00 0.00 ? 44 LEU A HA   4  
ATOM 4985  H HB2  . LEU A 1 44 ? -10.065 -0.449  15.113  1.00 0.00 ? 44 LEU A HB2  4  
ATOM 4986  H HB3  . LEU A 1 44 ? -10.611 0.808   16.204  1.00 0.00 ? 44 LEU A HB3  4  
ATOM 4987  H HG   . LEU A 1 44 ? -12.315 -0.886  17.068  1.00 0.00 ? 44 LEU A HG   4  
ATOM 4988  H HD11 . LEU A 1 44 ? -10.497 -2.788  15.600  1.00 0.00 ? 44 LEU A HD11 4  
ATOM 4989  H HD12 . LEU A 1 44 ? -12.196 -2.478  15.243  1.00 0.00 ? 44 LEU A HD12 4  
ATOM 4990  H HD13 . LEU A 1 44 ? -11.740 -3.242  16.766  1.00 0.00 ? 44 LEU A HD13 4  
ATOM 4991  H HD21 . LEU A 1 44 ? -10.345 -0.205  18.319  1.00 0.00 ? 44 LEU A HD21 4  
ATOM 4992  H HD22 . LEU A 1 44 ? -9.373  -1.409  17.475  1.00 0.00 ? 44 LEU A HD22 4  
ATOM 4993  H HD23 . LEU A 1 44 ? -10.676 -1.920  18.551  1.00 0.00 ? 44 LEU A HD23 4  
ATOM 4994  N N    . LEU A 1 45 ? -11.872 1.823   12.704  1.00 0.00 ? 45 LEU A N    4  
ATOM 4995  C CA   . LEU A 1 45 ? -11.452 3.006   11.957  1.00 0.00 ? 45 LEU A CA   4  
ATOM 4996  C C    . LEU A 1 45 ? -12.381 4.189   12.218  1.00 0.00 ? 45 LEU A C    4  
ATOM 4997  O O    . LEU A 1 45 ? -13.606 4.040   12.261  1.00 0.00 ? 45 LEU A O    4  
ATOM 4998  C CB   . LEU A 1 45 ? -11.421 2.709   10.458  1.00 0.00 ? 45 LEU A CB   4  
ATOM 4999  C CG   . LEU A 1 45 ? -10.777 3.798   9.602   1.00 0.00 ? 45 LEU A CG   4  
ATOM 5000  C CD1  . LEU A 1 45 ? -9.260  3.715   9.692   1.00 0.00 ? 45 LEU A CD1  4  
ATOM 5001  C CD2  . LEU A 1 45 ? -11.247 3.694   8.161   1.00 0.00 ? 45 LEU A CD2  4  
ATOM 5002  H H    . LEU A 1 45 ? -12.377 1.120   12.240  1.00 0.00 ? 45 LEU A H    4  
ATOM 5003  H HA   . LEU A 1 45 ? -10.456 3.266   12.283  1.00 0.00 ? 45 LEU A HA   4  
ATOM 5004  H HB2  . LEU A 1 45 ? -10.875 1.791   10.306  1.00 0.00 ? 45 LEU A HB2  4  
ATOM 5005  H HB3  . LEU A 1 45 ? -12.434 2.569   10.117  1.00 0.00 ? 45 LEU A HB3  4  
ATOM 5006  H HG   . LEU A 1 45 ? -11.077 4.764   9.982   1.00 0.00 ? 45 LEU A HG   4  
ATOM 5007  H HD11 . LEU A 1 45 ? -8.933  2.733   9.384   1.00 0.00 ? 45 LEU A HD11 4  
ATOM 5008  H HD12 . LEU A 1 45 ? -8.947  3.895   10.711  1.00 0.00 ? 45 LEU A HD12 4  
ATOM 5009  H HD13 . LEU A 1 45 ? -8.817  4.459   9.045   1.00 0.00 ? 45 LEU A HD13 4  
ATOM 5010  H HD21 . LEU A 1 45 ? -10.774 4.465   7.571   1.00 0.00 ? 45 LEU A HD21 4  
ATOM 5011  H HD22 . LEU A 1 45 ? -12.320 3.820   8.119   1.00 0.00 ? 45 LEU A HD22 4  
ATOM 5012  H HD23 . LEU A 1 45 ? -10.983 2.725   7.764   1.00 0.00 ? 45 LEU A HD23 4  
ATOM 5013  N N    . SER A 1 46 ? -11.786 5.356   12.401  1.00 0.00 ? 46 SER A N    4  
ATOM 5014  C CA   . SER A 1 46 ? -12.535 6.592   12.554  1.00 0.00 ? 46 SER A CA   4  
ATOM 5015  C C    . SER A 1 46 ? -12.721 7.259   11.190  1.00 0.00 ? 46 SER A C    4  
ATOM 5016  O O    . SER A 1 46 ? -11.963 6.995   10.255  1.00 0.00 ? 46 SER A O    4  
ATOM 5017  C CB   . SER A 1 46 ? -11.784 7.527   13.500  1.00 0.00 ? 46 SER A CB   4  
ATOM 5018  O OG   . SER A 1 46 ? -11.209 6.800   14.574  1.00 0.00 ? 46 SER A OG   4  
ATOM 5019  H H    . SER A 1 46 ? -10.802 5.388   12.450  1.00 0.00 ? 46 SER A H    4  
ATOM 5020  H HA   . SER A 1 46 ? -13.501 6.356   12.974  1.00 0.00 ? 46 SER A HA   4  
ATOM 5021  H HB2  . SER A 1 46 ? -10.996 8.028   12.957  1.00 0.00 ? 46 SER A HB2  4  
ATOM 5022  H HB3  . SER A 1 46 ? -12.469 8.259   13.902  1.00 0.00 ? 46 SER A HB3  4  
ATOM 5023  H HG   . SER A 1 46 ? -10.482 6.251   14.231  1.00 0.00 ? 46 SER A HG   4  
ATOM 5024  N N    . GLU A 1 47 ? -13.717 8.128   11.077  1.00 0.00 ? 47 GLU A N    4  
ATOM 5025  C CA   . GLU A 1 47 ? -13.976 8.842   9.827   1.00 0.00 ? 47 GLU A CA   4  
ATOM 5026  C C    . GLU A 1 47 ? -12.895 9.885   9.575   1.00 0.00 ? 47 GLU A C    4  
ATOM 5027  O O    . GLU A 1 47 ? -12.625 10.250  8.432   1.00 0.00 ? 47 GLU A O    4  
ATOM 5028  C CB   . GLU A 1 47 ? -15.355 9.510   9.874   1.00 0.00 ? 47 GLU A CB   4  
ATOM 5029  C CG   . GLU A 1 47 ? -16.492 8.553   10.204  1.00 0.00 ? 47 GLU A CG   4  
ATOM 5030  C CD   . GLU A 1 47 ? -16.768 7.547   9.100   1.00 0.00 ? 47 GLU A CD   4  
ATOM 5031  O OE1  . GLU A 1 47 ? -15.857 6.780   8.742   1.00 0.00 ? 47 GLU A OE1  4  
ATOM 5032  O OE2  . GLU A 1 47 ? -17.908 7.516   8.588   1.00 0.00 ? 47 GLU A OE2  4  
ATOM 5033  H H    . GLU A 1 47 ? -14.294 8.294   11.853  1.00 0.00 ? 47 GLU A H    4  
ATOM 5034  H HA   . GLU A 1 47 ? -13.952 8.124   9.015   1.00 0.00 ? 47 GLU A HA   4  
ATOM 5035  H HB2  . GLU A 1 47 ? -15.339 10.288  10.623  1.00 0.00 ? 47 GLU A HB2  4  
ATOM 5036  H HB3  . GLU A 1 47 ? -15.558 9.955   8.911   1.00 0.00 ? 47 GLU A HB3  4  
ATOM 5037  H HG2  . GLU A 1 47 ? -16.236 8.011   11.103  1.00 0.00 ? 47 GLU A HG2  4  
ATOM 5038  H HG3  . GLU A 1 47 ? -17.389 9.128   10.378  1.00 0.00 ? 47 GLU A HG3  4  
ATOM 5039  N N    . THR A 1 48 ? -12.276 10.368  10.645  1.00 0.00 ? 48 THR A N    4  
ATOM 5040  C CA   . THR A 1 48 ? -11.139 11.269  10.522  1.00 0.00 ? 48 THR A CA   4  
ATOM 5041  C C    . THR A 1 48 ? -9.955  10.526  9.898   1.00 0.00 ? 48 THR A C    4  
ATOM 5042  O O    . THR A 1 48 ? -9.136  11.109  9.184   1.00 0.00 ? 48 THR A O    4  
ATOM 5043  C CB   . THR A 1 48 ? -10.735 11.874  11.893  1.00 0.00 ? 48 THR A CB   4  
ATOM 5044  O OG1  . THR A 1 48 ? -9.715  12.863  11.723  1.00 0.00 ? 48 THR A OG1  4  
ATOM 5045  C CG2  . THR A 1 48 ? -10.235 10.805  12.852  1.00 0.00 ? 48 THR A CG2  4  
ATOM 5046  H H    . THR A 1 48 ? -12.605 10.126  11.540  1.00 0.00 ? 48 THR A H    4  
ATOM 5047  H HA   . THR A 1 48 ? -11.428 12.076  9.864   1.00 0.00 ? 48 THR A HA   4  
ATOM 5048  H HB   . THR A 1 48 ? -11.605 12.346  12.330  1.00 0.00 ? 48 THR A HB   4  
ATOM 5049  H HG1  . THR A 1 48 ? -10.105 13.677  11.372  1.00 0.00 ? 48 THR A HG1  4  
ATOM 5050  H HG21 . THR A 1 48 ? -9.367  10.319  12.431  1.00 0.00 ? 48 THR A HG21 4  
ATOM 5051  H HG22 . THR A 1 48 ? -11.013 10.073  13.015  1.00 0.00 ? 48 THR A HG22 4  
ATOM 5052  H HG23 . THR A 1 48 ? -9.969  11.263  13.794  1.00 0.00 ? 48 THR A HG23 4  
ATOM 5053  N N    . GLU A 1 49 ? -9.905  9.221   10.148  1.00 0.00 ? 49 GLU A N    4  
ATOM 5054  C CA   . GLU A 1 49 ? -8.854  8.363   9.620   1.00 0.00 ? 49 GLU A CA   4  
ATOM 5055  C C    . GLU A 1 49 ? -9.110  8.038   8.150   1.00 0.00 ? 49 GLU A C    4  
ATOM 5056  O O    . GLU A 1 49 ? -8.243  7.501   7.466   1.00 0.00 ? 49 GLU A O    4  
ATOM 5057  C CB   . GLU A 1 49 ? -8.745  7.078   10.444  1.00 0.00 ? 49 GLU A CB   4  
ATOM 5058  C CG   . GLU A 1 49 ? -8.353  7.314   11.893  1.00 0.00 ? 49 GLU A CG   4  
ATOM 5059  C CD   . GLU A 1 49 ? -8.237  6.028   12.687  1.00 0.00 ? 49 GLU A CD   4  
ATOM 5060  O OE1  . GLU A 1 49 ? -9.257  5.572   13.242  1.00 0.00 ? 49 GLU A OE1  4  
ATOM 5061  O OE2  . GLU A 1 49 ? -7.121  5.474   12.778  1.00 0.00 ? 49 GLU A OE2  4  
ATOM 5062  H H    . GLU A 1 49 ? -10.605 8.820   10.703  1.00 0.00 ? 49 GLU A H    4  
ATOM 5063  H HA   . GLU A 1 49 ? -7.923  8.903   9.694   1.00 0.00 ? 49 GLU A HA   4  
ATOM 5064  H HB2  . GLU A 1 49 ? -9.699  6.572   10.429  1.00 0.00 ? 49 GLU A HB2  4  
ATOM 5065  H HB3  . GLU A 1 49 ? -8.003  6.437   9.992   1.00 0.00 ? 49 GLU A HB3  4  
ATOM 5066  H HG2  . GLU A 1 49 ? -7.400  7.822   11.916  1.00 0.00 ? 49 GLU A HG2  4  
ATOM 5067  H HG3  . GLU A 1 49 ? -9.102  7.940   12.355  1.00 0.00 ? 49 GLU A HG3  4  
ATOM 5068  N N    . LYS A 1 50 ? -10.314 8.351   7.678   1.00 0.00 ? 50 LYS A N    4  
ATOM 5069  C CA   . LYS A 1 50 ? -10.688 8.118   6.283   1.00 0.00 ? 50 LYS A CA   4  
ATOM 5070  C C    . LYS A 1 50 ? -9.867  8.978   5.315   1.00 0.00 ? 50 LYS A C    4  
ATOM 5071  O O    . LYS A 1 50 ? -9.827  8.705   4.117   1.00 0.00 ? 50 LYS A O    4  
ATOM 5072  C CB   . LYS A 1 50 ? -12.171 8.417   6.067   1.00 0.00 ? 50 LYS A CB   4  
ATOM 5073  C CG   . LYS A 1 50 ? -13.048 7.185   5.945   1.00 0.00 ? 50 LYS A CG   4  
ATOM 5074  C CD   . LYS A 1 50 ? -14.401 7.554   5.365   1.00 0.00 ? 50 LYS A CD   4  
ATOM 5075  C CE   . LYS A 1 50 ? -15.291 6.339   5.158   1.00 0.00 ? 50 LYS A CE   4  
ATOM 5076  N NZ   . LYS A 1 50 ? -15.633 5.655   6.434   1.00 0.00 ? 50 LYS A NZ   4  
ATOM 5077  H H    . LYS A 1 50 ? -10.970 8.753   8.284   1.00 0.00 ? 50 LYS A H    4  
ATOM 5078  H HA   . LYS A 1 50 ? -10.516 7.079   6.069   1.00 0.00 ? 50 LYS A HA   4  
ATOM 5079  H HB2  . LYS A 1 50 ? -12.531 9.002   6.900   1.00 0.00 ? 50 LYS A HB2  4  
ATOM 5080  H HB3  . LYS A 1 50 ? -12.283 8.998   5.164   1.00 0.00 ? 50 LYS A HB3  4  
ATOM 5081  H HG2  . LYS A 1 50 ? -12.565 6.468   5.295   1.00 0.00 ? 50 LYS A HG2  4  
ATOM 5082  H HG3  . LYS A 1 50 ? -13.188 6.753   6.925   1.00 0.00 ? 50 LYS A HG3  4  
ATOM 5083  H HD2  . LYS A 1 50 ? -14.893 8.238   6.035   1.00 0.00 ? 50 LYS A HD2  4  
ATOM 5084  H HD3  . LYS A 1 50 ? -14.246 8.037   4.412   1.00 0.00 ? 50 LYS A HD3  4  
ATOM 5085  H HE2  . LYS A 1 50 ? -16.205 6.658   4.679   1.00 0.00 ? 50 LYS A HE2  4  
ATOM 5086  H HE3  . LYS A 1 50 ? -14.775 5.642   4.514   1.00 0.00 ? 50 LYS A HE3  4  
ATOM 5087  H HZ1  . LYS A 1 50 ? -15.926 6.353   7.156   1.00 0.00 ? 50 LYS A HZ1  4  
ATOM 5088  H HZ2  . LYS A 1 50 ? -14.810 5.131   6.800   1.00 0.00 ? 50 LYS A HZ2  4  
ATOM 5089  H HZ3  . LYS A 1 50 ? -16.416 4.986   6.282   1.00 0.00 ? 50 LYS A HZ3  4  
ATOM 5090  N N    . ARG A 1 51 ? -9.214  10.011  5.842   1.00 0.00 ? 51 ARG A N    4  
ATOM 5091  C CA   . ARG A 1 51 ? -8.510  10.993  5.010   1.00 0.00 ? 51 ARG A CA   4  
ATOM 5092  C C    . ARG A 1 51 ? -7.437  10.361  4.105   1.00 0.00 ? 51 ARG A C    4  
ATOM 5093  O O    . ARG A 1 51 ? -7.477  10.558  2.891   1.00 0.00 ? 51 ARG A O    4  
ATOM 5094  C CB   . ARG A 1 51 ? -7.900  12.100  5.883   1.00 0.00 ? 51 ARG A CB   4  
ATOM 5095  C CG   . ARG A 1 51 ? -7.083  13.129  5.110   1.00 0.00 ? 51 ARG A CG   4  
ATOM 5096  C CD   . ARG A 1 51 ? -7.895  13.797  4.008   1.00 0.00 ? 51 ARG A CD   4  
ATOM 5097  N NE   . ARG A 1 51 ? -9.111  14.426  4.517   1.00 0.00 ? 51 ARG A NE   4  
ATOM 5098  C CZ   . ARG A 1 51 ? -9.686  15.497  3.974   1.00 0.00 ? 51 ARG A CZ   4  
ATOM 5099  N NH1  . ARG A 1 51 ? -9.126  16.111  2.936   1.00 0.00 ? 51 ARG A NH1  4  
ATOM 5100  N NH2  . ARG A 1 51 ? -10.816 15.960  4.485   1.00 0.00 ? 51 ARG A NH2  4  
ATOM 5101  H H    . ARG A 1 51 ? -9.204  10.118  6.816   1.00 0.00 ? 51 ARG A H    4  
ATOM 5102  H HA   . ARG A 1 51 ? -9.252  11.443  4.370   1.00 0.00 ? 51 ARG A HA   4  
ATOM 5103  H HB2  . ARG A 1 51 ? -8.698  12.619  6.390   1.00 0.00 ? 51 ARG A HB2  4  
ATOM 5104  H HB3  . ARG A 1 51 ? -7.255  11.643  6.621   1.00 0.00 ? 51 ARG A HB3  4  
ATOM 5105  H HG2  . ARG A 1 51 ? -6.740  13.888  5.796   1.00 0.00 ? 51 ARG A HG2  4  
ATOM 5106  H HG3  . ARG A 1 51 ? -6.231  12.634  4.666   1.00 0.00 ? 51 ARG A HG3  4  
ATOM 5107  H HD2  . ARG A 1 51 ? -7.283  14.553  3.537   1.00 0.00 ? 51 ARG A HD2  4  
ATOM 5108  H HD3  . ARG A 1 51 ? -8.165  13.051  3.275   1.00 0.00 ? 51 ARG A HD3  4  
ATOM 5109  H HE   . ARG A 1 51 ? -9.537  14.013  5.310   1.00 0.00 ? 51 ARG A HE   4  
ATOM 5110  H HH11 . ARG A 1 51 ? -8.257  15.775  2.557   1.00 0.00 ? 51 ARG A HH11 4  
ATOM 5111  H HH12 . ARG A 1 51 ? -9.573  16.914  2.521   1.00 0.00 ? 51 ARG A HH12 4  
ATOM 5112  H HH21 . ARG A 1 51 ? -11.238 15.501  5.277   1.00 0.00 ? 51 ARG A HH21 4  
ATOM 5113  H HH22 . ARG A 1 51 ? -11.256 16.777  4.095   1.00 0.00 ? 51 ARG A HH22 4  
ATOM 5114  N N    . PRO A 1 52 ? -6.453  9.611   4.652   1.00 0.00 ? 52 PRO A N    4  
ATOM 5115  C CA   . PRO A 1 52 ? -5.394  9.016   3.831   1.00 0.00 ? 52 PRO A CA   4  
ATOM 5116  C C    . PRO A 1 52 ? -5.925  8.031   2.804   1.00 0.00 ? 52 PRO A C    4  
ATOM 5117  O O    . PRO A 1 52 ? -5.320  7.840   1.754   1.00 0.00 ? 52 PRO A O    4  
ATOM 5118  C CB   . PRO A 1 52 ? -4.482  8.310   4.840   1.00 0.00 ? 52 PRO A CB   4  
ATOM 5119  C CG   . PRO A 1 52 ? -5.309  8.149   6.068   1.00 0.00 ? 52 PRO A CG   4  
ATOM 5120  C CD   . PRO A 1 52 ? -6.263  9.311   6.081   1.00 0.00 ? 52 PRO A CD   4  
ATOM 5121  H HA   . PRO A 1 52 ? -4.845  9.780   3.313   1.00 0.00 ? 52 PRO A HA   4  
ATOM 5122  H HB2  . PRO A 1 52 ? -4.176  7.353   4.442   1.00 0.00 ? 52 PRO A HB2  4  
ATOM 5123  H HB3  . PRO A 1 52 ? -3.611  8.921   5.031   1.00 0.00 ? 52 PRO A HB3  4  
ATOM 5124  H HG2  . PRO A 1 52 ? -5.853  7.216   6.025   1.00 0.00 ? 52 PRO A HG2  4  
ATOM 5125  H HG3  . PRO A 1 52 ? -4.677  8.176   6.942   1.00 0.00 ? 52 PRO A HG3  4  
ATOM 5126  H HD2  . PRO A 1 52 ? -7.196  9.029   6.544   1.00 0.00 ? 52 PRO A HD2  4  
ATOM 5127  H HD3  . PRO A 1 52 ? -5.824  10.153  6.596   1.00 0.00 ? 52 PRO A HD3  4  
ATOM 5128  N N    . PHE A 1 53 ? -7.069  7.430   3.102   1.00 0.00 ? 53 PHE A N    4  
ATOM 5129  C CA   . PHE A 1 53 ? -7.742  6.555   2.154   1.00 0.00 ? 53 PHE A CA   4  
ATOM 5130  C C    . PHE A 1 53 ? -8.053  7.317   0.881   1.00 0.00 ? 53 PHE A C    4  
ATOM 5131  O O    . PHE A 1 53 ? -7.950  6.794   -0.224  1.00 0.00 ? 53 PHE A O    4  
ATOM 5132  C CB   . PHE A 1 53 ? -9.051  6.048   2.738   1.00 0.00 ? 53 PHE A CB   4  
ATOM 5133  C CG   . PHE A 1 53 ? -8.909  5.074   3.864   1.00 0.00 ? 53 PHE A CG   4  
ATOM 5134  C CD1  . PHE A 1 53 ? -8.264  5.420   5.041   1.00 0.00 ? 53 PHE A CD1  4  
ATOM 5135  C CD2  . PHE A 1 53 ? -9.450  3.811   3.745   1.00 0.00 ? 53 PHE A CD2  4  
ATOM 5136  C CE1  . PHE A 1 53 ? -8.161  4.518   6.079   1.00 0.00 ? 53 PHE A CE1  4  
ATOM 5137  C CE2  . PHE A 1 53 ? -9.348  2.902   4.781   1.00 0.00 ? 53 PHE A CE2  4  
ATOM 5138  C CZ   . PHE A 1 53 ? -8.703  3.256   5.949   1.00 0.00 ? 53 PHE A CZ   4  
ATOM 5139  H H    . PHE A 1 53 ? -7.475  7.585   3.980   1.00 0.00 ? 53 PHE A H    4  
ATOM 5140  H HA   . PHE A 1 53 ? -7.095  5.719   1.932   1.00 0.00 ? 53 PHE A HA   4  
ATOM 5141  H HB2  . PHE A 1 53 ? -9.618  6.889   3.106   1.00 0.00 ? 53 PHE A HB2  4  
ATOM 5142  H HB3  . PHE A 1 53 ? -9.615  5.563   1.954   1.00 0.00 ? 53 PHE A HB3  4  
ATOM 5143  H HD1  . PHE A 1 53 ? -7.838  6.409   5.142   1.00 0.00 ? 53 PHE A HD1  4  
ATOM 5144  H HD2  . PHE A 1 53 ? -9.954  3.536   2.818   1.00 0.00 ? 53 PHE A HD2  4  
ATOM 5145  H HE1  . PHE A 1 53 ? -7.654  4.799   6.991   1.00 0.00 ? 53 PHE A HE1  4  
ATOM 5146  H HE2  . PHE A 1 53 ? -9.772  1.915   4.677   1.00 0.00 ? 53 PHE A HE2  4  
ATOM 5147  H HZ   . PHE A 1 53 ? -8.623  2.548   6.760   1.00 0.00 ? 53 PHE A HZ   4  
ATOM 5148  N N    . ILE A 1 54 ? -8.396  8.580   1.053   1.00 0.00 ? 54 ILE A N    4  
ATOM 5149  C CA   . ILE A 1 54 ? -8.833  9.398   -0.056  1.00 0.00 ? 54 ILE A CA   4  
ATOM 5150  C C    . ILE A 1 54 ? -7.622  9.704   -0.947  1.00 0.00 ? 54 ILE A C    4  
ATOM 5151  O O    . ILE A 1 54 ? -7.735  9.850   -2.165  1.00 0.00 ? 54 ILE A O    4  
ATOM 5152  C CB   . ILE A 1 54 ? -9.495  10.707  0.439   1.00 0.00 ? 54 ILE A CB   4  
ATOM 5153  C CG1  . ILE A 1 54 ? -10.684 10.385  1.360   1.00 0.00 ? 54 ILE A CG1  4  
ATOM 5154  C CG2  . ILE A 1 54 ? -9.945  11.569  -0.734  1.00 0.00 ? 54 ILE A CG2  4  
ATOM 5155  C CD1  . ILE A 1 54 ? -11.783 9.582   0.691   1.00 0.00 ? 54 ILE A CD1  4  
ATOM 5156  H H    . ILE A 1 54 ? -8.303  8.987   1.950   1.00 0.00 ? 54 ILE A H    4  
ATOM 5157  H HA   . ILE A 1 54 ? -9.574  8.825   -0.617  1.00 0.00 ? 54 ILE A HA   4  
ATOM 5158  H HB   . ILE A 1 54 ? -8.760  11.265  0.999   1.00 0.00 ? 54 ILE A HB   4  
ATOM 5159  H HG12 . ILE A 1 54 ? -10.329 9.812   2.204   1.00 0.00 ? 54 ILE A HG12 4  
ATOM 5160  H HG13 . ILE A 1 54 ? -11.117 11.307  1.718   1.00 0.00 ? 54 ILE A HG13 4  
ATOM 5161  H HG21 . ILE A 1 54 ? -10.660 11.019  -1.331  1.00 0.00 ? 54 ILE A HG21 4  
ATOM 5162  H HG22 . ILE A 1 54 ? -9.090  11.822  -1.341  1.00 0.00 ? 54 ILE A HG22 4  
ATOM 5163  H HG23 . ILE A 1 54 ? -10.404 12.473  -0.363  1.00 0.00 ? 54 ILE A HG23 4  
ATOM 5164  H HD11 . ILE A 1 54 ? -12.580 9.404   1.399   1.00 0.00 ? 54 ILE A HD11 4  
ATOM 5165  H HD12 . ILE A 1 54 ? -11.386 8.637   0.352   1.00 0.00 ? 54 ILE A HD12 4  
ATOM 5166  H HD13 . ILE A 1 54 ? -12.170 10.134  -0.153  1.00 0.00 ? 54 ILE A HD13 4  
ATOM 5167  N N    . ASP A 1 55 ? -6.456  9.776   -0.304  1.00 0.00 ? 55 ASP A N    4  
ATOM 5168  C CA   . ASP A 1 55 ? -5.197  10.062  -0.988  1.00 0.00 ? 55 ASP A CA   4  
ATOM 5169  C C    . ASP A 1 55 ? -4.751  8.880   -1.848  1.00 0.00 ? 55 ASP A C    4  
ATOM 5170  O O    . ASP A 1 55 ? -4.340  9.066   -2.995  1.00 0.00 ? 55 ASP A O    4  
ATOM 5171  C CB   . ASP A 1 55 ? -4.114  10.422  0.030   1.00 0.00 ? 55 ASP A CB   4  
ATOM 5172  C CG   . ASP A 1 55 ? -2.792  10.783  -0.616  1.00 0.00 ? 55 ASP A CG   4  
ATOM 5173  O OD1  . ASP A 1 55 ? -2.648  11.938  -1.081  1.00 0.00 ? 55 ASP A OD1  4  
ATOM 5174  O OD2  . ASP A 1 55 ? -1.885  9.924   -0.639  1.00 0.00 ? 55 ASP A OD2  4  
ATOM 5175  H H    . ASP A 1 55 ? -6.441  9.616   0.662   1.00 0.00 ? 55 ASP A H    4  
ATOM 5176  H HA   . ASP A 1 55 ? -5.363  10.908  -1.634  1.00 0.00 ? 55 ASP A HA   4  
ATOM 5177  H HB2  . ASP A 1 55 ? -4.447  11.265  0.613   1.00 0.00 ? 55 ASP A HB2  4  
ATOM 5178  H HB3  . ASP A 1 55 ? -3.954  9.577   0.687   1.00 0.00 ? 55 ASP A HB3  4  
ATOM 5179  N N    . GLU A 1 56 ? -4.852  7.668   -1.297  1.00 0.00 ? 56 GLU A N    4  
ATOM 5180  C CA   . GLU A 1 56 ? -4.559  6.440   -2.052  1.00 0.00 ? 56 GLU A CA   4  
ATOM 5181  C C    . GLU A 1 56 ? -5.408  6.415   -3.326  1.00 0.00 ? 56 GLU A C    4  
ATOM 5182  O O    . GLU A 1 56 ? -4.953  5.981   -4.384  1.00 0.00 ? 56 GLU A O    4  
ATOM 5183  C CB   . GLU A 1 56 ? -4.870  5.204   -1.204  1.00 0.00 ? 56 GLU A CB   4  
ATOM 5184  C CG   . GLU A 1 56 ? -4.390  5.296   0.241   1.00 0.00 ? 56 GLU A CG   4  
ATOM 5185  C CD   . GLU A 1 56 ? -2.955  5.786   0.390   1.00 0.00 ? 56 GLU A CD   4  
ATOM 5186  O OE1  . GLU A 1 56 ? -2.168  5.694   -0.575  1.00 0.00 ? 56 GLU A OE1  4  
ATOM 5187  O OE2  . GLU A 1 56 ? -2.604  6.268   1.488   1.00 0.00 ? 56 GLU A OE2  4  
ATOM 5188  H H    . GLU A 1 56 ? -5.125  7.593   -0.355  1.00 0.00 ? 56 GLU A H    4  
ATOM 5189  H HA   . GLU A 1 56 ? -3.498  6.418   -2.320  1.00 0.00 ? 56 GLU A HA   4  
ATOM 5190  H HB2  . GLU A 1 56 ? -5.938  5.052   -1.193  1.00 0.00 ? 56 GLU A HB2  4  
ATOM 5191  H HB3  . GLU A 1 56 ? -4.398  4.346   -1.660  1.00 0.00 ? 56 GLU A HB3  4  
ATOM 5192  H HG2  . GLU A 1 56 ? -5.037  5.979   0.771   1.00 0.00 ? 56 GLU A HG2  4  
ATOM 5193  H HG3  . GLU A 1 56 ? -4.465  4.317   0.689   1.00 0.00 ? 56 GLU A HG3  4  
ATOM 5194  N N    . ALA A 1 57 ? -6.643  6.911   -3.208  1.00 0.00 ? 57 ALA A N    4  
ATOM 5195  C CA   . ALA A 1 57 ? -7.569  6.997   -4.339  1.00 0.00 ? 57 ALA A CA   4  
ATOM 5196  C C    . ALA A 1 57 ? -7.048  7.939   -5.422  1.00 0.00 ? 57 ALA A C    4  
ATOM 5197  O O    . ALA A 1 57 ? -7.074  7.604   -6.607  1.00 0.00 ? 57 ALA A O    4  
ATOM 5198  C CB   . ALA A 1 57 ? -8.942  7.456   -3.870  1.00 0.00 ? 57 ALA A CB   4  
ATOM 5199  H H    . ALA A 1 57 ? -6.945  7.220   -2.322  1.00 0.00 ? 57 ALA A H    4  
ATOM 5200  H HA   . ALA A 1 57 ? -7.673  6.007   -4.760  1.00 0.00 ? 57 ALA A HA   4  
ATOM 5201  H HB1  . ALA A 1 57 ? -9.301  6.787   -3.103  1.00 0.00 ? 57 ALA A HB1  4  
ATOM 5202  H HB2  . ALA A 1 57 ? -9.629  7.450   -4.705  1.00 0.00 ? 57 ALA A HB2  4  
ATOM 5203  H HB3  . ALA A 1 57 ? -8.871  8.456   -3.469  1.00 0.00 ? 57 ALA A HB3  4  
ATOM 5204  N N    . LYS A 1 58 ? -6.575  9.115   -5.011  1.00 0.00 ? 58 LYS A N    4  
ATOM 5205  C CA   . LYS A 1 58 ? -6.029  10.092  -5.953  1.00 0.00 ? 58 LYS A CA   4  
ATOM 5206  C C    . LYS A 1 58 ? -4.870  9.486   -6.733  1.00 0.00 ? 58 LYS A C    4  
ATOM 5207  O O    . LYS A 1 58 ? -4.719  9.720   -7.934  1.00 0.00 ? 58 LYS A O    4  
ATOM 5208  C CB   . LYS A 1 58 ? -5.549  11.351  -5.225  1.00 0.00 ? 58 LYS A CB   4  
ATOM 5209  C CG   . LYS A 1 58 ? -6.660  12.159  -4.577  1.00 0.00 ? 58 LYS A CG   4  
ATOM 5210  C CD   . LYS A 1 58 ? -6.105  13.401  -3.895  1.00 0.00 ? 58 LYS A CD   4  
ATOM 5211  C CE   . LYS A 1 58 ? -5.166  13.036  -2.757  1.00 0.00 ? 58 LYS A CE   4  
ATOM 5212  N NZ   . LYS A 1 58 ? -4.424  14.208  -2.231  1.00 0.00 ? 58 LYS A NZ   4  
ATOM 5213  H H    . LYS A 1 58 ? -6.591  9.330   -4.053  1.00 0.00 ? 58 LYS A H    4  
ATOM 5214  H HA   . LYS A 1 58 ? -6.812  10.362  -6.644  1.00 0.00 ? 58 LYS A HA   4  
ATOM 5215  H HB2  . LYS A 1 58 ? -4.850  11.062  -4.455  1.00 0.00 ? 58 LYS A HB2  4  
ATOM 5216  H HB3  . LYS A 1 58 ? -5.041  11.987  -5.935  1.00 0.00 ? 58 LYS A HB3  4  
ATOM 5217  H HG2  . LYS A 1 58 ? -7.363  12.461  -5.340  1.00 0.00 ? 58 LYS A HG2  4  
ATOM 5218  H HG3  . LYS A 1 58 ? -7.161  11.544  -3.842  1.00 0.00 ? 58 LYS A HG3  4  
ATOM 5219  H HD2  . LYS A 1 58 ? -5.563  13.987  -4.622  1.00 0.00 ? 58 LYS A HD2  4  
ATOM 5220  H HD3  . LYS A 1 58 ? -6.926  13.982  -3.502  1.00 0.00 ? 58 LYS A HD3  4  
ATOM 5221  H HE2  . LYS A 1 58 ? -5.751  12.615  -1.955  1.00 0.00 ? 58 LYS A HE2  4  
ATOM 5222  H HE3  . LYS A 1 58 ? -4.459  12.302  -3.111  1.00 0.00 ? 58 LYS A HE3  4  
ATOM 5223  H HZ1  . LYS A 1 58 ? -5.086  14.904  -1.824  1.00 0.00 ? 58 LYS A HZ1  4  
ATOM 5224  H HZ2  . LYS A 1 58 ? -3.882  14.664  -2.998  1.00 0.00 ? 58 LYS A HZ2  4  
ATOM 5225  H HZ3  . LYS A 1 58 ? -3.758  13.906  -1.491  1.00 0.00 ? 58 LYS A HZ3  4  
ATOM 5226  N N    . ARG A 1 59 ? -4.064  8.695   -6.040  1.00 0.00 ? 59 ARG A N    4  
ATOM 5227  C CA   . ARG A 1 59 ? -2.911  8.057   -6.650  1.00 0.00 ? 59 ARG A CA   4  
ATOM 5228  C C    . ARG A 1 59 ? -3.356  7.000   -7.653  1.00 0.00 ? 59 ARG A C    4  
ATOM 5229  O O    . ARG A 1 59 ? -2.745  6.840   -8.708  1.00 0.00 ? 59 ARG A O    4  
ATOM 5230  C CB   . ARG A 1 59 ? -2.017  7.438   -5.576  1.00 0.00 ? 59 ARG A CB   4  
ATOM 5231  C CG   . ARG A 1 59 ? -1.678  8.403   -4.455  1.00 0.00 ? 59 ARG A CG   4  
ATOM 5232  C CD   . ARG A 1 59 ? -0.604  7.850   -3.540  1.00 0.00 ? 59 ARG A CD   4  
ATOM 5233  N NE   . ARG A 1 59 ? 0.718   7.899   -4.158  1.00 0.00 ? 59 ARG A NE   4  
ATOM 5234  C CZ   . ARG A 1 59 ? 1.836   8.137   -3.481  1.00 0.00 ? 59 ARG A CZ   4  
ATOM 5235  N NH1  . ARG A 1 59 ? 1.794   8.297   -2.162  1.00 0.00 ? 59 ARG A NH1  4  
ATOM 5236  N NH2  . ARG A 1 59 ? 2.995   8.202   -4.120  1.00 0.00 ? 59 ARG A NH2  4  
ATOM 5237  H H    . ARG A 1 59 ? -4.252  8.537   -5.088  1.00 0.00 ? 59 ARG A H    4  
ATOM 5238  H HA   . ARG A 1 59 ? -2.354  8.819   -7.173  1.00 0.00 ? 59 ARG A HA   4  
ATOM 5239  H HB2  . ARG A 1 59 ? -2.523  6.584   -5.150  1.00 0.00 ? 59 ARG A HB2  4  
ATOM 5240  H HB3  . ARG A 1 59 ? -1.096  7.111   -6.032  1.00 0.00 ? 59 ARG A HB3  4  
ATOM 5241  H HG2  . ARG A 1 59 ? -1.323  9.326   -4.888  1.00 0.00 ? 59 ARG A HG2  4  
ATOM 5242  H HG3  . ARG A 1 59 ? -2.569  8.594   -3.876  1.00 0.00 ? 59 ARG A HG3  4  
ATOM 5243  H HD2  . ARG A 1 59 ? -0.588  8.434   -2.632  1.00 0.00 ? 59 ARG A HD2  4  
ATOM 5244  H HD3  . ARG A 1 59 ? -0.841  6.823   -3.302  1.00 0.00 ? 59 ARG A HD3  4  
ATOM 5245  H HE   . ARG A 1 59 ? 0.767   7.764   -5.138  1.00 0.00 ? 59 ARG A HE   4  
ATOM 5246  H HH11 . ARG A 1 59 ? 0.914   8.236   -1.672  1.00 0.00 ? 59 ARG A HH11 4  
ATOM 5247  H HH12 . ARG A 1 59 ? 2.632   8.494   -1.644  1.00 0.00 ? 59 ARG A HH12 4  
ATOM 5248  H HH21 . ARG A 1 59 ? 3.030   8.069   -5.118  1.00 0.00 ? 59 ARG A HH21 4  
ATOM 5249  H HH22 . ARG A 1 59 ? 3.845   8.390   -3.616  1.00 0.00 ? 59 ARG A HH22 4  
ATOM 5250  N N    . LEU A 1 60 ? -4.441  6.296   -7.329  1.00 0.00 ? 60 LEU A N    4  
ATOM 5251  C CA   . LEU A 1 60 ? -5.000  5.286   -8.225  1.00 0.00 ? 60 LEU A CA   4  
ATOM 5252  C C    . LEU A 1 60 ? -5.374  5.902   -9.564  1.00 0.00 ? 60 LEU A C    4  
ATOM 5253  O O    . LEU A 1 60 ? -5.194  5.282   -10.614 1.00 0.00 ? 60 LEU A O    4  
ATOM 5254  C CB   . LEU A 1 60 ? -6.241  4.630   -7.608  1.00 0.00 ? 60 LEU A CB   4  
ATOM 5255  C CG   . LEU A 1 60 ? -6.011  3.897   -6.288  1.00 0.00 ? 60 LEU A CG   4  
ATOM 5256  C CD1  . LEU A 1 60 ? -7.306  3.266   -5.800  1.00 0.00 ? 60 LEU A CD1  4  
ATOM 5257  C CD2  . LEU A 1 60 ? -4.920  2.846   -6.443  1.00 0.00 ? 60 LEU A CD2  4  
ATOM 5258  H H    . LEU A 1 60 ? -4.877  6.458   -6.462  1.00 0.00 ? 60 LEU A H    4  
ATOM 5259  H HA   . LEU A 1 60 ? -4.245  4.531   -8.385  1.00 0.00 ? 60 LEU A HA   4  
ATOM 5260  H HB2  . LEU A 1 60 ? -6.981  5.398   -7.443  1.00 0.00 ? 60 LEU A HB2  4  
ATOM 5261  H HB3  . LEU A 1 60 ? -6.637  3.921   -8.319  1.00 0.00 ? 60 LEU A HB3  4  
ATOM 5262  H HG   . LEU A 1 60 ? -5.691  4.611   -5.543  1.00 0.00 ? 60 LEU A HG   4  
ATOM 5263  H HD11 . LEU A 1 60 ? -7.689  2.600   -6.559  1.00 0.00 ? 60 LEU A HD11 4  
ATOM 5264  H HD12 . LEU A 1 60 ? -8.031  4.040   -5.601  1.00 0.00 ? 60 LEU A HD12 4  
ATOM 5265  H HD13 . LEU A 1 60 ? -7.116  2.709   -4.894  1.00 0.00 ? 60 LEU A HD13 4  
ATOM 5266  H HD21 . LEU A 1 60 ? -4.787  2.325   -5.505  1.00 0.00 ? 60 LEU A HD21 4  
ATOM 5267  H HD22 . LEU A 1 60 ? -3.994  3.326   -6.723  1.00 0.00 ? 60 LEU A HD22 4  
ATOM 5268  H HD23 . LEU A 1 60 ? -5.207  2.140   -7.207  1.00 0.00 ? 60 LEU A HD23 4  
ATOM 5269  N N    . ARG A 1 61 ? -5.892  7.123   -9.526  1.00 0.00 ? 61 ARG A N    4  
ATOM 5270  C CA   . ARG A 1 61 ? -6.309  7.815   -10.740 1.00 0.00 ? 61 ARG A CA   4  
ATOM 5271  C C    . ARG A 1 61 ? -5.087  8.194   -11.575 1.00 0.00 ? 61 ARG A C    4  
ATOM 5272  O O    . ARG A 1 61 ? -5.065  7.988   -12.791 1.00 0.00 ? 61 ARG A O    4  
ATOM 5273  C CB   . ARG A 1 61 ? -7.125  9.067   -10.388 1.00 0.00 ? 61 ARG A CB   4  
ATOM 5274  C CG   . ARG A 1 61 ? -8.324  9.304   -11.299 1.00 0.00 ? 61 ARG A CG   4  
ATOM 5275  C CD   . ARG A 1 61 ? -7.909  9.607   -12.730 1.00 0.00 ? 61 ARG A CD   4  
ATOM 5276  N NE   . ARG A 1 61 ? -7.244  10.904  -12.851 1.00 0.00 ? 61 ARG A NE   4  
ATOM 5277  C CZ   . ARG A 1 61 ? -6.791  11.409  -13.999 1.00 0.00 ? 61 ARG A CZ   4  
ATOM 5278  N NH1  . ARG A 1 61 ? -6.886  10.715  -15.127 1.00 0.00 ? 61 ARG A NH1  4  
ATOM 5279  N NH2  . ARG A 1 61 ? -6.236  12.611  -14.014 1.00 0.00 ? 61 ARG A NH2  4  
ATOM 5280  H H    . ARG A 1 61 ? -5.998  7.569   -8.655  1.00 0.00 ? 61 ARG A H    4  
ATOM 5281  H HA   . ARG A 1 61 ? -6.928  7.138   -11.313 1.00 0.00 ? 61 ARG A HA   4  
ATOM 5282  H HB2  . ARG A 1 61 ? -7.483  8.976   -9.373  1.00 0.00 ? 61 ARG A HB2  4  
ATOM 5283  H HB3  . ARG A 1 61 ? -6.478  9.929   -10.453 1.00 0.00 ? 61 ARG A HB3  4  
ATOM 5284  H HG2  . ARG A 1 61 ? -8.942  8.419   -11.297 1.00 0.00 ? 61 ARG A HG2  4  
ATOM 5285  H HG3  . ARG A 1 61 ? -8.892  10.139  -10.915 1.00 0.00 ? 61 ARG A HG3  4  
ATOM 5286  H HD2  . ARG A 1 61 ? -7.231  8.835   -13.064 1.00 0.00 ? 61 ARG A HD2  4  
ATOM 5287  H HD3  . ARG A 1 61 ? -8.790  9.603   -13.355 1.00 0.00 ? 61 ARG A HD3  4  
ATOM 5288  H HE   . ARG A 1 61 ? -7.143  11.439  -12.027 1.00 0.00 ? 61 ARG A HE   4  
ATOM 5289  H HH11 . ARG A 1 61 ? -7.297  9.805   -15.125 1.00 0.00 ? 61 ARG A HH11 4  
ATOM 5290  H HH12 . ARG A 1 61 ? -6.547  11.110  -15.995 1.00 0.00 ? 61 ARG A HH12 4  
ATOM 5291  H HH21 . ARG A 1 61 ? -6.159  13.140  -13.163 1.00 0.00 ? 61 ARG A HH21 4  
ATOM 5292  H HH22 . ARG A 1 61 ? -5.895  13.000  -14.873 1.00 0.00 ? 61 ARG A HH22 4  
ATOM 5293  N N    . ALA A 1 62 ? -4.066  8.728   -10.912 1.00 0.00 ? 62 ALA A N    4  
ATOM 5294  C CA   . ALA A 1 62 ? -2.836  9.136   -11.588 1.00 0.00 ? 62 ALA A CA   4  
ATOM 5295  C C    . ALA A 1 62 ? -2.110  7.930   -12.181 1.00 0.00 ? 62 ALA A C    4  
ATOM 5296  O O    . ALA A 1 62 ? -1.604  7.978   -13.303 1.00 0.00 ? 62 ALA A O    4  
ATOM 5297  C CB   . ALA A 1 62 ? -1.925  9.880   -10.622 1.00 0.00 ? 62 ALA A CB   4  
ATOM 5298  H H    . ALA A 1 62 ? -4.145  8.858   -9.941  1.00 0.00 ? 62 ALA A H    4  
ATOM 5299  H HA   . ALA A 1 62 ? -3.103  9.810   -12.388 1.00 0.00 ? 62 ALA A HA   4  
ATOM 5300  H HB1  . ALA A 1 62 ? -1.599  9.208   -9.842  1.00 0.00 ? 62 ALA A HB1  4  
ATOM 5301  H HB2  . ALA A 1 62 ? -2.462  10.707  -10.184 1.00 0.00 ? 62 ALA A HB2  4  
ATOM 5302  H HB3  . ALA A 1 62 ? -1.063  10.252  -11.157 1.00 0.00 ? 62 ALA A HB3  4  
ATOM 5303  N N    . LEU A 1 63 ? -2.077  6.841   -11.433 1.00 0.00 ? 63 LEU A N    4  
ATOM 5304  C CA   . LEU A 1 63 ? -1.433  5.628   -11.894 1.00 0.00 ? 63 LEU A CA   4  
ATOM 5305  C C    . LEU A 1 63 ? -2.178  5.053   -13.072 1.00 0.00 ? 63 LEU A C    4  
ATOM 5306  O O    . LEU A 1 63 ? -1.571  4.517   -13.992 1.00 0.00 ? 63 LEU A O    4  
ATOM 5307  C CB   . LEU A 1 63 ? -1.334  4.597   -10.765 1.00 0.00 ? 63 LEU A CB   4  
ATOM 5308  C CG   . LEU A 1 63 ? -0.470  5.017   -9.571  1.00 0.00 ? 63 LEU A CG   4  
ATOM 5309  C CD1  . LEU A 1 63 ? -0.458  3.930   -8.506  1.00 0.00 ? 63 LEU A CD1  4  
ATOM 5310  C CD2  . LEU A 1 63 ? 0.947   5.336   -10.024 1.00 0.00 ? 63 LEU A CD2  4  
ATOM 5311  H H    . LEU A 1 63 ? -2.493  6.853   -10.549 1.00 0.00 ? 63 LEU A H    4  
ATOM 5312  H HA   . LEU A 1 63 ? -0.449  5.885   -12.219 1.00 0.00 ? 63 LEU A HA   4  
ATOM 5313  H HB2  . LEU A 1 63 ? -2.332  4.391   -10.407 1.00 0.00 ? 63 LEU A HB2  4  
ATOM 5314  H HB3  . LEU A 1 63 ? -0.922  3.687   -11.175 1.00 0.00 ? 63 LEU A HB3  4  
ATOM 5315  H HG   . LEU A 1 63 ? -0.888  5.909   -9.127  1.00 0.00 ? 63 LEU A HG   4  
ATOM 5316  H HD11 . LEU A 1 63 ? -1.462  3.774   -8.140  1.00 0.00 ? 63 LEU A HD11 4  
ATOM 5317  H HD12 . LEU A 1 63 ? 0.180   4.233   -7.689  1.00 0.00 ? 63 LEU A HD12 4  
ATOM 5318  H HD13 . LEU A 1 63 ? -0.085  3.012   -8.935  1.00 0.00 ? 63 LEU A HD13 4  
ATOM 5319  H HD21 . LEU A 1 63 ? 1.541   5.632   -9.172  1.00 0.00 ? 63 LEU A HD21 4  
ATOM 5320  H HD22 . LEU A 1 63 ? 0.921   6.143   -10.742 1.00 0.00 ? 63 LEU A HD22 4  
ATOM 5321  H HD23 . LEU A 1 63 ? 1.384   4.462   -10.482 1.00 0.00 ? 63 LEU A HD23 4  
ATOM 5322  N N    . HIS A 1 64 ? -3.487  5.209   -13.075 1.00 0.00 ? 64 HIS A N    4  
ATOM 5323  C CA   . HIS A 1 64 ? -4.286  4.622   -14.123 1.00 0.00 ? 64 HIS A CA   4  
ATOM 5324  C C    . HIS A 1 64 ? -4.252  5.443   -15.404 1.00 0.00 ? 64 HIS A C    4  
ATOM 5325  O O    . HIS A 1 64 ? -4.574  4.927   -16.475 1.00 0.00 ? 64 HIS A O    4  
ATOM 5326  C CB   . HIS A 1 64 ? -5.722  4.386   -13.666 1.00 0.00 ? 64 HIS A CB   4  
ATOM 5327  C CG   . HIS A 1 64 ? -5.909  3.056   -13.006 1.00 0.00 ? 64 HIS A CG   4  
ATOM 5328  N ND1  . HIS A 1 64 ? -5.909  2.881   -11.644 1.00 0.00 ? 64 HIS A ND1  4  
ATOM 5329  C CD2  . HIS A 1 64 ? -6.089  1.829   -13.541 1.00 0.00 ? 64 HIS A CD2  4  
ATOM 5330  C CE1  . HIS A 1 64 ? -6.076  1.600   -11.368 1.00 0.00 ? 64 HIS A CE1  4  
ATOM 5331  N NE2  . HIS A 1 64 ? -6.190  0.937   -12.504 1.00 0.00 ? 64 HIS A NE2  4  
ATOM 5332  H H    . HIS A 1 64 ? -3.918  5.728   -12.362 1.00 0.00 ? 64 HIS A H    4  
ATOM 5333  H HA   . HIS A 1 64 ? -3.834  3.668   -14.334 1.00 0.00 ? 64 HIS A HA   4  
ATOM 5334  H HB2  . HIS A 1 64 ? -6.000  5.151   -12.959 1.00 0.00 ? 64 HIS A HB2  4  
ATOM 5335  H HB3  . HIS A 1 64 ? -6.378  4.433   -14.521 1.00 0.00 ? 64 HIS A HB3  4  
ATOM 5336  H HD1  . HIS A 1 64 ? -5.785  3.592   -10.976 1.00 0.00 ? 64 HIS A HD1  4  
ATOM 5337  H HD2  . HIS A 1 64 ? -6.137  1.593   -14.596 1.00 0.00 ? 64 HIS A HD2  4  
ATOM 5338  H HE1  . HIS A 1 64 ? -6.115  1.169   -10.378 1.00 0.00 ? 64 HIS A HE1  4  
ATOM 5339  H HE2  . HIS A 1 64 ? -6.040  -0.029  -12.596 1.00 0.00 ? 64 HIS A HE2  4  
ATOM 5340  N N    . MET A 1 65 ? -3.864  6.711   -15.311 1.00 0.00 ? 65 MET A N    4  
ATOM 5341  C CA   . MET A 1 65 ? -3.652  7.498   -16.521 1.00 0.00 ? 65 MET A CA   4  
ATOM 5342  C C    . MET A 1 65 ? -2.306  7.122   -17.125 1.00 0.00 ? 65 MET A C    4  
ATOM 5343  O O    . MET A 1 65 ? -2.096  7.244   -18.331 1.00 0.00 ? 65 MET A O    4  
ATOM 5344  C CB   . MET A 1 65 ? -3.746  9.013   -16.265 1.00 0.00 ? 65 MET A CB   4  
ATOM 5345  C CG   . MET A 1 65 ? -2.558  9.618   -15.536 1.00 0.00 ? 65 MET A CG   4  
ATOM 5346  S SD   . MET A 1 65 ? -2.718  11.403  -15.314 1.00 0.00 ? 65 MET A SD   4  
ATOM 5347  C CE   . MET A 1 65 ? -1.210  11.764  -14.416 1.00 0.00 ? 65 MET A CE   4  
ATOM 5348  H H    . MET A 1 65 ? -3.725  7.117   -14.428 1.00 0.00 ? 65 MET A H    4  
ATOM 5349  H HA   . MET A 1 65 ? -4.426  7.215   -17.223 1.00 0.00 ? 65 MET A HA   4  
ATOM 5350  H HB2  . MET A 1 65 ? -3.842  9.516   -17.215 1.00 0.00 ? 65 MET A HB2  4  
ATOM 5351  H HB3  . MET A 1 65 ? -4.634  9.207   -15.679 1.00 0.00 ? 65 MET A HB3  4  
ATOM 5352  H HG2  . MET A 1 65 ? -2.474  9.155   -14.565 1.00 0.00 ? 65 MET A HG2  4  
ATOM 5353  H HG3  . MET A 1 65 ? -1.663  9.421   -16.107 1.00 0.00 ? 65 MET A HG3  4  
ATOM 5354  H HE1  . MET A 1 65 ? -1.202  11.210  -13.489 1.00 0.00 ? 65 MET A HE1  4  
ATOM 5355  H HE2  . MET A 1 65 ? -1.163  12.822  -14.203 1.00 0.00 ? 65 MET A HE2  4  
ATOM 5356  H HE3  . MET A 1 65 ? -0.357  11.479  -15.014 1.00 0.00 ? 65 MET A HE3  4  
ATOM 5357  N N    . LYS A 1 66 ? -1.402  6.641   -16.272 1.00 0.00 ? 66 LYS A N    4  
ATOM 5358  C CA   . LYS A 1 66 ? -0.146  6.062   -16.737 1.00 0.00 ? 66 LYS A CA   4  
ATOM 5359  C C    . LYS A 1 66 ? -0.410  4.691   -17.346 1.00 0.00 ? 66 LYS A C    4  
ATOM 5360  O O    . LYS A 1 66 ? 0.114   4.348   -18.407 1.00 0.00 ? 66 LYS A O    4  
ATOM 5361  C CB   . LYS A 1 66 ? 0.840   5.901   -15.578 1.00 0.00 ? 66 LYS A CB   4  
ATOM 5362  C CG   . LYS A 1 66 ? 1.241   7.197   -14.896 1.00 0.00 ? 66 LYS A CG   4  
ATOM 5363  C CD   . LYS A 1 66 ? 2.135   6.917   -13.697 1.00 0.00 ? 66 LYS A CD   4  
ATOM 5364  C CE   . LYS A 1 66 ? 3.395   6.167   -14.103 1.00 0.00 ? 66 LYS A CE   4  
ATOM 5365  N NZ   . LYS A 1 66 ? 4.054   5.515   -12.941 1.00 0.00 ? 66 LYS A NZ   4  
ATOM 5366  H H    . LYS A 1 66 ? -1.583  6.685   -15.303 1.00 0.00 ? 66 LYS A H    4  
ATOM 5367  H HA   . LYS A 1 66 ? 0.278   6.713   -17.487 1.00 0.00 ? 66 LYS A HA   4  
ATOM 5368  H HB2  . LYS A 1 66 ? 0.393   5.258   -14.835 1.00 0.00 ? 66 LYS A HB2  4  
ATOM 5369  H HB3  . LYS A 1 66 ? 1.736   5.427   -15.951 1.00 0.00 ? 66 LYS A HB3  4  
ATOM 5370  H HG2  . LYS A 1 66 ? 1.776   7.816   -15.601 1.00 0.00 ? 66 LYS A HG2  4  
ATOM 5371  H HG3  . LYS A 1 66 ? 0.351   7.711   -14.561 1.00 0.00 ? 66 LYS A HG3  4  
ATOM 5372  H HD2  . LYS A 1 66 ? 2.415   7.856   -13.242 1.00 0.00 ? 66 LYS A HD2  4  
ATOM 5373  H HD3  . LYS A 1 66 ? 1.584   6.320   -12.984 1.00 0.00 ? 66 LYS A HD3  4  
ATOM 5374  H HE2  . LYS A 1 66 ? 3.131   5.410   -14.824 1.00 0.00 ? 66 LYS A HE2  4  
ATOM 5375  H HE3  . LYS A 1 66 ? 4.086   6.865   -14.553 1.00 0.00 ? 66 LYS A HE3  4  
ATOM 5376  H HZ1  . LYS A 1 66 ? 3.421   4.797   -12.529 1.00 0.00 ? 66 LYS A HZ1  4  
ATOM 5377  H HZ2  . LYS A 1 66 ? 4.285   6.222   -12.208 1.00 0.00 ? 66 LYS A HZ2  4  
ATOM 5378  H HZ3  . LYS A 1 66 ? 4.937   5.047   -13.243 1.00 0.00 ? 66 LYS A HZ3  4  
ATOM 5379  N N    . GLU A 1 67 ? -1.220  3.909   -16.642 1.00 0.00 ? 67 GLU A N    4  
ATOM 5380  C CA   . GLU A 1 67 ? -1.570  2.560   -17.065 1.00 0.00 ? 67 GLU A CA   4  
ATOM 5381  C C    . GLU A 1 67 ? -2.351  2.563   -18.374 1.00 0.00 ? 67 GLU A C    4  
ATOM 5382  O O    . GLU A 1 67 ? -1.888  2.017   -19.377 1.00 0.00 ? 67 GLU A O    4  
ATOM 5383  C CB   . GLU A 1 67 ? -2.416  1.867   -15.989 1.00 0.00 ? 67 GLU A CB   4  
ATOM 5384  C CG   . GLU A 1 67 ? -1.670  1.560   -14.700 1.00 0.00 ? 67 GLU A CG   4  
ATOM 5385  C CD   . GLU A 1 67 ? -2.595  1.091   -13.588 1.00 0.00 ? 67 GLU A CD   4  
ATOM 5386  O OE1  . GLU A 1 67 ? -3.471  0.244   -13.856 1.00 0.00 ? 67 GLU A OE1  4  
ATOM 5387  O OE2  . GLU A 1 67 ? -2.460  1.583   -12.444 1.00 0.00 ? 67 GLU A OE2  4  
ATOM 5388  H H    . GLU A 1 67 ? -1.582  4.248   -15.793 1.00 0.00 ? 67 GLU A H    4  
ATOM 5389  H HA   . GLU A 1 67 ? -0.655  2.005   -17.203 1.00 0.00 ? 67 GLU A HA   4  
ATOM 5390  H HB2  . GLU A 1 67 ? -3.256  2.501   -15.748 1.00 0.00 ? 67 GLU A HB2  4  
ATOM 5391  H HB3  . GLU A 1 67 ? -2.789  0.936   -16.393 1.00 0.00 ? 67 GLU A HB3  4  
ATOM 5392  H HG2  . GLU A 1 67 ? -0.946  0.786   -14.897 1.00 0.00 ? 67 GLU A HG2  4  
ATOM 5393  H HG3  . GLU A 1 67 ? -1.160  2.455   -14.372 1.00 0.00 ? 67 GLU A HG3  4  
ATOM 5394  N N    . HIS A 1 68 ? -3.531  3.195   -18.341 1.00 0.00 ? 68 HIS A N    4  
ATOM 5395  C CA   . HIS A 1 68 ? -4.535  3.111   -19.410 1.00 0.00 ? 68 HIS A CA   4  
ATOM 5396  C C    . HIS A 1 68 ? -4.686  1.676   -19.910 1.00 0.00 ? 68 HIS A C    4  
ATOM 5397  O O    . HIS A 1 68 ? -4.069  1.267   -20.893 1.00 0.00 ? 68 HIS A O    4  
ATOM 5398  C CB   . HIS A 1 68 ? -4.312  4.114   -20.567 1.00 0.00 ? 68 HIS A CB   4  
ATOM 5399  C CG   . HIS A 1 68 ? -2.970  4.085   -21.241 1.00 0.00 ? 68 HIS A CG   4  
ATOM 5400  N ND1  . HIS A 1 68 ? -2.688  3.297   -22.334 1.00 0.00 ? 68 HIS A ND1  4  
ATOM 5401  C CD2  . HIS A 1 68 ? -1.852  4.805   -21.001 1.00 0.00 ? 68 HIS A CD2  4  
ATOM 5402  C CE1  . HIS A 1 68 ? -1.455  3.534   -22.735 1.00 0.00 ? 68 HIS A CE1  4  
ATOM 5403  N NE2  . HIS A 1 68 ? -0.925  4.449   -21.944 1.00 0.00 ? 68 HIS A NE2  4  
ATOM 5404  H H    . HIS A 1 68 ? -3.738  3.748   -17.554 1.00 0.00 ? 68 HIS A H    4  
ATOM 5405  H HA   . HIS A 1 68 ? -5.476  3.366   -18.940 1.00 0.00 ? 68 HIS A HA   4  
ATOM 5406  H HB2  . HIS A 1 68 ? -5.053  3.925   -21.329 1.00 0.00 ? 68 HIS A HB2  4  
ATOM 5407  H HB3  . HIS A 1 68 ? -4.463  5.114   -20.185 1.00 0.00 ? 68 HIS A HB3  4  
ATOM 5408  H HD1  . HIS A 1 68 ? -3.302  2.649   -22.757 1.00 0.00 ? 68 HIS A HD1  4  
ATOM 5409  H HD2  . HIS A 1 68 ? -1.713  5.529   -20.211 1.00 0.00 ? 68 HIS A HD2  4  
ATOM 5410  H HE1  . HIS A 1 68 ? -0.963  3.067   -23.574 1.00 0.00 ? 68 HIS A HE1  4  
ATOM 5411  H HE2  . HIS A 1 68 ? -0.118  4.976   -22.163 1.00 0.00 ? 68 HIS A HE2  4  
ATOM 5412  N N    . PRO A 1 69 ? -5.507  0.888   -19.201 1.00 0.00 ? 69 PRO A N    4  
ATOM 5413  C CA   . PRO A 1 69 ? -5.693  -0.537  -19.485 1.00 0.00 ? 69 PRO A CA   4  
ATOM 5414  C C    . PRO A 1 69 ? -6.296  -0.789  -20.860 1.00 0.00 ? 69 PRO A C    4  
ATOM 5415  O O    . PRO A 1 69 ? -6.861  0.111   -21.479 1.00 0.00 ? 69 PRO A O    4  
ATOM 5416  C CB   . PRO A 1 69 ? -6.659  -1.004  -18.392 1.00 0.00 ? 69 PRO A CB   4  
ATOM 5417  C CG   . PRO A 1 69 ? -7.348  0.233   -17.933 1.00 0.00 ? 69 PRO A CG   4  
ATOM 5418  C CD   . PRO A 1 69 ? -6.337  1.332   -18.069 1.00 0.00 ? 69 PRO A CD   4  
ATOM 5419  H HA   . PRO A 1 69 ? -4.762  -1.078  -19.400 1.00 0.00 ? 69 PRO A HA   4  
ATOM 5420  H HB2  . PRO A 1 69 ? -7.357  -1.715  -18.808 1.00 0.00 ? 69 PRO A HB2  4  
ATOM 5421  H HB3  . PRO A 1 69 ? -6.101  -1.465  -17.590 1.00 0.00 ? 69 PRO A HB3  4  
ATOM 5422  H HG2  . PRO A 1 69 ? -8.205  0.431   -18.558 1.00 0.00 ? 69 PRO A HG2  4  
ATOM 5423  H HG3  . PRO A 1 69 ? -7.649  0.126   -16.902 1.00 0.00 ? 69 PRO A HG3  4  
ATOM 5424  H HD2  . PRO A 1 69 ? -6.826  2.269   -18.293 1.00 0.00 ? 69 PRO A HD2  4  
ATOM 5425  H HD3  . PRO A 1 69 ? -5.746  1.419   -17.168 1.00 0.00 ? 69 PRO A HD3  4  
ATOM 5426  N N    . ASP A 1 70 ? -6.187  -2.026  -21.316 1.00 0.00 ? 70 ASP A N    4  
ATOM 5427  C CA   . ASP A 1 70 ? -6.707  -2.423  -22.619 1.00 0.00 ? 70 ASP A CA   4  
ATOM 5428  C C    . ASP A 1 70 ? -8.152  -2.881  -22.496 1.00 0.00 ? 70 ASP A C    4  
ATOM 5429  O O    . ASP A 1 70 ? -8.712  -3.476  -23.419 1.00 0.00 ? 70 ASP A O    4  
ATOM 5430  C CB   . ASP A 1 70 ? -5.852  -3.542  -23.217 1.00 0.00 ? 70 ASP A CB   4  
ATOM 5431  C CG   . ASP A 1 70 ? -5.897  -4.818  -22.400 1.00 0.00 ? 70 ASP A CG   4  
ATOM 5432  O OD1  . ASP A 1 70 ? -5.691  -4.753  -21.168 1.00 0.00 ? 70 ASP A OD1  4  
ATOM 5433  O OD2  . ASP A 1 70 ? -6.110  -5.897  -22.987 1.00 0.00 ? 70 ASP A OD2  4  
ATOM 5434  H H    . ASP A 1 70 ? -5.745  -2.703  -20.758 1.00 0.00 ? 70 ASP A H    4  
ATOM 5435  H HA   . ASP A 1 70 ? -6.666  -1.563  -23.270 1.00 0.00 ? 70 ASP A HA   4  
ATOM 5436  H HB2  . ASP A 1 70 ? -6.206  -3.765  -24.212 1.00 0.00 ? 70 ASP A HB2  4  
ATOM 5437  H HB3  . ASP A 1 70 ? -4.826  -3.210  -23.270 1.00 0.00 ? 70 ASP A HB3  4  
ATOM 5438  N N    . TYR A 1 71 ? -8.744  -2.608  -21.341 1.00 0.00 ? 71 TYR A N    4  
ATOM 5439  C CA   . TYR A 1 71 ? -10.155 -2.877  -21.116 1.00 0.00 ? 71 TYR A CA   4  
ATOM 5440  C C    . TYR A 1 71 ? -10.966 -1.992  -22.053 1.00 0.00 ? 71 TYR A C    4  
ATOM 5441  O O    . TYR A 1 71 ? -10.644 -0.817  -22.226 1.00 0.00 ? 71 TYR A O    4  
ATOM 5442  C CB   . TYR A 1 71 ? -10.514 -2.598  -19.650 1.00 0.00 ? 71 TYR A CB   4  
ATOM 5443  C CG   . TYR A 1 71 ? -11.809 -3.239  -19.183 1.00 0.00 ? 71 TYR A CG   4  
ATOM 5444  C CD1  . TYR A 1 71 ? -13.030 -2.601  -19.356 1.00 0.00 ? 71 TYR A CD1  4  
ATOM 5445  C CD2  . TYR A 1 71 ? -11.801 -4.480  -18.555 1.00 0.00 ? 71 TYR A CD2  4  
ATOM 5446  C CE1  . TYR A 1 71 ? -14.206 -3.181  -18.917 1.00 0.00 ? 71 TYR A CE1  4  
ATOM 5447  C CE2  . TYR A 1 71 ? -12.973 -5.065  -18.112 1.00 0.00 ? 71 TYR A CE2  4  
ATOM 5448  C CZ   . TYR A 1 71 ? -14.172 -4.412  -18.297 1.00 0.00 ? 71 TYR A CZ   4  
ATOM 5449  O OH   . TYR A 1 71 ? -15.342 -4.991  -17.854 1.00 0.00 ? 71 TYR A OH   4  
ATOM 5450  H H    . TYR A 1 71 ? -8.217  -2.206  -20.624 1.00 0.00 ? 71 TYR A H    4  
ATOM 5451  H HA   . TYR A 1 71 ? -10.345 -3.913  -21.347 1.00 0.00 ? 71 TYR A HA   4  
ATOM 5452  H HB2  . TYR A 1 71 ? -9.720  -2.971  -19.020 1.00 0.00 ? 71 TYR A HB2  4  
ATOM 5453  H HB3  . TYR A 1 71 ? -10.601 -1.531  -19.510 1.00 0.00 ? 71 TYR A HB3  4  
ATOM 5454  H HD1  . TYR A 1 71 ? -13.055 -1.638  -19.842 1.00 0.00 ? 71 TYR A HD1  4  
ATOM 5455  H HD2  . TYR A 1 71 ? -10.862 -4.988  -18.413 1.00 0.00 ? 71 TYR A HD2  4  
ATOM 5456  H HE1  . TYR A 1 71 ? -15.145 -2.670  -19.062 1.00 0.00 ? 71 TYR A HE1  4  
ATOM 5457  H HE2  . TYR A 1 71 ? -12.945 -6.029  -17.626 1.00 0.00 ? 71 TYR A HE2  4  
ATOM 5458  H HH   . TYR A 1 71 ? -15.209 -5.352  -16.958 1.00 0.00 ? 71 TYR A HH   4  
ATOM 5459  N N    . LYS A 1 72 ? -11.993 -2.560  -22.666 1.00 0.00 ? 72 LYS A N    4  
ATOM 5460  C CA   . LYS A 1 72 ? -12.732 -1.872  -23.716 1.00 0.00 ? 72 LYS A CA   4  
ATOM 5461  C C    . LYS A 1 72 ? -13.493 -0.647  -23.213 1.00 0.00 ? 72 LYS A C    4  
ATOM 5462  O O    . LYS A 1 72 ? -14.670 -0.727  -22.853 1.00 0.00 ? 72 LYS A O    4  
ATOM 5463  C CB   . LYS A 1 72 ? -13.686 -2.833  -24.428 1.00 0.00 ? 72 LYS A CB   4  
ATOM 5464  C CG   . LYS A 1 72 ? -12.969 -3.847  -25.305 1.00 0.00 ? 72 LYS A CG   4  
ATOM 5465  C CD   . LYS A 1 72 ? -13.944 -4.774  -26.013 1.00 0.00 ? 72 LYS A CD   4  
ATOM 5466  C CE   . LYS A 1 72 ? -14.667 -5.688  -25.036 1.00 0.00 ? 72 LYS A CE   4  
ATOM 5467  N NZ   . LYS A 1 72 ? -13.723 -6.547  -24.271 1.00 0.00 ? 72 LYS A NZ   4  
ATOM 5468  H H    . LYS A 1 72 ? -12.258 -3.474  -22.410 1.00 0.00 ? 72 LYS A H    4  
ATOM 5469  H HA   . LYS A 1 72 ? -12.004 -1.532  -24.437 1.00 0.00 ? 72 LYS A HA   4  
ATOM 5470  H HB2  . LYS A 1 72 ? -14.262 -3.370  -23.688 1.00 0.00 ? 72 LYS A HB2  4  
ATOM 5471  H HB3  . LYS A 1 72 ? -14.357 -2.261  -25.051 1.00 0.00 ? 72 LYS A HB3  4  
ATOM 5472  H HG2  . LYS A 1 72 ? -12.391 -3.318  -26.047 1.00 0.00 ? 72 LYS A HG2  4  
ATOM 5473  H HG3  . LYS A 1 72 ? -12.308 -4.438  -24.686 1.00 0.00 ? 72 LYS A HG3  4  
ATOM 5474  H HD2  . LYS A 1 72 ? -14.676 -4.178  -26.537 1.00 0.00 ? 72 LYS A HD2  4  
ATOM 5475  H HD3  . LYS A 1 72 ? -13.397 -5.380  -26.721 1.00 0.00 ? 72 LYS A HD3  4  
ATOM 5476  H HE2  . LYS A 1 72 ? -15.228 -5.080  -24.342 1.00 0.00 ? 72 LYS A HE2  4  
ATOM 5477  H HE3  . LYS A 1 72 ? -15.346 -6.320  -25.589 1.00 0.00 ? 72 LYS A HE3  4  
ATOM 5478  H HZ1  . LYS A 1 72 ? -13.028 -6.987  -24.916 1.00 0.00 ? 72 LYS A HZ1  4  
ATOM 5479  H HZ2  . LYS A 1 72 ? -14.248 -7.301  -23.777 1.00 0.00 ? 72 LYS A HZ2  4  
ATOM 5480  H HZ3  . LYS A 1 72 ? -13.210 -5.977  -23.564 1.00 0.00 ? 72 LYS A HZ3  4  
ATOM 5481  N N    . TYR A 1 73 ? -12.789 0.472   -23.161 1.00 0.00 ? 73 TYR A N    4  
ATOM 5482  C CA   . TYR A 1 73 ? -13.399 1.778   -22.994 1.00 0.00 ? 73 TYR A CA   4  
ATOM 5483  C C    . TYR A 1 73 ? -13.065 2.607   -24.222 1.00 0.00 ? 73 TYR A C    4  
ATOM 5484  O O    . TYR A 1 73 ? -11.904 2.939   -24.457 1.00 0.00 ? 73 TYR A O    4  
ATOM 5485  C CB   . TYR A 1 73 ? -12.885 2.484   -21.735 1.00 0.00 ? 73 TYR A CB   4  
ATOM 5486  C CG   . TYR A 1 73 ? -13.346 1.868   -20.432 1.00 0.00 ? 73 TYR A CG   4  
ATOM 5487  C CD1  . TYR A 1 73 ? -14.659 2.005   -19.998 1.00 0.00 ? 73 TYR A CD1  4  
ATOM 5488  C CD2  . TYR A 1 73 ? -12.462 1.162   -19.626 1.00 0.00 ? 73 TYR A CD2  4  
ATOM 5489  C CE1  . TYR A 1 73 ? -15.078 1.453   -18.803 1.00 0.00 ? 73 TYR A CE1  4  
ATOM 5490  C CE2  . TYR A 1 73 ? -12.874 0.609   -18.427 1.00 0.00 ? 73 TYR A CE2  4  
ATOM 5491  C CZ   . TYR A 1 73 ? -14.183 0.757   -18.021 1.00 0.00 ? 73 TYR A CZ   4  
ATOM 5492  O OH   . TYR A 1 73 ? -14.596 0.209   -16.825 1.00 0.00 ? 73 TYR A OH   4  
ATOM 5493  H H    . TYR A 1 73 ? -11.810 0.416   -23.233 1.00 0.00 ? 73 TYR A H    4  
ATOM 5494  H HA   . TYR A 1 73 ? -14.472 1.649   -22.930 1.00 0.00 ? 73 TYR A HA   4  
ATOM 5495  H HB2  . TYR A 1 73 ? -11.806 2.465   -21.742 1.00 0.00 ? 73 TYR A HB2  4  
ATOM 5496  H HB3  . TYR A 1 73 ? -13.219 3.512   -21.752 1.00 0.00 ? 73 TYR A HB3  4  
ATOM 5497  H HD1  . TYR A 1 73 ? -15.359 2.551   -20.613 1.00 0.00 ? 73 TYR A HD1  4  
ATOM 5498  H HD2  . TYR A 1 73 ? -11.438 1.047   -19.949 1.00 0.00 ? 73 TYR A HD2  4  
ATOM 5499  H HE1  . TYR A 1 73 ? -16.104 1.568   -18.486 1.00 0.00 ? 73 TYR A HE1  4  
ATOM 5500  H HE2  . TYR A 1 73 ? -12.171 0.064   -17.815 1.00 0.00 ? 73 TYR A HE2  4  
ATOM 5501  H HH   . TYR A 1 73 ? -15.479 -0.188  -16.938 1.00 0.00 ? 73 TYR A HH   4  
ATOM 5502  N N    . ARG A 1 74 ? -14.072 2.912   -25.017 1.00 0.00 ? 74 ARG A N    4  
ATOM 5503  C CA   . ARG A 1 74 ? -13.857 3.607   -26.277 1.00 0.00 ? 74 ARG A CA   4  
ATOM 5504  C C    . ARG A 1 74 ? -14.517 4.977   -26.266 1.00 0.00 ? 74 ARG A C    4  
ATOM 5505  O O    . ARG A 1 74 ? -15.414 5.221   -25.454 1.00 0.00 ? 74 ARG A O    4  
ATOM 5506  C CB   . ARG A 1 74 ? -14.376 2.759   -27.442 1.00 0.00 ? 74 ARG A CB   4  
ATOM 5507  C CG   . ARG A 1 74 ? -13.509 1.542   -27.715 1.00 0.00 ? 74 ARG A CG   4  
ATOM 5508  C CD   . ARG A 1 74 ? -13.995 0.751   -28.916 1.00 0.00 ? 74 ARG A CD   4  
ATOM 5509  N NE   . ARG A 1 74 ? -13.068 -0.325  -29.266 1.00 0.00 ? 74 ARG A NE   4  
ATOM 5510  C CZ   . ARG A 1 74 ? -13.296 -1.232  -30.214 1.00 0.00 ? 74 ARG A CZ   4  
ATOM 5511  N NH1  . ARG A 1 74 ? -14.430 -1.212  -30.901 1.00 0.00 ? 74 ARG A NH1  4  
ATOM 5512  N NH2  . ARG A 1 74 ? -12.392 -2.167  -30.472 1.00 0.00 ? 74 ARG A NH2  4  
ATOM 5513  H H    . ARG A 1 74 ? -14.983 2.682   -24.747 1.00 0.00 ? 74 ARG A H    4  
ATOM 5514  H HA   . ARG A 1 74 ? -12.792 3.743   -26.398 1.00 0.00 ? 74 ARG A HA   4  
ATOM 5515  H HB2  . ARG A 1 74 ? -15.376 2.422   -27.212 1.00 0.00 ? 74 ARG A HB2  4  
ATOM 5516  H HB3  . ARG A 1 74 ? -14.403 3.365   -28.335 1.00 0.00 ? 74 ARG A HB3  4  
ATOM 5517  H HG2  . ARG A 1 74 ? -12.500 1.872   -27.903 1.00 0.00 ? 74 ARG A HG2  4  
ATOM 5518  H HG3  . ARG A 1 74 ? -13.524 0.903   -26.846 1.00 0.00 ? 74 ARG A HG3  4  
ATOM 5519  H HD2  . ARG A 1 74 ? -14.960 0.323   -28.686 1.00 0.00 ? 74 ARG A HD2  4  
ATOM 5520  H HD3  . ARG A 1 74 ? -14.090 1.420   -29.758 1.00 0.00 ? 74 ARG A HD3  4  
ATOM 5521  H HE   . ARG A 1 74 ? -12.211 -0.362  -28.768 1.00 0.00 ? 74 ARG A HE   4  
ATOM 5522  H HH11 . ARG A 1 74 ? -15.122 -0.516  -30.711 1.00 0.00 ? 74 ARG A HH11 4  
ATOM 5523  H HH12 . ARG A 1 74 ? -14.597 -1.891  -31.620 1.00 0.00 ? 74 ARG A HH12 4  
ATOM 5524  H HH21 . ARG A 1 74 ? -11.531 -2.202  -29.952 1.00 0.00 ? 74 ARG A HH21 4  
ATOM 5525  H HH22 . ARG A 1 74 ? -12.560 -2.843  -31.198 1.00 0.00 ? 74 ARG A HH22 4  
ATOM 5526  N N    . PRO A 1 75 ? -14.074 5.880   -27.171 1.00 0.00 ? 75 PRO A N    4  
ATOM 5527  C CA   . PRO A 1 75 ? -14.567 7.259   -27.267 1.00 0.00 ? 75 PRO A CA   4  
ATOM 5528  C C    . PRO A 1 75 ? -16.083 7.377   -27.141 1.00 0.00 ? 75 PRO A C    4  
ATOM 5529  O O    . PRO A 1 75 ? -16.838 6.495   -27.566 1.00 0.00 ? 75 PRO A O    4  
ATOM 5530  C CB   . PRO A 1 75 ? -14.116 7.719   -28.662 1.00 0.00 ? 75 PRO A CB   4  
ATOM 5531  C CG   . PRO A 1 75 ? -13.478 6.528   -29.305 1.00 0.00 ? 75 PRO A CG   4  
ATOM 5532  C CD   . PRO A 1 75 ? -13.043 5.633   -28.185 1.00 0.00 ? 75 PRO A CD   4  
ATOM 5533  H HA   . PRO A 1 75 ? -14.105 7.888   -26.520 1.00 0.00 ? 75 PRO A HA   4  
ATOM 5534  H HB2  . PRO A 1 75 ? -14.975 8.054   -29.224 1.00 0.00 ? 75 PRO A HB2  4  
ATOM 5535  H HB3  . PRO A 1 75 ? -13.413 8.532   -28.560 1.00 0.00 ? 75 PRO A HB3  4  
ATOM 5536  H HG2  . PRO A 1 75 ? -14.196 6.018   -29.932 1.00 0.00 ? 75 PRO A HG2  4  
ATOM 5537  H HG3  . PRO A 1 75 ? -12.624 6.839   -29.890 1.00 0.00 ? 75 PRO A HG3  4  
ATOM 5538  H HD2  . PRO A 1 75 ? -13.046 4.599   -28.502 1.00 0.00 ? 75 PRO A HD2  4  
ATOM 5539  H HD3  . PRO A 1 75 ? -12.066 5.922   -27.825 1.00 0.00 ? 75 PRO A HD3  4  
ATOM 5540  N N    . ARG A 1 76 ? -16.514 8.489   -26.574 1.00 0.00 ? 76 ARG A N    4  
ATOM 5541  C CA   . ARG A 1 76 ? -17.916 8.709   -26.287 1.00 0.00 ? 76 ARG A CA   4  
ATOM 5542  C C    . ARG A 1 76 ? -18.514 9.686   -27.291 1.00 0.00 ? 76 ARG A C    4  
ATOM 5543  O O    . ARG A 1 76 ? -17.910 10.711  -27.616 1.00 0.00 ? 76 ARG A O    4  
ATOM 5544  C CB   . ARG A 1 76 ? -18.082 9.232   -24.851 1.00 0.00 ? 76 ARG A CB   4  
ATOM 5545  C CG   . ARG A 1 76 ? -17.514 10.628  -24.617 1.00 0.00 ? 76 ARG A CG   4  
ATOM 5546  C CD   . ARG A 1 76 ? -17.324 10.913  -23.136 1.00 0.00 ? 76 ARG A CD   4  
ATOM 5547  N NE   . ARG A 1 76 ? -17.300 12.349  -22.839 1.00 0.00 ? 76 ARG A NE   4  
ATOM 5548  C CZ   . ARG A 1 76 ? -16.210 13.031  -22.464 1.00 0.00 ? 76 ARG A CZ   4  
ATOM 5549  N NH1  . ARG A 1 76 ? -15.018 12.449  -22.446 1.00 0.00 ? 76 ARG A NH1  4  
ATOM 5550  N NH2  . ARG A 1 76 ? -16.317 14.312  -22.130 1.00 0.00 ? 76 ARG A NH2  4  
ATOM 5551  H H    . ARG A 1 76 ? -15.866 9.200   -26.363 1.00 0.00 ? 76 ARG A H    4  
ATOM 5552  H HA   . ARG A 1 76 ? -18.426 7.759   -26.377 1.00 0.00 ? 76 ARG A HA   4  
ATOM 5553  H HB2  . ARG A 1 76 ? -19.134 9.255   -24.611 1.00 0.00 ? 76 ARG A HB2  4  
ATOM 5554  H HB3  . ARG A 1 76 ? -17.588 8.550   -24.173 1.00 0.00 ? 76 ARG A HB3  4  
ATOM 5555  H HG2  . ARG A 1 76 ? -16.558 10.707  -25.115 1.00 0.00 ? 76 ARG A HG2  4  
ATOM 5556  H HG3  . ARG A 1 76 ? -18.197 11.356  -25.029 1.00 0.00 ? 76 ARG A HG3  4  
ATOM 5557  H HD2  . ARG A 1 76 ? -18.137 10.458  -22.590 1.00 0.00 ? 76 ARG A HD2  4  
ATOM 5558  H HD3  . ARG A 1 76 ? -16.388 10.473  -22.818 1.00 0.00 ? 76 ARG A HD3  4  
ATOM 5559  H HE   . ARG A 1 76 ? -18.164 12.828  -22.886 1.00 0.00 ? 76 ARG A HE   4  
ATOM 5560  H HH11 . ARG A 1 76 ? -14.915 11.489  -22.716 1.00 0.00 ? 76 ARG A HH11 4  
ATOM 5561  H HH12 . ARG A 1 76 ? -14.203 12.970  -22.161 1.00 0.00 ? 76 ARG A HH12 4  
ATOM 5562  H HH21 . ARG A 1 76 ? -17.208 14.768  -22.160 1.00 0.00 ? 76 ARG A HH21 4  
ATOM 5563  H HH22 . ARG A 1 76 ? -15.502 14.830  -21.839 1.00 0.00 ? 76 ARG A HH22 4  
ATOM 5564  N N    . ARG A 1 77 ? -19.685 9.351   -27.809 1.00 0.00 ? 77 ARG A N    4  
ATOM 5565  C CA   . ARG A 1 77 ? -20.398 10.254  -28.697 1.00 0.00 ? 77 ARG A CA   4  
ATOM 5566  C C    . ARG A 1 77 ? -21.232 11.225  -27.880 1.00 0.00 ? 77 ARG A C    4  
ATOM 5567  O O    . ARG A 1 77 ? -22.343 10.893  -27.456 1.00 0.00 ? 77 ARG A O    4  
ATOM 5568  C CB   . ARG A 1 77 ? -21.284 9.483   -29.681 1.00 0.00 ? 77 ARG A CB   4  
ATOM 5569  C CG   . ARG A 1 77 ? -20.506 8.817   -30.807 1.00 0.00 ? 77 ARG A CG   4  
ATOM 5570  C CD   . ARG A 1 77 ? -19.696 9.833   -31.595 1.00 0.00 ? 77 ARG A CD   4  
ATOM 5571  N NE   . ARG A 1 77 ? -20.523 10.946  -32.059 1.00 0.00 ? 77 ARG A NE   4  
ATOM 5572  C CZ   . ARG A 1 77 ? -20.143 12.220  -32.027 1.00 0.00 ? 77 ARG A CZ   4  
ATOM 5573  N NH1  . ARG A 1 77 ? -18.931 12.545  -31.594 1.00 0.00 ? 77 ARG A NH1  4  
ATOM 5574  N NH2  . ARG A 1 77 ? -20.974 13.164  -32.438 1.00 0.00 ? 77 ARG A NH2  4  
ATOM 5575  H H    . ARG A 1 77 ? -20.081 8.483   -27.585 1.00 0.00 ? 77 ARG A H    4  
ATOM 5576  H HA   . ARG A 1 77 ? -19.662 10.816  -29.254 1.00 0.00 ? 77 ARG A HA   4  
ATOM 5577  H HB2  . ARG A 1 77 ? -21.820 8.717   -29.142 1.00 0.00 ? 77 ARG A HB2  4  
ATOM 5578  H HB3  . ARG A 1 77 ? -21.997 10.165  -30.121 1.00 0.00 ? 77 ARG A HB3  4  
ATOM 5579  H HG2  . ARG A 1 77 ? -19.833 8.085   -30.384 1.00 0.00 ? 77 ARG A HG2  4  
ATOM 5580  H HG3  . ARG A 1 77 ? -21.201 8.327   -31.474 1.00 0.00 ? 77 ARG A HG3  4  
ATOM 5581  H HD2  . ARG A 1 77 ? -18.910 10.219  -30.963 1.00 0.00 ? 77 ARG A HD2  4  
ATOM 5582  H HD3  . ARG A 1 77 ? -19.260 9.340   -32.452 1.00 0.00 ? 77 ARG A HD3  4  
ATOM 5583  H HE   . ARG A 1 77 ? -21.422 10.730  -32.407 1.00 0.00 ? 77 ARG A HE   4  
ATOM 5584  H HH11 . ARG A 1 77 ? -18.296 11.835  -31.293 1.00 0.00 ? 77 ARG A HH11 4  
ATOM 5585  H HH12 . ARG A 1 77 ? -18.642 13.512  -31.570 1.00 0.00 ? 77 ARG A HH12 4  
ATOM 5586  H HH21 . ARG A 1 77 ? -21.887 12.916  -32.779 1.00 0.00 ? 77 ARG A HH21 4  
ATOM 5587  H HH22 . ARG A 1 77 ? -20.703 14.133  -32.397 1.00 0.00 ? 77 ARG A HH22 4  
ATOM 5588  N N    . LYS A 1 78 ? -20.667 12.407  -27.635 1.00 0.00 ? 78 LYS A N    4  
ATOM 5589  C CA   . LYS A 1 78 ? -21.301 13.424  -26.803 1.00 0.00 ? 78 LYS A CA   4  
ATOM 5590  C C    . LYS A 1 78 ? -21.454 12.912  -25.370 1.00 0.00 ? 78 LYS A C    4  
ATOM 5591  O O    . LYS A 1 78 ? -20.915 11.860  -25.013 1.00 0.00 ? 78 LYS A O    4  
ATOM 5592  C CB   . LYS A 1 78 ? -22.658 13.834  -27.391 1.00 0.00 ? 78 LYS A CB   4  
ATOM 5593  C CG   . LYS A 1 78 ? -22.550 14.450  -28.780 1.00 0.00 ? 78 LYS A CG   4  
ATOM 5594  C CD   . LYS A 1 78 ? -23.909 14.578  -29.454 1.00 0.00 ? 78 LYS A CD   4  
ATOM 5595  C CE   . LYS A 1 78 ? -24.868 15.426  -28.638 1.00 0.00 ? 78 LYS A CE   4  
ATOM 5596  N NZ   . LYS A 1 78 ? -26.162 15.635  -29.340 1.00 0.00 ? 78 LYS A NZ   4  
ATOM 5597  H H    . LYS A 1 78 ? -19.783 12.602  -28.026 1.00 0.00 ? 78 LYS A H    4  
ATOM 5598  H HA   . LYS A 1 78 ? -20.651 14.287  -26.790 1.00 0.00 ? 78 LYS A HA   4  
ATOM 5599  H HB2  . LYS A 1 78 ? -23.291 12.961  -27.453 1.00 0.00 ? 78 LYS A HB2  4  
ATOM 5600  H HB3  . LYS A 1 78 ? -23.119 14.558  -26.736 1.00 0.00 ? 78 LYS A HB3  4  
ATOM 5601  H HG2  . LYS A 1 78 ? -22.114 15.434  -28.693 1.00 0.00 ? 78 LYS A HG2  4  
ATOM 5602  H HG3  . LYS A 1 78 ? -21.911 13.825  -29.389 1.00 0.00 ? 78 LYS A HG3  4  
ATOM 5603  H HD2  . LYS A 1 78 ? -23.776 15.035  -30.422 1.00 0.00 ? 78 LYS A HD2  4  
ATOM 5604  H HD3  . LYS A 1 78 ? -24.332 13.589  -29.579 1.00 0.00 ? 78 LYS A HD3  4  
ATOM 5605  H HE2  . LYS A 1 78 ? -25.055 14.931  -27.697 1.00 0.00 ? 78 LYS A HE2  4  
ATOM 5606  H HE3  . LYS A 1 78 ? -24.410 16.385  -28.453 1.00 0.00 ? 78 LYS A HE3  4  
ATOM 5607  H HZ1  . LYS A 1 78 ? -26.009 16.164  -30.228 1.00 0.00 ? 78 LYS A HZ1  4  
ATOM 5608  H HZ2  . LYS A 1 78 ? -26.814 16.179  -28.734 1.00 0.00 ? 78 LYS A HZ2  4  
ATOM 5609  H HZ3  . LYS A 1 78 ? -26.602 14.720  -29.569 1.00 0.00 ? 78 LYS A HZ3  4  
ATOM 5610  N N    . THR A 1 79 ? -22.137 13.673  -24.539 1.00 0.00 ? 79 THR A N    4  
ATOM 5611  C CA   . THR A 1 79 ? -22.391 13.260  -23.169 1.00 0.00 ? 79 THR A CA   4  
ATOM 5612  C C    . THR A 1 79 ? -23.686 13.887  -22.671 1.00 0.00 ? 79 THR A C    4  
ATOM 5613  O O    . THR A 1 79 ? -24.619 13.188  -22.273 1.00 0.00 ? 79 THR A O    4  
ATOM 5614  C CB   . THR A 1 79 ? -21.222 13.663  -22.242 1.00 0.00 ? 79 THR A CB   4  
ATOM 5615  O OG1  . THR A 1 79 ? -19.981 13.185  -22.789 1.00 0.00 ? 79 THR A OG1  4  
ATOM 5616  C CG2  . THR A 1 79 ? -21.414 13.095  -20.842 1.00 0.00 ? 79 THR A CG2  4  
ATOM 5617  H H    . THR A 1 79 ? -22.478 14.539  -24.850 1.00 0.00 ? 79 THR A H    4  
ATOM 5618  H HA   . THR A 1 79 ? -22.488 12.184  -23.153 1.00 0.00 ? 79 THR A HA   4  
ATOM 5619  H HB   . THR A 1 79 ? -21.187 14.741  -22.179 1.00 0.00 ? 79 THR A HB   4  
ATOM 5620  H HG1  . THR A 1 79 ? -20.171 12.641  -23.570 1.00 0.00 ? 79 THR A HG1  4  
ATOM 5621  H HG21 . THR A 1 79 ? -22.332 13.475  -20.422 1.00 0.00 ? 79 THR A HG21 4  
ATOM 5622  H HG22 . THR A 1 79 ? -20.582 13.388  -20.218 1.00 0.00 ? 79 THR A HG22 4  
ATOM 5623  H HG23 . THR A 1 79 ? -21.460 12.017  -20.896 1.00 0.00 ? 79 THR A HG23 4  
ATOM 5624  N N    . LYS A 1 80 ? -23.735 15.207  -22.729 1.00 0.00 ? 80 LYS A N    4  
ATOM 5625  C CA   . LYS A 1 80 ? -24.911 15.964  -22.336 1.00 0.00 ? 80 LYS A CA   4  
ATOM 5626  C C    . LYS A 1 80 ? -24.683 17.427  -22.682 1.00 0.00 ? 80 LYS A C    4  
ATOM 5627  O O    . LYS A 1 80 ? -23.718 18.036  -22.213 1.00 0.00 ? 80 LYS A O    4  
ATOM 5628  C CB   . LYS A 1 80 ? -25.183 15.818  -20.832 1.00 0.00 ? 80 LYS A CB   4  
ATOM 5629  C CG   . LYS A 1 80 ? -26.658 15.651  -20.479 1.00 0.00 ? 80 LYS A CG   4  
ATOM 5630  C CD   . LYS A 1 80 ? -27.483 16.885  -20.818 1.00 0.00 ? 80 LYS A CD   4  
ATOM 5631  C CE   . LYS A 1 80 ? -27.146 18.056  -19.908 1.00 0.00 ? 80 LYS A CE   4  
ATOM 5632  N NZ   . LYS A 1 80 ? -27.984 19.250  -20.202 1.00 0.00 ? 80 LYS A NZ   4  
ATOM 5633  H H    . LYS A 1 80 ? -22.947 15.698  -23.057 1.00 0.00 ? 80 LYS A H    4  
ATOM 5634  H HA   . LYS A 1 80 ? -25.757 15.592  -22.896 1.00 0.00 ? 80 LYS A HA   4  
ATOM 5635  H HB2  . LYS A 1 80 ? -24.650 14.953  -20.466 1.00 0.00 ? 80 LYS A HB2  4  
ATOM 5636  H HB3  . LYS A 1 80 ? -24.812 16.698  -20.326 1.00 0.00 ? 80 LYS A HB3  4  
ATOM 5637  H HG2  . LYS A 1 80 ? -27.055 14.810  -21.027 1.00 0.00 ? 80 LYS A HG2  4  
ATOM 5638  H HG3  . LYS A 1 80 ? -26.740 15.458  -19.419 1.00 0.00 ? 80 LYS A HG3  4  
ATOM 5639  H HD2  . LYS A 1 80 ? -27.286 17.169  -21.840 1.00 0.00 ? 80 LYS A HD2  4  
ATOM 5640  H HD3  . LYS A 1 80 ? -28.532 16.646  -20.706 1.00 0.00 ? 80 LYS A HD3  4  
ATOM 5641  H HE2  . LYS A 1 80 ? -27.311 17.756  -18.883 1.00 0.00 ? 80 LYS A HE2  4  
ATOM 5642  H HE3  . LYS A 1 80 ? -26.106 18.313  -20.044 1.00 0.00 ? 80 LYS A HE3  4  
ATOM 5643  H HZ1  . LYS A 1 80 ? -27.783 20.005  -19.510 1.00 0.00 ? 80 LYS A HZ1  4  
ATOM 5644  H HZ2  . LYS A 1 80 ? -28.997 19.003  -20.146 1.00 0.00 ? 80 LYS A HZ2  4  
ATOM 5645  H HZ3  . LYS A 1 80 ? -27.776 19.611  -21.162 1.00 0.00 ? 80 LYS A HZ3  4  
ATOM 5646  N N    . THR A 1 81 ? -25.536 17.969  -23.531 1.00 0.00 ? 81 THR A N    4  
ATOM 5647  C CA   . THR A 1 81 ? -25.441 19.364  -23.915 1.00 0.00 ? 81 THR A CA   4  
ATOM 5648  C C    . THR A 1 81 ? -25.960 20.249  -22.785 1.00 0.00 ? 81 THR A C    4  
ATOM 5649  O O    . THR A 1 81 ? -27.188 20.255  -22.547 1.00 0.00 ? 81 THR A O    4  
ATOM 5650  C CB   . THR A 1 81 ? -26.229 19.635  -25.214 1.00 0.00 ? 81 THR A CB   4  
ATOM 5651  O OG1  . THR A 1 81 ? -25.789 18.735  -26.247 1.00 0.00 ? 81 THR A OG1  4  
ATOM 5652  C CG2  . THR A 1 81 ? -26.040 21.071  -25.683 1.00 0.00 ? 81 THR A CG2  4  
ATOM 5653  O OXT  . THR A 1 81 ? -25.135 20.914  -22.119 1.00 0.00 ? 81 THR A OXT  4  
ATOM 5654  H H    . THR A 1 81 ? -26.256 17.416  -23.911 1.00 0.00 ? 81 THR A H    4  
ATOM 5655  H HA   . THR A 1 81 ? -24.400 19.594  -24.093 1.00 0.00 ? 81 THR A HA   4  
ATOM 5656  H HB   . THR A 1 81 ? -27.278 19.469  -25.022 1.00 0.00 ? 81 THR A HB   4  
ATOM 5657  H HG1  . THR A 1 81 ? -26.539 18.199  -26.546 1.00 0.00 ? 81 THR A HG1  4  
ATOM 5658  H HG21 . THR A 1 81 ? -24.995 21.246  -25.894 1.00 0.00 ? 81 THR A HG21 4  
ATOM 5659  H HG22 . THR A 1 81 ? -26.369 21.748  -24.909 1.00 0.00 ? 81 THR A HG22 4  
ATOM 5660  H HG23 . THR A 1 81 ? -26.621 21.238  -26.578 1.00 0.00 ? 81 THR A HG23 4  
ATOM 5661  N N    . SER A 1 1  ? -9.173  1.045   -26.201 1.00 0.00 ? 1  SER A N    5  
ATOM 5662  C CA   . SER A 1 1  ? -9.984  2.273   -26.080 1.00 0.00 ? 1  SER A CA   5  
ATOM 5663  C C    . SER A 1 1  ? -9.591  3.029   -24.819 1.00 0.00 ? 1  SER A C    5  
ATOM 5664  O O    . SER A 1 1  ? -9.501  2.448   -23.734 1.00 0.00 ? 1  SER A O    5  
ATOM 5665  C CB   . SER A 1 1  ? -11.482 1.931   -26.071 1.00 0.00 ? 1  SER A CB   5  
ATOM 5666  O OG   . SER A 1 1  ? -11.802 0.985   -25.058 1.00 0.00 ? 1  SER A OG   5  
ATOM 5667  H H1   . SER A 1 1  ? -8.161  1.291   -26.226 1.00 0.00 ? 1  SER A H1   5  
ATOM 5668  H H2   . SER A 1 1  ? -9.417  0.534   -27.080 1.00 0.00 ? 1  SER A H2   5  
ATOM 5669  H H3   . SER A 1 1  ? -9.349  0.421   -25.391 1.00 0.00 ? 1  SER A H3   5  
ATOM 5670  H HA   . SER A 1 1  ? -9.771  2.900   -26.935 1.00 0.00 ? 1  SER A HA   5  
ATOM 5671  H HB2  . SER A 1 1  ? -12.051 2.831   -25.893 1.00 0.00 ? 1  SER A HB2  5  
ATOM 5672  H HB3  . SER A 1 1  ? -11.758 1.518   -27.030 1.00 0.00 ? 1  SER A HB3  5  
ATOM 5673  H HG   . SER A 1 1  ? -11.517 0.099   -25.343 1.00 0.00 ? 1  SER A HG   5  
ATOM 5674  N N    . ASP A 1 2  ? -9.340  4.321   -24.967 1.00 0.00 ? 2  ASP A N    5  
ATOM 5675  C CA   . ASP A 1 2  ? -8.870  5.135   -23.856 1.00 0.00 ? 2  ASP A CA   5  
ATOM 5676  C C    . ASP A 1 2  ? -10.043 5.810   -23.160 1.00 0.00 ? 2  ASP A C    5  
ATOM 5677  O O    . ASP A 1 2  ? -10.748 6.623   -23.759 1.00 0.00 ? 2  ASP A O    5  
ATOM 5678  C CB   . ASP A 1 2  ? -7.877  6.189   -24.347 1.00 0.00 ? 2  ASP A CB   5  
ATOM 5679  C CG   . ASP A 1 2  ? -6.992  6.692   -23.233 1.00 0.00 ? 2  ASP A CG   5  
ATOM 5680  O OD1  . ASP A 1 2  ? -5.917  6.089   -23.010 1.00 0.00 ? 2  ASP A OD1  5  
ATOM 5681  O OD2  . ASP A 1 2  ? -7.361  7.677   -22.562 1.00 0.00 ? 2  ASP A OD2  5  
ATOM 5682  H H    . ASP A 1 2  ? -9.480  4.741   -25.840 1.00 0.00 ? 2  ASP A H    5  
ATOM 5683  H HA   . ASP A 1 2  ? -8.373  4.483   -23.154 1.00 0.00 ? 2  ASP A HA   5  
ATOM 5684  H HB2  . ASP A 1 2  ? -7.249  5.759   -25.115 1.00 0.00 ? 2  ASP A HB2  5  
ATOM 5685  H HB3  . ASP A 1 2  ? -8.421  7.027   -24.758 1.00 0.00 ? 2  ASP A HB3  5  
ATOM 5686  N N    . ARG A 1 3  ? -10.268 5.458   -21.902 1.00 0.00 ? 3  ARG A N    5  
ATOM 5687  C CA   . ARG A 1 3  ? -11.400 5.988   -21.158 1.00 0.00 ? 3  ARG A CA   5  
ATOM 5688  C C    . ARG A 1 3  ? -10.998 6.400   -19.744 1.00 0.00 ? 3  ARG A C    5  
ATOM 5689  O O    . ARG A 1 3  ? -10.429 5.612   -18.983 1.00 0.00 ? 3  ARG A O    5  
ATOM 5690  C CB   . ARG A 1 3  ? -12.530 4.958   -21.127 1.00 0.00 ? 3  ARG A CB   5  
ATOM 5691  C CG   . ARG A 1 3  ? -12.132 3.623   -20.520 1.00 0.00 ? 3  ARG A CG   5  
ATOM 5692  C CD   . ARG A 1 3  ? -13.205 2.576   -20.741 1.00 0.00 ? 3  ARG A CD   5  
ATOM 5693  N NE   . ARG A 1 3  ? -13.271 2.142   -22.138 1.00 0.00 ? 3  ARG A NE   5  
ATOM 5694  C CZ   . ARG A 1 3  ? -14.407 1.961   -22.810 1.00 0.00 ? 3  ARG A CZ   5  
ATOM 5695  N NH1  . ARG A 1 3  ? -15.565 2.287   -22.256 1.00 0.00 ? 3  ARG A NH1  5  
ATOM 5696  N NH2  . ARG A 1 3  ? -14.378 1.491   -24.048 1.00 0.00 ? 3  ARG A NH2  5  
ATOM 5697  H H    . ARG A 1 3  ? -9.655  4.836   -21.461 1.00 0.00 ? 3  ARG A H    5  
ATOM 5698  H HA   . ARG A 1 3  ? -11.750 6.866   -21.680 1.00 0.00 ? 3  ARG A HA   5  
ATOM 5699  H HB2  . ARG A 1 3  ? -13.352 5.359   -20.553 1.00 0.00 ? 3  ARG A HB2  5  
ATOM 5700  H HB3  . ARG A 1 3  ? -12.864 4.781   -22.139 1.00 0.00 ? 3  ARG A HB3  5  
ATOM 5701  H HG2  . ARG A 1 3  ? -11.216 3.289   -20.981 1.00 0.00 ? 3  ARG A HG2  5  
ATOM 5702  H HG3  . ARG A 1 3  ? -11.979 3.753   -19.458 1.00 0.00 ? 3  ARG A HG3  5  
ATOM 5703  H HD2  . ARG A 1 3  ? -12.987 1.721   -20.118 1.00 0.00 ? 3  ARG A HD2  5  
ATOM 5704  H HD3  . ARG A 1 3  ? -14.161 2.994   -20.456 1.00 0.00 ? 3  ARG A HD3  5  
ATOM 5705  H HE   . ARG A 1 3  ? -12.419 1.950   -22.591 1.00 0.00 ? 3  ARG A HE   5  
ATOM 5706  H HH11 . ARG A 1 3  ? -15.593 2.675   -21.332 1.00 0.00 ? 3  ARG A HH11 5  
ATOM 5707  H HH12 . ARG A 1 3  ? -16.426 2.153   -22.767 1.00 0.00 ? 3  ARG A HH12 5  
ATOM 5708  H HH21 . ARG A 1 3  ? -13.498 1.271   -24.484 1.00 0.00 ? 3  ARG A HH21 5  
ATOM 5709  H HH22 . ARG A 1 3  ? -15.237 1.353   -24.559 1.00 0.00 ? 3  ARG A HH22 5  
ATOM 5710  N N    . VAL A 1 4  ? -11.281 7.647   -19.401 1.00 0.00 ? 4  VAL A N    5  
ATOM 5711  C CA   . VAL A 1 4  ? -11.004 8.154   -18.064 1.00 0.00 ? 4  VAL A CA   5  
ATOM 5712  C C    . VAL A 1 4  ? -12.215 7.934   -17.164 1.00 0.00 ? 4  VAL A C    5  
ATOM 5713  O O    . VAL A 1 4  ? -13.353 7.979   -17.628 1.00 0.00 ? 4  VAL A O    5  
ATOM 5714  C CB   . VAL A 1 4  ? -10.649 9.657   -18.087 1.00 0.00 ? 4  VAL A CB   5  
ATOM 5715  C CG1  . VAL A 1 4  ? -10.134 10.122  -16.731 1.00 0.00 ? 4  VAL A CG1  5  
ATOM 5716  C CG2  . VAL A 1 4  ? -9.630  9.956   -19.173 1.00 0.00 ? 4  VAL A CG2  5  
ATOM 5717  H H    . VAL A 1 4  ? -11.687 8.246   -20.066 1.00 0.00 ? 4  VAL A H    5  
ATOM 5718  H HA   . VAL A 1 4  ? -10.162 7.606   -17.664 1.00 0.00 ? 4  VAL A HA   5  
ATOM 5719  H HB   . VAL A 1 4  ? -11.548 10.209  -18.307 1.00 0.00 ? 4  VAL A HB   5  
ATOM 5720  H HG11 . VAL A 1 4  ? -9.249  9.562   -16.470 1.00 0.00 ? 4  VAL A HG11 5  
ATOM 5721  H HG12 . VAL A 1 4  ? -10.896 9.962   -15.983 1.00 0.00 ? 4  VAL A HG12 5  
ATOM 5722  H HG13 . VAL A 1 4  ? -9.894  11.174  -16.780 1.00 0.00 ? 4  VAL A HG13 5  
ATOM 5723  H HG21 . VAL A 1 4  ? -10.035 9.675   -20.133 1.00 0.00 ? 4  VAL A HG21 5  
ATOM 5724  H HG22 . VAL A 1 4  ? -8.726  9.396   -18.985 1.00 0.00 ? 4  VAL A HG22 5  
ATOM 5725  H HG23 . VAL A 1 4  ? -9.406  11.012  -19.172 1.00 0.00 ? 4  VAL A HG23 5  
ATOM 5726  N N    . LYS A 1 5  ? -11.963 7.691   -15.885 1.00 0.00 ? 5  LYS A N    5  
ATOM 5727  C CA   . LYS A 1 5  ? -13.023 7.402   -14.926 1.00 0.00 ? 5  LYS A CA   5  
ATOM 5728  C C    . LYS A 1 5  ? -12.641 7.898   -13.535 1.00 0.00 ? 5  LYS A C    5  
ATOM 5729  O O    . LYS A 1 5  ? -11.459 8.079   -13.233 1.00 0.00 ? 5  LYS A O    5  
ATOM 5730  C CB   . LYS A 1 5  ? -13.319 5.894   -14.874 1.00 0.00 ? 5  LYS A CB   5  
ATOM 5731  C CG   . LYS A 1 5  ? -14.141 5.352   -16.042 1.00 0.00 ? 5  LYS A CG   5  
ATOM 5732  C CD   . LYS A 1 5  ? -15.646 5.502   -15.811 1.00 0.00 ? 5  LYS A CD   5  
ATOM 5733  C CE   . LYS A 1 5  ? -16.115 6.949   -15.905 1.00 0.00 ? 5  LYS A CE   5  
ATOM 5734  N NZ   . LYS A 1 5  ? -17.575 7.084   -15.656 1.00 0.00 ? 5  LYS A NZ   5  
ATOM 5735  H H    . LYS A 1 5  ? -11.042 7.740   -15.567 1.00 0.00 ? 5  LYS A H    5  
ATOM 5736  H HA   . LYS A 1 5  ? -13.906 7.924   -15.250 1.00 0.00 ? 5  LYS A HA   5  
ATOM 5737  H HB2  . LYS A 1 5  ? -12.381 5.360   -14.854 1.00 0.00 ? 5  LYS A HB2  5  
ATOM 5738  H HB3  . LYS A 1 5  ? -13.856 5.680   -13.961 1.00 0.00 ? 5  LYS A HB3  5  
ATOM 5739  H HG2  . LYS A 1 5  ? -13.873 5.892   -16.938 1.00 0.00 ? 5  LYS A HG2  5  
ATOM 5740  H HG3  . LYS A 1 5  ? -13.910 4.305   -16.170 1.00 0.00 ? 5  LYS A HG3  5  
ATOM 5741  H HD2  . LYS A 1 5  ? -16.168 4.921   -16.555 1.00 0.00 ? 5  LYS A HD2  5  
ATOM 5742  H HD3  . LYS A 1 5  ? -15.883 5.121   -14.830 1.00 0.00 ? 5  LYS A HD3  5  
ATOM 5743  H HE2  . LYS A 1 5  ? -15.585 7.533   -15.171 1.00 0.00 ? 5  LYS A HE2  5  
ATOM 5744  H HE3  . LYS A 1 5  ? -15.891 7.324   -16.893 1.00 0.00 ? 5  LYS A HE3  5  
ATOM 5745  H HZ1  . LYS A 1 5  ? -18.115 6.473   -16.307 1.00 0.00 ? 5  LYS A HZ1  5  
ATOM 5746  H HZ2  . LYS A 1 5  ? -17.872 8.075   -15.799 1.00 0.00 ? 5  LYS A HZ2  5  
ATOM 5747  H HZ3  . LYS A 1 5  ? -17.801 6.808   -14.675 1.00 0.00 ? 5  LYS A HZ3  5  
ATOM 5748  N N    . ARG A 1 6  ? -13.656 8.120   -12.709 1.00 0.00 ? 6  ARG A N    5  
ATOM 5749  C CA   . ARG A 1 6  ? -13.468 8.545   -11.326 1.00 0.00 ? 6  ARG A CA   5  
ATOM 5750  C C    . ARG A 1 6  ? -12.938 7.400   -10.466 1.00 0.00 ? 6  ARG A C    5  
ATOM 5751  O O    . ARG A 1 6  ? -13.176 6.227   -10.766 1.00 0.00 ? 6  ARG A O    5  
ATOM 5752  C CB   . ARG A 1 6  ? -14.798 9.051   -10.748 1.00 0.00 ? 6  ARG A CB   5  
ATOM 5753  C CG   . ARG A 1 6  ? -15.943 8.057   -10.901 1.00 0.00 ? 6  ARG A CG   5  
ATOM 5754  C CD   . ARG A 1 6  ? -17.215 8.543   -10.220 1.00 0.00 ? 6  ARG A CD   5  
ATOM 5755  N NE   . ARG A 1 6  ? -17.123 8.486   -8.761  1.00 0.00 ? 6  ARG A NE   5  
ATOM 5756  C CZ   . ARG A 1 6  ? -18.177 8.344   -7.950  1.00 0.00 ? 6  ARG A CZ   5  
ATOM 5757  N NH1  . ARG A 1 6  ? -19.401 8.224   -8.457  1.00 0.00 ? 6  ARG A NH1  5  
ATOM 5758  N NH2  . ARG A 1 6  ? -18.004 8.308   -6.635  1.00 0.00 ? 6  ARG A NH2  5  
ATOM 5759  H H    . ARG A 1 6  ? -14.569 8.004   -13.044 1.00 0.00 ? 6  ARG A H    5  
ATOM 5760  H HA   . ARG A 1 6  ? -12.751 9.352   -11.317 1.00 0.00 ? 6  ARG A HA   5  
ATOM 5761  H HB2  . ARG A 1 6  ? -14.666 9.257   -9.696  1.00 0.00 ? 6  ARG A HB2  5  
ATOM 5762  H HB3  . ARG A 1 6  ? -15.073 9.965   -11.255 1.00 0.00 ? 6  ARG A HB3  5  
ATOM 5763  H HG2  . ARG A 1 6  ? -16.146 7.919   -11.953 1.00 0.00 ? 6  ARG A HG2  5  
ATOM 5764  H HG3  . ARG A 1 6  ? -15.650 7.113   -10.465 1.00 0.00 ? 6  ARG A HG3  5  
ATOM 5765  H HD2  . ARG A 1 6  ? -17.398 9.564   -10.520 1.00 0.00 ? 6  ARG A HD2  5  
ATOM 5766  H HD3  . ARG A 1 6  ? -18.039 7.924   -10.543 1.00 0.00 ? 6  ARG A HD3  5  
ATOM 5767  H HE   . ARG A 1 6  ? -16.227 8.562   -8.362  1.00 0.00 ? 6  ARG A HE   5  
ATOM 5768  H HH11 . ARG A 1 6  ? -19.541 8.246   -9.448  1.00 0.00 ? 6  ARG A HH11 5  
ATOM 5769  H HH12 . ARG A 1 6  ? -20.195 8.093   -7.844  1.00 0.00 ? 6  ARG A HH12 5  
ATOM 5770  H HH21 . ARG A 1 6  ? -17.075 8.376   -6.242  1.00 0.00 ? 6  ARG A HH21 5  
ATOM 5771  H HH22 . ARG A 1 6  ? -18.798 8.228   -6.017  1.00 0.00 ? 6  ARG A HH22 5  
ATOM 5772  N N    . PRO A 1 7  ? -12.199 7.730   -9.394  1.00 0.00 ? 7  PRO A N    5  
ATOM 5773  C CA   . PRO A 1 7  ? -11.734 6.747   -8.413  1.00 0.00 ? 7  PRO A CA   5  
ATOM 5774  C C    . PRO A 1 7  ? -12.900 6.114   -7.657  1.00 0.00 ? 7  PRO A C    5  
ATOM 5775  O O    . PRO A 1 7  ? -13.942 6.747   -7.454  1.00 0.00 ? 7  PRO A O    5  
ATOM 5776  C CB   . PRO A 1 7  ? -10.863 7.566   -7.450  1.00 0.00 ? 7  PRO A CB   5  
ATOM 5777  C CG   . PRO A 1 7  ? -10.566 8.836   -8.170  1.00 0.00 ? 7  PRO A CG   5  
ATOM 5778  C CD   . PRO A 1 7  ? -11.746 9.088   -9.060  1.00 0.00 ? 7  PRO A CD   5  
ATOM 5779  H HA   . PRO A 1 7  ? -11.135 5.969   -8.873  1.00 0.00 ? 7  PRO A HA   5  
ATOM 5780  H HB2  . PRO A 1 7  ? -11.411 7.751   -6.538  1.00 0.00 ? 7  PRO A HB2  5  
ATOM 5781  H HB3  . PRO A 1 7  ? -9.958  7.021   -7.228  1.00 0.00 ? 7  PRO A HB3  5  
ATOM 5782  H HG2  . PRO A 1 7  ? -10.452 9.643   -7.460  1.00 0.00 ? 7  PRO A HG2  5  
ATOM 5783  H HG3  . PRO A 1 7  ? -9.668  8.723   -8.759  1.00 0.00 ? 7  PRO A HG3  5  
ATOM 5784  H HD2  . PRO A 1 7  ? -12.513 9.635   -8.529  1.00 0.00 ? 7  PRO A HD2  5  
ATOM 5785  H HD3  . PRO A 1 7  ? -11.445 9.624   -9.948  1.00 0.00 ? 7  PRO A HD3  5  
ATOM 5786  N N    . MET A 1 8  ? -12.720 4.871   -7.242  1.00 0.00 ? 8  MET A N    5  
ATOM 5787  C CA   . MET A 1 8  ? -13.737 4.159   -6.478  1.00 0.00 ? 8  MET A CA   5  
ATOM 5788  C C    . MET A 1 8  ? -13.750 4.667   -5.040  1.00 0.00 ? 8  MET A C    5  
ATOM 5789  O O    . MET A 1 8  ? -12.895 5.462   -4.659  1.00 0.00 ? 8  MET A O    5  
ATOM 5790  C CB   . MET A 1 8  ? -13.485 2.648   -6.514  1.00 0.00 ? 8  MET A CB   5  
ATOM 5791  C CG   . MET A 1 8  ? -14.713 1.837   -6.917  1.00 0.00 ? 8  MET A CG   5  
ATOM 5792  S SD   . MET A 1 8  ? -16.128 2.115   -5.833  1.00 0.00 ? 8  MET A SD   5  
ATOM 5793  C CE   . MET A 1 8  ? -17.370 1.094   -6.622  1.00 0.00 ? 8  MET A CE   5  
ATOM 5794  H H    . MET A 1 8  ? -11.871 4.424   -7.441  1.00 0.00 ? 8  MET A H    5  
ATOM 5795  H HA   . MET A 1 8  ? -14.696 4.370   -6.928  1.00 0.00 ? 8  MET A HA   5  
ATOM 5796  H HB2  . MET A 1 8  ? -12.698 2.442   -7.222  1.00 0.00 ? 8  MET A HB2  5  
ATOM 5797  H HB3  . MET A 1 8  ? -13.173 2.323   -5.533  1.00 0.00 ? 8  MET A HB3  5  
ATOM 5798  H HG2  . MET A 1 8  ? -14.993 2.110   -7.922  1.00 0.00 ? 8  MET A HG2  5  
ATOM 5799  H HG3  . MET A 1 8  ? -14.458 0.787   -6.889  1.00 0.00 ? 8  MET A HG3  5  
ATOM 5800  H HE1  . MET A 1 8  ? -17.525 1.434   -7.636  1.00 0.00 ? 8  MET A HE1  5  
ATOM 5801  H HE2  . MET A 1 8  ? -18.297 1.167   -6.073  1.00 0.00 ? 8  MET A HE2  5  
ATOM 5802  H HE3  . MET A 1 8  ? -17.039 0.066   -6.634  1.00 0.00 ? 8  MET A HE3  5  
ATOM 5803  N N    . ASN A 1 9  ? -14.739 4.255   -4.262  1.00 0.00 ? 9  ASN A N    5  
ATOM 5804  C CA   . ASN A 1 9  ? -14.816 4.660   -2.868  1.00 0.00 ? 9  ASN A CA   5  
ATOM 5805  C C    . ASN A 1 9  ? -13.710 4.000   -2.046  1.00 0.00 ? 9  ASN A C    5  
ATOM 5806  O O    . ASN A 1 9  ? -13.184 2.946   -2.421  1.00 0.00 ? 9  ASN A O    5  
ATOM 5807  C CB   . ASN A 1 9  ? -16.209 4.369   -2.270  1.00 0.00 ? 9  ASN A CB   5  
ATOM 5808  C CG   . ASN A 1 9  ? -16.665 2.919   -2.370  1.00 0.00 ? 9  ASN A CG   5  
ATOM 5809  O OD1  . ASN A 1 9  ? -17.861 2.645   -2.456  1.00 0.00 ? 9  ASN A OD1  5  
ATOM 5810  N ND2  . ASN A 1 9  ? -15.733 1.989   -2.365  1.00 0.00 ? 9  ASN A ND2  5  
ATOM 5811  H H    . ASN A 1 9  ? -15.425 3.659   -4.631  1.00 0.00 ? 9  ASN A H    5  
ATOM 5812  H HA   . ASN A 1 9  ? -14.655 5.728   -2.842  1.00 0.00 ? 9  ASN A HA   5  
ATOM 5813  H HB2  . ASN A 1 9  ? -16.203 4.643   -1.226  1.00 0.00 ? 9  ASN A HB2  5  
ATOM 5814  H HB3  . ASN A 1 9  ? -16.929 4.981   -2.783  1.00 0.00 ? 9  ASN A HB3  5  
ATOM 5815  H HD21 . ASN A 1 9  ? -14.798 2.280   -2.309  1.00 0.00 ? 9  ASN A HD21 5  
ATOM 5816  H HD22 . ASN A 1 9  ? -16.014 1.044   -2.406  1.00 0.00 ? 9  ASN A HD22 5  
ATOM 5817  N N    . ALA A 1 10 ? -13.405 4.617   -0.915  1.00 0.00 ? 10 ALA A N    5  
ATOM 5818  C CA   . ALA A 1 10 ? -12.280 4.254   -0.058  1.00 0.00 ? 10 ALA A CA   5  
ATOM 5819  C C    . ALA A 1 10 ? -12.102 2.747   0.204   1.00 0.00 ? 10 ALA A C    5  
ATOM 5820  O O    . ALA A 1 10 ? -10.970 2.274   0.230   1.00 0.00 ? 10 ALA A O    5  
ATOM 5821  C CB   . ALA A 1 10 ? -12.439 4.977   1.268   1.00 0.00 ? 10 ALA A CB   5  
ATOM 5822  H H    . ALA A 1 10 ? -13.930 5.413   -0.668  1.00 0.00 ? 10 ALA A H    5  
ATOM 5823  H HA   . ALA A 1 10 ? -11.381 4.630   -0.521  1.00 0.00 ? 10 ALA A HA   5  
ATOM 5824  H HB1  . ALA A 1 10 ? -12.446 6.043   1.099   1.00 0.00 ? 10 ALA A HB1  5  
ATOM 5825  H HB2  . ALA A 1 10 ? -11.620 4.719   1.921   1.00 0.00 ? 10 ALA A HB2  5  
ATOM 5826  H HB3  . ALA A 1 10 ? -13.370 4.681   1.728   1.00 0.00 ? 10 ALA A HB3  5  
ATOM 5827  N N    . PHE A 1 11 ? -13.181 1.986   0.395   1.00 0.00 ? 11 PHE A N    5  
ATOM 5828  C CA   . PHE A 1 11 ? -13.028 0.580   0.804   1.00 0.00 ? 11 PHE A CA   5  
ATOM 5829  C C    . PHE A 1 11 ? -12.276 -0.237  -0.251  1.00 0.00 ? 11 PHE A C    5  
ATOM 5830  O O    . PHE A 1 11 ? -11.266 -0.884  0.050   1.00 0.00 ? 11 PHE A O    5  
ATOM 5831  C CB   . PHE A 1 11 ? -14.389 -0.072  1.082   1.00 0.00 ? 11 PHE A CB   5  
ATOM 5832  C CG   . PHE A 1 11 ? -14.269 -1.460  1.657   1.00 0.00 ? 11 PHE A CG   5  
ATOM 5833  C CD1  . PHE A 1 11 ? -13.980 -1.638  3.000   1.00 0.00 ? 11 PHE A CD1  5  
ATOM 5834  C CD2  . PHE A 1 11 ? -14.424 -2.580  0.855   1.00 0.00 ? 11 PHE A CD2  5  
ATOM 5835  C CE1  . PHE A 1 11 ? -13.851 -2.905  3.534   1.00 0.00 ? 11 PHE A CE1  5  
ATOM 5836  C CE2  . PHE A 1 11 ? -14.290 -3.852  1.383   1.00 0.00 ? 11 PHE A CE2  5  
ATOM 5837  C CZ   . PHE A 1 11 ? -14.004 -4.014  2.727   1.00 0.00 ? 11 PHE A CZ   5  
ATOM 5838  H H    . PHE A 1 11 ? -14.073 2.364   0.265   1.00 0.00 ? 11 PHE A H    5  
ATOM 5839  H HA   . PHE A 1 11 ? -12.449 0.570   1.716   1.00 0.00 ? 11 PHE A HA   5  
ATOM 5840  H HB2  . PHE A 1 11 ? -14.937 0.534   1.789   1.00 0.00 ? 11 PHE A HB2  5  
ATOM 5841  H HB3  . PHE A 1 11 ? -14.947 -0.139  0.160   1.00 0.00 ? 11 PHE A HB3  5  
ATOM 5842  H HD1  . PHE A 1 11 ? -13.861 -0.774  3.634   1.00 0.00 ? 11 PHE A HD1  5  
ATOM 5843  H HD2  . PHE A 1 11 ? -14.648 -2.454  -0.194  1.00 0.00 ? 11 PHE A HD2  5  
ATOM 5844  H HE1  . PHE A 1 11 ? -13.627 -3.028  4.584   1.00 0.00 ? 11 PHE A HE1  5  
ATOM 5845  H HE2  . PHE A 1 11 ? -14.413 -4.718  0.748   1.00 0.00 ? 11 PHE A HE2  5  
ATOM 5846  H HZ   . PHE A 1 11 ? -13.896 -5.005  3.144   1.00 0.00 ? 11 PHE A HZ   5  
ATOM 5847  N N    . MET A 1 12 ? -12.737 -0.168  -1.494  1.00 0.00 ? 12 MET A N    5  
ATOM 5848  C CA   . MET A 1 12 ? -12.092 -0.899  -2.581  1.00 0.00 ? 12 MET A CA   5  
ATOM 5849  C C    . MET A 1 12 ? -10.742 -0.271  -2.880  1.00 0.00 ? 12 MET A C    5  
ATOM 5850  O O    . MET A 1 12 ? -9.770  -0.958  -3.206  1.00 0.00 ? 12 MET A O    5  
ATOM 5851  C CB   . MET A 1 12 ? -12.975 -0.897  -3.832  1.00 0.00 ? 12 MET A CB   5  
ATOM 5852  C CG   . MET A 1 12 ? -14.307 -1.602  -3.630  1.00 0.00 ? 12 MET A CG   5  
ATOM 5853  S SD   . MET A 1 12 ? -15.333 -1.583  -5.109  1.00 0.00 ? 12 MET A SD   5  
ATOM 5854  C CE   . MET A 1 12 ? -16.784 -2.453  -4.524  1.00 0.00 ? 12 MET A CE   5  
ATOM 5855  H H    . MET A 1 12 ? -13.522 0.382   -1.685  1.00 0.00 ? 12 MET A H    5  
ATOM 5856  H HA   . MET A 1 12 ? -11.939 -1.917  -2.254  1.00 0.00 ? 12 MET A HA   5  
ATOM 5857  H HB2  . MET A 1 12 ? -13.172 0.126   -4.121  1.00 0.00 ? 12 MET A HB2  5  
ATOM 5858  H HB3  . MET A 1 12 ? -12.448 -1.394  -4.633  1.00 0.00 ? 12 MET A HB3  5  
ATOM 5859  H HG2  . MET A 1 12 ? -14.115 -2.629  -3.355  1.00 0.00 ? 12 MET A HG2  5  
ATOM 5860  H HG3  . MET A 1 12 ? -14.845 -1.110  -2.832  1.00 0.00 ? 12 MET A HG3  5  
ATOM 5861  H HE1  . MET A 1 12 ? -17.213 -1.917  -3.690  1.00 0.00 ? 12 MET A HE1  5  
ATOM 5862  H HE2  . MET A 1 12 ? -16.507 -3.447  -4.208  1.00 0.00 ? 12 MET A HE2  5  
ATOM 5863  H HE3  . MET A 1 12 ? -17.509 -2.518  -5.322  1.00 0.00 ? 12 MET A HE3  5  
ATOM 5864  N N    . VAL A 1 13 ? -10.700 1.043   -2.724  1.00 0.00 ? 13 VAL A N    5  
ATOM 5865  C CA   . VAL A 1 13 ? -9.488  1.815   -2.893  1.00 0.00 ? 13 VAL A CA   5  
ATOM 5866  C C    . VAL A 1 13 ? -8.391  1.294   -1.999  1.00 0.00 ? 13 VAL A C    5  
ATOM 5867  O O    . VAL A 1 13 ? -7.290  1.045   -2.451  1.00 0.00 ? 13 VAL A O    5  
ATOM 5868  C CB   . VAL A 1 13 ? -9.714  3.299   -2.567  1.00 0.00 ? 13 VAL A CB   5  
ATOM 5869  C CG1  . VAL A 1 13 ? -8.389  4.022   -2.472  1.00 0.00 ? 13 VAL A CG1  5  
ATOM 5870  C CG2  . VAL A 1 13 ? -10.582 3.942   -3.625  1.00 0.00 ? 13 VAL A CG2  5  
ATOM 5871  H H    . VAL A 1 13 ? -11.515 1.507   -2.478  1.00 0.00 ? 13 VAL A H    5  
ATOM 5872  H HA   . VAL A 1 13 ? -9.176  1.734   -3.923  1.00 0.00 ? 13 VAL A HA   5  
ATOM 5873  H HB   . VAL A 1 13 ? -10.218 3.374   -1.604  1.00 0.00 ? 13 VAL A HB   5  
ATOM 5874  H HG11 . VAL A 1 13 ? -8.559  5.054   -2.206  1.00 0.00 ? 13 VAL A HG11 5  
ATOM 5875  H HG12 . VAL A 1 13 ? -7.885  3.975   -3.427  1.00 0.00 ? 13 VAL A HG12 5  
ATOM 5876  H HG13 . VAL A 1 13 ? -7.776  3.551   -1.719  1.00 0.00 ? 13 VAL A HG13 5  
ATOM 5877  H HG21 . VAL A 1 13 ? -10.096 3.863   -4.586  1.00 0.00 ? 13 VAL A HG21 5  
ATOM 5878  H HG22 . VAL A 1 13 ? -10.735 4.983   -3.382  1.00 0.00 ? 13 VAL A HG22 5  
ATOM 5879  H HG23 . VAL A 1 13 ? -11.537 3.438   -3.662  1.00 0.00 ? 13 VAL A HG23 5  
ATOM 5880  N N    . TRP A 1 14 ? -8.699  1.132   -0.729  1.00 0.00 ? 14 TRP A N    5  
ATOM 5881  C CA   . TRP A 1 14 ? -7.712  0.680   0.219   1.00 0.00 ? 14 TRP A CA   5  
ATOM 5882  C C    . TRP A 1 14 ? -7.287  -0.737  -0.101  1.00 0.00 ? 14 TRP A C    5  
ATOM 5883  O O    . TRP A 1 14 ? -6.155  -1.118  0.156   1.00 0.00 ? 14 TRP A O    5  
ATOM 5884  C CB   . TRP A 1 14 ? -8.250  0.766   1.638   1.00 0.00 ? 14 TRP A CB   5  
ATOM 5885  C CG   . TRP A 1 14 ? -7.295  1.420   2.591   1.00 0.00 ? 14 TRP A CG   5  
ATOM 5886  C CD1  . TRP A 1 14 ? -6.520  2.517   2.350   1.00 0.00 ? 14 TRP A CD1  5  
ATOM 5887  C CD2  . TRP A 1 14 ? -7.039  1.035   3.942   1.00 0.00 ? 14 TRP A CD2  5  
ATOM 5888  N NE1  . TRP A 1 14 ? -5.785  2.830   3.466   1.00 0.00 ? 14 TRP A NE1  5  
ATOM 5889  C CE2  . TRP A 1 14 ? -6.086  1.933   4.460   1.00 0.00 ? 14 TRP A CE2  5  
ATOM 5890  C CE3  . TRP A 1 14 ? -7.518  0.014   4.764   1.00 0.00 ? 14 TRP A CE3  5  
ATOM 5891  C CZ2  . TRP A 1 14 ? -5.609  1.839   5.763   1.00 0.00 ? 14 TRP A CZ2  5  
ATOM 5892  C CZ3  . TRP A 1 14 ? -7.046  -0.077  6.056   1.00 0.00 ? 14 TRP A CZ3  5  
ATOM 5893  C CH2  . TRP A 1 14 ? -6.100  0.827   6.544   1.00 0.00 ? 14 TRP A CH2  5  
ATOM 5894  H H    . TRP A 1 14 ? -9.612  1.327   -0.421  1.00 0.00 ? 14 TRP A H    5  
ATOM 5895  H HA   . TRP A 1 14 ? -6.851  1.325   0.128   1.00 0.00 ? 14 TRP A HA   5  
ATOM 5896  H HB2  . TRP A 1 14 ? -9.165  1.338   1.636   1.00 0.00 ? 14 TRP A HB2  5  
ATOM 5897  H HB3  . TRP A 1 14 ? -8.454  -0.231  2.001   1.00 0.00 ? 14 TRP A HB3  5  
ATOM 5898  H HD1  . TRP A 1 14 ? -6.494  3.047   1.410   1.00 0.00 ? 14 TRP A HD1  5  
ATOM 5899  H HE1  . TRP A 1 14 ? -5.153  3.577   3.539   1.00 0.00 ? 14 TRP A HE1  5  
ATOM 5900  H HE3  . TRP A 1 14 ? -8.249  -0.694  4.405   1.00 0.00 ? 14 TRP A HE3  5  
ATOM 5901  H HZ2  . TRP A 1 14 ? -4.877  2.531   6.158   1.00 0.00 ? 14 TRP A HZ2  5  
ATOM 5902  H HZ3  . TRP A 1 14 ? -7.410  -0.860  6.709   1.00 0.00 ? 14 TRP A HZ3  5  
ATOM 5903  H HH2  . TRP A 1 14 ? -5.759  0.715   7.560   1.00 0.00 ? 14 TRP A HH2  5  
ATOM 5904  N N    . SER A 1 15 ? -8.176  -1.517  -0.695  1.00 0.00 ? 15 SER A N    5  
ATOM 5905  C CA   . SER A 1 15 ? -7.812  -2.873  -1.042  1.00 0.00 ? 15 SER A CA   5  
ATOM 5906  C C    . SER A 1 15 ? -6.682  -2.867  -2.077  1.00 0.00 ? 15 SER A C    5  
ATOM 5907  O O    . SER A 1 15 ? -5.575  -3.342  -1.803  1.00 0.00 ? 15 SER A O    5  
ATOM 5908  C CB   . SER A 1 15 ? -9.029  -3.629  -1.579  1.00 0.00 ? 15 SER A CB   5  
ATOM 5909  O OG   . SER A 1 15 ? -10.106 -3.579  -0.656  1.00 0.00 ? 15 SER A OG   5  
ATOM 5910  H H    . SER A 1 15 ? -9.079  -1.174  -0.907  1.00 0.00 ? 15 SER A H    5  
ATOM 5911  H HA   . SER A 1 15 ? -7.460  -3.360  -0.145  1.00 0.00 ? 15 SER A HA   5  
ATOM 5912  H HB2  . SER A 1 15 ? -9.346  -3.181  -2.512  1.00 0.00 ? 15 SER A HB2  5  
ATOM 5913  H HB3  . SER A 1 15 ? -8.764  -4.662  -1.746  1.00 0.00 ? 15 SER A HB3  5  
ATOM 5914  H HG   . SER A 1 15 ? -10.010 -2.810  -0.084  1.00 0.00 ? 15 SER A HG   5  
ATOM 5915  N N    . ARG A 1 16 ? -6.935  -2.266  -3.236  1.00 0.00 ? 16 ARG A N    5  
ATOM 5916  C CA   . ARG A 1 16 ? -5.950  -2.275  -4.318  1.00 0.00 ? 16 ARG A CA   5  
ATOM 5917  C C    . ARG A 1 16 ? -4.863  -1.219  -4.123  1.00 0.00 ? 16 ARG A C    5  
ATOM 5918  O O    . ARG A 1 16 ? -3.687  -1.466  -4.395  1.00 0.00 ? 16 ARG A O    5  
ATOM 5919  C CB   . ARG A 1 16 ? -6.624  -2.100  -5.678  1.00 0.00 ? 16 ARG A CB   5  
ATOM 5920  C CG   . ARG A 1 16 ? -7.398  -3.330  -6.121  1.00 0.00 ? 16 ARG A CG   5  
ATOM 5921  C CD   . ARG A 1 16 ? -7.808  -3.238  -7.581  1.00 0.00 ? 16 ARG A CD   5  
ATOM 5922  N NE   . ARG A 1 16 ? -8.448  -4.470  -8.043  1.00 0.00 ? 16 ARG A NE   5  
ATOM 5923  C CZ   . ARG A 1 16 ? -8.392  -4.916  -9.297  1.00 0.00 ? 16 ARG A CZ   5  
ATOM 5924  N NH1  . ARG A 1 16 ? -7.676  -4.263  -10.210 1.00 0.00 ? 16 ARG A NH1  5  
ATOM 5925  N NH2  . ARG A 1 16 ? -9.026  -6.033  -9.625  1.00 0.00 ? 16 ARG A NH2  5  
ATOM 5926  H H    . ARG A 1 16 ? -7.796  -1.787  -3.357  1.00 0.00 ? 16 ARG A H    5  
ATOM 5927  H HA   . ARG A 1 16 ? -5.476  -3.246  -4.302  1.00 0.00 ? 16 ARG A HA   5  
ATOM 5928  H HB2  . ARG A 1 16 ? -7.311  -1.267  -5.622  1.00 0.00 ? 16 ARG A HB2  5  
ATOM 5929  H HB3  . ARG A 1 16 ? -5.869  -1.887  -6.418  1.00 0.00 ? 16 ARG A HB3  5  
ATOM 5930  H HG2  . ARG A 1 16 ? -6.775  -4.202  -5.989  1.00 0.00 ? 16 ARG A HG2  5  
ATOM 5931  H HG3  . ARG A 1 16 ? -8.286  -3.424  -5.511  1.00 0.00 ? 16 ARG A HG3  5  
ATOM 5932  H HD2  . ARG A 1 16 ? -8.501  -2.419  -7.696  1.00 0.00 ? 16 ARG A HD2  5  
ATOM 5933  H HD3  . ARG A 1 16 ? -6.928  -3.054  -8.179  1.00 0.00 ? 16 ARG A HD3  5  
ATOM 5934  H HE   . ARG A 1 16 ? -8.952  -4.993  -7.374  1.00 0.00 ? 16 ARG A HE   5  
ATOM 5935  H HH11 . ARG A 1 16 ? -7.173  -3.433  -9.957  1.00 0.00 ? 16 ARG A HH11 5  
ATOM 5936  H HH12 . ARG A 1 16 ? -7.634  -4.598  -11.153 1.00 0.00 ? 16 ARG A HH12 5  
ATOM 5937  H HH21 . ARG A 1 16 ? -9.544  -6.541  -8.931  1.00 0.00 ? 16 ARG A HH21 5  
ATOM 5938  H HH22 . ARG A 1 16 ? -8.992  -6.382  -10.574 1.00 0.00 ? 16 ARG A HH22 5  
ATOM 5939  N N    . GLY A 1 17 ? -5.263  -0.055  -3.649  1.00 0.00 ? 17 GLY A N    5  
ATOM 5940  C CA   . GLY A 1 17 ? -4.356  1.067   -3.520  1.00 0.00 ? 17 GLY A CA   5  
ATOM 5941  C C    . GLY A 1 17 ? -3.385  0.902   -2.374  1.00 0.00 ? 17 GLY A C    5  
ATOM 5942  O O    . GLY A 1 17 ? -2.179  1.083   -2.553  1.00 0.00 ? 17 GLY A O    5  
ATOM 5943  H H    . GLY A 1 17 ? -6.195  0.051   -3.363  1.00 0.00 ? 17 GLY A H    5  
ATOM 5944  H HA2  . GLY A 1 17 ? -3.797  1.168   -4.439  1.00 0.00 ? 17 GLY A HA2  5  
ATOM 5945  H HA3  . GLY A 1 17 ? -4.934  1.964   -3.361  1.00 0.00 ? 17 GLY A HA3  5  
ATOM 5946  N N    . GLN A 1 18 ? -3.901  0.538   -1.202  1.00 0.00 ? 18 GLN A N    5  
ATOM 5947  C CA   . GLN A 1 18 ? -3.048  0.332   -0.040  1.00 0.00 ? 18 GLN A CA   5  
ATOM 5948  C C    . GLN A 1 18 ? -2.142  -0.859  -0.299  1.00 0.00 ? 18 GLN A C    5  
ATOM 5949  O O    . GLN A 1 18 ? -0.973  -0.841  0.068   1.00 0.00 ? 18 GLN A O    5  
ATOM 5950  C CB   . GLN A 1 18 ? -3.885  0.123   1.226   1.00 0.00 ? 18 GLN A CB   5  
ATOM 5951  C CG   . GLN A 1 18 ? -3.103  0.203   2.530   1.00 0.00 ? 18 GLN A CG   5  
ATOM 5952  C CD   . GLN A 1 18 ? -2.258  1.451   2.630   1.00 0.00 ? 18 GLN A CD   5  
ATOM 5953  O OE1  . GLN A 1 18 ? -1.082  1.455   2.273   1.00 0.00 ? 18 GLN A OE1  5  
ATOM 5954  N NE2  . GLN A 1 18 ? -2.856  2.519   3.113   1.00 0.00 ? 18 GLN A NE2  5  
ATOM 5955  H H    . GLN A 1 18 ? -4.870  0.405   -1.118  1.00 0.00 ? 18 GLN A H    5  
ATOM 5956  H HA   . GLN A 1 18 ? -2.436  1.215   0.080   1.00 0.00 ? 18 GLN A HA   5  
ATOM 5957  H HB2  . GLN A 1 18 ? -4.661  0.872   1.258   1.00 0.00 ? 18 GLN A HB2  5  
ATOM 5958  H HB3  . GLN A 1 18 ? -4.348  -0.852  1.176   1.00 0.00 ? 18 GLN A HB3  5  
ATOM 5959  H HG2  . GLN A 1 18 ? -3.805  0.203   3.350   1.00 0.00 ? 18 GLN A HG2  5  
ATOM 5960  H HG3  . GLN A 1 18 ? -2.462  -0.655  2.613   1.00 0.00 ? 18 GLN A HG3  5  
ATOM 5961  H HE21 . GLN A 1 18 ? -3.797  2.438   3.376   1.00 0.00 ? 18 GLN A HE21 5  
ATOM 5962  H HE22 . GLN A 1 18 ? -2.346  3.347   3.170   1.00 0.00 ? 18 GLN A HE22 5  
ATOM 5963  N N    . ARG A 1 19 ? -2.678  -1.885  -0.969  1.00 0.00 ? 19 ARG A N    5  
ATOM 5964  C CA   . ARG A 1 19 ? -1.858  -3.003  -1.421  1.00 0.00 ? 19 ARG A CA   5  
ATOM 5965  C C    . ARG A 1 19 ? -0.716  -2.500  -2.301  1.00 0.00 ? 19 ARG A C    5  
ATOM 5966  O O    . ARG A 1 19 ? 0.398   -3.018  -2.250  1.00 0.00 ? 19 ARG A O    5  
ATOM 5967  C CB   . ARG A 1 19 ? -2.700  -3.992  -2.226  1.00 0.00 ? 19 ARG A CB   5  
ATOM 5968  C CG   . ARG A 1 19 ? -1.929  -5.215  -2.694  1.00 0.00 ? 19 ARG A CG   5  
ATOM 5969  C CD   . ARG A 1 19 ? -2.614  -5.894  -3.870  1.00 0.00 ? 19 ARG A CD   5  
ATOM 5970  N NE   . ARG A 1 19 ? -4.002  -6.263  -3.581  1.00 0.00 ? 19 ARG A NE   5  
ATOM 5971  C CZ   . ARG A 1 19 ? -4.818  -6.829  -4.474  1.00 0.00 ? 19 ARG A CZ   5  
ATOM 5972  N NH1  . ARG A 1 19 ? -4.386  -7.101  -5.697  1.00 0.00 ? 19 ARG A NH1  5  
ATOM 5973  N NH2  . ARG A 1 19 ? -6.068  -7.127  -4.148  1.00 0.00 ? 19 ARG A NH2  5  
ATOM 5974  H H    . ARG A 1 19 ? -3.651  -1.897  -1.148  1.00 0.00 ? 19 ARG A H    5  
ATOM 5975  H HA   . ARG A 1 19 ? -1.451  -3.500  -0.554  1.00 0.00 ? 19 ARG A HA   5  
ATOM 5976  H HB2  . ARG A 1 19 ? -3.523  -4.326  -1.613  1.00 0.00 ? 19 ARG A HB2  5  
ATOM 5977  H HB3  . ARG A 1 19 ? -3.092  -3.487  -3.096  1.00 0.00 ? 19 ARG A HB3  5  
ATOM 5978  H HG2  . ARG A 1 19 ? -0.938  -4.909  -2.997  1.00 0.00 ? 19 ARG A HG2  5  
ATOM 5979  H HG3  . ARG A 1 19 ? -1.857  -5.917  -1.876  1.00 0.00 ? 19 ARG A HG3  5  
ATOM 5980  H HD2  . ARG A 1 19 ? -2.604  -5.217  -4.712  1.00 0.00 ? 19 ARG A HD2  5  
ATOM 5981  H HD3  . ARG A 1 19 ? -2.060  -6.786  -4.125  1.00 0.00 ? 19 ARG A HD3  5  
ATOM 5982  H HE   . ARG A 1 19 ? -4.341  -6.071  -2.679  1.00 0.00 ? 19 ARG A HE   5  
ATOM 5983  H HH11 . ARG A 1 19 ? -3.441  -6.885  -5.966  1.00 0.00 ? 19 ARG A HH11 5  
ATOM 5984  H HH12 . ARG A 1 19 ? -5.006  -7.526  -6.367  1.00 0.00 ? 19 ARG A HH12 5  
ATOM 5985  H HH21 . ARG A 1 19 ? -6.415  -6.929  -3.231  1.00 0.00 ? 19 ARG A HH21 5  
ATOM 5986  H HH22 . ARG A 1 19 ? -6.677  -7.553  -4.829  1.00 0.00 ? 19 ARG A HH22 5  
ATOM 5987  N N    . ARG A 1 20 ? -1.001  -1.475  -3.097  1.00 0.00 ? 20 ARG A N    5  
ATOM 5988  C CA   . ARG A 1 20 ? -0.056  -1.001  -4.092  1.00 0.00 ? 20 ARG A CA   5  
ATOM 5989  C C    . ARG A 1 20 ? 1.032   -0.132  -3.466  1.00 0.00 ? 20 ARG A C    5  
ATOM 5990  O O    . ARG A 1 20 ? 2.219   -0.437  -3.611  1.00 0.00 ? 20 ARG A O    5  
ATOM 5991  C CB   . ARG A 1 20 ? -0.783  -0.251  -5.210  1.00 0.00 ? 20 ARG A CB   5  
ATOM 5992  C CG   . ARG A 1 20 ? -0.016  -0.246  -6.521  1.00 0.00 ? 20 ARG A CG   5  
ATOM 5993  C CD   . ARG A 1 20 ? -0.894  0.174   -7.684  1.00 0.00 ? 20 ARG A CD   5  
ATOM 5994  N NE   . ARG A 1 20 ? -0.256  -0.114  -8.968  1.00 0.00 ? 20 ARG A NE   5  
ATOM 5995  C CZ   . ARG A 1 20 ? -0.815  0.113   -10.155 1.00 0.00 ? 20 ARG A CZ   5  
ATOM 5996  N NH1  . ARG A 1 20 ? -2.019  0.671   -10.238 1.00 0.00 ? 20 ARG A NH1  5  
ATOM 5997  N NH2  . ARG A 1 20 ? -0.165  -0.224  -11.261 1.00 0.00 ? 20 ARG A NH2  5  
ATOM 5998  H H    . ARG A 1 20 ? -1.870  -1.024  -3.007  1.00 0.00 ? 20 ARG A H    5  
ATOM 5999  H HA   . ARG A 1 20 ? 0.418   -1.874  -4.520  1.00 0.00 ? 20 ARG A HA   5  
ATOM 6000  H HB2  . ARG A 1 20 ? -1.744  -0.717  -5.379  1.00 0.00 ? 20 ARG A HB2  5  
ATOM 6001  H HB3  . ARG A 1 20 ? -0.937  0.773   -4.903  1.00 0.00 ? 20 ARG A HB3  5  
ATOM 6002  H HG2  . ARG A 1 20 ? 0.810   0.444   -6.441  1.00 0.00 ? 20 ARG A HG2  5  
ATOM 6003  H HG3  . ARG A 1 20 ? 0.363   -1.241  -6.710  1.00 0.00 ? 20 ARG A HG3  5  
ATOM 6004  H HD2  . ARG A 1 20 ? -1.829  -0.362  -7.627  1.00 0.00 ? 20 ARG A HD2  5  
ATOM 6005  H HD3  . ARG A 1 20 ? -1.081  1.235   -7.616  1.00 0.00 ? 20 ARG A HD3  5  
ATOM 6006  H HE   . ARG A 1 20 ? 0.640   -0.523  -8.939  1.00 0.00 ? 20 ARG A HE   5  
ATOM 6007  H HH11 . ARG A 1 20 ? -2.516  0.918   -9.405  1.00 0.00 ? 20 ARG A HH11 5  
ATOM 6008  H HH12 . ARG A 1 20 ? -2.431  0.860   -11.141 1.00 0.00 ? 20 ARG A HH12 5  
ATOM 6009  H HH21 . ARG A 1 20 ? 0.746   -0.648  -11.199 1.00 0.00 ? 20 ARG A HH21 5  
ATOM 6010  H HH22 . ARG A 1 20 ? -0.584  -0.073  -12.165 1.00 0.00 ? 20 ARG A HH22 5  
ATOM 6011  N N    . LYS A 1 21 ? 0.664   0.946   -2.763  1.00 0.00 ? 21 LYS A N    5  
ATOM 6012  C CA   . LYS A 1 21 ? 1.696   1.786   -2.167  1.00 0.00 ? 21 LYS A CA   5  
ATOM 6013  C C    . LYS A 1 21 ? 2.466   1.019   -1.084  1.00 0.00 ? 21 LYS A C    5  
ATOM 6014  O O    . LYS A 1 21 ? 3.655   1.264   -0.879  1.00 0.00 ? 21 LYS A O    5  
ATOM 6015  C CB   . LYS A 1 21 ? 1.138   3.105   -1.619  1.00 0.00 ? 21 LYS A CB   5  
ATOM 6016  C CG   . LYS A 1 21 ? 0.606   3.038   -0.200  1.00 0.00 ? 21 LYS A CG   5  
ATOM 6017  C CD   . LYS A 1 21 ? 0.652   4.412   0.446   1.00 0.00 ? 21 LYS A CD   5  
ATOM 6018  C CE   . LYS A 1 21 ? 0.099   4.393   1.859   1.00 0.00 ? 21 LYS A CE   5  
ATOM 6019  N NZ   . LYS A 1 21 ? 0.756   3.365   2.704   1.00 0.00 ? 21 LYS A NZ   5  
ATOM 6020  H H    . LYS A 1 21 ? -0.299  1.191   -2.666  1.00 0.00 ? 21 LYS A H    5  
ATOM 6021  H HA   . LYS A 1 21 ? 2.394   2.020   -2.960  1.00 0.00 ? 21 LYS A HA   5  
ATOM 6022  H HB2  . LYS A 1 21 ? 1.922   3.846   -1.644  1.00 0.00 ? 21 LYS A HB2  5  
ATOM 6023  H HB3  . LYS A 1 21 ? 0.334   3.432   -2.262  1.00 0.00 ? 21 LYS A HB3  5  
ATOM 6024  H HG2  . LYS A 1 21 ? -0.416  2.689   -0.220  1.00 0.00 ? 21 LYS A HG2  5  
ATOM 6025  H HG3  . LYS A 1 21 ? 1.214   2.356   0.375   1.00 0.00 ? 21 LYS A HG3  5  
ATOM 6026  H HD2  . LYS A 1 21 ? 1.678   4.747   0.478   1.00 0.00 ? 21 LYS A HD2  5  
ATOM 6027  H HD3  . LYS A 1 21 ? 0.068   5.097   -0.151  1.00 0.00 ? 21 LYS A HD3  5  
ATOM 6028  H HE2  . LYS A 1 21 ? 0.252   5.365   2.305   1.00 0.00 ? 21 LYS A HE2  5  
ATOM 6029  H HE3  . LYS A 1 21 ? -0.960  4.184   1.812   1.00 0.00 ? 21 LYS A HE3  5  
ATOM 6030  H HZ1  . LYS A 1 21 ? 0.378   2.422   2.467   1.00 0.00 ? 21 LYS A HZ1  5  
ATOM 6031  H HZ2  . LYS A 1 21 ? 0.572   3.553   3.708   1.00 0.00 ? 21 LYS A HZ2  5  
ATOM 6032  H HZ3  . LYS A 1 21 ? 1.788   3.362   2.541   1.00 0.00 ? 21 LYS A HZ3  5  
ATOM 6033  N N    . MET A 1 22 ? 1.804   0.075   -0.407  1.00 0.00 ? 22 MET A N    5  
ATOM 6034  C CA   . MET A 1 22 ? 2.493   -0.780  0.557   1.00 0.00 ? 22 MET A CA   5  
ATOM 6035  C C    . MET A 1 22 ? 3.464   -1.716  -0.145  1.00 0.00 ? 22 MET A C    5  
ATOM 6036  O O    . MET A 1 22 ? 4.486   -2.074  0.413   1.00 0.00 ? 22 MET A O    5  
ATOM 6037  C CB   . MET A 1 22 ? 1.520   -1.603  1.408   1.00 0.00 ? 22 MET A CB   5  
ATOM 6038  C CG   . MET A 1 22 ? 0.969   -0.864  2.616   1.00 0.00 ? 22 MET A CG   5  
ATOM 6039  S SD   . MET A 1 22 ? 0.000   -1.938  3.697   1.00 0.00 ? 22 MET A SD   5  
ATOM 6040  C CE   . MET A 1 22 ? -0.436  -0.804  5.013   1.00 0.00 ? 22 MET A CE   5  
ATOM 6041  H H    . MET A 1 22 ? 0.838   -0.040  -0.554  1.00 0.00 ? 22 MET A H    5  
ATOM 6042  H HA   . MET A 1 22 ? 3.062   -0.137  1.212   1.00 0.00 ? 22 MET A HA   5  
ATOM 6043  H HB2  . MET A 1 22 ? 0.689   -1.902  0.789   1.00 0.00 ? 22 MET A HB2  5  
ATOM 6044  H HB3  . MET A 1 22 ? 2.031   -2.489  1.759   1.00 0.00 ? 22 MET A HB3  5  
ATOM 6045  H HG2  . MET A 1 22 ? 1.793   -0.455  3.183   1.00 0.00 ? 22 MET A HG2  5  
ATOM 6046  H HG3  . MET A 1 22 ? 0.337   -0.059  2.271   1.00 0.00 ? 22 MET A HG3  5  
ATOM 6047  H HE1  . MET A 1 22 ? 0.463   -0.446  5.491   1.00 0.00 ? 22 MET A HE1  5  
ATOM 6048  H HE2  . MET A 1 22 ? -1.052  -1.316  5.738   1.00 0.00 ? 22 MET A HE2  5  
ATOM 6049  H HE3  . MET A 1 22 ? -0.983  0.031   4.602   1.00 0.00 ? 22 MET A HE3  5  
ATOM 6050  N N    . ALA A 1 23 ? 3.152   -2.106  -1.373  1.00 0.00 ? 23 ALA A N    5  
ATOM 6051  C CA   . ALA A 1 23 ? 4.055   -2.956  -2.141  1.00 0.00 ? 23 ALA A CA   5  
ATOM 6052  C C    . ALA A 1 23 ? 5.352   -2.213  -2.450  1.00 0.00 ? 23 ALA A C    5  
ATOM 6053  O O    . ALA A 1 23 ? 6.416   -2.820  -2.591  1.00 0.00 ? 23 ALA A O    5  
ATOM 6054  C CB   . ALA A 1 23 ? 3.389   -3.432  -3.422  1.00 0.00 ? 23 ALA A CB   5  
ATOM 6055  H H    . ALA A 1 23 ? 2.300   -1.824  -1.769  1.00 0.00 ? 23 ALA A H    5  
ATOM 6056  H HA   . ALA A 1 23 ? 4.287   -3.823  -1.539  1.00 0.00 ? 23 ALA A HA   5  
ATOM 6057  H HB1  . ALA A 1 23 ? 4.052   -4.105  -3.944  1.00 0.00 ? 23 ALA A HB1  5  
ATOM 6058  H HB2  . ALA A 1 23 ? 3.171   -2.581  -4.051  1.00 0.00 ? 23 ALA A HB2  5  
ATOM 6059  H HB3  . ALA A 1 23 ? 2.473   -3.946  -3.180  1.00 0.00 ? 23 ALA A HB3  5  
ATOM 6060  N N    . GLN A 1 24 ? 5.253   -0.894  -2.553  1.00 0.00 ? 24 GLN A N    5  
ATOM 6061  C CA   . GLN A 1 24 ? 6.426   -0.051  -2.768  1.00 0.00 ? 24 GLN A CA   5  
ATOM 6062  C C    . GLN A 1 24 ? 7.150   0.261   -1.456  1.00 0.00 ? 24 GLN A C    5  
ATOM 6063  O O    . GLN A 1 24 ? 8.358   0.491   -1.451  1.00 0.00 ? 24 GLN A O    5  
ATOM 6064  C CB   . GLN A 1 24 ? 6.038   1.244   -3.488  1.00 0.00 ? 24 GLN A CB   5  
ATOM 6065  C CG   . GLN A 1 24 ? 6.235   1.183   -5.000  1.00 0.00 ? 24 GLN A CG   5  
ATOM 6066  C CD   . GLN A 1 24 ? 5.576   -0.027  -5.643  1.00 0.00 ? 24 GLN A CD   5  
ATOM 6067  O OE1  . GLN A 1 24 ? 4.420   0.027   -6.062  1.00 0.00 ? 24 GLN A OE1  5  
ATOM 6068  N NE2  . GLN A 1 24 ? 6.312   -1.126  -5.737  1.00 0.00 ? 24 GLN A NE2  5  
ATOM 6069  H H    . GLN A 1 24 ? 4.363   -0.478  -2.503  1.00 0.00 ? 24 GLN A H    5  
ATOM 6070  H HA   . GLN A 1 24 ? 7.104   -0.602  -3.404  1.00 0.00 ? 24 GLN A HA   5  
ATOM 6071  H HB2  . GLN A 1 24 ? 4.999   1.459   -3.287  1.00 0.00 ? 24 GLN A HB2  5  
ATOM 6072  H HB3  . GLN A 1 24 ? 6.645   2.052   -3.102  1.00 0.00 ? 24 GLN A HB3  5  
ATOM 6073  H HG2  . GLN A 1 24 ? 5.813   2.075   -5.440  1.00 0.00 ? 24 GLN A HG2  5  
ATOM 6074  H HG3  . GLN A 1 24 ? 7.295   1.150   -5.207  1.00 0.00 ? 24 GLN A HG3  5  
ATOM 6075  H HE21 . GLN A 1 24 ? 7.230   -1.100  -5.394  1.00 0.00 ? 24 GLN A HE21 5  
ATOM 6076  H HE22 . GLN A 1 24 ? 5.906   -1.923  -6.143  1.00 0.00 ? 24 GLN A HE22 5  
ATOM 6077  N N    . GLU A 1 25 ? 6.416   0.272   -0.349  1.00 0.00 ? 25 GLU A N    5  
ATOM 6078  C CA   . GLU A 1 25 ? 7.011   0.548   0.958   1.00 0.00 ? 25 GLU A CA   5  
ATOM 6079  C C    . GLU A 1 25 ? 7.572   -0.727  1.591   1.00 0.00 ? 25 GLU A C    5  
ATOM 6080  O O    . GLU A 1 25 ? 8.715   -0.761  2.048   1.00 0.00 ? 25 GLU A O    5  
ATOM 6081  C CB   . GLU A 1 25 ? 5.977   1.188   1.890   1.00 0.00 ? 25 GLU A CB   5  
ATOM 6082  C CG   . GLU A 1 25 ? 5.512   2.563   1.435   1.00 0.00 ? 25 GLU A CG   5  
ATOM 6083  C CD   . GLU A 1 25 ? 4.559   3.217   2.416   1.00 0.00 ? 25 GLU A CD   5  
ATOM 6084  O OE1  . GLU A 1 25 ? 3.343   2.955   2.340   1.00 0.00 ? 25 GLU A OE1  5  
ATOM 6085  O OE2  . GLU A 1 25 ? 5.024   3.999   3.272   1.00 0.00 ? 25 GLU A OE2  5  
ATOM 6086  H H    . GLU A 1 25 ? 5.452   0.098   -0.412  1.00 0.00 ? 25 GLU A H    5  
ATOM 6087  H HA   . GLU A 1 25 ? 7.823   1.243   0.809   1.00 0.00 ? 25 GLU A HA   5  
ATOM 6088  H HB2  . GLU A 1 25 ? 5.113   0.542   1.945   1.00 0.00 ? 25 GLU A HB2  5  
ATOM 6089  H HB3  . GLU A 1 25 ? 6.406   1.285   2.876   1.00 0.00 ? 25 GLU A HB3  5  
ATOM 6090  H HG2  . GLU A 1 25 ? 6.375   3.199   1.318   1.00 0.00 ? 25 GLU A HG2  5  
ATOM 6091  H HG3  . GLU A 1 25 ? 5.010   2.459   0.484   1.00 0.00 ? 25 GLU A HG3  5  
ATOM 6092  N N    . ASN A 1 26 ? 6.761   -1.770  1.603   1.00 0.00 ? 26 ASN A N    5  
ATOM 6093  C CA   . ASN A 1 26 ? 7.130   -3.053  2.191   1.00 0.00 ? 26 ASN A CA   5  
ATOM 6094  C C    . ASN A 1 26 ? 6.558   -4.204  1.356   1.00 0.00 ? 26 ASN A C    5  
ATOM 6095  O O    . ASN A 1 26 ? 5.459   -4.696  1.611   1.00 0.00 ? 26 ASN A O    5  
ATOM 6096  C CB   . ASN A 1 26 ? 6.700   -3.144  3.672   1.00 0.00 ? 26 ASN A CB   5  
ATOM 6097  C CG   . ASN A 1 26 ? 5.312   -2.579  3.976   1.00 0.00 ? 26 ASN A CG   5  
ATOM 6098  O OD1  . ASN A 1 26 ? 5.114   -1.949  5.016   1.00 0.00 ? 26 ASN A OD1  5  
ATOM 6099  N ND2  . ASN A 1 26 ? 4.343   -2.816  3.108   1.00 0.00 ? 26 ASN A ND2  5  
ATOM 6100  H H    . ASN A 1 26 ? 5.875   -1.685  1.184   1.00 0.00 ? 26 ASN A H    5  
ATOM 6101  H HA   . ASN A 1 26 ? 8.209   -3.117  2.145   1.00 0.00 ? 26 ASN A HA   5  
ATOM 6102  H HB2  . ASN A 1 26 ? 6.706   -4.182  3.968   1.00 0.00 ? 26 ASN A HB2  5  
ATOM 6103  H HB3  . ASN A 1 26 ? 7.420   -2.609  4.274   1.00 0.00 ? 26 ASN A HB3  5  
ATOM 6104  H HD21 . ASN A 1 26 ? 4.559   -3.349  2.306   1.00 0.00 ? 26 ASN A HD21 5  
ATOM 6105  H HD22 . ASN A 1 26 ? 3.452   -2.465  3.301   1.00 0.00 ? 26 ASN A HD22 5  
ATOM 6106  N N    . PRO A 1 27 ? 7.313   -4.631  0.326   1.00 0.00 ? 27 PRO A N    5  
ATOM 6107  C CA   . PRO A 1 27 ? 6.843   -5.579  -0.706  1.00 0.00 ? 27 PRO A CA   5  
ATOM 6108  C C    . PRO A 1 27 ? 6.416   -6.947  -0.169  1.00 0.00 ? 27 PRO A C    5  
ATOM 6109  O O    . PRO A 1 27 ? 5.925   -7.784  -0.927  1.00 0.00 ? 27 PRO A O    5  
ATOM 6110  C CB   . PRO A 1 27 ? 8.053   -5.734  -1.639  1.00 0.00 ? 27 PRO A CB   5  
ATOM 6111  C CG   . PRO A 1 27 ? 9.224   -5.289  -0.834  1.00 0.00 ? 27 PRO A CG   5  
ATOM 6112  C CD   . PRO A 1 27 ? 8.708   -4.221  0.085   1.00 0.00 ? 27 PRO A CD   5  
ATOM 6113  H HA   . PRO A 1 27 ? 6.023   -5.160  -1.266  1.00 0.00 ? 27 PRO A HA   5  
ATOM 6114  H HB2  . PRO A 1 27 ? 8.149   -6.768  -1.937  1.00 0.00 ? 27 PRO A HB2  5  
ATOM 6115  H HB3  . PRO A 1 27 ? 7.918   -5.114  -2.512  1.00 0.00 ? 27 PRO A HB3  5  
ATOM 6116  H HG2  . PRO A 1 27 ? 9.616   -6.119  -0.263  1.00 0.00 ? 27 PRO A HG2  5  
ATOM 6117  H HG3  . PRO A 1 27 ? 9.987   -4.889  -1.486  1.00 0.00 ? 27 PRO A HG3  5  
ATOM 6118  H HD2  . PRO A 1 27 ? 9.272   -4.210  1.006   1.00 0.00 ? 27 PRO A HD2  5  
ATOM 6119  H HD3  . PRO A 1 27 ? 8.747   -3.256  -0.398  1.00 0.00 ? 27 PRO A HD3  5  
ATOM 6120  N N    . LYS A 1 28 ? 6.592   -7.179  1.125   1.00 0.00 ? 28 LYS A N    5  
ATOM 6121  C CA   . LYS A 1 28 ? 6.173   -8.440  1.717   1.00 0.00 ? 28 LYS A CA   5  
ATOM 6122  C C    . LYS A 1 28 ? 4.657   -8.477  1.904   1.00 0.00 ? 28 LYS A C    5  
ATOM 6123  O O    . LYS A 1 28 ? 4.079   -9.537  2.137   1.00 0.00 ? 28 LYS A O    5  
ATOM 6124  C CB   . LYS A 1 28 ? 6.904   -8.700  3.038   1.00 0.00 ? 28 LYS A CB   5  
ATOM 6125  C CG   . LYS A 1 28 ? 8.391   -8.956  2.844   1.00 0.00 ? 28 LYS A CG   5  
ATOM 6126  C CD   . LYS A 1 28 ? 9.072   -9.415  4.125   1.00 0.00 ? 28 LYS A CD   5  
ATOM 6127  C CE   . LYS A 1 28 ? 10.541  -9.728  3.880   1.00 0.00 ? 28 LYS A CE   5  
ATOM 6128  N NZ   . LYS A 1 28 ? 11.228  -10.205 5.108   1.00 0.00 ? 28 LYS A NZ   5  
ATOM 6129  H H    . LYS A 1 28 ? 7.002   -6.490  1.687   1.00 0.00 ? 28 LYS A H    5  
ATOM 6130  H HA   . LYS A 1 28 ? 6.442   -9.220  1.017   1.00 0.00 ? 28 LYS A HA   5  
ATOM 6131  H HB2  . LYS A 1 28 ? 6.783   -7.842  3.685   1.00 0.00 ? 28 LYS A HB2  5  
ATOM 6132  H HB3  . LYS A 1 28 ? 6.470   -9.566  3.514   1.00 0.00 ? 28 LYS A HB3  5  
ATOM 6133  H HG2  . LYS A 1 28 ? 8.515   -9.723  2.095   1.00 0.00 ? 28 LYS A HG2  5  
ATOM 6134  H HG3  . LYS A 1 28 ? 8.859   -8.044  2.505   1.00 0.00 ? 28 LYS A HG3  5  
ATOM 6135  H HD2  . LYS A 1 28 ? 8.997   -8.631  4.865   1.00 0.00 ? 28 LYS A HD2  5  
ATOM 6136  H HD3  . LYS A 1 28 ? 8.578   -10.305 4.487   1.00 0.00 ? 28 LYS A HD3  5  
ATOM 6137  H HE2  . LYS A 1 28 ? 10.612  -10.493 3.121   1.00 0.00 ? 28 LYS A HE2  5  
ATOM 6138  H HE3  . LYS A 1 28 ? 11.032  -8.832  3.531   1.00 0.00 ? 28 LYS A HE3  5  
ATOM 6139  H HZ1  . LYS A 1 28 ? 10.776  -11.078 5.457   1.00 0.00 ? 28 LYS A HZ1  5  
ATOM 6140  H HZ2  . LYS A 1 28 ? 11.176  -9.480  5.854   1.00 0.00 ? 28 LYS A HZ2  5  
ATOM 6141  H HZ3  . LYS A 1 28 ? 12.232  -10.407 4.904   1.00 0.00 ? 28 LYS A HZ3  5  
ATOM 6142  N N    . MET A 1 29 ? 4.019   -7.320  1.805   1.00 0.00 ? 29 MET A N    5  
ATOM 6143  C CA   . MET A 1 29 ? 2.563   -7.245  1.767   1.00 0.00 ? 29 MET A CA   5  
ATOM 6144  C C    . MET A 1 29 ? 2.095   -7.513  0.343   1.00 0.00 ? 29 MET A C    5  
ATOM 6145  O O    . MET A 1 29 ? 2.550   -6.854  -0.593  1.00 0.00 ? 29 MET A O    5  
ATOM 6146  C CB   . MET A 1 29 ? 2.078   -5.866  2.229   1.00 0.00 ? 29 MET A CB   5  
ATOM 6147  C CG   . MET A 1 29 ? 1.877   -5.719  3.735   1.00 0.00 ? 29 MET A CG   5  
ATOM 6148  S SD   . MET A 1 29 ? 3.353   -6.082  4.713   1.00 0.00 ? 29 MET A SD   5  
ATOM 6149  C CE   . MET A 1 29 ? 3.144   -7.833  5.028   1.00 0.00 ? 29 MET A CE   5  
ATOM 6150  H H    . MET A 1 29 ? 4.541   -6.489  1.748   1.00 0.00 ? 29 MET A H    5  
ATOM 6151  H HA   . MET A 1 29 ? 2.166   -8.008  2.422   1.00 0.00 ? 29 MET A HA   5  
ATOM 6152  H HB2  . MET A 1 29 ? 2.803   -5.126  1.918   1.00 0.00 ? 29 MET A HB2  5  
ATOM 6153  H HB3  . MET A 1 29 ? 1.139   -5.651  1.741   1.00 0.00 ? 29 MET A HB3  5  
ATOM 6154  H HG2  . MET A 1 29 ? 1.577   -4.704  3.941   1.00 0.00 ? 29 MET A HG2  5  
ATOM 6155  H HG3  . MET A 1 29 ? 1.088   -6.391  4.041   1.00 0.00 ? 29 MET A HG3  5  
ATOM 6156  H HE1  . MET A 1 29 ? 3.959   -8.185  5.640   1.00 0.00 ? 29 MET A HE1  5  
ATOM 6157  H HE2  . MET A 1 29 ? 3.137   -8.368  4.092   1.00 0.00 ? 29 MET A HE2  5  
ATOM 6158  H HE3  . MET A 1 29 ? 2.206   -7.996  5.543   1.00 0.00 ? 29 MET A HE3  5  
ATOM 6159  N N    . HIS A 1 30 ? 1.202   -8.479  0.161   1.00 0.00 ? 30 HIS A N    5  
ATOM 6160  C CA   . HIS A 1 30 ? 0.826   -8.887  -1.188  1.00 0.00 ? 30 HIS A CA   5  
ATOM 6161  C C    . HIS A 1 30 ? -0.683  -9.059  -1.375  1.00 0.00 ? 30 HIS A C    5  
ATOM 6162  O O    . HIS A 1 30 ? -1.204  -8.661  -2.418  1.00 0.00 ? 30 HIS A O    5  
ATOM 6163  C CB   . HIS A 1 30 ? 1.587   -10.151 -1.635  1.00 0.00 ? 30 HIS A CB   5  
ATOM 6164  C CG   . HIS A 1 30 ? 1.612   -11.289 -0.652  1.00 0.00 ? 30 HIS A CG   5  
ATOM 6165  N ND1  . HIS A 1 30 ? 1.121   -12.543 -0.939  1.00 0.00 ? 30 HIS A ND1  5  
ATOM 6166  C CD2  . HIS A 1 30 ? 2.125   -11.372 0.599   1.00 0.00 ? 30 HIS A CD2  5  
ATOM 6167  C CE1  . HIS A 1 30 ? 1.330   -13.342 0.088   1.00 0.00 ? 30 HIS A CE1  5  
ATOM 6168  N NE2  . HIS A 1 30 ? 1.939   -12.657 1.032   1.00 0.00 ? 30 HIS A NE2  5  
ATOM 6169  H H    . HIS A 1 30 ? 0.771   -8.904  0.943   1.00 0.00 ? 30 HIS A H    5  
ATOM 6170  H HA   . HIS A 1 30 ? 1.132   -8.080  -1.840  1.00 0.00 ? 30 HIS A HA   5  
ATOM 6171  H HB2  . HIS A 1 30 ? 1.137   -10.522 -2.543  1.00 0.00 ? 30 HIS A HB2  5  
ATOM 6172  H HB3  . HIS A 1 30 ? 2.612   -9.878  -1.845  1.00 0.00 ? 30 HIS A HB3  5  
ATOM 6173  H HD1  . HIS A 1 30 ? 0.687   -12.818 -1.785  1.00 0.00 ? 30 HIS A HD1  5  
ATOM 6174  H HD2  . HIS A 1 30 ? 2.595   -10.571 1.150   1.00 0.00 ? 30 HIS A HD2  5  
ATOM 6175  H HE1  . HIS A 1 30 ? 1.053   -14.384 0.142   1.00 0.00 ? 30 HIS A HE1  5  
ATOM 6176  H HE2  . HIS A 1 30 ? 2.059   -12.966 1.962   1.00 0.00 ? 30 HIS A HE2  5  
ATOM 6177  N N    . ASN A 1 31 ? -1.395  -9.631  -0.398  1.00 0.00 ? 31 ASN A N    5  
ATOM 6178  C CA   . ASN A 1 31 ? -2.848  -9.812  -0.543  1.00 0.00 ? 31 ASN A CA   5  
ATOM 6179  C C    . ASN A 1 31 ? -3.542  -10.313 0.730   1.00 0.00 ? 31 ASN A C    5  
ATOM 6180  O O    . ASN A 1 31 ? -4.238  -9.546  1.393   1.00 0.00 ? 31 ASN A O    5  
ATOM 6181  C CB   . ASN A 1 31 ? -3.195  -10.729 -1.738  1.00 0.00 ? 31 ASN A CB   5  
ATOM 6182  C CG   . ASN A 1 31 ? -2.325  -11.974 -1.852  1.00 0.00 ? 31 ASN A CG   5  
ATOM 6183  O OD1  . ASN A 1 31 ? -1.851  -12.528 -0.861  1.00 0.00 ? 31 ASN A OD1  5  
ATOM 6184  N ND2  . ASN A 1 31 ? -2.100  -12.415 -3.080  1.00 0.00 ? 31 ASN A ND2  5  
ATOM 6185  H H    . ASN A 1 31 ? -0.946  -9.914  0.437   1.00 0.00 ? 31 ASN A H    5  
ATOM 6186  H HA   . ASN A 1 31 ? -3.251  -8.832  -0.760  1.00 0.00 ? 31 ASN A HA   5  
ATOM 6187  H HB2  . ASN A 1 31 ? -4.219  -11.051 -1.640  1.00 0.00 ? 31 ASN A HB2  5  
ATOM 6188  H HB3  . ASN A 1 31 ? -3.094  -10.161 -2.651  1.00 0.00 ? 31 ASN A HB3  5  
ATOM 6189  H HD21 . ASN A 1 31 ? -2.498  -11.918 -3.834  1.00 0.00 ? 31 ASN A HD21 5  
ATOM 6190  H HD22 . ASN A 1 31 ? -1.548  -13.222 -3.191  1.00 0.00 ? 31 ASN A HD22 5  
ATOM 6191  N N    . SER A 1 32 ? -3.361  -11.585 1.064   1.00 0.00 ? 32 SER A N    5  
ATOM 6192  C CA   . SER A 1 32 ? -4.149  -12.238 2.111   1.00 0.00 ? 32 SER A CA   5  
ATOM 6193  C C    . SER A 1 32 ? -4.005  -11.550 3.469   1.00 0.00 ? 32 SER A C    5  
ATOM 6194  O O    . SER A 1 32 ? -5.003  -11.244 4.127   1.00 0.00 ? 32 SER A O    5  
ATOM 6195  C CB   . SER A 1 32 ? -3.732  -13.702 2.221   1.00 0.00 ? 32 SER A CB   5  
ATOM 6196  O OG   . SER A 1 32 ? -3.854  -14.361 0.969   1.00 0.00 ? 32 SER A OG   5  
ATOM 6197  H H    . SER A 1 32 ? -2.683  -12.111 0.584   1.00 0.00 ? 32 SER A H    5  
ATOM 6198  H HA   . SER A 1 32 ? -5.185  -12.196 1.813   1.00 0.00 ? 32 SER A HA   5  
ATOM 6199  H HB2  . SER A 1 32 ? -2.703  -13.757 2.542   1.00 0.00 ? 32 SER A HB2  5  
ATOM 6200  H HB3  . SER A 1 32 ? -4.363  -14.201 2.942   1.00 0.00 ? 32 SER A HB3  5  
ATOM 6201  H HG   . SER A 1 32 ? -4.786  -14.552 0.797   1.00 0.00 ? 32 SER A HG   5  
ATOM 6202  N N    . GLU A 1 33 ? -2.771  -11.284 3.877   1.00 0.00 ? 33 GLU A N    5  
ATOM 6203  C CA   . GLU A 1 33 ? -2.516  -10.624 5.150   1.00 0.00 ? 33 GLU A CA   5  
ATOM 6204  C C    . GLU A 1 33 ? -3.127  -9.229  5.132   1.00 0.00 ? 33 GLU A C    5  
ATOM 6205  O O    . GLU A 1 33 ? -3.805  -8.814  6.079   1.00 0.00 ? 33 GLU A O    5  
ATOM 6206  C CB   . GLU A 1 33 ? -1.006  -10.572 5.461   1.00 0.00 ? 33 GLU A CB   5  
ATOM 6207  C CG   . GLU A 1 33 ? -0.151  -9.808  4.448   1.00 0.00 ? 33 GLU A CG   5  
ATOM 6208  C CD   . GLU A 1 33 ? -0.181  -10.412 3.056   1.00 0.00 ? 33 GLU A CD   5  
ATOM 6209  O OE1  . GLU A 1 33 ? -0.117  -11.652 2.935   1.00 0.00 ? 33 GLU A OE1  5  
ATOM 6210  O OE2  . GLU A 1 33 ? -0.303  -9.651  2.077   1.00 0.00 ? 33 GLU A OE2  5  
ATOM 6211  H H    . GLU A 1 33 ? -2.010  -11.529 3.304   1.00 0.00 ? 33 GLU A H    5  
ATOM 6212  H HA   . GLU A 1 33 ? -3.012  -11.201 5.919   1.00 0.00 ? 33 GLU A HA   5  
ATOM 6213  H HB2  . GLU A 1 33 ? -0.870  -10.105 6.425   1.00 0.00 ? 33 GLU A HB2  5  
ATOM 6214  H HB3  . GLU A 1 33 ? -0.634  -11.585 5.514   1.00 0.00 ? 33 GLU A HB3  5  
ATOM 6215  H HG2  . GLU A 1 33 ? -0.515  -8.793  4.388   1.00 0.00 ? 33 GLU A HG2  5  
ATOM 6216  H HG3  . GLU A 1 33 ? 0.870   -9.800  4.799   1.00 0.00 ? 33 GLU A HG3  5  
ATOM 6217  N N    . ILE A 1 34 ? -2.925  -8.539  4.016   1.00 0.00 ? 34 ILE A N    5  
ATOM 6218  C CA   . ILE A 1 34 ? -3.504  -7.226  3.791   1.00 0.00 ? 34 ILE A CA   5  
ATOM 6219  C C    . ILE A 1 34 ? -5.017  -7.266  3.990   1.00 0.00 ? 34 ILE A C    5  
ATOM 6220  O O    . ILE A 1 34 ? -5.597  -6.372  4.601   1.00 0.00 ? 34 ILE A O    5  
ATOM 6221  C CB   . ILE A 1 34 ? -3.197  -6.735  2.357   1.00 0.00 ? 34 ILE A CB   5  
ATOM 6222  C CG1  . ILE A 1 34 ? -1.688  -6.594  2.152   1.00 0.00 ? 34 ILE A CG1  5  
ATOM 6223  C CG2  . ILE A 1 34 ? -3.902  -5.419  2.062   1.00 0.00 ? 34 ILE A CG2  5  
ATOM 6224  C CD1  . ILE A 1 34 ? -1.307  -6.116  0.767   1.00 0.00 ? 34 ILE A CD1  5  
ATOM 6225  H H    . ILE A 1 34 ? -2.358  -8.932  3.316   1.00 0.00 ? 34 ILE A H    5  
ATOM 6226  H HA   . ILE A 1 34 ? -3.066  -6.533  4.495   1.00 0.00 ? 34 ILE A HA   5  
ATOM 6227  H HB   . ILE A 1 34 ? -3.576  -7.472  1.665   1.00 0.00 ? 34 ILE A HB   5  
ATOM 6228  H HG12 . ILE A 1 34 ? -1.300  -5.882  2.865   1.00 0.00 ? 34 ILE A HG12 5  
ATOM 6229  H HG13 . ILE A 1 34 ? -1.219  -7.554  2.314   1.00 0.00 ? 34 ILE A HG13 5  
ATOM 6230  H HG21 . ILE A 1 34 ? -3.532  -4.656  2.731   1.00 0.00 ? 34 ILE A HG21 5  
ATOM 6231  H HG22 . ILE A 1 34 ? -4.966  -5.542  2.208   1.00 0.00 ? 34 ILE A HG22 5  
ATOM 6232  H HG23 . ILE A 1 34 ? -3.708  -5.127  1.042   1.00 0.00 ? 34 ILE A HG23 5  
ATOM 6233  H HD11 . ILE A 1 34 ? -1.695  -5.119  0.611   1.00 0.00 ? 34 ILE A HD11 5  
ATOM 6234  H HD12 . ILE A 1 34 ? -1.723  -6.784  0.028   1.00 0.00 ? 34 ILE A HD12 5  
ATOM 6235  H HD13 . ILE A 1 34 ? -0.232  -6.101  0.674   1.00 0.00 ? 34 ILE A HD13 5  
ATOM 6236  N N    . SER A 1 35 ? -5.638  -8.337  3.515   1.00 0.00 ? 35 SER A N    5  
ATOM 6237  C CA   . SER A 1 35 ? -7.088  -8.445  3.532   1.00 0.00 ? 35 SER A CA   5  
ATOM 6238  C C    . SER A 1 35 ? -7.615  -8.553  4.965   1.00 0.00 ? 35 SER A C    5  
ATOM 6239  O O    . SER A 1 35 ? -8.644  -7.963  5.305   1.00 0.00 ? 35 SER A O    5  
ATOM 6240  C CB   . SER A 1 35 ? -7.532  -9.653  2.700   1.00 0.00 ? 35 SER A CB   5  
ATOM 6241  O OG   . SER A 1 35 ? -6.995  -9.591  1.383   1.00 0.00 ? 35 SER A OG   5  
ATOM 6242  H H    . SER A 1 35 ? -5.102  -9.085  3.156   1.00 0.00 ? 35 SER A H    5  
ATOM 6243  H HA   . SER A 1 35 ? -7.490  -7.548  3.083   1.00 0.00 ? 35 SER A HA   5  
ATOM 6244  H HB2  . SER A 1 35 ? -7.187  -10.560 3.173   1.00 0.00 ? 35 SER A HB2  5  
ATOM 6245  H HB3  . SER A 1 35 ? -8.612  -9.669  2.635   1.00 0.00 ? 35 SER A HB3  5  
ATOM 6246  H HG   . SER A 1 35 ? -6.037  -9.467  1.431   1.00 0.00 ? 35 SER A HG   5  
ATOM 6247  N N    . LYS A 1 36 ? -6.887  -9.275  5.814   1.00 0.00 ? 36 LYS A N    5  
ATOM 6248  C CA   . LYS A 1 36 ? -7.347  -9.518  7.174   1.00 0.00 ? 36 LYS A CA   5  
ATOM 6249  C C    . LYS A 1 36 ? -7.120  -8.285  8.043   1.00 0.00 ? 36 LYS A C    5  
ATOM 6250  O O    . LYS A 1 36 ? -7.968  -7.920  8.861   1.00 0.00 ? 36 LYS A O    5  
ATOM 6251  C CB   . LYS A 1 36 ? -6.642  -10.732 7.783   1.00 0.00 ? 36 LYS A CB   5  
ATOM 6252  C CG   . LYS A 1 36 ? -7.301  -11.238 9.060   1.00 0.00 ? 36 LYS A CG   5  
ATOM 6253  C CD   . LYS A 1 36 ? -8.707  -11.755 8.789   1.00 0.00 ? 36 LYS A CD   5  
ATOM 6254  C CE   . LYS A 1 36 ? -9.420  -12.186 10.065  1.00 0.00 ? 36 LYS A CE   5  
ATOM 6255  N NZ   . LYS A 1 36 ? -8.654  -13.212 10.817  1.00 0.00 ? 36 LYS A NZ   5  
ATOM 6256  H H    . LYS A 1 36 ? -6.013  -9.628  5.526   1.00 0.00 ? 36 LYS A H    5  
ATOM 6257  H HA   . LYS A 1 36 ? -8.408  -9.714  7.131   1.00 0.00 ? 36 LYS A HA   5  
ATOM 6258  H HB2  . LYS A 1 36 ? -6.637  -11.535 7.060   1.00 0.00 ? 36 LYS A HB2  5  
ATOM 6259  H HB3  . LYS A 1 36 ? -5.621  -10.463 8.013   1.00 0.00 ? 36 LYS A HB3  5  
ATOM 6260  H HG2  . LYS A 1 36 ? -6.704  -12.037 9.471   1.00 0.00 ? 36 LYS A HG2  5  
ATOM 6261  H HG3  . LYS A 1 36 ? -7.356  -10.426 9.772   1.00 0.00 ? 36 LYS A HG3  5  
ATOM 6262  H HD2  . LYS A 1 36 ? -9.283  -10.972 8.319   1.00 0.00 ? 36 LYS A HD2  5  
ATOM 6263  H HD3  . LYS A 1 36 ? -8.642  -12.603 8.122   1.00 0.00 ? 36 LYS A HD3  5  
ATOM 6264  H HE2  . LYS A 1 36 ? -9.556  -11.320 10.696  1.00 0.00 ? 36 LYS A HE2  5  
ATOM 6265  H HE3  . LYS A 1 36 ? -10.387 -12.593 9.802   1.00 0.00 ? 36 LYS A HE3  5  
ATOM 6266  H HZ1  . LYS A 1 36 ? -9.266  -13.685 11.516  1.00 0.00 ? 36 LYS A HZ1  5  
ATOM 6267  H HZ2  . LYS A 1 36 ? -7.851  -12.769 11.316  1.00 0.00 ? 36 LYS A HZ2  5  
ATOM 6268  H HZ3  . LYS A 1 36 ? -8.283  -13.933 10.162  1.00 0.00 ? 36 LYS A HZ3  5  
ATOM 6269  N N    . ARG A 1 37 ? -5.976  -7.640  7.854   1.00 0.00 ? 37 ARG A N    5  
ATOM 6270  C CA   . ARG A 1 37 ? -5.633  -6.465  8.641   1.00 0.00 ? 37 ARG A CA   5  
ATOM 6271  C C    . ARG A 1 37 ? -6.471  -5.258  8.235   1.00 0.00 ? 37 ARG A C    5  
ATOM 6272  O O    . ARG A 1 37 ? -7.031  -4.583  9.090   1.00 0.00 ? 37 ARG A O    5  
ATOM 6273  C CB   . ARG A 1 37 ? -4.141  -6.146  8.531   1.00 0.00 ? 37 ARG A CB   5  
ATOM 6274  C CG   . ARG A 1 37 ? -3.273  -7.087  9.349   1.00 0.00 ? 37 ARG A CG   5  
ATOM 6275  C CD   . ARG A 1 37 ? -1.819  -6.643  9.374   1.00 0.00 ? 37 ARG A CD   5  
ATOM 6276  N NE   . ARG A 1 37 ? -1.056  -7.366  10.392  1.00 0.00 ? 37 ARG A NE   5  
ATOM 6277  C CZ   . ARG A 1 37 ? 0.003   -6.868  11.029  1.00 0.00 ? 37 ARG A CZ   5  
ATOM 6278  N NH1  . ARG A 1 37 ? 0.499   -5.686  10.684  1.00 0.00 ? 37 ARG A NH1  5  
ATOM 6279  N NH2  . ARG A 1 37 ? 0.580   -7.566  12.001  1.00 0.00 ? 37 ARG A NH2  5  
ATOM 6280  H H    . ARG A 1 37 ? -5.348  -7.964  7.170   1.00 0.00 ? 37 ARG A H    5  
ATOM 6281  H HA   . ARG A 1 37 ? -5.858  -6.694  9.673   1.00 0.00 ? 37 ARG A HA   5  
ATOM 6282  H HB2  . ARG A 1 37 ? -3.842  -6.217  7.495   1.00 0.00 ? 37 ARG A HB2  5  
ATOM 6283  H HB3  . ARG A 1 37 ? -3.972  -5.138  8.880   1.00 0.00 ? 37 ARG A HB3  5  
ATOM 6284  H HG2  . ARG A 1 37 ? -3.646  -7.110  10.363  1.00 0.00 ? 37 ARG A HG2  5  
ATOM 6285  H HG3  . ARG A 1 37 ? -3.331  -8.076  8.922   1.00 0.00 ? 37 ARG A HG3  5  
ATOM 6286  H HD2  . ARG A 1 37 ? -1.380  -6.831  8.405   1.00 0.00 ? 37 ARG A HD2  5  
ATOM 6287  H HD3  . ARG A 1 37 ? -1.779  -5.585  9.590   1.00 0.00 ? 37 ARG A HD3  5  
ATOM 6288  H HE   . ARG A 1 37 ? -1.382  -8.266  10.644  1.00 0.00 ? 37 ARG A HE   5  
ATOM 6289  H HH11 . ARG A 1 37 ? 0.083   -5.159  9.935   1.00 0.00 ? 37 ARG A HH11 5  
ATOM 6290  H HH12 . ARG A 1 37 ? 1.282   -5.305  11.180  1.00 0.00 ? 37 ARG A HH12 5  
ATOM 6291  H HH21 . ARG A 1 37 ? 0.223   -8.471  12.257  1.00 0.00 ? 37 ARG A HH21 5  
ATOM 6292  H HH22 . ARG A 1 37 ? 1.366   -7.184  12.496  1.00 0.00 ? 37 ARG A HH22 5  
ATOM 6293  N N    . LEU A 1 38 ? -6.583  -5.009  6.937   1.00 0.00 ? 38 LEU A N    5  
ATOM 6294  C CA   . LEU A 1 38 ? -7.342  -3.858  6.447   1.00 0.00 ? 38 LEU A CA   5  
ATOM 6295  C C    . LEU A 1 38 ? -8.818  -3.964  6.824   1.00 0.00 ? 38 LEU A C    5  
ATOM 6296  O O    . LEU A 1 38 ? -9.443  -2.967  7.194   1.00 0.00 ? 38 LEU A O    5  
ATOM 6297  C CB   . LEU A 1 38 ? -7.181  -3.702  4.931   1.00 0.00 ? 38 LEU A CB   5  
ATOM 6298  C CG   . LEU A 1 38 ? -5.987  -2.844  4.483   1.00 0.00 ? 38 LEU A CG   5  
ATOM 6299  C CD1  . LEU A 1 38 ? -4.670  -3.402  5.002   1.00 0.00 ? 38 LEU A CD1  5  
ATOM 6300  C CD2  . LEU A 1 38 ? -5.966  -2.725  2.968   1.00 0.00 ? 38 LEU A CD2  5  
ATOM 6301  H H    . LEU A 1 38 ? -6.146  -5.607  6.290   1.00 0.00 ? 38 LEU A H    5  
ATOM 6302  H HA   . LEU A 1 38 ? -6.935  -2.979  6.927   1.00 0.00 ? 38 LEU A HA   5  
ATOM 6303  H HB2  . LEU A 1 38 ? -7.071  -4.686  4.499   1.00 0.00 ? 38 LEU A HB2  5  
ATOM 6304  H HB3  . LEU A 1 38 ? -8.082  -3.255  4.541   1.00 0.00 ? 38 LEU A HB3  5  
ATOM 6305  H HG   . LEU A 1 38 ? -6.101  -1.848  4.890   1.00 0.00 ? 38 LEU A HG   5  
ATOM 6306  H HD11 . LEU A 1 38 ? -4.693  -3.434  6.081   1.00 0.00 ? 38 LEU A HD11 5  
ATOM 6307  H HD12 . LEU A 1 38 ? -3.856  -2.770  4.677   1.00 0.00 ? 38 LEU A HD12 5  
ATOM 6308  H HD13 . LEU A 1 38 ? -4.526  -4.400  4.617   1.00 0.00 ? 38 LEU A HD13 5  
ATOM 6309  H HD21 . LEU A 1 38 ? -5.937  -3.710  2.530   1.00 0.00 ? 38 LEU A HD21 5  
ATOM 6310  H HD22 . LEU A 1 38 ? -5.094  -2.165  2.659   1.00 0.00 ? 38 LEU A HD22 5  
ATOM 6311  H HD23 . LEU A 1 38 ? -6.856  -2.211  2.634   1.00 0.00 ? 38 LEU A HD23 5  
ATOM 6312  N N    . GLY A 1 39 ? -9.369  -5.171  6.746   1.00 0.00 ? 39 GLY A N    5  
ATOM 6313  C CA   . GLY A 1 39 ? -10.739 -5.391  7.173   1.00 0.00 ? 39 GLY A CA   5  
ATOM 6314  C C    . GLY A 1 39 ? -10.932 -5.075  8.645   1.00 0.00 ? 39 GLY A C    5  
ATOM 6315  O O    . GLY A 1 39 ? -11.927 -4.463  9.037   1.00 0.00 ? 39 GLY A O    5  
ATOM 6316  H H    . GLY A 1 39 ? -8.846  -5.918  6.383   1.00 0.00 ? 39 GLY A H    5  
ATOM 6317  H HA2  . GLY A 1 39 ? -11.394 -4.761  6.587   1.00 0.00 ? 39 GLY A HA2  5  
ATOM 6318  H HA3  . GLY A 1 39 ? -10.998 -6.425  6.999   1.00 0.00 ? 39 GLY A HA3  5  
ATOM 6319  N N    . ALA A 1 40 ? -9.963  -5.476  9.460   1.00 0.00 ? 40 ALA A N    5  
ATOM 6320  C CA   . ALA A 1 40 ? -10.013 -5.222  10.893  1.00 0.00 ? 40 ALA A CA   5  
ATOM 6321  C C    . ALA A 1 40 ? -9.804  -3.741  11.189  1.00 0.00 ? 40 ALA A C    5  
ATOM 6322  O O    . ALA A 1 40 ? -10.360 -3.205  12.150  1.00 0.00 ? 40 ALA A O    5  
ATOM 6323  C CB   . ALA A 1 40 ? -8.968  -6.055  11.616  1.00 0.00 ? 40 ALA A CB   5  
ATOM 6324  H H    . ALA A 1 40 ? -9.191  -5.956  9.086   1.00 0.00 ? 40 ALA A H    5  
ATOM 6325  H HA   . ALA A 1 40 ? -10.989 -5.518  11.253  1.00 0.00 ? 40 ALA A HA   5  
ATOM 6326  H HB1  . ALA A 1 40 ? -9.109  -7.099  11.377  1.00 0.00 ? 40 ALA A HB1  5  
ATOM 6327  H HB2  . ALA A 1 40 ? -9.071  -5.911  12.682  1.00 0.00 ? 40 ALA A HB2  5  
ATOM 6328  H HB3  . ALA A 1 40 ? -7.983  -5.743  11.305  1.00 0.00 ? 40 ALA A HB3  5  
ATOM 6329  N N    . GLU A 1 41 ? -9.002  -3.080  10.364  1.00 0.00 ? 41 GLU A N    5  
ATOM 6330  C CA   . GLU A 1 41 ? -8.755  -1.655  10.530  1.00 0.00 ? 41 GLU A CA   5  
ATOM 6331  C C    . GLU A 1 41 ? -9.994  -0.847  10.173  1.00 0.00 ? 41 GLU A C    5  
ATOM 6332  O O    . GLU A 1 41 ? -10.333 0.111   10.866  1.00 0.00 ? 41 GLU A O    5  
ATOM 6333  C CB   . GLU A 1 41 ? -7.557  -1.201  9.695   1.00 0.00 ? 41 GLU A CB   5  
ATOM 6334  C CG   . GLU A 1 41 ? -6.232  -1.770  10.180  1.00 0.00 ? 41 GLU A CG   5  
ATOM 6335  C CD   . GLU A 1 41 ? -5.988  -1.501  11.653  1.00 0.00 ? 41 GLU A CD   5  
ATOM 6336  O OE1  . GLU A 1 41 ? -5.635  -0.358  12.000  1.00 0.00 ? 41 GLU A OE1  5  
ATOM 6337  O OE2  . GLU A 1 41 ? -6.157  -2.432  12.471  1.00 0.00 ? 41 GLU A OE2  5  
ATOM 6338  H H    . GLU A 1 41 ? -8.552  -3.567  9.634   1.00 0.00 ? 41 GLU A H    5  
ATOM 6339  H HA   . GLU A 1 41 ? -8.531  -1.485  11.572  1.00 0.00 ? 41 GLU A HA   5  
ATOM 6340  H HB2  . GLU A 1 41 ? -7.706  -1.513  8.670   1.00 0.00 ? 41 GLU A HB2  5  
ATOM 6341  H HB3  . GLU A 1 41 ? -7.496  -0.123  9.728   1.00 0.00 ? 41 GLU A HB3  5  
ATOM 6342  H HG2  . GLU A 1 41 ? -6.233  -2.838  10.020  1.00 0.00 ? 41 GLU A HG2  5  
ATOM 6343  H HG3  . GLU A 1 41 ? -5.431  -1.322  9.611   1.00 0.00 ? 41 GLU A HG3  5  
ATOM 6344  N N    . TRP A 1 42 ? -10.676 -1.241  9.100   1.00 0.00 ? 42 TRP A N    5  
ATOM 6345  C CA   . TRP A 1 42 ? -11.937 -0.608  8.722   1.00 0.00 ? 42 TRP A CA   5  
ATOM 6346  C C    . TRP A 1 42 ? -12.959 -0.735  9.855   1.00 0.00 ? 42 TRP A C    5  
ATOM 6347  O O    . TRP A 1 42 ? -13.748 0.180   10.105  1.00 0.00 ? 42 TRP A O    5  
ATOM 6348  C CB   . TRP A 1 42 ? -12.488 -1.217  7.427   1.00 0.00 ? 42 TRP A CB   5  
ATOM 6349  C CG   . TRP A 1 42 ? -13.772 -0.581  6.980   1.00 0.00 ? 42 TRP A CG   5  
ATOM 6350  C CD1  . TRP A 1 42 ? -15.004 -0.793  7.514   1.00 0.00 ? 42 TRP A CD1  5  
ATOM 6351  C CD2  . TRP A 1 42 ? -13.955 0.367   5.919   1.00 0.00 ? 42 TRP A CD2  5  
ATOM 6352  N NE1  . TRP A 1 42 ? -15.944 -0.032  6.866   1.00 0.00 ? 42 TRP A NE1  5  
ATOM 6353  C CE2  . TRP A 1 42 ? -15.328 0.680   5.875   1.00 0.00 ? 42 TRP A CE2  5  
ATOM 6354  C CE3  . TRP A 1 42 ? -13.099 0.977   5.002   1.00 0.00 ? 42 TRP A CE3  5  
ATOM 6355  C CZ2  . TRP A 1 42 ? -15.858 1.580   4.955   1.00 0.00 ? 42 TRP A CZ2  5  
ATOM 6356  C CZ3  . TRP A 1 42 ? -13.627 1.870   4.089   1.00 0.00 ? 42 TRP A CZ3  5  
ATOM 6357  C CH2  . TRP A 1 42 ? -14.996 2.161   4.068   1.00 0.00 ? 42 TRP A CH2  5  
ATOM 6358  H H    . TRP A 1 42 ? -10.311 -1.962  8.536   1.00 0.00 ? 42 TRP A H    5  
ATOM 6359  H HA   . TRP A 1 42 ? -11.746 0.435   8.555   1.00 0.00 ? 42 TRP A HA   5  
ATOM 6360  H HB2  . TRP A 1 42 ? -11.760 -1.091  6.639   1.00 0.00 ? 42 TRP A HB2  5  
ATOM 6361  H HB3  . TRP A 1 42 ? -12.669 -2.272  7.579   1.00 0.00 ? 42 TRP A HB3  5  
ATOM 6362  H HD1  . TRP A 1 42 ? -15.186 -1.454  8.343   1.00 0.00 ? 42 TRP A HD1  5  
ATOM 6363  H HE1  . TRP A 1 42 ? -16.905 -0.009  7.073   1.00 0.00 ? 42 TRP A HE1  5  
ATOM 6364  H HE3  . TRP A 1 42 ? -12.040 0.765   5.001   1.00 0.00 ? 42 TRP A HE3  5  
ATOM 6365  H HZ2  . TRP A 1 42 ? -16.910 1.817   4.928   1.00 0.00 ? 42 TRP A HZ2  5  
ATOM 6366  H HZ3  . TRP A 1 42 ? -12.979 2.349   3.371   1.00 0.00 ? 42 TRP A HZ3  5  
ATOM 6367  H HH2  . TRP A 1 42 ? -15.363 2.864   3.336   1.00 0.00 ? 42 TRP A HH2  5  
ATOM 6368  N N    . LYS A 1 43 ? -12.925 -1.864  10.550  1.00 0.00 ? 43 LYS A N    5  
ATOM 6369  C CA   . LYS A 1 43 ? -13.836 -2.113  11.663  1.00 0.00 ? 43 LYS A CA   5  
ATOM 6370  C C    . LYS A 1 43 ? -13.717 -1.049  12.757  1.00 0.00 ? 43 LYS A C    5  
ATOM 6371  O O    . LYS A 1 43 ? -14.686 -0.750  13.454  1.00 0.00 ? 43 LYS A O    5  
ATOM 6372  C CB   . LYS A 1 43 ? -13.591 -3.497  12.227  1.00 0.00 ? 43 LYS A CB   5  
ATOM 6373  C CG   . LYS A 1 43 ? -14.329 -4.555  11.443  1.00 0.00 ? 43 LYS A CG   5  
ATOM 6374  C CD   . LYS A 1 43 ? -13.879 -5.942  11.816  1.00 0.00 ? 43 LYS A CD   5  
ATOM 6375  C CE   . LYS A 1 43 ? -14.084 -6.238  13.294  1.00 0.00 ? 43 LYS A CE   5  
ATOM 6376  N NZ   . LYS A 1 43 ? -15.515 -6.160  13.689  1.00 0.00 ? 43 LYS A NZ   5  
ATOM 6377  H H    . LYS A 1 43 ? -12.270 -2.556  10.305  1.00 0.00 ? 43 LYS A H    5  
ATOM 6378  H HA   . LYS A 1 43 ? -14.838 -2.101  11.265  1.00 0.00 ? 43 LYS A HA   5  
ATOM 6379  H HB2  . LYS A 1 43 ? -12.533 -3.714  12.190  1.00 0.00 ? 43 LYS A HB2  5  
ATOM 6380  H HB3  . LYS A 1 43 ? -13.929 -3.528  13.250  1.00 0.00 ? 43 LYS A HB3  5  
ATOM 6381  H HG2  . LYS A 1 43 ? -15.387 -4.466  11.643  1.00 0.00 ? 43 LYS A HG2  5  
ATOM 6382  H HG3  . LYS A 1 43 ? -14.147 -4.398  10.389  1.00 0.00 ? 43 LYS A HG3  5  
ATOM 6383  H HD2  . LYS A 1 43 ? -14.450 -6.641  11.238  1.00 0.00 ? 43 LYS A HD2  5  
ATOM 6384  H HD3  . LYS A 1 43 ? -12.834 -6.038  11.577  1.00 0.00 ? 43 LYS A HD3  5  
ATOM 6385  H HE2  . LYS A 1 43 ? -13.719 -7.234  13.502  1.00 0.00 ? 43 LYS A HE2  5  
ATOM 6386  H HE3  . LYS A 1 43 ? -13.520 -5.522  13.873  1.00 0.00 ? 43 LYS A HE3  5  
ATOM 6387  H HZ1  . LYS A 1 43 ? -16.099 -6.741  13.049  1.00 0.00 ? 43 LYS A HZ1  5  
ATOM 6388  H HZ2  . LYS A 1 43 ? -15.847 -5.172  13.645  1.00 0.00 ? 43 LYS A HZ2  5  
ATOM 6389  H HZ3  . LYS A 1 43 ? -15.637 -6.509  14.664  1.00 0.00 ? 43 LYS A HZ3  5  
ATOM 6390  N N    . LEU A 1 44 ? -12.536 -0.465  12.886  1.00 0.00 ? 44 LEU A N    5  
ATOM 6391  C CA   . LEU A 1 44 ? -12.292 0.568   13.887  1.00 0.00 ? 44 LEU A CA   5  
ATOM 6392  C C    . LEU A 1 44 ? -11.995 1.904   13.211  1.00 0.00 ? 44 LEU A C    5  
ATOM 6393  O O    . LEU A 1 44 ? -11.510 2.838   13.848  1.00 0.00 ? 44 LEU A O    5  
ATOM 6394  C CB   . LEU A 1 44 ? -11.120 0.182   14.802  1.00 0.00 ? 44 LEU A CB   5  
ATOM 6395  C CG   . LEU A 1 44 ? -11.395 -0.934  15.822  1.00 0.00 ? 44 LEU A CG   5  
ATOM 6396  C CD1  . LEU A 1 44 ? -11.533 -2.291  15.146  1.00 0.00 ? 44 LEU A CD1  5  
ATOM 6397  C CD2  . LEU A 1 44 ? -10.293 -0.974  16.867  1.00 0.00 ? 44 LEU A CD2  5  
ATOM 6398  H H    . LEU A 1 44 ? -11.803 -0.729  12.288  1.00 0.00 ? 44 LEU A H    5  
ATOM 6399  H HA   . LEU A 1 44 ? -13.188 0.668   14.484  1.00 0.00 ? 44 LEU A HA   5  
ATOM 6400  H HB2  . LEU A 1 44 ? -10.295 -0.130  14.179  1.00 0.00 ? 44 LEU A HB2  5  
ATOM 6401  H HB3  . LEU A 1 44 ? -10.818 1.065   15.347  1.00 0.00 ? 44 LEU A HB3  5  
ATOM 6402  H HG   . LEU A 1 44 ? -12.325 -0.722  16.330  1.00 0.00 ? 44 LEU A HG   5  
ATOM 6403  H HD11 . LEU A 1 44 ? -10.614 -2.536  14.635  1.00 0.00 ? 44 LEU A HD11 5  
ATOM 6404  H HD12 . LEU A 1 44 ? -12.343 -2.256  14.432  1.00 0.00 ? 44 LEU A HD12 5  
ATOM 6405  H HD13 . LEU A 1 44 ? -11.744 -3.046  15.890  1.00 0.00 ? 44 LEU A HD13 5  
ATOM 6406  H HD21 . LEU A 1 44 ? -10.231 -0.016  17.361  1.00 0.00 ? 44 LEU A HD21 5  
ATOM 6407  H HD22 . LEU A 1 44 ? -9.349  -1.193  16.387  1.00 0.00 ? 44 LEU A HD22 5  
ATOM 6408  H HD23 . LEU A 1 44 ? -10.513 -1.741  17.594  1.00 0.00 ? 44 LEU A HD23 5  
ATOM 6409  N N    . LEU A 1 45 ? -12.326 1.991   11.928  1.00 0.00 ? 45 LEU A N    5  
ATOM 6410  C CA   . LEU A 1 45 ? -11.978 3.148   11.108  1.00 0.00 ? 45 LEU A CA   5  
ATOM 6411  C C    . LEU A 1 45 ? -12.639 4.432   11.598  1.00 0.00 ? 45 LEU A C    5  
ATOM 6412  O O    . LEU A 1 45 ? -13.868 4.556   11.579  1.00 0.00 ? 45 LEU A O    5  
ATOM 6413  C CB   . LEU A 1 45 ? -12.392 2.896   9.657   1.00 0.00 ? 45 LEU A CB   5  
ATOM 6414  C CG   . LEU A 1 45 ? -12.138 4.057   8.697   1.00 0.00 ? 45 LEU A CG   5  
ATOM 6415  C CD1  . LEU A 1 45 ? -10.651 4.286   8.532   1.00 0.00 ? 45 LEU A CD1  5  
ATOM 6416  C CD2  . LEU A 1 45 ? -12.792 3.797   7.352   1.00 0.00 ? 45 LEU A CD2  5  
ATOM 6417  H H    . LEU A 1 45 ? -12.818 1.247   11.515  1.00 0.00 ? 45 LEU A H    5  
ATOM 6418  H HA   . LEU A 1 45 ? -10.908 3.270   11.148  1.00 0.00 ? 45 LEU A HA   5  
ATOM 6419  H HB2  . LEU A 1 45 ? -11.847 2.036   9.298   1.00 0.00 ? 45 LEU A HB2  5  
ATOM 6420  H HB3  . LEU A 1 45 ? -13.446 2.668   9.640   1.00 0.00 ? 45 LEU A HB3  5  
ATOM 6421  H HG   . LEU A 1 45 ? -12.569 4.957   9.112   1.00 0.00 ? 45 LEU A HG   5  
ATOM 6422  H HD11 . LEU A 1 45 ? -10.486 5.168   7.930   1.00 0.00 ? 45 LEU A HD11 5  
ATOM 6423  H HD12 . LEU A 1 45 ? -10.208 3.430   8.046   1.00 0.00 ? 45 LEU A HD12 5  
ATOM 6424  H HD13 . LEU A 1 45 ? -10.203 4.421   9.503   1.00 0.00 ? 45 LEU A HD13 5  
ATOM 6425  H HD21 . LEU A 1 45 ? -12.406 2.878   6.934   1.00 0.00 ? 45 LEU A HD21 5  
ATOM 6426  H HD22 . LEU A 1 45 ? -12.574 4.616   6.684   1.00 0.00 ? 45 LEU A HD22 5  
ATOM 6427  H HD23 . LEU A 1 45 ? -13.861 3.712   7.482   1.00 0.00 ? 45 LEU A HD23 5  
ATOM 6428  N N    . SER A 1 46 ? -11.825 5.372   12.050  1.00 0.00 ? 46 SER A N    5  
ATOM 6429  C CA   . SER A 1 46 ? -12.292 6.724   12.294  1.00 0.00 ? 46 SER A CA   5  
ATOM 6430  C C    . SER A 1 46 ? -12.050 7.573   11.042  1.00 0.00 ? 46 SER A C    5  
ATOM 6431  O O    . SER A 1 46 ? -11.463 7.099   10.066  1.00 0.00 ? 46 SER A O    5  
ATOM 6432  C CB   . SER A 1 46 ? -11.588 7.320   13.511  1.00 0.00 ? 46 SER A CB   5  
ATOM 6433  O OG   . SER A 1 46 ? -11.680 6.445   14.626  1.00 0.00 ? 46 SER A OG   5  
ATOM 6434  H H    . SER A 1 46 ? -10.880 5.155   12.218  1.00 0.00 ? 46 SER A H    5  
ATOM 6435  H HA   . SER A 1 46 ? -13.355 6.679   12.484  1.00 0.00 ? 46 SER A HA   5  
ATOM 6436  H HB2  . SER A 1 46 ? -10.545 7.482   13.280  1.00 0.00 ? 46 SER A HB2  5  
ATOM 6437  H HB3  . SER A 1 46 ? -12.051 8.262   13.768  1.00 0.00 ? 46 SER A HB3  5  
ATOM 6438  H HG   . SER A 1 46 ? -11.932 5.568   14.315  1.00 0.00 ? 46 SER A HG   5  
ATOM 6439  N N    . GLU A 1 47 ? -12.490 8.819   11.071  1.00 0.00 ? 47 GLU A N    5  
ATOM 6440  C CA   . GLU A 1 47 ? -12.414 9.690   9.900   1.00 0.00 ? 47 GLU A CA   5  
ATOM 6441  C C    . GLU A 1 47 ? -10.984 10.136  9.606   1.00 0.00 ? 47 GLU A C    5  
ATOM 6442  O O    . GLU A 1 47 ? -10.649 10.420  8.455   1.00 0.00 ? 47 GLU A O    5  
ATOM 6443  C CB   . GLU A 1 47 ? -13.316 10.913  10.097  1.00 0.00 ? 47 GLU A CB   5  
ATOM 6444  C CG   . GLU A 1 47 ? -14.773 10.564  10.365  1.00 0.00 ? 47 GLU A CG   5  
ATOM 6445  C CD   . GLU A 1 47 ? -15.493 10.040  9.141   1.00 0.00 ? 47 GLU A CD   5  
ATOM 6446  O OE1  . GLU A 1 47 ? -14.860 9.353   8.315   1.00 0.00 ? 47 GLU A OE1  5  
ATOM 6447  O OE2  . GLU A 1 47 ? -16.700 10.329  8.986   1.00 0.00 ? 47 GLU A OE2  5  
ATOM 6448  H H    . GLU A 1 47 ? -12.864 9.174   11.906  1.00 0.00 ? 47 GLU A H    5  
ATOM 6449  H HA   . GLU A 1 47 ? -12.770 9.125   9.045   1.00 0.00 ? 47 GLU A HA   5  
ATOM 6450  H HB2  . GLU A 1 47 ? -12.945 11.488  10.936  1.00 0.00 ? 47 GLU A HB2  5  
ATOM 6451  H HB3  . GLU A 1 47 ? -13.271 11.526  9.209   1.00 0.00 ? 47 GLU A HB3  5  
ATOM 6452  H HG2  . GLU A 1 47 ? -14.809 9.808   11.132  1.00 0.00 ? 47 GLU A HG2  5  
ATOM 6453  H HG3  . GLU A 1 47 ? -15.284 11.451  10.713  1.00 0.00 ? 47 GLU A HG3  5  
ATOM 6454  N N    . THR A 1 48 ? -10.140 10.201  10.629  1.00 0.00 ? 48 THR A N    5  
ATOM 6455  C CA   . THR A 1 48 ? -8.760  10.617  10.421  1.00 0.00 ? 48 THR A CA   5  
ATOM 6456  C C    . THR A 1 48 ? -7.956  9.516   9.724   1.00 0.00 ? 48 THR A C    5  
ATOM 6457  O O    . THR A 1 48 ? -7.040  9.808   8.956   1.00 0.00 ? 48 THR A O    5  
ATOM 6458  C CB   . THR A 1 48 ? -8.061  11.056  11.732  1.00 0.00 ? 48 THR A CB   5  
ATOM 6459  O OG1  . THR A 1 48 ? -6.714  11.472  11.459  1.00 0.00 ? 48 THR A OG1  5  
ATOM 6460  C CG2  . THR A 1 48 ? -8.047  9.945   12.765  1.00 0.00 ? 48 THR A CG2  5  
ATOM 6461  H H    . THR A 1 48 ? -10.452 9.976   11.534  1.00 0.00 ? 48 THR A H    5  
ATOM 6462  H HA   . THR A 1 48 ? -8.785  11.475  9.761   1.00 0.00 ? 48 THR A HA   5  
ATOM 6463  H HB   . THR A 1 48 ? -8.607  11.896  12.142  1.00 0.00 ? 48 THR A HB   5  
ATOM 6464  H HG1  . THR A 1 48 ? -6.383  10.998  10.686  1.00 0.00 ? 48 THR A HG1  5  
ATOM 6465  H HG21 . THR A 1 48 ? -9.062  9.698   13.041  1.00 0.00 ? 48 THR A HG21 5  
ATOM 6466  H HG22 . THR A 1 48 ? -7.505  10.272  13.639  1.00 0.00 ? 48 THR A HG22 5  
ATOM 6467  H HG23 . THR A 1 48 ? -7.566  9.073   12.348  1.00 0.00 ? 48 THR A HG23 5  
ATOM 6468  N N    . GLU A 1 49 ? -8.309  8.257   9.970   1.00 0.00 ? 49 GLU A N    5  
ATOM 6469  C CA   . GLU A 1 49 ? -7.697  7.155   9.235   1.00 0.00 ? 49 GLU A CA   5  
ATOM 6470  C C    . GLU A 1 49 ? -8.319  7.051   7.848   1.00 0.00 ? 49 GLU A C    5  
ATOM 6471  O O    . GLU A 1 49 ? -7.790  6.371   6.973   1.00 0.00 ? 49 GLU A O    5  
ATOM 6472  C CB   . GLU A 1 49 ? -7.857  5.811   9.953   1.00 0.00 ? 49 GLU A CB   5  
ATOM 6473  C CG   . GLU A 1 49 ? -7.318  5.783   11.370  1.00 0.00 ? 49 GLU A CG   5  
ATOM 6474  C CD   . GLU A 1 49 ? -8.407  5.999   12.389  1.00 0.00 ? 49 GLU A CD   5  
ATOM 6475  O OE1  . GLU A 1 49 ? -8.869  7.143   12.524  1.00 0.00 ? 49 GLU A OE1  5  
ATOM 6476  O OE2  . GLU A 1 49 ? -8.807  5.023   13.058  1.00 0.00 ? 49 GLU A OE2  5  
ATOM 6477  H H    . GLU A 1 49 ? -8.973  8.062   10.671  1.00 0.00 ? 49 GLU A H    5  
ATOM 6478  H HA   . GLU A 1 49 ? -6.646  7.373   9.126   1.00 0.00 ? 49 GLU A HA   5  
ATOM 6479  H HB2  . GLU A 1 49 ? -8.906  5.570   9.993   1.00 0.00 ? 49 GLU A HB2  5  
ATOM 6480  H HB3  . GLU A 1 49 ? -7.346  5.050   9.381   1.00 0.00 ? 49 GLU A HB3  5  
ATOM 6481  H HG2  . GLU A 1 49 ? -6.858  4.823   11.552  1.00 0.00 ? 49 GLU A HG2  5  
ATOM 6482  H HG3  . GLU A 1 49 ? -6.580  6.563   11.480  1.00 0.00 ? 49 GLU A HG3  5  
ATOM 6483  N N    . LYS A 1 50 ? -9.447  7.727   7.652   1.00 0.00 ? 50 LYS A N    5  
ATOM 6484  C CA   . LYS A 1 50 ? -10.125 7.707   6.362   1.00 0.00 ? 50 LYS A CA   5  
ATOM 6485  C C    . LYS A 1 50 ? -9.372  8.566   5.342   1.00 0.00 ? 50 LYS A C    5  
ATOM 6486  O O    . LYS A 1 50 ? -9.579  8.443   4.137   1.00 0.00 ? 50 LYS A O    5  
ATOM 6487  C CB   . LYS A 1 50 ? -11.575 8.187   6.486   1.00 0.00 ? 50 LYS A CB   5  
ATOM 6488  C CG   . LYS A 1 50 ? -12.393 7.951   5.222   1.00 0.00 ? 50 LYS A CG   5  
ATOM 6489  C CD   . LYS A 1 50 ? -13.802 8.519   5.316   1.00 0.00 ? 50 LYS A CD   5  
ATOM 6490  C CE   . LYS A 1 50 ? -13.812 10.041  5.262   1.00 0.00 ? 50 LYS A CE   5  
ATOM 6491  N NZ   . LYS A 1 50 ? -13.329 10.659  6.525   1.00 0.00 ? 50 LYS A NZ   5  
ATOM 6492  H H    . LYS A 1 50 ? -9.836  8.238   8.393   1.00 0.00 ? 50 LYS A H    5  
ATOM 6493  H HA   . LYS A 1 50 ? -10.133 6.687   6.021   1.00 0.00 ? 50 LYS A HA   5  
ATOM 6494  H HB2  . LYS A 1 50 ? -12.048 7.663   7.303   1.00 0.00 ? 50 LYS A HB2  5  
ATOM 6495  H HB3  . LYS A 1 50 ? -11.577 9.247   6.699   1.00 0.00 ? 50 LYS A HB3  5  
ATOM 6496  H HG2  . LYS A 1 50 ? -11.888 8.420   4.393   1.00 0.00 ? 50 LYS A HG2  5  
ATOM 6497  H HG3  . LYS A 1 50 ? -12.456 6.888   5.046   1.00 0.00 ? 50 LYS A HG3  5  
ATOM 6498  H HD2  . LYS A 1 50 ? -14.384 8.139   4.489   1.00 0.00 ? 50 LYS A HD2  5  
ATOM 6499  H HD3  . LYS A 1 50 ? -14.247 8.198   6.246   1.00 0.00 ? 50 LYS A HD3  5  
ATOM 6500  H HE2  . LYS A 1 50 ? -13.174 10.360  4.451   1.00 0.00 ? 50 LYS A HE2  5  
ATOM 6501  H HE3  . LYS A 1 50 ? -14.823 10.373  5.071   1.00 0.00 ? 50 LYS A HE3  5  
ATOM 6502  H HZ1  . LYS A 1 50 ? -13.340 11.699  6.441   1.00 0.00 ? 50 LYS A HZ1  5  
ATOM 6503  H HZ2  . LYS A 1 50 ? -12.358 10.350  6.728   1.00 0.00 ? 50 LYS A HZ2  5  
ATOM 6504  H HZ3  . LYS A 1 50 ? -13.946 10.375  7.319   1.00 0.00 ? 50 LYS A HZ3  5  
ATOM 6505  N N    . ARG A 1 51 ? -8.493  9.433   5.832   1.00 0.00 ? 51 ARG A N    5  
ATOM 6506  C CA   . ARG A 1 51 ? -7.729  10.324  4.962   1.00 0.00 ? 51 ARG A CA   5  
ATOM 6507  C C    . ARG A 1 51 ? -6.851  9.545   3.968   1.00 0.00 ? 51 ARG A C    5  
ATOM 6508  O O    . ARG A 1 51 ? -6.973  9.751   2.761   1.00 0.00 ? 51 ARG A O    5  
ATOM 6509  C CB   . ARG A 1 51 ? -6.888  11.311  5.787   1.00 0.00 ? 51 ARG A CB   5  
ATOM 6510  C CG   . ARG A 1 51 ? -6.019  12.245  4.951   1.00 0.00 ? 51 ARG A CG   5  
ATOM 6511  C CD   . ARG A 1 51 ? -6.828  13.005  3.906   1.00 0.00 ? 51 ARG A CD   5  
ATOM 6512  N NE   . ARG A 1 51 ? -7.907  13.796  4.497   1.00 0.00 ? 51 ARG A NE   5  
ATOM 6513  C CZ   . ARG A 1 51 ? -8.840  14.429  3.783   1.00 0.00 ? 51 ARG A CZ   5  
ATOM 6514  N NH1  . ARG A 1 51 ? -8.806  14.392  2.456   1.00 0.00 ? 51 ARG A NH1  5  
ATOM 6515  N NH2  . ARG A 1 51 ? -9.797  15.117  4.392   1.00 0.00 ? 51 ARG A NH2  5  
ATOM 6516  H H    . ARG A 1 51 ? -8.353  9.473   6.801   1.00 0.00 ? 51 ARG A H    5  
ATOM 6517  H HA   . ARG A 1 51 ? -8.448  10.891  4.387   1.00 0.00 ? 51 ARG A HA   5  
ATOM 6518  H HB2  . ARG A 1 51 ? -7.551  11.914  6.390   1.00 0.00 ? 51 ARG A HB2  5  
ATOM 6519  H HB3  . ARG A 1 51 ? -6.240  10.746  6.443   1.00 0.00 ? 51 ARG A HB3  5  
ATOM 6520  H HG2  . ARG A 1 51 ? -5.543  12.957  5.607   1.00 0.00 ? 51 ARG A HG2  5  
ATOM 6521  H HG3  . ARG A 1 51 ? -5.264  11.658  4.449   1.00 0.00 ? 51 ARG A HG3  5  
ATOM 6522  H HD2  . ARG A 1 51 ? -6.166  13.665  3.367   1.00 0.00 ? 51 ARG A HD2  5  
ATOM 6523  H HD3  . ARG A 1 51 ? -7.257  12.290  3.218   1.00 0.00 ? 51 ARG A HD3  5  
ATOM 6524  H HE   . ARG A 1 51 ? -7.941  13.849  5.480   1.00 0.00 ? 51 ARG A HE   5  
ATOM 6525  H HH11 . ARG A 1 51 ? -8.071  13.892  1.978   1.00 0.00 ? 51 ARG A HH11 5  
ATOM 6526  H HH12 . ARG A 1 51 ? -9.520  14.851  1.919   1.00 0.00 ? 51 ARG A HH12 5  
ATOM 6527  H HH21 . ARG A 1 51 ? -9.823  15.170  5.396   1.00 0.00 ? 51 ARG A HH21 5  
ATOM 6528  H HH22 . ARG A 1 51 ? -10.504 15.594  3.847   1.00 0.00 ? 51 ARG A HH22 5  
ATOM 6529  N N    . PRO A 1 52 ? -5.958  8.641   4.430   1.00 0.00 ? 52 PRO A N    5  
ATOM 6530  C CA   . PRO A 1 52 ? -5.098  7.879   3.519   1.00 0.00 ? 52 PRO A CA   5  
ATOM 6531  C C    . PRO A 1 52 ? -5.883  6.963   2.590   1.00 0.00 ? 52 PRO A C    5  
ATOM 6532  O O    . PRO A 1 52 ? -5.390  6.586   1.533   1.00 0.00 ? 52 PRO A O    5  
ATOM 6533  C CB   . PRO A 1 52 ? -4.186  7.068   4.446   1.00 0.00 ? 52 PRO A CB   5  
ATOM 6534  C CG   . PRO A 1 52 ? -4.903  7.027   5.752   1.00 0.00 ? 52 PRO A CG   5  
ATOM 6535  C CD   . PRO A 1 52 ? -5.683  8.309   5.841   1.00 0.00 ? 52 PRO A CD   5  
ATOM 6536  H HA   . PRO A 1 52 ? -4.506  8.543   2.915   1.00 0.00 ? 52 PRO A HA   5  
ATOM 6537  H HB2  . PRO A 1 52 ? -4.047  6.076   4.039   1.00 0.00 ? 52 PRO A HB2  5  
ATOM 6538  H HB3  . PRO A 1 52 ? -3.231  7.563   4.536   1.00 0.00 ? 52 PRO A HB3  5  
ATOM 6539  H HG2  . PRO A 1 52 ? -5.572  6.180   5.775   1.00 0.00 ? 52 PRO A HG2  5  
ATOM 6540  H HG3  . PRO A 1 52 ? -4.190  6.965   6.561   1.00 0.00 ? 52 PRO A HG3  5  
ATOM 6541  H HD2  . PRO A 1 52 ? -6.602  8.153   6.388   1.00 0.00 ? 52 PRO A HD2  5  
ATOM 6542  H HD3  . PRO A 1 52 ? -5.090  9.081   6.308   1.00 0.00 ? 52 PRO A HD3  5  
ATOM 6543  N N    . PHE A 1 53 ? -7.112  6.637   2.968   1.00 0.00 ? 53 PHE A N    5  
ATOM 6544  C CA   . PHE A 1 53 ? -8.008  5.912   2.078   1.00 0.00 ? 53 PHE A CA   5  
ATOM 6545  C C    . PHE A 1 53 ? -8.181  6.697   0.794   1.00 0.00 ? 53 PHE A C    5  
ATOM 6546  O O    . PHE A 1 53 ? -8.162  6.152   -0.312  1.00 0.00 ? 53 PHE A O    5  
ATOM 6547  C CB   . PHE A 1 53 ? -9.380  5.747   2.715   1.00 0.00 ? 53 PHE A CB   5  
ATOM 6548  C CG   . PHE A 1 53 ? -9.551  4.517   3.544   1.00 0.00 ? 53 PHE A CG   5  
ATOM 6549  C CD1  . PHE A 1 53 ? -9.176  4.505   4.873   1.00 0.00 ? 53 PHE A CD1  5  
ATOM 6550  C CD2  . PHE A 1 53 ? -10.119 3.381   2.996   1.00 0.00 ? 53 PHE A CD2  5  
ATOM 6551  C CE1  . PHE A 1 53 ? -9.364  3.378   5.646   1.00 0.00 ? 53 PHE A CE1  5  
ATOM 6552  C CE2  . PHE A 1 53 ? -10.308 2.252   3.762   1.00 0.00 ? 53 PHE A CE2  5  
ATOM 6553  C CZ   . PHE A 1 53 ? -9.932  2.250   5.090   1.00 0.00 ? 53 PHE A CZ   5  
ATOM 6554  H H    . PHE A 1 53 ? -7.424  6.895   3.862   1.00 0.00 ? 53 PHE A H    5  
ATOM 6555  H HA   . PHE A 1 53 ? -7.584  4.944   1.863   1.00 0.00 ? 53 PHE A HA   5  
ATOM 6556  H HB2  . PHE A 1 53 ? -9.570  6.595   3.353   1.00 0.00 ? 53 PHE A HB2  5  
ATOM 6557  H HB3  . PHE A 1 53 ? -10.123 5.725   1.932   1.00 0.00 ? 53 PHE A HB3  5  
ATOM 6558  H HD1  . PHE A 1 53 ? -8.734  5.389   5.306   1.00 0.00 ? 53 PHE A HD1  5  
ATOM 6559  H HD2  . PHE A 1 53 ? -10.410 3.381   1.944   1.00 0.00 ? 53 PHE A HD2  5  
ATOM 6560  H HE1  . PHE A 1 53 ? -9.066  3.377   6.684   1.00 0.00 ? 53 PHE A HE1  5  
ATOM 6561  H HE2  . PHE A 1 53 ? -10.752 1.369   3.323   1.00 0.00 ? 53 PHE A HE2  5  
ATOM 6562  H HZ   . PHE A 1 53 ? -10.081 1.367   5.693   1.00 0.00 ? 53 PHE A HZ   5  
ATOM 6563  N N    . ILE A 1 54 ? -8.299  7.998   0.956   1.00 0.00 ? 54 ILE A N    5  
ATOM 6564  C CA   . ILE A 1 54 ? -8.609  8.863   -0.155  1.00 0.00 ? 54 ILE A CA   5  
ATOM 6565  C C    . ILE A 1 54 ? -7.336  9.101   -0.963  1.00 0.00 ? 54 ILE A C    5  
ATOM 6566  O O    . ILE A 1 54 ? -7.375  9.287   -2.176  1.00 0.00 ? 54 ILE A O    5  
ATOM 6567  C CB   . ILE A 1 54 ? -9.188  10.215  0.319   1.00 0.00 ? 54 ILE A CB   5  
ATOM 6568  C CG1  . ILE A 1 54 ? -10.366 9.994   1.276   1.00 0.00 ? 54 ILE A CG1  5  
ATOM 6569  C CG2  . ILE A 1 54 ? -9.628  11.053  -0.872  1.00 0.00 ? 54 ILE A CG2  5  
ATOM 6570  C CD1  . ILE A 1 54 ? -11.517 9.219   0.666   1.00 0.00 ? 54 ILE A CD1  5  
ATOM 6571  H H    . ILE A 1 54 ? -8.121  8.392   1.845   1.00 0.00 ? 54 ILE A H    5  
ATOM 6572  H HA   . ILE A 1 54 ? -9.355  8.357   -0.773  1.00 0.00 ? 54 ILE A HA   5  
ATOM 6573  H HB   . ILE A 1 54 ? -8.409  10.755  0.839   1.00 0.00 ? 54 ILE A HB   5  
ATOM 6574  H HG12 . ILE A 1 54 ? -10.020 9.447   2.139   1.00 0.00 ? 54 ILE A HG12 5  
ATOM 6575  H HG13 . ILE A 1 54 ? -10.745 10.955  1.594   1.00 0.00 ? 54 ILE A HG13 5  
ATOM 6576  H HG21 . ILE A 1 54 ? -10.428 10.549  -1.393  1.00 0.00 ? 54 ILE A HG21 5  
ATOM 6577  H HG22 . ILE A 1 54 ? -8.793  11.190  -1.542  1.00 0.00 ? 54 ILE A HG22 5  
ATOM 6578  H HG23 . ILE A 1 54 ? -9.974  12.015  -0.526  1.00 0.00 ? 54 ILE A HG23 5  
ATOM 6579  H HD11 . ILE A 1 54 ? -11.167 8.248   0.350   1.00 0.00 ? 54 ILE A HD11 5  
ATOM 6580  H HD12 . ILE A 1 54 ? -11.902 9.757   -0.187  1.00 0.00 ? 54 ILE A HD12 5  
ATOM 6581  H HD13 . ILE A 1 54 ? -12.299 9.099   1.401   1.00 0.00 ? 54 ILE A HD13 5  
ATOM 6582  N N    . ASP A 1 55 ? -6.203  9.090   -0.264  1.00 0.00 ? 55 ASP A N    5  
ATOM 6583  C CA   . ASP A 1 55 ? -4.903  9.305   -0.894  1.00 0.00 ? 55 ASP A CA   5  
ATOM 6584  C C    . ASP A 1 55 ? -4.531  8.129   -1.798  1.00 0.00 ? 55 ASP A C    5  
ATOM 6585  O O    . ASP A 1 55 ? -3.984  8.328   -2.885  1.00 0.00 ? 55 ASP A O    5  
ATOM 6586  C CB   . ASP A 1 55 ? -3.820  9.522   0.161   1.00 0.00 ? 55 ASP A CB   5  
ATOM 6587  C CG   . ASP A 1 55 ? -2.512  9.981   -0.450  1.00 0.00 ? 55 ASP A CG   5  
ATOM 6588  O OD1  . ASP A 1 55 ? -2.455  11.129  -0.944  1.00 0.00 ? 55 ASP A OD1  5  
ATOM 6589  O OD2  . ASP A 1 55 ? -1.537  9.204   -0.440  1.00 0.00 ? 55 ASP A OD2  5  
ATOM 6590  H H    . ASP A 1 55 ? -6.245  8.937   0.702   1.00 0.00 ? 55 ASP A H    5  
ATOM 6591  H HA   . ASP A 1 55 ? -4.979  10.194  -1.502  1.00 0.00 ? 55 ASP A HA   5  
ATOM 6592  H HB2  . ASP A 1 55 ? -4.153  10.273  0.861   1.00 0.00 ? 55 ASP A HB2  5  
ATOM 6593  H HB3  . ASP A 1 55 ? -3.646  8.595   0.686   1.00 0.00 ? 55 ASP A HB3  5  
ATOM 6594  N N    . GLU A 1 56 ? -4.826  6.906   -1.351  1.00 0.00 ? 56 GLU A N    5  
ATOM 6595  C CA   . GLU A 1 56 ? -4.686  5.727   -2.208  1.00 0.00 ? 56 GLU A CA   5  
ATOM 6596  C C    . GLU A 1 56 ? -5.510  5.944   -3.480  1.00 0.00 ? 56 GLU A C    5  
ATOM 6597  O O    . GLU A 1 56 ? -5.068  5.636   -4.585  1.00 0.00 ? 56 GLU A O    5  
ATOM 6598  C CB   . GLU A 1 56 ? -5.176  4.465   -1.493  1.00 0.00 ? 56 GLU A CB   5  
ATOM 6599  C CG   . GLU A 1 56 ? -4.555  4.237   -0.125  1.00 0.00 ? 56 GLU A CG   5  
ATOM 6600  C CD   . GLU A 1 56 ? -3.051  4.409   -0.117  1.00 0.00 ? 56 GLU A CD   5  
ATOM 6601  O OE1  . GLU A 1 56 ? -2.371  3.768   -0.940  1.00 0.00 ? 56 GLU A OE1  5  
ATOM 6602  O OE2  . GLU A 1 56 ? -2.553  5.193   0.719   1.00 0.00 ? 56 GLU A OE2  5  
ATOM 6603  H H    . GLU A 1 56 ? -5.129  6.791   -0.422  1.00 0.00 ? 56 GLU A H    5  
ATOM 6604  H HA   . GLU A 1 56 ? -3.637  5.601   -2.472  1.00 0.00 ? 56 GLU A HA   5  
ATOM 6605  H HB2  . GLU A 1 56 ? -6.244  4.535   -1.363  1.00 0.00 ? 56 GLU A HB2  5  
ATOM 6606  H HB3  . GLU A 1 56 ? -4.955  3.607   -2.111  1.00 0.00 ? 56 GLU A HB3  5  
ATOM 6607  H HG2  . GLU A 1 56 ? -4.982  4.943   0.570   1.00 0.00 ? 56 GLU A HG2  5  
ATOM 6608  H HG3  . GLU A 1 56 ? -4.789  3.233   0.197   1.00 0.00 ? 56 GLU A HG3  5  
ATOM 6609  N N    . ALA A 1 57 ? -6.715  6.500   -3.301  1.00 0.00 ? 57 ALA A N    5  
ATOM 6610  C CA   . ALA A 1 57 ? -7.605  6.813   -4.422  1.00 0.00 ? 57 ALA A CA   5  
ATOM 6611  C C    . ALA A 1 57 ? -6.990  7.862   -5.344  1.00 0.00 ? 57 ALA A C    5  
ATOM 6612  O O    . ALA A 1 57 ? -7.095  7.759   -6.568  1.00 0.00 ? 57 ALA A O    5  
ATOM 6613  C CB   . ALA A 1 57 ? -8.955  7.295   -3.913  1.00 0.00 ? 57 ALA A CB   5  
ATOM 6614  H H    . ALA A 1 57 ? -7.019  6.692   -2.381  1.00 0.00 ? 57 ALA A H    5  
ATOM 6615  H HA   . ALA A 1 57 ? -7.765  5.902   -4.984  1.00 0.00 ? 57 ALA A HA   5  
ATOM 6616  H HB1  . ALA A 1 57 ? -8.825  8.217   -3.365  1.00 0.00 ? 57 ALA A HB1  5  
ATOM 6617  H HB2  . ALA A 1 57 ? -9.384  6.549   -3.264  1.00 0.00 ? 57 ALA A HB2  5  
ATOM 6618  H HB3  . ALA A 1 57 ? -9.616  7.466   -4.752  1.00 0.00 ? 57 ALA A HB3  5  
ATOM 6619  N N    . LYS A 1 58 ? -6.355  8.874   -4.751  1.00 0.00 ? 58 LYS A N    5  
ATOM 6620  C CA   . LYS A 1 58 ? -5.661  9.903   -5.523  1.00 0.00 ? 58 LYS A CA   5  
ATOM 6621  C C    . LYS A 1 58 ? -4.622  9.246   -6.420  1.00 0.00 ? 58 LYS A C    5  
ATOM 6622  O O    . LYS A 1 58 ? -4.454  9.613   -7.587  1.00 0.00 ? 58 LYS A O    5  
ATOM 6623  C CB   . LYS A 1 58 ? -4.955  10.907  -4.600  1.00 0.00 ? 58 LYS A CB   5  
ATOM 6624  C CG   . LYS A 1 58 ? -5.854  11.584  -3.575  1.00 0.00 ? 58 LYS A CG   5  
ATOM 6625  C CD   . LYS A 1 58 ? -6.909  12.473  -4.219  1.00 0.00 ? 58 LYS A CD   5  
ATOM 6626  C CE   . LYS A 1 58 ? -7.674  13.261  -3.165  1.00 0.00 ? 58 LYS A CE   5  
ATOM 6627  N NZ   . LYS A 1 58 ? -8.789  14.054  -3.746  1.00 0.00 ? 58 LYS A NZ   5  
ATOM 6628  H H    . LYS A 1 58 ? -6.359  8.931   -3.771  1.00 0.00 ? 58 LYS A H    5  
ATOM 6629  H HA   . LYS A 1 58 ? -6.384  10.420  -6.133  1.00 0.00 ? 58 LYS A HA   5  
ATOM 6630  H HB2  . LYS A 1 58 ? -4.174  10.390  -4.065  1.00 0.00 ? 58 LYS A HB2  5  
ATOM 6631  H HB3  . LYS A 1 58 ? -4.503  11.677  -5.212  1.00 0.00 ? 58 LYS A HB3  5  
ATOM 6632  H HG2  . LYS A 1 58 ? -6.353  10.822  -2.997  1.00 0.00 ? 58 LYS A HG2  5  
ATOM 6633  H HG3  . LYS A 1 58 ? -5.241  12.187  -2.922  1.00 0.00 ? 58 LYS A HG3  5  
ATOM 6634  H HD2  . LYS A 1 58 ? -6.424  13.164  -4.892  1.00 0.00 ? 58 LYS A HD2  5  
ATOM 6635  H HD3  . LYS A 1 58 ? -7.603  11.855  -4.769  1.00 0.00 ? 58 LYS A HD3  5  
ATOM 6636  H HE2  . LYS A 1 58 ? -8.080  12.570  -2.442  1.00 0.00 ? 58 LYS A HE2  5  
ATOM 6637  H HE3  . LYS A 1 58 ? -6.988  13.932  -2.670  1.00 0.00 ? 58 LYS A HE3  5  
ATOM 6638  H HZ1  . LYS A 1 58 ? -8.422  14.732  -4.453  1.00 0.00 ? 58 LYS A HZ1  5  
ATOM 6639  H HZ2  . LYS A 1 58 ? -9.281  14.586  -2.995  1.00 0.00 ? 58 LYS A HZ2  5  
ATOM 6640  H HZ3  . LYS A 1 58 ? -9.478  13.425  -4.213  1.00 0.00 ? 58 LYS A HZ3  5  
ATOM 6641  N N    . ARG A 1 59 ? -3.939  8.256   -5.857  1.00 0.00 ? 59 ARG A N    5  
ATOM 6642  C CA   . ARG A 1 59 ? -2.903  7.535   -6.571  1.00 0.00 ? 59 ARG A CA   5  
ATOM 6643  C C    . ARG A 1 59 ? -3.498  6.692   -7.692  1.00 0.00 ? 59 ARG A C    5  
ATOM 6644  O O    . ARG A 1 59 ? -2.940  6.621   -8.785  1.00 0.00 ? 59 ARG A O    5  
ATOM 6645  C CB   . ARG A 1 59 ? -2.101  6.677   -5.608  1.00 0.00 ? 59 ARG A CB   5  
ATOM 6646  C CG   . ARG A 1 59 ? -1.366  7.535   -4.616  1.00 0.00 ? 59 ARG A CG   5  
ATOM 6647  C CD   . ARG A 1 59 ? -0.623  6.738   -3.577  1.00 0.00 ? 59 ARG A CD   5  
ATOM 6648  N NE   . ARG A 1 59 ? -0.325  7.601   -2.454  1.00 0.00 ? 59 ARG A NE   5  
ATOM 6649  C CZ   . ARG A 1 59 ? 0.865   7.723   -1.880  1.00 0.00 ? 59 ARG A CZ   5  
ATOM 6650  N NH1  . ARG A 1 59 ? 1.903   7.034   -2.335  1.00 0.00 ? 59 ARG A NH1  5  
ATOM 6651  N NH2  . ARG A 1 59 ? 1.014   8.550   -0.855  1.00 0.00 ? 59 ARG A NH2  5  
ATOM 6652  H H    . ARG A 1 59 ? -4.140  8.008   -4.927  1.00 0.00 ? 59 ARG A H    5  
ATOM 6653  H HA   . ARG A 1 59 ? -2.238  8.274   -6.987  1.00 0.00 ? 59 ARG A HA   5  
ATOM 6654  H HB2  . ARG A 1 59 ? -2.769  6.017   -5.074  1.00 0.00 ? 59 ARG A HB2  5  
ATOM 6655  H HB3  . ARG A 1 59 ? -1.379  6.094   -6.161  1.00 0.00 ? 59 ARG A HB3  5  
ATOM 6656  H HG2  . ARG A 1 59 ? -0.655  8.145   -5.150  1.00 0.00 ? 59 ARG A HG2  5  
ATOM 6657  H HG3  . ARG A 1 59 ? -2.080  8.176   -4.118  1.00 0.00 ? 59 ARG A HG3  5  
ATOM 6658  H HD2  . ARG A 1 59 ? -1.239  5.912   -3.249  1.00 0.00 ? 59 ARG A HD2  5  
ATOM 6659  H HD3  . ARG A 1 59 ? 0.300   6.370   -3.998  1.00 0.00 ? 59 ARG A HD3  5  
ATOM 6660  H HE   . ARG A 1 59 ? -1.077  8.141   -2.116  1.00 0.00 ? 59 ARG A HE   5  
ATOM 6661  H HH11 . ARG A 1 59 ? 1.793   6.419   -3.115  1.00 0.00 ? 59 ARG A HH11 5  
ATOM 6662  H HH12 . ARG A 1 59 ? 2.811   7.133   -1.902  1.00 0.00 ? 59 ARG A HH12 5  
ATOM 6663  H HH21 . ARG A 1 59 ? 0.215   9.074   -0.515  1.00 0.00 ? 59 ARG A HH21 5  
ATOM 6664  H HH22 . ARG A 1 59 ? 1.912   8.678   -0.428  1.00 0.00 ? 59 ARG A HH22 5  
ATOM 6665  N N    . LEU A 1 60 ? -4.649  6.073   -7.414  1.00 0.00 ? 60 LEU A N    5  
ATOM 6666  C CA   . LEU A 1 60 ? -5.350  5.264   -8.412  1.00 0.00 ? 60 LEU A CA   5  
ATOM 6667  C C    . LEU A 1 60 ? -5.687  6.099   -9.638  1.00 0.00 ? 60 LEU A C    5  
ATOM 6668  O O    . LEU A 1 60 ? -5.534  5.644   -10.767 1.00 0.00 ? 60 LEU A O    5  
ATOM 6669  C CB   . LEU A 1 60 ? -6.644  4.674   -7.842  1.00 0.00 ? 60 LEU A CB   5  
ATOM 6670  C CG   . LEU A 1 60 ? -6.489  3.792   -6.605  1.00 0.00 ? 60 LEU A CG   5  
ATOM 6671  C CD1  . LEU A 1 60 ? -7.826  3.182   -6.219  1.00 0.00 ? 60 LEU A CD1  5  
ATOM 6672  C CD2  . LEU A 1 60 ? -5.449  2.705   -6.838  1.00 0.00 ? 60 LEU A CD2  5  
ATOM 6673  H H    . LEU A 1 60 ? -5.031  6.158   -6.513  1.00 0.00 ? 60 LEU A H    5  
ATOM 6674  H HA   . LEU A 1 60 ? -4.696  4.457   -8.710  1.00 0.00 ? 60 LEU A HA   5  
ATOM 6675  H HB2  . LEU A 1 60 ? -7.303  5.492   -7.589  1.00 0.00 ? 60 LEU A HB2  5  
ATOM 6676  H HB3  . LEU A 1 60 ? -7.115  4.086   -8.616  1.00 0.00 ? 60 LEU A HB3  5  
ATOM 6677  H HG   . LEU A 1 60 ? -6.158  4.406   -5.782  1.00 0.00 ? 60 LEU A HG   5  
ATOM 6678  H HD11 . LEU A 1 60 ? -8.198  2.584   -7.037  1.00 0.00 ? 60 LEU A HD11 5  
ATOM 6679  H HD12 . LEU A 1 60 ? -8.531  3.970   -5.999  1.00 0.00 ? 60 LEU A HD12 5  
ATOM 6680  H HD13 . LEU A 1 60 ? -7.700  2.558   -5.345  1.00 0.00 ? 60 LEU A HD13 5  
ATOM 6681  H HD21 . LEU A 1 60 ? -4.499  3.161   -7.073  1.00 0.00 ? 60 LEU A HD21 5  
ATOM 6682  H HD22 . LEU A 1 60 ? -5.762  2.079   -7.660  1.00 0.00 ? 60 LEU A HD22 5  
ATOM 6683  H HD23 . LEU A 1 60 ? -5.349  2.106   -5.945  1.00 0.00 ? 60 LEU A HD23 5  
ATOM 6684  N N    . ARG A 1 61 ? -6.141  7.324   -9.403  1.00 0.00 ? 61 ARG A N    5  
ATOM 6685  C CA   . ARG A 1 61 ? -6.507  8.224   -10.488 1.00 0.00 ? 61 ARG A CA   5  
ATOM 6686  C C    . ARG A 1 61 ? -5.290  8.537   -11.355 1.00 0.00 ? 61 ARG A C    5  
ATOM 6687  O O    . ARG A 1 61 ? -5.371  8.518   -12.585 1.00 0.00 ? 61 ARG A O    5  
ATOM 6688  C CB   . ARG A 1 61 ? -7.110  9.512   -9.924  1.00 0.00 ? 61 ARG A CB   5  
ATOM 6689  C CG   . ARG A 1 61 ? -7.712  10.424  -10.979 1.00 0.00 ? 61 ARG A CG   5  
ATOM 6690  C CD   . ARG A 1 61 ? -8.299  11.678  -10.350 1.00 0.00 ? 61 ARG A CD   5  
ATOM 6691  N NE   . ARG A 1 61 ? -9.049  12.482  -11.315 1.00 0.00 ? 61 ARG A NE   5  
ATOM 6692  C CZ   . ARG A 1 61 ? -9.622  13.649  -11.024 1.00 0.00 ? 61 ARG A CZ   5  
ATOM 6693  N NH1  . ARG A 1 61 ? -9.480  14.175  -9.815  1.00 0.00 ? 61 ARG A NH1  5  
ATOM 6694  N NH2  . ARG A 1 61 ? -10.318 14.301  -11.944 1.00 0.00 ? 61 ARG A NH2  5  
ATOM 6695  H H    . ARG A 1 61 ? -6.237  7.628   -8.472  1.00 0.00 ? 61 ARG A H    5  
ATOM 6696  H HA   . ARG A 1 61 ? -7.247  7.725   -11.096 1.00 0.00 ? 61 ARG A HA   5  
ATOM 6697  H HB2  . ARG A 1 61 ? -7.886  9.249   -9.222  1.00 0.00 ? 61 ARG A HB2  5  
ATOM 6698  H HB3  . ARG A 1 61 ? -6.339  10.059  -9.403  1.00 0.00 ? 61 ARG A HB3  5  
ATOM 6699  H HG2  . ARG A 1 61 ? -6.943  10.711  -11.678 1.00 0.00 ? 61 ARG A HG2  5  
ATOM 6700  H HG3  . ARG A 1 61 ? -8.496  9.891   -11.498 1.00 0.00 ? 61 ARG A HG3  5  
ATOM 6701  H HD2  . ARG A 1 61 ? -8.962  11.384  -9.548  1.00 0.00 ? 61 ARG A HD2  5  
ATOM 6702  H HD3  . ARG A 1 61 ? -7.492  12.271  -9.949  1.00 0.00 ? 61 ARG A HD3  5  
ATOM 6703  H HE   . ARG A 1 61 ? -9.140  12.126  -12.228 1.00 0.00 ? 61 ARG A HE   5  
ATOM 6704  H HH11 . ARG A 1 61 ? -8.946  13.698  -9.117  1.00 0.00 ? 61 ARG A HH11 5  
ATOM 6705  H HH12 . ARG A 1 61 ? -9.892  15.067  -9.599  1.00 0.00 ? 61 ARG A HH12 5  
ATOM 6706  H HH21 . ARG A 1 61 ? -10.420 13.919  -12.871 1.00 0.00 ? 61 ARG A HH21 5  
ATOM 6707  H HH22 . ARG A 1 61 ? -10.754 15.182  -11.717 1.00 0.00 ? 61 ARG A HH22 5  
ATOM 6708  N N    . ALA A 1 62 ? -4.161  8.800   -10.706 1.00 0.00 ? 62 ALA A N    5  
ATOM 6709  C CA   . ALA A 1 62 ? -2.924  9.096   -11.413 1.00 0.00 ? 62 ALA A CA   5  
ATOM 6710  C C    . ALA A 1 62 ? -2.434  7.872   -12.178 1.00 0.00 ? 62 ALA A C    5  
ATOM 6711  O O    . ALA A 1 62 ? -2.109  7.959   -13.359 1.00 0.00 ? 62 ALA A O    5  
ATOM 6712  C CB   . ALA A 1 62 ? -1.859  9.576   -10.438 1.00 0.00 ? 62 ALA A CB   5  
ATOM 6713  H H    . ALA A 1 62 ? -4.162  8.794   -9.725  1.00 0.00 ? 62 ALA A H    5  
ATOM 6714  H HA   . ALA A 1 62 ? -3.121  9.893   -12.115 1.00 0.00 ? 62 ALA A HA   5  
ATOM 6715  H HB1  . ALA A 1 62 ? -0.968  9.849   -10.982 1.00 0.00 ? 62 ALA A HB1  5  
ATOM 6716  H HB2  . ALA A 1 62 ? -1.627  8.785   -9.740  1.00 0.00 ? 62 ALA A HB2  5  
ATOM 6717  H HB3  . ALA A 1 62 ? -2.228  10.435  -9.897  1.00 0.00 ? 62 ALA A HB3  5  
ATOM 6718  N N    . LEU A 1 63 ? -2.408  6.732   -11.497 1.00 0.00 ? 63 LEU A N    5  
ATOM 6719  C CA   . LEU A 1 63 ? -1.969  5.473   -12.092 1.00 0.00 ? 63 LEU A CA   5  
ATOM 6720  C C    . LEU A 1 63 ? -2.880  5.048   -13.224 1.00 0.00 ? 63 LEU A C    5  
ATOM 6721  O O    . LEU A 1 63 ? -2.461  4.344   -14.143 1.00 0.00 ? 63 LEU A O    5  
ATOM 6722  C CB   . LEU A 1 63 ? -1.910  4.376   -11.023 1.00 0.00 ? 63 LEU A CB   5  
ATOM 6723  C CG   . LEU A 1 63 ? -0.919  4.629   -9.882  1.00 0.00 ? 63 LEU A CG   5  
ATOM 6724  C CD1  . LEU A 1 63 ? -1.145  3.643   -8.750  1.00 0.00 ? 63 LEU A CD1  5  
ATOM 6725  C CD2  . LEU A 1 63 ? 0.513   4.535   -10.388 1.00 0.00 ? 63 LEU A CD2  5  
ATOM 6726  H H    . LEU A 1 63 ? -2.685  6.735   -10.556 1.00 0.00 ? 63 LEU A H    5  
ATOM 6727  H HA   . LEU A 1 63 ? -0.993  5.623   -12.495 1.00 0.00 ? 63 LEU A HA   5  
ATOM 6728  H HB2  . LEU A 1 63 ? -2.897  4.266   -10.597 1.00 0.00 ? 63 LEU A HB2  5  
ATOM 6729  H HB3  . LEU A 1 63 ? -1.640  3.448   -11.504 1.00 0.00 ? 63 LEU A HB3  5  
ATOM 6730  H HG   . LEU A 1 63 ? -1.074  5.625   -9.493  1.00 0.00 ? 63 LEU A HG   5  
ATOM 6731  H HD11 . LEU A 1 63 ? -2.141  3.775   -8.351  1.00 0.00 ? 63 LEU A HD11 5  
ATOM 6732  H HD12 . LEU A 1 63 ? -0.419  3.817   -7.969  1.00 0.00 ? 63 LEU A HD12 5  
ATOM 6733  H HD13 . LEU A 1 63 ? -1.038  2.635   -9.122  1.00 0.00 ? 63 LEU A HD13 5  
ATOM 6734  H HD21 . LEU A 1 63 ? 0.686   5.304   -11.127 1.00 0.00 ? 63 LEU A HD21 5  
ATOM 6735  H HD22 . LEU A 1 63 ? 0.677   3.563   -10.831 1.00 0.00 ? 63 LEU A HD22 5  
ATOM 6736  H HD23 . LEU A 1 63 ? 1.195   4.671   -9.562  1.00 0.00 ? 63 LEU A HD23 5  
ATOM 6737  N N    . HIS A 1 64 ? -4.122  5.474   -13.154 1.00 0.00 ? 64 HIS A N    5  
ATOM 6738  C CA   . HIS A 1 64 ? -5.081  5.151   -14.183 1.00 0.00 ? 64 HIS A CA   5  
ATOM 6739  C C    . HIS A 1 64 ? -4.894  6.062   -15.392 1.00 0.00 ? 64 HIS A C    5  
ATOM 6740  O O    . HIS A 1 64 ? -5.252  5.702   -16.512 1.00 0.00 ? 64 HIS A O    5  
ATOM 6741  C CB   . HIS A 1 64 ? -6.507  5.272   -13.626 1.00 0.00 ? 64 HIS A CB   5  
ATOM 6742  C CG   . HIS A 1 64 ? -7.595  4.990   -14.619 1.00 0.00 ? 64 HIS A CG   5  
ATOM 6743  N ND1  . HIS A 1 64 ? -8.372  5.980   -15.178 1.00 0.00 ? 64 HIS A ND1  5  
ATOM 6744  C CD2  . HIS A 1 64 ? -8.052  3.823   -15.128 1.00 0.00 ? 64 HIS A CD2  5  
ATOM 6745  C CE1  . HIS A 1 64 ? -9.261  5.434   -15.987 1.00 0.00 ? 64 HIS A CE1  5  
ATOM 6746  N NE2  . HIS A 1 64 ? -9.092  4.124   -15.977 1.00 0.00 ? 64 HIS A NE2  5  
ATOM 6747  H H    . HIS A 1 64 ? -4.403  6.014   -12.383 1.00 0.00 ? 64 HIS A H    5  
ATOM 6748  H HA   . HIS A 1 64 ? -4.891  4.135   -14.475 1.00 0.00 ? 64 HIS A HA   5  
ATOM 6749  H HB2  . HIS A 1 64 ? -6.624  4.577   -12.810 1.00 0.00 ? 64 HIS A HB2  5  
ATOM 6750  H HB3  . HIS A 1 64 ? -6.650  6.277   -13.254 1.00 0.00 ? 64 HIS A HB3  5  
ATOM 6751  H HD1  . HIS A 1 64 ? -8.285  6.941   -15.008 1.00 0.00 ? 64 HIS A HD1  5  
ATOM 6752  H HD2  . HIS A 1 64 ? -7.675  2.835   -14.903 1.00 0.00 ? 64 HIS A HD2  5  
ATOM 6753  H HE1  . HIS A 1 64 ? -10.006 5.968   -16.556 1.00 0.00 ? 64 HIS A HE1  5  
ATOM 6754  H HE2  . HIS A 1 64 ? -9.748  3.476   -16.317 1.00 0.00 ? 64 HIS A HE2  5  
ATOM 6755  N N    . MET A 1 65 ? -4.358  7.250   -15.149 1.00 0.00 ? 65 MET A N    5  
ATOM 6756  C CA   . MET A 1 65 ? -4.134  8.229   -16.207 1.00 0.00 ? 65 MET A CA   5  
ATOM 6757  C C    . MET A 1 65 ? -2.788  8.014   -16.900 1.00 0.00 ? 65 MET A C    5  
ATOM 6758  O O    . MET A 1 65 ? -2.723  7.893   -18.122 1.00 0.00 ? 65 MET A O    5  
ATOM 6759  C CB   . MET A 1 65 ? -4.207  9.646   -15.628 1.00 0.00 ? 65 MET A CB   5  
ATOM 6760  C CG   . MET A 1 65 ? -3.877  10.740  -16.634 1.00 0.00 ? 65 MET A CG   5  
ATOM 6761  S SD   . MET A 1 65 ? -4.046  12.396  -15.941 1.00 0.00 ? 65 MET A SD   5  
ATOM 6762  C CE   . MET A 1 65 ? -5.800  12.430  -15.587 1.00 0.00 ? 65 MET A CE   5  
ATOM 6763  H H    . MET A 1 65 ? -4.105  7.478   -14.227 1.00 0.00 ? 65 MET A H    5  
ATOM 6764  H HA   . MET A 1 65 ? -4.922  8.109   -16.937 1.00 0.00 ? 65 MET A HA   5  
ATOM 6765  H HB2  . MET A 1 65 ? -5.209  9.816   -15.260 1.00 0.00 ? 65 MET A HB2  5  
ATOM 6766  H HB3  . MET A 1 65 ? -3.514  9.722   -14.803 1.00 0.00 ? 65 MET A HB3  5  
ATOM 6767  H HG2  . MET A 1 65 ? -2.859  10.607  -16.968 1.00 0.00 ? 65 MET A HG2  5  
ATOM 6768  H HG3  . MET A 1 65 ? -4.545  10.650  -17.477 1.00 0.00 ? 65 MET A HG3  5  
ATOM 6769  H HE1  . MET A 1 65 ? -6.355  12.278  -16.502 1.00 0.00 ? 65 MET A HE1  5  
ATOM 6770  H HE2  . MET A 1 65 ? -6.063  13.386  -15.160 1.00 0.00 ? 65 MET A HE2  5  
ATOM 6771  H HE3  . MET A 1 65 ? -6.039  11.644  -14.886 1.00 0.00 ? 65 MET A HE3  5  
ATOM 6772  N N    . LYS A 1 66 ? -1.724  7.945   -16.107 1.00 0.00 ? 66 LYS A N    5  
ATOM 6773  C CA   . LYS A 1 66 ? -0.365  7.921   -16.639 1.00 0.00 ? 66 LYS A CA   5  
ATOM 6774  C C    . LYS A 1 66 ? -0.071  6.641   -17.419 1.00 0.00 ? 66 LYS A C    5  
ATOM 6775  O O    . LYS A 1 66 ? 0.801   6.627   -18.289 1.00 0.00 ? 66 LYS A O    5  
ATOM 6776  C CB   . LYS A 1 66 ? 0.655   8.111   -15.502 1.00 0.00 ? 66 LYS A CB   5  
ATOM 6777  C CG   . LYS A 1 66 ? 0.673   6.993   -14.466 1.00 0.00 ? 66 LYS A CG   5  
ATOM 6778  C CD   . LYS A 1 66 ? 1.752   5.963   -14.764 1.00 0.00 ? 66 LYS A CD   5  
ATOM 6779  C CE   . LYS A 1 66 ? 1.679   4.789   -13.801 1.00 0.00 ? 66 LYS A CE   5  
ATOM 6780  N NZ   . LYS A 1 66 ? 2.790   3.824   -14.009 1.00 0.00 ? 66 LYS A NZ   5  
ATOM 6781  H H    . LYS A 1 66 ? -1.856  7.917   -15.132 1.00 0.00 ? 66 LYS A H    5  
ATOM 6782  H HA   . LYS A 1 66 ? -0.273  8.758   -17.316 1.00 0.00 ? 66 LYS A HA   5  
ATOM 6783  H HB2  . LYS A 1 66 ? 1.641   8.177   -15.935 1.00 0.00 ? 66 LYS A HB2  5  
ATOM 6784  H HB3  . LYS A 1 66 ? 0.435   9.037   -14.993 1.00 0.00 ? 66 LYS A HB3  5  
ATOM 6785  H HG2  . LYS A 1 66 ? 0.859   7.421   -13.493 1.00 0.00 ? 66 LYS A HG2  5  
ATOM 6786  H HG3  . LYS A 1 66 ? -0.290  6.501   -14.466 1.00 0.00 ? 66 LYS A HG3  5  
ATOM 6787  H HD2  . LYS A 1 66 ? 1.620   5.598   -15.772 1.00 0.00 ? 66 LYS A HD2  5  
ATOM 6788  H HD3  . LYS A 1 66 ? 2.721   6.434   -14.673 1.00 0.00 ? 66 LYS A HD3  5  
ATOM 6789  H HE2  . LYS A 1 66 ? 1.728   5.166   -12.790 1.00 0.00 ? 66 LYS A HE2  5  
ATOM 6790  H HE3  . LYS A 1 66 ? 0.738   4.278   -13.949 1.00 0.00 ? 66 LYS A HE3  5  
ATOM 6791  H HZ1  . LYS A 1 66 ? 2.590   2.928   -13.514 1.00 0.00 ? 66 LYS A HZ1  5  
ATOM 6792  H HZ2  . LYS A 1 66 ? 3.685   4.221   -13.645 1.00 0.00 ? 66 LYS A HZ2  5  
ATOM 6793  H HZ3  . LYS A 1 66 ? 2.906   3.624   -15.026 1.00 0.00 ? 66 LYS A HZ3  5  
ATOM 6794  N N    . GLU A 1 67 ? -0.794  5.570   -17.124 1.00 0.00 ? 67 GLU A N    5  
ATOM 6795  C CA   . GLU A 1 67 ? -0.538  4.300   -17.781 1.00 0.00 ? 67 GLU A CA   5  
ATOM 6796  C C    . GLU A 1 67 ? -1.740  3.854   -18.600 1.00 0.00 ? 67 GLU A C    5  
ATOM 6797  O O    . GLU A 1 67 ? -2.860  3.776   -18.094 1.00 0.00 ? 67 GLU A O    5  
ATOM 6798  C CB   . GLU A 1 67 ? -0.152  3.233   -16.755 1.00 0.00 ? 67 GLU A CB   5  
ATOM 6799  C CG   . GLU A 1 67 ? 0.313   1.930   -17.384 1.00 0.00 ? 67 GLU A CG   5  
ATOM 6800  C CD   . GLU A 1 67 ? 1.124   1.086   -16.428 1.00 0.00 ? 67 GLU A CD   5  
ATOM 6801  O OE1  . GLU A 1 67 ? 0.528   0.322   -15.645 1.00 0.00 ? 67 GLU A OE1  5  
ATOM 6802  O OE2  . GLU A 1 67 ? 2.368   1.187   -16.454 1.00 0.00 ? 67 GLU A OE2  5  
ATOM 6803  H H    . GLU A 1 67 ? -1.517  5.638   -16.466 1.00 0.00 ? 67 GLU A H    5  
ATOM 6804  H HA   . GLU A 1 67 ? 0.295   4.448   -18.454 1.00 0.00 ? 67 GLU A HA   5  
ATOM 6805  H HB2  . GLU A 1 67 ? 0.646   3.615   -16.135 1.00 0.00 ? 67 GLU A HB2  5  
ATOM 6806  H HB3  . GLU A 1 67 ? -1.009  3.020   -16.134 1.00 0.00 ? 67 GLU A HB3  5  
ATOM 6807  H HG2  . GLU A 1 67 ? -0.553  1.365   -17.692 1.00 0.00 ? 67 GLU A HG2  5  
ATOM 6808  H HG3  . GLU A 1 67 ? 0.922   2.158   -18.248 1.00 0.00 ? 67 GLU A HG3  5  
ATOM 6809  N N    . HIS A 1 68 ? -1.490  3.580   -19.872 1.00 0.00 ? 68 HIS A N    5  
ATOM 6810  C CA   . HIS A 1 68 ? -2.528  3.150   -20.799 1.00 0.00 ? 68 HIS A CA   5  
ATOM 6811  C C    . HIS A 1 68 ? -1.891  2.468   -22.015 1.00 0.00 ? 68 HIS A C    5  
ATOM 6812  O O    . HIS A 1 68 ? -1.603  3.109   -23.022 1.00 0.00 ? 68 HIS A O    5  
ATOM 6813  C CB   . HIS A 1 68 ? -3.423  4.338   -21.222 1.00 0.00 ? 68 HIS A CB   5  
ATOM 6814  C CG   . HIS A 1 68 ? -2.715  5.477   -21.916 1.00 0.00 ? 68 HIS A CG   5  
ATOM 6815  N ND1  . HIS A 1 68 ? -3.306  6.228   -22.909 1.00 0.00 ? 68 HIS A ND1  5  
ATOM 6816  C CD2  . HIS A 1 68 ? -1.472  5.993   -21.754 1.00 0.00 ? 68 HIS A CD2  5  
ATOM 6817  C CE1  . HIS A 1 68 ? -2.458  7.148   -23.329 1.00 0.00 ? 68 HIS A CE1  5  
ATOM 6818  N NE2  . HIS A 1 68 ? -1.338  7.030   -22.644 1.00 0.00 ? 68 HIS A NE2  5  
ATOM 6819  H H    . HIS A 1 68 ? -0.569  3.660   -20.197 1.00 0.00 ? 68 HIS A H    5  
ATOM 6820  H HA   . HIS A 1 68 ? -3.138  2.423   -20.282 1.00 0.00 ? 68 HIS A HA   5  
ATOM 6821  H HB2  . HIS A 1 68 ? -4.184  3.976   -21.896 1.00 0.00 ? 68 HIS A HB2  5  
ATOM 6822  H HB3  . HIS A 1 68 ? -3.904  4.740   -20.341 1.00 0.00 ? 68 HIS A HB3  5  
ATOM 6823  H HD1  . HIS A 1 68 ? -4.230  6.111   -23.250 1.00 0.00 ? 68 HIS A HD1  5  
ATOM 6824  H HD2  . HIS A 1 68 ? -0.724  5.651   -21.050 1.00 0.00 ? 68 HIS A HD2  5  
ATOM 6825  H HE1  . HIS A 1 68 ? -2.650  7.877   -24.104 1.00 0.00 ? 68 HIS A HE1  5  
ATOM 6826  H HE2  . HIS A 1 68 ? -0.477  7.444   -22.905 1.00 0.00 ? 68 HIS A HE2  5  
ATOM 6827  N N    . PRO A 1 69 ? -1.615  1.159   -21.913 1.00 0.00 ? 69 PRO A N    5  
ATOM 6828  C CA   . PRO A 1 69 ? -0.917  0.421   -22.968 1.00 0.00 ? 69 PRO A CA   5  
ATOM 6829  C C    . PRO A 1 69 ? -1.803  0.152   -24.180 1.00 0.00 ? 69 PRO A C    5  
ATOM 6830  O O    . PRO A 1 69 ? -1.490  0.562   -25.299 1.00 0.00 ? 69 PRO A O    5  
ATOM 6831  C CB   . PRO A 1 69 ? -0.524  -0.903  -22.289 1.00 0.00 ? 69 PRO A CB   5  
ATOM 6832  C CG   . PRO A 1 69 ? -0.853  -0.736  -20.837 1.00 0.00 ? 69 PRO A CG   5  
ATOM 6833  C CD   . PRO A 1 69 ? -1.935  0.300   -20.771 1.00 0.00 ? 69 PRO A CD   5  
ATOM 6834  H HA   . PRO A 1 69 ? -0.030  0.941   -23.287 1.00 0.00 ? 69 PRO A HA   5  
ATOM 6835  H HB2  . PRO A 1 69 ? -1.089  -1.714  -22.727 1.00 0.00 ? 69 PRO A HB2  5  
ATOM 6836  H HB3  . PRO A 1 69 ? 0.532   -1.082  -22.434 1.00 0.00 ? 69 PRO A HB3  5  
ATOM 6837  H HG2  . PRO A 1 69 ? -1.205  -1.671  -20.430 1.00 0.00 ? 69 PRO A HG2  5  
ATOM 6838  H HG3  . PRO A 1 69 ? 0.022   -0.399  -20.301 1.00 0.00 ? 69 PRO A HG3  5  
ATOM 6839  H HD2  . PRO A 1 69 ? -2.907  -0.158  -20.888 1.00 0.00 ? 69 PRO A HD2  5  
ATOM 6840  H HD3  . PRO A 1 69 ? -1.880  0.850   -19.843 1.00 0.00 ? 69 PRO A HD3  5  
ATOM 6841  N N    . ASP A 1 70 ? -2.909  -0.528  -23.950 1.00 0.00 ? 70 ASP A N    5  
ATOM 6842  C CA   . ASP A 1 70 ? -3.885  -0.772  -25.002 1.00 0.00 ? 70 ASP A CA   5  
ATOM 6843  C C    . ASP A 1 70 ? -5.192  -0.076  -24.683 1.00 0.00 ? 70 ASP A C    5  
ATOM 6844  O O    . ASP A 1 70 ? -5.990  0.217   -25.574 1.00 0.00 ? 70 ASP A O    5  
ATOM 6845  C CB   . ASP A 1 70 ? -4.127  -2.269  -25.196 1.00 0.00 ? 70 ASP A CB   5  
ATOM 6846  C CG   . ASP A 1 70 ? -3.151  -2.898  -26.168 1.00 0.00 ? 70 ASP A CG   5  
ATOM 6847  O OD1  . ASP A 1 70 ? -3.295  -2.669  -27.387 1.00 0.00 ? 70 ASP A OD1  5  
ATOM 6848  O OD2  . ASP A 1 70 ? -2.240  -3.626  -25.724 1.00 0.00 ? 70 ASP A OD2  5  
ATOM 6849  H H    . ASP A 1 70 ? -3.074  -0.881  -23.054 1.00 0.00 ? 70 ASP A H    5  
ATOM 6850  H HA   . ASP A 1 70 ? -3.487  -0.360  -25.919 1.00 0.00 ? 70 ASP A HA   5  
ATOM 6851  H HB2  . ASP A 1 70 ? -4.026  -2.769  -24.244 1.00 0.00 ? 70 ASP A HB2  5  
ATOM 6852  H HB3  . ASP A 1 70 ? -5.130  -2.420  -25.571 1.00 0.00 ? 70 ASP A HB3  5  
ATOM 6853  N N    . TYR A 1 71 ? -5.397  0.201   -23.404 1.00 0.00 ? 71 TYR A N    5  
ATOM 6854  C CA   . TYR A 1 71 ? -6.657  0.747   -22.937 1.00 0.00 ? 71 TYR A CA   5  
ATOM 6855  C C    . TYR A 1 71 ? -6.559  1.155   -21.476 1.00 0.00 ? 71 TYR A C    5  
ATOM 6856  O O    . TYR A 1 71 ? -5.584  0.834   -20.792 1.00 0.00 ? 71 TYR A O    5  
ATOM 6857  C CB   . TYR A 1 71 ? -7.785  -0.278  -23.127 1.00 0.00 ? 71 TYR A CB   5  
ATOM 6858  C CG   . TYR A 1 71 ? -7.565  -1.571  -22.380 1.00 0.00 ? 71 TYR A CG   5  
ATOM 6859  C CD1  . TYR A 1 71 ? -7.825  -1.647  -21.022 1.00 0.00 ? 71 TYR A CD1  5  
ATOM 6860  C CD2  . TYR A 1 71 ? -7.095  -2.711  -23.024 1.00 0.00 ? 71 TYR A CD2  5  
ATOM 6861  C CE1  . TYR A 1 71 ? -7.624  -2.809  -20.322 1.00 0.00 ? 71 TYR A CE1  5  
ATOM 6862  C CE2  . TYR A 1 71 ? -6.893  -3.887  -22.326 1.00 0.00 ? 71 TYR A CE2  5  
ATOM 6863  C CZ   . TYR A 1 71 ? -7.158  -3.930  -20.975 1.00 0.00 ? 71 TYR A CZ   5  
ATOM 6864  O OH   . TYR A 1 71 ? -6.957  -5.098  -20.272 1.00 0.00 ? 71 TYR A OH   5  
ATOM 6865  H H    . TYR A 1 71 ? -4.673  0.055   -22.759 1.00 0.00 ? 71 TYR A H    5  
ATOM 6866  H HA   . TYR A 1 71 ? -6.879  1.616   -23.520 1.00 0.00 ? 71 TYR A HA   5  
ATOM 6867  H HB2  . TYR A 1 71 ? -8.714  0.152   -22.778 1.00 0.00 ? 71 TYR A HB2  5  
ATOM 6868  H HB3  . TYR A 1 71 ? -7.876  -0.512  -24.177 1.00 0.00 ? 71 TYR A HB3  5  
ATOM 6869  H HD1  . TYR A 1 71 ? -8.189  -0.770  -20.510 1.00 0.00 ? 71 TYR A HD1  5  
ATOM 6870  H HD2  . TYR A 1 71 ? -6.889  -2.671  -24.082 1.00 0.00 ? 71 TYR A HD2  5  
ATOM 6871  H HE1  . TYR A 1 71 ? -7.831  -2.834  -19.271 1.00 0.00 ? 71 TYR A HE1  5  
ATOM 6872  H HE2  . TYR A 1 71 ? -6.527  -4.766  -22.841 1.00 0.00 ? 71 TYR A HE2  5  
ATOM 6873  H HH   . TYR A 1 71 ? -7.709  -5.248  -19.687 1.00 0.00 ? 71 TYR A HH   5  
ATOM 6874  N N    . LYS A 1 72 ? -7.572  1.868   -21.013 1.00 0.00 ? 72 LYS A N    5  
ATOM 6875  C CA   . LYS A 1 72 ? -7.725  2.164   -19.603 1.00 0.00 ? 72 LYS A CA   5  
ATOM 6876  C C    . LYS A 1 72 ? -8.857  1.316   -19.049 1.00 0.00 ? 72 LYS A C    5  
ATOM 6877  O O    . LYS A 1 72 ? -9.600  0.708   -19.818 1.00 0.00 ? 72 LYS A O    5  
ATOM 6878  C CB   . LYS A 1 72 ? -8.011  3.654   -19.368 1.00 0.00 ? 72 LYS A CB   5  
ATOM 6879  C CG   . LYS A 1 72 ? -6.840  4.587   -19.667 1.00 0.00 ? 72 LYS A CG   5  
ATOM 6880  C CD   . LYS A 1 72 ? -7.168  6.017   -19.246 1.00 0.00 ? 72 LYS A CD   5  
ATOM 6881  C CE   . LYS A 1 72 ? -5.947  6.932   -19.278 1.00 0.00 ? 72 LYS A CE   5  
ATOM 6882  N NZ   . LYS A 1 72 ? -5.542  7.303   -20.657 1.00 0.00 ? 72 LYS A NZ   5  
ATOM 6883  H H    . LYS A 1 72 ? -8.250  2.187   -21.640 1.00 0.00 ? 72 LYS A H    5  
ATOM 6884  H HA   . LYS A 1 72 ? -6.815  1.886   -19.102 1.00 0.00 ? 72 LYS A HA   5  
ATOM 6885  H HB2  . LYS A 1 72 ? -8.841  3.950   -19.991 1.00 0.00 ? 72 LYS A HB2  5  
ATOM 6886  H HB3  . LYS A 1 72 ? -8.289  3.790   -18.333 1.00 0.00 ? 72 LYS A HB3  5  
ATOM 6887  H HG2  . LYS A 1 72 ? -5.971  4.249   -19.123 1.00 0.00 ? 72 LYS A HG2  5  
ATOM 6888  H HG3  . LYS A 1 72 ? -6.638  4.570   -20.727 1.00 0.00 ? 72 LYS A HG3  5  
ATOM 6889  H HD2  . LYS A 1 72 ? -7.914  6.413   -19.917 1.00 0.00 ? 72 LYS A HD2  5  
ATOM 6890  H HD3  . LYS A 1 72 ? -7.565  5.999   -18.240 1.00 0.00 ? 72 LYS A HD3  5  
ATOM 6891  H HE2  . LYS A 1 72 ? -6.178  7.833   -18.730 1.00 0.00 ? 72 LYS A HE2  5  
ATOM 6892  H HE3  . LYS A 1 72 ? -5.124  6.424   -18.794 1.00 0.00 ? 72 LYS A HE3  5  
ATOM 6893  H HZ1  . LYS A 1 72 ? -6.328  7.784   -21.151 1.00 0.00 ? 72 LYS A HZ1  5  
ATOM 6894  H HZ2  . LYS A 1 72 ? -5.285  6.454   -21.201 1.00 0.00 ? 72 LYS A HZ2  5  
ATOM 6895  H HZ3  . LYS A 1 72 ? -4.721  7.950   -20.633 1.00 0.00 ? 72 LYS A HZ3  5  
ATOM 6896  N N    . TYR A 1 73 ? -8.968  1.266   -17.725 1.00 0.00 ? 73 TYR A N    5  
ATOM 6897  C CA   . TYR A 1 73 ? -9.993  0.459   -17.064 1.00 0.00 ? 73 TYR A CA   5  
ATOM 6898  C C    . TYR A 1 73 ? -11.374 0.689   -17.661 1.00 0.00 ? 73 TYR A C    5  
ATOM 6899  O O    . TYR A 1 73 ? -11.953 1.772   -17.537 1.00 0.00 ? 73 TYR A O    5  
ATOM 6900  C CB   . TYR A 1 73 ? -10.026 0.753   -15.565 1.00 0.00 ? 73 TYR A CB   5  
ATOM 6901  C CG   . TYR A 1 73 ? -9.006  -0.025  -14.765 1.00 0.00 ? 73 TYR A CG   5  
ATOM 6902  C CD1  . TYR A 1 73 ? -7.646  0.090   -15.022 1.00 0.00 ? 73 TYR A CD1  5  
ATOM 6903  C CD2  . TYR A 1 73 ? -9.410  -0.874  -13.743 1.00 0.00 ? 73 TYR A CD2  5  
ATOM 6904  C CE1  . TYR A 1 73 ? -6.717  -0.620  -14.281 1.00 0.00 ? 73 TYR A CE1  5  
ATOM 6905  C CE2  . TYR A 1 73 ? -8.490  -1.588  -13.000 1.00 0.00 ? 73 TYR A CE2  5  
ATOM 6906  C CZ   . TYR A 1 73 ? -7.147  -1.459  -13.271 1.00 0.00 ? 73 TYR A CZ   5  
ATOM 6907  O OH   . TYR A 1 73 ? -6.230  -2.172  -12.528 1.00 0.00 ? 73 TYR A OH   5  
ATOM 6908  H H    . TYR A 1 73 ? -8.335  1.771   -17.178 1.00 0.00 ? 73 TYR A H    5  
ATOM 6909  H HA   . TYR A 1 73 ? -9.729  -0.578  -17.205 1.00 0.00 ? 73 TYR A HA   5  
ATOM 6910  H HB2  . TYR A 1 73 ? -9.834  1.805   -15.407 1.00 0.00 ? 73 TYR A HB2  5  
ATOM 6911  H HB3  . TYR A 1 73 ? -11.005 0.511   -15.179 1.00 0.00 ? 73 TYR A HB3  5  
ATOM 6912  H HD1  . TYR A 1 73 ? -7.316  0.745   -15.818 1.00 0.00 ? 73 TYR A HD1  5  
ATOM 6913  H HD2  . TYR A 1 73 ? -10.464 -0.975  -13.533 1.00 0.00 ? 73 TYR A HD2  5  
ATOM 6914  H HE1  . TYR A 1 73 ? -5.663  -0.518  -14.495 1.00 0.00 ? 73 TYR A HE1  5  
ATOM 6915  H HE2  . TYR A 1 73 ? -8.828  -2.244  -12.210 1.00 0.00 ? 73 TYR A HE2  5  
ATOM 6916  H HH   . TYR A 1 73 ? -5.514  -1.590  -12.255 1.00 0.00 ? 73 TYR A HH   5  
ATOM 6917  N N    . ARG A 1 74 ? -11.865 -0.338  -18.333 1.00 0.00 ? 74 ARG A N    5  
ATOM 6918  C CA   . ARG A 1 74 ? -13.221 -0.351  -18.868 1.00 0.00 ? 74 ARG A CA   5  
ATOM 6919  C C    . ARG A 1 74 ? -14.241 -0.573  -17.754 1.00 0.00 ? 74 ARG A C    5  
ATOM 6920  O O    . ARG A 1 74 ? -13.917 -1.147  -16.715 1.00 0.00 ? 74 ARG A O    5  
ATOM 6921  C CB   . ARG A 1 74 ? -13.371 -1.456  -19.918 1.00 0.00 ? 74 ARG A CB   5  
ATOM 6922  C CG   . ARG A 1 74 ? -12.931 -2.825  -19.424 1.00 0.00 ? 74 ARG A CG   5  
ATOM 6923  C CD   . ARG A 1 74 ? -13.582 -3.946  -20.215 1.00 0.00 ? 74 ARG A CD   5  
ATOM 6924  N NE   . ARG A 1 74 ? -15.008 -4.064  -19.915 1.00 0.00 ? 74 ARG A NE   5  
ATOM 6925  C CZ   . ARG A 1 74 ? -15.705 -5.190  -20.043 1.00 0.00 ? 74 ARG A CZ   5  
ATOM 6926  N NH1  . ARG A 1 74 ? -15.125 -6.289  -20.519 1.00 0.00 ? 74 ARG A NH1  5  
ATOM 6927  N NH2  . ARG A 1 74 ? -16.984 -5.213  -19.700 1.00 0.00 ? 74 ARG A NH2  5  
ATOM 6928  H H    . ARG A 1 74 ? -11.282 -1.108  -18.491 1.00 0.00 ? 74 ARG A H    5  
ATOM 6929  H HA   . ARG A 1 74 ? -13.406 0.605   -19.331 1.00 0.00 ? 74 ARG A HA   5  
ATOM 6930  H HB2  . ARG A 1 74 ? -14.409 -1.519  -20.210 1.00 0.00 ? 74 ARG A HB2  5  
ATOM 6931  H HB3  . ARG A 1 74 ? -12.776 -1.200  -20.782 1.00 0.00 ? 74 ARG A HB3  5  
ATOM 6932  H HG2  . ARG A 1 74 ? -11.860 -2.905  -19.523 1.00 0.00 ? 74 ARG A HG2  5  
ATOM 6933  H HG3  . ARG A 1 74 ? -13.206 -2.926  -18.384 1.00 0.00 ? 74 ARG A HG3  5  
ATOM 6934  H HD2  . ARG A 1 74 ? -13.460 -3.745  -21.269 1.00 0.00 ? 74 ARG A HD2  5  
ATOM 6935  H HD3  . ARG A 1 74 ? -13.094 -4.876  -19.967 1.00 0.00 ? 74 ARG A HD3  5  
ATOM 6936  H HE   . ARG A 1 74 ? -15.466 -3.262  -19.580 1.00 0.00 ? 74 ARG A HE   5  
ATOM 6937  H HH11 . ARG A 1 74 ? -14.151 -6.278  -20.783 1.00 0.00 ? 74 ARG A HH11 5  
ATOM 6938  H HH12 . ARG A 1 74 ? -15.660 -7.137  -20.629 1.00 0.00 ? 74 ARG A HH12 5  
ATOM 6939  H HH21 . ARG A 1 74 ? -17.428 -4.384  -19.351 1.00 0.00 ? 74 ARG A HH21 5  
ATOM 6940  H HH22 . ARG A 1 74 ? -17.514 -6.071  -19.766 1.00 0.00 ? 74 ARG A HH22 5  
ATOM 6941  N N    . PRO A 1 75 ? -15.488 -0.118  -17.957 1.00 0.00 ? 75 PRO A N    5  
ATOM 6942  C CA   . PRO A 1 75 ? -16.560 -0.315  -16.984 1.00 0.00 ? 75 PRO A CA   5  
ATOM 6943  C C    . PRO A 1 75 ? -17.062 -1.759  -16.951 1.00 0.00 ? 75 PRO A C    5  
ATOM 6944  O O    . PRO A 1 75 ? -17.179 -2.419  -17.987 1.00 0.00 ? 75 PRO A O    5  
ATOM 6945  C CB   . PRO A 1 75 ? -17.662 0.627   -17.473 1.00 0.00 ? 75 PRO A CB   5  
ATOM 6946  C CG   . PRO A 1 75 ? -17.429 0.757   -18.938 1.00 0.00 ? 75 PRO A CG   5  
ATOM 6947  C CD   . PRO A 1 75 ? -15.944 0.638   -19.139 1.00 0.00 ? 75 PRO A CD   5  
ATOM 6948  H HA   . PRO A 1 75 ? -16.248 -0.023  -15.991 1.00 0.00 ? 75 PRO A HA   5  
ATOM 6949  H HB2  . PRO A 1 75 ? -18.629 0.193   -17.262 1.00 0.00 ? 75 PRO A HB2  5  
ATOM 6950  H HB3  . PRO A 1 75 ? -17.573 1.581   -16.973 1.00 0.00 ? 75 PRO A HB3  5  
ATOM 6951  H HG2  . PRO A 1 75 ? -17.942 -0.036  -19.462 1.00 0.00 ? 75 PRO A HG2  5  
ATOM 6952  H HG3  . PRO A 1 75 ? -17.778 1.720   -19.281 1.00 0.00 ? 75 PRO A HG3  5  
ATOM 6953  H HD2  . PRO A 1 75 ? -15.731 0.095   -20.048 1.00 0.00 ? 75 PRO A HD2  5  
ATOM 6954  H HD3  . PRO A 1 75 ? -15.488 1.618   -19.171 1.00 0.00 ? 75 PRO A HD3  5  
ATOM 6955  N N    . ARG A 1 76 ? -17.337 -2.243  -15.746 1.00 0.00 ? 76 ARG A N    5  
ATOM 6956  C CA   . ARG A 1 76 ? -17.898 -3.577  -15.555 1.00 0.00 ? 76 ARG A CA   5  
ATOM 6957  C C    . ARG A 1 76 ? -19.415 -3.541  -15.719 1.00 0.00 ? 76 ARG A C    5  
ATOM 6958  O O    . ARG A 1 76 ? -20.036 -4.538  -16.094 1.00 0.00 ? 76 ARG A O    5  
ATOM 6959  C CB   . ARG A 1 76 ? -17.540 -4.105  -14.157 1.00 0.00 ? 76 ARG A CB   5  
ATOM 6960  C CG   . ARG A 1 76 ? -18.229 -5.415  -13.793 1.00 0.00 ? 76 ARG A CG   5  
ATOM 6961  C CD   . ARG A 1 76 ? -18.062 -5.746  -12.318 1.00 0.00 ? 76 ARG A CD   5  
ATOM 6962  N NE   . ARG A 1 76 ? -18.481 -4.635  -11.457 1.00 0.00 ? 76 ARG A NE   5  
ATOM 6963  C CZ   . ARG A 1 76 ? -19.445 -4.712  -10.533 1.00 0.00 ? 76 ARG A CZ   5  
ATOM 6964  N NH1  . ARG A 1 76 ? -20.111 -5.847  -10.339 1.00 0.00 ? 76 ARG A NH1  5  
ATOM 6965  N NH2  . ARG A 1 76 ? -19.742 -3.640  -9.803  1.00 0.00 ? 76 ARG A NH2  5  
ATOM 6966  H H    . ARG A 1 76 ? -17.146 -1.691  -14.961 1.00 0.00 ? 76 ARG A H    5  
ATOM 6967  H HA   . ARG A 1 76 ? -17.473 -4.232  -16.303 1.00 0.00 ? 76 ARG A HA   5  
ATOM 6968  H HB2  . ARG A 1 76 ? -16.473 -4.260  -14.106 1.00 0.00 ? 76 ARG A HB2  5  
ATOM 6969  H HB3  . ARG A 1 76 ? -17.821 -3.361  -13.425 1.00 0.00 ? 76 ARG A HB3  5  
ATOM 6970  H HG2  . ARG A 1 76 ? -19.281 -5.329  -14.015 1.00 0.00 ? 76 ARG A HG2  5  
ATOM 6971  H HG3  . ARG A 1 76 ? -17.800 -6.213  -14.381 1.00 0.00 ? 76 ARG A HG3  5  
ATOM 6972  H HD2  . ARG A 1 76 ? -18.664 -6.613  -12.086 1.00 0.00 ? 76 ARG A HD2  5  
ATOM 6973  H HD3  . ARG A 1 76 ? -17.023 -5.967  -12.125 1.00 0.00 ? 76 ARG A HD3  5  
ATOM 6974  H HE   . ARG A 1 76 ? -18.012 -3.784  -11.576 1.00 0.00 ? 76 ARG A HE   5  
ATOM 6975  H HH11 . ARG A 1 76 ? -19.896 -6.666  -10.891 1.00 0.00 ? 76 ARG A HH11 5  
ATOM 6976  H HH12 . ARG A 1 76 ? -20.841 -5.894  -9.645  1.00 0.00 ? 76 ARG A HH12 5  
ATOM 6977  H HH21 . ARG A 1 76 ? -19.249 -2.780  -9.944  1.00 0.00 ? 76 ARG A HH21 5  
ATOM 6978  H HH22 . ARG A 1 76 ? -20.468 -3.685  -9.102  1.00 0.00 ? 76 ARG A HH22 5  
ATOM 6979  N N    . ARG A 1 77 ? -19.995 -2.371  -15.444 1.00 0.00 ? 77 ARG A N    5  
ATOM 6980  C CA   . ARG A 1 77 ? -21.449 -2.183  -15.425 1.00 0.00 ? 77 ARG A CA   5  
ATOM 6981  C C    . ARG A 1 77 ? -22.074 -2.943  -14.256 1.00 0.00 ? 77 ARG A C    5  
ATOM 6982  O O    . ARG A 1 77 ? -21.361 -3.560  -13.462 1.00 0.00 ? 77 ARG A O    5  
ATOM 6983  C CB   . ARG A 1 77 ? -22.093 -2.580  -16.759 1.00 0.00 ? 77 ARG A CB   5  
ATOM 6984  C CG   . ARG A 1 77 ? -21.783 -1.601  -17.880 1.00 0.00 ? 77 ARG A CG   5  
ATOM 6985  C CD   . ARG A 1 77 ? -22.482 -1.977  -19.174 1.00 0.00 ? 77 ARG A CD   5  
ATOM 6986  N NE   . ARG A 1 77 ? -22.264 -0.971  -20.213 1.00 0.00 ? 77 ARG A NE   5  
ATOM 6987  C CZ   . ARG A 1 77 ? -22.622 -1.126  -21.486 1.00 0.00 ? 77 ARG A CZ   5  
ATOM 6988  N NH1  . ARG A 1 77 ? -23.203 -2.251  -21.881 1.00 0.00 ? 77 ARG A NH1  5  
ATOM 6989  N NH2  . ARG A 1 77 ? -22.399 -0.159  -22.364 1.00 0.00 ? 77 ARG A NH2  5  
ATOM 6990  H H    . ARG A 1 77 ? -19.422 -1.603  -15.245 1.00 0.00 ? 77 ARG A H    5  
ATOM 6991  H HA   . ARG A 1 77 ? -21.625 -1.130  -15.261 1.00 0.00 ? 77 ARG A HA   5  
ATOM 6992  H HB2  . ARG A 1 77 ? -21.729 -3.556  -17.049 1.00 0.00 ? 77 ARG A HB2  5  
ATOM 6993  H HB3  . ARG A 1 77 ? -23.164 -2.626  -16.635 1.00 0.00 ? 77 ARG A HB3  5  
ATOM 6994  H HG2  . ARG A 1 77 ? -22.110 -0.616  -17.583 1.00 0.00 ? 77 ARG A HG2  5  
ATOM 6995  H HG3  . ARG A 1 77 ? -20.717 -1.592  -18.049 1.00 0.00 ? 77 ARG A HG3  5  
ATOM 6996  H HD2  . ARG A 1 77 ? -22.094 -2.926  -19.516 1.00 0.00 ? 77 ARG A HD2  5  
ATOM 6997  H HD3  . ARG A 1 77 ? -23.541 -2.067  -18.987 1.00 0.00 ? 77 ARG A HD3  5  
ATOM 6998  H HE   . ARG A 1 77 ? -21.826 -0.125  -19.941 1.00 0.00 ? 77 ARG A HE   5  
ATOM 6999  H HH11 . ARG A 1 77 ? -23.373 -2.987  -21.223 1.00 0.00 ? 77 ARG A HH11 5  
ATOM 7000  H HH12 . ARG A 1 77 ? -23.476 -2.368  -22.838 1.00 0.00 ? 77 ARG A HH12 5  
ATOM 7001  H HH21 . ARG A 1 77 ? -21.956 0.701   -22.073 1.00 0.00 ? 77 ARG A HH21 5  
ATOM 7002  H HH22 . ARG A 1 77 ? -22.671 -0.277  -23.325 1.00 0.00 ? 77 ARG A HH22 5  
ATOM 7003  N N    . LYS A 1 78 ? -23.399 -2.853  -14.134 1.00 0.00 ? 78 LYS A N    5  
ATOM 7004  C CA   . LYS A 1 78 ? -24.125 -3.397  -12.979 1.00 0.00 ? 78 LYS A CA   5  
ATOM 7005  C C    . LYS A 1 78 ? -23.702 -2.702  -11.687 1.00 0.00 ? 78 LYS A C    5  
ATOM 7006  O O    . LYS A 1 78 ? -24.055 -3.129  -10.590 1.00 0.00 ? 78 LYS A O    5  
ATOM 7007  C CB   . LYS A 1 78 ? -23.942 -4.915  -12.862 1.00 0.00 ? 78 LYS A CB   5  
ATOM 7008  C CG   . LYS A 1 78 ? -24.877 -5.707  -13.760 1.00 0.00 ? 78 LYS A CG   5  
ATOM 7009  C CD   . LYS A 1 78 ? -26.333 -5.450  -13.398 1.00 0.00 ? 78 LYS A CD   5  
ATOM 7010  C CE   . LYS A 1 78 ? -27.285 -6.227  -14.292 1.00 0.00 ? 78 LYS A CE   5  
ATOM 7011  N NZ   . LYS A 1 78 ? -28.710 -5.932  -13.976 1.00 0.00 ? 78 LYS A NZ   5  
ATOM 7012  H H    . LYS A 1 78 ? -23.917 -2.409  -14.850 1.00 0.00 ? 78 LYS A H    5  
ATOM 7013  H HA   . LYS A 1 78 ? -25.175 -3.190  -13.140 1.00 0.00 ? 78 LYS A HA   5  
ATOM 7014  H HB2  . LYS A 1 78 ? -22.925 -5.164  -13.126 1.00 0.00 ? 78 LYS A HB2  5  
ATOM 7015  H HB3  . LYS A 1 78 ? -24.123 -5.210  -11.839 1.00 0.00 ? 78 LYS A HB3  5  
ATOM 7016  H HG2  . LYS A 1 78 ? -24.713 -5.411  -14.787 1.00 0.00 ? 78 LYS A HG2  5  
ATOM 7017  H HG3  . LYS A 1 78 ? -24.665 -6.759  -13.646 1.00 0.00 ? 78 LYS A HG3  5  
ATOM 7018  H HD2  . LYS A 1 78 ? -26.496 -5.751  -12.373 1.00 0.00 ? 78 LYS A HD2  5  
ATOM 7019  H HD3  . LYS A 1 78 ? -26.537 -4.394  -13.501 1.00 0.00 ? 78 LYS A HD3  5  
ATOM 7020  H HE2  . LYS A 1 78 ? -27.090 -5.962  -15.321 1.00 0.00 ? 78 LYS A HE2  5  
ATOM 7021  H HE3  . LYS A 1 78 ? -27.106 -7.284  -14.154 1.00 0.00 ? 78 LYS A HE3  5  
ATOM 7022  H HZ1  . LYS A 1 78 ? -29.339 -6.401  -14.666 1.00 0.00 ? 78 LYS A HZ1  5  
ATOM 7023  H HZ2  . LYS A 1 78 ? -28.883 -4.904  -14.016 1.00 0.00 ? 78 LYS A HZ2  5  
ATOM 7024  H HZ3  . LYS A 1 78 ? -28.949 -6.274  -13.020 1.00 0.00 ? 78 LYS A HZ3  5  
ATOM 7025  N N    . THR A 1 79 ? -22.962 -1.613  -11.833 1.00 0.00 ? 79 THR A N    5  
ATOM 7026  C CA   . THR A 1 79 ? -22.547 -0.809  -10.701 1.00 0.00 ? 79 THR A CA   5  
ATOM 7027  C C    . THR A 1 79 ? -23.533 0.335   -10.519 1.00 0.00 ? 79 THR A C    5  
ATOM 7028  O O    . THR A 1 79 ? -23.392 1.397   -11.126 1.00 0.00 ? 79 THR A O    5  
ATOM 7029  C CB   . THR A 1 79 ? -21.129 -0.249  -10.909 1.00 0.00 ? 79 THR A CB   5  
ATOM 7030  O OG1  . THR A 1 79 ? -20.278 -1.285  -11.423 1.00 0.00 ? 79 THR A OG1  5  
ATOM 7031  C CG2  . THR A 1 79 ? -20.552 0.283   -9.603  1.00 0.00 ? 79 THR A CG2  5  
ATOM 7032  H H    . THR A 1 79 ? -22.697 -1.337  -12.732 1.00 0.00 ? 79 THR A H    5  
ATOM 7033  H HA   . THR A 1 79 ? -22.550 -1.431  -9.818  1.00 0.00 ? 79 THR A HA   5  
ATOM 7034  H HB   . THR A 1 79 ? -21.177 0.559   -11.621 1.00 0.00 ? 79 THR A HB   5  
ATOM 7035  H HG1  . THR A 1 79 ? -20.818 -2.048  -11.664 1.00 0.00 ? 79 THR A HG1  5  
ATOM 7036  H HG21 . THR A 1 79 ? -19.564 0.685   -9.783  1.00 0.00 ? 79 THR A HG21 5  
ATOM 7037  H HG22 . THR A 1 79 ? -20.489 -0.520  -8.884  1.00 0.00 ? 79 THR A HG22 5  
ATOM 7038  H HG23 . THR A 1 79 ? -21.192 1.062   -9.219  1.00 0.00 ? 79 THR A HG23 5  
ATOM 7039  N N    . LYS A 1 80 ? -24.543 0.088   -9.707  1.00 0.00 ? 80 LYS A N    5  
ATOM 7040  C CA   . LYS A 1 80 ? -25.668 0.996   -9.558  1.00 0.00 ? 80 LYS A CA   5  
ATOM 7041  C C    . LYS A 1 80 ? -26.589 0.454   -8.476  1.00 0.00 ? 80 LYS A C    5  
ATOM 7042  O O    . LYS A 1 80 ? -27.053 1.185   -7.600  1.00 0.00 ? 80 LYS A O    5  
ATOM 7043  C CB   . LYS A 1 80 ? -26.434 1.106   -10.883 1.00 0.00 ? 80 LYS A CB   5  
ATOM 7044  C CG   . LYS A 1 80 ? -27.570 2.117   -10.864 1.00 0.00 ? 80 LYS A CG   5  
ATOM 7045  C CD   . LYS A 1 80 ? -28.434 2.009   -12.118 1.00 0.00 ? 80 LYS A CD   5  
ATOM 7046  C CE   . LYS A 1 80 ? -27.628 2.228   -13.395 1.00 0.00 ? 80 LYS A CE   5  
ATOM 7047  N NZ   . LYS A 1 80 ? -27.135 3.624   -13.522 1.00 0.00 ? 80 LYS A NZ   5  
ATOM 7048  H H    . LYS A 1 80 ? -24.522 -0.734  -9.163  1.00 0.00 ? 80 LYS A H    5  
ATOM 7049  H HA   . LYS A 1 80 ? -25.296 1.967   -9.269  1.00 0.00 ? 80 LYS A HA   5  
ATOM 7050  H HB2  . LYS A 1 80 ? -25.743 1.394   -11.660 1.00 0.00 ? 80 LYS A HB2  5  
ATOM 7051  H HB3  . LYS A 1 80 ? -26.848 0.138   -11.125 1.00 0.00 ? 80 LYS A HB3  5  
ATOM 7052  H HG2  . LYS A 1 80 ? -28.187 1.936   -9.997  1.00 0.00 ? 80 LYS A HG2  5  
ATOM 7053  H HG3  . LYS A 1 80 ? -27.152 3.112   -10.810 1.00 0.00 ? 80 LYS A HG3  5  
ATOM 7054  H HD2  . LYS A 1 80 ? -28.872 1.024   -12.152 1.00 0.00 ? 80 LYS A HD2  5  
ATOM 7055  H HD3  . LYS A 1 80 ? -29.219 2.751   -12.066 1.00 0.00 ? 80 LYS A HD3  5  
ATOM 7056  H HE2  . LYS A 1 80 ? -26.779 1.561   -13.387 1.00 0.00 ? 80 LYS A HE2  5  
ATOM 7057  H HE3  . LYS A 1 80 ? -28.256 1.999   -14.243 1.00 0.00 ? 80 LYS A HE3  5  
ATOM 7058  H HZ1  . LYS A 1 80 ? -26.485 3.857   -12.740 1.00 0.00 ? 80 LYS A HZ1  5  
ATOM 7059  H HZ2  . LYS A 1 80 ? -27.937 4.290   -13.505 1.00 0.00 ? 80 LYS A HZ2  5  
ATOM 7060  H HZ3  . LYS A 1 80 ? -26.628 3.740   -14.426 1.00 0.00 ? 80 LYS A HZ3  5  
ATOM 7061  N N    . THR A 1 81 ? -26.819 -0.846  -8.544  1.00 0.00 ? 81 THR A N    5  
ATOM 7062  C CA   . THR A 1 81 ? -27.678 -1.536  -7.604  1.00 0.00 ? 81 THR A CA   5  
ATOM 7063  C C    . THR A 1 81 ? -26.846 -2.254  -6.544  1.00 0.00 ? 81 THR A C    5  
ATOM 7064  O O    . THR A 1 81 ? -26.803 -1.772  -5.395  1.00 0.00 ? 81 THR A O    5  
ATOM 7065  C CB   . THR A 1 81 ? -28.573 -2.547  -8.339  1.00 0.00 ? 81 THR A CB   5  
ATOM 7066  O OG1  . THR A 1 81 ? -27.774 -3.325  -9.241  1.00 0.00 ? 81 THR A OG1  5  
ATOM 7067  C CG2  . THR A 1 81 ? -29.674 -1.836  -9.114  1.00 0.00 ? 81 THR A CG2  5  
ATOM 7068  O OXT  . THR A 1 81 ? -26.201 -3.274  -6.881  1.00 0.00 ? 81 THR A OXT  5  
ATOM 7069  H H    . THR A 1 81 ? -26.388 -1.366  -9.255  1.00 0.00 ? 81 THR A H    5  
ATOM 7070  H HA   . THR A 1 81 ? -28.309 -0.805  -7.122  1.00 0.00 ? 81 THR A HA   5  
ATOM 7071  H HB   . THR A 1 81 ? -29.026 -3.202  -7.610  1.00 0.00 ? 81 THR A HB   5  
ATOM 7072  H HG1  . THR A 1 81 ? -27.014 -3.681  -8.761  1.00 0.00 ? 81 THR A HG1  5  
ATOM 7073  H HG21 . THR A 1 81 ? -30.288 -1.268  -8.429  1.00 0.00 ? 81 THR A HG21 5  
ATOM 7074  H HG22 . THR A 1 81 ? -30.285 -2.565  -9.624  1.00 0.00 ? 81 THR A HG22 5  
ATOM 7075  H HG23 . THR A 1 81 ? -29.230 -1.167  -9.836  1.00 0.00 ? 81 THR A HG23 5  
ATOM 7076  N N    . SER A 1 1  ? -5.432  -8.169  -17.679 1.00 0.00 ? 1  SER A N    6  
ATOM 7077  C CA   . SER A 1 1  ? -5.887  -8.683  -16.366 1.00 0.00 ? 1  SER A CA   6  
ATOM 7078  C C    . SER A 1 1  ? -6.465  -7.557  -15.522 1.00 0.00 ? 1  SER A C    6  
ATOM 7079  O O    . SER A 1 1  ? -5.880  -6.477  -15.458 1.00 0.00 ? 1  SER A O    6  
ATOM 7080  C CB   . SER A 1 1  ? -4.717  -9.344  -15.639 1.00 0.00 ? 1  SER A CB   6  
ATOM 7081  O OG   . SER A 1 1  ? -3.595  -8.476  -15.578 1.00 0.00 ? 1  SER A OG   6  
ATOM 7082  H H1   . SER A 1 1  ? -4.628  -7.517  -17.548 1.00 0.00 ? 1  SER A H1   6  
ATOM 7083  H H2   . SER A 1 1  ? -6.201  -7.658  -18.150 1.00 0.00 ? 1  SER A H2   6  
ATOM 7084  H H3   . SER A 1 1  ? -5.126  -8.958  -18.289 1.00 0.00 ? 1  SER A H3   6  
ATOM 7085  H HA   . SER A 1 1  ? -6.659  -9.418  -16.539 1.00 0.00 ? 1  SER A HA   6  
ATOM 7086  H HB2  . SER A 1 1  ? -5.018  -9.594  -14.631 1.00 0.00 ? 1  SER A HB2  6  
ATOM 7087  H HB3  . SER A 1 1  ? -4.433  -10.244 -16.163 1.00 0.00 ? 1  SER A HB3  6  
ATOM 7088  H HG   . SER A 1 1  ? -3.852  -7.641  -15.168 1.00 0.00 ? 1  SER A HG   6  
ATOM 7089  N N    . ASP A 1 2  ? -7.602  -7.830  -14.870 1.00 0.00 ? 2  ASP A N    6  
ATOM 7090  C CA   . ASP A 1 2  ? -8.355  -6.814  -14.120 1.00 0.00 ? 2  ASP A CA   6  
ATOM 7091  C C    . ASP A 1 2  ? -8.863  -5.732  -15.067 1.00 0.00 ? 2  ASP A C    6  
ATOM 7092  O O    . ASP A 1 2  ? -8.096  -4.909  -15.564 1.00 0.00 ? 2  ASP A O    6  
ATOM 7093  C CB   . ASP A 1 2  ? -7.512  -6.196  -12.992 1.00 0.00 ? 2  ASP A CB   6  
ATOM 7094  C CG   . ASP A 1 2  ? -8.282  -5.158  -12.189 1.00 0.00 ? 2  ASP A CG   6  
ATOM 7095  O OD1  . ASP A 1 2  ? -9.215  -5.540  -11.456 1.00 0.00 ? 2  ASP A OD1  6  
ATOM 7096  O OD2  . ASP A 1 2  ? -7.961  -3.954  -12.291 1.00 0.00 ? 2  ASP A OD2  6  
ATOM 7097  H H    . ASP A 1 2  ? -7.948  -8.748  -14.890 1.00 0.00 ? 2  ASP A H    6  
ATOM 7098  H HA   . ASP A 1 2  ? -9.211  -7.309  -13.683 1.00 0.00 ? 2  ASP A HA   6  
ATOM 7099  H HB2  . ASP A 1 2  ? -7.194  -6.978  -12.319 1.00 0.00 ? 2  ASP A HB2  6  
ATOM 7100  H HB3  . ASP A 1 2  ? -6.642  -5.721  -13.420 1.00 0.00 ? 2  ASP A HB3  6  
ATOM 7101  N N    . ARG A 1 3  ? -10.157 -5.744  -15.332 1.00 0.00 ? 3  ARG A N    6  
ATOM 7102  C CA   . ARG A 1 3  ? -10.733 -4.832  -16.309 1.00 0.00 ? 3  ARG A CA   6  
ATOM 7103  C C    . ARG A 1 3  ? -11.114 -3.494  -15.678 1.00 0.00 ? 3  ARG A C    6  
ATOM 7104  O O    . ARG A 1 3  ? -11.800 -3.451  -14.654 1.00 0.00 ? 3  ARG A O    6  
ATOM 7105  C CB   . ARG A 1 3  ? -11.949 -5.461  -17.018 1.00 0.00 ? 3  ARG A CB   6  
ATOM 7106  C CG   . ARG A 1 3  ? -13.249 -5.499  -16.211 1.00 0.00 ? 3  ARG A CG   6  
ATOM 7107  C CD   . ARG A 1 3  ? -13.264 -6.589  -15.143 1.00 0.00 ? 3  ARG A CD   6  
ATOM 7108  N NE   . ARG A 1 3  ? -12.518 -6.223  -13.940 1.00 0.00 ? 3  ARG A NE   6  
ATOM 7109  C CZ   . ARG A 1 3  ? -12.367 -7.031  -12.886 1.00 0.00 ? 3  ARG A CZ   6  
ATOM 7110  N NH1  . ARG A 1 3  ? -12.941 -8.229  -12.869 1.00 0.00 ? 3  ARG A NH1  6  
ATOM 7111  N NH2  . ARG A 1 3  ? -11.644 -6.646  -11.847 1.00 0.00 ? 3  ARG A NH2  6  
ATOM 7112  H H    . ARG A 1 3  ? -10.740 -6.378  -14.861 1.00 0.00 ? 3  ARG A H    6  
ATOM 7113  H HA   . ARG A 1 3  ? -9.971  -4.644  -17.050 1.00 0.00 ? 3  ARG A HA   6  
ATOM 7114  H HB2  . ARG A 1 3  ? -12.140 -4.904  -17.922 1.00 0.00 ? 3  ARG A HB2  6  
ATOM 7115  H HB3  . ARG A 1 3  ? -11.696 -6.476  -17.289 1.00 0.00 ? 3  ARG A HB3  6  
ATOM 7116  H HG2  . ARG A 1 3  ? -13.380 -4.543  -15.726 1.00 0.00 ? 3  ARG A HG2  6  
ATOM 7117  H HG3  . ARG A 1 3  ? -14.072 -5.665  -16.892 1.00 0.00 ? 3  ARG A HG3  6  
ATOM 7118  H HD2  . ARG A 1 3  ? -14.289 -6.788  -14.867 1.00 0.00 ? 3  ARG A HD2  6  
ATOM 7119  H HD3  . ARG A 1 3  ? -12.830 -7.485  -15.563 1.00 0.00 ? 3  ARG A HD3  6  
ATOM 7120  H HE   . ARG A 1 3  ? -12.104 -5.326  -13.920 1.00 0.00 ? 3  ARG A HE   6  
ATOM 7121  H HH11 . ARG A 1 3  ? -13.496 -8.543  -13.651 1.00 0.00 ? 3  ARG A HH11 6  
ATOM 7122  H HH12 . ARG A 1 3  ? -12.821 -8.834  -12.070 1.00 0.00 ? 3  ARG A HH12 6  
ATOM 7123  H HH21 . ARG A 1 3  ? -11.194 -5.746  -11.843 1.00 0.00 ? 3  ARG A HH21 6  
ATOM 7124  H HH22 . ARG A 1 3  ? -11.535 -7.254  -11.058 1.00 0.00 ? 3  ARG A HH22 6  
ATOM 7125  N N    . VAL A 1 4  ? -10.634 -2.418  -16.308 1.00 0.00 ? 4  VAL A N    6  
ATOM 7126  C CA   . VAL A 1 4  ? -10.988 -1.038  -15.954 1.00 0.00 ? 4  VAL A CA   6  
ATOM 7127  C C    . VAL A 1 4  ? -10.475 -0.630  -14.571 1.00 0.00 ? 4  VAL A C    6  
ATOM 7128  O O    . VAL A 1 4  ? -10.315 -1.455  -13.673 1.00 0.00 ? 4  VAL A O    6  
ATOM 7129  C CB   . VAL A 1 4  ? -12.519 -0.798  -16.033 1.00 0.00 ? 4  VAL A CB   6  
ATOM 7130  C CG1  . VAL A 1 4  ? -12.866 0.677   -15.864 1.00 0.00 ? 4  VAL A CG1  6  
ATOM 7131  C CG2  . VAL A 1 4  ? -13.082 -1.328  -17.345 1.00 0.00 ? 4  VAL A CG2  6  
ATOM 7132  H H    . VAL A 1 4  ? -10.009 -2.560  -17.054 1.00 0.00 ? 4  VAL A H    6  
ATOM 7133  H HA   . VAL A 1 4  ? -10.514 -0.396  -16.683 1.00 0.00 ? 4  VAL A HA   6  
ATOM 7134  H HB   . VAL A 1 4  ? -12.980 -1.340  -15.226 1.00 0.00 ? 4  VAL A HB   6  
ATOM 7135  H HG11 . VAL A 1 4  ? -12.500 1.026   -14.910 1.00 0.00 ? 4  VAL A HG11 6  
ATOM 7136  H HG12 . VAL A 1 4  ? -13.938 0.801   -15.906 1.00 0.00 ? 4  VAL A HG12 6  
ATOM 7137  H HG13 . VAL A 1 4  ? -12.407 1.249   -16.657 1.00 0.00 ? 4  VAL A HG13 6  
ATOM 7138  H HG21 . VAL A 1 4  ? -14.146 -1.148  -17.378 1.00 0.00 ? 4  VAL A HG21 6  
ATOM 7139  H HG22 . VAL A 1 4  ? -12.893 -2.389  -17.415 1.00 0.00 ? 4  VAL A HG22 6  
ATOM 7140  H HG23 . VAL A 1 4  ? -12.605 -0.822  -18.171 1.00 0.00 ? 4  VAL A HG23 6  
ATOM 7141  N N    . LYS A 1 5  ? -10.172 0.657   -14.428 1.00 0.00 ? 5  LYS A N    6  
ATOM 7142  C CA   . LYS A 1 5  ? -9.721  1.214   -13.155 1.00 0.00 ? 5  LYS A CA   6  
ATOM 7143  C C    . LYS A 1 5  ? -10.223 2.642   -13.011 1.00 0.00 ? 5  LYS A C    6  
ATOM 7144  O O    . LYS A 1 5  ? -9.638  3.570   -13.566 1.00 0.00 ? 5  LYS A O    6  
ATOM 7145  C CB   . LYS A 1 5  ? -8.189  1.200   -13.056 1.00 0.00 ? 5  LYS A CB   6  
ATOM 7146  C CG   . LYS A 1 5  ? -7.531  0.297   -14.077 1.00 0.00 ? 5  LYS A CG   6  
ATOM 7147  C CD   . LYS A 1 5  ? -6.445  -0.558  -13.465 1.00 0.00 ? 5  LYS A CD   6  
ATOM 7148  C CE   . LYS A 1 5  ? -6.204  -1.787  -14.318 1.00 0.00 ? 5  LYS A CE   6  
ATOM 7149  N NZ   . LYS A 1 5  ? -7.440  -2.595  -14.467 1.00 0.00 ? 5  LYS A NZ   6  
ATOM 7150  H H    . LYS A 1 5  ? -10.267 1.254   -15.204 1.00 0.00 ? 5  LYS A H    6  
ATOM 7151  H HA   . LYS A 1 5  ? -10.134 0.611   -12.360 1.00 0.00 ? 5  LYS A HA   6  
ATOM 7152  H HB2  . LYS A 1 5  ? -7.819  2.204   -13.202 1.00 0.00 ? 5  LYS A HB2  6  
ATOM 7153  H HB3  . LYS A 1 5  ? -7.905  0.860   -12.070 1.00 0.00 ? 5  LYS A HB3  6  
ATOM 7154  H HG2  . LYS A 1 5  ? -8.282  -0.350  -14.504 1.00 0.00 ? 5  LYS A HG2  6  
ATOM 7155  H HG3  . LYS A 1 5  ? -7.098  0.909   -14.857 1.00 0.00 ? 5  LYS A HG3  6  
ATOM 7156  H HD2  . LYS A 1 5  ? -5.534  0.017   -13.403 1.00 0.00 ? 5  LYS A HD2  6  
ATOM 7157  H HD3  . LYS A 1 5  ? -6.751  -0.868  -12.476 1.00 0.00 ? 5  LYS A HD3  6  
ATOM 7158  H HE2  . LYS A 1 5  ? -5.868  -1.473  -15.294 1.00 0.00 ? 5  LYS A HE2  6  
ATOM 7159  H HE3  . LYS A 1 5  ? -5.446  -2.389  -13.852 1.00 0.00 ? 5  LYS A HE3  6  
ATOM 7160  H HZ1  . LYS A 1 5  ? -8.205  -2.015  -14.860 1.00 0.00 ? 5  LYS A HZ1  6  
ATOM 7161  H HZ2  . LYS A 1 5  ? -7.742  -2.965  -13.536 1.00 0.00 ? 5  LYS A HZ2  6  
ATOM 7162  H HZ3  . LYS A 1 5  ? -7.270  -3.401  -15.105 1.00 0.00 ? 5  LYS A HZ3  6  
ATOM 7163  N N    . ARG A 1 6  ? -11.323 2.806   -12.296 1.00 0.00 ? 6  ARG A N    6  
ATOM 7164  C CA   . ARG A 1 6  ? -11.896 4.123   -12.057 1.00 0.00 ? 6  ARG A CA   6  
ATOM 7165  C C    . ARG A 1 6  ? -11.721 4.500   -10.591 1.00 0.00 ? 6  ARG A C    6  
ATOM 7166  O O    . ARG A 1 6  ? -11.520 3.625   -9.752  1.00 0.00 ? 6  ARG A O    6  
ATOM 7167  C CB   . ARG A 1 6  ? -13.384 4.132   -12.423 1.00 0.00 ? 6  ARG A CB   6  
ATOM 7168  C CG   . ARG A 1 6  ? -14.235 3.234   -11.538 1.00 0.00 ? 6  ARG A CG   6  
ATOM 7169  C CD   . ARG A 1 6  ? -15.710 3.331   -11.890 1.00 0.00 ? 6  ARG A CD   6  
ATOM 7170  N NE   . ARG A 1 6  ? -16.534 2.524   -10.993 1.00 0.00 ? 6  ARG A NE   6  
ATOM 7171  C CZ   . ARG A 1 6  ? -17.853 2.380   -11.110 1.00 0.00 ? 6  ARG A CZ   6  
ATOM 7172  N NH1  . ARG A 1 6  ? -18.504 2.986   -12.095 1.00 0.00 ? 6  ARG A NH1  6  
ATOM 7173  N NH2  . ARG A 1 6  ? -18.514 1.625   -10.239 1.00 0.00 ? 6  ARG A NH2  6  
ATOM 7174  H H    . ARG A 1 6  ? -11.755 2.022   -11.904 1.00 0.00 ? 6  ARG A H    6  
ATOM 7175  H HA   . ARG A 1 6  ? -11.368 4.839   -12.674 1.00 0.00 ? 6  ARG A HA   6  
ATOM 7176  H HB2  . ARG A 1 6  ? -13.756 5.142   -12.336 1.00 0.00 ? 6  ARG A HB2  6  
ATOM 7177  H HB3  . ARG A 1 6  ? -13.494 3.803   -13.445 1.00 0.00 ? 6  ARG A HB3  6  
ATOM 7178  H HG2  . ARG A 1 6  ? -13.912 2.212   -11.662 1.00 0.00 ? 6  ARG A HG2  6  
ATOM 7179  H HG3  . ARG A 1 6  ? -14.099 3.533   -10.507 1.00 0.00 ? 6  ARG A HG3  6  
ATOM 7180  H HD2  . ARG A 1 6  ? -16.018 4.365   -11.816 1.00 0.00 ? 6  ARG A HD2  6  
ATOM 7181  H HD3  . ARG A 1 6  ? -15.851 2.986   -12.904 1.00 0.00 ? 6  ARG A HD3  6  
ATOM 7182  H HE   . ARG A 1 6  ? -16.073 2.060   -10.251 1.00 0.00 ? 6  ARG A HE   6  
ATOM 7183  H HH11 . ARG A 1 6  ? -18.008 3.555   -12.753 1.00 0.00 ? 6  ARG A HH11 6  
ATOM 7184  H HH12 . ARG A 1 6  ? -19.502 2.874   -12.188 1.00 0.00 ? 6  ARG A HH12 6  
ATOM 7185  H HH21 . ARG A 1 6  ? -18.017 1.167   -9.496  1.00 0.00 ? 6  ARG A HH21 6  
ATOM 7186  H HH22 . ARG A 1 6  ? -19.509 1.515   -10.314 1.00 0.00 ? 6  ARG A HH22 6  
ATOM 7187  N N    . PRO A 1 7  ? -11.779 5.799   -10.259 1.00 0.00 ? 7  PRO A N    6  
ATOM 7188  C CA   . PRO A 1 7  ? -11.784 6.248   -8.866  1.00 0.00 ? 7  PRO A CA   6  
ATOM 7189  C C    . PRO A 1 7  ? -13.051 5.783   -8.152  1.00 0.00 ? 7  PRO A C    6  
ATOM 7190  O O    . PRO A 1 7  ? -14.127 6.359   -8.327  1.00 0.00 ? 7  PRO A O    6  
ATOM 7191  C CB   . PRO A 1 7  ? -11.734 7.778   -8.965  1.00 0.00 ? 7  PRO A CB   6  
ATOM 7192  C CG   . PRO A 1 7  ? -11.304 8.066   -10.367 1.00 0.00 ? 7  PRO A CG   6  
ATOM 7193  C CD   . PRO A 1 7  ? -11.820 6.928   -11.198 1.00 0.00 ? 7  PRO A CD   6  
ATOM 7194  H HA   . PRO A 1 7  ? -10.919 5.884   -8.331  1.00 0.00 ? 7  PRO A HA   6  
ATOM 7195  H HB2  . PRO A 1 7  ? -12.714 8.186   -8.761  1.00 0.00 ? 7  PRO A HB2  6  
ATOM 7196  H HB3  . PRO A 1 7  ? -11.023 8.165   -8.250  1.00 0.00 ? 7  PRO A HB3  6  
ATOM 7197  H HG2  . PRO A 1 7  ? -11.736 8.998   -10.699 1.00 0.00 ? 7  PRO A HG2  6  
ATOM 7198  H HG3  . PRO A 1 7  ? -10.227 8.109   -10.420 1.00 0.00 ? 7  PRO A HG3  6  
ATOM 7199  H HD2  . PRO A 1 7  ? -12.831 7.122   -11.525 1.00 0.00 ? 7  PRO A HD2  6  
ATOM 7200  H HD3  . PRO A 1 7  ? -11.172 6.751   -12.042 1.00 0.00 ? 7  PRO A HD3  6  
ATOM 7201  N N    . MET A 1 8  ? -12.919 4.720   -7.375  1.00 0.00 ? 8  MET A N    6  
ATOM 7202  C CA   . MET A 1 8  ? -14.062 4.078   -6.736  1.00 0.00 ? 8  MET A CA   6  
ATOM 7203  C C    . MET A 1 8  ? -14.152 4.453   -5.264  1.00 0.00 ? 8  MET A C    6  
ATOM 7204  O O    . MET A 1 8  ? -13.280 5.140   -4.737  1.00 0.00 ? 8  MET A O    6  
ATOM 7205  C CB   . MET A 1 8  ? -13.991 2.554   -6.869  1.00 0.00 ? 8  MET A CB   6  
ATOM 7206  C CG   . MET A 1 8  ? -12.839 1.919   -6.103  1.00 0.00 ? 8  MET A CG   6  
ATOM 7207  S SD   . MET A 1 8  ? -11.313 1.826   -7.058  1.00 0.00 ? 8  MET A SD   6  
ATOM 7208  C CE   . MET A 1 8  ? -11.812 0.682   -8.341  1.00 0.00 ? 8  MET A CE   6  
ATOM 7209  H H    . MET A 1 8  ? -12.018 4.356   -7.218  1.00 0.00 ? 8  MET A H    6  
ATOM 7210  H HA   . MET A 1 8  ? -14.952 4.429   -7.234  1.00 0.00 ? 8  MET A HA   6  
ATOM 7211  H HB2  . MET A 1 8  ? -14.914 2.132   -6.500  1.00 0.00 ? 8  MET A HB2  6  
ATOM 7212  H HB3  . MET A 1 8  ? -13.883 2.302   -7.913  1.00 0.00 ? 8  MET A HB3  6  
ATOM 7213  H HG2  . MET A 1 8  ? -12.651 2.503   -5.215  1.00 0.00 ? 8  MET A HG2  6  
ATOM 7214  H HG3  . MET A 1 8  ? -13.127 0.919   -5.817  1.00 0.00 ? 8  MET A HG3  6  
ATOM 7215  H HE1  . MET A 1 8  ? -12.107 -0.255  -7.891  1.00 0.00 ? 8  MET A HE1  6  
ATOM 7216  H HE2  . MET A 1 8  ? -10.988 0.517   -9.016  1.00 0.00 ? 8  MET A HE2  6  
ATOM 7217  H HE3  . MET A 1 8  ? -12.649 1.098   -8.884  1.00 0.00 ? 8  MET A HE3  6  
ATOM 7218  N N    . ASN A 1 9  ? -15.245 4.045   -4.625  1.00 0.00 ? 9  ASN A N    6  
ATOM 7219  C CA   . ASN A 1 9  ? -15.419 4.237   -3.191  1.00 0.00 ? 9  ASN A CA   6  
ATOM 7220  C C    . ASN A 1 9  ? -14.218 3.691   -2.416  1.00 0.00 ? 9  ASN A C    6  
ATOM 7221  O O    . ASN A 1 9  ? -13.596 2.699   -2.811  1.00 0.00 ? 9  ASN A O    6  
ATOM 7222  C CB   . ASN A 1 9  ? -16.712 3.568   -2.705  1.00 0.00 ? 9  ASN A CB   6  
ATOM 7223  C CG   . ASN A 1 9  ? -16.748 2.074   -2.967  1.00 0.00 ? 9  ASN A CG   6  
ATOM 7224  O OD1  . ASN A 1 9  ? -17.180 1.625   -4.027  1.00 0.00 ? 9  ASN A OD1  6  
ATOM 7225  N ND2  . ASN A 1 9  ? -16.311 1.298   -1.992  1.00 0.00 ? 9  ASN A ND2  6  
ATOM 7226  H H    . ASN A 1 9  ? -15.952 3.598   -5.132  1.00 0.00 ? 9  ASN A H    6  
ATOM 7227  H HA   . ASN A 1 9  ? -15.489 5.298   -3.011  1.00 0.00 ? 9  ASN A HA   6  
ATOM 7228  H HB2  . ASN A 1 9  ? -16.808 3.726   -1.640  1.00 0.00 ? 9  ASN A HB2  6  
ATOM 7229  H HB3  . ASN A 1 9  ? -17.551 4.022   -3.202  1.00 0.00 ? 9  ASN A HB3  6  
ATOM 7230  H HD21 . ASN A 1 9  ? -15.996 1.730   -1.178  1.00 0.00 ? 9  ASN A HD21 6  
ATOM 7231  H HD22 . ASN A 1 9  ? -16.337 0.322   -2.120  1.00 0.00 ? 9  ASN A HD22 6  
ATOM 7232  N N    . ALA A 1 10 ? -13.935 4.342   -1.296  1.00 0.00 ? 10 ALA A N    6  
ATOM 7233  C CA   . ALA A 1 10 ? -12.725 4.116   -0.506  1.00 0.00 ? 10 ALA A CA   6  
ATOM 7234  C C    . ALA A 1 10 ? -12.412 2.639   -0.228  1.00 0.00 ? 10 ALA A C    6  
ATOM 7235  O O    . ALA A 1 10 ? -11.255 2.236   -0.308  1.00 0.00 ? 10 ALA A O    6  
ATOM 7236  C CB   . ALA A 1 10 ? -12.836 4.878   0.804   1.00 0.00 ? 10 ALA A CB   6  
ATOM 7237  H H    . ALA A 1 10 ? -14.562 5.041   -0.993  1.00 0.00 ? 10 ALA A H    6  
ATOM 7238  H HA   . ALA A 1 10 ? -11.898 4.540   -1.055  1.00 0.00 ? 10 ALA A HA   6  
ATOM 7239  H HB1  . ALA A 1 10 ? -11.884 4.856   1.315   1.00 0.00 ? 10 ALA A HB1  6  
ATOM 7240  H HB2  . ALA A 1 10 ? -13.588 4.417   1.425   1.00 0.00 ? 10 ALA A HB2  6  
ATOM 7241  H HB3  . ALA A 1 10 ? -13.112 5.904   0.604   1.00 0.00 ? 10 ALA A HB3  6  
ATOM 7242  N N    . PHE A 1 11 ? -13.424 1.836   0.102   1.00 0.00 ? 11 PHE A N    6  
ATOM 7243  C CA   . PHE A 1 11 ? -13.184 0.440   0.495   1.00 0.00 ? 11 PHE A CA   6  
ATOM 7244  C C    . PHE A 1 11 ? -12.455 -0.344  -0.600  1.00 0.00 ? 11 PHE A C    6  
ATOM 7245  O O    . PHE A 1 11 ? -11.473 -1.041  -0.327  1.00 0.00 ? 11 PHE A O    6  
ATOM 7246  C CB   . PHE A 1 11 ? -14.489 -0.276  0.856   1.00 0.00 ? 11 PHE A CB   6  
ATOM 7247  C CG   . PHE A 1 11 ? -14.265 -1.651  1.429   1.00 0.00 ? 11 PHE A CG   6  
ATOM 7248  C CD1  . PHE A 1 11 ? -13.742 -1.802  2.703   1.00 0.00 ? 11 PHE A CD1  6  
ATOM 7249  C CD2  . PHE A 1 11 ? -14.559 -2.786  0.692   1.00 0.00 ? 11 PHE A CD2  6  
ATOM 7250  C CE1  . PHE A 1 11 ? -13.519 -3.058  3.234   1.00 0.00 ? 11 PHE A CE1  6  
ATOM 7251  C CE2  . PHE A 1 11 ? -14.337 -4.048  1.217   1.00 0.00 ? 11 PHE A CE2  6  
ATOM 7252  C CZ   . PHE A 1 11 ? -13.815 -4.183  2.491   1.00 0.00 ? 11 PHE A CZ   6  
ATOM 7253  H H    . PHE A 1 11 ? -14.337 2.186   0.090   1.00 0.00 ? 11 PHE A H    6  
ATOM 7254  H HA   . PHE A 1 11 ? -12.552 0.460   1.372   1.00 0.00 ? 11 PHE A HA   6  
ATOM 7255  H HB2  . PHE A 1 11 ? -15.025 0.310   1.589   1.00 0.00 ? 11 PHE A HB2  6  
ATOM 7256  H HB3  . PHE A 1 11 ? -15.094 -0.378  -0.033  1.00 0.00 ? 11 PHE A HB3  6  
ATOM 7257  H HD1  . PHE A 1 11 ? -13.510 -0.926  3.288   1.00 0.00 ? 11 PHE A HD1  6  
ATOM 7258  H HD2  . PHE A 1 11 ? -14.967 -2.680  -0.303  1.00 0.00 ? 11 PHE A HD2  6  
ATOM 7259  H HE1  . PHE A 1 11 ? -13.111 -3.160  4.228   1.00 0.00 ? 11 PHE A HE1  6  
ATOM 7260  H HE2  . PHE A 1 11 ? -14.571 -4.924  0.633   1.00 0.00 ? 11 PHE A HE2  6  
ATOM 7261  H HZ   . PHE A 1 11 ? -13.637 -5.165  2.905   1.00 0.00 ? 11 PHE A HZ   6  
ATOM 7262  N N    . MET A 1 12 ? -12.929 -0.230  -1.838  1.00 0.00 ? 12 MET A N    6  
ATOM 7263  C CA   . MET A 1 12 ? -12.298 -0.928  -2.957  1.00 0.00 ? 12 MET A CA   6  
ATOM 7264  C C    . MET A 1 12 ? -10.906 -0.359  -3.195  1.00 0.00 ? 12 MET A C    6  
ATOM 7265  O O    . MET A 1 12 ? -9.953  -1.092  -3.482  1.00 0.00 ? 12 MET A O    6  
ATOM 7266  C CB   . MET A 1 12 ? -13.129 -0.790  -4.236  1.00 0.00 ? 12 MET A CB   6  
ATOM 7267  C CG   . MET A 1 12 ? -14.541 -1.338  -4.130  1.00 0.00 ? 12 MET A CG   6  
ATOM 7268  S SD   . MET A 1 12 ? -15.473 -1.132  -5.661  1.00 0.00 ? 12 MET A SD   6  
ATOM 7269  C CE   . MET A 1 12 ? -17.069 -1.785  -5.176  1.00 0.00 ? 12 MET A CE   6  
ATOM 7270  H H    . MET A 1 12 ? -13.706 0.344   -2.002  1.00 0.00 ? 12 MET A H    6  
ATOM 7271  H HA   . MET A 1 12 ? -12.211 -1.973  -2.697  1.00 0.00 ? 12 MET A HA   6  
ATOM 7272  H HB2  . MET A 1 12 ? -13.194 0.258   -4.493  1.00 0.00 ? 12 MET A HB2  6  
ATOM 7273  H HB3  . MET A 1 12 ? -12.624 -1.313  -5.034  1.00 0.00 ? 12 MET A HB3  6  
ATOM 7274  H HG2  . MET A 1 12 ? -14.488 -2.390  -3.896  1.00 0.00 ? 12 MET A HG2  6  
ATOM 7275  H HG3  . MET A 1 12 ? -15.057 -0.818  -3.336  1.00 0.00 ? 12 MET A HG3  6  
ATOM 7276  H HE1  . MET A 1 12 ? -17.473 -1.186  -4.372  1.00 0.00 ? 12 MET A HE1  6  
ATOM 7277  H HE2  . MET A 1 12 ? -16.954 -2.805  -4.841  1.00 0.00 ? 12 MET A HE2  6  
ATOM 7278  H HE3  . MET A 1 12 ? -17.742 -1.757  -6.019  1.00 0.00 ? 12 MET A HE3  6  
ATOM 7279  N N    . VAL A 1 13 ? -10.807 0.956   -3.053  1.00 0.00 ? 13 VAL A N    6  
ATOM 7280  C CA   . VAL A 1 13 ? -9.551  1.674   -3.193  1.00 0.00 ? 13 VAL A CA   6  
ATOM 7281  C C    . VAL A 1 13 ? -8.526  1.143   -2.217  1.00 0.00 ? 13 VAL A C    6  
ATOM 7282  O O    . VAL A 1 13 ? -7.388  0.895   -2.578  1.00 0.00 ? 13 VAL A O    6  
ATOM 7283  C CB   . VAL A 1 13 ? -9.724  3.183   -2.934  1.00 0.00 ? 13 VAL A CB   6  
ATOM 7284  C CG1  . VAL A 1 13 ? -8.381  3.890   -2.980  1.00 0.00 ? 13 VAL A CG1  6  
ATOM 7285  C CG2  . VAL A 1 13 ? -10.680 3.795   -3.937  1.00 0.00 ? 13 VAL A CG2  6  
ATOM 7286  H H    . VAL A 1 13 ? -11.609 1.460   -2.841  1.00 0.00 ? 13 VAL A H    6  
ATOM 7287  H HA   . VAL A 1 13 ? -9.190  1.535   -4.201  1.00 0.00 ? 13 VAL A HA   6  
ATOM 7288  H HB   . VAL A 1 13 ? -10.141 3.312   -1.941  1.00 0.00 ? 13 VAL A HB   6  
ATOM 7289  H HG11 . VAL A 1 13 ? -7.733  3.482   -2.219  1.00 0.00 ? 13 VAL A HG11 6  
ATOM 7290  H HG12 . VAL A 1 13 ? -8.524  4.946   -2.802  1.00 0.00 ? 13 VAL A HG12 6  
ATOM 7291  H HG13 . VAL A 1 13 ? -7.931  3.747   -3.952  1.00 0.00 ? 13 VAL A HG13 6  
ATOM 7292  H HG21 . VAL A 1 13 ? -11.639 3.304   -3.866  1.00 0.00 ? 13 VAL A HG21 6  
ATOM 7293  H HG22 . VAL A 1 13 ? -10.284 3.672   -4.935  1.00 0.00 ? 13 VAL A HG22 6  
ATOM 7294  H HG23 . VAL A 1 13 ? -10.799 4.847   -3.725  1.00 0.00 ? 13 VAL A HG23 6  
ATOM 7295  N N    . TRP A 1 14 ? -8.937  0.966   -0.978  1.00 0.00 ? 14 TRP A N    6  
ATOM 7296  C CA   . TRP A 1 14 ? -8.032  0.486   0.042   1.00 0.00 ? 14 TRP A CA   6  
ATOM 7297  C C    . TRP A 1 14 ? -7.647  -0.962  -0.223  1.00 0.00 ? 14 TRP A C    6  
ATOM 7298  O O    . TRP A 1 14 ? -6.579  -1.399  0.160   1.00 0.00 ? 14 TRP A O    6  
ATOM 7299  C CB   . TRP A 1 14 ? -8.641  0.631   1.429   1.00 0.00 ? 14 TRP A CB   6  
ATOM 7300  C CG   . TRP A 1 14 ? -7.668  1.174   2.432   1.00 0.00 ? 14 TRP A CG   6  
ATOM 7301  C CD1  . TRP A 1 14 ? -6.812  2.219   2.248   1.00 0.00 ? 14 TRP A CD1  6  
ATOM 7302  C CD2  . TRP A 1 14 ? -7.468  0.722   3.775   1.00 0.00 ? 14 TRP A CD2  6  
ATOM 7303  N NE1  . TRP A 1 14 ? -6.082  2.437   3.387   1.00 0.00 ? 14 TRP A NE1  6  
ATOM 7304  C CE2  . TRP A 1 14 ? -6.465  1.533   4.341   1.00 0.00 ? 14 TRP A CE2  6  
ATOM 7305  C CE3  . TRP A 1 14 ? -8.032  -0.289  4.556   1.00 0.00 ? 14 TRP A CE3  6  
ATOM 7306  C CZ2  . TRP A 1 14 ? -6.019  1.360   5.648   1.00 0.00 ? 14 TRP A CZ2  6  
ATOM 7307  C CZ3  . TRP A 1 14 ? -7.589  -0.457  5.851   1.00 0.00 ? 14 TRP A CZ3  6  
ATOM 7308  C CH2  . TRP A 1 14 ? -6.591  0.364   6.386   1.00 0.00 ? 14 TRP A CH2  6  
ATOM 7309  H H    . TRP A 1 14 ? -9.868  1.175   -0.741  1.00 0.00 ? 14 TRP A H    6  
ATOM 7310  H HA   . TRP A 1 14 ? -7.140  1.091   -0.009  1.00 0.00 ? 14 TRP A HA   6  
ATOM 7311  H HB2  . TRP A 1 14 ? -9.484  1.306   1.382   1.00 0.00 ? 14 TRP A HB2  6  
ATOM 7312  H HB3  . TRP A 1 14 ? -8.974  -0.336  1.775   1.00 0.00 ? 14 TRP A HB3  6  
ATOM 7313  H HD1  . TRP A 1 14 ? -6.728  2.780   1.329   1.00 0.00 ? 14 TRP A HD1  6  
ATOM 7314  H HE1  . TRP A 1 14 ? -5.396  3.130   3.501   1.00 0.00 ? 14 TRP A HE1  6  
ATOM 7315  H HE3  . TRP A 1 14 ? -8.804  -0.933  4.161   1.00 0.00 ? 14 TRP A HE3  6  
ATOM 7316  H HZ2  . TRP A 1 14 ? -5.250  1.988   6.076   1.00 0.00 ? 14 TRP A HZ2  6  
ATOM 7317  H HZ3  . TRP A 1 14 ? -8.015  -1.233  6.468   1.00 0.00 ? 14 TRP A HZ3  6  
ATOM 7318  H HH2  . TRP A 1 14 ? -6.274  0.194   7.402   1.00 0.00 ? 14 TRP A HH2  6  
ATOM 7319  N N    . SER A 1 15 ? -8.501  -1.713  -0.888  1.00 0.00 ? 15 SER A N    6  
ATOM 7320  C CA   . SER A 1 15 ? -8.162  -3.086  -1.184  1.00 0.00 ? 15 SER A CA   6  
ATOM 7321  C C    . SER A 1 15 ? -6.995  -3.133  -2.175  1.00 0.00 ? 15 SER A C    6  
ATOM 7322  O O    . SER A 1 15 ? -5.894  -3.595  -1.842  1.00 0.00 ? 15 SER A O    6  
ATOM 7323  C CB   . SER A 1 15 ? -9.381  -3.818  -1.753  1.00 0.00 ? 15 SER A CB   6  
ATOM 7324  O OG   . SER A 1 15 ? -9.096  -5.183  -1.995  1.00 0.00 ? 15 SER A OG   6  
ATOM 7325  H H    . SER A 1 15 ? -9.361  -1.341  -1.187  1.00 0.00 ? 15 SER A H    6  
ATOM 7326  H HA   . SER A 1 15 ? -7.860  -3.564  -0.264  1.00 0.00 ? 15 SER A HA   6  
ATOM 7327  H HB2  . SER A 1 15 ? -10.195 -3.755  -1.048  1.00 0.00 ? 15 SER A HB2  6  
ATOM 7328  H HB3  . SER A 1 15 ? -9.674  -3.354  -2.683  1.00 0.00 ? 15 SER A HB3  6  
ATOM 7329  H HG   . SER A 1 15 ? -9.454  -5.715  -1.262  1.00 0.00 ? 15 SER A HG   6  
ATOM 7330  N N    . ARG A 1 16 ? -7.209  -2.579  -3.364  1.00 0.00 ? 16 ARG A N    6  
ATOM 7331  C CA   . ARG A 1 16 ? -6.197  -2.663  -4.414  1.00 0.00 ? 16 ARG A CA   6  
ATOM 7332  C C    . ARG A 1 16 ? -5.101  -1.620  -4.227  1.00 0.00 ? 16 ARG A C    6  
ATOM 7333  O O    . ARG A 1 16 ? -3.943  -1.862  -4.548  1.00 0.00 ? 16 ARG A O    6  
ATOM 7334  C CB   . ARG A 1 16 ? -6.824  -2.557  -5.810  1.00 0.00 ? 16 ARG A CB   6  
ATOM 7335  C CG   . ARG A 1 16 ? -7.760  -1.371  -6.002  1.00 0.00 ? 16 ARG A CG   6  
ATOM 7336  C CD   . ARG A 1 16 ? -8.342  -1.361  -7.409  1.00 0.00 ? 16 ARG A CD   6  
ATOM 7337  N NE   . ARG A 1 16 ? -9.002  -2.630  -7.730  1.00 0.00 ? 16 ARG A NE   6  
ATOM 7338  C CZ   . ARG A 1 16 ? -8.937  -3.231  -8.922  1.00 0.00 ? 16 ARG A CZ   6  
ATOM 7339  N NH1  . ARG A 1 16 ? -8.260  -2.672  -9.919  1.00 0.00 ? 16 ARG A NH1  6  
ATOM 7340  N NH2  . ARG A 1 16 ? -9.548  -4.396  -9.113  1.00 0.00 ? 16 ARG A NH2  6  
ATOM 7341  H H    . ARG A 1 16 ? -8.051  -2.081  -3.526  1.00 0.00 ? 16 ARG A H    6  
ATOM 7342  H HA   . ARG A 1 16 ? -5.739  -3.636  -4.325  1.00 0.00 ? 16 ARG A HA   6  
ATOM 7343  H HB2  . ARG A 1 16 ? -6.029  -2.475  -6.537  1.00 0.00 ? 16 ARG A HB2  6  
ATOM 7344  H HB3  . ARG A 1 16 ? -7.381  -3.462  -6.007  1.00 0.00 ? 16 ARG A HB3  6  
ATOM 7345  H HG2  . ARG A 1 16 ? -8.568  -1.441  -5.288  1.00 0.00 ? 16 ARG A HG2  6  
ATOM 7346  H HG3  . ARG A 1 16 ? -7.209  -0.457  -5.841  1.00 0.00 ? 16 ARG A HG3  6  
ATOM 7347  H HD2  . ARG A 1 16 ? -9.065  -0.560  -7.481  1.00 0.00 ? 16 ARG A HD2  6  
ATOM 7348  H HD3  . ARG A 1 16 ? -7.544  -1.191  -8.114  1.00 0.00 ? 16 ARG A HD3  6  
ATOM 7349  H HE   . ARG A 1 16 ? -9.514  -3.062  -7.014  1.00 0.00 ? 16 ARG A HE   6  
ATOM 7350  H HH11 . ARG A 1 16 ? -7.796  -1.797  -9.786  1.00 0.00 ? 16 ARG A HH11 6  
ATOM 7351  H HH12 . ARG A 1 16 ? -8.204  -3.137  -10.819 1.00 0.00 ? 16 ARG A HH12 6  
ATOM 7352  H HH21 . ARG A 1 16 ? -10.063 -4.833  -8.365  1.00 0.00 ? 16 ARG A HH21 6  
ATOM 7353  H HH22 . ARG A 1 16 ? -9.489  -4.859  -10.016 1.00 0.00 ? 16 ARG A HH22 6  
ATOM 7354  N N    . GLY A 1 17 ? -5.476  -0.471  -3.696  1.00 0.00 ? 17 GLY A N    6  
ATOM 7355  C CA   . GLY A 1 17 ? -4.549  0.629   -3.554  1.00 0.00 ? 17 GLY A CA   6  
ATOM 7356  C C    . GLY A 1 17 ? -3.662  0.509   -2.335  1.00 0.00 ? 17 GLY A C    6  
ATOM 7357  O O    . GLY A 1 17 ? -2.471  0.809   -2.406  1.00 0.00 ? 17 GLY A O    6  
ATOM 7358  H H    . GLY A 1 17 ? -6.404  -0.362  -3.389  1.00 0.00 ? 17 GLY A H    6  
ATOM 7359  H HA2  . GLY A 1 17 ? -3.924  0.670   -4.432  1.00 0.00 ? 17 GLY A HA2  6  
ATOM 7360  H HA3  . GLY A 1 17 ? -5.111  1.549   -3.485  1.00 0.00 ? 17 GLY A HA3  6  
ATOM 7361  N N    . GLN A 1 18 ? -4.228  0.091   -1.208  1.00 0.00 ? 18 GLN A N    6  
ATOM 7362  C CA   . GLN A 1 18 ? -3.439  -0.059  0.009   1.00 0.00 ? 18 GLN A CA   6  
ATOM 7363  C C    . GLN A 1 18 ? -2.475  -1.218  -0.157  1.00 0.00 ? 18 GLN A C    6  
ATOM 7364  O O    . GLN A 1 18 ? -1.318  -1.129  0.249   1.00 0.00 ? 18 GLN A O    6  
ATOM 7365  C CB   . GLN A 1 18 ? -4.341  -0.261  1.228   1.00 0.00 ? 18 GLN A CB   6  
ATOM 7366  C CG   . GLN A 1 18 ? -3.624  -0.284  2.565   1.00 0.00 ? 18 GLN A CG   6  
ATOM 7367  C CD   . GLN A 1 18 ? -2.879  0.999   2.857   1.00 0.00 ? 18 GLN A CD   6  
ATOM 7368  O OE1  . GLN A 1 18 ? -1.891  0.993   3.581   1.00 0.00 ? 18 GLN A OE1  6  
ATOM 7369  N NE2  . GLN A 1 18 ? -3.340  2.102   2.293   1.00 0.00 ? 18 GLN A NE2  6  
ATOM 7370  H H    . GLN A 1 18 ? -5.187  -0.116  -1.193  1.00 0.00 ? 18 GLN A H    6  
ATOM 7371  H HA   . GLN A 1 18 ? -2.866  0.849   0.143   1.00 0.00 ? 18 GLN A HA   6  
ATOM 7372  H HB2  . GLN A 1 18 ? -5.064  0.539   1.255   1.00 0.00 ? 18 GLN A HB2  6  
ATOM 7373  H HB3  . GLN A 1 18 ? -4.866  -1.199  1.112   1.00 0.00 ? 18 GLN A HB3  6  
ATOM 7374  H HG2  . GLN A 1 18 ? -4.353  -0.444  3.346   1.00 0.00 ? 18 GLN A HG2  6  
ATOM 7375  H HG3  . GLN A 1 18 ? -2.916  -1.095  2.566   1.00 0.00 ? 18 GLN A HG3  6  
ATOM 7376  H HE21 . GLN A 1 18 ? -4.137  2.037   1.727   1.00 0.00 ? 18 GLN A HE21 6  
ATOM 7377  H HE22 . GLN A 1 18 ? -2.860  2.940   2.452   1.00 0.00 ? 18 GLN A HE22 6  
ATOM 7378  N N    . ARG A 1 19 ? -2.937  -2.298  -0.790  1.00 0.00 ? 19 ARG A N    6  
ATOM 7379  C CA   . ARG A 1 19 ? -2.031  -3.378  -1.146  1.00 0.00 ? 19 ARG A CA   6  
ATOM 7380  C C    . ARG A 1 19 ? -0.980  -2.874  -2.138  1.00 0.00 ? 19 ARG A C    6  
ATOM 7381  O O    . ARG A 1 19 ? 0.161   -3.329  -2.126  1.00 0.00 ? 19 ARG A O    6  
ATOM 7382  C CB   . ARG A 1 19 ? -2.795  -4.581  -1.703  1.00 0.00 ? 19 ARG A CB   6  
ATOM 7383  C CG   . ARG A 1 19 ? -3.433  -5.432  -0.615  1.00 0.00 ? 19 ARG A CG   6  
ATOM 7384  C CD   . ARG A 1 19 ? -4.062  -6.697  -1.177  1.00 0.00 ? 19 ARG A CD   6  
ATOM 7385  N NE   . ARG A 1 19 ? -5.380  -6.461  -1.773  1.00 0.00 ? 19 ARG A NE   6  
ATOM 7386  C CZ   . ARG A 1 19 ? -6.113  -7.417  -2.353  1.00 0.00 ? 19 ARG A CZ   6  
ATOM 7387  N NH1  . ARG A 1 19 ? -5.611  -8.637  -2.512  1.00 0.00 ? 19 ARG A NH1  6  
ATOM 7388  N NH2  . ARG A 1 19 ? -7.341  -7.154  -2.784  1.00 0.00 ? 19 ARG A NH2  6  
ATOM 7389  H H    . ARG A 1 19 ? -3.898  -2.372  -1.009  1.00 0.00 ? 19 ARG A H    6  
ATOM 7390  H HA   . ARG A 1 19 ? -1.522  -3.678  -0.241  1.00 0.00 ? 19 ARG A HA   6  
ATOM 7391  H HB2  . ARG A 1 19 ? -3.573  -4.227  -2.362  1.00 0.00 ? 19 ARG A HB2  6  
ATOM 7392  H HB3  . ARG A 1 19 ? -2.112  -5.201  -2.263  1.00 0.00 ? 19 ARG A HB3  6  
ATOM 7393  H HG2  . ARG A 1 19 ? -2.674  -5.709  0.101   1.00 0.00 ? 19 ARG A HG2  6  
ATOM 7394  H HG3  . ARG A 1 19 ? -4.198  -4.849  -0.121  1.00 0.00 ? 19 ARG A HG3  6  
ATOM 7395  H HD2  . ARG A 1 19 ? -3.407  -7.098  -1.935  1.00 0.00 ? 19 ARG A HD2  6  
ATOM 7396  H HD3  . ARG A 1 19 ? -4.165  -7.416  -0.377  1.00 0.00 ? 19 ARG A HD3  6  
ATOM 7397  H HE   . ARG A 1 19 ? -5.746  -5.548  -1.706  1.00 0.00 ? 19 ARG A HE   6  
ATOM 7398  H HH11 . ARG A 1 19 ? -4.684  -8.845  -2.202  1.00 0.00 ? 19 ARG A HH11 6  
ATOM 7399  H HH12 . ARG A 1 19 ? -6.168  -9.361  -2.944  1.00 0.00 ? 19 ARG A HH12 6  
ATOM 7400  H HH21 . ARG A 1 19 ? -7.734  -6.233  -2.679  1.00 0.00 ? 19 ARG A HH21 6  
ATOM 7401  H HH22 . ARG A 1 19 ? -7.889  -7.880  -3.209  1.00 0.00 ? 19 ARG A HH22 6  
ATOM 7402  N N    . ARG A 1 20 ? -1.366  -1.916  -2.978  1.00 0.00 ? 20 ARG A N    6  
ATOM 7403  C CA   . ARG A 1 20 ? -0.429  -1.279  -3.899  1.00 0.00 ? 20 ARG A CA   6  
ATOM 7404  C C    . ARG A 1 20 ? 0.645   -0.495  -3.143  1.00 0.00 ? 20 ARG A C    6  
ATOM 7405  O O    . ARG A 1 20 ? 1.834   -0.754  -3.313  1.00 0.00 ? 20 ARG A O    6  
ATOM 7406  C CB   . ARG A 1 20 ? -1.176  -0.362  -4.884  1.00 0.00 ? 20 ARG A CB   6  
ATOM 7407  C CG   . ARG A 1 20 ? -0.299  0.682   -5.572  1.00 0.00 ? 20 ARG A CG   6  
ATOM 7408  C CD   . ARG A 1 20 ? -0.455  2.051   -4.921  1.00 0.00 ? 20 ARG A CD   6  
ATOM 7409  N NE   . ARG A 1 20 ? 0.621   2.972   -5.287  1.00 0.00 ? 20 ARG A NE   6  
ATOM 7410  C CZ   . ARG A 1 20 ? 0.926   4.071   -4.590  1.00 0.00 ? 20 ARG A CZ   6  
ATOM 7411  N NH1  . ARG A 1 20 ? 0.195   4.419   -3.534  1.00 0.00 ? 20 ARG A NH1  6  
ATOM 7412  N NH2  . ARG A 1 20 ? 1.945   4.833   -4.960  1.00 0.00 ? 20 ARG A NH2  6  
ATOM 7413  H H    . ARG A 1 20 ? -2.306  -1.639  -2.986  1.00 0.00 ? 20 ARG A H    6  
ATOM 7414  H HA   . ARG A 1 20 ? 0.055   -2.064  -4.459  1.00 0.00 ? 20 ARG A HA   6  
ATOM 7415  H HB2  . ARG A 1 20 ? -1.629  -0.973  -5.646  1.00 0.00 ? 20 ARG A HB2  6  
ATOM 7416  H HB3  . ARG A 1 20 ? -1.957  0.157   -4.345  1.00 0.00 ? 20 ARG A HB3  6  
ATOM 7417  H HG2  . ARG A 1 20 ? 0.733   0.376   -5.502  1.00 0.00 ? 20 ARG A HG2  6  
ATOM 7418  H HG3  . ARG A 1 20 ? -0.589  0.752   -6.610  1.00 0.00 ? 20 ARG A HG3  6  
ATOM 7419  H HD2  . ARG A 1 20 ? -1.396  2.476   -5.232  1.00 0.00 ? 20 ARG A HD2  6  
ATOM 7420  H HD3  . ARG A 1 20 ? -0.457  1.924   -3.848  1.00 0.00 ? 20 ARG A HD3  6  
ATOM 7421  H HE   . ARG A 1 20 ? 1.152   2.751   -6.083  1.00 0.00 ? 20 ARG A HE   6  
ATOM 7422  H HH11 . ARG A 1 20 ? -0.592  3.866   -3.256  1.00 0.00 ? 20 ARG A HH11 6  
ATOM 7423  H HH12 . ARG A 1 20 ? 0.434   5.242   -2.995  1.00 0.00 ? 20 ARG A HH12 6  
ATOM 7424  H HH21 . ARG A 1 20 ? 2.495   4.597   -5.772  1.00 0.00 ? 20 ARG A HH21 6  
ATOM 7425  H HH22 . ARG A 1 20 ? 2.184   5.656   -4.422  1.00 0.00 ? 20 ARG A HH22 6  
ATOM 7426  N N    . LYS A 1 21 ? 0.232   0.466   -2.314  1.00 0.00 ? 21 LYS A N    6  
ATOM 7427  C CA   . LYS A 1 21 ? 1.191   1.296   -1.590  1.00 0.00 ? 21 LYS A CA   6  
ATOM 7428  C C    . LYS A 1 21 ? 2.053   0.451   -0.642  1.00 0.00 ? 21 LYS A C    6  
ATOM 7429  O O    . LYS A 1 21 ? 3.234   0.736   -0.456  1.00 0.00 ? 21 LYS A O    6  
ATOM 7430  C CB   . LYS A 1 21 ? 0.473   2.436   -0.849  1.00 0.00 ? 21 LYS A CB   6  
ATOM 7431  C CG   . LYS A 1 21 ? 0.032   2.113   0.567   1.00 0.00 ? 21 LYS A CG   6  
ATOM 7432  C CD   . LYS A 1 21 ? 0.975   2.732   1.589   1.00 0.00 ? 21 LYS A CD   6  
ATOM 7433  C CE   . LYS A 1 21 ? 0.526   2.441   3.008   1.00 0.00 ? 21 LYS A CE   6  
ATOM 7434  N NZ   . LYS A 1 21 ? 1.395   3.093   4.018   1.00 0.00 ? 21 LYS A NZ   6  
ATOM 7435  H H    . LYS A 1 21 ? -0.740  0.648   -2.219  1.00 0.00 ? 21 LYS A H    6  
ATOM 7436  H HA   . LYS A 1 21 ? 1.846   1.735   -2.330  1.00 0.00 ? 21 LYS A HA   6  
ATOM 7437  H HB2  . LYS A 1 21 ? 1.136   3.288   -0.800  1.00 0.00 ? 21 LYS A HB2  6  
ATOM 7438  H HB3  . LYS A 1 21 ? -0.404  2.715   -1.416  1.00 0.00 ? 21 LYS A HB3  6  
ATOM 7439  H HG2  . LYS A 1 21 ? -0.964  2.503   0.724   1.00 0.00 ? 21 LYS A HG2  6  
ATOM 7440  H HG3  . LYS A 1 21 ? 0.027   1.041   0.697   1.00 0.00 ? 21 LYS A HG3  6  
ATOM 7441  H HD2  . LYS A 1 21 ? 1.964   2.325   1.445   1.00 0.00 ? 21 LYS A HD2  6  
ATOM 7442  H HD3  . LYS A 1 21 ? 0.999   3.802   1.441   1.00 0.00 ? 21 LYS A HD3  6  
ATOM 7443  H HE2  . LYS A 1 21 ? -0.484  2.801   3.131   1.00 0.00 ? 21 LYS A HE2  6  
ATOM 7444  H HE3  . LYS A 1 21 ? 0.547   1.374   3.164   1.00 0.00 ? 21 LYS A HE3  6  
ATOM 7445  H HZ1  . LYS A 1 21 ? 1.047   2.880   4.978   1.00 0.00 ? 21 LYS A HZ1  6  
ATOM 7446  H HZ2  . LYS A 1 21 ? 1.390   4.126   3.881   1.00 0.00 ? 21 LYS A HZ2  6  
ATOM 7447  H HZ3  . LYS A 1 21 ? 2.375   2.742   3.928   1.00 0.00 ? 21 LYS A HZ3  6  
ATOM 7448  N N    . MET A 1 22 ? 1.471   -0.603  -0.070  1.00 0.00 ? 22 MET A N    6  
ATOM 7449  C CA   . MET A 1 22 ? 2.220   -1.519  0.786   1.00 0.00 ? 22 MET A CA   6  
ATOM 7450  C C    . MET A 1 22 ? 3.223   -2.326  -0.026  1.00 0.00 ? 22 MET A C    6  
ATOM 7451  O O    . MET A 1 22 ? 4.284   -2.678  0.471   1.00 0.00 ? 22 MET A O    6  
ATOM 7452  C CB   . MET A 1 22 ? 1.287   -2.461  1.547   1.00 0.00 ? 22 MET A CB   6  
ATOM 7453  C CG   . MET A 1 22 ? 0.568   -1.799  2.710   1.00 0.00 ? 22 MET A CG   6  
ATOM 7454  S SD   . MET A 1 22 ? -0.416  -2.966  3.669   1.00 0.00 ? 22 MET A SD   6  
ATOM 7455  C CE   . MET A 1 22 ? -1.083  -1.893  4.941   1.00 0.00 ? 22 MET A CE   6  
ATOM 7456  H H    . MET A 1 22 ? 0.516   -0.761  -0.216  1.00 0.00 ? 22 MET A H    6  
ATOM 7457  H HA   . MET A 1 22 ? 2.767   -0.922  1.503   1.00 0.00 ? 22 MET A HA   6  
ATOM 7458  H HB2  . MET A 1 22 ? 0.545   -2.843  0.861   1.00 0.00 ? 22 MET A HB2  6  
ATOM 7459  H HB3  . MET A 1 22 ? 1.865   -3.289  1.932   1.00 0.00 ? 22 MET A HB3  6  
ATOM 7460  H HG2  . MET A 1 22 ? 1.303   -1.349  3.360   1.00 0.00 ? 22 MET A HG2  6  
ATOM 7461  H HG3  . MET A 1 22 ? -0.085  -1.032  2.322   1.00 0.00 ? 22 MET A HG3  6  
ATOM 7462  H HE1  . MET A 1 22 ? -1.708  -2.470  5.605   1.00 0.00 ? 22 MET A HE1  6  
ATOM 7463  H HE2  . MET A 1 22 ? -1.671  -1.112  4.481   1.00 0.00 ? 22 MET A HE2  6  
ATOM 7464  H HE3  . MET A 1 22 ? -0.272  -1.451  5.501   1.00 0.00 ? 22 MET A HE3  6  
ATOM 7465  N N    . ALA A 1 23 ? 2.894   -2.608  -1.281  1.00 0.00 ? 23 ALA A N    6  
ATOM 7466  C CA   . ALA A 1 23 ? 3.817   -3.306  -2.168  1.00 0.00 ? 23 ALA A CA   6  
ATOM 7467  C C    . ALA A 1 23 ? 4.991   -2.403  -2.529  1.00 0.00 ? 23 ALA A C    6  
ATOM 7468  O O    . ALA A 1 23 ? 6.071   -2.876  -2.868  1.00 0.00 ? 23 ALA A O    6  
ATOM 7469  C CB   . ALA A 1 23 ? 3.104   -3.776  -3.426  1.00 0.00 ? 23 ALA A CB   6  
ATOM 7470  H H    . ALA A 1 23 ? 2.008   -2.351  -1.616  1.00 0.00 ? 23 ALA A H    6  
ATOM 7471  H HA   . ALA A 1 23 ? 4.191   -4.175  -1.644  1.00 0.00 ? 23 ALA A HA   6  
ATOM 7472  H HB1  . ALA A 1 23 ? 2.695   -2.923  -3.947  1.00 0.00 ? 23 ALA A HB1  6  
ATOM 7473  H HB2  . ALA A 1 23 ? 2.306   -4.453  -3.157  1.00 0.00 ? 23 ALA A HB2  6  
ATOM 7474  H HB3  . ALA A 1 23 ? 3.807   -4.285  -4.069  1.00 0.00 ? 23 ALA A HB3  6  
ATOM 7475  N N    . GLN A 1 24 ? 4.765   -1.096  -2.455  1.00 0.00 ? 24 GLN A N    6  
ATOM 7476  C CA   . GLN A 1 24 ? 5.815   -0.120  -2.714  1.00 0.00 ? 24 GLN A CA   6  
ATOM 7477  C C    . GLN A 1 24 ? 6.707   0.036   -1.483  1.00 0.00 ? 24 GLN A C    6  
ATOM 7478  O O    . GLN A 1 24 ? 7.902   0.307   -1.599  1.00 0.00 ? 24 GLN A O    6  
ATOM 7479  C CB   . GLN A 1 24 ? 5.203   1.238   -3.079  1.00 0.00 ? 24 GLN A CB   6  
ATOM 7480  C CG   . GLN A 1 24 ? 4.208   1.190   -4.234  1.00 0.00 ? 24 GLN A CG   6  
ATOM 7481  C CD   . GLN A 1 24 ? 4.847   1.322   -5.609  1.00 0.00 ? 24 GLN A CD   6  
ATOM 7482  O OE1  . GLN A 1 24 ? 4.220   1.823   -6.543  1.00 0.00 ? 24 GLN A OE1  6  
ATOM 7483  N NE2  . GLN A 1 24 ? 6.091   0.899   -5.749  1.00 0.00 ? 24 GLN A NE2  6  
ATOM 7484  H H    . GLN A 1 24 ? 3.865   -0.781  -2.224  1.00 0.00 ? 24 GLN A H    6  
ATOM 7485  H HA   . GLN A 1 24 ? 6.411   -0.479  -3.536  1.00 0.00 ? 24 GLN A HA   6  
ATOM 7486  H HB2  . GLN A 1 24 ? 4.694   1.631   -2.212  1.00 0.00 ? 24 GLN A HB2  6  
ATOM 7487  H HB3  . GLN A 1 24 ? 6.002   1.912   -3.349  1.00 0.00 ? 24 GLN A HB3  6  
ATOM 7488  H HG2  . GLN A 1 24 ? 3.684   0.247   -4.194  1.00 0.00 ? 24 GLN A HG2  6  
ATOM 7489  H HG3  . GLN A 1 24 ? 3.497   1.995   -4.108  1.00 0.00 ? 24 GLN A HG3  6  
ATOM 7490  H HE21 . GLN A 1 24 ? 6.547   0.526   -4.967  1.00 0.00 ? 24 GLN A HE21 6  
ATOM 7491  H HE22 . GLN A 1 24 ? 6.505   0.962   -6.635  1.00 0.00 ? 24 GLN A HE22 6  
ATOM 7492  N N    . GLU A 1 25 ? 6.111   -0.145  -0.310  1.00 0.00 ? 25 GLU A N    6  
ATOM 7493  C CA   . GLU A 1 25 ? 6.813   0.039   0.956   1.00 0.00 ? 25 GLU A CA   6  
ATOM 7494  C C    . GLU A 1 25 ? 7.487   -1.253  1.423   1.00 0.00 ? 25 GLU A C    6  
ATOM 7495  O O    . GLU A 1 25 ? 8.663   -1.260  1.786   1.00 0.00 ? 25 GLU A O    6  
ATOM 7496  C CB   . GLU A 1 25 ? 5.833   0.526   2.026   1.00 0.00 ? 25 GLU A CB   6  
ATOM 7497  C CG   . GLU A 1 25 ? 5.275   1.915   1.764   1.00 0.00 ? 25 GLU A CG   6  
ATOM 7498  C CD   . GLU A 1 25 ? 4.381   2.403   2.884   1.00 0.00 ? 25 GLU A CD   6  
ATOM 7499  O OE1  . GLU A 1 25 ? 3.561   1.611   3.389   1.00 0.00 ? 25 GLU A OE1  6  
ATOM 7500  O OE2  . GLU A 1 25 ? 4.496   3.585   3.276   1.00 0.00 ? 25 GLU A OE2  6  
ATOM 7501  H H    . GLU A 1 25 ? 5.163   -0.399  -0.297  1.00 0.00 ? 25 GLU A H    6  
ATOM 7502  H HA   . GLU A 1 25 ? 7.573   0.793   0.806   1.00 0.00 ? 25 GLU A HA   6  
ATOM 7503  H HB2  . GLU A 1 25 ? 4.998   -0.165  2.068   1.00 0.00 ? 25 GLU A HB2  6  
ATOM 7504  H HB3  . GLU A 1 25 ? 6.334   0.533   2.984   1.00 0.00 ? 25 GLU A HB3  6  
ATOM 7505  H HG2  . GLU A 1 25 ? 6.098   2.604   1.655   1.00 0.00 ? 25 GLU A HG2  6  
ATOM 7506  H HG3  . GLU A 1 25 ? 4.701   1.892   0.848   1.00 0.00 ? 25 GLU A HG3  6  
ATOM 7507  N N    . ASN A 1 26 ? 6.733   -2.340  1.415   1.00 0.00 ? 26 ASN A N    6  
ATOM 7508  C CA   . ASN A 1 26 ? 7.226   -3.632  1.880   1.00 0.00 ? 26 ASN A CA   6  
ATOM 7509  C C    . ASN A 1 26 ? 6.578   -4.777  1.100   1.00 0.00 ? 26 ASN A C    6  
ATOM 7510  O O    . ASN A 1 26 ? 5.544   -5.317  1.493   1.00 0.00 ? 26 ASN A O    6  
ATOM 7511  C CB   . ASN A 1 26 ? 7.021   -3.798  3.400   1.00 0.00 ? 26 ASN A CB   6  
ATOM 7512  C CG   . ASN A 1 26 ? 5.685   -3.272  3.927   1.00 0.00 ? 26 ASN A CG   6  
ATOM 7513  O OD1  . ASN A 1 26 ? 5.628   -2.710  5.023   1.00 0.00 ? 26 ASN A OD1  6  
ATOM 7514  N ND2  . ASN A 1 26 ? 4.604   -3.479  3.192   1.00 0.00 ? 26 ASN A ND2  6  
ATOM 7515  H H    . ASN A 1 26 ? 5.811   -2.279  1.077   1.00 0.00 ? 26 ASN A H    6  
ATOM 7516  H HA   . ASN A 1 26 ? 8.287   -3.655  1.678   1.00 0.00 ? 26 ASN A HA   6  
ATOM 7517  H HB2  . ASN A 1 26 ? 7.084   -4.846  3.643   1.00 0.00 ? 26 ASN A HB2  6  
ATOM 7518  H HB3  . ASN A 1 26 ? 7.817   -3.274  3.913   1.00 0.00 ? 26 ASN A HB3  6  
ATOM 7519  H HD21 . ASN A 1 26 ? 4.707   -3.964  2.339   1.00 0.00 ? 26 ASN A HD21 6  
ATOM 7520  H HD22 . ASN A 1 26 ? 3.747   -3.138  3.520   1.00 0.00 ? 26 ASN A HD22 6  
ATOM 7521  N N    . PRO A 1 27 ? 7.178   -5.141  -0.043  1.00 0.00 ? 27 PRO A N    6  
ATOM 7522  C CA   . PRO A 1 27 ? 6.613   -6.136  -0.968  1.00 0.00 ? 27 PRO A CA   6  
ATOM 7523  C C    . PRO A 1 27 ? 6.612   -7.562  -0.417  1.00 0.00 ? 27 PRO A C    6  
ATOM 7524  O O    . PRO A 1 27 ? 6.086   -8.474  -1.053  1.00 0.00 ? 27 PRO A O    6  
ATOM 7525  C CB   . PRO A 1 27 ? 7.529   -6.059  -2.200  1.00 0.00 ? 27 PRO A CB   6  
ATOM 7526  C CG   . PRO A 1 27 ? 8.375   -4.844  -2.010  1.00 0.00 ? 27 PRO A CG   6  
ATOM 7527  C CD   . PRO A 1 27 ? 8.459   -4.616  -0.530  1.00 0.00 ? 27 PRO A CD   6  
ATOM 7528  H HA   . PRO A 1 27 ? 5.607   -5.873  -1.258  1.00 0.00 ? 27 PRO A HA   6  
ATOM 7529  H HB2  . PRO A 1 27 ? 8.136   -6.951  -2.250  1.00 0.00 ? 27 PRO A HB2  6  
ATOM 7530  H HB3  . PRO A 1 27 ? 6.926   -5.982  -3.092  1.00 0.00 ? 27 PRO A HB3  6  
ATOM 7531  H HG2  . PRO A 1 27 ? 9.359   -5.017  -2.418  1.00 0.00 ? 27 PRO A HG2  6  
ATOM 7532  H HG3  . PRO A 1 27 ? 7.914   -3.995  -2.495  1.00 0.00 ? 27 PRO A HG3  6  
ATOM 7533  H HD2  . PRO A 1 27 ? 9.289   -5.167  -0.110  1.00 0.00 ? 27 PRO A HD2  6  
ATOM 7534  H HD3  . PRO A 1 27 ? 8.553   -3.561  -0.314  1.00 0.00 ? 27 PRO A HD3  6  
ATOM 7535  N N    . LYS A 1 28 ? 7.189   -7.760  0.762   1.00 0.00 ? 28 LYS A N    6  
ATOM 7536  C CA   . LYS A 1 28 ? 7.305   -9.099  1.324   1.00 0.00 ? 28 LYS A CA   6  
ATOM 7537  C C    . LYS A 1 28 ? 6.004   -9.523  2.010   1.00 0.00 ? 28 LYS A C    6  
ATOM 7538  O O    . LYS A 1 28 ? 5.880   -10.642 2.509   1.00 0.00 ? 28 LYS A O    6  
ATOM 7539  C CB   . LYS A 1 28 ? 8.480   -9.175  2.305   1.00 0.00 ? 28 LYS A CB   6  
ATOM 7540  C CG   . LYS A 1 28 ? 8.889   -10.602 2.635   1.00 0.00 ? 28 LYS A CG   6  
ATOM 7541  C CD   . LYS A 1 28 ? 10.127  -10.659 3.514   1.00 0.00 ? 28 LYS A CD   6  
ATOM 7542  C CE   . LYS A 1 28 ? 10.612  -12.092 3.677   1.00 0.00 ? 28 LYS A CE   6  
ATOM 7543  N NZ   . LYS A 1 28 ? 11.849  -12.177 4.494   1.00 0.00 ? 28 LYS A NZ   6  
ATOM 7544  H H    . LYS A 1 28 ? 7.539   -6.994  1.262   1.00 0.00 ? 28 LYS A H    6  
ATOM 7545  H HA   . LYS A 1 28 ? 7.491   -9.776  0.503   1.00 0.00 ? 28 LYS A HA   6  
ATOM 7546  H HB2  . LYS A 1 28 ? 9.330   -8.666  1.873   1.00 0.00 ? 28 LYS A HB2  6  
ATOM 7547  H HB3  . LYS A 1 28 ? 8.200   -8.680  3.223   1.00 0.00 ? 28 LYS A HB3  6  
ATOM 7548  H HG2  . LYS A 1 28 ? 8.075   -11.088 3.153   1.00 0.00 ? 28 LYS A HG2  6  
ATOM 7549  H HG3  . LYS A 1 28 ? 9.090   -11.126 1.713   1.00 0.00 ? 28 LYS A HG3  6  
ATOM 7550  H HD2  . LYS A 1 28 ? 10.910  -10.072 3.058   1.00 0.00 ? 28 LYS A HD2  6  
ATOM 7551  H HD3  . LYS A 1 28 ? 9.889   -10.256 4.486   1.00 0.00 ? 28 LYS A HD3  6  
ATOM 7552  H HE2  . LYS A 1 28 ? 9.837   -12.669 4.158   1.00 0.00 ? 28 LYS A HE2  6  
ATOM 7553  H HE3  . LYS A 1 28 ? 10.810  -12.503 2.698   1.00 0.00 ? 28 LYS A HE3  6  
ATOM 7554  H HZ1  . LYS A 1 28 ? 11.613  -12.346 5.499   1.00 0.00 ? 28 LYS A HZ1  6  
ATOM 7555  H HZ2  . LYS A 1 28 ? 12.397  -11.293 4.417   1.00 0.00 ? 28 LYS A HZ2  6  
ATOM 7556  H HZ3  . LYS A 1 28 ? 12.443  -12.965 4.152   1.00 0.00 ? 28 LYS A HZ3  6  
ATOM 7557  N N    . MET A 1 29 ? 5.034   -8.623  2.039   1.00 0.00 ? 29 MET A N    6  
ATOM 7558  C CA   . MET A 1 29 ? 3.728   -8.944  2.585   1.00 0.00 ? 29 MET A CA   6  
ATOM 7559  C C    . MET A 1 29 ? 2.866   -9.584  1.506   1.00 0.00 ? 29 MET A C    6  
ATOM 7560  O O    . MET A 1 29 ? 2.627   -8.993  0.454   1.00 0.00 ? 29 MET A O    6  
ATOM 7561  C CB   . MET A 1 29 ? 3.056   -7.695  3.165   1.00 0.00 ? 29 MET A CB   6  
ATOM 7562  C CG   . MET A 1 29 ? 3.645   -7.249  4.499   1.00 0.00 ? 29 MET A CG   6  
ATOM 7563  S SD   . MET A 1 29 ? 5.398   -6.821  4.396   1.00 0.00 ? 29 MET A SD   6  
ATOM 7564  C CE   . MET A 1 29 ? 5.794   -6.550  6.120   1.00 0.00 ? 29 MET A CE   6  
ATOM 7565  H H    . MET A 1 29 ? 5.200   -7.726  1.680   1.00 0.00 ? 29 MET A H    6  
ATOM 7566  H HA   . MET A 1 29 ? 3.874   -9.662  3.380   1.00 0.00 ? 29 MET A HA   6  
ATOM 7567  H HB2  . MET A 1 29 ? 3.157   -6.883  2.459   1.00 0.00 ? 29 MET A HB2  6  
ATOM 7568  H HB3  . MET A 1 29 ? 2.006   -7.904  3.312   1.00 0.00 ? 29 MET A HB3  6  
ATOM 7569  H HG2  . MET A 1 29 ? 3.100   -6.383  4.845   1.00 0.00 ? 29 MET A HG2  6  
ATOM 7570  H HG3  . MET A 1 29 ? 3.528   -8.051  5.213   1.00 0.00 ? 29 MET A HG3  6  
ATOM 7571  H HE1  . MET A 1 29 ? 5.181   -5.751  6.508   1.00 0.00 ? 29 MET A HE1  6  
ATOM 7572  H HE2  . MET A 1 29 ? 6.837   -6.283  6.212   1.00 0.00 ? 29 MET A HE2  6  
ATOM 7573  H HE3  . MET A 1 29 ? 5.604   -7.454  6.677   1.00 0.00 ? 29 MET A HE3  6  
ATOM 7574  N N    . HIS A 1 30 ? 2.385   -10.792 1.783   1.00 0.00 ? 30 HIS A N    6  
ATOM 7575  C CA   . HIS A 1 30 ? 1.779   -11.640 0.754   1.00 0.00 ? 30 HIS A CA   6  
ATOM 7576  C C    . HIS A 1 30 ? 0.304   -11.315 0.520   1.00 0.00 ? 30 HIS A C    6  
ATOM 7577  O O    . HIS A 1 30 ? -0.425  -12.119 -0.063  1.00 0.00 ? 30 HIS A O    6  
ATOM 7578  C CB   . HIS A 1 30 ? 1.954   -13.125 1.109   1.00 0.00 ? 30 HIS A CB   6  
ATOM 7579  C CG   . HIS A 1 30 ? 3.366   -13.615 0.959   1.00 0.00 ? 30 HIS A CG   6  
ATOM 7580  N ND1  . HIS A 1 30 ? 3.730   -14.942 1.081   1.00 0.00 ? 30 HIS A ND1  6  
ATOM 7581  C CD2  . HIS A 1 30 ? 4.509   -12.942 0.686   1.00 0.00 ? 30 HIS A CD2  6  
ATOM 7582  C CE1  . HIS A 1 30 ? 5.033   -15.058 0.894   1.00 0.00 ? 30 HIS A CE1  6  
ATOM 7583  N NE2  . HIS A 1 30 ? 5.528   -13.859 0.651   1.00 0.00 ? 30 HIS A NE2  6  
ATOM 7584  H H    . HIS A 1 30 ? 2.425   -11.117 2.707   1.00 0.00 ? 30 HIS A H    6  
ATOM 7585  H HA   . HIS A 1 30 ? 2.312   -11.449 -0.166  1.00 0.00 ? 30 HIS A HA   6  
ATOM 7586  H HB2  . HIS A 1 30 ? 1.655   -13.280 2.137   1.00 0.00 ? 30 HIS A HB2  6  
ATOM 7587  H HB3  . HIS A 1 30 ? 1.323   -13.718 0.464   1.00 0.00 ? 30 HIS A HB3  6  
ATOM 7588  H HD1  . HIS A 1 30 ? 3.125   -15.692 1.284   1.00 0.00 ? 30 HIS A HD1  6  
ATOM 7589  H HD2  . HIS A 1 30 ? 4.600   -11.875 0.529   1.00 0.00 ? 30 HIS A HD2  6  
ATOM 7590  H HE1  . HIS A 1 30 ? 5.597   -15.980 0.929   1.00 0.00 ? 30 HIS A HE1  6  
ATOM 7591  H HE2  . HIS A 1 30 ? 6.453   -13.674 0.348   1.00 0.00 ? 30 HIS A HE2  6  
ATOM 7592  N N    . ASN A 1 31 ? -0.126  -10.144 0.997   1.00 0.00 ? 31 ASN A N    6  
ATOM 7593  C CA   . ASN A 1 31 ? -1.442  -9.571  0.673   1.00 0.00 ? 31 ASN A CA   6  
ATOM 7594  C C    . ASN A 1 31 ? -2.597  -10.256 1.402   1.00 0.00 ? 31 ASN A C    6  
ATOM 7595  O O    . ASN A 1 31 ? -3.561  -9.595  1.796   1.00 0.00 ? 31 ASN A O    6  
ATOM 7596  C CB   . ASN A 1 31 ? -1.709  -9.584  -0.837  1.00 0.00 ? 31 ASN A CB   6  
ATOM 7597  C CG   . ASN A 1 31 ? -0.971  -8.491  -1.598  1.00 0.00 ? 31 ASN A CG   6  
ATOM 7598  O OD1  . ASN A 1 31 ? -1.490  -7.955  -2.575  1.00 0.00 ? 31 ASN A OD1  6  
ATOM 7599  N ND2  . ASN A 1 31 ? 0.241   -8.155  -1.171  1.00 0.00 ? 31 ASN A ND2  6  
ATOM 7600  H H    . ASN A 1 31 ? 0.455   -9.655  1.618   1.00 0.00 ? 31 ASN A H    6  
ATOM 7601  H HA   . ASN A 1 31 ? -1.418  -8.540  0.995   1.00 0.00 ? 31 ASN A HA   6  
ATOM 7602  H HB2  . ASN A 1 31 ? -1.403  -10.539 -1.240  1.00 0.00 ? 31 ASN A HB2  6  
ATOM 7603  H HB3  . ASN A 1 31 ? -2.769  -9.457  -1.005  1.00 0.00 ? 31 ASN A HB3  6  
ATOM 7604  H HD21 . ASN A 1 31 ? 0.610   -8.622  -0.390  1.00 0.00 ? 31 ASN A HD21 6  
ATOM 7605  H HD22 . ASN A 1 31 ? 0.723   -7.457  -1.661  1.00 0.00 ? 31 ASN A HD22 6  
ATOM 7606  N N    . SER A 1 32 ? -2.515  -11.567 1.571   1.00 0.00 ? 32 SER A N    6  
ATOM 7607  C CA   . SER A 1 32 ? -3.577  -12.321 2.221   1.00 0.00 ? 32 SER A CA   6  
ATOM 7608  C C    . SER A 1 32 ? -3.777  -11.864 3.666   1.00 0.00 ? 32 SER A C    6  
ATOM 7609  O O    . SER A 1 32 ? -4.898  -11.569 4.081   1.00 0.00 ? 32 SER A O    6  
ATOM 7610  C CB   . SER A 1 32 ? -3.270  -13.818 2.164   1.00 0.00 ? 32 SER A CB   6  
ATOM 7611  O OG   . SER A 1 32 ? -3.173  -14.264 0.817   1.00 0.00 ? 32 SER A OG   6  
ATOM 7612  H H    . SER A 1 32 ? -1.725  -12.043 1.236   1.00 0.00 ? 32 SER A H    6  
ATOM 7613  H HA   . SER A 1 32 ? -4.489  -12.134 1.675   1.00 0.00 ? 32 SER A HA   6  
ATOM 7614  H HB2  . SER A 1 32 ? -2.330  -14.010 2.663   1.00 0.00 ? 32 SER A HB2  6  
ATOM 7615  H HB3  . SER A 1 32 ? -4.059  -14.365 2.658   1.00 0.00 ? 32 SER A HB3  6  
ATOM 7616  H HG   . SER A 1 32 ? -2.251  -14.444 0.605   1.00 0.00 ? 32 SER A HG   6  
ATOM 7617  N N    . GLU A 1 33 ? -2.688  -11.748 4.416   1.00 0.00 ? 33 GLU A N    6  
ATOM 7618  C CA   . GLU A 1 33 ? -2.776  -11.322 5.806   1.00 0.00 ? 33 GLU A CA   6  
ATOM 7619  C C    . GLU A 1 33 ? -3.090  -9.834  5.880   1.00 0.00 ? 33 GLU A C    6  
ATOM 7620  O O    . GLU A 1 33 ? -3.764  -9.375  6.802   1.00 0.00 ? 33 GLU A O    6  
ATOM 7621  C CB   . GLU A 1 33 ? -1.495  -11.670 6.583   1.00 0.00 ? 33 GLU A CB   6  
ATOM 7622  C CG   . GLU A 1 33 ? -0.235  -11.778 5.729   1.00 0.00 ? 33 GLU A CG   6  
ATOM 7623  C CD   . GLU A 1 33 ? 0.141   -10.481 5.050   1.00 0.00 ? 33 GLU A CD   6  
ATOM 7624  O OE1  . GLU A 1 33 ? 0.783   -9.635  5.700   1.00 0.00 ? 33 GLU A OE1  6  
ATOM 7625  O OE2  . GLU A 1 33 ? -0.214  -10.307 3.867   1.00 0.00 ? 33 GLU A OE2  6  
ATOM 7626  H H    . GLU A 1 33 ? -1.808  -11.926 4.023   1.00 0.00 ? 33 GLU A H    6  
ATOM 7627  H HA   . GLU A 1 33 ? -3.603  -11.859 6.251   1.00 0.00 ? 33 GLU A HA   6  
ATOM 7628  H HB2  . GLU A 1 33 ? -1.328  -10.909 7.330   1.00 0.00 ? 33 GLU A HB2  6  
ATOM 7629  H HB3  . GLU A 1 33 ? -1.644  -12.617 7.083   1.00 0.00 ? 33 GLU A HB3  6  
ATOM 7630  H HG2  . GLU A 1 33 ? 0.585   -12.084 6.360   1.00 0.00 ? 33 GLU A HG2  6  
ATOM 7631  H HG3  . GLU A 1 33 ? -0.398  -12.530 4.969   1.00 0.00 ? 33 GLU A HG3  6  
ATOM 7632  N N    . ILE A 1 34 ? -2.623  -9.091  4.880   1.00 0.00 ? 34 ILE A N    6  
ATOM 7633  C CA   . ILE A 1 34 ? -2.970  -7.682  4.738   1.00 0.00 ? 34 ILE A CA   6  
ATOM 7634  C C    . ILE A 1 34 ? -4.487  -7.516  4.677   1.00 0.00 ? 34 ILE A C    6  
ATOM 7635  O O    . ILE A 1 34 ? -5.041  -6.573  5.242   1.00 0.00 ? 34 ILE A O    6  
ATOM 7636  C CB   . ILE A 1 34 ? -2.340  -7.068  3.463   1.00 0.00 ? 34 ILE A CB   6  
ATOM 7637  C CG1  . ILE A 1 34 ? -0.812  -7.102  3.542   1.00 0.00 ? 34 ILE A CG1  6  
ATOM 7638  C CG2  . ILE A 1 34 ? -2.824  -5.639  3.251   1.00 0.00 ? 34 ILE A CG2  6  
ATOM 7639  C CD1  . ILE A 1 34 ? -0.131  -6.540  2.312   1.00 0.00 ? 34 ILE A CD1  6  
ATOM 7640  H H    . ILE A 1 34 ? -2.010  -9.502  4.226   1.00 0.00 ? 34 ILE A H    6  
ATOM 7641  H HA   . ILE A 1 34 ? -2.588  -7.153  5.598   1.00 0.00 ? 34 ILE A HA   6  
ATOM 7642  H HB   . ILE A 1 34 ? -2.660  -7.656  2.615   1.00 0.00 ? 34 ILE A HB   6  
ATOM 7643  H HG12 . ILE A 1 34 ? -0.490  -6.520  4.394   1.00 0.00 ? 34 ILE A HG12 6  
ATOM 7644  H HG13 . ILE A 1 34 ? -0.487  -8.125  3.666   1.00 0.00 ? 34 ILE A HG13 6  
ATOM 7645  H HG21 . ILE A 1 34 ? -3.895  -5.638  3.112   1.00 0.00 ? 34 ILE A HG21 6  
ATOM 7646  H HG22 . ILE A 1 34 ? -2.346  -5.223  2.377   1.00 0.00 ? 34 ILE A HG22 6  
ATOM 7647  H HG23 . ILE A 1 34 ? -2.573  -5.043  4.116   1.00 0.00 ? 34 ILE A HG23 6  
ATOM 7648  H HD11 . ILE A 1 34 ? -0.414  -5.505  2.183   1.00 0.00 ? 34 ILE A HD11 6  
ATOM 7649  H HD12 . ILE A 1 34 ? -0.433  -7.105  1.443   1.00 0.00 ? 34 ILE A HD12 6  
ATOM 7650  H HD13 . ILE A 1 34 ? 0.940   -6.607  2.431   1.00 0.00 ? 34 ILE A HD13 6  
ATOM 7651  N N    . SER A 1 35 ? -5.154  -8.464  4.027   1.00 0.00 ? 35 SER A N    6  
ATOM 7652  C CA   . SER A 1 35 ? -6.596  -8.391  3.844   1.00 0.00 ? 35 SER A CA   6  
ATOM 7653  C C    . SER A 1 35 ? -7.316  -8.451  5.190   1.00 0.00 ? 35 SER A C    6  
ATOM 7654  O O    . SER A 1 35 ? -8.343  -7.797  5.387   1.00 0.00 ? 35 SER A O    6  
ATOM 7655  C CB   . SER A 1 35 ? -7.072  -9.526  2.934   1.00 0.00 ? 35 SER A CB   6  
ATOM 7656  O OG   . SER A 1 35 ? -6.409  -9.482  1.678   1.00 0.00 ? 35 SER A OG   6  
ATOM 7657  H H    . SER A 1 35 ? -4.664  -9.246  3.679   1.00 0.00 ? 35 SER A H    6  
ATOM 7658  H HA   . SER A 1 35 ? -6.822  -7.446  3.373   1.00 0.00 ? 35 SER A HA   6  
ATOM 7659  H HB2  . SER A 1 35 ? -6.861  -10.475 3.405   1.00 0.00 ? 35 SER A HB2  6  
ATOM 7660  H HB3  . SER A 1 35 ? -8.135  -9.432  2.770   1.00 0.00 ? 35 SER A HB3  6  
ATOM 7661  H HG   . SER A 1 35 ? -5.455  -9.541  1.814   1.00 0.00 ? 35 SER A HG   6  
ATOM 7662  N N    . LYS A 1 36 ? -6.746  -9.210  6.122   1.00 0.00 ? 36 LYS A N    6  
ATOM 7663  C CA   . LYS A 1 36 ? -7.320  -9.351  7.453   1.00 0.00 ? 36 LYS A CA   6  
ATOM 7664  C C    . LYS A 1 36 ? -7.117  -8.068  8.254   1.00 0.00 ? 36 LYS A C    6  
ATOM 7665  O O    . LYS A 1 36 ? -8.016  -7.620  8.969   1.00 0.00 ? 36 LYS A O    6  
ATOM 7666  C CB   . LYS A 1 36 ? -6.686  -10.542 8.175   1.00 0.00 ? 36 LYS A CB   6  
ATOM 7667  C CG   . LYS A 1 36 ? -7.217  -10.776 9.582   1.00 0.00 ? 36 LYS A CG   6  
ATOM 7668  C CD   . LYS A 1 36 ? -6.593  -12.017 10.202  1.00 0.00 ? 36 LYS A CD   6  
ATOM 7669  C CE   . LYS A 1 36 ? -6.995  -12.190 11.659  1.00 0.00 ? 36 LYS A CE   6  
ATOM 7670  N NZ   . LYS A 1 36 ? -8.469  -12.265 11.836  1.00 0.00 ? 36 LYS A NZ   6  
ATOM 7671  H H    . LYS A 1 36 ? -5.911  -9.681  5.911   1.00 0.00 ? 36 LYS A H    6  
ATOM 7672  H HA   . LYS A 1 36 ? -8.380  -9.528  7.341   1.00 0.00 ? 36 LYS A HA   6  
ATOM 7673  H HB2  . LYS A 1 36 ? -6.867  -11.435 7.597   1.00 0.00 ? 36 LYS A HB2  6  
ATOM 7674  H HB3  . LYS A 1 36 ? -5.620  -10.379 8.242   1.00 0.00 ? 36 LYS A HB3  6  
ATOM 7675  H HG2  . LYS A 1 36 ? -6.983  -9.919  10.194  1.00 0.00 ? 36 LYS A HG2  6  
ATOM 7676  H HG3  . LYS A 1 36 ? -8.288  -10.908 9.536   1.00 0.00 ? 36 LYS A HG3  6  
ATOM 7677  H HD2  . LYS A 1 36 ? -6.918  -12.885 9.647   1.00 0.00 ? 36 LYS A HD2  6  
ATOM 7678  H HD3  . LYS A 1 36 ? -5.519  -11.933 10.144  1.00 0.00 ? 36 LYS A HD3  6  
ATOM 7679  H HE2  . LYS A 1 36 ? -6.552  -13.099 12.035  1.00 0.00 ? 36 LYS A HE2  6  
ATOM 7680  H HE3  . LYS A 1 36 ? -6.618  -11.349 12.223  1.00 0.00 ? 36 LYS A HE3  6  
ATOM 7681  H HZ1  . LYS A 1 36 ? -8.695  -12.699 12.757  1.00 0.00 ? 36 LYS A HZ1  6  
ATOM 7682  H HZ2  . LYS A 1 36 ? -8.897  -12.843 11.081  1.00 0.00 ? 36 LYS A HZ2  6  
ATOM 7683  H HZ3  . LYS A 1 36 ? -8.887  -11.309 11.809  1.00 0.00 ? 36 LYS A HZ3  6  
ATOM 7684  N N    . ARG A 1 37 ? -5.933  -7.468  8.110   1.00 0.00 ? 37 ARG A N    6  
ATOM 7685  C CA   . ARG A 1 37 ? -5.622  -6.213  8.790   1.00 0.00 ? 37 ARG A CA   6  
ATOM 7686  C C    . ARG A 1 37 ? -6.609  -5.139  8.358   1.00 0.00 ? 37 ARG A C    6  
ATOM 7687  O O    . ARG A 1 37 ? -7.258  -4.505  9.186   1.00 0.00 ? 37 ARG A O    6  
ATOM 7688  C CB   . ARG A 1 37 ? -4.214  -5.725  8.447   1.00 0.00 ? 37 ARG A CB   6  
ATOM 7689  C CG   . ARG A 1 37 ? -3.133  -6.789  8.465   1.00 0.00 ? 37 ARG A CG   6  
ATOM 7690  C CD   . ARG A 1 37 ? -1.781  -6.154  8.190   1.00 0.00 ? 37 ARG A CD   6  
ATOM 7691  N NE   . ARG A 1 37 ? -0.768  -7.113  7.757   1.00 0.00 ? 37 ARG A NE   6  
ATOM 7692  C CZ   . ARG A 1 37 ? 0.540   -6.915  7.916   1.00 0.00 ? 37 ARG A CZ   6  
ATOM 7693  N NH1  . ARG A 1 37 ? 0.964   -5.862  8.603   1.00 0.00 ? 37 ARG A NH1  6  
ATOM 7694  N NH2  . ARG A 1 37 ? 1.419   -7.762  7.395   1.00 0.00 ? 37 ARG A NH2  6  
ATOM 7695  H H    . ARG A 1 37 ? -5.254  -7.884  7.535   1.00 0.00 ? 37 ARG A H    6  
ATOM 7696  H HA   . ARG A 1 37 ? -5.704  -6.370  9.856   1.00 0.00 ? 37 ARG A HA   6  
ATOM 7697  H HB2  . ARG A 1 37 ? -4.234  -5.291  7.459   1.00 0.00 ? 37 ARG A HB2  6  
ATOM 7698  H HB3  . ARG A 1 37 ? -3.937  -4.957  9.155   1.00 0.00 ? 37 ARG A HB3  6  
ATOM 7699  H HG2  . ARG A 1 37 ? -3.116  -7.264  9.435   1.00 0.00 ? 37 ARG A HG2  6  
ATOM 7700  H HG3  . ARG A 1 37 ? -3.343  -7.523  7.700   1.00 0.00 ? 37 ARG A HG3  6  
ATOM 7701  H HD2  . ARG A 1 37 ? -1.903  -5.411  7.418   1.00 0.00 ? 37 ARG A HD2  6  
ATOM 7702  H HD3  . ARG A 1 37 ? -1.438  -5.673  9.096   1.00 0.00 ? 37 ARG A HD3  6  
ATOM 7703  H HE   . ARG A 1 37 ? -1.075  -7.917  7.283   1.00 0.00 ? 37 ARG A HE   6  
ATOM 7704  H HH11 . ARG A 1 37 ? 0.299   -5.217  9.006   1.00 0.00 ? 37 ARG A HH11 6  
ATOM 7705  H HH12 . ARG A 1 37 ? 1.949   -5.689  8.723   1.00 0.00 ? 37 ARG A HH12 6  
ATOM 7706  H HH21 . ARG A 1 37 ? 1.100   -8.567  6.861   1.00 0.00 ? 37 ARG A HH21 6  
ATOM 7707  H HH22 . ARG A 1 37 ? 2.398   -7.616  7.527   1.00 0.00 ? 37 ARG A HH22 6  
ATOM 7708  N N    . LEU A 1 38 ? -6.716  -4.968  7.044   1.00 0.00 ? 38 LEU A N    6  
ATOM 7709  C CA   . LEU A 1 38 ? -7.572  -3.946  6.449   1.00 0.00 ? 38 LEU A CA   6  
ATOM 7710  C C    . LEU A 1 38 ? -9.025  -4.115  6.876   1.00 0.00 ? 38 LEU A C    6  
ATOM 7711  O O    . LEU A 1 38 ? -9.703  -3.137  7.193   1.00 0.00 ? 38 LEU A O    6  
ATOM 7712  C CB   . LEU A 1 38 ? -7.461  -3.989  4.920   1.00 0.00 ? 38 LEU A CB   6  
ATOM 7713  C CG   . LEU A 1 38 ? -6.337  -3.140  4.309   1.00 0.00 ? 38 LEU A CG   6  
ATOM 7714  C CD1  . LEU A 1 38 ? -4.997  -3.429  4.967   1.00 0.00 ? 38 LEU A CD1  6  
ATOM 7715  C CD2  . LEU A 1 38 ? -6.254  -3.383  2.810   1.00 0.00 ? 38 LEU A CD2  6  
ATOM 7716  H H    . LEU A 1 38 ? -6.197  -5.554  6.450   1.00 0.00 ? 38 LEU A H    6  
ATOM 7717  H HA   . LEU A 1 38 ? -7.221  -2.984  6.795   1.00 0.00 ? 38 LEU A HA   6  
ATOM 7718  H HB2  . LEU A 1 38 ? -7.305  -5.016  4.621   1.00 0.00 ? 38 LEU A HB2  6  
ATOM 7719  H HB3  . LEU A 1 38 ? -8.399  -3.651  4.505   1.00 0.00 ? 38 LEU A HB3  6  
ATOM 7720  H HG   . LEU A 1 38 ? -6.565  -2.095  4.466   1.00 0.00 ? 38 LEU A HG   6  
ATOM 7721  H HD11 . LEU A 1 38 ? -4.228  -2.831  4.497   1.00 0.00 ? 38 LEU A HD11 6  
ATOM 7722  H HD12 . LEU A 1 38 ? -4.759  -4.476  4.854   1.00 0.00 ? 38 LEU A HD12 6  
ATOM 7723  H HD13 . LEU A 1 38 ? -5.051  -3.183  6.017   1.00 0.00 ? 38 LEU A HD13 6  
ATOM 7724  H HD21 . LEU A 1 38 ? -6.025  -4.422  2.627   1.00 0.00 ? 38 LEU A HD21 6  
ATOM 7725  H HD22 . LEU A 1 38 ? -5.476  -2.763  2.389   1.00 0.00 ? 38 LEU A HD22 6  
ATOM 7726  H HD23 . LEU A 1 38 ? -7.199  -3.135  2.352   1.00 0.00 ? 38 LEU A HD23 6  
ATOM 7727  N N    . GLY A 1 39 ? -9.492  -5.358  6.892   1.00 0.00 ? 39 GLY A N    6  
ATOM 7728  C CA   . GLY A 1 39 ? -10.840 -5.635  7.340   1.00 0.00 ? 39 GLY A CA   6  
ATOM 7729  C C    . GLY A 1 39 ? -11.066 -5.174  8.764   1.00 0.00 ? 39 GLY A C    6  
ATOM 7730  O O    . GLY A 1 39 ? -12.067 -4.523  9.061   1.00 0.00 ? 39 GLY A O    6  
ATOM 7731  H H    . GLY A 1 39 ? -8.916  -6.092  6.591   1.00 0.00 ? 39 GLY A H    6  
ATOM 7732  H HA2  . GLY A 1 39 ? -11.537 -5.127  6.690   1.00 0.00 ? 39 GLY A HA2  6  
ATOM 7733  H HA3  . GLY A 1 39 ? -11.018 -6.699  7.284   1.00 0.00 ? 39 GLY A HA3  6  
ATOM 7734  N N    . ALA A 1 40 ? -10.117 -5.487  9.639   1.00 0.00 ? 40 ALA A N    6  
ATOM 7735  C CA   . ALA A 1 40 ? -10.212 -5.113  11.044  1.00 0.00 ? 40 ALA A CA   6  
ATOM 7736  C C    . ALA A 1 40 ? -10.073 -3.604  11.228  1.00 0.00 ? 40 ALA A C    6  
ATOM 7737  O O    . ALA A 1 40 ? -10.685 -3.022  12.124  1.00 0.00 ? 40 ALA A O    6  
ATOM 7738  C CB   . ALA A 1 40 ? -9.159  -5.847  11.861  1.00 0.00 ? 40 ALA A CB   6  
ATOM 7739  H H    . ALA A 1 40 ? -9.328  -5.985  9.330   1.00 0.00 ? 40 ALA A H    6  
ATOM 7740  H HA   . ALA A 1 40 ? -11.185 -5.418  11.402  1.00 0.00 ? 40 ALA A HA   6  
ATOM 7741  H HB1  . ALA A 1 40 ? -9.243  -6.910  11.684  1.00 0.00 ? 40 ALA A HB1  6  
ATOM 7742  H HB2  . ALA A 1 40 ? -9.310  -5.645  12.911  1.00 0.00 ? 40 ALA A HB2  6  
ATOM 7743  H HB3  . ALA A 1 40 ? -8.174  -5.510  11.570  1.00 0.00 ? 40 ALA A HB3  6  
ATOM 7744  N N    . GLU A 1 41 ? -9.275  -2.972  10.376  1.00 0.00 ? 41 GLU A N    6  
ATOM 7745  C CA   . GLU A 1 41 ? -9.084  -1.527  10.444  1.00 0.00 ? 41 GLU A CA   6  
ATOM 7746  C C    . GLU A 1 41 ? -10.356 -0.802  10.030  1.00 0.00 ? 41 GLU A C    6  
ATOM 7747  O O    . GLU A 1 41 ? -10.738 0.189   10.646  1.00 0.00 ? 41 GLU A O    6  
ATOM 7748  C CB   . GLU A 1 41 ? -7.913  -1.085  9.565   1.00 0.00 ? 41 GLU A CB   6  
ATOM 7749  C CG   . GLU A 1 41 ? -6.560  -1.585  10.047  1.00 0.00 ? 41 GLU A CG   6  
ATOM 7750  C CD   . GLU A 1 41 ? -6.243  -1.143  11.462  1.00 0.00 ? 41 GLU A CD   6  
ATOM 7751  O OE1  . GLU A 1 41 ? -6.596  -1.879  12.412  1.00 0.00 ? 41 GLU A OE1  6  
ATOM 7752  O OE2  . GLU A 1 41 ? -5.635  -0.066  11.632  1.00 0.00 ? 41 GLU A OE2  6  
ATOM 7753  H H    . GLU A 1 41 ? -8.799  -3.491  9.688   1.00 0.00 ? 41 GLU A H    6  
ATOM 7754  H HA   . GLU A 1 41 ? -8.865  -1.276  11.471  1.00 0.00 ? 41 GLU A HA   6  
ATOM 7755  H HB2  . GLU A 1 41 ? -8.071  -1.457  8.564   1.00 0.00 ? 41 GLU A HB2  6  
ATOM 7756  H HB3  . GLU A 1 41 ? -7.884  -0.006  9.539   1.00 0.00 ? 41 GLU A HB3  6  
ATOM 7757  H HG2  . GLU A 1 41 ? -6.556  -2.665  10.016  1.00 0.00 ? 41 GLU A HG2  6  
ATOM 7758  H HG3  . GLU A 1 41 ? -5.793  -1.206  9.387   1.00 0.00 ? 41 GLU A HG3  6  
ATOM 7759  N N    . TRP A 1 42 ? -11.016 -1.314  8.998   1.00 0.00 ? 42 TRP A N    6  
ATOM 7760  C CA   . TRP A 1 42 ? -12.271 -0.739  8.528   1.00 0.00 ? 42 TRP A CA   6  
ATOM 7761  C C    . TRP A 1 42 ? -13.349 -0.831  9.604   1.00 0.00 ? 42 TRP A C    6  
ATOM 7762  O O    . TRP A 1 42 ? -14.159 0.084   9.764   1.00 0.00 ? 42 TRP A O    6  
ATOM 7763  C CB   . TRP A 1 42 ? -12.725 -1.427  7.239   1.00 0.00 ? 42 TRP A CB   6  
ATOM 7764  C CG   . TRP A 1 42 ? -14.031 -0.906  6.731   1.00 0.00 ? 42 TRP A CG   6  
ATOM 7765  C CD1  . TRP A 1 42 ? -15.254 -1.260  7.184   1.00 0.00 ? 42 TRP A CD1  6  
ATOM 7766  C CD2  . TRP A 1 42 ? -14.247 0.061   5.698   1.00 0.00 ? 42 TRP A CD2  6  
ATOM 7767  N NE1  . TRP A 1 42 ? -16.233 -0.589  6.500   1.00 0.00 ? 42 TRP A NE1  6  
ATOM 7768  C CE2  . TRP A 1 42 ? -15.641 0.229   5.575   1.00 0.00 ? 42 TRP A CE2  6  
ATOM 7769  C CE3  . TRP A 1 42 ? -13.406 0.796   4.862   1.00 0.00 ? 42 TRP A CE3  6  
ATOM 7770  C CZ2  . TRP A 1 42 ? -16.208 1.103   4.653   1.00 0.00 ? 42 TRP A CZ2  6  
ATOM 7771  C CZ3  . TRP A 1 42 ? -13.969 1.663   3.947   1.00 0.00 ? 42 TRP A CZ3  6  
ATOM 7772  C CH2  . TRP A 1 42 ? -15.359 1.810   3.848   1.00 0.00 ? 42 TRP A CH2  6  
ATOM 7773  H H    . TRP A 1 42 ? -10.644 -2.098  8.534   1.00 0.00 ? 42 TRP A H    6  
ATOM 7774  H HA   . TRP A 1 42 ? -12.107 0.297   8.316   1.00 0.00 ? 42 TRP A HA   6  
ATOM 7775  H HB2  . TRP A 1 42 ? -11.981 -1.271  6.472   1.00 0.00 ? 42 TRP A HB2  6  
ATOM 7776  H HB3  . TRP A 1 42 ? -12.835 -2.484  7.423   1.00 0.00 ? 42 TRP A HB3  6  
ATOM 7777  H HD1  . TRP A 1 42 ? -15.407 -1.965  7.980   1.00 0.00 ? 42 TRP A HD1  6  
ATOM 7778  H HE1  . TRP A 1 42 ? -17.205 -0.686  6.649   1.00 0.00 ? 42 TRP A HE1  6  
ATOM 7779  H HE3  . TRP A 1 42 ? -12.333 0.697   4.923   1.00 0.00 ? 42 TRP A HE3  6  
ATOM 7780  H HZ2  . TRP A 1 42 ? -17.276 1.226   4.564   1.00 0.00 ? 42 TRP A HZ2  6  
ATOM 7781  H HZ3  . TRP A 1 42 ? -13.332 2.241   3.292   1.00 0.00 ? 42 TRP A HZ3  6  
ATOM 7782  H HH2  . TRP A 1 42 ? -15.754 2.499   3.116   1.00 0.00 ? 42 TRP A HH2  6  
ATOM 7783  N N    . LYS A 1 43 ? -13.346 -1.924  10.356  1.00 0.00 ? 43 LYS A N    6  
ATOM 7784  C CA   . LYS A 1 43 ? -14.335 -2.129  11.407  1.00 0.00 ? 43 LYS A CA   6  
ATOM 7785  C C    . LYS A 1 43 ? -14.227 -1.050  12.487  1.00 0.00 ? 43 LYS A C    6  
ATOM 7786  O O    . LYS A 1 43 ? -15.199 -0.747  13.174  1.00 0.00 ? 43 LYS A O    6  
ATOM 7787  C CB   . LYS A 1 43 ? -14.174 -3.510  12.022  1.00 0.00 ? 43 LYS A CB   6  
ATOM 7788  C CG   . LYS A 1 43 ? -14.329 -4.627  11.010  1.00 0.00 ? 43 LYS A CG   6  
ATOM 7789  C CD   . LYS A 1 43 ? -14.166 -5.970  11.673  1.00 0.00 ? 43 LYS A CD   6  
ATOM 7790  C CE   . LYS A 1 43 ? -13.863 -7.073  10.668  1.00 0.00 ? 43 LYS A CE   6  
ATOM 7791  N NZ   . LYS A 1 43 ? -14.897 -7.176  9.603   1.00 0.00 ? 43 LYS A NZ   6  
ATOM 7792  H H    . LYS A 1 43 ? -12.662 -2.612  10.199  1.00 0.00 ? 43 LYS A H    6  
ATOM 7793  H HA   . LYS A 1 43 ? -15.308 -2.075  10.954  1.00 0.00 ? 43 LYS A HA   6  
ATOM 7794  H HB2  . LYS A 1 43 ? -13.191 -3.582  12.465  1.00 0.00 ? 43 LYS A HB2  6  
ATOM 7795  H HB3  . LYS A 1 43 ? -14.920 -3.642  12.792  1.00 0.00 ? 43 LYS A HB3  6  
ATOM 7796  H HG2  . LYS A 1 43 ? -15.312 -4.569  10.566  1.00 0.00 ? 43 LYS A HG2  6  
ATOM 7797  H HG3  . LYS A 1 43 ? -13.575 -4.516  10.245  1.00 0.00 ? 43 LYS A HG3  6  
ATOM 7798  H HD2  . LYS A 1 43 ? -13.357 -5.897  12.377  1.00 0.00 ? 43 LYS A HD2  6  
ATOM 7799  H HD3  . LYS A 1 43 ? -15.079 -6.212  12.196  1.00 0.00 ? 43 LYS A HD3  6  
ATOM 7800  H HE2  . LYS A 1 43 ? -12.908 -6.866  10.206  1.00 0.00 ? 43 LYS A HE2  6  
ATOM 7801  H HE3  . LYS A 1 43 ? -13.805 -8.015  11.194  1.00 0.00 ? 43 LYS A HE3  6  
ATOM 7802  H HZ1  . LYS A 1 43 ? -14.813 -8.093  9.108   1.00 0.00 ? 43 LYS A HZ1  6  
ATOM 7803  H HZ2  . LYS A 1 43 ? -14.777 -6.409  8.907   1.00 0.00 ? 43 LYS A HZ2  6  
ATOM 7804  H HZ3  . LYS A 1 43 ? -15.851 -7.105  10.017  1.00 0.00 ? 43 LYS A HZ3  6  
ATOM 7805  N N    . LEU A 1 44 ? -13.037 -0.479  12.630  1.00 0.00 ? 44 LEU A N    6  
ATOM 7806  C CA   . LEU A 1 44 ? -12.801 0.588   13.598  1.00 0.00 ? 44 LEU A CA   6  
ATOM 7807  C C    . LEU A 1 44 ? -12.371 1.870   12.889  1.00 0.00 ? 44 LEU A C    6  
ATOM 7808  O O    . LEU A 1 44 ? -11.675 2.705   13.465  1.00 0.00 ? 44 LEU A O    6  
ATOM 7809  C CB   . LEU A 1 44 ? -11.727 0.176   14.618  1.00 0.00 ? 44 LEU A CB   6  
ATOM 7810  C CG   . LEU A 1 44 ? -12.145 -0.872  15.658  1.00 0.00 ? 44 LEU A CG   6  
ATOM 7811  C CD1  . LEU A 1 44 ? -12.229 -2.260  15.040  1.00 0.00 ? 44 LEU A CD1  6  
ATOM 7812  C CD2  . LEU A 1 44 ? -11.169 -0.870  16.823  1.00 0.00 ? 44 LEU A CD2  6  
ATOM 7813  H H    . LEU A 1 44 ? -12.291 -0.776  12.061  1.00 0.00 ? 44 LEU A H    6  
ATOM 7814  H HA   . LEU A 1 44 ? -13.729 0.774   14.119  1.00 0.00 ? 44 LEU A HA   6  
ATOM 7815  H HB2  . LEU A 1 44 ? -10.881 -0.214  14.073  1.00 0.00 ? 44 LEU A HB2  6  
ATOM 7816  H HB3  . LEU A 1 44 ? -11.409 1.064   15.147  1.00 0.00 ? 44 LEU A HB3  6  
ATOM 7817  H HG   . LEU A 1 44 ? -13.123 -0.619  16.041  1.00 0.00 ? 44 LEU A HG   6  
ATOM 7818  H HD11 . LEU A 1 44 ? -11.276 -2.518  14.603  1.00 0.00 ? 44 LEU A HD11 6  
ATOM 7819  H HD12 . LEU A 1 44 ? -12.991 -2.268  14.274  1.00 0.00 ? 44 LEU A HD12 6  
ATOM 7820  H HD13 . LEU A 1 44 ? -12.480 -2.980  15.806  1.00 0.00 ? 44 LEU A HD13 6  
ATOM 7821  H HD21 . LEU A 1 44 ? -11.492 -1.587  17.565  1.00 0.00 ? 44 LEU A HD21 6  
ATOM 7822  H HD22 . LEU A 1 44 ? -11.137 0.115   17.264  1.00 0.00 ? 44 LEU A HD22 6  
ATOM 7823  H HD23 . LEU A 1 44 ? -10.184 -1.137  16.469  1.00 0.00 ? 44 LEU A HD23 6  
ATOM 7824  N N    . LEU A 1 45 ? -12.804 2.034   11.646  1.00 0.00 ? 45 LEU A N    6  
ATOM 7825  C CA   . LEU A 1 45 ? -12.348 3.143   10.812  1.00 0.00 ? 45 LEU A CA   6  
ATOM 7826  C C    . LEU A 1 45 ? -13.025 4.463   11.168  1.00 0.00 ? 45 LEU A C    6  
ATOM 7827  O O    . LEU A 1 45 ? -14.245 4.598   11.063  1.00 0.00 ? 45 LEU A O    6  
ATOM 7828  C CB   . LEU A 1 45 ? -12.603 2.838   9.334   1.00 0.00 ? 45 LEU A CB   6  
ATOM 7829  C CG   . LEU A 1 45 ? -12.101 3.899   8.353   1.00 0.00 ? 45 LEU A CG   6  
ATOM 7830  C CD1  . LEU A 1 45 ? -10.581 3.945   8.352   1.00 0.00 ? 45 LEU A CD1  6  
ATOM 7831  C CD2  . LEU A 1 45 ? -12.642 3.626   6.958   1.00 0.00 ? 45 LEU A CD2  6  
ATOM 7832  H H    . LEU A 1 45 ? -13.445 1.390   11.275  1.00 0.00 ? 45 LEU A H    6  
ATOM 7833  H HA   . LEU A 1 45 ? -11.285 3.250   10.961  1.00 0.00 ? 45 LEU A HA   6  
ATOM 7834  H HB2  . LEU A 1 45 ? -12.121 1.903   9.098   1.00 0.00 ? 45 LEU A HB2  6  
ATOM 7835  H HB3  . LEU A 1 45 ? -13.668 2.722   9.190   1.00 0.00 ? 45 LEU A HB3  6  
ATOM 7836  H HG   . LEU A 1 45 ? -12.461 4.868   8.665   1.00 0.00 ? 45 LEU A HG   6  
ATOM 7837  H HD11 . LEU A 1 45 ? -10.228 4.192   9.343   1.00 0.00 ? 45 LEU A HD11 6  
ATOM 7838  H HD12 . LEU A 1 45 ? -10.242 4.694   7.652   1.00 0.00 ? 45 LEU A HD12 6  
ATOM 7839  H HD13 . LEU A 1 45 ? -10.190 2.980   8.063   1.00 0.00 ? 45 LEU A HD13 6  
ATOM 7840  H HD21 . LEU A 1 45 ? -13.722 3.651   6.982   1.00 0.00 ? 45 LEU A HD21 6  
ATOM 7841  H HD22 . LEU A 1 45 ? -12.312 2.654   6.628   1.00 0.00 ? 45 LEU A HD22 6  
ATOM 7842  H HD23 . LEU A 1 45 ? -12.279 4.381   6.273   1.00 0.00 ? 45 LEU A HD23 6  
ATOM 7843  N N    . SER A 1 46 ? -12.225 5.419   11.621  1.00 0.00 ? 46 SER A N    6  
ATOM 7844  C CA   . SER A 1 46 ? -12.665 6.800   11.731  1.00 0.00 ? 46 SER A CA   6  
ATOM 7845  C C    . SER A 1 46 ? -12.290 7.566   10.455  1.00 0.00 ? 46 SER A C    6  
ATOM 7846  O O    . SER A 1 46 ? -11.500 7.078   9.645   1.00 0.00 ? 46 SER A O    6  
ATOM 7847  C CB   . SER A 1 46 ? -12.040 7.466   12.958  1.00 0.00 ? 46 SER A CB   6  
ATOM 7848  O OG   . SER A 1 46 ? -12.453 6.834   14.159  1.00 0.00 ? 46 SER A OG   6  
ATOM 7849  H H    . SER A 1 46 ? -11.311 5.188   11.888  1.00 0.00 ? 46 SER A H    6  
ATOM 7850  H HA   . SER A 1 46 ? -13.741 6.800   11.836  1.00 0.00 ? 46 SER A HA   6  
ATOM 7851  H HB2  . SER A 1 46 ? -10.965 7.405   12.886  1.00 0.00 ? 46 SER A HB2  6  
ATOM 7852  H HB3  . SER A 1 46 ? -12.340 8.502   12.990  1.00 0.00 ? 46 SER A HB3  6  
ATOM 7853  H HG   . SER A 1 46 ? -12.688 5.910   13.981  1.00 0.00 ? 46 SER A HG   6  
ATOM 7854  N N    . GLU A 1 47 ? -12.832 8.771   10.293  1.00 0.00 ? 47 GLU A N    6  
ATOM 7855  C CA   . GLU A 1 47 ? -12.581 9.583   9.097   1.00 0.00 ? 47 GLU A CA   6  
ATOM 7856  C C    . GLU A 1 47 ? -11.118 10.013  9.019   1.00 0.00 ? 47 GLU A C    6  
ATOM 7857  O O    . GLU A 1 47 ? -10.577 10.205  7.928   1.00 0.00 ? 47 GLU A O    6  
ATOM 7858  C CB   . GLU A 1 47 ? -13.475 10.826  9.092   1.00 0.00 ? 47 GLU A CB   6  
ATOM 7859  C CG   . GLU A 1 47 ? -14.964 10.519  9.136   1.00 0.00 ? 47 GLU A CG   6  
ATOM 7860  C CD   . GLU A 1 47 ? -15.451 9.783   7.906   1.00 0.00 ? 47 GLU A CD   6  
ATOM 7861  O OE1  . GLU A 1 47 ? -15.623 10.425  6.846   1.00 0.00 ? 47 GLU A OE1  6  
ATOM 7862  O OE2  . GLU A 1 47 ? -15.678 8.561   7.990   1.00 0.00 ? 47 GLU A OE2  6  
ATOM 7863  H H    . GLU A 1 47 ? -13.413 9.132   10.998  1.00 0.00 ? 47 GLU A H    6  
ATOM 7864  H HA   . GLU A 1 47 ? -12.808 8.978   8.230   1.00 0.00 ? 47 GLU A HA   6  
ATOM 7865  H HB2  . GLU A 1 47 ? -13.229 11.434  9.951   1.00 0.00 ? 47 GLU A HB2  6  
ATOM 7866  H HB3  . GLU A 1 47 ? -13.274 11.393  8.194   1.00 0.00 ? 47 GLU A HB3  6  
ATOM 7867  H HG2  . GLU A 1 47 ? -15.164 9.909   10.004  1.00 0.00 ? 47 GLU A HG2  6  
ATOM 7868  H HG3  . GLU A 1 47 ? -15.507 11.451  9.220   1.00 0.00 ? 47 GLU A HG3  6  
ATOM 7869  N N    . THR A 1 48 ? -10.488 10.173  10.176  1.00 0.00 ? 48 THR A N    6  
ATOM 7870  C CA   . THR A 1 48 ? -9.070  10.498  10.238  1.00 0.00 ? 48 THR A CA   6  
ATOM 7871  C C    . THR A 1 48 ? -8.242  9.449   9.501   1.00 0.00 ? 48 THR A C    6  
ATOM 7872  O O    . THR A 1 48 ? -7.323  9.777   8.751   1.00 0.00 ? 48 THR A O    6  
ATOM 7873  C CB   . THR A 1 48 ? -8.582  10.627  11.703  1.00 0.00 ? 48 THR A CB   6  
ATOM 7874  O OG1  . THR A 1 48 ? -7.149  10.655  11.759  1.00 0.00 ? 48 THR A OG1  6  
ATOM 7875  C CG2  . THR A 1 48 ? -9.104  9.486   12.564  1.00 0.00 ? 48 THR A CG2  6  
ATOM 7876  H H    . THR A 1 48 ? -10.998 10.085  11.015  1.00 0.00 ? 48 THR A H    6  
ATOM 7877  H HA   . THR A 1 48 ? -8.930  11.453  9.751   1.00 0.00 ? 48 THR A HA   6  
ATOM 7878  H HB   . THR A 1 48 ? -8.961  11.556  12.105  1.00 0.00 ? 48 THR A HB   6  
ATOM 7879  H HG1  . THR A 1 48 ? -6.811  9.740   11.774  1.00 0.00 ? 48 THR A HG1  6  
ATOM 7880  H HG21 . THR A 1 48 ? -8.720  8.549   12.190  1.00 0.00 ? 48 THR A HG21 6  
ATOM 7881  H HG22 . THR A 1 48 ? -10.183 9.472   12.528  1.00 0.00 ? 48 THR A HG22 6  
ATOM 7882  H HG23 . THR A 1 48 ? -8.778  9.627   13.585  1.00 0.00 ? 48 THR A HG23 6  
ATOM 7883  N N    . GLU A 1 49 ? -8.606  8.188   9.682   1.00 0.00 ? 49 GLU A N    6  
ATOM 7884  C CA   . GLU A 1 49 ? -7.870  7.087   9.085   1.00 0.00 ? 49 GLU A CA   6  
ATOM 7885  C C    . GLU A 1 49 ? -8.362  6.821   7.669   1.00 0.00 ? 49 GLU A C    6  
ATOM 7886  O O    . GLU A 1 49 ? -7.752  6.065   6.920   1.00 0.00 ? 49 GLU A O    6  
ATOM 7887  C CB   . GLU A 1 49 ? -7.976  5.834   9.953   1.00 0.00 ? 49 GLU A CB   6  
ATOM 7888  C CG   . GLU A 1 49 ? -7.501  6.059   11.381  1.00 0.00 ? 49 GLU A CG   6  
ATOM 7889  C CD   . GLU A 1 49 ? -6.170  6.790   11.443  1.00 0.00 ? 49 GLU A CD   6  
ATOM 7890  O OE1  . GLU A 1 49 ? -5.123  6.162   11.187  1.00 0.00 ? 49 GLU A OE1  6  
ATOM 7891  O OE2  . GLU A 1 49 ? -6.165  8.007   11.734  1.00 0.00 ? 49 GLU A OE2  6  
ATOM 7892  H H    . GLU A 1 49 ? -9.398  7.992   10.226  1.00 0.00 ? 49 GLU A H    6  
ATOM 7893  H HA   . GLU A 1 49 ? -6.832  7.383   9.032   1.00 0.00 ? 49 GLU A HA   6  
ATOM 7894  H HB2  . GLU A 1 49 ? -9.009  5.512   9.981   1.00 0.00 ? 49 GLU A HB2  6  
ATOM 7895  H HB3  . GLU A 1 49 ? -7.375  5.050   9.514   1.00 0.00 ? 49 GLU A HB3  6  
ATOM 7896  H HG2  . GLU A 1 49 ? -8.240  6.644   11.906  1.00 0.00 ? 49 GLU A HG2  6  
ATOM 7897  H HG3  . GLU A 1 49 ? -7.391  5.101   11.866  1.00 0.00 ? 49 GLU A HG3  6  
ATOM 7898  N N    . LYS A 1 50 ? -9.489  7.435   7.320   1.00 0.00 ? 50 LYS A N    6  
ATOM 7899  C CA   . LYS A 1 50 ? -10.024 7.354   5.967   1.00 0.00 ? 50 LYS A CA   6  
ATOM 7900  C C    . LYS A 1 50 ? -9.127  8.120   4.981   1.00 0.00 ? 50 LYS A C    6  
ATOM 7901  O O    . LYS A 1 50 ? -9.253  7.980   3.767   1.00 0.00 ? 50 LYS A O    6  
ATOM 7902  C CB   . LYS A 1 50 ? -11.457 7.899   5.915   1.00 0.00 ? 50 LYS A CB   6  
ATOM 7903  C CG   . LYS A 1 50 ? -12.107 7.780   4.542   1.00 0.00 ? 50 LYS A CG   6  
ATOM 7904  C CD   . LYS A 1 50 ? -13.518 8.344   4.530   1.00 0.00 ? 50 LYS A CD   6  
ATOM 7905  C CE   . LYS A 1 50 ? -14.502 7.419   5.229   1.00 0.00 ? 50 LYS A CE   6  
ATOM 7906  N NZ   . LYS A 1 50 ? -15.857 8.019   5.306   1.00 0.00 ? 50 LYS A NZ   6  
ATOM 7907  H H    . LYS A 1 50 ? -9.974  7.958   7.993   1.00 0.00 ? 50 LYS A H    6  
ATOM 7908  H HA   . LYS A 1 50 ? -10.042 6.316   5.686   1.00 0.00 ? 50 LYS A HA   6  
ATOM 7909  H HB2  . LYS A 1 50 ? -12.061 7.355   6.623   1.00 0.00 ? 50 LYS A HB2  6  
ATOM 7910  H HB3  . LYS A 1 50 ? -11.442 8.943   6.193   1.00 0.00 ? 50 LYS A HB3  6  
ATOM 7911  H HG2  . LYS A 1 50 ? -11.510 8.321   3.825   1.00 0.00 ? 50 LYS A HG2  6  
ATOM 7912  H HG3  . LYS A 1 50 ? -12.145 6.736   4.267   1.00 0.00 ? 50 LYS A HG3  6  
ATOM 7913  H HD2  . LYS A 1 50 ? -13.517 9.299   5.036   1.00 0.00 ? 50 LYS A HD2  6  
ATOM 7914  H HD3  . LYS A 1 50 ? -13.831 8.479   3.504   1.00 0.00 ? 50 LYS A HD3  6  
ATOM 7915  H HE2  . LYS A 1 50 ? -14.560 6.492   4.677   1.00 0.00 ? 50 LYS A HE2  6  
ATOM 7916  H HE3  . LYS A 1 50 ? -14.145 7.220   6.229   1.00 0.00 ? 50 LYS A HE3  6  
ATOM 7917  H HZ1  . LYS A 1 50 ? -16.149 8.370   4.369   1.00 0.00 ? 50 LYS A HZ1  6  
ATOM 7918  H HZ2  . LYS A 1 50 ? -15.855 8.818   5.979   1.00 0.00 ? 50 LYS A HZ2  6  
ATOM 7919  H HZ3  . LYS A 1 50 ? -16.550 7.309   5.629   1.00 0.00 ? 50 LYS A HZ3  6  
ATOM 7920  N N    . ARG A 1 51 ? -8.219  8.930   5.516   1.00 0.00 ? 51 ARG A N    6  
ATOM 7921  C CA   . ARG A 1 51 ? -7.352  9.789   4.702   1.00 0.00 ? 51 ARG A CA   6  
ATOM 7922  C C    . ARG A 1 51 ? -6.573  9.013   3.623   1.00 0.00 ? 51 ARG A C    6  
ATOM 7923  O O    . ARG A 1 51 ? -6.648  9.372   2.446   1.00 0.00 ? 51 ARG A O    6  
ATOM 7924  C CB   . ARG A 1 51 ? -6.385  10.559  5.605   1.00 0.00 ? 51 ARG A CB   6  
ATOM 7925  C CG   . ARG A 1 51 ? -5.747  11.771  4.947   1.00 0.00 ? 51 ARG A CG   6  
ATOM 7926  C CD   . ARG A 1 51 ? -6.798  12.807  4.584   1.00 0.00 ? 51 ARG A CD   6  
ATOM 7927  N NE   . ARG A 1 51 ? -6.210  14.110  4.288   1.00 0.00 ? 51 ARG A NE   6  
ATOM 7928  C CZ   . ARG A 1 51 ? -6.603  15.246  4.863   1.00 0.00 ? 51 ARG A CZ   6  
ATOM 7929  N NH1  . ARG A 1 51 ? -7.598  15.237  5.742   1.00 0.00 ? 51 ARG A NH1  6  
ATOM 7930  N NH2  . ARG A 1 51 ? -6.000  16.390  4.557   1.00 0.00 ? 51 ARG A NH2  6  
ATOM 7931  H H    . ARG A 1 51 ? -8.126  8.954   6.490   1.00 0.00 ? 51 ARG A H    6  
ATOM 7932  H HA   . ARG A 1 51 ? -7.990  10.498  4.199   1.00 0.00 ? 51 ARG A HA   6  
ATOM 7933  H HB2  . ARG A 1 51 ? -6.921  10.894  6.482   1.00 0.00 ? 51 ARG A HB2  6  
ATOM 7934  H HB3  . ARG A 1 51 ? -5.596  9.889   5.916   1.00 0.00 ? 51 ARG A HB3  6  
ATOM 7935  H HG2  . ARG A 1 51 ? -5.039  12.214  5.633   1.00 0.00 ? 51 ARG A HG2  6  
ATOM 7936  H HG3  . ARG A 1 51 ? -5.237  11.456  4.050   1.00 0.00 ? 51 ARG A HG3  6  
ATOM 7937  H HD2  . ARG A 1 51 ? -7.338  12.461  3.716   1.00 0.00 ? 51 ARG A HD2  6  
ATOM 7938  H HD3  . ARG A 1 51 ? -7.483  12.910  5.414   1.00 0.00 ? 51 ARG A HD3  6  
ATOM 7939  H HE   . ARG A 1 51 ? -5.476  14.137  3.623   1.00 0.00 ? 51 ARG A HE   6  
ATOM 7940  H HH11 . ARG A 1 51 ? -8.058  14.377  5.975   1.00 0.00 ? 51 ARG A HH11 6  
ATOM 7941  H HH12 . ARG A 1 51 ? -7.891  16.096  6.188   1.00 0.00 ? 51 ARG A HH12 6  
ATOM 7942  H HH21 . ARG A 1 51 ? -5.240  16.402  3.894   1.00 0.00 ? 51 ARG A HH21 6  
ATOM 7943  H HH22 . ARG A 1 51 ? -6.303  17.254  4.982   1.00 0.00 ? 51 ARG A HH22 6  
ATOM 7944  N N    . PRO A 1 52 ? -5.808  7.952   3.979   1.00 0.00 ? 52 PRO A N    6  
ATOM 7945  C CA   . PRO A 1 52 ? -5.026  7.193   2.994   1.00 0.00 ? 52 PRO A CA   6  
ATOM 7946  C C    . PRO A 1 52 ? -5.886  6.534   1.923   1.00 0.00 ? 52 PRO A C    6  
ATOM 7947  O O    . PRO A 1 52 ? -5.400  6.224   0.838   1.00 0.00 ? 52 PRO A O    6  
ATOM 7948  C CB   . PRO A 1 52 ? -4.290  6.137   3.826   1.00 0.00 ? 52 PRO A CB   6  
ATOM 7949  C CG   . PRO A 1 52 ? -5.042  6.061   5.107   1.00 0.00 ? 52 PRO A CG   6  
ATOM 7950  C CD   . PRO A 1 52 ? -5.598  7.436   5.341   1.00 0.00 ? 52 PRO A CD   6  
ATOM 7951  H HA   . PRO A 1 52 ? -4.311  7.833   2.506   1.00 0.00 ? 52 PRO A HA   6  
ATOM 7952  H HB2  . PRO A 1 52 ? -4.302  5.191   3.305   1.00 0.00 ? 52 PRO A HB2  6  
ATOM 7953  H HB3  . PRO A 1 52 ? -3.269  6.451   3.989   1.00 0.00 ? 52 PRO A HB3  6  
ATOM 7954  H HG2  . PRO A 1 52 ? -5.843  5.342   5.021   1.00 0.00 ? 52 PRO A HG2  6  
ATOM 7955  H HG3  . PRO A 1 52 ? -4.373  5.786   5.910   1.00 0.00 ? 52 PRO A HG3  6  
ATOM 7956  H HD2  . PRO A 1 52 ? -6.532  7.379   5.881   1.00 0.00 ? 52 PRO A HD2  6  
ATOM 7957  H HD3  . PRO A 1 52 ? -4.887  8.045   5.877   1.00 0.00 ? 52 PRO A HD3  6  
ATOM 7958  N N    . PHE A 1 53 ? -7.164  6.337   2.216   1.00 0.00 ? 53 PHE A N    6  
ATOM 7959  C CA   . PHE A 1 53 ? -8.095  5.842   1.211   1.00 0.00 ? 53 PHE A CA   6  
ATOM 7960  C C    . PHE A 1 53 ? -8.125  6.807   0.039   1.00 0.00 ? 53 PHE A C    6  
ATOM 7961  O O    . PHE A 1 53 ? -8.269  6.410   -1.114  1.00 0.00 ? 53 PHE A O    6  
ATOM 7962  C CB   . PHE A 1 53 ? -9.508  5.711   1.780   1.00 0.00 ? 53 PHE A CB   6  
ATOM 7963  C CG   . PHE A 1 53 ? -9.685  4.623   2.798   1.00 0.00 ? 53 PHE A CG   6  
ATOM 7964  C CD1  . PHE A 1 53 ? -9.203  4.763   4.089   1.00 0.00 ? 53 PHE A CD1  6  
ATOM 7965  C CD2  . PHE A 1 53 ? -10.365 3.466   2.466   1.00 0.00 ? 53 PHE A CD2  6  
ATOM 7966  C CE1  . PHE A 1 53 ? -9.397  3.771   5.028   1.00 0.00 ? 53 PHE A CE1  6  
ATOM 7967  C CE2  . PHE A 1 53 ? -10.561 2.468   3.400   1.00 0.00 ? 53 PHE A CE2  6  
ATOM 7968  C CZ   . PHE A 1 53 ? -10.077 2.620   4.683   1.00 0.00 ? 53 PHE A CZ   6  
ATOM 7969  H H    . PHE A 1 53 ? -7.490  6.541   3.118   1.00 0.00 ? 53 PHE A H    6  
ATOM 7970  H HA   . PHE A 1 53 ? -7.749  4.877   0.873   1.00 0.00 ? 53 PHE A HA   6  
ATOM 7971  H HB2  . PHE A 1 53 ? -9.780  6.643   2.250   1.00 0.00 ? 53 PHE A HB2  6  
ATOM 7972  H HB3  . PHE A 1 53 ? -10.191 5.517   0.965   1.00 0.00 ? 53 PHE A HB3  6  
ATOM 7973  H HD1  . PHE A 1 53 ? -8.669  5.662   4.360   1.00 0.00 ? 53 PHE A HD1  6  
ATOM 7974  H HD2  . PHE A 1 53 ? -10.743 3.344   1.457   1.00 0.00 ? 53 PHE A HD2  6  
ATOM 7975  H HE1  . PHE A 1 53 ? -9.017  3.893   6.031   1.00 0.00 ? 53 PHE A HE1  6  
ATOM 7976  H HE2  . PHE A 1 53 ? -11.090 1.568   3.125   1.00 0.00 ? 53 PHE A HE2  6  
ATOM 7977  H HZ   . PHE A 1 53 ? -10.231 1.842   5.415   1.00 0.00 ? 53 PHE A HZ   6  
ATOM 7978  N N    . ILE A 1 54 ? -7.963  8.086   0.347   1.00 0.00 ? 54 ILE A N    6  
ATOM 7979  C CA   . ILE A 1 54 ? -8.009  9.121   -0.669  1.00 0.00 ? 54 ILE A CA   6  
ATOM 7980  C C    . ILE A 1 54 ? -6.654  9.222   -1.363  1.00 0.00 ? 54 ILE A C    6  
ATOM 7981  O O    . ILE A 1 54 ? -6.568  9.502   -2.559  1.00 0.00 ? 54 ILE A O    6  
ATOM 7982  C CB   . ILE A 1 54 ? -8.387  10.488  -0.060  1.00 0.00 ? 54 ILE A CB   6  
ATOM 7983  C CG1  . ILE A 1 54 ? -9.679  10.372  0.761   1.00 0.00 ? 54 ILE A CG1  6  
ATOM 7984  C CG2  . ILE A 1 54 ? -8.540  11.544  -1.150  1.00 0.00 ? 54 ILE A CG2  6  
ATOM 7985  C CD1  . ILE A 1 54 ? -10.881 9.891   -0.032  1.00 0.00 ? 54 ILE A CD1  6  
ATOM 7986  H H    . ILE A 1 54 ? -7.774  8.337   1.286   1.00 0.00 ? 54 ILE A H    6  
ATOM 7987  H HA   . ILE A 1 54 ? -8.765  8.844   -1.393  1.00 0.00 ? 54 ILE A HA   6  
ATOM 7988  H HB   . ILE A 1 54 ? -7.585  10.798  0.592   1.00 0.00 ? 54 ILE A HB   6  
ATOM 7989  H HG12 . ILE A 1 54 ? -9.519  9.675   1.568   1.00 0.00 ? 54 ILE A HG12 6  
ATOM 7990  H HG13 . ILE A 1 54 ? -9.920  11.341  1.174   1.00 0.00 ? 54 ILE A HG13 6  
ATOM 7991  H HG21 . ILE A 1 54 ? -8.856  12.477  -0.705  1.00 0.00 ? 54 ILE A HG21 6  
ATOM 7992  H HG22 . ILE A 1 54 ? -9.278  11.218  -1.867  1.00 0.00 ? 54 ILE A HG22 6  
ATOM 7993  H HG23 . ILE A 1 54 ? -7.592  11.686  -1.648  1.00 0.00 ? 54 ILE A HG23 6  
ATOM 7994  H HD11 . ILE A 1 54 ? -11.063 10.566  -0.855  1.00 0.00 ? 54 ILE A HD11 6  
ATOM 7995  H HD12 . ILE A 1 54 ? -11.748 9.865   0.610   1.00 0.00 ? 54 ILE A HD12 6  
ATOM 7996  H HD13 . ILE A 1 54 ? -10.688 8.899   -0.417  1.00 0.00 ? 54 ILE A HD13 6  
ATOM 7997  N N    . ASP A 1 55 ? -5.599  8.967   -0.600  1.00 0.00 ? 55 ASP A N    6  
ATOM 7998  C CA   . ASP A 1 55 ? -4.230  9.026   -1.109  1.00 0.00 ? 55 ASP A CA   6  
ATOM 7999  C C    . ASP A 1 55 ? -4.015  7.942   -2.168  1.00 0.00 ? 55 ASP A C    6  
ATOM 8000  O O    . ASP A 1 55 ? -3.549  8.216   -3.283  1.00 0.00 ? 55 ASP A O    6  
ATOM 8001  C CB   . ASP A 1 55 ? -3.245  8.854   0.053   1.00 0.00 ? 55 ASP A CB   6  
ATOM 8002  C CG   . ASP A 1 55 ? -1.831  9.259   -0.307  1.00 0.00 ? 55 ASP A CG   6  
ATOM 8003  O OD1  . ASP A 1 55 ? -1.616  10.448  -0.636  1.00 0.00 ? 55 ASP A OD1  6  
ATOM 8004  O OD2  . ASP A 1 55 ? -0.920  8.405   -0.243  1.00 0.00 ? 55 ASP A OD2  6  
ATOM 8005  H H    . ASP A 1 55 ? -5.743  8.727   0.341   1.00 0.00 ? 55 ASP A H    6  
ATOM 8006  H HA   . ASP A 1 55 ? -4.080  9.995   -1.563  1.00 0.00 ? 55 ASP A HA   6  
ATOM 8007  H HB2  . ASP A 1 55 ? -3.571  9.462   0.881   1.00 0.00 ? 55 ASP A HB2  6  
ATOM 8008  H HB3  . ASP A 1 55 ? -3.235  7.818   0.355   1.00 0.00 ? 55 ASP A HB3  6  
ATOM 8009  N N    . GLU A 1 56 ? -4.386  6.717   -1.806  1.00 0.00 ? 56 GLU A N    6  
ATOM 8010  C CA   . GLU A 1 56 ? -4.382  5.582   -2.730  1.00 0.00 ? 56 GLU A CA   6  
ATOM 8011  C C    . GLU A 1 56 ? -5.248  5.875   -3.962  1.00 0.00 ? 56 GLU A C    6  
ATOM 8012  O O    . GLU A 1 56 ? -4.856  5.577   -5.094  1.00 0.00 ? 56 GLU A O    6  
ATOM 8013  C CB   . GLU A 1 56 ? -4.904  4.343   -2.006  1.00 0.00 ? 56 GLU A CB   6  
ATOM 8014  C CG   . GLU A 1 56 ? -3.822  3.519   -1.319  1.00 0.00 ? 56 GLU A CG   6  
ATOM 8015  C CD   . GLU A 1 56 ? -2.839  4.340   -0.508  1.00 0.00 ? 56 GLU A CD   6  
ATOM 8016  O OE1  . GLU A 1 56 ? -1.844  4.813   -1.094  1.00 0.00 ? 56 GLU A OE1  6  
ATOM 8017  O OE2  . GLU A 1 56 ? -3.041  4.490   0.716   1.00 0.00 ? 56 GLU A OE2  6  
ATOM 8018  H H    . GLU A 1 56 ? -4.668  6.563   -0.875  1.00 0.00 ? 56 GLU A H    6  
ATOM 8019  H HA   . GLU A 1 56 ? -3.358  5.394   -3.044  1.00 0.00 ? 56 GLU A HA   6  
ATOM 8020  H HB2  . GLU A 1 56 ? -5.617  4.652   -1.257  1.00 0.00 ? 56 GLU A HB2  6  
ATOM 8021  H HB3  . GLU A 1 56 ? -5.404  3.709   -2.724  1.00 0.00 ? 56 GLU A HB3  6  
ATOM 8022  H HG2  . GLU A 1 56 ? -4.300  2.813   -0.658  1.00 0.00 ? 56 GLU A HG2  6  
ATOM 8023  H HG3  . GLU A 1 56 ? -3.273  2.978   -2.076  1.00 0.00 ? 56 GLU A HG3  6  
ATOM 8024  N N    . ALA A 1 57 ? -6.422  6.472   -3.731  1.00 0.00 ? 57 ALA A N    6  
ATOM 8025  C CA   . ALA A 1 57 ? -7.357  6.808   -4.811  1.00 0.00 ? 57 ALA A CA   6  
ATOM 8026  C C    . ALA A 1 57 ? -6.748  7.805   -5.791  1.00 0.00 ? 57 ALA A C    6  
ATOM 8027  O O    . ALA A 1 57 ? -6.970  7.717   -7.000  1.00 0.00 ? 57 ALA A O    6  
ATOM 8028  C CB   . ALA A 1 57 ? -8.652  7.369   -4.239  1.00 0.00 ? 57 ALA A CB   6  
ATOM 8029  H H    . ALA A 1 57 ? -6.671  6.684   -2.803  1.00 0.00 ? 57 ALA A H    6  
ATOM 8030  H HA   . ALA A 1 57 ? -7.597  5.897   -5.344  1.00 0.00 ? 57 ALA A HA   6  
ATOM 8031  H HB1  . ALA A 1 57 ? -9.344  7.566   -5.044  1.00 0.00 ? 57 ALA A HB1  6  
ATOM 8032  H HB2  . ALA A 1 57 ? -8.444  8.288   -3.709  1.00 0.00 ? 57 ALA A HB2  6  
ATOM 8033  H HB3  . ALA A 1 57 ? -9.087  6.651   -3.559  1.00 0.00 ? 57 ALA A HB3  6  
ATOM 8034  N N    . LYS A 1 58 ? -5.983  8.758   -5.271  1.00 0.00 ? 58 LYS A N    6  
ATOM 8035  C CA   . LYS A 1 58 ? -5.332  9.756   -6.113  1.00 0.00 ? 58 LYS A CA   6  
ATOM 8036  C C    . LYS A 1 58 ? -4.317  9.105   -7.044  1.00 0.00 ? 58 LYS A C    6  
ATOM 8037  O O    . LYS A 1 58 ? -4.128  9.551   -8.179  1.00 0.00 ? 58 LYS A O    6  
ATOM 8038  C CB   . LYS A 1 58 ? -4.664  10.841  -5.269  1.00 0.00 ? 58 LYS A CB   6  
ATOM 8039  C CG   . LYS A 1 58 ? -5.657  11.755  -4.565  1.00 0.00 ? 58 LYS A CG   6  
ATOM 8040  C CD   . LYS A 1 58 ? -4.967  12.890  -3.818  1.00 0.00 ? 58 LYS A CD   6  
ATOM 8041  C CE   . LYS A 1 58 ? -4.117  12.374  -2.669  1.00 0.00 ? 58 LYS A CE   6  
ATOM 8042  N NZ   . LYS A 1 58 ? -3.508  13.482  -1.887  1.00 0.00 ? 58 LYS A NZ   6  
ATOM 8043  H H    . LYS A 1 58 ? -5.860  8.796   -4.297  1.00 0.00 ? 58 LYS A H    6  
ATOM 8044  H HA   . LYS A 1 58 ? -6.103  10.216  -6.718  1.00 0.00 ? 58 LYS A HA   6  
ATOM 8045  H HB2  . LYS A 1 58 ? -4.045  10.368  -4.521  1.00 0.00 ? 58 LYS A HB2  6  
ATOM 8046  H HB3  . LYS A 1 58 ? -4.042  11.448  -5.909  1.00 0.00 ? 58 LYS A HB3  6  
ATOM 8047  H HG2  . LYS A 1 58 ? -6.324  12.179  -5.300  1.00 0.00 ? 58 LYS A HG2  6  
ATOM 8048  H HG3  . LYS A 1 58 ? -6.228  11.170  -3.858  1.00 0.00 ? 58 LYS A HG3  6  
ATOM 8049  H HD2  . LYS A 1 58 ? -4.336  13.430  -4.507  1.00 0.00 ? 58 LYS A HD2  6  
ATOM 8050  H HD3  . LYS A 1 58 ? -5.722  13.554  -3.423  1.00 0.00 ? 58 LYS A HD3  6  
ATOM 8051  H HE2  . LYS A 1 58 ? -4.741  11.786  -2.014  1.00 0.00 ? 58 LYS A HE2  6  
ATOM 8052  H HE3  . LYS A 1 58 ? -3.331  11.751  -3.070  1.00 0.00 ? 58 LYS A HE3  6  
ATOM 8053  H HZ1  . LYS A 1 58 ? -3.013  13.100  -1.051  1.00 0.00 ? 58 LYS A HZ1  6  
ATOM 8054  H HZ2  . LYS A 1 58 ? -4.249  14.143  -1.564  1.00 0.00 ? 58 LYS A HZ2  6  
ATOM 8055  H HZ3  . LYS A 1 58 ? -2.821  14.008  -2.471  1.00 0.00 ? 58 LYS A HZ3  6  
ATOM 8056  N N    . ARG A 1 59 ? -3.661  8.055   -6.566  1.00 0.00 ? 59 ARG A N    6  
ATOM 8057  C CA   . ARG A 1 59 ? -2.753  7.284   -7.410  1.00 0.00 ? 59 ARG A CA   6  
ATOM 8058  C C    . ARG A 1 59 ? -3.521  6.573   -8.515  1.00 0.00 ? 59 ARG A C    6  
ATOM 8059  O O    . ARG A 1 59 ? -3.097  6.569   -9.672  1.00 0.00 ? 59 ARG A O    6  
ATOM 8060  C CB   . ARG A 1 59 ? -1.967  6.264   -6.588  1.00 0.00 ? 59 ARG A CB   6  
ATOM 8061  C CG   . ARG A 1 59 ? -0.621  6.774   -6.098  1.00 0.00 ? 59 ARG A CG   6  
ATOM 8062  C CD   . ARG A 1 59 ? -0.759  8.061   -5.308  1.00 0.00 ? 59 ARG A CD   6  
ATOM 8063  N NE   . ARG A 1 59 ? 0.479   8.420   -4.629  1.00 0.00 ? 59 ARG A NE   6  
ATOM 8064  C CZ   . ARG A 1 59 ? 0.511   9.113   -3.496  1.00 0.00 ? 59 ARG A CZ   6  
ATOM 8065  N NH1  . ARG A 1 59 ? -0.610  9.624   -3.012  1.00 0.00 ? 59 ARG A NH1  6  
ATOM 8066  N NH2  . ARG A 1 59 ? 1.660   9.314   -2.866  1.00 0.00 ? 59 ARG A NH2  6  
ATOM 8067  H H    . ARG A 1 59 ? -3.787  7.796   -5.622  1.00 0.00 ? 59 ARG A H    6  
ATOM 8068  H HA   . ARG A 1 59 ? -2.061  7.977   -7.862  1.00 0.00 ? 59 ARG A HA   6  
ATOM 8069  H HB2  . ARG A 1 59 ? -2.558  5.986   -5.727  1.00 0.00 ? 59 ARG A HB2  6  
ATOM 8070  H HB3  . ARG A 1 59 ? -1.798  5.387   -7.195  1.00 0.00 ? 59 ARG A HB3  6  
ATOM 8071  H HG2  . ARG A 1 59 ? -0.172  6.023   -5.466  1.00 0.00 ? 59 ARG A HG2  6  
ATOM 8072  H HG3  . ARG A 1 59 ? 0.015   6.954   -6.951  1.00 0.00 ? 59 ARG A HG3  6  
ATOM 8073  H HD2  . ARG A 1 59 ? -1.028  8.855   -5.988  1.00 0.00 ? 59 ARG A HD2  6  
ATOM 8074  H HD3  . ARG A 1 59 ? -1.542  7.938   -4.573  1.00 0.00 ? 59 ARG A HD3  6  
ATOM 8075  H HE   . ARG A 1 59 ? 1.327   8.091   -5.021  1.00 0.00 ? 59 ARG A HE   6  
ATOM 8076  H HH11 . ARG A 1 59 ? -1.471  9.493   -3.503  1.00 0.00 ? 59 ARG A HH11 6  
ATOM 8077  H HH12 . ARG A 1 59 ? -0.609  10.121  -2.133  1.00 0.00 ? 59 ARG A HH12 6  
ATOM 8078  H HH21 . ARG A 1 59 ? 2.513   8.942   -3.240  1.00 0.00 ? 59 ARG A HH21 6  
ATOM 8079  H HH22 . ARG A 1 59 ? 1.678   9.825   -1.999  1.00 0.00 ? 59 ARG A HH22 6  
ATOM 8080  N N    . LEU A 1 60 ? -4.657  5.982   -8.149  1.00 0.00 ? 60 LEU A N    6  
ATOM 8081  C CA   . LEU A 1 60 ? -5.512  5.290   -9.113  1.00 0.00 ? 60 LEU A CA   6  
ATOM 8082  C C    . LEU A 1 60 ? -5.959  6.243   -10.218 1.00 0.00 ? 60 LEU A C    6  
ATOM 8083  O O    . LEU A 1 60 ? -6.009  5.870   -11.393 1.00 0.00 ? 60 LEU A O    6  
ATOM 8084  C CB   . LEU A 1 60 ? -6.737  4.691   -8.412  1.00 0.00 ? 60 LEU A CB   6  
ATOM 8085  C CG   . LEU A 1 60 ? -6.432  3.634   -7.347  1.00 0.00 ? 60 LEU A CG   6  
ATOM 8086  C CD1  . LEU A 1 60 ? -7.716  3.146   -6.698  1.00 0.00 ? 60 LEU A CD1  6  
ATOM 8087  C CD2  . LEU A 1 60 ? -5.666  2.469   -7.954  1.00 0.00 ? 60 LEU A CD2  6  
ATOM 8088  H H    . LEU A 1 60 ? -4.925  6.004   -7.202  1.00 0.00 ? 60 LEU A H    6  
ATOM 8089  H HA   . LEU A 1 60 ? -4.932  4.493   -9.555  1.00 0.00 ? 60 LEU A HA   6  
ATOM 8090  H HB2  . LEU A 1 60 ? -7.287  5.495   -7.943  1.00 0.00 ? 60 LEU A HB2  6  
ATOM 8091  H HB3  . LEU A 1 60 ? -7.368  4.239   -9.163  1.00 0.00 ? 60 LEU A HB3  6  
ATOM 8092  H HG   . LEU A 1 60 ? -5.816  4.077   -6.576  1.00 0.00 ? 60 LEU A HG   6  
ATOM 8093  H HD11 . LEU A 1 60 ? -7.482  2.390   -5.963  1.00 0.00 ? 60 LEU A HD11 6  
ATOM 8094  H HD12 . LEU A 1 60 ? -8.365  2.726   -7.452  1.00 0.00 ? 60 LEU A HD12 6  
ATOM 8095  H HD13 . LEU A 1 60 ? -8.214  3.975   -6.216  1.00 0.00 ? 60 LEU A HD13 6  
ATOM 8096  H HD21 . LEU A 1 60 ? -4.730  2.825   -8.360  1.00 0.00 ? 60 LEU A HD21 6  
ATOM 8097  H HD22 . LEU A 1 60 ? -6.255  2.021   -8.741  1.00 0.00 ? 60 LEU A HD22 6  
ATOM 8098  H HD23 . LEU A 1 60 ? -5.468  1.732   -7.189  1.00 0.00 ? 60 LEU A HD23 6  
ATOM 8099  N N    . ARG A 1 61 ? -6.277  7.476   -9.828  1.00 0.00 ? 61 ARG A N    6  
ATOM 8100  C CA   . ARG A 1 61 ? -6.661  8.512   -10.782 1.00 0.00 ? 61 ARG A CA   6  
ATOM 8101  C C    . ARG A 1 61 ? -5.562  8.730   -11.815 1.00 0.00 ? 61 ARG A C    6  
ATOM 8102  O O    . ARG A 1 61 ? -5.801  8.628   -13.019 1.00 0.00 ? 61 ARG A O    6  
ATOM 8103  C CB   . ARG A 1 61 ? -6.943  9.836   -10.066 1.00 0.00 ? 61 ARG A CB   6  
ATOM 8104  C CG   . ARG A 1 61 ? -7.274  10.969  -11.027 1.00 0.00 ? 61 ARG A CG   6  
ATOM 8105  C CD   . ARG A 1 61 ? -7.125  12.335  -10.377 1.00 0.00 ? 61 ARG A CD   6  
ATOM 8106  N NE   . ARG A 1 61 ? -8.073  12.541  -9.290  1.00 0.00 ? 61 ARG A NE   6  
ATOM 8107  C CZ   . ARG A 1 61 ? -8.768  13.662  -9.117  1.00 0.00 ? 61 ARG A CZ   6  
ATOM 8108  N NH1  . ARG A 1 61 ? -8.649  14.664  -9.983  1.00 0.00 ? 61 ARG A NH1  6  
ATOM 8109  N NH2  . ARG A 1 61 ? -9.586  13.779  -8.083  1.00 0.00 ? 61 ARG A NH2  6  
ATOM 8110  H H    . ARG A 1 61 ? -6.264  7.689   -8.868  1.00 0.00 ? 61 ARG A H    6  
ATOM 8111  H HA   . ARG A 1 61 ? -7.558  8.187   -11.287 1.00 0.00 ? 61 ARG A HA   6  
ATOM 8112  H HB2  . ARG A 1 61 ? -7.780  9.701   -9.395  1.00 0.00 ? 61 ARG A HB2  6  
ATOM 8113  H HB3  . ARG A 1 61 ? -6.074  10.119  -9.491  1.00 0.00 ? 61 ARG A HB3  6  
ATOM 8114  H HG2  . ARG A 1 61 ? -6.610  10.913  -11.875 1.00 0.00 ? 61 ARG A HG2  6  
ATOM 8115  H HG3  . ARG A 1 61 ? -8.295  10.853  -11.361 1.00 0.00 ? 61 ARG A HG3  6  
ATOM 8116  H HD2  . ARG A 1 61 ? -6.122  12.427  -9.987  1.00 0.00 ? 61 ARG A HD2  6  
ATOM 8117  H HD3  . ARG A 1 61 ? -7.285  13.095  -11.130 1.00 0.00 ? 61 ARG A HD3  6  
ATOM 8118  H HE   . ARG A 1 61 ? -8.187  11.808  -8.646  1.00 0.00 ? 61 ARG A HE   6  
ATOM 8119  H HH11 . ARG A 1 61 ? -8.033  14.581  -10.778 1.00 0.00 ? 61 ARG A HH11 6  
ATOM 8120  H HH12 . ARG A 1 61 ? -9.174  15.517  -9.849  1.00 0.00 ? 61 ARG A HH12 6  
ATOM 8121  H HH21 . ARG A 1 61 ? -9.680  13.018  -7.425  1.00 0.00 ? 61 ARG A HH21 6  
ATOM 8122  H HH22 . ARG A 1 61 ? -10.116 14.619  -7.948  1.00 0.00 ? 61 ARG A HH22 6  
ATOM 8123  N N    . ALA A 1 62 ? -4.357  9.014   -11.329 1.00 0.00 ? 62 ALA A N    6  
ATOM 8124  C CA   . ALA A 1 62 ? -3.224  9.311   -12.197 1.00 0.00 ? 62 ALA A CA   6  
ATOM 8125  C C    . ALA A 1 62 ? -2.949  8.154   -13.147 1.00 0.00 ? 62 ALA A C    6  
ATOM 8126  O O    . ALA A 1 62 ? -2.735  8.355   -14.342 1.00 0.00 ? 62 ALA A O    6  
ATOM 8127  C CB   . ALA A 1 62 ? -1.988  9.621   -11.364 1.00 0.00 ? 62 ALA A CB   6  
ATOM 8128  H H    . ALA A 1 62 ? -4.226  9.019   -10.358 1.00 0.00 ? 62 ALA A H    6  
ATOM 8129  H HA   . ALA A 1 62 ? -3.468  10.188  -12.779 1.00 0.00 ? 62 ALA A HA   6  
ATOM 8130  H HB1  . ALA A 1 62 ? -2.197  10.453  -10.709 1.00 0.00 ? 62 ALA A HB1  6  
ATOM 8131  H HB2  . ALA A 1 62 ? -1.167  9.875   -12.019 1.00 0.00 ? 62 ALA A HB2  6  
ATOM 8132  H HB3  . ALA A 1 62 ? -1.723  8.755   -10.775 1.00 0.00 ? 62 ALA A HB3  6  
ATOM 8133  N N    . LEU A 1 63 ? -2.976  6.942   -12.610 1.00 0.00 ? 63 LEU A N    6  
ATOM 8134  C CA   . LEU A 1 63 ? -2.737  5.746   -13.402 1.00 0.00 ? 63 LEU A CA   6  
ATOM 8135  C C    . LEU A 1 63 ? -3.772  5.593   -14.496 1.00 0.00 ? 63 LEU A C    6  
ATOM 8136  O O    . LEU A 1 63 ? -3.462  5.129   -15.592 1.00 0.00 ? 63 LEU A O    6  
ATOM 8137  C CB   . LEU A 1 63 ? -2.717  4.501   -12.509 1.00 0.00 ? 63 LEU A CB   6  
ATOM 8138  C CG   . LEU A 1 63 ? -1.574  4.452   -11.487 1.00 0.00 ? 63 LEU A CG   6  
ATOM 8139  C CD1  . LEU A 1 63 ? -1.670  3.193   -10.638 1.00 0.00 ? 63 LEU A CD1  6  
ATOM 8140  C CD2  . LEU A 1 63 ? -0.226  4.517   -12.192 1.00 0.00 ? 63 LEU A CD2  6  
ATOM 8141  H H    . LEU A 1 63 ? -3.159  6.849   -11.654 1.00 0.00 ? 63 LEU A H    6  
ATOM 8142  H HA   . LEU A 1 63 ? -1.782  5.853   -13.870 1.00 0.00 ? 63 LEU A HA   6  
ATOM 8143  H HB2  . LEU A 1 63 ? -3.654  4.453   -11.974 1.00 0.00 ? 63 LEU A HB2  6  
ATOM 8144  H HB3  . LEU A 1 63 ? -2.639  3.630   -13.144 1.00 0.00 ? 63 LEU A HB3  6  
ATOM 8145  H HG   . LEU A 1 63 ? -1.651  5.304   -10.828 1.00 0.00 ? 63 LEU A HG   6  
ATOM 8146  H HD11 . LEU A 1 63 ? -0.858  3.179   -9.926  1.00 0.00 ? 63 LEU A HD11 6  
ATOM 8147  H HD12 . LEU A 1 63 ? -1.607  2.323   -11.274 1.00 0.00 ? 63 LEU A HD12 6  
ATOM 8148  H HD13 . LEU A 1 63 ? -2.613  3.185   -10.108 1.00 0.00 ? 63 LEU A HD13 6  
ATOM 8149  H HD21 . LEU A 1 63 ? -0.138  3.686   -12.878 1.00 0.00 ? 63 LEU A HD21 6  
ATOM 8150  H HD22 . LEU A 1 63 ? 0.567   4.468   -11.461 1.00 0.00 ? 63 LEU A HD22 6  
ATOM 8151  H HD23 . LEU A 1 63 ? -0.152  5.444   -12.741 1.00 0.00 ? 63 LEU A HD23 6  
ATOM 8152  N N    . HIS A 1 64 ? -4.995  5.995   -14.225 1.00 0.00 ? 64 HIS A N    6  
ATOM 8153  C CA   . HIS A 1 64 ? -6.030  5.870   -15.219 1.00 0.00 ? 64 HIS A CA   6  
ATOM 8154  C C    . HIS A 1 64 ? -5.927  6.990   -16.251 1.00 0.00 ? 64 HIS A C    6  
ATOM 8155  O O    . HIS A 1 64 ? -6.018  6.742   -17.450 1.00 0.00 ? 64 HIS A O    6  
ATOM 8156  C CB   . HIS A 1 64 ? -7.421  5.858   -14.576 1.00 0.00 ? 64 HIS A CB   6  
ATOM 8157  C CG   . HIS A 1 64 ? -8.527  5.607   -15.561 1.00 0.00 ? 64 HIS A CG   6  
ATOM 8158  N ND1  . HIS A 1 64 ? -9.617  6.440   -15.709 1.00 0.00 ? 64 HIS A ND1  6  
ATOM 8159  C CD2  . HIS A 1 64 ? -8.707  4.600   -16.452 1.00 0.00 ? 64 HIS A CD2  6  
ATOM 8160  C CE1  . HIS A 1 64 ? -10.414 5.957   -16.645 1.00 0.00 ? 64 HIS A CE1  6  
ATOM 8161  N NE2  . HIS A 1 64 ? -9.886  4.844   -17.109 1.00 0.00 ? 64 HIS A NE2  6  
ATOM 8162  H H    . HIS A 1 64 ? -5.201  6.377   -13.342 1.00 0.00 ? 64 HIS A H    6  
ATOM 8163  H HA   . HIS A 1 64 ? -5.862  4.929   -15.716 1.00 0.00 ? 64 HIS A HA   6  
ATOM 8164  H HB2  . HIS A 1 64 ? -7.458  5.078   -13.827 1.00 0.00 ? 64 HIS A HB2  6  
ATOM 8165  H HB3  . HIS A 1 64 ? -7.601  6.813   -14.105 1.00 0.00 ? 64 HIS A HB3  6  
ATOM 8166  H HD1  . HIS A 1 64 ? -9.786  7.268   -15.196 1.00 0.00 ? 64 HIS A HD1  6  
ATOM 8167  H HD2  . HIS A 1 64 ? -8.046  3.760   -16.612 1.00 0.00 ? 64 HIS A HD2  6  
ATOM 8168  H HE1  . HIS A 1 64 ? -11.345 6.399   -16.968 1.00 0.00 ? 64 HIS A HE1  6  
ATOM 8169  H HE2  . HIS A 1 64 ? -10.218 4.342   -17.894 1.00 0.00 ? 64 HIS A HE2  6  
ATOM 8170  N N    . MET A 1 65 ? -5.696  8.206   -15.781 1.00 0.00 ? 65 MET A N    6  
ATOM 8171  C CA   . MET A 1 65 ? -5.700  9.377   -16.653 1.00 0.00 ? 65 MET A CA   6  
ATOM 8172  C C    . MET A 1 65 ? -4.460  9.437   -17.541 1.00 0.00 ? 65 MET A C    6  
ATOM 8173  O O    . MET A 1 65 ? -4.501  10.020  -18.621 1.00 0.00 ? 65 MET A O    6  
ATOM 8174  C CB   . MET A 1 65 ? -5.817  10.660  -15.831 1.00 0.00 ? 65 MET A CB   6  
ATOM 8175  C CG   . MET A 1 65 ? -7.138  10.786  -15.089 1.00 0.00 ? 65 MET A CG   6  
ATOM 8176  S SD   . MET A 1 65 ? -7.328  12.379  -14.263 1.00 0.00 ? 65 MET A SD   6  
ATOM 8177  C CE   . MET A 1 65 ? -7.310  13.487  -15.670 1.00 0.00 ? 65 MET A CE   6  
ATOM 8178  H H    . MET A 1 65 ? -5.517  8.324   -14.820 1.00 0.00 ? 65 MET A H    6  
ATOM 8179  H HA   . MET A 1 65 ? -6.568  9.298   -17.289 1.00 0.00 ? 65 MET A HA   6  
ATOM 8180  H HB2  . MET A 1 65 ? -5.018  10.684  -15.104 1.00 0.00 ? 65 MET A HB2  6  
ATOM 8181  H HB3  . MET A 1 65 ? -5.717  11.509  -16.492 1.00 0.00 ? 65 MET A HB3  6  
ATOM 8182  H HG2  . MET A 1 65 ? -7.946  10.668  -15.796 1.00 0.00 ? 65 MET A HG2  6  
ATOM 8183  H HG3  . MET A 1 65 ? -7.194  10.004  -14.346 1.00 0.00 ? 65 MET A HG3  6  
ATOM 8184  H HE1  . MET A 1 65 ? -7.392  14.509  -15.327 1.00 0.00 ? 65 MET A HE1  6  
ATOM 8185  H HE2  . MET A 1 65 ? -8.142  13.258  -16.320 1.00 0.00 ? 65 MET A HE2  6  
ATOM 8186  H HE3  . MET A 1 65 ? -6.385  13.365  -16.214 1.00 0.00 ? 65 MET A HE3  6  
ATOM 8187  N N    . LYS A 1 66 ? -3.357  8.846   -17.095 1.00 0.00 ? 66 LYS A N    6  
ATOM 8188  C CA   . LYS A 1 66 ? -2.133  8.852   -17.895 1.00 0.00 ? 66 LYS A CA   6  
ATOM 8189  C C    . LYS A 1 66 ? -2.215  7.847   -19.042 1.00 0.00 ? 66 LYS A C    6  
ATOM 8190  O O    . LYS A 1 66 ? -1.418  7.907   -19.983 1.00 0.00 ? 66 LYS A O    6  
ATOM 8191  C CB   . LYS A 1 66 ? -0.896  8.545   -17.045 1.00 0.00 ? 66 LYS A CB   6  
ATOM 8192  C CG   . LYS A 1 66 ? -0.858  7.123   -16.507 1.00 0.00 ? 66 LYS A CG   6  
ATOM 8193  C CD   . LYS A 1 66 ? 0.554   6.704   -16.132 1.00 0.00 ? 66 LYS A CD   6  
ATOM 8194  C CE   . LYS A 1 66 ? 1.150   7.613   -15.072 1.00 0.00 ? 66 LYS A CE   6  
ATOM 8195  N NZ   . LYS A 1 66 ? 2.580   7.298   -14.823 1.00 0.00 ? 66 LYS A NZ   6  
ATOM 8196  H H    . LYS A 1 66 ? -3.358  8.420   -16.206 1.00 0.00 ? 66 LYS A H    6  
ATOM 8197  H HA   . LYS A 1 66 ? -2.027  9.841   -18.316 1.00 0.00 ? 66 LYS A HA   6  
ATOM 8198  H HB2  . LYS A 1 66 ? -0.013  8.702   -17.647 1.00 0.00 ? 66 LYS A HB2  6  
ATOM 8199  H HB3  . LYS A 1 66 ? -0.872  9.225   -16.207 1.00 0.00 ? 66 LYS A HB3  6  
ATOM 8200  H HG2  . LYS A 1 66 ? -1.485  7.063   -15.629 1.00 0.00 ? 66 LYS A HG2  6  
ATOM 8201  H HG3  . LYS A 1 66 ? -1.234  6.453   -17.266 1.00 0.00 ? 66 LYS A HG3  6  
ATOM 8202  H HD2  . LYS A 1 66 ? 0.527   5.696   -15.747 1.00 0.00 ? 66 LYS A HD2  6  
ATOM 8203  H HD3  . LYS A 1 66 ? 1.177   6.737   -17.014 1.00 0.00 ? 66 LYS A HD3  6  
ATOM 8204  H HE2  . LYS A 1 66 ? 1.067   8.638   -15.405 1.00 0.00 ? 66 LYS A HE2  6  
ATOM 8205  H HE3  . LYS A 1 66 ? 0.596   7.487   -14.154 1.00 0.00 ? 66 LYS A HE3  6  
ATOM 8206  H HZ1  . LYS A 1 66 ? 2.954   7.909   -14.065 1.00 0.00 ? 66 LYS A HZ1  6  
ATOM 8207  H HZ2  . LYS A 1 66 ? 3.140   7.459   -15.690 1.00 0.00 ? 66 LYS A HZ2  6  
ATOM 8208  H HZ3  . LYS A 1 66 ? 2.686   6.300   -14.540 1.00 0.00 ? 66 LYS A HZ3  6  
ATOM 8209  N N    . GLU A 1 67 ? -3.182  6.932   -18.958 1.00 0.00 ? 67 GLU A N    6  
ATOM 8210  C CA   . GLU A 1 67 ? -3.337  5.870   -19.951 1.00 0.00 ? 67 GLU A CA   6  
ATOM 8211  C C    . GLU A 1 67 ? -2.088  4.982   -19.989 1.00 0.00 ? 67 GLU A C    6  
ATOM 8212  O O    . GLU A 1 67 ? -1.319  4.963   -19.028 1.00 0.00 ? 67 GLU A O    6  
ATOM 8213  C CB   . GLU A 1 67 ? -3.646  6.467   -21.331 1.00 0.00 ? 67 GLU A CB   6  
ATOM 8214  C CG   . GLU A 1 67 ? -4.915  7.306   -21.356 1.00 0.00 ? 67 GLU A CG   6  
ATOM 8215  C CD   . GLU A 1 67 ? -6.179  6.487   -21.168 1.00 0.00 ? 67 GLU A CD   6  
ATOM 8216  O OE1  . GLU A 1 67 ? -6.173  5.525   -20.373 1.00 0.00 ? 67 GLU A OE1  6  
ATOM 8217  O OE2  . GLU A 1 67 ? -7.191  6.797   -21.826 1.00 0.00 ? 67 GLU A OE2  6  
ATOM 8218  H H    . GLU A 1 67 ? -3.820  6.985   -18.216 1.00 0.00 ? 67 GLU A H    6  
ATOM 8219  H HA   . GLU A 1 67 ? -4.174  5.263   -19.641 1.00 0.00 ? 67 GLU A HA   6  
ATOM 8220  H HB2  . GLU A 1 67 ? -2.821  7.094   -21.633 1.00 0.00 ? 67 GLU A HB2  6  
ATOM 8221  H HB3  . GLU A 1 67 ? -3.759  5.663   -22.043 1.00 0.00 ? 67 GLU A HB3  6  
ATOM 8222  H HG2  . GLU A 1 67 ? -4.861  8.039   -20.565 1.00 0.00 ? 67 GLU A HG2  6  
ATOM 8223  H HG3  . GLU A 1 67 ? -4.974  7.813   -22.309 1.00 0.00 ? 67 GLU A HG3  6  
ATOM 8224  N N    . HIS A 1 68 ? -1.935  4.203   -21.061 1.00 0.00 ? 68 HIS A N    6  
ATOM 8225  C CA   . HIS A 1 68 ? -0.779  3.314   -21.237 1.00 0.00 ? 68 HIS A CA   6  
ATOM 8226  C C    . HIS A 1 68 ? -0.797  2.188   -20.196 1.00 0.00 ? 68 HIS A C    6  
ATOM 8227  O O    . HIS A 1 68 ? -0.143  2.270   -19.154 1.00 0.00 ? 68 HIS A O    6  
ATOM 8228  C CB   . HIS A 1 68 ? 0.540   4.108   -21.162 1.00 0.00 ? 68 HIS A CB   6  
ATOM 8229  C CG   . HIS A 1 68 ? 1.761   3.329   -21.564 1.00 0.00 ? 68 HIS A CG   6  
ATOM 8230  N ND1  . HIS A 1 68 ? 2.259   3.329   -22.846 1.00 0.00 ? 68 HIS A ND1  6  
ATOM 8231  C CD2  . HIS A 1 68 ? 2.588   2.534   -20.844 1.00 0.00 ? 68 HIS A CD2  6  
ATOM 8232  C CE1  . HIS A 1 68 ? 3.335   2.567   -22.901 1.00 0.00 ? 68 HIS A CE1  6  
ATOM 8233  N NE2  . HIS A 1 68 ? 3.561   2.073   -21.697 1.00 0.00 ? 68 HIS A NE2  6  
ATOM 8234  H H    . HIS A 1 68 ? -2.626  4.222   -21.764 1.00 0.00 ? 68 HIS A H    6  
ATOM 8235  H HA   . HIS A 1 68 ? -0.860  2.870   -22.221 1.00 0.00 ? 68 HIS A HA   6  
ATOM 8236  H HB2  . HIS A 1 68 ? 0.470   4.965   -21.813 1.00 0.00 ? 68 HIS A HB2  6  
ATOM 8237  H HB3  . HIS A 1 68 ? 0.686   4.447   -20.147 1.00 0.00 ? 68 HIS A HB3  6  
ATOM 8238  H HD1  . HIS A 1 68 ? 1.878   3.822   -23.611 1.00 0.00 ? 68 HIS A HD1  6  
ATOM 8239  H HD2  . HIS A 1 68 ? 2.503   2.310   -19.788 1.00 0.00 ? 68 HIS A HD2  6  
ATOM 8240  H HE1  . HIS A 1 68 ? 3.934   2.382   -23.780 1.00 0.00 ? 68 HIS A HE1  6  
ATOM 8241  H HE2  . HIS A 1 68 ? 4.158   1.306   -21.511 1.00 0.00 ? 68 HIS A HE2  6  
ATOM 8242  N N    . PRO A 1 69 ? -1.572  1.126   -20.465 1.00 0.00 ? 69 PRO A N    6  
ATOM 8243  C CA   . PRO A 1 69 ? -1.722  -0.019  -19.552 1.00 0.00 ? 69 PRO A CA   6  
ATOM 8244  C C    . PRO A 1 69 ? -0.420  -0.788  -19.316 1.00 0.00 ? 69 PRO A C    6  
ATOM 8245  O O    . PRO A 1 69 ? -0.301  -1.538  -18.347 1.00 0.00 ? 69 PRO A O    6  
ATOM 8246  C CB   . PRO A 1 69 ? -2.740  -0.918  -20.264 1.00 0.00 ? 69 PRO A CB   6  
ATOM 8247  C CG   . PRO A 1 69 ? -3.421  -0.036  -21.249 1.00 0.00 ? 69 PRO A CG   6  
ATOM 8248  C CD   . PRO A 1 69 ? -2.391  0.962   -21.679 1.00 0.00 ? 69 PRO A CD   6  
ATOM 8249  H HA   . PRO A 1 69 ? -2.125  0.290   -18.599 1.00 0.00 ? 69 PRO A HA   6  
ATOM 8250  H HB2  . PRO A 1 69 ? -2.224  -1.730  -20.753 1.00 0.00 ? 69 PRO A HB2  6  
ATOM 8251  H HB3  . PRO A 1 69 ? -3.438  -1.314  -19.541 1.00 0.00 ? 69 PRO A HB3  6  
ATOM 8252  H HG2  . PRO A 1 69 ? -3.758  -0.620  -22.094 1.00 0.00 ? 69 PRO A HG2  6  
ATOM 8253  H HG3  . PRO A 1 69 ? -4.256  0.464   -20.783 1.00 0.00 ? 69 PRO A HG3  6  
ATOM 8254  H HD2  . PRO A 1 69 ? -1.802  0.572   -22.498 1.00 0.00 ? 69 PRO A HD2  6  
ATOM 8255  H HD3  . PRO A 1 69 ? -2.859  1.896   -21.958 1.00 0.00 ? 69 PRO A HD3  6  
ATOM 8256  N N    . ASP A 1 70 ? 0.559   -0.574  -20.186 1.00 0.00 ? 70 ASP A N    6  
ATOM 8257  C CA   . ASP A 1 70 ? 1.832   -1.294  -20.122 1.00 0.00 ? 70 ASP A CA   6  
ATOM 8258  C C    . ASP A 1 70 ? 2.639   -0.919  -18.873 1.00 0.00 ? 70 ASP A C    6  
ATOM 8259  O O    . ASP A 1 70 ? 3.553   -1.641  -18.477 1.00 0.00 ? 70 ASP A O    6  
ATOM 8260  C CB   . ASP A 1 70 ? 2.631   -1.021  -21.406 1.00 0.00 ? 70 ASP A CB   6  
ATOM 8261  C CG   . ASP A 1 70 ? 4.118   -1.295  -21.282 1.00 0.00 ? 70 ASP A CG   6  
ATOM 8262  O OD1  . ASP A 1 70 ? 4.521   -2.479  -21.269 1.00 0.00 ? 70 ASP A OD1  6  
ATOM 8263  O OD2  . ASP A 1 70 ? 4.895   -0.318  -21.210 1.00 0.00 ? 70 ASP A OD2  6  
ATOM 8264  H H    . ASP A 1 70 ? 0.419   0.077   -20.908 1.00 0.00 ? 70 ASP A H    6  
ATOM 8265  H HA   . ASP A 1 70 ? 1.606   -2.347  -20.075 1.00 0.00 ? 70 ASP A HA   6  
ATOM 8266  H HB2  . ASP A 1 70 ? 2.241   -1.645  -22.195 1.00 0.00 ? 70 ASP A HB2  6  
ATOM 8267  H HB3  . ASP A 1 70 ? 2.500   0.015   -21.683 1.00 0.00 ? 70 ASP A HB3  6  
ATOM 8268  N N    . TYR A 1 71 ? 2.289   0.186   -18.229 1.00 0.00 ? 71 TYR A N    6  
ATOM 8269  C CA   . TYR A 1 71 ? 2.987   0.585   -17.011 1.00 0.00 ? 71 TYR A CA   6  
ATOM 8270  C C    . TYR A 1 71 ? 2.026   0.830   -15.858 1.00 0.00 ? 71 TYR A C    6  
ATOM 8271  O O    . TYR A 1 71 ? 2.151   1.817   -15.131 1.00 0.00 ? 71 TYR A O    6  
ATOM 8272  C CB   . TYR A 1 71 ? 3.855   1.822   -17.251 1.00 0.00 ? 71 TYR A CB   6  
ATOM 8273  C CG   . TYR A 1 71 ? 5.293   1.487   -17.579 1.00 0.00 ? 71 TYR A CG   6  
ATOM 8274  C CD1  . TYR A 1 71 ? 6.155   1.025   -16.591 1.00 0.00 ? 71 TYR A CD1  6  
ATOM 8275  C CD2  . TYR A 1 71 ? 5.787   1.616   -18.869 1.00 0.00 ? 71 TYR A CD2  6  
ATOM 8276  C CE1  . TYR A 1 71 ? 7.465   0.707   -16.877 1.00 0.00 ? 71 TYR A CE1  6  
ATOM 8277  C CE2  . TYR A 1 71 ? 7.100   1.295   -19.166 1.00 0.00 ? 71 TYR A CE2  6  
ATOM 8278  C CZ   . TYR A 1 71 ? 7.934   0.840   -18.164 1.00 0.00 ? 71 TYR A CZ   6  
ATOM 8279  O OH   . TYR A 1 71 ? 9.241   0.514   -18.451 1.00 0.00 ? 71 TYR A OH   6  
ATOM 8280  H H    . TYR A 1 71 ? 1.547   0.732   -18.565 1.00 0.00 ? 71 TYR A H    6  
ATOM 8281  H HA   . TYR A 1 71 ? 3.629   -0.237  -16.736 1.00 0.00 ? 71 TYR A HA   6  
ATOM 8282  H HB2  . TYR A 1 71 ? 3.446   2.386   -18.076 1.00 0.00 ? 71 TYR A HB2  6  
ATOM 8283  H HB3  . TYR A 1 71 ? 3.847   2.436   -16.362 1.00 0.00 ? 71 TYR A HB3  6  
ATOM 8284  H HD1  . TYR A 1 71 ? 5.787   0.921   -15.582 1.00 0.00 ? 71 TYR A HD1  6  
ATOM 8285  H HD2  . TYR A 1 71 ? 5.132   1.974   -19.649 1.00 0.00 ? 71 TYR A HD2  6  
ATOM 8286  H HE1  . TYR A 1 71 ? 8.118   0.350   -16.095 1.00 0.00 ? 71 TYR A HE1  6  
ATOM 8287  H HE2  . TYR A 1 71 ? 7.468   1.403   -20.176 1.00 0.00 ? 71 TYR A HE2  6  
ATOM 8288  H HH   . TYR A 1 71 ? 9.623   1.190   -19.029 1.00 0.00 ? 71 TYR A HH   6  
ATOM 8289  N N    . LYS A 1 72 ? 1.077   -0.082  -15.694 1.00 0.00 ? 72 LYS A N    6  
ATOM 8290  C CA   . LYS A 1 72 ? 0.154   -0.033  -14.562 1.00 0.00 ? 72 LYS A CA   6  
ATOM 8291  C C    . LYS A 1 72 ? -0.569  -1.364  -14.393 1.00 0.00 ? 72 LYS A C    6  
ATOM 8292  O O    . LYS A 1 72 ? -1.646  -1.434  -13.800 1.00 0.00 ? 72 LYS A O    6  
ATOM 8293  C CB   . LYS A 1 72 ? -0.848  1.110   -14.731 1.00 0.00 ? 72 LYS A CB   6  
ATOM 8294  C CG   . LYS A 1 72 ? -1.699  1.021   -15.985 1.00 0.00 ? 72 LYS A CG   6  
ATOM 8295  C CD   . LYS A 1 72 ? -2.457  2.312   -16.205 1.00 0.00 ? 72 LYS A CD   6  
ATOM 8296  C CE   . LYS A 1 72 ? -3.372  2.235   -17.410 1.00 0.00 ? 72 LYS A CE   6  
ATOM 8297  N NZ   . LYS A 1 72 ? -3.955  3.560   -17.735 1.00 0.00 ? 72 LYS A NZ   6  
ATOM 8298  H H    . LYS A 1 72 ? 0.986   -0.797  -16.357 1.00 0.00 ? 72 LYS A H    6  
ATOM 8299  H HA   . LYS A 1 72 ? 0.741   0.149   -13.673 1.00 0.00 ? 72 LYS A HA   6  
ATOM 8300  H HB2  . LYS A 1 72 ? -1.510  1.115   -13.878 1.00 0.00 ? 72 LYS A HB2  6  
ATOM 8301  H HB3  . LYS A 1 72 ? -0.305  2.043   -14.757 1.00 0.00 ? 72 LYS A HB3  6  
ATOM 8302  H HG2  . LYS A 1 72 ? -1.060  0.838   -16.835 1.00 0.00 ? 72 LYS A HG2  6  
ATOM 8303  H HG3  . LYS A 1 72 ? -2.406  0.211   -15.877 1.00 0.00 ? 72 LYS A HG3  6  
ATOM 8304  H HD2  . LYS A 1 72 ? -3.054  2.521   -15.329 1.00 0.00 ? 72 LYS A HD2  6  
ATOM 8305  H HD3  . LYS A 1 72 ? -1.746  3.112   -16.355 1.00 0.00 ? 72 LYS A HD3  6  
ATOM 8306  H HE2  . LYS A 1 72 ? -2.804  1.881   -18.257 1.00 0.00 ? 72 LYS A HE2  6  
ATOM 8307  H HE3  . LYS A 1 72 ? -4.171  1.541   -17.195 1.00 0.00 ? 72 LYS A HE3  6  
ATOM 8308  H HZ1  . LYS A 1 72 ? -3.228  4.173   -18.157 1.00 0.00 ? 72 LYS A HZ1  6  
ATOM 8309  H HZ2  . LYS A 1 72 ? -4.317  4.013   -16.872 1.00 0.00 ? 72 LYS A HZ2  6  
ATOM 8310  H HZ3  . LYS A 1 72 ? -4.741  3.452   -18.413 1.00 0.00 ? 72 LYS A HZ3  6  
ATOM 8311  N N    . TYR A 1 73 ? 0.042   -2.425  -14.904 1.00 0.00 ? 73 TYR A N    6  
ATOM 8312  C CA   . TYR A 1 73 ? -0.513  -3.762  -14.769 1.00 0.00 ? 73 TYR A CA   6  
ATOM 8313  C C    . TYR A 1 73 ? 0.404   -4.649  -13.942 1.00 0.00 ? 73 TYR A C    6  
ATOM 8314  O O    . TYR A 1 73 ? 1.526   -4.954  -14.351 1.00 0.00 ? 73 TYR A O    6  
ATOM 8315  C CB   . TYR A 1 73 ? -0.752  -4.411  -16.136 1.00 0.00 ? 73 TYR A CB   6  
ATOM 8316  C CG   . TYR A 1 73 ? -2.116  -4.128  -16.726 1.00 0.00 ? 73 TYR A CG   6  
ATOM 8317  C CD1  . TYR A 1 73 ? -3.237  -4.014  -15.913 1.00 0.00 ? 73 TYR A CD1  6  
ATOM 8318  C CD2  . TYR A 1 73 ? -2.286  -4.001  -18.098 1.00 0.00 ? 73 TYR A CD2  6  
ATOM 8319  C CE1  . TYR A 1 73 ? -4.487  -3.776  -16.453 1.00 0.00 ? 73 TYR A CE1  6  
ATOM 8320  C CE2  . TYR A 1 73 ? -3.533  -3.763  -18.643 1.00 0.00 ? 73 TYR A CE2  6  
ATOM 8321  C CZ   . TYR A 1 73 ? -4.629  -3.650  -17.818 1.00 0.00 ? 73 TYR A CZ   6  
ATOM 8322  O OH   . TYR A 1 73 ? -5.872  -3.415  -18.359 1.00 0.00 ? 73 TYR A OH   6  
ATOM 8323  H H    . TYR A 1 73 ? 0.892   -2.306  -15.371 1.00 0.00 ? 73 TYR A H    6  
ATOM 8324  H HA   . TYR A 1 73 ? -1.459  -3.672  -14.257 1.00 0.00 ? 73 TYR A HA   6  
ATOM 8325  H HB2  . TYR A 1 73 ? -0.011  -4.048  -16.833 1.00 0.00 ? 73 TYR A HB2  6  
ATOM 8326  H HB3  . TYR A 1 73 ? -0.649  -5.481  -16.037 1.00 0.00 ? 73 TYR A HB3  6  
ATOM 8327  H HD1  . TYR A 1 73 ? -3.123  -4.111  -14.843 1.00 0.00 ? 73 TYR A HD1  6  
ATOM 8328  H HD2  . TYR A 1 73 ? -1.426  -4.090  -18.742 1.00 0.00 ? 73 TYR A HD2  6  
ATOM 8329  H HE1  . TYR A 1 73 ? -5.348  -3.688  -15.803 1.00 0.00 ? 73 TYR A HE1  6  
ATOM 8330  H HE2  . TYR A 1 73 ? -3.643  -3.666  -19.714 1.00 0.00 ? 73 TYR A HE2  6  
ATOM 8331  H HH   . TYR A 1 73 ? -6.310  -2.704  -17.874 1.00 0.00 ? 73 TYR A HH   6  
ATOM 8332  N N    . ARG A 1 74 ? -0.072  -5.044  -12.773 1.00 0.00 ? 74 ARG A N    6  
ATOM 8333  C CA   . ARG A 1 74 ? 0.635   -6.016  -11.961 1.00 0.00 ? 74 ARG A CA   6  
ATOM 8334  C C    . ARG A 1 74 ? -0.240  -7.257  -11.809 1.00 0.00 ? 74 ARG A C    6  
ATOM 8335  O O    . ARG A 1 74 ? -1.466  -7.147  -11.745 1.00 0.00 ? 74 ARG A O    6  
ATOM 8336  C CB   . ARG A 1 74 ? 1.028   -5.411  -10.598 1.00 0.00 ? 74 ARG A CB   6  
ATOM 8337  C CG   . ARG A 1 74 ? -0.050  -5.455  -9.521  1.00 0.00 ? 74 ARG A CG   6  
ATOM 8338  C CD   . ARG A 1 74 ? 0.062   -6.718  -8.675  1.00 0.00 ? 74 ARG A CD   6  
ATOM 8339  N NE   . ARG A 1 74 ? 1.415   -6.889  -8.134  1.00 0.00 ? 74 ARG A NE   6  
ATOM 8340  C CZ   . ARG A 1 74 ? 1.914   -8.048  -7.701  1.00 0.00 ? 74 ARG A CZ   6  
ATOM 8341  N NH1  . ARG A 1 74 ? 1.174   -9.149  -7.718  1.00 0.00 ? 74 ARG A NH1  6  
ATOM 8342  N NH2  . ARG A 1 74 ? 3.162   -8.105  -7.251  1.00 0.00 ? 74 ARG A NH2  6  
ATOM 8343  H H    . ARG A 1 74 ? -0.924  -4.681  -12.456 1.00 0.00 ? 74 ARG A H    6  
ATOM 8344  H HA   . ARG A 1 74 ? 1.533   -6.294  -12.493 1.00 0.00 ? 74 ARG A HA   6  
ATOM 8345  H HB2  . ARG A 1 74 ? 1.889   -5.944  -10.224 1.00 0.00 ? 74 ARG A HB2  6  
ATOM 8346  H HB3  . ARG A 1 74 ? 1.307   -4.376  -10.750 1.00 0.00 ? 74 ARG A HB3  6  
ATOM 8347  H HG2  . ARG A 1 74 ? 0.062   -4.595  -8.879  1.00 0.00 ? 74 ARG A HG2  6  
ATOM 8348  H HG3  . ARG A 1 74 ? -1.021  -5.432  -9.994  1.00 0.00 ? 74 ARG A HG3  6  
ATOM 8349  H HD2  . ARG A 1 74 ? -0.637  -6.650  -7.854  1.00 0.00 ? 74 ARG A HD2  6  
ATOM 8350  H HD3  . ARG A 1 74 ? -0.184  -7.573  -9.287  1.00 0.00 ? 74 ARG A HD3  6  
ATOM 8351  H HE   . ARG A 1 74 ? 1.988   -6.089  -8.101  1.00 0.00 ? 74 ARG A HE   6  
ATOM 8352  H HH11 . ARG A 1 74 ? 0.232   -9.122  -8.061  1.00 0.00 ? 74 ARG A HH11 6  
ATOM 8353  H HH12 . ARG A 1 74 ? 1.554   -10.014 -7.385  1.00 0.00 ? 74 ARG A HH12 6  
ATOM 8354  H HH21 . ARG A 1 74 ? 3.736   -7.271  -7.230  1.00 0.00 ? 74 ARG A HH21 6  
ATOM 8355  H HH22 . ARG A 1 74 ? 3.556   -8.984  -6.945  1.00 0.00 ? 74 ARG A HH22 6  
ATOM 8356  N N    . PRO A 1 75 ? 0.368   -8.449  -11.771 1.00 0.00 ? 75 PRO A N    6  
ATOM 8357  C CA   . PRO A 1 75 ? -0.372  -9.712  -11.739 1.00 0.00 ? 75 PRO A CA   6  
ATOM 8358  C C    . PRO A 1 75 ? -1.158  -9.927  -10.447 1.00 0.00 ? 75 PRO A C    6  
ATOM 8359  O O    . PRO A 1 75 ? -0.612  -10.380 -9.442  1.00 0.00 ? 75 PRO A O    6  
ATOM 8360  C CB   . PRO A 1 75 ? 0.716   -10.788 -11.882 1.00 0.00 ? 75 PRO A CB   6  
ATOM 8361  C CG   . PRO A 1 75 ? 1.940   -10.061 -12.329 1.00 0.00 ? 75 PRO A CG   6  
ATOM 8362  C CD   . PRO A 1 75 ? 1.821   -8.669  -11.782 1.00 0.00 ? 75 PRO A CD   6  
ATOM 8363  H HA   . PRO A 1 75 ? -1.051  -9.783  -12.575 1.00 0.00 ? 75 PRO A HA   6  
ATOM 8364  H HB2  . PRO A 1 75 ? 0.872   -11.271 -10.927 1.00 0.00 ? 75 PRO A HB2  6  
ATOM 8365  H HB3  . PRO A 1 75 ? 0.404   -11.520 -12.612 1.00 0.00 ? 75 PRO A HB3  6  
ATOM 8366  H HG2  . PRO A 1 75 ? 2.822   -10.544 -11.932 1.00 0.00 ? 75 PRO A HG2  6  
ATOM 8367  H HG3  . PRO A 1 75 ? 1.979   -10.036 -13.407 1.00 0.00 ? 75 PRO A HG3  6  
ATOM 8368  H HD2  . PRO A 1 75 ? 2.232   -8.617  -10.783 1.00 0.00 ? 75 PRO A HD2  6  
ATOM 8369  H HD3  . PRO A 1 75 ? 2.314   -7.962  -12.433 1.00 0.00 ? 75 PRO A HD3  6  
ATOM 8370  N N    . ARG A 1 76 ? -2.432  -9.553  -10.468 1.00 0.00 ? 76 ARG A N    6  
ATOM 8371  C CA   . ARG A 1 76 ? -3.356  -9.948  -9.415  1.00 0.00 ? 76 ARG A CA   6  
ATOM 8372  C C    . ARG A 1 76 ? -3.859  -11.343 -9.759  1.00 0.00 ? 76 ARG A C    6  
ATOM 8373  O O    . ARG A 1 76 ? -3.961  -12.222 -8.905  1.00 0.00 ? 76 ARG A O    6  
ATOM 8374  C CB   . ARG A 1 76 ? -4.521  -8.949  -9.312  1.00 0.00 ? 76 ARG A CB   6  
ATOM 8375  C CG   . ARG A 1 76 ? -5.271  -8.982  -7.980  1.00 0.00 ? 76 ARG A CG   6  
ATOM 8376  C CD   . ARG A 1 76 ? -6.172  -10.202 -7.834  1.00 0.00 ? 76 ARG A CD   6  
ATOM 8377  N NE   . ARG A 1 76 ? -7.275  -10.194 -8.796  1.00 0.00 ? 76 ARG A NE   6  
ATOM 8378  C CZ   . ARG A 1 76 ? -8.332  -11.011 -8.735  1.00 0.00 ? 76 ARG A CZ   6  
ATOM 8379  N NH1  . ARG A 1 76 ? -8.443  -11.896 -7.748  1.00 0.00 ? 76 ARG A NH1  6  
ATOM 8380  N NH2  . ARG A 1 76 ? -9.281  -10.932 -9.661  1.00 0.00 ? 76 ARG A NH2  6  
ATOM 8381  H H    . ARG A 1 76 ? -2.750  -8.987  -11.204 1.00 0.00 ? 76 ARG A H    6  
ATOM 8382  H HA   . ARG A 1 76 ? -2.815  -9.979  -8.479  1.00 0.00 ? 76 ARG A HA   6  
ATOM 8383  H HB2  . ARG A 1 76 ? -4.132  -7.952  -9.452  1.00 0.00 ? 76 ARG A HB2  6  
ATOM 8384  H HB3  . ARG A 1 76 ? -5.227  -9.161  -10.103 1.00 0.00 ? 76 ARG A HB3  6  
ATOM 8385  H HG2  . ARG A 1 76 ? -4.550  -8.990  -7.177  1.00 0.00 ? 76 ARG A HG2  6  
ATOM 8386  H HG3  . ARG A 1 76 ? -5.877  -8.091  -7.906  1.00 0.00 ? 76 ARG A HG3  6  
ATOM 8387  H HD2  . ARG A 1 76 ? -5.581  -11.092 -7.989  1.00 0.00 ? 76 ARG A HD2  6  
ATOM 8388  H HD3  . ARG A 1 76 ? -6.581  -10.212 -6.834  1.00 0.00 ? 76 ARG A HD3  6  
ATOM 8389  H HE   . ARG A 1 76 ? -7.224  -9.541  -9.529  1.00 0.00 ? 76 ARG A HE   6  
ATOM 8390  H HH11 . ARG A 1 76 ? -7.735  -11.955 -7.044  1.00 0.00 ? 76 ARG A HH11 6  
ATOM 8391  H HH12 . ARG A 1 76 ? -9.243  -12.508 -7.704  1.00 0.00 ? 76 ARG A HH12 6  
ATOM 8392  H HH21 . ARG A 1 76 ? -9.209  -10.263 -10.402 1.00 0.00 ? 76 ARG A HH21 6  
ATOM 8393  H HH22 . ARG A 1 76 ? -10.081 -11.545 -9.625  1.00 0.00 ? 76 ARG A HH22 6  
ATOM 8394  N N    . ARG A 1 77 ? -4.165  -11.512 -11.041 1.00 0.00 ? 77 ARG A N    6  
ATOM 8395  C CA   . ARG A 1 77 ? -4.483  -12.799 -11.636 1.00 0.00 ? 77 ARG A CA   6  
ATOM 8396  C C    . ARG A 1 77 ? -4.627  -12.591 -13.136 1.00 0.00 ? 77 ARG A C    6  
ATOM 8397  O O    . ARG A 1 77 ? -5.194  -11.583 -13.563 1.00 0.00 ? 77 ARG A O    6  
ATOM 8398  C CB   . ARG A 1 77 ? -5.765  -13.405 -11.053 1.00 0.00 ? 77 ARG A CB   6  
ATOM 8399  C CG   . ARG A 1 77 ? -5.947  -14.862 -11.442 1.00 0.00 ? 77 ARG A CG   6  
ATOM 8400  C CD   . ARG A 1 77 ? -7.153  -15.496 -10.767 1.00 0.00 ? 77 ARG A CD   6  
ATOM 8401  N NE   . ARG A 1 77 ? -7.228  -16.928 -11.052 1.00 0.00 ? 77 ARG A NE   6  
ATOM 8402  C CZ   . ARG A 1 77 ? -8.363  -17.614 -11.176 1.00 0.00 ? 77 ARG A CZ   6  
ATOM 8403  N NH1  . ARG A 1 77 ? -9.531  -17.020 -10.979 1.00 0.00 ? 77 ARG A NH1  6  
ATOM 8404  N NH2  . ARG A 1 77 ? -8.328  -18.904 -11.483 1.00 0.00 ? 77 ARG A NH2  6  
ATOM 8405  H H    . ARG A 1 77 ? -4.174  -10.723 -11.623 1.00 0.00 ? 77 ARG A H    6  
ATOM 8406  H HA   . ARG A 1 77 ? -3.654  -13.467 -11.453 1.00 0.00 ? 77 ARG A HA   6  
ATOM 8407  H HB2  . ARG A 1 77 ? -5.728  -13.339 -9.976  1.00 0.00 ? 77 ARG A HB2  6  
ATOM 8408  H HB3  . ARG A 1 77 ? -6.616  -12.845 -11.416 1.00 0.00 ? 77 ARG A HB3  6  
ATOM 8409  H HG2  . ARG A 1 77 ? -6.079  -14.922 -12.511 1.00 0.00 ? 77 ARG A HG2  6  
ATOM 8410  H HG3  . ARG A 1 77 ? -5.060  -15.409 -11.157 1.00 0.00 ? 77 ARG A HG3  6  
ATOM 8411  H HD2  . ARG A 1 77 ? -7.074  -15.353 -9.700  1.00 0.00 ? 77 ARG A HD2  6  
ATOM 8412  H HD3  . ARG A 1 77 ? -8.050  -15.017 -11.130 1.00 0.00 ? 77 ARG A HD3  6  
ATOM 8413  H HE   . ARG A 1 77 ? -6.369  -17.404 -11.173 1.00 0.00 ? 77 ARG A HE   6  
ATOM 8414  H HH11 . ARG A 1 77 ? -9.576  -16.049 -10.730 1.00 0.00 ? 77 ARG A HH11 6  
ATOM 8415  H HH12 . ARG A 1 77 ? -10.388 -17.549 -11.081 1.00 0.00 ? 77 ARG A HH12 6  
ATOM 8416  H HH21 . ARG A 1 77 ? -7.440  -19.372 -11.623 1.00 0.00 ? 77 ARG A HH21 6  
ATOM 8417  H HH22 . ARG A 1 77 ? -9.183  -19.423 -11.586 1.00 0.00 ? 77 ARG A HH22 6  
ATOM 8418  N N    . LYS A 1 78 ? -4.097  -13.506 -13.932 1.00 0.00 ? 78 LYS A N    6  
ATOM 8419  C CA   . LYS A 1 78 ? -4.083  -13.329 -15.377 1.00 0.00 ? 78 LYS A CA   6  
ATOM 8420  C C    . LYS A 1 78 ? -5.482  -13.518 -15.963 1.00 0.00 ? 78 LYS A C    6  
ATOM 8421  O O    . LYS A 1 78 ? -5.897  -14.627 -16.285 1.00 0.00 ? 78 LYS A O    6  
ATOM 8422  C CB   . LYS A 1 78 ? -3.084  -14.289 -16.030 1.00 0.00 ? 78 LYS A CB   6  
ATOM 8423  C CG   . LYS A 1 78 ? -2.811  -13.984 -17.496 1.00 0.00 ? 78 LYS A CG   6  
ATOM 8424  C CD   . LYS A 1 78 ? -2.299  -12.562 -17.681 1.00 0.00 ? 78 LYS A CD   6  
ATOM 8425  C CE   . LYS A 1 78 ? -2.027  -12.241 -19.142 1.00 0.00 ? 78 LYS A CE   6  
ATOM 8426  N NZ   . LYS A 1 78 ? -0.854  -12.980 -19.675 1.00 0.00 ? 78 LYS A NZ   6  
ATOM 8427  H H    . LYS A 1 78 ? -3.710  -14.320 -13.545 1.00 0.00 ? 78 LYS A H    6  
ATOM 8428  H HA   . LYS A 1 78 ? -3.768  -12.315 -15.574 1.00 0.00 ? 78 LYS A HA   6  
ATOM 8429  H HB2  . LYS A 1 78 ? -2.148  -14.232 -15.495 1.00 0.00 ? 78 LYS A HB2  6  
ATOM 8430  H HB3  . LYS A 1 78 ? -3.469  -15.295 -15.959 1.00 0.00 ? 78 LYS A HB3  6  
ATOM 8431  H HG2  . LYS A 1 78 ? -2.068  -14.674 -17.865 1.00 0.00 ? 78 LYS A HG2  6  
ATOM 8432  H HG3  . LYS A 1 78 ? -3.727  -14.103 -18.054 1.00 0.00 ? 78 LYS A HG3  6  
ATOM 8433  H HD2  . LYS A 1 78 ? -3.040  -11.874 -17.306 1.00 0.00 ? 78 LYS A HD2  6  
ATOM 8434  H HD3  . LYS A 1 78 ? -1.383  -12.446 -17.119 1.00 0.00 ? 78 LYS A HD3  6  
ATOM 8435  H HE2  . LYS A 1 78 ? -2.899  -12.504 -19.723 1.00 0.00 ? 78 LYS A HE2  6  
ATOM 8436  H HE3  . LYS A 1 78 ? -1.844  -11.180 -19.233 1.00 0.00 ? 78 LYS A HE3  6  
ATOM 8437  H HZ1  . LYS A 1 78 ? -0.751  -12.790 -20.697 1.00 0.00 ? 78 LYS A HZ1  6  
ATOM 8438  H HZ2  . LYS A 1 78 ? -0.975  -14.006 -19.533 1.00 0.00 ? 78 LYS A HZ2  6  
ATOM 8439  H HZ3  . LYS A 1 78 ? 0.016   -12.672 -19.188 1.00 0.00 ? 78 LYS A HZ3  6  
ATOM 8440  N N    . THR A 1 79 ? -6.209  -12.418 -16.065 1.00 0.00 ? 79 THR A N    6  
ATOM 8441  C CA   . THR A 1 79 ? -7.549  -12.434 -16.617 1.00 0.00 ? 79 THR A CA   6  
ATOM 8442  C C    . THR A 1 79 ? -7.520  -12.043 -18.090 1.00 0.00 ? 79 THR A C    6  
ATOM 8443  O O    . THR A 1 79 ? -7.361  -10.867 -18.419 1.00 0.00 ? 79 THR A O    6  
ATOM 8444  C CB   . THR A 1 79 ? -8.460  -11.451 -15.860 1.00 0.00 ? 79 THR A CB   6  
ATOM 8445  O OG1  . THR A 1 79 ? -8.158  -11.496 -14.461 1.00 0.00 ? 79 THR A OG1  6  
ATOM 8446  C CG2  . THR A 1 79 ? -9.929  -11.785 -16.077 1.00 0.00 ? 79 THR A CG2  6  
ATOM 8447  H H    . THR A 1 79 ? -5.836  -11.573 -15.746 1.00 0.00 ? 79 THR A H    6  
ATOM 8448  H HA   . THR A 1 79 ? -7.953  -13.431 -16.515 1.00 0.00 ? 79 THR A HA   6  
ATOM 8449  H HB   . THR A 1 79 ? -8.272  -10.453 -16.231 1.00 0.00 ? 79 THR A HB   6  
ATOM 8450  H HG1  . THR A 1 79 ? -7.763  -12.347 -14.249 1.00 0.00 ? 79 THR A HG1  6  
ATOM 8451  H HG21 . THR A 1 79 ? -10.158 -11.729 -17.130 1.00 0.00 ? 79 THR A HG21 6  
ATOM 8452  H HG22 . THR A 1 79 ? -10.541 -11.078 -15.538 1.00 0.00 ? 79 THR A HG22 6  
ATOM 8453  H HG23 . THR A 1 79 ? -10.128 -12.784 -15.717 1.00 0.00 ? 79 THR A HG23 6  
ATOM 8454  N N    . LYS A 1 80 ? -7.645  -13.031 -18.967 1.00 0.00 ? 80 LYS A N    6  
ATOM 8455  C CA   . LYS A 1 80 ? -7.697  -12.774 -20.400 1.00 0.00 ? 80 LYS A CA   6  
ATOM 8456  C C    . LYS A 1 80 ? -8.944  -11.964 -20.733 1.00 0.00 ? 80 LYS A C    6  
ATOM 8457  O O    . LYS A 1 80 ? -8.898  -11.054 -21.558 1.00 0.00 ? 80 LYS A O    6  
ATOM 8458  C CB   . LYS A 1 80 ? -7.670  -14.100 -21.179 1.00 0.00 ? 80 LYS A CB   6  
ATOM 8459  C CG   . LYS A 1 80 ? -7.643  -13.953 -22.701 1.00 0.00 ? 80 LYS A CG   6  
ATOM 8460  C CD   . LYS A 1 80 ? -9.037  -13.795 -23.291 1.00 0.00 ? 80 LYS A CD   6  
ATOM 8461  C CE   . LYS A 1 80 ? -9.885  -15.035 -23.061 1.00 0.00 ? 80 LYS A CE   6  
ATOM 8462  N NZ   . LYS A 1 80 ? -11.287 -14.841 -23.509 1.00 0.00 ? 80 LYS A NZ   6  
ATOM 8463  H H    . LYS A 1 80 ? -7.691  -13.955 -18.643 1.00 0.00 ? 80 LYS A H    6  
ATOM 8464  H HA   . LYS A 1 80 ? -6.825  -12.191 -20.664 1.00 0.00 ? 80 LYS A HA   6  
ATOM 8465  H HB2  . LYS A 1 80 ? -6.793  -14.653 -20.884 1.00 0.00 ? 80 LYS A HB2  6  
ATOM 8466  H HB3  . LYS A 1 80 ? -8.547  -14.674 -20.913 1.00 0.00 ? 80 LYS A HB3  6  
ATOM 8467  H HG2  . LYS A 1 80 ? -7.058  -13.083 -22.955 1.00 0.00 ? 80 LYS A HG2  6  
ATOM 8468  H HG3  . LYS A 1 80 ? -7.181  -14.834 -23.126 1.00 0.00 ? 80 LYS A HG3  6  
ATOM 8469  H HD2  . LYS A 1 80 ? -9.522  -12.950 -22.826 1.00 0.00 ? 80 LYS A HD2  6  
ATOM 8470  H HD3  . LYS A 1 80 ? -8.950  -13.623 -24.354 1.00 0.00 ? 80 LYS A HD3  6  
ATOM 8471  H HE2  . LYS A 1 80 ? -9.451  -15.856 -23.610 1.00 0.00 ? 80 LYS A HE2  6  
ATOM 8472  H HE3  . LYS A 1 80 ? -9.881  -15.265 -22.005 1.00 0.00 ? 80 LYS A HE3  6  
ATOM 8473  H HZ1  . LYS A 1 80 ? -11.758 -14.117 -22.918 1.00 0.00 ? 80 LYS A HZ1  6  
ATOM 8474  H HZ2  . LYS A 1 80 ? -11.814 -15.737 -23.428 1.00 0.00 ? 80 LYS A HZ2  6  
ATOM 8475  H HZ3  . LYS A 1 80 ? -11.311 -14.527 -24.506 1.00 0.00 ? 80 LYS A HZ3  6  
ATOM 8476  N N    . THR A 1 81 ? -10.040 -12.292 -20.055 1.00 0.00 ? 81 THR A N    6  
ATOM 8477  C CA   . THR A 1 81 ? -11.316 -11.617 -20.250 1.00 0.00 ? 81 THR A CA   6  
ATOM 8478  C C    . THR A 1 81 ? -11.893 -11.956 -21.627 1.00 0.00 ? 81 THR A C    6  
ATOM 8479  O O    . THR A 1 81 ? -12.390 -13.094 -21.792 1.00 0.00 ? 81 THR A O    6  
ATOM 8480  C CB   . THR A 1 81 ? -11.180 -10.085 -20.082 1.00 0.00 ? 81 THR A CB   6  
ATOM 8481  O OG1  . THR A 1 81 ? -10.391 -9.792  -18.915 1.00 0.00 ? 81 THR A OG1  6  
ATOM 8482  C CG2  . THR A 1 81 ? -12.546 -9.430  -19.938 1.00 0.00 ? 81 THR A CG2  6  
ATOM 8483  O OXT  . THR A 1 81 ? -11.847 -11.105 -22.536 1.00 0.00 ? 81 THR A OXT  6  
ATOM 8484  H H    . THR A 1 81 ? -9.988  -13.015 -19.402 1.00 0.00 ? 81 THR A H    6  
ATOM 8485  H HA   . THR A 1 81 ? -11.998 -11.981 -19.494 1.00 0.00 ? 81 THR A HA   6  
ATOM 8486  H HB   . THR A 1 81 ? -10.690 -9.679  -20.953 1.00 0.00 ? 81 THR A HB   6  
ATOM 8487  H HG1  . THR A 1 81 ? -9.456  -9.875  -19.135 1.00 0.00 ? 81 THR A HG1  6  
ATOM 8488  H HG21 . THR A 1 81 ? -12.425 -8.360  -19.840 1.00 0.00 ? 81 THR A HG21 6  
ATOM 8489  H HG22 . THR A 1 81 ? -13.040 -9.818  -19.060 1.00 0.00 ? 81 THR A HG22 6  
ATOM 8490  H HG23 . THR A 1 81 ? -13.141 -9.647  -20.811 1.00 0.00 ? 81 THR A HG23 6  
ATOM 8491  N N    . SER A 1 1  ? -13.952 -9.901  -17.227 1.00 0.00 ? 1  SER A N    7  
ATOM 8492  C CA   . SER A 1 1  ? -14.861 -9.393  -16.183 1.00 0.00 ? 1  SER A CA   7  
ATOM 8493  C C    . SER A 1 1  ? -14.532 -7.945  -15.840 1.00 0.00 ? 1  SER A C    7  
ATOM 8494  O O    . SER A 1 1  ? -13.579 -7.681  -15.102 1.00 0.00 ? 1  SER A O    7  
ATOM 8495  C CB   . SER A 1 1  ? -14.756 -10.265 -14.932 1.00 0.00 ? 1  SER A CB   7  
ATOM 8496  O OG   . SER A 1 1  ? -15.169 -11.593 -15.204 1.00 0.00 ? 1  SER A OG   7  
ATOM 8497  H H1   . SER A 1 1  ? -12.963 -9.771  -16.930 1.00 0.00 ? 1  SER A H1   7  
ATOM 8498  H H2   . SER A 1 1  ? -14.110 -9.390  -18.122 1.00 0.00 ? 1  SER A H2   7  
ATOM 8499  H H3   . SER A 1 1  ? -14.124 -10.919 -17.387 1.00 0.00 ? 1  SER A H3   7  
ATOM 8500  H HA   . SER A 1 1  ? -15.871 -9.439  -16.561 1.00 0.00 ? 1  SER A HA   7  
ATOM 8501  H HB2  . SER A 1 1  ? -13.732 -10.283 -14.590 1.00 0.00 ? 1  SER A HB2  7  
ATOM 8502  H HB3  . SER A 1 1  ? -15.388 -9.858  -14.155 1.00 0.00 ? 1  SER A HB3  7  
ATOM 8503  H HG   . SER A 1 1  ? -16.107 -11.683 -14.977 1.00 0.00 ? 1  SER A HG   7  
ATOM 8504  N N    . ASP A 1 2  ? -15.315 -7.018  -16.399 1.00 0.00 ? 2  ASP A N    7  
ATOM 8505  C CA   . ASP A 1 2  ? -15.153 -5.585  -16.141 1.00 0.00 ? 2  ASP A CA   7  
ATOM 8506  C C    . ASP A 1 2  ? -13.805 -5.081  -16.654 1.00 0.00 ? 2  ASP A C    7  
ATOM 8507  O O    . ASP A 1 2  ? -12.783 -5.180  -15.974 1.00 0.00 ? 2  ASP A O    7  
ATOM 8508  C CB   . ASP A 1 2  ? -15.326 -5.282  -14.647 1.00 0.00 ? 2  ASP A CB   7  
ATOM 8509  C CG   . ASP A 1 2  ? -15.023 -3.840  -14.291 1.00 0.00 ? 2  ASP A CG   7  
ATOM 8510  O OD1  . ASP A 1 2  ? -15.684 -2.933  -14.836 1.00 0.00 ? 2  ASP A OD1  7  
ATOM 8511  O OD2  . ASP A 1 2  ? -14.138 -3.616  -13.437 1.00 0.00 ? 2  ASP A OD2  7  
ATOM 8512  H H    . ASP A 1 2  ? -16.026 -7.308  -17.018 1.00 0.00 ? 2  ASP A H    7  
ATOM 8513  H HA   . ASP A 1 2  ? -15.934 -5.074  -16.686 1.00 0.00 ? 2  ASP A HA   7  
ATOM 8514  H HB2  . ASP A 1 2  ? -16.347 -5.492  -14.362 1.00 0.00 ? 2  ASP A HB2  7  
ATOM 8515  H HB3  . ASP A 1 2  ? -14.663 -5.921  -14.080 1.00 0.00 ? 2  ASP A HB3  7  
ATOM 8516  N N    . ARG A 1 3  ? -13.809 -4.558  -17.873 1.00 0.00 ? 3  ARG A N    7  
ATOM 8517  C CA   . ARG A 1 3  ? -12.592 -4.054  -18.494 1.00 0.00 ? 3  ARG A CA   7  
ATOM 8518  C C    . ARG A 1 3  ? -12.311 -2.624  -18.051 1.00 0.00 ? 3  ARG A C    7  
ATOM 8519  O O    . ARG A 1 3  ? -13.224 -1.921  -17.616 1.00 0.00 ? 3  ARG A O    7  
ATOM 8520  C CB   . ARG A 1 3  ? -12.695 -4.125  -20.021 1.00 0.00 ? 3  ARG A CB   7  
ATOM 8521  C CG   . ARG A 1 3  ? -13.929 -3.441  -20.589 1.00 0.00 ? 3  ARG A CG   7  
ATOM 8522  C CD   . ARG A 1 3  ? -13.958 -3.513  -22.105 1.00 0.00 ? 3  ARG A CD   7  
ATOM 8523  N NE   . ARG A 1 3  ? -15.242 -3.071  -22.646 1.00 0.00 ? 3  ARG A NE   7  
ATOM 8524  C CZ   . ARG A 1 3  ? -15.385 -2.442  -23.812 1.00 0.00 ? 3  ARG A CZ   7  
ATOM 8525  N NH1  . ARG A 1 3  ? -14.318 -2.154  -24.547 1.00 0.00 ? 3  ARG A NH1  7  
ATOM 8526  N NH2  . ARG A 1 3  ? -16.594 -2.097  -24.239 1.00 0.00 ? 3  ARG A NH2  7  
ATOM 8527  H H    . ARG A 1 3  ? -14.653 -4.502  -18.364 1.00 0.00 ? 3  ARG A H    7  
ATOM 8528  H HA   . ARG A 1 3  ? -11.774 -4.682  -18.169 1.00 0.00 ? 3  ARG A HA   7  
ATOM 8529  H HB2  . ARG A 1 3  ? -11.822 -3.658  -20.450 1.00 0.00 ? 3  ARG A HB2  7  
ATOM 8530  H HB3  . ARG A 1 3  ? -12.716 -5.163  -20.318 1.00 0.00 ? 3  ARG A HB3  7  
ATOM 8531  H HG2  . ARG A 1 3  ? -14.811 -3.927  -20.199 1.00 0.00 ? 3  ARG A HG2  7  
ATOM 8532  H HG3  . ARG A 1 3  ? -13.925 -2.404  -20.286 1.00 0.00 ? 3  ARG A HG3  7  
ATOM 8533  H HD2  . ARG A 1 3  ? -13.174 -2.880  -22.498 1.00 0.00 ? 3  ARG A HD2  7  
ATOM 8534  H HD3  . ARG A 1 3  ? -13.780 -4.533  -22.409 1.00 0.00 ? 3  ARG A HD3  7  
ATOM 8535  H HE   . ARG A 1 3  ? -16.050 -3.269  -22.105 1.00 0.00 ? 3  ARG A HE   7  
ATOM 8536  H HH11 . ARG A 1 3  ? -13.405 -2.413  -24.231 1.00 0.00 ? 3  ARG A HH11 7  
ATOM 8537  H HH12 . ARG A 1 3  ? -14.421 -1.655  -25.417 1.00 0.00 ? 3  ARG A HH12 7  
ATOM 8538  H HH21 . ARG A 1 3  ? -17.402 -2.303  -23.685 1.00 0.00 ? 3  ARG A HH21 7  
ATOM 8539  H HH22 . ARG A 1 3  ? -16.706 -1.636  -25.130 1.00 0.00 ? 3  ARG A HH22 7  
ATOM 8540  N N    . VAL A 1 4  ? -11.035 -2.232  -18.166 1.00 0.00 ? 4  VAL A N    7  
ATOM 8541  C CA   . VAL A 1 4  ? -10.518 -0.912  -17.765 1.00 0.00 ? 4  VAL A CA   7  
ATOM 8542  C C    . VAL A 1 4  ? -10.885 -0.540  -16.327 1.00 0.00 ? 4  VAL A C    7  
ATOM 8543  O O    . VAL A 1 4  ? -12.020 -0.175  -16.011 1.00 0.00 ? 4  VAL A O    7  
ATOM 8544  C CB   . VAL A 1 4  ? -10.858 0.245   -18.754 1.00 0.00 ? 4  VAL A CB   7  
ATOM 8545  C CG1  . VAL A 1 4  ? -10.296 -0.060  -20.132 1.00 0.00 ? 4  VAL A CG1  7  
ATOM 8546  C CG2  . VAL A 1 4  ? -12.348 0.538   -18.856 1.00 0.00 ? 4  VAL A CG2  7  
ATOM 8547  H H    . VAL A 1 4  ? -10.398 -2.869  -18.559 1.00 0.00 ? 4  VAL A H    7  
ATOM 8548  H HA   . VAL A 1 4  ? -9.441  -1.022  -17.778 1.00 0.00 ? 4  VAL A HA   7  
ATOM 8549  H HB   . VAL A 1 4  ? -10.366 1.136   -18.394 1.00 0.00 ? 4  VAL A HB   7  
ATOM 8550  H HG11 . VAL A 1 4  ? -10.557 0.739   -20.811 1.00 0.00 ? 4  VAL A HG11 7  
ATOM 8551  H HG12 . VAL A 1 4  ? -10.709 -0.989  -20.493 1.00 0.00 ? 4  VAL A HG12 7  
ATOM 8552  H HG13 . VAL A 1 4  ? -9.221  -0.143  -20.072 1.00 0.00 ? 4  VAL A HG13 7  
ATOM 8553  H HG21 . VAL A 1 4  ? -12.508 1.368   -19.526 1.00 0.00 ? 4  VAL A HG21 7  
ATOM 8554  H HG22 . VAL A 1 4  ? -12.733 0.787   -17.877 1.00 0.00 ? 4  VAL A HG22 7  
ATOM 8555  H HG23 . VAL A 1 4  ? -12.863 -0.334  -19.232 1.00 0.00 ? 4  VAL A HG23 7  
ATOM 8556  N N    . LYS A 1 5  ? -9.892  -0.619  -15.457 1.00 0.00 ? 5  LYS A N    7  
ATOM 8557  C CA   . LYS A 1 5  ? -10.096 -0.377  -14.039 1.00 0.00 ? 5  LYS A CA   7  
ATOM 8558  C C    . LYS A 1 5  ? -10.042 1.111   -13.718 1.00 0.00 ? 5  LYS A C    7  
ATOM 8559  O O    . LYS A 1 5  ? -9.019  1.776   -13.913 1.00 0.00 ? 5  LYS A O    7  
ATOM 8560  C CB   . LYS A 1 5  ? -9.061  -1.143  -13.217 1.00 0.00 ? 5  LYS A CB   7  
ATOM 8561  C CG   . LYS A 1 5  ? -9.106  -2.638  -13.470 1.00 0.00 ? 5  LYS A CG   7  
ATOM 8562  C CD   . LYS A 1 5  ? -10.470 -3.218  -13.118 1.00 0.00 ? 5  LYS A CD   7  
ATOM 8563  C CE   . LYS A 1 5  ? -10.648 -4.608  -13.702 1.00 0.00 ? 5  LYS A CE   7  
ATOM 8564  N NZ   . LYS A 1 5  ? -11.921 -5.239  -13.262 1.00 0.00 ? 5  LYS A NZ   7  
ATOM 8565  H H    . LYS A 1 5  ? -8.995  -0.842  -15.778 1.00 0.00 ? 5  LYS A H    7  
ATOM 8566  H HA   . LYS A 1 5  ? -11.078 -0.746  -13.785 1.00 0.00 ? 5  LYS A HA   7  
ATOM 8567  H HB2  . LYS A 1 5  ? -8.075  -0.782  -13.468 1.00 0.00 ? 5  LYS A HB2  7  
ATOM 8568  H HB3  . LYS A 1 5  ? -9.248  -0.970  -12.168 1.00 0.00 ? 5  LYS A HB3  7  
ATOM 8569  H HG2  . LYS A 1 5  ? -8.907  -2.822  -14.514 1.00 0.00 ? 5  LYS A HG2  7  
ATOM 8570  H HG3  . LYS A 1 5  ? -8.355  -3.119  -12.865 1.00 0.00 ? 5  LYS A HG3  7  
ATOM 8571  H HD2  . LYS A 1 5  ? -10.560 -3.276  -12.044 1.00 0.00 ? 5  LYS A HD2  7  
ATOM 8572  H HD3  . LYS A 1 5  ? -11.238 -2.569  -13.512 1.00 0.00 ? 5  LYS A HD3  7  
ATOM 8573  H HE2  . LYS A 1 5  ? -10.652 -4.532  -14.780 1.00 0.00 ? 5  LYS A HE2  7  
ATOM 8574  H HE3  . LYS A 1 5  ? -9.819  -5.224  -13.392 1.00 0.00 ? 5  LYS A HE3  7  
ATOM 8575  H HZ1  . LYS A 1 5  ? -11.922 -5.367  -12.226 1.00 0.00 ? 5  LYS A HZ1  7  
ATOM 8576  H HZ2  . LYS A 1 5  ? -12.034 -6.168  -13.716 1.00 0.00 ? 5  LYS A HZ2  7  
ATOM 8577  H HZ3  . LYS A 1 5  ? -12.733 -4.634  -13.525 1.00 0.00 ? 5  LYS A HZ3  7  
ATOM 8578  N N    . ARG A 1 6  ? -11.168 1.615   -13.245 1.00 0.00 ? 6  ARG A N    7  
ATOM 8579  C CA   . ARG A 1 6  ? -11.322 3.011   -12.878 1.00 0.00 ? 6  ARG A CA   7  
ATOM 8580  C C    . ARG A 1 6  ? -11.440 3.144   -11.361 1.00 0.00 ? 6  ARG A C    7  
ATOM 8581  O O    . ARG A 1 6  ? -11.611 2.140   -10.664 1.00 0.00 ? 6  ARG A O    7  
ATOM 8582  C CB   . ARG A 1 6  ? -12.571 3.578   -13.559 1.00 0.00 ? 6  ARG A CB   7  
ATOM 8583  C CG   . ARG A 1 6  ? -12.469 3.626   -15.074 1.00 0.00 ? 6  ARG A CG   7  
ATOM 8584  C CD   . ARG A 1 6  ? -13.834 3.800   -15.711 1.00 0.00 ? 6  ARG A CD   7  
ATOM 8585  N NE   . ARG A 1 6  ? -14.670 2.614   -15.525 1.00 0.00 ? 6  ARG A NE   7  
ATOM 8586  C CZ   . ARG A 1 6  ? -15.910 2.637   -15.044 1.00 0.00 ? 6  ARG A CZ   7  
ATOM 8587  N NH1  . ARG A 1 6  ? -16.480 3.784   -14.701 1.00 0.00 ? 6  ARG A NH1  7  
ATOM 8588  N NH2  . ARG A 1 6  ? -16.586 1.509   -14.913 1.00 0.00 ? 6  ARG A NH2  7  
ATOM 8589  H H    . ARG A 1 6  ? -11.942 1.011   -13.130 1.00 0.00 ? 6  ARG A H    7  
ATOM 8590  H HA   . ARG A 1 6  ? -10.453 3.553   -13.218 1.00 0.00 ? 6  ARG A HA   7  
ATOM 8591  H HB2  . ARG A 1 6  ? -13.420 2.965   -13.297 1.00 0.00 ? 6  ARG A HB2  7  
ATOM 8592  H HB3  . ARG A 1 6  ? -12.740 4.583   -13.201 1.00 0.00 ? 6  ARG A HB3  7  
ATOM 8593  H HG2  . ARG A 1 6  ? -11.842 4.458   -15.357 1.00 0.00 ? 6  ARG A HG2  7  
ATOM 8594  H HG3  . ARG A 1 6  ? -12.031 2.704   -15.425 1.00 0.00 ? 6  ARG A HG3  7  
ATOM 8595  H HD2  . ARG A 1 6  ? -14.324 4.649   -15.258 1.00 0.00 ? 6  ARG A HD2  7  
ATOM 8596  H HD3  . ARG A 1 6  ? -13.706 3.979   -16.768 1.00 0.00 ? 6  ARG A HD3  7  
ATOM 8597  H HE   . ARG A 1 6  ? -14.278 1.746   -15.773 1.00 0.00 ? 6  ARG A HE   7  
ATOM 8598  H HH11 . ARG A 1 6  ? -15.982 4.645   -14.800 1.00 0.00 ? 6  ARG A HH11 7  
ATOM 8599  H HH12 . ARG A 1 6  ? -17.417 3.787   -14.327 1.00 0.00 ? 6  ARG A HH12 7  
ATOM 8600  H HH21 . ARG A 1 6  ? -16.163 0.633   -15.173 1.00 0.00 ? 6  ARG A HH21 7  
ATOM 8601  H HH22 . ARG A 1 6  ? -17.520 1.523   -14.546 1.00 0.00 ? 6  ARG A HH22 7  
ATOM 8602  N N    . PRO A 1 7  ? -11.303 4.372   -10.822 1.00 0.00 ? 7  PRO A N    7  
ATOM 8603  C CA   . PRO A 1 7  ? -11.536 4.642   -9.397  1.00 0.00 ? 7  PRO A CA   7  
ATOM 8604  C C    . PRO A 1 7  ? -12.884 4.098   -8.919  1.00 0.00 ? 7  PRO A C    7  
ATOM 8605  O O    . PRO A 1 7  ? -13.867 4.088   -9.664  1.00 0.00 ? 7  PRO A O    7  
ATOM 8606  C CB   . PRO A 1 7  ? -11.503 6.167   -9.316  1.00 0.00 ? 7  PRO A CB   7  
ATOM 8607  C CG   . PRO A 1 7  ? -10.620 6.574   -10.443 1.00 0.00 ? 7  PRO A CG   7  
ATOM 8608  C CD   . PRO A 1 7  ? -10.890 5.589   -11.545 1.00 0.00 ? 7  PRO A CD   7  
ATOM 8609  H HA   . PRO A 1 7  ? -10.747 4.229   -8.782  1.00 0.00 ? 7  PRO A HA   7  
ATOM 8610  H HB2  . PRO A 1 7  ? -12.503 6.559   -9.432  1.00 0.00 ? 7  PRO A HB2  7  
ATOM 8611  H HB3  . PRO A 1 7  ? -11.096 6.473   -8.363  1.00 0.00 ? 7  PRO A HB3  7  
ATOM 8612  H HG2  . PRO A 1 7  ? -10.870 7.574   -10.764 1.00 0.00 ? 7  PRO A HG2  7  
ATOM 8613  H HG3  . PRO A 1 7  ? -9.585  6.522   -10.138 1.00 0.00 ? 7  PRO A HG3  7  
ATOM 8614  H HD2  . PRO A 1 7  ? -11.684 5.945   -12.182 1.00 0.00 ? 7  PRO A HD2  7  
ATOM 8615  H HD3  . PRO A 1 7  ? -9.993  5.409   -12.118 1.00 0.00 ? 7  PRO A HD3  7  
ATOM 8616  N N    . MET A 1 8  ? -12.913 3.662   -7.672  1.00 0.00 ? 8  MET A N    7  
ATOM 8617  C CA   . MET A 1 8  ? -14.059 2.961   -7.112  1.00 0.00 ? 8  MET A CA   7  
ATOM 8618  C C    . MET A 1 8  ? -14.287 3.445   -5.683  1.00 0.00 ? 8  MET A C    7  
ATOM 8619  O O    . MET A 1 8  ? -13.505 4.242   -5.177  1.00 0.00 ? 8  MET A O    7  
ATOM 8620  C CB   . MET A 1 8  ? -13.815 1.444   -7.155  1.00 0.00 ? 8  MET A CB   7  
ATOM 8621  C CG   . MET A 1 8  ? -15.039 0.602   -6.821  1.00 0.00 ? 8  MET A CG   7  
ATOM 8622  S SD   . MET A 1 8  ? -16.452 0.963   -7.880  1.00 0.00 ? 8  MET A SD   7  
ATOM 8623  C CE   . MET A 1 8  ? -17.634 -0.241  -7.279  1.00 0.00 ? 8  MET A CE   7  
ATOM 8624  H H    . MET A 1 8  ? -12.140 3.830   -7.096  1.00 0.00 ? 8  MET A H    7  
ATOM 8625  H HA   . MET A 1 8  ? -14.925 3.204   -7.709  1.00 0.00 ? 8  MET A HA   7  
ATOM 8626  H HB2  . MET A 1 8  ? -13.481 1.177   -8.148  1.00 0.00 ? 8  MET A HB2  7  
ATOM 8627  H HB3  . MET A 1 8  ? -13.036 1.200   -6.450  1.00 0.00 ? 8  MET A HB3  7  
ATOM 8628  H HG2  . MET A 1 8  ? -14.781 -0.440  -6.935  1.00 0.00 ? 8  MET A HG2  7  
ATOM 8629  H HG3  . MET A 1 8  ? -15.318 0.791   -5.795  1.00 0.00 ? 8  MET A HG3  7  
ATOM 8630  H HE1  . MET A 1 8  ? -17.232 -1.235  -7.411  1.00 0.00 ? 8  MET A HE1  7  
ATOM 8631  H HE2  . MET A 1 8  ? -18.557 -0.149  -7.832  1.00 0.00 ? 8  MET A HE2  7  
ATOM 8632  H HE3  . MET A 1 8  ? -17.823 -0.065  -6.231  1.00 0.00 ? 8  MET A HE3  7  
ATOM 8633  N N    . ASN A 1 9  ? -15.388 3.031   -5.067  1.00 0.00 ? 9  ASN A N    7  
ATOM 8634  C CA   . ASN A 1 9  ? -15.682 3.389   -3.683  1.00 0.00 ? 9  ASN A CA   7  
ATOM 8635  C C    . ASN A 1 9  ? -14.488 3.110   -2.763  1.00 0.00 ? 9  ASN A C    7  
ATOM 8636  O O    . ASN A 1 9  ? -13.695 2.194   -3.008  1.00 0.00 ? 9  ASN A O    7  
ATOM 8637  C CB   . ASN A 1 9  ? -16.923 2.635   -3.191  1.00 0.00 ? 9  ASN A CB   7  
ATOM 8638  C CG   . ASN A 1 9  ? -16.691 1.148   -3.001  1.00 0.00 ? 9  ASN A CG   7  
ATOM 8639  O OD1  . ASN A 1 9  ? -16.714 0.375   -3.957  1.00 0.00 ? 9  ASN A OD1  7  
ATOM 8640  N ND2  . ASN A 1 9  ? -16.502 0.736   -1.760  1.00 0.00 ? 9  ASN A ND2  7  
ATOM 8641  H H    . ASN A 1 9  ? -16.022 2.472   -5.554  1.00 0.00 ? 9  ASN A H    7  
ATOM 8642  H HA   . ASN A 1 9  ? -15.889 4.448   -3.659  1.00 0.00 ? 9  ASN A HA   7  
ATOM 8643  H HB2  . ASN A 1 9  ? -17.232 3.053   -2.244  1.00 0.00 ? 9  ASN A HB2  7  
ATOM 8644  H HB3  . ASN A 1 9  ? -17.718 2.765   -3.908  1.00 0.00 ? 9  ASN A HB3  7  
ATOM 8645  H HD21 . ASN A 1 9  ? -16.520 1.412   -1.040  1.00 0.00 ? 9  ASN A HD21 7  
ATOM 8646  H HD22 . ASN A 1 9  ? -16.377 -0.223  -1.604  1.00 0.00 ? 9  ASN A HD22 7  
ATOM 8647  N N    . ALA A 1 10 ? -14.390 3.910   -1.704  1.00 0.00 ? 10 ALA A N    7  
ATOM 8648  C CA   . ALA A 1 10 ? -13.255 3.892   -0.782  1.00 0.00 ? 10 ALA A CA   7  
ATOM 8649  C C    . ALA A 1 10 ? -12.847 2.486   -0.326  1.00 0.00 ? 10 ALA A C    7  
ATOM 8650  O O    . ALA A 1 10 ? -11.657 2.177   -0.306  1.00 0.00 ? 10 ALA A O    7  
ATOM 8651  C CB   . ALA A 1 10 ? -13.573 4.755   0.428   1.00 0.00 ? 10 ALA A CB   7  
ATOM 8652  H H    . ALA A 1 10 ? -15.099 4.570   -1.552  1.00 0.00 ? 10 ALA A H    7  
ATOM 8653  H HA   . ALA A 1 10 ? -12.416 4.344   -1.288  1.00 0.00 ? 10 ALA A HA   7  
ATOM 8654  H HB1  . ALA A 1 10 ? -13.853 5.746   0.102   1.00 0.00 ? 10 ALA A HB1  7  
ATOM 8655  H HB2  . ALA A 1 10 ? -12.703 4.817   1.066   1.00 0.00 ? 10 ALA A HB2  7  
ATOM 8656  H HB3  . ALA A 1 10 ? -14.392 4.314   0.978   1.00 0.00 ? 10 ALA A HB3  7  
ATOM 8657  N N    . PHE A 1 11 ? -13.808 1.634   0.041   1.00 0.00 ? 11 PHE A N    7  
ATOM 8658  C CA   . PHE A 1 11 ? -13.472 0.288   0.522   1.00 0.00 ? 11 PHE A CA   7  
ATOM 8659  C C    . PHE A 1 11 ? -12.642 -0.467  -0.515  1.00 0.00 ? 11 PHE A C    7  
ATOM 8660  O O    . PHE A 1 11 ? -11.601 -1.046  -0.194  1.00 0.00 ? 11 PHE A O    7  
ATOM 8661  C CB   . PHE A 1 11 ? -14.725 -0.525  0.870   1.00 0.00 ? 11 PHE A CB   7  
ATOM 8662  C CG   . PHE A 1 11 ? -14.399 -1.871  1.465   1.00 0.00 ? 11 PHE A CG   7  
ATOM 8663  C CD1  . PHE A 1 11 ? -14.002 -1.974  2.788   1.00 0.00 ? 11 PHE A CD1  7  
ATOM 8664  C CD2  . PHE A 1 11 ? -14.463 -3.027  0.701   1.00 0.00 ? 11 PHE A CD2  7  
ATOM 8665  C CE1  . PHE A 1 11 ? -13.682 -3.198  3.343   1.00 0.00 ? 11 PHE A CE1  7  
ATOM 8666  C CE2  . PHE A 1 11 ? -14.140 -4.256  1.247   1.00 0.00 ? 11 PHE A CE2  7  
ATOM 8667  C CZ   . PHE A 1 11 ? -13.747 -4.341  2.573   1.00 0.00 ? 11 PHE A CZ   7  
ATOM 8668  H H    . PHE A 1 11 ? -14.750 1.916   -0.002  1.00 0.00 ? 11 PHE A H    7  
ATOM 8669  H HA   . PHE A 1 11 ? -12.877 0.404   1.416   1.00 0.00 ? 11 PHE A HA   7  
ATOM 8670  H HB2  . PHE A 1 11 ? -15.318 0.024   1.587   1.00 0.00 ? 11 PHE A HB2  7  
ATOM 8671  H HB3  . PHE A 1 11 ? -15.305 -0.686  -0.027  1.00 0.00 ? 11 PHE A HB3  7  
ATOM 8672  H HD1  . PHE A 1 11 ? -13.948 -1.081  3.394   1.00 0.00 ? 11 PHE A HD1  7  
ATOM 8673  H HD2  . PHE A 1 11 ? -14.771 -2.962  -0.334  1.00 0.00 ? 11 PHE A HD2  7  
ATOM 8674  H HE1  . PHE A 1 11 ? -13.379 -3.261  4.378   1.00 0.00 ? 11 PHE A HE1  7  
ATOM 8675  H HE2  . PHE A 1 11 ? -14.194 -5.148  0.642   1.00 0.00 ? 11 PHE A HE2  7  
ATOM 8676  H HZ   . PHE A 1 11 ? -13.489 -5.299  3.006   1.00 0.00 ? 11 PHE A HZ   7  
ATOM 8677  N N    . MET A 1 12 ? -13.097 -0.444  -1.763  1.00 0.00 ? 12 MET A N    7  
ATOM 8678  C CA   . MET A 1 12 ? -12.375 -1.101  -2.844  1.00 0.00 ? 12 MET A CA   7  
ATOM 8679  C C    . MET A 1 12 ? -11.038 -0.411  -3.071  1.00 0.00 ? 12 MET A C    7  
ATOM 8680  O O    . MET A 1 12 ? -10.025 -1.062  -3.342  1.00 0.00 ? 12 MET A O    7  
ATOM 8681  C CB   . MET A 1 12 ? -13.194 -1.090  -4.137  1.00 0.00 ? 12 MET A CB   7  
ATOM 8682  C CG   . MET A 1 12 ? -14.381 -2.037  -4.119  1.00 0.00 ? 12 MET A CG   7  
ATOM 8683  S SD   . MET A 1 12 ? -13.873 -3.763  -3.975  1.00 0.00 ? 12 MET A SD   7  
ATOM 8684  C CE   . MET A 1 12 ? -15.469 -4.579  -4.013  1.00 0.00 ? 12 MET A CE   7  
ATOM 8685  H H    . MET A 1 12 ? -13.925 0.039   -1.961  1.00 0.00 ? 12 MET A H    7  
ATOM 8686  H HA   . MET A 1 12 ? -12.194 -2.123  -2.548  1.00 0.00 ? 12 MET A HA   7  
ATOM 8687  H HB2  . MET A 1 12 ? -13.562 -0.090  -4.307  1.00 0.00 ? 12 MET A HB2  7  
ATOM 8688  H HB3  . MET A 1 12 ? -12.551 -1.371  -4.958  1.00 0.00 ? 12 MET A HB3  7  
ATOM 8689  H HG2  . MET A 1 12 ? -15.014 -1.786  -3.280  1.00 0.00 ? 12 MET A HG2  7  
ATOM 8690  H HG3  . MET A 1 12 ? -14.937 -1.912  -5.037  1.00 0.00 ? 12 MET A HG3  7  
ATOM 8691  H HE1  . MET A 1 12 ? -15.974 -4.345  -4.939  1.00 0.00 ? 12 MET A HE1  7  
ATOM 8692  H HE2  . MET A 1 12 ? -16.068 -4.239  -3.181  1.00 0.00 ? 12 MET A HE2  7  
ATOM 8693  H HE3  . MET A 1 12 ? -15.328 -5.647  -3.940  1.00 0.00 ? 12 MET A HE3  7  
ATOM 8694  N N    . VAL A 1 13 ? -11.045 0.910   -2.947  1.00 0.00 ? 13 VAL A N    7  
ATOM 8695  C CA   . VAL A 1 13 ? -9.832  1.705   -3.064  1.00 0.00 ? 13 VAL A CA   7  
ATOM 8696  C C    . VAL A 1 13 ? -8.792  1.270   -2.050  1.00 0.00 ? 13 VAL A C    7  
ATOM 8697  O O    . VAL A 1 13 ? -7.621  1.165   -2.373  1.00 0.00 ? 13 VAL A O    7  
ATOM 8698  C CB   . VAL A 1 13 ? -10.110 3.208   -2.878  1.00 0.00 ? 13 VAL A CB   7  
ATOM 8699  C CG1  . VAL A 1 13 ? -8.817  3.976   -2.686  1.00 0.00 ? 13 VAL A CG1  7  
ATOM 8700  C CG2  . VAL A 1 13 ? -10.864 3.756   -4.070  1.00 0.00 ? 13 VAL A CG2  7  
ATOM 8701  H H    . VAL A 1 13 ? -11.895 1.364   -2.767  1.00 0.00 ? 13 VAL A H    7  
ATOM 8702  H HA   . VAL A 1 13 ? -9.435  1.556   -4.057  1.00 0.00 ? 13 VAL A HA   7  
ATOM 8703  H HB   . VAL A 1 13 ? -10.721 3.342   -1.995  1.00 0.00 ? 13 VAL A HB   7  
ATOM 8704  H HG11 . VAL A 1 13 ? -8.206  3.880   -3.572  1.00 0.00 ? 13 VAL A HG11 7  
ATOM 8705  H HG12 . VAL A 1 13 ? -8.282  3.576   -1.838  1.00 0.00 ? 13 VAL A HG12 7  
ATOM 8706  H HG13 . VAL A 1 13 ? -9.039  5.019   -2.513  1.00 0.00 ? 13 VAL A HG13 7  
ATOM 8707  H HG21 . VAL A 1 13 ? -11.804 3.235   -4.172  1.00 0.00 ? 13 VAL A HG21 7  
ATOM 8708  H HG22 . VAL A 1 13 ? -10.274 3.614   -4.965  1.00 0.00 ? 13 VAL A HG22 7  
ATOM 8709  H HG23 . VAL A 1 13 ? -11.049 4.808   -3.925  1.00 0.00 ? 13 VAL A HG23 7  
ATOM 8710  N N    . TRP A 1 14 ? -9.214  1.009   -0.828  1.00 0.00 ? 14 TRP A N    7  
ATOM 8711  C CA   . TRP A 1 14 ? -8.275  0.601   0.197   1.00 0.00 ? 14 TRP A CA   7  
ATOM 8712  C C    . TRP A 1 14 ? -7.761  -0.804  -0.077  1.00 0.00 ? 14 TRP A C    7  
ATOM 8713  O O    . TRP A 1 14 ? -6.646  -1.141  0.291   1.00 0.00 ? 14 TRP A O    7  
ATOM 8714  C CB   . TRP A 1 14 ? -8.887  0.694   1.588   1.00 0.00 ? 14 TRP A CB   7  
ATOM 8715  C CG   . TRP A 1 14 ? -7.992  1.415   2.546   1.00 0.00 ? 14 TRP A CG   7  
ATOM 8716  C CD1  . TRP A 1 14 ? -7.251  2.531   2.281   1.00 0.00 ? 14 TRP A CD1  7  
ATOM 8717  C CD2  . TRP A 1 14 ? -7.754  1.091   3.921   1.00 0.00 ? 14 TRP A CD2  7  
ATOM 8718  N NE1  . TRP A 1 14 ? -6.556  2.912   3.400   1.00 0.00 ? 14 TRP A NE1  7  
ATOM 8719  C CE2  . TRP A 1 14 ? -6.851  2.047   4.420   1.00 0.00 ? 14 TRP A CE2  7  
ATOM 8720  C CE3  . TRP A 1 14 ? -8.212  0.086   4.779   1.00 0.00 ? 14 TRP A CE3  7  
ATOM 8721  C CZ2  . TRP A 1 14 ? -6.400  2.031   5.734   1.00 0.00 ? 14 TRP A CZ2  7  
ATOM 8722  C CZ3  . TRP A 1 14 ? -7.762  0.071   6.087   1.00 0.00 ? 14 TRP A CZ3  7  
ATOM 8723  C CH2  . TRP A 1 14 ? -6.864  1.039   6.551   1.00 0.00 ? 14 TRP A CH2  7  
ATOM 8724  H H    . TRP A 1 14 ? -10.170 1.106   -0.609  1.00 0.00 ? 14 TRP A H    7  
ATOM 8725  H HA   . TRP A 1 14 ? -7.435  1.280   0.149   1.00 0.00 ? 14 TRP A HA   7  
ATOM 8726  H HB2  . TRP A 1 14 ? -9.826  1.228   1.532   1.00 0.00 ? 14 TRP A HB2  7  
ATOM 8727  H HB3  . TRP A 1 14 ? -9.060  -0.300  1.973   1.00 0.00 ? 14 TRP A HB3  7  
ATOM 8728  H HD1  . TRP A 1 14 ? -7.219  3.027   1.322   1.00 0.00 ? 14 TRP A HD1  7  
ATOM 8729  H HE1  . TRP A 1 14 ? -5.948  3.681   3.458   1.00 0.00 ? 14 TRP A HE1  7  
ATOM 8730  H HE3  . TRP A 1 14 ? -8.904  -0.672  4.436   1.00 0.00 ? 14 TRP A HE3  7  
ATOM 8731  H HZ2  . TRP A 1 14 ? -5.708  2.771   6.107   1.00 0.00 ? 14 TRP A HZ2  7  
ATOM 8732  H HZ3  . TRP A 1 14 ? -8.102  -0.698  6.764   1.00 0.00 ? 14 TRP A HZ3  7  
ATOM 8733  H HH2  . TRP A 1 14 ? -6.536  0.989   7.577   1.00 0.00 ? 14 TRP A HH2  7  
ATOM 8734  N N    . SER A 1 15 ? -8.556  -1.624  -0.747  1.00 0.00 ? 15 SER A N    7  
ATOM 8735  C CA   . SER A 1 15 ? -8.106  -2.961  -1.086  1.00 0.00 ? 15 SER A CA   7  
ATOM 8736  C C    . SER A 1 15 ? -6.979  -2.878  -2.117  1.00 0.00 ? 15 SER A C    7  
ATOM 8737  O O    . SER A 1 15 ? -5.839  -3.278  -1.853  1.00 0.00 ? 15 SER A O    7  
ATOM 8738  C CB   . SER A 1 15 ? -9.272  -3.787  -1.637  1.00 0.00 ? 15 SER A CB   7  
ATOM 8739  O OG   . SER A 1 15 ? -10.396 -3.721  -0.772  1.00 0.00 ? 15 SER A OG   7  
ATOM 8740  H H    . SER A 1 15 ? -9.449  -1.321  -1.032  1.00 0.00 ? 15 SER A H    7  
ATOM 8741  H HA   . SER A 1 15 ? -7.730  -3.428  -0.188  1.00 0.00 ? 15 SER A HA   7  
ATOM 8742  H HB2  . SER A 1 15 ? -9.555  -3.403  -2.606  1.00 0.00 ? 15 SER A HB2  7  
ATOM 8743  H HB3  . SER A 1 15 ? -8.969  -4.820  -1.733  1.00 0.00 ? 15 SER A HB3  7  
ATOM 8744  H HG   . SER A 1 15 ? -10.220 -3.092  -0.064  1.00 0.00 ? 15 SER A HG   7  
ATOM 8745  N N    . ARG A 1 16 ? -7.286  -2.271  -3.259  1.00 0.00 ? 16 ARG A N    7  
ATOM 8746  C CA   . ARG A 1 16 ? -6.344  -2.222  -4.374  1.00 0.00 ? 16 ARG A CA   7  
ATOM 8747  C C    . ARG A 1 16 ? -5.263  -1.164  -4.152  1.00 0.00 ? 16 ARG A C    7  
ATOM 8748  O O    . ARG A 1 16 ? -4.116  -1.342  -4.549  1.00 0.00 ? 16 ARG A O    7  
ATOM 8749  C CB   . ARG A 1 16 ? -7.093  -1.960  -5.690  1.00 0.00 ? 16 ARG A CB   7  
ATOM 8750  C CG   . ARG A 1 16 ? -7.906  -0.674  -5.701  1.00 0.00 ? 16 ARG A CG   7  
ATOM 8751  C CD   . ARG A 1 16 ? -8.766  -0.559  -6.952  1.00 0.00 ? 16 ARG A CD   7  
ATOM 8752  N NE   . ARG A 1 16 ? -9.796  -1.601  -7.010  1.00 0.00 ? 16 ARG A NE   7  
ATOM 8753  C CZ   . ARG A 1 16 ? -10.853 -1.571  -7.829  1.00 0.00 ? 16 ARG A CZ   7  
ATOM 8754  N NH1  . ARG A 1 16 ? -11.040 -0.543  -8.651  1.00 0.00 ? 16 ARG A NH1  7  
ATOM 8755  N NH2  . ARG A 1 16 ? -11.728 -2.570  -7.819  1.00 0.00 ? 16 ARG A NH2  7  
ATOM 8756  H H    . ARG A 1 16 ? -8.168  -1.835  -3.348  1.00 0.00 ? 16 ARG A H    7  
ATOM 8757  H HA   . ARG A 1 16 ? -5.868  -3.189  -4.436  1.00 0.00 ? 16 ARG A HA   7  
ATOM 8758  H HB2  . ARG A 1 16 ? -6.373  -1.906  -6.492  1.00 0.00 ? 16 ARG A HB2  7  
ATOM 8759  H HB3  . ARG A 1 16 ? -7.765  -2.786  -5.878  1.00 0.00 ? 16 ARG A HB3  7  
ATOM 8760  H HG2  . ARG A 1 16 ? -8.548  -0.658  -4.832  1.00 0.00 ? 16 ARG A HG2  7  
ATOM 8761  H HG3  . ARG A 1 16 ? -7.228  0.166   -5.663  1.00 0.00 ? 16 ARG A HG3  7  
ATOM 8762  H HD2  . ARG A 1 16 ? -9.245  0.408   -6.955  1.00 0.00 ? 16 ARG A HD2  7  
ATOM 8763  H HD3  . ARG A 1 16 ? -8.130  -0.648  -7.822  1.00 0.00 ? 16 ARG A HD3  7  
ATOM 8764  H HE   . ARG A 1 16 ? -9.690  -2.369  -6.406  1.00 0.00 ? 16 ARG A HE   7  
ATOM 8765  H HH11 . ARG A 1 16 ? -10.390 0.218   -8.665  1.00 0.00 ? 16 ARG A HH11 7  
ATOM 8766  H HH12 . ARG A 1 16 ? -11.837 -0.523  -9.262  1.00 0.00 ? 16 ARG A HH12 7  
ATOM 8767  H HH21 . ARG A 1 16 ? -11.601 -3.351  -7.203  1.00 0.00 ? 16 ARG A HH21 7  
ATOM 8768  H HH22 . ARG A 1 16 ? -12.528 -2.551  -8.441  1.00 0.00 ? 16 ARG A HH22 7  
ATOM 8769  N N    . GLY A 1 17 ? -5.640  -0.078  -3.496  1.00 0.00 ? 17 GLY A N    7  
ATOM 8770  C CA   . GLY A 1 17 ? -4.753  1.053   -3.308  1.00 0.00 ? 17 GLY A CA   7  
ATOM 8771  C C    . GLY A 1 17 ? -3.792  0.872   -2.151  1.00 0.00 ? 17 GLY A C    7  
ATOM 8772  O O    . GLY A 1 17 ? -2.615  1.189   -2.277  1.00 0.00 ? 17 GLY A O    7  
ATOM 8773  H H    . GLY A 1 17 ? -6.547  -0.039  -3.120  1.00 0.00 ? 17 GLY A H    7  
ATOM 8774  H HA2  . GLY A 1 17 ? -4.180  1.199   -4.214  1.00 0.00 ? 17 GLY A HA2  7  
ATOM 8775  H HA3  . GLY A 1 17 ? -5.350  1.936   -3.131  1.00 0.00 ? 17 GLY A HA3  7  
ATOM 8776  N N    . GLN A 1 18 ? -4.282  0.378   -1.016  1.00 0.00 ? 18 GLN A N    7  
ATOM 8777  C CA   . GLN A 1 18 ? -3.410  0.137   0.132   1.00 0.00 ? 18 GLN A CA   7  
ATOM 8778  C C    . GLN A 1 18 ? -2.427  -0.968  -0.205  1.00 0.00 ? 18 GLN A C    7  
ATOM 8779  O O    . GLN A 1 18 ? -1.244  -0.879  0.117   1.00 0.00 ? 18 GLN A O    7  
ATOM 8780  C CB   . GLN A 1 18 ? -4.217  -0.230  1.380   1.00 0.00 ? 18 GLN A CB   7  
ATOM 8781  C CG   . GLN A 1 18 ? -4.032  0.724   2.551   1.00 0.00 ? 18 GLN A CG   7  
ATOM 8782  C CD   . GLN A 1 18 ? -2.760  0.469   3.341   1.00 0.00 ? 18 GLN A CD   7  
ATOM 8783  O OE1  . GLN A 1 18 ? -1.759  -0.004  2.810   1.00 0.00 ? 18 GLN A OE1  7  
ATOM 8784  N NE2  . GLN A 1 18 ? -2.786  0.804   4.619   1.00 0.00 ? 18 GLN A NE2  7  
ATOM 8785  H H    . GLN A 1 18 ? -5.238  0.174   -0.947  1.00 0.00 ? 18 GLN A H    7  
ATOM 8786  H HA   . GLN A 1 18 ? -2.857  1.045   0.324   1.00 0.00 ? 18 GLN A HA   7  
ATOM 8787  H HB2  . GLN A 1 18 ? -5.264  -0.242  1.121   1.00 0.00 ? 18 GLN A HB2  7  
ATOM 8788  H HB3  . GLN A 1 18 ? -3.925  -1.217  1.702   1.00 0.00 ? 18 GLN A HB3  7  
ATOM 8789  H HG2  . GLN A 1 18 ? -4.005  1.734   2.173   1.00 0.00 ? 18 GLN A HG2  7  
ATOM 8790  H HG3  . GLN A 1 18 ? -4.875  0.615   3.217   1.00 0.00 ? 18 GLN A HG3  7  
ATOM 8791  H HE21 . GLN A 1 18 ? -3.614  1.187   4.984   1.00 0.00 ? 18 GLN A HE21 7  
ATOM 8792  H HE22 . GLN A 1 18 ? -1.979  0.657   5.149   1.00 0.00 ? 18 GLN A HE22 7  
ATOM 8793  N N    . ARG A 1 19 ? -2.905  -1.998  -0.893  1.00 0.00 ? 19 ARG A N    7  
ATOM 8794  C CA   . ARG A 1 19 ? -2.019  -3.050  -1.353  1.00 0.00 ? 19 ARG A CA   7  
ATOM 8795  C C    . ARG A 1 19 ? -1.020  -2.469  -2.358  1.00 0.00 ? 19 ARG A C    7  
ATOM 8796  O O    . ARG A 1 19 ? 0.124   -2.905  -2.432  1.00 0.00 ? 19 ARG A O    7  
ATOM 8797  C CB   . ARG A 1 19 ? -2.826  -4.203  -1.962  1.00 0.00 ? 19 ARG A CB   7  
ATOM 8798  C CG   . ARG A 1 19 ? -2.119  -5.548  -1.898  1.00 0.00 ? 19 ARG A CG   7  
ATOM 8799  C CD   . ARG A 1 19 ? -1.140  -5.733  -3.043  1.00 0.00 ? 19 ARG A CD   7  
ATOM 8800  N NE   . ARG A 1 19 ? -1.828  -5.965  -4.312  1.00 0.00 ? 19 ARG A NE   7  
ATOM 8801  C CZ   . ARG A 1 19 ? -1.222  -6.350  -5.433  1.00 0.00 ? 19 ARG A CZ   7  
ATOM 8802  N NH1  . ARG A 1 19 ? 0.102   -6.484  -5.475  1.00 0.00 ? 19 ARG A NH1  7  
ATOM 8803  N NH2  . ARG A 1 19 ? -1.947  -6.588  -6.518  1.00 0.00 ? 19 ARG A NH2  7  
ATOM 8804  H H    . ARG A 1 19 ? -3.873  -2.055  -1.086  1.00 0.00 ? 19 ARG A H    7  
ATOM 8805  H HA   . ARG A 1 19 ? -1.472  -3.418  -0.495  1.00 0.00 ? 19 ARG A HA   7  
ATOM 8806  H HB2  . ARG A 1 19 ? -3.764  -4.288  -1.434  1.00 0.00 ? 19 ARG A HB2  7  
ATOM 8807  H HB3  . ARG A 1 19 ? -3.028  -3.977  -3.000  1.00 0.00 ? 19 ARG A HB3  7  
ATOM 8808  H HG2  . ARG A 1 19 ? -1.578  -5.612  -0.965  1.00 0.00 ? 19 ARG A HG2  7  
ATOM 8809  H HG3  . ARG A 1 19 ? -2.859  -6.332  -1.938  1.00 0.00 ? 19 ARG A HG3  7  
ATOM 8810  H HD2  . ARG A 1 19 ? -0.536  -4.842  -3.131  1.00 0.00 ? 19 ARG A HD2  7  
ATOM 8811  H HD3  . ARG A 1 19 ? -0.505  -6.579  -2.825  1.00 0.00 ? 19 ARG A HD3  7  
ATOM 8812  H HE   . ARG A 1 19 ? -2.808  -5.854  -4.320  1.00 0.00 ? 19 ARG A HE   7  
ATOM 8813  H HH11 . ARG A 1 19 ? 0.652   -6.295  -4.660  1.00 0.00 ? 19 ARG A HH11 7  
ATOM 8814  H HH12 . ARG A 1 19 ? 0.556   -6.786  -6.322  1.00 0.00 ? 19 ARG A HH12 7  
ATOM 8815  H HH21 . ARG A 1 19 ? -2.948  -6.480  -6.487  1.00 0.00 ? 19 ARG A HH21 7  
ATOM 8816  H HH22 . ARG A 1 19 ? -1.506  -6.892  -7.370  1.00 0.00 ? 19 ARG A HH22 7  
ATOM 8817  N N    . ARG A 1 20 ? -1.459  -1.464  -3.110  1.00 0.00 ? 20 ARG A N    7  
ATOM 8818  C CA   . ARG A 1 20 ? -0.593  -0.765  -4.061  1.00 0.00 ? 20 ARG A CA   7  
ATOM 8819  C C    . ARG A 1 20 ? 0.474   0.065   -3.339  1.00 0.00 ? 20 ARG A C    7  
ATOM 8820  O O    . ARG A 1 20 ? 1.670   -0.142  -3.562  1.00 0.00 ? 20 ARG A O    7  
ATOM 8821  C CB   . ARG A 1 20 ? -1.432  0.126   -4.987  1.00 0.00 ? 20 ARG A CB   7  
ATOM 8822  C CG   . ARG A 1 20 ? -0.634  1.154   -5.773  1.00 0.00 ? 20 ARG A CG   7  
ATOM 8823  C CD   . ARG A 1 20 ? 0.395   0.515   -6.693  1.00 0.00 ? 20 ARG A CD   7  
ATOM 8824  N NE   . ARG A 1 20 ? 1.212   1.529   -7.351  1.00 0.00 ? 20 ARG A NE   7  
ATOM 8825  C CZ   . ARG A 1 20 ? 2.276   1.265   -8.105  1.00 0.00 ? 20 ARG A CZ   7  
ATOM 8826  N NH1  . ARG A 1 20 ? 2.678   0.014   -8.291  1.00 0.00 ? 20 ARG A NH1  7  
ATOM 8827  N NH2  . ARG A 1 20 ? 2.939   2.260   -8.672  1.00 0.00 ? 20 ARG A NH2  7  
ATOM 8828  H H    . ARG A 1 20 ? -2.394  -1.181  -3.024  1.00 0.00 ? 20 ARG A H    7  
ATOM 8829  H HA   . ARG A 1 20 ? -0.094  -1.514  -4.658  1.00 0.00 ? 20 ARG A HA   7  
ATOM 8830  H HB2  . ARG A 1 20 ? -1.950  -0.505  -5.692  1.00 0.00 ? 20 ARG A HB2  7  
ATOM 8831  H HB3  . ARG A 1 20 ? -2.162  0.652   -4.390  1.00 0.00 ? 20 ARG A HB3  7  
ATOM 8832  H HG2  . ARG A 1 20 ? -1.318  1.736   -6.374  1.00 0.00 ? 20 ARG A HG2  7  
ATOM 8833  H HG3  . ARG A 1 20 ? -0.126  1.805   -5.077  1.00 0.00 ? 20 ARG A HG3  7  
ATOM 8834  H HD2  . ARG A 1 20 ? 1.035   -0.131  -6.109  1.00 0.00 ? 20 ARG A HD2  7  
ATOM 8835  H HD3  . ARG A 1 20 ? -0.119  -0.066  -7.444  1.00 0.00 ? 20 ARG A HD3  7  
ATOM 8836  H HE   . ARG A 1 20 ? 0.945   2.474   -7.222  1.00 0.00 ? 20 ARG A HE   7  
ATOM 8837  H HH11 . ARG A 1 20 ? 2.182   -0.752  -7.862  1.00 0.00 ? 20 ARG A HH11 7  
ATOM 8838  H HH12 . ARG A 1 20 ? 3.483   -0.179  -8.871  1.00 0.00 ? 20 ARG A HH12 7  
ATOM 8839  H HH21 . ARG A 1 20 ? 2.641   3.204   -8.534  1.00 0.00 ? 20 ARG A HH21 7  
ATOM 8840  H HH22 . ARG A 1 20 ? 3.753   2.072   -9.244  1.00 0.00 ? 20 ARG A HH22 7  
ATOM 8841  N N    . LYS A 1 21 ? 0.050   1.002   -2.479  1.00 0.00 ? 21 LYS A N    7  
ATOM 8842  C CA   . LYS A 1 21 ? 0.996   1.821   -1.719  1.00 0.00 ? 21 LYS A CA   7  
ATOM 8843  C C    . LYS A 1 21 ? 1.984   0.944   -0.939  1.00 0.00 ? 21 LYS A C    7  
ATOM 8844  O O    . LYS A 1 21 ? 3.175   1.237   -0.887  1.00 0.00 ? 21 LYS A O    7  
ATOM 8845  C CB   . LYS A 1 21 ? 0.246   2.763   -0.762  1.00 0.00 ? 21 LYS A CB   7  
ATOM 8846  C CG   . LYS A 1 21 ? -0.366  2.065   0.443   1.00 0.00 ? 21 LYS A CG   7  
ATOM 8847  C CD   . LYS A 1 21 ? -1.232  2.998   1.275   1.00 0.00 ? 21 LYS A CD   7  
ATOM 8848  C CE   . LYS A 1 21 ? -0.461  4.212   1.762   1.00 0.00 ? 21 LYS A CE   7  
ATOM 8849  N NZ   . LYS A 1 21 ? -1.312  5.111   2.582   1.00 0.00 ? 21 LYS A NZ   7  
ATOM 8850  H H    . LYS A 1 21 ? -0.926  1.177   -2.382  1.00 0.00 ? 21 LYS A H    7  
ATOM 8851  H HA   . LYS A 1 21 ? 1.554   2.417   -2.427  1.00 0.00 ? 21 LYS A HA   7  
ATOM 8852  H HB2  . LYS A 1 21 ? 0.936   3.511   -0.403  1.00 0.00 ? 21 LYS A HB2  7  
ATOM 8853  H HB3  . LYS A 1 21 ? -0.547  3.253   -1.308  1.00 0.00 ? 21 LYS A HB3  7  
ATOM 8854  H HG2  . LYS A 1 21 ? -0.976  1.245   0.095   1.00 0.00 ? 21 LYS A HG2  7  
ATOM 8855  H HG3  . LYS A 1 21 ? 0.430   1.682   1.063   1.00 0.00 ? 21 LYS A HG3  7  
ATOM 8856  H HD2  . LYS A 1 21 ? -2.062  3.333   0.672   1.00 0.00 ? 21 LYS A HD2  7  
ATOM 8857  H HD3  . LYS A 1 21 ? -1.605  2.454   2.131   1.00 0.00 ? 21 LYS A HD3  7  
ATOM 8858  H HE2  . LYS A 1 21 ? 0.373   3.875   2.359   1.00 0.00 ? 21 LYS A HE2  7  
ATOM 8859  H HE3  . LYS A 1 21 ? -0.094  4.756   0.905   1.00 0.00 ? 21 LYS A HE3  7  
ATOM 8860  H HZ1  . LYS A 1 21 ? -0.804  5.998   2.782   1.00 0.00 ? 21 LYS A HZ1  7  
ATOM 8861  H HZ2  . LYS A 1 21 ? -1.556  4.651   3.486   1.00 0.00 ? 21 LYS A HZ2  7  
ATOM 8862  H HZ3  . LYS A 1 21 ? -2.197  5.334   2.069   1.00 0.00 ? 21 LYS A HZ3  7  
ATOM 8863  N N    . MET A 1 22 ? 1.490   -0.145  -0.363  1.00 0.00 ? 22 MET A N    7  
ATOM 8864  C CA   . MET A 1 22 ? 2.320   -1.029  0.442   1.00 0.00 ? 22 MET A CA   7  
ATOM 8865  C C    . MET A 1 22 ? 3.263   -1.849  -0.434  1.00 0.00 ? 22 MET A C    7  
ATOM 8866  O O    . MET A 1 22 ? 4.381   -2.154  -0.028  1.00 0.00 ? 22 MET A O    7  
ATOM 8867  C CB   . MET A 1 22 ? 1.441   -1.957  1.280   1.00 0.00 ? 22 MET A CB   7  
ATOM 8868  C CG   . MET A 1 22 ? 2.225   -2.832  2.244   1.00 0.00 ? 22 MET A CG   7  
ATOM 8869  S SD   . MET A 1 22 ? 1.165   -3.871  3.264   1.00 0.00 ? 22 MET A SD   7  
ATOM 8870  C CE   . MET A 1 22 ? 0.174   -2.629  4.095   1.00 0.00 ? 22 MET A CE   7  
ATOM 8871  H H    . MET A 1 22 ? 0.538   -0.354  -0.472  1.00 0.00 ? 22 MET A H    7  
ATOM 8872  H HA   . MET A 1 22 ? 2.909   -0.416  1.105   1.00 0.00 ? 22 MET A HA   7  
ATOM 8873  H HB2  . MET A 1 22 ? 0.748   -1.358  1.852   1.00 0.00 ? 22 MET A HB2  7  
ATOM 8874  H HB3  . MET A 1 22 ? 0.883   -2.601  0.616   1.00 0.00 ? 22 MET A HB3  7  
ATOM 8875  H HG2  . MET A 1 22 ? 2.884   -3.468  1.674   1.00 0.00 ? 22 MET A HG2  7  
ATOM 8876  H HG3  . MET A 1 22 ? 2.812   -2.194  2.888   1.00 0.00 ? 22 MET A HG3  7  
ATOM 8877  H HE1  . MET A 1 22 ? 0.819   -1.975  4.665   1.00 0.00 ? 22 MET A HE1  7  
ATOM 8878  H HE2  . MET A 1 22 ? -0.527  -3.113  4.759   1.00 0.00 ? 22 MET A HE2  7  
ATOM 8879  H HE3  . MET A 1 22 ? -0.366  -2.049  3.361   1.00 0.00 ? 22 MET A HE3  7  
ATOM 8880  N N    . ALA A 1 23 ? 2.816   -2.191  -1.637  1.00 0.00 ? 23 ALA A N    7  
ATOM 8881  C CA   . ALA A 1 23 ? 3.616   -3.003  -2.549  1.00 0.00 ? 23 ALA A CA   7  
ATOM 8882  C C    . ALA A 1 23 ? 4.879   -2.268  -2.984  1.00 0.00 ? 23 ALA A C    7  
ATOM 8883  O O    . ALA A 1 23 ? 5.931   -2.880  -3.160  1.00 0.00 ? 23 ALA A O    7  
ATOM 8884  C CB   . ALA A 1 23 ? 2.797   -3.404  -3.766  1.00 0.00 ? 23 ALA A CB   7  
ATOM 8885  H H    . ALA A 1 23 ? 1.920   -1.895  -1.918  1.00 0.00 ? 23 ALA A H    7  
ATOM 8886  H HA   . ALA A 1 23 ? 3.899   -3.905  -2.026  1.00 0.00 ? 23 ALA A HA   7  
ATOM 8887  H HB1  . ALA A 1 23 ? 1.920   -3.947  -3.446  1.00 0.00 ? 23 ALA A HB1  7  
ATOM 8888  H HB2  . ALA A 1 23 ? 3.393   -4.031  -4.413  1.00 0.00 ? 23 ALA A HB2  7  
ATOM 8889  H HB3  . ALA A 1 23 ? 2.494   -2.518  -4.304  1.00 0.00 ? 23 ALA A HB3  7  
ATOM 8890  N N    . GLN A 1 24 ? 4.780   -0.958  -3.161  1.00 0.00 ? 24 GLN A N    7  
ATOM 8891  C CA   . GLN A 1 24 ? 5.939   -0.173  -3.568  1.00 0.00 ? 24 GLN A CA   7  
ATOM 8892  C C    . GLN A 1 24 ? 6.819   0.182   -2.373  1.00 0.00 ? 24 GLN A C    7  
ATOM 8893  O O    . GLN A 1 24 ? 8.031   0.353   -2.519  1.00 0.00 ? 24 GLN A O    7  
ATOM 8894  C CB   . GLN A 1 24 ? 5.511   1.090   -4.317  1.00 0.00 ? 24 GLN A CB   7  
ATOM 8895  C CG   . GLN A 1 24 ? 4.513   1.952   -3.569  1.00 0.00 ? 24 GLN A CG   7  
ATOM 8896  C CD   . GLN A 1 24 ? 4.200   3.247   -4.293  1.00 0.00 ? 24 GLN A CD   7  
ATOM 8897  O OE1  . GLN A 1 24 ? 3.859   4.254   -3.672  1.00 0.00 ? 24 GLN A OE1  7  
ATOM 8898  N NE2  . GLN A 1 24 ? 4.335   3.243   -5.612  1.00 0.00 ? 24 GLN A NE2  7  
ATOM 8899  H H    . GLN A 1 24 ? 3.910   -0.516  -3.027  1.00 0.00 ? 24 GLN A H    7  
ATOM 8900  H HA   . GLN A 1 24 ? 6.519   -0.789  -4.239  1.00 0.00 ? 24 GLN A HA   7  
ATOM 8901  H HB2  . GLN A 1 24 ? 6.388   1.689   -4.516  1.00 0.00 ? 24 GLN A HB2  7  
ATOM 8902  H HB3  . GLN A 1 24 ? 5.066   0.799   -5.257  1.00 0.00 ? 24 GLN A HB3  7  
ATOM 8903  H HG2  . GLN A 1 24 ? 3.597   1.395   -3.448  1.00 0.00 ? 24 GLN A HG2  7  
ATOM 8904  H HG3  . GLN A 1 24 ? 4.920   2.191   -2.596  1.00 0.00 ? 24 GLN A HG3  7  
ATOM 8905  H HE21 . GLN A 1 24 ? 4.630   2.410   -6.049  1.00 0.00 ? 24 GLN A HE21 7  
ATOM 8906  H HE22 . GLN A 1 24 ? 4.138   4.069   -6.097  1.00 0.00 ? 24 GLN A HE22 7  
ATOM 8907  N N    . GLU A 1 25 ? 6.216   0.279   -1.197  1.00 0.00 ? 25 GLU A N    7  
ATOM 8908  C CA   . GLU A 1 25 ? 6.961   0.599   0.011   1.00 0.00 ? 25 GLU A CA   7  
ATOM 8909  C C    . GLU A 1 25 ? 7.671   -0.635  0.561   1.00 0.00 ? 25 GLU A C    7  
ATOM 8910  O O    . GLU A 1 25 ? 8.867   -0.601  0.843   1.00 0.00 ? 25 GLU A O    7  
ATOM 8911  C CB   . GLU A 1 25 ? 6.028   1.170   1.078   1.00 0.00 ? 25 GLU A CB   7  
ATOM 8912  C CG   . GLU A 1 25 ? 5.461   2.533   0.731   1.00 0.00 ? 25 GLU A CG   7  
ATOM 8913  C CD   . GLU A 1 25 ? 4.591   3.091   1.839   1.00 0.00 ? 25 GLU A CD   7  
ATOM 8914  O OE1  . GLU A 1 25 ? 3.721   2.356   2.350   1.00 0.00 ? 25 GLU A OE1  7  
ATOM 8915  O OE2  . GLU A 1 25 ? 4.765   4.276   2.200   1.00 0.00 ? 25 GLU A OE2  7  
ATOM 8916  H H    . GLU A 1 25 ? 5.248   0.138   -1.139  1.00 0.00 ? 25 GLU A H    7  
ATOM 8917  H HA   . GLU A 1 25 ? 7.702   1.343   -0.245  1.00 0.00 ? 25 GLU A HA   7  
ATOM 8918  H HB2  . GLU A 1 25 ? 5.200   0.488   1.214   1.00 0.00 ? 25 GLU A HB2  7  
ATOM 8919  H HB3  . GLU A 1 25 ? 6.572   1.257   2.007   1.00 0.00 ? 25 GLU A HB3  7  
ATOM 8920  H HG2  . GLU A 1 25 ? 6.277   3.216   0.555   1.00 0.00 ? 25 GLU A HG2  7  
ATOM 8921  H HG3  . GLU A 1 25 ? 4.865   2.444   -0.166  1.00 0.00 ? 25 GLU A HG3  7  
ATOM 8922  N N    . ASN A 1 26 ? 6.926   -1.724  0.692   1.00 0.00 ? 26 ASN A N    7  
ATOM 8923  C CA   . ASN A 1 26 ? 7.439   -2.954  1.292   1.00 0.00 ? 26 ASN A CA   7  
ATOM 8924  C C    . ASN A 1 26 ? 6.535   -4.142  0.957   1.00 0.00 ? 26 ASN A C    7  
ATOM 8925  O O    . ASN A 1 26 ? 5.617   -4.477  1.708   1.00 0.00 ? 26 ASN A O    7  
ATOM 8926  C CB   . ASN A 1 26 ? 7.620   -2.807  2.820   1.00 0.00 ? 26 ASN A CB   7  
ATOM 8927  C CG   . ASN A 1 26 ? 6.530   -1.990  3.510   1.00 0.00 ? 26 ASN A CG   7  
ATOM 8928  O OD1  . ASN A 1 26 ? 6.805   -1.273  4.473   1.00 0.00 ? 26 ASN A OD1  7  
ATOM 8929  N ND2  . ASN A 1 26 ? 5.295   -2.107  3.055   1.00 0.00 ? 26 ASN A ND2  7  
ATOM 8930  H H    . ASN A 1 26 ? 5.996   -1.706  0.369   1.00 0.00 ? 26 ASN A H    7  
ATOM 8931  H HA   . ASN A 1 26 ? 8.408   -3.137  0.852   1.00 0.00 ? 26 ASN A HA   7  
ATOM 8932  H HB2  . ASN A 1 26 ? 7.626   -3.791  3.265   1.00 0.00 ? 26 ASN A HB2  7  
ATOM 8933  H HB3  . ASN A 1 26 ? 8.570   -2.331  3.014   1.00 0.00 ? 26 ASN A HB3  7  
ATOM 8934  H HD21 . ASN A 1 26 ? 5.136   -2.715  2.302   1.00 0.00 ? 26 ASN A HD21 7  
ATOM 8935  H HD22 . ASN A 1 26 ? 4.587   -1.568  3.481   1.00 0.00 ? 26 ASN A HD22 7  
ATOM 8936  N N    . PRO A 1 27 ? 6.775   -4.779  -0.200  1.00 0.00 ? 27 PRO A N    7  
ATOM 8937  C CA   . PRO A 1 27 ? 5.939   -5.879  -0.698  1.00 0.00 ? 27 PRO A CA   7  
ATOM 8938  C C    . PRO A 1 27 ? 6.170   -7.191  0.057   1.00 0.00 ? 27 PRO A C    7  
ATOM 8939  O O    . PRO A 1 27 ? 6.663   -8.170  -0.508  1.00 0.00 ? 27 PRO A O    7  
ATOM 8940  C CB   . PRO A 1 27 ? 6.377   -6.015  -2.158  1.00 0.00 ? 27 PRO A CB   7  
ATOM 8941  C CG   . PRO A 1 27 ? 7.788   -5.540  -2.178  1.00 0.00 ? 27 PRO A CG   7  
ATOM 8942  C CD   . PRO A 1 27 ? 7.889   -4.473  -1.123  1.00 0.00 ? 27 PRO A CD   7  
ATOM 8943  H HA   . PRO A 1 27 ? 4.891   -5.625  -0.657  1.00 0.00 ? 27 PRO A HA   7  
ATOM 8944  H HB2  . PRO A 1 27 ? 6.303   -7.047  -2.466  1.00 0.00 ? 27 PRO A HB2  7  
ATOM 8945  H HB3  . PRO A 1 27 ? 5.748   -5.401  -2.785  1.00 0.00 ? 27 PRO A HB3  7  
ATOM 8946  H HG2  . PRO A 1 27 ? 8.453   -6.358  -1.948  1.00 0.00 ? 27 PRO A HG2  7  
ATOM 8947  H HG3  . PRO A 1 27 ? 8.023   -5.128  -3.149  1.00 0.00 ? 27 PRO A HG3  7  
ATOM 8948  H HD2  . PRO A 1 27 ? 8.839   -4.537  -0.612  1.00 0.00 ? 27 PRO A HD2  7  
ATOM 8949  H HD3  . PRO A 1 27 ? 7.763   -3.496  -1.564  1.00 0.00 ? 27 PRO A HD3  7  
ATOM 8950  N N    . LYS A 1 28 ? 5.825   -7.205  1.336   1.00 0.00 ? 28 LYS A N    7  
ATOM 8951  C CA   . LYS A 1 28 ? 5.965   -8.406  2.148   1.00 0.00 ? 28 LYS A CA   7  
ATOM 8952  C C    . LYS A 1 28 ? 4.630   -9.134  2.249   1.00 0.00 ? 28 LYS A C    7  
ATOM 8953  O O    . LYS A 1 28 ? 4.581   -10.356 2.386   1.00 0.00 ? 28 LYS A O    7  
ATOM 8954  C CB   . LYS A 1 28 ? 6.484   -8.042  3.541   1.00 0.00 ? 28 LYS A CB   7  
ATOM 8955  C CG   . LYS A 1 28 ? 7.771   -7.236  3.502   1.00 0.00 ? 28 LYS A CG   7  
ATOM 8956  C CD   . LYS A 1 28 ? 8.272   -6.893  4.895   1.00 0.00 ? 28 LYS A CD   7  
ATOM 8957  C CE   . LYS A 1 28 ? 9.471   -5.963  4.830   1.00 0.00 ? 28 LYS A CE   7  
ATOM 8958  N NZ   . LYS A 1 28 ? 10.031  -5.667  6.174   1.00 0.00 ? 28 LYS A NZ   7  
ATOM 8959  H H    . LYS A 1 28 ? 5.480   -6.382  1.746   1.00 0.00 ? 28 LYS A H    7  
ATOM 8960  H HA   . LYS A 1 28 ? 6.681   -9.053  1.663   1.00 0.00 ? 28 LYS A HA   7  
ATOM 8961  H HB2  . LYS A 1 28 ? 5.732   -7.460  4.054   1.00 0.00 ? 28 LYS A HB2  7  
ATOM 8962  H HB3  . LYS A 1 28 ? 6.667   -8.952  4.095   1.00 0.00 ? 28 LYS A HB3  7  
ATOM 8963  H HG2  . LYS A 1 28 ? 8.526   -7.814  2.992   1.00 0.00 ? 28 LYS A HG2  7  
ATOM 8964  H HG3  . LYS A 1 28 ? 7.590   -6.320  2.958   1.00 0.00 ? 28 LYS A HG3  7  
ATOM 8965  H HD2  . LYS A 1 28 ? 7.479   -6.408  5.443   1.00 0.00 ? 28 LYS A HD2  7  
ATOM 8966  H HD3  . LYS A 1 28 ? 8.559   -7.804  5.400   1.00 0.00 ? 28 LYS A HD3  7  
ATOM 8967  H HE2  . LYS A 1 28 ? 10.236  -6.428  4.226   1.00 0.00 ? 28 LYS A HE2  7  
ATOM 8968  H HE3  . LYS A 1 28 ? 9.166   -5.036  4.366   1.00 0.00 ? 28 LYS A HE3  7  
ATOM 8969  H HZ1  . LYS A 1 28 ? 9.288   -5.289  6.803   1.00 0.00 ? 28 LYS A HZ1  7  
ATOM 8970  H HZ2  . LYS A 1 28 ? 10.794  -4.961  6.094   1.00 0.00 ? 28 LYS A HZ2  7  
ATOM 8971  H HZ3  . LYS A 1 28 ? 10.421  -6.534  6.602   1.00 0.00 ? 28 LYS A HZ3  7  
ATOM 8972  N N    . MET A 1 29 ? 3.550   -8.375  2.150   1.00 0.00 ? 29 MET A N    7  
ATOM 8973  C CA   . MET A 1 29 ? 2.207   -8.933  2.170   1.00 0.00 ? 29 MET A CA   7  
ATOM 8974  C C    . MET A 1 29 ? 1.536   -8.656  0.834   1.00 0.00 ? 29 MET A C    7  
ATOM 8975  O O    . MET A 1 29 ? 1.679   -7.563  0.288   1.00 0.00 ? 29 MET A O    7  
ATOM 8976  C CB   . MET A 1 29 ? 1.398   -8.332  3.321   1.00 0.00 ? 29 MET A CB   7  
ATOM 8977  C CG   . MET A 1 29 ? 1.907   -8.736  4.697   1.00 0.00 ? 29 MET A CG   7  
ATOM 8978  S SD   . MET A 1 29 ? 1.088   -7.848  6.036   1.00 0.00 ? 29 MET A SD   7  
ATOM 8979  C CE   . MET A 1 29 ? 1.736   -6.194  5.795   1.00 0.00 ? 29 MET A CE   7  
ATOM 8980  H H    . MET A 1 29 ? 3.658   -7.407  2.044   1.00 0.00 ? 29 MET A H    7  
ATOM 8981  H HA   . MET A 1 29 ? 2.289   -10.001 2.309   1.00 0.00 ? 29 MET A HA   7  
ATOM 8982  H HB2  . MET A 1 29 ? 1.434   -7.255  3.249   1.00 0.00 ? 29 MET A HB2  7  
ATOM 8983  H HB3  . MET A 1 29 ? 0.372   -8.657  3.232   1.00 0.00 ? 29 MET A HB3  7  
ATOM 8984  H HG2  . MET A 1 29 ? 1.736   -9.793  4.831   1.00 0.00 ? 29 MET A HG2  7  
ATOM 8985  H HG3  . MET A 1 29 ? 2.968   -8.538  4.745   1.00 0.00 ? 29 MET A HG3  7  
ATOM 8986  H HE1  . MET A 1 29 ? 1.367   -5.547  6.576   1.00 0.00 ? 29 MET A HE1  7  
ATOM 8987  H HE2  . MET A 1 29 ? 1.419   -5.818  4.834   1.00 0.00 ? 29 MET A HE2  7  
ATOM 8988  H HE3  . MET A 1 29 ? 2.815   -6.223  5.832   1.00 0.00 ? 29 MET A HE3  7  
ATOM 8989  N N    . HIS A 1 30 ? 0.809   -9.628  0.299   1.00 0.00 ? 30 HIS A N    7  
ATOM 8990  C CA   . HIS A 1 30 ? 0.339   -9.511  -1.075  1.00 0.00 ? 30 HIS A CA   7  
ATOM 8991  C C    . HIS A 1 30 ? -1.176  -9.443  -1.209  1.00 0.00 ? 30 HIS A C    7  
ATOM 8992  O O    . HIS A 1 30 ? -1.662  -8.807  -2.137  1.00 0.00 ? 30 HIS A O    7  
ATOM 8993  C CB   . HIS A 1 30 ? 0.933   -10.610 -1.974  1.00 0.00 ? 30 HIS A CB   7  
ATOM 8994  C CG   . HIS A 1 30 ? 0.740   -12.019 -1.495  1.00 0.00 ? 30 HIS A CG   7  
ATOM 8995  N ND1  . HIS A 1 30 ? -0.043  -12.939 -2.160  1.00 0.00 ? 30 HIS A ND1  7  
ATOM 8996  C CD2  . HIS A 1 30 ? 1.275   -12.678 -0.441  1.00 0.00 ? 30 HIS A CD2  7  
ATOM 8997  C CE1  . HIS A 1 30 ? 0.015   -14.100 -1.531  1.00 0.00 ? 30 HIS A CE1  7  
ATOM 8998  N NE2  . HIS A 1 30 ? 0.809   -13.967 -0.487  1.00 0.00 ? 30 HIS A NE2  7  
ATOM 8999  H H    . HIS A 1 30 ? 0.579   -10.417 0.833   1.00 0.00 ? 30 HIS A H    7  
ATOM 9000  H HA   . HIS A 1 30 ? 0.716   -8.571  -1.433  1.00 0.00 ? 30 HIS A HA   7  
ATOM 9001  H HB2  . HIS A 1 30 ? 0.483   -10.536 -2.952  1.00 0.00 ? 30 HIS A HB2  7  
ATOM 9002  H HB3  . HIS A 1 30 ? 1.995   -10.437 -2.067  1.00 0.00 ? 30 HIS A HB3  7  
ATOM 9003  H HD1  . HIS A 1 30 ? -0.557  -12.769 -2.985  1.00 0.00 ? 30 HIS A HD1  7  
ATOM 9004  H HD2  . HIS A 1 30 ? 1.943   -12.263 0.303   1.00 0.00 ? 30 HIS A HD2  7  
ATOM 9005  H HE1  . HIS A 1 30 ? -0.500  -15.005 -1.822  1.00 0.00 ? 30 HIS A HE1  7  
ATOM 9006  H HE2  . HIS A 1 30 ? 1.121   -14.708 0.089   1.00 0.00 ? 30 HIS A HE2  7  
ATOM 9007  N N    . ASN A 1 31 ? -1.940  -10.065 -0.307  1.00 0.00 ? 31 ASN A N    7  
ATOM 9008  C CA   . ASN A 1 31 ? -3.404  -9.977  -0.414  1.00 0.00 ? 31 ASN A CA   7  
ATOM 9009  C C    . ASN A 1 31 ? -4.148  -10.494 0.821   1.00 0.00 ? 31 ASN A C    7  
ATOM 9010  O O    . ASN A 1 31 ? -5.092  -9.859  1.284   1.00 0.00 ? 31 ASN A O    7  
ATOM 9011  C CB   . ASN A 1 31 ? -3.917  -10.664 -1.705  1.00 0.00 ? 31 ASN A CB   7  
ATOM 9012  C CG   . ASN A 1 31 ? -3.308  -12.035 -1.998  1.00 0.00 ? 31 ASN A CG   7  
ATOM 9013  O OD1  . ASN A 1 31 ? -2.990  -12.347 -3.146  1.00 0.00 ? 31 ASN A OD1  7  
ATOM 9014  N ND2  . ASN A 1 31 ? -3.167  -12.872 -0.986  1.00 0.00 ? 31 ASN A ND2  7  
ATOM 9015  H H    . ASN A 1 31 ? -1.527  -10.569 0.428   1.00 0.00 ? 31 ASN A H    7  
ATOM 9016  H HA   . ASN A 1 31 ? -3.633  -8.924  -0.498  1.00 0.00 ? 31 ASN A HA   7  
ATOM 9017  H HB2  . ASN A 1 31 ? -4.985  -10.788 -1.629  1.00 0.00 ? 31 ASN A HB2  7  
ATOM 9018  H HB3  . ASN A 1 31 ? -3.704  -10.017 -2.546  1.00 0.00 ? 31 ASN A HB3  7  
ATOM 9019  H HD21 . ASN A 1 31 ? -3.456  -12.575 -0.103  1.00 0.00 ? 31 ASN A HD21 7  
ATOM 9020  H HD22 . ASN A 1 31 ? -2.798  -13.762 -1.167  1.00 0.00 ? 31 ASN A HD22 7  
ATOM 9021  N N    . SER A 1 32 ? -3.716  -11.611 1.381   1.00 0.00 ? 32 SER A N    7  
ATOM 9022  C CA   . SER A 1 32 ? -4.464  -12.251 2.453   1.00 0.00 ? 32 SER A CA   7  
ATOM 9023  C C    . SER A 1 32 ? -4.317  -11.481 3.756   1.00 0.00 ? 32 SER A C    7  
ATOM 9024  O O    . SER A 1 32 ? -5.305  -11.138 4.409   1.00 0.00 ? 32 SER A O    7  
ATOM 9025  C CB   . SER A 1 32 ? -3.965  -13.677 2.613   1.00 0.00 ? 32 SER A CB   7  
ATOM 9026  O OG   . SER A 1 32 ? -2.567  -13.725 2.384   1.00 0.00 ? 32 SER A OG   7  
ATOM 9027  H H    . SER A 1 32 ? -2.859  -12.000 1.100   1.00 0.00 ? 32 SER A H    7  
ATOM 9028  H HA   . SER A 1 32 ? -5.504  -12.270 2.169   1.00 0.00 ? 32 SER A HA   7  
ATOM 9029  H HB2  . SER A 1 32 ? -4.171  -14.020 3.617   1.00 0.00 ? 32 SER A HB2  7  
ATOM 9030  H HB3  . SER A 1 32 ? -4.462  -14.319 1.900   1.00 0.00 ? 32 SER A HB3  7  
ATOM 9031  H HG   . SER A 1 32 ? -2.347  -14.538 1.897   1.00 0.00 ? 32 SER A HG   7  
ATOM 9032  N N    . GLU A 1 33 ? -3.075  -11.166 4.092   1.00 0.00 ? 33 GLU A N    7  
ATOM 9033  C CA   . GLU A 1 33 ? -2.770  -10.407 5.294   1.00 0.00 ? 33 GLU A CA   7  
ATOM 9034  C C    . GLU A 1 33 ? -3.403  -9.034  5.191   1.00 0.00 ? 33 GLU A C    7  
ATOM 9035  O O    . GLU A 1 33 ? -3.970  -8.515  6.156   1.00 0.00 ? 33 GLU A O    7  
ATOM 9036  C CB   . GLU A 1 33 ? -1.257  -10.269 5.468   1.00 0.00 ? 33 GLU A CB   7  
ATOM 9037  C CG   . GLU A 1 33 ? -0.528  -11.596 5.607   1.00 0.00 ? 33 GLU A CG   7  
ATOM 9038  C CD   . GLU A 1 33 ? -0.939  -12.360 6.848   1.00 0.00 ? 33 GLU A CD   7  
ATOM 9039  O OE1  . GLU A 1 33 ? -0.508  -11.979 7.957   1.00 0.00 ? 33 GLU A OE1  7  
ATOM 9040  O OE2  . GLU A 1 33 ? -1.690  -13.349 6.720   1.00 0.00 ? 33 GLU A OE2  7  
ATOM 9041  H H    . GLU A 1 33 ? -2.346  -11.455 3.512   1.00 0.00 ? 33 GLU A H    7  
ATOM 9042  H HA   . GLU A 1 33 ? -3.185  -10.933 6.142   1.00 0.00 ? 33 GLU A HA   7  
ATOM 9043  H HB2  . GLU A 1 33 ? -0.854  -9.752  4.607   1.00 0.00 ? 33 GLU A HB2  7  
ATOM 9044  H HB3  . GLU A 1 33 ? -1.062  -9.680  6.352   1.00 0.00 ? 33 GLU A HB3  7  
ATOM 9045  H HG2  . GLU A 1 33 ? -0.747  -12.202 4.740   1.00 0.00 ? 33 GLU A HG2  7  
ATOM 9046  H HG3  . GLU A 1 33 ? 0.535   -11.407 5.653   1.00 0.00 ? 33 GLU A HG3  7  
ATOM 9047  N N    . ILE A 1 34 ? -3.317  -8.475  3.987   1.00 0.00 ? 34 ILE A N    7  
ATOM 9048  C CA   . ILE A 1 34 ? -3.911  -7.186  3.671   1.00 0.00 ? 34 ILE A CA   7  
ATOM 9049  C C    . ILE A 1 34 ? -5.393  -7.194  4.014   1.00 0.00 ? 34 ILE A C    7  
ATOM 9050  O O    . ILE A 1 34 ? -5.904  -6.255  4.616   1.00 0.00 ? 34 ILE A O    7  
ATOM 9051  C CB   . ILE A 1 34 ? -3.746  -6.853  2.168   1.00 0.00 ? 34 ILE A CB   7  
ATOM 9052  C CG1  . ILE A 1 34 ? -2.275  -6.963  1.746   1.00 0.00 ? 34 ILE A CG1  7  
ATOM 9053  C CG2  . ILE A 1 34 ? -4.288  -5.461  1.863   1.00 0.00 ? 34 ILE A CG2  7  
ATOM 9054  C CD1  . ILE A 1 34 ? -1.355  -6.000  2.465   1.00 0.00 ? 34 ILE A CD1  7  
ATOM 9055  H H    . ILE A 1 34 ? -2.835  -8.953  3.284   1.00 0.00 ? 34 ILE A H    7  
ATOM 9056  H HA   . ILE A 1 34 ? -3.412  -6.426  4.251   1.00 0.00 ? 34 ILE A HA   7  
ATOM 9057  H HB   . ILE A 1 34 ? -4.329  -7.565  1.602   1.00 0.00 ? 34 ILE A HB   7  
ATOM 9058  H HG12 . ILE A 1 34 ? -1.924  -7.963  1.948   1.00 0.00 ? 34 ILE A HG12 7  
ATOM 9059  H HG13 . ILE A 1 34 ? -2.198  -6.768  0.684   1.00 0.00 ? 34 ILE A HG13 7  
ATOM 9060  H HG21 . ILE A 1 34 ? -5.338  -5.421  2.114   1.00 0.00 ? 34 ILE A HG21 7  
ATOM 9061  H HG22 . ILE A 1 34 ? -4.160  -5.247  0.812   1.00 0.00 ? 34 ILE A HG22 7  
ATOM 9062  H HG23 . ILE A 1 34 ? -3.751  -4.729  2.447   1.00 0.00 ? 34 ILE A HG23 7  
ATOM 9063  H HD11 . ILE A 1 34 ? -0.343  -6.134  2.107   1.00 0.00 ? 34 ILE A HD11 7  
ATOM 9064  H HD12 . ILE A 1 34 ? -1.389  -6.194  3.527   1.00 0.00 ? 34 ILE A HD12 7  
ATOM 9065  H HD13 . ILE A 1 34 ? -1.674  -4.987  2.273   1.00 0.00 ? 34 ILE A HD13 7  
ATOM 9066  N N    . SER A 1 35 ? -6.064  -8.285  3.678   1.00 0.00 ? 35 SER A N    7  
ATOM 9067  C CA   . SER A 1 35 ? -7.508  -8.367  3.863   1.00 0.00 ? 35 SER A CA   7  
ATOM 9068  C C    . SER A 1 35 ? -7.864  -8.451  5.346   1.00 0.00 ? 35 SER A C    7  
ATOM 9069  O O    . SER A 1 35 ? -8.871  -7.896  5.790   1.00 0.00 ? 35 SER A O    7  
ATOM 9070  C CB   . SER A 1 35 ? -8.068  -9.577  3.106   1.00 0.00 ? 35 SER A CB   7  
ATOM 9071  O OG   . SER A 1 35 ? -7.765  -9.493  1.721   1.00 0.00 ? 35 SER A OG   7  
ATOM 9072  H H    . SER A 1 35 ? -5.575  -9.065  3.319   1.00 0.00 ? 35 SER A H    7  
ATOM 9073  H HA   . SER A 1 35 ? -7.942  -7.467  3.454   1.00 0.00 ? 35 SER A HA   7  
ATOM 9074  H HB2  . SER A 1 35 ? -7.630  -10.481 3.502   1.00 0.00 ? 35 SER A HB2  7  
ATOM 9075  H HB3  . SER A 1 35 ? -9.141  -9.611  3.227   1.00 0.00 ? 35 SER A HB3  7  
ATOM 9076  H HG   . SER A 1 35 ? -6.809  -9.553  1.597   1.00 0.00 ? 35 SER A HG   7  
ATOM 9077  N N    . LYS A 1 36 ? -7.007  -9.111  6.114   1.00 0.00 ? 36 LYS A N    7  
ATOM 9078  C CA   . LYS A 1 36 ? -7.284  -9.359  7.519   1.00 0.00 ? 36 LYS A CA   7  
ATOM 9079  C C    . LYS A 1 36 ? -7.033  -8.098  8.340   1.00 0.00 ? 36 LYS A C    7  
ATOM 9080  O O    . LYS A 1 36 ? -7.871  -7.693  9.149   1.00 0.00 ? 36 LYS A O    7  
ATOM 9081  C CB   . LYS A 1 36 ? -6.418  -10.522 8.022   1.00 0.00 ? 36 LYS A CB   7  
ATOM 9082  C CG   . LYS A 1 36 ? -6.892  -11.149 9.330   1.00 0.00 ? 36 LYS A CG   7  
ATOM 9083  C CD   . LYS A 1 36 ? -6.496  -10.325 10.547  1.00 0.00 ? 36 LYS A CD   7  
ATOM 9084  C CE   . LYS A 1 36 ? -6.998  -10.961 11.832  1.00 0.00 ? 36 LYS A CE   7  
ATOM 9085  N NZ   . LYS A 1 36 ? -6.481  -10.263 13.038  1.00 0.00 ? 36 LYS A NZ   7  
ATOM 9086  H H    . LYS A 1 36 ? -6.157  -9.425  5.729   1.00 0.00 ? 36 LYS A H    7  
ATOM 9087  H HA   . LYS A 1 36 ? -8.325  -9.631  7.609   1.00 0.00 ? 36 LYS A HA   7  
ATOM 9088  H HB2  . LYS A 1 36 ? -6.402  -11.295 7.267   1.00 0.00 ? 36 LYS A HB2  7  
ATOM 9089  H HB3  . LYS A 1 36 ? -5.410  -10.162 8.169   1.00 0.00 ? 36 LYS A HB3  7  
ATOM 9090  H HG2  . LYS A 1 36 ? -7.968  -11.231 9.305   1.00 0.00 ? 36 LYS A HG2  7  
ATOM 9091  H HG3  . LYS A 1 36 ? -6.459  -12.135 9.420   1.00 0.00 ? 36 LYS A HG3  7  
ATOM 9092  H HD2  . LYS A 1 36 ? -5.419  -10.253 10.589  1.00 0.00 ? 36 LYS A HD2  7  
ATOM 9093  H HD3  . LYS A 1 36 ? -6.923  -9.337  10.454  1.00 0.00 ? 36 LYS A HD3  7  
ATOM 9094  H HE2  . LYS A 1 36 ? -8.077  -10.922 11.840  1.00 0.00 ? 36 LYS A HE2  7  
ATOM 9095  H HE3  . LYS A 1 36 ? -6.677  -11.991 11.855  1.00 0.00 ? 36 LYS A HE3  7  
ATOM 9096  H HZ1  . LYS A 1 36 ? -6.874  -9.300  13.102  1.00 0.00 ? 36 LYS A HZ1  7  
ATOM 9097  H HZ2  . LYS A 1 36 ? -5.439  -10.203 12.998  1.00 0.00 ? 36 LYS A HZ2  7  
ATOM 9098  H HZ3  . LYS A 1 36 ? -6.749  -10.793 13.897  1.00 0.00 ? 36 LYS A HZ3  7  
ATOM 9099  N N    . ARG A 1 37 ? -5.889  -7.467  8.116   1.00 0.00 ? 37 ARG A N    7  
ATOM 9100  C CA   . ARG A 1 37 ? -5.501  -6.304  8.900   1.00 0.00 ? 37 ARG A CA   7  
ATOM 9101  C C    . ARG A 1 37 ? -6.302  -5.066  8.510   1.00 0.00 ? 37 ARG A C    7  
ATOM 9102  O O    . ARG A 1 37 ? -6.694  -4.286  9.373   1.00 0.00 ? 37 ARG A O    7  
ATOM 9103  C CB   . ARG A 1 37 ? -3.998  -6.046  8.774   1.00 0.00 ? 37 ARG A CB   7  
ATOM 9104  C CG   . ARG A 1 37 ? -3.161  -7.052  9.547   1.00 0.00 ? 37 ARG A CG   7  
ATOM 9105  C CD   . ARG A 1 37 ? -1.670  -6.837  9.339   1.00 0.00 ? 37 ARG A CD   7  
ATOM 9106  N NE   . ARG A 1 37 ? -0.875  -7.718  10.195  1.00 0.00 ? 37 ARG A NE   7  
ATOM 9107  C CZ   . ARG A 1 37 ? -0.552  -8.973  9.881   1.00 0.00 ? 37 ARG A CZ   7  
ATOM 9108  N NH1  . ARG A 1 37 ? -0.907  -9.480  8.709   1.00 0.00 ? 37 ARG A NH1  7  
ATOM 9109  N NH2  . ARG A 1 37 ? 0.134   -9.718  10.737  1.00 0.00 ? 37 ARG A NH2  7  
ATOM 9110  H H    . ARG A 1 37 ? -5.293  -7.789  7.403   1.00 0.00 ? 37 ARG A H    7  
ATOM 9111  H HA   . ARG A 1 37 ? -5.722  -6.531  9.933   1.00 0.00 ? 37 ARG A HA   7  
ATOM 9112  H HB2  . ARG A 1 37 ? -3.719  -6.099  7.730   1.00 0.00 ? 37 ARG A HB2  7  
ATOM 9113  H HB3  . ARG A 1 37 ? -3.777  -5.060  9.149   1.00 0.00 ? 37 ARG A HB3  7  
ATOM 9114  H HG2  . ARG A 1 37 ? -3.380  -6.954  10.600  1.00 0.00 ? 37 ARG A HG2  7  
ATOM 9115  H HG3  . ARG A 1 37 ? -3.419  -8.048  9.216   1.00 0.00 ? 37 ARG A HG3  7  
ATOM 9116  H HD2  . ARG A 1 37 ? -1.430  -7.039  8.306   1.00 0.00 ? 37 ARG A HD2  7  
ATOM 9117  H HD3  . ARG A 1 37 ? -1.431  -5.810  9.572   1.00 0.00 ? 37 ARG A HD3  7  
ATOM 9118  H HE   . ARG A 1 37 ? -0.574  -7.350  11.063  1.00 0.00 ? 37 ARG A HE   7  
ATOM 9119  H HH11 . ARG A 1 37 ? -1.418  -8.926  8.056   1.00 0.00 ? 37 ARG A HH11 7  
ATOM 9120  H HH12 . ARG A 1 37 ? -0.664  -10.438 8.471   1.00 0.00 ? 37 ARG A HH12 7  
ATOM 9121  H HH21 . ARG A 1 37 ? 0.412   -9.339  11.632  1.00 0.00 ? 37 ARG A HH21 7  
ATOM 9122  H HH22 . ARG A 1 37 ? 0.380   -10.658 10.501  1.00 0.00 ? 37 ARG A HH22 7  
ATOM 9123  N N    . LEU A 1 38 ? -6.567  -4.895  7.219   1.00 0.00 ? 38 LEU A N    7  
ATOM 9124  C CA   . LEU A 1 38 ? -7.340  -3.741  6.759   1.00 0.00 ? 38 LEU A CA   7  
ATOM 9125  C C    . LEU A 1 38 ? -8.791  -3.845  7.213   1.00 0.00 ? 38 LEU A C    7  
ATOM 9126  O O    . LEU A 1 38 ? -9.412  -2.840  7.563   1.00 0.00 ? 38 LEU A O    7  
ATOM 9127  C CB   . LEU A 1 38 ? -7.267  -3.592  5.237   1.00 0.00 ? 38 LEU A CB   7  
ATOM 9128  C CG   . LEU A 1 38 ? -6.092  -2.755  4.706   1.00 0.00 ? 38 LEU A CG   7  
ATOM 9129  C CD1  . LEU A 1 38 ? -4.754  -3.347  5.123   1.00 0.00 ? 38 LEU A CD1  7  
ATOM 9130  C CD2  . LEU A 1 38 ? -6.173  -2.639  3.194   1.00 0.00 ? 38 LEU A CD2  7  
ATOM 9131  H H    . LEU A 1 38 ? -6.249  -5.554  6.565   1.00 0.00 ? 38 LEU A H    7  
ATOM 9132  H HA   . LEU A 1 38 ? -6.906  -2.861  7.213   1.00 0.00 ? 38 LEU A HA   7  
ATOM 9133  H HB2  . LEU A 1 38 ? -7.200  -4.581  4.805   1.00 0.00 ? 38 LEU A HB2  7  
ATOM 9134  H HB3  . LEU A 1 38 ? -8.185  -3.135  4.899   1.00 0.00 ? 38 LEU A HB3  7  
ATOM 9135  H HG   . LEU A 1 38 ? -6.155  -1.758  5.119   1.00 0.00 ? 38 LEU A HG   7  
ATOM 9136  H HD11 . LEU A 1 38 ? -4.709  -3.409  6.198   1.00 0.00 ? 38 LEU A HD11 7  
ATOM 9137  H HD12 . LEU A 1 38 ? -3.953  -2.715  4.766   1.00 0.00 ? 38 LEU A HD12 7  
ATOM 9138  H HD13 . LEU A 1 38 ? -4.649  -4.336  4.701   1.00 0.00 ? 38 LEU A HD13 7  
ATOM 9139  H HD21 . LEU A 1 38 ? -5.338  -2.056  2.833   1.00 0.00 ? 38 LEU A HD21 7  
ATOM 9140  H HD22 . LEU A 1 38 ? -7.097  -2.153  2.918   1.00 0.00 ? 38 LEU A HD22 7  
ATOM 9141  H HD23 . LEU A 1 38 ? -6.140  -3.625  2.752   1.00 0.00 ? 38 LEU A HD23 7  
ATOM 9142  N N    . GLY A 1 39 ? -9.325  -5.062  7.218   1.00 0.00 ? 39 GLY A N    7  
ATOM 9143  C CA   . GLY A 1 39 ? -10.657 -5.282  7.749   1.00 0.00 ? 39 GLY A CA   7  
ATOM 9144  C C    . GLY A 1 39 ? -10.740 -4.910  9.217   1.00 0.00 ? 39 GLY A C    7  
ATOM 9145  O O    . GLY A 1 39 ? -11.739 -4.347  9.674   1.00 0.00 ? 39 GLY A O    7  
ATOM 9146  H H    . GLY A 1 39 ? -8.816  -5.814  6.848   1.00 0.00 ? 39 GLY A H    7  
ATOM 9147  H HA2  . GLY A 1 39 ? -11.362 -4.683  7.191   1.00 0.00 ? 39 GLY A HA2  7  
ATOM 9148  H HA3  . GLY A 1 39 ? -10.914 -6.325  7.637   1.00 0.00 ? 39 GLY A HA3  7  
ATOM 9149  N N    . ALA A 1 40 ? -9.676  -5.208  9.952   1.00 0.00 ? 40 ALA A N    7  
ATOM 9150  C CA   . ALA A 1 40 ? -9.599  -4.855  11.361  1.00 0.00 ? 40 ALA A CA   7  
ATOM 9151  C C    . ALA A 1 40 ? -9.501  -3.342  11.530  1.00 0.00 ? 40 ALA A C    7  
ATOM 9152  O O    . ALA A 1 40 ? -10.086 -2.773  12.450  1.00 0.00 ? 40 ALA A O    7  
ATOM 9153  C CB   . ALA A 1 40 ? -8.418  -5.548  12.020  1.00 0.00 ? 40 ALA A CB   7  
ATOM 9154  H H    . ALA A 1 40 ? -8.923  -5.681  9.536   1.00 0.00 ? 40 ALA A H    7  
ATOM 9155  H HA   . ALA A 1 40 ? -10.504 -5.201  11.839  1.00 0.00 ? 40 ALA A HA   7  
ATOM 9156  H HB1  . ALA A 1 40 ? -8.499  -6.616  11.873  1.00 0.00 ? 40 ALA A HB1  7  
ATOM 9157  H HB2  . ALA A 1 40 ? -8.416  -5.330  13.078  1.00 0.00 ? 40 ALA A HB2  7  
ATOM 9158  H HB3  . ALA A 1 40 ? -7.498  -5.195  11.577  1.00 0.00 ? 40 ALA A HB3  7  
ATOM 9159  N N    . GLU A 1 41 ? -8.776  -2.693  10.626  1.00 0.00 ? 41 GLU A N    7  
ATOM 9160  C CA   . GLU A 1 41 ? -8.643  -1.242  10.659  1.00 0.00 ? 41 GLU A CA   7  
ATOM 9161  C C    . GLU A 1 41 ? -9.976  -0.582  10.329  1.00 0.00 ? 41 GLU A C    7  
ATOM 9162  O O    . GLU A 1 41 ? -10.289 0.488   10.841  1.00 0.00 ? 41 GLU A O    7  
ATOM 9163  C CB   . GLU A 1 41 ? -7.570  -0.766  9.680   1.00 0.00 ? 41 GLU A CB   7  
ATOM 9164  C CG   . GLU A 1 41 ? -6.165  -1.231  10.029  1.00 0.00 ? 41 GLU A CG   7  
ATOM 9165  C CD   . GLU A 1 41 ? -5.722  -0.776  11.404  1.00 0.00 ? 41 GLU A CD   7  
ATOM 9166  O OE1  . GLU A 1 41 ? -5.414  0.422   11.569  1.00 0.00 ? 41 GLU A OE1  7  
ATOM 9167  O OE2  . GLU A 1 41 ? -5.661  -1.620  12.324  1.00 0.00 ? 41 GLU A OE2  7  
ATOM 9168  H H    . GLU A 1 41 ? -8.319  -3.204  9.918   1.00 0.00 ? 41 GLU A H    7  
ATOM 9169  H HA   . GLU A 1 41 ? -8.355  -0.960  11.661  1.00 0.00 ? 41 GLU A HA   7  
ATOM 9170  H HB2  . GLU A 1 41 ? -7.812  -1.134  8.693   1.00 0.00 ? 41 GLU A HB2  7  
ATOM 9171  H HB3  . GLU A 1 41 ? -7.574  0.314   9.661   1.00 0.00 ? 41 GLU A HB3  7  
ATOM 9172  H HG2  . GLU A 1 41 ? -6.139  -2.310  9.999   1.00 0.00 ? 41 GLU A HG2  7  
ATOM 9173  H HG3  . GLU A 1 41 ? -5.478  -0.835  9.296   1.00 0.00 ? 41 GLU A HG3  7  
ATOM 9174  N N    . TRP A 1 42 ? -10.759 -1.232  9.476   1.00 0.00 ? 42 TRP A N    7  
ATOM 9175  C CA   . TRP A 1 42 ? -12.088 -0.748  9.133   1.00 0.00 ? 42 TRP A CA   7  
ATOM 9176  C C    . TRP A 1 42 ? -13.005 -0.796  10.351  1.00 0.00 ? 42 TRP A C    7  
ATOM 9177  O O    . TRP A 1 42 ? -13.859 0.069   10.533  1.00 0.00 ? 42 TRP A O    7  
ATOM 9178  C CB   . TRP A 1 42 ? -12.676 -1.568  7.982   1.00 0.00 ? 42 TRP A CB   7  
ATOM 9179  C CG   . TRP A 1 42 ? -13.988 -1.038  7.493   1.00 0.00 ? 42 TRP A CG   7  
ATOM 9180  C CD1  . TRP A 1 42 ? -15.198 -1.209  8.086   1.00 0.00 ? 42 TRP A CD1  7  
ATOM 9181  C CD2  . TRP A 1 42 ? -14.224 -0.246  6.324   1.00 0.00 ? 42 TRP A CD2  7  
ATOM 9182  N NE1  . TRP A 1 42 ? -16.179 -0.585  7.359   1.00 0.00 ? 42 TRP A NE1  7  
ATOM 9183  C CE2  . TRP A 1 42 ? -15.606 0.017   6.273   1.00 0.00 ? 42 TRP A CE2  7  
ATOM 9184  C CE3  . TRP A 1 42 ? -13.406 0.265   5.317   1.00 0.00 ? 42 TRP A CE3  7  
ATOM 9185  C CZ2  . TRP A 1 42 ? -16.184 0.767   5.253   1.00 0.00 ? 42 TRP A CZ2  7  
ATOM 9186  C CZ3  . TRP A 1 42 ? -13.982 1.012   4.308   1.00 0.00 ? 42 TRP A CZ3  7  
ATOM 9187  C CH2  . TRP A 1 42 ? -15.358 1.257   4.282   1.00 0.00 ? 42 TRP A CH2  7  
ATOM 9188  H H    . TRP A 1 42 ? -10.424 -2.053  9.052   1.00 0.00 ? 42 TRP A H    7  
ATOM 9189  H HA   . TRP A 1 42 ? -12.004 0.275   8.816   1.00 0.00 ? 42 TRP A HA   7  
ATOM 9190  H HB2  . TRP A 1 42 ? -11.984 -1.562  7.155   1.00 0.00 ? 42 TRP A HB2  7  
ATOM 9191  H HB3  . TRP A 1 42 ? -12.827 -2.584  8.315   1.00 0.00 ? 42 TRP A HB3  7  
ATOM 9192  H HD1  . TRP A 1 42 ? -15.342 -1.759  9.000   1.00 0.00 ? 42 TRP A HD1  7  
ATOM 9193  H HE1  . TRP A 1 42 ? -17.140 -0.570  7.585   1.00 0.00 ? 42 TRP A HE1  7  
ATOM 9194  H HE3  . TRP A 1 42 ? -12.341 0.087   5.317   1.00 0.00 ? 42 TRP A HE3  7  
ATOM 9195  H HZ2  . TRP A 1 42 ? -17.244 0.966   5.221   1.00 0.00 ? 42 TRP A HZ2  7  
ATOM 9196  H HZ3  . TRP A 1 42 ? -13.363 1.418   3.520   1.00 0.00 ? 42 TRP A HZ3  7  
ATOM 9197  H HH2  . TRP A 1 42 ? -15.762 1.846   3.471   1.00 0.00 ? 42 TRP A HH2  7  
ATOM 9198  N N    . LYS A 1 43 ? -12.820 -1.798  11.198  1.00 0.00 ? 43 LYS A N    7  
ATOM 9199  C CA   . LYS A 1 43 ? -13.623 -1.916  12.409  1.00 0.00 ? 43 LYS A CA   7  
ATOM 9200  C C    . LYS A 1 43 ? -13.164 -0.916  13.472  1.00 0.00 ? 43 LYS A C    7  
ATOM 9201  O O    . LYS A 1 43 ? -13.808 -0.740  14.508  1.00 0.00 ? 43 LYS A O    7  
ATOM 9202  C CB   . LYS A 1 43 ? -13.579 -3.342  12.931  1.00 0.00 ? 43 LYS A CB   7  
ATOM 9203  C CG   . LYS A 1 43 ? -14.303 -4.294  12.001  1.00 0.00 ? 43 LYS A CG   7  
ATOM 9204  C CD   . LYS A 1 43 ? -14.540 -5.648  12.626  1.00 0.00 ? 43 LYS A CD   7  
ATOM 9205  C CE   . LYS A 1 43 ? -13.253 -6.442  12.762  1.00 0.00 ? 43 LYS A CE   7  
ATOM 9206  N NZ   . LYS A 1 43 ? -13.509 -7.819  13.257  1.00 0.00 ? 43 LYS A NZ   7  
ATOM 9207  H H    . LYS A 1 43 ? -12.136 -2.475  11.002  1.00 0.00 ? 43 LYS A H    7  
ATOM 9208  H HA   . LYS A 1 43 ? -14.644 -1.694  12.138  1.00 0.00 ? 43 LYS A HA   7  
ATOM 9209  H HB2  . LYS A 1 43 ? -12.547 -3.655  13.016  1.00 0.00 ? 43 LYS A HB2  7  
ATOM 9210  H HB3  . LYS A 1 43 ? -14.048 -3.384  13.900  1.00 0.00 ? 43 LYS A HB3  7  
ATOM 9211  H HG2  . LYS A 1 43 ? -15.256 -3.863  11.736  1.00 0.00 ? 43 LYS A HG2  7  
ATOM 9212  H HG3  . LYS A 1 43 ? -13.710 -4.422  11.108  1.00 0.00 ? 43 LYS A HG3  7  
ATOM 9213  H HD2  . LYS A 1 43 ? -14.970 -5.510  13.609  1.00 0.00 ? 43 LYS A HD2  7  
ATOM 9214  H HD3  . LYS A 1 43 ? -15.228 -6.188  12.005  1.00 0.00 ? 43 LYS A HD3  7  
ATOM 9215  H HE2  . LYS A 1 43 ? -12.773 -6.498  11.797  1.00 0.00 ? 43 LYS A HE2  7  
ATOM 9216  H HE3  . LYS A 1 43 ? -12.602 -5.933  13.458  1.00 0.00 ? 43 LYS A HE3  7  
ATOM 9217  H HZ1  . LYS A 1 43 ? -12.609 -8.306  13.457  1.00 0.00 ? 43 LYS A HZ1  7  
ATOM 9218  H HZ2  . LYS A 1 43 ? -14.035 -8.369  12.541  1.00 0.00 ? 43 LYS A HZ2  7  
ATOM 9219  H HZ3  . LYS A 1 43 ? -14.075 -7.788  14.134  1.00 0.00 ? 43 LYS A HZ3  7  
ATOM 9220  N N    . LEU A 1 44 ? -12.042 -0.262  13.195  1.00 0.00 ? 44 LEU A N    7  
ATOM 9221  C CA   . LEU A 1 44 ? -11.516 0.801   14.044  1.00 0.00 ? 44 LEU A CA   7  
ATOM 9222  C C    . LEU A 1 44 ? -11.487 2.113   13.268  1.00 0.00 ? 44 LEU A C    7  
ATOM 9223  O O    . LEU A 1 44 ? -10.810 3.063   13.664  1.00 0.00 ? 44 LEU A O    7  
ATOM 9224  C CB   . LEU A 1 44 ? -10.092 0.469   14.519  1.00 0.00 ? 44 LEU A CB   7  
ATOM 9225  C CG   . LEU A 1 44 ? -9.974  -0.429  15.757  1.00 0.00 ? 44 LEU A CG   7  
ATOM 9226  C CD1  . LEU A 1 44 ? -10.682 0.200   16.941  1.00 0.00 ? 44 LEU A CD1  7  
ATOM 9227  C CD2  . LEU A 1 44 ? -10.516 -1.823  15.482  1.00 0.00 ? 44 LEU A CD2  7  
ATOM 9228  H H    . LEU A 1 44 ? -11.547 -0.500  12.383  1.00 0.00 ? 44 LEU A H    7  
ATOM 9229  H HA   . LEU A 1 44 ? -12.166 0.906   14.899  1.00 0.00 ? 44 LEU A HA   7  
ATOM 9230  H HB2  . LEU A 1 44 ? -9.575  -0.015  13.705  1.00 0.00 ? 44 LEU A HB2  7  
ATOM 9231  H HB3  . LEU A 1 44 ? -9.588  1.400   14.732  1.00 0.00 ? 44 LEU A HB3  7  
ATOM 9232  H HG   . LEU A 1 44 ? -8.930  -0.526  16.017  1.00 0.00 ? 44 LEU A HG   7  
ATOM 9233  H HD11 . LEU A 1 44 ? -11.725 0.340   16.706  1.00 0.00 ? 44 LEU A HD11 7  
ATOM 9234  H HD12 . LEU A 1 44 ? -10.231 1.156   17.163  1.00 0.00 ? 44 LEU A HD12 7  
ATOM 9235  H HD13 . LEU A 1 44 ? -10.591 -0.449  17.799  1.00 0.00 ? 44 LEU A HD13 7  
ATOM 9236  H HD21 . LEU A 1 44 ? -11.556 -1.755  15.199  1.00 0.00 ? 44 LEU A HD21 7  
ATOM 9237  H HD22 . LEU A 1 44 ? -10.423 -2.427  16.371  1.00 0.00 ? 44 LEU A HD22 7  
ATOM 9238  H HD23 . LEU A 1 44 ? -9.953  -2.275  14.678  1.00 0.00 ? 44 LEU A HD23 7  
ATOM 9239  N N    . LEU A 1 45 ? -12.242 2.155   12.173  1.00 0.00 ? 45 LEU A N    7  
ATOM 9240  C CA   . LEU A 1 45 ? -12.163 3.252   11.211  1.00 0.00 ? 45 LEU A CA   7  
ATOM 9241  C C    . LEU A 1 45 ? -12.510 4.599   11.836  1.00 0.00 ? 45 LEU A C    7  
ATOM 9242  O O    . LEU A 1 45 ? -13.658 4.849   12.203  1.00 0.00 ? 45 LEU A O    7  
ATOM 9243  C CB   . LEU A 1 45 ? -13.122 2.973   10.047  1.00 0.00 ? 45 LEU A CB   7  
ATOM 9244  C CG   . LEU A 1 45 ? -13.172 4.040   8.950   1.00 0.00 ? 45 LEU A CG   7  
ATOM 9245  C CD1  . LEU A 1 45 ? -11.864 4.083   8.181   1.00 0.00 ? 45 LEU A CD1  7  
ATOM 9246  C CD2  . LEU A 1 45 ? -14.334 3.777   8.005   1.00 0.00 ? 45 LEU A CD2  7  
ATOM 9247  H H    . LEU A 1 45 ? -12.874 1.424   12.005  1.00 0.00 ? 45 LEU A H    7  
ATOM 9248  H HA   . LEU A 1 45 ? -11.154 3.291   10.829  1.00 0.00 ? 45 LEU A HA   7  
ATOM 9249  H HB2  . LEU A 1 45 ? -12.835 2.035   9.593   1.00 0.00 ? 45 LEU A HB2  7  
ATOM 9250  H HB3  . LEU A 1 45 ? -14.117 2.862   10.454  1.00 0.00 ? 45 LEU A HB3  7  
ATOM 9251  H HG   . LEU A 1 45 ? -13.324 5.008   9.405   1.00 0.00 ? 45 LEU A HG   7  
ATOM 9252  H HD11 . LEU A 1 45 ? -11.715 3.142   7.670   1.00 0.00 ? 45 LEU A HD11 7  
ATOM 9253  H HD12 . LEU A 1 45 ? -11.050 4.251   8.867   1.00 0.00 ? 45 LEU A HD12 7  
ATOM 9254  H HD13 . LEU A 1 45 ? -11.897 4.885   7.457   1.00 0.00 ? 45 LEU A HD13 7  
ATOM 9255  H HD21 . LEU A 1 45 ? -14.214 2.807   7.548   1.00 0.00 ? 45 LEU A HD21 7  
ATOM 9256  H HD22 . LEU A 1 45 ? -14.353 4.538   7.239   1.00 0.00 ? 45 LEU A HD22 7  
ATOM 9257  H HD23 . LEU A 1 45 ? -15.261 3.801   8.559   1.00 0.00 ? 45 LEU A HD23 7  
ATOM 9258  N N    . SER A 1 46 ? -11.507 5.450   11.969  1.00 0.00 ? 46 SER A N    7  
ATOM 9259  C CA   . SER A 1 46 ? -11.725 6.846   12.309  1.00 0.00 ? 46 SER A CA   7  
ATOM 9260  C C    . SER A 1 46 ? -11.751 7.675   11.027  1.00 0.00 ? 46 SER A C    7  
ATOM 9261  O O    . SER A 1 46 ? -11.604 7.132   9.930   1.00 0.00 ? 46 SER A O    7  
ATOM 9262  C CB   . SER A 1 46 ? -10.617 7.336   13.239  1.00 0.00 ? 46 SER A CB   7  
ATOM 9263  O OG   . SER A 1 46 ? -10.251 6.325   14.163  1.00 0.00 ? 46 SER A OG   7  
ATOM 9264  H H    . SER A 1 46 ? -10.586 5.127   11.847  1.00 0.00 ? 46 SER A H    7  
ATOM 9265  H HA   . SER A 1 46 ? -12.679 6.929   12.807  1.00 0.00 ? 46 SER A HA   7  
ATOM 9266  H HB2  . SER A 1 46 ? -9.749  7.605   12.656  1.00 0.00 ? 46 SER A HB2  7  
ATOM 9267  H HB3  . SER A 1 46 ? -10.965 8.198   13.788  1.00 0.00 ? 46 SER A HB3  7  
ATOM 9268  H HG   . SER A 1 46 ? -9.700  5.667   13.703  1.00 0.00 ? 46 SER A HG   7  
ATOM 9269  N N    . GLU A 1 47 ? -11.918 8.984   11.158  1.00 0.00 ? 47 GLU A N    7  
ATOM 9270  C CA   . GLU A 1 47 ? -11.804 9.875   10.008  1.00 0.00 ? 47 GLU A CA   7  
ATOM 9271  C C    . GLU A 1 47 ? -10.343 9.978   9.585   1.00 0.00 ? 47 GLU A C    7  
ATOM 9272  O O    . GLU A 1 47 ? -10.041 10.231  8.421   1.00 0.00 ? 47 GLU A O    7  
ATOM 9273  C CB   . GLU A 1 47 ? -12.346 11.270  10.338  1.00 0.00 ? 47 GLU A CB   7  
ATOM 9274  C CG   . GLU A 1 47 ? -13.762 11.282  10.894  1.00 0.00 ? 47 GLU A CG   7  
ATOM 9275  C CD   . GLU A 1 47 ? -14.777 10.691  9.940   1.00 0.00 ? 47 GLU A CD   7  
ATOM 9276  O OE1  . GLU A 1 47 ? -14.930 11.219  8.821   1.00 0.00 ? 47 GLU A OE1  7  
ATOM 9277  O OE2  . GLU A 1 47 ? -15.422 9.686   10.303  1.00 0.00 ? 47 GLU A OE2  7  
ATOM 9278  H H    . GLU A 1 47 ? -12.121 9.359   12.041  1.00 0.00 ? 47 GLU A H    7  
ATOM 9279  H HA   . GLU A 1 47 ? -12.371 9.443   9.185   1.00 0.00 ? 47 GLU A HA   7  
ATOM 9280  H HB2  . GLU A 1 47 ? -11.695 11.729  11.068  1.00 0.00 ? 47 GLU A HB2  7  
ATOM 9281  H HB3  . GLU A 1 47 ? -12.331 11.867  9.438   1.00 0.00 ? 47 GLU A HB3  7  
ATOM 9282  H HG2  . GLU A 1 47 ? -13.779 10.709  11.808  1.00 0.00 ? 47 GLU A HG2  7  
ATOM 9283  H HG3  . GLU A 1 47 ? -14.043 12.304  11.106  1.00 0.00 ? 47 GLU A HG3  7  
ATOM 9284  N N    . THR A 1 48 ? -9.441  9.784   10.544  1.00 0.00 ? 48 THR A N    7  
ATOM 9285  C CA   . THR A 1 48 ? -8.018  9.730   10.256  1.00 0.00 ? 48 THR A CA   7  
ATOM 9286  C C    . THR A 1 48 ? -7.711  8.600   9.282   1.00 0.00 ? 48 THR A C    7  
ATOM 9287  O O    . THR A 1 48 ? -6.894  8.751   8.377   1.00 0.00 ? 48 THR A O    7  
ATOM 9288  C CB   . THR A 1 48 ? -7.193  9.533   11.545  1.00 0.00 ? 48 THR A CB   7  
ATOM 9289  O OG1  . THR A 1 48 ? -7.838  8.577   12.399  1.00 0.00 ? 48 THR A OG1  7  
ATOM 9290  C CG2  . THR A 1 48 ? -7.017  10.848  12.289  1.00 0.00 ? 48 THR A CG2  7  
ATOM 9291  H H    . THR A 1 48 ? -9.743  9.689   11.477  1.00 0.00 ? 48 THR A H    7  
ATOM 9292  H HA   . THR A 1 48 ? -7.730  10.670  9.807   1.00 0.00 ? 48 THR A HA   7  
ATOM 9293  H HB   . THR A 1 48 ? -6.216  9.158   11.275  1.00 0.00 ? 48 THR A HB   7  
ATOM 9294  H HG1  . THR A 1 48 ? -7.458  7.693   12.234  1.00 0.00 ? 48 THR A HG1  7  
ATOM 9295  H HG21 . THR A 1 48 ? -7.985  11.237  12.569  1.00 0.00 ? 48 THR A HG21 7  
ATOM 9296  H HG22 . THR A 1 48 ? -6.515  11.560  11.652  1.00 0.00 ? 48 THR A HG22 7  
ATOM 9297  H HG23 . THR A 1 48 ? -6.427  10.681  13.178  1.00 0.00 ? 48 THR A HG23 7  
ATOM 9298  N N    . GLU A 1 49 ? -8.395  7.476   9.457   1.00 0.00 ? 49 GLU A N    7  
ATOM 9299  C CA   . GLU A 1 49 ? -8.205  6.333   8.583   1.00 0.00 ? 49 GLU A CA   7  
ATOM 9300  C C    . GLU A 1 49 ? -8.919  6.541   7.257   1.00 0.00 ? 49 GLU A C    7  
ATOM 9301  O O    . GLU A 1 49 ? -8.582  5.904   6.271   1.00 0.00 ? 49 GLU A O    7  
ATOM 9302  C CB   . GLU A 1 49 ? -8.695  5.038   9.233   1.00 0.00 ? 49 GLU A CB   7  
ATOM 9303  C CG   . GLU A 1 49 ? -7.774  4.491   10.311  1.00 0.00 ? 49 GLU A CG   7  
ATOM 9304  C CD   . GLU A 1 49 ? -7.775  5.333   11.563  1.00 0.00 ? 49 GLU A CD   7  
ATOM 9305  O OE1  . GLU A 1 49 ? -8.663  5.136   12.413  1.00 0.00 ? 49 GLU A OE1  7  
ATOM 9306  O OE2  . GLU A 1 49 ? -6.887  6.199   11.705  1.00 0.00 ? 49 GLU A OE2  7  
ATOM 9307  H H    . GLU A 1 49 ? -9.038  7.414   10.194  1.00 0.00 ? 49 GLU A H    7  
ATOM 9308  H HA   . GLU A 1 49 ? -7.146  6.244   8.389   1.00 0.00 ? 49 GLU A HA   7  
ATOM 9309  H HB2  . GLU A 1 49 ? -9.659  5.222   9.680   1.00 0.00 ? 49 GLU A HB2  7  
ATOM 9310  H HB3  . GLU A 1 49 ? -8.803  4.285   8.467   1.00 0.00 ? 49 GLU A HB3  7  
ATOM 9311  H HG2  . GLU A 1 49 ? -8.097  3.493   10.568  1.00 0.00 ? 49 GLU A HG2  7  
ATOM 9312  H HG3  . GLU A 1 49 ? -6.768  4.452   9.921   1.00 0.00 ? 49 GLU A HG3  7  
ATOM 9313  N N    . LYS A 1 50 ? -9.896  7.445   7.230   1.00 0.00 ? 50 LYS A N    7  
ATOM 9314  C CA   . LYS A 1 50 ? -10.617 7.735   5.996   1.00 0.00 ? 50 LYS A CA   7  
ATOM 9315  C C    . LYS A 1 50 ? -9.748  8.528   5.026   1.00 0.00 ? 50 LYS A C    7  
ATOM 9316  O O    . LYS A 1 50 ? -9.971  8.510   3.816   1.00 0.00 ? 50 LYS A O    7  
ATOM 9317  C CB   . LYS A 1 50 ? -11.910 8.500   6.262   1.00 0.00 ? 50 LYS A CB   7  
ATOM 9318  C CG   . LYS A 1 50 ? -12.967 7.665   6.956   1.00 0.00 ? 50 LYS A CG   7  
ATOM 9319  C CD   . LYS A 1 50 ? -14.310 8.367   6.953   1.00 0.00 ? 50 LYS A CD   7  
ATOM 9320  C CE   . LYS A 1 50 ? -15.289 7.674   7.892   1.00 0.00 ? 50 LYS A CE   7  
ATOM 9321  N NZ   . LYS A 1 50 ? -16.508 8.489   8.126   1.00 0.00 ? 50 LYS A NZ   7  
ATOM 9322  H H    . LYS A 1 50 ? -10.136 7.919   8.054   1.00 0.00 ? 50 LYS A H    7  
ATOM 9323  H HA   . LYS A 1 50 ? -10.869 6.794   5.550   1.00 0.00 ? 50 LYS A HA   7  
ATOM 9324  H HB2  . LYS A 1 50 ? -11.686 9.355   6.883   1.00 0.00 ? 50 LYS A HB2  7  
ATOM 9325  H HB3  . LYS A 1 50 ? -12.310 8.844   5.320   1.00 0.00 ? 50 LYS A HB3  7  
ATOM 9326  H HG2  . LYS A 1 50 ? -13.065 6.721   6.441   1.00 0.00 ? 50 LYS A HG2  7  
ATOM 9327  H HG3  . LYS A 1 50 ? -12.662 7.492   7.977   1.00 0.00 ? 50 LYS A HG3  7  
ATOM 9328  H HD2  . LYS A 1 50 ? -14.171 9.393   7.258   1.00 0.00 ? 50 LYS A HD2  7  
ATOM 9329  H HD3  . LYS A 1 50 ? -14.711 8.341   5.951   1.00 0.00 ? 50 LYS A HD3  7  
ATOM 9330  H HE2  . LYS A 1 50 ? -15.579 6.730   7.455   1.00 0.00 ? 50 LYS A HE2  7  
ATOM 9331  H HE3  . LYS A 1 50 ? -14.799 7.495   8.838   1.00 0.00 ? 50 LYS A HE3  7  
ATOM 9332  H HZ1  . LYS A 1 50 ? -17.194 7.952   8.702   1.00 0.00 ? 50 LYS A HZ1  7  
ATOM 9333  H HZ2  . LYS A 1 50 ? -16.957 8.741   7.219   1.00 0.00 ? 50 LYS A HZ2  7  
ATOM 9334  H HZ3  . LYS A 1 50 ? -16.257 9.365   8.635   1.00 0.00 ? 50 LYS A HZ3  7  
ATOM 9335  N N    . ARG A 1 51 ? -8.759  9.214   5.573   1.00 0.00 ? 51 ARG A N    7  
ATOM 9336  C CA   . ARG A 1 51 ? -7.865  10.056  4.789   1.00 0.00 ? 51 ARG A CA   7  
ATOM 9337  C C    . ARG A 1 51 ? -7.106  9.244   3.721   1.00 0.00 ? 51 ARG A C    7  
ATOM 9338  O O    . ARG A 1 51 ? -7.134  9.611   2.545   1.00 0.00 ? 51 ARG A O    7  
ATOM 9339  C CB   . ARG A 1 51 ? -6.912  10.796  5.741   1.00 0.00 ? 51 ARG A CB   7  
ATOM 9340  C CG   . ARG A 1 51 ? -6.074  11.899  5.108   1.00 0.00 ? 51 ARG A CG   7  
ATOM 9341  C CD   . ARG A 1 51 ? -4.859  11.347  4.380   1.00 0.00 ? 51 ARG A CD   7  
ATOM 9342  N NE   . ARG A 1 51 ? -3.867  12.384  4.105   1.00 0.00 ? 51 ARG A NE   7  
ATOM 9343  C CZ   . ARG A 1 51 ? -3.343  12.614  2.903   1.00 0.00 ? 51 ARG A CZ   7  
ATOM 9344  N NH1  . ARG A 1 51 ? -3.807  11.961  1.848   1.00 0.00 ? 51 ARG A NH1  7  
ATOM 9345  N NH2  . ARG A 1 51 ? -2.375  13.512  2.755   1.00 0.00 ? 51 ARG A NH2  7  
ATOM 9346  H H    . ARG A 1 51 ? -8.626  9.159   6.544   1.00 0.00 ? 51 ARG A H    7  
ATOM 9347  H HA   . ARG A 1 51 ? -8.478  10.785  4.278   1.00 0.00 ? 51 ARG A HA   7  
ATOM 9348  H HB2  . ARG A 1 51 ? -7.496  11.237  6.535   1.00 0.00 ? 51 ARG A HB2  7  
ATOM 9349  H HB3  . ARG A 1 51 ? -6.237  10.072  6.176   1.00 0.00 ? 51 ARG A HB3  7  
ATOM 9350  H HG2  . ARG A 1 51 ? -6.685  12.441  4.403   1.00 0.00 ? 51 ARG A HG2  7  
ATOM 9351  H HG3  . ARG A 1 51 ? -5.740  12.570  5.885   1.00 0.00 ? 51 ARG A HG3  7  
ATOM 9352  H HD2  . ARG A 1 51 ? -4.407  10.579  4.991   1.00 0.00 ? 51 ARG A HD2  7  
ATOM 9353  H HD3  . ARG A 1 51 ? -5.184  10.914  3.444   1.00 0.00 ? 51 ARG A HD3  7  
ATOM 9354  H HE   . ARG A 1 51 ? -3.549  12.917  4.874   1.00 0.00 ? 51 ARG A HE   7  
ATOM 9355  H HH11 . ARG A 1 51 ? -4.549  11.300  1.955   1.00 0.00 ? 51 ARG A HH11 7  
ATOM 9356  H HH12 . ARG A 1 51 ? -3.404  12.113  0.934   1.00 0.00 ? 51 ARG A HH12 7  
ATOM 9357  H HH21 . ARG A 1 51 ? -2.031  14.023  3.548   1.00 0.00 ? 51 ARG A HH21 7  
ATOM 9358  H HH22 . ARG A 1 51 ? -1.975  13.680  1.846   1.00 0.00 ? 51 ARG A HH22 7  
ATOM 9359  N N    . PRO A 1 52 ? -6.411  8.144   4.088   1.00 0.00 ? 52 PRO A N    7  
ATOM 9360  C CA   . PRO A 1 52 ? -5.698  7.323   3.105   1.00 0.00 ? 52 PRO A CA   7  
ATOM 9361  C C    . PRO A 1 52 ? -6.613  6.668   2.071   1.00 0.00 ? 52 PRO A C    7  
ATOM 9362  O O    . PRO A 1 52 ? -6.186  6.411   0.950   1.00 0.00 ? 52 PRO A O    7  
ATOM 9363  C CB   . PRO A 1 52 ? -4.970  6.269   3.944   1.00 0.00 ? 52 PRO A CB   7  
ATOM 9364  C CG   . PRO A 1 52 ? -5.675  6.255   5.253   1.00 0.00 ? 52 PRO A CG   7  
ATOM 9365  C CD   . PRO A 1 52 ? -6.205  7.643   5.461   1.00 0.00 ? 52 PRO A CD   7  
ATOM 9366  H HA   . PRO A 1 52 ? -4.979  7.920   2.574   1.00 0.00 ? 52 PRO A HA   7  
ATOM 9367  H HB2  . PRO A 1 52 ? -5.033  5.309   3.452   1.00 0.00 ? 52 PRO A HB2  7  
ATOM 9368  H HB3  . PRO A 1 52 ? -3.933  6.552   4.058   1.00 0.00 ? 52 PRO A HB3  7  
ATOM 9369  H HG2  . PRO A 1 52 ? -6.488  5.543   5.225   1.00 0.00 ? 52 PRO A HG2  7  
ATOM 9370  H HG3  . PRO A 1 52 ? -4.981  6.000   6.039   1.00 0.00 ? 52 PRO A HG3  7  
ATOM 9371  H HD2  . PRO A 1 52 ? -7.140  7.614   6.003   1.00 0.00 ? 52 PRO A HD2  7  
ATOM 9372  H HD3  . PRO A 1 52 ? -5.482  8.248   5.987   1.00 0.00 ? 52 PRO A HD3  7  
ATOM 9373  N N    . PHE A 1 53 ? -7.874  6.436   2.420   1.00 0.00 ? 53 PHE A N    7  
ATOM 9374  C CA   . PHE A 1 53 ? -8.833  5.932   1.440   1.00 0.00 ? 53 PHE A CA   7  
ATOM 9375  C C    . PHE A 1 53 ? -8.901  6.893   0.268   1.00 0.00 ? 53 PHE A C    7  
ATOM 9376  O O    . PHE A 1 53 ? -8.975  6.497   -0.895  1.00 0.00 ? 53 PHE A O    7  
ATOM 9377  C CB   . PHE A 1 53 ? -10.238 5.812   2.038   1.00 0.00 ? 53 PHE A CB   7  
ATOM 9378  C CG   . PHE A 1 53 ? -10.454 4.619   2.919   1.00 0.00 ? 53 PHE A CG   7  
ATOM 9379  C CD1  . PHE A 1 53 ? -10.141 4.667   4.261   1.00 0.00 ? 53 PHE A CD1  7  
ATOM 9380  C CD2  . PHE A 1 53 ? -10.996 3.457   2.403   1.00 0.00 ? 53 PHE A CD2  7  
ATOM 9381  C CE1  . PHE A 1 53 ? -10.361 3.578   5.080   1.00 0.00 ? 53 PHE A CE1  7  
ATOM 9382  C CE2  . PHE A 1 53 ? -11.216 2.364   3.214   1.00 0.00 ? 53 PHE A CE2  7  
ATOM 9383  C CZ   . PHE A 1 53 ? -10.899 2.425   4.555   1.00 0.00 ? 53 PHE A CZ   7  
ATOM 9384  H H    . PHE A 1 53 ? -8.163  6.603   3.342   1.00 0.00 ? 53 PHE A H    7  
ATOM 9385  H HA   . PHE A 1 53 ? -8.500  4.966   1.094   1.00 0.00 ? 53 PHE A HA   7  
ATOM 9386  H HB2  . PHE A 1 53 ? -10.439 6.692   2.630   1.00 0.00 ? 53 PHE A HB2  7  
ATOM 9387  H HB3  . PHE A 1 53 ? -10.955 5.762   1.231   1.00 0.00 ? 53 PHE A HB3  7  
ATOM 9388  H HD1  . PHE A 1 53 ? -9.718  5.572   4.674   1.00 0.00 ? 53 PHE A HD1  7  
ATOM 9389  H HD2  . PHE A 1 53 ? -11.242 3.408   1.351   1.00 0.00 ? 53 PHE A HD2  7  
ATOM 9390  H HE1  . PHE A 1 53 ? -10.111 3.630   6.130   1.00 0.00 ? 53 PHE A HE1  7  
ATOM 9391  H HE2  . PHE A 1 53 ? -11.638 1.460   2.798   1.00 0.00 ? 53 PHE A HE2  7  
ATOM 9392  H HZ   . PHE A 1 53 ? -11.073 1.571   5.193   1.00 0.00 ? 53 PHE A HZ   7  
ATOM 9393  N N    . ILE A 1 54 ? -8.829  8.167   0.597   1.00 0.00 ? 54 ILE A N    7  
ATOM 9394  C CA   . ILE A 1 54 ? -9.038  9.206   -0.379  1.00 0.00 ? 54 ILE A CA   7  
ATOM 9395  C C    . ILE A 1 54 ? -7.745  9.457   -1.159  1.00 0.00 ? 54 ILE A C    7  
ATOM 9396  O O    . ILE A 1 54 ? -7.768  9.771   -2.352  1.00 0.00 ? 54 ILE A O    7  
ATOM 9397  C CB   . ILE A 1 54 ? -9.556  10.495  0.306   1.00 0.00 ? 54 ILE A CB   7  
ATOM 9398  C CG1  . ILE A 1 54 ? -10.800 10.167  1.158   1.00 0.00 ? 54 ILE A CG1  7  
ATOM 9399  C CG2  . ILE A 1 54 ? -9.879  11.568  -0.724  1.00 0.00 ? 54 ILE A CG2  7  
ATOM 9400  C CD1  . ILE A 1 54 ? -11.951 9.571   0.364   1.00 0.00 ? 54 ILE A CD1  7  
ATOM 9401  H H    . ILE A 1 54 ? -8.576  8.413   1.523   1.00 0.00 ? 54 ILE A H    7  
ATOM 9402  H HA   . ILE A 1 54 ? -9.800  8.858   -1.068  1.00 0.00 ? 54 ILE A HA   7  
ATOM 9403  H HB   . ILE A 1 54 ? -8.778  10.871  0.952   1.00 0.00 ? 54 ILE A HB   7  
ATOM 9404  H HG12 . ILE A 1 54 ? -10.525 9.449   1.917   1.00 0.00 ? 54 ILE A HG12 7  
ATOM 9405  H HG13 . ILE A 1 54 ? -11.159 11.067  1.643   1.00 0.00 ? 54 ILE A HG13 7  
ATOM 9406  H HG21 . ILE A 1 54 ? -10.657 11.213  -1.383  1.00 0.00 ? 54 ILE A HG21 7  
ATOM 9407  H HG22 . ILE A 1 54 ? -8.992  11.790  -1.300  1.00 0.00 ? 54 ILE A HG22 7  
ATOM 9408  H HG23 . ILE A 1 54 ? -10.214 12.461  -0.219  1.00 0.00 ? 54 ILE A HG23 7  
ATOM 9409  H HD11 . ILE A 1 54 ? -12.787 9.386   1.023   1.00 0.00 ? 54 ILE A HD11 7  
ATOM 9410  H HD12 . ILE A 1 54 ? -11.635 8.640   -0.086  1.00 0.00 ? 54 ILE A HD12 7  
ATOM 9411  H HD13 . ILE A 1 54 ? -12.249 10.261  -0.411  1.00 0.00 ? 54 ILE A HD13 7  
ATOM 9412  N N    . ASP A 1 55 ? -6.613  9.276   -0.480  1.00 0.00 ? 55 ASP A N    7  
ATOM 9413  C CA   . ASP A 1 55 ? -5.304  9.472   -1.101  1.00 0.00 ? 55 ASP A CA   7  
ATOM 9414  C C    . ASP A 1 55 ? -4.999  8.337   -2.070  1.00 0.00 ? 55 ASP A C    7  
ATOM 9415  O O    . ASP A 1 55 ? -4.667  8.582   -3.227  1.00 0.00 ? 55 ASP A O    7  
ATOM 9416  C CB   . ASP A 1 55 ? -4.203  9.550   -0.045  1.00 0.00 ? 55 ASP A CB   7  
ATOM 9417  C CG   . ASP A 1 55 ? -2.928  10.176  -0.585  1.00 0.00 ? 55 ASP A CG   7  
ATOM 9418  O OD1  . ASP A 1 55 ? -2.864  11.422  -0.642  1.00 0.00 ? 55 ASP A OD1  7  
ATOM 9419  O OD2  . ASP A 1 55 ? -1.978  9.439   -0.926  1.00 0.00 ? 55 ASP A OD2  7  
ATOM 9420  H H    . ASP A 1 55 ? -6.661  8.997   0.458   1.00 0.00 ? 55 ASP A H    7  
ATOM 9421  H HA   . ASP A 1 55 ? -5.332  10.401  -1.650  1.00 0.00 ? 55 ASP A HA   7  
ATOM 9422  H HB2  . ASP A 1 55 ? -4.550  10.146  0.787   1.00 0.00 ? 55 ASP A HB2  7  
ATOM 9423  H HB3  . ASP A 1 55 ? -3.974  8.554   0.303   1.00 0.00 ? 55 ASP A HB3  7  
ATOM 9424  N N    . GLU A 1 56 ? -5.143  7.098   -1.591  1.00 0.00 ? 56 GLU A N    7  
ATOM 9425  C CA   . GLU A 1 56 ? -4.939  5.899   -2.413  1.00 0.00 ? 56 GLU A CA   7  
ATOM 9426  C C    . GLU A 1 56 ? -5.798  5.960   -3.673  1.00 0.00 ? 56 GLU A C    7  
ATOM 9427  O O    . GLU A 1 56 ? -5.373  5.527   -4.749  1.00 0.00 ? 56 GLU A O    7  
ATOM 9428  C CB   . GLU A 1 56 ? -5.279  4.647   -1.602  1.00 0.00 ? 56 GLU A CB   7  
ATOM 9429  C CG   . GLU A 1 56 ? -4.102  4.087   -0.813  1.00 0.00 ? 56 GLU A CG   7  
ATOM 9430  C CD   . GLU A 1 56 ? -3.403  5.118   0.056   1.00 0.00 ? 56 GLU A CD   7  
ATOM 9431  O OE1  . GLU A 1 56 ? -2.563  5.878   -0.468  1.00 0.00 ? 56 GLU A OE1  7  
ATOM 9432  O OE2  . GLU A 1 56 ? -3.658  5.149   1.277   1.00 0.00 ? 56 GLU A OE2  7  
ATOM 9433  H H    . GLU A 1 56 ? -5.394  6.981   -0.647  1.00 0.00 ? 56 GLU A H    7  
ATOM 9434  H HA   . GLU A 1 56 ? -3.890  5.847   -2.696  1.00 0.00 ? 56 GLU A HA   7  
ATOM 9435  H HB2  . GLU A 1 56 ? -6.068  4.892   -0.905  1.00 0.00 ? 56 GLU A HB2  7  
ATOM 9436  H HB3  . GLU A 1 56 ? -5.632  3.882   -2.276  1.00 0.00 ? 56 GLU A HB3  7  
ATOM 9437  H HG2  . GLU A 1 56 ? -4.460  3.293   -0.175  1.00 0.00 ? 56 GLU A HG2  7  
ATOM 9438  H HG3  . GLU A 1 56 ? -3.382  3.681   -1.511  1.00 0.00 ? 56 GLU A HG3  7  
ATOM 9439  N N    . ALA A 1 57 ? -7.005  6.509   -3.535  1.00 0.00 ? 57 ALA A N    7  
ATOM 9440  C CA   . ALA A 1 57 ? -7.889  6.709   -4.675  1.00 0.00 ? 57 ALA A CA   7  
ATOM 9441  C C    . ALA A 1 57 ? -7.253  7.636   -5.706  1.00 0.00 ? 57 ALA A C    7  
ATOM 9442  O O    . ALA A 1 57 ? -7.268  7.352   -6.908  1.00 0.00 ? 57 ALA A O    7  
ATOM 9443  C CB   . ALA A 1 57 ? -9.223  7.271   -4.217  1.00 0.00 ? 57 ALA A CB   7  
ATOM 9444  H H    . ALA A 1 57 ? -7.316  6.767   -2.636  1.00 0.00 ? 57 ALA A H    7  
ATOM 9445  H HA   . ALA A 1 57 ? -8.067  5.746   -5.132  1.00 0.00 ? 57 ALA A HA   7  
ATOM 9446  H HB1  . ALA A 1 57 ? -9.076  8.259   -3.808  1.00 0.00 ? 57 ALA A HB1  7  
ATOM 9447  H HB2  . ALA A 1 57 ? -9.643  6.626   -3.457  1.00 0.00 ? 57 ALA A HB2  7  
ATOM 9448  H HB3  . ALA A 1 57 ? -9.899  7.324   -5.057  1.00 0.00 ? 57 ALA A HB3  7  
ATOM 9449  N N    . LYS A 1 58 ? -6.684  8.739   -5.233  1.00 0.00 ? 58 LYS A N    7  
ATOM 9450  C CA   . LYS A 1 58 ? -6.043  9.704   -6.118  1.00 0.00 ? 58 LYS A CA   7  
ATOM 9451  C C    . LYS A 1 58 ? -4.780  9.129   -6.748  1.00 0.00 ? 58 LYS A C    7  
ATOM 9452  O O    . LYS A 1 58 ? -4.458  9.446   -7.893  1.00 0.00 ? 58 LYS A O    7  
ATOM 9453  C CB   . LYS A 1 58 ? -5.706  11.000  -5.385  1.00 0.00 ? 58 LYS A CB   7  
ATOM 9454  C CG   . LYS A 1 58 ? -6.925  11.752  -4.884  1.00 0.00 ? 58 LYS A CG   7  
ATOM 9455  C CD   . LYS A 1 58 ? -6.592  13.205  -4.584  1.00 0.00 ? 58 LYS A CD   7  
ATOM 9456  C CE   . LYS A 1 58 ? -5.487  13.337  -3.546  1.00 0.00 ? 58 LYS A CE   7  
ATOM 9457  N NZ   . LYS A 1 58 ? -5.087  14.754  -3.342  1.00 0.00 ? 58 LYS A NZ   7  
ATOM 9458  H H    . LYS A 1 58 ? -6.698  8.908   -4.262  1.00 0.00 ? 58 LYS A H    7  
ATOM 9459  H HA   . LYS A 1 58 ? -6.743  9.929   -6.910  1.00 0.00 ? 58 LYS A HA   7  
ATOM 9460  H HB2  . LYS A 1 58 ? -5.079  10.767  -4.536  1.00 0.00 ? 58 LYS A HB2  7  
ATOM 9461  H HB3  . LYS A 1 58 ? -5.162  11.647  -6.055  1.00 0.00 ? 58 LYS A HB3  7  
ATOM 9462  H HG2  . LYS A 1 58 ? -7.694  11.719  -5.643  1.00 0.00 ? 58 LYS A HG2  7  
ATOM 9463  H HG3  . LYS A 1 58 ? -7.285  11.279  -3.981  1.00 0.00 ? 58 LYS A HG3  7  
ATOM 9464  H HD2  . LYS A 1 58 ? -6.269  13.682  -5.497  1.00 0.00 ? 58 LYS A HD2  7  
ATOM 9465  H HD3  . LYS A 1 58 ? -7.480  13.697  -4.216  1.00 0.00 ? 58 LYS A HD3  7  
ATOM 9466  H HE2  . LYS A 1 58 ? -5.842  12.935  -2.608  1.00 0.00 ? 58 LYS A HE2  7  
ATOM 9467  H HE3  . LYS A 1 58 ? -4.628  12.773  -3.876  1.00 0.00 ? 58 LYS A HE3  7  
ATOM 9468  H HZ1  . LYS A 1 58 ? -5.919  15.326  -3.080  1.00 0.00 ? 58 LYS A HZ1  7  
ATOM 9469  H HZ2  . LYS A 1 58 ? -4.678  15.144  -4.219  1.00 0.00 ? 58 LYS A HZ2  7  
ATOM 9470  H HZ3  . LYS A 1 58 ? -4.377  14.824  -2.581  1.00 0.00 ? 58 LYS A HZ3  7  
ATOM 9471  N N    . ARG A 1 59 ? -4.064  8.291   -6.002  1.00 0.00 ? 59 ARG A N    7  
ATOM 9472  C CA   . ARG A 1 59 ? -2.846  7.665   -6.517  1.00 0.00 ? 59 ARG A CA   7  
ATOM 9473  C C    . ARG A 1 59 ? -3.167  6.879   -7.787  1.00 0.00 ? 59 ARG A C    7  
ATOM 9474  O O    . ARG A 1 59 ? -2.441  6.951   -8.779  1.00 0.00 ? 59 ARG A O    7  
ATOM 9475  C CB   . ARG A 1 59 ? -2.214  6.716   -5.484  1.00 0.00 ? 59 ARG A CB   7  
ATOM 9476  C CG   . ARG A 1 59 ? -2.169  7.260   -4.061  1.00 0.00 ? 59 ARG A CG   7  
ATOM 9477  C CD   . ARG A 1 59 ? -1.390  8.564   -3.949  1.00 0.00 ? 59 ARG A CD   7  
ATOM 9478  N NE   . ARG A 1 59 ? 0.050   8.380   -4.114  1.00 0.00 ? 59 ARG A NE   7  
ATOM 9479  C CZ   . ARG A 1 59 ? 0.912   8.316   -3.097  1.00 0.00 ? 59 ARG A CZ   7  
ATOM 9480  N NH1  . ARG A 1 59 ? 0.477   8.343   -1.838  1.00 0.00 ? 59 ARG A NH1  7  
ATOM 9481  N NH2  . ARG A 1 59 ? 2.213   8.229   -3.345  1.00 0.00 ? 59 ARG A NH2  7  
ATOM 9482  H H    . ARG A 1 59 ? -4.360  8.093   -5.084  1.00 0.00 ? 59 ARG A H    7  
ATOM 9483  H HA   . ARG A 1 59 ? -2.145  8.450   -6.759  1.00 0.00 ? 59 ARG A HA   7  
ATOM 9484  H HB2  . ARG A 1 59 ? -2.780  5.798   -5.471  1.00 0.00 ? 59 ARG A HB2  7  
ATOM 9485  H HB3  . ARG A 1 59 ? -1.203  6.496   -5.791  1.00 0.00 ? 59 ARG A HB3  7  
ATOM 9486  H HG2  . ARG A 1 59 ? -3.180  7.435   -3.726  1.00 0.00 ? 59 ARG A HG2  7  
ATOM 9487  H HG3  . ARG A 1 59 ? -1.705  6.522   -3.424  1.00 0.00 ? 59 ARG A HG3  7  
ATOM 9488  H HD2  . ARG A 1 59 ? -1.743  9.239   -4.713  1.00 0.00 ? 59 ARG A HD2  7  
ATOM 9489  H HD3  . ARG A 1 59 ? -1.579  8.996   -2.977  1.00 0.00 ? 59 ARG A HD3  7  
ATOM 9490  H HE   . ARG A 1 59 ? 0.396   8.340   -5.032  1.00 0.00 ? 59 ARG A HE   7  
ATOM 9491  H HH11 . ARG A 1 59 ? -0.512  8.415   -1.644  1.00 0.00 ? 59 ARG A HH11 7  
ATOM 9492  H HH12 . ARG A 1 59 ? 1.128   8.294   -1.076  1.00 0.00 ? 59 ARG A HH12 7  
ATOM 9493  H HH21 . ARG A 1 59 ? 2.543   8.215   -4.294  1.00 0.00 ? 59 ARG A HH21 7  
ATOM 9494  H HH22 . ARG A 1 59 ? 2.878   8.189   -2.586  1.00 0.00 ? 59 ARG A HH22 7  
ATOM 9495  N N    . LEU A 1 60 ? -4.273  6.143   -7.746  1.00 0.00 ? 60 LEU A N    7  
ATOM 9496  C CA   . LEU A 1 60 ? -4.718  5.356   -8.888  1.00 0.00 ? 60 LEU A CA   7  
ATOM 9497  C C    . LEU A 1 60 ? -5.182  6.272   -10.017 1.00 0.00 ? 60 LEU A C    7  
ATOM 9498  O O    . LEU A 1 60 ? -4.938  6.003   -11.195 1.00 0.00 ? 60 LEU A O    7  
ATOM 9499  C CB   . LEU A 1 60 ? -5.861  4.427   -8.472  1.00 0.00 ? 60 LEU A CB   7  
ATOM 9500  C CG   . LEU A 1 60 ? -5.546  3.482   -7.310  1.00 0.00 ? 60 LEU A CG   7  
ATOM 9501  C CD1  . LEU A 1 60 ? -6.789  2.703   -6.910  1.00 0.00 ? 60 LEU A CD1  7  
ATOM 9502  C CD2  . LEU A 1 60 ? -4.418  2.530   -7.686  1.00 0.00 ? 60 LEU A CD2  7  
ATOM 9503  H H    . LEU A 1 60 ? -4.804  6.126   -6.918  1.00 0.00 ? 60 LEU A H    7  
ATOM 9504  H HA   . LEU A 1 60 ? -3.885  4.762   -9.235  1.00 0.00 ? 60 LEU A HA   7  
ATOM 9505  H HB2  . LEU A 1 60 ? -6.708  5.038   -8.191  1.00 0.00 ? 60 LEU A HB2  7  
ATOM 9506  H HB3  . LEU A 1 60 ? -6.140  3.829   -9.326  1.00 0.00 ? 60 LEU A HB3  7  
ATOM 9507  H HG   . LEU A 1 60 ? -5.228  4.062   -6.457  1.00 0.00 ? 60 LEU A HG   7  
ATOM 9508  H HD11 . LEU A 1 60 ? -7.562  3.391   -6.600  1.00 0.00 ? 60 LEU A HD11 7  
ATOM 9509  H HD12 . LEU A 1 60 ? -6.548  2.040   -6.090  1.00 0.00 ? 60 LEU A HD12 7  
ATOM 9510  H HD13 . LEU A 1 60 ? -7.138  2.123   -7.751  1.00 0.00 ? 60 LEU A HD13 7  
ATOM 9511  H HD21 . LEU A 1 60 ? -4.708  1.953   -8.553  1.00 0.00 ? 60 LEU A HD21 7  
ATOM 9512  H HD22 . LEU A 1 60 ? -4.215  1.863   -6.861  1.00 0.00 ? 60 LEU A HD22 7  
ATOM 9513  H HD23 . LEU A 1 60 ? -3.528  3.098   -7.915  1.00 0.00 ? 60 LEU A HD23 7  
ATOM 9514  N N    . ARG A 1 61 ? -5.850  7.359   -9.641  1.00 0.00 ? 61 ARG A N    7  
ATOM 9515  C CA   . ARG A 1 61 ? -6.342  8.340   -10.602 1.00 0.00 ? 61 ARG A CA   7  
ATOM 9516  C C    . ARG A 1 61 ? -5.180  8.949   -11.385 1.00 0.00 ? 61 ARG A C    7  
ATOM 9517  O O    . ARG A 1 61 ? -5.223  9.026   -12.613 1.00 0.00 ? 61 ARG A O    7  
ATOM 9518  C CB   . ARG A 1 61 ? -7.133  9.438   -9.876  1.00 0.00 ? 61 ARG A CB   7  
ATOM 9519  C CG   . ARG A 1 61 ? -7.684  10.523  -10.793 1.00 0.00 ? 61 ARG A CG   7  
ATOM 9520  C CD   . ARG A 1 61 ? -8.764  9.989   -11.727 1.00 0.00 ? 61 ARG A CD   7  
ATOM 9521  N NE   . ARG A 1 61 ? -9.259  11.027  -12.638 1.00 0.00 ? 61 ARG A NE   7  
ATOM 9522  C CZ   . ARG A 1 61 ? -10.325 10.891  -13.435 1.00 0.00 ? 61 ARG A CZ   7  
ATOM 9523  N NH1  . ARG A 1 61 ? -11.070 9.791   -13.382 1.00 0.00 ? 61 ARG A NH1  7  
ATOM 9524  N NH2  . ARG A 1 61 ? -10.664 11.879  -14.259 1.00 0.00 ? 61 ARG A NH2  7  
ATOM 9525  H H    . ARG A 1 61 ? -6.012  7.508   -8.683  1.00 0.00 ? 61 ARG A H    7  
ATOM 9526  H HA   . ARG A 1 61 ? -6.998  7.831   -11.292 1.00 0.00 ? 61 ARG A HA   7  
ATOM 9527  H HB2  . ARG A 1 61 ? -7.965  8.982   -9.358  1.00 0.00 ? 61 ARG A HB2  7  
ATOM 9528  H HB3  . ARG A 1 61 ? -6.486  9.908   -9.149  1.00 0.00 ? 61 ARG A HB3  7  
ATOM 9529  H HG2  . ARG A 1 61 ? -8.106  11.309  -10.187 1.00 0.00 ? 61 ARG A HG2  7  
ATOM 9530  H HG3  . ARG A 1 61 ? -6.875  10.920  -11.386 1.00 0.00 ? 61 ARG A HG3  7  
ATOM 9531  H HD2  . ARG A 1 61 ? -8.348  9.180   -12.310 1.00 0.00 ? 61 ARG A HD2  7  
ATOM 9532  H HD3  . ARG A 1 61 ? -9.587  9.619   -11.134 1.00 0.00 ? 61 ARG A HD3  7  
ATOM 9533  H HE   . ARG A 1 61 ? -8.757  11.876  -12.668 1.00 0.00 ? 61 ARG A HE   7  
ATOM 9534  H HH11 . ARG A 1 61 ? -10.843 9.058   -12.742 1.00 0.00 ? 61 ARG A HH11 7  
ATOM 9535  H HH12 . ARG A 1 61 ? -11.877 9.691   -13.985 1.00 0.00 ? 61 ARG A HH12 7  
ATOM 9536  H HH21 . ARG A 1 61 ? -10.122 12.729  -14.276 1.00 0.00 ? 61 ARG A HH21 7  
ATOM 9537  H HH22 . ARG A 1 61 ? -11.452 11.780  -14.875 1.00 0.00 ? 61 ARG A HH22 7  
ATOM 9538  N N    . ALA A 1 62 ? -4.140  9.355   -10.668 1.00 0.00 ? 62 ALA A N    7  
ATOM 9539  C CA   . ALA A 1 62 ? -2.976  9.977   -11.285 1.00 0.00 ? 62 ALA A CA   7  
ATOM 9540  C C    . ALA A 1 62 ? -2.271  9.015   -12.236 1.00 0.00 ? 62 ALA A C    7  
ATOM 9541  O O    . ALA A 1 62 ? -1.967  9.367   -13.379 1.00 0.00 ? 62 ALA A O    7  
ATOM 9542  C CB   . ALA A 1 62 ? -2.010  10.468  -10.219 1.00 0.00 ? 62 ALA A CB   7  
ATOM 9543  H H    . ALA A 1 62 ? -4.157  9.235   -9.690  1.00 0.00 ? 62 ALA A H    7  
ATOM 9544  H HA   . ALA A 1 62 ? -3.317  10.833  -11.847 1.00 0.00 ? 62 ALA A HA   7  
ATOM 9545  H HB1  . ALA A 1 62 ? -1.627  9.624   -9.665  1.00 0.00 ? 62 ALA A HB1  7  
ATOM 9546  H HB2  . ALA A 1 62 ? -2.526  11.138  -9.546  1.00 0.00 ? 62 ALA A HB2  7  
ATOM 9547  H HB3  . ALA A 1 62 ? -1.192  10.993  -10.691 1.00 0.00 ? 62 ALA A HB3  7  
ATOM 9548  N N    . LEU A 1 63 ? -2.030  7.797   -11.763 1.00 0.00 ? 63 LEU A N    7  
ATOM 9549  C CA   . LEU A 1 63 ? -1.343  6.783   -12.552 1.00 0.00 ? 63 LEU A CA   7  
ATOM 9550  C C    . LEU A 1 63 ? -2.098  6.458   -13.820 1.00 0.00 ? 63 LEU A C    7  
ATOM 9551  O O    . LEU A 1 63 ? -1.493  6.208   -14.860 1.00 0.00 ? 63 LEU A O    7  
ATOM 9552  C CB   . LEU A 1 63 ? -1.125  5.510   -11.731 1.00 0.00 ? 63 LEU A CB   7  
ATOM 9553  C CG   . LEU A 1 63 ? -0.197  5.660   -10.524 1.00 0.00 ? 63 LEU A CG   7  
ATOM 9554  C CD1  . LEU A 1 63 ? -0.055  4.332   -9.801  1.00 0.00 ? 63 LEU A CD1  7  
ATOM 9555  C CD2  . LEU A 1 63 ? 1.166   6.180   -10.953 1.00 0.00 ? 63 LEU A CD2  7  
ATOM 9556  H H    . LEU A 1 63 ? -2.315  7.574   -10.855 1.00 0.00 ? 63 LEU A H    7  
ATOM 9557  H HA   . LEU A 1 63 ? -0.391  7.179   -12.832 1.00 0.00 ? 63 LEU A HA   7  
ATOM 9558  H HB2  . LEU A 1 63 ? -2.085  5.168   -11.380 1.00 0.00 ? 63 LEU A HB2  7  
ATOM 9559  H HB3  . LEU A 1 63 ? -0.710  4.754   -12.382 1.00 0.00 ? 63 LEU A HB3  7  
ATOM 9560  H HG   . LEU A 1 63 ? -0.626  6.372   -9.834  1.00 0.00 ? 63 LEU A HG   7  
ATOM 9561  H HD11 . LEU A 1 63 ? 0.359   3.598   -10.476 1.00 0.00 ? 63 LEU A HD11 7  
ATOM 9562  H HD12 . LEU A 1 63 ? -1.025  4.001   -9.459  1.00 0.00 ? 63 LEU A HD12 7  
ATOM 9563  H HD13 . LEU A 1 63 ? 0.604   4.450   -8.954  1.00 0.00 ? 63 LEU A HD13 7  
ATOM 9564  H HD21 . LEU A 1 63 ? 1.796   6.296   -10.084 1.00 0.00 ? 63 LEU A HD21 7  
ATOM 9565  H HD22 . LEU A 1 63 ? 1.051   7.134   -11.445 1.00 0.00 ? 63 LEU A HD22 7  
ATOM 9566  H HD23 . LEU A 1 63 ? 1.621   5.475   -11.635 1.00 0.00 ? 63 LEU A HD23 7  
ATOM 9567  N N    . HIS A 1 64 ? -3.417  6.475   -13.756 1.00 0.00 ? 64 HIS A N    7  
ATOM 9568  C CA   . HIS A 1 64 ? -4.193  6.139   -14.926 1.00 0.00 ? 64 HIS A CA   7  
ATOM 9569  C C    . HIS A 1 64 ? -4.253  7.326   -15.884 1.00 0.00 ? 64 HIS A C    7  
ATOM 9570  O O    . HIS A 1 64 ? -4.377  7.148   -17.092 1.00 0.00 ? 64 HIS A O    7  
ATOM 9571  C CB   . HIS A 1 64 ? -5.604  5.667   -14.550 1.00 0.00 ? 64 HIS A CB   7  
ATOM 9572  C CG   . HIS A 1 64 ? -6.244  4.791   -15.592 1.00 0.00 ? 64 HIS A CG   7  
ATOM 9573  N ND1  . HIS A 1 64 ? -6.950  3.646   -15.287 1.00 0.00 ? 64 HIS A ND1  7  
ATOM 9574  C CD2  . HIS A 1 64 ? -6.270  4.892   -16.941 1.00 0.00 ? 64 HIS A CD2  7  
ATOM 9575  C CE1  . HIS A 1 64 ? -7.376  3.084   -16.403 1.00 0.00 ? 64 HIS A CE1  7  
ATOM 9576  N NE2  . HIS A 1 64 ? -6.978  3.821   -17.425 1.00 0.00 ? 64 HIS A NE2  7  
ATOM 9577  H H    . HIS A 1 64 ? -3.866  6.709   -12.914 1.00 0.00 ? 64 HIS A H    7  
ATOM 9578  H HA   . HIS A 1 64 ? -3.668  5.334   -15.414 1.00 0.00 ? 64 HIS A HA   7  
ATOM 9579  H HB2  . HIS A 1 64 ? -5.557  5.107   -13.627 1.00 0.00 ? 64 HIS A HB2  7  
ATOM 9580  H HB3  . HIS A 1 64 ? -6.238  6.531   -14.409 1.00 0.00 ? 64 HIS A HB3  7  
ATOM 9581  H HD1  . HIS A 1 64 ? -7.120  3.297   -14.384 1.00 0.00 ? 64 HIS A HD1  7  
ATOM 9582  H HD2  . HIS A 1 64 ? -5.813  5.674   -17.531 1.00 0.00 ? 64 HIS A HD2  7  
ATOM 9583  H HE1  . HIS A 1 64 ? -7.948  2.170   -16.470 1.00 0.00 ? 64 HIS A HE1  7  
ATOM 9584  H HE2  . HIS A 1 64 ? -6.917  3.493   -18.356 1.00 0.00 ? 64 HIS A HE2  7  
ATOM 9585  N N    . MET A 1 65 ? -4.149  8.538   -15.348 1.00 0.00 ? 65 MET A N    7  
ATOM 9586  C CA   . MET A 1 65 ? -4.124  9.730   -16.192 1.00 0.00 ? 65 MET A CA   7  
ATOM 9587  C C    . MET A 1 65 ? -2.805  9.816   -16.947 1.00 0.00 ? 65 MET A C    7  
ATOM 9588  O O    . MET A 1 65 ? -2.702  10.498  -17.968 1.00 0.00 ? 65 MET A O    7  
ATOM 9589  C CB   . MET A 1 65 ? -4.342  11.005  -15.373 1.00 0.00 ? 65 MET A CB   7  
ATOM 9590  C CG   . MET A 1 65 ? -5.756  11.154  -14.837 1.00 0.00 ? 65 MET A CG   7  
ATOM 9591  S SD   . MET A 1 65 ? -6.045  12.751  -14.046 1.00 0.00 ? 65 MET A SD   7  
ATOM 9592  C CE   . MET A 1 65 ? -4.819  12.719  -12.739 1.00 0.00 ? 65 MET A CE   7  
ATOM 9593  H H    . MET A 1 65 ? -4.088  8.634   -14.373 1.00 0.00 ? 65 MET A H    7  
ATOM 9594  H HA   . MET A 1 65 ? -4.925  9.637   -16.911 1.00 0.00 ? 65 MET A HA   7  
ATOM 9595  H HB2  . MET A 1 65 ? -3.661  11.000  -14.534 1.00 0.00 ? 65 MET A HB2  7  
ATOM 9596  H HB3  . MET A 1 65 ? -4.125  11.860  -15.996 1.00 0.00 ? 65 MET A HB3  7  
ATOM 9597  H HG2  . MET A 1 65 ? -6.447  11.046  -15.659 1.00 0.00 ? 65 MET A HG2  7  
ATOM 9598  H HG3  . MET A 1 65 ? -5.936  10.371  -14.114 1.00 0.00 ? 65 MET A HG3  7  
ATOM 9599  H HE1  . MET A 1 65 ? -3.833  12.646  -13.172 1.00 0.00 ? 65 MET A HE1  7  
ATOM 9600  H HE2  . MET A 1 65 ? -4.998  11.867  -12.099 1.00 0.00 ? 65 MET A HE2  7  
ATOM 9601  H HE3  . MET A 1 65 ? -4.891  13.626  -12.158 1.00 0.00 ? 65 MET A HE3  7  
ATOM 9602  N N    . LYS A 1 66 ? -1.795  9.112   -16.443 1.00 0.00 ? 66 LYS A N    7  
ATOM 9603  C CA   . LYS A 1 66 ? -0.505  9.034   -17.118 1.00 0.00 ? 66 LYS A CA   7  
ATOM 9604  C C    . LYS A 1 66 ? -0.567  8.092   -18.322 1.00 0.00 ? 66 LYS A C    7  
ATOM 9605  O O    . LYS A 1 66 ? 0.422   7.911   -19.031 1.00 0.00 ? 66 LYS A O    7  
ATOM 9606  C CB   . LYS A 1 66 ? 0.585   8.579   -16.146 1.00 0.00 ? 66 LYS A CB   7  
ATOM 9607  C CG   . LYS A 1 66 ? 0.998   9.653   -15.153 1.00 0.00 ? 66 LYS A CG   7  
ATOM 9608  C CD   . LYS A 1 66 ? 2.086   9.156   -14.216 1.00 0.00 ? 66 LYS A CD   7  
ATOM 9609  C CE   . LYS A 1 66 ? 2.658   10.290  -13.379 1.00 0.00 ? 66 LYS A CE   7  
ATOM 9610  N NZ   . LYS A 1 66 ? 3.327   11.319  -14.220 1.00 0.00 ? 66 LYS A NZ   7  
ATOM 9611  H H    . LYS A 1 66 ? -1.919  8.641   -15.586 1.00 0.00 ? 66 LYS A H    7  
ATOM 9612  H HA   . LYS A 1 66 ? -0.262  10.026  -17.471 1.00 0.00 ? 66 LYS A HA   7  
ATOM 9613  H HB2  . LYS A 1 66 ? 0.222   7.726   -15.594 1.00 0.00 ? 66 LYS A HB2  7  
ATOM 9614  H HB3  . LYS A 1 66 ? 1.458   8.285   -16.710 1.00 0.00 ? 66 LYS A HB3  7  
ATOM 9615  H HG2  . LYS A 1 66 ? 1.371   10.508  -15.696 1.00 0.00 ? 66 LYS A HG2  7  
ATOM 9616  H HG3  . LYS A 1 66 ? 0.136   9.941   -14.571 1.00 0.00 ? 66 LYS A HG3  7  
ATOM 9617  H HD2  . LYS A 1 66 ? 1.666   8.412   -13.556 1.00 0.00 ? 66 LYS A HD2  7  
ATOM 9618  H HD3  . LYS A 1 66 ? 2.880   8.716   -14.801 1.00 0.00 ? 66 LYS A HD3  7  
ATOM 9619  H HE2  . LYS A 1 66 ? 1.853   10.755  -12.830 1.00 0.00 ? 66 LYS A HE2  7  
ATOM 9620  H HE3  . LYS A 1 66 ? 3.377   9.880   -12.685 1.00 0.00 ? 66 LYS A HE3  7  
ATOM 9621  H HZ1  . LYS A 1 66 ? 2.638   11.775  -14.854 1.00 0.00 ? 66 LYS A HZ1  7  
ATOM 9622  H HZ2  . LYS A 1 66 ? 4.076   10.880  -14.799 1.00 0.00 ? 66 LYS A HZ2  7  
ATOM 9623  H HZ3  . LYS A 1 66 ? 3.761   12.051  -13.617 1.00 0.00 ? 66 LYS A HZ3  7  
ATOM 9624  N N    . GLU A 1 67 ? -1.729  7.494   -18.547 1.00 0.00 ? 67 GLU A N    7  
ATOM 9625  C CA   . GLU A 1 67 ? -1.946  6.654   -19.714 1.00 0.00 ? 67 GLU A CA   7  
ATOM 9626  C C    . GLU A 1 67 ? -2.818  7.413   -20.711 1.00 0.00 ? 67 GLU A C    7  
ATOM 9627  O O    . GLU A 1 67 ? -3.996  7.658   -20.453 1.00 0.00 ? 67 GLU A O    7  
ATOM 9628  C CB   . GLU A 1 67 ? -2.620  5.340   -19.295 1.00 0.00 ? 67 GLU A CB   7  
ATOM 9629  C CG   . GLU A 1 67 ? -2.099  4.113   -20.029 1.00 0.00 ? 67 GLU A CG   7  
ATOM 9630  C CD   . GLU A 1 67 ? -2.320  4.176   -21.523 1.00 0.00 ? 67 GLU A CD   7  
ATOM 9631  O OE1  . GLU A 1 67 ? -3.440  3.858   -21.973 1.00 0.00 ? 67 GLU A OE1  7  
ATOM 9632  O OE2  . GLU A 1 67 ? -1.367  4.527   -22.254 1.00 0.00 ? 67 GLU A OE2  7  
ATOM 9633  H H    . GLU A 1 67 ? -2.464  7.624   -17.910 1.00 0.00 ? 67 GLU A H    7  
ATOM 9634  H HA   . GLU A 1 67 ? -0.987  6.443   -20.165 1.00 0.00 ? 67 GLU A HA   7  
ATOM 9635  H HB2  . GLU A 1 67 ? -2.461  5.192   -18.238 1.00 0.00 ? 67 GLU A HB2  7  
ATOM 9636  H HB3  . GLU A 1 67 ? -3.681  5.420   -19.482 1.00 0.00 ? 67 GLU A HB3  7  
ATOM 9637  H HG2  . GLU A 1 67 ? -1.040  4.024   -19.843 1.00 0.00 ? 67 GLU A HG2  7  
ATOM 9638  H HG3  . GLU A 1 67 ? -2.605  3.239   -19.641 1.00 0.00 ? 67 GLU A HG3  7  
ATOM 9639  N N    . HIS A 1 68 ? -2.233  7.813   -21.834 1.00 0.00 ? 68 HIS A N    7  
ATOM 9640  C CA   . HIS A 1 68 ? -2.926  8.685   -22.778 1.00 0.00 ? 68 HIS A CA   7  
ATOM 9641  C C    . HIS A 1 68 ? -2.332  8.599   -24.188 1.00 0.00 ? 68 HIS A C    7  
ATOM 9642  O O    . HIS A 1 68 ? -1.585  9.475   -24.612 1.00 0.00 ? 68 HIS A O    7  
ATOM 9643  C CB   . HIS A 1 68 ? -2.902  10.139  -22.268 1.00 0.00 ? 68 HIS A CB   7  
ATOM 9644  C CG   . HIS A 1 68 ? -1.571  10.585  -21.711 1.00 0.00 ? 68 HIS A CG   7  
ATOM 9645  N ND1  . HIS A 1 68 ? -1.360  10.822  -20.366 1.00 0.00 ? 68 HIS A ND1  7  
ATOM 9646  C CD2  . HIS A 1 68 ? -0.385  10.840  -22.320 1.00 0.00 ? 68 HIS A CD2  7  
ATOM 9647  C CE1  . HIS A 1 68 ? -0.109  11.205  -20.179 1.00 0.00 ? 68 HIS A CE1  7  
ATOM 9648  N NE2  . HIS A 1 68 ? 0.503   11.221  -21.347 1.00 0.00 ? 68 HIS A NE2  7  
ATOM 9649  H H    . HIS A 1 68 ? -1.321  7.500   -22.044 1.00 0.00 ? 68 HIS A H    7  
ATOM 9650  H HA   . HIS A 1 68 ? -3.952  8.355   -22.825 1.00 0.00 ? 68 HIS A HA   7  
ATOM 9651  H HB2  . HIS A 1 68 ? -3.155  10.801  -23.083 1.00 0.00 ? 68 HIS A HB2  7  
ATOM 9652  H HB3  . HIS A 1 68 ? -3.641  10.244  -21.488 1.00 0.00 ? 68 HIS A HB3  7  
ATOM 9653  H HD1  . HIS A 1 68 ? -2.033  10.735  -19.651 1.00 0.00 ? 68 HIS A HD1  7  
ATOM 9654  H HD2  . HIS A 1 68 ? -0.177  10.753  -23.378 1.00 0.00 ? 68 HIS A HD2  7  
ATOM 9655  H HE1  . HIS A 1 68 ? 0.338   11.461  -19.228 1.00 0.00 ? 68 HIS A HE1  7  
ATOM 9656  H HE2  . HIS A 1 68 ? 1.473   11.359  -21.477 1.00 0.00 ? 68 HIS A HE2  7  
ATOM 9657  N N    . PRO A 1 69 ? -2.653  7.535   -24.933 1.00 0.00 ? 69 PRO A N    7  
ATOM 9658  C CA   . PRO A 1 69 ? -2.159  7.349   -26.297 1.00 0.00 ? 69 PRO A CA   7  
ATOM 9659  C C    . PRO A 1 69 ? -2.937  8.175   -27.322 1.00 0.00 ? 69 PRO A C    7  
ATOM 9660  O O    . PRO A 1 69 ? -2.355  8.904   -28.128 1.00 0.00 ? 69 PRO A O    7  
ATOM 9661  C CB   . PRO A 1 69 ? -2.363  5.849   -26.563 1.00 0.00 ? 69 PRO A CB   7  
ATOM 9662  C CG   . PRO A 1 69 ? -2.906  5.268   -25.294 1.00 0.00 ? 69 PRO A CG   7  
ATOM 9663  C CD   . PRO A 1 69 ? -3.489  6.409   -24.511 1.00 0.00 ? 69 PRO A CD   7  
ATOM 9664  H HA   . PRO A 1 69 ? -1.108  7.587   -26.370 1.00 0.00 ? 69 PRO A HA   7  
ATOM 9665  H HB2  . PRO A 1 69 ? -3.057  5.721   -27.379 1.00 0.00 ? 69 PRO A HB2  7  
ATOM 9666  H HB3  . PRO A 1 69 ? -1.415  5.399   -26.823 1.00 0.00 ? 69 PRO A HB3  7  
ATOM 9667  H HG2  . PRO A 1 69 ? -3.671  4.542   -25.525 1.00 0.00 ? 69 PRO A HG2  7  
ATOM 9668  H HG3  . PRO A 1 69 ? -2.106  4.802   -24.737 1.00 0.00 ? 69 PRO A HG3  7  
ATOM 9669  H HD2  . PRO A 1 69 ? -4.524  6.570   -24.779 1.00 0.00 ? 69 PRO A HD2  7  
ATOM 9670  H HD3  . PRO A 1 69 ? -3.391  6.233   -23.449 1.00 0.00 ? 69 PRO A HD3  7  
ATOM 9671  N N    . ASP A 1 70 ? -4.258  8.063   -27.279 1.00 0.00 ? 70 ASP A N    7  
ATOM 9672  C CA   . ASP A 1 70 ? -5.124  8.704   -28.269 1.00 0.00 ? 70 ASP A CA   7  
ATOM 9673  C C    . ASP A 1 70 ? -5.626  10.066  -27.797 1.00 0.00 ? 70 ASP A C    7  
ATOM 9674  O O    . ASP A 1 70 ? -6.114  10.861  -28.601 1.00 0.00 ? 70 ASP A O    7  
ATOM 9675  C CB   . ASP A 1 70 ? -6.311  7.796   -28.595 1.00 0.00 ? 70 ASP A CB   7  
ATOM 9676  C CG   . ASP A 1 70 ? -6.898  7.150   -27.359 1.00 0.00 ? 70 ASP A CG   7  
ATOM 9677  O OD1  . ASP A 1 70 ? -7.315  7.879   -26.434 1.00 0.00 ? 70 ASP A OD1  7  
ATOM 9678  O OD2  . ASP A 1 70 ? -6.938  5.907   -27.298 1.00 0.00 ? 70 ASP A OD2  7  
ATOM 9679  H H    . ASP A 1 70 ? -4.666  7.533   -26.563 1.00 0.00 ? 70 ASP A H    7  
ATOM 9680  H HA   . ASP A 1 70 ? -4.542  8.848   -29.167 1.00 0.00 ? 70 ASP A HA   7  
ATOM 9681  H HB2  . ASP A 1 70 ? -7.082  8.379   -29.075 1.00 0.00 ? 70 ASP A HB2  7  
ATOM 9682  H HB3  . ASP A 1 70 ? -5.985  7.014   -29.267 1.00 0.00 ? 70 ASP A HB3  7  
ATOM 9683  N N    . TYR A 1 71 ? -5.510  10.320  -26.495 1.00 0.00 ? 71 TYR A N    7  
ATOM 9684  C CA   . TYR A 1 71 ? -5.873  11.613  -25.907 1.00 0.00 ? 71 TYR A CA   7  
ATOM 9685  C C    . TYR A 1 71 ? -7.360  11.925  -26.088 1.00 0.00 ? 71 TYR A C    7  
ATOM 9686  O O    . TYR A 1 71 ? -7.722  12.967  -26.633 1.00 0.00 ? 71 TYR A O    7  
ATOM 9687  C CB   . TYR A 1 71 ? -5.031  12.745  -26.505 1.00 0.00 ? 71 TYR A CB   7  
ATOM 9688  C CG   . TYR A 1 71 ? -3.558  12.641  -26.198 1.00 0.00 ? 71 TYR A CG   7  
ATOM 9689  C CD1  . TYR A 1 71 ? -3.046  13.113  -24.999 1.00 0.00 ? 71 TYR A CD1  7  
ATOM 9690  C CD2  . TYR A 1 71 ? -2.678  12.082  -27.114 1.00 0.00 ? 71 TYR A CD2  7  
ATOM 9691  C CE1  . TYR A 1 71 ? -1.697  13.028  -24.718 1.00 0.00 ? 71 TYR A CE1  7  
ATOM 9692  C CE2  . TYR A 1 71 ? -1.331  11.991  -26.841 1.00 0.00 ? 71 TYR A CE2  7  
ATOM 9693  C CZ   . TYR A 1 71 ? -0.844  12.467  -25.643 1.00 0.00 ? 71 TYR A CZ   7  
ATOM 9694  O OH   . TYR A 1 71 ? 0.500   12.384  -25.373 1.00 0.00 ? 71 TYR A OH   7  
ATOM 9695  H H    . TYR A 1 71 ? -5.182  9.611   -25.908 1.00 0.00 ? 71 TYR A H    7  
ATOM 9696  H HA   . TYR A 1 71 ? -5.663  11.553  -24.850 1.00 0.00 ? 71 TYR A HA   7  
ATOM 9697  H HB2  . TYR A 1 71 ? -5.145  12.741  -27.578 1.00 0.00 ? 71 TYR A HB2  7  
ATOM 9698  H HB3  . TYR A 1 71 ? -5.385  13.689  -26.116 1.00 0.00 ? 71 TYR A HB3  7  
ATOM 9699  H HD1  . TYR A 1 71 ? -3.718  13.552  -24.277 1.00 0.00 ? 71 TYR A HD1  7  
ATOM 9700  H HD2  . TYR A 1 71 ? -3.064  11.711  -28.052 1.00 0.00 ? 71 TYR A HD2  7  
ATOM 9701  H HE1  . TYR A 1 71 ? -1.316  13.402  -23.779 1.00 0.00 ? 71 TYR A HE1  7  
ATOM 9702  H HE2  . TYR A 1 71 ? -0.662  11.552  -27.566 1.00 0.00 ? 71 TYR A HE2  7  
ATOM 9703  H HH   . TYR A 1 71 ? 0.994   12.752  -26.118 1.00 0.00 ? 71 TYR A HH   7  
ATOM 9704  N N    . LYS A 1 72 ? -8.216  11.026  -25.613 1.00 0.00 ? 72 LYS A N    7  
ATOM 9705  C CA   . LYS A 1 72 ? -9.668  11.231  -25.669 1.00 0.00 ? 72 LYS A CA   7  
ATOM 9706  C C    . LYS A 1 72 ? -10.143 12.143  -24.544 1.00 0.00 ? 72 LYS A C    7  
ATOM 9707  O O    . LYS A 1 72 ? -11.341 12.249  -24.286 1.00 0.00 ? 72 LYS A O    7  
ATOM 9708  C CB   . LYS A 1 72 ? -10.409 9.890   -25.579 1.00 0.00 ? 72 LYS A CB   7  
ATOM 9709  C CG   . LYS A 1 72 ? -10.165 8.958   -26.753 1.00 0.00 ? 72 LYS A CG   7  
ATOM 9710  C CD   . LYS A 1 72 ? -10.987 7.683   -26.625 1.00 0.00 ? 72 LYS A CD   7  
ATOM 9711  C CE   . LYS A 1 72 ? -10.580 6.860   -25.409 1.00 0.00 ? 72 LYS A CE   7  
ATOM 9712  N NZ   . LYS A 1 72 ? -9.242  6.233   -25.577 1.00 0.00 ? 72 LYS A NZ   7  
ATOM 9713  H H    . LYS A 1 72 ? -7.867  10.195  -25.230 1.00 0.00 ? 72 LYS A H    7  
ATOM 9714  H HA   . LYS A 1 72 ? -9.903  11.703  -26.609 1.00 0.00 ? 72 LYS A HA   7  
ATOM 9715  H HB2  . LYS A 1 72 ? -10.095 9.383   -24.679 1.00 0.00 ? 72 LYS A HB2  7  
ATOM 9716  H HB3  . LYS A 1 72 ? -11.471 10.085  -25.517 1.00 0.00 ? 72 LYS A HB3  7  
ATOM 9717  H HG2  . LYS A 1 72 ? -10.441 9.462   -27.667 1.00 0.00 ? 72 LYS A HG2  7  
ATOM 9718  H HG3  . LYS A 1 72 ? -9.116  8.700   -26.783 1.00 0.00 ? 72 LYS A HG3  7  
ATOM 9719  H HD2  . LYS A 1 72 ? -12.029 7.949   -26.531 1.00 0.00 ? 72 LYS A HD2  7  
ATOM 9720  H HD3  . LYS A 1 72 ? -10.846 7.087   -27.514 1.00 0.00 ? 72 LYS A HD3  7  
ATOM 9721  H HE2  . LYS A 1 72 ? -10.558 7.507   -24.543 1.00 0.00 ? 72 LYS A HE2  7  
ATOM 9722  H HE3  . LYS A 1 72 ? -11.314 6.084   -25.254 1.00 0.00 ? 72 LYS A HE3  7  
ATOM 9723  H HZ1  . LYS A 1 72 ? -8.546  6.945   -25.897 1.00 0.00 ? 72 LYS A HZ1  7  
ATOM 9724  H HZ2  . LYS A 1 72 ? -9.289  5.473   -26.291 1.00 0.00 ? 72 LYS A HZ2  7  
ATOM 9725  H HZ3  . LYS A 1 72 ? -8.914  5.827   -24.674 1.00 0.00 ? 72 LYS A HZ3  7  
ATOM 9726  N N    . TYR A 1 73 ? -9.215  12.811  -23.878 1.00 0.00 ? 73 TYR A N    7  
ATOM 9727  C CA   . TYR A 1 73 ? -9.579  13.676  -22.775 1.00 0.00 ? 73 TYR A CA   7  
ATOM 9728  C C    . TYR A 1 73 ? -9.463  15.142  -23.189 1.00 0.00 ? 73 TYR A C    7  
ATOM 9729  O O    . TYR A 1 73 ? -8.404  15.606  -23.618 1.00 0.00 ? 73 TYR A O    7  
ATOM 9730  C CB   . TYR A 1 73 ? -8.714  13.383  -21.529 1.00 0.00 ? 73 TYR A CB   7  
ATOM 9731  C CG   . TYR A 1 73 ? -7.342  14.035  -21.529 1.00 0.00 ? 73 TYR A CG   7  
ATOM 9732  C CD1  . TYR A 1 73 ? -6.282  13.499  -22.252 1.00 0.00 ? 73 TYR A CD1  7  
ATOM 9733  C CD2  . TYR A 1 73 ? -7.114  15.195  -20.796 1.00 0.00 ? 73 TYR A CD2  7  
ATOM 9734  C CE1  . TYR A 1 73 ? -5.037  14.103  -22.243 1.00 0.00 ? 73 TYR A CE1  7  
ATOM 9735  C CE2  . TYR A 1 73 ? -5.875  15.803  -20.783 1.00 0.00 ? 73 TYR A CE2  7  
ATOM 9736  C CZ   . TYR A 1 73 ? -4.840  15.256  -21.508 1.00 0.00 ? 73 TYR A CZ   7  
ATOM 9737  O OH   . TYR A 1 73 ? -3.602  15.864  -21.495 1.00 0.00 ? 73 TYR A OH   7  
ATOM 9738  H H    . TYR A 1 73 ? -8.278  12.739  -24.148 1.00 0.00 ? 73 TYR A H    7  
ATOM 9739  H HA   . TYR A 1 73 ? -10.611 13.472  -22.534 1.00 0.00 ? 73 TYR A HA   7  
ATOM 9740  H HB2  . TYR A 1 73 ? -9.239  13.732  -20.652 1.00 0.00 ? 73 TYR A HB2  7  
ATOM 9741  H HB3  . TYR A 1 73 ? -8.573  12.315  -21.448 1.00 0.00 ? 73 TYR A HB3  7  
ATOM 9742  H HD1  . TYR A 1 73 ? -6.441  12.598  -22.827 1.00 0.00 ? 73 TYR A HD1  7  
ATOM 9743  H HD2  . TYR A 1 73 ? -7.928  15.623  -20.227 1.00 0.00 ? 73 TYR A HD2  7  
ATOM 9744  H HE1  . TYR A 1 73 ? -4.227  13.673  -22.811 1.00 0.00 ? 73 TYR A HE1  7  
ATOM 9745  H HE2  . TYR A 1 73 ? -5.723  16.703  -20.209 1.00 0.00 ? 73 TYR A HE2  7  
ATOM 9746  H HH   . TYR A 1 73 ? -3.228  15.851  -22.384 1.00 0.00 ? 73 TYR A HH   7  
ATOM 9747  N N    . ARG A 1 74 ? -10.571 15.853  -23.124 1.00 0.00 ? 74 ARG A N    7  
ATOM 9748  C CA   . ARG A 1 74 ? -10.538 17.301  -23.246 1.00 0.00 ? 74 ARG A CA   7  
ATOM 9749  C C    . ARG A 1 74 ? -11.032 17.930  -21.949 1.00 0.00 ? 74 ARG A C    7  
ATOM 9750  O O    . ARG A 1 74 ? -11.957 17.413  -21.322 1.00 0.00 ? 74 ARG A O    7  
ATOM 9751  C CB   . ARG A 1 74 ? -11.392 17.782  -24.424 1.00 0.00 ? 74 ARG A CB   7  
ATOM 9752  C CG   . ARG A 1 74 ? -10.957 17.216  -25.767 1.00 0.00 ? 74 ARG A CG   7  
ATOM 9753  C CD   . ARG A 1 74 ? -11.541 18.017  -26.918 1.00 0.00 ? 74 ARG A CD   7  
ATOM 9754  N NE   . ARG A 1 74 ? -10.984 19.369  -26.976 1.00 0.00 ? 74 ARG A NE   7  
ATOM 9755  C CZ   . ARG A 1 74 ? -11.418 20.330  -27.791 1.00 0.00 ? 74 ARG A CZ   7  
ATOM 9756  N NH1  . ARG A 1 74 ? -12.449 20.116  -28.600 1.00 0.00 ? 74 ARG A NH1  7  
ATOM 9757  N NH2  . ARG A 1 74 ? -10.814 21.511  -27.792 1.00 0.00 ? 74 ARG A NH2  7  
ATOM 9758  H H    . ARG A 1 74 ? -11.430 15.395  -23.009 1.00 0.00 ? 74 ARG A H    7  
ATOM 9759  H HA   . ARG A 1 74 ? -9.511  17.598  -23.408 1.00 0.00 ? 74 ARG A HA   7  
ATOM 9760  H HB2  . ARG A 1 74 ? -12.417 17.489  -24.251 1.00 0.00 ? 74 ARG A HB2  7  
ATOM 9761  H HB3  . ARG A 1 74 ? -11.339 18.860  -24.477 1.00 0.00 ? 74 ARG A HB3  7  
ATOM 9762  H HG2  . ARG A 1 74 ? -9.879  17.245  -25.829 1.00 0.00 ? 74 ARG A HG2  7  
ATOM 9763  H HG3  . ARG A 1 74 ? -11.296 16.193  -25.842 1.00 0.00 ? 74 ARG A HG3  7  
ATOM 9764  H HD2  . ARG A 1 74 ? -11.322 17.506  -27.844 1.00 0.00 ? 74 ARG A HD2  7  
ATOM 9765  H HD3  . ARG A 1 74 ? -12.610 18.085  -26.789 1.00 0.00 ? 74 ARG A HD3  7  
ATOM 9766  H HE   . ARG A 1 74 ? -10.220 19.569  -26.376 1.00 0.00 ? 74 ARG A HE   7  
ATOM 9767  H HH11 . ARG A 1 74 ? -12.914 19.218  -28.609 1.00 0.00 ? 74 ARG A HH11 7  
ATOM 9768  H HH12 . ARG A 1 74 ? -12.783 20.856  -29.206 1.00 0.00 ? 74 ARG A HH12 7  
ATOM 9769  H HH21 . ARG A 1 74 ? -10.031 21.681  -27.181 1.00 0.00 ? 74 ARG A HH21 7  
ATOM 9770  H HH22 . ARG A 1 74 ? -11.129 22.247  -28.411 1.00 0.00 ? 74 ARG A HH22 7  
ATOM 9771  N N    . PRO A 1 75 ? -10.424 19.050  -21.531 1.00 0.00 ? 75 PRO A N    7  
ATOM 9772  C CA   . PRO A 1 75 ? -10.783 19.725  -20.280 1.00 0.00 ? 75 PRO A CA   7  
ATOM 9773  C C    . PRO A 1 75 ? -12.154 20.388  -20.347 1.00 0.00 ? 75 PRO A C    7  
ATOM 9774  O O    . PRO A 1 75 ? -12.895 20.389  -19.363 1.00 0.00 ? 75 PRO A O    7  
ATOM 9775  C CB   . PRO A 1 75 ? -9.689  20.791  -20.108 1.00 0.00 ? 75 PRO A CB   7  
ATOM 9776  C CG   . PRO A 1 75 ? -8.622  20.438  -21.093 1.00 0.00 ? 75 PRO A CG   7  
ATOM 9777  C CD   . PRO A 1 75 ? -9.316  19.726  -22.215 1.00 0.00 ? 75 PRO A CD   7  
ATOM 9778  H HA   . PRO A 1 75 ? -10.757 19.042  -19.444 1.00 0.00 ? 75 PRO A HA   7  
ATOM 9779  H HB2  . PRO A 1 75 ? -10.104 21.768  -20.310 1.00 0.00 ? 75 PRO A HB2  7  
ATOM 9780  H HB3  . PRO A 1 75 ? -9.312  20.762  -19.096 1.00 0.00 ? 75 PRO A HB3  7  
ATOM 9781  H HG2  . PRO A 1 75 ? -8.146  21.337  -21.458 1.00 0.00 ? 75 PRO A HG2  7  
ATOM 9782  H HG3  . PRO A 1 75 ? -7.895  19.787  -20.630 1.00 0.00 ? 75 PRO A HG3  7  
ATOM 9783  H HD2  . PRO A 1 75 ? -9.682  20.434  -22.946 1.00 0.00 ? 75 PRO A HD2  7  
ATOM 9784  H HD3  . PRO A 1 75 ? -8.653  19.011  -22.677 1.00 0.00 ? 75 PRO A HD3  7  
ATOM 9785  N N    . ARG A 1 76 ? -12.476 20.938  -21.522 1.00 0.00 ? 76 ARG A N    7  
ATOM 9786  C CA   . ARG A 1 76 ? -13.715 21.689  -21.738 1.00 0.00 ? 76 ARG A CA   7  
ATOM 9787  C C    . ARG A 1 76 ? -13.742 22.969  -20.908 1.00 0.00 ? 76 ARG A C    7  
ATOM 9788  O O    . ARG A 1 76 ? -13.789 22.940  -19.679 1.00 0.00 ? 76 ARG A O    7  
ATOM 9789  C CB   . ARG A 1 76 ? -14.950 20.825  -21.443 1.00 0.00 ? 76 ARG A CB   7  
ATOM 9790  C CG   . ARG A 1 76 ? -15.268 19.824  -22.546 1.00 0.00 ? 76 ARG A CG   7  
ATOM 9791  C CD   . ARG A 1 76 ? -15.816 20.522  -23.784 1.00 0.00 ? 76 ARG A CD   7  
ATOM 9792  N NE   . ARG A 1 76 ? -17.164 21.051  -23.564 1.00 0.00 ? 76 ARG A NE   7  
ATOM 9793  C CZ   . ARG A 1 76 ? -17.493 22.342  -23.625 1.00 0.00 ? 76 ARG A CZ   7  
ATOM 9794  N NH1  . ARG A 1 76 ? -16.587 23.257  -23.952 1.00 0.00 ? 76 ARG A NH1  7  
ATOM 9795  N NH2  . ARG A 1 76 ? -18.742 22.710  -23.376 1.00 0.00 ? 76 ARG A NH2  7  
ATOM 9796  H H    . ARG A 1 76 ? -11.852 20.834  -22.268 1.00 0.00 ? 76 ARG A H    7  
ATOM 9797  H HA   . ARG A 1 76 ? -13.737 21.968  -22.783 1.00 0.00 ? 76 ARG A HA   7  
ATOM 9798  H HB2  . ARG A 1 76 ? -14.783 20.278  -20.527 1.00 0.00 ? 76 ARG A HB2  7  
ATOM 9799  H HB3  . ARG A 1 76 ? -15.806 21.471  -21.317 1.00 0.00 ? 76 ARG A HB3  7  
ATOM 9800  H HG2  . ARG A 1 76 ? -14.365 19.296  -22.812 1.00 0.00 ? 76 ARG A HG2  7  
ATOM 9801  H HG3  . ARG A 1 76 ? -16.005 19.123  -22.183 1.00 0.00 ? 76 ARG A HG3  7  
ATOM 9802  H HD2  . ARG A 1 76 ? -15.159 21.339  -24.042 1.00 0.00 ? 76 ARG A HD2  7  
ATOM 9803  H HD3  . ARG A 1 76 ? -15.846 19.813  -24.598 1.00 0.00 ? 76 ARG A HD3  7  
ATOM 9804  H HE   . ARG A 1 76 ? -17.874 20.397  -23.354 1.00 0.00 ? 76 ARG A HE   7  
ATOM 9805  H HH11 . ARG A 1 76 ? -15.650 22.985  -24.158 1.00 0.00 ? 76 ARG A HH11 7  
ATOM 9806  H HH12 . ARG A 1 76 ? -16.848 24.234  -23.999 1.00 0.00 ? 76 ARG A HH12 7  
ATOM 9807  H HH21 . ARG A 1 76 ? -19.434 22.016  -23.151 1.00 0.00 ? 76 ARG A HH21 7  
ATOM 9808  H HH22 . ARG A 1 76 ? -18.998 23.681  -23.395 1.00 0.00 ? 76 ARG A HH22 7  
ATOM 9809  N N    . ARG A 1 77 ? -13.711 24.099  -21.596 1.00 0.00 ? 77 ARG A N    7  
ATOM 9810  C CA   . ARG A 1 77 ? -13.741 25.393  -20.939 1.00 0.00 ? 77 ARG A CA   7  
ATOM 9811  C C    . ARG A 1 77 ? -15.162 25.759  -20.529 1.00 0.00 ? 77 ARG A C    7  
ATOM 9812  O O    . ARG A 1 77 ? -15.894 26.392  -21.293 1.00 0.00 ? 77 ARG A O    7  
ATOM 9813  C CB   . ARG A 1 77 ? -13.158 26.467  -21.863 1.00 0.00 ? 77 ARG A CB   7  
ATOM 9814  C CG   . ARG A 1 77 ? -11.647 26.386  -22.023 1.00 0.00 ? 77 ARG A CG   7  
ATOM 9815  C CD   . ARG A 1 77 ? -10.929 26.910  -20.787 1.00 0.00 ? 77 ARG A CD   7  
ATOM 9816  N NE   . ARG A 1 77 ? -11.151 28.346  -20.606 1.00 0.00 ? 77 ARG A NE   7  
ATOM 9817  C CZ   . ARG A 1 77 ? -11.467 28.921  -19.446 1.00 0.00 ? 77 ARG A CZ   7  
ATOM 9818  N NH1  . ARG A 1 77 ? -11.593 28.187  -18.348 1.00 0.00 ? 77 ARG A NH1  7  
ATOM 9819  N NH2  . ARG A 1 77 ? -11.657 30.235  -19.391 1.00 0.00 ? 77 ARG A NH2  7  
ATOM 9820  H H    . ARG A 1 77 ? -13.668 24.063  -22.572 1.00 0.00 ? 77 ARG A H    7  
ATOM 9821  H HA   . ARG A 1 77 ? -13.129 25.326  -20.052 1.00 0.00 ? 77 ARG A HA   7  
ATOM 9822  H HB2  . ARG A 1 77 ? -13.609 26.365  -22.839 1.00 0.00 ? 77 ARG A HB2  7  
ATOM 9823  H HB3  . ARG A 1 77 ? -13.405 27.440  -21.464 1.00 0.00 ? 77 ARG A HB3  7  
ATOM 9824  H HG2  . ARG A 1 77 ? -11.365 25.355  -22.181 1.00 0.00 ? 77 ARG A HG2  7  
ATOM 9825  H HG3  . ARG A 1 77 ? -11.352 26.977  -22.879 1.00 0.00 ? 77 ARG A HG3  7  
ATOM 9826  H HD2  . ARG A 1 77 ? -11.298 26.383  -19.920 1.00 0.00 ? 77 ARG A HD2  7  
ATOM 9827  H HD3  . ARG A 1 77 ? -9.870  26.729  -20.896 1.00 0.00 ? 77 ARG A HD3  7  
ATOM 9828  H HE   . ARG A 1 77 ? -11.057 28.918  -21.404 1.00 0.00 ? 77 ARG A HE   7  
ATOM 9829  H HH11 . ARG A 1 77 ? -11.446 27.201  -18.385 1.00 0.00 ? 77 ARG A HH11 7  
ATOM 9830  H HH12 . ARG A 1 77 ? -11.854 28.623  -17.473 1.00 0.00 ? 77 ARG A HH12 7  
ATOM 9831  H HH21 . ARG A 1 77 ? -11.567 30.793  -20.227 1.00 0.00 ? 77 ARG A HH21 7  
ATOM 9832  H HH22 . ARG A 1 77 ? -11.882 30.681  -18.517 1.00 0.00 ? 77 ARG A HH22 7  
ATOM 9833  N N    . LYS A 1 78 ? -15.561 25.321  -19.341 1.00 0.00 ? 78 LYS A N    7  
ATOM 9834  C CA   . LYS A 1 78 ? -16.866 25.672  -18.806 1.00 0.00 ? 78 LYS A CA   7  
ATOM 9835  C C    . LYS A 1 78 ? -16.853 27.121  -18.334 1.00 0.00 ? 78 LYS A C    7  
ATOM 9836  O O    . LYS A 1 78 ? -16.124 27.483  -17.408 1.00 0.00 ? 78 LYS A O    7  
ATOM 9837  C CB   . LYS A 1 78 ? -17.279 24.727  -17.666 1.00 0.00 ? 78 LYS A CB   7  
ATOM 9838  C CG   . LYS A 1 78 ? -16.241 24.582  -16.564 1.00 0.00 ? 78 LYS A CG   7  
ATOM 9839  C CD   . LYS A 1 78 ? -16.770 23.746  -15.405 1.00 0.00 ? 78 LYS A CD   7  
ATOM 9840  C CE   . LYS A 1 78 ? -15.710 23.533  -14.335 1.00 0.00 ? 78 LYS A CE   7  
ATOM 9841  N NZ   . LYS A 1 78 ? -16.250 22.794  -13.161 1.00 0.00 ? 78 LYS A NZ   7  
ATOM 9842  H H    . LYS A 1 78 ? -14.965 24.751  -18.814 1.00 0.00 ? 78 LYS A H    7  
ATOM 9843  H HA   . LYS A 1 78 ? -17.583 25.580  -19.610 1.00 0.00 ? 78 LYS A HA   7  
ATOM 9844  H HB2  . LYS A 1 78 ? -18.190 25.100  -17.220 1.00 0.00 ? 78 LYS A HB2  7  
ATOM 9845  H HB3  . LYS A 1 78 ? -17.471 23.746  -18.080 1.00 0.00 ? 78 LYS A HB3  7  
ATOM 9846  H HG2  . LYS A 1 78 ? -15.364 24.103  -16.971 1.00 0.00 ? 78 LYS A HG2  7  
ATOM 9847  H HG3  . LYS A 1 78 ? -15.980 25.565  -16.197 1.00 0.00 ? 78 LYS A HG3  7  
ATOM 9848  H HD2  . LYS A 1 78 ? -17.614 24.255  -14.963 1.00 0.00 ? 78 LYS A HD2  7  
ATOM 9849  H HD3  . LYS A 1 78 ? -17.086 22.786  -15.783 1.00 0.00 ? 78 LYS A HD3  7  
ATOM 9850  H HE2  . LYS A 1 78 ? -14.894 22.970  -14.762 1.00 0.00 ? 78 LYS A HE2  7  
ATOM 9851  H HE3  . LYS A 1 78 ? -15.350 24.497  -14.007 1.00 0.00 ? 78 LYS A HE3  7  
ATOM 9852  H HZ1  . LYS A 1 78 ? -16.791 21.961  -13.478 1.00 0.00 ? 78 LYS A HZ1  7  
ATOM 9853  H HZ2  . LYS A 1 78 ? -16.882 23.414  -12.607 1.00 0.00 ? 78 LYS A HZ2  7  
ATOM 9854  H HZ3  . LYS A 1 78 ? -15.472 22.471  -12.546 1.00 0.00 ? 78 LYS A HZ3  7  
ATOM 9855  N N    . THR A 1 79 ? -17.636 27.949  -19.002 1.00 0.00 ? 79 THR A N    7  
ATOM 9856  C CA   . THR A 1 79 ? -17.700 29.363  -18.687 1.00 0.00 ? 79 THR A CA   7  
ATOM 9857  C C    . THR A 1 79 ? -18.723 29.628  -17.587 1.00 0.00 ? 79 THR A C    7  
ATOM 9858  O O    . THR A 1 79 ? -19.469 28.729  -17.191 1.00 0.00 ? 79 THR A O    7  
ATOM 9859  C CB   . THR A 1 79 ? -18.058 30.183  -19.940 1.00 0.00 ? 79 THR A CB   7  
ATOM 9860  O OG1  . THR A 1 79 ? -19.193 29.607  -20.601 1.00 0.00 ? 79 THR A OG1  7  
ATOM 9861  C CG2  . THR A 1 79 ? -16.879 30.248  -20.898 1.00 0.00 ? 79 THR A CG2  7  
ATOM 9862  H H    . THR A 1 79 ? -18.190 27.602  -19.730 1.00 0.00 ? 79 THR A H    7  
ATOM 9863  H HA   . THR A 1 79 ? -16.724 29.675  -18.344 1.00 0.00 ? 79 THR A HA   7  
ATOM 9864  H HB   . THR A 1 79 ? -18.306 31.189  -19.633 1.00 0.00 ? 79 THR A HB   7  
ATOM 9865  H HG1  . THR A 1 79 ? -19.877 30.286  -20.709 1.00 0.00 ? 79 THR A HG1  7  
ATOM 9866  H HG21 . THR A 1 79 ? -16.606 29.248  -21.201 1.00 0.00 ? 79 THR A HG21 7  
ATOM 9867  H HG22 . THR A 1 79 ? -16.040 30.713  -20.402 1.00 0.00 ? 79 THR A HG22 7  
ATOM 9868  H HG23 . THR A 1 79 ? -17.151 30.826  -21.768 1.00 0.00 ? 79 THR A HG23 7  
ATOM 9869  N N    . LYS A 1 80 ? -18.753 30.856  -17.093 1.00 0.00 ? 80 LYS A N    7  
ATOM 9870  C CA   . LYS A 1 80 ? -19.694 31.227  -16.053 1.00 0.00 ? 80 LYS A CA   7  
ATOM 9871  C C    . LYS A 1 80 ? -21.044 31.581  -16.665 1.00 0.00 ? 80 LYS A C    7  
ATOM 9872  O O    . LYS A 1 80 ? -21.203 32.647  -17.264 1.00 0.00 ? 80 LYS A O    7  
ATOM 9873  C CB   . LYS A 1 80 ? -19.147 32.397  -15.227 1.00 0.00 ? 80 LYS A CB   7  
ATOM 9874  C CG   . LYS A 1 80 ? -20.115 32.922  -14.175 1.00 0.00 ? 80 LYS A CG   7  
ATOM 9875  C CD   . LYS A 1 80 ? -20.592 31.818  -13.245 1.00 0.00 ? 80 LYS A CD   7  
ATOM 9876  C CE   . LYS A 1 80 ? -21.632 32.329  -12.260 1.00 0.00 ? 80 LYS A CE   7  
ATOM 9877  N NZ   . LYS A 1 80 ? -21.046 33.243  -11.244 1.00 0.00 ? 80 LYS A NZ   7  
ATOM 9878  H H    . LYS A 1 80 ? -18.134 31.530  -17.444 1.00 0.00 ? 80 LYS A H    7  
ATOM 9879  H HA   . LYS A 1 80 ? -19.823 30.371  -15.406 1.00 0.00 ? 80 LYS A HA   7  
ATOM 9880  H HB2  . LYS A 1 80 ? -18.247 32.075  -14.726 1.00 0.00 ? 80 LYS A HB2  7  
ATOM 9881  H HB3  . LYS A 1 80 ? -18.904 33.208  -15.896 1.00 0.00 ? 80 LYS A HB3  7  
ATOM 9882  H HG2  . LYS A 1 80 ? -19.616 33.678  -13.589 1.00 0.00 ? 80 LYS A HG2  7  
ATOM 9883  H HG3  . LYS A 1 80 ? -20.972 33.357  -14.673 1.00 0.00 ? 80 LYS A HG3  7  
ATOM 9884  H HD2  . LYS A 1 80 ? -21.030 31.029  -13.836 1.00 0.00 ? 80 LYS A HD2  7  
ATOM 9885  H HD3  . LYS A 1 80 ? -19.746 31.434  -12.696 1.00 0.00 ? 80 LYS A HD3  7  
ATOM 9886  H HE2  . LYS A 1 80 ? -22.395 32.861  -12.807 1.00 0.00 ? 80 LYS A HE2  7  
ATOM 9887  H HE3  . LYS A 1 80 ? -22.074 31.484  -11.756 1.00 0.00 ? 80 LYS A HE3  7  
ATOM 9888  H HZ1  . LYS A 1 80 ? -21.809 33.688  -10.683 1.00 0.00 ? 80 LYS A HZ1  7  
ATOM 9889  H HZ2  . LYS A 1 80 ? -20.491 33.997  -11.705 1.00 0.00 ? 80 LYS A HZ2  7  
ATOM 9890  H HZ3  . LYS A 1 80 ? -20.424 32.710  -10.597 1.00 0.00 ? 80 LYS A HZ3  7  
ATOM 9891  N N    . THR A 1 81 ? -21.996 30.664  -16.514 1.00 0.00 ? 81 THR A N    7  
ATOM 9892  C CA   . THR A 1 81 ? -23.343 30.829  -17.044 1.00 0.00 ? 81 THR A CA   7  
ATOM 9893  C C    . THR A 1 81 ? -23.329 30.757  -18.570 1.00 0.00 ? 81 THR A C    7  
ATOM 9894  O O    . THR A 1 81 ? -23.432 29.639  -19.110 1.00 0.00 ? 81 THR A O    7  
ATOM 9895  C CB   . THR A 1 81 ? -23.979 32.156  -16.575 1.00 0.00 ? 81 THR A CB   7  
ATOM 9896  O OG1  . THR A 1 81 ? -23.787 32.317  -15.158 1.00 0.00 ? 81 THR A OG1  7  
ATOM 9897  C CG2  . THR A 1 81 ? -25.467 32.180  -16.887 1.00 0.00 ? 81 THR A CG2  7  
ATOM 9898  O OXT  . THR A 1 81 ? -23.193 31.811  -19.228 1.00 0.00 ? 81 THR A OXT  7  
ATOM 9899  H H    . THR A 1 81 ? -21.781 29.838  -16.035 1.00 0.00 ? 81 THR A H    7  
ATOM 9900  H HA   . THR A 1 81 ? -23.943 30.014  -16.666 1.00 0.00 ? 81 THR A HA   7  
ATOM 9901  H HB   . THR A 1 81 ? -23.501 32.974  -17.094 1.00 0.00 ? 81 THR A HB   7  
ATOM 9902  H HG1  . THR A 1 81 ? -24.639 32.519  -14.738 1.00 0.00 ? 81 THR A HG1  7  
ATOM 9903  H HG21 . THR A 1 81 ? -25.951 31.358  -16.382 1.00 0.00 ? 81 THR A HG21 7  
ATOM 9904  H HG22 . THR A 1 81 ? -25.614 32.085  -17.952 1.00 0.00 ? 81 THR A HG22 7  
ATOM 9905  H HG23 . THR A 1 81 ? -25.891 33.112  -16.546 1.00 0.00 ? 81 THR A HG23 7  
ATOM 9906  N N    . SER A 1 1  ? -2.362  0.280   -24.184 1.00 0.00 ? 1  SER A N    8  
ATOM 9907  C CA   . SER A 1 1  ? -3.636  -0.419  -23.905 1.00 0.00 ? 1  SER A CA   8  
ATOM 9908  C C    . SER A 1 1  ? -4.311  0.170   -22.669 1.00 0.00 ? 1  SER A C    8  
ATOM 9909  O O    . SER A 1 1  ? -3.922  -0.124  -21.536 1.00 0.00 ? 1  SER A O    8  
ATOM 9910  C CB   . SER A 1 1  ? -3.374  -1.911  -23.706 1.00 0.00 ? 1  SER A CB   8  
ATOM 9911  O OG   . SER A 1 1  ? -2.723  -2.467  -24.836 1.00 0.00 ? 1  SER A OG   8  
ATOM 9912  H H1   . SER A 1 1  ? -1.752  0.264   -23.342 1.00 0.00 ? 1  SER A H1   8  
ATOM 9913  H H2   . SER A 1 1  ? -2.545  1.273   -24.445 1.00 0.00 ? 1  SER A H2   8  
ATOM 9914  H H3   . SER A 1 1  ? -1.861  -0.186  -24.969 1.00 0.00 ? 1  SER A H3   8  
ATOM 9915  H HA   . SER A 1 1  ? -4.290  -0.286  -24.754 1.00 0.00 ? 1  SER A HA   8  
ATOM 9916  H HB2  . SER A 1 1  ? -2.746  -2.052  -22.838 1.00 0.00 ? 1  SER A HB2  8  
ATOM 9917  H HB3  . SER A 1 1  ? -4.313  -2.424  -23.559 1.00 0.00 ? 1  SER A HB3  8  
ATOM 9918  H HG   . SER A 1 1  ? -2.829  -3.430  -24.824 1.00 0.00 ? 1  SER A HG   8  
ATOM 9919  N N    . ASP A 1 2  ? -5.324  1.002   -22.885 1.00 0.00 ? 2  ASP A N    8  
ATOM 9920  C CA   . ASP A 1 2  ? -5.993  1.683   -21.785 1.00 0.00 ? 2  ASP A CA   8  
ATOM 9921  C C    . ASP A 1 2  ? -7.505  1.560   -21.885 1.00 0.00 ? 2  ASP A C    8  
ATOM 9922  O O    . ASP A 1 2  ? -8.139  2.210   -22.718 1.00 0.00 ? 2  ASP A O    8  
ATOM 9923  C CB   . ASP A 1 2  ? -5.612  3.168   -21.739 1.00 0.00 ? 2  ASP A CB   8  
ATOM 9924  C CG   . ASP A 1 2  ? -4.218  3.406   -21.199 1.00 0.00 ? 2  ASP A CG   8  
ATOM 9925  O OD1  . ASP A 1 2  ? -4.077  3.565   -19.971 1.00 0.00 ? 2  ASP A OD1  8  
ATOM 9926  O OD2  . ASP A 1 2  ? -3.262  3.442   -22.003 1.00 0.00 ? 2  ASP A OD2  8  
ATOM 9927  H H    . ASP A 1 2  ? -5.637  1.147   -23.803 1.00 0.00 ? 2  ASP A H    8  
ATOM 9928  H HA   . ASP A 1 2  ? -5.672  1.216   -20.865 1.00 0.00 ? 2  ASP A HA   8  
ATOM 9929  H HB2  . ASP A 1 2  ? -5.664  3.577   -22.737 1.00 0.00 ? 2  ASP A HB2  8  
ATOM 9930  H HB3  . ASP A 1 2  ? -6.316  3.691   -21.108 1.00 0.00 ? 2  ASP A HB3  8  
ATOM 9931  N N    . ARG A 1 3  ? -8.076  0.715   -21.043 1.00 0.00 ? 3  ARG A N    8  
ATOM 9932  C CA   . ARG A 1 3  ? -9.520  0.661   -20.886 1.00 0.00 ? 3  ARG A CA   8  
ATOM 9933  C C    . ARG A 1 3  ? -9.942  1.617   -19.782 1.00 0.00 ? 3  ARG A C    8  
ATOM 9934  O O    . ARG A 1 3  ? -9.094  2.280   -19.175 1.00 0.00 ? 3  ARG A O    8  
ATOM 9935  C CB   . ARG A 1 3  ? -9.993  -0.756  -20.560 1.00 0.00 ? 3  ARG A CB   8  
ATOM 9936  C CG   . ARG A 1 3  ? -9.950  -1.708  -21.743 1.00 0.00 ? 3  ARG A CG   8  
ATOM 9937  C CD   . ARG A 1 3  ? -10.611 -3.035  -21.406 1.00 0.00 ? 3  ARG A CD   8  
ATOM 9938  N NE   . ARG A 1 3  ? -10.662 -3.935  -22.557 1.00 0.00 ? 3  ARG A NE   8  
ATOM 9939  C CZ   . ARG A 1 3  ? -11.590 -4.878  -22.725 1.00 0.00 ? 3  ARG A CZ   8  
ATOM 9940  N NH1  . ARG A 1 3  ? -12.526 -5.065  -21.806 1.00 0.00 ? 3  ARG A NH1  8  
ATOM 9941  N NH2  . ARG A 1 3  ? -11.572 -5.646  -23.808 1.00 0.00 ? 3  ARG A NH2  8  
ATOM 9942  H H    . ARG A 1 3  ? -7.514  0.122   -20.507 1.00 0.00 ? 3  ARG A H    8  
ATOM 9943  H HA   . ARG A 1 3  ? -9.967  0.981   -21.817 1.00 0.00 ? 3  ARG A HA   8  
ATOM 9944  H HB2  . ARG A 1 3  ? -9.366  -1.161  -19.779 1.00 0.00 ? 3  ARG A HB2  8  
ATOM 9945  H HB3  . ARG A 1 3  ? -11.011 -0.709  -20.200 1.00 0.00 ? 3  ARG A HB3  8  
ATOM 9946  H HG2  . ARG A 1 3  ? -10.469 -1.257  -22.575 1.00 0.00 ? 3  ARG A HG2  8  
ATOM 9947  H HG3  . ARG A 1 3  ? -8.919  -1.885  -22.013 1.00 0.00 ? 3  ARG A HG3  8  
ATOM 9948  H HD2  . ARG A 1 3  ? -10.051 -3.508  -20.616 1.00 0.00 ? 3  ARG A HD2  8  
ATOM 9949  H HD3  . ARG A 1 3  ? -11.618 -2.843  -21.068 1.00 0.00 ? 3  ARG A HD3  8  
ATOM 9950  H HE   . ARG A 1 3  ? -9.958  -3.827  -23.248 1.00 0.00 ? 3  ARG A HE   8  
ATOM 9951  H HH11 . ARG A 1 3  ? -12.541 -4.499  -20.976 1.00 0.00 ? 3  ARG A HH11 8  
ATOM 9952  H HH12 . ARG A 1 3  ? -13.223 -5.785  -21.932 1.00 0.00 ? 3  ARG A HH12 8  
ATOM 9953  H HH21 . ARG A 1 3  ? -10.857 -5.522  -24.509 1.00 0.00 ? 3  ARG A HH21 8  
ATOM 9954  H HH22 . ARG A 1 3  ? -12.271 -6.351  -23.934 1.00 0.00 ? 3  ARG A HH22 8  
ATOM 9955  N N    . VAL A 1 4  ? -11.238 1.689   -19.517 1.00 0.00 ? 4  VAL A N    8  
ATOM 9956  C CA   . VAL A 1 4  ? -11.745 2.571   -18.481 1.00 0.00 ? 4  VAL A CA   8  
ATOM 9957  C C    . VAL A 1 4  ? -11.309 2.112   -17.089 1.00 0.00 ? 4  VAL A C    8  
ATOM 9958  O O    . VAL A 1 4  ? -11.815 1.134   -16.540 1.00 0.00 ? 4  VAL A O    8  
ATOM 9959  C CB   . VAL A 1 4  ? -13.282 2.730   -18.541 1.00 0.00 ? 4  VAL A CB   8  
ATOM 9960  C CG1  . VAL A 1 4  ? -13.682 3.543   -19.765 1.00 0.00 ? 4  VAL A CG1  8  
ATOM 9961  C CG2  . VAL A 1 4  ? -13.986 1.375   -18.547 1.00 0.00 ? 4  VAL A CG2  8  
ATOM 9962  H H    . VAL A 1 4  ? -11.868 1.140   -20.038 1.00 0.00 ? 4  VAL A H    8  
ATOM 9963  H HA   . VAL A 1 4  ? -11.310 3.545   -18.657 1.00 0.00 ? 4  VAL A HA   8  
ATOM 9964  H HB   . VAL A 1 4  ? -13.597 3.270   -17.662 1.00 0.00 ? 4  VAL A HB   8  
ATOM 9965  H HG11 . VAL A 1 4  ? -13.188 4.504   -19.735 1.00 0.00 ? 4  VAL A HG11 8  
ATOM 9966  H HG12 . VAL A 1 4  ? -14.752 3.691   -19.764 1.00 0.00 ? 4  VAL A HG12 8  
ATOM 9967  H HG13 . VAL A 1 4  ? -13.391 3.016   -20.661 1.00 0.00 ? 4  VAL A HG13 8  
ATOM 9968  H HG21 . VAL A 1 4  ? -13.674 0.808   -19.413 1.00 0.00 ? 4  VAL A HG21 8  
ATOM 9969  H HG22 . VAL A 1 4  ? -15.055 1.524   -18.582 1.00 0.00 ? 4  VAL A HG22 8  
ATOM 9970  H HG23 . VAL A 1 4  ? -13.729 0.830   -17.650 1.00 0.00 ? 4  VAL A HG23 8  
ATOM 9971  N N    . LYS A 1 5  ? -10.340 2.820   -16.538 1.00 0.00 ? 5  LYS A N    8  
ATOM 9972  C CA   . LYS A 1 5  ? -9.841  2.535   -15.205 1.00 0.00 ? 5  LYS A CA   8  
ATOM 9973  C C    . LYS A 1 5  ? -10.304 3.631   -14.255 1.00 0.00 ? 5  LYS A C    8  
ATOM 9974  O O    . LYS A 1 5  ? -9.713  4.709   -14.198 1.00 0.00 ? 5  LYS A O    8  
ATOM 9975  C CB   . LYS A 1 5  ? -8.311  2.417   -15.230 1.00 0.00 ? 5  LYS A CB   8  
ATOM 9976  C CG   . LYS A 1 5  ? -7.824  1.215   -16.029 1.00 0.00 ? 5  LYS A CG   8  
ATOM 9977  C CD   . LYS A 1 5  ? -6.330  1.272   -16.311 1.00 0.00 ? 5  LYS A CD   8  
ATOM 9978  C CE   . LYS A 1 5  ? -5.982  2.386   -17.291 1.00 0.00 ? 5  LYS A CE   8  
ATOM 9979  N NZ   . LYS A 1 5  ? -4.605  2.238   -17.831 1.00 0.00 ? 5  LYS A NZ   8  
ATOM 9980  H H    . LYS A 1 5  ? -9.954  3.564   -17.042 1.00 0.00 ? 5  LYS A H    8  
ATOM 9981  H HA   . LYS A 1 5  ? -10.264 1.595   -14.884 1.00 0.00 ? 5  LYS A HA   8  
ATOM 9982  H HB2  . LYS A 1 5  ? -7.898  3.311   -15.673 1.00 0.00 ? 5  LYS A HB2  8  
ATOM 9983  H HB3  . LYS A 1 5  ? -7.947  2.325   -14.217 1.00 0.00 ? 5  LYS A HB3  8  
ATOM 9984  H HG2  . LYS A 1 5  ? -8.036  0.316   -15.468 1.00 0.00 ? 5  LYS A HG2  8  
ATOM 9985  H HG3  . LYS A 1 5  ? -8.358  1.186   -16.968 1.00 0.00 ? 5  LYS A HG3  8  
ATOM 9986  H HD2  . LYS A 1 5  ? -5.807  1.448   -15.383 1.00 0.00 ? 5  LYS A HD2  8  
ATOM 9987  H HD3  . LYS A 1 5  ? -6.018  0.325   -16.728 1.00 0.00 ? 5  LYS A HD3  8  
ATOM 9988  H HE2  . LYS A 1 5  ? -6.685  2.361   -18.109 1.00 0.00 ? 5  LYS A HE2  8  
ATOM 9989  H HE3  . LYS A 1 5  ? -6.058  3.334   -16.779 1.00 0.00 ? 5  LYS A HE3  8  
ATOM 9990  H HZ1  . LYS A 1 5  ? -4.522  1.350   -18.362 1.00 0.00 ? 5  LYS A HZ1  8  
ATOM 9991  H HZ2  . LYS A 1 5  ? -3.904  2.222   -17.056 1.00 0.00 ? 5  LYS A HZ2  8  
ATOM 9992  H HZ3  . LYS A 1 5  ? -4.376  3.030   -18.477 1.00 0.00 ? 5  LYS A HZ3  8  
ATOM 9993  N N    . ARG A 1 6  ? -11.377 3.355   -13.535 1.00 0.00 ? 6  ARG A N    8  
ATOM 9994  C CA   . ARG A 1 6  ? -12.037 4.368   -12.724 1.00 0.00 ? 6  ARG A CA   8  
ATOM 9995  C C    . ARG A 1 6  ? -11.729 4.183   -11.238 1.00 0.00 ? 6  ARG A C    8  
ATOM 9996  O O    . ARG A 1 6  ? -11.545 3.056   -10.763 1.00 0.00 ? 6  ARG A O    8  
ATOM 9997  C CB   . ARG A 1 6  ? -13.554 4.300   -12.955 1.00 0.00 ? 6  ARG A CB   8  
ATOM 9998  C CG   . ARG A 1 6  ? -14.330 5.429   -12.295 1.00 0.00 ? 6  ARG A CG   8  
ATOM 9999  C CD   . ARG A 1 6  ? -15.827 5.186   -12.345 1.00 0.00 ? 6  ARG A CD   8  
ATOM 10000 N NE   . ARG A 1 6  ? -16.578 6.260   -11.693 1.00 0.00 ? 6  ARG A NE   8  
ATOM 10001 C CZ   . ARG A 1 6  ? -16.999 6.217   -10.429 1.00 0.00 ? 6  ARG A CZ   8  
ATOM 10002 N NH1  . ARG A 1 6  ? -16.643 5.207   -9.643  1.00 0.00 ? 6  ARG A NH1  8  
ATOM 10003 N NH2  . ARG A 1 6  ? -17.748 7.203   -9.941  1.00 0.00 ? 6  ARG A NH2  8  
ATOM 10004 H H    . ARG A 1 6  ? -11.737 2.443   -13.546 1.00 0.00 ? 6  ARG A H    8  
ATOM 10005 H HA   . ARG A 1 6  ? -11.678 5.335   -13.039 1.00 0.00 ? 6  ARG A HA   8  
ATOM 10006 H HB2  . ARG A 1 6  ? -13.747 4.334   -14.017 1.00 0.00 ? 6  ARG A HB2  8  
ATOM 10007 H HB3  . ARG A 1 6  ? -13.924 3.363   -12.563 1.00 0.00 ? 6  ARG A HB3  8  
ATOM 10008 H HG2  . ARG A 1 6  ? -14.024 5.508   -11.263 1.00 0.00 ? 6  ARG A HG2  8  
ATOM 10009 H HG3  . ARG A 1 6  ? -14.107 6.353   -12.810 1.00 0.00 ? 6  ARG A HG3  8  
ATOM 10010 H HD2  . ARG A 1 6  ? -16.135 5.121   -13.377 1.00 0.00 ? 6  ARG A HD2  8  
ATOM 10011 H HD3  . ARG A 1 6  ? -16.044 4.254   -11.844 1.00 0.00 ? 6  ARG A HD3  8  
ATOM 10012 H HE   . ARG A 1 6  ? -16.807 7.051   -12.245 1.00 0.00 ? 6  ARG A HE   8  
ATOM 10013 H HH11 . ARG A 1 6  ? -16.053 4.478   -9.995  1.00 0.00 ? 6  ARG A HH11 8  
ATOM 10014 H HH12 . ARG A 1 6  ? -16.969 5.163   -8.687  1.00 0.00 ? 6  ARG A HH12 8  
ATOM 10015 H HH21 . ARG A 1 6  ? -18.003 7.984   -10.528 1.00 0.00 ? 6  ARG A HH21 8  
ATOM 10016 H HH22 . ARG A 1 6  ? -18.061 7.180   -8.989  1.00 0.00 ? 6  ARG A HH22 8  
ATOM 10017 N N    . PRO A 1 7  ? -11.625 5.299   -10.491 1.00 0.00 ? 7  PRO A N    8  
ATOM 10018 C CA   . PRO A 1 7  ? -11.559 5.268   -9.029  1.00 0.00 ? 7  PRO A CA   8  
ATOM 10019 C C    . PRO A 1 7  ? -12.822 4.655   -8.414  1.00 0.00 ? 7  PRO A C    8  
ATOM 10020 O O    . PRO A 1 7  ? -13.807 4.394   -9.106  1.00 0.00 ? 7  PRO A O    8  
ATOM 10021 C CB   . PRO A 1 7  ? -11.433 6.744   -8.632  1.00 0.00 ? 7  PRO A CB   8  
ATOM 10022 C CG   . PRO A 1 7  ? -10.938 7.432   -9.855  1.00 0.00 ? 7  PRO A CG   8  
ATOM 10023 C CD   . PRO A 1 7  ? -11.523 6.674   -11.011 1.00 0.00 ? 7  PRO A CD   8  
ATOM 10024 H HA   . PRO A 1 7  ? -10.694 4.722   -8.684  1.00 0.00 ? 7  PRO A HA   8  
ATOM 10025 H HB2  . PRO A 1 7  ? -12.399 7.122   -8.330  1.00 0.00 ? 7  PRO A HB2  8  
ATOM 10026 H HB3  . PRO A 1 7  ? -10.733 6.841   -7.814  1.00 0.00 ? 7  PRO A HB3  8  
ATOM 10027 H HG2  . PRO A 1 7  ? -11.281 8.457   -9.864  1.00 0.00 ? 7  PRO A HG2  8  
ATOM 10028 H HG3  . PRO A 1 7  ? -9.859  7.394   -9.890  1.00 0.00 ? 7  PRO A HG3  8  
ATOM 10029 H HD2  . PRO A 1 7  ? -12.498 7.066   -11.265 1.00 0.00 ? 7  PRO A HD2  8  
ATOM 10030 H HD3  . PRO A 1 7  ? -10.863 6.717   -11.866 1.00 0.00 ? 7  PRO A HD3  8  
ATOM 10031 N N    . MET A 1 8  ? -12.785 4.445   -7.112  1.00 0.00 ? 8  MET A N    8  
ATOM 10032 C CA   . MET A 1 8  ? -13.865 3.771   -6.403  1.00 0.00 ? 8  MET A CA   8  
ATOM 10033 C C    . MET A 1 8  ? -13.968 4.352   -5.001  1.00 0.00 ? 8  MET A C    8  
ATOM 10034 O O    . MET A 1 8  ? -13.122 5.154   -4.611  1.00 0.00 ? 8  MET A O    8  
ATOM 10035 C CB   . MET A 1 8  ? -13.591 2.260   -6.356  1.00 0.00 ? 8  MET A CB   8  
ATOM 10036 C CG   . MET A 1 8  ? -14.728 1.431   -5.771  1.00 0.00 ? 8  MET A CG   8  
ATOM 10037 S SD   . MET A 1 8  ? -16.301 1.689   -6.619  1.00 0.00 ? 8  MET A SD   8  
ATOM 10038 C CE   . MET A 1 8  ? -17.369 0.568   -5.714  1.00 0.00 ? 8  MET A CE   8  
ATOM 10039 H H    . MET A 1 8  ? -12.018 4.772   -6.597  1.00 0.00 ? 8  MET A H    8  
ATOM 10040 H HA   . MET A 1 8  ? -14.788 3.954   -6.933  1.00 0.00 ? 8  MET A HA   8  
ATOM 10041 H HB2  . MET A 1 8  ? -13.404 1.913   -7.361  1.00 0.00 ? 8  MET A HB2  8  
ATOM 10042 H HB3  . MET A 1 8  ? -12.708 2.090   -5.757  1.00 0.00 ? 8  MET A HB3  8  
ATOM 10043 H HG2  . MET A 1 8  ? -14.467 0.388   -5.846  1.00 0.00 ? 8  MET A HG2  8  
ATOM 10044 H HG3  . MET A 1 8  ? -14.846 1.697   -4.730  1.00 0.00 ? 8  MET A HG3  8  
ATOM 10045 H HE1  . MET A 1 8  ? -17.385 0.845   -4.670  1.00 0.00 ? 8  MET A HE1  8  
ATOM 10046 H HE2  . MET A 1 8  ? -16.995 -0.442  -5.813  1.00 0.00 ? 8  MET A HE2  8  
ATOM 10047 H HE3  . MET A 1 8  ? -18.370 0.621   -6.113  1.00 0.00 ? 8  MET A HE3  8  
ATOM 10048 N N    . ASN A 1 9  ? -15.017 4.003   -4.267  1.00 0.00 ? 9  ASN A N    8  
ATOM 10049 C CA   . ASN A 1 9  ? -15.142 4.425   -2.881  1.00 0.00 ? 9  ASN A CA   8  
ATOM 10050 C C    . ASN A 1 9  ? -13.958 3.921   -2.053  1.00 0.00 ? 9  ASN A C    8  
ATOM 10051 O O    . ASN A 1 9  ? -13.327 2.915   -2.399  1.00 0.00 ? 9  ASN A O    8  
ATOM 10052 C CB   . ASN A 1 9  ? -16.479 3.961   -2.269  1.00 0.00 ? 9  ASN A CB   8  
ATOM 10053 C CG   . ASN A 1 9  ? -16.742 2.464   -2.369  1.00 0.00 ? 9  ASN A CG   8  
ATOM 10054 O OD1  . ASN A 1 9  ? -17.888 2.032   -2.445  1.00 0.00 ? 9  ASN A OD1  8  
ATOM 10055 N ND2  . ASN A 1 9  ? -15.695 1.666   -2.365  1.00 0.00 ? 9  ASN A ND2  8  
ATOM 10056 H H    . ASN A 1 9  ? -15.720 3.455   -4.665  1.00 0.00 ? 9  ASN A H    8  
ATOM 10057 H HA   . ASN A 1 9  ? -15.119 5.507   -2.875  1.00 0.00 ? 9  ASN A HA   8  
ATOM 10058 H HB2  . ASN A 1 9  ? -16.495 4.232   -1.225  1.00 0.00 ? 9  ASN A HB2  8  
ATOM 10059 H HB3  . ASN A 1 9  ? -17.279 4.473   -2.773  1.00 0.00 ? 9  ASN A HB3  8  
ATOM 10060 H HD21 . ASN A 1 9  ? -14.806 2.082   -2.304  1.00 0.00 ? 9  ASN A HD21 8  
ATOM 10061 H HD22 . ASN A 1 9  ? -15.847 0.694   -2.414  1.00 0.00 ? 9  ASN A HD22 8  
ATOM 10062 N N    . ALA A 1 10 ? -13.705 4.607   -0.956  1.00 0.00 ? 10 ALA A N    8  
ATOM 10063 C CA   . ALA A 1 10 ? -12.551 4.371   -0.095  1.00 0.00 ? 10 ALA A CA   8  
ATOM 10064 C C    . ALA A 1 10 ? -12.278 2.894   0.226   1.00 0.00 ? 10 ALA A C    8  
ATOM 10065 O O    . ALA A 1 10 ? -11.130 2.462   0.146   1.00 0.00 ? 10 ALA A O    8  
ATOM 10066 C CB   . ALA A 1 10 ? -12.754 5.139   1.195   1.00 0.00 ? 10 ALA A CB   8  
ATOM 10067 H H    . ALA A 1 10 ? -14.297 5.351   -0.732  1.00 0.00 ? 10 ALA A H    8  
ATOM 10068 H HA   . ALA A 1 10 ? -11.685 4.784   -0.585  1.00 0.00 ? 10 ALA A HA   8  
ATOM 10069 H HB1  . ALA A 1 10 ? -13.648 4.787   1.685   1.00 0.00 ? 10 ALA A HB1  8  
ATOM 10070 H HB2  . ALA A 1 10 ? -12.853 6.193   0.974   1.00 0.00 ? 10 ALA A HB2  8  
ATOM 10071 H HB3  . ALA A 1 10 ? -11.905 4.984   1.843   1.00 0.00 ? 10 ALA A HB3  8  
ATOM 10072 N N    . PHE A 1 11 ? -13.309 2.122   0.576   1.00 0.00 ? 11 PHE A N    8  
ATOM 10073 C CA   . PHE A 1 11 ? -13.100 0.747   1.053   1.00 0.00 ? 11 PHE A CA   8  
ATOM 10074 C C    . PHE A 1 11 ? -12.343 -0.105  0.032   1.00 0.00 ? 11 PHE A C    8  
ATOM 10075 O O    . PHE A 1 11 ? -11.315 -0.711  0.352   1.00 0.00 ? 11 PHE A O    8  
ATOM 10076 C CB   . PHE A 1 11 ? -14.443 0.085   1.378   1.00 0.00 ? 11 PHE A CB   8  
ATOM 10077 C CG   . PHE A 1 11 ? -14.317 -1.299  1.964   1.00 0.00 ? 11 PHE A CG   8  
ATOM 10078 C CD1  . PHE A 1 11 ? -14.039 -1.467  3.310   1.00 0.00 ? 11 PHE A CD1  8  
ATOM 10079 C CD2  . PHE A 1 11 ? -14.476 -2.427  1.173   1.00 0.00 ? 11 PHE A CD2  8  
ATOM 10080 C CE1  . PHE A 1 11 ? -13.920 -2.729  3.859   1.00 0.00 ? 11 PHE A CE1  8  
ATOM 10081 C CE2  . PHE A 1 11 ? -14.358 -3.694  1.716   1.00 0.00 ? 11 PHE A CE2  8  
ATOM 10082 C CZ   . PHE A 1 11 ? -14.079 -3.845  3.062   1.00 0.00 ? 11 PHE A CZ   8  
ATOM 10083 H H    . PHE A 1 11 ? -14.220 2.480   0.523   1.00 0.00 ? 11 PHE A H    8  
ATOM 10084 H HA   . PHE A 1 11 ? -12.513 0.802   1.958   1.00 0.00 ? 11 PHE A HA   8  
ATOM 10085 H HB2  . PHE A 1 11 ? -14.973 0.699   2.090   1.00 0.00 ? 11 PHE A HB2  8  
ATOM 10086 H HB3  . PHE A 1 11 ? -15.025 0.010   0.472   1.00 0.00 ? 11 PHE A HB3  8  
ATOM 10087 H HD1  . PHE A 1 11 ? -13.915 -0.596  3.937   1.00 0.00 ? 11 PHE A HD1  8  
ATOM 10088 H HD2  . PHE A 1 11 ? -14.693 -2.310  0.122   1.00 0.00 ? 11 PHE A HD2  8  
ATOM 10089 H HE1  . PHE A 1 11 ? -13.703 -2.842  4.910   1.00 0.00 ? 11 PHE A HE1  8  
ATOM 10090 H HE2  . PHE A 1 11 ? -14.483 -4.565  1.089   1.00 0.00 ? 11 PHE A HE2  8  
ATOM 10091 H HZ   . PHE A 1 11 ? -13.984 -4.834  3.489   1.00 0.00 ? 11 PHE A HZ   8  
ATOM 10092 N N    . MET A 1 12 ? -12.827 -0.119  -1.204  1.00 0.00 ? 12 MET A N    8  
ATOM 10093 C CA   . MET A 1 12 ? -12.192 -0.911  -2.251  1.00 0.00 ? 12 MET A CA   8  
ATOM 10094 C C    . MET A 1 12 ? -10.856 -0.294  -2.636  1.00 0.00 ? 12 MET A C    8  
ATOM 10095 O O    . MET A 1 12 ? -9.899  -1.002  -2.955  1.00 0.00 ? 12 MET A O    8  
ATOM 10096 C CB   . MET A 1 12 ? -13.093 -1.038  -3.485  1.00 0.00 ? 12 MET A CB   8  
ATOM 10097 C CG   . MET A 1 12 ? -14.280 -1.976  -3.299  1.00 0.00 ? 12 MET A CG   8  
ATOM 10098 S SD   . MET A 1 12 ? -15.529 -1.316  -2.176  1.00 0.00 ? 12 MET A SD   8  
ATOM 10099 C CE   . MET A 1 12 ? -16.697 -2.674  -2.135  1.00 0.00 ? 12 MET A CE   8  
ATOM 10100 H H    . MET A 1 12 ? -13.627 0.404   -1.413  1.00 0.00 ? 12 MET A H    8  
ATOM 10101 H HA   . MET A 1 12 ? -12.011 -1.895  -1.849  1.00 0.00 ? 12 MET A HA   8  
ATOM 10102 H HB2  . MET A 1 12 ? -13.476 -0.061  -3.735  1.00 0.00 ? 12 MET A HB2  8  
ATOM 10103 H HB3  . MET A 1 12 ? -12.501 -1.404  -4.312  1.00 0.00 ? 12 MET A HB3  8  
ATOM 10104 H HG2  . MET A 1 12 ? -14.738 -2.148  -4.261  1.00 0.00 ? 12 MET A HG2  8  
ATOM 10105 H HG3  . MET A 1 12 ? -13.919 -2.914  -2.902  1.00 0.00 ? 12 MET A HG3  8  
ATOM 10106 H HE1  . MET A 1 12 ? -16.208 -3.559  -1.751  1.00 0.00 ? 12 MET A HE1  8  
ATOM 10107 H HE2  . MET A 1 12 ? -17.058 -2.867  -3.134  1.00 0.00 ? 12 MET A HE2  8  
ATOM 10108 H HE3  . MET A 1 12 ? -17.527 -2.417  -1.493  1.00 0.00 ? 12 MET A HE3  8  
ATOM 10109 N N    . VAL A 1 13 ? -10.795 1.034   -2.581  1.00 0.00 ? 13 VAL A N    8  
ATOM 10110 C CA   . VAL A 1 13 ? -9.562  1.760   -2.849  1.00 0.00 ? 13 VAL A CA   8  
ATOM 10111 C C    . VAL A 1 13 ? -8.460  1.283   -1.937  1.00 0.00 ? 13 VAL A C    8  
ATOM 10112 O O    . VAL A 1 13 ? -7.369  0.968   -2.387  1.00 0.00 ? 13 VAL A O    8  
ATOM 10113 C CB   . VAL A 1 13 ? -9.724  3.274   -2.639  1.00 0.00 ? 13 VAL A CB   8  
ATOM 10114 C CG1  . VAL A 1 13 ? -8.380  3.966   -2.759  1.00 0.00 ? 13 VAL A CG1  8  
ATOM 10115 C CG2  . VAL A 1 13 ? -10.697 3.841   -3.646  1.00 0.00 ? 13 VAL A CG2  8  
ATOM 10116 H H    . VAL A 1 13 ? -11.598 1.533   -2.338  1.00 0.00 ? 13 VAL A H    8  
ATOM 10117 H HA   . VAL A 1 13 ? -9.276  1.583   -3.874  1.00 0.00 ? 13 VAL A HA   8  
ATOM 10118 H HB   . VAL A 1 13 ? -10.114 3.446   -1.638  1.00 0.00 ? 13 VAL A HB   8  
ATOM 10119 H HG11 . VAL A 1 13 ? -8.508  5.026   -2.595  1.00 0.00 ? 13 VAL A HG11 8  
ATOM 10120 H HG12 . VAL A 1 13 ? -7.975  3.800   -3.746  1.00 0.00 ? 13 VAL A HG12 8  
ATOM 10121 H HG13 . VAL A 1 13 ? -7.702  3.567   -2.019  1.00 0.00 ? 13 VAL A HG13 8  
ATOM 10122 H HG21 . VAL A 1 13 ? -10.318 3.677   -4.645  1.00 0.00 ? 13 VAL A HG21 8  
ATOM 10123 H HG22 . VAL A 1 13 ? -10.816 4.901   -3.475  1.00 0.00 ? 13 VAL A HG22 8  
ATOM 10124 H HG23 . VAL A 1 13 ? -11.653 3.350   -3.540  1.00 0.00 ? 13 VAL A HG23 8  
ATOM 10125 N N    . TRP A 1 14 ? -8.762  1.227   -0.658  1.00 0.00 ? 14 TRP A N    8  
ATOM 10126 C CA   . TRP A 1 14 ? -7.782  0.841   0.329   1.00 0.00 ? 14 TRP A CA   8  
ATOM 10127 C C    . TRP A 1 14 ? -7.371  -0.609  0.127   1.00 0.00 ? 14 TRP A C    8  
ATOM 10128 O O    . TRP A 1 14 ? -6.238  -0.979  0.405   1.00 0.00 ? 14 TRP A O    8  
ATOM 10129 C CB   . TRP A 1 14 ? -8.340  1.050   1.728   1.00 0.00 ? 14 TRP A CB   8  
ATOM 10130 C CG   . TRP A 1 14 ? -7.297  1.439   2.727   1.00 0.00 ? 14 TRP A CG   8  
ATOM 10131 C CD1  . TRP A 1 14 ? -6.402  2.463   2.614   1.00 0.00 ? 14 TRP A CD1  8  
ATOM 10132 C CD2  . TRP A 1 14 ? -7.062  0.835   4.000   1.00 0.00 ? 14 TRP A CD2  8  
ATOM 10133 N NE1  . TRP A 1 14 ? -5.613  2.522   3.736   1.00 0.00 ? 14 TRP A NE1  8  
ATOM 10134 C CE2  . TRP A 1 14 ? -5.998  1.531   4.601   1.00 0.00 ? 14 TRP A CE2  8  
ATOM 10135 C CE3  . TRP A 1 14 ? -7.643  -0.230  4.689   1.00 0.00 ? 14 TRP A CE3  8  
ATOM 10136 C CZ2  . TRP A 1 14 ? -5.506  1.194   5.857   1.00 0.00 ? 14 TRP A CZ2  8  
ATOM 10137 C CZ3  . TRP A 1 14 ? -7.154  -0.561  5.934   1.00 0.00 ? 14 TRP A CZ3  8  
ATOM 10138 C CH2  . TRP A 1 14 ? -6.095  0.147   6.504   1.00 0.00 ? 14 TRP A CH2  8  
ATOM 10139 H H    . TRP A 1 14 ? -9.673  1.463   -0.367  1.00 0.00 ? 14 TRP A H    8  
ATOM 10140 H HA   . TRP A 1 14 ? -6.913  1.471   0.200   1.00 0.00 ? 14 TRP A HA   8  
ATOM 10141 H HB2  . TRP A 1 14 ? -9.084  1.834   1.699   1.00 0.00 ? 14 TRP A HB2  8  
ATOM 10142 H HB3  . TRP A 1 14 ? -8.803  0.134   2.066   1.00 0.00 ? 14 TRP A HB3  8  
ATOM 10143 H HD1  . TRP A 1 14 ? -6.332  3.120   1.760   1.00 0.00 ? 14 TRP A HD1  8  
ATOM 10144 H HE1  . TRP A 1 14 ? -4.892  3.169   3.892   1.00 0.00 ? 14 TRP A HE1  8  
ATOM 10145 H HE3  . TRP A 1 14 ? -8.460  -0.792  4.264   1.00 0.00 ? 14 TRP A HE3  8  
ATOM 10146 H HZ2  . TRP A 1 14 ? -4.690  1.730   6.313   1.00 0.00 ? 14 TRP A HZ2  8  
ATOM 10147 H HZ3  . TRP A 1 14 ? -7.591  -1.384  6.482   1.00 0.00 ? 14 TRP A HZ3  8  
ATOM 10148 H HH2  . TRP A 1 14 ? -5.744  -0.156  7.474   1.00 0.00 ? 14 TRP A HH2  8  
ATOM 10149 N N    . SER A 1 15 ? -8.283  -1.421  -0.395  1.00 0.00 ? 15 SER A N    8  
ATOM 10150 C CA   . SER A 1 15 ? -7.982  -2.826  -0.623  1.00 0.00 ? 15 SER A CA   8  
ATOM 10151 C C    . SER A 1 15 ? -6.960  -2.983  -1.749  1.00 0.00 ? 15 SER A C    8  
ATOM 10152 O O    . SER A 1 15 ? -5.882  -3.546  -1.548  1.00 0.00 ? 15 SER A O    8  
ATOM 10153 C CB   . SER A 1 15 ? -9.260  -3.596  -0.960  1.00 0.00 ? 15 SER A CB   8  
ATOM 10154 O OG   . SER A 1 15 ? -10.252 -3.403  0.036   1.00 0.00 ? 15 SER A OG   8  
ATOM 10155 H H    . SER A 1 15 ? -9.171  -1.067  -0.644  1.00 0.00 ? 15 SER A H    8  
ATOM 10156 H HA   . SER A 1 15 ? -7.556  -3.224  0.286   1.00 0.00 ? 15 SER A HA   8  
ATOM 10157 H HB2  . SER A 1 15 ? -9.647  -3.252  -1.908  1.00 0.00 ? 15 SER A HB2  8  
ATOM 10158 H HB3  . SER A 1 15 ? -9.034  -4.651  -1.027  1.00 0.00 ? 15 SER A HB3  8  
ATOM 10159 H HG   . SER A 1 15 ? -10.070 -2.590  0.519   1.00 0.00 ? 15 SER A HG   8  
ATOM 10160 N N    . ARG A 1 16 ? -7.283  -2.456  -2.927  1.00 0.00 ? 16 ARG A N    8  
ATOM 10161 C CA   . ARG A 1 16 ? -6.398  -2.607  -4.079  1.00 0.00 ? 16 ARG A CA   8  
ATOM 10162 C C    . ARG A 1 16 ? -5.215  -1.642  -3.987  1.00 0.00 ? 16 ARG A C    8  
ATOM 10163 O O    . ARG A 1 16 ? -4.135  -1.904  -4.522  1.00 0.00 ? 16 ARG A O    8  
ATOM 10164 C CB   . ARG A 1 16 ? -7.170  -2.410  -5.395  1.00 0.00 ? 16 ARG A CB   8  
ATOM 10165 C CG   . ARG A 1 16 ? -7.817  -1.040  -5.560  1.00 0.00 ? 16 ARG A CG   8  
ATOM 10166 C CD   . ARG A 1 16 ? -8.586  -0.951  -6.874  1.00 0.00 ? 16 ARG A CD   8  
ATOM 10167 N NE   . ARG A 1 16 ? -9.174  0.373   -7.092  1.00 0.00 ? 16 ARG A NE   8  
ATOM 10168 C CZ   . ARG A 1 16 ? -9.825  0.732   -8.207  1.00 0.00 ? 16 ARG A CZ   8  
ATOM 10169 N NH1  . ARG A 1 16 ? -9.981  -0.138  -9.201  1.00 0.00 ? 16 ARG A NH1  8  
ATOM 10170 N NH2  . ARG A 1 16 ? -10.318 1.960   -8.330  1.00 0.00 ? 16 ARG A NH2  8  
ATOM 10171 H H    . ARG A 1 16 ? -8.128  -1.950  -3.017  1.00 0.00 ? 16 ARG A H    8  
ATOM 10172 H HA   . ARG A 1 16 ? -6.012  -3.617  -4.056  1.00 0.00 ? 16 ARG A HA   8  
ATOM 10173 H HB2  . ARG A 1 16 ? -6.488  -2.555  -6.219  1.00 0.00 ? 16 ARG A HB2  8  
ATOM 10174 H HB3  . ARG A 1 16 ? -7.948  -3.158  -5.453  1.00 0.00 ? 16 ARG A HB3  8  
ATOM 10175 H HG2  . ARG A 1 16 ? -8.498  -0.872  -4.740  1.00 0.00 ? 16 ARG A HG2  8  
ATOM 10176 H HG3  . ARG A 1 16 ? -7.044  -0.284  -5.553  1.00 0.00 ? 16 ARG A HG3  8  
ATOM 10177 H HD2  . ARG A 1 16 ? -7.906  -1.168  -7.686  1.00 0.00 ? 16 ARG A HD2  8  
ATOM 10178 H HD3  . ARG A 1 16 ? -9.376  -1.689  -6.863  1.00 0.00 ? 16 ARG A HD3  8  
ATOM 10179 H HE   . ARG A 1 16 ? -9.074  1.032   -6.371  1.00 0.00 ? 16 ARG A HE   8  
ATOM 10180 H HH11 . ARG A 1 16 ? -9.613  -1.070  -9.127  1.00 0.00 ? 16 ARG A HH11 8  
ATOM 10181 H HH12 . ARG A 1 16 ? -10.469 0.133   -10.035 1.00 0.00 ? 16 ARG A HH12 8  
ATOM 10182 H HH21 . ARG A 1 16 ? -10.204 2.623   -7.590  1.00 0.00 ? 16 ARG A HH21 8  
ATOM 10183 H HH22 . ARG A 1 16 ? -10.807 2.229   -9.172  1.00 0.00 ? 16 ARG A HH22 8  
ATOM 10184 N N    . GLY A 1 17 ? -5.424  -0.543  -3.280  1.00 0.00 ? 17 GLY A N    8  
ATOM 10185 C CA   . GLY A 1 17 ? -4.396  0.467   -3.129  1.00 0.00 ? 17 GLY A CA   8  
ATOM 10186 C C    . GLY A 1 17 ? -3.319  0.051   -2.156  1.00 0.00 ? 17 GLY A C    8  
ATOM 10187 O O    . GLY A 1 17 ? -2.134  0.157   -2.466  1.00 0.00 ? 17 GLY A O    8  
ATOM 10188 H H    . GLY A 1 17 ? -6.297  -0.408  -2.850  1.00 0.00 ? 17 GLY A H    8  
ATOM 10189 H HA2  . GLY A 1 17 ? -3.944  0.650   -4.092  1.00 0.00 ? 17 GLY A HA2  8  
ATOM 10190 H HA3  . GLY A 1 17 ? -4.854  1.381   -2.778  1.00 0.00 ? 17 GLY A HA3  8  
ATOM 10191 N N    . GLN A 1 18 ? -3.716  -0.436  -0.983  1.00 0.00 ? 18 GLN A N    8  
ATOM 10192 C CA   . GLN A 1 18 ? -2.751  -0.896  0.005   1.00 0.00 ? 18 GLN A CA   8  
ATOM 10193 C C    . GLN A 1 18 ? -2.032  -2.138  -0.490  1.00 0.00 ? 18 GLN A C    8  
ATOM 10194 O O    . GLN A 1 18 ? -0.874  -2.359  -0.154  1.00 0.00 ? 18 GLN A O    8  
ATOM 10195 C CB   . GLN A 1 18 ? -3.415  -1.174  1.355   1.00 0.00 ? 18 GLN A CB   8  
ATOM 10196 C CG   . GLN A 1 18 ? -3.814  0.088   2.102   1.00 0.00 ? 18 GLN A CG   8  
ATOM 10197 C CD   . GLN A 1 18 ? -2.659  1.056   2.288   1.00 0.00 ? 18 GLN A CD   8  
ATOM 10198 O OE1  . GLN A 1 18 ? -1.506  0.654   2.451   1.00 0.00 ? 18 GLN A OE1  8  
ATOM 10199 N NE2  . GLN A 1 18 ? -2.957  2.345   2.236   1.00 0.00 ? 18 GLN A NE2  8  
ATOM 10200 H H    . GLN A 1 18 ? -4.677  -0.488  -0.778  1.00 0.00 ? 18 GLN A H    8  
ATOM 10201 H HA   . GLN A 1 18 ? -2.020  -0.109  0.135   1.00 0.00 ? 18 GLN A HA   8  
ATOM 10202 H HB2  . GLN A 1 18 ? -4.307  -1.761  1.186   1.00 0.00 ? 18 GLN A HB2  8  
ATOM 10203 H HB3  . GLN A 1 18 ? -2.738  -1.739  1.972   1.00 0.00 ? 18 GLN A HB3  8  
ATOM 10204 H HG2  . GLN A 1 18 ? -4.596  0.587   1.555   1.00 0.00 ? 18 GLN A HG2  8  
ATOM 10205 H HG3  . GLN A 1 18 ? -4.186  -0.193  3.076   1.00 0.00 ? 18 GLN A HG3  8  
ATOM 10206 H HE21 . GLN A 1 18 ? -3.893  2.597   2.084   1.00 0.00 ? 18 GLN A HE21 8  
ATOM 10207 H HE22 . GLN A 1 18 ? -2.232  2.997   2.343   1.00 0.00 ? 18 GLN A HE22 8  
ATOM 10208 N N    . ARG A 1 19 ? -2.721  -2.944  -1.297  1.00 0.00 ? 19 ARG A N    8  
ATOM 10209 C CA   . ARG A 1 19 ? -2.093  -4.096  -1.927  1.00 0.00 ? 19 ARG A CA   8  
ATOM 10210 C C    . ARG A 1 19 ? -0.873  -3.630  -2.723  1.00 0.00 ? 19 ARG A C    8  
ATOM 10211 O O    . ARG A 1 19 ? 0.220   -4.177  -2.586  1.00 0.00 ? 19 ARG A O    8  
ATOM 10212 C CB   . ARG A 1 19 ? -3.091  -4.817  -2.842  1.00 0.00 ? 19 ARG A CB   8  
ATOM 10213 C CG   . ARG A 1 19 ? -2.911  -6.332  -2.895  1.00 0.00 ? 19 ARG A CG   8  
ATOM 10214 C CD   . ARG A 1 19 ? -1.624  -6.746  -3.595  1.00 0.00 ? 19 ARG A CD   8  
ATOM 10215 N NE   . ARG A 1 19 ? -1.461  -8.198  -3.606  1.00 0.00 ? 19 ARG A NE   8  
ATOM 10216 C CZ   . ARG A 1 19 ? -0.803  -8.877  -4.544  1.00 0.00 ? 19 ARG A CZ   8  
ATOM 10217 N NH1  . ARG A 1 19 ? -0.238  -8.242  -5.566  1.00 0.00 ? 19 ARG A NH1  8  
ATOM 10218 N NH2  . ARG A 1 19 ? -0.723  -10.199 -4.462  1.00 0.00 ? 19 ARG A NH2  8  
ATOM 10219 H H    . ARG A 1 19 ? -3.674  -2.766  -1.457  1.00 0.00 ? 19 ARG A H    8  
ATOM 10220 H HA   . ARG A 1 19 ? -1.769  -4.771  -1.146  1.00 0.00 ? 19 ARG A HA   8  
ATOM 10221 H HB2  . ARG A 1 19 ? -4.093  -4.610  -2.493  1.00 0.00 ? 19 ARG A HB2  8  
ATOM 10222 H HB3  . ARG A 1 19 ? -2.985  -4.429  -3.845  1.00 0.00 ? 19 ARG A HB3  8  
ATOM 10223 H HG2  . ARG A 1 19 ? -2.894  -6.716  -1.887  1.00 0.00 ? 19 ARG A HG2  8  
ATOM 10224 H HG3  . ARG A 1 19 ? -3.750  -6.761  -3.426  1.00 0.00 ? 19 ARG A HG3  8  
ATOM 10225 H HD2  . ARG A 1 19 ? -1.651  -6.386  -4.613  1.00 0.00 ? 19 ARG A HD2  8  
ATOM 10226 H HD3  . ARG A 1 19 ? -0.788  -6.301  -3.078  1.00 0.00 ? 19 ARG A HD3  8  
ATOM 10227 H HE   . ARG A 1 19 ? -1.864  -8.701  -2.860  1.00 0.00 ? 19 ARG A HE   8  
ATOM 10228 H HH11 . ARG A 1 19 ? -0.307  -7.240  -5.640  1.00 0.00 ? 19 ARG A HH11 8  
ATOM 10229 H HH12 . ARG A 1 19 ? 0.259   -8.755  -6.267  1.00 0.00 ? 19 ARG A HH12 8  
ATOM 10230 H HH21 . ARG A 1 19 ? -1.161  -10.683 -3.695  1.00 0.00 ? 19 ARG A HH21 8  
ATOM 10231 H HH22 . ARG A 1 19 ? -0.220  -10.720 -5.152  1.00 0.00 ? 19 ARG A HH22 8  
ATOM 10232 N N    . ARG A 1 20 ? -1.063  -2.594  -3.538  1.00 0.00 ? 20 ARG A N    8  
ATOM 10233 C CA   . ARG A 1 20 ? 0.044   -1.999  -4.282  1.00 0.00 ? 20 ARG A CA   8  
ATOM 10234 C C    . ARG A 1 20 ? 1.034   -1.329  -3.330  1.00 0.00 ? 20 ARG A C    8  
ATOM 10235 O O    . ARG A 1 20 ? 2.224   -1.631  -3.350  1.00 0.00 ? 20 ARG A O    8  
ATOM 10236 C CB   . ARG A 1 20 ? -0.462  -0.961  -5.291  1.00 0.00 ? 20 ARG A CB   8  
ATOM 10237 C CG   . ARG A 1 20 ? 0.668   -0.222  -5.997  1.00 0.00 ? 20 ARG A CG   8  
ATOM 10238 C CD   . ARG A 1 20 ? 0.183   1.039   -6.694  1.00 0.00 ? 20 ARG A CD   8  
ATOM 10239 N NE   . ARG A 1 20 ? 1.296   1.827   -7.236  1.00 0.00 ? 20 ARG A NE   8  
ATOM 10240 C CZ   . ARG A 1 20 ? 1.298   3.160   -7.325  1.00 0.00 ? 20 ARG A CZ   8  
ATOM 10241 N NH1  . ARG A 1 20 ? 0.247   3.862   -6.917  1.00 0.00 ? 20 ARG A NH1  8  
ATOM 10242 N NH2  . ARG A 1 20 ? 2.354   3.797   -7.822  1.00 0.00 ? 20 ARG A NH2  8  
ATOM 10243 H H    . ARG A 1 20 ? -1.969  -2.223  -3.641  1.00 0.00 ? 20 ARG A H    8  
ATOM 10244 H HA   . ARG A 1 20 ? 0.551   -2.790  -4.812  1.00 0.00 ? 20 ARG A HA   8  
ATOM 10245 H HB2  . ARG A 1 20 ? -1.060  -1.461  -6.037  1.00 0.00 ? 20 ARG A HB2  8  
ATOM 10246 H HB3  . ARG A 1 20 ? -1.071  -0.235  -4.775  1.00 0.00 ? 20 ARG A HB3  8  
ATOM 10247 H HG2  . ARG A 1 20 ? 1.415   0.051   -5.266  1.00 0.00 ? 20 ARG A HG2  8  
ATOM 10248 H HG3  . ARG A 1 20 ? 1.109   -0.880  -6.731  1.00 0.00 ? 20 ARG A HG3  8  
ATOM 10249 H HD2  . ARG A 1 20 ? -0.474  0.759   -7.503  1.00 0.00 ? 20 ARG A HD2  8  
ATOM 10250 H HD3  . ARG A 1 20 ? -0.360  1.643   -5.981  1.00 0.00 ? 20 ARG A HD3  8  
ATOM 10251 H HE   . ARG A 1 20 ? 2.086   1.332   -7.546  1.00 0.00 ? 20 ARG A HE   8  
ATOM 10252 H HH11 . ARG A 1 20 ? -0.556  3.399   -6.538  1.00 0.00 ? 20 ARG A HH11 8  
ATOM 10253 H HH12 . ARG A 1 20 ? 0.255   4.869   -6.993  1.00 0.00 ? 20 ARG A HH12 8  
ATOM 10254 H HH21 . ARG A 1 20 ? 3.163   3.280   -8.140  1.00 0.00 ? 20 ARG A HH21 8  
ATOM 10255 H HH22 . ARG A 1 20 ? 2.355   4.799   -7.880  1.00 0.00 ? 20 ARG A HH22 8  
ATOM 10256 N N    . LYS A 1 21 ? 0.522   -0.427  -2.497  1.00 0.00 ? 21 LYS A N    8  
ATOM 10257 C CA   . LYS A 1 21 ? 1.348   0.395   -1.616  1.00 0.00 ? 21 LYS A CA   8  
ATOM 10258 C C    . LYS A 1 21 ? 2.267   -0.457  -0.740  1.00 0.00 ? 21 LYS A C    8  
ATOM 10259 O O    . LYS A 1 21 ? 3.481   -0.254  -0.727  1.00 0.00 ? 21 LYS A O    8  
ATOM 10260 C CB   . LYS A 1 21 ? 0.446   1.274   -0.745  1.00 0.00 ? 21 LYS A CB   8  
ATOM 10261 C CG   . LYS A 1 21 ? 1.196   2.321   0.061   1.00 0.00 ? 21 LYS A CG   8  
ATOM 10262 C CD   . LYS A 1 21 ? 0.236   3.237   0.805   1.00 0.00 ? 21 LYS A CD   8  
ATOM 10263 C CE   . LYS A 1 21 ? 0.975   4.299   1.601   1.00 0.00 ? 21 LYS A CE   8  
ATOM 10264 N NZ   . LYS A 1 21 ? 1.804   3.708   2.683   1.00 0.00 ? 21 LYS A NZ   8  
ATOM 10265 H H    . LYS A 1 21 ? -0.456  -0.304  -2.477  1.00 0.00 ? 21 LYS A H    8  
ATOM 10266 H HA   . LYS A 1 21 ? 1.957   1.033   -2.238  1.00 0.00 ? 21 LYS A HA   8  
ATOM 10267 H HB2  . LYS A 1 21 ? -0.263  1.784   -1.383  1.00 0.00 ? 21 LYS A HB2  8  
ATOM 10268 H HB3  . LYS A 1 21 ? -0.094  0.640   -0.059  1.00 0.00 ? 21 LYS A HB3  8  
ATOM 10269 H HG2  . LYS A 1 21 ? 1.830   1.822   0.779   1.00 0.00 ? 21 LYS A HG2  8  
ATOM 10270 H HG3  . LYS A 1 21 ? 1.801   2.914   -0.609  1.00 0.00 ? 21 LYS A HG3  8  
ATOM 10271 H HD2  . LYS A 1 21 ? -0.408  3.722   0.090   1.00 0.00 ? 21 LYS A HD2  8  
ATOM 10272 H HD3  . LYS A 1 21 ? -0.360  2.642   1.483   1.00 0.00 ? 21 LYS A HD3  8  
ATOM 10273 H HE2  . LYS A 1 21 ? 1.618   4.852   0.932   1.00 0.00 ? 21 LYS A HE2  8  
ATOM 10274 H HE3  . LYS A 1 21 ? 0.250   4.970   2.040   1.00 0.00 ? 21 LYS A HE3  8  
ATOM 10275 H HZ1  . LYS A 1 21 ? 1.204   3.161   3.339   1.00 0.00 ? 21 LYS A HZ1  8  
ATOM 10276 H HZ2  . LYS A 1 21 ? 2.287   4.461   3.217   1.00 0.00 ? 21 LYS A HZ2  8  
ATOM 10277 H HZ3  . LYS A 1 21 ? 2.529   3.068   2.278   1.00 0.00 ? 21 LYS A HZ3  8  
ATOM 10278 N N    . MET A 1 22 ? 1.694   -1.426  -0.036  1.00 0.00 ? 22 MET A N    8  
ATOM 10279 C CA   . MET A 1 22 ? 2.466   -2.283  0.856   1.00 0.00 ? 22 MET A CA   8  
ATOM 10280 C C    . MET A 1 22 ? 3.463   -3.123  0.071   1.00 0.00 ? 22 MET A C    8  
ATOM 10281 O O    . MET A 1 22 ? 4.604   -3.286  0.495   1.00 0.00 ? 22 MET A O    8  
ATOM 10282 C CB   . MET A 1 22 ? 1.552   -3.197  1.678   1.00 0.00 ? 22 MET A CB   8  
ATOM 10283 C CG   . MET A 1 22 ? 0.639   -2.450  2.636   1.00 0.00 ? 22 MET A CG   8  
ATOM 10284 S SD   . MET A 1 22 ? -0.366  -3.557  3.644   1.00 0.00 ? 22 MET A SD   8  
ATOM 10285 C CE   . MET A 1 22 ? -1.362  -2.376  4.553   1.00 0.00 ? 22 MET A CE   8  
ATOM 10286 H H    . MET A 1 22 ? 0.729   -1.576  -0.123  1.00 0.00 ? 22 MET A H    8  
ATOM 10287 H HA   . MET A 1 22 ? 3.015   -1.641  1.531   1.00 0.00 ? 22 MET A HA   8  
ATOM 10288 H HB2  . MET A 1 22 ? 0.935   -3.770  1.003   1.00 0.00 ? 22 MET A HB2  8  
ATOM 10289 H HB3  . MET A 1 22 ? 2.165   -3.875  2.255   1.00 0.00 ? 22 MET A HB3  8  
ATOM 10290 H HG2  . MET A 1 22 ? 1.247   -1.840  3.290   1.00 0.00 ? 22 MET A HG2  8  
ATOM 10291 H HG3  . MET A 1 22 ? -0.018  -1.814  2.062   1.00 0.00 ? 22 MET A HG3  8  
ATOM 10292 H HE1  . MET A 1 22 ? -2.045  -2.903  5.201   1.00 0.00 ? 22 MET A HE1  8  
ATOM 10293 H HE2  . MET A 1 22 ? -1.922  -1.769  3.858   1.00 0.00 ? 22 MET A HE2  8  
ATOM 10294 H HE3  . MET A 1 22 ? -0.719  -1.744  5.145   1.00 0.00 ? 22 MET A HE3  8  
ATOM 10295 N N    . ALA A 1 23 ? 3.043   -3.637  -1.083  1.00 0.00 ? 23 ALA A N    8  
ATOM 10296 C CA   . ALA A 1 23 ? 3.919   -4.462  -1.911  1.00 0.00 ? 23 ALA A CA   8  
ATOM 10297 C C    . ALA A 1 23 ? 5.081   -3.648  -2.473  1.00 0.00 ? 23 ALA A C    8  
ATOM 10298 O O    . ALA A 1 23 ? 6.161   -4.181  -2.711  1.00 0.00 ? 23 ALA A O    8  
ATOM 10299 C CB   . ALA A 1 23 ? 3.135   -5.108  -3.042  1.00 0.00 ? 23 ALA A CB   8  
ATOM 10300 H H    . ALA A 1 23 ? 2.119   -3.468  -1.381  1.00 0.00 ? 23 ALA A H    8  
ATOM 10301 H HA   . ALA A 1 23 ? 4.316   -5.249  -1.288  1.00 0.00 ? 23 ALA A HA   8  
ATOM 10302 H HB1  . ALA A 1 23 ? 2.322   -5.688  -2.631  1.00 0.00 ? 23 ALA A HB1  8  
ATOM 10303 H HB2  . ALA A 1 23 ? 3.788   -5.755  -3.608  1.00 0.00 ? 23 ALA A HB2  8  
ATOM 10304 H HB3  . ALA A 1 23 ? 2.738   -4.341  -3.691  1.00 0.00 ? 23 ALA A HB3  8  
ATOM 10305 N N    . GLN A 1 24 ? 4.858   -2.358  -2.680  1.00 0.00 ? 24 GLN A N    8  
ATOM 10306 C CA   . GLN A 1 24 ? 5.897   -1.482  -3.210  1.00 0.00 ? 24 GLN A CA   8  
ATOM 10307 C C    . GLN A 1 24 ? 6.828   -0.994  -2.105  1.00 0.00 ? 24 GLN A C    8  
ATOM 10308 O O    . GLN A 1 24 ? 7.955   -0.576  -2.370  1.00 0.00 ? 24 GLN A O    8  
ATOM 10309 C CB   . GLN A 1 24 ? 5.272   -0.288  -3.933  1.00 0.00 ? 24 GLN A CB   8  
ATOM 10310 C CG   . GLN A 1 24 ? 4.469   -0.681  -5.162  1.00 0.00 ? 24 GLN A CG   8  
ATOM 10311 C CD   . GLN A 1 24 ? 5.318   -1.335  -6.234  1.00 0.00 ? 24 GLN A CD   8  
ATOM 10312 O OE1  . GLN A 1 24 ? 5.848   -0.664  -7.117  1.00 0.00 ? 24 GLN A OE1  8  
ATOM 10313 N NE2  . GLN A 1 24 ? 5.455   -2.650  -6.164  1.00 0.00 ? 24 GLN A NE2  8  
ATOM 10314 H H    . GLN A 1 24 ? 3.970   -1.985  -2.478  1.00 0.00 ? 24 GLN A H    8  
ATOM 10315 H HA   . GLN A 1 24 ? 6.475   -2.053  -3.921  1.00 0.00 ? 24 GLN A HA   8  
ATOM 10316 H HB2  . GLN A 1 24 ? 4.615   0.229   -3.249  1.00 0.00 ? 24 GLN A HB2  8  
ATOM 10317 H HB3  . GLN A 1 24 ? 6.058   0.385   -4.243  1.00 0.00 ? 24 GLN A HB3  8  
ATOM 10318 H HG2  . GLN A 1 24 ? 3.699   -1.377  -4.863  1.00 0.00 ? 24 GLN A HG2  8  
ATOM 10319 H HG3  . GLN A 1 24 ? 4.008   0.206   -5.576  1.00 0.00 ? 24 GLN A HG3  8  
ATOM 10320 H HE21 . GLN A 1 24 ? 5.004   -3.125  -5.435  1.00 0.00 ? 24 GLN A HE21 8  
ATOM 10321 H HE22 . GLN A 1 24 ? 6.008   -3.092  -6.838  1.00 0.00 ? 24 GLN A HE22 8  
ATOM 10322 N N    . GLU A 1 25 ? 6.352   -1.046  -0.869  1.00 0.00 ? 25 GLU A N    8  
ATOM 10323 C CA   . GLU A 1 25 ? 7.135   -0.580  0.269   1.00 0.00 ? 25 GLU A CA   8  
ATOM 10324 C C    . GLU A 1 25 ? 7.844   -1.732  0.978   1.00 0.00 ? 25 GLU A C    8  
ATOM 10325 O O    . GLU A 1 25 ? 9.018   -1.619  1.338   1.00 0.00 ? 25 GLU A O    8  
ATOM 10326 C CB   . GLU A 1 25 ? 6.239   0.176   1.253   1.00 0.00 ? 25 GLU A CB   8  
ATOM 10327 C CG   . GLU A 1 25 ? 5.755   1.514   0.720   1.00 0.00 ? 25 GLU A CG   8  
ATOM 10328 C CD   . GLU A 1 25 ? 5.024   2.327   1.765   1.00 0.00 ? 25 GLU A CD   8  
ATOM 10329 O OE1  . GLU A 1 25 ? 5.693   3.051   2.532   1.00 0.00 ? 25 GLU A OE1  8  
ATOM 10330 O OE2  . GLU A 1 25 ? 3.783   2.259   1.816   1.00 0.00 ? 25 GLU A OE2  8  
ATOM 10331 H H    . GLU A 1 25 ? 5.447   -1.391  -0.721  1.00 0.00 ? 25 GLU A H    8  
ATOM 10332 H HA   . GLU A 1 25 ? 7.882   0.100   -0.110  1.00 0.00 ? 25 GLU A HA   8  
ATOM 10333 H HB2  . GLU A 1 25 ? 5.371   -0.432  1.473   1.00 0.00 ? 25 GLU A HB2  8  
ATOM 10334 H HB3  . GLU A 1 25 ? 6.790   0.353   2.166   1.00 0.00 ? 25 GLU A HB3  8  
ATOM 10335 H HG2  . GLU A 1 25 ? 6.609   2.080   0.377   1.00 0.00 ? 25 GLU A HG2  8  
ATOM 10336 H HG3  . GLU A 1 25 ? 5.087   1.334   -0.110  1.00 0.00 ? 25 GLU A HG3  8  
ATOM 10337 N N    . ASN A 1 26 ? 7.135   -2.839  1.166   1.00 0.00 ? 26 ASN A N    8  
ATOM 10338 C CA   . ASN A 1 26 ? 7.666   -3.986  1.903   1.00 0.00 ? 26 ASN A CA   8  
ATOM 10339 C C    . ASN A 1 26 ? 6.822   -5.236  1.644   1.00 0.00 ? 26 ASN A C    8  
ATOM 10340 O O    . ASN A 1 26 ? 5.843   -5.501  2.343   1.00 0.00 ? 26 ASN A O    8  
ATOM 10341 C CB   . ASN A 1 26 ? 7.795   -3.699  3.416   1.00 0.00 ? 26 ASN A CB   8  
ATOM 10342 C CG   . ASN A 1 26 ? 6.485   -3.416  4.148   1.00 0.00 ? 26 ASN A CG   8  
ATOM 10343 O OD1  . ASN A 1 26 ? 6.359   -3.710  5.337   1.00 0.00 ? 26 ASN A OD1  8  
ATOM 10344 N ND2  . ASN A 1 26 ? 5.508   -2.846  3.464   1.00 0.00 ? 26 ASN A ND2  8  
ATOM 10345 H H    . ASN A 1 26 ? 6.230   -2.899  0.782   1.00 0.00 ? 26 ASN A H    8  
ATOM 10346 H HA   . ASN A 1 26 ? 8.656   -4.173  1.511   1.00 0.00 ? 26 ASN A HA   8  
ATOM 10347 H HB2  . ASN A 1 26 ? 8.254   -4.551  3.888   1.00 0.00 ? 26 ASN A HB2  8  
ATOM 10348 H HB3  . ASN A 1 26 ? 8.443   -2.843  3.546   1.00 0.00 ? 26 ASN A HB3  8  
ATOM 10349 H HD21 . ASN A 1 26 ? 5.663   -2.636  2.520   1.00 0.00 ? 26 ASN A HD21 8  
ATOM 10350 H HD22 . ASN A 1 26 ? 4.670   -2.654  3.931   1.00 0.00 ? 26 ASN A HD22 8  
ATOM 10351 N N    . PRO A 1 27 ? 7.168   -5.994  0.592   1.00 0.00 ? 27 PRO A N    8  
ATOM 10352 C CA   . PRO A 1 27 ? 6.411   -7.182  0.177   1.00 0.00 ? 27 PRO A CA   8  
ATOM 10353 C C    . PRO A 1 27 ? 6.524   -8.338  1.175   1.00 0.00 ? 27 PRO A C    8  
ATOM 10354 O O    . PRO A 1 27 ? 7.076   -9.396  0.864   1.00 0.00 ? 27 PRO A O    8  
ATOM 10355 C CB   . PRO A 1 27 ? 7.045   -7.579  -1.165  1.00 0.00 ? 27 PRO A CB   8  
ATOM 10356 C CG   . PRO A 1 27 ? 7.947   -6.452  -1.547  1.00 0.00 ? 27 PRO A CG   8  
ATOM 10357 C CD   . PRO A 1 27 ? 8.333   -5.765  -0.270  1.00 0.00 ? 27 PRO A CD   8  
ATOM 10358 H HA   . PRO A 1 27 ? 5.369   -6.947  0.026   1.00 0.00 ? 27 PRO A HA   8  
ATOM 10359 H HB2  . PRO A 1 27 ? 7.600   -8.499  -1.043  1.00 0.00 ? 27 PRO A HB2  8  
ATOM 10360 H HB3  . PRO A 1 27 ? 6.266   -7.723  -1.899  1.00 0.00 ? 27 PRO A HB3  8  
ATOM 10361 H HG2  . PRO A 1 27 ? 8.823   -6.837  -2.044  1.00 0.00 ? 27 PRO A HG2  8  
ATOM 10362 H HG3  . PRO A 1 27 ? 7.420   -5.767  -2.195  1.00 0.00 ? 27 PRO A HG3  8  
ATOM 10363 H HD2  . PRO A 1 27 ? 9.220   -6.217  0.150   1.00 0.00 ? 27 PRO A HD2  8  
ATOM 10364 H HD3  . PRO A 1 27 ? 8.489   -4.710  -0.440  1.00 0.00 ? 27 PRO A HD3  8  
ATOM 10365 N N    . LYS A 1 28 ? 6.002   -8.126  2.375   1.00 0.00 ? 28 LYS A N    8  
ATOM 10366 C CA   . LYS A 1 28 ? 5.990   -9.157  3.404   1.00 0.00 ? 28 LYS A CA   8  
ATOM 10367 C C    . LYS A 1 28 ? 4.687   -9.942  3.341   1.00 0.00 ? 28 LYS A C    8  
ATOM 10368 O O    . LYS A 1 28 ? 4.626   -11.106 3.738   1.00 0.00 ? 28 LYS A O    8  
ATOM 10369 C CB   . LYS A 1 28 ? 6.140   -8.528  4.793   1.00 0.00 ? 28 LYS A CB   8  
ATOM 10370 C CG   . LYS A 1 28 ? 7.336   -7.600  4.934   1.00 0.00 ? 28 LYS A CG   8  
ATOM 10371 C CD   . LYS A 1 28 ? 7.461   -7.077  6.355   1.00 0.00 ? 28 LYS A CD   8  
ATOM 10372 C CE   . LYS A 1 28 ? 8.555   -6.032  6.468   1.00 0.00 ? 28 LYS A CE   8  
ATOM 10373 N NZ   . LYS A 1 28 ? 8.713   -5.543  7.861   1.00 0.00 ? 28 LYS A NZ   8  
ATOM 10374 H H    . LYS A 1 28 ? 5.628   -7.239  2.579   1.00 0.00 ? 28 LYS A H    8  
ATOM 10375 H HA   . LYS A 1 28 ? 6.816   -9.826  3.223   1.00 0.00 ? 28 LYS A HA   8  
ATOM 10376 H HB2  . LYS A 1 28 ? 5.248   -7.962  5.016   1.00 0.00 ? 28 LYS A HB2  8  
ATOM 10377 H HB3  . LYS A 1 28 ? 6.241   -9.320  5.522   1.00 0.00 ? 28 LYS A HB3  8  
ATOM 10378 H HG2  . LYS A 1 28 ? 8.234   -8.142  4.679   1.00 0.00 ? 28 LYS A HG2  8  
ATOM 10379 H HG3  . LYS A 1 28 ? 7.212   -6.763  4.262   1.00 0.00 ? 28 LYS A HG3  8  
ATOM 10380 H HD2  . LYS A 1 28 ? 6.522   -6.634  6.649   1.00 0.00 ? 28 LYS A HD2  8  
ATOM 10381 H HD3  . LYS A 1 28 ? 7.694   -7.901  7.014   1.00 0.00 ? 28 LYS A HD3  8  
ATOM 10382 H HE2  . LYS A 1 28 ? 9.488   -6.466  6.140   1.00 0.00 ? 28 LYS A HE2  8  
ATOM 10383 H HE3  . LYS A 1 28 ? 8.304   -5.198  5.829   1.00 0.00 ? 28 LYS A HE3  8  
ATOM 10384 H HZ1  . LYS A 1 28 ? 7.783   -5.298  8.265   1.00 0.00 ? 28 LYS A HZ1  8  
ATOM 10385 H HZ2  . LYS A 1 28 ? 9.324   -4.703  7.879   1.00 0.00 ? 28 LYS A HZ2  8  
ATOM 10386 H HZ3  . LYS A 1 28 ? 9.149   -6.285  8.451   1.00 0.00 ? 28 LYS A HZ3  8  
ATOM 10387 N N    . MET A 1 29 ? 3.646   -9.291  2.845   1.00 0.00 ? 29 MET A N    8  
ATOM 10388 C CA   . MET A 1 29 ? 2.331   -9.901  2.736   1.00 0.00 ? 29 MET A CA   8  
ATOM 10389 C C    . MET A 1 29 ? 1.906   -9.939  1.281   1.00 0.00 ? 29 MET A C    8  
ATOM 10390 O O    . MET A 1 29 ? 2.337   -9.106  0.486   1.00 0.00 ? 29 MET A O    8  
ATOM 10391 C CB   . MET A 1 29 ? 1.315   -9.115  3.564   1.00 0.00 ? 29 MET A CB   8  
ATOM 10392 C CG   . MET A 1 29 ? 1.622   -9.116  5.053   1.00 0.00 ? 29 MET A CG   8  
ATOM 10393 S SD   . MET A 1 29 ? 0.528   -8.038  5.994   1.00 0.00 ? 29 MET A SD   8  
ATOM 10394 C CE   . MET A 1 29 ? 0.945   -6.444  5.290   1.00 0.00 ? 29 MET A CE   8  
ATOM 10395 H H    . MET A 1 29 ? 3.768   -8.371  2.528   1.00 0.00 ? 29 MET A H    8  
ATOM 10396 H HA   . MET A 1 29 ? 2.394   -10.913 3.112   1.00 0.00 ? 29 MET A HA   8  
ATOM 10397 H HB2  . MET A 1 29 ? 1.307   -8.091  3.220   1.00 0.00 ? 29 MET A HB2  8  
ATOM 10398 H HB3  . MET A 1 29 ? 0.334   -9.544  3.418   1.00 0.00 ? 29 MET A HB3  8  
ATOM 10399 H HG2  . MET A 1 29 ? 1.517   -10.124 5.428   1.00 0.00 ? 29 MET A HG2  8  
ATOM 10400 H HG3  . MET A 1 29 ? 2.641   -8.786  5.196   1.00 0.00 ? 29 MET A HG3  8  
ATOM 10401 H HE1  . MET A 1 29 ? 0.392   -5.668  5.801   1.00 0.00 ? 29 MET A HE1  8  
ATOM 10402 H HE2  . MET A 1 29 ? 0.691   -6.435  4.241   1.00 0.00 ? 29 MET A HE2  8  
ATOM 10403 H HE3  . MET A 1 29 ? 2.004   -6.266  5.405   1.00 0.00 ? 29 MET A HE3  8  
ATOM 10404 N N    . HIS A 1 30 ? 1.076   -10.908 0.929   1.00 0.00 ? 30 HIS A N    8  
ATOM 10405 C CA   . HIS A 1 30 ? 0.663   -11.073 -0.456  1.00 0.00 ? 30 HIS A CA   8  
ATOM 10406 C C    . HIS A 1 30 ? -0.831  -10.843 -0.627  1.00 0.00 ? 30 HIS A C    8  
ATOM 10407 O O    . HIS A 1 30 ? -1.242  -9.961  -1.379  1.00 0.00 ? 30 HIS A O    8  
ATOM 10408 C CB   . HIS A 1 30 ? 1.049   -12.463 -0.979  1.00 0.00 ? 30 HIS A CB   8  
ATOM 10409 C CG   . HIS A 1 30 ? 2.527   -12.655 -1.145  1.00 0.00 ? 30 HIS A CG   8  
ATOM 10410 N ND1  . HIS A 1 30 ? 3.154   -12.650 -2.372  1.00 0.00 ? 30 HIS A ND1  8  
ATOM 10411 C CD2  . HIS A 1 30 ? 3.502   -12.860 -0.230  1.00 0.00 ? 30 HIS A CD2  8  
ATOM 10412 C CE1  . HIS A 1 30 ? 4.448   -12.840 -2.202  1.00 0.00 ? 30 HIS A CE1  8  
ATOM 10413 N NE2  . HIS A 1 30 ? 4.686   -12.970 -0.913  1.00 0.00 ? 30 HIS A NE2  8  
ATOM 10414 H H    . HIS A 1 30 ? 0.731   -11.523 1.613   1.00 0.00 ? 30 HIS A H    8  
ATOM 10415 H HA   . HIS A 1 30 ? 1.184   -10.333 -1.040  1.00 0.00 ? 30 HIS A HA   8  
ATOM 10416 H HB2  . HIS A 1 30 ? 0.694   -13.212 -0.285  1.00 0.00 ? 30 HIS A HB2  8  
ATOM 10417 H HB3  . HIS A 1 30 ? 0.582   -12.620 -1.940  1.00 0.00 ? 30 HIS A HB3  8  
ATOM 10418 H HD1  . HIS A 1 30 ? 2.714   -12.528 -3.247  1.00 0.00 ? 30 HIS A HD1  8  
ATOM 10419 H HD2  . HIS A 1 30 ? 3.372   -12.925 0.842   1.00 0.00 ? 30 HIS A HD2  8  
ATOM 10420 H HE1  . HIS A 1 30 ? 5.188   -12.880 -2.988  1.00 0.00 ? 30 HIS A HE1  8  
ATOM 10421 H HE2  . HIS A 1 30 ? 5.586   -12.952 -0.501  1.00 0.00 ? 30 HIS A HE2  8  
ATOM 10422 N N    . ASN A 1 31 ? -1.647  -11.618 0.076   1.00 0.00 ? 31 ASN A N    8  
ATOM 10423 C CA   . ASN A 1 31 ? -3.088  -11.592 -0.167  1.00 0.00 ? 31 ASN A CA   8  
ATOM 10424 C C    . ASN A 1 31 ? -3.895  -11.649 1.130   1.00 0.00 ? 31 ASN A C    8  
ATOM 10425 O O    . ASN A 1 31 ? -4.442  -10.638 1.576   1.00 0.00 ? 31 ASN A O    8  
ATOM 10426 C CB   . ASN A 1 31 ? -3.484  -12.765 -1.074  1.00 0.00 ? 31 ASN A CB   8  
ATOM 10427 C CG   . ASN A 1 31 ? -2.923  -12.647 -2.482  1.00 0.00 ? 31 ASN A CG   8  
ATOM 10428 O OD1  . ASN A 1 31 ? -2.855  -11.558 -3.051  1.00 0.00 ? 31 ASN A OD1  8  
ATOM 10429 N ND2  . ASN A 1 31 ? -2.476  -13.761 -3.038  1.00 0.00 ? 31 ASN A ND2  8  
ATOM 10430 H H    . ASN A 1 31 ? -1.282  -12.203 0.775   1.00 0.00 ? 31 ASN A H    8  
ATOM 10431 H HA   . ASN A 1 31 ? -3.319  -10.671 -0.677  1.00 0.00 ? 31 ASN A HA   8  
ATOM 10432 H HB2  . ASN A 1 31 ? -3.119  -13.685 -0.639  1.00 0.00 ? 31 ASN A HB2  8  
ATOM 10433 H HB3  . ASN A 1 31 ? -4.561  -12.810 -1.138  1.00 0.00 ? 31 ASN A HB3  8  
ATOM 10434 H HD21 . ASN A 1 31 ? -2.530  -14.593 -2.521  1.00 0.00 ? 31 ASN A HD21 8  
ATOM 10435 H HD22 . ASN A 1 31 ? -2.119  -13.714 -3.947  1.00 0.00 ? 31 ASN A HD22 8  
ATOM 10436 N N    . SER A 1 32 ? -3.934  -12.828 1.742   1.00 0.00 ? 32 SER A N    8  
ATOM 10437 C CA   . SER A 1 32 ? -4.822  -13.103 2.868   1.00 0.00 ? 32 SER A CA   8  
ATOM 10438 C C    . SER A 1 32 ? -4.553  -12.196 4.068   1.00 0.00 ? 32 SER A C    8  
ATOM 10439 O O    . SER A 1 32 ? -5.485  -11.662 4.670   1.00 0.00 ? 32 SER A O    8  
ATOM 10440 C CB   . SER A 1 32 ? -4.672  -14.570 3.264   1.00 0.00 ? 32 SER A CB   8  
ATOM 10441 O OG   . SER A 1 32 ? -3.302  -14.938 3.295   1.00 0.00 ? 32 SER A OG   8  
ATOM 10442 H H    . SER A 1 32 ? -3.339  -13.542 1.434   1.00 0.00 ? 32 SER A H    8  
ATOM 10443 H HA   . SER A 1 32 ? -5.835  -12.939 2.533   1.00 0.00 ? 32 SER A HA   8  
ATOM 10444 H HB2  . SER A 1 32 ? -5.100  -14.724 4.244   1.00 0.00 ? 32 SER A HB2  8  
ATOM 10445 H HB3  . SER A 1 32 ? -5.185  -15.190 2.543   1.00 0.00 ? 32 SER A HB3  8  
ATOM 10446 H HG   . SER A 1 32 ? -3.155  -15.582 4.004   1.00 0.00 ? 32 SER A HG   8  
ATOM 10447 N N    . GLU A 1 33 ? -3.283  -12.012 4.404   1.00 0.00 ? 33 GLU A N    8  
ATOM 10448 C CA   . GLU A 1 33 ? -2.912  -11.205 5.562   1.00 0.00 ? 33 GLU A CA   8  
ATOM 10449 C C    . GLU A 1 33 ? -3.417  -9.778  5.393   1.00 0.00 ? 33 GLU A C    8  
ATOM 10450 O O    . GLU A 1 33 ? -4.000  -9.195  6.310   1.00 0.00 ? 33 GLU A O    8  
ATOM 10451 C CB   . GLU A 1 33 ? -1.395  -11.204 5.752   1.00 0.00 ? 33 GLU A CB   8  
ATOM 10452 C CG   . GLU A 1 33 ? -0.796  -12.588 5.954   1.00 0.00 ? 33 GLU A CG   8  
ATOM 10453 C CD   . GLU A 1 33 ? -1.426  -13.332 7.116   1.00 0.00 ? 33 GLU A CD   8  
ATOM 10454 O OE1  . GLU A 1 33 ? -1.323  -12.853 8.264   1.00 0.00 ? 33 GLU A OE1  8  
ATOM 10455 O OE2  . GLU A 1 33 ? -2.037  -14.394 6.884   1.00 0.00 ? 33 GLU A OE2  8  
ATOM 10456 H H    . GLU A 1 33 ? -2.584  -12.424 3.860   1.00 0.00 ? 33 GLU A H    8  
ATOM 10457 H HA   . GLU A 1 33 ? -3.380  -11.641 6.435   1.00 0.00 ? 33 GLU A HA   8  
ATOM 10458 H HB2  . GLU A 1 33 ? -0.938  -10.762 4.882   1.00 0.00 ? 33 GLU A HB2  8  
ATOM 10459 H HB3  . GLU A 1 33 ? -1.156  -10.602 6.618   1.00 0.00 ? 33 GLU A HB3  8  
ATOM 10460 H HG2  . GLU A 1 33 ? -0.943  -13.166 5.054   1.00 0.00 ? 33 GLU A HG2  8  
ATOM 10461 H HG3  . GLU A 1 33 ? 0.262   -12.483 6.145   1.00 0.00 ? 33 GLU A HG3  8  
ATOM 10462 N N    . ILE A 1 34 ? -3.225  -9.241  4.193   1.00 0.00 ? 34 ILE A N    8  
ATOM 10463 C CA   . ILE A 1 34 ? -3.678  -7.897  3.866   1.00 0.00 ? 34 ILE A CA   8  
ATOM 10464 C C    . ILE A 1 34 ? -5.192  -7.793  4.039   1.00 0.00 ? 34 ILE A C    8  
ATOM 10465 O O    . ILE A 1 34 ? -5.708  -6.782  4.510   1.00 0.00 ? 34 ILE A O    8  
ATOM 10466 C CB   . ILE A 1 34 ? -3.291  -7.517  2.418   1.00 0.00 ? 34 ILE A CB   8  
ATOM 10467 C CG1  . ILE A 1 34 ? -1.777  -7.643  2.226   1.00 0.00 ? 34 ILE A CG1  8  
ATOM 10468 C CG2  . ILE A 1 34 ? -3.752  -6.102  2.088   1.00 0.00 ? 34 ILE A CG2  8  
ATOM 10469 C CD1  . ILE A 1 34 ? -1.305  -7.319  0.823   1.00 0.00 ? 34 ILE A CD1  8  
ATOM 10470 H H    . ILE A 1 34 ? -2.775  -9.769  3.503   1.00 0.00 ? 34 ILE A H    8  
ATOM 10471 H HA   . ILE A 1 34 ? -3.197  -7.205  4.541   1.00 0.00 ? 34 ILE A HA   8  
ATOM 10472 H HB   . ILE A 1 34 ? -3.792  -8.199  1.746   1.00 0.00 ? 34 ILE A HB   8  
ATOM 10473 H HG12 . ILE A 1 34 ? -1.280  -6.968  2.904   1.00 0.00 ? 34 ILE A HG12 8  
ATOM 10474 H HG13 . ILE A 1 34 ? -1.475  -8.658  2.450   1.00 0.00 ? 34 ILE A HG13 8  
ATOM 10475 H HG21 . ILE A 1 34 ? -3.263  -5.402  2.747   1.00 0.00 ? 34 ILE A HG21 8  
ATOM 10476 H HG22 . ILE A 1 34 ? -4.821  -6.033  2.222   1.00 0.00 ? 34 ILE A HG22 8  
ATOM 10477 H HG23 . ILE A 1 34 ? -3.501  -5.871  1.063   1.00 0.00 ? 34 ILE A HG23 8  
ATOM 10478 H HD11 . ILE A 1 34 ? -1.555  -6.295  0.585   1.00 0.00 ? 34 ILE A HD11 8  
ATOM 10479 H HD12 . ILE A 1 34 ? -1.788  -7.980  0.119   1.00 0.00 ? 34 ILE A HD12 8  
ATOM 10480 H HD13 . ILE A 1 34 ? -0.234  -7.451  0.765   1.00 0.00 ? 34 ILE A HD13 8  
ATOM 10481 N N    . SER A 1 35 ? -5.894  -8.868  3.705   1.00 0.00 ? 35 SER A N    8  
ATOM 10482 C CA   . SER A 1 35 ? -7.348  -8.882  3.803   1.00 0.00 ? 35 SER A CA   8  
ATOM 10483 C C    . SER A 1 35 ? -7.787  -8.816  5.267   1.00 0.00 ? 35 SER A C    8  
ATOM 10484 O O    . SER A 1 35 ? -8.757  -8.132  5.609   1.00 0.00 ? 35 SER A O    8  
ATOM 10485 C CB   . SER A 1 35 ? -7.903  -10.143 3.136   1.00 0.00 ? 35 SER A CB   8  
ATOM 10486 O OG   . SER A 1 35 ? -7.400  -10.286 1.819   1.00 0.00 ? 35 SER A OG   8  
ATOM 10487 H H    . SER A 1 35 ? -5.421  -9.681  3.407   1.00 0.00 ? 35 SER A H    8  
ATOM 10488 H HA   . SER A 1 35 ? -7.726  -8.013  3.283   1.00 0.00 ? 35 SER A HA   8  
ATOM 10489 H HB2  . SER A 1 35 ? -7.613  -11.008 3.711   1.00 0.00 ? 35 SER A HB2  8  
ATOM 10490 H HB3  . SER A 1 35 ? -8.981  -10.083 3.093   1.00 0.00 ? 35 SER A HB3  8  
ATOM 10491 H HG   . SER A 1 35 ? -6.646  -9.701  1.699   1.00 0.00 ? 35 SER A HG   8  
ATOM 10492 N N    . LYS A 1 36 ? -7.040  -9.497  6.130   1.00 0.00 ? 36 LYS A N    8  
ATOM 10493 C CA   . LYS A 1 36 ? -7.377  -9.562  7.546   1.00 0.00 ? 36 LYS A CA   8  
ATOM 10494 C C    . LYS A 1 36 ? -7.140  -8.219  8.219   1.00 0.00 ? 36 LYS A C    8  
ATOM 10495 O O    . LYS A 1 36 ? -8.008  -7.713  8.934   1.00 0.00 ? 36 LYS A O    8  
ATOM 10496 C CB   . LYS A 1 36 ? -6.552  -10.641 8.252   1.00 0.00 ? 36 LYS A CB   8  
ATOM 10497 C CG   . LYS A 1 36 ? -6.930  -12.062 7.869   1.00 0.00 ? 36 LYS A CG   8  
ATOM 10498 C CD   . LYS A 1 36 ? -6.104  -13.075 8.647   1.00 0.00 ? 36 LYS A CD   8  
ATOM 10499 C CE   . LYS A 1 36 ? -4.626  -12.934 8.335   1.00 0.00 ? 36 LYS A CE   8  
ATOM 10500 N NZ   . LYS A 1 36 ? -3.782  -13.820 9.178   1.00 0.00 ? 36 LYS A NZ   8  
ATOM 10501 H H    . LYS A 1 36 ? -6.227  -9.948  5.809   1.00 0.00 ? 36 LYS A H    8  
ATOM 10502 H HA   . LYS A 1 36 ? -8.425  -9.814  7.627   1.00 0.00 ? 36 LYS A HA   8  
ATOM 10503 H HB2  . LYS A 1 36 ? -5.510  -10.494 8.007   1.00 0.00 ? 36 LYS A HB2  8  
ATOM 10504 H HB3  . LYS A 1 36 ? -6.678  -10.532 9.317   1.00 0.00 ? 36 LYS A HB3  8  
ATOM 10505 H HG2  . LYS A 1 36 ? -7.977  -12.220 8.086   1.00 0.00 ? 36 LYS A HG2  8  
ATOM 10506 H HG3  . LYS A 1 36 ? -6.754  -12.201 6.812   1.00 0.00 ? 36 LYS A HG3  8  
ATOM 10507 H HD2  . LYS A 1 36 ? -6.256  -12.916 9.704   1.00 0.00 ? 36 LYS A HD2  8  
ATOM 10508 H HD3  . LYS A 1 36 ? -6.428  -14.070 8.380   1.00 0.00 ? 36 LYS A HD3  8  
ATOM 10509 H HE2  . LYS A 1 36 ? -4.465  -13.186 7.296   1.00 0.00 ? 36 LYS A HE2  8  
ATOM 10510 H HE3  . LYS A 1 36 ? -4.334  -11.908 8.502   1.00 0.00 ? 36 LYS A HE3  8  
ATOM 10511 H HZ1  . LYS A 1 36 ? -2.784  -13.754 8.877   1.00 0.00 ? 36 LYS A HZ1  8  
ATOM 10512 H HZ2  . LYS A 1 36 ? -4.096  -14.811 9.087   1.00 0.00 ? 36 LYS A HZ2  8  
ATOM 10513 H HZ3  . LYS A 1 36 ? -3.849  -13.539 10.180  1.00 0.00 ? 36 LYS A HZ3  8  
ATOM 10514 N N    . ARG A 1 37 ? -5.968  -7.640  7.977   1.00 0.00 ? 37 ARG A N    8  
ATOM 10515 C CA   . ARG A 1 37 ? -5.613  -6.374  8.596   1.00 0.00 ? 37 ARG A CA   8  
ATOM 10516 C C    . ARG A 1 37 ? -6.562  -5.269  8.170   1.00 0.00 ? 37 ARG A C    8  
ATOM 10517 O O    . ARG A 1 37 ? -7.118  -4.580  9.012   1.00 0.00 ? 37 ARG A O    8  
ATOM 10518 C CB   . ARG A 1 37 ? -4.178  -5.972  8.270   1.00 0.00 ? 37 ARG A CB   8  
ATOM 10519 C CG   . ARG A 1 37 ? -3.137  -6.781  9.017   1.00 0.00 ? 37 ARG A CG   8  
ATOM 10520 C CD   . ARG A 1 37 ? -1.772  -6.119  8.947   1.00 0.00 ? 37 ARG A CD   8  
ATOM 10521 N NE   . ARG A 1 37 ? -0.798  -6.803  9.790   1.00 0.00 ? 37 ARG A NE   8  
ATOM 10522 C CZ   . ARG A 1 37 ? -0.130  -6.220  10.782  1.00 0.00 ? 37 ARG A CZ   8  
ATOM 10523 N NH1  . ARG A 1 37 ? -0.337  -4.937  11.066  1.00 0.00 ? 37 ARG A NH1  8  
ATOM 10524 N NH2  . ARG A 1 37 ? 0.736   -6.924  11.500  1.00 0.00 ? 37 ARG A NH2  8  
ATOM 10525 H H    . ARG A 1 37 ? -5.333  -8.076  7.368   1.00 0.00 ? 37 ARG A H    8  
ATOM 10526 H HA   . ARG A 1 37 ? -5.699  -6.501  9.664   1.00 0.00 ? 37 ARG A HA   8  
ATOM 10527 H HB2  . ARG A 1 37 ? -4.011  -6.100  7.210   1.00 0.00 ? 37 ARG A HB2  8  
ATOM 10528 H HB3  . ARG A 1 37 ? -4.041  -4.931  8.524   1.00 0.00 ? 37 ARG A HB3  8  
ATOM 10529 H HG2  . ARG A 1 37 ? -3.432  -6.866  10.052  1.00 0.00 ? 37 ARG A HG2  8  
ATOM 10530 H HG3  . ARG A 1 37 ? -3.074  -7.764  8.573   1.00 0.00 ? 37 ARG A HG3  8  
ATOM 10531 H HD2  . ARG A 1 37 ? -1.427  -6.137  7.924   1.00 0.00 ? 37 ARG A HD2  8  
ATOM 10532 H HD3  . ARG A 1 37 ? -1.863  -5.095  9.278   1.00 0.00 ? 37 ARG A HD3  8  
ATOM 10533 H HE   . ARG A 1 37 ? -0.636  -7.760  9.602   1.00 0.00 ? 37 ARG A HE   8  
ATOM 10534 H HH11 . ARG A 1 37 ? -1.001  -4.403  10.537  1.00 0.00 ? 37 ARG A HH11 8  
ATOM 10535 H HH12 . ARG A 1 37 ? 0.179   -4.489  11.813  1.00 0.00 ? 37 ARG A HH12 8  
ATOM 10536 H HH21 . ARG A 1 37 ? 0.886   -7.900  11.299  1.00 0.00 ? 37 ARG A HH21 8  
ATOM 10537 H HH22 . ARG A 1 37 ? 1.250   -6.486  12.251  1.00 0.00 ? 37 ARG A HH22 8  
ATOM 10538 N N    . LEU A 1 38 ? -6.763  -5.118  6.867   1.00 0.00 ? 38 LEU A N    8  
ATOM 10539 C CA   . LEU A 1 38 ? -7.579  -4.026  6.345   1.00 0.00 ? 38 LEU A CA   8  
ATOM 10540 C C    . LEU A 1 38 ? -9.002  -4.066  6.900   1.00 0.00 ? 38 LEU A C    8  
ATOM 10541 O O    . LEU A 1 38 ? -9.579  -3.024  7.213   1.00 0.00 ? 38 LEU A O    8  
ATOM 10542 C CB   . LEU A 1 38 ? -7.587  -4.048  4.816   1.00 0.00 ? 38 LEU A CB   8  
ATOM 10543 C CG   . LEU A 1 38 ? -6.445  -3.269  4.146   1.00 0.00 ? 38 LEU A CG   8  
ATOM 10544 C CD1  . LEU A 1 38 ? -5.082  -3.763  4.604   1.00 0.00 ? 38 LEU A CD1  8  
ATOM 10545 C CD2  . LEU A 1 38 ? -6.558  -3.366  2.636   1.00 0.00 ? 38 LEU A CD2  8  
ATOM 10546 H H    . LEU A 1 38 ? -6.360  -5.760  6.239   1.00 0.00 ? 38 LEU A H    8  
ATOM 10547 H HA   . LEU A 1 38 ? -7.118  -3.104  6.670   1.00 0.00 ? 38 LEU A HA   8  
ATOM 10548 H HB2  . LEU A 1 38 ? -7.531  -5.078  4.494   1.00 0.00 ? 38 LEU A HB2  8  
ATOM 10549 H HB3  . LEU A 1 38 ? -8.524  -3.632  4.477   1.00 0.00 ? 38 LEU A HB3  8  
ATOM 10550 H HG   . LEU A 1 38 ? -6.524  -2.225  4.422   1.00 0.00 ? 38 LEU A HG   8  
ATOM 10551 H HD11 . LEU A 1 38 ? -4.989  -3.631  5.673   1.00 0.00 ? 38 LEU A HD11 8  
ATOM 10552 H HD12 . LEU A 1 38 ? -4.310  -3.198  4.105   1.00 0.00 ? 38 LEU A HD12 8  
ATOM 10553 H HD13 . LEU A 1 38 ? -4.975  -4.810  4.360   1.00 0.00 ? 38 LEU A HD13 8  
ATOM 10554 H HD21 . LEU A 1 38 ? -7.495  -2.933  2.318   1.00 0.00 ? 38 LEU A HD21 8  
ATOM 10555 H HD22 . LEU A 1 38 ? -6.519  -4.402  2.338   1.00 0.00 ? 38 LEU A HD22 8  
ATOM 10556 H HD23 . LEU A 1 38 ? -5.738  -2.828  2.179   1.00 0.00 ? 38 LEU A HD23 8  
ATOM 10557 N N    . GLY A 1 39 ? -9.555  -5.265  7.045   1.00 0.00 ? 39 GLY A N    8  
ATOM 10558 C CA   . GLY A 1 39 ? -10.874 -5.398  7.640   1.00 0.00 ? 39 GLY A CA   8  
ATOM 10559 C C    . GLY A 1 39 ? -10.892 -4.948  9.094   1.00 0.00 ? 39 GLY A C    8  
ATOM 10560 O O    . GLY A 1 39 ? -11.783 -4.208  9.520   1.00 0.00 ? 39 GLY A O    8  
ATOM 10561 H H    . GLY A 1 39 ? -9.069  -6.065  6.743   1.00 0.00 ? 39 GLY A H    8  
ATOM 10562 H HA2  . GLY A 1 39 ? -11.577 -4.798  7.079   1.00 0.00 ? 39 GLY A HA2  8  
ATOM 10563 H HA3  . GLY A 1 39 ? -11.179 -6.433  7.591   1.00 0.00 ? 39 GLY A HA3  8  
ATOM 10564 N N    . ALA A 1 40 ? -9.891  -5.383  9.851   1.00 0.00 ? 40 ALA A N    8  
ATOM 10565 C CA   . ALA A 1 40 ? -9.784  -5.028  11.261  1.00 0.00 ? 40 ALA A CA   8  
ATOM 10566 C C    . ALA A 1 40 ? -9.476  -3.543  11.434  1.00 0.00 ? 40 ALA A C    8  
ATOM 10567 O O    . ALA A 1 40 ? -9.943  -2.907  12.381  1.00 0.00 ? 40 ALA A O    8  
ATOM 10568 C CB   . ALA A 1 40 ? -8.716  -5.877  11.935  1.00 0.00 ? 40 ALA A CB   8  
ATOM 10569 H H    . ALA A 1 40 ? -9.204  -5.960  9.451   1.00 0.00 ? 40 ALA A H    8  
ATOM 10570 H HA   . ALA A 1 40 ? -10.732 -5.245  11.730  1.00 0.00 ? 40 ALA A HA   8  
ATOM 10571 H HB1  . ALA A 1 40 ? -8.692  -5.655  12.992  1.00 0.00 ? 40 ALA A HB1  8  
ATOM 10572 H HB2  . ALA A 1 40 ? -7.751  -5.658  11.499  1.00 0.00 ? 40 ALA A HB2  8  
ATOM 10573 H HB3  . ALA A 1 40 ? -8.947  -6.923  11.793  1.00 0.00 ? 40 ALA A HB3  8  
ATOM 10574 N N    . GLU A 1 41 ? -8.695  -2.993  10.512  1.00 0.00 ? 41 GLU A N    8  
ATOM 10575 C CA   . GLU A 1 41 ? -8.341  -1.580  10.550  1.00 0.00 ? 41 GLU A CA   8  
ATOM 10576 C C    . GLU A 1 41 ? -9.568  -0.716  10.301  1.00 0.00 ? 41 GLU A C    8  
ATOM 10577 O O    . GLU A 1 41 ? -9.740  0.316   10.936  1.00 0.00 ? 41 GLU A O    8  
ATOM 10578 C CB   . GLU A 1 41 ? -7.257  -1.263  9.516   1.00 0.00 ? 41 GLU A CB   8  
ATOM 10579 C CG   . GLU A 1 41 ? -5.931  -1.960  9.781   1.00 0.00 ? 41 GLU A CG   8  
ATOM 10580 C CD   . GLU A 1 41 ? -5.279  -1.522  11.076  1.00 0.00 ? 41 GLU A CD   8  
ATOM 10581 O OE1  . GLU A 1 41 ? -5.700  -1.993  12.152  1.00 0.00 ? 41 GLU A OE1  8  
ATOM 10582 O OE2  . GLU A 1 41 ? -4.327  -0.712  11.026  1.00 0.00 ? 41 GLU A OE2  8  
ATOM 10583 H H    . GLU A 1 41 ? -8.340  -3.558  9.788   1.00 0.00 ? 41 GLU A H    8  
ATOM 10584 H HA   . GLU A 1 41 ? -7.962  -1.360  11.537  1.00 0.00 ? 41 GLU A HA   8  
ATOM 10585 H HB2  . GLU A 1 41 ? -7.610  -1.567  8.541   1.00 0.00 ? 41 GLU A HB2  8  
ATOM 10586 H HB3  . GLU A 1 41 ? -7.085  -0.196  9.509   1.00 0.00 ? 41 GLU A HB3  8  
ATOM 10587 H HG2  . GLU A 1 41 ? -6.101  -3.025  9.829   1.00 0.00 ? 41 GLU A HG2  8  
ATOM 10588 H HG3  . GLU A 1 41 ? -5.256  -1.743  8.963   1.00 0.00 ? 41 GLU A HG3  8  
ATOM 10589 N N    . TRP A 1 42 ? -10.425 -1.151  9.381   1.00 0.00 ? 42 TRP A N    8  
ATOM 10590 C CA   . TRP A 1 42 ? -11.666 -0.435  9.095   1.00 0.00 ? 42 TRP A CA   8  
ATOM 10591 C C    . TRP A 1 42 ? -12.576 -0.403  10.326  1.00 0.00 ? 42 TRP A C    8  
ATOM 10592 O O    . TRP A 1 42 ? -13.252 0.597   10.585  1.00 0.00 ? 42 TRP A O    8  
ATOM 10593 C CB   . TRP A 1 42 ? -12.387 -1.071  7.905   1.00 0.00 ? 42 TRP A CB   8  
ATOM 10594 C CG   . TRP A 1 42 ? -13.612 -0.314  7.485   1.00 0.00 ? 42 TRP A CG   8  
ATOM 10595 C CD1  . TRP A 1 42 ? -14.823 -0.344  8.097   1.00 0.00 ? 42 TRP A CD1  8  
ATOM 10596 C CD2  . TRP A 1 42 ? -13.746 0.580   6.374   1.00 0.00 ? 42 TRP A CD2  8  
ATOM 10597 N NE1  . TRP A 1 42 ? -15.711 0.469   7.440   1.00 0.00 ? 42 TRP A NE1  8  
ATOM 10598 C CE2  . TRP A 1 42 ? -15.073 1.050   6.377   1.00 0.00 ? 42 TRP A CE2  8  
ATOM 10599 C CE3  . TRP A 1 42 ? -12.875 1.029   5.379   1.00 0.00 ? 42 TRP A CE3  8  
ATOM 10600 C CZ2  . TRP A 1 42 ? -15.548 1.946   5.424   1.00 0.00 ? 42 TRP A CZ2  8  
ATOM 10601 C CZ3  . TRP A 1 42 ? -13.349 1.918   4.433   1.00 0.00 ? 42 TRP A CZ3  8  
ATOM 10602 C CH2  . TRP A 1 42 ? -14.674 2.370   4.460   1.00 0.00 ? 42 TRP A CH2  8  
ATOM 10603 H H    . TRP A 1 42 ? -10.210 -1.968  8.873   1.00 0.00 ? 42 TRP A H    8  
ATOM 10604 H HA   . TRP A 1 42 ? -11.415 0.578   8.841   1.00 0.00 ? 42 TRP A HA   8  
ATOM 10605 H HB2  . TRP A 1 42 ? -11.713 -1.112  7.061   1.00 0.00 ? 42 TRP A HB2  8  
ATOM 10606 H HB3  . TRP A 1 42 ? -12.687 -2.073  8.170   1.00 0.00 ? 42 TRP A HB3  8  
ATOM 10607 H HD1  . TRP A 1 42 ? -15.031 -0.926  8.977   1.00 0.00 ? 42 TRP A HD1  8  
ATOM 10608 H HE1  . TRP A 1 42 ? -16.648 0.610   7.690   1.00 0.00 ? 42 TRP A HE1  8  
ATOM 10609 H HE3  . TRP A 1 42 ? -11.850 0.692   5.340   1.00 0.00 ? 42 TRP A HE3  8  
ATOM 10610 H HZ2  . TRP A 1 42 ? -16.568 2.305   5.434   1.00 0.00 ? 42 TRP A HZ2  8  
ATOM 10611 H HZ3  . TRP A 1 42 ? -12.690 2.276   3.656   1.00 0.00 ? 42 TRP A HZ3  8  
ATOM 10612 H HH2  . TRP A 1 42 ? -14.999 3.066   3.701   1.00 0.00 ? 42 TRP A HH2  8  
ATOM 10613 N N    . LYS A 1 43 ? -12.589 -1.484  11.094  1.00 0.00 ? 43 LYS A N    8  
ATOM 10614 C CA   . LYS A 1 43 ? -13.420 -1.544  12.294  1.00 0.00 ? 43 LYS A CA   8  
ATOM 10615 C C    . LYS A 1 43 ? -12.933 -0.588  13.385  1.00 0.00 ? 43 LYS A C    8  
ATOM 10616 O O    . LYS A 1 43 ? -13.704 -0.186  14.256  1.00 0.00 ? 43 LYS A O    8  
ATOM 10617 C CB   . LYS A 1 43 ? -13.512 -2.964  12.828  1.00 0.00 ? 43 LYS A CB   8  
ATOM 10618 C CG   . LYS A 1 43 ? -14.481 -3.815  12.032  1.00 0.00 ? 43 LYS A CG   8  
ATOM 10619 C CD   . LYS A 1 43 ? -14.809 -5.088  12.769  1.00 0.00 ? 43 LYS A CD   8  
ATOM 10620 C CE   . LYS A 1 43 ? -15.861 -5.910  12.039  1.00 0.00 ? 43 LYS A CE   8  
ATOM 10621 N NZ   . LYS A 1 43 ? -16.281 -7.095  12.828  1.00 0.00 ? 43 LYS A NZ   8  
ATOM 10622 H H    . LYS A 1 43 ? -12.040 -2.261  10.843  1.00 0.00 ? 43 LYS A H    8  
ATOM 10623 H HA   . LYS A 1 43 ? -14.413 -1.244  12.004  1.00 0.00 ? 43 LYS A HA   8  
ATOM 10624 H HB2  . LYS A 1 43 ? -12.534 -3.422  12.785  1.00 0.00 ? 43 LYS A HB2  8  
ATOM 10625 H HB3  . LYS A 1 43 ? -13.846 -2.936  13.853  1.00 0.00 ? 43 LYS A HB3  8  
ATOM 10626 H HG2  . LYS A 1 43 ? -15.391 -3.256  11.872  1.00 0.00 ? 43 LYS A HG2  8  
ATOM 10627 H HG3  . LYS A 1 43 ? -14.034 -4.061  11.082  1.00 0.00 ? 43 LYS A HG3  8  
ATOM 10628 H HD2  . LYS A 1 43 ? -13.909 -5.664  12.860  1.00 0.00 ? 43 LYS A HD2  8  
ATOM 10629 H HD3  . LYS A 1 43 ? -15.179 -4.838  13.753  1.00 0.00 ? 43 LYS A HD3  8  
ATOM 10630 H HE2  . LYS A 1 43 ? -16.725 -5.287  11.855  1.00 0.00 ? 43 LYS A HE2  8  
ATOM 10631 H HE3  . LYS A 1 43 ? -15.451 -6.242  11.098  1.00 0.00 ? 43 LYS A HE3  8  
ATOM 10632 H HZ1  . LYS A 1 43 ? -16.533 -6.808  13.798  1.00 0.00 ? 43 LYS A HZ1  8  
ATOM 10633 H HZ2  . LYS A 1 43 ? -15.508 -7.792  12.877  1.00 0.00 ? 43 LYS A HZ2  8  
ATOM 10634 H HZ3  . LYS A 1 43 ? -17.112 -7.547  12.388  1.00 0.00 ? 43 LYS A HZ3  8  
ATOM 10635 N N    . LEU A 1 44 ? -11.661 -0.218  13.332  1.00 0.00 ? 44 LEU A N    8  
ATOM 10636 C CA   . LEU A 1 44 ? -11.099 0.728   14.292  1.00 0.00 ? 44 LEU A CA   8  
ATOM 10637 C C    . LEU A 1 44 ? -10.615 1.985   13.572  1.00 0.00 ? 44 LEU A C    8  
ATOM 10638 O O    . LEU A 1 44 ? -9.767  2.725   14.079  1.00 0.00 ? 44 LEU A O    8  
ATOM 10639 C CB   . LEU A 1 44 ? -9.944  0.091   15.084  1.00 0.00 ? 44 LEU A CB   8  
ATOM 10640 C CG   . LEU A 1 44 ? -10.337 -0.934  16.158  1.00 0.00 ? 44 LEU A CG   8  
ATOM 10641 C CD1  . LEU A 1 44 ? -11.425 -0.379  17.065  1.00 0.00 ? 44 LEU A CD1  8  
ATOM 10642 C CD2  . LEU A 1 44 ? -10.772 -2.253  15.536  1.00 0.00 ? 44 LEU A CD2  8  
ATOM 10643 H H    . LEU A 1 44 ? -11.086 -0.581  12.625  1.00 0.00 ? 44 LEU A H    8  
ATOM 10644 H HA   . LEU A 1 44 ? -11.885 1.005   14.979  1.00 0.00 ? 44 LEU A HA   8  
ATOM 10645 H HB2  . LEU A 1 44 ? -9.288  -0.398  14.379  1.00 0.00 ? 44 LEU A HB2  8  
ATOM 10646 H HB3  . LEU A 1 44 ? -9.392  0.884   15.565  1.00 0.00 ? 44 LEU A HB3  8  
ATOM 10647 H HG   . LEU A 1 44 ? -9.473  -1.133  16.775  1.00 0.00 ? 44 LEU A HG   8  
ATOM 10648 H HD11 . LEU A 1 44 ? -12.303 -0.153  16.480  1.00 0.00 ? 44 LEU A HD11 8  
ATOM 10649 H HD12 . LEU A 1 44 ? -11.070 0.521   17.542  1.00 0.00 ? 44 LEU A HD12 8  
ATOM 10650 H HD13 . LEU A 1 44 ? -11.674 -1.111  17.820  1.00 0.00 ? 44 LEU A HD13 8  
ATOM 10651 H HD21 . LEU A 1 44 ? -9.963  -2.658  14.946  1.00 0.00 ? 44 LEU A HD21 8  
ATOM 10652 H HD22 . LEU A 1 44 ? -11.631 -2.087  14.902  1.00 0.00 ? 44 LEU A HD22 8  
ATOM 10653 H HD23 . LEU A 1 44 ? -11.032 -2.952  16.317  1.00 0.00 ? 44 LEU A HD23 8  
ATOM 10654 N N    . LEU A 1 45 ? -11.180 2.229   12.399  1.00 0.00 ? 45 LEU A N    8  
ATOM 10655 C CA   . LEU A 1 45 ? -10.752 3.326   11.541  1.00 0.00 ? 45 LEU A CA   8  
ATOM 10656 C C    . LEU A 1 45 ? -11.208 4.672   12.085  1.00 0.00 ? 45 LEU A C    8  
ATOM 10657 O O    . LEU A 1 45 ? -12.347 4.824   12.530  1.00 0.00 ? 45 LEU A O    8  
ATOM 10658 C CB   . LEU A 1 45 ? -11.312 3.131   10.129  1.00 0.00 ? 45 LEU A CB   8  
ATOM 10659 C CG   . LEU A 1 45 ? -10.912 4.198   9.108   1.00 0.00 ? 45 LEU A CG   8  
ATOM 10660 C CD1  . LEU A 1 45 ? -9.416  4.146   8.837   1.00 0.00 ? 45 LEU A CD1  8  
ATOM 10661 C CD2  . LEU A 1 45 ? -11.693 4.022   7.816   1.00 0.00 ? 45 LEU A CD2  8  
ATOM 10662 H H    . LEU A 1 45 ? -11.913 1.651   12.099  1.00 0.00 ? 45 LEU A H    8  
ATOM 10663 H HA   . LEU A 1 45 ? -9.672  3.314   11.495  1.00 0.00 ? 45 LEU A HA   8  
ATOM 10664 H HB2  . LEU A 1 45 ? -10.978 2.169   9.765   1.00 0.00 ? 45 LEU A HB2  8  
ATOM 10665 H HB3  . LEU A 1 45 ? -12.390 3.114   10.194  1.00 0.00 ? 45 LEU A HB3  8  
ATOM 10666 H HG   . LEU A 1 45 ? -11.143 5.177   9.506   1.00 0.00 ? 45 LEU A HG   8  
ATOM 10667 H HD11 . LEU A 1 45 ? -9.155  4.908   8.117   1.00 0.00 ? 45 LEU A HD11 8  
ATOM 10668 H HD12 . LEU A 1 45 ? -9.155  3.176   8.443   1.00 0.00 ? 45 LEU A HD12 8  
ATOM 10669 H HD13 . LEU A 1 45 ? -8.877  4.319   9.755   1.00 0.00 ? 45 LEU A HD13 8  
ATOM 10670 H HD21 . LEU A 1 45 ? -11.447 4.824   7.136   1.00 0.00 ? 45 LEU A HD21 8  
ATOM 10671 H HD22 . LEU A 1 45 ? -12.751 4.045   8.030   1.00 0.00 ? 45 LEU A HD22 8  
ATOM 10672 H HD23 . LEU A 1 45 ? -11.436 3.076   7.366   1.00 0.00 ? 45 LEU A HD23 8  
ATOM 10673 N N    . SER A 1 46 ? -10.312 5.644   12.049  1.00 0.00 ? 46 SER A N    8  
ATOM 10674 C CA   . SER A 1 46 ? -10.655 7.011   12.390  1.00 0.00 ? 46 SER A CA   8  
ATOM 10675 C C    . SER A 1 46 ? -11.078 7.752   11.126  1.00 0.00 ? 46 SER A C    8  
ATOM 10676 O O    . SER A 1 46 ? -10.601 7.446   10.030  1.00 0.00 ? 46 SER A O    8  
ATOM 10677 C CB   . SER A 1 46 ? -9.464  7.697   13.058  1.00 0.00 ? 46 SER A CB   8  
ATOM 10678 O OG   . SER A 1 46 ? -8.278  7.484   12.318  1.00 0.00 ? 46 SER A OG   8  
ATOM 10679 H H    . SER A 1 46 ? -9.394  5.440   11.774  1.00 0.00 ? 46 SER A H    8  
ATOM 10680 H HA   . SER A 1 46 ? -11.489 6.986   13.078  1.00 0.00 ? 46 SER A HA   8  
ATOM 10681 H HB2  . SER A 1 46 ? -9.649  8.760   13.120  1.00 0.00 ? 46 SER A HB2  8  
ATOM 10682 H HB3  . SER A 1 46 ? -9.331  7.297   14.054  1.00 0.00 ? 46 SER A HB3  8  
ATOM 10683 H HG   . SER A 1 46 ? -7.517  7.606   12.893  1.00 0.00 ? 46 SER A HG   8  
ATOM 10684 N N    . GLU A 1 47 ? -11.967 8.721   11.270  1.00 0.00 ? 47 GLU A N    8  
ATOM 10685 C CA   . GLU A 1 47 ? -12.514 9.420   10.118  1.00 0.00 ? 47 GLU A CA   8  
ATOM 10686 C C    . GLU A 1 47 ? -11.470 10.341  9.484   1.00 0.00 ? 47 GLU A C    8  
ATOM 10687 O O    . GLU A 1 47 ? -11.582 10.705  8.312   1.00 0.00 ? 47 GLU A O    8  
ATOM 10688 C CB   . GLU A 1 47 ? -13.798 10.178  10.498  1.00 0.00 ? 47 GLU A CB   8  
ATOM 10689 C CG   . GLU A 1 47 ? -13.611 11.319  11.486  1.00 0.00 ? 47 GLU A CG   8  
ATOM 10690 C CD   . GLU A 1 47 ? -13.380 12.647  10.796  1.00 0.00 ? 47 GLU A CD   8  
ATOM 10691 O OE1  . GLU A 1 47 ? -14.345 13.201  10.230  1.00 0.00 ? 47 GLU A OE1  8  
ATOM 10692 O OE2  . GLU A 1 47 ? -12.236 13.139  10.804  1.00 0.00 ? 47 GLU A OE2  8  
ATOM 10693 H H    . GLU A 1 47 ? -12.252 8.982   12.172  1.00 0.00 ? 47 GLU A H    8  
ATOM 10694 H HA   . GLU A 1 47 ? -12.769 8.664   9.387   1.00 0.00 ? 47 GLU A HA   8  
ATOM 10695 H HB2  . GLU A 1 47 ? -14.230 10.588  9.599   1.00 0.00 ? 47 GLU A HB2  8  
ATOM 10696 H HB3  . GLU A 1 47 ? -14.496 9.473   10.927  1.00 0.00 ? 47 GLU A HB3  8  
ATOM 10697 H HG2  . GLU A 1 47 ? -14.497 11.397  12.098  1.00 0.00 ? 47 GLU A HG2  8  
ATOM 10698 H HG3  . GLU A 1 47 ? -12.758 11.101  12.112  1.00 0.00 ? 47 GLU A HG3  8  
ATOM 10699 N N    . THR A 1 48 ? -10.462 10.731  10.255  1.00 0.00 ? 48 THR A N    8  
ATOM 10700 C CA   . THR A 1 48 ? -9.369  11.522  9.711   1.00 0.00 ? 48 THR A CA   8  
ATOM 10701 C C    . THR A 1 48 ? -8.469  10.651  8.823   1.00 0.00 ? 48 THR A C    8  
ATOM 10702 O O    . THR A 1 48 ? -7.956  11.113  7.802   1.00 0.00 ? 48 THR A O    8  
ATOM 10703 C CB   . THR A 1 48 ? -8.538  12.210  10.823  1.00 0.00 ? 48 THR A CB   8  
ATOM 10704 O OG1  . THR A 1 48 ? -7.597  13.120  10.246  1.00 0.00 ? 48 THR A OG1  8  
ATOM 10705 C CG2  . THR A 1 48 ? -7.800  11.190  11.677  1.00 0.00 ? 48 THR A CG2  8  
ATOM 10706 H H    . THR A 1 48 ? -10.464 10.498  11.213  1.00 0.00 ? 48 THR A H    8  
ATOM 10707 H HA   . THR A 1 48 ? -9.809  12.295  9.095   1.00 0.00 ? 48 THR A HA   8  
ATOM 10708 H HB   . THR A 1 48 ? -9.216  12.764  11.459  1.00 0.00 ? 48 THR A HB   8  
ATOM 10709 H HG1  . THR A 1 48 ? -8.074  13.845  9.818   1.00 0.00 ? 48 THR A HG1  8  
ATOM 10710 H HG21 . THR A 1 48 ? -7.218  11.703  12.428  1.00 0.00 ? 48 THR A HG21 8  
ATOM 10711 H HG22 . THR A 1 48 ? -7.143  10.604  11.051  1.00 0.00 ? 48 THR A HG22 8  
ATOM 10712 H HG23 . THR A 1 48 ? -8.514  10.540  12.159  1.00 0.00 ? 48 THR A HG23 8  
ATOM 10713 N N    . GLU A 1 49 ? -8.320  9.376   9.190   1.00 0.00 ? 49 GLU A N    8  
ATOM 10714 C CA   . GLU A 1 49 ? -7.541  8.431   8.394   1.00 0.00 ? 49 GLU A CA   8  
ATOM 10715 C C    . GLU A 1 49 ? -8.359  7.924   7.214   1.00 0.00 ? 49 GLU A C    8  
ATOM 10716 O O    . GLU A 1 49 ? -7.834  7.272   6.317   1.00 0.00 ? 49 GLU A O    8  
ATOM 10717 C CB   . GLU A 1 49 ? -7.041  7.258   9.238   1.00 0.00 ? 49 GLU A CB   8  
ATOM 10718 C CG   . GLU A 1 49 ? -5.914  7.634   10.188  1.00 0.00 ? 49 GLU A CG   8  
ATOM 10719 C CD   . GLU A 1 49 ? -4.767  8.340   9.486   1.00 0.00 ? 49 GLU A CD   8  
ATOM 10720 O OE1  . GLU A 1 49 ? -3.963  7.665   8.805   1.00 0.00 ? 49 GLU A OE1  8  
ATOM 10721 O OE2  . GLU A 1 49 ? -4.673  9.581   9.607   1.00 0.00 ? 49 GLU A OE2  8  
ATOM 10722 H H    . GLU A 1 49 ? -8.743  9.063   10.016  1.00 0.00 ? 49 GLU A H    8  
ATOM 10723 H HA   . GLU A 1 49 ? -6.685  8.967   8.008   1.00 0.00 ? 49 GLU A HA   8  
ATOM 10724 H HB2  . GLU A 1 49 ? -7.864  6.874   9.824   1.00 0.00 ? 49 GLU A HB2  8  
ATOM 10725 H HB3  . GLU A 1 49 ? -6.684  6.481   8.579   1.00 0.00 ? 49 GLU A HB3  8  
ATOM 10726 H HG2  . GLU A 1 49 ? -6.306  8.291   10.952  1.00 0.00 ? 49 GLU A HG2  8  
ATOM 10727 H HG3  . GLU A 1 49 ? -5.535  6.735   10.649  1.00 0.00 ? 49 GLU A HG3  8  
ATOM 10728 N N    . LYS A 1 50 ? -9.656  8.201   7.243   1.00 0.00 ? 50 LYS A N    8  
ATOM 10729 C CA   . LYS A 1 50 ? -10.523 7.912   6.110   1.00 0.00 ? 50 LYS A CA   8  
ATOM 10730 C C    . LYS A 1 50 ? -10.082 8.729   4.889   1.00 0.00 ? 50 LYS A C    8  
ATOM 10731 O O    . LYS A 1 50 ? -10.285 8.325   3.747   1.00 0.00 ? 50 LYS A O    8  
ATOM 10732 C CB   . LYS A 1 50 ? -11.976 8.250   6.455   1.00 0.00 ? 50 LYS A CB   8  
ATOM 10733 C CG   . LYS A 1 50 ? -12.966 7.896   5.360   1.00 0.00 ? 50 LYS A CG   8  
ATOM 10734 C CD   . LYS A 1 50 ? -14.250 8.698   5.490   1.00 0.00 ? 50 LYS A CD   8  
ATOM 10735 C CE   . LYS A 1 50 ? -14.958 8.435   6.809   1.00 0.00 ? 50 LYS A CE   8  
ATOM 10736 N NZ   . LYS A 1 50 ? -16.120 9.340   6.997   1.00 0.00 ? 50 LYS A NZ   8  
ATOM 10737 H H    . LYS A 1 50 ? -10.040 8.600   8.053   1.00 0.00 ? 50 LYS A H    8  
ATOM 10738 H HA   . LYS A 1 50 ? -10.446 6.862   5.886   1.00 0.00 ? 50 LYS A HA   8  
ATOM 10739 H HB2  . LYS A 1 50 ? -12.256 7.710   7.348   1.00 0.00 ? 50 LYS A HB2  8  
ATOM 10740 H HB3  . LYS A 1 50 ? -12.050 9.310   6.647   1.00 0.00 ? 50 LYS A HB3  8  
ATOM 10741 H HG2  . LYS A 1 50 ? -12.515 8.103   4.404   1.00 0.00 ? 50 LYS A HG2  8  
ATOM 10742 H HG3  . LYS A 1 50 ? -13.202 6.842   5.428   1.00 0.00 ? 50 LYS A HG3  8  
ATOM 10743 H HD2  . LYS A 1 50 ? -14.010 9.749   5.428   1.00 0.00 ? 50 LYS A HD2  8  
ATOM 10744 H HD3  . LYS A 1 50 ? -14.911 8.432   4.678   1.00 0.00 ? 50 LYS A HD3  8  
ATOM 10745 H HE2  . LYS A 1 50 ? -15.305 7.411   6.819   1.00 0.00 ? 50 LYS A HE2  8  
ATOM 10746 H HE3  . LYS A 1 50 ? -14.258 8.586   7.616   1.00 0.00 ? 50 LYS A HE3  8  
ATOM 10747 H HZ1  . LYS A 1 50 ? -16.655 9.069   7.851   1.00 0.00 ? 50 LYS A HZ1  8  
ATOM 10748 H HZ2  . LYS A 1 50 ? -16.759 9.283   6.172   1.00 0.00 ? 50 LYS A HZ2  8  
ATOM 10749 H HZ3  . LYS A 1 50 ? -15.798 10.325  7.106   1.00 0.00 ? 50 LYS A HZ3  8  
ATOM 10750 N N    . ARG A 1 51 ? -9.472  9.883   5.150   1.00 0.00 ? 51 ARG A N    8  
ATOM 10751 C CA   . ARG A 1 51 ? -9.049  10.799  4.093   1.00 0.00 ? 51 ARG A CA   8  
ATOM 10752 C C    . ARG A 1 51 ? -8.010  10.168  3.147   1.00 0.00 ? 51 ARG A C    8  
ATOM 10753 O O    . ARG A 1 51 ? -8.196  10.206  1.932   1.00 0.00 ? 51 ARG A O    8  
ATOM 10754 C CB   . ARG A 1 51 ? -8.510  12.098  4.694   1.00 0.00 ? 51 ARG A CB   8  
ATOM 10755 C CG   . ARG A 1 51 ? -9.179  13.352  4.152   1.00 0.00 ? 51 ARG A CG   8  
ATOM 10756 C CD   . ARG A 1 51 ? -10.684 13.347  4.400   1.00 0.00 ? 51 ARG A CD   8  
ATOM 10757 N NE   . ARG A 1 51 ? -11.016 13.034  5.792   1.00 0.00 ? 51 ARG A NE   8  
ATOM 10758 C CZ   . ARG A 1 51 ? -11.277 13.949  6.726   1.00 0.00 ? 51 ARG A CZ   8  
ATOM 10759 N NH1  . ARG A 1 51 ? -11.245 15.244  6.427   1.00 0.00 ? 51 ARG A NH1  8  
ATOM 10760 N NH2  . ARG A 1 51 ? -11.571 13.565  7.961   1.00 0.00 ? 51 ARG A NH2  8  
ATOM 10761 H H    . ARG A 1 51 ? -9.287  10.118  6.085   1.00 0.00 ? 51 ARG A H    8  
ATOM 10762 H HA   . ARG A 1 51 ? -9.925  11.034  3.511   1.00 0.00 ? 51 ARG A HA   8  
ATOM 10763 H HB2  . ARG A 1 51 ? -8.658  12.071  5.763   1.00 0.00 ? 51 ARG A HB2  8  
ATOM 10764 H HB3  . ARG A 1 51 ? -7.451  12.164  4.491   1.00 0.00 ? 51 ARG A HB3  8  
ATOM 10765 H HG2  . ARG A 1 51 ? -8.750  14.216  4.637   1.00 0.00 ? 51 ARG A HG2  8  
ATOM 10766 H HG3  . ARG A 1 51 ? -9.000  13.408  3.088   1.00 0.00 ? 51 ARG A HG3  8  
ATOM 10767 H HD2  . ARG A 1 51 ? -11.078 14.321  4.158   1.00 0.00 ? 51 ARG A HD2  8  
ATOM 10768 H HD3  . ARG A 1 51 ? -11.136 12.606  3.757   1.00 0.00 ? 51 ARG A HD3  8  
ATOM 10769 H HE   . ARG A 1 51 ? -11.051 12.084  6.041   1.00 0.00 ? 51 ARG A HE   8  
ATOM 10770 H HH11 . ARG A 1 51 ? -11.030 15.538  5.496   1.00 0.00 ? 51 ARG A HH11 8  
ATOM 10771 H HH12 . ARG A 1 51 ? -11.432 15.931  7.136   1.00 0.00 ? 51 ARG A HH12 8  
ATOM 10772 H HH21 . ARG A 1 51 ? -11.596 12.587  8.197   1.00 0.00 ? 51 ARG A HH21 8  
ATOM 10773 H HH22 . ARG A 1 51 ? -11.778 14.250  8.671   1.00 0.00 ? 51 ARG A HH22 8  
ATOM 10774 N N    . PRO A 1 52 ? -6.894  9.601   3.668   1.00 0.00 ? 52 PRO A N    8  
ATOM 10775 C CA   . PRO A 1 52 ? -5.877  8.945   2.827   1.00 0.00 ? 52 PRO A CA   8  
ATOM 10776 C C    . PRO A 1 52 ? -6.419  7.795   1.978   1.00 0.00 ? 52 PRO A C    8  
ATOM 10777 O O    . PRO A 1 52 ? -5.772  7.383   1.016   1.00 0.00 ? 52 PRO A O    8  
ATOM 10778 C CB   . PRO A 1 52 ? -4.840  8.433   3.828   1.00 0.00 ? 52 PRO A CB   8  
ATOM 10779 C CG   . PRO A 1 52 ? -5.023  9.283   5.036   1.00 0.00 ? 52 PRO A CG   8  
ATOM 10780 C CD   . PRO A 1 52 ? -6.488  9.609   5.087   1.00 0.00 ? 52 PRO A CD   8  
ATOM 10781 H HA   . PRO A 1 52 ? -5.419  9.659   2.167   1.00 0.00 ? 52 PRO A HA   8  
ATOM 10782 H HB2  . PRO A 1 52 ? -5.028  7.391   4.044   1.00 0.00 ? 52 PRO A HB2  8  
ATOM 10783 H HB3  . PRO A 1 52 ? -3.850  8.547   3.413   1.00 0.00 ? 52 PRO A HB3  8  
ATOM 10784 H HG2  . PRO A 1 52 ? -4.732  8.735   5.921   1.00 0.00 ? 52 PRO A HG2  8  
ATOM 10785 H HG3  . PRO A 1 52 ? -4.441  10.186  4.942   1.00 0.00 ? 52 PRO A HG3  8  
ATOM 10786 H HD2  . PRO A 1 52 ? -7.023  8.855   5.648   1.00 0.00 ? 52 PRO A HD2  8  
ATOM 10787 H HD3  . PRO A 1 52 ? -6.642  10.584  5.524   1.00 0.00 ? 52 PRO A HD3  8  
ATOM 10788 N N    . PHE A 1 53 ? -7.595  7.284   2.319   1.00 0.00 ? 53 PHE A N    8  
ATOM 10789 C CA   . PHE A 1 53 ? -8.284  6.340   1.446   1.00 0.00 ? 53 PHE A CA   8  
ATOM 10790 C C    . PHE A 1 53 ? -8.524  6.993   0.100   1.00 0.00 ? 53 PHE A C    8  
ATOM 10791 O O    . PHE A 1 53 ? -8.357  6.386   -0.956  1.00 0.00 ? 53 PHE A O    8  
ATOM 10792 C CB   . PHE A 1 53 ? -9.636  5.945   2.025   1.00 0.00 ? 53 PHE A CB   8  
ATOM 10793 C CG   . PHE A 1 53 ? -9.596  4.912   3.104   1.00 0.00 ? 53 PHE A CG   8  
ATOM 10794 C CD1  . PHE A 1 53 ? -9.064  5.196   4.348   1.00 0.00 ? 53 PHE A CD1  8  
ATOM 10795 C CD2  . PHE A 1 53 ? -10.130 3.659   2.874   1.00 0.00 ? 53 PHE A CD2  8  
ATOM 10796 C CE1  . PHE A 1 53 ? -9.065  4.245   5.347   1.00 0.00 ? 53 PHE A CE1  8  
ATOM 10797 C CE2  . PHE A 1 53 ? -10.132 2.701   3.867   1.00 0.00 ? 53 PHE A CE2  8  
ATOM 10798 C CZ   . PHE A 1 53 ? -9.600  2.995   5.108   1.00 0.00 ? 53 PHE A CZ   8  
ATOM 10799 H H    . PHE A 1 53 ? -8.007  7.546   3.168   1.00 0.00 ? 53 PHE A H    8  
ATOM 10800 H HA   . PHE A 1 53 ? -7.666  5.463   1.324   1.00 0.00 ? 53 PHE A HA   8  
ATOM 10801 H HB2  . PHE A 1 53 ? -10.109 6.825   2.435   1.00 0.00 ? 53 PHE A HB2  8  
ATOM 10802 H HB3  . PHE A 1 53 ? -10.253 5.562   1.224   1.00 0.00 ? 53 PHE A HB3  8  
ATOM 10803 H HD1  . PHE A 1 53 ? -8.645  6.175   4.535   1.00 0.00 ? 53 PHE A HD1  8  
ATOM 10804 H HD2  . PHE A 1 53 ? -10.540 3.430   1.892   1.00 0.00 ? 53 PHE A HD2  8  
ATOM 10805 H HE1  . PHE A 1 53 ? -8.646  4.478   6.315   1.00 0.00 ? 53 PHE A HE1  8  
ATOM 10806 H HE2  . PHE A 1 53 ? -10.552 1.724   3.677   1.00 0.00 ? 53 PHE A HE2  8  
ATOM 10807 H HZ   . PHE A 1 53 ? -9.603  2.248   5.889   1.00 0.00 ? 53 PHE A HZ   8  
ATOM 10808 N N    . ILE A 1 54 ? -8.883  8.261   0.158   1.00 0.00 ? 54 ILE A N    8  
ATOM 10809 C CA   . ILE A 1 54 ? -9.224  9.006   -1.032  1.00 0.00 ? 54 ILE A CA   8  
ATOM 10810 C C    . ILE A 1 54 ? -7.932  9.388   -1.750  1.00 0.00 ? 54 ILE A C    8  
ATOM 10811 O O    . ILE A 1 54 ? -7.883  9.500   -2.972  1.00 0.00 ? 54 ILE A O    8  
ATOM 10812 C CB   . ILE A 1 54 ? -10.032 10.279  -0.688  1.00 0.00 ? 54 ILE A CB   8  
ATOM 10813 C CG1  . ILE A 1 54 ? -11.268 9.920   0.145   1.00 0.00 ? 54 ILE A CG1  8  
ATOM 10814 C CG2  . ILE A 1 54 ? -10.440 11.022  -1.955  1.00 0.00 ? 54 ILE A CG2  8  
ATOM 10815 C CD1  . ILE A 1 54 ? -12.220 8.957   -0.542  1.00 0.00 ? 54 ILE A CD1  8  
ATOM 10816 H H    . ILE A 1 54 ? -8.869  8.724   1.030   1.00 0.00 ? 54 ILE A H    8  
ATOM 10817 H HA   . ILE A 1 54 ? -9.838  8.363   -1.666  1.00 0.00 ? 54 ILE A HA   8  
ATOM 10818 H HB   . ILE A 1 54 ? -9.398  10.934  -0.110  1.00 0.00 ? 54 ILE A HB   8  
ATOM 10819 H HG12 . ILE A 1 54 ? -10.948 9.463   1.068   1.00 0.00 ? 54 ILE A HG12 8  
ATOM 10820 H HG13 . ILE A 1 54 ? -11.815 10.824  0.367   1.00 0.00 ? 54 ILE A HG13 8  
ATOM 10821 H HG21 . ILE A 1 54 ? -11.056 10.378  -2.565  1.00 0.00 ? 54 ILE A HG21 8  
ATOM 10822 H HG22 . ILE A 1 54 ? -9.557  11.305  -2.507  1.00 0.00 ? 54 ILE A HG22 8  
ATOM 10823 H HG23 . ILE A 1 54 ? -10.998 11.907  -1.688  1.00 0.00 ? 54 ILE A HG23 8  
ATOM 10824 H HD11 . ILE A 1 54 ? -12.566 9.392   -1.468  1.00 0.00 ? 54 ILE A HD11 8  
ATOM 10825 H HD12 . ILE A 1 54 ? -13.064 8.767   0.104   1.00 0.00 ? 54 ILE A HD12 8  
ATOM 10826 H HD13 . ILE A 1 54 ? -11.708 8.030   -0.749  1.00 0.00 ? 54 ILE A HD13 8  
ATOM 10827 N N    . ASP A 1 55 ? -6.881  9.585   -0.954  1.00 0.00 ? 55 ASP A N    8  
ATOM 10828 C CA   . ASP A 1 55 ? -5.558  9.930   -1.470  1.00 0.00 ? 55 ASP A CA   8  
ATOM 10829 C C    . ASP A 1 55 ? -4.971  8.780   -2.282  1.00 0.00 ? 55 ASP A C    8  
ATOM 10830 O O    . ASP A 1 55 ? -4.429  8.988   -3.369  1.00 0.00 ? 55 ASP A O    8  
ATOM 10831 C CB   . ASP A 1 55 ? -4.619  10.299  -0.321  1.00 0.00 ? 55 ASP A CB   8  
ATOM 10832 C CG   . ASP A 1 55 ? -3.228  10.657  -0.805  1.00 0.00 ? 55 ASP A CG   8  
ATOM 10833 O OD1  . ASP A 1 55 ? -3.075  11.727  -1.431  1.00 0.00 ? 55 ASP A OD1  8  
ATOM 10834 O OD2  . ASP A 1 55 ? -2.287  9.883   -0.540  1.00 0.00 ? 55 ASP A OD2  8  
ATOM 10835 H H    . ASP A 1 55 ? -7.001  9.491   0.013   1.00 0.00 ? 55 ASP A H    8  
ATOM 10836 H HA   . ASP A 1 55 ? -5.671  10.786  -2.118  1.00 0.00 ? 55 ASP A HA   8  
ATOM 10837 H HB2  . ASP A 1 55 ? -5.025  11.151  0.206   1.00 0.00 ? 55 ASP A HB2  8  
ATOM 10838 H HB3  . ASP A 1 55 ? -4.541  9.463   0.359   1.00 0.00 ? 55 ASP A HB3  8  
ATOM 10839 N N    . GLU A 1 56 ? -5.092  7.566   -1.759  1.00 0.00 ? 56 GLU A N    8  
ATOM 10840 C CA   . GLU A 1 56 ? -4.684  6.377   -2.494  1.00 0.00 ? 56 GLU A CA   8  
ATOM 10841 C C    . GLU A 1 56 ? -5.477  6.276   -3.799  1.00 0.00 ? 56 GLU A C    8  
ATOM 10842 O O    . GLU A 1 56 ? -4.956  5.838   -4.828  1.00 0.00 ? 56 GLU A O    8  
ATOM 10843 C CB   . GLU A 1 56 ? -4.887  5.127   -1.634  1.00 0.00 ? 56 GLU A CB   8  
ATOM 10844 C CG   . GLU A 1 56 ? -3.588  4.420   -1.273  1.00 0.00 ? 56 GLU A CG   8  
ATOM 10845 C CD   . GLU A 1 56 ? -2.580  5.334   -0.596  1.00 0.00 ? 56 GLU A CD   8  
ATOM 10846 O OE1  . GLU A 1 56 ? -2.620  5.461   0.646   1.00 0.00 ? 56 GLU A OE1  8  
ATOM 10847 O OE2  . GLU A 1 56 ? -1.734  5.918   -1.305  1.00 0.00 ? 56 GLU A OE2  8  
ATOM 10848 H H    . GLU A 1 56 ? -5.453  7.469   -0.850  1.00 0.00 ? 56 GLU A H    8  
ATOM 10849 H HA   . GLU A 1 56 ? -3.633  6.473   -2.731  1.00 0.00 ? 56 GLU A HA   8  
ATOM 10850 H HB2  . GLU A 1 56 ? -5.383  5.413   -0.717  1.00 0.00 ? 56 GLU A HB2  8  
ATOM 10851 H HB3  . GLU A 1 56 ? -5.514  4.432   -2.171  1.00 0.00 ? 56 GLU A HB3  8  
ATOM 10852 H HG2  . GLU A 1 56 ? -3.813  3.602   -0.604  1.00 0.00 ? 56 GLU A HG2  8  
ATOM 10853 H HG3  . GLU A 1 56 ? -3.144  4.028   -2.177  1.00 0.00 ? 56 GLU A HG3  8  
ATOM 10854 N N    . ALA A 1 57 ? -6.736  6.715   -3.756  1.00 0.00 ? 57 ALA A N    8  
ATOM 10855 C CA   . ALA A 1 57 ? -7.572  6.776   -4.951  1.00 0.00 ? 57 ALA A CA   8  
ATOM 10856 C C    . ALA A 1 57 ? -7.035  7.809   -5.941  1.00 0.00 ? 57 ALA A C    8  
ATOM 10857 O O    . ALA A 1 57 ? -7.099  7.610   -7.154  1.00 0.00 ? 57 ALA A O    8  
ATOM 10858 C CB   . ALA A 1 57 ? -9.013  7.094   -4.584  1.00 0.00 ? 57 ALA A CB   8  
ATOM 10859 H H    . ALA A 1 57 ? -7.113  6.995   -2.891  1.00 0.00 ? 57 ALA A H    8  
ATOM 10860 H HA   . ALA A 1 57 ? -7.553  5.801   -5.419  1.00 0.00 ? 57 ALA A HA   8  
ATOM 10861 H HB1  . ALA A 1 57 ? -9.381  6.354   -3.890  1.00 0.00 ? 57 ALA A HB1  8  
ATOM 10862 H HB2  . ALA A 1 57 ? -9.623  7.086   -5.476  1.00 0.00 ? 57 ALA A HB2  8  
ATOM 10863 H HB3  . ALA A 1 57 ? -9.061  8.071   -4.125  1.00 0.00 ? 57 ALA A HB3  8  
ATOM 10864 N N    . LYS A 1 58 ? -6.503  8.909   -5.414  1.00 0.00 ? 58 LYS A N    8  
ATOM 10865 C CA   . LYS A 1 58 ? -5.885  9.946   -6.240  1.00 0.00 ? 58 LYS A CA   8  
ATOM 10866 C C    . LYS A 1 58 ? -4.707  9.360   -7.013  1.00 0.00 ? 58 LYS A C    8  
ATOM 10867 O O    . LYS A 1 58 ? -4.487  9.681   -8.180  1.00 0.00 ? 58 LYS A O    8  
ATOM 10868 C CB   . LYS A 1 58 ? -5.387  11.107  -5.376  1.00 0.00 ? 58 LYS A CB   8  
ATOM 10869 C CG   . LYS A 1 58 ? -6.465  11.791  -4.554  1.00 0.00 ? 58 LYS A CG   8  
ATOM 10870 C CD   . LYS A 1 58 ? -5.849  12.627  -3.445  1.00 0.00 ? 58 LYS A CD   8  
ATOM 10871 C CE   . LYS A 1 58 ? -6.899  13.235  -2.533  1.00 0.00 ? 58 LYS A CE   8  
ATOM 10872 N NZ   . LYS A 1 58 ? -7.577  14.399  -3.157  1.00 0.00 ? 58 LYS A NZ   8  
ATOM 10873 H H    . LYS A 1 58 ? -6.529  9.029   -4.438  1.00 0.00 ? 58 LYS A H    8  
ATOM 10874 H HA   . LYS A 1 58 ? -6.623  10.308  -6.939  1.00 0.00 ? 58 LYS A HA   8  
ATOM 10875 H HB2  . LYS A 1 58 ? -4.637  10.735  -4.696  1.00 0.00 ? 58 LYS A HB2  8  
ATOM 10876 H HB3  . LYS A 1 58 ? -4.935  11.849  -6.020  1.00 0.00 ? 58 LYS A HB3  8  
ATOM 10877 H HG2  . LYS A 1 58 ? -7.047  12.434  -5.200  1.00 0.00 ? 58 LYS A HG2  8  
ATOM 10878 H HG3  . LYS A 1 58 ? -7.105  11.041  -4.115  1.00 0.00 ? 58 LYS A HG3  8  
ATOM 10879 H HD2  . LYS A 1 58 ? -5.201  11.996  -2.855  1.00 0.00 ? 58 LYS A HD2  8  
ATOM 10880 H HD3  . LYS A 1 58 ? -5.268  13.420  -3.891  1.00 0.00 ? 58 LYS A HD3  8  
ATOM 10881 H HE2  . LYS A 1 58 ? -7.638  12.482  -2.305  1.00 0.00 ? 58 LYS A HE2  8  
ATOM 10882 H HE3  . LYS A 1 58 ? -6.420  13.555  -1.619  1.00 0.00 ? 58 LYS A HE3  8  
ATOM 10883 H HZ1  . LYS A 1 58 ? -6.876  15.141  -3.378  1.00 0.00 ? 58 LYS A HZ1  8  
ATOM 10884 H HZ2  . LYS A 1 58 ? -8.285  14.793  -2.498  1.00 0.00 ? 58 LYS A HZ2  8  
ATOM 10885 H HZ3  . LYS A 1 58 ? -8.056  14.115  -4.041  1.00 0.00 ? 58 LYS A HZ3  8  
ATOM 10886 N N    . ARG A 1 59 ? -3.958  8.493   -6.346  1.00 0.00 ? 59 ARG A N    8  
ATOM 10887 C CA   . ARG A 1 59 ? -2.812  7.838   -6.955  1.00 0.00 ? 59 ARG A CA   8  
ATOM 10888 C C    . ARG A 1 59 ? -3.255  6.846   -8.025  1.00 0.00 ? 59 ARG A C    8  
ATOM 10889 O O    . ARG A 1 59 ? -2.580  6.671   -9.040  1.00 0.00 ? 59 ARG A O    8  
ATOM 10890 C CB   . ARG A 1 59 ? -1.977  7.151   -5.883  1.00 0.00 ? 59 ARG A CB   8  
ATOM 10891 C CG   . ARG A 1 59 ? -1.280  8.151   -4.986  1.00 0.00 ? 59 ARG A CG   8  
ATOM 10892 C CD   . ARG A 1 59 ? -0.460  7.481   -3.906  1.00 0.00 ? 59 ARG A CD   8  
ATOM 10893 N NE   . ARG A 1 59 ? 0.504   8.413   -3.339  1.00 0.00 ? 59 ARG A NE   8  
ATOM 10894 C CZ   . ARG A 1 59 ? 0.794   8.506   -2.046  1.00 0.00 ? 59 ARG A CZ   8  
ATOM 10895 N NH1  . ARG A 1 59 ? 0.167   7.751   -1.152  1.00 0.00 ? 59 ARG A NH1  8  
ATOM 10896 N NH2  . ARG A 1 59 ? 1.706   9.380   -1.650  1.00 0.00 ? 59 ARG A NH2  8  
ATOM 10897 H H    . ARG A 1 59 ? -4.180  8.293   -5.409  1.00 0.00 ? 59 ARG A H    8  
ATOM 10898 H HA   . ARG A 1 59 ? -2.209  8.604   -7.422  1.00 0.00 ? 59 ARG A HA   8  
ATOM 10899 H HB2  . ARG A 1 59 ? -2.619  6.530   -5.277  1.00 0.00 ? 59 ARG A HB2  8  
ATOM 10900 H HB3  . ARG A 1 59 ? -1.227  6.536   -6.357  1.00 0.00 ? 59 ARG A HB3  8  
ATOM 10901 H HG2  . ARG A 1 59 ? -0.628  8.764   -5.588  1.00 0.00 ? 59 ARG A HG2  8  
ATOM 10902 H HG3  . ARG A 1 59 ? -2.028  8.776   -4.519  1.00 0.00 ? 59 ARG A HG3  8  
ATOM 10903 H HD2  . ARG A 1 59 ? -1.121  7.136   -3.127  1.00 0.00 ? 59 ARG A HD2  8  
ATOM 10904 H HD3  . ARG A 1 59 ? 0.069   6.643   -4.336  1.00 0.00 ? 59 ARG A HD3  8  
ATOM 10905 H HE   . ARG A 1 59 ? 0.968   9.015   -3.968  1.00 0.00 ? 59 ARG A HE   8  
ATOM 10906 H HH11 . ARG A 1 59 ? -0.544  7.089   -1.446  1.00 0.00 ? 59 ARG A HH11 8  
ATOM 10907 H HH12 . ARG A 1 59 ? 0.377   7.842   -0.180  1.00 0.00 ? 59 ARG A HH12 8  
ATOM 10908 H HH21 . ARG A 1 59 ? 2.166   9.964   -2.323  1.00 0.00 ? 59 ARG A HH21 8  
ATOM 10909 H HH22 . ARG A 1 59 ? 1.937   9.465   -0.671  1.00 0.00 ? 59 ARG A HH22 8  
ATOM 10910 N N    . LEU A 1 60 ? -4.395  6.210   -7.797  1.00 0.00 ? 60 LEU A N    8  
ATOM 10911 C CA   . LEU A 1 60 ? -4.991  5.331   -8.797  1.00 0.00 ? 60 LEU A CA   8  
ATOM 10912 C C    . LEU A 1 60 ? -5.432  6.147   -10.010 1.00 0.00 ? 60 LEU A C    8  
ATOM 10913 O O    . LEU A 1 60 ? -5.326  5.699   -11.153 1.00 0.00 ? 60 LEU A O    8  
ATOM 10914 C CB   . LEU A 1 60 ? -6.186  4.577   -8.204  1.00 0.00 ? 60 LEU A CB   8  
ATOM 10915 C CG   . LEU A 1 60 ? -5.861  3.678   -7.008  1.00 0.00 ? 60 LEU A CG   8  
ATOM 10916 C CD1  . LEU A 1 60 ? -7.132  3.078   -6.431  1.00 0.00 ? 60 LEU A CD1  8  
ATOM 10917 C CD2  . LEU A 1 60 ? -4.896  2.576   -7.419  1.00 0.00 ? 60 LEU A CD2  8  
ATOM 10918 H H    . LEU A 1 60 ? -4.845  6.328   -6.931  1.00 0.00 ? 60 LEU A H    8  
ATOM 10919 H HA   . LEU A 1 60 ? -4.239  4.621   -9.104  1.00 0.00 ? 60 LEU A HA   8  
ATOM 10920 H HB2  . LEU A 1 60 ? -6.923  5.302   -7.891  1.00 0.00 ? 60 LEU A HB2  8  
ATOM 10921 H HB3  . LEU A 1 60 ? -6.617  3.962   -8.981  1.00 0.00 ? 60 LEU A HB3  8  
ATOM 10922 H HG   . LEU A 1 60 ? -5.389  4.270   -6.236  1.00 0.00 ? 60 LEU A HG   8  
ATOM 10923 H HD11 . LEU A 1 60 ? -6.882  2.446   -5.592  1.00 0.00 ? 60 LEU A HD11 8  
ATOM 10924 H HD12 . LEU A 1 60 ? -7.629  2.489   -7.188  1.00 0.00 ? 60 LEU A HD12 8  
ATOM 10925 H HD13 . LEU A 1 60 ? -7.789  3.870   -6.101  1.00 0.00 ? 60 LEU A HD13 8  
ATOM 10926 H HD21 . LEU A 1 60 ? -3.981  3.017   -7.783  1.00 0.00 ? 60 LEU A HD21 8  
ATOM 10927 H HD22 . LEU A 1 60 ? -5.344  1.979   -8.199  1.00 0.00 ? 60 LEU A HD22 8  
ATOM 10928 H HD23 . LEU A 1 60 ? -4.680  1.951   -6.566  1.00 0.00 ? 60 LEU A HD23 8  
ATOM 10929 N N    . ARG A 1 61 ? -5.915  7.355   -9.737  1.00 0.00 ? 61 ARG A N    8  
ATOM 10930 C CA   . ARG A 1 61 ? -6.302  8.301   -10.777 1.00 0.00 ? 61 ARG A CA   8  
ATOM 10931 C C    . ARG A 1 61 ? -5.091  8.682   -11.628 1.00 0.00 ? 61 ARG A C    8  
ATOM 10932 O O    . ARG A 1 61 ? -5.177  8.758   -12.855 1.00 0.00 ? 61 ARG A O    8  
ATOM 10933 C CB   . ARG A 1 61 ? -6.915  9.548   -10.130 1.00 0.00 ? 61 ARG A CB   8  
ATOM 10934 C CG   . ARG A 1 61 ? -7.328  10.627  -11.113 1.00 0.00 ? 61 ARG A CG   8  
ATOM 10935 C CD   . ARG A 1 61 ? -7.828  11.864  -10.386 1.00 0.00 ? 61 ARG A CD   8  
ATOM 10936 N NE   . ARG A 1 61 ? -8.257  12.923  -11.301 1.00 0.00 ? 61 ARG A NE   8  
ATOM 10937 C CZ   . ARG A 1 61 ? -8.478  14.180  -10.918 1.00 0.00 ? 61 ARG A CZ   8  
ATOM 10938 N NH1  . ARG A 1 61 ? -8.235  14.548  -9.667  1.00 0.00 ? 61 ARG A NH1  8  
ATOM 10939 N NH2  . ARG A 1 61 ? -8.909  15.078  -11.793 1.00 0.00 ? 61 ARG A NH2  8  
ATOM 10940 H H    . ARG A 1 61 ? -6.025  7.616   -8.797  1.00 0.00 ? 61 ARG A H    8  
ATOM 10941 H HA   . ARG A 1 61 ? -7.041  7.829   -11.407 1.00 0.00 ? 61 ARG A HA   8  
ATOM 10942 H HB2  . ARG A 1 61 ? -7.789  9.253   -9.570  1.00 0.00 ? 61 ARG A HB2  8  
ATOM 10943 H HB3  . ARG A 1 61 ? -6.192  9.973   -9.447  1.00 0.00 ? 61 ARG A HB3  8  
ATOM 10944 H HG2  . ARG A 1 61 ? -6.475  10.895  -11.721 1.00 0.00 ? 61 ARG A HG2  8  
ATOM 10945 H HG3  . ARG A 1 61 ? -8.118  10.245  -11.743 1.00 0.00 ? 61 ARG A HG3  8  
ATOM 10946 H HD2  . ARG A 1 61 ? -8.665  11.587  -9.765  1.00 0.00 ? 61 ARG A HD2  8  
ATOM 10947 H HD3  . ARG A 1 61 ? -7.032  12.246  -9.764  1.00 0.00 ? 61 ARG A HD3  8  
ATOM 10948 H HE   . ARG A 1 61 ? -8.405  12.677  -12.243 1.00 0.00 ? 61 ARG A HE   8  
ATOM 10949 H HH11 . ARG A 1 61 ? -7.882  13.883  -9.003  1.00 0.00 ? 61 ARG A HH11 8  
ATOM 10950 H HH12 . ARG A 1 61 ? -8.392  15.502  -9.376  1.00 0.00 ? 61 ARG A HH12 8  
ATOM 10951 H HH21 . ARG A 1 61 ? -9.062  14.821  -12.756 1.00 0.00 ? 61 ARG A HH21 8  
ATOM 10952 H HH22 . ARG A 1 61 ? -9.109  16.019  -11.494 1.00 0.00 ? 61 ARG A HH22 8  
ATOM 10953 N N    . ALA A 1 62 ? -3.961  8.906   -10.966 1.00 0.00 ? 62 ALA A N    8  
ATOM 10954 C CA   . ALA A 1 62 ? -2.716  9.233   -11.650 1.00 0.00 ? 62 ALA A CA   8  
ATOM 10955 C C    . ALA A 1 62 ? -2.285  8.087   -12.558 1.00 0.00 ? 62 ALA A C    8  
ATOM 10956 O O    . ALA A 1 62 ? -1.879  8.301   -13.702 1.00 0.00 ? 62 ALA A O    8  
ATOM 10957 C CB   . ALA A 1 62 ? -1.628  9.549   -10.634 1.00 0.00 ? 62 ALA A CB   8  
ATOM 10958 H H    . ALA A 1 62 ? -3.966  8.850   -9.986  1.00 0.00 ? 62 ALA A H    8  
ATOM 10959 H HA   . ALA A 1 62 ? -2.883  10.114  -12.253 1.00 0.00 ? 62 ALA A HA   8  
ATOM 10960 H HB1  . ALA A 1 62 ? -1.974  10.326  -9.967  1.00 0.00 ? 62 ALA A HB1  8  
ATOM 10961 H HB2  . ALA A 1 62 ? -0.740  9.887   -11.149 1.00 0.00 ? 62 ALA A HB2  8  
ATOM 10962 H HB3  . ALA A 1 62 ? -1.400  8.661   -10.062 1.00 0.00 ? 62 ALA A HB3  8  
ATOM 10963 N N    . LEU A 1 63 ? -2.403  6.868   -12.052 1.00 0.00 ? 63 LEU A N    8  
ATOM 10964 C CA   . LEU A 1 63 ? -2.062  5.679   -12.819 1.00 0.00 ? 63 LEU A CA   8  
ATOM 10965 C C    . LEU A 1 63 ? -2.984  5.508   -14.005 1.00 0.00 ? 63 LEU A C    8  
ATOM 10966 O O    . LEU A 1 63 ? -2.623  4.875   -14.992 1.00 0.00 ? 63 LEU A O    8  
ATOM 10967 C CB   . LEU A 1 63 ? -2.108  4.426   -11.940 1.00 0.00 ? 63 LEU A CB   8  
ATOM 10968 C CG   . LEU A 1 63 ? -1.124  4.409   -10.770 1.00 0.00 ? 63 LEU A CG   8  
ATOM 10969 C CD1  . LEU A 1 63 ? -1.307  3.146   -9.947  1.00 0.00 ? 63 LEU A CD1  8  
ATOM 10970 C CD2  . LEU A 1 63 ? 0.309   4.514   -11.271 1.00 0.00 ? 63 LEU A CD2  8  
ATOM 10971 H H    . LEU A 1 63 ? -2.717  6.762   -11.130 1.00 0.00 ? 63 LEU A H    8  
ATOM 10972 H HA   . LEU A 1 63 ? -1.069  5.809   -13.195 1.00 0.00 ? 63 LEU A HA   8  
ATOM 10973 H HB2  . LEU A 1 63 ? -3.109  4.330   -11.541 1.00 0.00 ? 63 LEU A HB2  8  
ATOM 10974 H HB3  . LEU A 1 63 ? -1.905  3.570   -12.565 1.00 0.00 ? 63 LEU A HB3  8  
ATOM 10975 H HG   . LEU A 1 63 ? -1.320  5.257   -10.130 1.00 0.00 ? 63 LEU A HG   8  
ATOM 10976 H HD11 . LEU A 1 63 ? -2.312  3.117   -9.551  1.00 0.00 ? 63 LEU A HD11 8  
ATOM 10977 H HD12 . LEU A 1 63 ? -0.599  3.142   -9.130  1.00 0.00 ? 63 LEU A HD12 8  
ATOM 10978 H HD13 . LEU A 1 63 ? -1.141  2.280   -10.572 1.00 0.00 ? 63 LEU A HD13 8  
ATOM 10979 H HD21 . LEU A 1 63 ? 0.429   5.427   -11.835 1.00 0.00 ? 63 LEU A HD21 8  
ATOM 10980 H HD22 . LEU A 1 63 ? 0.533   3.668   -11.903 1.00 0.00 ? 63 LEU A HD22 8  
ATOM 10981 H HD23 . LEU A 1 63 ? 0.984   4.521   -10.428 1.00 0.00 ? 63 LEU A HD23 8  
ATOM 10982 N N    . HIS A 1 64 ? -4.172  6.071   -13.914 1.00 0.00 ? 64 HIS A N    8  
ATOM 10983 C CA   . HIS A 1 64 ? -5.112  5.986   -15.009 1.00 0.00 ? 64 HIS A CA   8  
ATOM 10984 C C    . HIS A 1 64 ? -4.756  6.981   -16.108 1.00 0.00 ? 64 HIS A C    8  
ATOM 10985 O O    . HIS A 1 64 ? -4.985  6.722   -17.285 1.00 0.00 ? 64 HIS A O    8  
ATOM 10986 C CB   . HIS A 1 64 ? -6.549  6.212   -14.509 1.00 0.00 ? 64 HIS A CB   8  
ATOM 10987 C CG   . HIS A 1 64 ? -7.550  6.482   -15.599 1.00 0.00 ? 64 HIS A CG   8  
ATOM 10988 N ND1  . HIS A 1 64 ? -8.255  7.661   -15.685 1.00 0.00 ? 64 HIS A ND1  8  
ATOM 10989 C CD2  . HIS A 1 64 ? -7.963  5.726   -16.644 1.00 0.00 ? 64 HIS A CD2  8  
ATOM 10990 C CE1  . HIS A 1 64 ? -9.057  7.620   -16.729 1.00 0.00 ? 64 HIS A CE1  8  
ATOM 10991 N NE2  . HIS A 1 64 ? -8.899  6.458   -17.331 1.00 0.00 ? 64 HIS A NE2  8  
ATOM 10992 H H    . HIS A 1 64 ? -4.424  6.546   -13.092 1.00 0.00 ? 64 HIS A H    8  
ATOM 10993 H HA   . HIS A 1 64 ? -5.026  4.991   -15.407 1.00 0.00 ? 64 HIS A HA   8  
ATOM 10994 H HB2  . HIS A 1 64 ? -6.876  5.334   -13.972 1.00 0.00 ? 64 HIS A HB2  8  
ATOM 10995 H HB3  . HIS A 1 64 ? -6.556  7.058   -13.835 1.00 0.00 ? 64 HIS A HB3  8  
ATOM 10996 H HD1  . HIS A 1 64 ? -8.175  8.428   -15.064 1.00 0.00 ? 64 HIS A HD1  8  
ATOM 10997 H HD2  . HIS A 1 64 ? -7.615  4.732   -16.893 1.00 0.00 ? 64 HIS A HD2  8  
ATOM 10998 H HE1  . HIS A 1 64 ? -9.732  8.405   -17.038 1.00 0.00 ? 64 HIS A HE1  8  
ATOM 10999 H HE2  . HIS A 1 64 ? -9.257  6.236   -18.229 1.00 0.00 ? 64 HIS A HE2  8  
ATOM 11000 N N    . MET A 1 65 ? -4.193  8.115   -15.714 1.00 0.00 ? 65 MET A N    8  
ATOM 11001 C CA   . MET A 1 65 ? -3.831  9.150   -16.671 1.00 0.00 ? 65 MET A CA   8  
ATOM 11002 C C    . MET A 1 65 ? -2.504  8.829   -17.347 1.00 0.00 ? 65 MET A C    8  
ATOM 11003 O O    . MET A 1 65 ? -2.265  9.229   -18.488 1.00 0.00 ? 65 MET A O    8  
ATOM 11004 C CB   . MET A 1 65 ? -3.752  10.517  -15.987 1.00 0.00 ? 65 MET A CB   8  
ATOM 11005 C CG   . MET A 1 65 ? -5.083  10.988  -15.424 1.00 0.00 ? 65 MET A CG   8  
ATOM 11006 S SD   . MET A 1 65 ? -4.990  12.619  -14.659 1.00 0.00 ? 65 MET A SD   8  
ATOM 11007 C CE   . MET A 1 65 ? -3.799  12.328  -13.353 1.00 0.00 ? 65 MET A CE   8  
ATOM 11008 H H    . MET A 1 65 ? -4.021  8.258   -14.758 1.00 0.00 ? 65 MET A H    8  
ATOM 11009 H HA   . MET A 1 65 ? -4.603  9.182   -17.426 1.00 0.00 ? 65 MET A HA   8  
ATOM 11010 H HB2  . MET A 1 65 ? -3.042  10.460  -15.174 1.00 0.00 ? 65 MET A HB2  8  
ATOM 11011 H HB3  . MET A 1 65 ? -3.409  11.250  -16.704 1.00 0.00 ? 65 MET A HB3  8  
ATOM 11012 H HG2  . MET A 1 65 ? -5.803  11.028  -16.228 1.00 0.00 ? 65 MET A HG2  8  
ATOM 11013 H HG3  . MET A 1 65 ? -5.415  10.275  -14.683 1.00 0.00 ? 65 MET A HG3  8  
ATOM 11014 H HE1  . MET A 1 65 ? -2.864  11.999  -13.783 1.00 0.00 ? 65 MET A HE1  8  
ATOM 11015 H HE2  . MET A 1 65 ? -4.176  11.566  -12.686 1.00 0.00 ? 65 MET A HE2  8  
ATOM 11016 H HE3  . MET A 1 65 ? -3.640  13.243  -12.801 1.00 0.00 ? 65 MET A HE3  8  
ATOM 11017 N N    . LYS A 1 66 ? -1.645  8.102   -16.643 1.00 0.00 ? 66 LYS A N    8  
ATOM 11018 C CA   . LYS A 1 66 ? -0.324  7.779   -17.167 1.00 0.00 ? 66 LYS A CA   8  
ATOM 11019 C C    . LYS A 1 66 ? -0.248  6.360   -17.718 1.00 0.00 ? 66 LYS A C    8  
ATOM 11020 O O    . LYS A 1 66 ? -0.014  6.167   -18.915 1.00 0.00 ? 66 LYS A O    8  
ATOM 11021 C CB   . LYS A 1 66 ? 0.727   7.913   -16.066 1.00 0.00 ? 66 LYS A CB   8  
ATOM 11022 C CG   . LYS A 1 66 ? 1.004   9.337   -15.620 1.00 0.00 ? 66 LYS A CG   8  
ATOM 11023 C CD   . LYS A 1 66 ? 2.060   9.372   -14.524 1.00 0.00 ? 66 LYS A CD   8  
ATOM 11024 C CE   . LYS A 1 66 ? 3.237   8.469   -14.864 1.00 0.00 ? 66 LYS A CE   8  
ATOM 11025 N NZ   . LYS A 1 66 ? 4.414   8.714   -13.992 1.00 0.00 ? 66 LYS A NZ   8  
ATOM 11026 H H    . LYS A 1 66 ? -1.904  7.781   -15.753 1.00 0.00 ? 66 LYS A H    8  
ATOM 11027 H HA   . LYS A 1 66 ? -0.095  8.479   -17.956 1.00 0.00 ? 66 LYS A HA   8  
ATOM 11028 H HB2  . LYS A 1 66 ? 0.395   7.353   -15.206 1.00 0.00 ? 66 LYS A HB2  8  
ATOM 11029 H HB3  . LYS A 1 66 ? 1.653   7.486   -16.423 1.00 0.00 ? 66 LYS A HB3  8  
ATOM 11030 H HG2  . LYS A 1 66 ? 1.355   9.908   -16.465 1.00 0.00 ? 66 LYS A HG2  8  
ATOM 11031 H HG3  . LYS A 1 66 ? 0.089   9.772   -15.242 1.00 0.00 ? 66 LYS A HG3  8  
ATOM 11032 H HD2  . LYS A 1 66 ? 2.417   10.386  -14.411 1.00 0.00 ? 66 LYS A HD2  8  
ATOM 11033 H HD3  . LYS A 1 66 ? 1.616   9.037   -13.597 1.00 0.00 ? 66 LYS A HD3  8  
ATOM 11034 H HE2  . LYS A 1 66 ? 2.925   7.443   -14.743 1.00 0.00 ? 66 LYS A HE2  8  
ATOM 11035 H HE3  . LYS A 1 66 ? 3.513   8.637   -15.890 1.00 0.00 ? 66 LYS A HE3  8  
ATOM 11036 H HZ1  . LYS A 1 66 ? 4.720   9.709   -14.079 1.00 0.00 ? 66 LYS A HZ1  8  
ATOM 11037 H HZ2  . LYS A 1 66 ? 5.207   8.095   -14.279 1.00 0.00 ? 66 LYS A HZ2  8  
ATOM 11038 H HZ3  . LYS A 1 66 ? 4.177   8.522   -12.994 1.00 0.00 ? 66 LYS A HZ3  8  
ATOM 11039 N N    . GLU A 1 67 ? -0.487  5.385   -16.839 1.00 0.00 ? 67 GLU A N    8  
ATOM 11040 C CA   . GLU A 1 67 ? -0.224  3.973   -17.120 1.00 0.00 ? 67 GLU A CA   8  
ATOM 11041 C C    . GLU A 1 67 ? 1.256   3.755   -17.485 1.00 0.00 ? 67 GLU A C    8  
ATOM 11042 O O    . GLU A 1 67 ? 2.012   4.707   -17.697 1.00 0.00 ? 67 GLU A O    8  
ATOM 11043 C CB   . GLU A 1 67 ? -1.156  3.451   -18.225 1.00 0.00 ? 67 GLU A CB   8  
ATOM 11044 C CG   . GLU A 1 67 ? -1.148  1.934   -18.370 1.00 0.00 ? 67 GLU A CG   8  
ATOM 11045 C CD   . GLU A 1 67 ? -1.428  1.225   -17.058 1.00 0.00 ? 67 GLU A CD   8  
ATOM 11046 O OE1  . GLU A 1 67 ? -2.615  1.032   -16.722 1.00 0.00 ? 67 GLU A OE1  8  
ATOM 11047 O OE2  . GLU A 1 67 ? -0.461  0.867   -16.351 1.00 0.00 ? 67 GLU A OE2  8  
ATOM 11048 H H    . GLU A 1 67 ? -0.864  5.622   -15.968 1.00 0.00 ? 67 GLU A H    8  
ATOM 11049 H HA   . GLU A 1 67 ? -0.428  3.424   -16.211 1.00 0.00 ? 67 GLU A HA   8  
ATOM 11050 H HB2  . GLU A 1 67 ? -2.165  3.765   -18.003 1.00 0.00 ? 67 GLU A HB2  8  
ATOM 11051 H HB3  . GLU A 1 67 ? -0.854  3.883   -19.168 1.00 0.00 ? 67 GLU A HB3  8  
ATOM 11052 H HG2  . GLU A 1 67 ? -1.906  1.650   -19.086 1.00 0.00 ? 67 GLU A HG2  8  
ATOM 11053 H HG3  . GLU A 1 67 ? -0.178  1.625   -18.731 1.00 0.00 ? 67 GLU A HG3  8  
ATOM 11054 N N    . HIS A 1 68 ? 1.681   2.505   -17.520 1.00 0.00 ? 68 HIS A N    8  
ATOM 11055 C CA   . HIS A 1 68 ? 3.055   2.182   -17.871 1.00 0.00 ? 68 HIS A CA   8  
ATOM 11056 C C    . HIS A 1 68 ? 3.097   0.896   -18.685 1.00 0.00 ? 68 HIS A C    8  
ATOM 11057 O O    . HIS A 1 68 ? 2.274   0.010   -18.482 1.00 0.00 ? 68 HIS A O    8  
ATOM 11058 C CB   . HIS A 1 68 ? 3.930   2.067   -16.610 1.00 0.00 ? 68 HIS A CB   8  
ATOM 11059 C CG   . HIS A 1 68 ? 3.556   0.948   -15.681 1.00 0.00 ? 68 HIS A CG   8  
ATOM 11060 N ND1  . HIS A 1 68 ? 4.443   -0.030  -15.298 1.00 0.00 ? 68 HIS A ND1  8  
ATOM 11061 C CD2  . HIS A 1 68 ? 2.399   0.675   -15.032 1.00 0.00 ? 68 HIS A CD2  8  
ATOM 11062 C CE1  . HIS A 1 68 ? 3.851   -0.855  -14.458 1.00 0.00 ? 68 HIS A CE1  8  
ATOM 11063 N NE2  . HIS A 1 68 ? 2.611   -0.451  -14.277 1.00 0.00 ? 68 HIS A NE2  8  
ATOM 11064 H H    . HIS A 1 68 ? 1.052   1.775   -17.309 1.00 0.00 ? 68 HIS A H    8  
ATOM 11065 H HA   . HIS A 1 68 ? 3.432   2.989   -18.485 1.00 0.00 ? 68 HIS A HA   8  
ATOM 11066 H HB2  . HIS A 1 68 ? 4.956   1.911   -16.911 1.00 0.00 ? 68 HIS A HB2  8  
ATOM 11067 H HB3  . HIS A 1 68 ? 3.865   2.993   -16.057 1.00 0.00 ? 68 HIS A HB3  8  
ATOM 11068 H HD1  . HIS A 1 68 ? 5.382   -0.113  -15.608 1.00 0.00 ? 68 HIS A HD1  8  
ATOM 11069 H HD2  . HIS A 1 68 ? 1.480   1.243   -15.093 1.00 0.00 ? 68 HIS A HD2  8  
ATOM 11070 H HE1  . HIS A 1 68 ? 4.309   -1.712  -13.987 1.00 0.00 ? 68 HIS A HE1  8  
ATOM 11071 H HE2  . HIS A 1 68 ? 2.019   -0.768  -13.567 1.00 0.00 ? 68 HIS A HE2  8  
ATOM 11072 N N    . PRO A 1 69 ? 4.054   0.785   -19.622 1.00 0.00 ? 69 PRO A N    8  
ATOM 11073 C CA   . PRO A 1 69 ? 4.166   -0.371  -20.528 1.00 0.00 ? 69 PRO A CA   8  
ATOM 11074 C C    . PRO A 1 69 ? 4.324   -1.705  -19.794 1.00 0.00 ? 69 PRO A C    8  
ATOM 11075 O O    . PRO A 1 69 ? 4.020   -2.762  -20.346 1.00 0.00 ? 69 PRO A O    8  
ATOM 11076 C CB   . PRO A 1 69 ? 5.422   -0.062  -21.349 1.00 0.00 ? 69 PRO A CB   8  
ATOM 11077 C CG   . PRO A 1 69 ? 5.581   1.415   -21.259 1.00 0.00 ? 69 PRO A CG   8  
ATOM 11078 C CD   . PRO A 1 69 ? 5.097   1.790   -19.890 1.00 0.00 ? 69 PRO A CD   8  
ATOM 11079 H HA   . PRO A 1 69 ? 3.313   -0.432  -21.189 1.00 0.00 ? 69 PRO A HA   8  
ATOM 11080 H HB2  . PRO A 1 69 ? 6.271   -0.575  -20.923 1.00 0.00 ? 69 PRO A HB2  8  
ATOM 11081 H HB3  . PRO A 1 69 ? 5.276   -0.380  -22.371 1.00 0.00 ? 69 PRO A HB3  8  
ATOM 11082 H HG2  . PRO A 1 69 ? 6.620   1.681   -21.378 1.00 0.00 ? 69 PRO A HG2  8  
ATOM 11083 H HG3  . PRO A 1 69 ? 4.979   1.898   -22.015 1.00 0.00 ? 69 PRO A HG3  8  
ATOM 11084 H HD2  . PRO A 1 69 ? 5.899   1.715   -19.172 1.00 0.00 ? 69 PRO A HD2  8  
ATOM 11085 H HD3  . PRO A 1 69 ? 4.680   2.786   -19.893 1.00 0.00 ? 69 PRO A HD3  8  
ATOM 11086 N N    . ASP A 1 70 ? 4.778   -1.654  -18.548 1.00 0.00 ? 70 ASP A N    8  
ATOM 11087 C CA   . ASP A 1 70 ? 4.953   -2.866  -17.743 1.00 0.00 ? 70 ASP A CA   8  
ATOM 11088 C C    . ASP A 1 70 ? 3.636   -3.247  -17.074 1.00 0.00 ? 70 ASP A C    8  
ATOM 11089 O O    . ASP A 1 70 ? 3.623   -3.970  -16.075 1.00 0.00 ? 70 ASP A O    8  
ATOM 11090 C CB   . ASP A 1 70 ? 6.012   -2.658  -16.655 1.00 0.00 ? 70 ASP A CB   8  
ATOM 11091 C CG   . ASP A 1 70 ? 6.993   -1.555  -16.979 1.00 0.00 ? 70 ASP A CG   8  
ATOM 11092 O OD1  . ASP A 1 70 ? 6.708   -0.390  -16.624 1.00 0.00 ? 70 ASP A OD1  8  
ATOM 11093 O OD2  . ASP A 1 70 ? 8.043   -1.841  -17.591 1.00 0.00 ? 70 ASP A OD2  8  
ATOM 11094 H H    . ASP A 1 70 ? 5.008   -0.784  -18.159 1.00 0.00 ? 70 ASP A H    8  
ATOM 11095 H HA   . ASP A 1 70 ? 5.265   -3.667  -18.399 1.00 0.00 ? 70 ASP A HA   8  
ATOM 11096 H HB2  . ASP A 1 70 ? 5.519   -2.408  -15.729 1.00 0.00 ? 70 ASP A HB2  8  
ATOM 11097 H HB3  . ASP A 1 70 ? 6.566   -3.578  -16.524 1.00 0.00 ? 70 ASP A HB3  8  
ATOM 11098 N N    . TYR A 1 71 ? 2.534   -2.749  -17.621 1.00 0.00 ? 71 TYR A N    8  
ATOM 11099 C CA   . TYR A 1 71 ? 1.216   -2.982  -17.051 1.00 0.00 ? 71 TYR A CA   8  
ATOM 11100 C C    . TYR A 1 71 ? 0.885   -4.469  -17.032 1.00 0.00 ? 71 TYR A C    8  
ATOM 11101 O O    . TYR A 1 71 ? 1.272   -5.226  -17.926 1.00 0.00 ? 71 TYR A O    8  
ATOM 11102 C CB   . TYR A 1 71 ? 0.147   -2.194  -17.814 1.00 0.00 ? 71 TYR A CB   8  
ATOM 11103 C CG   . TYR A 1 71 ? -0.058  -2.663  -19.228 1.00 0.00 ? 71 TYR A CG   8  
ATOM 11104 C CD1  . TYR A 1 71 ? -0.954  -3.677  -19.502 1.00 0.00 ? 71 TYR A CD1  8  
ATOM 11105 C CD2  . TYR A 1 71 ? 0.652   -2.106  -20.282 1.00 0.00 ? 71 TYR A CD2  8  
ATOM 11106 C CE1  . TYR A 1 71 ? -1.144  -4.127  -20.782 1.00 0.00 ? 71 TYR A CE1  8  
ATOM 11107 C CE2  . TYR A 1 71 ? 0.465   -2.549  -21.574 1.00 0.00 ? 71 TYR A CE2  8  
ATOM 11108 C CZ   . TYR A 1 71 ? -0.435  -3.564  -21.819 1.00 0.00 ? 71 TYR A CZ   8  
ATOM 11109 O OH   . TYR A 1 71 ? -0.624  -4.014  -23.105 1.00 0.00 ? 71 TYR A OH   8  
ATOM 11110 H H    . TYR A 1 71 ? 2.610   -2.214  -18.438 1.00 0.00 ? 71 TYR A H    8  
ATOM 11111 H HA   . TYR A 1 71 ? 1.231   -2.634  -16.040 1.00 0.00 ? 71 TYR A HA   8  
ATOM 11112 H HB2  . TYR A 1 71 ? -0.797  -2.287  -17.297 1.00 0.00 ? 71 TYR A HB2  8  
ATOM 11113 H HB3  . TYR A 1 71 ? 0.433   -1.154  -17.848 1.00 0.00 ? 71 TYR A HB3  8  
ATOM 11114 H HD1  . TYR A 1 71 ? -1.513  -4.118  -18.689 1.00 0.00 ? 71 TYR A HD1  8  
ATOM 11115 H HD2  . TYR A 1 71 ? 1.354   -1.311  -20.081 1.00 0.00 ? 71 TYR A HD2  8  
ATOM 11116 H HE1  . TYR A 1 71 ? -1.843  -4.919  -20.963 1.00 0.00 ? 71 TYR A HE1  8  
ATOM 11117 H HE2  . TYR A 1 71 ? 1.025   -2.105  -22.384 1.00 0.00 ? 71 TYR A HE2  8  
ATOM 11118 H HH   . TYR A 1 71 ? 0.239   -4.182  -23.517 1.00 0.00 ? 71 TYR A HH   8  
ATOM 11119 N N    . LYS A 1 72 ? 0.184   -4.878  -15.991 1.00 0.00 ? 72 LYS A N    8  
ATOM 11120 C CA   . LYS A 1 72 ? -0.184  -6.268  -15.797 1.00 0.00 ? 72 LYS A CA   8  
ATOM 11121 C C    . LYS A 1 72 ? -1.610  -6.332  -15.294 1.00 0.00 ? 72 LYS A C    8  
ATOM 11122 O O    . LYS A 1 72 ? -2.349  -5.357  -15.440 1.00 0.00 ? 72 LYS A O    8  
ATOM 11123 C CB   . LYS A 1 72 ? 0.785   -6.949  -14.821 1.00 0.00 ? 72 LYS A CB   8  
ATOM 11124 C CG   . LYS A 1 72 ? 2.231   -6.889  -15.290 1.00 0.00 ? 72 LYS A CG   8  
ATOM 11125 C CD   . LYS A 1 72 ? 3.178   -7.604  -14.347 1.00 0.00 ? 72 LYS A CD   8  
ATOM 11126 C CE   . LYS A 1 72 ? 4.612   -7.505  -14.847 1.00 0.00 ? 72 LYS A CE   8  
ATOM 11127 N NZ   . LYS A 1 72 ? 4.766   -8.077  -16.213 1.00 0.00 ? 72 LYS A NZ   8  
ATOM 11128 H H    . LYS A 1 72 ? -0.108  -4.219  -15.330 1.00 0.00 ? 72 LYS A H    8  
ATOM 11129 H HA   . LYS A 1 72 ? -0.141  -6.761  -16.754 1.00 0.00 ? 72 LYS A HA   8  
ATOM 11130 H HB2  . LYS A 1 72 ? 0.717   -6.462  -13.859 1.00 0.00 ? 72 LYS A HB2  8  
ATOM 11131 H HB3  . LYS A 1 72 ? 0.505   -7.985  -14.714 1.00 0.00 ? 72 LYS A HB3  8  
ATOM 11132 H HG2  . LYS A 1 72 ? 2.300   -7.352  -16.262 1.00 0.00 ? 72 LYS A HG2  8  
ATOM 11133 H HG3  . LYS A 1 72 ? 2.527   -5.852  -15.365 1.00 0.00 ? 72 LYS A HG3  8  
ATOM 11134 H HD2  . LYS A 1 72 ? 3.113   -7.150  -13.369 1.00 0.00 ? 72 LYS A HD2  8  
ATOM 11135 H HD3  . LYS A 1 72 ? 2.896   -8.646  -14.285 1.00 0.00 ? 72 LYS A HD3  8  
ATOM 11136 H HE2  . LYS A 1 72 ? 4.900   -6.465  -14.868 1.00 0.00 ? 72 LYS A HE2  8  
ATOM 11137 H HE3  . LYS A 1 72 ? 5.254   -8.042  -14.165 1.00 0.00 ? 72 LYS A HE3  8  
ATOM 11138 H HZ1  . LYS A 1 72 ? 4.471   -9.077  -16.220 1.00 0.00 ? 72 LYS A HZ1  8  
ATOM 11139 H HZ2  . LYS A 1 72 ? 5.763   -8.021  -16.517 1.00 0.00 ? 72 LYS A HZ2  8  
ATOM 11140 H HZ3  . LYS A 1 72 ? 4.178   -7.550  -16.897 1.00 0.00 ? 72 LYS A HZ3  8  
ATOM 11141 N N    . TYR A 1 73 ? -2.003  -7.474  -14.745 1.00 0.00 ? 73 TYR A N    8  
ATOM 11142 C CA   . TYR A 1 73 ? -3.363  -7.662  -14.254 1.00 0.00 ? 73 TYR A CA   8  
ATOM 11143 C C    . TYR A 1 73 ? -3.781  -6.500  -13.350 1.00 0.00 ? 73 TYR A C    8  
ATOM 11144 O O    . TYR A 1 73 ? -3.239  -6.298  -12.265 1.00 0.00 ? 73 TYR A O    8  
ATOM 11145 C CB   . TYR A 1 73 ? -3.494  -9.011  -13.524 1.00 0.00 ? 73 TYR A CB   8  
ATOM 11146 C CG   . TYR A 1 73 ? -2.634  -9.158  -12.278 1.00 0.00 ? 73 TYR A CG   8  
ATOM 11147 C CD1  . TYR A 1 73 ? -1.248  -9.262  -12.360 1.00 0.00 ? 73 TYR A CD1  8  
ATOM 11148 C CD2  . TYR A 1 73 ? -3.216  -9.199  -11.015 1.00 0.00 ? 73 TYR A CD2  8  
ATOM 11149 C CE1  . TYR A 1 73 ? -0.472  -9.406  -11.224 1.00 0.00 ? 73 TYR A CE1  8  
ATOM 11150 C CE2  . TYR A 1 73 ? -2.445  -9.341  -9.877  1.00 0.00 ? 73 TYR A CE2  8  
ATOM 11151 C CZ   . TYR A 1 73 ? -1.076  -9.443  -9.987  1.00 0.00 ? 73 TYR A CZ   8  
ATOM 11152 O OH   . TYR A 1 73 ? -0.309  -9.590  -8.852  1.00 0.00 ? 73 TYR A OH   8  
ATOM 11153 H H    . TYR A 1 73 ? -1.362  -8.210  -14.665 1.00 0.00 ? 73 TYR A H    8  
ATOM 11154 H HA   . TYR A 1 73 ? -4.018  -7.670  -15.116 1.00 0.00 ? 73 TYR A HA   8  
ATOM 11155 H HB2  . TYR A 1 73 ? -4.521  -9.148  -13.225 1.00 0.00 ? 73 TYR A HB2  8  
ATOM 11156 H HB3  . TYR A 1 73 ? -3.221  -9.803  -14.207 1.00 0.00 ? 73 TYR A HB3  8  
ATOM 11157 H HD1  . TYR A 1 73 ? -0.775  -9.233  -13.329 1.00 0.00 ? 73 TYR A HD1  8  
ATOM 11158 H HD2  . TYR A 1 73 ? -4.288  -9.119  -10.929 1.00 0.00 ? 73 TYR A HD2  8  
ATOM 11159 H HE1  . TYR A 1 73 ? 0.602   -9.484  -11.308 1.00 0.00 ? 73 TYR A HE1  8  
ATOM 11160 H HE2  . TYR A 1 73 ? -2.918  -9.374  -8.906  1.00 0.00 ? 73 TYR A HE2  8  
ATOM 11161 H HH   . TYR A 1 73 ? -0.620  -10.351 -8.355  1.00 0.00 ? 73 TYR A HH   8  
ATOM 11162 N N    . ARG A 1 74 ? -4.719  -5.707  -13.841 1.00 0.00 ? 74 ARG A N    8  
ATOM 11163 C CA   . ARG A 1 74 ? -5.234  -4.575  -13.085 1.00 0.00 ? 74 ARG A CA   8  
ATOM 11164 C C    . ARG A 1 74 ? -6.555  -4.939  -12.421 1.00 0.00 ? 74 ARG A C    8  
ATOM 11165 O O    . ARG A 1 74 ? -7.367  -5.665  -12.995 1.00 0.00 ? 74 ARG A O    8  
ATOM 11166 C CB   . ARG A 1 74 ? -5.450  -3.366  -14.004 1.00 0.00 ? 74 ARG A CB   8  
ATOM 11167 C CG   . ARG A 1 74 ? -4.199  -2.888  -14.727 1.00 0.00 ? 74 ARG A CG   8  
ATOM 11168 C CD   . ARG A 1 74 ? -3.148  -2.348  -13.766 1.00 0.00 ? 74 ARG A CD   8  
ATOM 11169 N NE   . ARG A 1 74 ? -3.637  -1.205  -12.992 1.00 0.00 ? 74 ARG A NE   8  
ATOM 11170 C CZ   . ARG A 1 74 ? -3.180  0.043   -13.133 1.00 0.00 ? 74 ARG A CZ   8  
ATOM 11171 N NH1  . ARG A 1 74 ? -2.258  0.317   -14.049 1.00 0.00 ? 74 ARG A NH1  8  
ATOM 11172 N NH2  . ARG A 1 74 ? -3.658  1.019   -12.368 1.00 0.00 ? 74 ARG A NH2  8  
ATOM 11173 H H    . ARG A 1 74 ? -5.058  -5.877  -14.746 1.00 0.00 ? 74 ARG A H    8  
ATOM 11174 H HA   . ARG A 1 74 ? -4.511  -4.322  -12.324 1.00 0.00 ? 74 ARG A HA   8  
ATOM 11175 H HB2  . ARG A 1 74 ? -6.188  -3.625  -14.750 1.00 0.00 ? 74 ARG A HB2  8  
ATOM 11176 H HB3  . ARG A 1 74 ? -5.830  -2.545  -13.412 1.00 0.00 ? 74 ARG A HB3  8  
ATOM 11177 H HG2  . ARG A 1 74 ? -3.774  -3.717  -15.274 1.00 0.00 ? 74 ARG A HG2  8  
ATOM 11178 H HG3  . ARG A 1 74 ? -4.474  -2.106  -15.420 1.00 0.00 ? 74 ARG A HG3  8  
ATOM 11179 H HD2  . ARG A 1 74 ? -2.865  -3.137  -13.085 1.00 0.00 ? 74 ARG A HD2  8  
ATOM 11180 H HD3  . ARG A 1 74 ? -2.283  -2.041  -14.336 1.00 0.00 ? 74 ARG A HD3  8  
ATOM 11181 H HE   . ARG A 1 74 ? -4.335  -1.382  -12.326 1.00 0.00 ? 74 ARG A HE   8  
ATOM 11182 H HH11 . ARG A 1 74 ? -1.900  -0.407  -14.642 1.00 0.00 ? 74 ARG A HH11 8  
ATOM 11183 H HH12 . ARG A 1 74 ? -1.924  1.255   -14.171 1.00 0.00 ? 74 ARG A HH12 8  
ATOM 11184 H HH21 . ARG A 1 74 ? -4.362  0.825   -11.685 1.00 0.00 ? 74 ARG A HH21 8  
ATOM 11185 H HH22 . ARG A 1 74 ? -3.317  1.955   -12.476 1.00 0.00 ? 74 ARG A HH22 8  
ATOM 11186 N N    . PRO A 1 75 ? -6.788  -4.438  -11.200 1.00 0.00 ? 75 PRO A N    8  
ATOM 11187 C CA   . PRO A 1 75 ? -8.061  -4.625  -10.510 1.00 0.00 ? 75 PRO A CA   8  
ATOM 11188 C C    . PRO A 1 75 ? -9.136  -3.678  -11.043 1.00 0.00 ? 75 PRO A C    8  
ATOM 11189 O O    . PRO A 1 75 ? -9.278  -2.543  -10.573 1.00 0.00 ? 75 PRO A O    8  
ATOM 11190 C CB   . PRO A 1 75 ? -7.719  -4.309  -9.055  1.00 0.00 ? 75 PRO A CB   8  
ATOM 11191 C CG   . PRO A 1 75 ? -6.585  -3.345  -9.133  1.00 0.00 ? 75 PRO A CG   8  
ATOM 11192 C CD   . PRO A 1 75 ? -5.818  -3.683  -10.384 1.00 0.00 ? 75 PRO A CD   8  
ATOM 11193 H HA   . PRO A 1 75 ? -8.407  -5.645  -10.590 1.00 0.00 ? 75 PRO A HA   8  
ATOM 11194 H HB2  . PRO A 1 75 ? -8.577  -3.869  -8.569  1.00 0.00 ? 75 PRO A HB2  8  
ATOM 11195 H HB3  . PRO A 1 75 ? -7.432  -5.216  -8.542  1.00 0.00 ? 75 PRO A HB3  8  
ATOM 11196 H HG2  . PRO A 1 75 ? -6.967  -2.337  -9.193  1.00 0.00 ? 75 PRO A HG2  8  
ATOM 11197 H HG3  . PRO A 1 75 ? -5.952  -3.453  -8.265  1.00 0.00 ? 75 PRO A HG3  8  
ATOM 11198 H HD2  . PRO A 1 75 ? -5.511  -2.781  -10.892 1.00 0.00 ? 75 PRO A HD2  8  
ATOM 11199 H HD3  . PRO A 1 75 ? -4.960  -4.292  -10.145 1.00 0.00 ? 75 PRO A HD3  8  
ATOM 11200 N N    . ARG A 1 76 ? -9.866  -4.141  -12.049 1.00 0.00 ? 76 ARG A N    8  
ATOM 11201 C CA   . ARG A 1 76 ? -10.907 -3.337  -12.681 1.00 0.00 ? 76 ARG A CA   8  
ATOM 11202 C C    . ARG A 1 76 ? -12.254 -3.583  -12.015 1.00 0.00 ? 76 ARG A C    8  
ATOM 11203 O O    . ARG A 1 76 ? -12.500 -4.667  -11.484 1.00 0.00 ? 76 ARG A O    8  
ATOM 11204 C CB   . ARG A 1 76 ? -11.012 -3.668  -14.176 1.00 0.00 ? 76 ARG A CB   8  
ATOM 11205 C CG   . ARG A 1 76 ? -11.384 -5.118  -14.449 1.00 0.00 ? 76 ARG A CG   8  
ATOM 11206 C CD   . ARG A 1 76 ? -11.727 -5.353  -15.913 1.00 0.00 ? 76 ARG A CD   8  
ATOM 11207 N NE   . ARG A 1 76 ? -12.113 -6.746  -16.168 1.00 0.00 ? 76 ARG A NE   8  
ATOM 11208 C CZ   . ARG A 1 76 ? -13.148 -7.115  -16.927 1.00 0.00 ? 76 ARG A CZ   8  
ATOM 11209 N NH1  . ARG A 1 76 ? -13.932 -6.194  -17.480 1.00 0.00 ? 76 ARG A NH1  8  
ATOM 11210 N NH2  . ARG A 1 76 ? -13.398 -8.405  -17.132 1.00 0.00 ? 76 ARG A NH2  8  
ATOM 11211 H H    . ARG A 1 76 ? -9.706  -5.055  -12.371 1.00 0.00 ? 76 ARG A H    8  
ATOM 11212 H HA   . ARG A 1 76 ? -10.645 -2.296  -12.568 1.00 0.00 ? 76 ARG A HA   8  
ATOM 11213 H HB2  . ARG A 1 76 ? -11.765 -3.036  -14.623 1.00 0.00 ? 76 ARG A HB2  8  
ATOM 11214 H HB3  . ARG A 1 76 ? -10.061 -3.467  -14.646 1.00 0.00 ? 76 ARG A HB3  8  
ATOM 11215 H HG2  . ARG A 1 76 ? -10.547 -5.748  -14.183 1.00 0.00 ? 76 ARG A HG2  8  
ATOM 11216 H HG3  . ARG A 1 76 ? -12.238 -5.378  -13.842 1.00 0.00 ? 76 ARG A HG3  8  
ATOM 11217 H HD2  . ARG A 1 76 ? -12.548 -4.706  -16.184 1.00 0.00 ? 76 ARG A HD2  8  
ATOM 11218 H HD3  . ARG A 1 76 ? -10.864 -5.112  -16.515 1.00 0.00 ? 76 ARG A HD3  8  
ATOM 11219 H HE   . ARG A 1 76 ? -11.560 -7.450  -15.746 1.00 0.00 ? 76 ARG A HE   8  
ATOM 11220 H HH11 . ARG A 1 76 ? -13.747 -5.220  -17.327 1.00 0.00 ? 76 ARG A HH11 8  
ATOM 11221 H HH12 . ARG A 1 76 ? -14.715 -6.466  -18.060 1.00 0.00 ? 76 ARG A HH12 8  
ATOM 11222 H HH21 . ARG A 1 76 ? -12.800 -9.108  -16.721 1.00 0.00 ? 76 ARG A HH21 8  
ATOM 11223 H HH22 . ARG A 1 76 ? -14.188 -8.688  -17.692 1.00 0.00 ? 76 ARG A HH22 8  
ATOM 11224 N N    . ARG A 1 77 ? -13.119 -2.580  -12.044 1.00 0.00 ? 77 ARG A N    8  
ATOM 11225 C CA   . ARG A 1 77 ? -14.471 -2.726  -11.529 1.00 0.00 ? 77 ARG A CA   8  
ATOM 11226 C C    . ARG A 1 77 ? -15.360 -1.622  -12.081 1.00 0.00 ? 77 ARG A C    8  
ATOM 11227 O O    . ARG A 1 77 ? -15.127 -0.445  -11.812 1.00 0.00 ? 77 ARG A O    8  
ATOM 11228 C CB   . ARG A 1 77 ? -14.483 -2.704  -9.997  1.00 0.00 ? 77 ARG A CB   8  
ATOM 11229 C CG   . ARG A 1 77 ? -15.390 -3.767  -9.388  1.00 0.00 ? 77 ARG A CG   8  
ATOM 11230 C CD   . ARG A 1 77 ? -16.842 -3.578  -9.801  1.00 0.00 ? 77 ARG A CD   8  
ATOM 11231 N NE   . ARG A 1 77 ? -17.644 -4.775  -9.558  1.00 0.00 ? 77 ARG A NE   8  
ATOM 11232 C CZ   . ARG A 1 77 ? -18.954 -4.762  -9.319  1.00 0.00 ? 77 ARG A CZ   8  
ATOM 11233 N NH1  . ARG A 1 77 ? -19.601 -3.609  -9.212  1.00 0.00 ? 77 ARG A NH1  8  
ATOM 11234 N NH2  . ARG A 1 77 ? -19.615 -5.904  -9.186  1.00 0.00 ? 77 ARG A NH2  8  
ATOM 11235 H H    . ARG A 1 77 ? -12.848 -1.717  -12.424 1.00 0.00 ? 77 ARG A H    8  
ATOM 11236 H HA   . ARG A 1 77 ? -14.851 -3.678  -11.870 1.00 0.00 ? 77 ARG A HA   8  
ATOM 11237 H HB2  . ARG A 1 77 ? -13.478 -2.867  -9.637  1.00 0.00 ? 77 ARG A HB2  8  
ATOM 11238 H HB3  . ARG A 1 77 ? -14.824 -1.736  -9.664  1.00 0.00 ? 77 ARG A HB3  8  
ATOM 11239 H HG2  . ARG A 1 77 ? -15.060 -4.740  -9.717  1.00 0.00 ? 77 ARG A HG2  8  
ATOM 11240 H HG3  . ARG A 1 77 ? -15.321 -3.708  -8.310  1.00 0.00 ? 77 ARG A HG3  8  
ATOM 11241 H HD2  . ARG A 1 77 ? -17.260 -2.758  -9.234  1.00 0.00 ? 77 ARG A HD2  8  
ATOM 11242 H HD3  . ARG A 1 77 ? -16.875 -3.340  -10.854 1.00 0.00 ? 77 ARG A HD3  8  
ATOM 11243 H HE   . ARG A 1 77 ? -17.177 -5.651  -9.599  1.00 0.00 ? 77 ARG A HE   8  
ATOM 11244 H HH11 . ARG A 1 77 ? -19.109 -2.746  -9.311  1.00 0.00 ? 77 ARG A HH11 8  
ATOM 11245 H HH12 . ARG A 1 77 ? -20.592 -3.598  -9.029  1.00 0.00 ? 77 ARG A HH12 8  
ATOM 11246 H HH21 . ARG A 1 77 ? -19.129 -6.784  -9.270  1.00 0.00 ? 77 ARG A HH21 8  
ATOM 11247 H HH22 . ARG A 1 77 ? -20.609 -5.900  -9.011  1.00 0.00 ? 77 ARG A HH22 8  
ATOM 11248 N N    . LYS A 1 78 ? -16.358 -2.037  -12.862 1.00 0.00 ? 78 LYS A N    8  
ATOM 11249 C CA   . LYS A 1 78 ? -17.340 -1.152  -13.506 1.00 0.00 ? 78 LYS A CA   8  
ATOM 11250 C C    . LYS A 1 78 ? -16.703 -0.264  -14.573 1.00 0.00 ? 78 LYS A C    8  
ATOM 11251 O O    . LYS A 1 78 ? -15.492 -0.040  -14.590 1.00 0.00 ? 78 LYS A O    8  
ATOM 11252 C CB   . LYS A 1 78 ? -18.122 -0.296  -12.489 1.00 0.00 ? 78 LYS A CB   8  
ATOM 11253 C CG   . LYS A 1 78 ? -17.521 1.076   -12.198 1.00 0.00 ? 78 LYS A CG   8  
ATOM 11254 C CD   . LYS A 1 78 ? -18.439 1.917   -11.329 1.00 0.00 ? 78 LYS A CD   8  
ATOM 11255 C CE   . LYS A 1 78 ? -19.753 2.223   -12.034 1.00 0.00 ? 78 LYS A CE   8  
ATOM 11256 N NZ   . LYS A 1 78 ? -19.569 3.128   -13.203 1.00 0.00 ? 78 LYS A NZ   8  
ATOM 11257 H H    . LYS A 1 78 ? -16.437 -3.005  -13.026 1.00 0.00 ? 78 LYS A H    8  
ATOM 11258 H HA   . LYS A 1 78 ? -18.048 -1.799  -14.008 1.00 0.00 ? 78 LYS A HA   8  
ATOM 11259 H HB2  . LYS A 1 78 ? -19.121 -0.145  -12.865 1.00 0.00 ? 78 LYS A HB2  8  
ATOM 11260 H HB3  . LYS A 1 78 ? -18.180 -0.841  -11.558 1.00 0.00 ? 78 LYS A HB3  8  
ATOM 11261 H HG2  . LYS A 1 78 ? -16.580 0.944   -11.684 1.00 0.00 ? 78 LYS A HG2  8  
ATOM 11262 H HG3  . LYS A 1 78 ? -17.353 1.589   -13.134 1.00 0.00 ? 78 LYS A HG3  8  
ATOM 11263 H HD2  . LYS A 1 78 ? -18.650 1.377   -10.418 1.00 0.00 ? 78 LYS A HD2  8  
ATOM 11264 H HD3  . LYS A 1 78 ? -17.943 2.847   -11.092 1.00 0.00 ? 78 LYS A HD3  8  
ATOM 11265 H HE2  . LYS A 1 78 ? -20.186 1.294   -12.376 1.00 0.00 ? 78 LYS A HE2  8  
ATOM 11266 H HE3  . LYS A 1 78 ? -20.422 2.692   -11.328 1.00 0.00 ? 78 LYS A HE3  8  
ATOM 11267 H HZ1  . LYS A 1 78 ? -20.444 3.162   -13.769 1.00 0.00 ? 78 LYS A HZ1  8  
ATOM 11268 H HZ2  . LYS A 1 78 ? -18.792 2.787   -13.809 1.00 0.00 ? 78 LYS A HZ2  8  
ATOM 11269 H HZ3  . LYS A 1 78 ? -19.347 4.093   -12.880 1.00 0.00 ? 78 LYS A HZ3  8  
ATOM 11270 N N    . THR A 1 79 ? -17.538 0.219   -15.478 1.00 0.00 ? 79 THR A N    8  
ATOM 11271 C CA   . THR A 1 79 ? -17.102 1.124   -16.523 1.00 0.00 ? 79 THR A CA   8  
ATOM 11272 C C    . THR A 1 79 ? -16.993 2.552   -15.994 1.00 0.00 ? 79 THR A C    8  
ATOM 11273 O O    . THR A 1 79 ? -17.375 2.826   -14.851 1.00 0.00 ? 79 THR A O    8  
ATOM 11274 C CB   . THR A 1 79 ? -18.088 1.081   -17.704 1.00 0.00 ? 79 THR A CB   8  
ATOM 11275 O OG1  . THR A 1 79 ? -19.436 1.046   -17.209 1.00 0.00 ? 79 THR A OG1  8  
ATOM 11276 C CG2  . THR A 1 79 ? -17.831 -0.138  -18.575 1.00 0.00 ? 79 THR A CG2  8  
ATOM 11277 H H    . THR A 1 79 ? -18.481 -0.047  -15.449 1.00 0.00 ? 79 THR A H    8  
ATOM 11278 H HA   . THR A 1 79 ? -16.134 0.799   -16.872 1.00 0.00 ? 79 THR A HA   8  
ATOM 11279 H HB   . THR A 1 79 ? -17.953 1.972   -18.301 1.00 0.00 ? 79 THR A HB   8  
ATOM 11280 H HG1  . THR A 1 79 ? -19.717 1.939   -16.952 1.00 0.00 ? 79 THR A HG1  8  
ATOM 11281 H HG21 . THR A 1 79 ? -17.955 -1.034  -17.985 1.00 0.00 ? 79 THR A HG21 8  
ATOM 11282 H HG22 . THR A 1 79 ? -16.823 -0.098  -18.963 1.00 0.00 ? 79 THR A HG22 8  
ATOM 11283 H HG23 . THR A 1 79 ? -18.534 -0.149  -19.395 1.00 0.00 ? 79 THR A HG23 8  
ATOM 11284 N N    . LYS A 1 80 ? -16.479 3.458   -16.822 1.00 0.00 ? 80 LYS A N    8  
ATOM 11285 C CA   . LYS A 1 80 ? -16.404 4.867   -16.456 1.00 0.00 ? 80 LYS A CA   8  
ATOM 11286 C C    . LYS A 1 80 ? -17.801 5.381   -16.143 1.00 0.00 ? 80 LYS A C    8  
ATOM 11287 O O    . LYS A 1 80 ? -18.030 6.022   -15.118 1.00 0.00 ? 80 LYS A O    8  
ATOM 11288 C CB   . LYS A 1 80 ? -15.798 5.693   -17.593 1.00 0.00 ? 80 LYS A CB   8  
ATOM 11289 C CG   . LYS A 1 80 ? -15.762 7.189   -17.308 1.00 0.00 ? 80 LYS A CG   8  
ATOM 11290 C CD   . LYS A 1 80 ? -15.409 7.989   -18.550 1.00 0.00 ? 80 LYS A CD   8  
ATOM 11291 C CE   . LYS A 1 80 ? -15.417 9.485   -18.268 1.00 0.00 ? 80 LYS A CE   8  
ATOM 11292 N NZ   . LYS A 1 80 ? -15.149 10.280  -19.490 1.00 0.00 ? 80 LYS A NZ   8  
ATOM 11293 H H    . LYS A 1 80 ? -16.154 3.172   -17.703 1.00 0.00 ? 80 LYS A H    8  
ATOM 11294 H HA   . LYS A 1 80 ? -15.785 4.958   -15.575 1.00 0.00 ? 80 LYS A HA   8  
ATOM 11295 H HB2  . LYS A 1 80 ? -14.788 5.354   -17.769 1.00 0.00 ? 80 LYS A HB2  8  
ATOM 11296 H HB3  . LYS A 1 80 ? -16.383 5.532   -18.486 1.00 0.00 ? 80 LYS A HB3  8  
ATOM 11297 H HG2  . LYS A 1 80 ? -16.736 7.503   -16.960 1.00 0.00 ? 80 LYS A HG2  8  
ATOM 11298 H HG3  . LYS A 1 80 ? -15.026 7.384   -16.542 1.00 0.00 ? 80 LYS A HG3  8  
ATOM 11299 H HD2  . LYS A 1 80 ? -14.423 7.700   -18.886 1.00 0.00 ? 80 LYS A HD2  8  
ATOM 11300 H HD3  . LYS A 1 80 ? -16.132 7.774   -19.322 1.00 0.00 ? 80 LYS A HD3  8  
ATOM 11301 H HE2  . LYS A 1 80 ? -16.387 9.757   -17.879 1.00 0.00 ? 80 LYS A HE2  8  
ATOM 11302 H HE3  . LYS A 1 80 ? -14.660 9.705   -17.530 1.00 0.00 ? 80 LYS A HE3  8  
ATOM 11303 H HZ1  . LYS A 1 80 ? -15.924 10.156  -20.178 1.00 0.00 ? 80 LYS A HZ1  8  
ATOM 11304 H HZ2  . LYS A 1 80 ? -14.251 9.977   -19.931 1.00 0.00 ? 80 LYS A HZ2  8  
ATOM 11305 H HZ3  . LYS A 1 80 ? -15.078 11.294  -19.251 1.00 0.00 ? 80 LYS A HZ3  8  
ATOM 11306 N N    . THR A 1 81 ? -18.724 5.087   -17.041 1.00 0.00 ? 81 THR A N    8  
ATOM 11307 C CA   . THR A 1 81 ? -20.113 5.434   -16.855 1.00 0.00 ? 81 THR A CA   8  
ATOM 11308 C C    . THR A 1 81 ? -20.758 4.454   -15.879 1.00 0.00 ? 81 THR A C    8  
ATOM 11309 O O    . THR A 1 81 ? -20.743 3.238   -16.163 1.00 0.00 ? 81 THR A O    8  
ATOM 11310 C CB   . THR A 1 81 ? -20.860 5.414   -18.200 1.00 0.00 ? 81 THR A CB   8  
ATOM 11311 O OG1  . THR A 1 81 ? -20.114 6.159   -19.176 1.00 0.00 ? 81 THR A OG1  8  
ATOM 11312 C CG2  . THR A 1 81 ? -22.248 6.013   -18.057 1.00 0.00 ? 81 THR A CG2  8  
ATOM 11313 O OXT  . THR A 1 81 ? -21.255 4.900   -14.825 1.00 0.00 ? 81 THR A OXT  8  
ATOM 11314 H H    . THR A 1 81 ? -18.462 4.612   -17.858 1.00 0.00 ? 81 THR A H    8  
ATOM 11315 H HA   . THR A 1 81 ? -20.165 6.433   -16.447 1.00 0.00 ? 81 THR A HA   8  
ATOM 11316 H HB   . THR A 1 81 ? -20.954 4.390   -18.533 1.00 0.00 ? 81 THR A HB   8  
ATOM 11317 H HG1  . THR A 1 81 ? -19.754 6.961   -18.762 1.00 0.00 ? 81 THR A HG1  8  
ATOM 11318 H HG21 . THR A 1 81 ? -22.814 5.440   -17.338 1.00 0.00 ? 81 THR A HG21 8  
ATOM 11319 H HG22 . THR A 1 81 ? -22.751 5.988   -19.013 1.00 0.00 ? 81 THR A HG22 8  
ATOM 11320 H HG23 . THR A 1 81 ? -22.166 7.035   -17.720 1.00 0.00 ? 81 THR A HG23 8  
ATOM 11321 N N    . SER A 1 1  ? 3.043   -6.958  -15.947 1.00 0.00 ? 1  SER A N    9  
ATOM 11322 C CA   . SER A 1 1  ? 1.657   -7.340  -16.276 1.00 0.00 ? 1  SER A CA   9  
ATOM 11323 C C    . SER A 1 1  ? 0.849   -6.097  -16.622 1.00 0.00 ? 1  SER A C    9  
ATOM 11324 O O    . SER A 1 1  ? 0.518   -5.286  -15.751 1.00 0.00 ? 1  SER A O    9  
ATOM 11325 C CB   . SER A 1 1  ? 1.026   -8.080  -15.092 1.00 0.00 ? 1  SER A CB   9  
ATOM 11326 O OG   . SER A 1 1  ? -0.283  -8.531  -15.398 1.00 0.00 ? 1  SER A OG   9  
ATOM 11327 H H1   . SER A 1 1  ? 3.609   -7.805  -15.730 1.00 0.00 ? 1  SER A H1   9  
ATOM 11328 H H2   . SER A 1 1  ? 3.052   -6.323  -15.121 1.00 0.00 ? 1  SER A H2   9  
ATOM 11329 H H3   . SER A 1 1  ? 3.478   -6.460  -16.755 1.00 0.00 ? 1  SER A H3   9  
ATOM 11330 H HA   . SER A 1 1  ? 1.677   -7.994  -17.136 1.00 0.00 ? 1  SER A HA   9  
ATOM 11331 H HB2  . SER A 1 1  ? 1.638   -8.935  -14.841 1.00 0.00 ? 1  SER A HB2  9  
ATOM 11332 H HB3  . SER A 1 1  ? 0.976   -7.416  -14.240 1.00 0.00 ? 1  SER A HB3  9  
ATOM 11333 H HG   . SER A 1 1  ? -0.321  -9.497  -15.313 1.00 0.00 ? 1  SER A HG   9  
ATOM 11334 N N    . ASP A 1 2  ? 0.542   -5.939  -17.898 1.00 0.00 ? 2  ASP A N    9  
ATOM 11335 C CA   . ASP A 1 2  ? -0.149  -4.753  -18.368 1.00 0.00 ? 2  ASP A CA   9  
ATOM 11336 C C    . ASP A 1 2  ? -1.630  -5.036  -18.580 1.00 0.00 ? 2  ASP A C    9  
ATOM 11337 O O    . ASP A 1 2  ? -2.024  -5.661  -19.563 1.00 0.00 ? 2  ASP A O    9  
ATOM 11338 C CB   . ASP A 1 2  ? 0.482   -4.228  -19.662 1.00 0.00 ? 2  ASP A CB   9  
ATOM 11339 C CG   . ASP A 1 2  ? -0.207  -2.976  -20.172 1.00 0.00 ? 2  ASP A CG   9  
ATOM 11340 O OD1  . ASP A 1 2  ? 0.022   -1.887  -19.599 1.00 0.00 ? 2  ASP A OD1  9  
ATOM 11341 O OD2  . ASP A 1 2  ? -0.976  -3.071  -21.149 1.00 0.00 ? 2  ASP A OD2  9  
ATOM 11342 H H    . ASP A 1 2  ? 0.776   -6.649  -18.544 1.00 0.00 ? 2  ASP A H    9  
ATOM 11343 H HA   . ASP A 1 2  ? -0.051  -3.996  -17.602 1.00 0.00 ? 2  ASP A HA   9  
ATOM 11344 H HB2  . ASP A 1 2  ? 1.522   -3.996  -19.482 1.00 0.00 ? 2  ASP A HB2  9  
ATOM 11345 H HB3  . ASP A 1 2  ? 0.415   -4.991  -20.424 1.00 0.00 ? 2  ASP A HB3  9  
ATOM 11346 N N    . ARG A 1 3  ? -2.432  -4.620  -17.618 1.00 0.00 ? 3  ARG A N    9  
ATOM 11347 C CA   . ARG A 1 3  ? -3.881  -4.665  -17.742 1.00 0.00 ? 3  ARG A CA   9  
ATOM 11348 C C    . ARG A 1 3  ? -4.468  -3.357  -17.232 1.00 0.00 ? 3  ARG A C    9  
ATOM 11349 O O    . ARG A 1 3  ? -3.833  -2.663  -16.434 1.00 0.00 ? 3  ARG A O    9  
ATOM 11350 C CB   . ARG A 1 3  ? -4.475  -5.866  -16.990 1.00 0.00 ? 3  ARG A CB   9  
ATOM 11351 C CG   . ARG A 1 3  ? -3.917  -6.077  -15.589 1.00 0.00 ? 3  ARG A CG   9  
ATOM 11352 C CD   . ARG A 1 3  ? -4.662  -7.182  -14.851 1.00 0.00 ? 3  ARG A CD   9  
ATOM 11353 N NE   . ARG A 1 3  ? -4.769  -8.407  -15.649 1.00 0.00 ? 3  ARG A NE   9  
ATOM 11354 C CZ   . ARG A 1 3  ? -5.546  -9.443  -15.324 1.00 0.00 ? 3  ARG A CZ   9  
ATOM 11355 N NH1  . ARG A 1 3  ? -6.219  -9.434  -14.182 1.00 0.00 ? 3  ARG A NH1  9  
ATOM 11356 N NH2  . ARG A 1 3  ? -5.638  -10.490 -16.133 1.00 0.00 ? 3  ARG A NH2  9  
ATOM 11357 H H    . ARG A 1 3  ? -2.039  -4.262  -16.798 1.00 0.00 ? 3  ARG A H    9  
ATOM 11358 H HA   . ARG A 1 3  ? -4.114  -4.759  -18.793 1.00 0.00 ? 3  ARG A HA   9  
ATOM 11359 H HB2  . ARG A 1 3  ? -5.542  -5.724  -16.910 1.00 0.00 ? 3  ARG A HB2  9  
ATOM 11360 H HB3  . ARG A 1 3  ? -4.287  -6.761  -17.566 1.00 0.00 ? 3  ARG A HB3  9  
ATOM 11361 H HG2  . ARG A 1 3  ? -2.874  -6.348  -15.663 1.00 0.00 ? 3  ARG A HG2  9  
ATOM 11362 H HG3  . ARG A 1 3  ? -4.012  -5.156  -15.032 1.00 0.00 ? 3  ARG A HG3  9  
ATOM 11363 H HD2  . ARG A 1 3  ? -4.132  -7.409  -13.938 1.00 0.00 ? 3  ARG A HD2  9  
ATOM 11364 H HD3  . ARG A 1 3  ? -5.655  -6.832  -14.611 1.00 0.00 ? 3  ARG A HD3  9  
ATOM 11365 H HE   . ARG A 1 3  ? -4.247  -8.448  -16.485 1.00 0.00 ? 3  ARG A HE   9  
ATOM 11366 H HH11 . ARG A 1 3  ? -6.143  -8.656  -13.562 1.00 0.00 ? 3  ARG A HH11 9  
ATOM 11367 H HH12 . ARG A 1 3  ? -6.812  -10.215 -13.935 1.00 0.00 ? 3  ARG A HH12 9  
ATOM 11368 H HH21 . ARG A 1 3  ? -5.121  -10.512 -17.002 1.00 0.00 ? 3  ARG A HH21 9  
ATOM 11369 H HH22 . ARG A 1 3  ? -6.233  -11.270 -15.890 1.00 0.00 ? 3  ARG A HH22 9  
ATOM 11370 N N    . VAL A 1 4  ? -5.664  -3.022  -17.689 1.00 0.00 ? 4  VAL A N    9  
ATOM 11371 C CA   . VAL A 1 4  ? -6.277  -1.739  -17.359 1.00 0.00 ? 4  VAL A CA   9  
ATOM 11372 C C    . VAL A 1 4  ? -6.676  -1.680  -15.881 1.00 0.00 ? 4  VAL A C    9  
ATOM 11373 O O    . VAL A 1 4  ? -7.006  -2.698  -15.274 1.00 0.00 ? 4  VAL A O    9  
ATOM 11374 C CB   . VAL A 1 4  ? -7.520  -1.473  -18.236 1.00 0.00 ? 4  VAL A CB   9  
ATOM 11375 C CG1  . VAL A 1 4  ? -7.996  -0.036  -18.087 1.00 0.00 ? 4  VAL A CG1  9  
ATOM 11376 C CG2  . VAL A 1 4  ? -7.231  -1.793  -19.696 1.00 0.00 ? 4  VAL A CG2  9  
ATOM 11377 H H    . VAL A 1 4  ? -6.156  -3.658  -18.260 1.00 0.00 ? 4  VAL A H    9  
ATOM 11378 H HA   . VAL A 1 4  ? -5.553  -0.962  -17.556 1.00 0.00 ? 4  VAL A HA   9  
ATOM 11379 H HB   . VAL A 1 4  ? -8.311  -2.123  -17.897 1.00 0.00 ? 4  VAL A HB   9  
ATOM 11380 H HG11 . VAL A 1 4  ? -7.197  0.637   -18.366 1.00 0.00 ? 4  VAL A HG11 9  
ATOM 11381 H HG12 . VAL A 1 4  ? -8.278  0.147   -17.060 1.00 0.00 ? 4  VAL A HG12 9  
ATOM 11382 H HG13 . VAL A 1 4  ? -8.848  0.130   -18.730 1.00 0.00 ? 4  VAL A HG13 9  
ATOM 11383 H HG21 . VAL A 1 4  ? -6.973  -2.837  -19.793 1.00 0.00 ? 4  VAL A HG21 9  
ATOM 11384 H HG22 . VAL A 1 4  ? -6.408  -1.186  -20.041 1.00 0.00 ? 4  VAL A HG22 9  
ATOM 11385 H HG23 . VAL A 1 4  ? -8.108  -1.582  -20.291 1.00 0.00 ? 4  VAL A HG23 9  
ATOM 11386 N N    . LYS A 1 5  ? -6.621  -0.482  -15.310 1.00 0.00 ? 5  LYS A N    9  
ATOM 11387 C CA   . LYS A 1 5  ? -7.012  -0.260  -13.923 1.00 0.00 ? 5  LYS A CA   9  
ATOM 11388 C C    . LYS A 1 5  ? -8.150  0.752   -13.885 1.00 0.00 ? 5  LYS A C    9  
ATOM 11389 O O    . LYS A 1 5  ? -8.075  1.788   -14.549 1.00 0.00 ? 5  LYS A O    9  
ATOM 11390 C CB   . LYS A 1 5  ? -5.845  0.280   -13.081 1.00 0.00 ? 5  LYS A CB   9  
ATOM 11391 C CG   . LYS A 1 5  ? -4.537  -0.489  -13.208 1.00 0.00 ? 5  LYS A CG   9  
ATOM 11392 C CD   . LYS A 1 5  ? -3.674  0.052   -14.340 1.00 0.00 ? 5  LYS A CD   9  
ATOM 11393 C CE   . LYS A 1 5  ? -2.257  -0.497  -14.278 1.00 0.00 ? 5  LYS A CE   9  
ATOM 11394 N NZ   . LYS A 1 5  ? -2.218  -1.974  -14.442 1.00 0.00 ? 5  LYS A NZ   9  
ATOM 11395 H H    . LYS A 1 5  ? -6.336  0.284   -15.846 1.00 0.00 ? 5  LYS A H    9  
ATOM 11396 H HA   . LYS A 1 5  ? -7.355  -1.198  -13.509 1.00 0.00 ? 5  LYS A HA   9  
ATOM 11397 H HB2  . LYS A 1 5  ? -5.657  1.302   -13.372 1.00 0.00 ? 5  LYS A HB2  9  
ATOM 11398 H HB3  . LYS A 1 5  ? -6.140  0.268   -12.041 1.00 0.00 ? 5  LYS A HB3  9  
ATOM 11399 H HG2  . LYS A 1 5  ? -3.989  -0.404  -12.281 1.00 0.00 ? 5  LYS A HG2  9  
ATOM 11400 H HG3  . LYS A 1 5  ? -4.759  -1.528  -13.403 1.00 0.00 ? 5  LYS A HG3  9  
ATOM 11401 H HD2  . LYS A 1 5  ? -4.117  -0.231  -15.285 1.00 0.00 ? 5  LYS A HD2  9  
ATOM 11402 H HD3  . LYS A 1 5  ? -3.636  1.130   -14.267 1.00 0.00 ? 5  LYS A HD3  9  
ATOM 11403 H HE2  . LYS A 1 5  ? -1.675  -0.044  -15.064 1.00 0.00 ? 5  LYS A HE2  9  
ATOM 11404 H HE3  . LYS A 1 5  ? -1.828  -0.240  -13.321 1.00 0.00 ? 5  LYS A HE3  9  
ATOM 11405 H HZ1  . LYS A 1 5  ? -1.230  -2.315  -14.400 1.00 0.00 ? 5  LYS A HZ1  9  
ATOM 11406 H HZ2  . LYS A 1 5  ? -2.626  -2.241  -15.365 1.00 0.00 ? 5  LYS A HZ2  9  
ATOM 11407 H HZ3  . LYS A 1 5  ? -2.762  -2.433  -13.689 1.00 0.00 ? 5  LYS A HZ3  9  
ATOM 11408 N N    . ARG A 1 6  ? -9.199  0.464   -13.130 1.00 0.00 ? 6  ARG A N    9  
ATOM 11409 C CA   . ARG A 1 6  ? -10.323 1.384   -13.041 1.00 0.00 ? 6  ARG A CA   9  
ATOM 11410 C C    . ARG A 1 6  ? -10.397 2.036   -11.662 1.00 0.00 ? 6  ARG A C    9  
ATOM 11411 O O    . ARG A 1 6  ? -10.035 1.427   -10.650 1.00 0.00 ? 6  ARG A O    9  
ATOM 11412 C CB   . ARG A 1 6  ? -11.648 0.683   -13.352 1.00 0.00 ? 6  ARG A CB   9  
ATOM 11413 C CG   . ARG A 1 6  ? -12.045 -0.391  -12.350 1.00 0.00 ? 6  ARG A CG   9  
ATOM 11414 C CD   . ARG A 1 6  ? -13.555 -0.497  -12.247 1.00 0.00 ? 6  ARG A CD   9  
ATOM 11415 N NE   . ARG A 1 6  ? -14.143 0.758   -11.772 1.00 0.00 ? 6  ARG A NE   9  
ATOM 11416 C CZ   . ARG A 1 6  ? -15.314 1.242   -12.180 1.00 0.00 ? 6  ARG A CZ   9  
ATOM 11417 N NH1  . ARG A 1 6  ? -16.051 0.576   -13.060 1.00 0.00 ? 6  ARG A NH1  9  
ATOM 11418 N NH2  . ARG A 1 6  ? -15.746 2.405   -11.710 1.00 0.00 ? 6  ARG A NH2  9  
ATOM 11419 H H    . ARG A 1 6  ? -9.211  -0.375  -12.611 1.00 0.00 ? 6  ARG A H    9  
ATOM 11420 H HA   . ARG A 1 6  ? -10.163 2.159   -13.776 1.00 0.00 ? 6  ARG A HA   9  
ATOM 11421 H HB2  . ARG A 1 6  ? -12.433 1.423   -13.372 1.00 0.00 ? 6  ARG A HB2  9  
ATOM 11422 H HB3  . ARG A 1 6  ? -11.577 0.224   -14.327 1.00 0.00 ? 6  ARG A HB3  9  
ATOM 11423 H HG2  . ARG A 1 6  ? -11.646 -1.342  -12.671 1.00 0.00 ? 6  ARG A HG2  9  
ATOM 11424 H HG3  . ARG A 1 6  ? -11.642 -0.135  -11.380 1.00 0.00 ? 6  ARG A HG3  9  
ATOM 11425 H HD2  . ARG A 1 6  ? -13.957 -0.728  -13.224 1.00 0.00 ? 6  ARG A HD2  9  
ATOM 11426 H HD3  . ARG A 1 6  ? -13.804 -1.289  -11.556 1.00 0.00 ? 6  ARG A HD3  9  
ATOM 11427 H HE   . ARG A 1 6  ? -13.623 1.276   -11.113 1.00 0.00 ? 6  ARG A HE   9  
ATOM 11428 H HH11 . ARG A 1 6  ? -15.731 -0.303  -13.428 1.00 0.00 ? 6  ARG A HH11 9  
ATOM 11429 H HH12 . ARG A 1 6  ? -16.940 0.946   -13.357 1.00 0.00 ? 6  ARG A HH12 9  
ATOM 11430 H HH21 . ARG A 1 6  ? -15.194 2.917   -11.041 1.00 0.00 ? 6  ARG A HH21 9  
ATOM 11431 H HH22 . ARG A 1 6  ? -16.621 2.788   -12.026 1.00 0.00 ? 6  ARG A HH22 9  
ATOM 11432 N N    . PRO A 1 7  ? -10.862 3.294   -11.610 1.00 0.00 ? 7  PRO A N    9  
ATOM 11433 C CA   . PRO A 1 7  ? -11.109 4.004   -10.353 1.00 0.00 ? 7  PRO A CA   9  
ATOM 11434 C C    . PRO A 1 7  ? -12.341 3.456   -9.639  1.00 0.00 ? 7  PRO A C    9  
ATOM 11435 O O    . PRO A 1 7  ? -13.321 3.066   -10.280 1.00 0.00 ? 7  PRO A O    9  
ATOM 11436 C CB   . PRO A 1 7  ? -11.344 5.462   -10.788 1.00 0.00 ? 7  PRO A CB   9  
ATOM 11437 C CG   . PRO A 1 7  ? -10.957 5.518   -12.230 1.00 0.00 ? 7  PRO A CG   9  
ATOM 11438 C CD   . PRO A 1 7  ? -11.176 4.137   -12.769 1.00 0.00 ? 7  PRO A CD   9  
ATOM 11439 H HA   . PRO A 1 7  ? -10.254 3.951   -9.691  1.00 0.00 ? 7  PRO A HA   9  
ATOM 11440 H HB2  . PRO A 1 7  ? -12.386 5.714   -10.652 1.00 0.00 ? 7  PRO A HB2  9  
ATOM 11441 H HB3  . PRO A 1 7  ? -10.731 6.120   -10.191 1.00 0.00 ? 7  PRO A HB3  9  
ATOM 11442 H HG2  . PRO A 1 7  ? -11.579 6.229   -12.752 1.00 0.00 ? 7  PRO A HG2  9  
ATOM 11443 H HG3  . PRO A 1 7  ? -9.916  5.794   -12.320 1.00 0.00 ? 7  PRO A HG3  9  
ATOM 11444 H HD2  . PRO A 1 7  ? -12.202 4.007   -13.078 1.00 0.00 ? 7  PRO A HD2  9  
ATOM 11445 H HD3  . PRO A 1 7  ? -10.501 3.935   -13.588 1.00 0.00 ? 7  PRO A HD3  9  
ATOM 11446 N N    . MET A 1 8  ? -12.282 3.402   -8.319  1.00 0.00 ? 8  MET A N    9  
ATOM 11447 C CA   . MET A 1 8  ? -13.370 2.850   -7.528  1.00 0.00 ? 8  MET A CA   9  
ATOM 11448 C C    . MET A 1 8  ? -13.429 3.563   -6.181  1.00 0.00 ? 8  MET A C    9  
ATOM 11449 O O    . MET A 1 8  ? -12.550 4.365   -5.875  1.00 0.00 ? 8  MET A O    9  
ATOM 11450 C CB   . MET A 1 8  ? -13.188 1.337   -7.354  1.00 0.00 ? 8  MET A CB   9  
ATOM 11451 C CG   . MET A 1 8  ? -14.491 0.591   -7.098  1.00 0.00 ? 8  MET A CG   9  
ATOM 11452 S SD   . MET A 1 8  ? -14.312 -1.196  -7.263  1.00 0.00 ? 8  MET A SD   9  
ATOM 11453 C CE   . MET A 1 8  ? -16.005 -1.724  -7.007  1.00 0.00 ? 8  MET A CE   9  
ATOM 11454 H H    . MET A 1 8  ? -11.495 3.761   -7.857  1.00 0.00 ? 8  MET A H    9  
ATOM 11455 H HA   . MET A 1 8  ? -14.294 3.035   -8.058  1.00 0.00 ? 8  MET A HA   9  
ATOM 11456 H HB2  . MET A 1 8  ? -12.741 0.935   -8.250  1.00 0.00 ? 8  MET A HB2  9  
ATOM 11457 H HB3  . MET A 1 8  ? -12.526 1.159   -6.520  1.00 0.00 ? 8  MET A HB3  9  
ATOM 11458 H HG2  . MET A 1 8  ? -14.827 0.813   -6.096  1.00 0.00 ? 8  MET A HG2  9  
ATOM 11459 H HG3  . MET A 1 8  ? -15.231 0.932   -7.808  1.00 0.00 ? 8  MET A HG3  9  
ATOM 11460 H HE1  . MET A 1 8  ? -16.340 -1.402  -6.032  1.00 0.00 ? 8  MET A HE1  9  
ATOM 11461 H HE2  . MET A 1 8  ? -16.059 -2.800  -7.069  1.00 0.00 ? 8  MET A HE2  9  
ATOM 11462 H HE3  . MET A 1 8  ? -16.636 -1.287  -7.767  1.00 0.00 ? 8  MET A HE3  9  
ATOM 11463 N N    . ASN A 1 9  ? -14.481 3.314   -5.413  1.00 0.00 ? 9  ASN A N    9  
ATOM 11464 C CA   . ASN A 1 9  ? -14.652 3.932   -4.101  1.00 0.00 ? 9  ASN A CA   9  
ATOM 11465 C C    . ASN A 1 9  ? -13.519 3.557   -3.140  1.00 0.00 ? 9  ASN A C    9  
ATOM 11466 O O    . ASN A 1 9  ? -12.851 2.529   -3.309  1.00 0.00 ? 9  ASN A O    9  
ATOM 11467 C CB   . ASN A 1 9  ? -16.004 3.525   -3.510  1.00 0.00 ? 9  ASN A CB   9  
ATOM 11468 C CG   . ASN A 1 9  ? -16.166 2.019   -3.422  1.00 0.00 ? 9  ASN A CG   9  
ATOM 11469 O OD1  . ASN A 1 9  ? -16.533 1.367   -4.399  1.00 0.00 ? 9  ASN A OD1  9  
ATOM 11470 N ND2  . ASN A 1 9  ? -15.930 1.465   -2.246  1.00 0.00 ? 9  ASN A ND2  9  
ATOM 11471 H H    . ASN A 1 9  ? -15.164 2.693   -5.730  1.00 0.00 ? 9  ASN A H    9  
ATOM 11472 H HA   . ASN A 1 9  ? -14.643 5.002   -4.241  1.00 0.00 ? 9  ASN A HA   9  
ATOM 11473 H HB2  . ASN A 1 9  ? -16.095 3.936   -2.516  1.00 0.00 ? 9  ASN A HB2  9  
ATOM 11474 H HB3  . ASN A 1 9  ? -16.793 3.917   -4.128  1.00 0.00 ? 9  ASN A HB3  9  
ATOM 11475 H HD21 . ASN A 1 9  ? -15.670 2.054   -1.504  1.00 0.00 ? 9  ASN A HD21 9  
ATOM 11476 H HD22 . ASN A 1 9  ? -16.023 0.492   -2.164  1.00 0.00 ? 9  ASN A HD22 9  
ATOM 11477 N N    . ALA A 1 10 ? -13.342 4.399   -2.121  1.00 0.00 ? 10 ALA A N    9  
ATOM 11478 C CA   . ALA A 1 10 ? -12.256 4.297   -1.148  1.00 0.00 ? 10 ALA A CA   9  
ATOM 11479 C C    . ALA A 1 10 ? -12.004 2.886   -0.597  1.00 0.00 ? 10 ALA A C    9  
ATOM 11480 O O    . ALA A 1 10 ? -10.847 2.510   -0.425  1.00 0.00 ? 10 ALA A O    9  
ATOM 11481 C CB   . ALA A 1 10 ? -12.546 5.243   0.004   1.00 0.00 ? 10 ALA A CB   9  
ATOM 11482 H H    . ALA A 1 10 ? -13.937 5.171   -2.052  1.00 0.00 ? 10 ALA A H    9  
ATOM 11483 H HA   . ALA A 1 10 ? -11.353 4.643   -1.628  1.00 0.00 ? 10 ALA A HA   9  
ATOM 11484 H HB1  . ALA A 1 10 ? -13.526 5.028   0.407   1.00 0.00 ? 10 ALA A HB1  9  
ATOM 11485 H HB2  . ALA A 1 10 ? -12.515 6.263   -0.348  1.00 0.00 ? 10 ALA A HB2  9  
ATOM 11486 H HB3  . ALA A 1 10 ? -11.807 5.105   0.776   1.00 0.00 ? 10 ALA A HB3  9  
ATOM 11487 N N    . PHE A 1 11 ? -13.050 2.108   -0.305  1.00 0.00 ? 11 PHE A N    9  
ATOM 11488 C CA   . PHE A 1 11 ? -12.849 0.773   0.278   1.00 0.00 ? 11 PHE A CA   9  
ATOM 11489 C C    . PHE A 1 11 ? -11.934 -0.084  -0.598  1.00 0.00 ? 11 PHE A C    9  
ATOM 11490 O O    . PHE A 1 11 ? -10.939 -0.641  -0.122  1.00 0.00 ? 11 PHE A O    9  
ATOM 11491 C CB   . PHE A 1 11 ? -14.183 0.047   0.487   1.00 0.00 ? 11 PHE A CB   9  
ATOM 11492 C CG   . PHE A 1 11 ? -14.013 -1.368  0.977   1.00 0.00 ? 11 PHE A CG   9  
ATOM 11493 C CD1  . PHE A 1 11 ? -13.610 -1.623  2.279   1.00 0.00 ? 11 PHE A CD1  9  
ATOM 11494 C CD2  . PHE A 1 11 ? -14.241 -2.442  0.131   1.00 0.00 ? 11 PHE A CD2  9  
ATOM 11495 C CE1  . PHE A 1 11 ? -13.438 -2.918  2.728   1.00 0.00 ? 11 PHE A CE1  9  
ATOM 11496 C CE2  . PHE A 1 11 ? -14.068 -3.739  0.574   1.00 0.00 ? 11 PHE A CE2  9  
ATOM 11497 C CZ   . PHE A 1 11 ? -13.667 -3.977  1.874   1.00 0.00 ? 11 PHE A CZ   9  
ATOM 11498 H H    . PHE A 1 11 ? -13.960 2.435   -0.471  1.00 0.00 ? 11 PHE A H    9  
ATOM 11499 H HA   . PHE A 1 11 ? -12.375 0.906   1.237   1.00 0.00 ? 11 PHE A HA   9  
ATOM 11500 H HB2  . PHE A 1 11 ? -14.770 0.585   1.216   1.00 0.00 ? 11 PHE A HB2  9  
ATOM 11501 H HB3  . PHE A 1 11 ? -14.721 0.014   -0.448  1.00 0.00 ? 11 PHE A HB3  9  
ATOM 11502 H HD1  . PHE A 1 11 ? -13.430 -0.794  2.948   1.00 0.00 ? 11 PHE A HD1  9  
ATOM 11503 H HD2  . PHE A 1 11 ? -14.556 -2.258  -0.885  1.00 0.00 ? 11 PHE A HD2  9  
ATOM 11504 H HE1  . PHE A 1 11 ? -13.125 -3.101  3.745   1.00 0.00 ? 11 PHE A HE1  9  
ATOM 11505 H HE2  . PHE A 1 11 ? -14.250 -4.566  -0.096  1.00 0.00 ? 11 PHE A HE2  9  
ATOM 11506 H HZ   . PHE A 1 11 ? -13.530 -4.990  2.222   1.00 0.00 ? 11 PHE A HZ   9  
ATOM 11507 N N    . MET A 1 12 ? -12.253 -0.160  -1.881  1.00 0.00 ? 12 MET A N    9  
ATOM 11508 C CA   . MET A 1 12 ? -11.435 -0.923  -2.812  1.00 0.00 ? 12 MET A CA   9  
ATOM 11509 C C    . MET A 1 12 ? -10.102 -0.222  -3.009  1.00 0.00 ? 12 MET A C    9  
ATOM 11510 O O    . MET A 1 12 ? -9.057  -0.863  -3.104  1.00 0.00 ? 12 MET A O    9  
ATOM 11511 C CB   . MET A 1 12 ? -12.149 -1.111  -4.156  1.00 0.00 ? 12 MET A CB   9  
ATOM 11512 C CG   . MET A 1 12 ? -13.348 -2.051  -4.095  1.00 0.00 ? 12 MET A CG   9  
ATOM 11513 S SD   . MET A 1 12 ? -14.728 -1.394  -3.134  1.00 0.00 ? 12 MET A SD   9  
ATOM 11514 C CE   . MET A 1 12 ? -15.930 -2.710  -3.325  1.00 0.00 ? 12 MET A CE   9  
ATOM 11515 H H    . MET A 1 12 ? -13.052 0.307   -2.208  1.00 0.00 ? 12 MET A H    9  
ATOM 11516 H HA   . MET A 1 12 ? -11.255 -1.893  -2.370  1.00 0.00 ? 12 MET A HA   9  
ATOM 11517 H HB2  . MET A 1 12 ? -12.492 -0.149  -4.504  1.00 0.00 ? 12 MET A HB2  9  
ATOM 11518 H HB3  . MET A 1 12 ? -11.445 -1.511  -4.870  1.00 0.00 ? 12 MET A HB3  9  
ATOM 11519 H HG2  . MET A 1 12 ? -13.691 -2.235  -5.103  1.00 0.00 ? 12 MET A HG2  9  
ATOM 11520 H HG3  . MET A 1 12 ? -13.031 -2.984  -3.651  1.00 0.00 ? 12 MET A HG3  9  
ATOM 11521 H HE1  . MET A 1 12 ? -16.151 -2.847  -4.374  1.00 0.00 ? 12 MET A HE1  9  
ATOM 11522 H HE2  . MET A 1 12 ? -16.837 -2.449  -2.798  1.00 0.00 ? 12 MET A HE2  9  
ATOM 11523 H HE3  . MET A 1 12 ? -15.530 -3.627  -2.919  1.00 0.00 ? 12 MET A HE3  9  
ATOM 11524 N N    . VAL A 1 13 ? -10.155 1.102   -3.024  1.00 0.00 ? 13 VAL A N    9  
ATOM 11525 C CA   . VAL A 1 13 ? -8.972  1.936   -3.165  1.00 0.00 ? 13 VAL A CA   9  
ATOM 11526 C C    . VAL A 1 13 ? -7.912  1.563   -2.150  1.00 0.00 ? 13 VAL A C    9  
ATOM 11527 O O    . VAL A 1 13 ? -6.777  1.283   -2.513  1.00 0.00 ? 13 VAL A O    9  
ATOM 11528 C CB   . VAL A 1 13 ? -9.310  3.428   -2.988  1.00 0.00 ? 13 VAL A CB   9  
ATOM 11529 C CG1  . VAL A 1 13 ? -8.044  4.256   -2.898  1.00 0.00 ? 13 VAL A CG1  9  
ATOM 11530 C CG2  . VAL A 1 13 ? -10.174 3.916   -4.132  1.00 0.00 ? 13 VAL A CG2  9  
ATOM 11531 H H    . VAL A 1 13 ? -11.022 1.532   -2.932  1.00 0.00 ? 13 VAL A H    9  
ATOM 11532 H HA   . VAL A 1 13 ? -8.574  1.792   -4.157  1.00 0.00 ? 13 VAL A HA   9  
ATOM 11533 H HB   . VAL A 1 13 ? -9.864  3.550   -2.060  1.00 0.00 ? 13 VAL A HB   9  
ATOM 11534 H HG11 . VAL A 1 13 ? -8.301  5.299   -2.778  1.00 0.00 ? 13 VAL A HG11 9  
ATOM 11535 H HG12 . VAL A 1 13 ? -7.465  4.129   -3.800  1.00 0.00 ? 13 VAL A HG12 9  
ATOM 11536 H HG13 . VAL A 1 13 ? -7.460  3.931   -2.049  1.00 0.00 ? 13 VAL A HG13 9  
ATOM 11537 H HG21 . VAL A 1 13 ? -9.663  3.747   -5.068  1.00 0.00 ? 13 VAL A HG21 9  
ATOM 11538 H HG22 . VAL A 1 13 ? -10.364 4.972   -4.012  1.00 0.00 ? 13 VAL A HG22 9  
ATOM 11539 H HG23 . VAL A 1 13 ? -11.111 3.380   -4.130  1.00 0.00 ? 13 VAL A HG23 9  
ATOM 11540 N N    . TRP A 1 14 ? -8.289  1.553   -0.882  1.00 0.00 ? 14 TRP A N    9  
ATOM 11541 C CA   . TRP A 1 14 ? -7.352  1.253   0.181   1.00 0.00 ? 14 TRP A CA   9  
ATOM 11542 C C    . TRP A 1 14 ? -6.876  -0.183  0.066   1.00 0.00 ? 14 TRP A C    9  
ATOM 11543 O O    . TRP A 1 14 ? -5.747  -0.498  0.429   1.00 0.00 ? 14 TRP A O    9  
ATOM 11544 C CB   . TRP A 1 14 ? -7.998  1.486   1.540   1.00 0.00 ? 14 TRP A CB   9  
ATOM 11545 C CG   . TRP A 1 14 ? -7.012  1.729   2.643   1.00 0.00 ? 14 TRP A CG   9  
ATOM 11546 C CD1  . TRP A 1 14 ? -6.010  2.657   2.655   1.00 0.00 ? 14 TRP A CD1  9  
ATOM 11547 C CD2  . TRP A 1 14 ? -6.951  1.057   3.908   1.00 0.00 ? 14 TRP A CD2  9  
ATOM 11548 N NE1  . TRP A 1 14 ? -5.322  2.591   3.841   1.00 0.00 ? 14 TRP A NE1  9  
ATOM 11549 C CE2  . TRP A 1 14 ? -5.882  1.620   4.626   1.00 0.00 ? 14 TRP A CE2  9  
ATOM 11550 C CE3  . TRP A 1 14 ? -7.695  0.032   4.501   1.00 0.00 ? 14 TRP A CE3  9  
ATOM 11551 C CZ2  . TRP A 1 14 ? -5.537  1.195   5.904   1.00 0.00 ? 14 TRP A CZ2  9  
ATOM 11552 C CZ3  . TRP A 1 14 ? -7.351  -0.388  5.771   1.00 0.00 ? 14 TRP A CZ3  9  
ATOM 11553 C CH2  . TRP A 1 14 ? -6.281  0.195   6.461   1.00 0.00 ? 14 TRP A CH2  9  
ATOM 11554 H H    . TRP A 1 14 ? -9.226  1.756   -0.655  1.00 0.00 ? 14 TRP A H    9  
ATOM 11555 H HA   . TRP A 1 14 ? -6.505  1.912   0.076   1.00 0.00 ? 14 TRP A HA   9  
ATOM 11556 H HB2  . TRP A 1 14 ? -8.647  2.347   1.476   1.00 0.00 ? 14 TRP A HB2  9  
ATOM 11557 H HB3  . TRP A 1 14 ? -8.585  0.618   1.802   1.00 0.00 ? 14 TRP A HB3  9  
ATOM 11558 H HD1  . TRP A 1 14 ? -5.794  3.332   1.841   1.00 0.00 ? 14 TRP A HD1  9  
ATOM 11559 H HE1  . TRP A 1 14 ? -4.555  3.151   4.088   1.00 0.00 ? 14 TRP A HE1  9  
ATOM 11560 H HE3  . TRP A 1 14 ? -8.523  -0.429  3.985   1.00 0.00 ? 14 TRP A HE3  9  
ATOM 11561 H HZ2  . TRP A 1 14 ? -4.714  1.635   6.448   1.00 0.00 ? 14 TRP A HZ2  9  
ATOM 11562 H HZ3  . TRP A 1 14 ? -7.912  -1.176  6.246   1.00 0.00 ? 14 TRP A HZ3  9  
ATOM 11563 H HH2  . TRP A 1 14 ? -6.045  -0.163  7.452   1.00 0.00 ? 14 TRP A HH2  9  
ATOM 11564 N N    . SER A 1 15 ? -7.733  -1.046  -0.467  1.00 0.00 ? 15 SER A N    9  
ATOM 11565 C CA   . SER A 1 15 ? -7.381  -2.441  -0.640  1.00 0.00 ? 15 SER A CA   9  
ATOM 11566 C C    . SER A 1 15 ? -6.152  -2.571  -1.544  1.00 0.00 ? 15 SER A C    9  
ATOM 11567 O O    . SER A 1 15 ? -5.106  -3.068  -1.114  1.00 0.00 ? 15 SER A O    9  
ATOM 11568 C CB   . SER A 1 15 ? -8.572  -3.209  -1.223  1.00 0.00 ? 15 SER A CB   9  
ATOM 11569 O OG   . SER A 1 15 ? -8.269  -4.578  -1.431  1.00 0.00 ? 15 SER A OG   9  
ATOM 11570 H H    . SER A 1 15 ? -8.625  -0.734  -0.751  1.00 0.00 ? 15 SER A H    9  
ATOM 11571 H HA   . SER A 1 15 ? -7.143  -2.846  0.332   1.00 0.00 ? 15 SER A HA   9  
ATOM 11572 H HB2  . SER A 1 15 ? -9.406  -3.143  -0.541  1.00 0.00 ? 15 SER A HB2  9  
ATOM 11573 H HB3  . SER A 1 15 ? -8.850  -2.768  -2.169  1.00 0.00 ? 15 SER A HB3  9  
ATOM 11574 H HG   . SER A 1 15 ? -9.034  -5.011  -1.836  1.00 0.00 ? 15 SER A HG   9  
ATOM 11575 N N    . ARG A 1 16 ? -6.249  -2.077  -2.779  1.00 0.00 ? 16 ARG A N    9  
ATOM 11576 C CA   . ARG A 1 16 ? -5.113  -2.179  -3.695  1.00 0.00 ? 16 ARG A CA   9  
ATOM 11577 C C    . ARG A 1 16 ? -4.067  -1.103  -3.414  1.00 0.00 ? 16 ARG A C    9  
ATOM 11578 O O    . ARG A 1 16 ? -2.888  -1.291  -3.691  1.00 0.00 ? 16 ARG A O    9  
ATOM 11579 C CB   . ARG A 1 16 ? -5.534  -2.156  -5.176  1.00 0.00 ? 16 ARG A CB   9  
ATOM 11580 C CG   . ARG A 1 16 ? -6.344  -0.946  -5.620  1.00 0.00 ? 16 ARG A CG   9  
ATOM 11581 C CD   . ARG A 1 16 ? -7.817  -1.294  -5.721  1.00 0.00 ? 16 ARG A CD   9  
ATOM 11582 N NE   . ARG A 1 16 ? -8.468  -0.660  -6.868  1.00 0.00 ? 16 ARG A NE   9  
ATOM 11583 C CZ   . ARG A 1 16 ? -9.551  -1.163  -7.464  1.00 0.00 ? 16 ARG A CZ   9  
ATOM 11584 N NH1  . ARG A 1 16 ? -10.111 -2.271  -6.995  1.00 0.00 ? 16 ARG A NH1  9  
ATOM 11585 N NH2  . ARG A 1 16 ? -10.075 -0.569  -8.530  1.00 0.00 ? 16 ARG A NH2  9  
ATOM 11586 H H    . ARG A 1 16 ? -7.083  -1.626  -3.063  1.00 0.00 ? 16 ARG A H    9  
ATOM 11587 H HA   . ARG A 1 16 ? -4.648  -3.136  -3.497  1.00 0.00 ? 16 ARG A HA   9  
ATOM 11588 H HB2  . ARG A 1 16 ? -4.642  -2.194  -5.783  1.00 0.00 ? 16 ARG A HB2  9  
ATOM 11589 H HB3  . ARG A 1 16 ? -6.121  -3.042  -5.376  1.00 0.00 ? 16 ARG A HB3  9  
ATOM 11590 H HG2  . ARG A 1 16 ? -6.219  -0.153  -4.897  1.00 0.00 ? 16 ARG A HG2  9  
ATOM 11591 H HG3  . ARG A 1 16 ? -5.992  -0.620  -6.587  1.00 0.00 ? 16 ARG A HG3  9  
ATOM 11592 H HD2  . ARG A 1 16 ? -7.911  -2.366  -5.815  1.00 0.00 ? 16 ARG A HD2  9  
ATOM 11593 H HD3  . ARG A 1 16 ? -8.311  -0.971  -4.815  1.00 0.00 ? 16 ARG A HD3  9  
ATOM 11594 H HE   . ARG A 1 16 ? -8.071  0.168   -7.213  1.00 0.00 ? 16 ARG A HE   9  
ATOM 11595 H HH11 . ARG A 1 16 ? -9.727  -2.734  -6.185  1.00 0.00 ? 16 ARG A HH11 9  
ATOM 11596 H HH12 . ARG A 1 16 ? -10.923 -2.656  -7.447  1.00 0.00 ? 16 ARG A HH12 9  
ATOM 11597 H HH21 . ARG A 1 16 ? -9.666  0.268   -8.903  1.00 0.00 ? 16 ARG A HH21 9  
ATOM 11598 H HH22 . ARG A 1 16 ? -10.892 -0.962  -8.972  1.00 0.00 ? 16 ARG A HH22 9  
ATOM 11599 N N    . GLY A 1 17 ? -4.504  0.011   -2.849  1.00 0.00 ? 17 GLY A N    9  
ATOM 11600 C CA   . GLY A 1 17 ? -3.616  1.135   -2.613  1.00 0.00 ? 17 GLY A CA   9  
ATOM 11601 C C    . GLY A 1 17 ? -2.704  0.932   -1.424  1.00 0.00 ? 17 GLY A C    9  
ATOM 11602 O O    . GLY A 1 17 ? -1.513  1.255   -1.482  1.00 0.00 ? 17 GLY A O    9  
ATOM 11603 H H    . GLY A 1 17 ? -5.451  0.082   -2.589  1.00 0.00 ? 17 GLY A H    9  
ATOM 11604 H HA2  . GLY A 1 17 ? -3.010  1.288   -3.493  1.00 0.00 ? 17 GLY A HA2  9  
ATOM 11605 H HA3  . GLY A 1 17 ? -4.214  2.020   -2.446  1.00 0.00 ? 17 GLY A HA3  9  
ATOM 11606 N N    . GLN A 1 18 ? -3.248  0.399   -0.342  1.00 0.00 ? 18 GLN A N    9  
ATOM 11607 C CA   . GLN A 1 18 ? -2.457  0.169   0.852   1.00 0.00 ? 18 GLN A CA   9  
ATOM 11608 C C    . GLN A 1 18 ? -1.600  -1.071  0.668   1.00 0.00 ? 18 GLN A C    9  
ATOM 11609 O O    . GLN A 1 18 ? -0.456  -1.111  1.107   1.00 0.00 ? 18 GLN A O    9  
ATOM 11610 C CB   . GLN A 1 18 ? -3.341  0.026   2.091   1.00 0.00 ? 18 GLN A CB   9  
ATOM 11611 C CG   . GLN A 1 18 ? -2.593  0.246   3.396   1.00 0.00 ? 18 GLN A CG   9  
ATOM 11612 C CD   . GLN A 1 18 ? -2.127  1.684   3.564   1.00 0.00 ? 18 GLN A CD   9  
ATOM 11613 O OE1  . GLN A 1 18 ? -1.879  2.393   2.586   1.00 0.00 ? 18 GLN A OE1  9  
ATOM 11614 N NE2  . GLN A 1 18 ? -2.010  2.129   4.803   1.00 0.00 ? 18 GLN A NE2  9  
ATOM 11615 H H    . GLN A 1 18 ? -4.202  0.156   -0.344  1.00 0.00 ? 18 GLN A H    9  
ATOM 11616 H HA   . GLN A 1 18 ? -1.805  1.020   0.983   1.00 0.00 ? 18 GLN A HA   9  
ATOM 11617 H HB2  . GLN A 1 18 ? -4.142  0.748   2.034   1.00 0.00 ? 18 GLN A HB2  9  
ATOM 11618 H HB3  . GLN A 1 18 ? -3.765  -0.969  2.106   1.00 0.00 ? 18 GLN A HB3  9  
ATOM 11619 H HG2  . GLN A 1 18 ? -3.244  -0.006  4.218   1.00 0.00 ? 18 GLN A HG2  9  
ATOM 11620 H HG3  . GLN A 1 18 ? -1.725  -0.401  3.412   1.00 0.00 ? 18 GLN A HG3  9  
ATOM 11621 H HE21 . GLN A 1 18 ? -2.234  1.521   5.539   1.00 0.00 ? 18 GLN A HE21 9  
ATOM 11622 H HE22 . GLN A 1 18 ? -1.680  3.048   4.937   1.00 0.00 ? 18 GLN A HE22 9  
ATOM 11623 N N    . ARG A 1 19 ? -2.153  -2.077  -0.007  1.00 0.00 ? 19 ARG A N    9  
ATOM 11624 C CA   . ARG A 1 19 ? -1.411  -3.298  -0.293  1.00 0.00 ? 19 ARG A CA   9  
ATOM 11625 C C    . ARG A 1 19 ? -0.245  -3.017  -1.241  1.00 0.00 ? 19 ARG A C    9  
ATOM 11626 O O    . ARG A 1 19 ? 0.808   -3.646  -1.144  1.00 0.00 ? 19 ARG A O    9  
ATOM 11627 C CB   . ARG A 1 19 ? -2.350  -4.356  -0.870  1.00 0.00 ? 19 ARG A CB   9  
ATOM 11628 C CG   . ARG A 1 19 ? -1.661  -5.632  -1.318  1.00 0.00 ? 19 ARG A CG   9  
ATOM 11629 C CD   . ARG A 1 19 ? -2.645  -6.788  -1.374  1.00 0.00 ? 19 ARG A CD   9  
ATOM 11630 N NE   . ARG A 1 19 ? -3.883  -6.433  -2.073  1.00 0.00 ? 19 ARG A NE   9  
ATOM 11631 C CZ   . ARG A 1 19 ? -5.094  -6.842  -1.690  1.00 0.00 ? 19 ARG A CZ   9  
ATOM 11632 N NH1  . ARG A 1 19 ? -5.226  -7.632  -0.631  1.00 0.00 ? 19 ARG A NH1  9  
ATOM 11633 N NH2  . ARG A 1 19 ? -6.172  -6.461  -2.366  1.00 0.00 ? 19 ARG A NH2  9  
ATOM 11634 H H    . ARG A 1 19 ? -3.089  -2.001  -0.312  1.00 0.00 ? 19 ARG A H    9  
ATOM 11635 H HA   . ARG A 1 19 ? -1.010  -3.662  0.641   1.00 0.00 ? 19 ARG A HA   9  
ATOM 11636 H HB2  . ARG A 1 19 ? -3.078  -4.617  -0.116  1.00 0.00 ? 19 ARG A HB2  9  
ATOM 11637 H HB3  . ARG A 1 19 ? -2.866  -3.934  -1.721  1.00 0.00 ? 19 ARG A HB3  9  
ATOM 11638 H HG2  . ARG A 1 19 ? -1.237  -5.480  -2.300  1.00 0.00 ? 19 ARG A HG2  9  
ATOM 11639 H HG3  . ARG A 1 19 ? -0.876  -5.870  -0.615  1.00 0.00 ? 19 ARG A HG3  9  
ATOM 11640 H HD2  . ARG A 1 19 ? -2.180  -7.615  -1.888  1.00 0.00 ? 19 ARG A HD2  9  
ATOM 11641 H HD3  . ARG A 1 19 ? -2.887  -7.083  -0.365  1.00 0.00 ? 19 ARG A HD3  9  
ATOM 11642 H HE   . ARG A 1 19 ? -3.804  -5.857  -2.862  1.00 0.00 ? 19 ARG A HE   9  
ATOM 11643 H HH11 . ARG A 1 19 ? -4.420  -7.924  -0.116  1.00 0.00 ? 19 ARG A HH11 9  
ATOM 11644 H HH12 . ARG A 1 19 ? -6.139  -7.951  -0.343  1.00 0.00 ? 19 ARG A HH12 9  
ATOM 11645 H HH21 . ARG A 1 19 ? -6.083  -5.871  -3.168  1.00 0.00 ? 19 ARG A HH21 9  
ATOM 11646 H HH22 . ARG A 1 19 ? -7.082  -6.753  -2.066  1.00 0.00 ? 19 ARG A HH22 9  
ATOM 11647 N N    . ARG A 1 20 ? -0.437  -2.061  -2.147  1.00 0.00 ? 20 ARG A N    9  
ATOM 11648 C CA   . ARG A 1 20 ? 0.631   -1.631  -3.051  1.00 0.00 ? 20 ARG A CA   9  
ATOM 11649 C C    . ARG A 1 20 ? 1.835   -1.120  -2.269  1.00 0.00 ? 20 ARG A C    9  
ATOM 11650 O O    . ARG A 1 20 ? 2.945   -1.635  -2.414  1.00 0.00 ? 20 ARG A O    9  
ATOM 11651 C CB   . ARG A 1 20 ? 0.133   -0.533  -3.991  1.00 0.00 ? 20 ARG A CB   9  
ATOM 11652 C CG   . ARG A 1 20 ? -0.264  -1.024  -5.375  1.00 0.00 ? 20 ARG A CG   9  
ATOM 11653 C CD   . ARG A 1 20 ? -0.988  0.062   -6.160  1.00 0.00 ? 20 ARG A CD   9  
ATOM 11654 N NE   . ARG A 1 20 ? -0.279  1.342   -6.108  1.00 0.00 ? 20 ARG A NE   9  
ATOM 11655 C CZ   . ARG A 1 20 ? -0.762  2.433   -5.509  1.00 0.00 ? 20 ARG A CZ   9  
ATOM 11656 N NH1  . ARG A 1 20 ? -1.971  2.411   -4.968  1.00 0.00 ? 20 ARG A NH1  9  
ATOM 11657 N NH2  . ARG A 1 20 ? -0.045  3.548   -5.460  1.00 0.00 ? 20 ARG A NH2  9  
ATOM 11658 H H    . ARG A 1 20 ? -1.319  -1.639  -2.216  1.00 0.00 ? 20 ARG A H    9  
ATOM 11659 H HA   . ARG A 1 20 ? 0.933   -2.485  -3.636  1.00 0.00 ? 20 ARG A HA   9  
ATOM 11660 H HB2  . ARG A 1 20 ? -0.726  -0.054  -3.544  1.00 0.00 ? 20 ARG A HB2  9  
ATOM 11661 H HB3  . ARG A 1 20 ? 0.917   0.200   -4.108  1.00 0.00 ? 20 ARG A HB3  9  
ATOM 11662 H HG2  . ARG A 1 20 ? 0.626   -1.310  -5.914  1.00 0.00 ? 20 ARG A HG2  9  
ATOM 11663 H HG3  . ARG A 1 20 ? -0.916  -1.877  -5.271  1.00 0.00 ? 20 ARG A HG3  9  
ATOM 11664 H HD2  . ARG A 1 20 ? -1.070  -0.251  -7.191  1.00 0.00 ? 20 ARG A HD2  9  
ATOM 11665 H HD3  . ARG A 1 20 ? -1.976  0.192   -5.745  1.00 0.00 ? 20 ARG A HD3  9  
ATOM 11666 H HE   . ARG A 1 20 ? 0.607   1.382   -6.526  1.00 0.00 ? 20 ARG A HE   9  
ATOM 11667 H HH11 . ARG A 1 20 ? -2.526  1.583   -5.009  1.00 0.00 ? 20 ARG A HH11 9  
ATOM 11668 H HH12 . ARG A 1 20 ? -2.332  3.235   -4.488  1.00 0.00 ? 20 ARG A HH12 9  
ATOM 11669 H HH21 . ARG A 1 20 ? 0.867   3.582   -5.871  1.00 0.00 ? 20 ARG A HH21 9  
ATOM 11670 H HH22 . ARG A 1 20 ? -0.416  4.360   -4.999  1.00 0.00 ? 20 ARG A HH22 9  
ATOM 11671 N N    . LYS A 1 21 ? 1.615   -0.114  -1.429  1.00 0.00 ? 21 LYS A N    9  
ATOM 11672 C CA   . LYS A 1 21 ? 2.708   0.461   -0.658  1.00 0.00 ? 21 LYS A CA   9  
ATOM 11673 C C    . LYS A 1 21 ? 3.201   -0.518  0.403   1.00 0.00 ? 21 LYS A C    9  
ATOM 11674 O O    . LYS A 1 21 ? 4.373   -0.504  0.758   1.00 0.00 ? 21 LYS A O    9  
ATOM 11675 C CB   . LYS A 1 21 ? 2.308   1.799   -0.026  1.00 0.00 ? 21 LYS A CB   9  
ATOM 11676 C CG   . LYS A 1 21 ? 1.201   1.703   1.010   1.00 0.00 ? 21 LYS A CG   9  
ATOM 11677 C CD   . LYS A 1 21 ? 0.998   3.031   1.725   1.00 0.00 ? 21 LYS A CD   9  
ATOM 11678 C CE   . LYS A 1 21 ? 0.503   4.112   0.778   1.00 0.00 ? 21 LYS A CE   9  
ATOM 11679 N NZ   . LYS A 1 21 ? -0.845  3.801   0.235   1.00 0.00 ? 21 LYS A NZ   9  
ATOM 11680 H H    . LYS A 1 21 ? 0.707   0.250   -1.333  1.00 0.00 ? 21 LYS A H    9  
ATOM 11681 H HA   . LYS A 1 21 ? 3.521   0.640   -1.346  1.00 0.00 ? 21 LYS A HA   9  
ATOM 11682 H HB2  . LYS A 1 21 ? 3.177   2.228   0.451   1.00 0.00 ? 21 LYS A HB2  9  
ATOM 11683 H HB3  . LYS A 1 21 ? 1.979   2.465   -0.811  1.00 0.00 ? 21 LYS A HB3  9  
ATOM 11684 H HG2  . LYS A 1 21 ? 0.280   1.427   0.516   1.00 0.00 ? 21 LYS A HG2  9  
ATOM 11685 H HG3  . LYS A 1 21 ? 1.463   0.947   1.736   1.00 0.00 ? 21 LYS A HG3  9  
ATOM 11686 H HD2  . LYS A 1 21 ? 0.270   2.897   2.513   1.00 0.00 ? 21 LYS A HD2  9  
ATOM 11687 H HD3  . LYS A 1 21 ? 1.939   3.343   2.154   1.00 0.00 ? 21 LYS A HD3  9  
ATOM 11688 H HE2  . LYS A 1 21 ? 0.460   5.050   1.310   1.00 0.00 ? 21 LYS A HE2  9  
ATOM 11689 H HE3  . LYS A 1 21 ? 1.201   4.197   -0.043  1.00 0.00 ? 21 LYS A HE3  9  
ATOM 11690 H HZ1  . LYS A 1 21 ? -0.830  2.894   -0.270  1.00 0.00 ? 21 LYS A HZ1  9  
ATOM 11691 H HZ2  . LYS A 1 21 ? -1.145  4.552   -0.431  1.00 0.00 ? 21 LYS A HZ2  9  
ATOM 11692 H HZ3  . LYS A 1 21 ? -1.537  3.740   1.010   1.00 0.00 ? 21 LYS A HZ3  9  
ATOM 11693 N N    . MET A 1 22 ? 2.309   -1.371  0.901   1.00 0.00 ? 22 MET A N    9  
ATOM 11694 C CA   . MET A 1 22 ? 2.684   -2.388  1.881   1.00 0.00 ? 22 MET A CA   9  
ATOM 11695 C C    . MET A 1 22 ? 3.786   -3.284  1.323   1.00 0.00 ? 22 MET A C    9  
ATOM 11696 O O    . MET A 1 22 ? 4.781   -3.555  1.999   1.00 0.00 ? 22 MET A O    9  
ATOM 11697 C CB   . MET A 1 22 ? 1.469   -3.237  2.266   1.00 0.00 ? 22 MET A CB   9  
ATOM 11698 C CG   . MET A 1 22 ? 1.747   -4.238  3.374   1.00 0.00 ? 22 MET A CG   9  
ATOM 11699 S SD   . MET A 1 22 ? 2.105   -3.447  4.956   1.00 0.00 ? 22 MET A SD   9  
ATOM 11700 C CE   . MET A 1 22 ? 0.540   -2.636  5.297   1.00 0.00 ? 22 MET A CE   9  
ATOM 11701 H H    . MET A 1 22 ? 1.374   -1.309  0.609   1.00 0.00 ? 22 MET A H    9  
ATOM 11702 H HA   . MET A 1 22 ? 3.056   -1.885  2.762   1.00 0.00 ? 22 MET A HA   9  
ATOM 11703 H HB2  . MET A 1 22 ? 0.675   -2.582  2.595   1.00 0.00 ? 22 MET A HB2  9  
ATOM 11704 H HB3  . MET A 1 22 ? 1.135   -3.781  1.395   1.00 0.00 ? 22 MET A HB3  9  
ATOM 11705 H HG2  . MET A 1 22 ? 0.881   -4.871  3.493   1.00 0.00 ? 22 MET A HG2  9  
ATOM 11706 H HG3  . MET A 1 22 ? 2.596   -4.844  3.088   1.00 0.00 ? 22 MET A HG3  9  
ATOM 11707 H HE1  . MET A 1 22 ? -0.244  -3.376  5.352   1.00 0.00 ? 22 MET A HE1  9  
ATOM 11708 H HE2  . MET A 1 22 ? 0.318   -1.936  4.507   1.00 0.00 ? 22 MET A HE2  9  
ATOM 11709 H HE3  . MET A 1 22 ? 0.604   -2.108  6.238   1.00 0.00 ? 22 MET A HE3  9  
ATOM 11710 N N    . ALA A 1 23 ? 3.611   -3.720  0.080   1.00 0.00 ? 23 ALA A N    9  
ATOM 11711 C CA   . ALA A 1 23 ? 4.603   -4.557  -0.586  1.00 0.00 ? 23 ALA A CA   9  
ATOM 11712 C C    . ALA A 1 23 ? 5.912   -3.797  -0.773  1.00 0.00 ? 23 ALA A C    9  
ATOM 11713 O O    . ALA A 1 23 ? 6.995   -4.360  -0.635  1.00 0.00 ? 23 ALA A O    9  
ATOM 11714 C CB   . ALA A 1 23 ? 4.073   -5.042  -1.930  1.00 0.00 ? 23 ALA A CB   9  
ATOM 11715 H H    . ALA A 1 23 ? 2.794   -3.472  -0.405  1.00 0.00 ? 23 ALA A H    9  
ATOM 11716 H HA   . ALA A 1 23 ? 4.787   -5.421  0.039   1.00 0.00 ? 23 ALA A HA   9  
ATOM 11717 H HB1  . ALA A 1 23 ? 3.161   -5.600  -1.777  1.00 0.00 ? 23 ALA A HB1  9  
ATOM 11718 H HB2  . ALA A 1 23 ? 4.810   -5.679  -2.399  1.00 0.00 ? 23 ALA A HB2  9  
ATOM 11719 H HB3  . ALA A 1 23 ? 3.873   -4.193  -2.567  1.00 0.00 ? 23 ALA A HB3  9  
ATOM 11720 N N    . GLN A 1 24 ? 5.799   -2.511  -1.081  1.00 0.00 ? 24 GLN A N    9  
ATOM 11721 C CA   . GLN A 1 24 ? 6.968   -1.656  -1.245  1.00 0.00 ? 24 GLN A CA   9  
ATOM 11722 C C    . GLN A 1 24 ? 7.695   -1.474  0.085   1.00 0.00 ? 24 GLN A C    9  
ATOM 11723 O O    . GLN A 1 24 ? 8.922   -1.568  0.154   1.00 0.00 ? 24 GLN A O    9  
ATOM 11724 C CB   . GLN A 1 24 ? 6.554   -0.289  -1.799  1.00 0.00 ? 24 GLN A CB   9  
ATOM 11725 C CG   . GLN A 1 24 ? 5.909   -0.352  -3.174  1.00 0.00 ? 24 GLN A CG   9  
ATOM 11726 C CD   . GLN A 1 24 ? 6.872   -0.809  -4.250  1.00 0.00 ? 24 GLN A CD   9  
ATOM 11727 O OE1  . GLN A 1 24 ? 7.560   0.005   -4.867  1.00 0.00 ? 24 GLN A OE1  9  
ATOM 11728 N NE2  . GLN A 1 24 ? 6.925   -2.108  -4.486  1.00 0.00 ? 24 GLN A NE2  9  
ATOM 11729 H H    . GLN A 1 24 ? 4.903   -2.128  -1.204  1.00 0.00 ? 24 GLN A H    9  
ATOM 11730 H HA   . GLN A 1 24 ? 7.635   -2.134  -1.946  1.00 0.00 ? 24 GLN A HA   9  
ATOM 11731 H HB2  . GLN A 1 24 ? 5.851   0.164   -1.116  1.00 0.00 ? 24 GLN A HB2  9  
ATOM 11732 H HB3  . GLN A 1 24 ? 7.430   0.340   -1.866  1.00 0.00 ? 24 GLN A HB3  9  
ATOM 11733 H HG2  . GLN A 1 24 ? 5.080   -1.044  -3.137  1.00 0.00 ? 24 GLN A HG2  9  
ATOM 11734 H HG3  . GLN A 1 24 ? 5.543   0.631   -3.434  1.00 0.00 ? 24 GLN A HG3  9  
ATOM 11735 H HE21 . GLN A 1 24 ? 6.348   -2.701  -3.959  1.00 0.00 ? 24 GLN A HE21 9  
ATOM 11736 H HE22 . GLN A 1 24 ? 7.542   -2.431  -5.186  1.00 0.00 ? 24 GLN A HE22 9  
ATOM 11737 N N    . GLU A 1 25 ? 6.925   -1.214  1.134   1.00 0.00 ? 25 GLU A N    9  
ATOM 11738 C CA   . GLU A 1 25 ? 7.472   -0.962  2.462   1.00 0.00 ? 25 GLU A CA   9  
ATOM 11739 C C    . GLU A 1 25 ? 8.098   -2.213  3.063   1.00 0.00 ? 25 GLU A C    9  
ATOM 11740 O O    . GLU A 1 25 ? 9.232   -2.178  3.544   1.00 0.00 ? 25 GLU A O    9  
ATOM 11741 C CB   . GLU A 1 25 ? 6.374   -0.442  3.396   1.00 0.00 ? 25 GLU A CB   9  
ATOM 11742 C CG   . GLU A 1 25 ? 5.900   0.963   3.067   1.00 0.00 ? 25 GLU A CG   9  
ATOM 11743 C CD   . GLU A 1 25 ? 6.892   2.027   3.487   1.00 0.00 ? 25 GLU A CD   9  
ATOM 11744 O OE1  . GLU A 1 25 ? 7.999   2.080   2.918   1.00 0.00 ? 25 GLU A OE1  9  
ATOM 11745 O OE2  . GLU A 1 25 ? 6.570   2.816   4.401   1.00 0.00 ? 25 GLU A OE2  9  
ATOM 11746 H H    . GLU A 1 25 ? 5.949   -1.182  1.009   1.00 0.00 ? 25 GLU A H    9  
ATOM 11747 H HA   . GLU A 1 25 ? 8.234   -0.203  2.367   1.00 0.00 ? 25 GLU A HA   9  
ATOM 11748 H HB2  . GLU A 1 25 ? 5.525   -1.106  3.336   1.00 0.00 ? 25 GLU A HB2  9  
ATOM 11749 H HB3  . GLU A 1 25 ? 6.750   -0.445  4.408   1.00 0.00 ? 25 GLU A HB3  9  
ATOM 11750 H HG2  . GLU A 1 25 ? 5.749   1.036   2.002   1.00 0.00 ? 25 GLU A HG2  9  
ATOM 11751 H HG3  . GLU A 1 25 ? 4.964   1.141   3.576   1.00 0.00 ? 25 GLU A HG3  9  
ATOM 11752 N N    . ASN A 1 26 ? 7.367   -3.324  3.025   1.00 0.00 ? 26 ASN A N    9  
ATOM 11753 C CA   . ASN A 1 26 ? 7.790   -4.532  3.727   1.00 0.00 ? 26 ASN A CA   9  
ATOM 11754 C C    . ASN A 1 26 ? 7.101   -5.787  3.177   1.00 0.00 ? 26 ASN A C    9  
ATOM 11755 O O    . ASN A 1 26 ? 6.060   -6.219  3.671   1.00 0.00 ? 26 ASN A O    9  
ATOM 11756 C CB   . ASN A 1 26 ? 7.562   -4.385  5.248   1.00 0.00 ? 26 ASN A CB   9  
ATOM 11757 C CG   . ASN A 1 26 ? 6.103   -4.208  5.679   1.00 0.00 ? 26 ASN A CG   9  
ATOM 11758 O OD1  . ASN A 1 26 ? 5.738   -4.560  6.799   1.00 0.00 ? 26 ASN A OD1  9  
ATOM 11759 N ND2  . ASN A 1 26 ? 5.259   -3.676  4.809   1.00 0.00 ? 26 ASN A ND2  9  
ATOM 11760 H H    . ASN A 1 26 ? 6.535   -3.337  2.499   1.00 0.00 ? 26 ASN A H    9  
ATOM 11761 H HA   . ASN A 1 26 ? 8.851   -4.639  3.555   1.00 0.00 ? 26 ASN A HA   9  
ATOM 11762 H HB2  . ASN A 1 26 ? 7.944   -5.265  5.738   1.00 0.00 ? 26 ASN A HB2  9  
ATOM 11763 H HB3  . ASN A 1 26 ? 8.121   -3.527  5.596   1.00 0.00 ? 26 ASN A HB3  9  
ATOM 11764 H HD21 . ASN A 1 26 ? 5.598   -3.426  3.927   1.00 0.00 ? 26 ASN A HD21 9  
ATOM 11765 H HD22 . ASN A 1 26 ? 4.323   -3.554  5.084   1.00 0.00 ? 26 ASN A HD22 9  
ATOM 11766 N N    . PRO A 1 27 ? 7.676   -6.387  2.128   1.00 0.00 ? 27 PRO A N    9  
ATOM 11767 C CA   . PRO A 1 27 ? 7.104   -7.570  1.490   1.00 0.00 ? 27 PRO A CA   9  
ATOM 11768 C C    . PRO A 1 27 ? 7.404   -8.855  2.265   1.00 0.00 ? 27 PRO A C    9  
ATOM 11769 O O    . PRO A 1 27 ? 8.094   -9.746  1.772   1.00 0.00 ? 27 PRO A O    9  
ATOM 11770 C CB   . PRO A 1 27 ? 7.791   -7.586  0.125   1.00 0.00 ? 27 PRO A CB   9  
ATOM 11771 C CG   . PRO A 1 27 ? 9.119   -6.945  0.355   1.00 0.00 ? 27 PRO A CG   9  
ATOM 11772 C CD   . PRO A 1 27 ? 8.933   -5.963  1.484   1.00 0.00 ? 27 PRO A CD   9  
ATOM 11773 H HA   . PRO A 1 27 ? 6.036   -7.472  1.358   1.00 0.00 ? 27 PRO A HA   9  
ATOM 11774 H HB2  . PRO A 1 27 ? 7.896   -8.607  -0.214  1.00 0.00 ? 27 PRO A HB2  9  
ATOM 11775 H HB3  . PRO A 1 27 ? 7.201   -7.025  -0.585  1.00 0.00 ? 27 PRO A HB3  9  
ATOM 11776 H HG2  . PRO A 1 27 ? 9.847   -7.695  0.628   1.00 0.00 ? 27 PRO A HG2  9  
ATOM 11777 H HG3  . PRO A 1 27 ? 9.435   -6.428  -0.539  1.00 0.00 ? 27 PRO A HG3  9  
ATOM 11778 H HD2  . PRO A 1 27 ? 9.758   -6.030  2.178   1.00 0.00 ? 27 PRO A HD2  9  
ATOM 11779 H HD3  . PRO A 1 27 ? 8.848   -4.958  1.099   1.00 0.00 ? 27 PRO A HD3  9  
ATOM 11780 N N    . LYS A 1 28 ? 6.886   -8.945  3.483   1.00 0.00 ? 28 LYS A N    9  
ATOM 11781 C CA   . LYS A 1 28 ? 7.039   -10.160 4.276   1.00 0.00 ? 28 LYS A CA   9  
ATOM 11782 C C    . LYS A 1 28 ? 5.763   -10.993 4.215   1.00 0.00 ? 28 LYS A C    9  
ATOM 11783 O O    . LYS A 1 28 ? 5.776   -12.190 4.497   1.00 0.00 ? 28 LYS A O    9  
ATOM 11784 C CB   . LYS A 1 28 ? 7.380   -9.850  5.741   1.00 0.00 ? 28 LYS A CB   9  
ATOM 11785 C CG   . LYS A 1 28 ? 8.713   -9.143  5.941   1.00 0.00 ? 28 LYS A CG   9  
ATOM 11786 C CD   . LYS A 1 28 ? 8.538   -7.635  6.044   1.00 0.00 ? 28 LYS A CD   9  
ATOM 11787 C CE   . LYS A 1 28 ? 9.866   -6.917  6.246   1.00 0.00 ? 28 LYS A CE   9  
ATOM 11788 N NZ   . LYS A 1 28 ? 10.548  -7.320  7.505   1.00 0.00 ? 28 LYS A NZ   9  
ATOM 11789 H H    . LYS A 1 28 ? 6.392   -8.180  3.856   1.00 0.00 ? 28 LYS A H    9  
ATOM 11790 H HA   . LYS A 1 28 ? 7.847   -10.733 3.841   1.00 0.00 ? 28 LYS A HA   9  
ATOM 11791 H HB2  . LYS A 1 28 ? 6.602   -9.225  6.153   1.00 0.00 ? 28 LYS A HB2  9  
ATOM 11792 H HB3  . LYS A 1 28 ? 7.406   -10.780 6.291   1.00 0.00 ? 28 LYS A HB3  9  
ATOM 11793 H HG2  . LYS A 1 28 ? 9.170   -9.505  6.851   1.00 0.00 ? 28 LYS A HG2  9  
ATOM 11794 H HG3  . LYS A 1 28 ? 9.355   -9.364  5.102   1.00 0.00 ? 28 LYS A HG3  9  
ATOM 11795 H HD2  . LYS A 1 28 ? 8.084   -7.274  5.133   1.00 0.00 ? 28 LYS A HD2  9  
ATOM 11796 H HD3  . LYS A 1 28 ? 7.890   -7.416  6.881   1.00 0.00 ? 28 LYS A HD3  9  
ATOM 11797 H HE2  . LYS A 1 28 ? 10.512  -7.147  5.412   1.00 0.00 ? 28 LYS A HE2  9  
ATOM 11798 H HE3  . LYS A 1 28 ? 9.683   -5.853  6.272   1.00 0.00 ? 28 LYS A HE3  9  
ATOM 11799 H HZ1  . LYS A 1 28 ? 11.412  -6.748  7.647   1.00 0.00 ? 28 LYS A HZ1  9  
ATOM 11800 H HZ2  . LYS A 1 28 ? 10.822  -8.325  7.461   1.00 0.00 ? 28 LYS A HZ2  9  
ATOM 11801 H HZ3  . LYS A 1 28 ? 9.919   -7.178  8.324   1.00 0.00 ? 28 LYS A HZ3  9  
ATOM 11802 N N    . MET A 1 29 ? 4.666   -10.351 3.835   1.00 0.00 ? 29 MET A N    9  
ATOM 11803 C CA   . MET A 1 29 ? 3.368   -11.012 3.792   1.00 0.00 ? 29 MET A CA   9  
ATOM 11804 C C    . MET A 1 29 ? 2.777   -10.957 2.386   1.00 0.00 ? 29 MET A C    9  
ATOM 11805 O O    . MET A 1 29 ? 3.228   -10.180 1.539   1.00 0.00 ? 29 MET A O    9  
ATOM 11806 C CB   . MET A 1 29 ? 2.410   -10.372 4.801   1.00 0.00 ? 29 MET A CB   9  
ATOM 11807 C CG   . MET A 1 29 ? 2.123   -8.907  4.530   1.00 0.00 ? 29 MET A CG   9  
ATOM 11808 S SD   . MET A 1 29 ? 1.121   -8.149  5.823   1.00 0.00 ? 29 MET A SD   9  
ATOM 11809 C CE   . MET A 1 29 ? 2.192   -8.370  7.244   1.00 0.00 ? 29 MET A CE   9  
ATOM 11810 H H    . MET A 1 29 ? 4.730   -9.409  3.567   1.00 0.00 ? 29 MET A H    9  
ATOM 11811 H HA   . MET A 1 29 ? 3.518   -12.049 4.061   1.00 0.00 ? 29 MET A HA   9  
ATOM 11812 H HB2  . MET A 1 29 ? 1.474   -10.908 4.783   1.00 0.00 ? 29 MET A HB2  9  
ATOM 11813 H HB3  . MET A 1 29 ? 2.842   -10.454 5.789   1.00 0.00 ? 29 MET A HB3  9  
ATOM 11814 H HG2  . MET A 1 29 ? 3.061   -8.377  4.465   1.00 0.00 ? 29 MET A HG2  9  
ATOM 11815 H HG3  . MET A 1 29 ? 1.597   -8.826  3.592   1.00 0.00 ? 29 MET A HG3  9  
ATOM 11816 H HE1  . MET A 1 29 ? 2.368   -9.424  7.401   1.00 0.00 ? 29 MET A HE1  9  
ATOM 11817 H HE2  . MET A 1 29 ? 1.720   -7.950  8.119   1.00 0.00 ? 29 MET A HE2  9  
ATOM 11818 H HE3  . MET A 1 29 ? 3.135   -7.872  7.066   1.00 0.00 ? 29 MET A HE3  9  
ATOM 11819 N N    . HIS A 1 30 ? 1.783   -11.795 2.143   1.00 0.00 ? 30 HIS A N    9  
ATOM 11820 C CA   . HIS A 1 30 ? 1.145   -11.875 0.837   1.00 0.00 ? 30 HIS A CA   9  
ATOM 11821 C C    . HIS A 1 30 ? -0.161  -11.086 0.819   1.00 0.00 ? 30 HIS A C    9  
ATOM 11822 O O    . HIS A 1 30 ? -0.497  -10.407 1.789   1.00 0.00 ? 30 HIS A O    9  
ATOM 11823 C CB   . HIS A 1 30 ? 0.905   -13.336 0.451   1.00 0.00 ? 30 HIS A CB   9  
ATOM 11824 C CG   . HIS A 1 30 ? 2.170   -14.120 0.304   1.00 0.00 ? 30 HIS A CG   9  
ATOM 11825 N ND1  . HIS A 1 30 ? 3.104   -13.859 -0.676  1.00 0.00 ? 30 HIS A ND1  9  
ATOM 11826 C CD2  . HIS A 1 30 ? 2.666   -15.155 1.024   1.00 0.00 ? 30 HIS A CD2  9  
ATOM 11827 C CE1  . HIS A 1 30 ? 4.113   -14.697 -0.556  1.00 0.00 ? 30 HIS A CE1  9  
ATOM 11828 N NE2  . HIS A 1 30 ? 3.876   -15.495 0.466   1.00 0.00 ? 30 HIS A NE2  9  
ATOM 11829 H H    . HIS A 1 30 ? 1.455   -12.376 2.873   1.00 0.00 ? 30 HIS A H    9  
ATOM 11830 H HA   . HIS A 1 30 ? 1.821   -11.435 0.118   1.00 0.00 ? 30 HIS A HA   9  
ATOM 11831 H HB2  . HIS A 1 30 ? 0.305   -13.810 1.213   1.00 0.00 ? 30 HIS A HB2  9  
ATOM 11832 H HB3  . HIS A 1 30 ? 0.380   -13.371 -0.492  1.00 0.00 ? 30 HIS A HB3  9  
ATOM 11833 H HD1  . HIS A 1 30 ? 3.043   -13.144 -1.351  1.00 0.00 ? 30 HIS A HD1  9  
ATOM 11834 H HD2  . HIS A 1 30 ? 2.197   -15.623 1.877   1.00 0.00 ? 30 HIS A HD2  9  
ATOM 11835 H HE1  . HIS A 1 30 ? 4.988   -14.726 -1.189  1.00 0.00 ? 30 HIS A HE1  9  
ATOM 11836 H HE2  . HIS A 1 30 ? 4.372   -16.323 0.653   1.00 0.00 ? 30 HIS A HE2  9  
ATOM 11837 N N    . ASN A 1 31 ? -0.902  -11.181 -0.280  1.00 0.00 ? 31 ASN A N    9  
ATOM 11838 C CA   . ASN A 1 31 ? -2.071  -10.328 -0.483  1.00 0.00 ? 31 ASN A CA   9  
ATOM 11839 C C    . ASN A 1 31 ? -3.275  -10.793 0.337   1.00 0.00 ? 31 ASN A C    9  
ATOM 11840 O O    . ASN A 1 31 ? -4.121  -9.981  0.716   1.00 0.00 ? 31 ASN A O    9  
ATOM 11841 C CB   . ASN A 1 31 ? -2.445  -10.263 -1.972  1.00 0.00 ? 31 ASN A CB   9  
ATOM 11842 C CG   . ASN A 1 31 ? -3.290  -11.440 -2.435  1.00 0.00 ? 31 ASN A CG   9  
ATOM 11843 O OD1  . ASN A 1 31 ? -4.518  -11.396 -2.372  1.00 0.00 ? 31 ASN A OD1  9  
ATOM 11844 N ND2  . ASN A 1 31 ? -2.643  -12.495 -2.904  1.00 0.00 ? 31 ASN A ND2  9  
ATOM 11845 H H    . ASN A 1 31 ? -0.655  -11.837 -0.971  1.00 0.00 ? 31 ASN A H    9  
ATOM 11846 H HA   . ASN A 1 31 ? -1.803  -9.335  -0.158  1.00 0.00 ? 31 ASN A HA   9  
ATOM 11847 H HB2  . ASN A 1 31 ? -3.000  -9.357  -2.156  1.00 0.00 ? 31 ASN A HB2  9  
ATOM 11848 H HB3  . ASN A 1 31 ? -1.538  -10.245 -2.558  1.00 0.00 ? 31 ASN A HB3  9  
ATOM 11849 H HD21 . ASN A 1 31 ? -1.657  -12.471 -2.926  1.00 0.00 ? 31 ASN A HD21 9  
ATOM 11850 H HD22 . ASN A 1 31 ? -3.175  -13.258 -3.232  1.00 0.00 ? 31 ASN A HD22 9  
ATOM 11851 N N    . SER A 1 32 ? -3.341  -12.088 0.626   1.00 0.00 ? 32 SER A N    9  
ATOM 11852 C CA   . SER A 1 32 ? -4.509  -12.664 1.282   1.00 0.00 ? 32 SER A CA   9  
ATOM 11853 C C    . SER A 1 32 ? -4.635  -12.179 2.727   1.00 0.00 ? 32 SER A C    9  
ATOM 11854 O O    . SER A 1 32 ? -5.701  -11.725 3.149   1.00 0.00 ? 32 SER A O    9  
ATOM 11855 C CB   . SER A 1 32 ? -4.426  -14.189 1.234   1.00 0.00 ? 32 SER A CB   9  
ATOM 11856 O OG   . SER A 1 32 ? -