data_2LKT
# 
_entry.id   2LKT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LKT         
RCSB  RCSB102503   
BMRB  18012        
WWPDB D_1000102503 
# 
_pdbx_database_related.db_id          18012 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LKT 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, L.' 1 
'Yu, W.'   2 
'Xia, B.'  3 
# 
_citation.id                        primary 
_citation.title                     '(1)H, (13)C, and (15)N resonance assignments of the N-terminal domain of human TIG3' 
_citation.journal_abbrev            'Biomol.Nmr Assign.' 
_citation.journal_volume            6 
_citation.page_first                201 
_citation.page_last                 203 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   NE 
_citation.journal_id_ISSN           1874-2718 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22290676 
_citation.pdbx_database_id_DOI      10.1007/s12104-012-9357-2 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, L.' 1 
primary 'Yu, W.'   2 
primary 'Ren, X.'  3 
primary 'Lin, J.'  4 
primary 'Jin, C.'  5 
primary 'Xia, B.'  6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Retinoic acid receptor responder protein 3' 
_entity.formula_weight             14050.886 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.1.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'NlpC/P60 structural domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAR-responsive protein TIG3, Retinoid-inducible gene 1 protein, Tazarotene-induced gene 3 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL
DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL
DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   PRO n 
1 5   HIS n 
1 6   GLN n 
1 7   GLU n 
1 8   PRO n 
1 9   LYS n 
1 10  PRO n 
1 11  GLY n 
1 12  ASP n 
1 13  LEU n 
1 14  ILE n 
1 15  GLU n 
1 16  ILE n 
1 17  PHE n 
1 18  ARG n 
1 19  LEU n 
1 20  GLY n 
1 21  TYR n 
1 22  GLU n 
1 23  HIS n 
1 24  TRP n 
1 25  ALA n 
1 26  LEU n 
1 27  TYR n 
1 28  ILE n 
1 29  GLY n 
1 30  ASP n 
1 31  GLY n 
1 32  TYR n 
1 33  VAL n 
1 34  ILE n 
1 35  HIS n 
1 36  LEU n 
1 37  ALA n 
1 38  PRO n 
1 39  PRO n 
1 40  SER n 
1 41  GLU n 
1 42  TYR n 
1 43  PRO n 
1 44  GLY n 
1 45  ALA n 
1 46  GLY n 
1 47  SER n 
1 48  SER n 
1 49  SER n 
1 50  VAL n 
1 51  PHE n 
1 52  SER n 
1 53  VAL n 
1 54  LEU n 
1 55  SER n 
1 56  ASN n 
1 57  SER n 
1 58  ALA n 
1 59  GLU n 
1 60  VAL n 
1 61  LYS n 
1 62  ARG n 
1 63  GLU n 
1 64  ARG n 
1 65  LEU n 
1 66  GLU n 
1 67  ASP n 
1 68  VAL n 
1 69  VAL n 
1 70  GLY n 
1 71  GLY n 
1 72  CYS n 
1 73  CYS n 
1 74  TYR n 
1 75  ARG n 
1 76  VAL n 
1 77  ASN n 
1 78  ASN n 
1 79  SER n 
1 80  LEU n 
1 81  ASP n 
1 82  HIS n 
1 83  GLU n 
1 84  TYR n 
1 85  GLN n 
1 86  PRO n 
1 87  ARG n 
1 88  PRO n 
1 89  VAL n 
1 90  GLU n 
1 91  VAL n 
1 92  ILE n 
1 93  ILE n 
1 94  SER n 
1 95  SER n 
1 96  ALA n 
1 97  LYS n 
1 98  GLU n 
1 99  MET n 
1 100 VAL n 
1 101 GLY n 
1 102 GLN n 
1 103 LYS n 
1 104 MET n 
1 105 LYS n 
1 106 TYR n 
1 107 SER n 
1 108 ILE n 
1 109 VAL n 
1 110 SER n 
1 111 ARG n 
1 112 ASN n 
1 113 CYS n 
1 114 GLU n 
1 115 HIS n 
1 116 PHE n 
1 117 VAL n 
1 118 THR n 
1 119 GLN n 
1 120 LEU n 
1 121 ARG n 
1 122 TYR n 
1 123 GLY n 
1 124 LYS n 
1 125 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TIG3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET-21a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TIG3_HUMAN 
_struct_ref.pdbx_db_accession          Q9UL19 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL
DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LKT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UL19 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'            
1 2  1 '3D 1H-15N NOESY'           
1 3  1 '3D 1H-13C NOESY aliphatic' 
1 4  1 '3D 1H-13C NOESY aromatic'  
1 5  1 '3D CBCA(CO)NH'             
1 6  1 '3D HNCACB'                 
1 7  1 '3D HBHA(CO)NH'             
1 8  1 '3D HNCO'                   
1 9  1 '3D HNCA'                   
1 10 1 '3D HN(CO)CA'               
1 11 1 '3D HCCH-TOCSY'             
1 12 1 '3D HCCH-COSY'              
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;0.5 mM [U-13C; U-15N] TIG3N protein-1, 50 mM sodium phosphate-2, 50 mM sodium chloride-3, 20 mM DTT-4, 2 M urea-5, 95 % H2O-6, 5 % [U-2H] D2O-7, 0.01 % DSS-8, 95% H2O/5% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LKT 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'using AMBER ff03 force filed refinement' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LKT 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.099 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.231 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LKT 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement                  AMBER       1  9.0 
'Guntert, Mumenthaler and Wuthrich'                                       'structure solution'        CYANA       2  3.0 
'Guntert, Braun and Wuthrich'                                             'structure solution'        DYANA       3  3.0 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                       processing                  NMRDraw     4  ?   
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                       processing                  NMRPipe     5  ?   
'Johnson, One Moon Scientific'                                            'peak picking'              NMRView     6  5.0 
'Laskowski and MacArthur'                                                 'geometry optimization'     ProcheckNMR 7  ?   
'Duggan, Legge, Dyson & Wright'                                           'chemical shift assignment' SANE        8  ?   
'Bruker Biospin'                                                          collection                  TOPSPIN     9  3.0 
'Cornilescu, Delaglio and Bax'                                            'geometry optimization'     TALOS       10 ?   
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Solution structure of N-terminal domain of human TIG3' 
_exptl.entry_id                   2LKT 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LKT 
_struct.title                     'Solution structure of N-terminal domain of human TIG3 in 2 M UREA' 
_struct.pdbx_descriptor           'Retinoic acid receptor responder protein 3 (E.C.3.1.1.-)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LKT 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'TIG3, human tumor suppressor II family, NlpC/P60, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 65  ? GLY A 70  ? LEU A 65  GLY A 70  1 ? 6  
HELX_P HELX_P2 2 ASN A 78  ? TYR A 84  ? ASN A 78  TYR A 84  1 ? 7  
HELX_P HELX_P3 3 PRO A 88  ? VAL A 100 ? PRO A 88  VAL A 100 1 ? 13 
HELX_P HELX_P4 4 ILE A 108 ? TYR A 122 ? ILE A 108 TYR A 122 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 73  ? VAL A 76  ? CYS A 73  VAL A 76  
A 2 LEU A 13  ? PHE A 17  ? LEU A 13  PHE A 17  
A 3 HIS A 23  ? GLY A 29  ? HIS A 23  GLY A 29  
A 4 TYR A 32  ? ALA A 37  ? TYR A 32  ALA A 37  
A 5 ALA A 58  ? ARG A 64  ? ALA A 58  ARG A 64  
A 6 LYS A 103 ? MET A 104 ? LYS A 103 MET A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 75 ? O ARG A 75 N GLU A 15  ? N GLU A 15  
A 2 3 N ILE A 16 ? N ILE A 16 O HIS A 23  ? O HIS A 23  
A 3 4 N LEU A 26 ? N LEU A 26 O ILE A 34  ? O ILE A 34  
A 4 5 N VAL A 33 ? N VAL A 33 O GLU A 63  ? O GLU A 63  
A 5 6 N ALA A 58 ? N ALA A 58 O MET A 104 ? O MET A 104 
# 
_atom_sites.entry_id                    2LKT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 9.706   -9.644  -4.157  1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 9.994   -8.237  -3.745  1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 11.326  -8.122  -2.988  1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 11.825  -9.109  -2.448  1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 8.825   -7.599  -2.949  1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 8.569   -8.202  -1.554  1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 7.306   -7.353  -0.557  1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 5.794   -7.783  -1.466  1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 8.842   -9.696  -4.679  1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 10.449  -9.999  -4.745  1.00 0.00 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 9.633   -10.253 -3.353  1.00 0.00 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 10.108  -7.651  -4.663  1.00 0.00 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 9.031   -6.535  -2.825  1.00 0.00 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 7.912   -7.682  -3.542  1.00 0.00 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 8.274   -9.248  -1.657  1.00 0.00 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 9.498   -8.172  -0.983  1.00 0.00 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 5.698   -8.867  -1.527  1.00 0.00 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 4.928   -7.375  -0.944  1.00 0.00 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 5.829   -7.360  -2.471  1.00 0.00 ? 1   MET A HE3  1  
ATOM 20    N N    . ALA A 1 2   ? 11.904  -6.912  -2.922  1.00 0.00 ? 2   ALA A N    1  
ATOM 21    C CA   . ALA A 1 2   ? 13.161  -6.640  -2.205  1.00 0.00 ? 2   ALA A CA   1  
ATOM 22    C C    . ALA A 1 2   ? 12.983  -6.533  -0.675  1.00 0.00 ? 2   ALA A C    1  
ATOM 23    O O    . ALA A 1 2   ? 13.901  -6.856  0.080   1.00 0.00 ? 2   ALA A O    1  
ATOM 24    C CB   . ALA A 1 2   ? 13.757  -5.349  -2.783  1.00 0.00 ? 2   ALA A CB   1  
ATOM 25    H H    . ALA A 1 2   ? 11.479  -6.142  -3.424  1.00 0.00 ? 2   ALA A H    1  
ATOM 26    H HA   . ALA A 1 2   ? 13.862  -7.457  -2.392  1.00 0.00 ? 2   ALA A HA   1  
ATOM 27    H HB1  . ALA A 1 2   ? 13.088  -4.507  -2.600  1.00 0.00 ? 2   ALA A HB1  1  
ATOM 28    H HB2  . ALA A 1 2   ? 14.718  -5.143  -2.308  1.00 0.00 ? 2   ALA A HB2  1  
ATOM 29    H HB3  . ALA A 1 2   ? 13.914  -5.459  -3.857  1.00 0.00 ? 2   ALA A HB3  1  
ATOM 30    N N    . SER A 1 3   ? 11.816  -6.084  -0.209  1.00 0.00 ? 3   SER A N    1  
ATOM 31    C CA   . SER A 1 3   ? 11.498  -5.923  1.221   1.00 0.00 ? 3   SER A CA   1  
ATOM 32    C C    . SER A 1 3   ? 11.393  -7.275  1.974   1.00 0.00 ? 3   SER A C    1  
ATOM 33    O O    . SER A 1 3   ? 10.976  -8.276  1.373   1.00 0.00 ? 3   SER A O    1  
ATOM 34    C CB   . SER A 1 3   ? 10.177  -5.146  1.380   1.00 0.00 ? 3   SER A CB   1  
ATOM 35    O OG   . SER A 1 3   ? 10.230  -3.894  0.712   1.00 0.00 ? 3   SER A OG   1  
ATOM 36    H H    . SER A 1 3   ? 11.130  -5.759  -0.874  1.00 0.00 ? 3   SER A H    1  
ATOM 37    H HA   . SER A 1 3   ? 12.292  -5.325  1.673   1.00 0.00 ? 3   SER A HA   1  
ATOM 38    H HB2  . SER A 1 3   ? 9.363   -5.745  0.969   1.00 0.00 ? 3   SER A HB2  1  
ATOM 39    H HB3  . SER A 1 3   ? 9.984   -4.981  2.441   1.00 0.00 ? 3   SER A HB3  1  
ATOM 40    H HG   . SER A 1 3   ? 9.392   -3.427  0.858   1.00 0.00 ? 3   SER A HG   1  
ATOM 41    N N    . PRO A 1 4   ? 11.720  -7.324  3.286   1.00 0.00 ? 4   PRO A N    1  
ATOM 42    C CA   . PRO A 1 4   ? 11.646  -8.549  4.088   1.00 0.00 ? 4   PRO A CA   1  
ATOM 43    C C    . PRO A 1 4   ? 10.203  -8.956  4.441   1.00 0.00 ? 4   PRO A C    1  
ATOM 44    O O    . PRO A 1 4   ? 9.946   -10.136 4.671   1.00 0.00 ? 4   PRO A O    1  
ATOM 45    C CB   . PRO A 1 4   ? 12.461  -8.249  5.351   1.00 0.00 ? 4   PRO A CB   1  
ATOM 46    C CG   . PRO A 1 4   ? 12.315  -6.739  5.523   1.00 0.00 ? 4   PRO A CG   1  
ATOM 47    C CD   . PRO A 1 4   ? 12.274  -6.234  4.084   1.00 0.00 ? 4   PRO A CD   1  
ATOM 48    H HA   . PRO A 1 4   ? 12.114  -9.373  3.549   1.00 0.00 ? 4   PRO A HA   1  
ATOM 49    H HB2  . PRO A 1 4   ? 12.095  -8.792  6.222   1.00 0.00 ? 4   PRO A HB2  1  
ATOM 50    H HB3  . PRO A 1 4   ? 13.509  -8.493  5.172   1.00 0.00 ? 4   PRO A HB3  1  
ATOM 51    H HG2  . PRO A 1 4   ? 11.370  -6.514  6.018   1.00 0.00 ? 4   PRO A HG2  1  
ATOM 52    H HG3  . PRO A 1 4   ? 13.152  -6.310  6.074   1.00 0.00 ? 4   PRO A HG3  1  
ATOM 53    H HD2  . PRO A 1 4   ? 11.664  -5.330  4.026   1.00 0.00 ? 4   PRO A HD2  1  
ATOM 54    H HD3  . PRO A 1 4   ? 13.289  -6.026  3.746   1.00 0.00 ? 4   PRO A HD3  1  
ATOM 55    N N    . HIS A 1 5   ? 9.259   -8.008  4.464   1.00 0.00 ? 5   HIS A N    1  
ATOM 56    C CA   . HIS A 1 5   ? 7.831   -8.212  4.743   1.00 0.00 ? 5   HIS A CA   1  
ATOM 57    C C    . HIS A 1 5   ? 6.995   -7.003  4.261   1.00 0.00 ? 5   HIS A C    1  
ATOM 58    O O    . HIS A 1 5   ? 7.552   -5.972  3.865   1.00 0.00 ? 5   HIS A O    1  
ATOM 59    C CB   . HIS A 1 5   ? 7.628   -8.485  6.251   1.00 0.00 ? 5   HIS A CB   1  
ATOM 60    C CG   . HIS A 1 5   ? 8.088   -7.370  7.161   1.00 0.00 ? 5   HIS A CG   1  
ATOM 61    N ND1  . HIS A 1 5   ? 7.382   -6.233  7.492   1.00 0.00 ? 5   HIS A ND1  1  
ATOM 62    C CD2  . HIS A 1 5   ? 9.282   -7.311  7.834   1.00 0.00 ? 5   HIS A CD2  1  
ATOM 63    C CE1  . HIS A 1 5   ? 8.137   -5.504  8.332   1.00 0.00 ? 5   HIS A CE1  1  
ATOM 64    N NE2  . HIS A 1 5   ? 9.311   -6.118  8.573   1.00 0.00 ? 5   HIS A NE2  1  
ATOM 65    H H    . HIS A 1 5   ? 9.530   -7.053  4.275   1.00 0.00 ? 5   HIS A H    1  
ATOM 66    H HA   . HIS A 1 5   ? 7.482   -9.088  4.188   1.00 0.00 ? 5   HIS A HA   1  
ATOM 67    H HB2  . HIS A 1 5   ? 6.576   -8.683  6.453   1.00 0.00 ? 5   HIS A HB2  1  
ATOM 68    H HB3  . HIS A 1 5   ? 8.172   -9.390  6.523   1.00 0.00 ? 5   HIS A HB3  1  
ATOM 69    H HD1  . HIS A 1 5   ? 6.455   -5.975  7.161   1.00 0.00 ? 5   HIS A HD1  1  
ATOM 70    H HD2  . HIS A 1 5   ? 10.064  -8.061  7.795   1.00 0.00 ? 5   HIS A HD2  1  
ATOM 71    H HE1  . HIS A 1 5   ? 7.838   -4.552  8.754   1.00 0.00 ? 5   HIS A HE1  1  
ATOM 72    N N    . GLN A 1 6   ? 5.661   -7.108  4.317   1.00 0.00 ? 6   GLN A N    1  
ATOM 73    C CA   . GLN A 1 6   ? 4.754   -5.976  4.085   1.00 0.00 ? 6   GLN A CA   1  
ATOM 74    C C    . GLN A 1 6   ? 4.793   -5.009  5.276   1.00 0.00 ? 6   GLN A C    1  
ATOM 75    O O    . GLN A 1 6   ? 4.831   -5.439  6.430   1.00 0.00 ? 6   GLN A O    1  
ATOM 76    C CB   . GLN A 1 6   ? 3.316   -6.488  3.882   1.00 0.00 ? 6   GLN A CB   1  
ATOM 77    C CG   . GLN A 1 6   ? 3.082   -7.096  2.493   1.00 0.00 ? 6   GLN A CG   1  
ATOM 78    C CD   . GLN A 1 6   ? 1.728   -7.812  2.413   1.00 0.00 ? 6   GLN A CD   1  
ATOM 79    O OE1  . GLN A 1 6   ? 0.805   -7.376  1.737   1.00 0.00 ? 6   GLN A OE1  1  
ATOM 80    N NE2  . GLN A 1 6   ? 1.535   -8.914  3.109   1.00 0.00 ? 6   GLN A NE2  1  
ATOM 81    H H    . GLN A 1 6   ? 5.258   -7.974  4.648   1.00 0.00 ? 6   GLN A H    1  
ATOM 82    H HA   . GLN A 1 6   ? 5.069   -5.432  3.188   1.00 0.00 ? 6   GLN A HA   1  
ATOM 83    H HB2  . GLN A 1 6   ? 3.096   -7.232  4.644   1.00 0.00 ? 6   GLN A HB2  1  
ATOM 84    H HB3  . GLN A 1 6   ? 2.616   -5.661  4.009   1.00 0.00 ? 6   GLN A HB3  1  
ATOM 85    H HG2  . GLN A 1 6   ? 3.107   -6.287  1.756   1.00 0.00 ? 6   GLN A HG2  1  
ATOM 86    H HG3  . GLN A 1 6   ? 3.873   -7.810  2.265   1.00 0.00 ? 6   GLN A HG3  1  
ATOM 87    H HE21 . GLN A 1 6   ? 2.260   -9.306  3.690   1.00 0.00 ? 6   GLN A HE21 1  
ATOM 88    H HE22 . GLN A 1 6   ? 0.595   -9.303  3.126   1.00 0.00 ? 6   GLN A HE22 1  
ATOM 89    N N    . GLU A 1 7   ? 4.749   -3.705  5.008   1.00 0.00 ? 7   GLU A N    1  
ATOM 90    C CA   . GLU A 1 7   ? 4.780   -2.654  6.030   1.00 0.00 ? 7   GLU A CA   1  
ATOM 91    C C    . GLU A 1 7   ? 3.388   -2.004  6.140   1.00 0.00 ? 7   GLU A C    1  
ATOM 92    O O    . GLU A 1 7   ? 2.975   -1.326  5.189   1.00 0.00 ? 7   GLU A O    1  
ATOM 93    C CB   . GLU A 1 7   ? 5.838   -1.607  5.642   1.00 0.00 ? 7   GLU A CB   1  
ATOM 94    C CG   . GLU A 1 7   ? 6.002   -0.488  6.682   1.00 0.00 ? 7   GLU A CG   1  
ATOM 95    C CD   . GLU A 1 7   ? 6.907   0.619   6.126   1.00 0.00 ? 7   GLU A CD   1  
ATOM 96    O OE1  . GLU A 1 7   ? 6.468   1.329   5.189   1.00 0.00 ? 7   GLU A OE1  1  
ATOM 97    O OE2  . GLU A 1 7   ? 8.050   0.781   6.614   1.00 0.00 ? 7   GLU A OE2  1  
ATOM 98    H H    . GLU A 1 7   ? 4.650   -3.409  4.045   1.00 0.00 ? 7   GLU A H    1  
ATOM 99    H HA   . GLU A 1 7   ? 5.083   -3.075  6.988   1.00 0.00 ? 7   GLU A HA   1  
ATOM 100   H HB2  . GLU A 1 7   ? 6.800   -2.106  5.522   1.00 0.00 ? 7   GLU A HB2  1  
ATOM 101   H HB3  . GLU A 1 7   ? 5.558   -1.163  4.685   1.00 0.00 ? 7   GLU A HB3  1  
ATOM 102   H HG2  . GLU A 1 7   ? 5.031   -0.053  6.926   1.00 0.00 ? 7   GLU A HG2  1  
ATOM 103   H HG3  . GLU A 1 7   ? 6.425   -0.909  7.597   1.00 0.00 ? 7   GLU A HG3  1  
ATOM 104   N N    . PRO A 1 8   ? 2.669   -2.162  7.271   1.00 0.00 ? 8   PRO A N    1  
ATOM 105   C CA   . PRO A 1 8   ? 1.449   -1.411  7.528   1.00 0.00 ? 8   PRO A CA   1  
ATOM 106   C C    . PRO A 1 8   ? 1.785   0.042   7.870   1.00 0.00 ? 8   PRO A C    1  
ATOM 107   O O    . PRO A 1 8   ? 2.772   0.329   8.550   1.00 0.00 ? 8   PRO A O    1  
ATOM 108   C CB   . PRO A 1 8   ? 0.742   -2.146  8.665   1.00 0.00 ? 8   PRO A CB   1  
ATOM 109   C CG   . PRO A 1 8   ? 1.896   -2.764  9.450   1.00 0.00 ? 8   PRO A CG   1  
ATOM 110   C CD   . PRO A 1 8   ? 2.950   -3.064  8.384   1.00 0.00 ? 8   PRO A CD   1  
ATOM 111   H HA   . PRO A 1 8   ? 0.809   -1.428  6.649   1.00 0.00 ? 8   PRO A HA   1  
ATOM 112   H HB2  . PRO A 1 8   ? 0.138   -1.478  9.279   1.00 0.00 ? 8   PRO A HB2  1  
ATOM 113   H HB3  . PRO A 1 8   ? 0.124   -2.941  8.243   1.00 0.00 ? 8   PRO A HB3  1  
ATOM 114   H HG2  . PRO A 1 8   ? 2.290   -2.036  10.157  1.00 0.00 ? 8   PRO A HG2  1  
ATOM 115   H HG3  . PRO A 1 8   ? 1.576   -3.666  9.970   1.00 0.00 ? 8   PRO A HG3  1  
ATOM 116   H HD2  . PRO A 1 8   ? 3.947   -2.899  8.795   1.00 0.00 ? 8   PRO A HD2  1  
ATOM 117   H HD3  . PRO A 1 8   ? 2.849   -4.098  8.047   1.00 0.00 ? 8   PRO A HD3  1  
ATOM 118   N N    . LYS A 1 9   ? 0.957   0.968   7.384   1.00 0.00 ? 9   LYS A N    1  
ATOM 119   C CA   . LYS A 1 9   ? 1.122   2.408   7.605   1.00 0.00 ? 9   LYS A CA   1  
ATOM 120   C C    . LYS A 1 9   ? 0.342   2.858   8.860   1.00 0.00 ? 9   LYS A C    1  
ATOM 121   O O    . LYS A 1 9   ? -0.757  2.349   9.106   1.00 0.00 ? 9   LYS A O    1  
ATOM 122   C CB   . LYS A 1 9   ? 0.670   3.151   6.332   1.00 0.00 ? 9   LYS A CB   1  
ATOM 123   C CG   . LYS A 1 9   ? 1.750   3.263   5.239   1.00 0.00 ? 9   LYS A CG   1  
ATOM 124   C CD   . LYS A 1 9   ? 2.468   1.960   4.835   1.00 0.00 ? 9   LYS A CD   1  
ATOM 125   C CE   . LYS A 1 9   ? 3.343   2.239   3.604   1.00 0.00 ? 9   LYS A CE   1  
ATOM 126   N NZ   . LYS A 1 9   ? 4.322   1.148   3.360   1.00 0.00 ? 9   LYS A NZ   1  
ATOM 127   H H    . LYS A 1 9   ? 0.150   0.667   6.852   1.00 0.00 ? 9   LYS A H    1  
ATOM 128   H HA   . LYS A 1 9   ? 2.182   2.622   7.769   1.00 0.00 ? 9   LYS A HA   1  
ATOM 129   H HB2  . LYS A 1 9   ? -0.212  2.665   5.914   1.00 0.00 ? 9   LYS A HB2  1  
ATOM 130   H HB3  . LYS A 1 9   ? 0.373   4.169   6.597   1.00 0.00 ? 9   LYS A HB3  1  
ATOM 131   H HG2  . LYS A 1 9   ? 1.272   3.683   4.354   1.00 0.00 ? 9   LYS A HG2  1  
ATOM 132   H HG3  . LYS A 1 9   ? 2.504   3.973   5.579   1.00 0.00 ? 9   LYS A HG3  1  
ATOM 133   H HD2  . LYS A 1 9   ? 3.094   1.610   5.659   1.00 0.00 ? 9   LYS A HD2  1  
ATOM 134   H HD3  . LYS A 1 9   ? 1.745   1.177   4.592   1.00 0.00 ? 9   LYS A HD3  1  
ATOM 135   H HE2  . LYS A 1 9   ? 2.689   2.362   2.736   1.00 0.00 ? 9   LYS A HE2  1  
ATOM 136   H HE3  . LYS A 1 9   ? 3.882   3.181   3.754   1.00 0.00 ? 9   LYS A HE3  1  
ATOM 137   H HZ1  . LYS A 1 9   ? 4.784   1.275   2.469   1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 138   H HZ2  . LYS A 1 9   ? 5.051   1.164   4.077   1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 139   H HZ3  . LYS A 1 9   ? 3.869   0.242   3.365   1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 140   N N    . PRO A 1 10  ? 0.878   3.795   9.673   1.00 0.00 ? 10  PRO A N    1  
ATOM 141   C CA   . PRO A 1 10  ? 0.249   4.203   10.928  1.00 0.00 ? 10  PRO A CA   1  
ATOM 142   C C    . PRO A 1 10  ? -1.098  4.875   10.651  1.00 0.00 ? 10  PRO A C    1  
ATOM 143   O O    . PRO A 1 10  ? -1.207  5.761   9.805   1.00 0.00 ? 10  PRO A O    1  
ATOM 144   C CB   . PRO A 1 10  ? 1.266   5.096   11.650  1.00 0.00 ? 10  PRO A CB   1  
ATOM 145   C CG   . PRO A 1 10  ? 2.110   5.656   10.505  1.00 0.00 ? 10  PRO A CG   1  
ATOM 146   C CD   . PRO A 1 10  ? 2.141   4.502   9.500   1.00 0.00 ? 10  PRO A CD   1  
ATOM 147   H HA   . PRO A 1 10  ? 0.071   3.331   11.555  1.00 0.00 ? 10  PRO A HA   1  
ATOM 148   H HB2  . PRO A 1 10  ? 0.785   5.892   12.221  1.00 0.00 ? 10  PRO A HB2  1  
ATOM 149   H HB3  . PRO A 1 10  ? 1.894   4.473   12.302  1.00 0.00 ? 10  PRO A HB3  1  
ATOM 150   H HG2  . PRO A 1 10  ? 1.601   6.512   10.059  1.00 0.00 ? 10  PRO A HG2  1  
ATOM 151   H HG3  . PRO A 1 10  ? 3.111   5.936   10.837  1.00 0.00 ? 10  PRO A HG3  1  
ATOM 152   H HD2  . PRO A 1 10  ? 2.252   4.892   8.488   1.00 0.00 ? 10  PRO A HD2  1  
ATOM 153   H HD3  . PRO A 1 10  ? 2.966   3.829   9.744   1.00 0.00 ? 10  PRO A HD3  1  
ATOM 154   N N    . GLY A 1 11  ? -2.130  4.393   11.350  1.00 0.00 ? 11  GLY A N    1  
ATOM 155   C CA   . GLY A 1 11  ? -3.523  4.829   11.221  1.00 0.00 ? 11  GLY A CA   1  
ATOM 156   C C    . GLY A 1 11  ? -4.272  4.239   10.028  1.00 0.00 ? 11  GLY A C    1  
ATOM 157   O O    . GLY A 1 11  ? -5.450  4.548   9.861   1.00 0.00 ? 11  GLY A O    1  
ATOM 158   H H    . GLY A 1 11  ? -1.939  3.659   12.027  1.00 0.00 ? 11  GLY A H    1  
ATOM 159   H HA2  . GLY A 1 11  ? -4.063  4.528   12.116  1.00 0.00 ? 11  GLY A HA2  1  
ATOM 160   H HA3  . GLY A 1 11  ? -3.561  5.913   11.123  1.00 0.00 ? 11  GLY A HA3  1  
ATOM 161   N N    . ASP A 1 12  ? -3.629  3.435   9.181   1.00 0.00 ? 12  ASP A N    1  
ATOM 162   C CA   . ASP A 1 12  ? -4.272  2.640   8.125   1.00 0.00 ? 12  ASP A CA   1  
ATOM 163   C C    . ASP A 1 12  ? -4.621  1.229   8.627   1.00 0.00 ? 12  ASP A C    1  
ATOM 164   O O    . ASP A 1 12  ? -4.127  0.770   9.662   1.00 0.00 ? 12  ASP A O    1  
ATOM 165   C CB   . ASP A 1 12  ? -3.396  2.600   6.857   1.00 0.00 ? 12  ASP A CB   1  
ATOM 166   C CG   . ASP A 1 12  ? -3.643  3.836   5.982   1.00 0.00 ? 12  ASP A CG   1  
ATOM 167   O OD1  . ASP A 1 12  ? -4.602  3.797   5.177   1.00 0.00 ? 12  ASP A OD1  1  
ATOM 168   O OD2  . ASP A 1 12  ? -2.937  4.859   6.148   1.00 0.00 ? 12  ASP A OD2  1  
ATOM 169   H H    . ASP A 1 12  ? -2.660  3.218   9.387   1.00 0.00 ? 12  ASP A H    1  
ATOM 170   H HA   . ASP A 1 12  ? -5.217  3.107   7.850   1.00 0.00 ? 12  ASP A HA   1  
ATOM 171   H HB2  . ASP A 1 12  ? -2.344  2.530   7.123   1.00 0.00 ? 12  ASP A HB2  1  
ATOM 172   H HB3  . ASP A 1 12  ? -3.644  1.715   6.270   1.00 0.00 ? 12  ASP A HB3  1  
ATOM 173   N N    . LEU A 1 13  ? -5.520  0.561   7.894   1.00 0.00 ? 13  LEU A N    1  
ATOM 174   C CA   . LEU A 1 13  ? -6.120  -0.710  8.294   1.00 0.00 ? 13  LEU A CA   1  
ATOM 175   C C    . LEU A 1 13  ? -5.770  -1.878  7.367   1.00 0.00 ? 13  LEU A C    1  
ATOM 176   O O    . LEU A 1 13  ? -5.574  -1.739  6.158   1.00 0.00 ? 13  LEU A O    1  
ATOM 177   C CB   . LEU A 1 13  ? -7.624  -0.530  8.571   1.00 0.00 ? 13  LEU A CB   1  
ATOM 178   C CG   . LEU A 1 13  ? -8.492  -0.001  7.414   1.00 0.00 ? 13  LEU A CG   1  
ATOM 179   C CD1  . LEU A 1 13  ? -9.125  -1.152  6.622   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 180   C CD2  . LEU A 1 13  ? -9.577  0.915   7.993   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 181   H H    . LEU A 1 13  ? -5.822  0.967   7.018   1.00 0.00 ? 13  LEU A H    1  
ATOM 182   H HA   . LEU A 1 13  ? -5.678  -0.978  9.253   1.00 0.00 ? 13  LEU A HA   1  
ATOM 183   H HB2  . LEU A 1 13  ? -8.045  -1.468  8.944   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 184   H HB3  . LEU A 1 13  ? -7.693  0.172   9.398   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 185   H HG   . LEU A 1 13  ? -7.886  0.595   6.732   1.00 0.00 ? 13  LEU A HG   1  
ATOM 186   H HD11 . LEU A 1 13  ? -8.346  -1.736  6.138   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 187   H HD12 . LEU A 1 13  ? -9.693  -1.799  7.289   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 188   H HD13 . LEU A 1 13  ? -9.800  -0.762  5.862   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 189   H HD21 . LEU A 1 13  ? -10.247 1.243   7.202   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 190   H HD22 . LEU A 1 13  ? -10.147 0.388   8.757   1.00 0.00 ? 13  LEU A HD22 1  
ATOM 191   H HD23 . LEU A 1 13  ? -9.115  1.797   8.438   1.00 0.00 ? 13  LEU A HD23 1  
ATOM 192   N N    . ILE A 1 14  ? -5.657  -3.043  7.997   1.00 0.00 ? 14  ILE A N    1  
ATOM 193   C CA   . ILE A 1 14  ? -5.012  -4.257  7.505   1.00 0.00 ? 14  ILE A CA   1  
ATOM 194   C C    . ILE A 1 14  ? -6.043  -5.390  7.542   1.00 0.00 ? 14  ILE A C    1  
ATOM 195   O O    . ILE A 1 14  ? -6.674  -5.617  8.575   1.00 0.00 ? 14  ILE A O    1  
ATOM 196   C CB   . ILE A 1 14  ? -3.797  -4.639  8.402   1.00 0.00 ? 14  ILE A CB   1  
ATOM 197   C CG1  . ILE A 1 14  ? -2.995  -3.452  8.999   1.00 0.00 ? 14  ILE A CG1  1  
ATOM 198   C CG2  . ILE A 1 14  ? -2.859  -5.547  7.584   1.00 0.00 ? 14  ILE A CG2  1  
ATOM 199   C CD1  . ILE A 1 14  ? -1.992  -3.887  10.076  1.00 0.00 ? 14  ILE A CD1  1  
ATOM 200   H H    . ILE A 1 14  ? -5.944  -3.053  8.973   1.00 0.00 ? 14  ILE A H    1  
ATOM 201   H HA   . ILE A 1 14  ? -4.678  -4.106  6.478   1.00 0.00 ? 14  ILE A HA   1  
ATOM 202   H HB   . ILE A 1 14  ? -4.178  -5.211  9.247   1.00 0.00 ? 14  ILE A HB   1  
ATOM 203   H HG12 . ILE A 1 14  ? -2.471  -2.920  8.203   1.00 0.00 ? 14  ILE A HG12 1  
ATOM 204   H HG13 . ILE A 1 14  ? -3.672  -2.752  9.488   1.00 0.00 ? 14  ILE A HG13 1  
ATOM 205   H HG21 . ILE A 1 14  ? -2.368  -4.966  6.801   1.00 0.00 ? 14  ILE A HG21 1  
ATOM 206   H HG22 . ILE A 1 14  ? -2.097  -5.993  8.224   1.00 0.00 ? 14  ILE A HG22 1  
ATOM 207   H HG23 . ILE A 1 14  ? -3.424  -6.356  7.122   1.00 0.00 ? 14  ILE A HG23 1  
ATOM 208   H HD11 . ILE A 1 14  ? -2.507  -4.451  10.855  1.00 0.00 ? 14  ILE A HD11 1  
ATOM 209   H HD12 . ILE A 1 14  ? -1.198  -4.498  9.647   1.00 0.00 ? 14  ILE A HD12 1  
ATOM 210   H HD13 . ILE A 1 14  ? -1.548  -3.003  10.529  1.00 0.00 ? 14  ILE A HD13 1  
ATOM 211   N N    . GLU A 1 15  ? -6.196  -6.103  6.434   1.00 0.00 ? 15  GLU A N    1  
ATOM 212   C CA   . GLU A 1 15  ? -6.964  -7.337  6.342   1.00 0.00 ? 15  GLU A CA   1  
ATOM 213   C C    . GLU A 1 15  ? -6.067  -8.486  6.829   1.00 0.00 ? 15  GLU A C    1  
ATOM 214   O O    . GLU A 1 15  ? -4.957  -8.656  6.319   1.00 0.00 ? 15  GLU A O    1  
ATOM 215   C CB   . GLU A 1 15  ? -7.382  -7.516  4.875   1.00 0.00 ? 15  GLU A CB   1  
ATOM 216   C CG   . GLU A 1 15  ? -8.424  -8.615  4.664   1.00 0.00 ? 15  GLU A CG   1  
ATOM 217   C CD   . GLU A 1 15  ? -8.728  -8.801  3.166   1.00 0.00 ? 15  GLU A CD   1  
ATOM 218   O OE1  . GLU A 1 15  ? -8.978  -7.795  2.456   1.00 0.00 ? 15  GLU A OE1  1  
ATOM 219   O OE2  . GLU A 1 15  ? -8.713  -9.961  2.688   1.00 0.00 ? 15  GLU A OE2  1  
ATOM 220   H H    . GLU A 1 15  ? -5.615  -5.878  5.636   1.00 0.00 ? 15  GLU A H    1  
ATOM 221   H HA   . GLU A 1 15  ? -7.858  -7.264  6.964   1.00 0.00 ? 15  GLU A HA   1  
ATOM 222   H HB2  . GLU A 1 15  ? -7.802  -6.575  4.519   1.00 0.00 ? 15  GLU A HB2  1  
ATOM 223   H HB3  . GLU A 1 15  ? -6.499  -7.738  4.273   1.00 0.00 ? 15  GLU A HB3  1  
ATOM 224   H HG2  . GLU A 1 15  ? -8.050  -9.551  5.085   1.00 0.00 ? 15  GLU A HG2  1  
ATOM 225   H HG3  . GLU A 1 15  ? -9.341  -8.345  5.190   1.00 0.00 ? 15  GLU A HG3  1  
ATOM 226   N N    . ILE A 1 16  ? -6.517  -9.257  7.825   1.00 0.00 ? 16  ILE A N    1  
ATOM 227   C CA   . ILE A 1 16  ? -5.742  -10.324 8.482   1.00 0.00 ? 16  ILE A CA   1  
ATOM 228   C C    . ILE A 1 16  ? -6.430  -11.682 8.285   1.00 0.00 ? 16  ILE A C    1  
ATOM 229   O O    . ILE A 1 16  ? -7.538  -11.910 8.774   1.00 0.00 ? 16  ILE A O    1  
ATOM 230   C CB   . ILE A 1 16  ? -5.573  -10.048 10.002  1.00 0.00 ? 16  ILE A CB   1  
ATOM 231   C CG1  . ILE A 1 16  ? -5.115  -8.621  10.390  1.00 0.00 ? 16  ILE A CG1  1  
ATOM 232   C CG2  . ILE A 1 16  ? -4.624  -11.095 10.618  1.00 0.00 ? 16  ILE A CG2  1  
ATOM 233   C CD1  . ILE A 1 16  ? -3.738  -8.201  9.869   1.00 0.00 ? 16  ILE A CD1  1  
ATOM 234   H H    . ILE A 1 16  ? -7.450  -9.062  8.187   1.00 0.00 ? 16  ILE A H    1  
ATOM 235   H HA   . ILE A 1 16  ? -4.748  -10.385 8.035   1.00 0.00 ? 16  ILE A HA   1  
ATOM 236   H HB   . ILE A 1 16  ? -6.548  -10.181 10.470  1.00 0.00 ? 16  ILE A HB   1  
ATOM 237   H HG12 . ILE A 1 16  ? -5.852  -7.900  10.037  1.00 0.00 ? 16  ILE A HG12 1  
ATOM 238   H HG13 . ILE A 1 16  ? -5.100  -8.548  11.476  1.00 0.00 ? 16  ILE A HG13 1  
ATOM 239   H HG21 . ILE A 1 16  ? -4.496  -10.901 11.681  1.00 0.00 ? 16  ILE A HG21 1  
ATOM 240   H HG22 . ILE A 1 16  ? -5.035  -12.097 10.511  1.00 0.00 ? 16  ILE A HG22 1  
ATOM 241   H HG23 . ILE A 1 16  ? -3.651  -11.070 10.126  1.00 0.00 ? 16  ILE A HG23 1  
ATOM 242   H HD11 . ILE A 1 16  ? -2.965  -8.896  10.199  1.00 0.00 ? 16  ILE A HD11 1  
ATOM 243   H HD12 . ILE A 1 16  ? -3.759  -8.164  8.783   1.00 0.00 ? 16  ILE A HD12 1  
ATOM 244   H HD13 . ILE A 1 16  ? -3.494  -7.212  10.256  1.00 0.00 ? 16  ILE A HD13 1  
ATOM 245   N N    . PHE A 1 17  ? -5.742  -12.623 7.644   1.00 0.00 ? 17  PHE A N    1  
ATOM 246   C CA   . PHE A 1 17  ? -6.145  -14.026 7.554   1.00 0.00 ? 17  PHE A CA   1  
ATOM 247   C C    . PHE A 1 17  ? -5.716  -14.743 8.849   1.00 0.00 ? 17  PHE A C    1  
ATOM 248   O O    . PHE A 1 17  ? -4.728  -15.480 8.882   1.00 0.00 ? 17  PHE A O    1  
ATOM 249   C CB   . PHE A 1 17  ? -5.541  -14.625 6.272   1.00 0.00 ? 17  PHE A CB   1  
ATOM 250   C CG   . PHE A 1 17  ? -5.934  -16.063 6.001   1.00 0.00 ? 17  PHE A CG   1  
ATOM 251   C CD1  . PHE A 1 17  ? -7.272  -16.380 5.692   1.00 0.00 ? 17  PHE A CD1  1  
ATOM 252   C CD2  . PHE A 1 17  ? -4.969  -17.091 6.048   1.00 0.00 ? 17  PHE A CD2  1  
ATOM 253   C CE1  . PHE A 1 17  ? -7.644  -17.712 5.438   1.00 0.00 ? 17  PHE A CE1  1  
ATOM 254   C CE2  . PHE A 1 17  ? -5.342  -18.423 5.793   1.00 0.00 ? 17  PHE A CE2  1  
ATOM 255   C CZ   . PHE A 1 17  ? -6.678  -18.734 5.485   1.00 0.00 ? 17  PHE A CZ   1  
ATOM 256   H H    . PHE A 1 17  ? -4.819  -12.391 7.300   1.00 0.00 ? 17  PHE A H    1  
ATOM 257   H HA   . PHE A 1 17  ? -7.233  -14.086 7.477   1.00 0.00 ? 17  PHE A HA   1  
ATOM 258   H HB2  . PHE A 1 17  ? -5.851  -14.019 5.418   1.00 0.00 ? 17  PHE A HB2  1  
ATOM 259   H HB3  . PHE A 1 17  ? -4.456  -14.550 6.337   1.00 0.00 ? 17  PHE A HB3  1  
ATOM 260   H HD1  . PHE A 1 17  ? -8.018  -15.601 5.650   1.00 0.00 ? 17  PHE A HD1  1  
ATOM 261   H HD2  . PHE A 1 17  ? -3.939  -16.861 6.281   1.00 0.00 ? 17  PHE A HD2  1  
ATOM 262   H HE1  . PHE A 1 17  ? -8.676  -17.950 5.213   1.00 0.00 ? 17  PHE A HE1  1  
ATOM 263   H HE2  . PHE A 1 17  ? -4.600  -19.208 5.831   1.00 0.00 ? 17  PHE A HE2  1  
ATOM 264   H HZ   . PHE A 1 17  ? -6.966  -19.758 5.289   1.00 0.00 ? 17  PHE A HZ   1  
ATOM 265   N N    . ARG A 1 18  ? -6.432  -14.449 9.946   1.00 0.00 ? 18  ARG A N    1  
ATOM 266   C CA   . ARG A 1 18  ? -6.078  -14.864 11.317  1.00 0.00 ? 18  ARG A CA   1  
ATOM 267   C C    . ARG A 1 18  ? -6.366  -16.346 11.601  1.00 0.00 ? 18  ARG A C    1  
ATOM 268   O O    . ARG A 1 18  ? -5.748  -16.948 12.479  1.00 0.00 ? 18  ARG A O    1  
ATOM 269   C CB   . ARG A 1 18  ? -6.796  -13.939 12.326  1.00 0.00 ? 18  ARG A CB   1  
ATOM 270   C CG   . ARG A 1 18  ? -5.937  -13.474 13.516  1.00 0.00 ? 18  ARG A CG   1  
ATOM 271   C CD   . ARG A 1 18  ? -5.546  -14.581 14.507  1.00 0.00 ? 18  ARG A CD   1  
ATOM 272   N NE   . ARG A 1 18  ? -5.050  -14.009 15.774  1.00 0.00 ? 18  ARG A NE   1  
ATOM 273   C CZ   . ARG A 1 18  ? -3.791  -13.744 16.116  1.00 0.00 ? 18  ARG A CZ   1  
ATOM 274   N NH1  . ARG A 1 18  ? -2.778  -13.973 15.310  1.00 0.00 ? 18  ARG A NH1  1  
ATOM 275   N NH2  . ARG A 1 18  ? -3.537  -13.227 17.298  1.00 0.00 ? 18  ARG A NH2  1  
ATOM 276   H H    . ARG A 1 18  ? -7.203  -13.803 9.830   1.00 0.00 ? 18  ARG A H    1  
ATOM 277   H HA   . ARG A 1 18  ? -5.016  -14.730 11.444  1.00 0.00 ? 18  ARG A HA   1  
ATOM 278   H HB2  . ARG A 1 18  ? -7.117  -13.032 11.809  1.00 0.00 ? 18  ARG A HB2  1  
ATOM 279   H HB3  . ARG A 1 18  ? -7.695  -14.431 12.698  1.00 0.00 ? 18  ARG A HB3  1  
ATOM 280   H HG2  . ARG A 1 18  ? -5.030  -12.992 13.145  1.00 0.00 ? 18  ARG A HG2  1  
ATOM 281   H HG3  . ARG A 1 18  ? -6.515  -12.723 14.053  1.00 0.00 ? 18  ARG A HG3  1  
ATOM 282   H HD2  . ARG A 1 18  ? -6.426  -15.189 14.727  1.00 0.00 ? 18  ARG A HD2  1  
ATOM 283   H HD3  . ARG A 1 18  ? -4.792  -15.230 14.061  1.00 0.00 ? 18  ARG A HD3  1  
ATOM 284   H HE   . ARG A 1 18  ? -5.760  -13.811 16.465  1.00 0.00 ? 18  ARG A HE   1  
ATOM 285   H HH11 . ARG A 1 18  ? -2.930  -14.331 14.382  1.00 0.00 ? 18  ARG A HH11 1  
ATOM 286   H HH12 . ARG A 1 18  ? -1.840  -13.711 15.598  1.00 0.00 ? 18  ARG A HH12 1  
ATOM 287   H HH21 . ARG A 1 18  ? -4.282  -13.046 17.951  1.00 0.00 ? 18  ARG A HH21 1  
ATOM 288   H HH22 . ARG A 1 18  ? -2.588  -13.017 17.603  1.00 0.00 ? 18  ARG A HH22 1  
ATOM 289   N N    . LEU A 1 19  ? -7.324  -16.919 10.874  1.00 0.00 ? 19  LEU A N    1  
ATOM 290   C CA   . LEU A 1 19  ? -8.070  -18.136 11.210  1.00 0.00 ? 19  LEU A CA   1  
ATOM 291   C C    . LEU A 1 19  ? -8.724  -18.688 9.923   1.00 0.00 ? 19  LEU A C    1  
ATOM 292   O O    . LEU A 1 19  ? -8.327  -18.310 8.817   1.00 0.00 ? 19  LEU A O    1  
ATOM 293   C CB   . LEU A 1 19  ? -9.088  -17.727 12.315  1.00 0.00 ? 19  LEU A CB   1  
ATOM 294   C CG   . LEU A 1 19  ? -8.633  -17.941 13.774  1.00 0.00 ? 19  LEU A CG   1  
ATOM 295   C CD1  . LEU A 1 19  ? -9.702  -17.380 14.725  1.00 0.00 ? 19  LEU A CD1  1  
ATOM 296   C CD2  . LEU A 1 19  ? -8.397  -19.423 14.107  1.00 0.00 ? 19  LEU A CD2  1  
ATOM 297   H H    . LEU A 1 19  ? -7.710  -16.370 10.118  1.00 0.00 ? 19  LEU A H    1  
ATOM 298   H HA   . LEU A 1 19  ? -7.392  -18.909 11.572  1.00 0.00 ? 19  LEU A HA   1  
ATOM 299   H HB2  . LEU A 1 19  ? -9.305  -16.661 12.189  1.00 0.00 ? 19  LEU A HB2  1  
ATOM 300   H HB3  . LEU A 1 19  ? -10.033 -18.256 12.189  1.00 0.00 ? 19  LEU A HB3  1  
ATOM 301   H HG   . LEU A 1 19  ? -7.712  -17.388 13.952  1.00 0.00 ? 19  LEU A HG   1  
ATOM 302   H HD11 . LEU A 1 19  ? -10.647 -17.907 14.583  1.00 0.00 ? 19  LEU A HD11 1  
ATOM 303   H HD12 . LEU A 1 19  ? -9.375  -17.500 15.758  1.00 0.00 ? 19  LEU A HD12 1  
ATOM 304   H HD13 . LEU A 1 19  ? -9.848  -16.318 14.530  1.00 0.00 ? 19  LEU A HD13 1  
ATOM 305   H HD21 . LEU A 1 19  ? -7.569  -19.818 13.524  1.00 0.00 ? 19  LEU A HD21 1  
ATOM 306   H HD22 . LEU A 1 19  ? -8.144  -19.524 15.163  1.00 0.00 ? 19  LEU A HD22 1  
ATOM 307   H HD23 . LEU A 1 19  ? -9.295  -20.006 13.900  1.00 0.00 ? 19  LEU A HD23 1  
ATOM 308   N N    . GLY A 1 20  ? -9.760  -19.530 10.038  1.00 0.00 ? 20  GLY A N    1  
ATOM 309   C CA   . GLY A 1 20  ? -10.617 -19.964 8.918   1.00 0.00 ? 20  GLY A CA   1  
ATOM 310   C C    . GLY A 1 20  ? -11.601 -18.870 8.465   1.00 0.00 ? 20  GLY A C    1  
ATOM 311   O O    . GLY A 1 20  ? -12.732 -19.174 8.089   1.00 0.00 ? 20  GLY A O    1  
ATOM 312   H H    . GLY A 1 20  ? -10.028 -19.821 10.969  1.00 0.00 ? 20  GLY A H    1  
ATOM 313   H HA2  . GLY A 1 20  ? -9.993  -20.216 8.060   1.00 0.00 ? 20  GLY A HA2  1  
ATOM 314   H HA3  . GLY A 1 20  ? -11.197 -20.836 9.218   1.00 0.00 ? 20  GLY A HA3  1  
ATOM 315   N N    . TYR A 1 21  ? -11.173 -17.607 8.542   1.00 0.00 ? 21  TYR A N    1  
ATOM 316   C CA   . TYR A 1 21  ? -11.944 -16.372 8.373   1.00 0.00 ? 21  TYR A CA   1  
ATOM 317   C C    . TYR A 1 21  ? -11.008 -15.141 8.284   1.00 0.00 ? 21  TYR A C    1  
ATOM 318   O O    . TYR A 1 21  ? -9.862  -15.189 8.747   1.00 0.00 ? 21  TYR A O    1  
ATOM 319   C CB   . TYR A 1 21  ? -12.938 -16.233 9.542   1.00 0.00 ? 21  TYR A CB   1  
ATOM 320   C CG   . TYR A 1 21  ? -13.885 -15.055 9.418   1.00 0.00 ? 21  TYR A CG   1  
ATOM 321   C CD1  . TYR A 1 21  ? -14.751 -14.973 8.311   1.00 0.00 ? 21  TYR A CD1  1  
ATOM 322   C CD2  . TYR A 1 21  ? -13.873 -14.027 10.382  1.00 0.00 ? 21  TYR A CD2  1  
ATOM 323   C CE1  . TYR A 1 21  ? -15.581 -13.848 8.144   1.00 0.00 ? 21  TYR A CE1  1  
ATOM 324   C CE2  . TYR A 1 21  ? -14.713 -12.908 10.232  1.00 0.00 ? 21  TYR A CE2  1  
ATOM 325   C CZ   . TYR A 1 21  ? -15.554 -12.809 9.099   1.00 0.00 ? 21  TYR A CZ   1  
ATOM 326   O OH   . TYR A 1 21  ? -16.333 -11.711 8.914   1.00 0.00 ? 21  TYR A OH   1  
ATOM 327   H H    . TYR A 1 21  ? -10.196 -17.485 8.771   1.00 0.00 ? 21  TYR A H    1  
ATOM 328   H HA   . TYR A 1 21  ? -12.498 -16.439 7.436   1.00 0.00 ? 21  TYR A HA   1  
ATOM 329   H HB2  . TYR A 1 21  ? -13.542 -17.136 9.618   1.00 0.00 ? 21  TYR A HB2  1  
ATOM 330   H HB3  . TYR A 1 21  ? -12.368 -16.147 10.470  1.00 0.00 ? 21  TYR A HB3  1  
ATOM 331   H HD1  . TYR A 1 21  ? -14.774 -15.768 7.578   1.00 0.00 ? 21  TYR A HD1  1  
ATOM 332   H HD2  . TYR A 1 21  ? -13.209 -14.089 11.234  1.00 0.00 ? 21  TYR A HD2  1  
ATOM 333   H HE1  . TYR A 1 21  ? -16.234 -13.775 7.286   1.00 0.00 ? 21  TYR A HE1  1  
ATOM 334   H HE2  . TYR A 1 21  ? -14.692 -12.115 10.968  1.00 0.00 ? 21  TYR A HE2  1  
ATOM 335   H HH   . TYR A 1 21  ? -16.237 -11.062 9.620   1.00 0.00 ? 21  TYR A HH   1  
ATOM 336   N N    . GLU A 1 22  ? -11.497 -14.035 7.710   1.00 0.00 ? 22  GLU A N    1  
ATOM 337   C CA   . GLU A 1 22  ? -10.745 -12.790 7.520   1.00 0.00 ? 22  GLU A CA   1  
ATOM 338   C C    . GLU A 1 22  ? -11.180 -11.728 8.543   1.00 0.00 ? 22  GLU A C    1  
ATOM 339   O O    . GLU A 1 22  ? -12.354 -11.365 8.633   1.00 0.00 ? 22  GLU A O    1  
ATOM 340   C CB   . GLU A 1 22  ? -10.919 -12.243 6.092   1.00 0.00 ? 22  GLU A CB   1  
ATOM 341   C CG   . GLU A 1 22  ? -10.375 -13.164 4.989   1.00 0.00 ? 22  GLU A CG   1  
ATOM 342   C CD   . GLU A 1 22  ? -11.312 -14.345 4.682   1.00 0.00 ? 22  GLU A CD   1  
ATOM 343   O OE1  . GLU A 1 22  ? -12.439 -14.117 4.180   1.00 0.00 ? 22  GLU A OE1  1  
ATOM 344   O OE2  . GLU A 1 22  ? -10.923 -15.513 4.922   1.00 0.00 ? 22  GLU A OE2  1  
ATOM 345   H H    . GLU A 1 22  ? -12.459 -14.042 7.407   1.00 0.00 ? 22  GLU A H    1  
ATOM 346   H HA   . GLU A 1 22  ? -9.682  -12.987 7.659   1.00 0.00 ? 22  GLU A HA   1  
ATOM 347   H HB2  . GLU A 1 22  ? -11.972 -12.028 5.905   1.00 0.00 ? 22  GLU A HB2  1  
ATOM 348   H HB3  . GLU A 1 22  ? -10.376 -11.298 6.034   1.00 0.00 ? 22  GLU A HB3  1  
ATOM 349   H HG2  . GLU A 1 22  ? -10.261 -12.575 4.077   1.00 0.00 ? 22  GLU A HG2  1  
ATOM 350   H HG3  . GLU A 1 22  ? -9.386  -13.527 5.274   1.00 0.00 ? 22  GLU A HG3  1  
ATOM 351   N N    . HIS A 1 23  ? -10.215 -11.214 9.303   1.00 0.00 ? 23  HIS A N    1  
ATOM 352   C CA   . HIS A 1 23  ? -10.392 -10.174 10.316  1.00 0.00 ? 23  HIS A CA   1  
ATOM 353   C C    . HIS A 1 23  ? -9.841  -8.817  9.815   1.00 0.00 ? 23  HIS A C    1  
ATOM 354   O O    . HIS A 1 23  ? -9.086  -8.760  8.840   1.00 0.00 ? 23  HIS A O    1  
ATOM 355   C CB   . HIS A 1 23  ? -9.642  -10.591 11.601  1.00 0.00 ? 23  HIS A CB   1  
ATOM 356   C CG   . HIS A 1 23  ? -10.140 -11.839 12.298  1.00 0.00 ? 23  HIS A CG   1  
ATOM 357   N ND1  . HIS A 1 23  ? -10.464 -11.934 13.634  1.00 0.00 ? 23  HIS A ND1  1  
ATOM 358   C CD2  . HIS A 1 23  ? -10.194 -13.110 11.786  1.00 0.00 ? 23  HIS A CD2  1  
ATOM 359   C CE1  . HIS A 1 23  ? -10.701 -13.228 13.911  1.00 0.00 ? 23  HIS A CE1  1  
ATOM 360   N NE2  . HIS A 1 23  ? -10.562 -13.987 12.812  1.00 0.00 ? 23  HIS A NE2  1  
ATOM 361   H H    . HIS A 1 23  ? -9.259  -11.501 9.108   1.00 0.00 ? 23  HIS A H    1  
ATOM 362   H HA   . HIS A 1 23  ? -11.454 -10.050 10.546  1.00 0.00 ? 23  HIS A HA   1  
ATOM 363   H HB2  . HIS A 1 23  ? -8.590  -10.742 11.362  1.00 0.00 ? 23  HIS A HB2  1  
ATOM 364   H HB3  . HIS A 1 23  ? -9.694  -9.769  12.318  1.00 0.00 ? 23  HIS A HB3  1  
ATOM 365   H HD1  . HIS A 1 23  ? -10.508 -11.166 14.299  1.00 0.00 ? 23  HIS A HD1  1  
ATOM 366   H HD2  . HIS A 1 23  ? -9.945  -13.396 10.772  1.00 0.00 ? 23  HIS A HD2  1  
ATOM 367   H HE1  . HIS A 1 23  ? -10.974 -13.608 14.889  1.00 0.00 ? 23  HIS A HE1  1  
ATOM 368   N N    . TRP A 1 24  ? -10.157 -7.731  10.531  1.00 0.00 ? 24  TRP A N    1  
ATOM 369   C CA   . TRP A 1 24  ? -9.547  -6.411  10.323  1.00 0.00 ? 24  TRP A CA   1  
ATOM 370   C C    . TRP A 1 24  ? -8.678  -5.993  11.517  1.00 0.00 ? 24  TRP A C    1  
ATOM 371   O O    . TRP A 1 24  ? -8.966  -6.345  12.666  1.00 0.00 ? 24  TRP A O    1  
ATOM 372   C CB   . TRP A 1 24  ? -10.643 -5.363  10.104  1.00 0.00 ? 24  TRP A CB   1  
ATOM 373   C CG   . TRP A 1 24  ? -11.362 -5.417  8.795   1.00 0.00 ? 24  TRP A CG   1  
ATOM 374   C CD1  . TRP A 1 24  ? -12.675 -5.673  8.645   1.00 0.00 ? 24  TRP A CD1  1  
ATOM 375   C CD2  . TRP A 1 24  ? -10.862 -5.117  7.458   1.00 0.00 ? 24  TRP A CD2  1  
ATOM 376   N NE1  . TRP A 1 24  ? -13.021 -5.597  7.309   1.00 0.00 ? 24  TRP A NE1  1  
ATOM 377   C CE2  . TRP A 1 24  ? -11.939 -5.246  6.530   1.00 0.00 ? 24  TRP A CE2  1  
ATOM 378   C CE3  . TRP A 1 24  ? -9.614  -4.710  6.941   1.00 0.00 ? 24  TRP A CE3  1  
ATOM 379   C CZ2  . TRP A 1 24  ? -11.779 -5.009  5.157   1.00 0.00 ? 24  TRP A CZ2  1  
ATOM 380   C CZ3  . TRP A 1 24  ? -9.442  -4.468  5.567   1.00 0.00 ? 24  TRP A CZ3  1  
ATOM 381   C CH2  . TRP A 1 24  ? -10.518 -4.620  4.674   1.00 0.00 ? 24  TRP A CH2  1  
ATOM 382   H H    . TRP A 1 24  ? -10.788 -7.826  11.316  1.00 0.00 ? 24  TRP A H    1  
ATOM 383   H HA   . TRP A 1 24  ? -8.914  -6.425  9.436   1.00 0.00 ? 24  TRP A HA   1  
ATOM 384   H HB2  . TRP A 1 24  ? -11.383 -5.433  10.903  1.00 0.00 ? 24  TRP A HB2  1  
ATOM 385   H HB3  . TRP A 1 24  ? -10.184 -4.379  10.172  1.00 0.00 ? 24  TRP A HB3  1  
ATOM 386   H HD1  . TRP A 1 24  ? -13.345 -5.881  9.468   1.00 0.00 ? 24  TRP A HD1  1  
ATOM 387   H HE1  . TRP A 1 24  ? -13.959 -5.755  6.962   1.00 0.00 ? 24  TRP A HE1  1  
ATOM 388   H HE3  . TRP A 1 24  ? -8.784  -4.572  7.616   1.00 0.00 ? 24  TRP A HE3  1  
ATOM 389   H HZ2  . TRP A 1 24  ? -12.619 -5.110  4.485   1.00 0.00 ? 24  TRP A HZ2  1  
ATOM 390   H HZ3  . TRP A 1 24  ? -8.474  -4.155  5.200   1.00 0.00 ? 24  TRP A HZ3  1  
ATOM 391   H HH2  . TRP A 1 24  ? -10.379 -4.422  3.618   1.00 0.00 ? 24  TRP A HH2  1  
ATOM 392   N N    . ALA A 1 25  ? -7.658  -5.171  11.257  1.00 0.00 ? 25  ALA A N    1  
ATOM 393   C CA   . ALA A 1 25  ? -6.855  -4.501  12.281  1.00 0.00 ? 25  ALA A CA   1  
ATOM 394   C C    . ALA A 1 25  ? -6.408  -3.088  11.860  1.00 0.00 ? 25  ALA A C    1  
ATOM 395   O O    . ALA A 1 25  ? -6.327  -2.796  10.673  1.00 0.00 ? 25  ALA A O    1  
ATOM 396   C CB   . ALA A 1 25  ? -5.654  -5.398  12.620  1.00 0.00 ? 25  ALA A CB   1  
ATOM 397   H H    . ALA A 1 25  ? -7.421  -4.996  10.283  1.00 0.00 ? 25  ALA A H    1  
ATOM 398   H HA   . ALA A 1 25  ? -7.486  -4.374  13.160  1.00 0.00 ? 25  ALA A HA   1  
ATOM 399   H HB1  . ALA A 1 25  ? -5.998  -6.390  12.911  1.00 0.00 ? 25  ALA A HB1  1  
ATOM 400   H HB2  . ALA A 1 25  ? -5.002  -5.492  11.752  1.00 0.00 ? 25  ALA A HB2  1  
ATOM 401   H HB3  . ALA A 1 25  ? -5.091  -4.958  13.442  1.00 0.00 ? 25  ALA A HB3  1  
ATOM 402   N N    . LEU A 1 26  ? -6.103  -2.224  12.831  1.00 0.00 ? 26  LEU A N    1  
ATOM 403   C CA   . LEU A 1 26  ? -5.695  -0.821  12.665  1.00 0.00 ? 26  LEU A CA   1  
ATOM 404   C C    . LEU A 1 26  ? -4.337  -0.619  13.346  1.00 0.00 ? 26  LEU A C    1  
ATOM 405   O O    . LEU A 1 26  ? -4.223  -0.841  14.549  1.00 0.00 ? 26  LEU A O    1  
ATOM 406   C CB   . LEU A 1 26  ? -6.793  0.046   13.328  1.00 0.00 ? 26  LEU A CB   1  
ATOM 407   C CG   . LEU A 1 26  ? -6.850  1.559   13.015  1.00 0.00 ? 26  LEU A CG   1  
ATOM 408   C CD1  . LEU A 1 26  ? -5.551  2.322   13.287  1.00 0.00 ? 26  LEU A CD1  1  
ATOM 409   C CD2  . LEU A 1 26  ? -7.305  1.815   11.573  1.00 0.00 ? 26  LEU A CD2  1  
ATOM 410   H H    . LEU A 1 26  ? -6.231  -2.551  13.784  1.00 0.00 ? 26  LEU A H    1  
ATOM 411   H HA   . LEU A 1 26  ? -5.611  -0.569  11.605  1.00 0.00 ? 26  LEU A HA   1  
ATOM 412   H HB2  . LEU A 1 26  ? -7.758  -0.374  13.045  1.00 0.00 ? 26  LEU A HB2  1  
ATOM 413   H HB3  . LEU A 1 26  ? -6.723  -0.067  14.408  1.00 0.00 ? 26  LEU A HB3  1  
ATOM 414   H HG   . LEU A 1 26  ? -7.605  1.974   13.681  1.00 0.00 ? 26  LEU A HG   1  
ATOM 415   H HD11 . LEU A 1 26  ? -5.165  2.058   14.269  1.00 0.00 ? 26  LEU A HD11 1  
ATOM 416   H HD12 . LEU A 1 26  ? -4.803  2.096   12.528  1.00 0.00 ? 26  LEU A HD12 1  
ATOM 417   H HD13 . LEU A 1 26  ? -5.752  3.394   13.272  1.00 0.00 ? 26  LEU A HD13 1  
ATOM 418   H HD21 . LEU A 1 26  ? -7.453  2.881   11.416  1.00 0.00 ? 26  LEU A HD21 1  
ATOM 419   H HD22 . LEU A 1 26  ? -6.547  1.464   10.873  1.00 0.00 ? 26  LEU A HD22 1  
ATOM 420   H HD23 . LEU A 1 26  ? -8.250  1.303   11.383  1.00 0.00 ? 26  LEU A HD23 1  
ATOM 421   N N    . TYR A 1 27  ? -3.317  -0.191  12.602  1.00 0.00 ? 27  TYR A N    1  
ATOM 422   C CA   . TYR A 1 27  ? -1.953  0.018   13.110  1.00 0.00 ? 27  TYR A CA   1  
ATOM 423   C C    . TYR A 1 27  ? -1.836  1.325   13.921  1.00 0.00 ? 27  TYR A C    1  
ATOM 424   O O    . TYR A 1 27  ? -1.607  2.401   13.367  1.00 0.00 ? 27  TYR A O    1  
ATOM 425   C CB   . TYR A 1 27  ? -1.001  -0.053  11.903  1.00 0.00 ? 27  TYR A CB   1  
ATOM 426   C CG   . TYR A 1 27  ? 0.476   -0.239  12.203  1.00 0.00 ? 27  TYR A CG   1  
ATOM 427   C CD1  . TYR A 1 27  ? 0.926   -1.353  12.936  1.00 0.00 ? 27  TYR A CD1  1  
ATOM 428   C CD2  . TYR A 1 27  ? 1.420   0.640   11.645  1.00 0.00 ? 27  TYR A CD2  1  
ATOM 429   C CE1  . TYR A 1 27  ? 2.304   -1.587  13.103  1.00 0.00 ? 27  TYR A CE1  1  
ATOM 430   C CE2  . TYR A 1 27  ? 2.798   0.419   11.803  1.00 0.00 ? 27  TYR A CE2  1  
ATOM 431   C CZ   . TYR A 1 27  ? 3.247   -0.710  12.520  1.00 0.00 ? 27  TYR A CZ   1  
ATOM 432   O OH   . TYR A 1 27  ? 4.579   -0.968  12.626  1.00 0.00 ? 27  TYR A OH   1  
ATOM 433   H H    . TYR A 1 27  ? -3.476  -0.015  11.616  1.00 0.00 ? 27  TYR A H    1  
ATOM 434   H HA   . TYR A 1 27  ? -1.700  -0.799  13.783  1.00 0.00 ? 27  TYR A HA   1  
ATOM 435   H HB2  . TYR A 1 27  ? -1.301  -0.896  11.282  1.00 0.00 ? 27  TYR A HB2  1  
ATOM 436   H HB3  . TYR A 1 27  ? -1.143  0.839   11.297  1.00 0.00 ? 27  TYR A HB3  1  
ATOM 437   H HD1  . TYR A 1 27  ? 0.216   -2.049  13.351  1.00 0.00 ? 27  TYR A HD1  1  
ATOM 438   H HD2  . TYR A 1 27  ? 1.090   1.472   11.053  1.00 0.00 ? 27  TYR A HD2  1  
ATOM 439   H HE1  . TYR A 1 27  ? 2.642   -2.451  13.655  1.00 0.00 ? 27  TYR A HE1  1  
ATOM 440   H HE2  . TYR A 1 27  ? 3.510   1.089   11.343  1.00 0.00 ? 27  TYR A HE2  1  
ATOM 441   H HH   . TYR A 1 27  ? 5.119   -0.327  12.152  1.00 0.00 ? 27  TYR A HH   1  
ATOM 442   N N    . ILE A 1 28  ? -2.024  1.252   15.244  1.00 0.00 ? 28  ILE A N    1  
ATOM 443   C CA   . ILE A 1 28  ? -2.037  2.432   16.140  1.00 0.00 ? 28  ILE A CA   1  
ATOM 444   C C    . ILE A 1 28  ? -0.651  2.948   16.549  1.00 0.00 ? 28  ILE A C    1  
ATOM 445   O O    . ILE A 1 28  ? -0.532  4.109   16.941  1.00 0.00 ? 28  ILE A O    1  
ATOM 446   C CB   . ILE A 1 28  ? -2.875  2.183   17.415  1.00 0.00 ? 28  ILE A CB   1  
ATOM 447   C CG1  . ILE A 1 28  ? -2.457  0.911   18.189  1.00 0.00 ? 28  ILE A CG1  1  
ATOM 448   C CG2  . ILE A 1 28  ? -4.364  2.164   17.050  1.00 0.00 ? 28  ILE A CG2  1  
ATOM 449   C CD1  . ILE A 1 28  ? -2.910  0.926   19.655  1.00 0.00 ? 28  ILE A CD1  1  
ATOM 450   H H    . ILE A 1 28  ? -2.192  0.331   15.634  1.00 0.00 ? 28  ILE A H    1  
ATOM 451   H HA   . ILE A 1 28  ? -2.491  3.265   15.600  1.00 0.00 ? 28  ILE A HA   1  
ATOM 452   H HB   . ILE A 1 28  ? -2.724  3.043   18.071  1.00 0.00 ? 28  ILE A HB   1  
ATOM 453   H HG12 . ILE A 1 28  ? -2.867  0.028   17.697  1.00 0.00 ? 28  ILE A HG12 1  
ATOM 454   H HG13 . ILE A 1 28  ? -1.373  0.823   18.190  1.00 0.00 ? 28  ILE A HG13 1  
ATOM 455   H HG21 . ILE A 1 28  ? -4.966  2.175   17.957  1.00 0.00 ? 28  ILE A HG21 1  
ATOM 456   H HG22 . ILE A 1 28  ? -4.611  3.056   16.472  1.00 0.00 ? 28  ILE A HG22 1  
ATOM 457   H HG23 . ILE A 1 28  ? -4.602  1.276   16.462  1.00 0.00 ? 28  ILE A HG23 1  
ATOM 458   H HD11 . ILE A 1 28  ? -3.989  1.042   19.725  1.00 0.00 ? 28  ILE A HD11 1  
ATOM 459   H HD12 . ILE A 1 28  ? -2.621  -0.012  20.131  1.00 0.00 ? 28  ILE A HD12 1  
ATOM 460   H HD13 . ILE A 1 28  ? -2.426  1.753   20.178  1.00 0.00 ? 28  ILE A HD13 1  
ATOM 461   N N    . GLY A 1 29  ? 0.385   2.110   16.476  1.00 0.00 ? 29  GLY A N    1  
ATOM 462   C CA   . GLY A 1 29  ? 1.759   2.468   16.830  1.00 0.00 ? 29  GLY A CA   1  
ATOM 463   C C    . GLY A 1 29  ? 2.754   1.622   16.059  1.00 0.00 ? 29  GLY A C    1  
ATOM 464   O O    . GLY A 1 29  ? 2.361   0.678   15.375  1.00 0.00 ? 29  GLY A O    1  
ATOM 465   H H    . GLY A 1 29  ? 0.248   1.171   16.107  1.00 0.00 ? 29  GLY A H    1  
ATOM 466   H HA2  . GLY A 1 29  ? 1.948   3.522   16.623  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 467   H HA3  . GLY A 1 29  ? 1.916   2.297   17.893  1.00 0.00 ? 29  GLY A HA3  1  
ATOM 468   N N    . ASP A 1 30  ? 4.040   1.939   16.186  1.00 0.00 ? 30  ASP A N    1  
ATOM 469   C CA   . ASP A 1 30  ? 5.109   1.181   15.543  1.00 0.00 ? 30  ASP A CA   1  
ATOM 470   C C    . ASP A 1 30  ? 5.221   -0.220  16.186  1.00 0.00 ? 30  ASP A C    1  
ATOM 471   O O    . ASP A 1 30  ? 5.922   -0.422  17.182  1.00 0.00 ? 30  ASP A O    1  
ATOM 472   C CB   . ASP A 1 30  ? 6.436   1.952   15.625  1.00 0.00 ? 30  ASP A CB   1  
ATOM 473   C CG   . ASP A 1 30  ? 6.426   3.227   14.773  1.00 0.00 ? 30  ASP A CG   1  
ATOM 474   O OD1  . ASP A 1 30  ? 6.530   3.117   13.528  1.00 0.00 ? 30  ASP A OD1  1  
ATOM 475   O OD2  . ASP A 1 30  ? 6.331   4.336   15.353  1.00 0.00 ? 30  ASP A OD2  1  
ATOM 476   H H    . ASP A 1 30  ? 4.294   2.721   16.773  1.00 0.00 ? 30  ASP A H    1  
ATOM 477   H HA   . ASP A 1 30  ? 4.846   1.079   14.486  1.00 0.00 ? 30  ASP A HA   1  
ATOM 478   H HB2  . ASP A 1 30  ? 6.644   2.200   16.667  1.00 0.00 ? 30  ASP A HB2  1  
ATOM 479   H HB3  . ASP A 1 30  ? 7.238   1.303   15.268  1.00 0.00 ? 30  ASP A HB3  1  
ATOM 480   N N    . GLY A 1 31  ? 4.486   -1.180  15.617  1.00 0.00 ? 31  GLY A N    1  
ATOM 481   C CA   . GLY A 1 31  ? 4.382   -2.571  16.066  1.00 0.00 ? 31  GLY A CA   1  
ATOM 482   C C    . GLY A 1 31  ? 3.125   -2.914  16.869  1.00 0.00 ? 31  GLY A C    1  
ATOM 483   O O    . GLY A 1 31  ? 3.038   -4.033  17.367  1.00 0.00 ? 31  GLY A O    1  
ATOM 484   H H    . GLY A 1 31  ? 3.916   -0.900  14.828  1.00 0.00 ? 31  GLY A H    1  
ATOM 485   H HA2  . GLY A 1 31  ? 4.353   -3.198  15.178  1.00 0.00 ? 31  GLY A HA2  1  
ATOM 486   H HA3  . GLY A 1 31  ? 5.242   -2.826  16.680  1.00 0.00 ? 31  GLY A HA3  1  
ATOM 487   N N    . TYR A 1 32  ? 2.142   -2.014  16.978  1.00 0.00 ? 32  TYR A N    1  
ATOM 488   C CA   . TYR A 1 32  ? 0.927   -2.208  17.790  1.00 0.00 ? 32  TYR A CA   1  
ATOM 489   C C    . TYR A 1 32  ? -0.367  -1.999  16.991  1.00 0.00 ? 32  TYR A C    1  
ATOM 490   O O    . TYR A 1 32  ? -0.457  -1.089  16.167  1.00 0.00 ? 32  TYR A O    1  
ATOM 491   C CB   . TYR A 1 32  ? 0.975   -1.276  19.007  1.00 0.00 ? 32  TYR A CB   1  
ATOM 492   C CG   . TYR A 1 32  ? 2.039   -1.669  20.015  1.00 0.00 ? 32  TYR A CG   1  
ATOM 493   C CD1  . TYR A 1 32  ? 1.769   -2.682  20.956  1.00 0.00 ? 32  TYR A CD1  1  
ATOM 494   C CD2  . TYR A 1 32  ? 3.305   -1.055  19.992  1.00 0.00 ? 32  TYR A CD2  1  
ATOM 495   C CE1  . TYR A 1 32  ? 2.759   -3.073  21.881  1.00 0.00 ? 32  TYR A CE1  1  
ATOM 496   C CE2  . TYR A 1 32  ? 4.300   -1.441  20.910  1.00 0.00 ? 32  TYR A CE2  1  
ATOM 497   C CZ   . TYR A 1 32  ? 4.029   -2.450  21.860  1.00 0.00 ? 32  TYR A CZ   1  
ATOM 498   O OH   . TYR A 1 32  ? 4.993   -2.821  22.746  1.00 0.00 ? 32  TYR A OH   1  
ATOM 499   H H    . TYR A 1 32  ? 2.250   -1.132  16.489  1.00 0.00 ? 32  TYR A H    1  
ATOM 500   H HA   . TYR A 1 32  ? 0.906   -3.232  18.166  1.00 0.00 ? 32  TYR A HA   1  
ATOM 501   H HB2  . TYR A 1 32  ? 1.141   -0.251  18.674  1.00 0.00 ? 32  TYR A HB2  1  
ATOM 502   H HB3  . TYR A 1 32  ? 0.007   -1.304  19.512  1.00 0.00 ? 32  TYR A HB3  1  
ATOM 503   H HD1  . TYR A 1 32  ? 0.802   -3.171  20.970  1.00 0.00 ? 32  TYR A HD1  1  
ATOM 504   H HD2  . TYR A 1 32  ? 3.523   -0.292  19.257  1.00 0.00 ? 32  TYR A HD2  1  
ATOM 505   H HE1  . TYR A 1 32  ? 2.546   -3.850  22.603  1.00 0.00 ? 32  TYR A HE1  1  
ATOM 506   H HE2  . TYR A 1 32  ? 5.270   -0.968  20.890  1.00 0.00 ? 32  TYR A HE2  1  
ATOM 507   H HH   . TYR A 1 32  ? 4.698   -3.516  23.343  1.00 0.00 ? 32  TYR A HH   1  
ATOM 508   N N    . VAL A 1 33  ? -1.379  -2.835  17.247  1.00 0.00 ? 33  VAL A N    1  
ATOM 509   C CA   . VAL A 1 33  ? -2.633  -2.882  16.474  1.00 0.00 ? 33  VAL A CA   1  
ATOM 510   C C    . VAL A 1 33  ? -3.880  -3.009  17.353  1.00 0.00 ? 33  VAL A C    1  
ATOM 511   O O    . VAL A 1 33  ? -3.853  -3.608  18.425  1.00 0.00 ? 33  VAL A O    1  
ATOM 512   C CB   . VAL A 1 33  ? -2.655  -4.037  15.437  1.00 0.00 ? 33  VAL A CB   1  
ATOM 513   C CG1  . VAL A 1 33  ? -1.697  -3.805  14.267  1.00 0.00 ? 33  VAL A CG1  1  
ATOM 514   C CG2  . VAL A 1 33  ? -2.336  -5.415  16.037  1.00 0.00 ? 33  VAL A CG2  1  
ATOM 515   H H    . VAL A 1 33  ? -1.266  -3.533  17.991  1.00 0.00 ? 33  VAL A H    1  
ATOM 516   H HA   . VAL A 1 33  ? -2.712  -1.948  15.934  1.00 0.00 ? 33  VAL A HA   1  
ATOM 517   H HB   . VAL A 1 33  ? -3.657  -4.086  15.018  1.00 0.00 ? 33  VAL A HB   1  
ATOM 518   H HG11 . VAL A 1 33  ? -1.980  -2.896  13.743  1.00 0.00 ? 33  VAL A HG11 1  
ATOM 519   H HG12 . VAL A 1 33  ? -0.672  -3.735  14.628  1.00 0.00 ? 33  VAL A HG12 1  
ATOM 520   H HG13 . VAL A 1 33  ? -1.766  -4.634  13.560  1.00 0.00 ? 33  VAL A HG13 1  
ATOM 521   H HG21 . VAL A 1 33  ? -2.426  -6.172  15.258  1.00 0.00 ? 33  VAL A HG21 1  
ATOM 522   H HG22 . VAL A 1 33  ? -1.317  -5.439  16.419  1.00 0.00 ? 33  VAL A HG22 1  
ATOM 523   H HG23 . VAL A 1 33  ? -3.031  -5.655  16.841  1.00 0.00 ? 33  VAL A HG23 1  
ATOM 524   N N    . ILE A 1 34  ? -4.987  -2.453  16.863  1.00 0.00 ? 34  ILE A N    1  
ATOM 525   C CA   . ILE A 1 34  ? -6.350  -2.641  17.395  1.00 0.00 ? 34  ILE A CA   1  
ATOM 526   C C    . ILE A 1 34  ? -7.062  -3.570  16.411  1.00 0.00 ? 34  ILE A C    1  
ATOM 527   O O    . ILE A 1 34  ? -6.980  -3.339  15.212  1.00 0.00 ? 34  ILE A O    1  
ATOM 528   C CB   . ILE A 1 34  ? -7.078  -1.282  17.509  1.00 0.00 ? 34  ILE A CB   1  
ATOM 529   C CG1  . ILE A 1 34  ? -6.381  -0.331  18.502  1.00 0.00 ? 34  ILE A CG1  1  
ATOM 530   C CG2  . ILE A 1 34  ? -8.567  -1.446  17.870  1.00 0.00 ? 34  ILE A CG2  1  
ATOM 531   C CD1  . ILE A 1 34  ? -6.426  -0.752  19.975  1.00 0.00 ? 34  ILE A CD1  1  
ATOM 532   H H    . ILE A 1 34  ? -4.898  -1.939  15.984  1.00 0.00 ? 34  ILE A H    1  
ATOM 533   H HA   . ILE A 1 34  ? -6.323  -3.126  18.373  1.00 0.00 ? 34  ILE A HA   1  
ATOM 534   H HB   . ILE A 1 34  ? -7.042  -0.804  16.531  1.00 0.00 ? 34  ILE A HB   1  
ATOM 535   H HG12 . ILE A 1 34  ? -5.339  -0.235  18.212  1.00 0.00 ? 34  ILE A HG12 1  
ATOM 536   H HG13 . ILE A 1 34  ? -6.840  0.655   18.417  1.00 0.00 ? 34  ILE A HG13 1  
ATOM 537   H HG21 . ILE A 1 34  ? -8.676  -2.080  18.749  1.00 0.00 ? 34  ILE A HG21 1  
ATOM 538   H HG22 . ILE A 1 34  ? -9.011  -0.471  18.070  1.00 0.00 ? 34  ILE A HG22 1  
ATOM 539   H HG23 . ILE A 1 34  ? -9.108  -1.898  17.038  1.00 0.00 ? 34  ILE A HG23 1  
ATOM 540   H HD11 . ILE A 1 34  ? -5.861  -1.671  20.110  1.00 0.00 ? 34  ILE A HD11 1  
ATOM 541   H HD12 . ILE A 1 34  ? -5.983  0.035   20.589  1.00 0.00 ? 34  ILE A HD12 1  
ATOM 542   H HD13 . ILE A 1 34  ? -7.455  -0.907  20.298  1.00 0.00 ? 34  ILE A HD13 1  
ATOM 543   N N    . HIS A 1 35  ? -7.735  -4.621  16.862  1.00 0.00 ? 35  HIS A N    1  
ATOM 544   C CA   . HIS A 1 35  ? -8.317  -5.643  15.984  1.00 0.00 ? 35  HIS A CA   1  
ATOM 545   C C    . HIS A 1 35  ? -9.621  -6.221  16.556  1.00 0.00 ? 35  HIS A C    1  
ATOM 546   O O    . HIS A 1 35  ? -9.899  -6.075  17.746  1.00 0.00 ? 35  HIS A O    1  
ATOM 547   C CB   . HIS A 1 35  ? -7.268  -6.742  15.728  1.00 0.00 ? 35  HIS A CB   1  
ATOM 548   C CG   . HIS A 1 35  ? -6.975  -7.605  16.933  1.00 0.00 ? 35  HIS A CG   1  
ATOM 549   N ND1  . HIS A 1 35  ? -7.497  -8.855  17.189  1.00 0.00 ? 35  HIS A ND1  1  
ATOM 550   C CD2  . HIS A 1 35  ? -6.174  -7.279  17.995  1.00 0.00 ? 35  HIS A CD2  1  
ATOM 551   C CE1  . HIS A 1 35  ? -7.023  -9.268  18.377  1.00 0.00 ? 35  HIS A CE1  1  
ATOM 552   N NE2  . HIS A 1 35  ? -6.211  -8.337  18.912  1.00 0.00 ? 35  HIS A NE2  1  
ATOM 553   H H    . HIS A 1 35  ? -7.815  -4.769  17.867  1.00 0.00 ? 35  HIS A H    1  
ATOM 554   H HA   . HIS A 1 35  ? -8.575  -5.188  15.027  1.00 0.00 ? 35  HIS A HA   1  
ATOM 555   H HB2  . HIS A 1 35  ? -7.617  -7.382  14.919  1.00 0.00 ? 35  HIS A HB2  1  
ATOM 556   H HB3  . HIS A 1 35  ? -6.336  -6.280  15.399  1.00 0.00 ? 35  HIS A HB3  1  
ATOM 557   H HD1  . HIS A 1 35  ? -8.126  -9.380  16.594  1.00 0.00 ? 35  HIS A HD1  1  
ATOM 558   H HD2  . HIS A 1 35  ? -5.628  -6.352  18.111  1.00 0.00 ? 35  HIS A HD2  1  
ATOM 559   H HE1  . HIS A 1 35  ? -7.269  -10.215 18.843  1.00 0.00 ? 35  HIS A HE1  1  
ATOM 560   N N    . LEU A 1 36  ? -10.420 -6.884  15.711  1.00 0.00 ? 36  LEU A N    1  
ATOM 561   C CA   . LEU A 1 36  ? -11.724 -7.432  16.098  1.00 0.00 ? 36  LEU A CA   1  
ATOM 562   C C    . LEU A 1 36  ? -11.672 -8.938  16.374  1.00 0.00 ? 36  LEU A C    1  
ATOM 563   O O    . LEU A 1 36  ? -11.141 -9.717  15.579  1.00 0.00 ? 36  LEU A O    1  
ATOM 564   C CB   . LEU A 1 36  ? -12.723 -7.118  14.967  1.00 0.00 ? 36  LEU A CB   1  
ATOM 565   C CG   . LEU A 1 36  ? -14.186 -7.530  15.238  1.00 0.00 ? 36  LEU A CG   1  
ATOM 566   C CD1  . LEU A 1 36  ? -14.831 -6.672  16.334  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 567   C CD2  . LEU A 1 36  ? -14.984 -7.397  13.939  1.00 0.00 ? 36  LEU A CD2  1  
ATOM 568   H H    . LEU A 1 36  ? -10.134 -6.982  14.744  1.00 0.00 ? 36  LEU A H    1  
ATOM 569   H HA   . LEU A 1 36  ? -12.065 -6.930  17.008  1.00 0.00 ? 36  LEU A HA   1  
ATOM 570   H HB2  . LEU A 1 36  ? -12.705 -6.045  14.791  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 571   H HB3  . LEU A 1 36  ? -12.375 -7.611  14.056  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 572   H HG   . LEU A 1 36  ? -14.226 -8.576  15.538  1.00 0.00 ? 36  LEU A HG   1  
ATOM 573   H HD11 . LEU A 1 36  ? -15.876 -6.955  16.450  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 574   H HD12 . LEU A 1 36  ? -14.320 -6.825  17.282  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 575   H HD13 . LEU A 1 36  ? -14.779 -5.616  16.066  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 576   H HD21 . LEU A 1 36  ? -16.004 -7.738  14.091  1.00 0.00 ? 36  LEU A HD21 1  
ATOM 577   H HD22 . LEU A 1 36  ? -14.997 -6.357  13.613  1.00 0.00 ? 36  LEU A HD22 1  
ATOM 578   H HD23 . LEU A 1 36  ? -14.525 -8.011  13.163  1.00 0.00 ? 36  LEU A HD23 1  
ATOM 579   N N    . ALA A 1 37  ? -12.291 -9.338  17.483  1.00 0.00 ? 37  ALA A N    1  
ATOM 580   C CA   . ALA A 1 37  ? -12.588 -10.718 17.855  1.00 0.00 ? 37  ALA A CA   1  
ATOM 581   C C    . ALA A 1 37  ? -14.087 -10.949 17.508  1.00 0.00 ? 37  ALA A C    1  
ATOM 582   O O    . ALA A 1 37  ? -14.935 -10.327 18.159  1.00 0.00 ? 37  ALA A O    1  
ATOM 583   C CB   . ALA A 1 37  ? -12.264 -10.885 19.347  1.00 0.00 ? 37  ALA A CB   1  
ATOM 584   H H    . ALA A 1 37  ? -12.638 -8.621  18.116  1.00 0.00 ? 37  ALA A H    1  
ATOM 585   H HA   . ALA A 1 37  ? -11.947 -11.407 17.305  1.00 0.00 ? 37  ALA A HA   1  
ATOM 586   H HB1  . ALA A 1 37  ? -11.225 -10.593 19.531  1.00 0.00 ? 37  ALA A HB1  1  
ATOM 587   H HB2  . ALA A 1 37  ? -12.913 -10.256 19.958  1.00 0.00 ? 37  ALA A HB2  1  
ATOM 588   H HB3  . ALA A 1 37  ? -12.402 -11.926 19.645  1.00 0.00 ? 37  ALA A HB3  1  
ATOM 589   N N    . PRO A 1 38  ? -14.432 -11.735 16.460  1.00 0.00 ? 38  PRO A N    1  
ATOM 590   C CA   . PRO A 1 38  ? -15.794 -11.847 15.920  1.00 0.00 ? 38  PRO A CA   1  
ATOM 591   C C    . PRO A 1 38  ? -16.835 -12.419 16.903  1.00 0.00 ? 38  PRO A C    1  
ATOM 592   O O    . PRO A 1 38  ? -16.458 -13.107 17.854  1.00 0.00 ? 38  PRO A O    1  
ATOM 593   C CB   . PRO A 1 38  ? -15.678 -12.752 14.680  1.00 0.00 ? 38  PRO A CB   1  
ATOM 594   C CG   . PRO A 1 38  ? -14.236 -12.571 14.231  1.00 0.00 ? 38  PRO A CG   1  
ATOM 595   C CD   . PRO A 1 38  ? -13.504 -12.406 15.559  1.00 0.00 ? 38  PRO A CD   1  
ATOM 596   H HA   . PRO A 1 38  ? -16.100 -10.849 15.599  1.00 0.00 ? 38  PRO A HA   1  
ATOM 597   H HB2  . PRO A 1 38  ? -15.837 -13.795 14.961  1.00 0.00 ? 38  PRO A HB2  1  
ATOM 598   H HB3  . PRO A 1 38  ? -16.371 -12.467 13.890  1.00 0.00 ? 38  PRO A HB3  1  
ATOM 599   H HG2  . PRO A 1 38  ? -13.872 -13.431 13.671  1.00 0.00 ? 38  PRO A HG2  1  
ATOM 600   H HG3  . PRO A 1 38  ? -14.141 -11.654 13.643  1.00 0.00 ? 38  PRO A HG3  1  
ATOM 601   H HD2  . PRO A 1 38  ? -13.253 -13.388 15.967  1.00 0.00 ? 38  PRO A HD2  1  
ATOM 602   H HD3  . PRO A 1 38  ? -12.605 -11.818 15.388  1.00 0.00 ? 38  PRO A HD3  1  
ATOM 603   N N    . PRO A 1 39  ? -18.148 -12.223 16.640  1.00 0.00 ? 39  PRO A N    1  
ATOM 604   C CA   . PRO A 1 39  ? -19.254 -12.791 17.423  1.00 0.00 ? 39  PRO A CA   1  
ATOM 605   C C    . PRO A 1 39  ? -19.484 -14.298 17.170  1.00 0.00 ? 39  PRO A C    1  
ATOM 606   O O    . PRO A 1 39  ? -20.552 -14.820 17.483  1.00 0.00 ? 39  PRO A O    1  
ATOM 607   C CB   . PRO A 1 39  ? -20.474 -11.934 17.052  1.00 0.00 ? 39  PRO A CB   1  
ATOM 608   C CG   . PRO A 1 39  ? -20.202 -11.558 15.599  1.00 0.00 ? 39  PRO A CG   1  
ATOM 609   C CD   . PRO A 1 39  ? -18.683 -11.385 15.572  1.00 0.00 ? 39  PRO A CD   1  
ATOM 610   H HA   . PRO A 1 39  ? -19.042 -12.667 18.484  1.00 0.00 ? 39  PRO A HA   1  
ATOM 611   H HB2  . PRO A 1 39  ? -21.420 -12.462 17.165  1.00 0.00 ? 39  PRO A HB2  1  
ATOM 612   H HB3  . PRO A 1 39  ? -20.483 -11.033 17.663  1.00 0.00 ? 39  PRO A HB3  1  
ATOM 613   H HG2  . PRO A 1 39  ? -20.491 -12.381 14.942  1.00 0.00 ? 39  PRO A HG2  1  
ATOM 614   H HG3  . PRO A 1 39  ? -20.718 -10.642 15.314  1.00 0.00 ? 39  PRO A HG3  1  
ATOM 615   H HD2  . PRO A 1 39  ? -18.294 -11.669 14.596  1.00 0.00 ? 39  PRO A HD2  1  
ATOM 616   H HD3  . PRO A 1 39  ? -18.429 -10.344 15.770  1.00 0.00 ? 39  PRO A HD3  1  
ATOM 617   N N    . SER A 1 40  ? -18.500 -15.010 16.615  1.00 0.00 ? 40  SER A N    1  
ATOM 618   C CA   . SER A 1 40  ? -18.548 -16.455 16.344  1.00 0.00 ? 40  SER A CA   1  
ATOM 619   C C    . SER A 1 40  ? -17.197 -17.119 16.658  1.00 0.00 ? 40  SER A C    1  
ATOM 620   O O    . SER A 1 40  ? -16.135 -16.547 16.389  1.00 0.00 ? 40  SER A O    1  
ATOM 621   C CB   . SER A 1 40  ? -18.896 -16.727 14.869  1.00 0.00 ? 40  SER A CB   1  
ATOM 622   O OG   . SER A 1 40  ? -20.237 -16.370 14.562  1.00 0.00 ? 40  SER A OG   1  
ATOM 623   H H    . SER A 1 40  ? -17.604 -14.564 16.474  1.00 0.00 ? 40  SER A H    1  
ATOM 624   H HA   . SER A 1 40  ? -19.313 -16.919 16.964  1.00 0.00 ? 40  SER A HA   1  
ATOM 625   H HB2  . SER A 1 40  ? -18.208 -16.175 14.227  1.00 0.00 ? 40  SER A HB2  1  
ATOM 626   H HB3  . SER A 1 40  ? -18.765 -17.793 14.671  1.00 0.00 ? 40  SER A HB3  1  
ATOM 627   H HG   . SER A 1 40  ? -20.416 -16.591 13.636  1.00 0.00 ? 40  SER A HG   1  
ATOM 628   N N    . GLU A 1 41  ? -17.238 -18.340 17.199  1.00 0.00 ? 41  GLU A N    1  
ATOM 629   C CA   . GLU A 1 41  ? -16.073 -19.199 17.434  1.00 0.00 ? 41  GLU A CA   1  
ATOM 630   C C    . GLU A 1 41  ? -15.644 -19.943 16.153  1.00 0.00 ? 41  GLU A C    1  
ATOM 631   O O    . GLU A 1 41  ? -16.390 -20.035 15.174  1.00 0.00 ? 41  GLU A O    1  
ATOM 632   C CB   . GLU A 1 41  ? -16.382 -20.217 18.548  1.00 0.00 ? 41  GLU A CB   1  
ATOM 633   C CG   . GLU A 1 41  ? -16.769 -19.552 19.874  1.00 0.00 ? 41  GLU A CG   1  
ATOM 634   C CD   . GLU A 1 41  ? -16.851 -20.581 21.009  1.00 0.00 ? 41  GLU A CD   1  
ATOM 635   O OE1  . GLU A 1 41  ? -15.801 -20.885 21.625  1.00 0.00 ? 41  GLU A OE1  1  
ATOM 636   O OE2  . GLU A 1 41  ? -17.963 -21.081 21.300  1.00 0.00 ? 41  GLU A OE2  1  
ATOM 637   H H    . GLU A 1 41  ? -18.149 -18.744 17.389  1.00 0.00 ? 41  GLU A H    1  
ATOM 638   H HA   . GLU A 1 41  ? -15.235 -18.581 17.764  1.00 0.00 ? 41  GLU A HA   1  
ATOM 639   H HB2  . GLU A 1 41  ? -17.189 -20.875 18.227  1.00 0.00 ? 41  GLU A HB2  1  
ATOM 640   H HB3  . GLU A 1 41  ? -15.497 -20.832 18.717  1.00 0.00 ? 41  GLU A HB3  1  
ATOM 641   H HG2  . GLU A 1 41  ? -16.028 -18.792 20.127  1.00 0.00 ? 41  GLU A HG2  1  
ATOM 642   H HG3  . GLU A 1 41  ? -17.738 -19.061 19.766  1.00 0.00 ? 41  GLU A HG3  1  
ATOM 643   N N    . TYR A 1 42  ? -14.442 -20.526 16.160  1.00 0.00 ? 42  TYR A N    1  
ATOM 644   C CA   . TYR A 1 42  ? -13.992 -21.443 15.104  1.00 0.00 ? 42  TYR A CA   1  
ATOM 645   C C    . TYR A 1 42  ? -14.868 -22.727 15.077  1.00 0.00 ? 42  TYR A C    1  
ATOM 646   O O    . TYR A 1 42  ? -15.145 -23.280 16.152  1.00 0.00 ? 42  TYR A O    1  
ATOM 647   C CB   . TYR A 1 42  ? -12.507 -21.761 15.336  1.00 0.00 ? 42  TYR A CB   1  
ATOM 648   C CG   . TYR A 1 42  ? -11.868 -22.605 14.251  1.00 0.00 ? 42  TYR A CG   1  
ATOM 649   C CD1  . TYR A 1 42  ? -11.419 -21.999 13.061  1.00 0.00 ? 42  TYR A CD1  1  
ATOM 650   C CD2  . TYR A 1 42  ? -11.734 -23.997 14.423  1.00 0.00 ? 42  TYR A CD2  1  
ATOM 651   C CE1  . TYR A 1 42  ? -10.842 -22.780 12.040  1.00 0.00 ? 42  TYR A CE1  1  
ATOM 652   C CE2  . TYR A 1 42  ? -11.161 -24.783 13.407  1.00 0.00 ? 42  TYR A CE2  1  
ATOM 653   C CZ   . TYR A 1 42  ? -10.715 -24.179 12.211  1.00 0.00 ? 42  TYR A CZ   1  
ATOM 654   O OH   . TYR A 1 42  ? -10.165 -24.947 11.230  1.00 0.00 ? 42  TYR A OH   1  
ATOM 655   H H    . TYR A 1 42  ? -13.854 -20.424 16.977  1.00 0.00 ? 42  TYR A H    1  
ATOM 656   H HA   . TYR A 1 42  ? -14.083 -20.924 14.151  1.00 0.00 ? 42  TYR A HA   1  
ATOM 657   H HB2  . TYR A 1 42  ? -11.956 -20.823 15.401  1.00 0.00 ? 42  TYR A HB2  1  
ATOM 658   H HB3  . TYR A 1 42  ? -12.395 -22.272 16.293  1.00 0.00 ? 42  TYR A HB3  1  
ATOM 659   H HD1  . TYR A 1 42  ? -11.523 -20.929 12.929  1.00 0.00 ? 42  TYR A HD1  1  
ATOM 660   H HD2  . TYR A 1 42  ? -12.080 -24.467 15.334  1.00 0.00 ? 42  TYR A HD2  1  
ATOM 661   H HE1  . TYR A 1 42  ? -10.505 -22.314 11.126  1.00 0.00 ? 42  TYR A HE1  1  
ATOM 662   H HE2  . TYR A 1 42  ? -11.065 -25.852 13.536  1.00 0.00 ? 42  TYR A HE2  1  
ATOM 663   H HH   . TYR A 1 42  ? -9.892  -24.431 10.465  1.00 0.00 ? 42  TYR A HH   1  
ATOM 664   N N    . PRO A 1 43  ? -15.316 -23.213 13.897  1.00 0.00 ? 43  PRO A N    1  
ATOM 665   C CA   . PRO A 1 43  ? -16.222 -24.358 13.789  1.00 0.00 ? 43  PRO A CA   1  
ATOM 666   C C    . PRO A 1 43  ? -15.552 -25.656 14.251  1.00 0.00 ? 43  PRO A C    1  
ATOM 667   O O    . PRO A 1 43  ? -14.364 -25.876 14.010  1.00 0.00 ? 43  PRO A O    1  
ATOM 668   C CB   . PRO A 1 43  ? -16.645 -24.428 12.316  1.00 0.00 ? 43  PRO A CB   1  
ATOM 669   C CG   . PRO A 1 43  ? -15.492 -23.749 11.582  1.00 0.00 ? 43  PRO A CG   1  
ATOM 670   C CD   . PRO A 1 43  ? -15.043 -22.673 12.572  1.00 0.00 ? 43  PRO A CD   1  
ATOM 671   H HA   . PRO A 1 43  ? -17.108 -24.184 14.400  1.00 0.00 ? 43  PRO A HA   1  
ATOM 672   H HB2  . PRO A 1 43  ? -16.791 -25.453 11.977  1.00 0.00 ? 43  PRO A HB2  1  
ATOM 673   H HB3  . PRO A 1 43  ? -17.558 -23.848 12.166  1.00 0.00 ? 43  PRO A HB3  1  
ATOM 674   H HG2  . PRO A 1 43  ? -14.680 -24.463 11.425  1.00 0.00 ? 43  PRO A HG2  1  
ATOM 675   H HG3  . PRO A 1 43  ? -15.813 -23.317 10.634  1.00 0.00 ? 43  PRO A HG3  1  
ATOM 676   H HD2  . PRO A 1 43  ? -13.984 -22.467 12.428  1.00 0.00 ? 43  PRO A HD2  1  
ATOM 677   H HD3  . PRO A 1 43  ? -15.632 -21.767 12.421  1.00 0.00 ? 43  PRO A HD3  1  
ATOM 678   N N    . GLY A 1 44  ? -16.326 -26.521 14.919  1.00 0.00 ? 44  GLY A N    1  
ATOM 679   C CA   . GLY A 1 44  ? -15.827 -27.760 15.522  1.00 0.00 ? 44  GLY A CA   1  
ATOM 680   C C    . GLY A 1 44  ? -15.105 -27.487 16.841  1.00 0.00 ? 44  GLY A C    1  
ATOM 681   O O    . GLY A 1 44  ? -13.888 -27.661 16.931  1.00 0.00 ? 44  GLY A O    1  
ATOM 682   H H    . GLY A 1 44  ? -17.304 -26.288 15.064  1.00 0.00 ? 44  GLY A H    1  
ATOM 683   H HA2  . GLY A 1 44  ? -16.663 -28.427 15.727  1.00 0.00 ? 44  GLY A HA2  1  
ATOM 684   H HA3  . GLY A 1 44  ? -15.130 -28.253 14.847  1.00 0.00 ? 44  GLY A HA3  1  
ATOM 685   N N    . ALA A 1 45  ? -15.857 -27.053 17.860  1.00 0.00 ? 45  ALA A N    1  
ATOM 686   C CA   . ALA A 1 45  ? -15.338 -26.621 19.164  1.00 0.00 ? 45  ALA A CA   1  
ATOM 687   C C    . ALA A 1 45  ? -14.567 -27.709 19.949  1.00 0.00 ? 45  ALA A C    1  
ATOM 688   O O    . ALA A 1 45  ? -13.739 -27.375 20.800  1.00 0.00 ? 45  ALA A O    1  
ATOM 689   C CB   . ALA A 1 45  ? -16.518 -26.063 19.974  1.00 0.00 ? 45  ALA A CB   1  
ATOM 690   H H    . ALA A 1 45  ? -16.846 -26.913 17.679  1.00 0.00 ? 45  ALA A H    1  
ATOM 691   H HA   . ALA A 1 45  ? -14.628 -25.807 18.996  1.00 0.00 ? 45  ALA A HA   1  
ATOM 692   H HB1  . ALA A 1 45  ? -16.983 -25.234 19.436  1.00 0.00 ? 45  ALA A HB1  1  
ATOM 693   H HB2  . ALA A 1 45  ? -17.262 -26.839 20.149  1.00 0.00 ? 45  ALA A HB2  1  
ATOM 694   H HB3  . ALA A 1 45  ? -16.162 -25.696 20.935  1.00 0.00 ? 45  ALA A HB3  1  
ATOM 695   N N    . GLY A 1 46  ? -14.816 -28.995 19.664  1.00 0.00 ? 46  GLY A N    1  
ATOM 696   C CA   . GLY A 1 46  ? -14.020 -30.133 20.160  1.00 0.00 ? 46  GLY A CA   1  
ATOM 697   C C    . GLY A 1 46  ? -14.371 -30.650 21.560  1.00 0.00 ? 46  GLY A C    1  
ATOM 698   O O    . GLY A 1 46  ? -13.748 -31.610 22.014  1.00 0.00 ? 46  GLY A O    1  
ATOM 699   H H    . GLY A 1 46  ? -15.500 -29.183 18.947  1.00 0.00 ? 46  GLY A H    1  
ATOM 700   H HA2  . GLY A 1 46  ? -14.136 -30.970 19.473  1.00 0.00 ? 46  GLY A HA2  1  
ATOM 701   H HA3  . GLY A 1 46  ? -12.971 -29.838 20.189  1.00 0.00 ? 46  GLY A HA3  1  
ATOM 702   N N    . SER A 1 47  ? -15.345 -30.058 22.250  1.00 0.00 ? 47  SER A N    1  
ATOM 703   C CA   . SER A 1 47  ? -15.757 -30.468 23.605  1.00 0.00 ? 47  SER A CA   1  
ATOM 704   C C    . SER A 1 47  ? -16.866 -31.535 23.565  1.00 0.00 ? 47  SER A C    1  
ATOM 705   O O    . SER A 1 47  ? -17.801 -31.450 22.767  1.00 0.00 ? 47  SER A O    1  
ATOM 706   C CB   . SER A 1 47  ? -16.251 -29.247 24.401  1.00 0.00 ? 47  SER A CB   1  
ATOM 707   O OG   . SER A 1 47  ? -15.221 -28.275 24.552  1.00 0.00 ? 47  SER A OG   1  
ATOM 708   H H    . SER A 1 47  ? -15.844 -29.297 21.816  1.00 0.00 ? 47  SER A H    1  
ATOM 709   H HA   . SER A 1 47  ? -14.904 -30.886 24.143  1.00 0.00 ? 47  SER A HA   1  
ATOM 710   H HB2  . SER A 1 47  ? -17.102 -28.799 23.886  1.00 0.00 ? 47  SER A HB2  1  
ATOM 711   H HB3  . SER A 1 47  ? -16.578 -29.575 25.390  1.00 0.00 ? 47  SER A HB3  1  
ATOM 712   H HG   . SER A 1 47  ? -15.573 -27.531 25.066  1.00 0.00 ? 47  SER A HG   1  
ATOM 713   N N    . SER A 1 48  ? -16.844 -32.513 24.476  1.00 0.00 ? 48  SER A N    1  
ATOM 714   C CA   . SER A 1 48  ? -17.877 -33.569 24.556  1.00 0.00 ? 48  SER A CA   1  
ATOM 715   C C    . SER A 1 48  ? -19.295 -33.015 24.817  1.00 0.00 ? 48  SER A C    1  
ATOM 716   O O    . SER A 1 48  ? -20.293 -33.644 24.460  1.00 0.00 ? 48  SER A O    1  
ATOM 717   C CB   . SER A 1 48  ? -17.489 -34.580 25.644  1.00 0.00 ? 48  SER A CB   1  
ATOM 718   O OG   . SER A 1 48  ? -17.253 -33.944 26.897  1.00 0.00 ? 48  SER A OG   1  
ATOM 719   H H    . SER A 1 48  ? -16.084 -32.564 25.147  1.00 0.00 ? 48  SER A H    1  
ATOM 720   H HA   . SER A 1 48  ? -17.916 -34.103 23.603  1.00 0.00 ? 48  SER A HA   1  
ATOM 721   H HB2  . SER A 1 48  ? -18.288 -35.316 25.751  1.00 0.00 ? 48  SER A HB2  1  
ATOM 722   H HB3  . SER A 1 48  ? -16.580 -35.098 25.331  1.00 0.00 ? 48  SER A HB3  1  
ATOM 723   H HG   . SER A 1 48  ? -17.017 -34.625 27.546  1.00 0.00 ? 48  SER A HG   1  
ATOM 724   N N    . SER A 1 49  ? -19.395 -31.809 25.384  1.00 0.00 ? 49  SER A N    1  
ATOM 725   C CA   . SER A 1 49  ? -20.640 -31.062 25.600  1.00 0.00 ? 49  SER A CA   1  
ATOM 726   C C    . SER A 1 49  ? -21.087 -30.192 24.404  1.00 0.00 ? 49  SER A C    1  
ATOM 727   O O    . SER A 1 49  ? -22.236 -29.742 24.398  1.00 0.00 ? 49  SER A O    1  
ATOM 728   C CB   . SER A 1 49  ? -20.455 -30.173 26.842  1.00 0.00 ? 49  SER A CB   1  
ATOM 729   O OG   . SER A 1 49  ? -19.297 -29.352 26.724  1.00 0.00 ? 49  SER A OG   1  
ATOM 730   H H    . SER A 1 49  ? -18.545 -31.384 25.735  1.00 0.00 ? 49  SER A H    1  
ATOM 731   H HA   . SER A 1 49  ? -21.453 -31.760 25.811  1.00 0.00 ? 49  SER A HA   1  
ATOM 732   H HB2  . SER A 1 49  ? -21.339 -29.548 26.980  1.00 0.00 ? 49  SER A HB2  1  
ATOM 733   H HB3  . SER A 1 49  ? -20.348 -30.816 27.717  1.00 0.00 ? 49  SER A HB3  1  
ATOM 734   H HG   . SER A 1 49  ? -19.229 -28.805 27.523  1.00 0.00 ? 49  SER A HG   1  
ATOM 735   N N    . VAL A 1 50  ? -20.232 -29.944 23.393  1.00 0.00 ? 50  VAL A N    1  
ATOM 736   C CA   . VAL A 1 50  ? -20.481 -28.984 22.290  1.00 0.00 ? 50  VAL A CA   1  
ATOM 737   C C    . VAL A 1 50  ? -19.406 -29.043 21.191  1.00 0.00 ? 50  VAL A C    1  
ATOM 738   O O    . VAL A 1 50  ? -18.212 -28.932 21.462  1.00 0.00 ? 50  VAL A O    1  
ATOM 739   C CB   . VAL A 1 50  ? -20.677 -27.521 22.791  1.00 0.00 ? 50  VAL A CB   1  
ATOM 740   C CG1  . VAL A 1 50  ? -19.474 -26.944 23.559  1.00 0.00 ? 50  VAL A CG1  1  
ATOM 741   C CG2  . VAL A 1 50  ? -21.044 -26.578 21.635  1.00 0.00 ? 50  VAL A CG2  1  
ATOM 742   H H    . VAL A 1 50  ? -19.349 -30.455 23.381  1.00 0.00 ? 50  VAL A H    1  
ATOM 743   H HA   . VAL A 1 50  ? -21.426 -29.288 21.834  1.00 0.00 ? 50  VAL A HA   1  
ATOM 744   H HB   . VAL A 1 50  ? -21.525 -27.501 23.475  1.00 0.00 ? 50  VAL A HB   1  
ATOM 745   H HG11 . VAL A 1 50  ? -18.613 -26.821 22.900  1.00 0.00 ? 50  VAL A HG11 1  
ATOM 746   H HG12 . VAL A 1 50  ? -19.735 -25.969 23.970  1.00 0.00 ? 50  VAL A HG12 1  
ATOM 747   H HG13 . VAL A 1 50  ? -19.203 -27.601 24.383  1.00 0.00 ? 50  VAL A HG13 1  
ATOM 748   H HG21 . VAL A 1 50  ? -21.321 -25.599 22.028  1.00 0.00 ? 50  VAL A HG21 1  
ATOM 749   H HG22 . VAL A 1 50  ? -20.199 -26.450 20.957  1.00 0.00 ? 50  VAL A HG22 1  
ATOM 750   H HG23 . VAL A 1 50  ? -21.891 -26.988 21.084  1.00 0.00 ? 50  VAL A HG23 1  
ATOM 751   N N    . PHE A 1 51  ? -19.859 -29.169 19.936  1.00 0.00 ? 51  PHE A N    1  
ATOM 752   C CA   . PHE A 1 51  ? -18.996 -29.219 18.750  1.00 0.00 ? 51  PHE A CA   1  
ATOM 753   C C    . PHE A 1 51  ? -19.459 -28.267 17.637  1.00 0.00 ? 51  PHE A C    1  
ATOM 754   O O    . PHE A 1 51  ? -18.702 -27.397 17.211  1.00 0.00 ? 51  PHE A O    1  
ATOM 755   C CB   . PHE A 1 51  ? -18.908 -30.680 18.271  1.00 0.00 ? 51  PHE A CB   1  
ATOM 756   C CG   . PHE A 1 51  ? -17.908 -30.900 17.152  1.00 0.00 ? 51  PHE A CG   1  
ATOM 757   C CD1  . PHE A 1 51  ? -16.568 -31.196 17.463  1.00 0.00 ? 51  PHE A CD1  1  
ATOM 758   C CD2  . PHE A 1 51  ? -18.308 -30.802 15.805  1.00 0.00 ? 51  PHE A CD2  1  
ATOM 759   C CE1  . PHE A 1 51  ? -15.626 -31.377 16.433  1.00 0.00 ? 51  PHE A CE1  1  
ATOM 760   C CE2  . PHE A 1 51  ? -17.367 -30.986 14.776  1.00 0.00 ? 51  PHE A CE2  1  
ATOM 761   C CZ   . PHE A 1 51  ? -16.025 -31.269 15.089  1.00 0.00 ? 51  PHE A CZ   1  
ATOM 762   H H    . PHE A 1 51  ? -20.855 -29.291 19.808  1.00 0.00 ? 51  PHE A H    1  
ATOM 763   H HA   . PHE A 1 51  ? -17.996 -28.903 19.024  1.00 0.00 ? 51  PHE A HA   1  
ATOM 764   H HB2  . PHE A 1 51  ? -18.613 -31.305 19.117  1.00 0.00 ? 51  PHE A HB2  1  
ATOM 765   H HB3  . PHE A 1 51  ? -19.891 -31.025 17.944  1.00 0.00 ? 51  PHE A HB3  1  
ATOM 766   H HD1  . PHE A 1 51  ? -16.262 -31.293 18.495  1.00 0.00 ? 51  PHE A HD1  1  
ATOM 767   H HD2  . PHE A 1 51  ? -19.338 -30.582 15.559  1.00 0.00 ? 51  PHE A HD2  1  
ATOM 768   H HE1  . PHE A 1 51  ? -14.596 -31.602 16.675  1.00 0.00 ? 51  PHE A HE1  1  
ATOM 769   H HE2  . PHE A 1 51  ? -17.676 -30.910 13.742  1.00 0.00 ? 51  PHE A HE2  1  
ATOM 770   H HZ   . PHE A 1 51  ? -15.305 -31.409 14.294  1.00 0.00 ? 51  PHE A HZ   1  
ATOM 771   N N    . SER A 1 52  ? -20.700 -28.420 17.171  1.00 0.00 ? 52  SER A N    1  
ATOM 772   C CA   . SER A 1 52  ? -21.210 -27.705 15.984  1.00 0.00 ? 52  SER A CA   1  
ATOM 773   C C    . SER A 1 52  ? -21.646 -26.253 16.281  1.00 0.00 ? 52  SER A C    1  
ATOM 774   O O    . SER A 1 52  ? -21.547 -25.382 15.411  1.00 0.00 ? 52  SER A O    1  
ATOM 775   C CB   . SER A 1 52  ? -22.374 -28.514 15.385  1.00 0.00 ? 52  SER A CB   1  
ATOM 776   O OG   . SER A 1 52  ? -22.737 -28.051 14.092  1.00 0.00 ? 52  SER A OG   1  
ATOM 777   H H    . SER A 1 52  ? -21.238 -29.198 17.532  1.00 0.00 ? 52  SER A H    1  
ATOM 778   H HA   . SER A 1 52  ? -20.423 -27.655 15.228  1.00 0.00 ? 52  SER A HA   1  
ATOM 779   H HB2  . SER A 1 52  ? -22.071 -29.560 15.306  1.00 0.00 ? 52  SER A HB2  1  
ATOM 780   H HB3  . SER A 1 52  ? -23.238 -28.455 16.053  1.00 0.00 ? 52  SER A HB3  1  
ATOM 781   H HG   . SER A 1 52  ? -23.471 -28.594 13.762  1.00 0.00 ? 52  SER A HG   1  
ATOM 782   N N    . VAL A 1 53  ? -22.096 -25.966 17.513  1.00 0.00 ? 53  VAL A N    1  
ATOM 783   C CA   . VAL A 1 53  ? -22.526 -24.614 17.937  1.00 0.00 ? 53  VAL A CA   1  
ATOM 784   C C    . VAL A 1 53  ? -21.300 -23.720 18.160  1.00 0.00 ? 53  VAL A C    1  
ATOM 785   O O    . VAL A 1 53  ? -20.349 -24.117 18.837  1.00 0.00 ? 53  VAL A O    1  
ATOM 786   C CB   . VAL A 1 53  ? -23.429 -24.641 19.197  1.00 0.00 ? 53  VAL A CB   1  
ATOM 787   C CG1  . VAL A 1 53  ? -23.832 -23.226 19.655  1.00 0.00 ? 53  VAL A CG1  1  
ATOM 788   C CG2  . VAL A 1 53  ? -24.709 -25.456 18.941  1.00 0.00 ? 53  VAL A CG2  1  
ATOM 789   H H    . VAL A 1 53  ? -22.094 -26.715 18.192  1.00 0.00 ? 53  VAL A H    1  
ATOM 790   H HA   . VAL A 1 53  ? -23.119 -24.189 17.126  1.00 0.00 ? 53  VAL A HA   1  
ATOM 791   H HB   . VAL A 1 53  ? -22.884 -25.118 20.008  1.00 0.00 ? 53  VAL A HB   1  
ATOM 792   H HG11 . VAL A 1 53  ? -24.333 -22.696 18.844  1.00 0.00 ? 53  VAL A HG11 1  
ATOM 793   H HG12 . VAL A 1 53  ? -24.506 -23.296 20.509  1.00 0.00 ? 53  VAL A HG12 1  
ATOM 794   H HG13 . VAL A 1 53  ? -22.952 -22.662 19.963  1.00 0.00 ? 53  VAL A HG13 1  
ATOM 795   H HG21 . VAL A 1 53  ? -24.461 -26.491 18.706  1.00 0.00 ? 53  VAL A HG21 1  
ATOM 796   H HG22 . VAL A 1 53  ? -25.338 -25.452 19.834  1.00 0.00 ? 53  VAL A HG22 1  
ATOM 797   H HG23 . VAL A 1 53  ? -25.274 -25.027 18.114  1.00 0.00 ? 53  VAL A HG23 1  
ATOM 798   N N    . LEU A 1 54  ? -21.351 -22.504 17.599  1.00 0.00 ? 54  LEU A N    1  
ATOM 799   C CA   . LEU A 1 54  ? -20.249 -21.529 17.597  1.00 0.00 ? 54  LEU A CA   1  
ATOM 800   C C    . LEU A 1 54  ? -20.672 -20.084 17.939  1.00 0.00 ? 54  LEU A C    1  
ATOM 801   O O    . LEU A 1 54  ? -19.868 -19.162 17.806  1.00 0.00 ? 54  LEU A O    1  
ATOM 802   C CB   . LEU A 1 54  ? -19.487 -21.643 16.255  1.00 0.00 ? 54  LEU A CB   1  
ATOM 803   C CG   . LEU A 1 54  ? -20.311 -21.572 14.948  1.00 0.00 ? 54  LEU A CG   1  
ATOM 804   C CD1  . LEU A 1 54  ? -21.110 -20.270 14.784  1.00 0.00 ? 54  LEU A CD1  1  
ATOM 805   C CD2  . LEU A 1 54  ? -19.366 -21.732 13.748  1.00 0.00 ? 54  LEU A CD2  1  
ATOM 806   H H    . LEU A 1 54  ? -22.151 -22.303 17.013  1.00 0.00 ? 54  LEU A H    1  
ATOM 807   H HA   . LEU A 1 54  ? -19.549 -21.803 18.391  1.00 0.00 ? 54  LEU A HA   1  
ATOM 808   H HB2  . LEU A 1 54  ? -18.716 -20.872 16.225  1.00 0.00 ? 54  LEU A HB2  1  
ATOM 809   H HB3  . LEU A 1 54  ? -18.968 -22.604 16.263  1.00 0.00 ? 54  LEU A HB3  1  
ATOM 810   H HG   . LEU A 1 54  ? -21.011 -22.409 14.927  1.00 0.00 ? 54  LEU A HG   1  
ATOM 811   H HD11 . LEU A 1 54  ? -21.908 -20.226 15.524  1.00 0.00 ? 54  LEU A HD11 1  
ATOM 812   H HD12 . LEU A 1 54  ? -20.455 -19.405 14.902  1.00 0.00 ? 54  LEU A HD12 1  
ATOM 813   H HD13 . LEU A 1 54  ? -21.565 -20.238 13.792  1.00 0.00 ? 54  LEU A HD13 1  
ATOM 814   H HD21 . LEU A 1 54  ? -18.658 -20.905 13.711  1.00 0.00 ? 54  LEU A HD21 1  
ATOM 815   H HD22 . LEU A 1 54  ? -18.819 -22.671 13.839  1.00 0.00 ? 54  LEU A HD22 1  
ATOM 816   H HD23 . LEU A 1 54  ? -19.939 -21.753 12.823  1.00 0.00 ? 54  LEU A HD23 1  
ATOM 817   N N    . SER A 1 55  ? -21.917 -19.853 18.355  1.00 0.00 ? 55  SER A N    1  
ATOM 818   C CA   . SER A 1 55  ? -22.451 -18.511 18.647  1.00 0.00 ? 55  SER A CA   1  
ATOM 819   C C    . SER A 1 55  ? -21.762 -17.849 19.858  1.00 0.00 ? 55  SER A C    1  
ATOM 820   O O    . SER A 1 55  ? -21.508 -18.498 20.878  1.00 0.00 ? 55  SER A O    1  
ATOM 821   C CB   . SER A 1 55  ? -23.968 -18.586 18.893  1.00 0.00 ? 55  SER A CB   1  
ATOM 822   O OG   . SER A 1 55  ? -24.639 -19.221 17.810  1.00 0.00 ? 55  SER A OG   1  
ATOM 823   H H    . SER A 1 55  ? -22.546 -20.631 18.463  1.00 0.00 ? 55  SER A H    1  
ATOM 824   H HA   . SER A 1 55  ? -22.287 -17.876 17.774  1.00 0.00 ? 55  SER A HA   1  
ATOM 825   H HB2  . SER A 1 55  ? -24.154 -19.144 19.814  1.00 0.00 ? 55  SER A HB2  1  
ATOM 826   H HB3  . SER A 1 55  ? -24.361 -17.573 19.020  1.00 0.00 ? 55  SER A HB3  1  
ATOM 827   H HG   . SER A 1 55  ? -25.590 -19.222 17.998  1.00 0.00 ? 55  SER A HG   1  
ATOM 828   N N    . ASN A 1 56  ? -21.478 -16.541 19.767  1.00 0.00 ? 56  ASN A N    1  
ATOM 829   C CA   . ASN A 1 56  ? -20.718 -15.786 20.772  1.00 0.00 ? 56  ASN A CA   1  
ATOM 830   C C    . ASN A 1 56  ? -21.002 -14.262 20.703  1.00 0.00 ? 56  ASN A C    1  
ATOM 831   O O    . ASN A 1 56  ? -22.001 -13.839 20.118  1.00 0.00 ? 56  ASN A O    1  
ATOM 832   C CB   . ASN A 1 56  ? -19.220 -16.138 20.615  1.00 0.00 ? 56  ASN A CB   1  
ATOM 833   C CG   . ASN A 1 56  ? -18.496 -16.112 21.955  1.00 0.00 ? 56  ASN A CG   1  
ATOM 834   O OD1  . ASN A 1 56  ? -18.047 -15.071 22.418  1.00 0.00 ? 56  ASN A OD1  1  
ATOM 835   N ND2  . ASN A 1 56  ? -18.404 -17.243 22.633  1.00 0.00 ? 56  ASN A ND2  1  
ATOM 836   H H    . ASN A 1 56  ? -21.705 -16.044 18.911  1.00 0.00 ? 56  ASN A H    1  
ATOM 837   H HA   . ASN A 1 56  ? -21.039 -16.122 21.759  1.00 0.00 ? 56  ASN A HA   1  
ATOM 838   H HB2  . ASN A 1 56  ? -19.112 -17.140 20.196  1.00 0.00 ? 56  ASN A HB2  1  
ATOM 839   H HB3  . ASN A 1 56  ? -18.736 -15.448 19.921  1.00 0.00 ? 56  ASN A HB3  1  
ATOM 840   H HD21 . ASN A 1 56  ? -18.809 -18.092 22.264  1.00 0.00 ? 56  ASN A HD21 1  
ATOM 841   H HD22 . ASN A 1 56  ? -17.934 -17.246 23.526  1.00 0.00 ? 56  ASN A HD22 1  
ATOM 842   N N    . SER A 1 57  ? -20.147 -13.424 21.294  1.00 0.00 ? 57  SER A N    1  
ATOM 843   C CA   . SER A 1 57  ? -20.240 -11.951 21.274  1.00 0.00 ? 57  SER A CA   1  
ATOM 844   C C    . SER A 1 57  ? -18.935 -11.329 20.735  1.00 0.00 ? 57  SER A C    1  
ATOM 845   O O    . SER A 1 57  ? -17.852 -11.875 20.969  1.00 0.00 ? 57  SER A O    1  
ATOM 846   C CB   . SER A 1 57  ? -20.485 -11.405 22.689  1.00 0.00 ? 57  SER A CB   1  
ATOM 847   O OG   . SER A 1 57  ? -21.636 -11.983 23.291  1.00 0.00 ? 57  SER A OG   1  
ATOM 848   H H    . SER A 1 57  ? -19.331 -13.815 21.756  1.00 0.00 ? 57  SER A H    1  
ATOM 849   H HA   . SER A 1 57  ? -21.075 -11.634 20.645  1.00 0.00 ? 57  SER A HA   1  
ATOM 850   H HB2  . SER A 1 57  ? -19.609 -11.616 23.304  1.00 0.00 ? 57  SER A HB2  1  
ATOM 851   H HB3  . SER A 1 57  ? -20.621 -10.324 22.626  1.00 0.00 ? 57  SER A HB3  1  
ATOM 852   H HG   . SER A 1 57  ? -21.689 -11.685 24.212  1.00 0.00 ? 57  SER A HG   1  
ATOM 853   N N    . ALA A 1 58  ? -19.011 -10.197 20.021  1.00 0.00 ? 58  ALA A N    1  
ATOM 854   C CA   . ALA A 1 58  ? -17.822 -9.553  19.453  1.00 0.00 ? 58  ALA A CA   1  
ATOM 855   C C    . ALA A 1 58  ? -17.107 -8.658  20.479  1.00 0.00 ? 58  ALA A C    1  
ATOM 856   O O    . ALA A 1 58  ? -17.765 -8.038  21.318  1.00 0.00 ? 58  ALA A O    1  
ATOM 857   C CB   . ALA A 1 58  ? -18.225 -8.732  18.223  1.00 0.00 ? 58  ALA A CB   1  
ATOM 858   H H    . ALA A 1 58  ? -19.897 -9.711  19.916  1.00 0.00 ? 58  ALA A H    1  
ATOM 859   H HA   . ALA A 1 58  ? -17.131 -10.333 19.135  1.00 0.00 ? 58  ALA A HA   1  
ATOM 860   H HB1  . ALA A 1 58  ? -18.711 -7.812  18.540  1.00 0.00 ? 58  ALA A HB1  1  
ATOM 861   H HB2  . ALA A 1 58  ? -17.334 -8.478  17.647  1.00 0.00 ? 58  ALA A HB2  1  
ATOM 862   H HB3  . ALA A 1 58  ? -18.911 -9.293  17.595  1.00 0.00 ? 58  ALA A HB3  1  
ATOM 863   N N    . GLU A 1 59  ? -15.787 -8.515  20.353  1.00 0.00 ? 59  GLU A N    1  
ATOM 864   C CA   . GLU A 1 59  ? -14.972 -7.614  21.175  1.00 0.00 ? 59  GLU A CA   1  
ATOM 865   C C    . GLU A 1 59  ? -13.845 -6.981  20.344  1.00 0.00 ? 59  GLU A C    1  
ATOM 866   O O    . GLU A 1 59  ? -13.177 -7.669  19.576  1.00 0.00 ? 59  GLU A O    1  
ATOM 867   C CB   . GLU A 1 59  ? -14.397 -8.370  22.393  1.00 0.00 ? 59  GLU A CB   1  
ATOM 868   C CG   . GLU A 1 59  ? -13.729 -7.424  23.399  1.00 0.00 ? 59  GLU A CG   1  
ATOM 869   C CD   . GLU A 1 59  ? -13.319 -8.153  24.689  1.00 0.00 ? 59  GLU A CD   1  
ATOM 870   O OE1  . GLU A 1 59  ? -12.461 -9.065  24.632  1.00 0.00 ? 59  GLU A OE1  1  
ATOM 871   O OE2  . GLU A 1 59  ? -13.836 -7.792  25.774  1.00 0.00 ? 59  GLU A OE2  1  
ATOM 872   H H    . GLU A 1 59  ? -15.317 -9.032  19.615  1.00 0.00 ? 59  GLU A H    1  
ATOM 873   H HA   . GLU A 1 59  ? -15.613 -6.811  21.544  1.00 0.00 ? 59  GLU A HA   1  
ATOM 874   H HB2  . GLU A 1 59  ? -15.212 -8.889  22.901  1.00 0.00 ? 59  GLU A HB2  1  
ATOM 875   H HB3  . GLU A 1 59  ? -13.668 -9.115  22.062  1.00 0.00 ? 59  GLU A HB3  1  
ATOM 876   H HG2  . GLU A 1 59  ? -12.843 -6.981  22.948  1.00 0.00 ? 59  GLU A HG2  1  
ATOM 877   H HG3  . GLU A 1 59  ? -14.420 -6.614  23.642  1.00 0.00 ? 59  GLU A HG3  1  
ATOM 878   N N    . VAL A 1 60  ? -13.613 -5.678  20.515  1.00 0.00 ? 60  VAL A N    1  
ATOM 879   C CA   . VAL A 1 60  ? -12.449 -4.957  19.972  1.00 0.00 ? 60  VAL A CA   1  
ATOM 880   C C    . VAL A 1 60  ? -11.300 -5.038  20.984  1.00 0.00 ? 60  VAL A C    1  
ATOM 881   O O    . VAL A 1 60  ? -11.478 -4.713  22.157  1.00 0.00 ? 60  VAL A O    1  
ATOM 882   C CB   . VAL A 1 60  ? -12.789 -3.491  19.653  1.00 0.00 ? 60  VAL A CB   1  
ATOM 883   C CG1  . VAL A 1 60  ? -11.552 -2.744  19.120  1.00 0.00 ? 60  VAL A CG1  1  
ATOM 884   C CG2  . VAL A 1 60  ? -13.921 -3.402  18.618  1.00 0.00 ? 60  VAL A CG2  1  
ATOM 885   H H    . VAL A 1 60  ? -14.258 -5.157  21.114  1.00 0.00 ? 60  VAL A H    1  
ATOM 886   H HA   . VAL A 1 60  ? -12.140 -5.439  19.044  1.00 0.00 ? 60  VAL A HA   1  
ATOM 887   H HB   . VAL A 1 60  ? -13.127 -3.013  20.571  1.00 0.00 ? 60  VAL A HB   1  
ATOM 888   H HG11 . VAL A 1 60  ? -10.792 -2.666  19.897  1.00 0.00 ? 60  VAL A HG11 1  
ATOM 889   H HG12 . VAL A 1 60  ? -11.136 -3.277  18.264  1.00 0.00 ? 60  VAL A HG12 1  
ATOM 890   H HG13 . VAL A 1 60  ? -11.825 -1.733  18.820  1.00 0.00 ? 60  VAL A HG13 1  
ATOM 891   H HG21 . VAL A 1 60  ? -13.649 -3.958  17.721  1.00 0.00 ? 60  VAL A HG21 1  
ATOM 892   H HG22 . VAL A 1 60  ? -14.844 -3.815  19.025  1.00 0.00 ? 60  VAL A HG22 1  
ATOM 893   H HG23 . VAL A 1 60  ? -14.101 -2.361  18.351  1.00 0.00 ? 60  VAL A HG23 1  
ATOM 894   N N    . LYS A 1 61  ? -10.120 -5.462  20.524  1.00 0.00 ? 61  LYS A N    1  
ATOM 895   C CA   . LYS A 1 61  ? -8.958  -5.819  21.354  1.00 0.00 ? 61  LYS A CA   1  
ATOM 896   C C    . LYS A 1 61  ? -7.655  -5.135  20.876  1.00 0.00 ? 61  LYS A C    1  
ATOM 897   O O    . LYS A 1 61  ? -7.507  -4.823  19.692  1.00 0.00 ? 61  LYS A O    1  
ATOM 898   C CB   . LYS A 1 61  ? -8.844  -7.366  21.367  1.00 0.00 ? 61  LYS A CB   1  
ATOM 899   C CG   . LYS A 1 61  ? -10.119 -8.026  21.932  1.00 0.00 ? 61  LYS A CG   1  
ATOM 900   C CD   . LYS A 1 61  ? -10.013 -9.549  22.098  1.00 0.00 ? 61  LYS A CD   1  
ATOM 901   C CE   . LYS A 1 61  ? -9.184  -10.029 23.301  1.00 0.00 ? 61  LYS A CE   1  
ATOM 902   N NZ   . LYS A 1 61  ? -9.712  -9.536  24.605  1.00 0.00 ? 61  LYS A NZ   1  
ATOM 903   H H    . LYS A 1 61  ? -10.062 -5.685  19.532  1.00 0.00 ? 61  LYS A H    1  
ATOM 904   H HA   . LYS A 1 61  ? -9.133  -5.484  22.379  1.00 0.00 ? 61  LYS A HA   1  
ATOM 905   H HB2  . LYS A 1 61  ? -8.702  -7.734  20.348  1.00 0.00 ? 61  LYS A HB2  1  
ATOM 906   H HB3  . LYS A 1 61  ? -7.979  -7.665  21.965  1.00 0.00 ? 61  LYS A HB3  1  
ATOM 907   H HG2  . LYS A 1 61  ? -10.384 -7.566  22.884  1.00 0.00 ? 61  LYS A HG2  1  
ATOM 908   H HG3  . LYS A 1 61  ? -10.937 -7.843  21.236  1.00 0.00 ? 61  LYS A HG3  1  
ATOM 909   H HD2  . LYS A 1 61  ? -11.023 -9.952  22.201  1.00 0.00 ? 61  LYS A HD2  1  
ATOM 910   H HD3  . LYS A 1 61  ? -9.581  -9.971  21.188  1.00 0.00 ? 61  LYS A HD3  1  
ATOM 911   H HE2  . LYS A 1 61  ? -9.220  -11.125 23.301  1.00 0.00 ? 61  LYS A HE2  1  
ATOM 912   H HE3  . LYS A 1 61  ? -8.142  -9.726  23.176  1.00 0.00 ? 61  LYS A HE3  1  
ATOM 913   H HZ1  . LYS A 1 61  ? -9.470  -8.568  24.760  1.00 0.00 ? 61  LYS A HZ1  1  
ATOM 914   H HZ2  . LYS A 1 61  ? -10.733 -9.599  24.639  1.00 0.00 ? 61  LYS A HZ2  1  
ATOM 915   H HZ3  . LYS A 1 61  ? -9.339  -10.075 25.376  1.00 0.00 ? 61  LYS A HZ3  1  
ATOM 916   N N    . ARG A 1 62  ? -6.712  -4.885  21.799  1.00 0.00 ? 62  ARG A N    1  
ATOM 917   C CA   . ARG A 1 62  ? -5.374  -4.320  21.523  1.00 0.00 ? 62  ARG A CA   1  
ATOM 918   C C    . ARG A 1 62  ? -4.297  -5.409  21.624  1.00 0.00 ? 62  ARG A C    1  
ATOM 919   O O    . ARG A 1 62  ? -4.336  -6.230  22.541  1.00 0.00 ? 62  ARG A O    1  
ATOM 920   C CB   . ARG A 1 62  ? -5.086  -3.165  22.502  1.00 0.00 ? 62  ARG A CB   1  
ATOM 921   C CG   . ARG A 1 62  ? -3.757  -2.442  22.211  1.00 0.00 ? 62  ARG A CG   1  
ATOM 922   C CD   . ARG A 1 62  ? -3.578  -1.172  23.060  1.00 0.00 ? 62  ARG A CD   1  
ATOM 923   N NE   . ARG A 1 62  ? -3.510  -1.473  24.506  1.00 0.00 ? 62  ARG A NE   1  
ATOM 924   C CZ   . ARG A 1 62  ? -2.446  -1.876  25.197  1.00 0.00 ? 62  ARG A CZ   1  
ATOM 925   N NH1  . ARG A 1 62  ? -1.271  -2.075  24.633  1.00 0.00 ? 62  ARG A NH1  1  
ATOM 926   N NH2  . ARG A 1 62  ? -2.555  -2.087  26.490  1.00 0.00 ? 62  ARG A NH2  1  
ATOM 927   H H    . ARG A 1 62  ? -6.903  -5.176  22.751  1.00 0.00 ? 62  ARG A H    1  
ATOM 928   H HA   . ARG A 1 62  ? -5.361  -3.917  20.508  1.00 0.00 ? 62  ARG A HA   1  
ATOM 929   H HB2  . ARG A 1 62  ? -5.894  -2.441  22.414  1.00 0.00 ? 62  ARG A HB2  1  
ATOM 930   H HB3  . ARG A 1 62  ? -5.076  -3.550  23.523  1.00 0.00 ? 62  ARG A HB3  1  
ATOM 931   H HG2  . ARG A 1 62  ? -2.922  -3.114  22.401  1.00 0.00 ? 62  ARG A HG2  1  
ATOM 932   H HG3  . ARG A 1 62  ? -3.733  -2.154  21.157  1.00 0.00 ? 62  ARG A HG3  1  
ATOM 933   H HD2  . ARG A 1 62  ? -2.675  -0.654  22.743  1.00 0.00 ? 62  ARG A HD2  1  
ATOM 934   H HD3  . ARG A 1 62  ? -4.418  -0.499  22.874  1.00 0.00 ? 62  ARG A HD3  1  
ATOM 935   H HE   . ARG A 1 62  ? -4.361  -1.322  25.031  1.00 0.00 ? 62  ARG A HE   1  
ATOM 936   H HH11 . ARG A 1 62  ? -1.143  -1.915  23.648  1.00 0.00 ? 62  ARG A HH11 1  
ATOM 937   H HH12 . ARG A 1 62  ? -0.484  -2.378  25.188  1.00 0.00 ? 62  ARG A HH12 1  
ATOM 938   H HH21 . ARG A 1 62  ? -3.432  -1.943  26.966  1.00 0.00 ? 62  ARG A HH21 1  
ATOM 939   H HH22 . ARG A 1 62  ? -1.756  -2.384  27.032  1.00 0.00 ? 62  ARG A HH22 1  
ATOM 940   N N    . GLU A 1 63  ? -3.331  -5.398  20.702  1.00 0.00 ? 63  GLU A N    1  
ATOM 941   C CA   . GLU A 1 63  ? -2.347  -6.473  20.527  1.00 0.00 ? 63  GLU A CA   1  
ATOM 942   C C    . GLU A 1 63  ? -1.164  -6.003  19.663  1.00 0.00 ? 63  GLU A C    1  
ATOM 943   O O    . GLU A 1 63  ? -1.208  -4.941  19.039  1.00 0.00 ? 63  GLU A O    1  
ATOM 944   C CB   . GLU A 1 63  ? -3.084  -7.700  19.942  1.00 0.00 ? 63  GLU A CB   1  
ATOM 945   C CG   . GLU A 1 63  ? -2.329  -9.028  19.875  1.00 0.00 ? 63  GLU A CG   1  
ATOM 946   C CD   . GLU A 1 63  ? -1.657  -9.400  21.203  1.00 0.00 ? 63  GLU A CD   1  
ATOM 947   O OE1  . GLU A 1 63  ? -0.484  -9.003  21.393  1.00 0.00 ? 63  GLU A OE1  1  
ATOM 948   O OE2  . GLU A 1 63  ? -2.282  -10.074 22.054  1.00 0.00 ? 63  GLU A OE2  1  
ATOM 949   H H    . GLU A 1 63  ? -3.342  -4.668  19.994  1.00 0.00 ? 63  GLU A H    1  
ATOM 950   H HA   . GLU A 1 63  ? -1.951  -6.734  21.510  1.00 0.00 ? 63  GLU A HA   1  
ATOM 951   H HB2  . GLU A 1 63  ? -3.970  -7.892  20.545  1.00 0.00 ? 63  GLU A HB2  1  
ATOM 952   H HB3  . GLU A 1 63  ? -3.418  -7.449  18.934  1.00 0.00 ? 63  GLU A HB3  1  
ATOM 953   H HG2  . GLU A 1 63  ? -3.042  -9.805  19.595  1.00 0.00 ? 63  GLU A HG2  1  
ATOM 954   H HG3  . GLU A 1 63  ? -1.579  -8.963  19.092  1.00 0.00 ? 63  GLU A HG3  1  
ATOM 955   N N    . ARG A 1 64  ? -0.089  -6.790  19.638  1.00 0.00 ? 64  ARG A N    1  
ATOM 956   C CA   . ARG A 1 64  ? 1.127   -6.532  18.858  1.00 0.00 ? 64  ARG A CA   1  
ATOM 957   C C    . ARG A 1 64  ? 0.959   -7.026  17.418  1.00 0.00 ? 64  ARG A C    1  
ATOM 958   O O    . ARG A 1 64  ? 0.400   -8.103  17.188  1.00 0.00 ? 64  ARG A O    1  
ATOM 959   C CB   . ARG A 1 64  ? 2.318   -7.239  19.532  1.00 0.00 ? 64  ARG A CB   1  
ATOM 960   C CG   . ARG A 1 64  ? 2.614   -6.703  20.948  1.00 0.00 ? 64  ARG A CG   1  
ATOM 961   C CD   . ARG A 1 64  ? 3.202   -7.789  21.860  1.00 0.00 ? 64  ARG A CD   1  
ATOM 962   N NE   . ARG A 1 64  ? 2.188   -8.822  22.136  1.00 0.00 ? 64  ARG A NE   1  
ATOM 963   C CZ   . ARG A 1 64  ? 2.353   -10.038 22.631  1.00 0.00 ? 64  ARG A CZ   1  
ATOM 964   N NH1  . ARG A 1 64  ? 3.517   -10.495 23.041  1.00 0.00 ? 64  ARG A NH1  1  
ATOM 965   N NH2  . ARG A 1 64  ? 1.287   -10.799 22.691  1.00 0.00 ? 64  ARG A NH2  1  
ATOM 966   H H    . ARG A 1 64  ? -0.121  -7.644  20.190  1.00 0.00 ? 64  ARG A H    1  
ATOM 967   H HA   . ARG A 1 64  ? 1.323   -5.458  18.848  1.00 0.00 ? 64  ARG A HA   1  
ATOM 968   H HB2  . ARG A 1 64  ? 2.097   -8.307  19.571  1.00 0.00 ? 64  ARG A HB2  1  
ATOM 969   H HB3  . ARG A 1 64  ? 3.215   -7.106  18.925  1.00 0.00 ? 64  ARG A HB3  1  
ATOM 970   H HG2  . ARG A 1 64  ? 3.319   -5.875  20.868  1.00 0.00 ? 64  ARG A HG2  1  
ATOM 971   H HG3  . ARG A 1 64  ? 1.705   -6.318  21.418  1.00 0.00 ? 64  ARG A HG3  1  
ATOM 972   H HD2  . ARG A 1 64  ? 4.074   -8.229  21.377  1.00 0.00 ? 64  ARG A HD2  1  
ATOM 973   H HD3  . ARG A 1 64  ? 3.511   -7.331  22.801  1.00 0.00 ? 64  ARG A HD3  1  
ATOM 974   H HE   . ARG A 1 64  ? 1.225   -8.611  21.868  1.00 0.00 ? 64  ARG A HE   1  
ATOM 975   H HH11 . ARG A 1 64  ? 4.336   -9.907  22.999  1.00 0.00 ? 64  ARG A HH11 1  
ATOM 976   H HH12 . ARG A 1 64  ? 3.600   -11.429 23.415  1.00 0.00 ? 64  ARG A HH12 1  
ATOM 977   H HH21 . ARG A 1 64  ? 0.415   -10.411 22.330  1.00 0.00 ? 64  ARG A HH21 1  
ATOM 978   H HH22 . ARG A 1 64  ? 1.326   -11.748 23.023  1.00 0.00 ? 64  ARG A HH22 1  
ATOM 979   N N    . LEU A 1 65  ? 1.522   -6.304  16.443  1.00 0.00 ? 65  LEU A N    1  
ATOM 980   C CA   . LEU A 1 65  ? 1.512   -6.704  15.026  1.00 0.00 ? 65  LEU A CA   1  
ATOM 981   C C    . LEU A 1 65  ? 2.102   -8.110  14.860  1.00 0.00 ? 65  LEU A C    1  
ATOM 982   O O    . LEU A 1 65  ? 1.451   -8.968  14.281  1.00 0.00 ? 65  LEU A O    1  
ATOM 983   C CB   . LEU A 1 65  ? 2.267   -5.653  14.181  1.00 0.00 ? 65  LEU A CB   1  
ATOM 984   C CG   . LEU A 1 65  ? 2.260   -5.955  12.662  1.00 0.00 ? 65  LEU A CG   1  
ATOM 985   C CD1  . LEU A 1 65  ? 0.871   -5.737  12.041  1.00 0.00 ? 65  LEU A CD1  1  
ATOM 986   C CD2  . LEU A 1 65  ? 3.296   -5.090  11.935  1.00 0.00 ? 65  LEU A CD2  1  
ATOM 987   H H    . LEU A 1 65  ? 2.011   -5.454  16.706  1.00 0.00 ? 65  LEU A H    1  
ATOM 988   H HA   . LEU A 1 65  ? 0.471   -6.752  14.688  1.00 0.00 ? 65  LEU A HA   1  
ATOM 989   H HB2  . LEU A 1 65  ? 1.818   -4.671  14.346  1.00 0.00 ? 65  LEU A HB2  1  
ATOM 990   H HB3  . LEU A 1 65  ? 3.302   -5.606  14.526  1.00 0.00 ? 65  LEU A HB3  1  
ATOM 991   H HG   . LEU A 1 65  ? 2.549   -6.993  12.500  1.00 0.00 ? 65  LEU A HG   1  
ATOM 992   H HD11 . LEU A 1 65  ? 0.556   -4.702  12.180  1.00 0.00 ? 65  LEU A HD11 1  
ATOM 993   H HD12 . LEU A 1 65  ? 0.908   -5.954  10.971  1.00 0.00 ? 65  LEU A HD12 1  
ATOM 994   H HD13 . LEU A 1 65  ? 0.140   -6.401  12.498  1.00 0.00 ? 65  LEU A HD13 1  
ATOM 995   H HD21 . LEU A 1 65  ? 4.285   -5.259  12.363  1.00 0.00 ? 65  LEU A HD21 1  
ATOM 996   H HD22 . LEU A 1 65  ? 3.325   -5.360  10.877  1.00 0.00 ? 65  LEU A HD22 1  
ATOM 997   H HD23 . LEU A 1 65  ? 3.042   -4.035  12.027  1.00 0.00 ? 65  LEU A HD23 1  
ATOM 998   N N    . GLU A 1 66  ? 3.270   -8.375  15.448  1.00 0.00 ? 66  GLU A N    1  
ATOM 999   C CA   . GLU A 1 66  ? 3.937   -9.684  15.373  1.00 0.00 ? 66  GLU A CA   1  
ATOM 1000  C C    . GLU A 1 66  ? 3.114   -10.848 15.968  1.00 0.00 ? 66  GLU A C    1  
ATOM 1001  O O    . GLU A 1 66  ? 3.288   -11.987 15.538  1.00 0.00 ? 66  GLU A O    1  
ATOM 1002  C CB   . GLU A 1 66  ? 5.341   -9.610  16.004  1.00 0.00 ? 66  GLU A CB   1  
ATOM 1003  C CG   . GLU A 1 66  ? 5.350   -9.351  17.516  1.00 0.00 ? 66  GLU A CG   1  
ATOM 1004  C CD   . GLU A 1 66  ? 6.787   -9.273  18.049  1.00 0.00 ? 66  GLU A CD   1  
ATOM 1005  O OE1  . GLU A 1 66  ? 7.349   -10.321 18.447  1.00 0.00 ? 66  GLU A OE1  1  
ATOM 1006  O OE2  . GLU A 1 66  ? 7.362   -8.159  18.081  1.00 0.00 ? 66  GLU A OE2  1  
ATOM 1007  H H    . GLU A 1 66  ? 3.772   -7.609  15.884  1.00 0.00 ? 66  GLU A H    1  
ATOM 1008  H HA   . GLU A 1 66  ? 4.077   -9.910  14.314  1.00 0.00 ? 66  GLU A HA   1  
ATOM 1009  H HB2  . GLU A 1 66  ? 5.859   -10.550 15.811  1.00 0.00 ? 66  GLU A HB2  1  
ATOM 1010  H HB3  . GLU A 1 66  ? 5.901   -8.814  15.511  1.00 0.00 ? 66  GLU A HB3  1  
ATOM 1011  H HG2  . GLU A 1 66  ? 4.835   -8.415  17.733  1.00 0.00 ? 66  GLU A HG2  1  
ATOM 1012  H HG3  . GLU A 1 66  ? 4.817   -10.152 18.030  1.00 0.00 ? 66  GLU A HG3  1  
ATOM 1013  N N    . ASP A 1 67  ? 2.182   -10.587 16.896  1.00 0.00 ? 67  ASP A N    1  
ATOM 1014  C CA   . ASP A 1 67  ? 1.248   -11.606 17.395  1.00 0.00 ? 67  ASP A CA   1  
ATOM 1015  C C    . ASP A 1 67  ? 0.079   -11.784 16.413  1.00 0.00 ? 67  ASP A C    1  
ATOM 1016  O O    . ASP A 1 67  ? -0.253  -12.910 16.049  1.00 0.00 ? 67  ASP A O    1  
ATOM 1017  C CB   . ASP A 1 67  ? 0.746   -11.226 18.793  1.00 0.00 ? 67  ASP A CB   1  
ATOM 1018  C CG   . ASP A 1 67  ? -0.186  -12.308 19.365  1.00 0.00 ? 67  ASP A CG   1  
ATOM 1019  O OD1  . ASP A 1 67  ? -1.367  -12.366 18.951  1.00 0.00 ? 67  ASP A OD1  1  
ATOM 1020  O OD2  . ASP A 1 67  ? 0.277   -13.105 20.214  1.00 0.00 ? 67  ASP A OD2  1  
ATOM 1021  H H    . ASP A 1 67  ? 2.031   -9.633  17.189  1.00 0.00 ? 67  ASP A H    1  
ATOM 1022  H HA   . ASP A 1 67  ? 1.763   -12.563 17.481  1.00 0.00 ? 67  ASP A HA   1  
ATOM 1023  H HB2  . ASP A 1 67  ? 1.605   -11.100 19.453  1.00 0.00 ? 67  ASP A HB2  1  
ATOM 1024  H HB3  . ASP A 1 67  ? 0.220   -10.274 18.747  1.00 0.00 ? 67  ASP A HB3  1  
ATOM 1025  N N    . VAL A 1 68  ? -0.505  -10.676 15.939  1.00 0.00 ? 68  VAL A N    1  
ATOM 1026  C CA   . VAL A 1 68  ? -1.607  -10.680 14.954  1.00 0.00 ? 68  VAL A CA   1  
ATOM 1027  C C    . VAL A 1 68  ? -1.176  -11.272 13.599  1.00 0.00 ? 68  VAL A C    1  
ATOM 1028  O O    . VAL A 1 68  ? -1.980  -11.911 12.925  1.00 0.00 ? 68  VAL A O    1  
ATOM 1029  C CB   . VAL A 1 68  ? -2.245  -9.276  14.825  1.00 0.00 ? 68  VAL A CB   1  
ATOM 1030  C CG1  . VAL A 1 68  ? -3.329  -9.181  13.742  1.00 0.00 ? 68  VAL A CG1  1  
ATOM 1031  C CG2  . VAL A 1 68  ? -2.873  -8.897  16.178  1.00 0.00 ? 68  VAL A CG2  1  
ATOM 1032  H H    . VAL A 1 68  ? -0.198  -9.787  16.333  1.00 0.00 ? 68  VAL A H    1  
ATOM 1033  H HA   . VAL A 1 68  ? -2.372  -11.339 15.340  1.00 0.00 ? 68  VAL A HA   1  
ATOM 1034  H HB   . VAL A 1 68  ? -1.463  -8.553  14.588  1.00 0.00 ? 68  VAL A HB   1  
ATOM 1035  H HG11 . VAL A 1 68  ? -3.783  -8.189  13.754  1.00 0.00 ? 68  VAL A HG11 1  
ATOM 1036  H HG12 . VAL A 1 68  ? -2.885  -9.334  12.760  1.00 0.00 ? 68  VAL A HG12 1  
ATOM 1037  H HG13 . VAL A 1 68  ? -4.103  -9.931  13.917  1.00 0.00 ? 68  VAL A HG13 1  
ATOM 1038  H HG21 . VAL A 1 68  ? -2.085  -8.719  16.906  1.00 0.00 ? 68  VAL A HG21 1  
ATOM 1039  H HG22 . VAL A 1 68  ? -3.477  -7.995  16.083  1.00 0.00 ? 68  VAL A HG22 1  
ATOM 1040  H HG23 . VAL A 1 68  ? -3.518  -9.703  16.531  1.00 0.00 ? 68  VAL A HG23 1  
ATOM 1041  N N    . VAL A 1 69  ? 0.097   -11.115 13.237  1.00 0.00 ? 69  VAL A N    1  
ATOM 1042  C CA   . VAL A 1 69  ? 0.716   -11.642 12.011  1.00 0.00 ? 69  VAL A CA   1  
ATOM 1043  C C    . VAL A 1 69  ? 1.349   -13.035 12.213  1.00 0.00 ? 69  VAL A C    1  
ATOM 1044  O O    . VAL A 1 69  ? 1.498   -13.775 11.243  1.00 0.00 ? 69  VAL A O    1  
ATOM 1045  C CB   . VAL A 1 69  ? 1.745   -10.610 11.489  1.00 0.00 ? 69  VAL A CB   1  
ATOM 1046  C CG1  . VAL A 1 69  ? 2.617   -11.112 10.329  1.00 0.00 ? 69  VAL A CG1  1  
ATOM 1047  C CG2  . VAL A 1 69  ? 0.990   -9.343  11.040  1.00 0.00 ? 69  VAL A CG2  1  
ATOM 1048  H H    . VAL A 1 69  ? 0.665   -10.495 13.816  1.00 0.00 ? 69  VAL A H    1  
ATOM 1049  H HA   . VAL A 1 69  ? -0.060  -11.744 11.251  1.00 0.00 ? 69  VAL A HA   1  
ATOM 1050  H HB   . VAL A 1 69  ? 2.416   -10.350 12.307  1.00 0.00 ? 69  VAL A HB   1  
ATOM 1051  H HG11 . VAL A 1 69  ? 3.290   -11.895 10.679  1.00 0.00 ? 69  VAL A HG11 1  
ATOM 1052  H HG12 . VAL A 1 69  ? 1.987   -11.505 9.531   1.00 0.00 ? 69  VAL A HG12 1  
ATOM 1053  H HG13 . VAL A 1 69  ? 3.228   -10.297 9.947   1.00 0.00 ? 69  VAL A HG13 1  
ATOM 1054  H HG21 . VAL A 1 69  ? 0.408   -8.932  11.867  1.00 0.00 ? 69  VAL A HG21 1  
ATOM 1055  H HG22 . VAL A 1 69  ? 1.695   -8.584  10.699  1.00 0.00 ? 69  VAL A HG22 1  
ATOM 1056  H HG23 . VAL A 1 69  ? 0.304   -9.586  10.227  1.00 0.00 ? 69  VAL A HG23 1  
ATOM 1057  N N    . GLY A 1 70  ? 1.681   -13.434 13.450  1.00 0.00 ? 70  GLY A N    1  
ATOM 1058  C CA   . GLY A 1 70  ? 2.301   -14.730 13.753  1.00 0.00 ? 70  GLY A CA   1  
ATOM 1059  C C    . GLY A 1 70  ? 1.395   -15.904 13.371  1.00 0.00 ? 70  GLY A C    1  
ATOM 1060  O O    . GLY A 1 70  ? 0.272   -16.018 13.866  1.00 0.00 ? 70  GLY A O    1  
ATOM 1061  H H    . GLY A 1 70  ? 1.566   -12.788 14.220  1.00 0.00 ? 70  GLY A H    1  
ATOM 1062  H HA2  . GLY A 1 70  ? 3.236   -14.815 13.198  1.00 0.00 ? 70  GLY A HA2  1  
ATOM 1063  H HA3  . GLY A 1 70  ? 2.524   -14.795 14.819  1.00 0.00 ? 70  GLY A HA3  1  
ATOM 1064  N N    . GLY A 1 71  ? 1.869   -16.752 12.449  1.00 0.00 ? 71  GLY A N    1  
ATOM 1065  C CA   . GLY A 1 71  ? 1.110   -17.883 11.889  1.00 0.00 ? 71  GLY A CA   1  
ATOM 1066  C C    . GLY A 1 71  ? 0.001   -17.484 10.905  1.00 0.00 ? 71  GLY A C    1  
ATOM 1067  O O    . GLY A 1 71  ? -0.801  -18.338 10.525  1.00 0.00 ? 71  GLY A O    1  
ATOM 1068  H H    . GLY A 1 71  ? 2.809   -16.597 12.104  1.00 0.00 ? 71  GLY A H    1  
ATOM 1069  H HA2  . GLY A 1 71  ? 1.795   -18.550 11.365  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1070  H HA3  . GLY A 1 71  ? 0.639   -18.434 12.707  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1071  N N    . CYS A 1 72  ? -0.064  -16.204 10.516  1.00 0.00 ? 72  CYS A N    1  
ATOM 1072  C CA   . CYS A 1 72  ? -1.142  -15.592 9.731   1.00 0.00 ? 72  CYS A CA   1  
ATOM 1073  C C    . CYS A 1 72  ? -0.608  -14.931 8.441   1.00 0.00 ? 72  CYS A C    1  
ATOM 1074  O O    . CYS A 1 72  ? 0.586   -14.637 8.319   1.00 0.00 ? 72  CYS A O    1  
ATOM 1075  C CB   . CYS A 1 72  ? -1.850  -14.542 10.611  1.00 0.00 ? 72  CYS A CB   1  
ATOM 1076  S SG   . CYS A 1 72  ? -2.425  -15.261 12.181  1.00 0.00 ? 72  CYS A SG   1  
ATOM 1077  H H    . CYS A 1 72  ? 0.673   -15.584 10.824  1.00 0.00 ? 72  CYS A H    1  
ATOM 1078  H HA   . CYS A 1 72  ? -1.870  -16.356 9.441   1.00 0.00 ? 72  CYS A HA   1  
ATOM 1079  H HB2  . CYS A 1 72  ? -1.164  -13.717 10.817  1.00 0.00 ? 72  CYS A HB2  1  
ATOM 1080  H HB3  . CYS A 1 72  ? -2.703  -14.128 10.070  1.00 0.00 ? 72  CYS A HB3  1  
ATOM 1081  H HG   . CYS A 1 72  ? -1.224  -15.656 12.638  1.00 0.00 ? 72  CYS A HG   1  
ATOM 1082  N N    . CYS A 1 73  ? -1.515  -14.651 7.499   1.00 0.00 ? 73  CYS A N    1  
ATOM 1083  C CA   . CYS A 1 73  ? -1.253  -13.829 6.303   1.00 0.00 ? 73  CYS A CA   1  
ATOM 1084  C C    . CYS A 1 73  ? -1.997  -12.483 6.416   1.00 0.00 ? 73  CYS A C    1  
ATOM 1085  O O    . CYS A 1 73  ? -2.955  -12.369 7.180   1.00 0.00 ? 73  CYS A O    1  
ATOM 1086  C CB   . CYS A 1 73  ? -1.652  -14.617 5.039   1.00 0.00 ? 73  CYS A CB   1  
ATOM 1087  S SG   . CYS A 1 73  ? -0.642  -16.123 4.903   1.00 0.00 ? 73  CYS A SG   1  
ATOM 1088  H H    . CYS A 1 73  ? -2.475  -14.903 7.686   1.00 0.00 ? 73  CYS A H    1  
ATOM 1089  H HA   . CYS A 1 73  ? -0.188  -13.598 6.238   1.00 0.00 ? 73  CYS A HA   1  
ATOM 1090  H HB2  . CYS A 1 73  ? -2.707  -14.887 5.070   1.00 0.00 ? 73  CYS A HB2  1  
ATOM 1091  H HB3  . CYS A 1 73  ? -1.485  -13.994 4.152   1.00 0.00 ? 73  CYS A HB3  1  
ATOM 1092  H HG   . CYS A 1 73  ? -1.175  -16.579 3.760   1.00 0.00 ? 73  CYS A HG   1  
ATOM 1093  N N    . TYR A 1 74  ? -1.581  -11.461 5.665   1.00 0.00 ? 74  TYR A N    1  
ATOM 1094  C CA   . TYR A 1 74  ? -2.162  -10.110 5.756   1.00 0.00 ? 74  TYR A CA   1  
ATOM 1095  C C    . TYR A 1 74  ? -1.956  -9.236  4.506   1.00 0.00 ? 74  TYR A C    1  
ATOM 1096  O O    . TYR A 1 74  ? -1.167  -9.577  3.623   1.00 0.00 ? 74  TYR A O    1  
ATOM 1097  C CB   . TYR A 1 74  ? -1.642  -9.395  7.019   1.00 0.00 ? 74  TYR A CB   1  
ATOM 1098  C CG   . TYR A 1 74  ? -0.176  -8.998  7.008   1.00 0.00 ? 74  TYR A CG   1  
ATOM 1099  C CD1  . TYR A 1 74  ? 0.815   -9.961  7.269   1.00 0.00 ? 74  TYR A CD1  1  
ATOM 1100  C CD2  . TYR A 1 74  ? 0.195   -7.656  6.781   1.00 0.00 ? 74  TYR A CD2  1  
ATOM 1101  C CE1  . TYR A 1 74  ? 2.171   -9.587  7.324   1.00 0.00 ? 74  TYR A CE1  1  
ATOM 1102  C CE2  . TYR A 1 74  ? 1.546   -7.268  6.872   1.00 0.00 ? 74  TYR A CE2  1  
ATOM 1103  C CZ   . TYR A 1 74  ? 2.538   -8.234  7.153   1.00 0.00 ? 74  TYR A CZ   1  
ATOM 1104  O OH   . TYR A 1 74  ? 3.846   -7.877  7.249   1.00 0.00 ? 74  TYR A OH   1  
ATOM 1105  H H    . TYR A 1 74  ? -0.803  -11.602 5.034   1.00 0.00 ? 74  TYR A H    1  
ATOM 1106  H HA   . TYR A 1 74  ? -3.238  -10.231 5.866   1.00 0.00 ? 74  TYR A HA   1  
ATOM 1107  H HB2  . TYR A 1 74  ? -2.234  -8.495  7.161   1.00 0.00 ? 74  TYR A HB2  1  
ATOM 1108  H HB3  . TYR A 1 74  ? -1.819  -10.025 7.892   1.00 0.00 ? 74  TYR A HB3  1  
ATOM 1109  H HD1  . TYR A 1 74  ? 0.538   -10.992 7.443   1.00 0.00 ? 74  TYR A HD1  1  
ATOM 1110  H HD2  . TYR A 1 74  ? -0.556  -6.914  6.549   1.00 0.00 ? 74  TYR A HD2  1  
ATOM 1111  H HE1  . TYR A 1 74  ? 2.935   -10.327 7.515   1.00 0.00 ? 74  TYR A HE1  1  
ATOM 1112  H HE2  . TYR A 1 74  ? 1.821   -6.230  6.733   1.00 0.00 ? 74  TYR A HE2  1  
ATOM 1113  H HH   . TYR A 1 74  ? 3.988   -6.931  7.100   1.00 0.00 ? 74  TYR A HH   1  
ATOM 1114  N N    . ARG A 1 75  ? -2.655  -8.091  4.457   1.00 0.00 ? 75  ARG A N    1  
ATOM 1115  C CA   . ARG A 1 75  ? -2.620  -7.094  3.366   1.00 0.00 ? 75  ARG A CA   1  
ATOM 1116  C C    . ARG A 1 75  ? -3.224  -5.758  3.830   1.00 0.00 ? 75  ARG A C    1  
ATOM 1117  O O    . ARG A 1 75  ? -4.307  -5.755  4.406   1.00 0.00 ? 75  ARG A O    1  
ATOM 1118  C CB   . ARG A 1 75  ? -3.405  -7.682  2.164   1.00 0.00 ? 75  ARG A CB   1  
ATOM 1119  C CG   . ARG A 1 75  ? -3.571  -6.783  0.925   1.00 0.00 ? 75  ARG A CG   1  
ATOM 1120  C CD   . ARG A 1 75  ? -2.260  -6.295  0.290   1.00 0.00 ? 75  ARG A CD   1  
ATOM 1121  N NE   . ARG A 1 75  ? -1.362  -7.402  -0.083  1.00 0.00 ? 75  ARG A NE   1  
ATOM 1122  C CZ   . ARG A 1 75  ? -1.439  -8.192  -1.147  1.00 0.00 ? 75  ARG A CZ   1  
ATOM 1123  N NH1  . ARG A 1 75  ? -2.403  -8.081  -2.038  1.00 0.00 ? 75  ARG A NH1  1  
ATOM 1124  N NH2  . ARG A 1 75  ? -0.527  -9.122  -1.327  1.00 0.00 ? 75  ARG A NH2  1  
ATOM 1125  H H    . ARG A 1 75  ? -3.347  -7.950  5.191   1.00 0.00 ? 75  ARG A H    1  
ATOM 1126  H HA   . ARG A 1 75  ? -1.580  -6.935  3.075   1.00 0.00 ? 75  ARG A HA   1  
ATOM 1127  H HB2  . ARG A 1 75  ? -2.922  -8.607  1.845   1.00 0.00 ? 75  ARG A HB2  1  
ATOM 1128  H HB3  . ARG A 1 75  ? -4.404  -7.951  2.505   1.00 0.00 ? 75  ARG A HB3  1  
ATOM 1129  H HG2  . ARG A 1 75  ? -4.129  -7.344  0.177   1.00 0.00 ? 75  ARG A HG2  1  
ATOM 1130  H HG3  . ARG A 1 75  ? -4.175  -5.917  1.194   1.00 0.00 ? 75  ARG A HG3  1  
ATOM 1131  H HD2  . ARG A 1 75  ? -2.493  -5.695  -0.591  1.00 0.00 ? 75  ARG A HD2  1  
ATOM 1132  H HD3  . ARG A 1 75  ? -1.737  -5.651  0.996   1.00 0.00 ? 75  ARG A HD3  1  
ATOM 1133  H HE   . ARG A 1 75  ? -0.563  -7.539  0.533   1.00 0.00 ? 75  ARG A HE   1  
ATOM 1134  H HH11 . ARG A 1 75  ? -3.111  -7.370  -1.936  1.00 0.00 ? 75  ARG A HH11 1  
ATOM 1135  H HH12 . ARG A 1 75  ? -2.432  -8.691  -2.841  1.00 0.00 ? 75  ARG A HH12 1  
ATOM 1136  H HH21 . ARG A 1 75  ? 0.228   -9.227  -0.666  1.00 0.00 ? 75  ARG A HH21 1  
ATOM 1137  H HH22 . ARG A 1 75  ? -0.569  -9.732  -2.128  1.00 0.00 ? 75  ARG A HH22 1  
ATOM 1138  N N    . VAL A 1 76  ? -2.571  -4.617  3.577   1.00 0.00 ? 76  VAL A N    1  
ATOM 1139  C CA   . VAL A 1 76  ? -3.192  -3.284  3.792   1.00 0.00 ? 76  VAL A CA   1  
ATOM 1140  C C    . VAL A 1 76  ? -4.292  -3.092  2.739   1.00 0.00 ? 76  VAL A C    1  
ATOM 1141  O O    . VAL A 1 76  ? -4.045  -3.272  1.547   1.00 0.00 ? 76  VAL A O    1  
ATOM 1142  C CB   . VAL A 1 76  ? -2.179  -2.114  3.745   1.00 0.00 ? 76  VAL A CB   1  
ATOM 1143  C CG1  . VAL A 1 76  ? -2.858  -0.743  3.942   1.00 0.00 ? 76  VAL A CG1  1  
ATOM 1144  C CG2  . VAL A 1 76  ? -1.109  -2.279  4.835   1.00 0.00 ? 76  VAL A CG2  1  
ATOM 1145  H H    . VAL A 1 76  ? -1.655  -4.672  3.144   1.00 0.00 ? 76  VAL A H    1  
ATOM 1146  H HA   . VAL A 1 76  ? -3.648  -3.279  4.781   1.00 0.00 ? 76  VAL A HA   1  
ATOM 1147  H HB   . VAL A 1 76  ? -1.679  -2.122  2.777   1.00 0.00 ? 76  VAL A HB   1  
ATOM 1148  H HG11 . VAL A 1 76  ? -2.109  0.050   3.925   1.00 0.00 ? 76  VAL A HG11 1  
ATOM 1149  H HG12 . VAL A 1 76  ? -3.571  -0.544  3.142   1.00 0.00 ? 76  VAL A HG12 1  
ATOM 1150  H HG13 . VAL A 1 76  ? -3.383  -0.711  4.898   1.00 0.00 ? 76  VAL A HG13 1  
ATOM 1151  H HG21 . VAL A 1 76  ? -0.404  -1.451  4.782   1.00 0.00 ? 76  VAL A HG21 1  
ATOM 1152  H HG22 . VAL A 1 76  ? -1.573  -2.291  5.824   1.00 0.00 ? 76  VAL A HG22 1  
ATOM 1153  H HG23 . VAL A 1 76  ? -0.555  -3.207  4.695   1.00 0.00 ? 76  VAL A HG23 1  
ATOM 1154  N N    . ASN A 1 77  ? -5.504  -2.749  3.187   1.00 0.00 ? 77  ASN A N    1  
ATOM 1155  C CA   . ASN A 1 77  ? -6.698  -2.677  2.338   1.00 0.00 ? 77  ASN A CA   1  
ATOM 1156  C C    . ASN A 1 77  ? -7.709  -1.663  2.906   1.00 0.00 ? 77  ASN A C    1  
ATOM 1157  O O    . ASN A 1 77  ? -8.809  -2.011  3.339   1.00 0.00 ? 77  ASN A O    1  
ATOM 1158  C CB   . ASN A 1 77  ? -7.281  -4.094  2.134   1.00 0.00 ? 77  ASN A CB   1  
ATOM 1159  C CG   . ASN A 1 77  ? -8.457  -4.134  1.151   1.00 0.00 ? 77  ASN A CG   1  
ATOM 1160  O OD1  . ASN A 1 77  ? -8.735  -3.184  0.427   1.00 0.00 ? 77  ASN A OD1  1  
ATOM 1161  N ND2  . ASN A 1 77  ? -9.176  -5.240  1.086   1.00 0.00 ? 77  ASN A ND2  1  
ATOM 1162  H H    . ASN A 1 77  ? -5.616  -2.575  4.181   1.00 0.00 ? 77  ASN A H    1  
ATOM 1163  H HA   . ASN A 1 77  ? -6.397  -2.300  1.358   1.00 0.00 ? 77  ASN A HA   1  
ATOM 1164  H HB2  . ASN A 1 77  ? -6.503  -4.755  1.752   1.00 0.00 ? 77  ASN A HB2  1  
ATOM 1165  H HB3  . ASN A 1 77  ? -7.610  -4.492  3.091   1.00 0.00 ? 77  ASN A HB3  1  
ATOM 1166  H HD21 . ASN A 1 77  ? -8.963  -6.048  1.672   1.00 0.00 ? 77  ASN A HD21 1  
ATOM 1167  H HD22 . ASN A 1 77  ? -9.948  -5.281  0.440   1.00 0.00 ? 77  ASN A HD22 1  
ATOM 1168  N N    . ASN A 1 78  ? -7.324  -0.385  2.928   1.00 0.00 ? 78  ASN A N    1  
ATOM 1169  C CA   . ASN A 1 78  ? -8.145  0.715   3.428   1.00 0.00 ? 78  ASN A CA   1  
ATOM 1170  C C    . ASN A 1 78  ? -9.170  1.167   2.374   1.00 0.00 ? 78  ASN A C    1  
ATOM 1171  O O    . ASN A 1 78  ? -9.097  2.258   1.816   1.00 0.00 ? 78  ASN A O    1  
ATOM 1172  C CB   . ASN A 1 78  ? -7.257  1.850   3.964   1.00 0.00 ? 78  ASN A CB   1  
ATOM 1173  C CG   . ASN A 1 78  ? -8.073  2.866   4.757   1.00 0.00 ? 78  ASN A CG   1  
ATOM 1174  O OD1  . ASN A 1 78  ? -9.291  2.780   4.858   1.00 0.00 ? 78  ASN A OD1  1  
ATOM 1175  N ND2  . ASN A 1 78  ? -7.435  3.841   5.364   1.00 0.00 ? 78  ASN A ND2  1  
ATOM 1176  H H    . ASN A 1 78  ? -6.474  -0.145  2.442   1.00 0.00 ? 78  ASN A H    1  
ATOM 1177  H HA   . ASN A 1 78  ? -8.712  0.342   4.278   1.00 0.00 ? 78  ASN A HA   1  
ATOM 1178  H HB2  . ASN A 1 78  ? -6.495  1.431   4.623   1.00 0.00 ? 78  ASN A HB2  1  
ATOM 1179  H HB3  . ASN A 1 78  ? -6.751  2.356   3.142   1.00 0.00 ? 78  ASN A HB3  1  
ATOM 1180  H HD21 . ASN A 1 78  ? -6.419  3.912   5.265   1.00 0.00 ? 78  ASN A HD21 1  
ATOM 1181  H HD22 . ASN A 1 78  ? -7.978  4.537   5.850   1.00 0.00 ? 78  ASN A HD22 1  
ATOM 1182  N N    . SER A 1 79  ? -10.144 0.294   2.121   1.00 0.00 ? 79  SER A N    1  
ATOM 1183  C CA   . SER A 1 79  ? -11.211 0.410   1.110   1.00 0.00 ? 79  SER A CA   1  
ATOM 1184  C C    . SER A 1 79  ? -11.738 1.835   0.870   1.00 0.00 ? 79  SER A C    1  
ATOM 1185  O O    . SER A 1 79  ? -11.543 2.385   -0.210  1.00 0.00 ? 79  SER A O    1  
ATOM 1186  C CB   . SER A 1 79  ? -12.352 -0.544  1.501   1.00 0.00 ? 79  SER A CB   1  
ATOM 1187  O OG   . SER A 1 79  ? -12.766 -0.350  2.852   1.00 0.00 ? 79  SER A OG   1  
ATOM 1188  H H    . SER A 1 79  ? -10.057 -0.605  2.590   1.00 0.00 ? 79  SER A H    1  
ATOM 1189  H HA   . SER A 1 79  ? -10.822 0.077   0.151   1.00 0.00 ? 79  SER A HA   1  
ATOM 1190  H HB2  . SER A 1 79  ? -13.202 -0.393  0.832   1.00 0.00 ? 79  SER A HB2  1  
ATOM 1191  H HB3  . SER A 1 79  ? -12.000 -1.571  1.385   1.00 0.00 ? 79  SER A HB3  1  
ATOM 1192  H HG   . SER A 1 79  ? -13.448 -1.023  3.028   1.00 0.00 ? 79  SER A HG   1  
ATOM 1193  N N    . LEU A 1 80  ? -12.365 2.461   1.869   1.00 0.00 ? 80  LEU A N    1  
ATOM 1194  C CA   . LEU A 1 80  ? -13.015 3.777   1.724   1.00 0.00 ? 80  LEU A CA   1  
ATOM 1195  C C    . LEU A 1 80  ? -12.028 4.933   1.484   1.00 0.00 ? 80  LEU A C    1  
ATOM 1196  O O    . LEU A 1 80  ? -12.362 5.909   0.815   1.00 0.00 ? 80  LEU A O    1  
ATOM 1197  C CB   . LEU A 1 80  ? -13.922 4.042   2.939   1.00 0.00 ? 80  LEU A CB   1  
ATOM 1198  C CG   . LEU A 1 80  ? -15.036 2.996   3.162   1.00 0.00 ? 80  LEU A CG   1  
ATOM 1199  C CD1  . LEU A 1 80  ? -15.893 3.421   4.365   1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1200  C CD2  . LEU A 1 80  ? -15.918 2.787   1.921   1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1201  H H    . LEU A 1 80  ? -12.504 1.922   2.712   1.00 0.00 ? 80  LEU A H    1  
ATOM 1202  H HA   . LEU A 1 80  ? -13.640 3.749   0.834   1.00 0.00 ? 80  LEU A HA   1  
ATOM 1203  H HB2  . LEU A 1 80  ? -13.301 4.098   3.837   1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1204  H HB3  . LEU A 1 80  ? -14.390 5.018   2.802   1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1205  H HG   . LEU A 1 80  ? -14.578 2.040   3.405   1.00 0.00 ? 80  LEU A HG   1  
ATOM 1206  H HD11 . LEU A 1 80  ? -16.416 4.350   4.147   1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1207  H HD12 . LEU A 1 80  ? -16.621 2.639   4.593   1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1208  H HD13 . LEU A 1 80  ? -15.260 3.572   5.238   1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1209  H HD21 . LEU A 1 80  ? -16.343 3.734   1.592   1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1210  H HD22 . LEU A 1 80  ? -15.334 2.357   1.105   1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1211  H HD23 . LEU A 1 80  ? -16.728 2.098   2.155   1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1212  N N    . ASP A 1 81  ? -10.802 4.821   1.995   1.00 0.00 ? 81  ASP A N    1  
ATOM 1213  C CA   . ASP A 1 81  ? -9.701  5.742   1.676   1.00 0.00 ? 81  ASP A CA   1  
ATOM 1214  C C    . ASP A 1 81  ? -9.193  5.573   0.234   1.00 0.00 ? 81  ASP A C    1  
ATOM 1215  O O    . ASP A 1 81  ? -8.951  6.563   -0.458  1.00 0.00 ? 81  ASP A O    1  
ATOM 1216  C CB   . ASP A 1 81  ? -8.585  5.510   2.695   1.00 0.00 ? 81  ASP A CB   1  
ATOM 1217  C CG   . ASP A 1 81  ? -7.519  6.609   2.675   1.00 0.00 ? 81  ASP A CG   1  
ATOM 1218  O OD1  . ASP A 1 81  ? -6.573  6.530   1.855   1.00 0.00 ? 81  ASP A OD1  1  
ATOM 1219  O OD2  . ASP A 1 81  ? -7.598  7.495   3.557   1.00 0.00 ? 81  ASP A OD2  1  
ATOM 1220  H H    . ASP A 1 81  ? -10.598 4.008   2.563   1.00 0.00 ? 81  ASP A H    1  
ATOM 1221  H HA   . ASP A 1 81  ? -10.049 6.769   1.763   1.00 0.00 ? 81  ASP A HA   1  
ATOM 1222  H HB2  . ASP A 1 81  ? -9.034  5.476   3.690   1.00 0.00 ? 81  ASP A HB2  1  
ATOM 1223  H HB3  . ASP A 1 81  ? -8.113  4.550   2.502   1.00 0.00 ? 81  ASP A HB3  1  
ATOM 1224  N N    . HIS A 1 82  ? -9.106  4.330   -0.250  1.00 0.00 ? 82  HIS A N    1  
ATOM 1225  C CA   . HIS A 1 82  ? -8.799  4.033   -1.654  1.00 0.00 ? 82  HIS A CA   1  
ATOM 1226  C C    . HIS A 1 82  ? -9.946  4.464   -2.606  1.00 0.00 ? 82  HIS A C    1  
ATOM 1227  O O    . HIS A 1 82  ? -9.684  4.847   -3.751  1.00 0.00 ? 82  HIS A O    1  
ATOM 1228  C CB   . HIS A 1 82  ? -8.481  2.533   -1.805  1.00 0.00 ? 82  HIS A CB   1  
ATOM 1229  C CG   . HIS A 1 82  ? -7.385  1.997   -0.907  1.00 0.00 ? 82  HIS A CG   1  
ATOM 1230  N ND1  . HIS A 1 82  ? -6.360  2.707   -0.313  1.00 0.00 ? 82  HIS A ND1  1  
ATOM 1231  C CD2  . HIS A 1 82  ? -7.213  0.684   -0.551  1.00 0.00 ? 82  HIS A CD2  1  
ATOM 1232  C CE1  . HIS A 1 82  ? -5.604  1.844   0.385   1.00 0.00 ? 82  HIS A CE1  1  
ATOM 1233  N NE2  . HIS A 1 82  ? -6.083  0.591   0.273   1.00 0.00 ? 82  HIS A NE2  1  
ATOM 1234  H H    . HIS A 1 82  ? -9.300  3.557   0.381   1.00 0.00 ? 82  HIS A H    1  
ATOM 1235  H HA   . HIS A 1 82  ? -7.913  4.602   -1.947  1.00 0.00 ? 82  HIS A HA   1  
ATOM 1236  H HB2  . HIS A 1 82  ? -9.390  1.957   -1.621  1.00 0.00 ? 82  HIS A HB2  1  
ATOM 1237  H HB3  . HIS A 1 82  ? -8.189  2.348   -2.842  1.00 0.00 ? 82  HIS A HB3  1  
ATOM 1238  H HD1  . HIS A 1 82  ? -6.201  3.704   -0.380  1.00 0.00 ? 82  HIS A HD1  1  
ATOM 1239  H HD2  . HIS A 1 82  ? -7.850  -0.138  -0.860  1.00 0.00 ? 82  HIS A HD2  1  
ATOM 1240  H HE1  . HIS A 1 82  ? -4.725  2.125   0.957   1.00 0.00 ? 82  HIS A HE1  1  
ATOM 1241  N N    . GLU A 1 83  ? -11.201 4.435   -2.135  1.00 0.00 ? 83  GLU A N    1  
ATOM 1242  C CA   . GLU A 1 83  ? -12.381 4.886   -2.880  1.00 0.00 ? 83  GLU A CA   1  
ATOM 1243  C C    . GLU A 1 83  ? -12.512 6.418   -2.945  1.00 0.00 ? 83  GLU A C    1  
ATOM 1244  O O    . GLU A 1 83  ? -12.920 6.939   -3.987  1.00 0.00 ? 83  GLU A O    1  
ATOM 1245  C CB   . GLU A 1 83  ? -13.666 4.259   -2.308  1.00 0.00 ? 83  GLU A CB   1  
ATOM 1246  C CG   . GLU A 1 83  ? -13.805 2.757   -2.601  1.00 0.00 ? 83  GLU A CG   1  
ATOM 1247  C CD   . GLU A 1 83  ? -14.116 2.497   -4.083  1.00 0.00 ? 83  GLU A CD   1  
ATOM 1248  O OE1  . GLU A 1 83  ? -15.286 2.681   -4.498  1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1249  O OE2  . GLU A 1 83  ? -13.203 2.098   -4.846  1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1250  H H    . GLU A 1 83  ? -11.349 4.010   -1.227  1.00 0.00 ? 83  GLU A H    1  
ATOM 1251  H HA   . GLU A 1 83  ? -12.279 4.541   -3.900  1.00 0.00 ? 83  GLU A HA   1  
ATOM 1252  H HB2  . GLU A 1 83  ? -13.704 4.427   -1.233  1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1253  H HB3  . GLU A 1 83  ? -14.530 4.757   -2.749  1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1254  H HG2  . GLU A 1 83  ? -12.893 2.229   -2.325  1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1255  H HG3  . GLU A 1 83  ? -14.613 2.357   -1.986  1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1256  N N    . TYR A 1 84  ? -12.159 7.147   -1.875  1.00 0.00 ? 84  TYR A N    1  
ATOM 1257  C CA   . TYR A 1 84  ? -12.312 8.616   -1.803  1.00 0.00 ? 84  TYR A CA   1  
ATOM 1258  C C    . TYR A 1 84  ? -11.518 9.376   -0.714  1.00 0.00 ? 84  TYR A C    1  
ATOM 1259  O O    . TYR A 1 84  ? -10.899 10.392  -1.041  1.00 0.00 ? 84  TYR A O    1  
ATOM 1260  C CB   . TYR A 1 84  ? -13.806 9.004   -1.702  1.00 0.00 ? 84  TYR A CB   1  
ATOM 1261  C CG   . TYR A 1 84  ? -14.619 8.310   -0.624  1.00 0.00 ? 84  TYR A CG   1  
ATOM 1262  C CD1  . TYR A 1 84  ? -15.273 7.097   -0.910  1.00 0.00 ? 84  TYR A CD1  1  
ATOM 1263  C CD2  . TYR A 1 84  ? -14.742 8.883   0.655   1.00 0.00 ? 84  TYR A CD2  1  
ATOM 1264  C CE1  . TYR A 1 84  ? -15.990 6.419   0.090   1.00 0.00 ? 84  TYR A CE1  1  
ATOM 1265  C CE2  . TYR A 1 84  ? -15.452 8.210   1.666   1.00 0.00 ? 84  TYR A CE2  1  
ATOM 1266  C CZ   . TYR A 1 84  ? -16.076 6.973   1.387   1.00 0.00 ? 84  TYR A CZ   1  
ATOM 1267  O OH   . TYR A 1 84  ? -16.763 6.323   2.362   1.00 0.00 ? 84  TYR A OH   1  
ATOM 1268  H H    . TYR A 1 84  ? -11.859 6.637   -1.054  1.00 0.00 ? 84  TYR A H    1  
ATOM 1269  H HA   . TYR A 1 84  ? -11.949 9.023   -2.749  1.00 0.00 ? 84  TYR A HA   1  
ATOM 1270  H HB2  . TYR A 1 84  ? -13.867 10.078  -1.523  1.00 0.00 ? 84  TYR A HB2  1  
ATOM 1271  H HB3  . TYR A 1 84  ? -14.280 8.812   -2.662  1.00 0.00 ? 84  TYR A HB3  1  
ATOM 1272  H HD1  . TYR A 1 84  ? -15.225 6.687   -1.906  1.00 0.00 ? 84  TYR A HD1  1  
ATOM 1273  H HD2  . TYR A 1 84  ? -14.293 9.844   0.864   1.00 0.00 ? 84  TYR A HD2  1  
ATOM 1274  H HE1  . TYR A 1 84  ? -16.472 5.480   -0.138  1.00 0.00 ? 84  TYR A HE1  1  
ATOM 1275  H HE2  . TYR A 1 84  ? -15.531 8.643   2.651   1.00 0.00 ? 84  TYR A HE2  1  
ATOM 1276  H HH   . TYR A 1 84  ? -17.132 5.494   2.043   1.00 0.00 ? 84  TYR A HH   1  
ATOM 1277  N N    . GLN A 1 85  ? -11.610 8.999   0.570   1.00 0.00 ? 85  GLN A N    1  
ATOM 1278  C CA   . GLN A 1 85  ? -11.373 9.974   1.658   1.00 0.00 ? 85  GLN A CA   1  
ATOM 1279  C C    . GLN A 1 85  ? -9.890  10.394  1.847   1.00 0.00 ? 85  GLN A C    1  
ATOM 1280  O O    . GLN A 1 85  ? -8.999  9.573   1.615   1.00 0.00 ? 85  GLN A O    1  
ATOM 1281  C CB   . GLN A 1 85  ? -11.993 9.509   2.992   1.00 0.00 ? 85  GLN A CB   1  
ATOM 1282  C CG   . GLN A 1 85  ? -11.494 8.163   3.536   1.00 0.00 ? 85  GLN A CG   1  
ATOM 1283  C CD   . GLN A 1 85  ? -12.185 7.760   4.835   1.00 0.00 ? 85  GLN A CD   1  
ATOM 1284  O OE1  . GLN A 1 85  ? -11.700 7.984   5.933   1.00 0.00 ? 85  GLN A OE1  1  
ATOM 1285  N NE2  . GLN A 1 85  ? -13.349 7.154   4.745   1.00 0.00 ? 85  GLN A NE2  1  
ATOM 1286  H H    . GLN A 1 85  ? -12.070 8.121   0.778   1.00 0.00 ? 85  GLN A H    1  
ATOM 1287  H HA   . GLN A 1 85  ? -11.921 10.877  1.368   1.00 0.00 ? 85  GLN A HA   1  
ATOM 1288  H HB2  . GLN A 1 85  ? -11.770 10.266  3.740   1.00 0.00 ? 85  GLN A HB2  1  
ATOM 1289  H HB3  . GLN A 1 85  ? -13.077 9.467   2.886   1.00 0.00 ? 85  GLN A HB3  1  
ATOM 1290  H HG2  . GLN A 1 85  ? -11.725 7.397   2.804   1.00 0.00 ? 85  GLN A HG2  1  
ATOM 1291  H HG3  . GLN A 1 85  ? -10.417 8.197   3.695   1.00 0.00 ? 85  GLN A HG3  1  
ATOM 1292  H HE21 . GLN A 1 85  ? -13.766 6.990   3.842   1.00 0.00 ? 85  GLN A HE21 1  
ATOM 1293  H HE22 . GLN A 1 85  ? -13.856 6.934   5.600   1.00 0.00 ? 85  GLN A HE22 1  
ATOM 1294  N N    . PRO A 1 86  ? -9.615  11.648  2.295   1.00 0.00 ? 86  PRO A N    1  
ATOM 1295  C CA   . PRO A 1 86  ? -8.269  12.110  2.644   1.00 0.00 ? 86  PRO A CA   1  
ATOM 1296  C C    . PRO A 1 86  ? -7.808  11.635  4.031   1.00 0.00 ? 86  PRO A C    1  
ATOM 1297  O O    . PRO A 1 86  ? -6.630  11.320  4.188   1.00 0.00 ? 86  PRO A O    1  
ATOM 1298  C CB   . PRO A 1 86  ? -8.330  13.637  2.592   1.00 0.00 ? 86  PRO A CB   1  
ATOM 1299  C CG   . PRO A 1 86  ? -9.783  13.956  2.936   1.00 0.00 ? 86  PRO A CG   1  
ATOM 1300  C CD   . PRO A 1 86  ? -10.554 12.766  2.364   1.00 0.00 ? 86  PRO A CD   1  
ATOM 1301  H HA   . PRO A 1 86  ? -7.554  11.755  1.904   1.00 0.00 ? 86  PRO A HA   1  
ATOM 1302  H HB2  . PRO A 1 86  ? -7.637  14.095  3.302   1.00 0.00 ? 86  PRO A HB2  1  
ATOM 1303  H HB3  . PRO A 1 86  ? -8.116  13.970  1.579   1.00 0.00 ? 86  PRO A HB3  1  
ATOM 1304  H HG2  . PRO A 1 86  ? -9.908  13.997  4.019   1.00 0.00 ? 86  PRO A HG2  1  
ATOM 1305  H HG3  . PRO A 1 86  ? -10.106 14.897  2.489   1.00 0.00 ? 86  PRO A HG3  1  
ATOM 1306  H HD2  . PRO A 1 86  ? -11.414 12.541  2.998   1.00 0.00 ? 86  PRO A HD2  1  
ATOM 1307  H HD3  . PRO A 1 86  ? -10.892 13.008  1.355   1.00 0.00 ? 86  PRO A HD3  1  
ATOM 1308  N N    . ARG A 1 87  ? -8.727  11.588  5.015   1.00 0.00 ? 87  ARG A N    1  
ATOM 1309  C CA   . ARG A 1 87  ? -8.586  10.980  6.345   1.00 0.00 ? 87  ARG A CA   1  
ATOM 1310  C C    . ARG A 1 87  ? -7.603  11.672  7.337   1.00 0.00 ? 87  ARG A C    1  
ATOM 1311  O O    . ARG A 1 87  ? -6.396  11.706  7.085   1.00 0.00 ? 87  ARG A O    1  
ATOM 1312  C CB   . ARG A 1 87  ? -8.257  9.496   6.138   1.00 0.00 ? 87  ARG A CB   1  
ATOM 1313  C CG   . ARG A 1 87  ? -8.639  8.673   7.363   1.00 0.00 ? 87  ARG A CG   1  
ATOM 1314  C CD   . ARG A 1 87  ? -8.588  7.168   7.080   1.00 0.00 ? 87  ARG A CD   1  
ATOM 1315  N NE   . ARG A 1 87  ? -7.308  6.562   7.517   1.00 0.00 ? 87  ARG A NE   1  
ATOM 1316  C CZ   . ARG A 1 87  ? -6.128  6.568   6.898   1.00 0.00 ? 87  ARG A CZ   1  
ATOM 1317  N NH1  . ARG A 1 87  ? -5.933  7.005   5.679   1.00 0.00 ? 87  ARG A NH1  1  
ATOM 1318  N NH2  . ARG A 1 87  ? -5.081  6.091   7.521   1.00 0.00 ? 87  ARG A NH2  1  
ATOM 1319  H H    . ARG A 1 87  ? -9.674  11.837  4.763   1.00 0.00 ? 87  ARG A H    1  
ATOM 1320  H HA   . ARG A 1 87  ? -9.590  11.009  6.767   1.00 0.00 ? 87  ARG A HA   1  
ATOM 1321  H HB2  . ARG A 1 87  ? -8.838  9.127   5.291   1.00 0.00 ? 87  ARG A HB2  1  
ATOM 1322  H HB3  . ARG A 1 87  ? -7.198  9.371   5.917   1.00 0.00 ? 87  ARG A HB3  1  
ATOM 1323  H HG2  . ARG A 1 87  ? -7.974  8.935   8.186   1.00 0.00 ? 87  ARG A HG2  1  
ATOM 1324  H HG3  . ARG A 1 87  ? -9.659  8.930   7.646   1.00 0.00 ? 87  ARG A HG3  1  
ATOM 1325  H HD2  . ARG A 1 87  ? -9.403  6.723   7.657   1.00 0.00 ? 87  ARG A HD2  1  
ATOM 1326  H HD3  . ARG A 1 87  ? -8.793  6.972   6.027   1.00 0.00 ? 87  ARG A HD3  1  
ATOM 1327  H HE   . ARG A 1 87  ? -7.324  6.126   8.432   1.00 0.00 ? 87  ARG A HE   1  
ATOM 1328  H HH11 . ARG A 1 87  ? -6.705  7.311   5.088   1.00 0.00 ? 87  ARG A HH11 1  
ATOM 1329  H HH12 . ARG A 1 87  ? -5.015  6.956   5.269   1.00 0.00 ? 87  ARG A HH12 1  
ATOM 1330  H HH21 . ARG A 1 87  ? -5.176  5.689   8.442   1.00 0.00 ? 87  ARG A HH21 1  
ATOM 1331  H HH22 . ARG A 1 87  ? -4.211  5.939   7.011   1.00 0.00 ? 87  ARG A HH22 1  
ATOM 1332  N N    . PRO A 1 88  ? -8.074  12.152  8.515   1.00 0.00 ? 88  PRO A N    1  
ATOM 1333  C CA   . PRO A 1 88  ? -7.232  12.721  9.575   1.00 0.00 ? 88  PRO A CA   1  
ATOM 1334  C C    . PRO A 1 88  ? -6.563  11.611  10.402  1.00 0.00 ? 88  PRO A C    1  
ATOM 1335  O O    . PRO A 1 88  ? -7.094  11.170  11.416  1.00 0.00 ? 88  PRO A O    1  
ATOM 1336  C CB   . PRO A 1 88  ? -8.177  13.603  10.404  1.00 0.00 ? 88  PRO A CB   1  
ATOM 1337  C CG   . PRO A 1 88  ? -9.515  12.874  10.296  1.00 0.00 ? 88  PRO A CG   1  
ATOM 1338  C CD   . PRO A 1 88  ? -9.482  12.313  8.875   1.00 0.00 ? 88  PRO A CD   1  
ATOM 1339  H HA   . PRO A 1 88  ? -6.452  13.353  9.149   1.00 0.00 ? 88  PRO A HA   1  
ATOM 1340  H HB2  . PRO A 1 88  ? -7.850  13.713  11.437  1.00 0.00 ? 88  PRO A HB2  1  
ATOM 1341  H HB3  . PRO A 1 88  ? -8.259  14.582  9.933   1.00 0.00 ? 88  PRO A HB3  1  
ATOM 1342  H HG2  . PRO A 1 88  ? -9.554  12.050  11.004  1.00 0.00 ? 88  PRO A HG2  1  
ATOM 1343  H HG3  . PRO A 1 88  ? -10.360 13.549  10.446  1.00 0.00 ? 88  PRO A HG3  1  
ATOM 1344  H HD2  . PRO A 1 88  ? -10.016 11.361  8.847   1.00 0.00 ? 88  PRO A HD2  1  
ATOM 1345  H HD3  . PRO A 1 88  ? -9.944  13.032  8.199   1.00 0.00 ? 88  PRO A HD3  1  
ATOM 1346  N N    . VAL A 1 89  ? -5.375  11.175  9.974   1.00 0.00 ? 89  VAL A N    1  
ATOM 1347  C CA   . VAL A 1 89  ? -4.656  9.982   10.482  1.00 0.00 ? 89  VAL A CA   1  
ATOM 1348  C C    . VAL A 1 89  ? -4.539  9.929   12.015  1.00 0.00 ? 89  VAL A C    1  
ATOM 1349  O O    . VAL A 1 89  ? -4.775  8.877   12.606  1.00 0.00 ? 89  VAL A O    1  
ATOM 1350  C CB   . VAL A 1 89  ? -3.260  9.885   9.815   1.00 0.00 ? 89  VAL A CB   1  
ATOM 1351  C CG1  . VAL A 1 89  ? -2.375  8.768   10.398  1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1352  C CG2  . VAL A 1 89  ? -3.409  9.645   8.299   1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1353  H H    . VAL A 1 89  ? -5.003  11.619  9.134   1.00 0.00 ? 89  VAL A H    1  
ATOM 1354  H HA   . VAL A 1 89  ? -5.233  9.109   10.175  1.00 0.00 ? 89  VAL A HA   1  
ATOM 1355  H HB   . VAL A 1 89  ? -2.754  10.838  9.960   1.00 0.00 ? 89  VAL A HB   1  
ATOM 1356  H HG11 . VAL A 1 89  ? -2.138  8.962   11.444  1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1357  H HG12 . VAL A 1 89  ? -2.892  7.815   10.314  1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1358  H HG13 . VAL A 1 89  ? -1.437  8.704   9.847   1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1359  H HG21 . VAL A 1 89  ? -3.953  8.717   8.114   1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1360  H HG22 . VAL A 1 89  ? -3.943  10.469  7.825   1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1361  H HG23 . VAL A 1 89  ? -2.425  9.574   7.835   1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1362  N N    . GLU A 1 90  ? -4.256  11.058  12.674  1.00 0.00 ? 90  GLU A N    1  
ATOM 1363  C CA   . GLU A 1 90  ? -4.107  11.121  14.142  1.00 0.00 ? 90  GLU A CA   1  
ATOM 1364  C C    . GLU A 1 90  ? -5.445  10.875  14.855  1.00 0.00 ? 90  GLU A C    1  
ATOM 1365  O O    . GLU A 1 90  ? -5.504  10.210  15.893  1.00 0.00 ? 90  GLU A O    1  
ATOM 1366  C CB   . GLU A 1 90  ? -3.549  12.489  14.575  1.00 0.00 ? 90  GLU A CB   1  
ATOM 1367  C CG   . GLU A 1 90  ? -2.210  12.833  13.916  1.00 0.00 ? 90  GLU A CG   1  
ATOM 1368  C CD   . GLU A 1 90  ? -1.603  14.103  14.527  1.00 0.00 ? 90  GLU A CD   1  
ATOM 1369  O OE1  . GLU A 1 90  ? -1.943  15.220  14.069  1.00 0.00 ? 90  GLU A OE1  1  
ATOM 1370  O OE2  . GLU A 1 90  ? -0.773  14.000  15.462  1.00 0.00 ? 90  GLU A OE2  1  
ATOM 1371  H H    . GLU A 1 90  ? -4.095  11.901  12.132  1.00 0.00 ? 90  GLU A H    1  
ATOM 1372  H HA   . GLU A 1 90  ? -3.408  10.345  14.456  1.00 0.00 ? 90  GLU A HA   1  
ATOM 1373  H HB2  . GLU A 1 90  ? -4.270  13.271  14.337  1.00 0.00 ? 90  GLU A HB2  1  
ATOM 1374  H HB3  . GLU A 1 90  ? -3.406  12.476  15.655  1.00 0.00 ? 90  GLU A HB3  1  
ATOM 1375  H HG2  . GLU A 1 90  ? -1.521  11.996  14.045  1.00 0.00 ? 90  GLU A HG2  1  
ATOM 1376  H HG3  . GLU A 1 90  ? -2.367  12.987  12.848  1.00 0.00 ? 90  GLU A HG3  1  
ATOM 1377  N N    . VAL A 1 91  ? -6.541  11.361  14.268  1.00 0.00 ? 91  VAL A N    1  
ATOM 1378  C CA   . VAL A 1 91  ? -7.903  11.199  14.803  1.00 0.00 ? 91  VAL A CA   1  
ATOM 1379  C C    . VAL A 1 91  ? -8.400  9.769   14.568  1.00 0.00 ? 91  VAL A C    1  
ATOM 1380  O O    . VAL A 1 91  ? -9.157  9.258   15.385  1.00 0.00 ? 91  VAL A O    1  
ATOM 1381  C CB   . VAL A 1 91  ? -8.860  12.254  14.200  1.00 0.00 ? 91  VAL A CB   1  
ATOM 1382  C CG1  . VAL A 1 91  ? -10.293 12.144  14.748  1.00 0.00 ? 91  VAL A CG1  1  
ATOM 1383  C CG2  . VAL A 1 91  ? -8.333  13.681  14.458  1.00 0.00 ? 91  VAL A CG2  1  
ATOM 1384  H H    . VAL A 1 91  ? -6.424  11.853  13.385  1.00 0.00 ? 91  VAL A H    1  
ATOM 1385  H HA   . VAL A 1 91  ? -7.856  11.367  15.879  1.00 0.00 ? 91  VAL A HA   1  
ATOM 1386  H HB   . VAL A 1 91  ? -8.895  12.102  13.126  1.00 0.00 ? 91  VAL A HB   1  
ATOM 1387  H HG11 . VAL A 1 91  ? -10.747 11.203  14.437  1.00 0.00 ? 91  VAL A HG11 1  
ATOM 1388  H HG12 . VAL A 1 91  ? -10.281 12.197  15.836  1.00 0.00 ? 91  VAL A HG12 1  
ATOM 1389  H HG13 . VAL A 1 91  ? -10.906 12.956  14.357  1.00 0.00 ? 91  VAL A HG13 1  
ATOM 1390  H HG21 . VAL A 1 91  ? -8.247  13.860  15.530  1.00 0.00 ? 91  VAL A HG21 1  
ATOM 1391  H HG22 . VAL A 1 91  ? -7.352  13.824  14.001  1.00 0.00 ? 91  VAL A HG22 1  
ATOM 1392  H HG23 . VAL A 1 91  ? -9.013  14.414  14.020  1.00 0.00 ? 91  VAL A HG23 1  
ATOM 1393  N N    . ILE A 1 92  ? -7.922  9.074   13.523  1.00 0.00 ? 92  ILE A N    1  
ATOM 1394  C CA   . ILE A 1 92  ? -8.192  7.634   13.326  1.00 0.00 ? 92  ILE A CA   1  
ATOM 1395  C C    . ILE A 1 92  ? -7.488  6.801   14.400  1.00 0.00 ? 92  ILE A C    1  
ATOM 1396  O O    . ILE A 1 92  ? -8.123  5.976   15.045  1.00 0.00 ? 92  ILE A O    1  
ATOM 1397  C CB   . ILE A 1 92  ? -7.788  7.170   11.905  1.00 0.00 ? 92  ILE A CB   1  
ATOM 1398  C CG1  . ILE A 1 92  ? -8.349  8.058   10.774  1.00 0.00 ? 92  ILE A CG1  1  
ATOM 1399  C CG2  . ILE A 1 92  ? -8.220  5.713   11.656  1.00 0.00 ? 92  ILE A CG2  1  
ATOM 1400  C CD1  . ILE A 1 92  ? -9.784  8.581   10.920  1.00 0.00 ? 92  ILE A CD1  1  
ATOM 1401  H H    . ILE A 1 92  ? -7.364  9.572   12.834  1.00 0.00 ? 92  ILE A H    1  
ATOM 1402  H HA   . ILE A 1 92  ? -9.262  7.442   13.447  1.00 0.00 ? 92  ILE A HA   1  
ATOM 1403  H HB   . ILE A 1 92  ? -6.699  7.195   11.825  1.00 0.00 ? 92  ILE A HB   1  
ATOM 1404  H HG12 . ILE A 1 92  ? -7.690  8.911   10.638  1.00 0.00 ? 92  ILE A HG12 1  
ATOM 1405  H HG13 . ILE A 1 92  ? -8.307  7.481   9.858   1.00 0.00 ? 92  ILE A HG13 1  
ATOM 1406  H HG21 . ILE A 1 92  ? -9.305  5.639   11.652  1.00 0.00 ? 92  ILE A HG21 1  
ATOM 1407  H HG22 . ILE A 1 92  ? -7.845  5.373   10.693  1.00 0.00 ? 92  ILE A HG22 1  
ATOM 1408  H HG23 . ILE A 1 92  ? -7.815  5.052   12.422  1.00 0.00 ? 92  ILE A HG23 1  
ATOM 1409  H HD11 . ILE A 1 92  ? -10.087 9.058   9.985   1.00 0.00 ? 92  ILE A HD11 1  
ATOM 1410  H HD12 . ILE A 1 92  ? -10.462 7.760   11.139  1.00 0.00 ? 92  ILE A HD12 1  
ATOM 1411  H HD13 . ILE A 1 92  ? -9.848  9.323   11.713  1.00 0.00 ? 92  ILE A HD13 1  
ATOM 1412  N N    . ILE A 1 93  ? -6.202  7.063   14.663  1.00 0.00 ? 93  ILE A N    1  
ATOM 1413  C CA   . ILE A 1 93  ? -5.452  6.397   15.749  1.00 0.00 ? 93  ILE A CA   1  
ATOM 1414  C C    . ILE A 1 93  ? -6.090  6.693   17.113  1.00 0.00 ? 93  ILE A C    1  
ATOM 1415  O O    . ILE A 1 93  ? -6.196  5.808   17.955  1.00 0.00 ? 93  ILE A O    1  
ATOM 1416  C CB   . ILE A 1 93  ? -3.957  6.802   15.678  1.00 0.00 ? 93  ILE A CB   1  
ATOM 1417  C CG1  . ILE A 1 93  ? -3.322  6.208   14.396  1.00 0.00 ? 93  ILE A CG1  1  
ATOM 1418  C CG2  . ILE A 1 93  ? -3.188  6.343   16.932  1.00 0.00 ? 93  ILE A CG2  1  
ATOM 1419  C CD1  . ILE A 1 93  ? -1.893  6.689   14.115  1.00 0.00 ? 93  ILE A CD1  1  
ATOM 1420  H H    . ILE A 1 93  ? -5.721  7.750   14.088  1.00 0.00 ? 93  ILE A H    1  
ATOM 1421  H HA   . ILE A 1 93  ? -5.528  5.313   15.626  1.00 0.00 ? 93  ILE A HA   1  
ATOM 1422  H HB   . ILE A 1 93  ? -3.894  7.891   15.631  1.00 0.00 ? 93  ILE A HB   1  
ATOM 1423  H HG12 . ILE A 1 93  ? -3.325  5.120   14.463  1.00 0.00 ? 93  ILE A HG12 1  
ATOM 1424  H HG13 . ILE A 1 93  ? -3.926  6.493   13.536  1.00 0.00 ? 93  ILE A HG13 1  
ATOM 1425  H HG21 . ILE A 1 93  ? -2.130  6.594   16.856  1.00 0.00 ? 93  ILE A HG21 1  
ATOM 1426  H HG22 . ILE A 1 93  ? -3.565  6.870   17.808  1.00 0.00 ? 93  ILE A HG22 1  
ATOM 1427  H HG23 . ILE A 1 93  ? -3.298  5.268   17.070  1.00 0.00 ? 93  ILE A HG23 1  
ATOM 1428  H HD11 . ILE A 1 93  ? -1.207  6.311   14.874  1.00 0.00 ? 93  ILE A HD11 1  
ATOM 1429  H HD12 . ILE A 1 93  ? -1.564  6.304   13.151  1.00 0.00 ? 93  ILE A HD12 1  
ATOM 1430  H HD13 . ILE A 1 93  ? -1.876  7.779   14.091  1.00 0.00 ? 93  ILE A HD13 1  
ATOM 1431  N N    . SER A 1 94  ? -6.575  7.915   17.318  1.00 0.00 ? 94  SER A N    1  
ATOM 1432  C CA   . SER A 1 94  ? -7.274  8.299   18.548  1.00 0.00 ? 94  SER A CA   1  
ATOM 1433  C C    . SER A 1 94  ? -8.621  7.565   18.674  1.00 0.00 ? 94  SER A C    1  
ATOM 1434  O O    . SER A 1 94  ? -8.959  7.053   19.740  1.00 0.00 ? 94  SER A O    1  
ATOM 1435  C CB   . SER A 1 94  ? -7.490  9.822   18.587  1.00 0.00 ? 94  SER A CB   1  
ATOM 1436  O OG   . SER A 1 94  ? -6.268  10.541  18.475  1.00 0.00 ? 94  SER A OG   1  
ATOM 1437  H H    . SER A 1 94  ? -6.433  8.607   16.596  1.00 0.00 ? 94  SER A H    1  
ATOM 1438  H HA   . SER A 1 94  ? -6.663  8.021   19.403  1.00 0.00 ? 94  SER A HA   1  
ATOM 1439  H HB2  . SER A 1 94  ? -8.156  10.118  17.773  1.00 0.00 ? 94  SER A HB2  1  
ATOM 1440  H HB3  . SER A 1 94  ? -7.972  10.088  19.531  1.00 0.00 ? 94  SER A HB3  1  
ATOM 1441  H HG   . SER A 1 94  ? -5.946  10.465  17.552  1.00 0.00 ? 94  SER A HG   1  
ATOM 1442  N N    . SER A 1 95  ? -9.357  7.438   17.568  1.00 0.00 ? 95  SER A N    1  
ATOM 1443  C CA   . SER A 1 95  ? -10.625 6.711   17.494  1.00 0.00 ? 95  SER A CA   1  
ATOM 1444  C C    . SER A 1 95  ? -10.443 5.213   17.753  1.00 0.00 ? 95  SER A C    1  
ATOM 1445  O O    . SER A 1 95  ? -11.232 4.615   18.481  1.00 0.00 ? 95  SER A O    1  
ATOM 1446  C CB   . SER A 1 95  ? -11.270 6.920   16.117  1.00 0.00 ? 95  SER A CB   1  
ATOM 1447  O OG   . SER A 1 95  ? -11.691 8.265   15.938  1.00 0.00 ? 95  SER A OG   1  
ATOM 1448  H H    . SER A 1 95  ? -9.004  7.840   16.712  1.00 0.00 ? 95  SER A H    1  
ATOM 1449  H HA   . SER A 1 95  ? -11.302 7.100   18.253  1.00 0.00 ? 95  SER A HA   1  
ATOM 1450  H HB2  . SER A 1 95  ? -10.542 6.666   15.344  1.00 0.00 ? 95  SER A HB2  1  
ATOM 1451  H HB3  . SER A 1 95  ? -12.136 6.263   16.024  1.00 0.00 ? 95  SER A HB3  1  
ATOM 1452  H HG   . SER A 1 95  ? -10.901 8.803   15.767  1.00 0.00 ? 95  SER A HG   1  
ATOM 1453  N N    . ALA A 1 96  ? -9.370  4.603   17.241  1.00 0.00 ? 96  ALA A N    1  
ATOM 1454  C CA   . ALA A 1 96  ? -9.011  3.214   17.527  1.00 0.00 ? 96  ALA A CA   1  
ATOM 1455  C C    . ALA A 1 96  ? -8.712  3.000   19.025  1.00 0.00 ? 96  ALA A C    1  
ATOM 1456  O O    . ALA A 1 96  ? -9.248  2.083   19.649  1.00 0.00 ? 96  ALA A O    1  
ATOM 1457  C CB   . ALA A 1 96  ? -7.827  2.865   16.617  1.00 0.00 ? 96  ALA A CB   1  
ATOM 1458  H H    . ALA A 1 96  ? -8.766  5.131   16.616  1.00 0.00 ? 96  ALA A H    1  
ATOM 1459  H HA   . ALA A 1 96  ? -9.852  2.572   17.269  1.00 0.00 ? 96  ALA A HA   1  
ATOM 1460  H HB1  . ALA A 1 96  ? -8.064  3.146   15.589  1.00 0.00 ? 96  ALA A HB1  1  
ATOM 1461  H HB2  . ALA A 1 96  ? -6.942  3.417   16.930  1.00 0.00 ? 96  ALA A HB2  1  
ATOM 1462  H HB3  . ALA A 1 96  ? -7.627  1.794   16.650  1.00 0.00 ? 96  ALA A HB3  1  
ATOM 1463  N N    . LYS A 1 97  ? -7.945  3.908   19.641  1.00 0.00 ? 97  LYS A N    1  
ATOM 1464  C CA   . LYS A 1 97  ? -7.699  3.912   21.095  1.00 0.00 ? 97  LYS A CA   1  
ATOM 1465  C C    . LYS A 1 97  ? -8.944  4.269   21.943  1.00 0.00 ? 97  LYS A C    1  
ATOM 1466  O O    . LYS A 1 97  ? -8.919  4.065   23.156  1.00 0.00 ? 97  LYS A O    1  
ATOM 1467  C CB   . LYS A 1 97  ? -6.489  4.805   21.409  1.00 0.00 ? 97  LYS A CB   1  
ATOM 1468  C CG   . LYS A 1 97  ? -5.182  4.217   20.842  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1469  C CD   . LYS A 1 97  ? -3.934  4.986   21.300  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1470  C CE   . LYS A 1 97  ? -3.976  6.467   20.887  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1471  N NZ   . LYS A 1 97  ? -2.714  7.173   21.242  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1472  H H    . LYS A 1 97  ? -7.516  4.640   19.078  1.00 0.00 ? 97  LYS A H    1  
ATOM 1473  H HA   . LYS A 1 97  ? -7.441  2.893   21.397  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1474  H HB2  . LYS A 1 97  ? -6.668  5.801   21.002  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1475  H HB3  . LYS A 1 97  ? -6.380  4.879   22.494  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1476  H HG2  . LYS A 1 97  ? -5.081  3.181   21.176  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1477  H HG3  . LYS A 1 97  ? -5.217  4.214   19.753  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1478  H HD2  . LYS A 1 97  ? -3.852  4.914   22.386  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1479  H HD3  . LYS A 1 97  ? -3.056  4.513   20.857  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1480  H HE2  . LYS A 1 97  ? -4.149  6.521   19.809  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1481  H HE3  . LYS A 1 97  ? -4.823  6.950   21.388  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1482  H HZ1  . LYS A 1 97  ? -2.549  7.141   22.242  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1483  H HZ2  . LYS A 1 97  ? -1.911  6.757   20.787  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1484  H HZ3  . LYS A 1 97  ? -2.749  8.146   20.970  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1485  N N    . GLU A 1 98  ? -10.034 4.753   21.336  1.00 0.00 ? 98  GLU A N    1  
ATOM 1486  C CA   . GLU A 1 98  ? -11.345 4.900   21.979  1.00 0.00 ? 98  GLU A CA   1  
ATOM 1487  C C    . GLU A 1 98  ? -12.212 3.636   21.775  1.00 0.00 ? 98  GLU A C    1  
ATOM 1488  O O    . GLU A 1 98  ? -12.928 3.220   22.685  1.00 0.00 ? 98  GLU A O    1  
ATOM 1489  C CB   . GLU A 1 98  ? -12.088 6.146   21.473  1.00 0.00 ? 98  GLU A CB   1  
ATOM 1490  C CG   . GLU A 1 98  ? -11.506 7.436   22.061  1.00 0.00 ? 98  GLU A CG   1  
ATOM 1491  C CD   . GLU A 1 98  ? -12.304 8.660   21.598  1.00 0.00 ? 98  GLU A CD   1  
ATOM 1492  O OE1  . GLU A 1 98  ? -12.074 9.151   20.467  1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1493  O OE2  . GLU A 1 98  ? -13.173 9.145   22.366  1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1494  H H    . GLU A 1 98  ? -9.944  5.073   20.383  1.00 0.00 ? 98  GLU A H    1  
ATOM 1495  H HA   . GLU A 1 98  ? -11.194 5.019   23.043  1.00 0.00 ? 98  GLU A HA   1  
ATOM 1496  H HB2  . GLU A 1 98  ? -12.058 6.190   20.385  1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1497  H HB3  . GLU A 1 98  ? -13.129 6.079   21.784  1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1498  H HG2  . GLU A 1 98  ? -11.538 7.374   23.151  1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1499  H HG3  . GLU A 1 98  ? -10.463 7.544   21.763  1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1500  N N    . MET A 1 99  ? -12.105 2.987   20.606  1.00 0.00 ? 99  MET A N    1  
ATOM 1501  C CA   . MET A 1 99  ? -12.783 1.725   20.257  1.00 0.00 ? 99  MET A CA   1  
ATOM 1502  C C    . MET A 1 99  ? -12.209 0.495   20.972  1.00 0.00 ? 99  MET A C    1  
ATOM 1503  O O    . MET A 1 99  ? -12.902 -0.513  21.079  1.00 0.00 ? 99  MET A O    1  
ATOM 1504  C CB   . MET A 1 99  ? -12.747 1.508   18.731  1.00 0.00 ? 99  MET A CB   1  
ATOM 1505  C CG   . MET A 1 99  ? -13.757 2.399   17.994  1.00 0.00 ? 99  MET A CG   1  
ATOM 1506  S SD   . MET A 1 99  ? -15.513 2.066   18.321  1.00 0.00 ? 99  MET A SD   1  
ATOM 1507  C CE   . MET A 1 99  ? -15.672 0.397   17.632  1.00 0.00 ? 99  MET A CE   1  
ATOM 1508  H H    . MET A 1 99  ? -11.578 3.452   19.874  1.00 0.00 ? 99  MET A H    1  
ATOM 1509  H HA   . MET A 1 99  ? -13.824 1.790   20.571  1.00 0.00 ? 99  MET A HA   1  
ATOM 1510  H HB2  . MET A 1 99  ? -11.743 1.710   18.358  1.00 0.00 ? 99  MET A HB2  1  
ATOM 1511  H HB3  . MET A 1 99  ? -12.980 0.466   18.504  1.00 0.00 ? 99  MET A HB3  1  
ATOM 1512  H HG2  . MET A 1 99  ? -13.557 3.438   18.259  1.00 0.00 ? 99  MET A HG2  1  
ATOM 1513  H HG3  . MET A 1 99  ? -13.590 2.295   16.921  1.00 0.00 ? 99  MET A HG3  1  
ATOM 1514  H HE1  . MET A 1 99  ? -16.724 0.111   17.611  1.00 0.00 ? 99  MET A HE1  1  
ATOM 1515  H HE2  . MET A 1 99  ? -15.272 0.367   16.618  1.00 0.00 ? 99  MET A HE2  1  
ATOM 1516  H HE3  . MET A 1 99  ? -15.132 -0.316  18.255  1.00 0.00 ? 99  MET A HE3  1  
ATOM 1517  N N    . VAL A 1 100 ? -10.981 0.538   21.484  1.00 0.00 ? 100 VAL A N    1  
ATOM 1518  C CA   . VAL A 1 100 ? -10.457 -0.525  22.362  1.00 0.00 ? 100 VAL A CA   1  
ATOM 1519  C C    . VAL A 1 100 ? -11.434 -0.848  23.507  1.00 0.00 ? 100 VAL A C    1  
ATOM 1520  O O    . VAL A 1 100 ? -11.871 0.027   24.256  1.00 0.00 ? 100 VAL A O    1  
ATOM 1521  C CB   . VAL A 1 100 ? -9.038  -0.218  22.884  1.00 0.00 ? 100 VAL A CB   1  
ATOM 1522  C CG1  . VAL A 1 100 ? -8.981  0.898   23.934  1.00 0.00 ? 100 VAL A CG1  1  
ATOM 1523  C CG2  . VAL A 1 100 ? -8.373  -1.488  23.433  1.00 0.00 ? 100 VAL A CG2  1  
ATOM 1524  H H    . VAL A 1 100 ? -10.386 1.305   21.194  1.00 0.00 ? 100 VAL A H    1  
ATOM 1525  H HA   . VAL A 1 100 ? -10.393 -1.415  21.737  1.00 0.00 ? 100 VAL A HA   1  
ATOM 1526  H HB   . VAL A 1 100 ? -8.452  0.122   22.035  1.00 0.00 ? 100 VAL A HB   1  
ATOM 1527  H HG11 . VAL A 1 100 ? -7.957  1.263   24.025  1.00 0.00 ? 100 VAL A HG11 1  
ATOM 1528  H HG12 . VAL A 1 100 ? -9.631  1.716   23.632  1.00 0.00 ? 100 VAL A HG12 1  
ATOM 1529  H HG13 . VAL A 1 100 ? -9.306  0.526   24.907  1.00 0.00 ? 100 VAL A HG13 1  
ATOM 1530  H HG21 . VAL A 1 100 ? -8.932  -1.879  24.283  1.00 0.00 ? 100 VAL A HG21 1  
ATOM 1531  H HG22 . VAL A 1 100 ? -8.332  -2.249  22.651  1.00 0.00 ? 100 VAL A HG22 1  
ATOM 1532  H HG23 . VAL A 1 100 ? -7.359  -1.253  23.761  1.00 0.00 ? 100 VAL A HG23 1  
ATOM 1533  N N    . GLY A 1 101 ? -11.808 -2.126  23.596  1.00 0.00 ? 101 GLY A N    1  
ATOM 1534  C CA   . GLY A 1 101 ? -12.745 -2.659  24.591  1.00 0.00 ? 101 GLY A CA   1  
ATOM 1535  C C    . GLY A 1 101 ? -14.224 -2.604  24.194  1.00 0.00 ? 101 GLY A C    1  
ATOM 1536  O O    . GLY A 1 101 ? -15.047 -3.128  24.948  1.00 0.00 ? 101 GLY A O    1  
ATOM 1537  H H    . GLY A 1 101 ? -11.426 -2.777  22.920  1.00 0.00 ? 101 GLY A H    1  
ATOM 1538  H HA2  . GLY A 1 101 ? -12.503 -3.710  24.763  1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1539  H HA3  . GLY A 1 101 ? -12.639 -2.111  25.527  1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1540  N N    . GLN A 1 102 ? -14.591 -2.011  23.047  1.00 0.00 ? 102 GLN A N    1  
ATOM 1541  C CA   . GLN A 1 102 ? -15.968 -2.008  22.554  1.00 0.00 ? 102 GLN A CA   1  
ATOM 1542  C C    . GLN A 1 102 ? -16.430 -3.430  22.202  1.00 0.00 ? 102 GLN A C    1  
ATOM 1543  O O    . GLN A 1 102 ? -15.638 -4.286  21.806  1.00 0.00 ? 102 GLN A O    1  
ATOM 1544  C CB   . GLN A 1 102 ? -16.126 -1.055  21.343  1.00 0.00 ? 102 GLN A CB   1  
ATOM 1545  C CG   . GLN A 1 102 ? -17.226 -0.010  21.530  1.00 0.00 ? 102 GLN A CG   1  
ATOM 1546  C CD   . GLN A 1 102 ? -18.607 -0.650  21.645  1.00 0.00 ? 102 GLN A CD   1  
ATOM 1547  O OE1  . GLN A 1 102 ? -19.084 -0.950  22.731  1.00 0.00 ? 102 GLN A OE1  1  
ATOM 1548  N NE2  . GLN A 1 102 ? -19.253 -0.978  20.545  1.00 0.00 ? 102 GLN A NE2  1  
ATOM 1549  H H    . GLN A 1 102 ? -13.900 -1.568  22.457  1.00 0.00 ? 102 GLN A H    1  
ATOM 1550  H HA   . GLN A 1 102 ? -16.601 -1.654  23.371  1.00 0.00 ? 102 GLN A HA   1  
ATOM 1551  H HB2  . GLN A 1 102 ? -15.220 -0.490  21.188  1.00 0.00 ? 102 GLN A HB2  1  
ATOM 1552  H HB3  . GLN A 1 102 ? -16.314 -1.630  20.432  1.00 0.00 ? 102 GLN A HB3  1  
ATOM 1553  H HG2  . GLN A 1 102 ? -17.002 0.561   22.433  1.00 0.00 ? 102 GLN A HG2  1  
ATOM 1554  H HG3  . GLN A 1 102 ? -17.203 0.671   20.677  1.00 0.00 ? 102 GLN A HG3  1  
ATOM 1555  H HE21 . GLN A 1 102 ? -18.882 -0.743  19.637  1.00 0.00 ? 102 GLN A HE21 1  
ATOM 1556  H HE22 . GLN A 1 102 ? -20.083 -1.548  20.642  1.00 0.00 ? 102 GLN A HE22 1  
ATOM 1557  N N    . LYS A 1 103 ? -17.734 -3.652  22.333  1.00 0.00 ? 103 LYS A N    1  
ATOM 1558  C CA   . LYS A 1 103 ? -18.421 -4.927  22.078  1.00 0.00 ? 103 LYS A CA   1  
ATOM 1559  C C    . LYS A 1 103 ? -19.637 -4.760  21.145  1.00 0.00 ? 103 LYS A C    1  
ATOM 1560  O O    . LYS A 1 103 ? -20.289 -3.713  21.141  1.00 0.00 ? 103 LYS A O    1  
ATOM 1561  C CB   . LYS A 1 103 ? -18.850 -5.556  23.417  1.00 0.00 ? 103 LYS A CB   1  
ATOM 1562  C CG   . LYS A 1 103 ? -17.655 -5.959  24.297  1.00 0.00 ? 103 LYS A CG   1  
ATOM 1563  C CD   . LYS A 1 103 ? -18.140 -6.547  25.631  1.00 0.00 ? 103 LYS A CD   1  
ATOM 1564  C CE   . LYS A 1 103 ? -16.977 -7.029  26.510  1.00 0.00 ? 103 LYS A CE   1  
ATOM 1565  N NZ   . LYS A 1 103 ? -16.123 -5.915  27.010  1.00 0.00 ? 103 LYS A NZ   1  
ATOM 1566  H H    . LYS A 1 103 ? -18.293 -2.864  22.638  1.00 0.00 ? 103 LYS A H    1  
ATOM 1567  H HA   . LYS A 1 103 ? -17.728 -5.607  21.584  1.00 0.00 ? 103 LYS A HA   1  
ATOM 1568  H HB2  . LYS A 1 103 ? -19.480 -4.848  23.958  1.00 0.00 ? 103 LYS A HB2  1  
ATOM 1569  H HB3  . LYS A 1 103 ? -19.443 -6.451  23.217  1.00 0.00 ? 103 LYS A HB3  1  
ATOM 1570  H HG2  . LYS A 1 103 ? -17.055 -6.701  23.769  1.00 0.00 ? 103 LYS A HG2  1  
ATOM 1571  H HG3  . LYS A 1 103 ? -17.038 -5.085  24.497  1.00 0.00 ? 103 LYS A HG3  1  
ATOM 1572  H HD2  . LYS A 1 103 ? -18.729 -5.803  26.171  1.00 0.00 ? 103 LYS A HD2  1  
ATOM 1573  H HD3  . LYS A 1 103 ? -18.784 -7.405  25.425  1.00 0.00 ? 103 LYS A HD3  1  
ATOM 1574  H HE2  . LYS A 1 103 ? -17.390 -7.576  27.363  1.00 0.00 ? 103 LYS A HE2  1  
ATOM 1575  H HE3  . LYS A 1 103 ? -16.368 -7.734  25.935  1.00 0.00 ? 103 LYS A HE3  1  
ATOM 1576  H HZ1  . LYS A 1 103 ? -16.652 -5.281  27.596  1.00 0.00 ? 103 LYS A HZ1  1  
ATOM 1577  H HZ2  . LYS A 1 103 ? -15.358 -6.283  27.562  1.00 0.00 ? 103 LYS A HZ2  1  
ATOM 1578  H HZ3  . LYS A 1 103 ? -15.716 -5.387  26.248  1.00 0.00 ? 103 LYS A HZ3  1  
ATOM 1579  N N    . MET A 1 104 ? -19.954 -5.800  20.361  1.00 0.00 ? 104 MET A N    1  
ATOM 1580  C CA   . MET A 1 104 ? -21.068 -5.819  19.386  1.00 0.00 ? 104 MET A CA   1  
ATOM 1581  C C    . MET A 1 104 ? -21.730 -7.209  19.322  1.00 0.00 ? 104 MET A C    1  
ATOM 1582  O O    . MET A 1 104 ? -21.114 -8.205  19.700  1.00 0.00 ? 104 MET A O    1  
ATOM 1583  C CB   . MET A 1 104 ? -20.581 -5.371  17.990  1.00 0.00 ? 104 MET A CB   1  
ATOM 1584  C CG   . MET A 1 104 ? -20.071 -3.924  17.961  1.00 0.00 ? 104 MET A CG   1  
ATOM 1585  S SD   . MET A 1 104 ? -19.731 -3.265  16.305  1.00 0.00 ? 104 MET A SD   1  
ATOM 1586  C CE   . MET A 1 104 ? -18.332 -4.308  15.830  1.00 0.00 ? 104 MET A CE   1  
ATOM 1587  H H    . MET A 1 104 ? -19.424 -6.658  20.487  1.00 0.00 ? 104 MET A H    1  
ATOM 1588  H HA   . MET A 1 104 ? -21.837 -5.116  19.712  1.00 0.00 ? 104 MET A HA   1  
ATOM 1589  H HB2  . MET A 1 104 ? -19.786 -6.035  17.656  1.00 0.00 ? 104 MET A HB2  1  
ATOM 1590  H HB3  . MET A 1 104 ? -21.414 -5.443  17.289  1.00 0.00 ? 104 MET A HB3  1  
ATOM 1591  H HG2  . MET A 1 104 ? -20.824 -3.282  18.422  1.00 0.00 ? 104 MET A HG2  1  
ATOM 1592  H HG3  . MET A 1 104 ? -19.160 -3.847  18.555  1.00 0.00 ? 104 MET A HG3  1  
ATOM 1593  H HE1  . MET A 1 104 ? -18.625 -5.359  15.826  1.00 0.00 ? 104 MET A HE1  1  
ATOM 1594  H HE2  . MET A 1 104 ? -18.006 -4.037  14.824  1.00 0.00 ? 104 MET A HE2  1  
ATOM 1595  H HE3  . MET A 1 104 ? -17.506 -4.169  16.529  1.00 0.00 ? 104 MET A HE3  1  
ATOM 1596  N N    . LYS A 1 105 ? -22.977 -7.286  18.840  1.00 0.00 ? 105 LYS A N    1  
ATOM 1597  C CA   . LYS A 1 105 ? -23.778 -8.529  18.904  1.00 0.00 ? 105 LYS A CA   1  
ATOM 1598  C C    . LYS A 1 105 ? -24.853 -8.695  17.806  1.00 0.00 ? 105 LYS A C    1  
ATOM 1599  O O    . LYS A 1 105 ? -25.135 -9.819  17.391  1.00 0.00 ? 105 LYS A O    1  
ATOM 1600  C CB   . LYS A 1 105 ? -24.438 -8.554  20.304  1.00 0.00 ? 105 LYS A CB   1  
ATOM 1601  C CG   . LYS A 1 105 ? -25.009 -9.917  20.735  1.00 0.00 ? 105 LYS A CG   1  
ATOM 1602  C CD   . LYS A 1 105 ? -23.906 -10.980 20.855  1.00 0.00 ? 105 LYS A CD   1  
ATOM 1603  C CE   . LYS A 1 105 ? -24.360 -12.253 21.581  1.00 0.00 ? 105 LYS A CE   1  
ATOM 1604  N NZ   . LYS A 1 105 ? -25.323 -13.065 20.786  1.00 0.00 ? 105 LYS A NZ   1  
ATOM 1605  H H    . LYS A 1 105 ? -23.426 -6.427  18.552  1.00 0.00 ? 105 LYS A H    1  
ATOM 1606  H HA   . LYS A 1 105 ? -23.096 -9.378  18.805  1.00 0.00 ? 105 LYS A HA   1  
ATOM 1607  H HB2  . LYS A 1 105 ? -23.703 -8.257  21.055  1.00 0.00 ? 105 LYS A HB2  1  
ATOM 1608  H HB3  . LYS A 1 105 ? -25.242 -7.816  20.329  1.00 0.00 ? 105 LYS A HB3  1  
ATOM 1609  H HG2  . LYS A 1 105 ? -25.482 -9.790  21.709  1.00 0.00 ? 105 LYS A HG2  1  
ATOM 1610  H HG3  . LYS A 1 105 ? -25.772 -10.246 20.027  1.00 0.00 ? 105 LYS A HG3  1  
ATOM 1611  H HD2  . LYS A 1 105 ? -23.528 -11.249 19.866  1.00 0.00 ? 105 LYS A HD2  1  
ATOM 1612  H HD3  . LYS A 1 105 ? -23.087 -10.544 21.430  1.00 0.00 ? 105 LYS A HD3  1  
ATOM 1613  H HE2  . LYS A 1 105 ? -23.459 -12.847 21.785  1.00 0.00 ? 105 LYS A HE2  1  
ATOM 1614  H HE3  . LYS A 1 105 ? -24.802 -11.981 22.543  1.00 0.00 ? 105 LYS A HE3  1  
ATOM 1615  H HZ1  . LYS A 1 105 ? -26.174 -12.551 20.593  1.00 0.00 ? 105 LYS A HZ1  1  
ATOM 1616  H HZ2  . LYS A 1 105 ? -24.915 -13.354 19.905  1.00 0.00 ? 105 LYS A HZ2  1  
ATOM 1617  H HZ3  . LYS A 1 105 ? -25.582 -13.902 21.293  1.00 0.00 ? 105 LYS A HZ3  1  
ATOM 1618  N N    . TYR A 1 106 ? -25.461 -7.598  17.340  1.00 0.00 ? 106 TYR A N    1  
ATOM 1619  C CA   . TYR A 1 106 ? -26.651 -7.643  16.468  1.00 0.00 ? 106 TYR A CA   1  
ATOM 1620  C C    . TYR A 1 106 ? -26.369 -7.983  14.990  1.00 0.00 ? 106 TYR A C    1  
ATOM 1621  O O    . TYR A 1 106 ? -27.231 -8.544  14.311  1.00 0.00 ? 106 TYR A O    1  
ATOM 1622  C CB   . TYR A 1 106 ? -27.387 -6.298  16.582  1.00 0.00 ? 106 TYR A CB   1  
ATOM 1623  C CG   . TYR A 1 106 ? -27.782 -5.927  18.001  1.00 0.00 ? 106 TYR A CG   1  
ATOM 1624  C CD1  . TYR A 1 106 ? -28.800 -6.647  18.655  1.00 0.00 ? 106 TYR A CD1  1  
ATOM 1625  C CD2  . TYR A 1 106 ? -27.115 -4.885  18.676  1.00 0.00 ? 106 TYR A CD2  1  
ATOM 1626  C CE1  . TYR A 1 106 ? -29.154 -6.333  19.980  1.00 0.00 ? 106 TYR A CE1  1  
ATOM 1627  C CE2  . TYR A 1 106 ? -27.464 -4.565  20.003  1.00 0.00 ? 106 TYR A CE2  1  
ATOM 1628  C CZ   . TYR A 1 106 ? -28.485 -5.287  20.659  1.00 0.00 ? 106 TYR A CZ   1  
ATOM 1629  O OH   . TYR A 1 106 ? -28.820 -4.975  21.942  1.00 0.00 ? 106 TYR A OH   1  
ATOM 1630  H H    . TYR A 1 106 ? -25.209 -6.706  17.743  1.00 0.00 ? 106 TYR A H    1  
ATOM 1631  H HA   . TYR A 1 106 ? -27.322 -8.419  16.842  1.00 0.00 ? 106 TYR A HA   1  
ATOM 1632  H HB2  . TYR A 1 106 ? -26.755 -5.512  16.165  1.00 0.00 ? 106 TYR A HB2  1  
ATOM 1633  H HB3  . TYR A 1 106 ? -28.296 -6.345  15.976  1.00 0.00 ? 106 TYR A HB3  1  
ATOM 1634  H HD1  . TYR A 1 106 ? -29.312 -7.447  18.139  1.00 0.00 ? 106 TYR A HD1  1  
ATOM 1635  H HD2  . TYR A 1 106 ? -26.333 -4.327  18.178  1.00 0.00 ? 106 TYR A HD2  1  
ATOM 1636  H HE1  . TYR A 1 106 ? -29.936 -6.892  20.479  1.00 0.00 ? 106 TYR A HE1  1  
ATOM 1637  H HE2  . TYR A 1 106 ? -26.955 -3.765  20.524  1.00 0.00 ? 106 TYR A HE2  1  
ATOM 1638  H HH   . TYR A 1 106 ? -29.530 -5.529  22.283  1.00 0.00 ? 106 TYR A HH   1  
ATOM 1639  N N    . SER A 1 107 ? -25.182 -7.650  14.480  1.00 0.00 ? 107 SER A N    1  
ATOM 1640  C CA   . SER A 1 107 ? -24.784 -7.890  13.083  1.00 0.00 ? 107 SER A CA   1  
ATOM 1641  C C    . SER A 1 107 ? -24.103 -9.262  12.874  1.00 0.00 ? 107 SER A C    1  
ATOM 1642  O O    . SER A 1 107 ? -23.429 -9.784  13.767  1.00 0.00 ? 107 SER A O    1  
ATOM 1643  C CB   . SER A 1 107 ? -23.870 -6.743  12.614  1.00 0.00 ? 107 SER A CB   1  
ATOM 1644  O OG   . SER A 1 107 ? -22.840 -6.457  13.553  1.00 0.00 ? 107 SER A OG   1  
ATOM 1645  H H    . SER A 1 107 ? -24.504 -7.201  15.080  1.00 0.00 ? 107 SER A H    1  
ATOM 1646  H HA   . SER A 1 107 ? -25.673 -7.871  12.446  1.00 0.00 ? 107 SER A HA   1  
ATOM 1647  H HB2  . SER A 1 107 ? -23.425 -6.998  11.650  1.00 0.00 ? 107 SER A HB2  1  
ATOM 1648  H HB3  . SER A 1 107 ? -24.481 -5.849  12.483  1.00 0.00 ? 107 SER A HB3  1  
ATOM 1649  H HG   . SER A 1 107 ? -22.605 -5.520  13.463  1.00 0.00 ? 107 SER A HG   1  
ATOM 1650  N N    . ILE A 1 108 ? -24.255 -9.847  11.673  1.00 0.00 ? 108 ILE A N    1  
ATOM 1651  C CA   . ILE A 1 108 ? -23.536 -11.074 11.270  1.00 0.00 ? 108 ILE A CA   1  
ATOM 1652  C C    . ILE A 1 108 ? -22.052 -10.784 10.981  1.00 0.00 ? 108 ILE A C    1  
ATOM 1653  O O    . ILE A 1 108 ? -21.702 -9.648  10.669  1.00 0.00 ? 108 ILE A O    1  
ATOM 1654  C CB   . ILE A 1 108 ? -24.276 -11.838 10.134  1.00 0.00 ? 108 ILE A CB   1  
ATOM 1655  C CG1  . ILE A 1 108 ? -24.737 -11.020 8.902   1.00 0.00 ? 108 ILE A CG1  1  
ATOM 1656  C CG2  . ILE A 1 108 ? -25.513 -12.533 10.730  1.00 0.00 ? 108 ILE A CG2  1  
ATOM 1657  C CD1  . ILE A 1 108 ? -23.616 -10.321 8.127   1.00 0.00 ? 108 ILE A CD1  1  
ATOM 1658  H H    . ILE A 1 108 ? -24.815 -9.382  10.971  1.00 0.00 ? 108 ILE A H    1  
ATOM 1659  H HA   . ILE A 1 108 ? -23.527 -11.735 12.141  1.00 0.00 ? 108 ILE A HA   1  
ATOM 1660  H HB   . ILE A 1 108 ? -23.619 -12.629 9.769   1.00 0.00 ? 108 ILE A HB   1  
ATOM 1661  H HG12 . ILE A 1 108 ? -25.235 -11.701 8.211   1.00 0.00 ? 108 ILE A HG12 1  
ATOM 1662  H HG13 . ILE A 1 108 ? -25.471 -10.271 9.203   1.00 0.00 ? 108 ILE A HG13 1  
ATOM 1663  H HG21 . ILE A 1 108 ? -26.220 -11.797 11.114  1.00 0.00 ? 108 ILE A HG21 1  
ATOM 1664  H HG22 . ILE A 1 108 ? -26.006 -13.134 9.963   1.00 0.00 ? 108 ILE A HG22 1  
ATOM 1665  H HG23 . ILE A 1 108 ? -25.216 -13.196 11.544  1.00 0.00 ? 108 ILE A HG23 1  
ATOM 1666  H HD11 . ILE A 1 108 ? -24.011 -9.949  7.181   1.00 0.00 ? 108 ILE A HD11 1  
ATOM 1667  H HD12 . ILE A 1 108 ? -23.244 -9.475  8.698   1.00 0.00 ? 108 ILE A HD12 1  
ATOM 1668  H HD13 . ILE A 1 108 ? -22.807 -11.024 7.916   1.00 0.00 ? 108 ILE A HD13 1  
ATOM 1669  N N    . VAL A 1 109 ? -21.179 -11.798 11.063  1.00 0.00 ? 109 VAL A N    1  
ATOM 1670  C CA   . VAL A 1 109 ? -19.704 -11.623 11.046  1.00 0.00 ? 109 VAL A CA   1  
ATOM 1671  C C    . VAL A 1 109 ? -19.168 -10.726 9.923   1.00 0.00 ? 109 VAL A C    1  
ATOM 1672  O O    . VAL A 1 109 ? -18.316 -9.878  10.185  1.00 0.00 ? 109 VAL A O    1  
ATOM 1673  C CB   . VAL A 1 109 ? -18.916 -12.964 11.063  1.00 0.00 ? 109 VAL A CB   1  
ATOM 1674  C CG1  . VAL A 1 109 ? -19.208 -13.777 12.331  1.00 0.00 ? 109 VAL A CG1  1  
ATOM 1675  C CG2  . VAL A 1 109 ? -19.164 -13.859 9.833   1.00 0.00 ? 109 VAL A CG2  1  
ATOM 1676  H H    . VAL A 1 109 ? -21.557 -12.711 11.298  1.00 0.00 ? 109 VAL A H    1  
ATOM 1677  H HA   . VAL A 1 109 ? -19.473 -11.097 11.973  1.00 0.00 ? 109 VAL A HA   1  
ATOM 1678  H HB   . VAL A 1 109 ? -17.857 -12.720 11.089  1.00 0.00 ? 109 VAL A HB   1  
ATOM 1679  H HG11 . VAL A 1 109 ? -18.562 -14.656 12.363  1.00 0.00 ? 109 VAL A HG11 1  
ATOM 1680  H HG12 . VAL A 1 109 ? -19.005 -13.177 13.211  1.00 0.00 ? 109 VAL A HG12 1  
ATOM 1681  H HG13 . VAL A 1 109 ? -20.245 -14.107 12.346  1.00 0.00 ? 109 VAL A HG13 1  
ATOM 1682  H HG21 . VAL A 1 109 ? -18.607 -14.789 9.934   1.00 0.00 ? 109 VAL A HG21 1  
ATOM 1683  H HG22 . VAL A 1 109 ? -20.226 -14.093 9.742   1.00 0.00 ? 109 VAL A HG22 1  
ATOM 1684  H HG23 . VAL A 1 109 ? -18.818 -13.364 8.928   1.00 0.00 ? 109 VAL A HG23 1  
ATOM 1685  N N    . SER A 1 110 ? -19.680 -10.852 8.697   1.00 0.00 ? 110 SER A N    1  
ATOM 1686  C CA   . SER A 1 110 ? -19.187 -10.078 7.547   1.00 0.00 ? 110 SER A CA   1  
ATOM 1687  C C    . SER A 1 110 ? -19.434 -8.576  7.737   1.00 0.00 ? 110 SER A C    1  
ATOM 1688  O O    . SER A 1 110 ? -18.519 -7.762  7.576   1.00 0.00 ? 110 SER A O    1  
ATOM 1689  C CB   . SER A 1 110 ? -19.858 -10.573 6.254   1.00 0.00 ? 110 SER A CB   1  
ATOM 1690  O OG   . SER A 1 110 ? -19.695 -11.975 6.096   1.00 0.00 ? 110 SER A OG   1  
ATOM 1691  H H    . SER A 1 110 ? -20.345 -11.592 8.512   1.00 0.00 ? 110 SER A H    1  
ATOM 1692  H HA   . SER A 1 110 ? -18.111 -10.223 7.447   1.00 0.00 ? 110 SER A HA   1  
ATOM 1693  H HB2  . SER A 1 110 ? -20.924 -10.340 6.285   1.00 0.00 ? 110 SER A HB2  1  
ATOM 1694  H HB3  . SER A 1 110 ? -19.413 -10.059 5.402   1.00 0.00 ? 110 SER A HB3  1  
ATOM 1695  H HG   . SER A 1 110 ? -20.078 -12.240 5.244   1.00 0.00 ? 110 SER A HG   1  
ATOM 1696  N N    . ARG A 1 111 ? -20.647 -8.204  8.175   1.00 0.00 ? 111 ARG A N    1  
ATOM 1697  C CA   . ARG A 1 111 ? -20.974 -6.807  8.476   1.00 0.00 ? 111 ARG A CA   1  
ATOM 1698  C C    . ARG A 1 111 ? -20.370 -6.355  9.803   1.00 0.00 ? 111 ARG A C    1  
ATOM 1699  O O    . ARG A 1 111 ? -19.955 -5.210  9.908   1.00 0.00 ? 111 ARG A O    1  
ATOM 1700  C CB   . ARG A 1 111 ? -22.494 -6.571  8.429   1.00 0.00 ? 111 ARG A CB   1  
ATOM 1701  C CG   . ARG A 1 111 ? -22.863 -5.074  8.420   1.00 0.00 ? 111 ARG A CG   1  
ATOM 1702  C CD   . ARG A 1 111 ? -22.438 -4.379  7.117   1.00 0.00 ? 111 ARG A CD   1  
ATOM 1703  N NE   . ARG A 1 111 ? -22.883 -2.977  7.074   1.00 0.00 ? 111 ARG A NE   1  
ATOM 1704  C CZ   . ARG A 1 111 ? -22.462 -2.049  6.220   1.00 0.00 ? 111 ARG A CZ   1  
ATOM 1705  N NH1  . ARG A 1 111 ? -21.535 -2.289  5.315   1.00 0.00 ? 111 ARG A NH1  1  
ATOM 1706  N NH2  . ARG A 1 111 ? -22.979 -0.839  6.268   1.00 0.00 ? 111 ARG A NH2  1  
ATOM 1707  H H    . ARG A 1 111 ? -21.328 -8.922  8.390   1.00 0.00 ? 111 ARG A H    1  
ATOM 1708  H HA   . ARG A 1 111 ? -20.512 -6.205  7.701   1.00 0.00 ? 111 ARG A HA   1  
ATOM 1709  H HB2  . ARG A 1 111 ? -22.902 -7.034  7.528   1.00 0.00 ? 111 ARG A HB2  1  
ATOM 1710  H HB3  . ARG A 1 111 ? -22.962 -7.048  9.290   1.00 0.00 ? 111 ARG A HB3  1  
ATOM 1711  H HG2  . ARG A 1 111 ? -23.944 -4.990  8.530   1.00 0.00 ? 111 ARG A HG2  1  
ATOM 1712  H HG3  . ARG A 1 111 ? -22.393 -4.567  9.265   1.00 0.00 ? 111 ARG A HG3  1  
ATOM 1713  H HD2  . ARG A 1 111 ? -21.356 -4.403  7.041   1.00 0.00 ? 111 ARG A HD2  1  
ATOM 1714  H HD3  . ARG A 1 111 ? -22.863 -4.914  6.264   1.00 0.00 ? 111 ARG A HD3  1  
ATOM 1715  H HE   . ARG A 1 111 ? -23.611 -2.716  7.725   1.00 0.00 ? 111 ARG A HE   1  
ATOM 1716  H HH11 . ARG A 1 111 ? -21.098 -3.211  5.240   1.00 0.00 ? 111 ARG A HH11 1  
ATOM 1717  H HH12 . ARG A 1 111 ? -21.251 -1.573  4.666   1.00 0.00 ? 111 ARG A HH12 1  
ATOM 1718  H HH21 . ARG A 1 111 ? -23.697 -0.608  6.939   1.00 0.00 ? 111 ARG A HH21 1  
ATOM 1719  H HH22 . ARG A 1 111 ? -22.677 -0.126  5.623   1.00 0.00 ? 111 ARG A HH22 1  
ATOM 1720  N N    . ASN A 1 112 ? -20.232 -7.239  10.788  1.00 0.00 ? 112 ASN A N    1  
ATOM 1721  C CA   . ASN A 1 112 ? -19.585 -6.940  12.073  1.00 0.00 ? 112 ASN A CA   1  
ATOM 1722  C C    . ASN A 1 112 ? -18.132 -6.453  11.872  1.00 0.00 ? 112 ASN A C    1  
ATOM 1723  O O    . ASN A 1 112 ? -17.721 -5.461  12.470  1.00 0.00 ? 112 ASN A O    1  
ATOM 1724  C CB   . ASN A 1 112 ? -19.675 -8.196  12.954  1.00 0.00 ? 112 ASN A CB   1  
ATOM 1725  C CG   . ASN A 1 112 ? -19.504 -7.873  14.429  1.00 0.00 ? 112 ASN A CG   1  
ATOM 1726  O OD1  . ASN A 1 112 ? -18.412 -7.916  14.973  1.00 0.00 ? 112 ASN A OD1  1  
ATOM 1727  N ND2  . ASN A 1 112 ? -20.582 -7.538  15.110  1.00 0.00 ? 112 ASN A ND2  1  
ATOM 1728  H H    . ASN A 1 112 ? -20.632 -8.161  10.644  1.00 0.00 ? 112 ASN A H    1  
ATOM 1729  H HA   . ASN A 1 112 ? -20.147 -6.137  12.554  1.00 0.00 ? 112 ASN A HA   1  
ATOM 1730  H HB2  . ASN A 1 112 ? -20.657 -8.657  12.827  1.00 0.00 ? 112 ASN A HB2  1  
ATOM 1731  H HB3  . ASN A 1 112 ? -18.916 -8.920  12.654  1.00 0.00 ? 112 ASN A HB3  1  
ATOM 1732  H HD21 . ASN A 1 112 ? -21.478 -7.465  14.632  1.00 0.00 ? 112 ASN A HD21 1  
ATOM 1733  H HD22 . ASN A 1 112 ? -20.500 -7.354  16.094  1.00 0.00 ? 112 ASN A HD22 1  
ATOM 1734  N N    . CYS A 1 113 ? -17.406 -7.076  10.931  1.00 0.00 ? 113 CYS A N    1  
ATOM 1735  C CA   . CYS A 1 113 ? -16.095 -6.647  10.432  1.00 0.00 ? 113 CYS A CA   1  
ATOM 1736  C C    . CYS A 1 113 ? -16.134 -5.262  9.752   1.00 0.00 ? 113 CYS A C    1  
ATOM 1737  O O    . CYS A 1 113 ? -15.412 -4.355  10.166  1.00 0.00 ? 113 CYS A O    1  
ATOM 1738  C CB   . CYS A 1 113 ? -15.563 -7.764  9.505   1.00 0.00 ? 113 CYS A CB   1  
ATOM 1739  S SG   . CYS A 1 113 ? -14.992 -9.161  10.516  1.00 0.00 ? 113 CYS A SG   1  
ATOM 1740  H H    . CYS A 1 113 ? -17.797 -7.923  10.536  1.00 0.00 ? 113 CYS A H    1  
ATOM 1741  H HA   . CYS A 1 113 ? -15.409 -6.543  11.275  1.00 0.00 ? 113 CYS A HA   1  
ATOM 1742  H HB2  . CYS A 1 113 ? -16.336 -8.104  8.811   1.00 0.00 ? 113 CYS A HB2  1  
ATOM 1743  H HB3  . CYS A 1 113 ? -14.723 -7.405  8.909   1.00 0.00 ? 113 CYS A HB3  1  
ATOM 1744  H HG   . CYS A 1 113 ? -14.314 -9.810  9.555   1.00 0.00 ? 113 CYS A HG   1  
ATOM 1745  N N    . GLU A 1 114 ? -16.992 -5.066  8.744   1.00 0.00 ? 114 GLU A N    1  
ATOM 1746  C CA   . GLU A 1 114 ? -17.098 -3.779  8.027   1.00 0.00 ? 114 GLU A CA   1  
ATOM 1747  C C    . GLU A 1 114 ? -17.537 -2.629  8.951   1.00 0.00 ? 114 GLU A C    1  
ATOM 1748  O O    . GLU A 1 114 ? -16.964 -1.542  8.922   1.00 0.00 ? 114 GLU A O    1  
ATOM 1749  C CB   . GLU A 1 114 ? -18.115 -3.881  6.877   1.00 0.00 ? 114 GLU A CB   1  
ATOM 1750  C CG   . GLU A 1 114 ? -17.694 -4.813  5.734   1.00 0.00 ? 114 GLU A CG   1  
ATOM 1751  C CD   . GLU A 1 114 ? -18.735 -4.855  4.597   1.00 0.00 ? 114 GLU A CD   1  
ATOM 1752  O OE1  . GLU A 1 114 ? -19.932 -4.562  4.832   1.00 0.00 ? 114 GLU A OE1  1  
ATOM 1753  O OE2  . GLU A 1 114 ? -18.350 -5.180  3.449   1.00 0.00 ? 114 GLU A OE2  1  
ATOM 1754  H H    . GLU A 1 114 ? -17.546 -5.855  8.421   1.00 0.00 ? 114 GLU A H    1  
ATOM 1755  H HA   . GLU A 1 114 ? -16.110 -3.528  7.628   1.00 0.00 ? 114 GLU A HA   1  
ATOM 1756  H HB2  . GLU A 1 114 ? -19.064 -4.225  7.288   1.00 0.00 ? 114 GLU A HB2  1  
ATOM 1757  H HB3  . GLU A 1 114 ? -18.268 -2.887  6.453   1.00 0.00 ? 114 GLU A HB3  1  
ATOM 1758  H HG2  . GLU A 1 114 ? -16.740 -4.465  5.335   1.00 0.00 ? 114 GLU A HG2  1  
ATOM 1759  H HG3  . GLU A 1 114 ? -17.550 -5.823  6.115   1.00 0.00 ? 114 GLU A HG3  1  
ATOM 1760  N N    . HIS A 1 115 ? -18.527 -2.863  9.813   1.00 0.00 ? 115 HIS A N    1  
ATOM 1761  C CA   . HIS A 1 115 ? -19.029 -1.882  10.777  1.00 0.00 ? 115 HIS A CA   1  
ATOM 1762  C C    . HIS A 1 115 ? -17.942 -1.501  11.802  1.00 0.00 ? 115 HIS A C    1  
ATOM 1763  O O    . HIS A 1 115 ? -17.833 -0.334  12.180  1.00 0.00 ? 115 HIS A O    1  
ATOM 1764  C CB   . HIS A 1 115 ? -20.297 -2.444  11.443  1.00 0.00 ? 115 HIS A CB   1  
ATOM 1765  C CG   . HIS A 1 115 ? -21.033 -1.468  12.333  1.00 0.00 ? 115 HIS A CG   1  
ATOM 1766  N ND1  . HIS A 1 115 ? -21.347 -0.156  12.046  1.00 0.00 ? 115 HIS A ND1  1  
ATOM 1767  C CD2  . HIS A 1 115 ? -21.591 -1.751  13.553  1.00 0.00 ? 115 HIS A CD2  1  
ATOM 1768  C CE1  . HIS A 1 115 ? -22.061 0.339   13.073  1.00 0.00 ? 115 HIS A CE1  1  
ATOM 1769  N NE2  . HIS A 1 115 ? -22.241 -0.600  14.021  1.00 0.00 ? 115 HIS A NE2  1  
ATOM 1770  H H    . HIS A 1 115 ? -18.988 -3.771  9.781   1.00 0.00 ? 115 HIS A H    1  
ATOM 1771  H HA   . HIS A 1 115 ? -19.315 -0.984  10.226  1.00 0.00 ? 115 HIS A HA   1  
ATOM 1772  H HB2  . HIS A 1 115 ? -20.992 -2.764  10.665  1.00 0.00 ? 115 HIS A HB2  1  
ATOM 1773  H HB3  . HIS A 1 115 ? -20.029 -3.326  12.033  1.00 0.00 ? 115 HIS A HB3  1  
ATOM 1774  H HD1  . HIS A 1 115 ? -21.132 0.351   11.197  1.00 0.00 ? 115 HIS A HD1  1  
ATOM 1775  H HD2  . HIS A 1 115 ? -21.554 -2.710  14.056  1.00 0.00 ? 115 HIS A HD2  1  
ATOM 1776  H HE1  . HIS A 1 115 ? -22.453 1.348   13.118  1.00 0.00 ? 115 HIS A HE1  1  
ATOM 1777  N N    . PHE A 1 116 ? -17.079 -2.452  12.193  1.00 0.00 ? 116 PHE A N    1  
ATOM 1778  C CA   . PHE A 1 116 ? -15.881 -2.174  12.990  1.00 0.00 ? 116 PHE A CA   1  
ATOM 1779  C C    . PHE A 1 116 ? -14.914 -1.230  12.258  1.00 0.00 ? 116 PHE A C    1  
ATOM 1780  O O    . PHE A 1 116 ? -14.631 -0.162  12.787  1.00 0.00 ? 116 PHE A O    1  
ATOM 1781  C CB   . PHE A 1 116 ? -15.222 -3.494  13.415  1.00 0.00 ? 116 PHE A CB   1  
ATOM 1782  C CG   . PHE A 1 116 ? -13.796 -3.366  13.914  1.00 0.00 ? 116 PHE A CG   1  
ATOM 1783  C CD1  . PHE A 1 116 ? -13.522 -2.658  15.097  1.00 0.00 ? 116 PHE A CD1  1  
ATOM 1784  C CD2  . PHE A 1 116 ? -12.742 -3.946  13.183  1.00 0.00 ? 116 PHE A CD2  1  
ATOM 1785  C CE1  . PHE A 1 116 ? -12.200 -2.561  15.565  1.00 0.00 ? 116 PHE A CE1  1  
ATOM 1786  C CE2  . PHE A 1 116 ? -11.424 -3.864  13.665  1.00 0.00 ? 116 PHE A CE2  1  
ATOM 1787  C CZ   . PHE A 1 116 ? -11.155 -3.189  14.867  1.00 0.00 ? 116 PHE A CZ   1  
ATOM 1788  H H    . PHE A 1 116 ? -17.230 -3.410  11.889  1.00 0.00 ? 116 PHE A H    1  
ATOM 1789  H HA   . PHE A 1 116 ? -16.183 -1.651  13.899  1.00 0.00 ? 116 PHE A HA   1  
ATOM 1790  H HB2  . PHE A 1 116 ? -15.818 -3.941  14.209  1.00 0.00 ? 116 PHE A HB2  1  
ATOM 1791  H HB3  . PHE A 1 116 ? -15.232 -4.194  12.585  1.00 0.00 ? 116 PHE A HB3  1  
ATOM 1792  H HD1  . PHE A 1 116 ? -14.322 -2.190  15.649  1.00 0.00 ? 116 PHE A HD1  1  
ATOM 1793  H HD2  . PHE A 1 116 ? -12.949 -4.475  12.264  1.00 0.00 ? 116 PHE A HD2  1  
ATOM 1794  H HE1  . PHE A 1 116 ? -11.991 -1.995  16.459  1.00 0.00 ? 116 PHE A HE1  1  
ATOM 1795  H HE2  . PHE A 1 116 ? -10.615 -4.317  13.110  1.00 0.00 ? 116 PHE A HE2  1  
ATOM 1796  H HZ   . PHE A 1 116 ? -10.141 -3.119  15.230  1.00 0.00 ? 116 PHE A HZ   1  
ATOM 1797  N N    . VAL A 1 117 ? -14.461 -1.541  11.032  1.00 0.00 ? 117 VAL A N    1  
ATOM 1798  C CA   . VAL A 1 117 ? -13.536 -0.619  10.314  1.00 0.00 ? 117 VAL A CA   1  
ATOM 1799  C C    . VAL A 1 117 ? -14.185 0.705   9.881   1.00 0.00 ? 117 VAL A C    1  
ATOM 1800  O O    . VAL A 1 117 ? -13.478 1.696   9.706   1.00 0.00 ? 117 VAL A O    1  
ATOM 1801  C CB   . VAL A 1 117 ? -12.751 -1.254  9.143   1.00 0.00 ? 117 VAL A CB   1  
ATOM 1802  C CG1  . VAL A 1 117 ? -11.608 -2.107  9.700   1.00 0.00 ? 117 VAL A CG1  1  
ATOM 1803  C CG2  . VAL A 1 117 ? -13.622 -2.046  8.160   1.00 0.00 ? 117 VAL A CG2  1  
ATOM 1804  H H    . VAL A 1 117 ? -14.720 -2.449  10.636  1.00 0.00 ? 117 VAL A H    1  
ATOM 1805  H HA   . VAL A 1 117 ? -12.785 -0.332  11.044  1.00 0.00 ? 117 VAL A HA   1  
ATOM 1806  H HB   . VAL A 1 117 ? -12.292 -0.450  8.571   1.00 0.00 ? 117 VAL A HB   1  
ATOM 1807  H HG11 . VAL A 1 117 ? -11.086 -2.601  8.885   1.00 0.00 ? 117 VAL A HG11 1  
ATOM 1808  H HG12 . VAL A 1 117 ? -10.885 -1.479  10.224  1.00 0.00 ? 117 VAL A HG12 1  
ATOM 1809  H HG13 . VAL A 1 117 ? -11.995 -2.856  10.389  1.00 0.00 ? 117 VAL A HG13 1  
ATOM 1810  H HG21 . VAL A 1 117 ? -13.024 -2.337  7.295   1.00 0.00 ? 117 VAL A HG21 1  
ATOM 1811  H HG22 . VAL A 1 117 ? -14.008 -2.944  8.634   1.00 0.00 ? 117 VAL A HG22 1  
ATOM 1812  H HG23 . VAL A 1 117 ? -14.452 -1.430  7.814   1.00 0.00 ? 117 VAL A HG23 1  
ATOM 1813  N N    . THR A 1 118 ? -15.519 0.771   9.783   1.00 0.00 ? 118 THR A N    1  
ATOM 1814  C CA   . THR A 1 118 ? -16.243 2.046   9.592   1.00 0.00 ? 118 THR A CA   1  
ATOM 1815  C C    . THR A 1 118 ? -16.234 2.864   10.879  1.00 0.00 ? 118 THR A C    1  
ATOM 1816  O O    . THR A 1 118 ? -16.029 4.061   10.789  1.00 0.00 ? 118 THR A O    1  
ATOM 1817  C CB   . THR A 1 118 ? -17.673 1.833   9.072   1.00 0.00 ? 118 THR A CB   1  
ATOM 1818  O OG1  . THR A 1 118 ? -17.650 0.924   7.991   1.00 0.00 ? 118 THR A OG1  1  
ATOM 1819  C CG2  . THR A 1 118 ? -18.277 3.129   8.528   1.00 0.00 ? 118 THR A CG2  1  
ATOM 1820  H H    . THR A 1 118 ? -16.050 -0.091  9.874   1.00 0.00 ? 118 THR A H    1  
ATOM 1821  H HA   . THR A 1 118 ? -15.718 2.660   8.856   1.00 0.00 ? 118 THR A HA   1  
ATOM 1822  H HB   . THR A 1 118 ? -18.306 1.464   9.878   1.00 0.00 ? 118 THR A HB   1  
ATOM 1823  H HG1  . THR A 1 118 ? -17.417 0.037   8.320   1.00 0.00 ? 118 THR A HG1  1  
ATOM 1824  H HG21 . THR A 1 118 ? -18.343 3.875   9.320   1.00 0.00 ? 118 THR A HG21 1  
ATOM 1825  H HG22 . THR A 1 118 ? -17.667 3.520   7.712   1.00 0.00 ? 118 THR A HG22 1  
ATOM 1826  H HG23 . THR A 1 118 ? -19.282 2.931   8.154   1.00 0.00 ? 118 THR A HG23 1  
ATOM 1827  N N    . GLN A 1 119 ? -16.357 2.250   12.059  1.00 0.00 ? 119 GLN A N    1  
ATOM 1828  C CA   . GLN A 1 119 ? -16.199 2.937   13.355  1.00 0.00 ? 119 GLN A CA   1  
ATOM 1829  C C    . GLN A 1 119 ? -14.737 3.316   13.675  1.00 0.00 ? 119 GLN A C    1  
ATOM 1830  O O    . GLN A 1 119 ? -14.519 4.308   14.374  1.00 0.00 ? 119 GLN A O    1  
ATOM 1831  C CB   . GLN A 1 119 ? -16.775 2.062   14.478  1.00 0.00 ? 119 GLN A CB   1  
ATOM 1832  C CG   . GLN A 1 119 ? -18.313 2.072   14.487  1.00 0.00 ? 119 GLN A CG   1  
ATOM 1833  C CD   . GLN A 1 119 ? -18.861 0.959   15.377  1.00 0.00 ? 119 GLN A CD   1  
ATOM 1834  O OE1  . GLN A 1 119 ? -19.302 1.166   16.504  1.00 0.00 ? 119 GLN A OE1  1  
ATOM 1835  N NE2  . GLN A 1 119 ? -18.831 -0.266  14.899  1.00 0.00 ? 119 GLN A NE2  1  
ATOM 1836  H H    . GLN A 1 119 ? -16.553 1.253   12.069  1.00 0.00 ? 119 GLN A H    1  
ATOM 1837  H HA   . GLN A 1 119 ? -16.757 3.873   13.339  1.00 0.00 ? 119 GLN A HA   1  
ATOM 1838  H HB2  . GLN A 1 119 ? -16.404 1.042   14.368  1.00 0.00 ? 119 GLN A HB2  1  
ATOM 1839  H HB3  . GLN A 1 119 ? -16.437 2.446   15.440  1.00 0.00 ? 119 GLN A HB3  1  
ATOM 1840  H HG2  . GLN A 1 119 ? -18.667 3.038   14.847  1.00 0.00 ? 119 GLN A HG2  1  
ATOM 1841  H HG3  . GLN A 1 119 ? -18.691 1.924   13.476  1.00 0.00 ? 119 GLN A HG3  1  
ATOM 1842  H HE21 . GLN A 1 119 ? -18.509 -0.402  13.948  1.00 0.00 ? 119 GLN A HE21 1  
ATOM 1843  H HE22 . GLN A 1 119 ? -19.250 -1.006  15.437  1.00 0.00 ? 119 GLN A HE22 1  
ATOM 1844  N N    . LEU A 1 120 ? -13.741 2.581   13.156  1.00 0.00 ? 120 LEU A N    1  
ATOM 1845  C CA   . LEU A 1 120 ? -12.327 2.978   13.238  1.00 0.00 ? 120 LEU A CA   1  
ATOM 1846  C C    . LEU A 1 120 ? -12.043 4.250   12.420  1.00 0.00 ? 120 LEU A C    1  
ATOM 1847  O O    . LEU A 1 120 ? -11.403 5.164   12.943  1.00 0.00 ? 120 LEU A O    1  
ATOM 1848  C CB   . LEU A 1 120 ? -11.424 1.822   12.769  1.00 0.00 ? 120 LEU A CB   1  
ATOM 1849  C CG   . LEU A 1 120 ? -11.341 0.612   13.723  1.00 0.00 ? 120 LEU A CG   1  
ATOM 1850  C CD1  . LEU A 1 120 ? -10.583 -0.517  13.011  1.00 0.00 ? 120 LEU A CD1  1  
ATOM 1851  C CD2  . LEU A 1 120 ? -10.640 0.970   15.042  1.00 0.00 ? 120 LEU A CD2  1  
ATOM 1852  H H    . LEU A 1 120 ? -13.975 1.705   12.701  1.00 0.00 ? 120 LEU A H    1  
ATOM 1853  H HA   . LEU A 1 120 ? -12.086 3.229   14.270  1.00 0.00 ? 120 LEU A HA   1  
ATOM 1854  H HB2  . LEU A 1 120 ? -11.763 1.491   11.788  1.00 0.00 ? 120 LEU A HB2  1  
ATOM 1855  H HB3  . LEU A 1 120 ? -10.413 2.213   12.644  1.00 0.00 ? 120 LEU A HB3  1  
ATOM 1856  H HG   . LEU A 1 120 ? -12.341 0.254   13.964  1.00 0.00 ? 120 LEU A HG   1  
ATOM 1857  H HD11 . LEU A 1 120 ? -11.297 -1.167  12.505  1.00 0.00 ? 120 LEU A HD11 1  
ATOM 1858  H HD12 . LEU A 1 120 ? -9.888  -0.114  12.274  1.00 0.00 ? 120 LEU A HD12 1  
ATOM 1859  H HD13 . LEU A 1 120 ? -10.018 -1.116  13.725  1.00 0.00 ? 120 LEU A HD13 1  
ATOM 1860  H HD21 . LEU A 1 120 ? -11.218 1.717   15.584  1.00 0.00 ? 120 LEU A HD21 1  
ATOM 1861  H HD22 . LEU A 1 120 ? -10.564 0.084   15.672  1.00 0.00 ? 120 LEU A HD22 1  
ATOM 1862  H HD23 . LEU A 1 120 ? -9.642  1.353   14.843  1.00 0.00 ? 120 LEU A HD23 1  
ATOM 1863  N N    . ARG A 1 121 ? -12.532 4.312   11.169  1.00 0.00 ? 121 ARG A N    1  
ATOM 1864  C CA   . ARG A 1 121 ? -12.537 5.526   10.328  1.00 0.00 ? 121 ARG A CA   1  
ATOM 1865  C C    . ARG A 1 121 ? -13.541 6.531   10.921  1.00 0.00 ? 121 ARG A C    1  
ATOM 1866  O O    . ARG A 1 121 ? -13.182 7.332   11.781  1.00 0.00 ? 121 ARG A O    1  
ATOM 1867  C CB   . ARG A 1 121 ? -12.765 5.188   8.836   1.00 0.00 ? 121 ARG A CB   1  
ATOM 1868  C CG   . ARG A 1 121 ? -11.643 4.298   8.263   1.00 0.00 ? 121 ARG A CG   1  
ATOM 1869  C CD   . ARG A 1 121 ? -11.820 3.926   6.783   1.00 0.00 ? 121 ARG A CD   1  
ATOM 1870  N NE   . ARG A 1 121 ? -12.869 2.895   6.597   1.00 0.00 ? 121 ARG A NE   1  
ATOM 1871  C CZ   . ARG A 1 121 ? -12.835 1.784   5.861   1.00 0.00 ? 121 ARG A CZ   1  
ATOM 1872  N NH1  . ARG A 1 121 ? -11.822 1.473   5.081   1.00 0.00 ? 121 ARG A NH1  1  
ATOM 1873  N NH2  . ARG A 1 121 ? -13.857 0.953   5.884   1.00 0.00 ? 121 ARG A NH2  1  
ATOM 1874  H H    . ARG A 1 121 ? -13.018 3.496   10.821  1.00 0.00 ? 121 ARG A H    1  
ATOM 1875  H HA   . ARG A 1 121 ? -11.566 6.016   10.373  1.00 0.00 ? 121 ARG A HA   1  
ATOM 1876  H HB2  . ARG A 1 121 ? -13.722 4.682   8.711   1.00 0.00 ? 121 ARG A HB2  1  
ATOM 1877  H HB3  . ARG A 1 121 ? -12.781 6.126   8.267   1.00 0.00 ? 121 ARG A HB3  1  
ATOM 1878  H HG2  . ARG A 1 121 ? -10.696 4.825   8.372   1.00 0.00 ? 121 ARG A HG2  1  
ATOM 1879  H HG3  . ARG A 1 121 ? -11.573 3.372   8.838   1.00 0.00 ? 121 ARG A HG3  1  
ATOM 1880  H HD2  . ARG A 1 121 ? -12.066 4.819   6.204   1.00 0.00 ? 121 ARG A HD2  1  
ATOM 1881  H HD3  . ARG A 1 121 ? -10.863 3.551   6.435   1.00 0.00 ? 121 ARG A HD3  1  
ATOM 1882  H HE   . ARG A 1 121 ? -13.722 3.063   7.105   1.00 0.00 ? 121 ARG A HE   1  
ATOM 1883  H HH11 . ARG A 1 121 ? -10.995 2.070   5.051   1.00 0.00 ? 121 ARG A HH11 1  
ATOM 1884  H HH12 . ARG A 1 121 ? -11.835 0.613   4.539   1.00 0.00 ? 121 ARG A HH12 1  
ATOM 1885  H HH21 . ARG A 1 121 ? -14.681 1.143   6.438   1.00 0.00 ? 121 ARG A HH21 1  
ATOM 1886  H HH22 . ARG A 1 121 ? -13.851 0.116   5.317   1.00 0.00 ? 121 ARG A HH22 1  
ATOM 1887  N N    . TYR A 1 122 ? -14.782 6.535   10.416  1.00 0.00 ? 122 TYR A N    1  
ATOM 1888  C CA   . TYR A 1 122 ? -15.974 7.246   10.924  1.00 0.00 ? 122 TYR A CA   1  
ATOM 1889  C C    . TYR A 1 122 ? -15.894 8.780   10.725  1.00 0.00 ? 122 TYR A C    1  
ATOM 1890  O O    . TYR A 1 122 ? -16.845 9.515   10.993  1.00 0.00 ? 122 TYR A O    1  
ATOM 1891  C CB   . TYR A 1 122 ? -16.194 6.897   12.409  1.00 0.00 ? 122 TYR A CB   1  
ATOM 1892  C CG   . TYR A 1 122 ? -17.641 6.940   12.868  1.00 0.00 ? 122 TYR A CG   1  
ATOM 1893  C CD1  . TYR A 1 122 ? -18.523 5.894   12.524  1.00 0.00 ? 122 TYR A CD1  1  
ATOM 1894  C CD2  . TYR A 1 122 ? -18.106 8.010   13.659  1.00 0.00 ? 122 TYR A CD2  1  
ATOM 1895  C CE1  . TYR A 1 122 ? -19.861 5.921   12.962  1.00 0.00 ? 122 TYR A CE1  1  
ATOM 1896  C CE2  . TYR A 1 122 ? -19.444 8.043   14.098  1.00 0.00 ? 122 TYR A CE2  1  
ATOM 1897  C CZ   . TYR A 1 122 ? -20.327 6.997   13.750  1.00 0.00 ? 122 TYR A CZ   1  
ATOM 1898  O OH   . TYR A 1 122 ? -21.622 7.019   14.167  1.00 0.00 ? 122 TYR A OH   1  
ATOM 1899  H H    . TYR A 1 122 ? -14.980 5.836   9.721   1.00 0.00 ? 122 TYR A H    1  
ATOM 1900  H HA   . TYR A 1 122 ? -16.823 6.845   10.359  1.00 0.00 ? 122 TYR A HA   1  
ATOM 1901  H HB2  . TYR A 1 122 ? -15.835 5.888   12.593  1.00 0.00 ? 122 TYR A HB2  1  
ATOM 1902  H HB3  . TYR A 1 122 ? -15.594 7.565   13.029  1.00 0.00 ? 122 TYR A HB3  1  
ATOM 1903  H HD1  . TYR A 1 122 ? -18.175 5.064   11.924  1.00 0.00 ? 122 TYR A HD1  1  
ATOM 1904  H HD2  . TYR A 1 122 ? -17.436 8.816   13.928  1.00 0.00 ? 122 TYR A HD2  1  
ATOM 1905  H HE1  . TYR A 1 122 ? -20.540 5.122   12.697  1.00 0.00 ? 122 TYR A HE1  1  
ATOM 1906  H HE2  . TYR A 1 122 ? -19.794 8.869   14.701  1.00 0.00 ? 122 TYR A HE2  1  
ATOM 1907  H HH   . TYR A 1 122 ? -21.829 7.798   14.695  1.00 0.00 ? 122 TYR A HH   1  
ATOM 1908  N N    . GLY A 1 123 ? -14.724 9.247   10.269  1.00 0.00 ? 123 GLY A N    1  
ATOM 1909  C CA   . GLY A 1 123 ? -14.298 10.649  10.190  1.00 0.00 ? 123 GLY A CA   1  
ATOM 1910  C C    . GLY A 1 123 ? -14.712 11.294  8.880   1.00 0.00 ? 123 GLY A C    1  
ATOM 1911  O O    . GLY A 1 123 ? -15.592 12.153  8.844   1.00 0.00 ? 123 GLY A O    1  
ATOM 1912  H H    . GLY A 1 123 ? -14.033 8.532   10.084  1.00 0.00 ? 123 GLY A H    1  
ATOM 1913  H HA2  . GLY A 1 123 ? -14.720 11.228  11.011  1.00 0.00 ? 123 GLY A HA2  1  
ATOM 1914  H HA3  . GLY A 1 123 ? -13.206 10.678  10.233  1.00 0.00 ? 123 GLY A HA3  1  
ATOM 1915  N N    . LYS A 1 124 ? -14.068 10.850  7.798   1.00 0.00 ? 124 LYS A N    1  
ATOM 1916  C CA   . LYS A 1 124 ? -14.326 11.322  6.429   1.00 0.00 ? 124 LYS A CA   1  
ATOM 1917  C C    . LYS A 1 124 ? -15.166 10.331  5.589   1.00 0.00 ? 124 LYS A C    1  
ATOM 1918  O O    . LYS A 1 124 ? -15.447 10.604  4.418   1.00 0.00 ? 124 LYS A O    1  
ATOM 1919  C CB   . LYS A 1 124 ? -12.968 11.661  5.786   1.00 0.00 ? 124 LYS A CB   1  
ATOM 1920  C CG   . LYS A 1 124 ? -12.249 12.865  6.425   1.00 0.00 ? 124 LYS A CG   1  
ATOM 1921  C CD   . LYS A 1 124 ? -12.977 14.200  6.204   1.00 0.00 ? 124 LYS A CD   1  
ATOM 1922  C CE   . LYS A 1 124 ? -12.144 15.361  6.769   1.00 0.00 ? 124 LYS A CE   1  
ATOM 1923  N NZ   . LYS A 1 124 ? -12.824 16.672  6.580   1.00 0.00 ? 124 LYS A NZ   1  
ATOM 1924  H H    . LYS A 1 124 ? -13.343 10.151  7.933   1.00 0.00 ? 124 LYS A H    1  
ATOM 1925  H HA   . LYS A 1 124 ? -14.929 12.230  6.464   1.00 0.00 ? 124 LYS A HA   1  
ATOM 1926  H HB2  . LYS A 1 124 ? -12.319 10.787  5.871   1.00 0.00 ? 124 LYS A HB2  1  
ATOM 1927  H HB3  . LYS A 1 124 ? -13.119 11.881  4.730   1.00 0.00 ? 124 LYS A HB3  1  
ATOM 1928  H HG2  . LYS A 1 124 ? -12.142 12.697  7.495   1.00 0.00 ? 124 LYS A HG2  1  
ATOM 1929  H HG3  . LYS A 1 124 ? -11.251 12.934  5.988   1.00 0.00 ? 124 LYS A HG3  1  
ATOM 1930  H HD2  . LYS A 1 124 ? -13.132 14.354  5.134   1.00 0.00 ? 124 LYS A HD2  1  
ATOM 1931  H HD3  . LYS A 1 124 ? -13.944 14.178  6.709   1.00 0.00 ? 124 LYS A HD3  1  
ATOM 1932  H HE2  . LYS A 1 124 ? -11.971 15.187  7.839   1.00 0.00 ? 124 LYS A HE2  1  
ATOM 1933  H HE3  . LYS A 1 124 ? -11.169 15.377  6.272   1.00 0.00 ? 124 LYS A HE3  1  
ATOM 1934  H HZ1  . LYS A 1 124 ? -12.984 16.865  5.602   1.00 0.00 ? 124 LYS A HZ1  1  
ATOM 1935  H HZ2  . LYS A 1 124 ? -13.721 16.691  7.049   1.00 0.00 ? 124 LYS A HZ2  1  
ATOM 1936  H HZ3  . LYS A 1 124 ? -12.267 17.427  6.957   1.00 0.00 ? 124 LYS A HZ3  1  
ATOM 1937  N N    . SER A 1 125 ? -15.576 9.200   6.181   1.00 0.00 ? 125 SER A N    1  
ATOM 1938  C CA   . SER A 1 125 ? -16.547 8.240   5.621   1.00 0.00 ? 125 SER A CA   1  
ATOM 1939  C C    . SER A 1 125 ? -17.936 8.865   5.408   1.00 0.00 ? 125 SER A C    1  
ATOM 1940  O O    . SER A 1 125 ? -18.411 9.612   6.297   1.00 0.00 ? 125 SER A O    1  
ATOM 1941  C CB   . SER A 1 125 ? -16.686 7.023   6.533   1.00 0.00 ? 125 SER A CB   1  
ATOM 1942  O OG   . SER A 1 125 ? -15.414 6.420   6.714   1.00 0.00 ? 125 SER A OG   1  
ATOM 1943  O OXT  . SER A 1 125 ? -18.561 8.594   4.357   1.00 0.00 ? 125 SER A OXT  1  
ATOM 1944  H H    . SER A 1 125 ? -15.294 9.055   7.138   1.00 0.00 ? 125 SER A H    1  
ATOM 1945  H HA   . SER A 1 125 ? -16.200 7.893   4.653   1.00 0.00 ? 125 SER A HA   1  
ATOM 1946  H HB2  . SER A 1 125 ? -17.099 7.328   7.499   1.00 0.00 ? 125 SER A HB2  1  
ATOM 1947  H HB3  . SER A 1 125 ? -17.375 6.312   6.069   1.00 0.00 ? 125 SER A HB3  1  
ATOM 1948  H HG   . SER A 1 125 ? -15.569 5.529   7.061   1.00 0.00 ? 125 SER A HG   1  
ATOM 1949  N N    . MET A 1 1   ? 18.747  -4.272  -6.338  1.00 0.00 ? 1   MET A N    2  
ATOM 1950  C CA   . MET A 1 1   ? 17.674  -3.825  -5.403  1.00 0.00 ? 1   MET A CA   2  
ATOM 1951  C C    . MET A 1 1   ? 17.341  -4.901  -4.358  1.00 0.00 ? 1   MET A C    2  
ATOM 1952  O O    . MET A 1 1   ? 17.694  -6.070  -4.529  1.00 0.00 ? 1   MET A O    2  
ATOM 1953  C CB   . MET A 1 1   ? 16.406  -3.312  -6.134  1.00 0.00 ? 1   MET A CB   2  
ATOM 1954  C CG   . MET A 1 1   ? 15.533  -4.369  -6.833  1.00 0.00 ? 1   MET A CG   2  
ATOM 1955  S SD   . MET A 1 1   ? 16.245  -5.163  -8.304  1.00 0.00 ? 1   MET A SD   2  
ATOM 1956  C CE   . MET A 1 1   ? 14.862  -6.244  -8.762  1.00 0.00 ? 1   MET A CE   2  
ATOM 1957  H H1   . MET A 1 1   ? 18.981  -3.534  -6.988  1.00 0.00 ? 1   MET A H1   2  
ATOM 1958  H H2   . MET A 1 1   ? 19.583  -4.518  -5.827  1.00 0.00 ? 1   MET A H2   2  
ATOM 1959  H H3   . MET A 1 1   ? 18.453  -5.081  -6.867  1.00 0.00 ? 1   MET A H3   2  
ATOM 1960  H HA   . MET A 1 1   ? 18.079  -2.977  -4.845  1.00 0.00 ? 1   MET A HA   2  
ATOM 1961  H HB2  . MET A 1 1   ? 15.777  -2.808  -5.400  1.00 0.00 ? 1   MET A HB2  2  
ATOM 1962  H HB3  . MET A 1 1   ? 16.697  -2.562  -6.872  1.00 0.00 ? 1   MET A HB3  2  
ATOM 1963  H HG2  . MET A 1 1   ? 15.258  -5.144  -6.118  1.00 0.00 ? 1   MET A HG2  2  
ATOM 1964  H HG3  . MET A 1 1   ? 14.606  -3.885  -7.144  1.00 0.00 ? 1   MET A HG3  2  
ATOM 1965  H HE1  . MET A 1 1   ? 14.641  -6.931  -7.945  1.00 0.00 ? 1   MET A HE1  2  
ATOM 1966  H HE2  . MET A 1 1   ? 13.977  -5.644  -8.974  1.00 0.00 ? 1   MET A HE2  2  
ATOM 1967  H HE3  . MET A 1 1   ? 15.126  -6.816  -9.654  1.00 0.00 ? 1   MET A HE3  2  
ATOM 1968  N N    . ALA A 1 2   ? 16.655  -4.517  -3.272  1.00 0.00 ? 2   ALA A N    2  
ATOM 1969  C CA   . ALA A 1 2   ? 16.201  -5.430  -2.211  1.00 0.00 ? 2   ALA A CA   2  
ATOM 1970  C C    . ALA A 1 2   ? 14.990  -6.289  -2.644  1.00 0.00 ? 2   ALA A C    2  
ATOM 1971  O O    . ALA A 1 2   ? 14.287  -5.972  -3.606  1.00 0.00 ? 2   ALA A O    2  
ATOM 1972  C CB   . ALA A 1 2   ? 15.885  -4.593  -0.960  1.00 0.00 ? 2   ALA A CB   2  
ATOM 1973  H H    . ALA A 1 2   ? 16.391  -3.543  -3.182  1.00 0.00 ? 2   ALA A H    2  
ATOM 1974  H HA   . ALA A 1 2   ? 17.013  -6.116  -1.961  1.00 0.00 ? 2   ALA A HA   2  
ATOM 1975  H HB1  . ALA A 1 2   ? 15.596  -5.248  -0.138  1.00 0.00 ? 2   ALA A HB1  2  
ATOM 1976  H HB2  . ALA A 1 2   ? 16.766  -4.024  -0.658  1.00 0.00 ? 2   ALA A HB2  2  
ATOM 1977  H HB3  . ALA A 1 2   ? 15.065  -3.901  -1.164  1.00 0.00 ? 2   ALA A HB3  2  
ATOM 1978  N N    . SER A 1 3   ? 14.726  -7.374  -1.913  1.00 0.00 ? 3   SER A N    2  
ATOM 1979  C CA   . SER A 1 3   ? 13.591  -8.282  -2.168  1.00 0.00 ? 3   SER A CA   2  
ATOM 1980  C C    . SER A 1 3   ? 12.215  -7.626  -1.881  1.00 0.00 ? 3   SER A C    2  
ATOM 1981  O O    . SER A 1 3   ? 12.136  -6.730  -1.024  1.00 0.00 ? 3   SER A O    2  
ATOM 1982  C CB   . SER A 1 3   ? 13.730  -9.551  -1.308  1.00 0.00 ? 3   SER A CB   2  
ATOM 1983  O OG   . SER A 1 3   ? 14.966  -10.211 -1.547  1.00 0.00 ? 3   SER A OG   2  
ATOM 1984  H H    . SER A 1 3   ? 15.332  -7.594  -1.137  1.00 0.00 ? 3   SER A H    2  
ATOM 1985  H HA   . SER A 1 3   ? 13.639  -8.586  -3.212  1.00 0.00 ? 3   SER A HA   2  
ATOM 1986  H HB2  . SER A 1 3   ? 13.667  -9.277  -0.252  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1987  H HB3  . SER A 1 3   ? 12.907  -10.228 -1.541  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1988  H HG   . SER A 1 3   ? 15.010  -11.003 -0.985  1.00 0.00 ? 3   SER A HG   2  
ATOM 1989  N N    . PRO A 1 4   ? 11.123  -8.076  -2.544  1.00 0.00 ? 4   PRO A N    2  
ATOM 1990  C CA   . PRO A 1 4   ? 9.752   -7.652  -2.250  1.00 0.00 ? 4   PRO A CA   2  
ATOM 1991  C C    . PRO A 1 4   ? 9.341   -7.886  -0.788  1.00 0.00 ? 4   PRO A C    2  
ATOM 1992  O O    . PRO A 1 4   ? 9.791   -8.836  -0.146  1.00 0.00 ? 4   PRO A O    2  
ATOM 1993  C CB   . PRO A 1 4   ? 8.845   -8.444  -3.198  1.00 0.00 ? 4   PRO A CB   2  
ATOM 1994  C CG   . PRO A 1 4   ? 9.764   -8.792  -4.363  1.00 0.00 ? 4   PRO A CG   2  
ATOM 1995  C CD   . PRO A 1 4   ? 11.114  -8.993  -3.679  1.00 0.00 ? 4   PRO A CD   2  
ATOM 1996  H HA   . PRO A 1 4   ? 9.668   -6.591  -2.490  1.00 0.00 ? 4   PRO A HA   2  
ATOM 1997  H HB2  . PRO A 1 4   ? 8.514   -9.366  -2.716  1.00 0.00 ? 4   PRO A HB2  2  
ATOM 1998  H HB3  . PRO A 1 4   ? 7.989   -7.854  -3.523  1.00 0.00 ? 4   PRO A HB3  2  
ATOM 1999  H HG2  . PRO A 1 4   ? 9.438   -9.691  -4.883  1.00 0.00 ? 4   PRO A HG2  2  
ATOM 2000  H HG3  . PRO A 1 4   ? 9.825   -7.947  -5.049  1.00 0.00 ? 4   PRO A HG3  2  
ATOM 2001  H HD2  . PRO A 1 4   ? 11.201  -10.021 -3.321  1.00 0.00 ? 4   PRO A HD2  2  
ATOM 2002  H HD3  . PRO A 1 4   ? 11.908  -8.771  -4.391  1.00 0.00 ? 4   PRO A HD3  2  
ATOM 2003  N N    . HIS A 1 5   ? 8.449   -7.032  -0.275  1.00 0.00 ? 5   HIS A N    2  
ATOM 2004  C CA   . HIS A 1 5   ? 7.970   -7.032  1.114   1.00 0.00 ? 5   HIS A CA   2  
ATOM 2005  C C    . HIS A 1 5   ? 6.659   -6.215  1.250   1.00 0.00 ? 5   HIS A C    2  
ATOM 2006  O O    . HIS A 1 5   ? 6.324   -5.416  0.367   1.00 0.00 ? 5   HIS A O    2  
ATOM 2007  C CB   . HIS A 1 5   ? 9.088   -6.486  2.025   1.00 0.00 ? 5   HIS A CB   2  
ATOM 2008  C CG   . HIS A 1 5   ? 8.801   -6.610  3.502   1.00 0.00 ? 5   HIS A CG   2  
ATOM 2009  N ND1  . HIS A 1 5   ? 8.597   -5.573  4.386   1.00 0.00 ? 5   HIS A ND1  2  
ATOM 2010  C CD2  . HIS A 1 5   ? 8.683   -7.776  4.214   1.00 0.00 ? 5   HIS A CD2  2  
ATOM 2011  C CE1  . HIS A 1 5   ? 8.361   -6.101  5.600   1.00 0.00 ? 5   HIS A CE1  2  
ATOM 2012  N NE2  . HIS A 1 5   ? 8.400   -7.447  5.547   1.00 0.00 ? 5   HIS A NE2  2  
ATOM 2013  H H    . HIS A 1 5   ? 8.076   -6.302  -0.872  1.00 0.00 ? 5   HIS A H    2  
ATOM 2014  H HA   . HIS A 1 5   ? 7.748   -8.062  1.407   1.00 0.00 ? 5   HIS A HA   2  
ATOM 2015  H HB2  . HIS A 1 5   ? 10.012  -7.028  1.822   1.00 0.00 ? 5   HIS A HB2  2  
ATOM 2016  H HB3  . HIS A 1 5   ? 9.267   -5.438  1.781   1.00 0.00 ? 5   HIS A HB3  2  
ATOM 2017  H HD1  . HIS A 1 5   ? 8.651   -4.585  4.169   1.00 0.00 ? 5   HIS A HD1  2  
ATOM 2018  H HD2  . HIS A 1 5   ? 8.792   -8.776  3.807   1.00 0.00 ? 5   HIS A HD2  2  
ATOM 2019  H HE1  . HIS A 1 5   ? 8.168   -5.522  6.497   1.00 0.00 ? 5   HIS A HE1  2  
ATOM 2020  N N    . GLN A 1 6   ? 5.915   -6.394  2.353   1.00 0.00 ? 6   GLN A N    2  
ATOM 2021  C CA   . GLN A 1 6   ? 4.632   -5.728  2.609   1.00 0.00 ? 6   GLN A CA   2  
ATOM 2022  C C    . GLN A 1 6   ? 4.579   -5.264  4.076   1.00 0.00 ? 6   GLN A C    2  
ATOM 2023  O O    . GLN A 1 6   ? 4.309   -6.064  4.972   1.00 0.00 ? 6   GLN A O    2  
ATOM 2024  C CB   . GLN A 1 6   ? 3.500   -6.709  2.239   1.00 0.00 ? 6   GLN A CB   2  
ATOM 2025  C CG   . GLN A 1 6   ? 2.098   -6.095  2.379   1.00 0.00 ? 6   GLN A CG   2  
ATOM 2026  C CD   . GLN A 1 6   ? 1.004   -7.030  1.860   1.00 0.00 ? 6   GLN A CD   2  
ATOM 2027  O OE1  . GLN A 1 6   ? 0.405   -6.799  0.817   1.00 0.00 ? 6   GLN A OE1  2  
ATOM 2028  N NE2  . GLN A 1 6   ? 0.684   -8.104  2.554   1.00 0.00 ? 6   GLN A NE2  2  
ATOM 2029  H H    . GLN A 1 6   ? 6.247   -7.037  3.061   1.00 0.00 ? 6   GLN A H    2  
ATOM 2030  H HA   . GLN A 1 6   ? 4.536   -4.846  1.970   1.00 0.00 ? 6   GLN A HA   2  
ATOM 2031  H HB2  . GLN A 1 6   ? 3.630   -7.012  1.197   1.00 0.00 ? 6   GLN A HB2  2  
ATOM 2032  H HB3  . GLN A 1 6   ? 3.571   -7.603  2.863   1.00 0.00 ? 6   GLN A HB3  2  
ATOM 2033  H HG2  . GLN A 1 6   ? 1.898   -5.862  3.427   1.00 0.00 ? 6   GLN A HG2  2  
ATOM 2034  H HG3  . GLN A 1 6   ? 2.061   -5.162  1.813   1.00 0.00 ? 6   GLN A HG3  2  
ATOM 2035  H HE21 . GLN A 1 6   ? 1.128   -8.314  3.436   1.00 0.00 ? 6   GLN A HE21 2  
ATOM 2036  H HE22 . GLN A 1 6   ? -0.122  -8.642  2.244   1.00 0.00 ? 6   GLN A HE22 2  
ATOM 2037  N N    . GLU A 1 7   ? 4.837   -3.973  4.325   1.00 0.00 ? 7   GLU A N    2  
ATOM 2038  C CA   . GLU A 1 7   ? 4.898   -3.389  5.672   1.00 0.00 ? 7   GLU A CA   2  
ATOM 2039  C C    . GLU A 1 7   ? 3.755   -2.375  5.878   1.00 0.00 ? 7   GLU A C    2  
ATOM 2040  O O    . GLU A 1 7   ? 3.762   -1.322  5.225   1.00 0.00 ? 7   GLU A O    2  
ATOM 2041  C CB   . GLU A 1 7   ? 6.253   -2.691  5.892   1.00 0.00 ? 7   GLU A CB   2  
ATOM 2042  C CG   . GLU A 1 7   ? 6.468   -2.305  7.361   1.00 0.00 ? 7   GLU A CG   2  
ATOM 2043  C CD   . GLU A 1 7   ? 7.807   -1.580  7.535   1.00 0.00 ? 7   GLU A CD   2  
ATOM 2044  O OE1  . GLU A 1 7   ? 7.900   -0.404  7.107   1.00 0.00 ? 7   GLU A OE1  2  
ATOM 2045  O OE2  . GLU A 1 7   ? 8.764   -2.174  8.085   1.00 0.00 ? 7   GLU A OE2  2  
ATOM 2046  H H    . GLU A 1 7   ? 4.987   -3.348  3.542   1.00 0.00 ? 7   GLU A H    2  
ATOM 2047  H HA   . GLU A 1 7   ? 4.843   -4.192  6.406   1.00 0.00 ? 7   GLU A HA   2  
ATOM 2048  H HB2  . GLU A 1 7   ? 7.056   -3.364  5.595   1.00 0.00 ? 7   GLU A HB2  2  
ATOM 2049  H HB3  . GLU A 1 7   ? 6.306   -1.789  5.281   1.00 0.00 ? 7   GLU A HB3  2  
ATOM 2050  H HG2  . GLU A 1 7   ? 5.667   -1.642  7.695   1.00 0.00 ? 7   GLU A HG2  2  
ATOM 2051  H HG3  . GLU A 1 7   ? 6.444   -3.205  7.981   1.00 0.00 ? 7   GLU A HG3  2  
ATOM 2052  N N    . PRO A 1 8   ? 2.810   -2.641  6.800   1.00 0.00 ? 8   PRO A N    2  
ATOM 2053  C CA   . PRO A 1 8   ? 1.809   -1.668  7.223   1.00 0.00 ? 8   PRO A CA   2  
ATOM 2054  C C    . PRO A 1 8   ? 2.424   -0.612  8.153   1.00 0.00 ? 8   PRO A C    2  
ATOM 2055  O O    . PRO A 1 8   ? 3.376   -0.883  8.885   1.00 0.00 ? 8   PRO A O    2  
ATOM 2056  C CB   . PRO A 1 8   ? 0.720   -2.493  7.912   1.00 0.00 ? 8   PRO A CB   2  
ATOM 2057  C CG   . PRO A 1 8   ? 1.484   -3.684  8.486   1.00 0.00 ? 8   PRO A CG   2  
ATOM 2058  C CD   . PRO A 1 8   ? 2.611   -3.910  7.485   1.00 0.00 ? 8   PRO A CD   2  
ATOM 2059  H HA   . PRO A 1 8   ? 1.379   -1.168  6.356   1.00 0.00 ? 8   PRO A HA   2  
ATOM 2060  H HB2  . PRO A 1 8   ? 0.195   -1.926  8.683   1.00 0.00 ? 8   PRO A HB2  2  
ATOM 2061  H HB3  . PRO A 1 8   ? 0.020   -2.857  7.161   1.00 0.00 ? 8   PRO A HB3  2  
ATOM 2062  H HG2  . PRO A 1 8   ? 1.915   -3.422  9.450   1.00 0.00 ? 8   PRO A HG2  2  
ATOM 2063  H HG3  . PRO A 1 8   ? 0.850   -4.565  8.574   1.00 0.00 ? 8   PRO A HG3  2  
ATOM 2064  H HD2  . PRO A 1 8   ? 3.508   -4.222  8.022   1.00 0.00 ? 8   PRO A HD2  2  
ATOM 2065  H HD3  . PRO A 1 8   ? 2.318   -4.668  6.759   1.00 0.00 ? 8   PRO A HD3  2  
ATOM 2066  N N    . LYS A 1 9   ? 1.868   0.603   8.119   1.00 0.00 ? 9   LYS A N    2  
ATOM 2067  C CA   . LYS A 1 9   ? 2.277   1.753   8.943   1.00 0.00 ? 9   LYS A CA   2  
ATOM 2068  C C    . LYS A 1 9   ? 1.230   2.077   10.028  1.00 0.00 ? 9   LYS A C    2  
ATOM 2069  O O    . LYS A 1 9   ? 0.061   1.694   9.892   1.00 0.00 ? 9   LYS A O    2  
ATOM 2070  C CB   . LYS A 1 9   ? 2.492   2.971   8.018   1.00 0.00 ? 9   LYS A CB   2  
ATOM 2071  C CG   . LYS A 1 9   ? 3.921   3.113   7.474   1.00 0.00 ? 9   LYS A CG   2  
ATOM 2072  C CD   . LYS A 1 9   ? 4.456   1.856   6.777   1.00 0.00 ? 9   LYS A CD   2  
ATOM 2073  C CE   . LYS A 1 9   ? 5.689   2.252   5.951   1.00 0.00 ? 9   LYS A CE   2  
ATOM 2074  N NZ   . LYS A 1 9   ? 6.336   1.080   5.311   1.00 0.00 ? 9   LYS A NZ   2  
ATOM 2075  H H    . LYS A 1 9   ? 1.078   0.755   7.503   1.00 0.00 ? 9   LYS A H    2  
ATOM 2076  H HA   . LYS A 1 9   ? 3.213   1.522   9.454   1.00 0.00 ? 9   LYS A HA   2  
ATOM 2077  H HB2  . LYS A 1 9   ? 1.800   2.923   7.177   1.00 0.00 ? 9   LYS A HB2  2  
ATOM 2078  H HB3  . LYS A 1 9   ? 2.256   3.888   8.557   1.00 0.00 ? 9   LYS A HB3  2  
ATOM 2079  H HG2  . LYS A 1 9   ? 3.923   3.946   6.772   1.00 0.00 ? 9   LYS A HG2  2  
ATOM 2080  H HG3  . LYS A 1 9   ? 4.589   3.370   8.297   1.00 0.00 ? 9   LYS A HG3  2  
ATOM 2081  H HD2  . LYS A 1 9   ? 4.716   1.111   7.534   1.00 0.00 ? 9   LYS A HD2  2  
ATOM 2082  H HD3  . LYS A 1 9   ? 3.685   1.438   6.126   1.00 0.00 ? 9   LYS A HD3  2  
ATOM 2083  H HE2  . LYS A 1 9   ? 5.376   2.960   5.179   1.00 0.00 ? 9   LYS A HE2  2  
ATOM 2084  H HE3  . LYS A 1 9   ? 6.407   2.760   6.599   1.00 0.00 ? 9   LYS A HE3  2  
ATOM 2085  H HZ1  . LYS A 1 9   ? 7.045   1.380   4.652   1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 2086  H HZ2  . LYS A 1 9   ? 6.807   0.506   6.014   1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 2087  H HZ3  . LYS A 1 9   ? 5.659   0.512   4.814   1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 2088  N N    . PRO A 1 10  ? 1.610   2.810   11.096  1.00 0.00 ? 10  PRO A N    2  
ATOM 2089  C CA   . PRO A 1 10  ? 0.678   3.162   12.153  1.00 0.00 ? 10  PRO A CA   2  
ATOM 2090  C C    . PRO A 1 10  ? -0.450  4.056   11.632  1.00 0.00 ? 10  PRO A C    2  
ATOM 2091  O O    . PRO A 1 10  ? -0.215  4.990   10.865  1.00 0.00 ? 10  PRO A O    2  
ATOM 2092  C CB   . PRO A 1 10  ? 1.509   3.796   13.270  1.00 0.00 ? 10  PRO A CB   2  
ATOM 2093  C CG   . PRO A 1 10  ? 2.724   4.347   12.525  1.00 0.00 ? 10  PRO A CG   2  
ATOM 2094  C CD   . PRO A 1 10  ? 2.938   3.324   11.408  1.00 0.00 ? 10  PRO A CD   2  
ATOM 2095  H HA   . PRO A 1 10  ? 0.231   2.247   12.508  1.00 0.00 ? 10  PRO A HA   2  
ATOM 2096  H HB2  . PRO A 1 10  ? 0.960   4.575   13.800  1.00 0.00 ? 10  PRO A HB2  2  
ATOM 2097  H HB3  . PRO A 1 10  ? 1.845   3.022   13.964  1.00 0.00 ? 10  PRO A HB3  2  
ATOM 2098  H HG2  . PRO A 1 10  ? 2.480   5.320   12.093  1.00 0.00 ? 10  PRO A HG2  2  
ATOM 2099  H HG3  . PRO A 1 10  ? 3.597   4.424   13.173  1.00 0.00 ? 10  PRO A HG3  2  
ATOM 2100  H HD2  . PRO A 1 10  ? 3.404   3.808   10.549  1.00 0.00 ? 10  PRO A HD2  2  
ATOM 2101  H HD3  . PRO A 1 10  ? 3.566   2.507   11.769  1.00 0.00 ? 10  PRO A HD3  2  
ATOM 2102  N N    . GLY A 1 11  ? -1.682  3.718   12.031  1.00 0.00 ? 11  GLY A N    2  
ATOM 2103  C CA   . GLY A 1 11  ? -2.919  4.344   11.553  1.00 0.00 ? 11  GLY A CA   2  
ATOM 2104  C C    . GLY A 1 11  ? -3.556  3.658   10.347  1.00 0.00 ? 11  GLY A C    2  
ATOM 2105  O O    . GLY A 1 11  ? -4.696  3.982   10.005  1.00 0.00 ? 11  GLY A O    2  
ATOM 2106  H H    . GLY A 1 11  ? -1.777  2.940   12.680  1.00 0.00 ? 11  GLY A H    2  
ATOM 2107  H HA2  . GLY A 1 11  ? -3.656  4.337   12.358  1.00 0.00 ? 11  GLY A HA2  2  
ATOM 2108  H HA3  . GLY A 1 11  ? -2.712  5.365   11.241  1.00 0.00 ? 11  GLY A HA3  2  
ATOM 2109  N N    . ASP A 1 12  ? -2.865  2.715   9.706   1.00 0.00 ? 12  ASP A N    2  
ATOM 2110  C CA   . ASP A 1 12  ? -3.445  1.915   8.628   1.00 0.00 ? 12  ASP A CA   2  
ATOM 2111  C C    . ASP A 1 12  ? -4.267  0.748   9.175   1.00 0.00 ? 12  ASP A C    2  
ATOM 2112  O O    . ASP A 1 12  ? -3.908  0.112   10.171  1.00 0.00 ? 12  ASP A O    2  
ATOM 2113  C CB   . ASP A 1 12  ? -2.372  1.389   7.659   1.00 0.00 ? 12  ASP A CB   2  
ATOM 2114  C CG   . ASP A 1 12  ? -1.684  2.485   6.824   1.00 0.00 ? 12  ASP A CG   2  
ATOM 2115  O OD1  . ASP A 1 12  ? -2.260  3.588   6.646   1.00 0.00 ? 12  ASP A OD1  2  
ATOM 2116  O OD2  . ASP A 1 12  ? -0.577  2.211   6.303   1.00 0.00 ? 12  ASP A OD2  2  
ATOM 2117  H H    . ASP A 1 12  ? -1.931  2.488   10.025  1.00 0.00 ? 12  ASP A H    2  
ATOM 2118  H HA   . ASP A 1 12  ? -4.121  2.547   8.055   1.00 0.00 ? 12  ASP A HA   2  
ATOM 2119  H HB2  . ASP A 1 12  ? -1.629  0.814   8.212   1.00 0.00 ? 12  ASP A HB2  2  
ATOM 2120  H HB3  . ASP A 1 12  ? -2.854  0.696   6.970   1.00 0.00 ? 12  ASP A HB3  2  
ATOM 2121  N N    . LEU A 1 13  ? -5.375  0.464   8.484   1.00 0.00 ? 13  LEU A N    2  
ATOM 2122  C CA   . LEU A 1 13  ? -6.177  -0.729  8.691   1.00 0.00 ? 13  LEU A CA   2  
ATOM 2123  C C    . LEU A 1 13  ? -5.842  -1.725  7.579   1.00 0.00 ? 13  LEU A C    2  
ATOM 2124  O O    . LEU A 1 13  ? -5.826  -1.410  6.387   1.00 0.00 ? 13  LEU A O    2  
ATOM 2125  C CB   . LEU A 1 13  ? -7.667  -0.376  8.862   1.00 0.00 ? 13  LEU A CB   2  
ATOM 2126  C CG   . LEU A 1 13  ? -8.436  -0.004  7.582   1.00 0.00 ? 13  LEU A CG   2  
ATOM 2127  C CD1  . LEU A 1 13  ? -9.134  -1.241  7.006   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 2128  C CD2  . LEU A 1 13  ? -9.483  1.067   7.895   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 2129  H H    . LEU A 1 13  ? -5.545  0.992   7.633   1.00 0.00 ? 13  LEU A H    2  
ATOM 2130  H HA   . LEU A 1 13  ? -5.862  -1.185  9.629   1.00 0.00 ? 13  LEU A HA   2  
ATOM 2131  H HB2  . LEU A 1 13  ? -8.166  -1.220  9.344   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 2132  H HB3  . LEU A 1 13  ? -7.721  0.457   9.558   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 2133  H HG   . LEU A 1 13  ? -7.748  0.400   6.845   1.00 0.00 ? 13  LEU A HG   2  
ATOM 2134  H HD11 . LEU A 1 13  ? -8.396  -2.012  6.794   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 2135  H HD12 . LEU A 1 13  ? -9.853  -1.634  7.725   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 2136  H HD13 . LEU A 1 13  ? -9.652  -0.981  6.084   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 2137  H HD21 . LEU A 1 13  ? -10.080 0.768   8.755   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 2138  H HD22 . LEU A 1 13  ? -8.975  2.001   8.128   1.00 0.00 ? 13  LEU A HD22 2  
ATOM 2139  H HD23 . LEU A 1 13  ? -10.132 1.224   7.032   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 2140  N N    . ILE A 1 14  ? -5.520  -2.932  8.008   1.00 0.00 ? 14  ILE A N    2  
ATOM 2141  C CA   . ILE A 1 14  ? -4.972  -4.029  7.220   1.00 0.00 ? 14  ILE A CA   2  
ATOM 2142  C C    . ILE A 1 14  ? -6.113  -5.031  7.043   1.00 0.00 ? 14  ILE A C    2  
ATOM 2143  O O    . ILE A 1 14  ? -6.710  -5.433  8.040   1.00 0.00 ? 14  ILE A O    2  
ATOM 2144  C CB   . ILE A 1 14  ? -3.785  -4.661  7.999   1.00 0.00 ? 14  ILE A CB   2  
ATOM 2145  C CG1  . ILE A 1 14  ? -2.790  -3.632  8.601   1.00 0.00 ? 14  ILE A CG1  2  
ATOM 2146  C CG2  . ILE A 1 14  ? -3.026  -5.628  7.072   1.00 0.00 ? 14  ILE A CG2  2  
ATOM 2147  C CD1  . ILE A 1 14  ? -1.920  -4.235  9.712   1.00 0.00 ? 14  ILE A CD1  2  
ATOM 2148  H H    . ILE A 1 14  ? -5.570  -3.090  9.010   1.00 0.00 ? 14  ILE A H    2  
ATOM 2149  H HA   . ILE A 1 14  ? -4.631  -3.670  6.249   1.00 0.00 ? 14  ILE A HA   2  
ATOM 2150  H HB   . ILE A 1 14  ? -4.203  -5.238  8.826   1.00 0.00 ? 14  ILE A HB   2  
ATOM 2151  H HG12 . ILE A 1 14  ? -2.159  -3.230  7.811   1.00 0.00 ? 14  ILE A HG12 2  
ATOM 2152  H HG13 . ILE A 1 14  ? -3.309  -2.794  9.055   1.00 0.00 ? 14  ILE A HG13 2  
ATOM 2153  H HG21 . ILE A 1 14  ? -2.299  -6.214  7.640   1.00 0.00 ? 14  ILE A HG21 2  
ATOM 2154  H HG22 . ILE A 1 14  ? -3.723  -6.321  6.608   1.00 0.00 ? 14  ILE A HG22 2  
ATOM 2155  H HG23 . ILE A 1 14  ? -2.503  -5.069  6.293   1.00 0.00 ? 14  ILE A HG23 2  
ATOM 2156  H HD11 . ILE A 1 14  ? -1.318  -5.055  9.326   1.00 0.00 ? 14  ILE A HD11 2  
ATOM 2157  H HD12 . ILE A 1 14  ? -1.264  -3.466  10.117  1.00 0.00 ? 14  ILE A HD12 2  
ATOM 2158  H HD13 . ILE A 1 14  ? -2.555  -4.602  10.518  1.00 0.00 ? 14  ILE A HD13 2  
ATOM 2159  N N    . GLU A 1 15  ? -6.430  -5.430  5.815   1.00 0.00 ? 15  GLU A N    2  
ATOM 2160  C CA   . GLU A 1 15  ? -7.367  -6.523  5.567   1.00 0.00 ? 15  GLU A CA   2  
ATOM 2161  C C    . GLU A 1 15  ? -6.663  -7.840  5.882   1.00 0.00 ? 15  GLU A C    2  
ATOM 2162  O O    . GLU A 1 15  ? -5.552  -8.076  5.403   1.00 0.00 ? 15  GLU A O    2  
ATOM 2163  C CB   . GLU A 1 15  ? -7.855  -6.492  4.114   1.00 0.00 ? 15  GLU A CB   2  
ATOM 2164  C CG   . GLU A 1 15  ? -9.073  -7.403  3.901   1.00 0.00 ? 15  GLU A CG   2  
ATOM 2165  C CD   . GLU A 1 15  ? -9.588  -7.399  2.452   1.00 0.00 ? 15  GLU A CD   2  
ATOM 2166  O OE1  . GLU A 1 15  ? -9.032  -6.680  1.587   1.00 0.00 ? 15  GLU A OE1  2  
ATOM 2167  O OE2  . GLU A 1 15  ? -10.535 -8.162  2.150   1.00 0.00 ? 15  GLU A OE2  2  
ATOM 2168  H H    . GLU A 1 15  ? -5.848  -5.123  5.044   1.00 0.00 ? 15  GLU A H    2  
ATOM 2169  H HA   . GLU A 1 15  ? -8.226  -6.417  6.228   1.00 0.00 ? 15  GLU A HA   2  
ATOM 2170  H HB2  . GLU A 1 15  ? -8.127  -5.472  3.851   1.00 0.00 ? 15  GLU A HB2  2  
ATOM 2171  H HB3  . GLU A 1 15  ? -7.046  -6.803  3.457   1.00 0.00 ? 15  GLU A HB3  2  
ATOM 2172  H HG2  . GLU A 1 15  ? -8.800  -8.424  4.172   1.00 0.00 ? 15  GLU A HG2  2  
ATOM 2173  H HG3  . GLU A 1 15  ? -9.882  -7.079  4.561   1.00 0.00 ? 15  GLU A HG3  2  
ATOM 2174  N N    . ILE A 1 16  ? -7.300  -8.691  6.684   1.00 0.00 ? 16  ILE A N    2  
ATOM 2175  C CA   . ILE A 1 16  ? -6.775  -9.976  7.155   1.00 0.00 ? 16  ILE A CA   2  
ATOM 2176  C C    . ILE A 1 16  ? -7.664  -11.104 6.624   1.00 0.00 ? 16  ILE A C    2  
ATOM 2177  O O    . ILE A 1 16  ? -8.852  -11.185 6.950   1.00 0.00 ? 16  ILE A O    2  
ATOM 2178  C CB   . ILE A 1 16  ? -6.722  -9.994  8.704   1.00 0.00 ? 16  ILE A CB   2  
ATOM 2179  C CG1  . ILE A 1 16  ? -5.924  -8.822  9.325   1.00 0.00 ? 16  ILE A CG1  2  
ATOM 2180  C CG2  . ILE A 1 16  ? -6.156  -11.335 9.208   1.00 0.00 ? 16  ILE A CG2  2  
ATOM 2181  C CD1  . ILE A 1 16  ? -4.464  -8.683  8.873   1.00 0.00 ? 16  ILE A CD1  2  
ATOM 2182  H H    . ILE A 1 16  ? -8.238  -8.436  6.984   1.00 0.00 ? 16  ILE A H    2  
ATOM 2183  H HA   . ILE A 1 16  ? -5.765  -10.129 6.766   1.00 0.00 ? 16  ILE A HA   2  
ATOM 2184  H HB   . ILE A 1 16  ? -7.744  -9.912  9.079   1.00 0.00 ? 16  ILE A HB   2  
ATOM 2185  H HG12 . ILE A 1 16  ? -6.440  -7.889  9.100   1.00 0.00 ? 16  ILE A HG12 2  
ATOM 2186  H HG13 . ILE A 1 16  ? -5.936  -8.931  10.410  1.00 0.00 ? 16  ILE A HG13 2  
ATOM 2187  H HG21 . ILE A 1 16  ? -6.810  -12.160 8.921   1.00 0.00 ? 16  ILE A HG21 2  
ATOM 2188  H HG22 . ILE A 1 16  ? -5.163  -11.504 8.790   1.00 0.00 ? 16  ILE A HG22 2  
ATOM 2189  H HG23 . ILE A 1 16  ? -6.088  -11.325 10.298  1.00 0.00 ? 16  ILE A HG23 2  
ATOM 2190  H HD11 . ILE A 1 16  ? -4.422  -8.479  7.804   1.00 0.00 ? 16  ILE A HD11 2  
ATOM 2191  H HD12 . ILE A 1 16  ? -4.003  -7.849  9.402   1.00 0.00 ? 16  ILE A HD12 2  
ATOM 2192  H HD13 . ILE A 1 16  ? -3.902  -9.590  9.091   1.00 0.00 ? 16  ILE A HD13 2  
ATOM 2193  N N    . PHE A 1 17  ? -7.082  -12.016 5.848   1.00 0.00 ? 17  PHE A N    2  
ATOM 2194  C CA   . PHE A 1 17  ? -7.738  -13.249 5.430   1.00 0.00 ? 17  PHE A CA   2  
ATOM 2195  C C    . PHE A 1 17  ? -7.644  -14.279 6.563   1.00 0.00 ? 17  PHE A C    2  
ATOM 2196  O O    . PHE A 1 17  ? -6.702  -15.071 6.626   1.00 0.00 ? 17  PHE A O    2  
ATOM 2197  C CB   . PHE A 1 17  ? -7.102  -13.739 4.122   1.00 0.00 ? 17  PHE A CB   2  
ATOM 2198  C CG   . PHE A 1 17  ? -7.724  -15.014 3.580   1.00 0.00 ? 17  PHE A CG   2  
ATOM 2199  C CD1  . PHE A 1 17  ? -9.061  -15.014 3.134   1.00 0.00 ? 17  PHE A CD1  2  
ATOM 2200  C CD2  . PHE A 1 17  ? -6.977  -16.208 3.535   1.00 0.00 ? 17  PHE A CD2  2  
ATOM 2201  C CE1  . PHE A 1 17  ? -9.642  -16.194 2.636   1.00 0.00 ? 17  PHE A CE1  2  
ATOM 2202  C CE2  . PHE A 1 17  ? -7.558  -17.388 3.037   1.00 0.00 ? 17  PHE A CE2  2  
ATOM 2203  C CZ   . PHE A 1 17  ? -8.888  -17.380 2.582   1.00 0.00 ? 17  PHE A CZ   2  
ATOM 2204  H H    . PHE A 1 17  ? -6.099  -11.907 5.621   1.00 0.00 ? 17  PHE A H    2  
ATOM 2205  H HA   . PHE A 1 17  ? -8.795  -13.046 5.237   1.00 0.00 ? 17  PHE A HA   2  
ATOM 2206  H HB2  . PHE A 1 17  ? -7.186  -12.958 3.367   1.00 0.00 ? 17  PHE A HB2  2  
ATOM 2207  H HB3  . PHE A 1 17  ? -6.038  -13.902 4.294   1.00 0.00 ? 17  PHE A HB3  2  
ATOM 2208  H HD1  . PHE A 1 17  ? -9.645  -14.106 3.167   1.00 0.00 ? 17  PHE A HD1  2  
ATOM 2209  H HD2  . PHE A 1 17  ? -5.953  -16.224 3.881   1.00 0.00 ? 17  PHE A HD2  2  
ATOM 2210  H HE1  . PHE A 1 17  ? -10.665 -16.183 2.276   1.00 0.00 ? 17  PHE A HE1  2  
ATOM 2211  H HE2  . PHE A 1 17  ? -6.977  -18.301 2.995   1.00 0.00 ? 17  PHE A HE2  2  
ATOM 2212  H HZ   . PHE A 1 17  ? -9.328  -18.286 2.186   1.00 0.00 ? 17  PHE A HZ   2  
ATOM 2213  N N    . ARG A 1 18  ? -8.644  -14.289 7.453   1.00 0.00 ? 18  ARG A N    2  
ATOM 2214  C CA   . ARG A 1 18  ? -8.765  -15.224 8.586   1.00 0.00 ? 18  ARG A CA   2  
ATOM 2215  C C    . ARG A 1 18  ? -9.354  -16.592 8.170   1.00 0.00 ? 18  ARG A C    2  
ATOM 2216  O O    . ARG A 1 18  ? -9.985  -17.277 8.977   1.00 0.00 ? 18  ARG A O    2  
ATOM 2217  C CB   . ARG A 1 18  ? -9.497  -14.505 9.737   1.00 0.00 ? 18  ARG A CB   2  
ATOM 2218  C CG   . ARG A 1 18  ? -9.673  -15.251 11.075  1.00 0.00 ? 18  ARG A CG   2  
ATOM 2219  C CD   . ARG A 1 18  ? -8.475  -16.116 11.508  1.00 0.00 ? 18  ARG A CD   2  
ATOM 2220  N NE   . ARG A 1 18  ? -8.796  -16.931 12.695  1.00 0.00 ? 18  ARG A NE   2  
ATOM 2221  C CZ   . ARG A 1 18  ? -9.612  -17.984 12.752  1.00 0.00 ? 18  ARG A CZ   2  
ATOM 2222  N NH1  . ARG A 1 18  ? -10.234 -18.463 11.693  1.00 0.00 ? 18  ARG A NH1  2  
ATOM 2223  N NH2  . ARG A 1 18  ? -9.830  -18.567 13.910  1.00 0.00 ? 18  ARG A NH2  2  
ATOM 2224  H H    . ARG A 1 18  ? -9.395  -13.620 7.318   1.00 0.00 ? 18  ARG A H    2  
ATOM 2225  H HA   . ARG A 1 18  ? -7.753  -15.423 8.928   1.00 0.00 ? 18  ARG A HA   2  
ATOM 2226  H HB2  . ARG A 1 18  ? -8.954  -13.582 9.947   1.00 0.00 ? 18  ARG A HB2  2  
ATOM 2227  H HB3  . ARG A 1 18  ? -10.485 -14.236 9.378   1.00 0.00 ? 18  ARG A HB3  2  
ATOM 2228  H HG2  . ARG A 1 18  ? -9.875  -14.515 11.853  1.00 0.00 ? 18  ARG A HG2  2  
ATOM 2229  H HG3  . ARG A 1 18  ? -10.564 -15.874 10.998  1.00 0.00 ? 18  ARG A HG3  2  
ATOM 2230  H HD2  . ARG A 1 18  ? -8.172  -16.785 10.701  1.00 0.00 ? 18  ARG A HD2  2  
ATOM 2231  H HD3  . ARG A 1 18  ? -7.633  -15.460 11.733  1.00 0.00 ? 18  ARG A HD3  2  
ATOM 2232  H HE   . ARG A 1 18  ? -8.343  -16.654 13.558  1.00 0.00 ? 18  ARG A HE   2  
ATOM 2233  H HH11 . ARG A 1 18  ? -10.115 -18.031 10.782  1.00 0.00 ? 18  ARG A HH11 2  
ATOM 2234  H HH12 . ARG A 1 18  ? -10.846 -19.260 11.788  1.00 0.00 ? 18  ARG A HH12 2  
ATOM 2235  H HH21 . ARG A 1 18  ? -9.357  -18.258 14.744  1.00 0.00 ? 18  ARG A HH21 2  
ATOM 2236  H HH22 . ARG A 1 18  ? -10.539 -19.301 13.996  1.00 0.00 ? 18  ARG A HH22 2  
ATOM 2237  N N    . LEU A 1 19  ? -9.081  -17.009 6.925   1.00 0.00 ? 19  LEU A N    2  
ATOM 2238  C CA   . LEU A 1 19  ? -9.066  -18.405 6.447   1.00 0.00 ? 19  LEU A CA   2  
ATOM 2239  C C    . LEU A 1 19  ? -10.486 -18.883 6.104   1.00 0.00 ? 19  LEU A C    2  
ATOM 2240  O O    . LEU A 1 19  ? -11.112 -19.646 6.843   1.00 0.00 ? 19  LEU A O    2  
ATOM 2241  C CB   . LEU A 1 19  ? -8.302  -19.331 7.429   1.00 0.00 ? 19  LEU A CB   2  
ATOM 2242  C CG   . LEU A 1 19  ? -6.914  -18.813 7.873   1.00 0.00 ? 19  LEU A CG   2  
ATOM 2243  C CD1  . LEU A 1 19  ? -6.306  -19.790 8.886   1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2244  C CD2  . LEU A 1 19  ? -5.950  -18.632 6.689   1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2245  H H    . LEU A 1 19  ? -8.604  -16.338 6.342   1.00 0.00 ? 19  LEU A H    2  
ATOM 2246  H HA   . LEU A 1 19  ? -8.509  -18.418 5.508   1.00 0.00 ? 19  LEU A HA   2  
ATOM 2247  H HB2  . LEU A 1 19  ? -8.909  -19.490 8.323   1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2248  H HB3  . LEU A 1 19  ? -8.174  -20.307 6.954   1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2249  H HG   . LEU A 1 19  ? -7.032  -17.844 8.368   1.00 0.00 ? 19  LEU A HG   2  
ATOM 2250  H HD11 . LEU A 1 19  ? -5.344  -19.414 9.234   1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2251  H HD12 . LEU A 1 19  ? -6.968  -19.895 9.746   1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2252  H HD13 . LEU A 1 19  ? -6.158  -20.765 8.423   1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2253  H HD21 . LEU A 1 19  ? -4.973  -18.316 7.050   1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2254  H HD22 . LEU A 1 19  ? -5.837  -19.572 6.150   1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2255  H HD23 . LEU A 1 19  ? -6.323  -17.867 6.007   1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2256  N N    . GLY A 1 20  ? -11.001 -18.363 4.984   1.00 0.00 ? 20  GLY A N    2  
ATOM 2257  C CA   . GLY A 1 20  ? -12.406 -18.497 4.563   1.00 0.00 ? 20  GLY A CA   2  
ATOM 2258  C C    . GLY A 1 20  ? -13.309 -17.373 5.090   1.00 0.00 ? 20  GLY A C    2  
ATOM 2259  O O    . GLY A 1 20  ? -14.509 -17.386 4.827   1.00 0.00 ? 20  GLY A O    2  
ATOM 2260  H H    . GLY A 1 20  ? -10.402 -17.783 4.416   1.00 0.00 ? 20  GLY A H    2  
ATOM 2261  H HA2  . GLY A 1 20  ? -12.449 -18.463 3.472   1.00 0.00 ? 20  GLY A HA2  2  
ATOM 2262  H HA3  . GLY A 1 20  ? -12.812 -19.445 4.920   1.00 0.00 ? 20  GLY A HA3  2  
ATOM 2263  N N    . TYR A 1 21  ? -12.735 -16.411 5.823   1.00 0.00 ? 21  TYR A N    2  
ATOM 2264  C CA   . TYR A 1 21  ? -13.419 -15.271 6.449   1.00 0.00 ? 21  TYR A CA   2  
ATOM 2265  C C    . TYR A 1 21  ? -12.587 -13.984 6.290   1.00 0.00 ? 21  TYR A C    2  
ATOM 2266  O O    . TYR A 1 21  ? -11.362 -14.015 6.442   1.00 0.00 ? 21  TYR A O    2  
ATOM 2267  C CB   . TYR A 1 21  ? -13.634 -15.567 7.943   1.00 0.00 ? 21  TYR A CB   2  
ATOM 2268  C CG   . TYR A 1 21  ? -14.339 -16.882 8.245   1.00 0.00 ? 21  TYR A CG   2  
ATOM 2269  C CD1  . TYR A 1 21  ? -15.700 -17.048 7.920   1.00 0.00 ? 21  TYR A CD1  2  
ATOM 2270  C CD2  . TYR A 1 21  ? -13.629 -17.947 8.837   1.00 0.00 ? 21  TYR A CD2  2  
ATOM 2271  C CE1  . TYR A 1 21  ? -16.349 -18.271 8.172   1.00 0.00 ? 21  TYR A CE1  2  
ATOM 2272  C CE2  . TYR A 1 21  ? -14.269 -19.176 9.084   1.00 0.00 ? 21  TYR A CE2  2  
ATOM 2273  C CZ   . TYR A 1 21  ? -15.631 -19.345 8.745   1.00 0.00 ? 21  TYR A CZ   2  
ATOM 2274  O OH   . TYR A 1 21  ? -16.255 -20.533 8.973   1.00 0.00 ? 21  TYR A OH   2  
ATOM 2275  H H    . TYR A 1 21  ? -11.742 -16.477 5.972   1.00 0.00 ? 21  TYR A H    2  
ATOM 2276  H HA   . TYR A 1 21  ? -14.392 -15.123 5.974   1.00 0.00 ? 21  TYR A HA   2  
ATOM 2277  H HB2  . TYR A 1 21  ? -12.663 -15.567 8.440   1.00 0.00 ? 21  TYR A HB2  2  
ATOM 2278  H HB3  . TYR A 1 21  ? -14.222 -14.759 8.375   1.00 0.00 ? 21  TYR A HB3  2  
ATOM 2279  H HD1  . TYR A 1 21  ? -16.246 -16.242 7.449   1.00 0.00 ? 21  TYR A HD1  2  
ATOM 2280  H HD2  . TYR A 1 21  ? -12.585 -17.827 9.087   1.00 0.00 ? 21  TYR A HD2  2  
ATOM 2281  H HE1  . TYR A 1 21  ? -17.391 -18.398 7.911   1.00 0.00 ? 21  TYR A HE1  2  
ATOM 2282  H HE2  . TYR A 1 21  ? -13.712 -19.994 9.522   1.00 0.00 ? 21  TYR A HE2  2  
ATOM 2283  H HH   . TYR A 1 21  ? -15.666 -21.187 9.364   1.00 0.00 ? 21  TYR A HH   2  
ATOM 2284  N N    . GLU A 1 22  ? -13.242 -12.849 6.021   1.00 0.00 ? 22  GLU A N    2  
ATOM 2285  C CA   . GLU A 1 22  ? -12.580 -11.550 5.843   1.00 0.00 ? 22  GLU A CA   2  
ATOM 2286  C C    . GLU A 1 22  ? -12.646 -10.732 7.142   1.00 0.00 ? 22  GLU A C    2  
ATOM 2287  O O    . GLU A 1 22  ? -13.728 -10.408 7.636   1.00 0.00 ? 22  GLU A O    2  
ATOM 2288  C CB   . GLU A 1 22  ? -13.219 -10.754 4.691   1.00 0.00 ? 22  GLU A CB   2  
ATOM 2289  C CG   . GLU A 1 22  ? -12.964 -11.349 3.296   1.00 0.00 ? 22  GLU A CG   2  
ATOM 2290  C CD   . GLU A 1 22  ? -13.723 -12.660 3.043   1.00 0.00 ? 22  GLU A CD   2  
ATOM 2291  O OE1  . GLU A 1 22  ? -14.975 -12.670 3.128   1.00 0.00 ? 22  GLU A OE1  2  
ATOM 2292  O OE2  . GLU A 1 22  ? -13.073 -13.690 2.745   1.00 0.00 ? 22  GLU A OE2  2  
ATOM 2293  H H    . GLU A 1 22  ? -14.249 -12.881 5.923   1.00 0.00 ? 22  GLU A H    2  
ATOM 2294  H HA   . GLU A 1 22  ? -11.528 -11.709 5.592   1.00 0.00 ? 22  GLU A HA   2  
ATOM 2295  H HB2  . GLU A 1 22  ? -14.292 -10.650 4.860   1.00 0.00 ? 22  GLU A HB2  2  
ATOM 2296  H HB3  . GLU A 1 22  ? -12.785 -9.753  4.698   1.00 0.00 ? 22  GLU A HB3  2  
ATOM 2297  H HG2  . GLU A 1 22  ? -13.280 -10.618 2.550   1.00 0.00 ? 22  GLU A HG2  2  
ATOM 2298  H HG3  . GLU A 1 22  ? -11.890 -11.507 3.172   1.00 0.00 ? 22  GLU A HG3  2  
ATOM 2299  N N    . HIS A 1 23  ? -11.480 -10.391 7.688   1.00 0.00 ? 23  HIS A N    2  
ATOM 2300  C CA   . HIS A 1 23  ? -11.307 -9.625  8.922   1.00 0.00 ? 23  HIS A CA   2  
ATOM 2301  C C    . HIS A 1 23  ? -10.405 -8.396  8.689   1.00 0.00 ? 23  HIS A C    2  
ATOM 2302  O O    . HIS A 1 23  ? -9.891  -8.184  7.588   1.00 0.00 ? 23  HIS A O    2  
ATOM 2303  C CB   . HIS A 1 23  ? -10.752 -10.577 10.004  1.00 0.00 ? 23  HIS A CB   2  
ATOM 2304  C CG   . HIS A 1 23  ? -11.823 -11.481 10.564  1.00 0.00 ? 23  HIS A CG   2  
ATOM 2305  N ND1  . HIS A 1 23  ? -12.493 -11.296 11.750  1.00 0.00 ? 23  HIS A ND1  2  
ATOM 2306  C CD2  . HIS A 1 23  ? -12.423 -12.536 9.930   1.00 0.00 ? 23  HIS A CD2  2  
ATOM 2307  C CE1  . HIS A 1 23  ? -13.504 -12.175 11.797  1.00 0.00 ? 23  HIS A CE1  2  
ATOM 2308  N NE2  . HIS A 1 23  ? -13.494 -12.977 10.717  1.00 0.00 ? 23  HIS A NE2  2  
ATOM 2309  H H    . HIS A 1 23  ? -10.620 -10.651 7.207   1.00 0.00 ? 23  HIS A H    2  
ATOM 2310  H HA   . HIS A 1 23  ? -12.266 -9.236  9.259   1.00 0.00 ? 23  HIS A HA   2  
ATOM 2311  H HB2  . HIS A 1 23  ? -9.942  -11.182 9.587   1.00 0.00 ? 23  HIS A HB2  2  
ATOM 2312  H HB3  . HIS A 1 23  ? -10.338 -10.002 10.833  1.00 0.00 ? 23  HIS A HB3  2  
ATOM 2313  H HD1  . HIS A 1 23  ? -12.278 -10.611 12.469  1.00 0.00 ? 23  HIS A HD1  2  
ATOM 2314  H HD2  . HIS A 1 23  ? -12.140 -12.932 8.962   1.00 0.00 ? 23  HIS A HD2  2  
ATOM 2315  H HE1  . HIS A 1 23  ? -14.243 -12.206 12.583  1.00 0.00 ? 23  HIS A HE1  2  
ATOM 2316  N N    . TRP A 1 24  ? -10.186 -7.588  9.735   1.00 0.00 ? 24  TRP A N    2  
ATOM 2317  C CA   . TRP A 1 24  ? -9.286  -6.431  9.688   1.00 0.00 ? 24  TRP A CA   2  
ATOM 2318  C C    . TRP A 1 24  ? -8.423  -6.304  10.949  1.00 0.00 ? 24  TRP A C    2  
ATOM 2319  O O    . TRP A 1 24  ? -8.821  -6.745  12.029  1.00 0.00 ? 24  TRP A O    2  
ATOM 2320  C CB   . TRP A 1 24  ? -10.085 -5.134  9.526   1.00 0.00 ? 24  TRP A CB   2  
ATOM 2321  C CG   . TRP A 1 24  ? -11.153 -5.084  8.478   1.00 0.00 ? 24  TRP A CG   2  
ATOM 2322  C CD1  . TRP A 1 24  ? -12.464 -5.286  8.711   1.00 0.00 ? 24  TRP A CD1  2  
ATOM 2323  C CD2  . TRP A 1 24  ? -11.055 -4.734  7.064   1.00 0.00 ? 24  TRP A CD2  2  
ATOM 2324  N NE1  . TRP A 1 24  ? -13.177 -5.158  7.534   1.00 0.00 ? 24  TRP A NE1  2  
ATOM 2325  C CE2  . TRP A 1 24  ? -12.362 -4.783  6.489   1.00 0.00 ? 24  TRP A CE2  2  
ATOM 2326  C CE3  . TRP A 1 24  ? -10.002 -4.335  6.216   1.00 0.00 ? 24  TRP A CE3  2  
ATOM 2327  C CZ2  . TRP A 1 24  ? -12.610 -4.471  5.144   1.00 0.00 ? 24  TRP A CZ2  2  
ATOM 2328  C CZ3  . TRP A 1 24  ? -10.242 -4.000  4.869   1.00 0.00 ? 24  TRP A CZ3  2  
ATOM 2329  C CH2  . TRP A 1 24  ? -11.537 -4.073  4.328   1.00 0.00 ? 24  TRP A CH2  2  
ATOM 2330  H H    . TRP A 1 24  ? -10.630 -7.788  10.621  1.00 0.00 ? 24  TRP A H    2  
ATOM 2331  H HA   . TRP A 1 24  ? -8.627  -6.537  8.829   1.00 0.00 ? 24  TRP A HA   2  
ATOM 2332  H HB2  . TRP A 1 24  ? -10.561 -4.921  10.484  1.00 0.00 ? 24  TRP A HB2  2  
ATOM 2333  H HB3  . TRP A 1 24  ? -9.382  -4.326  9.321   1.00 0.00 ? 24  TRP A HB3  2  
ATOM 2334  H HD1  . TRP A 1 24  ? -12.873 -5.504  9.688   1.00 0.00 ? 24  TRP A HD1  2  
ATOM 2335  H HE1  . TRP A 1 24  ? -14.177 -5.293  7.462   1.00 0.00 ? 24  TRP A HE1  2  
ATOM 2336  H HE3  . TRP A 1 24  ? -9.003  -4.269  6.619   1.00 0.00 ? 24  TRP A HE3  2  
ATOM 2337  H HZ2  . TRP A 1 24  ? -13.613 -4.520  4.748   1.00 0.00 ? 24  TRP A HZ2  2  
ATOM 2338  H HZ3  . TRP A 1 24  ? -9.422  -3.681  4.248   1.00 0.00 ? 24  TRP A HZ3  2  
ATOM 2339  H HH2  . TRP A 1 24  ? -11.707 -3.817  3.291   1.00 0.00 ? 24  TRP A HH2  2  
ATOM 2340  N N    . ALA A 1 25  ? -7.288  -5.613  10.826  1.00 0.00 ? 25  ALA A N    2  
ATOM 2341  C CA   . ALA A 1 25  ? -6.436  -5.213  11.946  1.00 0.00 ? 25  ALA A CA   2  
ATOM 2342  C C    . ALA A 1 25  ? -5.932  -3.765  11.780  1.00 0.00 ? 25  ALA A C    2  
ATOM 2343  O O    . ALA A 1 25  ? -5.382  -3.423  10.738  1.00 0.00 ? 25  ALA A O    2  
ATOM 2344  C CB   . ALA A 1 25  ? -5.287  -6.227  12.041  1.00 0.00 ? 25  ALA A CB   2  
ATOM 2345  H H    . ALA A 1 25  ? -7.008  -5.331  9.889   1.00 0.00 ? 25  ALA A H    2  
ATOM 2346  H HA   . ALA A 1 25  ? -7.024  -5.258  12.861  1.00 0.00 ? 25  ALA A HA   2  
ATOM 2347  H HB1  . ALA A 1 25  ? -4.671  -6.007  12.908  1.00 0.00 ? 25  ALA A HB1  2  
ATOM 2348  H HB2  . ALA A 1 25  ? -5.691  -7.237  12.149  1.00 0.00 ? 25  ALA A HB2  2  
ATOM 2349  H HB3  . ALA A 1 25  ? -4.668  -6.179  11.144  1.00 0.00 ? 25  ALA A HB3  2  
ATOM 2350  N N    . LEU A 1 26  ? -6.119  -2.912  12.791  1.00 0.00 ? 26  LEU A N    2  
ATOM 2351  C CA   . LEU A 1 26  ? -5.631  -1.527  12.845  1.00 0.00 ? 26  LEU A CA   2  
ATOM 2352  C C    . LEU A 1 26  ? -4.255  -1.519  13.527  1.00 0.00 ? 26  LEU A C    2  
ATOM 2353  O O    . LEU A 1 26  ? -4.150  -1.922  14.685  1.00 0.00 ? 26  LEU A O    2  
ATOM 2354  C CB   . LEU A 1 26  ? -6.660  -0.693  13.646  1.00 0.00 ? 26  LEU A CB   2  
ATOM 2355  C CG   . LEU A 1 26  ? -6.577  0.849   13.554  1.00 0.00 ? 26  LEU A CG   2  
ATOM 2356  C CD1  . LEU A 1 26  ? -5.216  1.464   13.901  1.00 0.00 ? 26  LEU A CD1  2  
ATOM 2357  C CD2  . LEU A 1 26  ? -7.017  1.335   12.167  1.00 0.00 ? 26  LEU A CD2  2  
ATOM 2358  H H    . LEU A 1 26  ? -6.565  -3.275  13.628  1.00 0.00 ? 26  LEU A H    2  
ATOM 2359  H HA   . LEU A 1 26  ? -5.556  -1.128  11.830  1.00 0.00 ? 26  LEU A HA   2  
ATOM 2360  H HB2  . LEU A 1 26  ? -7.660  -0.983  13.318  1.00 0.00 ? 26  LEU A HB2  2  
ATOM 2361  H HB3  . LEU A 1 26  ? -6.592  -0.968  14.699  1.00 0.00 ? 26  LEU A HB3  2  
ATOM 2362  H HG   . LEU A 1 26  ? -7.282  1.238   14.287  1.00 0.00 ? 26  LEU A HG   2  
ATOM 2363  H HD11 . LEU A 1 26  ? -5.327  2.543   14.033  1.00 0.00 ? 26  LEU A HD11 2  
ATOM 2364  H HD12 . LEU A 1 26  ? -4.840  1.034   14.829  1.00 0.00 ? 26  LEU A HD12 2  
ATOM 2365  H HD13 . LEU A 1 26  ? -4.503  1.291   13.097  1.00 0.00 ? 26  LEU A HD13 2  
ATOM 2366  H HD21 . LEU A 1 26  ? -7.046  2.423   12.146  1.00 0.00 ? 26  LEU A HD21 2  
ATOM 2367  H HD22 . LEU A 1 26  ? -6.314  0.992   11.409  1.00 0.00 ? 26  LEU A HD22 2  
ATOM 2368  H HD23 . LEU A 1 26  ? -8.015  0.952   11.942  1.00 0.00 ? 26  LEU A HD23 2  
ATOM 2369  N N    . TYR A 1 27  ? -3.209  -1.044  12.852  1.00 0.00 ? 27  TYR A N    2  
ATOM 2370  C CA   . TYR A 1 27  ? -1.861  -0.880  13.418  1.00 0.00 ? 27  TYR A CA   2  
ATOM 2371  C C    . TYR A 1 27  ? -1.810  0.275   14.438  1.00 0.00 ? 27  TYR A C    2  
ATOM 2372  O O    . TYR A 1 27  ? -1.896  1.446   14.060  1.00 0.00 ? 27  TYR A O    2  
ATOM 2373  C CB   . TYR A 1 27  ? -0.904  -0.663  12.235  1.00 0.00 ? 27  TYR A CB   2  
ATOM 2374  C CG   . TYR A 1 27  ? 0.594   -0.792  12.488  1.00 0.00 ? 27  TYR A CG   2  
ATOM 2375  C CD1  . TYR A 1 27  ? 1.277   0.081   13.359  1.00 0.00 ? 27  TYR A CD1  2  
ATOM 2376  C CD2  . TYR A 1 27  ? 1.332   -1.727  11.737  1.00 0.00 ? 27  TYR A CD2  2  
ATOM 2377  C CE1  . TYR A 1 27  ? 2.684   0.074   13.416  1.00 0.00 ? 27  TYR A CE1  2  
ATOM 2378  C CE2  . TYR A 1 27  ? 2.737   -1.761  11.812  1.00 0.00 ? 27  TYR A CE2  2  
ATOM 2379  C CZ   . TYR A 1 27  ? 3.420   -0.848  12.643  1.00 0.00 ? 27  TYR A CZ   2  
ATOM 2380  O OH   . TYR A 1 27  ? 4.780   -0.845  12.691  1.00 0.00 ? 27  TYR A OH   2  
ATOM 2381  H H    . TYR A 1 27  ? -3.356  -0.733  11.895  1.00 0.00 ? 27  TYR A H    2  
ATOM 2382  H HA   . TYR A 1 27  ? -1.572  -1.795  13.930  1.00 0.00 ? 27  TYR A HA   2  
ATOM 2383  H HB2  . TYR A 1 27  ? -1.172  -1.385  11.462  1.00 0.00 ? 27  TYR A HB2  2  
ATOM 2384  H HB3  . TYR A 1 27  ? -1.097  0.320   11.809  1.00 0.00 ? 27  TYR A HB3  2  
ATOM 2385  H HD1  . TYR A 1 27  ? 0.737   0.789   13.967  1.00 0.00 ? 27  TYR A HD1  2  
ATOM 2386  H HD2  . TYR A 1 27  ? 0.815   -2.403  11.074  1.00 0.00 ? 27  TYR A HD2  2  
ATOM 2387  H HE1  . TYR A 1 27  ? 3.205   0.772   14.057  1.00 0.00 ? 27  TYR A HE1  2  
ATOM 2388  H HE2  . TYR A 1 27  ? 3.300   -2.459  11.208  1.00 0.00 ? 27  TYR A HE2  2  
ATOM 2389  H HH   . TYR A 1 27  ? 5.173   -1.494  12.099  1.00 0.00 ? 27  TYR A HH   2  
ATOM 2390  N N    . ILE A 1 28  ? -1.647  -0.037  15.732  1.00 0.00 ? 28  ILE A N    2  
ATOM 2391  C CA   . ILE A 1 28  ? -1.656  0.964   16.828  1.00 0.00 ? 28  ILE A CA   2  
ATOM 2392  C C    . ILE A 1 28  ? -0.271  1.384   17.339  1.00 0.00 ? 28  ILE A C    2  
ATOM 2393  O O    . ILE A 1 28  ? -0.153  2.438   17.966  1.00 0.00 ? 28  ILE A O    2  
ATOM 2394  C CB   . ILE A 1 28  ? -2.519  0.508   18.022  1.00 0.00 ? 28  ILE A CB   2  
ATOM 2395  C CG1  . ILE A 1 28  ? -2.141  -0.898  18.541  1.00 0.00 ? 28  ILE A CG1  2  
ATOM 2396  C CG2  . ILE A 1 28  ? -4.009  0.626   17.656  1.00 0.00 ? 28  ILE A CG2  2  
ATOM 2397  C CD1  . ILE A 1 28  ? -2.545  -1.118  20.004  1.00 0.00 ? 28  ILE A CD1  2  
ATOM 2398  H H    . ILE A 1 28  ? -1.537  -1.022  15.964  1.00 0.00 ? 28  ILE A H    2  
ATOM 2399  H HA   . ILE A 1 28  ? -2.098  1.882   16.453  1.00 0.00 ? 28  ILE A HA   2  
ATOM 2400  H HB   . ILE A 1 28  ? -2.344  1.216   18.836  1.00 0.00 ? 28  ILE A HB   2  
ATOM 2401  H HG12 . ILE A 1 28  ? -2.611  -1.660  17.916  1.00 0.00 ? 28  ILE A HG12 2  
ATOM 2402  H HG13 . ILE A 1 28  ? -1.062  -1.036  18.483  1.00 0.00 ? 28  ILE A HG13 2  
ATOM 2403  H HG21 . ILE A 1 28  ? -4.613  0.522   18.555  1.00 0.00 ? 28  ILE A HG21 2  
ATOM 2404  H HG22 . ILE A 1 28  ? -4.220  1.610   17.235  1.00 0.00 ? 28  ILE A HG22 2  
ATOM 2405  H HG23 . ILE A 1 28  ? -4.284  -0.138  16.928  1.00 0.00 ? 28  ILE A HG23 2  
ATOM 2406  H HD11 . ILE A 1 28  ? -1.957  -0.465  20.650  1.00 0.00 ? 28  ILE A HD11 2  
ATOM 2407  H HD12 . ILE A 1 28  ? -3.599  -0.895  20.146  1.00 0.00 ? 28  ILE A HD12 2  
ATOM 2408  H HD13 . ILE A 1 28  ? -2.357  -2.154  20.281  1.00 0.00 ? 28  ILE A HD13 2  
ATOM 2409  N N    . GLY A 1 29  ? 0.768   0.583   17.098  1.00 0.00 ? 29  GLY A N    2  
ATOM 2410  C CA   . GLY A 1 29  ? 2.138   0.843   17.545  1.00 0.00 ? 29  GLY A CA   2  
ATOM 2411  C C    . GLY A 1 29  ? 3.099   -0.110  16.860  1.00 0.00 ? 29  GLY A C    2  
ATOM 2412  O O    . GLY A 1 29  ? 2.646   -1.030  16.184  1.00 0.00 ? 29  GLY A O    2  
ATOM 2413  H H    . GLY A 1 29  ? 0.626   -0.270  16.564  1.00 0.00 ? 29  GLY A H    2  
ATOM 2414  H HA2  . GLY A 1 29  ? 2.419   1.871   17.314  1.00 0.00 ? 29  GLY A HA2  2  
ATOM 2415  H HA3  . GLY A 1 29  ? 2.207   0.706   18.625  1.00 0.00 ? 29  GLY A HA3  2  
ATOM 2416  N N    . ASP A 1 30  ? 4.404   0.114   17.006  1.00 0.00 ? 30  ASP A N    2  
ATOM 2417  C CA   . ASP A 1 30  ? 5.442   -0.593  16.246  1.00 0.00 ? 30  ASP A CA   2  
ATOM 2418  C C    . ASP A 1 30  ? 5.373   -2.126  16.431  1.00 0.00 ? 30  ASP A C    2  
ATOM 2419  O O    . ASP A 1 30  ? 5.889   -2.681  17.406  1.00 0.00 ? 30  ASP A O    2  
ATOM 2420  C CB   . ASP A 1 30  ? 6.819   -0.023  16.623  1.00 0.00 ? 30  ASP A CB   2  
ATOM 2421  C CG   . ASP A 1 30  ? 7.973   -0.727  15.888  1.00 0.00 ? 30  ASP A CG   2  
ATOM 2422  O OD1  . ASP A 1 30  ? 7.908   -0.860  14.641  1.00 0.00 ? 30  ASP A OD1  2  
ATOM 2423  O OD2  . ASP A 1 30  ? 8.960   -1.122  16.555  1.00 0.00 ? 30  ASP A OD2  2  
ATOM 2424  H H    . ASP A 1 30  ? 4.693   0.882   17.595  1.00 0.00 ? 30  ASP A H    2  
ATOM 2425  H HA   . ASP A 1 30  ? 5.274   -0.370  15.191  1.00 0.00 ? 30  ASP A HA   2  
ATOM 2426  H HB2  . ASP A 1 30  ? 6.842   1.040   16.379  1.00 0.00 ? 30  ASP A HB2  2  
ATOM 2427  H HB3  . ASP A 1 30  ? 6.962   -0.118  17.702  1.00 0.00 ? 30  ASP A HB3  2  
ATOM 2428  N N    . GLY A 1 31  ? 4.707   -2.801  15.483  1.00 0.00 ? 31  GLY A N    2  
ATOM 2429  C CA   . GLY A 1 31  ? 4.455   -4.246  15.489  1.00 0.00 ? 31  GLY A CA   2  
ATOM 2430  C C    . GLY A 1 31  ? 3.266   -4.711  16.337  1.00 0.00 ? 31  GLY A C    2  
ATOM 2431  O O    . GLY A 1 31  ? 3.187   -5.898  16.642  1.00 0.00 ? 31  GLY A O    2  
ATOM 2432  H H    . GLY A 1 31  ? 4.278   -2.253  14.750  1.00 0.00 ? 31  GLY A H    2  
ATOM 2433  H HA2  . GLY A 1 31  ? 4.241   -4.546  14.464  1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2434  H HA3  . GLY A 1 31  ? 5.338   -4.764  15.858  1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2435  N N    . TYR A 1 32  ? 2.322   -3.832  16.690  1.00 0.00 ? 32  TYR A N    2  
ATOM 2436  C CA   . TYR A 1 32  ? 1.115   -4.139  17.478  1.00 0.00 ? 32  TYR A CA   2  
ATOM 2437  C C    . TYR A 1 32  ? -0.182  -3.667  16.790  1.00 0.00 ? 32  TYR A C    2  
ATOM 2438  O O    . TYR A 1 32  ? -0.232  -2.588  16.192  1.00 0.00 ? 32  TYR A O    2  
ATOM 2439  C CB   . TYR A 1 32  ? 1.236   -3.514  18.876  1.00 0.00 ? 32  TYR A CB   2  
ATOM 2440  C CG   . TYR A 1 32  ? 2.262   -4.209  19.754  1.00 0.00 ? 32  TYR A CG   2  
ATOM 2441  C CD1  . TYR A 1 32  ? 1.903   -5.381  20.452  1.00 0.00 ? 32  TYR A CD1  2  
ATOM 2442  C CD2  . TYR A 1 32  ? 3.573   -3.706  19.854  1.00 0.00 ? 32  TYR A CD2  2  
ATOM 2443  C CE1  . TYR A 1 32  ? 2.851   -6.041  21.256  1.00 0.00 ? 32  TYR A CE1  2  
ATOM 2444  C CE2  . TYR A 1 32  ? 4.528   -4.368  20.651  1.00 0.00 ? 32  TYR A CE2  2  
ATOM 2445  C CZ   . TYR A 1 32  ? 4.167   -5.538  21.356  1.00 0.00 ? 32  TYR A CZ   2  
ATOM 2446  O OH   . TYR A 1 32  ? 5.082   -6.184  22.129  1.00 0.00 ? 32  TYR A OH   2  
ATOM 2447  H H    . TYR A 1 32  ? 2.453   -2.864  16.405  1.00 0.00 ? 32  TYR A H    2  
ATOM 2448  H HA   . TYR A 1 32  ? 1.038   -5.219  17.608  1.00 0.00 ? 32  TYR A HA   2  
ATOM 2449  H HB2  . TYR A 1 32  ? 1.488   -2.457  18.780  1.00 0.00 ? 32  TYR A HB2  2  
ATOM 2450  H HB3  . TYR A 1 32  ? 0.266   -3.573  19.373  1.00 0.00 ? 32  TYR A HB3  2  
ATOM 2451  H HD1  . TYR A 1 32  ? 0.897   -5.774  20.371  1.00 0.00 ? 32  TYR A HD1  2  
ATOM 2452  H HD2  . TYR A 1 32  ? 3.850   -2.814  19.309  1.00 0.00 ? 32  TYR A HD2  2  
ATOM 2453  H HE1  . TYR A 1 32  ? 2.575   -6.934  21.800  1.00 0.00 ? 32  TYR A HE1  2  
ATOM 2454  H HE2  . TYR A 1 32  ? 5.533   -3.975  20.722  1.00 0.00 ? 32  TYR A HE2  2  
ATOM 2455  H HH   . TYR A 1 32  ? 5.942   -5.751  22.113  1.00 0.00 ? 32  TYR A HH   2  
ATOM 2456  N N    . VAL A 1 33  ? -1.247  -4.469  16.899  1.00 0.00 ? 33  VAL A N    2  
ATOM 2457  C CA   . VAL A 1 33  ? -2.520  -4.273  16.184  1.00 0.00 ? 33  VAL A CA   2  
ATOM 2458  C C    . VAL A 1 33  ? -3.749  -4.479  17.076  1.00 0.00 ? 33  VAL A C    2  
ATOM 2459  O O    . VAL A 1 33  ? -3.700  -5.207  18.065  1.00 0.00 ? 33  VAL A O    2  
ATOM 2460  C CB   . VAL A 1 33  ? -2.644  -5.196  14.945  1.00 0.00 ? 33  VAL A CB   2  
ATOM 2461  C CG1  . VAL A 1 33  ? -1.608  -4.888  13.855  1.00 0.00 ? 33  VAL A CG1  2  
ATOM 2462  C CG2  . VAL A 1 33  ? -2.565  -6.698  15.276  1.00 0.00 ? 33  VAL A CG2  2  
ATOM 2463  H H    . VAL A 1 33  ? -1.161  -5.308  17.480  1.00 0.00 ? 33  VAL A H    2  
ATOM 2464  H HA   . VAL A 1 33  ? -2.544  -3.246  15.836  1.00 0.00 ? 33  VAL A HA   2  
ATOM 2465  H HB   . VAL A 1 33  ? -3.622  -5.006  14.509  1.00 0.00 ? 33  VAL A HB   2  
ATOM 2466  H HG11 . VAL A 1 33  ? -1.762  -5.551  13.003  1.00 0.00 ? 33  VAL A HG11 2  
ATOM 2467  H HG12 . VAL A 1 33  ? -1.726  -3.863  13.511  1.00 0.00 ? 33  VAL A HG12 2  
ATOM 2468  H HG13 . VAL A 1 33  ? -0.596  -5.031  14.235  1.00 0.00 ? 33  VAL A HG13 2  
ATOM 2469  H HG21 . VAL A 1 33  ? -3.326  -6.971  16.009  1.00 0.00 ? 33  VAL A HG21 2  
ATOM 2470  H HG22 . VAL A 1 33  ? -2.733  -7.278  14.369  1.00 0.00 ? 33  VAL A HG22 2  
ATOM 2471  H HG23 . VAL A 1 33  ? -1.580  -6.953  15.667  1.00 0.00 ? 33  VAL A HG23 2  
ATOM 2472  N N    . ILE A 1 34  ? -4.867  -3.865  16.683  1.00 0.00 ? 34  ILE A N    2  
ATOM 2473  C CA   . ILE A 1 34  ? -6.218  -4.074  17.240  1.00 0.00 ? 34  ILE A CA   2  
ATOM 2474  C C    . ILE A 1 34  ? -7.066  -4.740  16.159  1.00 0.00 ? 34  ILE A C    2  
ATOM 2475  O O    . ILE A 1 34  ? -7.056  -4.280  15.024  1.00 0.00 ? 34  ILE A O    2  
ATOM 2476  C CB   . ILE A 1 34  ? -6.839  -2.717  17.646  1.00 0.00 ? 34  ILE A CB   2  
ATOM 2477  C CG1  . ILE A 1 34  ? -6.015  -2.000  18.737  1.00 0.00 ? 34  ILE A CG1  2  
ATOM 2478  C CG2  . ILE A 1 34  ? -8.310  -2.860  18.079  1.00 0.00 ? 34  ILE A CG2  2  
ATOM 2479  C CD1  . ILE A 1 34  ? -6.165  -2.559  20.151  1.00 0.00 ? 34  ILE A CD1  2  
ATOM 2480  H H    . ILE A 1 34  ? -4.793  -3.247  15.874  1.00 0.00 ? 34  ILE A H    2  
ATOM 2481  H HA   . ILE A 1 34  ? -6.177  -4.731  18.110  1.00 0.00 ? 34  ILE A HA   2  
ATOM 2482  H HB   . ILE A 1 34  ? -6.824  -2.075  16.764  1.00 0.00 ? 34  ILE A HB   2  
ATOM 2483  H HG12 . ILE A 1 34  ? -4.961  -2.028  18.467  1.00 0.00 ? 34  ILE A HG12 2  
ATOM 2484  H HG13 . ILE A 1 34  ? -6.318  -0.954  18.762  1.00 0.00 ? 34  ILE A HG13 2  
ATOM 2485  H HG21 . ILE A 1 34  ? -8.923  -3.166  17.232  1.00 0.00 ? 34  ILE A HG21 2  
ATOM 2486  H HG22 . ILE A 1 34  ? -8.400  -3.604  18.869  1.00 0.00 ? 34  ILE A HG22 2  
ATOM 2487  H HG23 . ILE A 1 34  ? -8.691  -1.902  18.436  1.00 0.00 ? 34  ILE A HG23 2  
ATOM 2488  H HD11 . ILE A 1 34  ? -7.135  -2.264  20.542  1.00 0.00 ? 34  ILE A HD11 2  
ATOM 2489  H HD12 . ILE A 1 34  ? -6.079  -3.645  20.142  1.00 0.00 ? 34  ILE A HD12 2  
ATOM 2490  H HD13 . ILE A 1 34  ? -5.399  -2.146  20.805  1.00 0.00 ? 34  ILE A HD13 2  
ATOM 2491  N N    . HIS A 1 35  ? -7.805  -5.801  16.462  1.00 0.00 ? 35  HIS A N    2  
ATOM 2492  C CA   . HIS A 1 35  ? -8.523  -6.584  15.447  1.00 0.00 ? 35  HIS A CA   2  
ATOM 2493  C C    . HIS A 1 35  ? -9.811  -7.205  16.008  1.00 0.00 ? 35  HIS A C    2  
ATOM 2494  O O    . HIS A 1 35  ? -9.859  -7.567  17.183  1.00 0.00 ? 35  HIS A O    2  
ATOM 2495  C CB   . HIS A 1 35  ? -7.575  -7.674  14.910  1.00 0.00 ? 35  HIS A CB   2  
ATOM 2496  C CG   . HIS A 1 35  ? -7.162  -8.702  15.935  1.00 0.00 ? 35  HIS A CG   2  
ATOM 2497  N ND1  . HIS A 1 35  ? -7.681  -9.971  16.067  1.00 0.00 ? 35  HIS A ND1  2  
ATOM 2498  C CD2  . HIS A 1 35  ? -6.233  -8.544  16.929  1.00 0.00 ? 35  HIS A CD2  2  
ATOM 2499  C CE1  . HIS A 1 35  ? -7.087  -10.556 17.120  1.00 0.00 ? 35  HIS A CE1  2  
ATOM 2500  N NE2  . HIS A 1 35  ? -6.192  -9.725  17.681  1.00 0.00 ? 35  HIS A NE2  2  
ATOM 2501  H H    . HIS A 1 35  ? -7.820  -6.150  17.421  1.00 0.00 ? 35  HIS A H    2  
ATOM 2502  H HA   . HIS A 1 35  ? -8.812  -5.931  14.622  1.00 0.00 ? 35  HIS A HA   2  
ATOM 2503  H HB2  . HIS A 1 35  ? -8.059  -8.190  14.080  1.00 0.00 ? 35  HIS A HB2  2  
ATOM 2504  H HB3  . HIS A 1 35  ? -6.680  -7.196  14.516  1.00 0.00 ? 35  HIS A HB3  2  
ATOM 2505  H HD1  . HIS A 1 35  ? -8.388  -10.396 15.481  1.00 0.00 ? 35  HIS A HD1  2  
ATOM 2506  H HD2  . HIS A 1 35  ? -5.649  -7.652  17.112  1.00 0.00 ? 35  HIS A HD2  2  
ATOM 2507  H HE1  . HIS A 1 35  ? -7.294  -11.564 17.463  1.00 0.00 ? 35  HIS A HE1  2  
ATOM 2508  N N    . LEU A 1 36  ? -10.845 -7.376  15.173  1.00 0.00 ? 36  LEU A N    2  
ATOM 2509  C CA   . LEU A 1 36  ? -12.063 -8.095  15.559  1.00 0.00 ? 36  LEU A CA   2  
ATOM 2510  C C    . LEU A 1 36  ? -11.835 -9.603  15.376  1.00 0.00 ? 36  LEU A C    2  
ATOM 2511  O O    . LEU A 1 36  ? -11.796 -10.098 14.250  1.00 0.00 ? 36  LEU A O    2  
ATOM 2512  C CB   . LEU A 1 36  ? -13.262 -7.545  14.749  1.00 0.00 ? 36  LEU A CB   2  
ATOM 2513  C CG   . LEU A 1 36  ? -14.629 -8.115  15.188  1.00 0.00 ? 36  LEU A CG   2  
ATOM 2514  C CD1  . LEU A 1 36  ? -15.053 -7.580  16.560  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2515  C CD2  . LEU A 1 36  ? -15.729 -7.754  14.183  1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2516  H H    . LEU A 1 36  ? -10.759 -7.073  14.211  1.00 0.00 ? 36  LEU A H    2  
ATOM 2517  H HA   . LEU A 1 36  ? -12.247 -7.915  16.619  1.00 0.00 ? 36  LEU A HA   2  
ATOM 2518  H HB2  . LEU A 1 36  ? -13.293 -6.462  14.864  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2519  H HB3  . LEU A 1 36  ? -13.104 -7.767  13.692  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2520  H HG   . LEU A 1 36  ? -14.559 -9.200  15.234  1.00 0.00 ? 36  LEU A HG   2  
ATOM 2521  H HD11 . LEU A 1 36  ? -15.196 -6.500  16.511  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 2522  H HD12 . LEU A 1 36  ? -15.983 -8.049  16.873  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 2523  H HD13 . LEU A 1 36  ? -14.293 -7.804  17.300  1.00 0.00 ? 36  LEU A HD13 2  
ATOM 2524  H HD21 . LEU A 1 36  ? -16.692 -8.118  14.537  1.00 0.00 ? 36  LEU A HD21 2  
ATOM 2525  H HD22 . LEU A 1 36  ? -15.781 -6.672  14.058  1.00 0.00 ? 36  LEU A HD22 2  
ATOM 2526  H HD23 . LEU A 1 36  ? -15.514 -8.217  13.223  1.00 0.00 ? 36  LEU A HD23 2  
ATOM 2527  N N    . ALA A 1 37  ? -11.674 -10.331 16.480  1.00 0.00 ? 37  ALA A N    2  
ATOM 2528  C CA   . ALA A 1 37  ? -11.521 -11.785 16.516  1.00 0.00 ? 37  ALA A CA   2  
ATOM 2529  C C    . ALA A 1 37  ? -12.841 -12.493 16.120  1.00 0.00 ? 37  ALA A C    2  
ATOM 2530  O O    . ALA A 1 37  ? -13.918 -12.031 16.522  1.00 0.00 ? 37  ALA A O    2  
ATOM 2531  C CB   . ALA A 1 37  ? -11.011 -12.176 17.909  1.00 0.00 ? 37  ALA A CB   2  
ATOM 2532  H H    . ALA A 1 37  ? -11.747 -9.852  17.374  1.00 0.00 ? 37  ALA A H    2  
ATOM 2533  H HA   . ALA A 1 37  ? -10.745 -12.041 15.793  1.00 0.00 ? 37  ALA A HA   2  
ATOM 2534  H HB1  . ALA A 1 37  ? -10.070 -11.660 18.109  1.00 0.00 ? 37  ALA A HB1  2  
ATOM 2535  H HB2  . ALA A 1 37  ? -11.739 -11.887 18.669  1.00 0.00 ? 37  ALA A HB2  2  
ATOM 2536  H HB3  . ALA A 1 37  ? -10.843 -13.253 17.963  1.00 0.00 ? 37  ALA A HB3  2  
ATOM 2537  N N    . PRO A 1 38  ? -12.766 -13.609 15.359  1.00 0.00 ? 38  PRO A N    2  
ATOM 2538  C CA   . PRO A 1 38  ? -13.916 -14.242 14.716  1.00 0.00 ? 38  PRO A CA   2  
ATOM 2539  C C    . PRO A 1 38  ? -14.918 -14.939 15.648  1.00 0.00 ? 38  PRO A C    2  
ATOM 2540  O O    . PRO A 1 38  ? -14.505 -15.637 16.575  1.00 0.00 ? 38  PRO A O    2  
ATOM 2541  C CB   . PRO A 1 38  ? -13.333 -15.255 13.722  1.00 0.00 ? 38  PRO A CB   2  
ATOM 2542  C CG   . PRO A 1 38  ? -11.986 -15.616 14.332  1.00 0.00 ? 38  PRO A CG   2  
ATOM 2543  C CD   . PRO A 1 38  ? -11.544 -14.297 14.960  1.00 0.00 ? 38  PRO A CD   2  
ATOM 2544  H HA   . PRO A 1 38  ? -14.423 -13.467 14.155  1.00 0.00 ? 38  PRO A HA   2  
ATOM 2545  H HB2  . PRO A 1 38  ? -13.966 -16.133 13.597  1.00 0.00 ? 38  PRO A HB2  2  
ATOM 2546  H HB3  . PRO A 1 38  ? -13.172 -14.777 12.758  1.00 0.00 ? 38  PRO A HB3  2  
ATOM 2547  H HG2  . PRO A 1 38  ? -12.116 -16.371 15.108  1.00 0.00 ? 38  PRO A HG2  2  
ATOM 2548  H HG3  . PRO A 1 38  ? -11.285 -15.951 13.573  1.00 0.00 ? 38  PRO A HG3  2  
ATOM 2549  H HD2  . PRO A 1 38  ? -10.898 -14.490 15.816  1.00 0.00 ? 38  PRO A HD2  2  
ATOM 2550  H HD3  . PRO A 1 38  ? -11.021 -13.696 14.212  1.00 0.00 ? 38  PRO A HD3  2  
ATOM 2551  N N    . PRO A 1 39  ? -16.231 -14.837 15.344  1.00 0.00 ? 39  PRO A N    2  
ATOM 2552  C CA   . PRO A 1 39  ? -17.277 -15.621 15.993  1.00 0.00 ? 39  PRO A CA   2  
ATOM 2553  C C    . PRO A 1 39  ? -17.374 -17.042 15.405  1.00 0.00 ? 39  PRO A C    2  
ATOM 2554  O O    . PRO A 1 39  ? -17.999 -17.913 16.003  1.00 0.00 ? 39  PRO A O    2  
ATOM 2555  C CB   . PRO A 1 39  ? -18.564 -14.834 15.725  1.00 0.00 ? 39  PRO A CB   2  
ATOM 2556  C CG   . PRO A 1 39  ? -18.325 -14.187 14.361  1.00 0.00 ? 39  PRO A CG   2  
ATOM 2557  C CD   . PRO A 1 39  ? -16.814 -13.965 14.325  1.00 0.00 ? 39  PRO A CD   2  
ATOM 2558  H HA   . PRO A 1 39  ? -17.101 -15.688 17.067  1.00 0.00 ? 39  PRO A HA   2  
ATOM 2559  H HB2  . PRO A 1 39  ? -19.451 -15.470 15.724  1.00 0.00 ? 39  PRO A HB2  2  
ATOM 2560  H HB3  . PRO A 1 39  ? -18.674 -14.051 16.470  1.00 0.00 ? 39  PRO A HB3  2  
ATOM 2561  H HG2  . PRO A 1 39  ? -18.611 -14.880 13.569  1.00 0.00 ? 39  PRO A HG2  2  
ATOM 2562  H HG3  . PRO A 1 39  ? -18.862 -13.241 14.255  1.00 0.00 ? 39  PRO A HG3  2  
ATOM 2563  H HD2  . PRO A 1 39  ? -16.435 -14.210 13.332  1.00 0.00 ? 39  PRO A HD2  2  
ATOM 2564  H HD3  . PRO A 1 39  ? -16.587 -12.925 14.559  1.00 0.00 ? 39  PRO A HD3  2  
ATOM 2565  N N    . SER A 1 40  ? -16.752 -17.288 14.241  1.00 0.00 ? 40  SER A N    2  
ATOM 2566  C CA   . SER A 1 40  ? -16.879 -18.489 13.396  1.00 0.00 ? 40  SER A CA   2  
ATOM 2567  C C    . SER A 1 40  ? -16.399 -19.821 14.008  1.00 0.00 ? 40  SER A C    2  
ATOM 2568  O O    . SER A 1 40  ? -16.515 -20.868 13.368  1.00 0.00 ? 40  SER A O    2  
ATOM 2569  C CB   . SER A 1 40  ? -16.116 -18.251 12.081  1.00 0.00 ? 40  SER A CB   2  
ATOM 2570  O OG   . SER A 1 40  ? -16.328 -16.944 11.562  1.00 0.00 ? 40  SER A OG   2  
ATOM 2571  H H    . SER A 1 40  ? -16.305 -16.510 13.772  1.00 0.00 ? 40  SER A H    2  
ATOM 2572  H HA   . SER A 1 40  ? -17.931 -18.615 13.147  1.00 0.00 ? 40  SER A HA   2  
ATOM 2573  H HB2  . SER A 1 40  ? -15.047 -18.385 12.258  1.00 0.00 ? 40  SER A HB2  2  
ATOM 2574  H HB3  . SER A 1 40  ? -16.444 -18.995 11.354  1.00 0.00 ? 40  SER A HB3  2  
ATOM 2575  H HG   . SER A 1 40  ? -15.959 -16.904 10.667  1.00 0.00 ? 40  SER A HG   2  
ATOM 2576  N N    . GLU A 1 41  ? -15.864 -19.800 15.232  1.00 0.00 ? 41  GLU A N    2  
ATOM 2577  C CA   . GLU A 1 41  ? -15.431 -20.978 15.998  1.00 0.00 ? 41  GLU A CA   2  
ATOM 2578  C C    . GLU A 1 41  ? -16.627 -21.750 16.598  1.00 0.00 ? 41  GLU A C    2  
ATOM 2579  O O    . GLU A 1 41  ? -16.632 -22.135 17.766  1.00 0.00 ? 41  GLU A O    2  
ATOM 2580  C CB   . GLU A 1 41  ? -14.428 -20.554 17.085  1.00 0.00 ? 41  GLU A CB   2  
ATOM 2581  C CG   . GLU A 1 41  ? -13.150 -19.886 16.549  1.00 0.00 ? 41  GLU A CG   2  
ATOM 2582  C CD   . GLU A 1 41  ? -12.358 -20.776 15.574  1.00 0.00 ? 41  GLU A CD   2  
ATOM 2583  O OE1  . GLU A 1 41  ? -12.084 -21.957 15.899  1.00 0.00 ? 41  GLU A OE1  2  
ATOM 2584  O OE2  . GLU A 1 41  ? -11.966 -20.283 14.489  1.00 0.00 ? 41  GLU A OE2  2  
ATOM 2585  H H    . GLU A 1 41  ? -15.866 -18.910 15.712  1.00 0.00 ? 41  GLU A H    2  
ATOM 2586  H HA   . GLU A 1 41  ? -14.923 -21.664 15.319  1.00 0.00 ? 41  GLU A HA   2  
ATOM 2587  H HB2  . GLU A 1 41  ? -14.933 -19.852 17.746  1.00 0.00 ? 41  GLU A HB2  2  
ATOM 2588  H HB3  . GLU A 1 41  ? -14.153 -21.433 17.674  1.00 0.00 ? 41  GLU A HB3  2  
ATOM 2589  H HG2  . GLU A 1 41  ? -13.418 -18.948 16.059  1.00 0.00 ? 41  GLU A HG2  2  
ATOM 2590  H HG3  . GLU A 1 41  ? -12.508 -19.641 17.397  1.00 0.00 ? 41  GLU A HG3  2  
ATOM 2591  N N    . TYR A 1 42  ? -17.673 -21.971 15.799  1.00 0.00 ? 42  TYR A N    2  
ATOM 2592  C CA   . TYR A 1 42  ? -18.874 -22.721 16.181  1.00 0.00 ? 42  TYR A CA   2  
ATOM 2593  C C    . TYR A 1 42  ? -18.639 -24.182 16.641  1.00 0.00 ? 42  TYR A C    2  
ATOM 2594  O O    . TYR A 1 42  ? -19.363 -24.618 17.542  1.00 0.00 ? 42  TYR A O    2  
ATOM 2595  C CB   . TYR A 1 42  ? -19.911 -22.657 15.045  1.00 0.00 ? 42  TYR A CB   2  
ATOM 2596  C CG   . TYR A 1 42  ? -20.188 -21.267 14.491  1.00 0.00 ? 42  TYR A CG   2  
ATOM 2597  C CD1  . TYR A 1 42  ? -20.636 -20.240 15.344  1.00 0.00 ? 42  TYR A CD1  2  
ATOM 2598  C CD2  . TYR A 1 42  ? -19.999 -21.000 13.121  1.00 0.00 ? 42  TYR A CD2  2  
ATOM 2599  C CE1  . TYR A 1 42  ? -20.882 -18.948 14.839  1.00 0.00 ? 42  TYR A CE1  2  
ATOM 2600  C CE2  . TYR A 1 42  ? -20.251 -19.716 12.605  1.00 0.00 ? 42  TYR A CE2  2  
ATOM 2601  C CZ   . TYR A 1 42  ? -20.686 -18.682 13.464  1.00 0.00 ? 42  TYR A CZ   2  
ATOM 2602  O OH   . TYR A 1 42  ? -20.909 -17.434 12.962  1.00 0.00 ? 42  TYR A OH   2  
ATOM 2603  H H    . TYR A 1 42  ? -17.608 -21.635 14.844  1.00 0.00 ? 42  TYR A H    2  
ATOM 2604  H HA   . TYR A 1 42  ? -19.295 -22.209 17.033  1.00 0.00 ? 42  TYR A HA   2  
ATOM 2605  H HB2  . TYR A 1 42  ? -19.581 -23.300 14.228  1.00 0.00 ? 42  TYR A HB2  2  
ATOM 2606  H HB3  . TYR A 1 42  ? -20.850 -23.069 15.415  1.00 0.00 ? 42  TYR A HB3  2  
ATOM 2607  H HD1  . TYR A 1 42  ? -20.785 -20.436 16.397  1.00 0.00 ? 42  TYR A HD1  2  
ATOM 2608  H HD2  . TYR A 1 42  ? -19.656 -21.785 12.459  1.00 0.00 ? 42  TYR A HD2  2  
ATOM 2609  H HE1  . TYR A 1 42  ? -21.208 -18.164 15.508  1.00 0.00 ? 42  TYR A HE1  2  
ATOM 2610  H HE2  . TYR A 1 42  ? -20.105 -19.512 11.553  1.00 0.00 ? 42  TYR A HE2  2  
ATOM 2611  H HH   . TYR A 1 42  ? -21.204 -16.814 13.638  1.00 0.00 ? 42  TYR A HH   2  
ATOM 2612  N N    . PRO A 1 43  ? -17.666 -24.941 16.076  1.00 0.00 ? 43  PRO A N    2  
ATOM 2613  C CA   . PRO A 1 43  ? -17.323 -26.291 16.518  1.00 0.00 ? 43  PRO A CA   2  
ATOM 2614  C C    . PRO A 1 43  ? -16.897 -26.356 17.989  1.00 0.00 ? 43  PRO A C    2  
ATOM 2615  O O    . PRO A 1 43  ? -16.378 -25.390 18.553  1.00 0.00 ? 43  PRO A O    2  
ATOM 2616  C CB   . PRO A 1 43  ? -16.198 -26.770 15.592  1.00 0.00 ? 43  PRO A CB   2  
ATOM 2617  C CG   . PRO A 1 43  ? -16.427 -25.963 14.319  1.00 0.00 ? 43  PRO A CG   2  
ATOM 2618  C CD   . PRO A 1 43  ? -16.909 -24.627 14.874  1.00 0.00 ? 43  PRO A CD   2  
ATOM 2619  H HA   . PRO A 1 43  ? -18.196 -26.928 16.367  1.00 0.00 ? 43  PRO A HA   2  
ATOM 2620  H HB2  . PRO A 1 43  ? -15.225 -26.510 16.011  1.00 0.00 ? 43  PRO A HB2  2  
ATOM 2621  H HB3  . PRO A 1 43  ? -16.257 -27.843 15.403  1.00 0.00 ? 43  PRO A HB3  2  
ATOM 2622  H HG2  . PRO A 1 43  ? -15.512 -25.856 13.733  1.00 0.00 ? 43  PRO A HG2  2  
ATOM 2623  H HG3  . PRO A 1 43  ? -17.218 -26.422 13.722  1.00 0.00 ? 43  PRO A HG3  2  
ATOM 2624  H HD2  . PRO A 1 43  ? -16.054 -24.008 15.145  1.00 0.00 ? 43  PRO A HD2  2  
ATOM 2625  H HD3  . PRO A 1 43  ? -17.532 -24.107 14.145  1.00 0.00 ? 43  PRO A HD3  2  
ATOM 2626  N N    . GLY A 1 44  ? -17.127 -27.517 18.612  1.00 0.00 ? 44  GLY A N    2  
ATOM 2627  C CA   . GLY A 1 44  ? -16.801 -27.801 20.015  1.00 0.00 ? 44  GLY A CA   2  
ATOM 2628  C C    . GLY A 1 44  ? -17.827 -27.232 21.000  1.00 0.00 ? 44  GLY A C    2  
ATOM 2629  O O    . GLY A 1 44  ? -18.241 -27.939 21.919  1.00 0.00 ? 44  GLY A O    2  
ATOM 2630  H H    . GLY A 1 44  ? -17.557 -28.262 18.080  1.00 0.00 ? 44  GLY A H    2  
ATOM 2631  H HA2  . GLY A 1 44  ? -16.759 -28.882 20.159  1.00 0.00 ? 44  GLY A HA2  2  
ATOM 2632  H HA3  . GLY A 1 44  ? -15.831 -27.367 20.256  1.00 0.00 ? 44  GLY A HA3  2  
ATOM 2633  N N    . ALA A 1 45  ? -18.261 -25.981 20.809  1.00 0.00 ? 45  ALA A N    2  
ATOM 2634  C CA   . ALA A 1 45  ? -19.335 -25.362 21.592  1.00 0.00 ? 45  ALA A CA   2  
ATOM 2635  C C    . ALA A 1 45  ? -20.737 -25.897 21.224  1.00 0.00 ? 45  ALA A C    2  
ATOM 2636  O O    . ALA A 1 45  ? -21.013 -26.231 20.069  1.00 0.00 ? 45  ALA A O    2  
ATOM 2637  C CB   . ALA A 1 45  ? -19.242 -23.840 21.434  1.00 0.00 ? 45  ALA A CB   2  
ATOM 2638  H H    . ALA A 1 45  ? -17.868 -25.457 20.032  1.00 0.00 ? 45  ALA A H    2  
ATOM 2639  H HA   . ALA A 1 45  ? -19.167 -25.602 22.642  1.00 0.00 ? 45  ALA A HA   2  
ATOM 2640  H HB1  . ALA A 1 45  ? -18.251 -23.493 21.731  1.00 0.00 ? 45  ALA A HB1  2  
ATOM 2641  H HB2  . ALA A 1 45  ? -19.413 -23.570 20.390  1.00 0.00 ? 45  ALA A HB2  2  
ATOM 2642  H HB3  . ALA A 1 45  ? -19.994 -23.346 22.053  1.00 0.00 ? 45  ALA A HB3  2  
ATOM 2643  N N    . GLY A 1 46  ? -21.627 -25.951 22.227  1.00 0.00 ? 46  GLY A N    2  
ATOM 2644  C CA   . GLY A 1 46  ? -23.017 -26.423 22.101  1.00 0.00 ? 46  GLY A CA   2  
ATOM 2645  C C    . GLY A 1 46  ? -24.047 -25.600 22.879  1.00 0.00 ? 46  GLY A C    2  
ATOM 2646  O O    . GLY A 1 46  ? -25.150 -26.083 23.123  1.00 0.00 ? 46  GLY A O    2  
ATOM 2647  H H    . GLY A 1 46  ? -21.304 -25.723 23.158  1.00 0.00 ? 46  GLY A H    2  
ATOM 2648  H HA2  . GLY A 1 46  ? -23.317 -26.439 21.053  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2649  H HA3  . GLY A 1 46  ? -23.071 -27.446 22.481  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2650  N N    . SER A 1 47  ? -23.702 -24.378 23.291  1.00 0.00 ? 47  SER A N    2  
ATOM 2651  C CA   . SER A 1 47  ? -24.528 -23.440 24.079  1.00 0.00 ? 47  SER A CA   2  
ATOM 2652  C C    . SER A 1 47  ? -23.852 -22.055 24.167  1.00 0.00 ? 47  SER A C    2  
ATOM 2653  O O    . SER A 1 47  ? -22.628 -21.944 24.073  1.00 0.00 ? 47  SER A O    2  
ATOM 2654  C CB   . SER A 1 47  ? -24.780 -23.978 25.507  1.00 0.00 ? 47  SER A CB   2  
ATOM 2655  O OG   . SER A 1 47  ? -25.732 -25.031 25.530  1.00 0.00 ? 47  SER A OG   2  
ATOM 2656  H H    . SER A 1 47  ? -22.797 -24.025 23.005  1.00 0.00 ? 47  SER A H    2  
ATOM 2657  H HA   . SER A 1 47  ? -25.491 -23.301 23.584  1.00 0.00 ? 47  SER A HA   2  
ATOM 2658  H HB2  . SER A 1 47  ? -23.836 -24.326 25.928  1.00 0.00 ? 47  SER A HB2  2  
ATOM 2659  H HB3  . SER A 1 47  ? -25.154 -23.168 26.137  1.00 0.00 ? 47  SER A HB3  2  
ATOM 2660  H HG   . SER A 1 47  ? -25.577 -25.577 24.734  1.00 0.00 ? 47  SER A HG   2  
ATOM 2661  N N    . SER A 1 48  ? -24.634 -20.996 24.403  1.00 0.00 ? 48  SER A N    2  
ATOM 2662  C CA   . SER A 1 48  ? -24.187 -19.585 24.406  1.00 0.00 ? 48  SER A CA   2  
ATOM 2663  C C    . SER A 1 48  ? -23.092 -19.266 25.441  1.00 0.00 ? 48  SER A C    2  
ATOM 2664  O O    . SER A 1 48  ? -22.385 -18.264 25.324  1.00 0.00 ? 48  SER A O    2  
ATOM 2665  C CB   . SER A 1 48  ? -25.405 -18.679 24.660  1.00 0.00 ? 48  SER A CB   2  
ATOM 2666  O OG   . SER A 1 48  ? -26.478 -18.966 23.765  1.00 0.00 ? 48  SER A OG   2  
ATOM 2667  H H    . SER A 1 48  ? -25.638 -21.132 24.445  1.00 0.00 ? 48  SER A H    2  
ATOM 2668  H HA   . SER A 1 48  ? -23.781 -19.343 23.423  1.00 0.00 ? 48  SER A HA   2  
ATOM 2669  H HB2  . SER A 1 48  ? -25.747 -18.827 25.685  1.00 0.00 ? 48  SER A HB2  2  
ATOM 2670  H HB3  . SER A 1 48  ? -25.103 -17.637 24.547  1.00 0.00 ? 48  SER A HB3  2  
ATOM 2671  H HG   . SER A 1 48  ? -27.199 -18.340 23.935  1.00 0.00 ? 48  SER A HG   2  
ATOM 2672  N N    . SER A 1 49  ? -22.911 -20.125 26.447  1.00 0.00 ? 49  SER A N    2  
ATOM 2673  C CA   . SER A 1 49  ? -21.815 -20.058 27.424  1.00 0.00 ? 49  SER A CA   2  
ATOM 2674  C C    . SER A 1 49  ? -20.439 -20.422 26.833  1.00 0.00 ? 49  SER A C    2  
ATOM 2675  O O    . SER A 1 49  ? -19.424 -20.015 27.404  1.00 0.00 ? 49  SER A O    2  
ATOM 2676  C CB   . SER A 1 49  ? -22.147 -20.995 28.599  1.00 0.00 ? 49  SER A CB   2  
ATOM 2677  O OG   . SER A 1 49  ? -22.489 -22.304 28.150  1.00 0.00 ? 49  SER A OG   2  
ATOM 2678  H H    . SER A 1 49  ? -23.539 -20.917 26.526  1.00 0.00 ? 49  SER A H    2  
ATOM 2679  H HA   . SER A 1 49  ? -21.744 -19.043 27.816  1.00 0.00 ? 49  SER A HA   2  
ATOM 2680  H HB2  . SER A 1 49  ? -21.292 -21.045 29.273  1.00 0.00 ? 49  SER A HB2  2  
ATOM 2681  H HB3  . SER A 1 49  ? -22.992 -20.578 29.151  1.00 0.00 ? 49  SER A HB3  2  
ATOM 2682  H HG   . SER A 1 49  ? -22.695 -22.847 28.929  1.00 0.00 ? 49  SER A HG   2  
ATOM 2683  N N    . VAL A 1 50  ? -20.396 -21.155 25.705  1.00 0.00 ? 50  VAL A N    2  
ATOM 2684  C CA   . VAL A 1 50  ? -19.203 -21.583 24.938  1.00 0.00 ? 50  VAL A CA   2  
ATOM 2685  C C    . VAL A 1 50  ? -18.419 -22.702 25.643  1.00 0.00 ? 50  VAL A C    2  
ATOM 2686  O O    . VAL A 1 50  ? -18.030 -22.562 26.803  1.00 0.00 ? 50  VAL A O    2  
ATOM 2687  C CB   . VAL A 1 50  ? -18.236 -20.424 24.569  1.00 0.00 ? 50  VAL A CB   2  
ATOM 2688  C CG1  . VAL A 1 50  ? -17.046 -20.944 23.744  1.00 0.00 ? 50  VAL A CG1  2  
ATOM 2689  C CG2  . VAL A 1 50  ? -18.958 -19.335 23.755  1.00 0.00 ? 50  VAL A CG2  2  
ATOM 2690  H H    . VAL A 1 50  ? -21.299 -21.412 25.305  1.00 0.00 ? 50  VAL A H    2  
ATOM 2691  H HA   . VAL A 1 50  ? -19.584 -21.990 24.001  1.00 0.00 ? 50  VAL A HA   2  
ATOM 2692  H HB   . VAL A 1 50  ? -17.822 -19.965 25.465  1.00 0.00 ? 50  VAL A HB   2  
ATOM 2693  H HG11 . VAL A 1 50  ? -16.433 -21.619 24.347  1.00 0.00 ? 50  VAL A HG11 2  
ATOM 2694  H HG12 . VAL A 1 50  ? -17.401 -21.475 22.861  1.00 0.00 ? 50  VAL A HG12 2  
ATOM 2695  H HG13 . VAL A 1 50  ? -16.422 -20.109 23.436  1.00 0.00 ? 50  VAL A HG13 2  
ATOM 2696  H HG21 . VAL A 1 50  ? -18.248 -18.569 23.442  1.00 0.00 ? 50  VAL A HG21 2  
ATOM 2697  H HG22 . VAL A 1 50  ? -19.423 -19.771 22.872  1.00 0.00 ? 50  VAL A HG22 2  
ATOM 2698  H HG23 . VAL A 1 50  ? -19.726 -18.859 24.365  1.00 0.00 ? 50  VAL A HG23 2  
ATOM 2699  N N    . PHE A 1 51  ? -18.124 -23.786 24.906  1.00 0.00 ? 51  PHE A N    2  
ATOM 2700  C CA   . PHE A 1 51  ? -17.243 -24.868 25.381  1.00 0.00 ? 51  PHE A CA   2  
ATOM 2701  C C    . PHE A 1 51  ? -15.854 -24.907 24.714  1.00 0.00 ? 51  PHE A C    2  
ATOM 2702  O O    . PHE A 1 51  ? -14.910 -25.413 25.323  1.00 0.00 ? 51  PHE A O    2  
ATOM 2703  C CB   . PHE A 1 51  ? -17.939 -26.236 25.244  1.00 0.00 ? 51  PHE A CB   2  
ATOM 2704  C CG   . PHE A 1 51  ? -19.385 -26.337 25.711  1.00 0.00 ? 51  PHE A CG   2  
ATOM 2705  C CD1  . PHE A 1 51  ? -19.838 -25.650 26.858  1.00 0.00 ? 51  PHE A CD1  2  
ATOM 2706  C CD2  . PHE A 1 51  ? -20.286 -27.154 25.003  1.00 0.00 ? 51  PHE A CD2  2  
ATOM 2707  C CE1  . PHE A 1 51  ? -21.181 -25.750 27.261  1.00 0.00 ? 51  PHE A CE1  2  
ATOM 2708  C CE2  . PHE A 1 51  ? -21.628 -27.263 25.412  1.00 0.00 ? 51  PHE A CE2  2  
ATOM 2709  C CZ   . PHE A 1 51  ? -22.077 -26.553 26.537  1.00 0.00 ? 51  PHE A CZ   2  
ATOM 2710  H H    . PHE A 1 51  ? -18.542 -23.866 23.992  1.00 0.00 ? 51  PHE A H    2  
ATOM 2711  H HA   . PHE A 1 51  ? -17.045 -24.698 26.433  1.00 0.00 ? 51  PHE A HA   2  
ATOM 2712  H HB2  . PHE A 1 51  ? -17.884 -26.544 24.201  1.00 0.00 ? 51  PHE A HB2  2  
ATOM 2713  H HB3  . PHE A 1 51  ? -17.360 -26.968 25.812  1.00 0.00 ? 51  PHE A HB3  2  
ATOM 2714  H HD1  . PHE A 1 51  ? -19.157 -25.038 27.433  1.00 0.00 ? 51  PHE A HD1  2  
ATOM 2715  H HD2  . PHE A 1 51  ? -19.948 -27.712 24.140  1.00 0.00 ? 51  PHE A HD2  2  
ATOM 2716  H HE1  . PHE A 1 51  ? -21.523 -25.215 28.137  1.00 0.00 ? 51  PHE A HE1  2  
ATOM 2717  H HE2  . PHE A 1 51  ? -22.313 -27.895 24.863  1.00 0.00 ? 51  PHE A HE2  2  
ATOM 2718  H HZ   . PHE A 1 51  ? -23.108 -26.636 26.855  1.00 0.00 ? 51  PHE A HZ   2  
ATOM 2719  N N    . SER A 1 52  ? -15.701 -24.383 23.493  1.00 0.00 ? 52  SER A N    2  
ATOM 2720  C CA   . SER A 1 52  ? -14.404 -24.255 22.807  1.00 0.00 ? 52  SER A CA   2  
ATOM 2721  C C    . SER A 1 52  ? -13.787 -22.866 23.067  1.00 0.00 ? 52  SER A C    2  
ATOM 2722  O O    . SER A 1 52  ? -13.038 -22.707 24.032  1.00 0.00 ? 52  SER A O    2  
ATOM 2723  C CB   . SER A 1 52  ? -14.567 -24.583 21.310  1.00 0.00 ? 52  SER A CB   2  
ATOM 2724  O OG   . SER A 1 52  ? -15.542 -23.753 20.697  1.00 0.00 ? 52  SER A OG   2  
ATOM 2725  H H    . SER A 1 52  ? -16.502 -23.994 23.024  1.00 0.00 ? 52  SER A H    2  
ATOM 2726  H HA   . SER A 1 52  ? -13.698 -24.987 23.208  1.00 0.00 ? 52  SER A HA   2  
ATOM 2727  H HB2  . SER A 1 52  ? -13.609 -24.460 20.802  1.00 0.00 ? 52  SER A HB2  2  
ATOM 2728  H HB3  . SER A 1 52  ? -14.874 -25.623 21.217  1.00 0.00 ? 52  SER A HB3  2  
ATOM 2729  H HG   . SER A 1 52  ? -15.742 -24.117 19.812  1.00 0.00 ? 52  SER A HG   2  
ATOM 2730  N N    . VAL A 1 53  ? -14.104 -21.858 22.241  1.00 0.00 ? 53  VAL A N    2  
ATOM 2731  C CA   . VAL A 1 53  ? -13.596 -20.472 22.344  1.00 0.00 ? 53  VAL A CA   2  
ATOM 2732  C C    . VAL A 1 53  ? -14.349 -19.524 21.400  1.00 0.00 ? 53  VAL A C    2  
ATOM 2733  O O    . VAL A 1 53  ? -14.483 -19.807 20.215  1.00 0.00 ? 53  VAL A O    2  
ATOM 2734  C CB   . VAL A 1 53  ? -12.059 -20.385 22.123  1.00 0.00 ? 53  VAL A CB   2  
ATOM 2735  C CG1  . VAL A 1 53  ? -11.581 -20.929 20.761  1.00 0.00 ? 53  VAL A CG1  2  
ATOM 2736  C CG2  . VAL A 1 53  ? -11.534 -18.952 22.317  1.00 0.00 ? 53  VAL A CG2  2  
ATOM 2737  H H    . VAL A 1 53  ? -14.734 -22.094 21.470  1.00 0.00 ? 53  VAL A H    2  
ATOM 2738  H HA   . VAL A 1 53  ? -13.793 -20.143 23.365  1.00 0.00 ? 53  VAL A HA   2  
ATOM 2739  H HB   . VAL A 1 53  ? -11.570 -20.986 22.888  1.00 0.00 ? 53  VAL A HB   2  
ATOM 2740  H HG11 . VAL A 1 53  ? -10.490 -20.934 20.739  1.00 0.00 ? 53  VAL A HG11 2  
ATOM 2741  H HG12 . VAL A 1 53  ? -11.933 -21.950 20.612  1.00 0.00 ? 53  VAL A HG12 2  
ATOM 2742  H HG13 . VAL A 1 53  ? -11.940 -20.300 19.948  1.00 0.00 ? 53  VAL A HG13 2  
ATOM 2743  H HG21 . VAL A 1 53  ? -10.443 -18.957 22.324  1.00 0.00 ? 53  VAL A HG21 2  
ATOM 2744  H HG22 . VAL A 1 53  ? -11.873 -18.309 21.506  1.00 0.00 ? 53  VAL A HG22 2  
ATOM 2745  H HG23 . VAL A 1 53  ? -11.887 -18.555 23.270  1.00 0.00 ? 53  VAL A HG23 2  
ATOM 2746  N N    . LEU A 1 54  ? -14.849 -18.401 21.943  1.00 0.00 ? 54  LEU A N    2  
ATOM 2747  C CA   . LEU A 1 54  ? -15.419 -17.241 21.221  1.00 0.00 ? 54  LEU A CA   2  
ATOM 2748  C C    . LEU A 1 54  ? -16.670 -17.529 20.350  1.00 0.00 ? 54  LEU A C    2  
ATOM 2749  O O    . LEU A 1 54  ? -17.120 -16.677 19.591  1.00 0.00 ? 54  LEU A O    2  
ATOM 2750  C CB   . LEU A 1 54  ? -14.258 -16.542 20.463  1.00 0.00 ? 54  LEU A CB   2  
ATOM 2751  C CG   . LEU A 1 54  ? -14.492 -15.086 19.998  1.00 0.00 ? 54  LEU A CG   2  
ATOM 2752  C CD1  . LEU A 1 54  ? -14.925 -14.150 21.136  1.00 0.00 ? 54  LEU A CD1  2  
ATOM 2753  C CD2  . LEU A 1 54  ? -13.198 -14.530 19.389  1.00 0.00 ? 54  LEU A CD2  2  
ATOM 2754  H H    . LEU A 1 54  ? -14.713 -18.282 22.940  1.00 0.00 ? 54  LEU A H    2  
ATOM 2755  H HA   . LEU A 1 54  ? -15.769 -16.560 21.997  1.00 0.00 ? 54  LEU A HA   2  
ATOM 2756  H HB2  . LEU A 1 54  ? -13.389 -16.529 21.125  1.00 0.00 ? 54  LEU A HB2  2  
ATOM 2757  H HB3  . LEU A 1 54  ? -13.999 -17.143 19.590  1.00 0.00 ? 54  LEU A HB3  2  
ATOM 2758  H HG   . LEU A 1 54  ? -15.255 -15.067 19.223  1.00 0.00 ? 54  LEU A HG   2  
ATOM 2759  H HD11 . LEU A 1 54  ? -15.892 -14.450 21.536  1.00 0.00 ? 54  LEU A HD11 2  
ATOM 2760  H HD12 . LEU A 1 54  ? -14.183 -14.160 21.936  1.00 0.00 ? 54  LEU A HD12 2  
ATOM 2761  H HD13 . LEU A 1 54  ? -15.023 -13.137 20.750  1.00 0.00 ? 54  LEU A HD13 2  
ATOM 2762  H HD21 . LEU A 1 54  ? -13.395 -13.547 18.961  1.00 0.00 ? 54  LEU A HD21 2  
ATOM 2763  H HD22 . LEU A 1 54  ? -12.424 -14.444 20.152  1.00 0.00 ? 54  LEU A HD22 2  
ATOM 2764  H HD23 . LEU A 1 54  ? -12.841 -15.188 18.597  1.00 0.00 ? 54  LEU A HD23 2  
ATOM 2765  N N    . SER A 1 55  ? -17.280 -18.707 20.464  1.00 0.00 ? 55  SER A N    2  
ATOM 2766  C CA   . SER A 1 55  ? -18.339 -19.190 19.559  1.00 0.00 ? 55  SER A CA   2  
ATOM 2767  C C    . SER A 1 55  ? -19.668 -18.399 19.612  1.00 0.00 ? 55  SER A C    2  
ATOM 2768  O O    . SER A 1 55  ? -20.508 -18.550 18.725  1.00 0.00 ? 55  SER A O    2  
ATOM 2769  C CB   . SER A 1 55  ? -18.629 -20.661 19.898  1.00 0.00 ? 55  SER A CB   2  
ATOM 2770  O OG   . SER A 1 55  ? -17.434 -21.386 20.143  1.00 0.00 ? 55  SER A OG   2  
ATOM 2771  H H    . SER A 1 55  ? -16.838 -19.415 21.033  1.00 0.00 ? 55  SER A H    2  
ATOM 2772  H HA   . SER A 1 55  ? -17.977 -19.139 18.530  1.00 0.00 ? 55  SER A HA   2  
ATOM 2773  H HB2  . SER A 1 55  ? -19.244 -20.705 20.799  1.00 0.00 ? 55  SER A HB2  2  
ATOM 2774  H HB3  . SER A 1 55  ? -19.183 -21.119 19.077  1.00 0.00 ? 55  SER A HB3  2  
ATOM 2775  H HG   . SER A 1 55  ? -17.075 -21.693 19.278  1.00 0.00 ? 55  SER A HG   2  
ATOM 2776  N N    . ASN A 1 56  ? -19.886 -17.574 20.647  1.00 0.00 ? 56  ASN A N    2  
ATOM 2777  C CA   . ASN A 1 56  ? -21.124 -16.809 20.839  1.00 0.00 ? 56  ASN A CA   2  
ATOM 2778  C C    . ASN A 1 56  ? -21.235 -15.566 19.938  1.00 0.00 ? 56  ASN A C    2  
ATOM 2779  O O    . ASN A 1 56  ? -22.300 -15.283 19.393  1.00 0.00 ? 56  ASN A O    2  
ATOM 2780  C CB   . ASN A 1 56  ? -21.179 -16.359 22.303  1.00 0.00 ? 56  ASN A CB   2  
ATOM 2781  C CG   . ASN A 1 56  ? -22.509 -15.687 22.633  1.00 0.00 ? 56  ASN A CG   2  
ATOM 2782  O OD1  . ASN A 1 56  ? -23.529 -16.343 22.814  1.00 0.00 ? 56  ASN A OD1  2  
ATOM 2783  N ND2  . ASN A 1 56  ? -22.546 -14.366 22.684  1.00 0.00 ? 56  ASN A ND2  2  
ATOM 2784  H H    . ASN A 1 56  ? -19.164 -17.502 21.352  1.00 0.00 ? 56  ASN A H    2  
ATOM 2785  H HA   . ASN A 1 56  ? -21.978 -17.459 20.643  1.00 0.00 ? 56  ASN A HA   2  
ATOM 2786  H HB2  . ASN A 1 56  ? -21.051 -17.220 22.959  1.00 0.00 ? 56  ASN A HB2  2  
ATOM 2787  H HB3  . ASN A 1 56  ? -20.367 -15.652 22.478  1.00 0.00 ? 56  ASN A HB3  2  
ATOM 2788  H HD21 . ASN A 1 56  ? -21.715 -13.820 22.485  1.00 0.00 ? 56  ASN A HD21 2  
ATOM 2789  H HD22 . ASN A 1 56  ? -23.422 -13.913 22.896  1.00 0.00 ? 56  ASN A HD22 2  
ATOM 2790  N N    . SER A 1 57  ? -20.148 -14.807 19.805  1.00 0.00 ? 57  SER A N    2  
ATOM 2791  C CA   . SER A 1 57  ? -20.101 -13.477 19.176  1.00 0.00 ? 57  SER A CA   2  
ATOM 2792  C C    . SER A 1 57  ? -18.643 -12.999 18.995  1.00 0.00 ? 57  SER A C    2  
ATOM 2793  O O    . SER A 1 57  ? -17.727 -13.550 19.608  1.00 0.00 ? 57  SER A O    2  
ATOM 2794  C CB   . SER A 1 57  ? -20.922 -12.447 19.983  1.00 0.00 ? 57  SER A CB   2  
ATOM 2795  O OG   . SER A 1 57  ? -20.568 -12.413 21.361  1.00 0.00 ? 57  SER A OG   2  
ATOM 2796  H H    . SER A 1 57  ? -19.281 -15.134 20.215  1.00 0.00 ? 57  SER A H    2  
ATOM 2797  H HA   . SER A 1 57  ? -20.562 -13.570 18.192  1.00 0.00 ? 57  SER A HA   2  
ATOM 2798  H HB2  . SER A 1 57  ? -20.780 -11.456 19.546  1.00 0.00 ? 57  SER A HB2  2  
ATOM 2799  H HB3  . SER A 1 57  ? -21.979 -12.696 19.906  1.00 0.00 ? 57  SER A HB3  2  
ATOM 2800  H HG   . SER A 1 57  ? -20.939 -11.608 21.755  1.00 0.00 ? 57  SER A HG   2  
ATOM 2801  N N    . ALA A 1 58  ? -18.399 -11.992 18.140  1.00 0.00 ? 58  ALA A N    2  
ATOM 2802  C CA   . ALA A 1 58  ? -17.043 -11.506 17.852  1.00 0.00 ? 58  ALA A CA   2  
ATOM 2803  C C    . ALA A 1 58  ? -16.530 -10.587 18.973  1.00 0.00 ? 58  ALA A C    2  
ATOM 2804  O O    . ALA A 1 58  ? -17.331 -9.961  19.668  1.00 0.00 ? 58  ALA A O    2  
ATOM 2805  C CB   . ALA A 1 58  ? -17.071 -10.785 16.499  1.00 0.00 ? 58  ALA A CB   2  
ATOM 2806  H H    . ALA A 1 58  ? -19.170 -11.471 17.736  1.00 0.00 ? 58  ALA A H    2  
ATOM 2807  H HA   . ALA A 1 58  ? -16.368 -12.362 17.774  1.00 0.00 ? 58  ALA A HA   2  
ATOM 2808  H HB1  . ALA A 1 58  ? -17.598 -11.388 15.761  1.00 0.00 ? 58  ALA A HB1  2  
ATOM 2809  H HB2  . ALA A 1 58  ? -17.575 -9.823  16.600  1.00 0.00 ? 58  ALA A HB2  2  
ATOM 2810  H HB3  . ALA A 1 58  ? -16.053 -10.620 16.148  1.00 0.00 ? 58  ALA A HB3  2  
ATOM 2811  N N    . GLU A 1 59  ? -15.209 -10.452 19.124  1.00 0.00 ? 59  GLU A N    2  
ATOM 2812  C CA   . GLU A 1 59  ? -14.599 -9.594  20.155  1.00 0.00 ? 59  GLU A CA   2  
ATOM 2813  C C    . GLU A 1 59  ? -13.431 -8.787  19.586  1.00 0.00 ? 59  GLU A C    2  
ATOM 2814  O O    . GLU A 1 59  ? -12.590 -9.342  18.887  1.00 0.00 ? 59  GLU A O    2  
ATOM 2815  C CB   . GLU A 1 59  ? -14.133 -10.436 21.355  1.00 0.00 ? 59  GLU A CB   2  
ATOM 2816  C CG   . GLU A 1 59  ? -13.606 -9.563  22.501  1.00 0.00 ? 59  GLU A CG   2  
ATOM 2817  C CD   . GLU A 1 59  ? -13.371 -10.387 23.773  1.00 0.00 ? 59  GLU A CD   2  
ATOM 2818  O OE1  . GLU A 1 59  ? -12.423 -11.206 23.808  1.00 0.00 ? 59  GLU A OE1  2  
ATOM 2819  O OE2  . GLU A 1 59  ? -14.133 -10.204 24.749  1.00 0.00 ? 59  GLU A OE2  2  
ATOM 2820  H H    . GLU A 1 59  ? -14.591 -10.927 18.470  1.00 0.00 ? 59  GLU A H    2  
ATOM 2821  H HA   . GLU A 1 59  ? -15.343 -8.886  20.511  1.00 0.00 ? 59  GLU A HA   2  
ATOM 2822  H HB2  . GLU A 1 59  ? -14.982 -11.009 21.727  1.00 0.00 ? 59  GLU A HB2  2  
ATOM 2823  H HB3  . GLU A 1 59  ? -13.347 -11.126 21.044  1.00 0.00 ? 59  GLU A HB3  2  
ATOM 2824  H HG2  . GLU A 1 59  ? -12.668 -9.095  22.207  1.00 0.00 ? 59  GLU A HG2  2  
ATOM 2825  H HG3  . GLU A 1 59  ? -14.333 -8.779  22.712  1.00 0.00 ? 59  GLU A HG3  2  
ATOM 2826  N N    . VAL A 1 60  ? -13.354 -7.492  19.898  1.00 0.00 ? 60  VAL A N    2  
ATOM 2827  C CA   . VAL A 1 60  ? -12.203 -6.650  19.536  1.00 0.00 ? 60  VAL A CA   2  
ATOM 2828  C C    . VAL A 1 60  ? -11.066 -6.907  20.531  1.00 0.00 ? 60  VAL A C    2  
ATOM 2829  O O    . VAL A 1 60  ? -11.243 -6.725  21.735  1.00 0.00 ? 60  VAL A O    2  
ATOM 2830  C CB   . VAL A 1 60  ? -12.551 -5.147  19.494  1.00 0.00 ? 60  VAL A CB   2  
ATOM 2831  C CG1  . VAL A 1 60  ? -11.341 -4.330  19.006  1.00 0.00 ? 60  VAL A CG1  2  
ATOM 2832  C CG2  . VAL A 1 60  ? -13.737 -4.842  18.567  1.00 0.00 ? 60  VAL A CG2  2  
ATOM 2833  H H    . VAL A 1 60  ? -14.079 -7.094  20.498  1.00 0.00 ? 60  VAL A H    2  
ATOM 2834  H HA   . VAL A 1 60  ? -11.881 -6.933  18.535  1.00 0.00 ? 60  VAL A HA   2  
ATOM 2835  H HB   . VAL A 1 60  ? -12.815 -4.836  20.501  1.00 0.00 ? 60  VAL A HB   2  
ATOM 2836  H HG11 . VAL A 1 60  ? -11.583 -3.268  18.996  1.00 0.00 ? 60  VAL A HG11 2  
ATOM 2837  H HG12 . VAL A 1 60  ? -10.486 -4.479  19.664  1.00 0.00 ? 60  VAL A HG12 2  
ATOM 2838  H HG13 . VAL A 1 60  ? -11.061 -4.640  17.997  1.00 0.00 ? 60  VAL A HG13 2  
ATOM 2839  H HG21 . VAL A 1 60  ? -14.639 -5.344  18.918  1.00 0.00 ? 60  VAL A HG21 2  
ATOM 2840  H HG22 . VAL A 1 60  ? -13.928 -3.770  18.557  1.00 0.00 ? 60  VAL A HG22 2  
ATOM 2841  H HG23 . VAL A 1 60  ? -13.510 -5.170  17.553  1.00 0.00 ? 60  VAL A HG23 2  
ATOM 2842  N N    . LYS A 1 61  ? -9.905  -7.323  20.024  1.00 0.00 ? 61  LYS A N    2  
ATOM 2843  C CA   . LYS A 1 61  ? -8.731  -7.734  20.808  1.00 0.00 ? 61  LYS A CA   2  
ATOM 2844  C C    . LYS A 1 61  ? -7.452  -6.988  20.379  1.00 0.00 ? 61  LYS A C    2  
ATOM 2845  O O    . LYS A 1 61  ? -7.358  -6.491  19.253  1.00 0.00 ? 61  LYS A O    2  
ATOM 2846  C CB   . LYS A 1 61  ? -8.561  -9.267  20.694  1.00 0.00 ? 61  LYS A CB   2  
ATOM 2847  C CG   . LYS A 1 61  ? -9.794  -10.023 21.229  1.00 0.00 ? 61  LYS A CG   2  
ATOM 2848  C CD   . LYS A 1 61  ? -9.609  -11.545 21.307  1.00 0.00 ? 61  LYS A CD   2  
ATOM 2849  C CE   . LYS A 1 61  ? -8.669  -11.940 22.457  1.00 0.00 ? 61  LYS A CE   2  
ATOM 2850  N NZ   . LYS A 1 61  ? -8.547  -13.420 22.592  1.00 0.00 ? 61  LYS A NZ   2  
ATOM 2851  H H    . LYS A 1 61  ? -9.857  -7.456  19.017  1.00 0.00 ? 61  LYS A H    2  
ATOM 2852  H HA   . LYS A 1 61  ? -8.904  -7.505  21.863  1.00 0.00 ? 61  LYS A HA   2  
ATOM 2853  H HB2  . LYS A 1 61  ? -8.401  -9.539  19.648  1.00 0.00 ? 61  LYS A HB2  2  
ATOM 2854  H HB3  . LYS A 1 61  ? -7.678  -9.566  21.266  1.00 0.00 ? 61  LYS A HB3  2  
ATOM 2855  H HG2  . LYS A 1 61  ? -10.053 -9.644  22.219  1.00 0.00 ? 61  LYS A HG2  2  
ATOM 2856  H HG3  . LYS A 1 61  ? -10.635 -9.830  20.566  1.00 0.00 ? 61  LYS A HG3  2  
ATOM 2857  H HD2  . LYS A 1 61  ? -10.592 -11.991 21.474  1.00 0.00 ? 61  LYS A HD2  2  
ATOM 2858  H HD3  . LYS A 1 61  ? -9.211  -11.911 20.358  1.00 0.00 ? 61  LYS A HD3  2  
ATOM 2859  H HE2  . LYS A 1 61  ? -7.680  -11.504 22.278  1.00 0.00 ? 61  LYS A HE2  2  
ATOM 2860  H HE3  . LYS A 1 61  ? -9.062  -11.517 23.387  1.00 0.00 ? 61  LYS A HE3  2  
ATOM 2861  H HZ1  . LYS A 1 61  ? -8.170  -13.836 21.749  1.00 0.00 ? 61  LYS A HZ1  2  
ATOM 2862  H HZ2  . LYS A 1 61  ? -7.930  -13.659 23.357  1.00 0.00 ? 61  LYS A HZ2  2  
ATOM 2863  H HZ3  . LYS A 1 61  ? -9.446  -13.845 22.785  1.00 0.00 ? 61  LYS A HZ3  2  
ATOM 2864  N N    . ARG A 1 62  ? -6.465  -6.912  21.283  1.00 0.00 ? 62  ARG A N    2  
ATOM 2865  C CA   . ARG A 1 62  ? -5.101  -6.406  21.014  1.00 0.00 ? 62  ARG A CA   2  
ATOM 2866  C C    . ARG A 1 62  ? -4.119  -7.576  20.847  1.00 0.00 ? 62  ARG A C    2  
ATOM 2867  O O    . ARG A 1 62  ? -4.226  -8.580  21.553  1.00 0.00 ? 62  ARG A O    2  
ATOM 2868  C CB   . ARG A 1 62  ? -4.654  -5.417  22.113  1.00 0.00 ? 62  ARG A CB   2  
ATOM 2869  C CG   . ARG A 1 62  ? -4.549  -6.015  23.529  1.00 0.00 ? 62  ARG A CG   2  
ATOM 2870  C CD   . ARG A 1 62  ? -4.193  -4.939  24.564  1.00 0.00 ? 62  ARG A CD   2  
ATOM 2871  N NE   . ARG A 1 62  ? -4.163  -5.496  25.931  1.00 0.00 ? 62  ARG A NE   2  
ATOM 2872  C CZ   . ARG A 1 62  ? -3.142  -6.090  26.545  1.00 0.00 ? 62  ARG A CZ   2  
ATOM 2873  N NH1  . ARG A 1 62  ? -1.974  -6.265  25.960  1.00 0.00 ? 62  ARG A NH1  2  
ATOM 2874  N NH2  . ARG A 1 62  ? -3.291  -6.525  27.778  1.00 0.00 ? 62  ARG A NH2  2  
ATOM 2875  H H    . ARG A 1 62  ? -6.619  -7.358  22.180  1.00 0.00 ? 62  ARG A H    2  
ATOM 2876  H HA   . ARG A 1 62  ? -5.116  -5.854  20.074  1.00 0.00 ? 62  ARG A HA   2  
ATOM 2877  H HB2  . ARG A 1 62  ? -3.682  -5.006  21.833  1.00 0.00 ? 62  ARG A HB2  2  
ATOM 2878  H HB3  . ARG A 1 62  ? -5.363  -4.590  22.140  1.00 0.00 ? 62  ARG A HB3  2  
ATOM 2879  H HG2  . ARG A 1 62  ? -5.504  -6.463  23.809  1.00 0.00 ? 62  ARG A HG2  2  
ATOM 2880  H HG3  . ARG A 1 62  ? -3.779  -6.788  23.546  1.00 0.00 ? 62  ARG A HG3  2  
ATOM 2881  H HD2  . ARG A 1 62  ? -3.231  -4.487  24.317  1.00 0.00 ? 62  ARG A HD2  2  
ATOM 2882  H HD3  . ARG A 1 62  ? -4.948  -4.150  24.529  1.00 0.00 ? 62  ARG A HD3  2  
ATOM 2883  H HE   . ARG A 1 62  ? -5.019  -5.402  26.463  1.00 0.00 ? 62  ARG A HE   2  
ATOM 2884  H HH11 . ARG A 1 62  ? -1.823  -5.936  25.023  1.00 0.00 ? 62  ARG A HH11 2  
ATOM 2885  H HH12 . ARG A 1 62  ? -1.215  -6.721  26.447  1.00 0.00 ? 62  ARG A HH12 2  
ATOM 2886  H HH21 . ARG A 1 62  ? -4.170  -6.412  28.262  1.00 0.00 ? 62  ARG A HH21 2  
ATOM 2887  H HH22 . ARG A 1 62  ? -2.531  -6.977  28.260  1.00 0.00 ? 62  ARG A HH22 2  
ATOM 2888  N N    . GLU A 1 63  ? -3.161  -7.449  19.926  1.00 0.00 ? 63  GLU A N    2  
ATOM 2889  C CA   . GLU A 1 63  ? -2.249  -8.533  19.530  1.00 0.00 ? 63  GLU A CA   2  
ATOM 2890  C C    . GLU A 1 63  ? -1.043  -7.988  18.748  1.00 0.00 ? 63  GLU A C    2  
ATOM 2891  O O    . GLU A 1 63  ? -1.055  -6.852  18.265  1.00 0.00 ? 63  GLU A O    2  
ATOM 2892  C CB   . GLU A 1 63  ? -3.045  -9.593  18.729  1.00 0.00 ? 63  GLU A CB   2  
ATOM 2893  C CG   . GLU A 1 63  ? -2.334  -10.910 18.403  1.00 0.00 ? 63  GLU A CG   2  
ATOM 2894  C CD   . GLU A 1 63  ? -1.697  -11.561 19.639  1.00 0.00 ? 63  GLU A CD   2  
ATOM 2895  O OE1  . GLU A 1 63  ? -2.375  -12.334 20.356  1.00 0.00 ? 63  GLU A OE1  2  
ATOM 2896  O OE2  . GLU A 1 63  ? -0.501  -11.289 19.900  1.00 0.00 ? 63  GLU A OE2  2  
ATOM 2897  H H    . GLU A 1 63  ? -3.120  -6.589  19.386  1.00 0.00 ? 63  GLU A H    2  
ATOM 2898  H HA   . GLU A 1 63  ? -1.865  -9.003  20.435  1.00 0.00 ? 63  GLU A HA   2  
ATOM 2899  H HB2  . GLU A 1 63  ? -3.934  -9.858  19.296  1.00 0.00 ? 63  GLU A HB2  2  
ATOM 2900  H HB3  . GLU A 1 63  ? -3.372  -9.141  17.791  1.00 0.00 ? 63  GLU A HB3  2  
ATOM 2901  H HG2  . GLU A 1 63  ? -3.069  -11.590 17.972  1.00 0.00 ? 63  GLU A HG2  2  
ATOM 2902  H HG3  . GLU A 1 63  ? -1.572  -10.733 17.646  1.00 0.00 ? 63  GLU A HG3  2  
ATOM 2903  N N    . ARG A 1 64  ? 0.008   -8.798  18.615  1.00 0.00 ? 64  ARG A N    2  
ATOM 2904  C CA   . ARG A 1 64  ? 1.195   -8.516  17.804  1.00 0.00 ? 64  ARG A CA   2  
ATOM 2905  C C    . ARG A 1 64  ? 0.876   -8.682  16.313  1.00 0.00 ? 64  ARG A C    2  
ATOM 2906  O O    . ARG A 1 64  ? 0.217   -9.645  15.911  1.00 0.00 ? 64  ARG A O    2  
ATOM 2907  C CB   . ARG A 1 64  ? 2.330   -9.474  18.208  1.00 0.00 ? 64  ARG A CB   2  
ATOM 2908  C CG   . ARG A 1 64  ? 2.810   -9.284  19.662  1.00 0.00 ? 64  ARG A CG   2  
ATOM 2909  C CD   . ARG A 1 64  ? 3.327   -10.595 20.273  1.00 0.00 ? 64  ARG A CD   2  
ATOM 2910  N NE   . ARG A 1 64  ? 2.216   -11.547 20.435  1.00 0.00 ? 64  ARG A NE   2  
ATOM 2911  C CZ   . ARG A 1 64  ? 2.264   -12.848 20.666  1.00 0.00 ? 64  ARG A CZ   2  
ATOM 2912  N NH1  . ARG A 1 64  ? 3.389   -13.498 20.881  1.00 0.00 ? 64  ARG A NH1  2  
ATOM 2913  N NH2  . ARG A 1 64  ? 1.120   -13.489 20.669  1.00 0.00 ? 64  ARG A NH2  2  
ATOM 2914  H H    . ARG A 1 64  ? -0.063  -9.722  19.037  1.00 0.00 ? 64  ARG A H    2  
ATOM 2915  H HA   . ARG A 1 64  ? 1.522   -7.492  17.992  1.00 0.00 ? 64  ARG A HA   2  
ATOM 2916  H HB2  . ARG A 1 64  ? 1.972   -10.493 18.059  1.00 0.00 ? 64  ARG A HB2  2  
ATOM 2917  H HB3  . ARG A 1 64  ? 3.182   -9.324  17.543  1.00 0.00 ? 64  ARG A HB3  2  
ATOM 2918  H HG2  . ARG A 1 64  ? 3.607   -8.541  19.676  1.00 0.00 ? 64  ARG A HG2  2  
ATOM 2919  H HG3  . ARG A 1 64  ? 1.999   -8.915  20.288  1.00 0.00 ? 64  ARG A HG3  2  
ATOM 2920  H HD2  . ARG A 1 64  ? 4.100   -11.017 19.628  1.00 0.00 ? 64  ARG A HD2  2  
ATOM 2921  H HD3  . ARG A 1 64  ? 3.761   -10.382 21.253  1.00 0.00 ? 64  ARG A HD3  2  
ATOM 2922  H HE   . ARG A 1 64  ? 1.273   -11.185 20.298  1.00 0.00 ? 64  ARG A HE   2  
ATOM 2923  H HH11 . ARG A 1 64  ? 4.267   -13.000 20.893  1.00 0.00 ? 64  ARG A HH11 2  
ATOM 2924  H HH12 . ARG A 1 64  ? 3.386   -14.492 21.047  1.00 0.00 ? 64  ARG A HH12 2  
ATOM 2925  H HH21 . ARG A 1 64  ? 0.284   -12.940 20.464  1.00 0.00 ? 64  ARG A HH21 2  
ATOM 2926  H HH22 . ARG A 1 64  ? 1.068   -14.485 20.808  1.00 0.00 ? 64  ARG A HH22 2  
ATOM 2927  N N    . LEU A 1 65  ? 1.416   -7.797  15.470  1.00 0.00 ? 65  LEU A N    2  
ATOM 2928  C CA   . LEU A 1 65  ? 1.268   -7.852  14.010  1.00 0.00 ? 65  LEU A CA   2  
ATOM 2929  C C    . LEU A 1 65  ? 1.695   -9.221  13.469  1.00 0.00 ? 65  LEU A C    2  
ATOM 2930  O O    . LEU A 1 65  ? 0.874   -9.914  12.876  1.00 0.00 ? 65  LEU A O    2  
ATOM 2931  C CB   . LEU A 1 65  ? 2.082   -6.695  13.388  1.00 0.00 ? 65  LEU A CB   2  
ATOM 2932  C CG   . LEU A 1 65  ? 2.082   -6.656  11.844  1.00 0.00 ? 65  LEU A CG   2  
ATOM 2933  C CD1  . LEU A 1 65  ? 0.681   -6.396  11.273  1.00 0.00 ? 65  LEU A CD1  2  
ATOM 2934  C CD2  . LEU A 1 65  ? 3.044   -5.563  11.370  1.00 0.00 ? 65  LEU A CD2  2  
ATOM 2935  H H    . LEU A 1 65  ? 1.994   -7.063  15.867  1.00 0.00 ? 65  LEU A H    2  
ATOM 2936  H HA   . LEU A 1 65  ? 0.211   -7.723  13.762  1.00 0.00 ? 65  LEU A HA   2  
ATOM 2937  H HB2  . LEU A 1 65  ? 1.689   -5.747  13.765  1.00 0.00 ? 65  LEU A HB2  2  
ATOM 2938  H HB3  . LEU A 1 65  ? 3.118   -6.775  13.726  1.00 0.00 ? 65  LEU A HB3  2  
ATOM 2939  H HG   . LEU A 1 65  ? 2.445   -7.608  11.456  1.00 0.00 ? 65  LEU A HG   2  
ATOM 2940  H HD11 . LEU A 1 65  ? 0.718   -6.403  10.184  1.00 0.00 ? 65  LEU A HD11 2  
ATOM 2941  H HD12 . LEU A 1 65  ? -0.014  -7.172  11.596  1.00 0.00 ? 65  LEU A HD12 2  
ATOM 2942  H HD13 . LEU A 1 65  ? 0.318   -5.425  11.611  1.00 0.00 ? 65  LEU A HD13 2  
ATOM 2943  H HD21 . LEU A 1 65  ? 4.047   -5.760  11.741  1.00 0.00 ? 65  LEU A HD21 2  
ATOM 2944  H HD22 . LEU A 1 65  ? 3.073   -5.540  10.280  1.00 0.00 ? 65  LEU A HD22 2  
ATOM 2945  H HD23 . LEU A 1 65  ? 2.710   -4.597  11.743  1.00 0.00 ? 65  LEU A HD23 2  
ATOM 2946  N N    . GLU A 1 66  ? 2.937   -9.634  13.738  1.00 0.00 ? 66  GLU A N    2  
ATOM 2947  C CA   . GLU A 1 66  ? 3.507   -10.900 13.249  1.00 0.00 ? 66  GLU A CA   2  
ATOM 2948  C C    . GLU A 1 66  ? 2.795   -12.160 13.778  1.00 0.00 ? 66  GLU A C    2  
ATOM 2949  O O    . GLU A 1 66  ? 2.852   -13.201 13.128  1.00 0.00 ? 66  GLU A O    2  
ATOM 2950  C CB   . GLU A 1 66  ? 5.018   -10.950 13.543  1.00 0.00 ? 66  GLU A CB   2  
ATOM 2951  C CG   . GLU A 1 66  ? 5.372   -11.017 15.036  1.00 0.00 ? 66  GLU A CG   2  
ATOM 2952  C CD   . GLU A 1 66  ? 6.894   -11.030 15.238  1.00 0.00 ? 66  GLU A CD   2  
ATOM 2953  O OE1  . GLU A 1 66  ? 7.499   -12.128 15.243  1.00 0.00 ? 66  GLU A OE1  2  
ATOM 2954  O OE2  . GLU A 1 66  ? 7.499   -9.945  15.396  1.00 0.00 ? 66  GLU A OE2  2  
ATOM 2955  H H    . GLU A 1 66  ? 3.555   -8.999  14.230  1.00 0.00 ? 66  GLU A H    2  
ATOM 2956  H HA   . GLU A 1 66  ? 3.386   -10.919 12.162  1.00 0.00 ? 66  GLU A HA   2  
ATOM 2957  H HB2  . GLU A 1 66  ? 5.438   -11.825 13.045  1.00 0.00 ? 66  GLU A HB2  2  
ATOM 2958  H HB3  . GLU A 1 66  ? 5.490   -10.069 13.104  1.00 0.00 ? 66  GLU A HB3  2  
ATOM 2959  H HG2  . GLU A 1 66  ? 4.947   -10.159 15.558  1.00 0.00 ? 66  GLU A HG2  2  
ATOM 2960  H HG3  . GLU A 1 66  ? 4.948   -11.922 15.473  1.00 0.00 ? 66  GLU A HG3  2  
ATOM 2961  N N    . ASP A 1 67  ? 2.078   -12.080 14.908  1.00 0.00 ? 67  ASP A N    2  
ATOM 2962  C CA   . ASP A 1 67  ? 1.210   -13.174 15.364  1.00 0.00 ? 67  ASP A CA   2  
ATOM 2963  C C    . ASP A 1 67  ? -0.049  -13.278 14.485  1.00 0.00 ? 67  ASP A C    2  
ATOM 2964  O O    . ASP A 1 67  ? -0.429  -14.380 14.085  1.00 0.00 ? 67  ASP A O    2  
ATOM 2965  C CB   . ASP A 1 67  ? 0.851   -12.979 16.843  1.00 0.00 ? 67  ASP A CB   2  
ATOM 2966  C CG   . ASP A 1 67  ? 0.045   -14.173 17.379  1.00 0.00 ? 67  ASP A CG   2  
ATOM 2967  O OD1  . ASP A 1 67  ? 0.672   -15.189 17.763  1.00 0.00 ? 67  ASP A OD1  2  
ATOM 2968  O OD2  . ASP A 1 67  ? -1.205  -14.092 17.412  1.00 0.00 ? 67  ASP A OD2  2  
ATOM 2969  H H    . ASP A 1 67  ? 2.074   -11.216 15.429  1.00 0.00 ? 67  ASP A H    2  
ATOM 2970  H HA   . ASP A 1 67  ? 1.754   -14.117 15.279  1.00 0.00 ? 67  ASP A HA   2  
ATOM 2971  H HB2  . ASP A 1 67  ? 1.772   -12.877 17.420  1.00 0.00 ? 67  ASP A HB2  2  
ATOM 2972  H HB3  . ASP A 1 67  ? 0.277   -12.062 16.959  1.00 0.00 ? 67  ASP A HB3  2  
ATOM 2973  N N    . VAL A 1 68  ? -0.649  -12.134 14.124  1.00 0.00 ? 68  VAL A N    2  
ATOM 2974  C CA   . VAL A 1 68  ? -1.785  -12.069 13.190  1.00 0.00 ? 68  VAL A CA   2  
ATOM 2975  C C    . VAL A 1 68  ? -1.346  -12.452 11.765  1.00 0.00 ? 68  VAL A C    2  
ATOM 2976  O O    . VAL A 1 68  ? -1.923  -13.368 11.179  1.00 0.00 ? 68  VAL A O    2  
ATOM 2977  C CB   . VAL A 1 68  ? -2.491  -10.690 13.219  1.00 0.00 ? 68  VAL A CB   2  
ATOM 2978  C CG1  . VAL A 1 68  ? -3.627  -10.597 12.185  1.00 0.00 ? 68  VAL A CG1  2  
ATOM 2979  C CG2  . VAL A 1 68  ? -3.081  -10.408 14.613  1.00 0.00 ? 68  VAL A CG2  2  
ATOM 2980  H H    . VAL A 1 68  ? -0.289  -11.273 14.525  1.00 0.00 ? 68  VAL A H    2  
ATOM 2981  H HA   . VAL A 1 68  ? -2.508  -12.808 13.529  1.00 0.00 ? 68  VAL A HA   2  
ATOM 2982  H HB   . VAL A 1 68  ? -1.761  -9.912  12.992  1.00 0.00 ? 68  VAL A HB   2  
ATOM 2983  H HG11 . VAL A 1 68  ? -4.359  -11.386 12.353  1.00 0.00 ? 68  VAL A HG11 2  
ATOM 2984  H HG12 . VAL A 1 68  ? -4.121  -9.627  12.269  1.00 0.00 ? 68  VAL A HG12 2  
ATOM 2985  H HG13 . VAL A 1 68  ? -3.227  -10.680 11.173  1.00 0.00 ? 68  VAL A HG13 2  
ATOM 2986  H HG21 . VAL A 1 68  ? -2.286  -10.336 15.352  1.00 0.00 ? 68  VAL A HG21 2  
ATOM 2987  H HG22 . VAL A 1 68  ? -3.629  -9.466  14.604  1.00 0.00 ? 68  VAL A HG22 2  
ATOM 2988  H HG23 . VAL A 1 68  ? -3.763  -11.208 14.901  1.00 0.00 ? 68  VAL A HG23 2  
ATOM 2989  N N    . VAL A 1 69  ? -0.321  -11.793 11.204  1.00 0.00 ? 69  VAL A N    2  
ATOM 2990  C CA   . VAL A 1 69  ? 0.112   -11.998 9.815   1.00 0.00 ? 69  VAL A CA   2  
ATOM 2991  C C    . VAL A 1 69  ? 0.971   -13.257 9.598   1.00 0.00 ? 69  VAL A C    2  
ATOM 2992  O O    . VAL A 1 69  ? 1.264   -13.614 8.457   1.00 0.00 ? 69  VAL A O    2  
ATOM 2993  C CB   . VAL A 1 69  ? 0.803   -10.748 9.231   1.00 0.00 ? 69  VAL A CB   2  
ATOM 2994  C CG1  . VAL A 1 69  ? -0.127  -9.525  9.261   1.00 0.00 ? 69  VAL A CG1  2  
ATOM 2995  C CG2  . VAL A 1 69  ? 2.176   -10.386 9.806   1.00 0.00 ? 69  VAL A CG2  2  
ATOM 2996  H H    . VAL A 1 69  ? 0.142   -11.046 11.720  1.00 0.00 ? 69  VAL A H    2  
ATOM 2997  H HA   . VAL A 1 69  ? -0.800  -12.143 9.233   1.00 0.00 ? 69  VAL A HA   2  
ATOM 2998  H HB   . VAL A 1 69  ? 0.992   -10.989 8.205   1.00 0.00 ? 69  VAL A HB   2  
ATOM 2999  H HG11 . VAL A 1 69  ? -0.334  -9.227  10.290  1.00 0.00 ? 69  VAL A HG11 2  
ATOM 3000  H HG12 . VAL A 1 69  ? 0.339   -8.692  8.738   1.00 0.00 ? 69  VAL A HG12 2  
ATOM 3001  H HG13 . VAL A 1 69  ? -1.074  -9.765  8.773   1.00 0.00 ? 69  VAL A HG13 2  
ATOM 3002  H HG21 . VAL A 1 69  ? 2.807   -11.271 9.889   1.00 0.00 ? 69  VAL A HG21 2  
ATOM 3003  H HG22 . VAL A 1 69  ? 2.666   -9.673  9.144   1.00 0.00 ? 69  VAL A HG22 2  
ATOM 3004  H HG23 . VAL A 1 69  ? 2.066   -9.920  10.777  1.00 0.00 ? 69  VAL A HG23 2  
ATOM 3005  N N    . GLY A 1 70  ? 1.355   -13.959 10.674  1.00 0.00 ? 70  GLY A N    2  
ATOM 3006  C CA   . GLY A 1 70  ? 2.018   -15.266 10.610  1.00 0.00 ? 70  GLY A CA   2  
ATOM 3007  C C    . GLY A 1 70  ? 1.048   -16.422 10.343  1.00 0.00 ? 70  GLY A C    2  
ATOM 3008  O O    . GLY A 1 70  ? 1.442   -17.420 9.737   1.00 0.00 ? 70  GLY A O    2  
ATOM 3009  H H    . GLY A 1 70  ? 1.178   -13.575 11.594  1.00 0.00 ? 70  GLY A H    2  
ATOM 3010  H HA2  . GLY A 1 70  ? 2.767   -15.264 9.814   1.00 0.00 ? 70  GLY A HA2  2  
ATOM 3011  H HA3  . GLY A 1 70  ? 2.502   -15.460 11.569  1.00 0.00 ? 70  GLY A HA3  2  
ATOM 3012  N N    . GLY A 1 71  ? -0.220  -16.279 10.760  1.00 0.00 ? 71  GLY A N    2  
ATOM 3013  C CA   . GLY A 1 71  ? -1.289  -17.266 10.539  1.00 0.00 ? 71  GLY A CA   2  
ATOM 3014  C C    . GLY A 1 71  ? -2.247  -16.928 9.390   1.00 0.00 ? 71  GLY A C    2  
ATOM 3015  O O    . GLY A 1 71  ? -2.961  -17.817 8.928   1.00 0.00 ? 71  GLY A O    2  
ATOM 3016  H H    . GLY A 1 71  ? -0.445  -15.451 11.297  1.00 0.00 ? 71  GLY A H    2  
ATOM 3017  H HA2  . GLY A 1 71  ? -0.864  -18.249 10.341  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 3018  H HA3  . GLY A 1 71  ? -1.896  -17.317 11.442  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 3019  N N    . CYS A 1 72  ? -2.278  -15.669 8.934   1.00 0.00 ? 72  CYS A N    2  
ATOM 3020  C CA   . CYS A 1 72  ? -3.234  -15.148 7.947   1.00 0.00 ? 72  CYS A CA   2  
ATOM 3021  C C    . CYS A 1 72  ? -2.542  -14.375 6.810   1.00 0.00 ? 72  CYS A C    2  
ATOM 3022  O O    . CYS A 1 72  ? -1.535  -13.700 7.034   1.00 0.00 ? 72  CYS A O    2  
ATOM 3023  C CB   . CYS A 1 72  ? -4.198  -14.183 8.660   1.00 0.00 ? 72  CYS A CB   2  
ATOM 3024  S SG   . CYS A 1 72  ? -5.133  -15.012 9.980   1.00 0.00 ? 72  CYS A SG   2  
ATOM 3025  H H    . CYS A 1 72  ? -1.643  -15.002 9.349   1.00 0.00 ? 72  CYS A H    2  
ATOM 3026  H HA   . CYS A 1 72  ? -3.809  -15.964 7.504   1.00 0.00 ? 72  CYS A HA   2  
ATOM 3027  H HB2  . CYS A 1 72  ? -3.629  -13.345 9.073   1.00 0.00 ? 72  CYS A HB2  2  
ATOM 3028  H HB3  . CYS A 1 72  ? -4.899  -13.780 7.925   1.00 0.00 ? 72  CYS A HB3  2  
ATOM 3029  H HG   . CYS A 1 72  ? -4.090  -15.237 10.792  1.00 0.00 ? 72  CYS A HG   2  
ATOM 3030  N N    . CYS A 1 73  ? -3.118  -14.415 5.601   1.00 0.00 ? 73  CYS A N    2  
ATOM 3031  C CA   . CYS A 1 73  ? -2.707  -13.544 4.489   1.00 0.00 ? 73  CYS A CA   2  
ATOM 3032  C C    . CYS A 1 73  ? -3.269  -12.122 4.714   1.00 0.00 ? 73  CYS A C    2  
ATOM 3033  O O    . CYS A 1 73  ? -4.249  -11.952 5.445   1.00 0.00 ? 73  CYS A O    2  
ATOM 3034  C CB   . CYS A 1 73  ? -3.153  -14.153 3.144   1.00 0.00 ? 73  CYS A CB   2  
ATOM 3035  S SG   . CYS A 1 73  ? -2.461  -15.823 2.936   1.00 0.00 ? 73  CYS A SG   2  
ATOM 3036  H H    . CYS A 1 73  ? -3.943  -14.982 5.482   1.00 0.00 ? 73  CYS A H    2  
ATOM 3037  H HA   . CYS A 1 73  ? -1.617  -13.466 4.483   1.00 0.00 ? 73  CYS A HA   2  
ATOM 3038  H HB2  . CYS A 1 73  ? -4.241  -14.205 3.089   1.00 0.00 ? 73  CYS A HB2  2  
ATOM 3039  H HB3  . CYS A 1 73  ? -2.808  -13.519 2.322   1.00 0.00 ? 73  CYS A HB3  2  
ATOM 3040  H HG   . CYS A 1 73  ? -1.164  -15.482 2.968   1.00 0.00 ? 73  CYS A HG   2  
ATOM 3041  N N    . TYR A 1 74  ? -2.667  -11.093 4.109   1.00 0.00 ? 74  TYR A N    2  
ATOM 3042  C CA   . TYR A 1 74  ? -2.995  -9.691  4.431   1.00 0.00 ? 74  TYR A CA   2  
ATOM 3043  C C    . TYR A 1 74  ? -2.642  -8.664  3.338   1.00 0.00 ? 74  TYR A C    2  
ATOM 3044  O O    . TYR A 1 74  ? -1.962  -9.012  2.370   1.00 0.00 ? 74  TYR A O    2  
ATOM 3045  C CB   . TYR A 1 74  ? -2.338  -9.314  5.779   1.00 0.00 ? 74  TYR A CB   2  
ATOM 3046  C CG   . TYR A 1 74  ? -0.833  -9.107  5.740   1.00 0.00 ? 74  TYR A CG   2  
ATOM 3047  C CD1  . TYR A 1 74  ? 0.035   -10.217 5.710   1.00 0.00 ? 74  TYR A CD1  2  
ATOM 3048  C CD2  . TYR A 1 74  ? -0.295  -7.804  5.751   1.00 0.00 ? 74  TYR A CD2  2  
ATOM 3049  C CE1  . TYR A 1 74  ? 1.431   -10.027 5.694   1.00 0.00 ? 74  TYR A CE1  2  
ATOM 3050  C CE2  . TYR A 1 74  ? 1.098   -7.608  5.752   1.00 0.00 ? 74  TYR A CE2  2  
ATOM 3051  C CZ   . TYR A 1 74  ? 1.966   -8.722  5.727   1.00 0.00 ? 74  TYR A CZ   2  
ATOM 3052  O OH   . TYR A 1 74  ? 3.312   -8.536  5.704   1.00 0.00 ? 74  TYR A OH   2  
ATOM 3053  H H    . TYR A 1 74  ? -1.892  -11.271 3.481   1.00 0.00 ? 74  TYR A H    2  
ATOM 3054  H HA   . TYR A 1 74  ? -4.073  -9.646  4.562   1.00 0.00 ? 74  TYR A HA   2  
ATOM 3055  H HB2  . TYR A 1 74  ? -2.799  -8.397  6.139   1.00 0.00 ? 74  TYR A HB2  2  
ATOM 3056  H HB3  . TYR A 1 74  ? -2.563  -10.079 6.524   1.00 0.00 ? 74  TYR A HB3  2  
ATOM 3057  H HD1  . TYR A 1 74  ? -0.368  -11.219 5.717   1.00 0.00 ? 74  TYR A HD1  2  
ATOM 3058  H HD2  . TYR A 1 74  ? -0.948  -6.945  5.772   1.00 0.00 ? 74  TYR A HD2  2  
ATOM 3059  H HE1  . TYR A 1 74  ? 2.095   -10.881 5.670   1.00 0.00 ? 74  TYR A HE1  2  
ATOM 3060  H HE2  . TYR A 1 74  ? 1.505   -6.607  5.770   1.00 0.00 ? 74  TYR A HE2  2  
ATOM 3061  H HH   . TYR A 1 74  ? 3.556   -7.598  5.645   1.00 0.00 ? 74  TYR A HH   2  
ATOM 3062  N N    . ARG A 1 75  ? -3.069  -7.399  3.531   1.00 0.00 ? 75  ARG A N    2  
ATOM 3063  C CA   . ARG A 1 75  ? -2.705  -6.179  2.763   1.00 0.00 ? 75  ARG A CA   2  
ATOM 3064  C C    . ARG A 1 75  ? -3.311  -4.898  3.371   1.00 0.00 ? 75  ARG A C    2  
ATOM 3065  O O    . ARG A 1 75  ? -4.326  -4.977  4.054   1.00 0.00 ? 75  ARG A O    2  
ATOM 3066  C CB   . ARG A 1 75  ? -2.977  -6.276  1.239   1.00 0.00 ? 75  ARG A CB   2  
ATOM 3067  C CG   . ARG A 1 75  ? -4.447  -6.282  0.800   1.00 0.00 ? 75  ARG A CG   2  
ATOM 3068  C CD   . ARG A 1 75  ? -5.179  -7.552  1.233   1.00 0.00 ? 75  ARG A CD   2  
ATOM 3069  N NE   . ARG A 1 75  ? -6.540  -7.598  0.677   1.00 0.00 ? 75  ARG A NE   2  
ATOM 3070  C CZ   . ARG A 1 75  ? -6.956  -8.162  -0.449  1.00 0.00 ? 75  ARG A CZ   2  
ATOM 3071  N NH1  . ARG A 1 75  ? -6.154  -8.779  -1.292  1.00 0.00 ? 75  ARG A NH1  2  
ATOM 3072  N NH2  . ARG A 1 75  ? -8.237  -8.089  -0.717  1.00 0.00 ? 75  ARG A NH2  2  
ATOM 3073  H H    . ARG A 1 75  ? -3.695  -7.260  4.321   1.00 0.00 ? 75  ARG A H    2  
ATOM 3074  H HA   . ARG A 1 75  ? -1.630  -6.091  2.859   1.00 0.00 ? 75  ARG A HA   2  
ATOM 3075  H HB2  . ARG A 1 75  ? -2.505  -5.417  0.761   1.00 0.00 ? 75  ARG A HB2  2  
ATOM 3076  H HB3  . ARG A 1 75  ? -2.483  -7.153  0.823   1.00 0.00 ? 75  ARG A HB3  2  
ATOM 3077  H HG2  . ARG A 1 75  ? -4.956  -5.407  1.208   1.00 0.00 ? 75  ARG A HG2  2  
ATOM 3078  H HG3  . ARG A 1 75  ? -4.475  -6.219  -0.288  1.00 0.00 ? 75  ARG A HG3  2  
ATOM 3079  H HD2  . ARG A 1 75  ? -4.600  -8.422  0.920   1.00 0.00 ? 75  ARG A HD2  2  
ATOM 3080  H HD3  . ARG A 1 75  ? -5.244  -7.556  2.319   1.00 0.00 ? 75  ARG A HD3  2  
ATOM 3081  H HE   . ARG A 1 75  ? -7.275  -7.130  1.207   1.00 0.00 ? 75  ARG A HE   2  
ATOM 3082  H HH11 . ARG A 1 75  ? -5.164  -8.830  -1.115  1.00 0.00 ? 75  ARG A HH11 2  
ATOM 3083  H HH12 . ARG A 1 75  ? -6.525  -9.195  -2.131  1.00 0.00 ? 75  ARG A HH12 2  
ATOM 3084  H HH21 . ARG A 1 75  ? -8.830  -7.609  -0.037  1.00 0.00 ? 75  ARG A HH21 2  
ATOM 3085  H HH22 . ARG A 1 75  ? -8.635  -8.484  -1.554  1.00 0.00 ? 75  ARG A HH22 2  
ATOM 3086  N N    . VAL A 1 76  ? -2.717  -3.728  3.134   1.00 0.00 ? 76  VAL A N    2  
ATOM 3087  C CA   . VAL A 1 76  ? -3.219  -2.417  3.630   1.00 0.00 ? 76  VAL A CA   2  
ATOM 3088  C C    . VAL A 1 76  ? -4.406  -1.928  2.787   1.00 0.00 ? 76  VAL A C    2  
ATOM 3089  O O    . VAL A 1 76  ? -4.451  -2.180  1.581   1.00 0.00 ? 76  VAL A O    2  
ATOM 3090  C CB   . VAL A 1 76  ? -2.084  -1.363  3.671   1.00 0.00 ? 76  VAL A CB   2  
ATOM 3091  C CG1  . VAL A 1 76  ? -2.575  0.072   3.931   1.00 0.00 ? 76  VAL A CG1  2  
ATOM 3092  C CG2  . VAL A 1 76  ? -1.088  -1.747  4.778   1.00 0.00 ? 76  VAL A CG2  2  
ATOM 3093  H H    . VAL A 1 76  ? -1.908  -3.733  2.522   1.00 0.00 ? 76  VAL A H    2  
ATOM 3094  H HA   . VAL A 1 76  ? -3.568  -2.552  4.653   1.00 0.00 ? 76  VAL A HA   2  
ATOM 3095  H HB   . VAL A 1 76  ? -1.564  -1.376  2.714   1.00 0.00 ? 76  VAL A HB   2  
ATOM 3096  H HG11 . VAL A 1 76  ? -3.140  0.440   3.074   1.00 0.00 ? 76  VAL A HG11 2  
ATOM 3097  H HG12 . VAL A 1 76  ? -3.213  0.101   4.815   1.00 0.00 ? 76  VAL A HG12 2  
ATOM 3098  H HG13 . VAL A 1 76  ? -1.723  0.736   4.080   1.00 0.00 ? 76  VAL A HG13 2  
ATOM 3099  H HG21 . VAL A 1 76  ? -0.700  -2.752  4.610   1.00 0.00 ? 76  VAL A HG21 2  
ATOM 3100  H HG22 . VAL A 1 76  ? -0.254  -1.046  4.776   1.00 0.00 ? 76  VAL A HG22 2  
ATOM 3101  H HG23 . VAL A 1 76  ? -1.589  -1.716  5.745   1.00 0.00 ? 76  VAL A HG23 2  
ATOM 3102  N N    . ASN A 1 77  ? -5.358  -1.224  3.418   1.00 0.00 ? 77  ASN A N    2  
ATOM 3103  C CA   . ASN A 1 77  ? -6.607  -0.783  2.786   1.00 0.00 ? 77  ASN A CA   2  
ATOM 3104  C C    . ASN A 1 77  ? -6.927  0.719   2.995   1.00 0.00 ? 77  ASN A C    2  
ATOM 3105  O O    . ASN A 1 77  ? -6.721  1.523   2.087   1.00 0.00 ? 77  ASN A O    2  
ATOM 3106  C CB   . ASN A 1 77  ? -7.707  -1.740  3.273   1.00 0.00 ? 77  ASN A CB   2  
ATOM 3107  C CG   . ASN A 1 77  ? -9.063  -1.425  2.658   1.00 0.00 ? 77  ASN A CG   2  
ATOM 3108  O OD1  . ASN A 1 77  ? -9.868  -0.729  3.255   1.00 0.00 ? 77  ASN A OD1  2  
ATOM 3109  N ND2  . ASN A 1 77  ? -9.339  -1.895  1.456   1.00 0.00 ? 77  ASN A ND2  2  
ATOM 3110  H H    . ASN A 1 77  ? -5.274  -1.095  4.424   1.00 0.00 ? 77  ASN A H    2  
ATOM 3111  H HA   . ASN A 1 77  ? -6.528  -0.911  1.710   1.00 0.00 ? 77  ASN A HA   2  
ATOM 3112  H HB2  . ASN A 1 77  ? -7.428  -2.763  3.010   1.00 0.00 ? 77  ASN A HB2  2  
ATOM 3113  H HB3  . ASN A 1 77  ? -7.792  -1.691  4.357   1.00 0.00 ? 77  ASN A HB3  2  
ATOM 3114  H HD21 . ASN A 1 77  ? -8.679  -2.483  0.964   1.00 0.00 ? 77  ASN A HD21 2  
ATOM 3115  H HD22 . ASN A 1 77  ? -10.243 -1.701  1.056   1.00 0.00 ? 77  ASN A HD22 2  
ATOM 3116  N N    . ASN A 1 78  ? -7.484  1.088   4.154   1.00 0.00 ? 78  ASN A N    2  
ATOM 3117  C CA   . ASN A 1 78  ? -8.044  2.417   4.487   1.00 0.00 ? 78  ASN A CA   2  
ATOM 3118  C C    . ASN A 1 78  ? -9.060  2.916   3.428   1.00 0.00 ? 78  ASN A C    2  
ATOM 3119  O O    . ASN A 1 78  ? -8.930  4.031   2.923   1.00 0.00 ? 78  ASN A O    2  
ATOM 3120  C CB   . ASN A 1 78  ? -6.964  3.498   4.754   1.00 0.00 ? 78  ASN A CB   2  
ATOM 3121  C CG   . ASN A 1 78  ? -5.822  3.158   5.700   1.00 0.00 ? 78  ASN A CG   2  
ATOM 3122  O OD1  . ASN A 1 78  ? -5.627  2.033   6.136   1.00 0.00 ? 78  ASN A OD1  2  
ATOM 3123  N ND2  . ASN A 1 78  ? -5.023  4.152   6.034   1.00 0.00 ? 78  ASN A ND2  2  
ATOM 3124  H H    . ASN A 1 78  ? -7.540  0.370   4.860   1.00 0.00 ? 78  ASN A H    2  
ATOM 3125  H HA   . ASN A 1 78  ? -8.604  2.296   5.416   1.00 0.00 ? 78  ASN A HA   2  
ATOM 3126  H HB2  . ASN A 1 78  ? -6.516  3.809   3.811   1.00 0.00 ? 78  ASN A HB2  2  
ATOM 3127  H HB3  . ASN A 1 78  ? -7.466  4.369   5.184   1.00 0.00 ? 78  ASN A HB3  2  
ATOM 3128  H HD21 . ASN A 1 78  ? -5.187  5.079   5.672   1.00 0.00 ? 78  ASN A HD21 2  
ATOM 3129  H HD22 . ASN A 1 78  ? -4.140  3.930   6.494   1.00 0.00 ? 78  ASN A HD22 2  
ATOM 3130  N N    . SER A 1 79  ? -10.042 2.102   3.037   1.00 0.00 ? 79  SER A N    2  
ATOM 3131  C CA   . SER A 1 79  ? -10.980 2.393   1.933   1.00 0.00 ? 79  SER A CA   2  
ATOM 3132  C C    . SER A 1 79  ? -11.613 3.787   2.023   1.00 0.00 ? 79  SER A C    2  
ATOM 3133  O O    . SER A 1 79  ? -11.429 4.614   1.134   1.00 0.00 ? 79  SER A O    2  
ATOM 3134  C CB   . SER A 1 79  ? -12.062 1.302   1.867   1.00 0.00 ? 79  SER A CB   2  
ATOM 3135  O OG   . SER A 1 79  ? -12.688 1.112   3.130   1.00 0.00 ? 79  SER A OG   2  
ATOM 3136  H H    . SER A 1 79  ? -10.115 1.176   3.456   1.00 0.00 ? 79  SER A H    2  
ATOM 3137  H HA   . SER A 1 79  ? -10.436 2.368   0.992   1.00 0.00 ? 79  SER A HA   2  
ATOM 3138  H HB2  . SER A 1 79  ? -12.812 1.575   1.122   1.00 0.00 ? 79  SER A HB2  2  
ATOM 3139  H HB3  . SER A 1 79  ? -11.598 0.366   1.559   1.00 0.00 ? 79  SER A HB3  2  
ATOM 3140  H HG   . SER A 1 79  ? -13.287 0.352   3.068   1.00 0.00 ? 79  SER A HG   2  
ATOM 3141  N N    . LEU A 1 80  ? -12.286 4.097   3.132   1.00 0.00 ? 80  LEU A N    2  
ATOM 3142  C CA   . LEU A 1 80  ? -12.969 5.382   3.358   1.00 0.00 ? 80  LEU A CA   2  
ATOM 3143  C C    . LEU A 1 80  ? -12.012 6.588   3.385   1.00 0.00 ? 80  LEU A C    2  
ATOM 3144  O O    . LEU A 1 80  ? -12.389 7.694   3.003   1.00 0.00 ? 80  LEU A O    2  
ATOM 3145  C CB   . LEU A 1 80  ? -13.813 5.271   4.644   1.00 0.00 ? 80  LEU A CB   2  
ATOM 3146  C CG   . LEU A 1 80  ? -15.246 4.757   4.384   1.00 0.00 ? 80  LEU A CG   2  
ATOM 3147  C CD1  . LEU A 1 80  ? -15.321 3.447   3.587   1.00 0.00 ? 80  LEU A CD1  2  
ATOM 3148  C CD2  . LEU A 1 80  ? -15.974 4.597   5.725   1.00 0.00 ? 80  LEU A CD2  2  
ATOM 3149  H H    . LEU A 1 80  ? -12.415 3.345   3.798   1.00 0.00 ? 80  LEU A H    2  
ATOM 3150  H HA   . LEU A 1 80  ? -13.643 5.562   2.521   1.00 0.00 ? 80  LEU A HA   2  
ATOM 3151  H HB2  . LEU A 1 80  ? -13.309 4.628   5.367   1.00 0.00 ? 80  LEU A HB2  2  
ATOM 3152  H HB3  . LEU A 1 80  ? -13.900 6.260   5.096   1.00 0.00 ? 80  LEU A HB3  2  
ATOM 3153  H HG   . LEU A 1 80  ? -15.770 5.513   3.806   1.00 0.00 ? 80  LEU A HG   2  
ATOM 3154  H HD11 . LEU A 1 80  ? -16.360 3.132   3.488   1.00 0.00 ? 80  LEU A HD11 2  
ATOM 3155  H HD12 . LEU A 1 80  ? -14.919 3.591   2.584   1.00 0.00 ? 80  LEU A HD12 2  
ATOM 3156  H HD13 . LEU A 1 80  ? -14.760 2.666   4.098   1.00 0.00 ? 80  LEU A HD13 2  
ATOM 3157  H HD21 . LEU A 1 80  ? -17.010 4.302   5.555   1.00 0.00 ? 80  LEU A HD21 2  
ATOM 3158  H HD22 . LEU A 1 80  ? -15.477 3.838   6.329   1.00 0.00 ? 80  LEU A HD22 2  
ATOM 3159  H HD23 . LEU A 1 80  ? -15.961 5.542   6.268   1.00 0.00 ? 80  LEU A HD23 2  
ATOM 3160  N N    . ASP A 1 81  ? -10.752 6.367   3.760   1.00 0.00 ? 81  ASP A N    2  
ATOM 3161  C CA   . ASP A 1 81  ? -9.692  7.385   3.712   1.00 0.00 ? 81  ASP A CA   2  
ATOM 3162  C C    . ASP A 1 81  ? -9.246  7.696   2.268   1.00 0.00 ? 81  ASP A C    2  
ATOM 3163  O O    . ASP A 1 81  ? -8.792  8.804   1.981   1.00 0.00 ? 81  ASP A O    2  
ATOM 3164  C CB   . ASP A 1 81  ? -8.523  6.893   4.582   1.00 0.00 ? 81  ASP A CB   2  
ATOM 3165  C CG   . ASP A 1 81  ? -7.852  7.991   5.420   1.00 0.00 ? 81  ASP A CG   2  
ATOM 3166  O OD1  . ASP A 1 81  ? -6.870  8.606   4.942   1.00 0.00 ? 81  ASP A OD1  2  
ATOM 3167  O OD2  . ASP A 1 81  ? -8.255  8.134   6.602   1.00 0.00 ? 81  ASP A OD2  2  
ATOM 3168  H H    . ASP A 1 81  ? -10.493 5.422   4.007   1.00 0.00 ? 81  ASP A H    2  
ATOM 3169  H HA   . ASP A 1 81  ? -10.095 8.308   4.125   1.00 0.00 ? 81  ASP A HA   2  
ATOM 3170  H HB2  . ASP A 1 81  ? -8.891  6.138   5.282   1.00 0.00 ? 81  ASP A HB2  2  
ATOM 3171  H HB3  . ASP A 1 81  ? -7.780  6.406   3.946   1.00 0.00 ? 81  ASP A HB3  2  
ATOM 3172  N N    . HIS A 1 82  ? -9.431  6.745   1.343   1.00 0.00 ? 82  HIS A N    2  
ATOM 3173  C CA   . HIS A 1 82  ? -9.249  6.942   -0.101  1.00 0.00 ? 82  HIS A CA   2  
ATOM 3174  C C    . HIS A 1 82  ? -10.542 7.416   -0.805  1.00 0.00 ? 82  HIS A C    2  
ATOM 3175  O O    . HIS A 1 82  ? -10.457 8.167   -1.782  1.00 0.00 ? 82  HIS A O    2  
ATOM 3176  C CB   . HIS A 1 82  ? -8.736  5.639   -0.731  1.00 0.00 ? 82  HIS A CB   2  
ATOM 3177  C CG   . HIS A 1 82  ? -7.336  5.265   -0.305  1.00 0.00 ? 82  HIS A CG   2  
ATOM 3178  N ND1  . HIS A 1 82  ? -6.980  4.639   0.866   1.00 0.00 ? 82  HIS A ND1  2  
ATOM 3179  C CD2  . HIS A 1 82  ? -6.183  5.480   -1.012  1.00 0.00 ? 82  HIS A CD2  2  
ATOM 3180  C CE1  . HIS A 1 82  ? -5.644  4.481   0.867   1.00 0.00 ? 82  HIS A CE1  2  
ATOM 3181  N NE2  . HIS A 1 82  ? -5.108  4.982   -0.262  1.00 0.00 ? 82  HIS A NE2  2  
ATOM 3182  H H    . HIS A 1 82  ? -9.833  5.867   1.652   1.00 0.00 ? 82  HIS A H    2  
ATOM 3183  H HA   . HIS A 1 82  ? -8.497  7.718   -0.270  1.00 0.00 ? 82  HIS A HA   2  
ATOM 3184  H HB2  . HIS A 1 82  ? -9.414  4.819   -0.496  1.00 0.00 ? 82  HIS A HB2  2  
ATOM 3185  H HB3  . HIS A 1 82  ? -8.739  5.760   -1.816  1.00 0.00 ? 82  HIS A HB3  2  
ATOM 3186  H HD1  . HIS A 1 82  ? -7.609  4.357   1.610   1.00 0.00 ? 82  HIS A HD1  2  
ATOM 3187  H HD2  . HIS A 1 82  ? -6.120  5.953   -1.986  1.00 0.00 ? 82  HIS A HD2  2  
ATOM 3188  H HE1  . HIS A 1 82  ? -5.083  4.010   1.668   1.00 0.00 ? 82  HIS A HE1  2  
ATOM 3189  N N    . GLU A 1 83  ? -11.727 7.024   -0.315  1.00 0.00 ? 83  GLU A N    2  
ATOM 3190  C CA   . GLU A 1 83  ? -13.021 7.528   -0.804  1.00 0.00 ? 83  GLU A CA   2  
ATOM 3191  C C    . GLU A 1 83  ? -13.190 9.030   -0.533  1.00 0.00 ? 83  GLU A C    2  
ATOM 3192  O O    . GLU A 1 83  ? -13.732 9.751   -1.375  1.00 0.00 ? 83  GLU A O    2  
ATOM 3193  C CB   . GLU A 1 83  ? -14.203 6.774   -0.175  1.00 0.00 ? 83  GLU A CB   2  
ATOM 3194  C CG   . GLU A 1 83  ? -14.333 5.310   -0.613  1.00 0.00 ? 83  GLU A CG   2  
ATOM 3195  C CD   . GLU A 1 83  ? -14.716 5.189   -2.095  1.00 0.00 ? 83  GLU A CD   2  
ATOM 3196  O OE1  . GLU A 1 83  ? -15.909 5.376   -2.433  1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3197  O OE2  . GLU A 1 83  ? -13.834 4.885   -2.933  1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3198  H H    . GLU A 1 83  ? -11.734 6.330   0.423   1.00 0.00 ? 83  GLU A H    2  
ATOM 3199  H HA   . GLU A 1 83  ? -13.065 7.377   -1.874  1.00 0.00 ? 83  GLU A HA   2  
ATOM 3200  H HB2  . GLU A 1 83  ? -14.117 6.825   0.906   1.00 0.00 ? 83  GLU A HB2  2  
ATOM 3201  H HB3  . GLU A 1 83  ? -15.125 7.286   -0.450  1.00 0.00 ? 83  GLU A HB3  2  
ATOM 3202  H HG2  . GLU A 1 83  ? -13.402 4.781   -0.426  1.00 0.00 ? 83  GLU A HG2  2  
ATOM 3203  H HG3  . GLU A 1 83  ? -15.108 4.841   -0.006  1.00 0.00 ? 83  GLU A HG3  2  
ATOM 3204  N N    . TYR A 1 84  ? -12.708 9.505   0.622   1.00 0.00 ? 84  TYR A N    2  
ATOM 3205  C CA   . TYR A 1 84  ? -12.832 10.906  1.046   1.00 0.00 ? 84  TYR A CA   2  
ATOM 3206  C C    . TYR A 1 84  ? -11.801 11.384  2.089   1.00 0.00 ? 84  TYR A C    2  
ATOM 3207  O O    . TYR A 1 84  ? -10.992 12.258  1.772   1.00 0.00 ? 84  TYR A O    2  
ATOM 3208  C CB   . TYR A 1 84  ? -14.281 11.248  1.478   1.00 0.00 ? 84  TYR A CB   2  
ATOM 3209  C CG   . TYR A 1 84  ? -15.193 10.101  1.900   1.00 0.00 ? 84  TYR A CG   2  
ATOM 3210  C CD1  . TYR A 1 84  ? -15.029 9.472   3.150   1.00 0.00 ? 84  TYR A CD1  2  
ATOM 3211  C CD2  . TYR A 1 84  ? -16.235 9.682   1.046   1.00 0.00 ? 84  TYR A CD2  2  
ATOM 3212  C CE1  . TYR A 1 84  ? -15.878 8.423   3.541   1.00 0.00 ? 84  TYR A CE1  2  
ATOM 3213  C CE2  . TYR A 1 84  ? -17.107 8.652   1.444   1.00 0.00 ? 84  TYR A CE2  2  
ATOM 3214  C CZ   . TYR A 1 84  ? -16.935 8.020   2.695   1.00 0.00 ? 84  TYR A CZ   2  
ATOM 3215  O OH   . TYR A 1 84  ? -17.806 7.045   3.083   1.00 0.00 ? 84  TYR A OH   2  
ATOM 3216  H H    . TYR A 1 84  ? -12.329 8.829   1.269   1.00 0.00 ? 84  TYR A H    2  
ATOM 3217  H HA   . TYR A 1 84  ? -12.632 11.515  0.161   1.00 0.00 ? 84  TYR A HA   2  
ATOM 3218  H HB2  . TYR A 1 84  ? -14.248 11.974  2.291   1.00 0.00 ? 84  TYR A HB2  2  
ATOM 3219  H HB3  . TYR A 1 84  ? -14.758 11.758  0.640   1.00 0.00 ? 84  TYR A HB3  2  
ATOM 3220  H HD1  . TYR A 1 84  ? -14.249 9.781   3.823   1.00 0.00 ? 84  TYR A HD1  2  
ATOM 3221  H HD2  . TYR A 1 84  ? -16.368 10.157  0.084   1.00 0.00 ? 84  TYR A HD2  2  
ATOM 3222  H HE1  . TYR A 1 84  ? -15.707 7.942   4.493   1.00 0.00 ? 84  TYR A HE1  2  
ATOM 3223  H HE2  . TYR A 1 84  ? -17.910 8.344   0.790   1.00 0.00 ? 84  TYR A HE2  2  
ATOM 3224  H HH   . TYR A 1 84  ? -17.627 6.711   3.967   1.00 0.00 ? 84  TYR A HH   2  
ATOM 3225  N N    . GLN A 1 85  ? -11.893 10.943  3.350   1.00 0.00 ? 85  GLN A N    2  
ATOM 3226  C CA   . GLN A 1 85  ? -11.520 11.826  4.470   1.00 0.00 ? 85  GLN A CA   2  
ATOM 3227  C C    . GLN A 1 85  ? -10.040 11.693  4.909   1.00 0.00 ? 85  GLN A C    2  
ATOM 3228  O O    . GLN A 1 85  ? -9.606  10.580  5.202   1.00 0.00 ? 85  GLN A O    2  
ATOM 3229  C CB   . GLN A 1 85  ? -12.520 11.678  5.644   1.00 0.00 ? 85  GLN A CB   2  
ATOM 3230  C CG   . GLN A 1 85  ? -12.204 10.663  6.758   1.00 0.00 ? 85  GLN A CG   2  
ATOM 3231  C CD   . GLN A 1 85  ? -12.306 9.185   6.389   1.00 0.00 ? 85  GLN A CD   2  
ATOM 3232  O OE1  . GLN A 1 85  ? -13.389 8.653   6.200   1.00 0.00 ? 85  GLN A OE1  2  
ATOM 3233  N NE2  . GLN A 1 85  ? -11.210 8.457   6.328   1.00 0.00 ? 85  GLN A NE2  2  
ATOM 3234  H H    . GLN A 1 85  ? -12.450 10.118  3.532   1.00 0.00 ? 85  GLN A H    2  
ATOM 3235  H HA   . GLN A 1 85  ? -11.671 12.847  4.113   1.00 0.00 ? 85  GLN A HA   2  
ATOM 3236  H HB2  . GLN A 1 85  ? -12.568 12.651  6.133   1.00 0.00 ? 85  GLN A HB2  2  
ATOM 3237  H HB3  . GLN A 1 85  ? -13.523 11.485  5.255   1.00 0.00 ? 85  GLN A HB3  2  
ATOM 3238  H HG2  . GLN A 1 85  ? -11.215 10.873  7.145   1.00 0.00 ? 85  GLN A HG2  2  
ATOM 3239  H HG3  . GLN A 1 85  ? -12.895 10.831  7.580   1.00 0.00 ? 85  GLN A HG3  2  
ATOM 3240  H HE21 . GLN A 1 85  ? -10.281 8.881   6.375   1.00 0.00 ? 85  GLN A HE21 2  
ATOM 3241  H HE22 . GLN A 1 85  ? -11.294 7.509   6.006   1.00 0.00 ? 85  GLN A HE22 2  
ATOM 3242  N N    . PRO A 1 86  ? -9.273  12.796  5.047   1.00 0.00 ? 86  PRO A N    2  
ATOM 3243  C CA   . PRO A 1 86  ? -7.936  12.791  5.641   1.00 0.00 ? 86  PRO A CA   2  
ATOM 3244  C C    . PRO A 1 86  ? -8.027  12.925  7.175   1.00 0.00 ? 86  PRO A C    2  
ATOM 3245  O O    . PRO A 1 86  ? -7.646  13.942  7.759   1.00 0.00 ? 86  PRO A O    2  
ATOM 3246  C CB   . PRO A 1 86  ? -7.216  13.965  4.964   1.00 0.00 ? 86  PRO A CB   2  
ATOM 3247  C CG   . PRO A 1 86  ? -8.338  14.995  4.813   1.00 0.00 ? 86  PRO A CG   2  
ATOM 3248  C CD   . PRO A 1 86  ? -9.571  14.131  4.532   1.00 0.00 ? 86  PRO A CD   2  
ATOM 3249  H HA   . PRO A 1 86  ? -7.409  11.868  5.401   1.00 0.00 ? 86  PRO A HA   2  
ATOM 3250  H HB2  . PRO A 1 86  ? -6.379  14.341  5.554   1.00 0.00 ? 86  PRO A HB2  2  
ATOM 3251  H HB3  . PRO A 1 86  ? -6.866  13.655  3.980   1.00 0.00 ? 86  PRO A HB3  2  
ATOM 3252  H HG2  . PRO A 1 86  ? -8.477  15.532  5.752   1.00 0.00 ? 86  PRO A HG2  2  
ATOM 3253  H HG3  . PRO A 1 86  ? -8.140  15.691  3.999   1.00 0.00 ? 86  PRO A HG3  2  
ATOM 3254  H HD2  . PRO A 1 86  ? -10.445 14.560  5.023   1.00 0.00 ? 86  PRO A HD2  2  
ATOM 3255  H HD3  . PRO A 1 86  ? -9.735  14.079  3.454   1.00 0.00 ? 86  PRO A HD3  2  
ATOM 3256  N N    . ARG A 1 87  ? -8.570  11.899  7.845   1.00 0.00 ? 87  ARG A N    2  
ATOM 3257  C CA   . ARG A 1 87  ? -8.762  11.903  9.306   1.00 0.00 ? 87  ARG A CA   2  
ATOM 3258  C C    . ARG A 1 87  ? -7.401  11.901  10.050  1.00 0.00 ? 87  ARG A C    2  
ATOM 3259  O O    . ARG A 1 87  ? -6.517  11.132  9.654   1.00 0.00 ? 87  ARG A O    2  
ATOM 3260  C CB   . ARG A 1 87  ? -9.656  10.715  9.723   1.00 0.00 ? 87  ARG A CB   2  
ATOM 3261  C CG   . ARG A 1 87  ? -10.090 10.828  11.199  1.00 0.00 ? 87  ARG A CG   2  
ATOM 3262  C CD   . ARG A 1 87  ? -11.203 9.876   11.662  1.00 0.00 ? 87  ARG A CD   2  
ATOM 3263  N NE   . ARG A 1 87  ? -11.726 10.351  12.963  1.00 0.00 ? 87  ARG A NE   2  
ATOM 3264  C CZ   . ARG A 1 87  ? -12.051 9.666   14.054  1.00 0.00 ? 87  ARG A CZ   2  
ATOM 3265  N NH1  . ARG A 1 87  ? -11.966 8.356   14.142  1.00 0.00 ? 87  ARG A NH1  2  
ATOM 3266  N NH2  . ARG A 1 87  ? -12.498 10.317  15.105  1.00 0.00 ? 87  ARG A NH2  2  
ATOM 3267  H H    . ARG A 1 87  ? -8.817  11.068  7.318   1.00 0.00 ? 87  ARG A H    2  
ATOM 3268  H HA   . ARG A 1 87  ? -9.296  12.825  9.541   1.00 0.00 ? 87  ARG A HA   2  
ATOM 3269  H HB2  . ARG A 1 87  ? -10.559 10.718  9.120   1.00 0.00 ? 87  ARG A HB2  2  
ATOM 3270  H HB3  . ARG A 1 87  ? -9.137  9.778   9.516   1.00 0.00 ? 87  ARG A HB3  2  
ATOM 3271  H HG2  . ARG A 1 87  ? -9.223  10.696  11.848  1.00 0.00 ? 87  ARG A HG2  2  
ATOM 3272  H HG3  . ARG A 1 87  ? -10.477 11.833  11.343  1.00 0.00 ? 87  ARG A HG3  2  
ATOM 3273  H HD2  . ARG A 1 87  ? -12.016 9.890   10.933  1.00 0.00 ? 87  ARG A HD2  2  
ATOM 3274  H HD3  . ARG A 1 87  ? -10.811 8.863   11.727  1.00 0.00 ? 87  ARG A HD3  2  
ATOM 3275  H HE   . ARG A 1 87  ? -11.843 11.353  13.034  1.00 0.00 ? 87  ARG A HE   2  
ATOM 3276  H HH11 . ARG A 1 87  ? -11.625 7.787   13.385  1.00 0.00 ? 87  ARG A HH11 2  
ATOM 3277  H HH12 . ARG A 1 87  ? -12.226 7.883   14.996  1.00 0.00 ? 87  ARG A HH12 2  
ATOM 3278  H HH21 . ARG A 1 87  ? -12.589 11.324  15.097  1.00 0.00 ? 87  ARG A HH21 2  
ATOM 3279  H HH22 . ARG A 1 87  ? -12.780 9.826   15.944  1.00 0.00 ? 87  ARG A HH22 2  
ATOM 3280  N N    . PRO A 1 88  ? -7.220  12.699  11.131  1.00 0.00 ? 88  PRO A N    2  
ATOM 3281  C CA   . PRO A 1 88  ? -6.016  12.656  11.967  1.00 0.00 ? 88  PRO A CA   2  
ATOM 3282  C C    . PRO A 1 88  ? -5.874  11.282  12.624  1.00 0.00 ? 88  PRO A C    2  
ATOM 3283  O O    . PRO A 1 88  ? -6.772  10.815  13.326  1.00 0.00 ? 88  PRO A O    2  
ATOM 3284  C CB   . PRO A 1 88  ? -6.166  13.774  13.003  1.00 0.00 ? 88  PRO A CB   2  
ATOM 3285  C CG   . PRO A 1 88  ? -7.681  13.941  13.102  1.00 0.00 ? 88  PRO A CG   2  
ATOM 3286  C CD   . PRO A 1 88  ? -8.118  13.721  11.657  1.00 0.00 ? 88  PRO A CD   2  
ATOM 3287  H HA   . PRO A 1 88  ? -5.137  12.868  11.358  1.00 0.00 ? 88  PRO A HA   2  
ATOM 3288  H HB2  . PRO A 1 88  ? -5.722  13.514  13.966  1.00 0.00 ? 88  PRO A HB2  2  
ATOM 3289  H HB3  . PRO A 1 88  ? -5.724  14.693  12.613  1.00 0.00 ? 88  PRO A HB3  2  
ATOM 3290  H HG2  . PRO A 1 88  ? -8.099  13.152  13.728  1.00 0.00 ? 88  PRO A HG2  2  
ATOM 3291  H HG3  . PRO A 1 88  ? -7.962  14.926  13.473  1.00 0.00 ? 88  PRO A HG3  2  
ATOM 3292  H HD2  . PRO A 1 88  ? -9.161  13.428  11.637  1.00 0.00 ? 88  PRO A HD2  2  
ATOM 3293  H HD3  . PRO A 1 88  ? -7.986  14.643  11.087  1.00 0.00 ? 88  PRO A HD3  2  
ATOM 3294  N N    . VAL A 1 89  ? -4.735  10.629  12.385  1.00 0.00 ? 89  VAL A N    2  
ATOM 3295  C CA   . VAL A 1 89  ? -4.516  9.218   12.750  1.00 0.00 ? 89  VAL A CA   2  
ATOM 3296  C C    . VAL A 1 89  ? -4.527  9.002   14.263  1.00 0.00 ? 89  VAL A C    2  
ATOM 3297  O O    . VAL A 1 89  ? -5.028  7.977   14.703  1.00 0.00 ? 89  VAL A O    2  
ATOM 3298  C CB   . VAL A 1 89  ? -3.246  8.669   12.050  1.00 0.00 ? 89  VAL A CB   2  
ATOM 3299  C CG1  . VAL A 1 89  ? -2.552  7.521   12.803  1.00 0.00 ? 89  VAL A CG1  2  
ATOM 3300  C CG2  . VAL A 1 89  ? -3.642  8.220   10.630  1.00 0.00 ? 89  VAL A CG2  2  
ATOM 3301  H H    . VAL A 1 89  ? -4.011  11.103  11.851  1.00 0.00 ? 89  VAL A H    2  
ATOM 3302  H HA   . VAL A 1 89  ? -5.362  8.649   12.368  1.00 0.00 ? 89  VAL A HA   2  
ATOM 3303  H HB   . VAL A 1 89  ? -2.519  9.477   11.964  1.00 0.00 ? 89  VAL A HB   2  
ATOM 3304  H HG11 . VAL A 1 89  ? -3.260  6.713   12.985  1.00 0.00 ? 89  VAL A HG11 2  
ATOM 3305  H HG12 . VAL A 1 89  ? -1.706  7.155   12.220  1.00 0.00 ? 89  VAL A HG12 2  
ATOM 3306  H HG13 . VAL A 1 89  ? -2.166  7.876   13.758  1.00 0.00 ? 89  VAL A HG13 2  
ATOM 3307  H HG21 . VAL A 1 89  ? -2.756  7.892   10.081  1.00 0.00 ? 89  VAL A HG21 2  
ATOM 3308  H HG22 . VAL A 1 89  ? -4.363  7.401   10.678  1.00 0.00 ? 89  VAL A HG22 2  
ATOM 3309  H HG23 . VAL A 1 89  ? -4.102  9.046   10.080  1.00 0.00 ? 89  VAL A HG23 2  
ATOM 3310  N N    . GLU A 1 90  ? -4.093  9.969   15.071  1.00 0.00 ? 90  GLU A N    2  
ATOM 3311  C CA   . GLU A 1 90  ? -4.061  9.859   16.539  1.00 0.00 ? 90  GLU A CA   2  
ATOM 3312  C C    . GLU A 1 90  ? -5.430  9.493   17.128  1.00 0.00 ? 90  GLU A C    2  
ATOM 3313  O O    . GLU A 1 90  ? -5.528  8.679   18.045  1.00 0.00 ? 90  GLU A O    2  
ATOM 3314  C CB   . GLU A 1 90  ? -3.596  11.186  17.166  1.00 0.00 ? 90  GLU A CB   2  
ATOM 3315  C CG   . GLU A 1 90  ? -2.249  11.698  16.645  1.00 0.00 ? 90  GLU A CG   2  
ATOM 3316  C CD   . GLU A 1 90  ? -2.396  12.674  15.464  1.00 0.00 ? 90  GLU A CD   2  
ATOM 3317  O OE1  . GLU A 1 90  ? -2.608  12.214  14.318  1.00 0.00 ? 90  GLU A OE1  2  
ATOM 3318  O OE2  . GLU A 1 90  ? -2.302  13.905  15.684  1.00 0.00 ? 90  GLU A OE2  2  
ATOM 3319  H H    . GLU A 1 90  ? -3.686  10.802  14.637  1.00 0.00 ? 90  GLU A H    2  
ATOM 3320  H HA   . GLU A 1 90  ? -3.358  9.067   16.811  1.00 0.00 ? 90  GLU A HA   2  
ATOM 3321  H HB2  . GLU A 1 90  ? -4.353  11.956  17.014  1.00 0.00 ? 90  GLU A HB2  2  
ATOM 3322  H HB3  . GLU A 1 90  ? -3.500  11.030  18.243  1.00 0.00 ? 90  GLU A HB3  2  
ATOM 3323  H HG2  . GLU A 1 90  ? -1.760  12.220  17.467  1.00 0.00 ? 90  GLU A HG2  2  
ATOM 3324  H HG3  . GLU A 1 90  ? -1.626  10.846  16.360  1.00 0.00 ? 90  GLU A HG3  2  
ATOM 3325  N N    . VAL A 1 91  ? -6.500  10.041  16.549  1.00 0.00 ? 91  VAL A N    2  
ATOM 3326  C CA   . VAL A 1 91  ? -7.879  9.834   17.026  1.00 0.00 ? 91  VAL A CA   2  
ATOM 3327  C C    . VAL A 1 91  ? -8.413  8.458   16.584  1.00 0.00 ? 91  VAL A C    2  
ATOM 3328  O O    . VAL A 1 91  ? -9.191  7.837   17.301  1.00 0.00 ? 91  VAL A O    2  
ATOM 3329  C CB   . VAL A 1 91  ? -8.799  11.004  16.590  1.00 0.00 ? 91  VAL A CB   2  
ATOM 3330  C CG1  . VAL A 1 91  ? -10.123 10.981  17.369  1.00 0.00 ? 91  VAL A CG1  2  
ATOM 3331  C CG2  . VAL A 1 91  ? -8.116  12.370  16.816  1.00 0.00 ? 91  VAL A CG2  2  
ATOM 3332  H H    . VAL A 1 91  ? -6.334  10.683  15.774  1.00 0.00 ? 91  VAL A H    2  
ATOM 3333  H HA   . VAL A 1 91  ? -7.844  9.845   18.115  1.00 0.00 ? 91  VAL A HA   2  
ATOM 3334  H HB   . VAL A 1 91  ? -9.011  10.902  15.526  1.00 0.00 ? 91  VAL A HB   2  
ATOM 3335  H HG11 . VAL A 1 91  ? -10.654 10.049  17.186  1.00 0.00 ? 91  VAL A HG11 2  
ATOM 3336  H HG12 . VAL A 1 91  ? -9.929  11.078  18.439  1.00 0.00 ? 91  VAL A HG12 2  
ATOM 3337  H HG13 . VAL A 1 91  ? -10.753 11.809  17.048  1.00 0.00 ? 91  VAL A HG13 2  
ATOM 3338  H HG21 . VAL A 1 91  ? -7.801  12.462  17.857  1.00 0.00 ? 91  VAL A HG21 2  
ATOM 3339  H HG22 . VAL A 1 91  ? -7.235  12.480  16.181  1.00 0.00 ? 91  VAL A HG22 2  
ATOM 3340  H HG23 . VAL A 1 91  ? -8.806  13.177  16.576  1.00 0.00 ? 91  VAL A HG23 2  
ATOM 3341  N N    . ILE A 1 92  ? -7.927  7.927   15.454  1.00 0.00 ? 92  ILE A N    2  
ATOM 3342  C CA   . ILE A 1 92  ? -8.173  6.537   15.009  1.00 0.00 ? 92  ILE A CA   2  
ATOM 3343  C C    . ILE A 1 92  ? -7.437  5.542   15.924  1.00 0.00 ? 92  ILE A C    2  
ATOM 3344  O O    . ILE A 1 92  ? -8.045  4.573   16.372  1.00 0.00 ? 92  ILE A O    2  
ATOM 3345  C CB   . ILE A 1 92  ? -7.758  6.401   13.522  1.00 0.00 ? 92  ILE A CB   2  
ATOM 3346  C CG1  . ILE A 1 92  ? -8.675  7.263   12.628  1.00 0.00 ? 92  ILE A CG1  2  
ATOM 3347  C CG2  . ILE A 1 92  ? -7.818  4.939   13.046  1.00 0.00 ? 92  ILE A CG2  2  
ATOM 3348  C CD1  . ILE A 1 92  ? -7.973  7.766   11.364  1.00 0.00 ? 92  ILE A CD1  2  
ATOM 3349  H H    . ILE A 1 92  ? -7.289  8.495   14.907  1.00 0.00 ? 92  ILE A H    2  
ATOM 3350  H HA   . ILE A 1 92  ? -9.243  6.306   15.075  1.00 0.00 ? 92  ILE A HA   2  
ATOM 3351  H HB   . ILE A 1 92  ? -6.731  6.743   13.403  1.00 0.00 ? 92  ILE A HB   2  
ATOM 3352  H HG12 . ILE A 1 92  ? -9.547  6.673   12.340  1.00 0.00 ? 92  ILE A HG12 2  
ATOM 3353  H HG13 . ILE A 1 92  ? -9.034  8.139   13.165  1.00 0.00 ? 92  ILE A HG13 2  
ATOM 3354  H HG21 . ILE A 1 92  ? -8.815  4.530   13.207  1.00 0.00 ? 92  ILE A HG21 2  
ATOM 3355  H HG22 . ILE A 1 92  ? -7.578  4.880   11.985  1.00 0.00 ? 92  ILE A HG22 2  
ATOM 3356  H HG23 . ILE A 1 92  ? -7.088  4.337   13.586  1.00 0.00 ? 92  ILE A HG23 2  
ATOM 3357  H HD11 . ILE A 1 92  ? -7.338  6.991   10.939  1.00 0.00 ? 92  ILE A HD11 2  
ATOM 3358  H HD12 . ILE A 1 92  ? -8.726  8.041   10.632  1.00 0.00 ? 92  ILE A HD12 2  
ATOM 3359  H HD13 . ILE A 1 92  ? -7.381  8.653   11.597  1.00 0.00 ? 92  ILE A HD13 2  
ATOM 3360  N N    . ILE A 1 93  ? -6.170  5.815   16.272  1.00 0.00 ? 93  ILE A N    2  
ATOM 3361  C CA   . ILE A 1 93  ? -5.380  5.018   17.238  1.00 0.00 ? 93  ILE A CA   2  
ATOM 3362  C C    . ILE A 1 93  ? -6.091  4.994   18.598  1.00 0.00 ? 93  ILE A C    2  
ATOM 3363  O O    . ILE A 1 93  ? -6.255  3.935   19.195  1.00 0.00 ? 93  ILE A O    2  
ATOM 3364  C CB   . ILE A 1 93  ? -3.940  5.590   17.378  1.00 0.00 ? 93  ILE A CB   2  
ATOM 3365  C CG1  . ILE A 1 93  ? -3.142  5.650   16.050  1.00 0.00 ? 93  ILE A CG1  2  
ATOM 3366  C CG2  . ILE A 1 93  ? -3.132  4.841   18.454  1.00 0.00 ? 93  ILE A CG2  2  
ATOM 3367  C CD1  . ILE A 1 93  ? -2.567  4.335   15.535  1.00 0.00 ? 93  ILE A CD1  2  
ATOM 3368  H H    . ILE A 1 93  ? -5.735  6.633   15.855  1.00 0.00 ? 93  ILE A H    2  
ATOM 3369  H HA   . ILE A 1 93  ? -5.324  3.981   16.899  1.00 0.00 ? 93  ILE A HA   2  
ATOM 3370  H HB   . ILE A 1 93  ? -4.032  6.619   17.722  1.00 0.00 ? 93  ILE A HB   2  
ATOM 3371  H HG12 . ILE A 1 93  ? -3.774  6.036   15.261  1.00 0.00 ? 93  ILE A HG12 2  
ATOM 3372  H HG13 . ILE A 1 93  ? -2.315  6.352   16.178  1.00 0.00 ? 93  ILE A HG13 2  
ATOM 3373  H HG21 . ILE A 1 93  ? -3.567  5.009   19.437  1.00 0.00 ? 93  ILE A HG21 2  
ATOM 3374  H HG22 . ILE A 1 93  ? -3.129  3.772   18.246  1.00 0.00 ? 93  ILE A HG22 2  
ATOM 3375  H HG23 . ILE A 1 93  ? -2.103  5.207   18.467  1.00 0.00 ? 93  ILE A HG23 2  
ATOM 3376  H HD11 . ILE A 1 93  ? -2.116  4.507   14.557  1.00 0.00 ? 93  ILE A HD11 2  
ATOM 3377  H HD12 . ILE A 1 93  ? -1.782  3.992   16.203  1.00 0.00 ? 93  ILE A HD12 2  
ATOM 3378  H HD13 . ILE A 1 93  ? -3.363  3.597   15.440  1.00 0.00 ? 93  ILE A HD13 2  
ATOM 3379  N N    . SER A 1 94  ? -6.548  6.154   19.070  1.00 0.00 ? 94  SER A N    2  
ATOM 3380  C CA   . SER A 1 94  ? -7.271  6.282   20.341  1.00 0.00 ? 94  SER A CA   2  
ATOM 3381  C C    . SER A 1 94  ? -8.612  5.529   20.307  1.00 0.00 ? 94  SER A C    2  
ATOM 3382  O O    . SER A 1 94  ? -8.959  4.824   21.256  1.00 0.00 ? 94  SER A O    2  
ATOM 3383  C CB   . SER A 1 94  ? -7.482  7.773   20.647  1.00 0.00 ? 94  SER A CB   2  
ATOM 3384  O OG   . SER A 1 94  ? -8.012  7.968   21.947  1.00 0.00 ? 94  SER A OG   2  
ATOM 3385  H H    . SER A 1 94  ? -6.337  6.998   18.548  1.00 0.00 ? 94  SER A H    2  
ATOM 3386  H HA   . SER A 1 94  ? -6.667  5.852   21.138  1.00 0.00 ? 94  SER A HA   2  
ATOM 3387  H HB2  . SER A 1 94  ? -6.519  8.284   20.581  1.00 0.00 ? 94  SER A HB2  2  
ATOM 3388  H HB3  . SER A 1 94  ? -8.159  8.205   19.908  1.00 0.00 ? 94  SER A HB3  2  
ATOM 3389  H HG   . SER A 1 94  ? -8.095  8.923   22.108  1.00 0.00 ? 94  SER A HG   2  
ATOM 3390  N N    . SER A 1 95  ? -9.348  5.596   19.190  1.00 0.00 ? 95  SER A N    2  
ATOM 3391  C CA   . SER A 1 95  ? -10.590 4.842   18.990  1.00 0.00 ? 95  SER A CA   2  
ATOM 3392  C C    . SER A 1 95  ? -10.348 3.326   19.048  1.00 0.00 ? 95  SER A C    2  
ATOM 3393  O O    . SER A 1 95  ? -11.068 2.612   19.744  1.00 0.00 ? 95  SER A O    2  
ATOM 3394  C CB   . SER A 1 95  ? -11.247 5.257   17.664  1.00 0.00 ? 95  SER A CB   2  
ATOM 3395  O OG   . SER A 1 95  ? -12.551 4.709   17.560  1.00 0.00 ? 95  SER A OG   2  
ATOM 3396  H H    . SER A 1 95  ? -9.026  6.185   18.433  1.00 0.00 ? 95  SER A H    2  
ATOM 3397  H HA   . SER A 1 95  ? -11.279 5.096   19.793  1.00 0.00 ? 95  SER A HA   2  
ATOM 3398  H HB2  . SER A 1 95  ? -11.315 6.347   17.634  1.00 0.00 ? 95  SER A HB2  2  
ATOM 3399  H HB3  . SER A 1 95  ? -10.635 4.922   16.828  1.00 0.00 ? 95  SER A HB3  2  
ATOM 3400  H HG   . SER A 1 95  ? -13.021 5.111   16.817  1.00 0.00 ? 95  SER A HG   2  
ATOM 3401  N N    . ALA A 1 96  ? -9.286  2.823   18.410  1.00 0.00 ? 96  ALA A N    2  
ATOM 3402  C CA   . ALA A 1 96  ? -8.920  1.405   18.462  1.00 0.00 ? 96  ALA A CA   2  
ATOM 3403  C C    . ALA A 1 96  ? -8.555  0.957   19.893  1.00 0.00 ? 96  ALA A C    2  
ATOM 3404  O O    . ALA A 1 96  ? -9.060  -0.059  20.384  1.00 0.00 ? 96  ALA A O    2  
ATOM 3405  C CB   . ALA A 1 96  ? -7.795  1.196   17.439  1.00 0.00 ? 96  ALA A CB   2  
ATOM 3406  H H    . ALA A 1 96  ? -8.705  3.449   17.853  1.00 0.00 ? 96  ALA A H    2  
ATOM 3407  H HA   . ALA A 1 96  ? -9.782  0.813   18.155  1.00 0.00 ? 96  ALA A HA   2  
ATOM 3408  H HB1  . ALA A 1 96  ? -8.084  1.638   16.485  1.00 0.00 ? 96  ALA A HB1  2  
ATOM 3409  H HB2  . ALA A 1 96  ? -6.875  1.671   17.780  1.00 0.00 ? 96  ALA A HB2  2  
ATOM 3410  H HB3  . ALA A 1 96  ? -7.629  0.133   17.281  1.00 0.00 ? 96  ALA A HB3  2  
ATOM 3411  N N    . LYS A 1 97  ? -7.756  1.760   20.605  1.00 0.00 ? 97  LYS A N    2  
ATOM 3412  C CA   . LYS A 1 97  ? -7.415  1.544   22.019  1.00 0.00 ? 97  LYS A CA   2  
ATOM 3413  C C    . LYS A 1 97  ? -8.634  1.622   22.967  1.00 0.00 ? 97  LYS A C    2  
ATOM 3414  O O    . LYS A 1 97  ? -8.623  0.975   24.017  1.00 0.00 ? 97  LYS A O    2  
ATOM 3415  C CB   . LYS A 1 97  ? -6.328  2.553   22.432  1.00 0.00 ? 97  LYS A CB   2  
ATOM 3416  C CG   . LYS A 1 97  ? -4.955  2.217   21.820  1.00 0.00 ? 97  LYS A CG   2  
ATOM 3417  C CD   . LYS A 1 97  ? -3.905  3.255   22.242  1.00 0.00 ? 97  LYS A CD   2  
ATOM 3418  C CE   . LYS A 1 97  ? -2.526  2.887   21.669  1.00 0.00 ? 97  LYS A CE   2  
ATOM 3419  N NZ   . LYS A 1 97  ? -1.465  3.823   22.137  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 3420  H H    . LYS A 1 97  ? -7.369  2.576   20.136  1.00 0.00 ? 97  LYS A H    2  
ATOM 3421  H HA   . LYS A 1 97  ? -7.008  0.537   22.133  1.00 0.00 ? 97  LYS A HA   2  
ATOM 3422  H HB2  . LYS A 1 97  ? -6.630  3.561   22.138  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 3423  H HB3  . LYS A 1 97  ? -6.230  2.531   23.521  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 3424  H HG2  . LYS A 1 97  ? -4.644  1.231   22.167  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 3425  H HG3  . LYS A 1 97  ? -5.024  2.193   20.731  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 3426  H HD2  . LYS A 1 97  ? -4.207  4.240   21.880  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 3427  H HD3  . LYS A 1 97  ? -3.852  3.283   23.333  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 3428  H HE2  . LYS A 1 97  ? -2.277  1.866   21.981  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 3429  H HE3  . LYS A 1 97  ? -2.582  2.905   20.575  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 3430  H HZ1  . LYS A 1 97  ? -1.379  3.799   23.145  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 3431  H HZ2  . LYS A 1 97  ? -0.563  3.576   21.753  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 3432  H HZ3  . LYS A 1 97  ? -1.665  4.778   21.865  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 3433  N N    . GLU A 1 98  ? -9.702  2.338   22.601  1.00 0.00 ? 98  GLU A N    2  
ATOM 3434  C CA   . GLU A 1 98  ? -10.987 2.321   23.308  1.00 0.00 ? 98  GLU A CA   2  
ATOM 3435  C C    . GLU A 1 98  ? -11.869 1.113   22.927  1.00 0.00 ? 98  GLU A C    2  
ATOM 3436  O O    . GLU A 1 98  ? -12.567 0.569   23.783  1.00 0.00 ? 98  GLU A O    2  
ATOM 3437  C CB   . GLU A 1 98  ? -11.754 3.635   23.068  1.00 0.00 ? 98  GLU A CB   2  
ATOM 3438  C CG   . GLU A 1 98  ? -11.165 4.829   23.832  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3439  C CD   . GLU A 1 98  ? -11.388 4.712   25.347  1.00 0.00 ? 98  GLU A CD   2  
ATOM 3440  O OE1  . GLU A 1 98  ? -12.517 4.986   25.818  1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3441  O OE2  . GLU A 1 98  ? -10.432 4.359   26.080  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3442  H H    . GLU A 1 98  ? -9.612  2.952   21.804  1.00 0.00 ? 98  GLU A H    2  
ATOM 3443  H HA   . GLU A 1 98  ? -10.784 2.238   24.366  1.00 0.00 ? 98  GLU A HA   2  
ATOM 3444  H HB2  . GLU A 1 98  ? -11.758 3.863   22.002  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3445  H HB3  . GLU A 1 98  ? -12.790 3.505   23.382  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3446  H HG2  . GLU A 1 98  ? -10.099 4.920   23.624  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3447  H HG3  . GLU A 1 98  ? -11.652 5.738   23.475  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3448  N N    . MET A 1 99  ? -11.831 0.671   21.663  1.00 0.00 ? 99  MET A N    2  
ATOM 3449  C CA   . MET A 1 99  ? -12.657 -0.434  21.147  1.00 0.00 ? 99  MET A CA   2  
ATOM 3450  C C    . MET A 1 99  ? -12.216 -1.821  21.622  1.00 0.00 ? 99  MET A C    2  
ATOM 3451  O O    . MET A 1 99  ? -13.069 -2.691  21.777  1.00 0.00 ? 99  MET A O    2  
ATOM 3452  C CB   . MET A 1 99  ? -12.719 -0.391  19.611  1.00 0.00 ? 99  MET A CB   2  
ATOM 3453  C CG   . MET A 1 99  ? -13.692 0.680   19.098  1.00 0.00 ? 99  MET A CG   2  
ATOM 3454  S SD   . MET A 1 99  ? -15.442 0.466   19.534  1.00 0.00 ? 99  MET A SD   2  
ATOM 3455  C CE   . MET A 1 99  ? -15.802 -1.076  18.655  1.00 0.00 ? 99  MET A CE   2  
ATOM 3456  H H    . MET A 1 99  ? -11.297 1.221   20.995  1.00 0.00 ? 99  MET A H    2  
ATOM 3457  H HA   . MET A 1 99  ? -13.666 -0.310  21.532  1.00 0.00 ? 99  MET A HA   2  
ATOM 3458  H HB2  . MET A 1 99  ? -11.725 -0.202  19.203  1.00 0.00 ? 99  MET A HB2  2  
ATOM 3459  H HB3  . MET A 1 99  ? -13.050 -1.358  19.231  1.00 0.00 ? 99  MET A HB3  2  
ATOM 3460  H HG2  . MET A 1 99  ? -13.369 1.649   19.479  1.00 0.00 ? 99  MET A HG2  2  
ATOM 3461  H HG3  . MET A 1 99  ? -13.617 0.722   18.014  1.00 0.00 ? 99  MET A HG3  2  
ATOM 3462  H HE1  . MET A 1 99  ? -16.873 -1.285  18.703  1.00 0.00 ? 99  MET A HE1  2  
ATOM 3463  H HE2  . MET A 1 99  ? -15.502 -0.990  17.610  1.00 0.00 ? 99  MET A HE2  2  
ATOM 3464  H HE3  . MET A 1 99  ? -15.266 -1.902  19.123  1.00 0.00 ? 99  MET A HE3  2  
ATOM 3465  N N    . VAL A 1 100 ? -10.925 -2.047  21.884  1.00 0.00 ? 100 VAL A N    2  
ATOM 3466  C CA   . VAL A 1 100 ? -10.461 -3.305  22.506  1.00 0.00 ? 100 VAL A CA   2  
ATOM 3467  C C    . VAL A 1 100 ? -11.197 -3.576  23.826  1.00 0.00 ? 100 VAL A C    2  
ATOM 3468  O O    . VAL A 1 100 ? -11.263 -2.730  24.717  1.00 0.00 ? 100 VAL A O    2  
ATOM 3469  C CB   . VAL A 1 100 ? -8.926  -3.412  22.649  1.00 0.00 ? 100 VAL A CB   2  
ATOM 3470  C CG1  . VAL A 1 100 ? -8.264  -2.193  23.304  1.00 0.00 ? 100 VAL A CG1  2  
ATOM 3471  C CG2  . VAL A 1 100 ? -8.497  -4.686  23.390  1.00 0.00 ? 100 VAL A CG2  2  
ATOM 3472  H H    . VAL A 1 100 ? -10.269 -1.304  21.669  1.00 0.00 ? 100 VAL A H    2  
ATOM 3473  H HA   . VAL A 1 100 ? -10.747 -4.101  21.820  1.00 0.00 ? 100 VAL A HA   2  
ATOM 3474  H HB   . VAL A 1 100 ? -8.536  -3.494  21.640  1.00 0.00 ? 100 VAL A HB   2  
ATOM 3475  H HG11 . VAL A 1 100 ? -8.636  -2.054  24.320  1.00 0.00 ? 100 VAL A HG11 2  
ATOM 3476  H HG12 . VAL A 1 100 ? -7.184  -2.335  23.342  1.00 0.00 ? 100 VAL A HG12 2  
ATOM 3477  H HG13 . VAL A 1 100 ? -8.470  -1.303  22.715  1.00 0.00 ? 100 VAL A HG13 2  
ATOM 3478  H HG21 . VAL A 1 100 ? -8.979  -5.554  22.948  1.00 0.00 ? 100 VAL A HG21 2  
ATOM 3479  H HG22 . VAL A 1 100 ? -7.417  -4.810  23.311  1.00 0.00 ? 100 VAL A HG22 2  
ATOM 3480  H HG23 . VAL A 1 100 ? -8.767  -4.629  24.445  1.00 0.00 ? 100 VAL A HG23 2  
ATOM 3481  N N    . GLY A 1 101 ? -11.773 -4.780  23.905  1.00 0.00 ? 101 GLY A N    2  
ATOM 3482  C CA   . GLY A 1 101 ? -12.645 -5.250  24.987  1.00 0.00 ? 101 GLY A CA   2  
ATOM 3483  C C    . GLY A 1 101 ? -14.138 -5.250  24.638  1.00 0.00 ? 101 GLY A C    2  
ATOM 3484  O O    . GLY A 1 101 ? -14.928 -5.803  25.404  1.00 0.00 ? 101 GLY A O    2  
ATOM 3485  H H    . GLY A 1 101 ? -11.633 -5.405  23.115  1.00 0.00 ? 101 GLY A H    2  
ATOM 3486  H HA2  . GLY A 1 101 ? -12.374 -6.280  25.224  1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3487  H HA3  . GLY A 1 101 ? -12.509 -4.629  25.875  1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3488  N N    . GLN A 1 102 ? -14.542 -4.664  23.505  1.00 0.00 ? 102 GLN A N    2  
ATOM 3489  C CA   . GLN A 1 102 ? -15.924 -4.692  23.029  1.00 0.00 ? 102 GLN A CA   2  
ATOM 3490  C C    . GLN A 1 102 ? -16.218 -5.987  22.263  1.00 0.00 ? 102 GLN A C    2  
ATOM 3491  O O    . GLN A 1 102 ? -15.402 -6.474  21.477  1.00 0.00 ? 102 GLN A O    2  
ATOM 3492  C CB   . GLN A 1 102 ? -16.216 -3.481  22.119  1.00 0.00 ? 102 GLN A CB   2  
ATOM 3493  C CG   . GLN A 1 102 ? -16.114 -2.114  22.824  1.00 0.00 ? 102 GLN A CG   2  
ATOM 3494  C CD   . GLN A 1 102 ? -17.163 -1.876  23.917  1.00 0.00 ? 102 GLN A CD   2  
ATOM 3495  O OE1  . GLN A 1 102 ? -18.119 -2.621  24.105  1.00 0.00 ? 102 GLN A OE1  2  
ATOM 3496  N NE2  . GLN A 1 102 ? -17.028 -0.815  24.689  1.00 0.00 ? 102 GLN A NE2  2  
ATOM 3497  H H    . GLN A 1 102 ? -13.862 -4.204  22.914  1.00 0.00 ? 102 GLN A H    2  
ATOM 3498  H HA   . GLN A 1 102 ? -16.598 -4.655  23.886  1.00 0.00 ? 102 GLN A HA   2  
ATOM 3499  H HB2  . GLN A 1 102 ? -15.523 -3.494  21.278  1.00 0.00 ? 102 GLN A HB2  2  
ATOM 3500  H HB3  . GLN A 1 102 ? -17.222 -3.580  21.705  1.00 0.00 ? 102 GLN A HB3  2  
ATOM 3501  H HG2  . GLN A 1 102 ? -15.125 -2.006  23.267  1.00 0.00 ? 102 GLN A HG2  2  
ATOM 3502  H HG3  . GLN A 1 102 ? -16.222 -1.333  22.071  1.00 0.00 ? 102 GLN A HG3  2  
ATOM 3503  H HE21 . GLN A 1 102 ? -16.256 -0.179  24.554  1.00 0.00 ? 102 GLN A HE21 2  
ATOM 3504  H HE22 . GLN A 1 102 ? -17.723 -0.642  25.400  1.00 0.00 ? 102 GLN A HE22 2  
ATOM 3505  N N    . LYS A 1 103 ? -17.425 -6.516  22.470  1.00 0.00 ? 103 LYS A N    2  
ATOM 3506  C CA   . LYS A 1 103 ? -18.020 -7.619  21.704  1.00 0.00 ? 103 LYS A CA   2  
ATOM 3507  C C    . LYS A 1 103 ? -19.088 -7.100  20.718  1.00 0.00 ? 103 LYS A C    2  
ATOM 3508  O O    . LYS A 1 103 ? -19.705 -6.059  20.957  1.00 0.00 ? 103 LYS A O    2  
ATOM 3509  C CB   . LYS A 1 103 ? -18.638 -8.655  22.664  1.00 0.00 ? 103 LYS A CB   2  
ATOM 3510  C CG   . LYS A 1 103 ? -17.606 -9.486  23.446  1.00 0.00 ? 103 LYS A CG   2  
ATOM 3511  C CD   . LYS A 1 103 ? -18.343 -10.475 24.365  1.00 0.00 ? 103 LYS A CD   2  
ATOM 3512  C CE   . LYS A 1 103 ? -17.432 -11.490 25.074  1.00 0.00 ? 103 LYS A CE   2  
ATOM 3513  N NZ   . LYS A 1 103 ? -16.494 -10.859 26.042  1.00 0.00 ? 103 LYS A NZ   2  
ATOM 3514  H H    . LYS A 1 103 ? -18.028 -6.036  23.120  1.00 0.00 ? 103 LYS A H    2  
ATOM 3515  H HA   . LYS A 1 103 ? -17.242 -8.101  21.118  1.00 0.00 ? 103 LYS A HA   2  
ATOM 3516  H HB2  . LYS A 1 103 ? -19.302 -8.144  23.365  1.00 0.00 ? 103 LYS A HB2  2  
ATOM 3517  H HB3  . LYS A 1 103 ? -19.243 -9.351  22.078  1.00 0.00 ? 103 LYS A HB3  2  
ATOM 3518  H HG2  . LYS A 1 103 ? -16.982 -10.038 22.745  1.00 0.00 ? 103 LYS A HG2  2  
ATOM 3519  H HG3  . LYS A 1 103 ? -16.974 -8.823  24.041  1.00 0.00 ? 103 LYS A HG3  2  
ATOM 3520  H HD2  . LYS A 1 103 ? -18.908 -9.916  25.114  1.00 0.00 ? 103 LYS A HD2  2  
ATOM 3521  H HD3  . LYS A 1 103 ? -19.057 -11.044 23.766  1.00 0.00 ? 103 LYS A HD3  2  
ATOM 3522  H HE2  . LYS A 1 103 ? -18.071 -12.202 25.607  1.00 0.00 ? 103 LYS A HE2  2  
ATOM 3523  H HE3  . LYS A 1 103 ? -16.869 -12.053 24.325  1.00 0.00 ? 103 LYS A HE3  2  
ATOM 3524  H HZ1  . LYS A 1 103 ? -16.069 -11.562 26.631  1.00 0.00 ? 103 LYS A HZ1  2  
ATOM 3525  H HZ2  . LYS A 1 103 ? -15.725 -10.397 25.554  1.00 0.00 ? 103 LYS A HZ2  2  
ATOM 3526  H HZ3  . LYS A 1 103 ? -16.965 -10.194 26.640  1.00 0.00 ? 103 LYS A HZ3  2  
ATOM 3527  N N    . MET A 1 104 ? -19.346 -7.844  19.632  1.00 0.00 ? 104 MET A N    2  
ATOM 3528  C CA   . MET A 1 104 ? -20.357 -7.497  18.611  1.00 0.00 ? 104 MET A CA   2  
ATOM 3529  C C    . MET A 1 104 ? -20.788 -8.667  17.717  1.00 0.00 ? 104 MET A C    2  
ATOM 3530  O O    . MET A 1 104 ? -20.027 -9.597  17.452  1.00 0.00 ? 104 MET A O    2  
ATOM 3531  C CB   . MET A 1 104 ? -19.890 -6.294  17.762  1.00 0.00 ? 104 MET A CB   2  
ATOM 3532  C CG   . MET A 1 104 ? -18.556 -6.540  17.043  1.00 0.00 ? 104 MET A CG   2  
ATOM 3533  S SD   . MET A 1 104 ? -18.055 -5.204  15.931  1.00 0.00 ? 104 MET A SD   2  
ATOM 3534  C CE   . MET A 1 104 ? -17.550 -3.953  17.138  1.00 0.00 ? 104 MET A CE   2  
ATOM 3535  H H    . MET A 1 104 ? -18.805 -8.695  19.507  1.00 0.00 ? 104 MET A H    2  
ATOM 3536  H HA   . MET A 1 104 ? -21.260 -7.180  19.142  1.00 0.00 ? 104 MET A HA   2  
ATOM 3537  H HB2  . MET A 1 104 ? -20.655 -6.062  17.016  1.00 0.00 ? 104 MET A HB2  2  
ATOM 3538  H HB3  . MET A 1 104 ? -19.794 -5.419  18.400  1.00 0.00 ? 104 MET A HB3  2  
ATOM 3539  H HG2  . MET A 1 104 ? -17.765 -6.696  17.779  1.00 0.00 ? 104 MET A HG2  2  
ATOM 3540  H HG3  . MET A 1 104 ? -18.648 -7.444  16.445  1.00 0.00 ? 104 MET A HG3  2  
ATOM 3541  H HE1  . MET A 1 104 ? -16.760 -4.353  17.777  1.00 0.00 ? 104 MET A HE1  2  
ATOM 3542  H HE2  . MET A 1 104 ? -17.171 -3.077  16.610  1.00 0.00 ? 104 MET A HE2  2  
ATOM 3543  H HE3  . MET A 1 104 ? -18.400 -3.655  17.750  1.00 0.00 ? 104 MET A HE3  2  
ATOM 3544  N N    . LYS A 1 105 ? -22.019 -8.584  17.209  1.00 0.00 ? 105 LYS A N    2  
ATOM 3545  C CA   . LYS A 1 105 ? -22.665 -9.577  16.331  1.00 0.00 ? 105 LYS A CA   2  
ATOM 3546  C C    . LYS A 1 105 ? -23.680 -8.881  15.389  1.00 0.00 ? 105 LYS A C    2  
ATOM 3547  O O    . LYS A 1 105 ? -24.802 -9.341  15.173  1.00 0.00 ? 105 LYS A O    2  
ATOM 3548  C CB   . LYS A 1 105 ? -23.283 -10.680 17.221  1.00 0.00 ? 105 LYS A CB   2  
ATOM 3549  C CG   . LYS A 1 105 ? -23.391 -12.023 16.486  1.00 0.00 ? 105 LYS A CG   2  
ATOM 3550  C CD   . LYS A 1 105 ? -24.081 -13.076 17.367  1.00 0.00 ? 105 LYS A CD   2  
ATOM 3551  C CE   . LYS A 1 105 ? -23.886 -14.502 16.831  1.00 0.00 ? 105 LYS A CE   2  
ATOM 3552  N NZ   . LYS A 1 105 ? -24.640 -14.750 15.570  1.00 0.00 ? 105 LYS A NZ   2  
ATOM 3553  H H    . LYS A 1 105 ? -22.585 -7.795  17.501  1.00 0.00 ? 105 LYS A H    2  
ATOM 3554  H HA   . LYS A 1 105 ? -21.897 -10.030 15.696  1.00 0.00 ? 105 LYS A HA   2  
ATOM 3555  H HB2  . LYS A 1 105 ? -22.656 -10.829 18.100  1.00 0.00 ? 105 LYS A HB2  2  
ATOM 3556  H HB3  . LYS A 1 105 ? -24.267 -10.360 17.570  1.00 0.00 ? 105 LYS A HB3  2  
ATOM 3557  H HG2  . LYS A 1 105 ? -23.958 -11.901 15.562  1.00 0.00 ? 105 LYS A HG2  2  
ATOM 3558  H HG3  . LYS A 1 105 ? -22.382 -12.365 16.239  1.00 0.00 ? 105 LYS A HG3  2  
ATOM 3559  H HD2  . LYS A 1 105 ? -23.652 -13.037 18.368  1.00 0.00 ? 105 LYS A HD2  2  
ATOM 3560  H HD3  . LYS A 1 105 ? -25.147 -12.847 17.457  1.00 0.00 ? 105 LYS A HD3  2  
ATOM 3561  H HE2  . LYS A 1 105 ? -22.813 -14.679 16.690  1.00 0.00 ? 105 LYS A HE2  2  
ATOM 3562  H HE3  . LYS A 1 105 ? -24.231 -15.203 17.598  1.00 0.00 ? 105 LYS A HE3  2  
ATOM 3563  H HZ1  . LYS A 1 105 ? -24.530 -15.713 15.272  1.00 0.00 ? 105 LYS A HZ1  2  
ATOM 3564  H HZ2  . LYS A 1 105 ? -25.630 -14.587 15.702  1.00 0.00 ? 105 LYS A HZ2  2  
ATOM 3565  H HZ3  . LYS A 1 105 ? -24.319 -14.153 14.819  1.00 0.00 ? 105 LYS A HZ3  2  
ATOM 3566  N N    . TYR A 1 106 ? -23.282 -7.711  14.871  1.00 0.00 ? 106 TYR A N    2  
ATOM 3567  C CA   . TYR A 1 106 ? -24.123 -6.753  14.131  1.00 0.00 ? 106 TYR A CA   2  
ATOM 3568  C C    . TYR A 1 106 ? -24.732 -7.288  12.818  1.00 0.00 ? 106 TYR A C    2  
ATOM 3569  O O    . TYR A 1 106 ? -25.783 -6.818  12.383  1.00 0.00 ? 106 TYR A O    2  
ATOM 3570  C CB   . TYR A 1 106 ? -23.242 -5.520  13.856  1.00 0.00 ? 106 TYR A CB   2  
ATOM 3571  C CG   . TYR A 1 106 ? -23.826 -4.486  12.913  1.00 0.00 ? 106 TYR A CG   2  
ATOM 3572  C CD1  . TYR A 1 106 ? -24.845 -3.616  13.349  1.00 0.00 ? 106 TYR A CD1  2  
ATOM 3573  C CD2  . TYR A 1 106 ? -23.347 -4.396  11.590  1.00 0.00 ? 106 TYR A CD2  2  
ATOM 3574  C CE1  . TYR A 1 106 ? -25.378 -2.651  12.472  1.00 0.00 ? 106 TYR A CE1  2  
ATOM 3575  C CE2  . TYR A 1 106 ? -23.872 -3.431  10.709  1.00 0.00 ? 106 TYR A CE2  2  
ATOM 3576  C CZ   . TYR A 1 106 ? -24.892 -2.556  11.147  1.00 0.00 ? 106 TYR A CZ   2  
ATOM 3577  O OH   . TYR A 1 106 ? -25.395 -1.625  10.288  1.00 0.00 ? 106 TYR A OH   2  
ATOM 3578  H H    . TYR A 1 106 ? -22.325 -7.429  15.061  1.00 0.00 ? 106 TYR A H    2  
ATOM 3579  H HA   . TYR A 1 106 ? -24.954 -6.442  14.766  1.00 0.00 ? 106 TYR A HA   2  
ATOM 3580  H HB2  . TYR A 1 106 ? -23.014 -5.037  14.808  1.00 0.00 ? 106 TYR A HB2  2  
ATOM 3581  H HB3  . TYR A 1 106 ? -22.293 -5.857  13.436  1.00 0.00 ? 106 TYR A HB3  2  
ATOM 3582  H HD1  . TYR A 1 106 ? -25.216 -3.684  14.362  1.00 0.00 ? 106 TYR A HD1  2  
ATOM 3583  H HD2  . TYR A 1 106 ? -22.561 -5.058  11.250  1.00 0.00 ? 106 TYR A HD2  2  
ATOM 3584  H HE1  . TYR A 1 106 ? -26.162 -1.987  12.811  1.00 0.00 ? 106 TYR A HE1  2  
ATOM 3585  H HE2  . TYR A 1 106 ? -23.497 -3.353  9.700   1.00 0.00 ? 106 TYR A HE2  2  
ATOM 3586  H HH   . TYR A 1 106 ? -26.083 -1.087  10.693  1.00 0.00 ? 106 TYR A HH   2  
ATOM 3587  N N    . SER A 1 107 ? -24.070 -8.241  12.159  1.00 0.00 ? 107 SER A N    2  
ATOM 3588  C CA   . SER A 1 107 ? -24.375 -8.754  10.808  1.00 0.00 ? 107 SER A CA   2  
ATOM 3589  C C    . SER A 1 107 ? -23.497 -9.986  10.489  1.00 0.00 ? 107 SER A C    2  
ATOM 3590  O O    . SER A 1 107 ? -22.813 -10.502 11.378  1.00 0.00 ? 107 SER A O    2  
ATOM 3591  C CB   . SER A 1 107 ? -24.131 -7.622  9.782   1.00 0.00 ? 107 SER A CB   2  
ATOM 3592  O OG   . SER A 1 107 ? -25.178 -6.666  9.768   1.00 0.00 ? 107 SER A OG   2  
ATOM 3593  H H    . SER A 1 107 ? -23.249 -8.632  12.605  1.00 0.00 ? 107 SER A H    2  
ATOM 3594  H HA   . SER A 1 107 ? -25.421 -9.069  10.746  1.00 0.00 ? 107 SER A HA   2  
ATOM 3595  H HB2  . SER A 1 107 ? -23.180 -7.131  10.017  1.00 0.00 ? 107 SER A HB2  2  
ATOM 3596  H HB3  . SER A 1 107 ? -24.060 -8.032  8.775   1.00 0.00 ? 107 SER A HB3  2  
ATOM 3597  H HG   . SER A 1 107 ? -25.461 -6.516  10.691  1.00 0.00 ? 107 SER A HG   2  
ATOM 3598  N N    . ILE A 1 108 ? -23.490 -10.457 9.228   1.00 0.00 ? 108 ILE A N    2  
ATOM 3599  C CA   . ILE A 1 108 ? -22.536 -11.475 8.734   1.00 0.00 ? 108 ILE A CA   2  
ATOM 3600  C C    . ILE A 1 108 ? -21.086 -11.029 8.999   1.00 0.00 ? 108 ILE A C    2  
ATOM 3601  O O    . ILE A 1 108 ? -20.813 -9.831  9.002   1.00 0.00 ? 108 ILE A O    2  
ATOM 3602  C CB   . ILE A 1 108 ? -22.779 -11.797 7.235   1.00 0.00 ? 108 ILE A CB   2  
ATOM 3603  C CG1  . ILE A 1 108 ? -22.612 -10.560 6.315   1.00 0.00 ? 108 ILE A CG1  2  
ATOM 3604  C CG2  . ILE A 1 108 ? -24.161 -12.456 7.070   1.00 0.00 ? 108 ILE A CG2  2  
ATOM 3605  C CD1  . ILE A 1 108 ? -22.707 -10.873 4.815   1.00 0.00 ? 108 ILE A CD1  2  
ATOM 3606  H H    . ILE A 1 108 ? -24.130 -10.051 8.557   1.00 0.00 ? 108 ILE A H    2  
ATOM 3607  H HA   . ILE A 1 108 ? -22.698 -12.391 9.308   1.00 0.00 ? 108 ILE A HA   2  
ATOM 3608  H HB   . ILE A 1 108 ? -22.035 -12.537 6.928   1.00 0.00 ? 108 ILE A HB   2  
ATOM 3609  H HG12 . ILE A 1 108 ? -23.366 -9.811  6.557   1.00 0.00 ? 108 ILE A HG12 2  
ATOM 3610  H HG13 . ILE A 1 108 ? -21.634 -10.115 6.491   1.00 0.00 ? 108 ILE A HG13 2  
ATOM 3611  H HG21 . ILE A 1 108 ? -24.264 -13.284 7.775   1.00 0.00 ? 108 ILE A HG21 2  
ATOM 3612  H HG22 . ILE A 1 108 ? -24.958 -11.734 7.257   1.00 0.00 ? 108 ILE A HG22 2  
ATOM 3613  H HG23 . ILE A 1 108 ? -24.272 -12.855 6.060   1.00 0.00 ? 108 ILE A HG23 2  
ATOM 3614  H HD11 . ILE A 1 108 ? -23.717 -11.195 4.554   1.00 0.00 ? 108 ILE A HD11 2  
ATOM 3615  H HD12 . ILE A 1 108 ? -22.474 -9.974  4.246   1.00 0.00 ? 108 ILE A HD12 2  
ATOM 3616  H HD13 . ILE A 1 108 ? -21.992 -11.653 4.549   1.00 0.00 ? 108 ILE A HD13 2  
ATOM 3617  N N    . VAL A 1 109 ? -20.148 -11.965 9.190   1.00 0.00 ? 109 VAL A N    2  
ATOM 3618  C CA   . VAL A 1 109 ? -18.785 -11.643 9.681   1.00 0.00 ? 109 VAL A CA   2  
ATOM 3619  C C    . VAL A 1 109 ? -18.049 -10.575 8.871   1.00 0.00 ? 109 VAL A C    2  
ATOM 3620  O O    . VAL A 1 109 ? -17.411 -9.712  9.462   1.00 0.00 ? 109 VAL A O    2  
ATOM 3621  C CB   . VAL A 1 109 ? -17.873 -12.879 9.873   1.00 0.00 ? 109 VAL A CB   2  
ATOM 3622  C CG1  . VAL A 1 109 ? -18.522 -13.871 10.848  1.00 0.00 ? 109 VAL A CG1  2  
ATOM 3623  C CG2  . VAL A 1 109 ? -17.514 -13.610 8.568   1.00 0.00 ? 109 VAL A CG2  2  
ATOM 3624  H H    . VAL A 1 109 ? -20.442 -12.934 9.150   1.00 0.00 ? 109 VAL A H    2  
ATOM 3625  H HA   . VAL A 1 109 ? -18.934 -11.220 10.675  1.00 0.00 ? 109 VAL A HA   2  
ATOM 3626  H HB   . VAL A 1 109 ? -16.944 -12.536 10.331  1.00 0.00 ? 109 VAL A HB   2  
ATOM 3627  H HG11 . VAL A 1 109 ? -19.368 -14.376 10.383  1.00 0.00 ? 109 VAL A HG11 2  
ATOM 3628  H HG12 . VAL A 1 109 ? -17.792 -14.619 11.153  1.00 0.00 ? 109 VAL A HG12 2  
ATOM 3629  H HG13 . VAL A 1 109 ? -18.865 -13.335 11.734  1.00 0.00 ? 109 VAL A HG13 2  
ATOM 3630  H HG21 . VAL A 1 109 ? -18.417 -13.934 8.047   1.00 0.00 ? 109 VAL A HG21 2  
ATOM 3631  H HG22 . VAL A 1 109 ? -16.933 -12.963 7.913   1.00 0.00 ? 109 VAL A HG22 2  
ATOM 3632  H HG23 . VAL A 1 109 ? -16.904 -14.481 8.806   1.00 0.00 ? 109 VAL A HG23 2  
ATOM 3633  N N    . SER A 1 110 ? -18.190 -10.556 7.542   1.00 0.00 ? 110 SER A N    2  
ATOM 3634  C CA   . SER A 1 110 ? -17.573 -9.529  6.694   1.00 0.00 ? 110 SER A CA   2  
ATOM 3635  C C    . SER A 1 110 ? -18.115 -8.127  7.014   1.00 0.00 ? 110 SER A C    2  
ATOM 3636  O O    . SER A 1 110 ? -17.335 -7.193  7.228   1.00 0.00 ? 110 SER A O    2  
ATOM 3637  C CB   . SER A 1 110 ? -17.791 -9.887  5.216   1.00 0.00 ? 110 SER A CB   2  
ATOM 3638  O OG   . SER A 1 110 ? -19.161 -10.140 4.931   1.00 0.00 ? 110 SER A OG   2  
ATOM 3639  H H    . SER A 1 110 ? -18.782 -11.243 7.090   1.00 0.00 ? 110 SER A H    2  
ATOM 3640  H HA   . SER A 1 110 ? -16.498 -9.506  6.882   1.00 0.00 ? 110 SER A HA   2  
ATOM 3641  H HB2  . SER A 1 110 ? -17.429 -9.071  4.589   1.00 0.00 ? 110 SER A HB2  2  
ATOM 3642  H HB3  . SER A 1 110 ? -17.209 -10.782 4.986   1.00 0.00 ? 110 SER A HB3  2  
ATOM 3643  H HG   . SER A 1 110 ? -19.246 -10.361 3.990   1.00 0.00 ? 110 SER A HG   2  
ATOM 3644  N N    . ARG A 1 111 ? -19.442 -7.983  7.156   1.00 0.00 ? 111 ARG A N    2  
ATOM 3645  C CA   . ARG A 1 111 ? -20.067 -6.727  7.584   1.00 0.00 ? 111 ARG A CA   2  
ATOM 3646  C C    . ARG A 1 111 ? -19.792 -6.423  9.053   1.00 0.00 ? 111 ARG A C    2  
ATOM 3647  O O    . ARG A 1 111 ? -19.583 -5.267  9.377   1.00 0.00 ? 111 ARG A O    2  
ATOM 3648  C CB   . ARG A 1 111 ? -21.571 -6.720  7.280   1.00 0.00 ? 111 ARG A CB   2  
ATOM 3649  C CG   . ARG A 1 111 ? -22.261 -5.370  7.595   1.00 0.00 ? 111 ARG A CG   2  
ATOM 3650  C CD   . ARG A 1 111 ? -21.909 -4.239  6.618   1.00 0.00 ? 111 ARG A CD   2  
ATOM 3651  N NE   . ARG A 1 111 ? -22.775 -3.070  6.867   1.00 0.00 ? 111 ARG A NE   2  
ATOM 3652  C CZ   . ARG A 1 111 ? -22.530 -1.802  6.556   1.00 0.00 ? 111 ARG A CZ   2  
ATOM 3653  N NH1  . ARG A 1 111 ? -21.455 -1.436  5.895   1.00 0.00 ? 111 ARG A NH1  2  
ATOM 3654  N NH2  . ARG A 1 111 ? -23.386 -0.868  6.915   1.00 0.00 ? 111 ARG A NH2  2  
ATOM 3655  H H    . ARG A 1 111 ? -20.026 -8.801  7.024   1.00 0.00 ? 111 ARG A H    2  
ATOM 3656  H HA   . ARG A 1 111 ? -19.611 -5.934  7.005   1.00 0.00 ? 111 ARG A HA   2  
ATOM 3657  H HB2  . ARG A 1 111 ? -21.724 -6.961  6.226   1.00 0.00 ? 111 ARG A HB2  2  
ATOM 3658  H HB3  . ARG A 1 111 ? -22.041 -7.506  7.871   1.00 0.00 ? 111 ARG A HB3  2  
ATOM 3659  H HG2  . ARG A 1 111 ? -23.339 -5.532  7.556   1.00 0.00 ? 111 ARG A HG2  2  
ATOM 3660  H HG3  . ARG A 1 111 ? -22.006 -5.025  8.602   1.00 0.00 ? 111 ARG A HG3  2  
ATOM 3661  H HD2  . ARG A 1 111 ? -20.861 -3.965  6.756   1.00 0.00 ? 111 ARG A HD2  2  
ATOM 3662  H HD3  . ARG A 1 111 ? -22.057 -4.585  5.593   1.00 0.00 ? 111 ARG A HD3  2  
ATOM 3663  H HE   . ARG A 1 111 ? -23.663 -3.267  7.307   1.00 0.00 ? 111 ARG A HE   2  
ATOM 3664  H HH11 . ARG A 1 111 ? -20.798 -2.137  5.542   1.00 0.00 ? 111 ARG A HH11 2  
ATOM 3665  H HH12 . ARG A 1 111 ? -21.296 -0.469  5.662   1.00 0.00 ? 111 ARG A HH12 2  
ATOM 3666  H HH21 . ARG A 1 111 ? -24.219 -1.104  7.437   1.00 0.00 ? 111 ARG A HH21 2  
ATOM 3667  H HH22 . ARG A 1 111 ? -23.216 0.099   6.686   1.00 0.00 ? 111 ARG A HH22 2  
ATOM 3668  N N    . ASN A 1 112 ? -19.717 -7.407  9.941   1.00 0.00 ? 112 ASN A N    2  
ATOM 3669  C CA   . ASN A 1 112 ? -19.385 -7.201  11.364  1.00 0.00 ? 112 ASN A CA   2  
ATOM 3670  C C    . ASN A 1 112 ? -17.977 -6.589  11.518  1.00 0.00 ? 112 ASN A C    2  
ATOM 3671  O O    . ASN A 1 112 ? -17.780 -5.611  12.234  1.00 0.00 ? 112 ASN A O    2  
ATOM 3672  C CB   . ASN A 1 112 ? -19.538 -8.554  12.089  1.00 0.00 ? 112 ASN A CB   2  
ATOM 3673  C CG   . ASN A 1 112 ? -19.747 -8.450  13.598  1.00 0.00 ? 112 ASN A CG   2  
ATOM 3674  O OD1  . ASN A 1 112 ? -20.325 -7.506  14.115  1.00 0.00 ? 112 ASN A OD1  2  
ATOM 3675  N ND2  . ASN A 1 112 ? -19.324 -9.454  14.348  1.00 0.00 ? 112 ASN A ND2  2  
ATOM 3676  H H    . ASN A 1 112 ? -19.927 -8.341  9.601   1.00 0.00 ? 112 ASN A H    2  
ATOM 3677  H HA   . ASN A 1 112 ? -20.084 -6.479  11.785  1.00 0.00 ? 112 ASN A HA   2  
ATOM 3678  H HB2  . ASN A 1 112 ? -20.404 -9.081  11.690  1.00 0.00 ? 112 ASN A HB2  2  
ATOM 3679  H HB3  . ASN A 1 112 ? -18.659 -9.171  11.891  1.00 0.00 ? 112 ASN A HB3  2  
ATOM 3680  H HD21 . ASN A 1 112 ? -18.876 -10.253 13.925  1.00 0.00 ? 112 ASN A HD21 2  
ATOM 3681  H HD22 . ASN A 1 112 ? -19.468 -9.413  15.350  1.00 0.00 ? 112 ASN A HD22 2  
ATOM 3682  N N    . CYS A 1 113 ? -17.025 -7.086  10.726  1.00 0.00 ? 113 CYS A N    2  
ATOM 3683  C CA   . CYS A 1 113 ? -15.673 -6.558  10.545  1.00 0.00 ? 113 CYS A CA   2  
ATOM 3684  C C    . CYS A 1 113 ? -15.668 -5.150  9.905   1.00 0.00 ? 113 CYS A C    2  
ATOM 3685  O O    . CYS A 1 113 ? -15.029 -4.238  10.428  1.00 0.00 ? 113 CYS A O    2  
ATOM 3686  C CB   . CYS A 1 113 ? -14.931 -7.626  9.717   1.00 0.00 ? 113 CYS A CB   2  
ATOM 3687  S SG   . CYS A 1 113 ? -14.620 -9.071  10.758  1.00 0.00 ? 113 CYS A SG   2  
ATOM 3688  H H    . CYS A 1 113 ? -17.260 -7.921  10.207  1.00 0.00 ? 113 CYS A H    2  
ATOM 3689  H HA   . CYS A 1 113 ? -15.183 -6.462  11.518  1.00 0.00 ? 113 CYS A HA   2  
ATOM 3690  H HB2  . CYS A 1 113 ? -15.538 -7.940  8.863   1.00 0.00 ? 113 CYS A HB2  2  
ATOM 3691  H HB3  . CYS A 1 113 ? -13.977 -7.262  9.344   1.00 0.00 ? 113 CYS A HB3  2  
ATOM 3692  H HG   . CYS A 1 113 ? -14.323 -9.931  9.769   1.00 0.00 ? 113 CYS A HG   2  
ATOM 3693  N N    . GLU A 1 114 ? -16.403 -4.947  8.806   1.00 0.00 ? 114 GLU A N    2  
ATOM 3694  C CA   . GLU A 1 114 ? -16.533 -3.639  8.144   1.00 0.00 ? 114 GLU A CA   2  
ATOM 3695  C C    . GLU A 1 114 ? -17.179 -2.583  9.061   1.00 0.00 ? 114 GLU A C    2  
ATOM 3696  O O    . GLU A 1 114 ? -16.662 -1.481  9.199   1.00 0.00 ? 114 GLU A O    2  
ATOM 3697  C CB   . GLU A 1 114 ? -17.332 -3.817  6.846   1.00 0.00 ? 114 GLU A CB   2  
ATOM 3698  C CG   . GLU A 1 114 ? -17.392 -2.547  5.992   1.00 0.00 ? 114 GLU A CG   2  
ATOM 3699  C CD   . GLU A 1 114 ? -18.171 -2.815  4.697   1.00 0.00 ? 114 GLU A CD   2  
ATOM 3700  O OE1  . GLU A 1 114 ? -19.416 -2.940  4.764   1.00 0.00 ? 114 GLU A OE1  2  
ATOM 3701  O OE2  . GLU A 1 114 ? -17.546 -2.893  3.612   1.00 0.00 ? 114 GLU A OE2  2  
ATOM 3702  H H    . GLU A 1 114 ? -16.867 -5.749  8.384   1.00 0.00 ? 114 GLU A H    2  
ATOM 3703  H HA   . GLU A 1 114 ? -15.538 -3.285  7.875   1.00 0.00 ? 114 GLU A HA   2  
ATOM 3704  H HB2  . GLU A 1 114 ? -16.868 -4.606  6.254   1.00 0.00 ? 114 GLU A HB2  2  
ATOM 3705  H HB3  . GLU A 1 114 ? -18.347 -4.122  7.096   1.00 0.00 ? 114 GLU A HB3  2  
ATOM 3706  H HG2  . GLU A 1 114 ? -17.888 -1.748  6.547   1.00 0.00 ? 114 GLU A HG2  2  
ATOM 3707  H HG3  . GLU A 1 114 ? -16.376 -2.227  5.759   1.00 0.00 ? 114 GLU A HG3  2  
ATOM 3708  N N    . HIS A 1 115 ? -18.267 -2.932  9.749   1.00 0.00 ? 115 HIS A N    2  
ATOM 3709  C CA   . HIS A 1 115 ? -18.938 -2.141  10.787  1.00 0.00 ? 115 HIS A CA   2  
ATOM 3710  C C    . HIS A 1 115 ? -17.934 -1.706  11.875  1.00 0.00 ? 115 HIS A C    2  
ATOM 3711  O O    . HIS A 1 115 ? -17.889 -0.533  12.267  1.00 0.00 ? 115 HIS A O    2  
ATOM 3712  C CB   . HIS A 1 115 ? -20.069 -3.010  11.375  1.00 0.00 ? 115 HIS A CB   2  
ATOM 3713  C CG   . HIS A 1 115 ? -20.752 -2.471  12.606  1.00 0.00 ? 115 HIS A CG   2  
ATOM 3714  N ND1  . HIS A 1 115 ? -21.718 -1.491  12.655  1.00 0.00 ? 115 HIS A ND1  2  
ATOM 3715  C CD2  . HIS A 1 115 ? -20.607 -2.956  13.880  1.00 0.00 ? 115 HIS A CD2  2  
ATOM 3716  C CE1  . HIS A 1 115 ? -22.137 -1.385  13.929  1.00 0.00 ? 115 HIS A CE1  2  
ATOM 3717  N NE2  . HIS A 1 115 ? -21.475 -2.250  14.722  1.00 0.00 ? 115 HIS A NE2  2  
ATOM 3718  H H    . HIS A 1 115 ? -18.661 -3.844  9.556   1.00 0.00 ? 115 HIS A H    2  
ATOM 3719  H HA   . HIS A 1 115 ? -19.396 -1.265  10.326  1.00 0.00 ? 115 HIS A HA   2  
ATOM 3720  H HB2  . HIS A 1 115 ? -20.825 -3.167  10.603  1.00 0.00 ? 115 HIS A HB2  2  
ATOM 3721  H HB3  . HIS A 1 115 ? -19.671 -3.986  11.642  1.00 0.00 ? 115 HIS A HB3  2  
ATOM 3722  H HD1  . HIS A 1 115 ? -22.096 -0.974  11.873  1.00 0.00 ? 115 HIS A HD1  2  
ATOM 3723  H HD2  . HIS A 1 115 ? -19.947 -3.763  14.173  1.00 0.00 ? 115 HIS A HD2  2  
ATOM 3724  H HE1  . HIS A 1 115 ? -22.904 -0.696  14.266  1.00 0.00 ? 115 HIS A HE1  2  
ATOM 3725  N N    . PHE A 1 116 ? -17.090 -2.644  12.325  1.00 0.00 ? 116 PHE A N    2  
ATOM 3726  C CA   . PHE A 1 116 ? -16.000 -2.400  13.267  1.00 0.00 ? 116 PHE A CA   2  
ATOM 3727  C C    . PHE A 1 116 ? -14.976 -1.383  12.727  1.00 0.00 ? 116 PHE A C    2  
ATOM 3728  O O    . PHE A 1 116 ? -14.802 -0.332  13.346  1.00 0.00 ? 116 PHE A O    2  
ATOM 3729  C CB   . PHE A 1 116 ? -15.384 -3.759  13.653  1.00 0.00 ? 116 PHE A CB   2  
ATOM 3730  C CG   . PHE A 1 116 ? -13.940 -3.715  14.117  1.00 0.00 ? 116 PHE A CG   2  
ATOM 3731  C CD1  . PHE A 1 116 ? -13.606 -3.101  15.338  1.00 0.00 ? 116 PHE A CD1  2  
ATOM 3732  C CD2  . PHE A 1 116 ? -12.921 -4.260  13.309  1.00 0.00 ? 116 PHE A CD2  2  
ATOM 3733  C CE1  . PHE A 1 116 ? -12.264 -3.028  15.749  1.00 0.00 ? 116 PHE A CE1  2  
ATOM 3734  C CE2  . PHE A 1 116 ? -11.578 -4.196  13.725  1.00 0.00 ? 116 PHE A CE2  2  
ATOM 3735  C CZ   . PHE A 1 116 ? -11.249 -3.581  14.946  1.00 0.00 ? 116 PHE A CZ   2  
ATOM 3736  H H    . PHE A 1 116 ? -17.209 -3.597  11.990  1.00 0.00 ? 116 PHE A H    2  
ATOM 3737  H HA   . PHE A 1 116 ? -16.421 -1.960  14.172  1.00 0.00 ? 116 PHE A HA   2  
ATOM 3738  H HB2  . PHE A 1 116 ? -15.992 -4.200  14.440  1.00 0.00 ? 116 PHE A HB2  2  
ATOM 3739  H HB3  . PHE A 1 116 ? -15.468 -4.457  12.823  1.00 0.00 ? 116 PHE A HB3  2  
ATOM 3740  H HD1  . PHE A 1 116 ? -14.377 -2.672  15.958  1.00 0.00 ? 116 PHE A HD1  2  
ATOM 3741  H HD2  . PHE A 1 116 ? -13.165 -4.731  12.366  1.00 0.00 ? 116 PHE A HD2  2  
ATOM 3742  H HE1  . PHE A 1 116 ? -12.013 -2.540  16.682  1.00 0.00 ? 116 PHE A HE1  2  
ATOM 3743  H HE2  . PHE A 1 116 ? -10.799 -4.608  13.098  1.00 0.00 ? 116 PHE A HE2  2  
ATOM 3744  H HZ   . PHE A 1 116 ? -10.216 -3.516  15.259  1.00 0.00 ? 116 PHE A HZ   2  
ATOM 3745  N N    . VAL A 1 117 ? -14.330 -1.627  11.578  1.00 0.00 ? 117 VAL A N    2  
ATOM 3746  C CA   . VAL A 1 117 ? -13.305 -0.671  11.077  1.00 0.00 ? 117 VAL A CA   2  
ATOM 3747  C C    . VAL A 1 117 ? -13.890 0.670   10.628  1.00 0.00 ? 117 VAL A C    2  
ATOM 3748  O O    . VAL A 1 117 ? -13.210 1.695   10.734  1.00 0.00 ? 117 VAL A O    2  
ATOM 3749  C CB   . VAL A 1 117 ? -12.375 -1.222  9.979   1.00 0.00 ? 117 VAL A CB   2  
ATOM 3750  C CG1  . VAL A 1 117 ? -11.450 -2.283  10.575  1.00 0.00 ? 117 VAL A CG1  2  
ATOM 3751  C CG2  . VAL A 1 117 ? -13.112 -1.738  8.734   1.00 0.00 ? 117 VAL A CG2  2  
ATOM 3752  H H    . VAL A 1 117 ? -14.511 -2.511  11.093  1.00 0.00 ? 117 VAL A H    2  
ATOM 3753  H HA   . VAL A 1 117 ? -12.667 -0.448  11.932  1.00 0.00 ? 117 VAL A HA   2  
ATOM 3754  H HB   . VAL A 1 117 ? -11.739 -0.398  9.658   1.00 0.00 ? 117 VAL A HB   2  
ATOM 3755  H HG11 . VAL A 1 117 ? -10.673 -2.512  9.850   1.00 0.00 ? 117 VAL A HG11 2  
ATOM 3756  H HG12 . VAL A 1 117 ? -10.968 -1.910  11.479  1.00 0.00 ? 117 VAL A HG12 2  
ATOM 3757  H HG13 . VAL A 1 117 ? -12.018 -3.182  10.814  1.00 0.00 ? 117 VAL A HG13 2  
ATOM 3758  H HG21 . VAL A 1 117 ? -13.729 -2.593  8.993   1.00 0.00 ? 117 VAL A HG21 2  
ATOM 3759  H HG22 . VAL A 1 117 ? -13.743 -0.954  8.316   1.00 0.00 ? 117 VAL A HG22 2  
ATOM 3760  H HG23 . VAL A 1 117 ? -12.387 -2.040  7.979   1.00 0.00 ? 117 VAL A HG23 2  
ATOM 3761  N N    . THR A 1 118 ? -15.163 0.696   10.204  1.00 0.00 ? 118 THR A N    2  
ATOM 3762  C CA   . THR A 1 118 ? -15.873 1.958   9.969   1.00 0.00 ? 118 THR A CA   2  
ATOM 3763  C C    . THR A 1 118 ? -15.939 2.691   11.284  1.00 0.00 ? 118 THR A C    2  
ATOM 3764  O O    . THR A 1 118 ? -15.431 3.788   11.305  1.00 0.00 ? 118 THR A O    2  
ATOM 3765  C CB   . THR A 1 118 ? -17.273 1.799   9.359   1.00 0.00 ? 118 THR A CB   2  
ATOM 3766  O OG1  . THR A 1 118 ? -17.211 0.951   8.235   1.00 0.00 ? 118 THR A OG1  2  
ATOM 3767  C CG2  . THR A 1 118 ? -17.829 3.145   8.893   1.00 0.00 ? 118 THR A CG2  2  
ATOM 3768  H H    . THR A 1 118 ? -15.670 -0.180  10.103  1.00 0.00 ? 118 THR A H    2  
ATOM 3769  H HA   . THR A 1 118 ? -15.273 2.595   9.306   1.00 0.00 ? 118 THR A HA   2  
ATOM 3770  H HB   . THR A 1 118 ? -17.955 1.395   10.105  1.00 0.00 ? 118 THR A HB   2  
ATOM 3771  H HG1  . THR A 1 118 ? -16.991 0.054   8.552   1.00 0.00 ? 118 THR A HG1  2  
ATOM 3772  H HG21 . THR A 1 118 ? -17.134 3.621   8.202   1.00 0.00 ? 118 THR A HG21 2  
ATOM 3773  H HG22 . THR A 1 118 ? -18.786 2.994   8.395   1.00 0.00 ? 118 THR A HG22 2  
ATOM 3774  H HG23 . THR A 1 118 ? -17.980 3.806   9.746   1.00 0.00 ? 118 THR A HG23 2  
ATOM 3775  N N    . GLN A 1 119 ? -16.404 2.122   12.397  1.00 0.00 ? 119 GLN A N    2  
ATOM 3776  C CA   . GLN A 1 119 ? -16.412 2.834   13.691  1.00 0.00 ? 119 GLN A CA   2  
ATOM 3777  C C    . GLN A 1 119 ? -15.031 3.344   14.160  1.00 0.00 ? 119 GLN A C    2  
ATOM 3778  O O    . GLN A 1 119 ? -14.978 4.354   14.864  1.00 0.00 ? 119 GLN A O    2  
ATOM 3779  C CB   . GLN A 1 119 ? -17.088 1.964   14.756  1.00 0.00 ? 119 GLN A CB   2  
ATOM 3780  C CG   . GLN A 1 119 ? -18.617 2.063   14.619  1.00 0.00 ? 119 GLN A CG   2  
ATOM 3781  C CD   . GLN A 1 119 ? -19.337 0.920   15.326  1.00 0.00 ? 119 GLN A CD   2  
ATOM 3782  O OE1  . GLN A 1 119 ? -19.983 1.076   16.356  1.00 0.00 ? 119 GLN A OE1  2  
ATOM 3783  N NE2  . GLN A 1 119 ? -19.259 -0.266  14.771  1.00 0.00 ? 119 GLN A NE2  2  
ATOM 3784  H H    . GLN A 1 119 ? -16.764 1.172   12.353  1.00 0.00 ? 119 GLN A H    2  
ATOM 3785  H HA   . GLN A 1 119 ? -17.015 3.739   13.576  1.00 0.00 ? 119 GLN A HA   2  
ATOM 3786  H HB2  . GLN A 1 119 ? -16.756 0.931   14.649  1.00 0.00 ? 119 GLN A HB2  2  
ATOM 3787  H HB3  . GLN A 1 119 ? -16.811 2.308   15.753  1.00 0.00 ? 119 GLN A HB3  2  
ATOM 3788  H HG2  . GLN A 1 119 ? -18.953 3.019   15.020  1.00 0.00 ? 119 GLN A HG2  2  
ATOM 3789  H HG3  . GLN A 1 119 ? -18.895 2.026   13.564  1.00 0.00 ? 119 GLN A HG3  2  
ATOM 3790  H HE21 . GLN A 1 119 ? -18.764 -0.367  13.894  1.00 0.00 ? 119 GLN A HE21 2  
ATOM 3791  H HE22 . GLN A 1 119 ? -19.907 -0.985  15.078  1.00 0.00 ? 119 GLN A HE22 2  
ATOM 3792  N N    . LEU A 1 120 ? -13.916 2.732   13.731  1.00 0.00 ? 120 LEU A N    2  
ATOM 3793  C CA   . LEU A 1 120 ? -12.572 3.302   13.959  1.00 0.00 ? 120 LEU A CA   2  
ATOM 3794  C C    . LEU A 1 120 ? -12.324 4.594   13.151  1.00 0.00 ? 120 LEU A C    2  
ATOM 3795  O O    . LEU A 1 120 ? -11.623 5.489   13.624  1.00 0.00 ? 120 LEU A O    2  
ATOM 3796  C CB   . LEU A 1 120 ? -11.484 2.248   13.669  1.00 0.00 ? 120 LEU A CB   2  
ATOM 3797  C CG   . LEU A 1 120 ? -11.593 0.937   14.481  1.00 0.00 ? 120 LEU A CG   2  
ATOM 3798  C CD1  . LEU A 1 120 ? -10.401 0.034   14.139  1.00 0.00 ? 120 LEU A CD1  2  
ATOM 3799  C CD2  . LEU A 1 120 ? -11.616 1.201   15.992  1.00 0.00 ? 120 LEU A CD2  2  
ATOM 3800  H H    . LEU A 1 120 ? -14.005 1.855   13.223  1.00 0.00 ? 120 LEU A H    2  
ATOM 3801  H HA   . LEU A 1 120 ? -12.491 3.590   15.007  1.00 0.00 ? 120 LEU A HA   2  
ATOM 3802  H HB2  . LEU A 1 120 ? -11.489 2.002   12.606  1.00 0.00 ? 120 LEU A HB2  2  
ATOM 3803  H HB3  . LEU A 1 120 ? -10.514 2.699   13.895  1.00 0.00 ? 120 LEU A HB3  2  
ATOM 3804  H HG   . LEU A 1 120 ? -12.506 0.415   14.204  1.00 0.00 ? 120 LEU A HG   2  
ATOM 3805  H HD11 . LEU A 1 120 ? -9.472  0.514   14.440  1.00 0.00 ? 120 LEU A HD11 2  
ATOM 3806  H HD12 . LEU A 1 120 ? -10.499 -0.916  14.663  1.00 0.00 ? 120 LEU A HD12 2  
ATOM 3807  H HD13 . LEU A 1 120 ? -10.374 -0.155  13.064  1.00 0.00 ? 120 LEU A HD13 2  
ATOM 3808  H HD21 . LEU A 1 120 ? -10.763 1.820   16.267  1.00 0.00 ? 120 LEU A HD21 2  
ATOM 3809  H HD22 . LEU A 1 120 ? -12.533 1.720   16.265  1.00 0.00 ? 120 LEU A HD22 2  
ATOM 3810  H HD23 . LEU A 1 120 ? -11.576 0.259   16.537  1.00 0.00 ? 120 LEU A HD23 2  
ATOM 3811  N N    . ARG A 1 121 ? -12.898 4.706   11.945  1.00 0.00 ? 121 ARG A N    2  
ATOM 3812  C CA   . ARG A 1 121 ? -12.739 5.838   11.002  1.00 0.00 ? 121 ARG A CA   2  
ATOM 3813  C C    . ARG A 1 121 ? -13.946 6.794   10.877  1.00 0.00 ? 121 ARG A C    2  
ATOM 3814  O O    . ARG A 1 121 ? -13.789 7.917   10.405  1.00 0.00 ? 121 ARG A O    2  
ATOM 3815  C CB   . ARG A 1 121 ? -12.452 5.198   9.622   1.00 0.00 ? 121 ARG A CB   2  
ATOM 3816  C CG   . ARG A 1 121 ? -11.688 6.079   8.617   1.00 0.00 ? 121 ARG A CG   2  
ATOM 3817  C CD   . ARG A 1 121 ? -10.225 6.319   8.971   1.00 0.00 ? 121 ARG A CD   2  
ATOM 3818  N NE   . ARG A 1 121 ? -9.419  5.081   8.990   1.00 0.00 ? 121 ARG A NE   2  
ATOM 3819  C CZ   . ARG A 1 121 ? -8.097  5.021   8.844   1.00 0.00 ? 121 ARG A CZ   2  
ATOM 3820  N NH1  . ARG A 1 121 ? -7.393  6.004   8.323   1.00 0.00 ? 121 ARG A NH1  2  
ATOM 3821  N NH2  . ARG A 1 121 ? -7.441  3.961   9.261   1.00 0.00 ? 121 ARG A NH2  2  
ATOM 3822  H H    . ARG A 1 121 ? -13.417 3.891   11.612  1.00 0.00 ? 121 ARG A H    2  
ATOM 3823  H HA   . ARG A 1 121 ? -11.910 6.457   11.347  1.00 0.00 ? 121 ARG A HA   2  
ATOM 3824  H HB2  . ARG A 1 121 ? -11.889 4.274   9.758   1.00 0.00 ? 121 ARG A HB2  2  
ATOM 3825  H HB3  . ARG A 1 121 ? -13.404 4.916   9.170   1.00 0.00 ? 121 ARG A HB3  2  
ATOM 3826  H HG2  . ARG A 1 121 ? -11.727 5.613   7.633   1.00 0.00 ? 121 ARG A HG2  2  
ATOM 3827  H HG3  . ARG A 1 121 ? -12.165 7.055   8.565   1.00 0.00 ? 121 ARG A HG3  2  
ATOM 3828  H HD2  . ARG A 1 121 ? -9.816  7.025   8.251   1.00 0.00 ? 121 ARG A HD2  2  
ATOM 3829  H HD3  . ARG A 1 121 ? -10.196 6.771   9.957   1.00 0.00 ? 121 ARG A HD3  2  
ATOM 3830  H HE   . ARG A 1 121 ? -9.910  4.234   9.264   1.00 0.00 ? 121 ARG A HE   2  
ATOM 3831  H HH11 . ARG A 1 121 ? -7.841  6.815   7.895   1.00 0.00 ? 121 ARG A HH11 2  
ATOM 3832  H HH12 . ARG A 1 121 ? -6.388  5.941   8.279   1.00 0.00 ? 121 ARG A HH12 2  
ATOM 3833  H HH21 . ARG A 1 121 ? -7.918  3.209   9.734   1.00 0.00 ? 121 ARG A HH21 2  
ATOM 3834  H HH22 . ARG A 1 121 ? -6.423  3.957   9.272   1.00 0.00 ? 121 ARG A HH22 2  
ATOM 3835  N N    . TYR A 1 122 ? -15.109 6.400   11.390  1.00 0.00 ? 122 TYR A N    2  
ATOM 3836  C CA   . TYR A 1 122 ? -16.442 7.000   11.215  1.00 0.00 ? 122 TYR A CA   2  
ATOM 3837  C C    . TYR A 1 122 ? -16.505 8.471   11.664  1.00 0.00 ? 122 TYR A C    2  
ATOM 3838  O O    . TYR A 1 122 ? -17.367 9.237   11.227  1.00 0.00 ? 122 TYR A O    2  
ATOM 3839  C CB   . TYR A 1 122 ? -17.442 6.150   12.029  1.00 0.00 ? 122 TYR A CB   2  
ATOM 3840  C CG   . TYR A 1 122 ? -18.926 6.471   11.963  1.00 0.00 ? 122 TYR A CG   2  
ATOM 3841  C CD1  . TYR A 1 122 ? -19.517 7.029   10.807  1.00 0.00 ? 122 TYR A CD1  2  
ATOM 3842  C CD2  . TYR A 1 122 ? -19.747 6.109   13.052  1.00 0.00 ? 122 TYR A CD2  2  
ATOM 3843  C CE1  . TYR A 1 122 ? -20.902 7.277   10.764  1.00 0.00 ? 122 TYR A CE1  2  
ATOM 3844  C CE2  . TYR A 1 122 ? -21.133 6.349   13.014  1.00 0.00 ? 122 TYR A CE2  2  
ATOM 3845  C CZ   . TYR A 1 122 ? -21.715 6.942   11.871  1.00 0.00 ? 122 TYR A CZ   2  
ATOM 3846  O OH   . TYR A 1 122 ? -23.055 7.179   11.822  1.00 0.00 ? 122 TYR A OH   2  
ATOM 3847  H H    . TYR A 1 122 ? -15.105 5.492   11.829  1.00 0.00 ? 122 TYR A H    2  
ATOM 3848  H HA   . TYR A 1 122 ? -16.705 6.889   10.159  1.00 0.00 ? 122 TYR A HA   2  
ATOM 3849  H HB2  . TYR A 1 122 ? -17.372 5.123   11.688  1.00 0.00 ? 122 TYR A HB2  2  
ATOM 3850  H HB3  . TYR A 1 122 ? -17.128 6.173   13.077  1.00 0.00 ? 122 TYR A HB3  2  
ATOM 3851  H HD1  . TYR A 1 122 ? -18.912 7.268   9.944   1.00 0.00 ? 122 TYR A HD1  2  
ATOM 3852  H HD2  . TYR A 1 122 ? -19.314 5.627   13.919  1.00 0.00 ? 122 TYR A HD2  2  
ATOM 3853  H HE1  . TYR A 1 122 ? -21.352 7.707   9.881   1.00 0.00 ? 122 TYR A HE1  2  
ATOM 3854  H HE2  . TYR A 1 122 ? -21.751 6.073   13.859  1.00 0.00 ? 122 TYR A HE2  2  
ATOM 3855  H HH   . TYR A 1 122 ? -23.503 6.907   12.631  1.00 0.00 ? 122 TYR A HH   2  
ATOM 3856  N N    . GLY A 1 123 ? -15.567 8.869   12.535  1.00 0.00 ? 123 GLY A N    2  
ATOM 3857  C CA   . GLY A 1 123 ? -15.592 10.163  13.237  1.00 0.00 ? 123 GLY A CA   2  
ATOM 3858  C C    . GLY A 1 123 ? -15.295 11.389  12.367  1.00 0.00 ? 123 GLY A C    2  
ATOM 3859  O O    . GLY A 1 123 ? -15.539 12.508  12.815  1.00 0.00 ? 123 GLY A O    2  
ATOM 3860  H H    . GLY A 1 123 ? -14.849 8.185   12.765  1.00 0.00 ? 123 GLY A H    2  
ATOM 3861  H HA2  . GLY A 1 123 ? -16.589 10.309  13.659  1.00 0.00 ? 123 GLY A HA2  2  
ATOM 3862  H HA3  . GLY A 1 123 ? -14.875 10.139  14.053  1.00 0.00 ? 123 GLY A HA3  2  
ATOM 3863  N N    . LYS A 1 124 ? -14.805 11.199  11.132  1.00 0.00 ? 124 LYS A N    2  
ATOM 3864  C CA   . LYS A 1 124 ? -14.670 12.288  10.139  1.00 0.00 ? 124 LYS A CA   2  
ATOM 3865  C C    . LYS A 1 124 ? -15.167 11.918  8.718   1.00 0.00 ? 124 LYS A C    2  
ATOM 3866  O O    . LYS A 1 124 ? -15.038 12.723  7.790   1.00 0.00 ? 124 LYS A O    2  
ATOM 3867  C CB   . LYS A 1 124 ? -13.208 12.793  10.164  1.00 0.00 ? 124 LYS A CB   2  
ATOM 3868  C CG   . LYS A 1 124 ? -13.104 14.290  9.815   1.00 0.00 ? 124 LYS A CG   2  
ATOM 3869  C CD   . LYS A 1 124 ? -11.648 14.778  9.832   1.00 0.00 ? 124 LYS A CD   2  
ATOM 3870  C CE   . LYS A 1 124 ? -11.543 16.311  9.748   1.00 0.00 ? 124 LYS A CE   2  
ATOM 3871  N NZ   . LYS A 1 124 ? -12.019 16.868  8.450   1.00 0.00 ? 124 LYS A NZ   2  
ATOM 3872  H H    . LYS A 1 124 ? -14.549 10.256  10.862  1.00 0.00 ? 124 LYS A H    2  
ATOM 3873  H HA   . LYS A 1 124 ? -15.314 13.113  10.450  1.00 0.00 ? 124 LYS A HA   2  
ATOM 3874  H HB2  . LYS A 1 124 ? -12.810 12.665  11.172  1.00 0.00 ? 124 LYS A HB2  2  
ATOM 3875  H HB3  . LYS A 1 124 ? -12.601 12.200  9.476   1.00 0.00 ? 124 LYS A HB3  2  
ATOM 3876  H HG2  . LYS A 1 124 ? -13.529 14.473  8.828   1.00 0.00 ? 124 LYS A HG2  2  
ATOM 3877  H HG3  . LYS A 1 124 ? -13.676 14.856  10.550  1.00 0.00 ? 124 LYS A HG3  2  
ATOM 3878  H HD2  . LYS A 1 124 ? -11.186 14.466  10.771  1.00 0.00 ? 124 LYS A HD2  2  
ATOM 3879  H HD3  . LYS A 1 124 ? -11.094 14.320  9.008   1.00 0.00 ? 124 LYS A HD3  2  
ATOM 3880  H HE2  . LYS A 1 124 ? -12.119 16.746  10.570  1.00 0.00 ? 124 LYS A HE2  2  
ATOM 3881  H HE3  . LYS A 1 124 ? -10.496 16.592  9.898   1.00 0.00 ? 124 LYS A HE3  2  
ATOM 3882  H HZ1  . LYS A 1 124 ? -11.921 17.876  8.439   1.00 0.00 ? 124 LYS A HZ1  2  
ATOM 3883  H HZ2  . LYS A 1 124 ? -11.483 16.503  7.672   1.00 0.00 ? 124 LYS A HZ2  2  
ATOM 3884  H HZ3  . LYS A 1 124 ? -12.997 16.660  8.296   1.00 0.00 ? 124 LYS A HZ3  2  
ATOM 3885  N N    . SER A 1 125 ? -15.713 10.708  8.534   1.00 0.00 ? 125 SER A N    2  
ATOM 3886  C CA   . SER A 1 125 ? -16.282 10.213  7.262   1.00 0.00 ? 125 SER A CA   2  
ATOM 3887  C C    . SER A 1 125 ? -17.501 11.024  6.797   1.00 0.00 ? 125 SER A C    2  
ATOM 3888  O O    . SER A 1 125 ? -18.408 11.292  7.622   1.00 0.00 ? 125 SER A O    2  
ATOM 3889  C CB   . SER A 1 125 ? -16.676 8.741   7.384   1.00 0.00 ? 125 SER A CB   2  
ATOM 3890  O OG   . SER A 1 125 ? -15.532 7.976   7.721   1.00 0.00 ? 125 SER A OG   2  
ATOM 3891  O OXT  . SER A 1 125 ? -17.551 11.391  5.599   1.00 0.00 ? 125 SER A OXT  2  
ATOM 3892  H H    . SER A 1 125 ? -15.828 10.113  9.341   1.00 0.00 ? 125 SER A H    2  
ATOM 3893  H HA   . SER A 1 125 ? -15.531 10.294  6.478   1.00 0.00 ? 125 SER A HA   2  
ATOM 3894  H HB2  . SER A 1 125 ? -17.443 8.626   8.153   1.00 0.00 ? 125 SER A HB2  2  
ATOM 3895  H HB3  . SER A 1 125 ? -17.086 8.400   6.431   1.00 0.00 ? 125 SER A HB3  2  
ATOM 3896  H HG   . SER A 1 125 ? -14.799 8.229   7.119   1.00 0.00 ? 125 SER A HG   2  
ATOM 3897  N N    . MET A 1 1   ? 16.580  -10.103 1.408   1.00 0.00 ? 1   MET A N    3  
ATOM 3898  C CA   . MET A 1 1   ? 15.166  -9.771  1.751   1.00 0.00 ? 1   MET A CA   3  
ATOM 3899  C C    . MET A 1 1   ? 14.771  -10.403 3.096   1.00 0.00 ? 1   MET A C    3  
ATOM 3900  O O    . MET A 1 1   ? 15.048  -11.581 3.330   1.00 0.00 ? 1   MET A O    3  
ATOM 3901  C CB   . MET A 1 1   ? 14.201  -10.196 0.619   1.00 0.00 ? 1   MET A CB   3  
ATOM 3902  C CG   . MET A 1 1   ? 12.760  -9.714  0.836   1.00 0.00 ? 1   MET A CG   3  
ATOM 3903  S SD   . MET A 1 1   ? 11.602  -10.181 -0.481  1.00 0.00 ? 1   MET A SD   3  
ATOM 3904  C CE   . MET A 1 1   ? 10.059  -9.563  0.250   1.00 0.00 ? 1   MET A CE   3  
ATOM 3905  H H1   . MET A 1 1   ? 16.697  -11.102 1.306   1.00 0.00 ? 1   MET A H1   3  
ATOM 3906  H H2   . MET A 1 1   ? 16.846  -9.663  0.537   1.00 0.00 ? 1   MET A H2   3  
ATOM 3907  H H3   . MET A 1 1   ? 17.209  -9.784  2.130   1.00 0.00 ? 1   MET A H3   3  
ATOM 3908  H HA   . MET A 1 1   ? 15.094  -8.685  1.855   1.00 0.00 ? 1   MET A HA   3  
ATOM 3909  H HB2  . MET A 1 1   ? 14.555  -9.784  -0.329  1.00 0.00 ? 1   MET A HB2  3  
ATOM 3910  H HB3  . MET A 1 1   ? 14.198  -11.285 0.531   1.00 0.00 ? 1   MET A HB3  3  
ATOM 3911  H HG2  . MET A 1 1   ? 12.387  -10.131 1.767   1.00 0.00 ? 1   MET A HG2  3  
ATOM 3912  H HG3  . MET A 1 1   ? 12.759  -8.627  0.924   1.00 0.00 ? 1   MET A HG3  3  
ATOM 3913  H HE1  . MET A 1 1   ? 9.877   -10.063 1.202   1.00 0.00 ? 1   MET A HE1  3  
ATOM 3914  H HE2  . MET A 1 1   ? 10.128  -8.486  0.414   1.00 0.00 ? 1   MET A HE2  3  
ATOM 3915  H HE3  . MET A 1 1   ? 9.228   -9.771  -0.420  1.00 0.00 ? 1   MET A HE3  3  
ATOM 3916  N N    . ALA A 1 2   ? 14.132  -9.631  3.988   1.00 0.00 ? 2   ALA A N    3  
ATOM 3917  C CA   . ALA A 1 2   ? 13.615  -10.099 5.282   1.00 0.00 ? 2   ALA A CA   3  
ATOM 3918  C C    . ALA A 1 2   ? 12.259  -10.834 5.151   1.00 0.00 ? 2   ALA A C    3  
ATOM 3919  O O    . ALA A 1 2   ? 11.670  -10.904 4.072   1.00 0.00 ? 2   ALA A O    3  
ATOM 3920  C CB   . ALA A 1 2   ? 13.532  -8.883  6.221   1.00 0.00 ? 2   ALA A CB   3  
ATOM 3921  H H    . ALA A 1 2   ? 13.934  -8.669  3.741   1.00 0.00 ? 2   ALA A H    3  
ATOM 3922  H HA   . ALA A 1 2   ? 14.318  -10.810 5.721   1.00 0.00 ? 2   ALA A HA   3  
ATOM 3923  H HB1  . ALA A 1 2   ? 14.509  -8.403  6.296   1.00 0.00 ? 2   ALA A HB1  3  
ATOM 3924  H HB2  . ALA A 1 2   ? 12.813  -8.162  5.834   1.00 0.00 ? 2   ALA A HB2  3  
ATOM 3925  H HB3  . ALA A 1 2   ? 13.228  -9.196  7.222   1.00 0.00 ? 2   ALA A HB3  3  
ATOM 3926  N N    . SER A 1 3   ? 11.740  -11.373 6.257   1.00 0.00 ? 3   SER A N    3  
ATOM 3927  C CA   . SER A 1 3   ? 10.474  -12.132 6.279   1.00 0.00 ? 3   SER A CA   3  
ATOM 3928  C C    . SER A 1 3   ? 9.213   -11.337 5.859   1.00 0.00 ? 3   SER A C    3  
ATOM 3929  O O    . SER A 1 3   ? 8.372   -11.926 5.167   1.00 0.00 ? 3   SER A O    3  
ATOM 3930  C CB   . SER A 1 3   ? 10.253  -12.776 7.661   1.00 0.00 ? 3   SER A CB   3  
ATOM 3931  O OG   . SER A 1 3   ? 11.390  -13.529 8.067   1.00 0.00 ? 3   SER A OG   3  
ATOM 3932  H H    . SER A 1 3   ? 12.288  -11.353 7.108   1.00 0.00 ? 3   SER A H    3  
ATOM 3933  H HA   . SER A 1 3   ? 10.560  -12.950 5.562   1.00 0.00 ? 3   SER A HA   3  
ATOM 3934  H HB2  . SER A 1 3   ? 10.051  -12.001 8.401   1.00 0.00 ? 3   SER A HB2  3  
ATOM 3935  H HB3  . SER A 1 3   ? 9.381   -13.435 7.610   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3936  H HG   . SER A 1 3   ? 11.197  -13.941 8.927   1.00 0.00 ? 3   SER A HG   3  
ATOM 3937  N N    . PRO A 1 4   ? 9.038   -10.040 6.218   1.00 0.00 ? 4   PRO A N    3  
ATOM 3938  C CA   . PRO A 1 4   ? 7.889   -9.244  5.785   1.00 0.00 ? 4   PRO A CA   3  
ATOM 3939  C C    . PRO A 1 4   ? 7.820   -9.073  4.264   1.00 0.00 ? 4   PRO A C    3  
ATOM 3940  O O    . PRO A 1 4   ? 8.831   -8.867  3.595   1.00 0.00 ? 4   PRO A O    3  
ATOM 3941  C CB   . PRO A 1 4   ? 8.004   -7.887  6.490   1.00 0.00 ? 4   PRO A CB   3  
ATOM 3942  C CG   . PRO A 1 4   ? 8.867   -8.197  7.710   1.00 0.00 ? 4   PRO A CG   3  
ATOM 3943  C CD   . PRO A 1 4   ? 9.817   -9.266  7.179   1.00 0.00 ? 4   PRO A CD   3  
ATOM 3944  H HA   . PRO A 1 4   ? 6.982   -9.738  6.138   1.00 0.00 ? 4   PRO A HA   3  
ATOM 3945  H HB2  . PRO A 1 4   ? 8.525   -7.174  5.849   1.00 0.00 ? 4   PRO A HB2  3  
ATOM 3946  H HB3  . PRO A 1 4   ? 7.026   -7.501  6.774   1.00 0.00 ? 4   PRO A HB3  3  
ATOM 3947  H HG2  . PRO A 1 4   ? 9.405   -7.315  8.058   1.00 0.00 ? 4   PRO A HG2  3  
ATOM 3948  H HG3  . PRO A 1 4   ? 8.251   -8.617  8.505   1.00 0.00 ? 4   PRO A HG3  3  
ATOM 3949  H HD2  . PRO A 1 4   ? 10.651  -8.787  6.661   1.00 0.00 ? 4   PRO A HD2  3  
ATOM 3950  H HD3  . PRO A 1 4   ? 10.189  -9.878  7.999   1.00 0.00 ? 4   PRO A HD3  3  
ATOM 3951  N N    . HIS A 1 5   ? 6.600   -9.118  3.726   1.00 0.00 ? 5   HIS A N    3  
ATOM 3952  C CA   . HIS A 1 5   ? 6.267   -8.870  2.312   1.00 0.00 ? 5   HIS A CA   3  
ATOM 3953  C C    . HIS A 1 5   ? 5.295   -7.667  2.164   1.00 0.00 ? 5   HIS A C    3  
ATOM 3954  O O    . HIS A 1 5   ? 4.627   -7.501  1.141   1.00 0.00 ? 5   HIS A O    3  
ATOM 3955  C CB   . HIS A 1 5   ? 5.702   -10.174 1.711   1.00 0.00 ? 5   HIS A CB   3  
ATOM 3956  C CG   . HIS A 1 5   ? 6.741   -11.241 1.450   1.00 0.00 ? 5   HIS A CG   3  
ATOM 3957  N ND1  . HIS A 1 5   ? 7.581   -11.835 2.367   1.00 0.00 ? 5   HIS A ND1  3  
ATOM 3958  C CD2  . HIS A 1 5   ? 7.016   -11.813 0.233   1.00 0.00 ? 5   HIS A CD2  3  
ATOM 3959  C CE1  . HIS A 1 5   ? 8.339   -12.737 1.720   1.00 0.00 ? 5   HIS A CE1  3  
ATOM 3960  N NE2  . HIS A 1 5   ? 8.031   -12.765 0.408   1.00 0.00 ? 5   HIS A NE2  3  
ATOM 3961  H H    . HIS A 1 5   ? 5.811   -9.259  4.362   1.00 0.00 ? 5   HIS A H    3  
ATOM 3962  H HA   . HIS A 1 5   ? 7.170   -8.600  1.759   1.00 0.00 ? 5   HIS A HA   3  
ATOM 3963  H HB2  . HIS A 1 5   ? 4.933   -10.576 2.376   1.00 0.00 ? 5   HIS A HB2  3  
ATOM 3964  H HB3  . HIS A 1 5   ? 5.219   -9.944  0.761   1.00 0.00 ? 5   HIS A HB3  3  
ATOM 3965  H HD1  . HIS A 1 5   ? 7.642   -11.627 3.361   1.00 0.00 ? 5   HIS A HD1  3  
ATOM 3966  H HD2  . HIS A 1 5   ? 6.521   -11.573 -0.702  1.00 0.00 ? 5   HIS A HD2  3  
ATOM 3967  H HE1  . HIS A 1 5   ? 9.096   -13.351 2.200   1.00 0.00 ? 5   HIS A HE1  3  
ATOM 3968  N N    . GLN A 1 6   ? 5.195   -6.843  3.214   1.00 0.00 ? 6   GLN A N    3  
ATOM 3969  C CA   . GLN A 1 6   ? 4.279   -5.714  3.388   1.00 0.00 ? 6   GLN A CA   3  
ATOM 3970  C C    . GLN A 1 6   ? 4.821   -4.766  4.478   1.00 0.00 ? 6   GLN A C    3  
ATOM 3971  O O    . GLN A 1 6   ? 5.805   -5.083  5.153   1.00 0.00 ? 6   GLN A O    3  
ATOM 3972  C CB   . GLN A 1 6   ? 2.852   -6.212  3.725   1.00 0.00 ? 6   GLN A CB   3  
ATOM 3973  C CG   . GLN A 1 6   ? 2.682   -6.904  5.095   1.00 0.00 ? 6   GLN A CG   3  
ATOM 3974  C CD   . GLN A 1 6   ? 3.119   -8.374  5.101   1.00 0.00 ? 6   GLN A CD   3  
ATOM 3975  O OE1  . GLN A 1 6   ? 4.272   -8.716  5.334   1.00 0.00 ? 6   GLN A OE1  3  
ATOM 3976  N NE2  . GLN A 1 6   ? 2.232   -9.306  4.815   1.00 0.00 ? 6   GLN A NE2  3  
ATOM 3977  H H    . GLN A 1 6   ? 5.810   -7.024  4.000   1.00 0.00 ? 6   GLN A H    3  
ATOM 3978  H HA   . GLN A 1 6   ? 4.229   -5.147  2.453   1.00 0.00 ? 6   GLN A HA   3  
ATOM 3979  H HB2  . GLN A 1 6   ? 2.180   -5.350  3.704   1.00 0.00 ? 6   GLN A HB2  3  
ATOM 3980  H HB3  . GLN A 1 6   ? 2.510   -6.891  2.945   1.00 0.00 ? 6   GLN A HB3  3  
ATOM 3981  H HG2  . GLN A 1 6   ? 3.226   -6.357  5.866   1.00 0.00 ? 6   GLN A HG2  3  
ATOM 3982  H HG3  . GLN A 1 6   ? 1.627   -6.857  5.364   1.00 0.00 ? 6   GLN A HG3  3  
ATOM 3983  H HE21 . GLN A 1 6   ? 1.255   -9.066  4.673   1.00 0.00 ? 6   GLN A HE21 3  
ATOM 3984  H HE22 . GLN A 1 6   ? 2.536   -10.267 4.841   1.00 0.00 ? 6   GLN A HE22 3  
ATOM 3985  N N    . GLU A 1 7   ? 4.146   -3.632  4.701   1.00 0.00 ? 7   GLU A N    3  
ATOM 3986  C CA   . GLU A 1 7   ? 4.403   -2.733  5.835   1.00 0.00 ? 7   GLU A CA   3  
ATOM 3987  C C    . GLU A 1 7   ? 3.072   -2.148  6.354   1.00 0.00 ? 7   GLU A C    3  
ATOM 3988  O O    . GLU A 1 7   ? 2.307   -1.606  5.547   1.00 0.00 ? 7   GLU A O    3  
ATOM 3989  C CB   . GLU A 1 7   ? 5.365   -1.612  5.405   1.00 0.00 ? 7   GLU A CB   3  
ATOM 3990  C CG   . GLU A 1 7   ? 5.838   -0.766  6.593   1.00 0.00 ? 7   GLU A CG   3  
ATOM 3991  C CD   . GLU A 1 7   ? 6.820   0.320   6.137   1.00 0.00 ? 7   GLU A CD   3  
ATOM 3992  O OE1  . GLU A 1 7   ? 6.362   1.370   5.629   1.00 0.00 ? 7   GLU A OE1  3  
ATOM 3993  O OE2  . GLU A 1 7   ? 8.052   0.129   6.280   1.00 0.00 ? 7   GLU A OE2  3  
ATOM 3994  H H    . GLU A 1 7   ? 3.359   -3.398  4.104   1.00 0.00 ? 7   GLU A H    3  
ATOM 3995  H HA   . GLU A 1 7   ? 4.892   -3.307  6.620   1.00 0.00 ? 7   GLU A HA   3  
ATOM 3996  H HB2  . GLU A 1 7   ? 6.242   -2.062  4.937   1.00 0.00 ? 7   GLU A HB2  3  
ATOM 3997  H HB3  . GLU A 1 7   ? 4.873   -0.968  4.674   1.00 0.00 ? 7   GLU A HB3  3  
ATOM 3998  H HG2  . GLU A 1 7   ? 4.981   -0.290  7.071   1.00 0.00 ? 7   GLU A HG2  3  
ATOM 3999  H HG3  . GLU A 1 7   ? 6.320   -1.416  7.325   1.00 0.00 ? 7   GLU A HG3  3  
ATOM 4000  N N    . PRO A 1 8   ? 2.781   -2.240  7.668   1.00 0.00 ? 8   PRO A N    3  
ATOM 4001  C CA   . PRO A 1 8   ? 1.588   -1.653  8.274   1.00 0.00 ? 8   PRO A CA   3  
ATOM 4002  C C    . PRO A 1 8   ? 1.747   -0.132  8.419   1.00 0.00 ? 8   PRO A C    3  
ATOM 4003  O O    . PRO A 1 8   ? 2.831   0.364   8.728   1.00 0.00 ? 8   PRO A O    3  
ATOM 4004  C CB   . PRO A 1 8   ? 1.439   -2.351  9.626   1.00 0.00 ? 8   PRO A CB   3  
ATOM 4005  C CG   . PRO A 1 8   ? 2.889   -2.631  10.022  1.00 0.00 ? 8   PRO A CG   3  
ATOM 4006  C CD   . PRO A 1 8   ? 3.552   -2.950  8.684   1.00 0.00 ? 8   PRO A CD   3  
ATOM 4007  H HA   . PRO A 1 8   ? 0.711   -1.870  7.661   1.00 0.00 ? 8   PRO A HA   3  
ATOM 4008  H HB2  . PRO A 1 8   ? 0.926   -1.723  10.356  1.00 0.00 ? 8   PRO A HB2  3  
ATOM 4009  H HB3  . PRO A 1 8   ? 0.911   -3.298  9.495   1.00 0.00 ? 8   PRO A HB3  3  
ATOM 4010  H HG2  . PRO A 1 8   ? 3.336   -1.729  10.436  1.00 0.00 ? 8   PRO A HG2  3  
ATOM 4011  H HG3  . PRO A 1 8   ? 2.976   -3.456  10.726  1.00 0.00 ? 8   PRO A HG3  3  
ATOM 4012  H HD2  . PRO A 1 8   ? 4.592   -2.616  8.705   1.00 0.00 ? 8   PRO A HD2  3  
ATOM 4013  H HD3  . PRO A 1 8   ? 3.504   -4.023  8.497   1.00 0.00 ? 8   PRO A HD3  3  
ATOM 4014  N N    . LYS A 1 9   ? 0.657   0.610   8.194   1.00 0.00 ? 9   LYS A N    3  
ATOM 4015  C CA   . LYS A 1 9   ? 0.647   2.081   8.179   1.00 0.00 ? 9   LYS A CA   3  
ATOM 4016  C C    . LYS A 1 9   ? -0.223  2.660   9.323   1.00 0.00 ? 9   LYS A C    3  
ATOM 4017  O O    . LYS A 1 9   ? -1.308  2.126   9.578   1.00 0.00 ? 9   LYS A O    3  
ATOM 4018  C CB   . LYS A 1 9   ? 0.130   2.559   6.808   1.00 0.00 ? 9   LYS A CB   3  
ATOM 4019  C CG   . LYS A 1 9   ? 0.876   2.022   5.571   1.00 0.00 ? 9   LYS A CG   3  
ATOM 4020  C CD   . LYS A 1 9   ? 2.387   2.295   5.584   1.00 0.00 ? 9   LYS A CD   3  
ATOM 4021  C CE   . LYS A 1 9   ? 2.970   2.030   4.187   1.00 0.00 ? 9   LYS A CE   3  
ATOM 4022  N NZ   . LYS A 1 9   ? 4.368   2.520   4.060   1.00 0.00 ? 9   LYS A NZ   3  
ATOM 4023  H H    . LYS A 1 9   ? -0.215  0.141   7.982   1.00 0.00 ? 9   LYS A H    3  
ATOM 4024  H HA   . LYS A 1 9   ? 1.668   2.441   8.307   1.00 0.00 ? 9   LYS A HA   3  
ATOM 4025  H HB2  . LYS A 1 9   ? -0.913  2.266   6.709   1.00 0.00 ? 9   LYS A HB2  3  
ATOM 4026  H HB3  . LYS A 1 9   ? 0.171   3.651   6.784   1.00 0.00 ? 9   LYS A HB3  3  
ATOM 4027  H HG2  . LYS A 1 9   ? 0.714   0.947   5.482   1.00 0.00 ? 9   LYS A HG2  3  
ATOM 4028  H HG3  . LYS A 1 9   ? 0.437   2.496   4.691   1.00 0.00 ? 9   LYS A HG3  3  
ATOM 4029  H HD2  . LYS A 1 9   ? 2.554   3.337   5.866   1.00 0.00 ? 9   LYS A HD2  3  
ATOM 4030  H HD3  . LYS A 1 9   ? 2.869   1.637   6.308   1.00 0.00 ? 9   LYS A HD3  3  
ATOM 4031  H HE2  . LYS A 1 9   ? 2.925   0.955   3.983   1.00 0.00 ? 9   LYS A HE2  3  
ATOM 4032  H HE3  . LYS A 1 9   ? 2.342   2.537   3.444   1.00 0.00 ? 9   LYS A HE3  3  
ATOM 4033  H HZ1  . LYS A 1 9   ? 4.734   2.340   3.133   1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 4034  H HZ2  . LYS A 1 9   ? 4.424   3.516   4.223   1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 4035  H HZ3  . LYS A 1 9   ? 4.993   2.062   4.724   1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 4036  N N    . PRO A 1 10  ? 0.210   3.741   10.012  1.00 0.00 ? 10  PRO A N    3  
ATOM 4037  C CA   . PRO A 1 10  ? -0.503  4.304   11.158  1.00 0.00 ? 10  PRO A CA   3  
ATOM 4038  C C    . PRO A 1 10  ? -1.880  4.824   10.754  1.00 0.00 ? 10  PRO A C    3  
ATOM 4039  O O    . PRO A 1 10  ? -2.023  5.551   9.773   1.00 0.00 ? 10  PRO A O    3  
ATOM 4040  C CB   . PRO A 1 10  ? 0.401   5.390   11.745  1.00 0.00 ? 10  PRO A CB   3  
ATOM 4041  C CG   . PRO A 1 10  ? 1.239   5.819   10.546  1.00 0.00 ? 10  PRO A CG   3  
ATOM 4042  C CD   . PRO A 1 10  ? 1.415   4.519   9.759   1.00 0.00 ? 10  PRO A CD   3  
ATOM 4043  H HA   . PRO A 1 10  ? -0.652  3.557   11.931  1.00 0.00 ? 10  PRO A HA   3  
ATOM 4044  H HB2  . PRO A 1 10  ? -0.185  6.220   12.148  1.00 0.00 ? 10  PRO A HB2  3  
ATOM 4045  H HB3  . PRO A 1 10  ? 1.050   4.947   12.508  1.00 0.00 ? 10  PRO A HB3  3  
ATOM 4046  H HG2  . PRO A 1 10  ? 0.667   6.534   9.950   1.00 0.00 ? 10  PRO A HG2  3  
ATOM 4047  H HG3  . PRO A 1 10  ? 2.198   6.242   10.848  1.00 0.00 ? 10  PRO A HG3  3  
ATOM 4048  H HD2  . PRO A 1 10  ? 1.540   4.737   8.697   1.00 0.00 ? 10  PRO A HD2  3  
ATOM 4049  H HD3  . PRO A 1 10  ? 2.282   3.972   10.138  1.00 0.00 ? 10  PRO A HD3  3  
ATOM 4050  N N    . GLY A 1 11  ? -2.887  4.405   11.524  1.00 0.00 ? 11  GLY A N    3  
ATOM 4051  C CA   . GLY A 1 11  ? -4.295  4.782   11.386  1.00 0.00 ? 11  GLY A CA   3  
ATOM 4052  C C    . GLY A 1 11  ? -5.033  4.134   10.215  1.00 0.00 ? 11  GLY A C    3  
ATOM 4053  O O    . GLY A 1 11  ? -6.235  4.343   10.067  1.00 0.00 ? 11  GLY A O    3  
ATOM 4054  H H    . GLY A 1 11  ? -2.654  3.774   12.283  1.00 0.00 ? 11  GLY A H    3  
ATOM 4055  H HA2  . GLY A 1 11  ? -4.817  4.483   12.291  1.00 0.00 ? 11  GLY A HA2  3  
ATOM 4056  H HA3  . GLY A 1 11  ? -4.362  5.856   11.277  1.00 0.00 ? 11  GLY A HA3  3  
ATOM 4057  N N    . ASP A 1 12  ? -4.332  3.348   9.399   1.00 0.00 ? 12  ASP A N    3  
ATOM 4058  C CA   . ASP A 1 12  ? -4.925  2.489   8.381   1.00 0.00 ? 12  ASP A CA   3  
ATOM 4059  C C    . ASP A 1 12  ? -5.247  1.106   8.967   1.00 0.00 ? 12  ASP A C    3  
ATOM 4060  O O    . ASP A 1 12  ? -4.786  0.738   10.054  1.00 0.00 ? 12  ASP A O    3  
ATOM 4061  C CB   . ASP A 1 12  ? -4.012  2.392   7.153   1.00 0.00 ? 12  ASP A CB   3  
ATOM 4062  C CG   . ASP A 1 12  ? -3.953  3.717   6.374   1.00 0.00 ? 12  ASP A CG   3  
ATOM 4063  O OD1  . ASP A 1 12  ? -5.014  4.135   5.850   1.00 0.00 ? 12  ASP A OD1  3  
ATOM 4064  O OD2  . ASP A 1 12  ? -2.851  4.305   6.253   1.00 0.00 ? 12  ASP A OD2  3  
ATOM 4065  H H    . ASP A 1 12  ? -3.353  3.220   9.612   1.00 0.00 ? 12  ASP A H    3  
ATOM 4066  H HA   . ASP A 1 12  ? -5.871  2.921   8.053   1.00 0.00 ? 12  ASP A HA   3  
ATOM 4067  H HB2  . ASP A 1 12  ? -3.018  2.076   7.467   1.00 0.00 ? 12  ASP A HB2  3  
ATOM 4068  H HB3  . ASP A 1 12  ? -4.402  1.630   6.480   1.00 0.00 ? 12  ASP A HB3  3  
ATOM 4069  N N    . LEU A 1 13  ? -6.071  0.348   8.242   1.00 0.00 ? 13  LEU A N    3  
ATOM 4070  C CA   . LEU A 1 13  ? -6.595  -0.941  8.691   1.00 0.00 ? 13  LEU A CA   3  
ATOM 4071  C C    . LEU A 1 13  ? -6.199  -2.097  7.777   1.00 0.00 ? 13  LEU A C    3  
ATOM 4072  O O    . LEU A 1 13  ? -5.988  -1.948  6.572   1.00 0.00 ? 13  LEU A O    3  
ATOM 4073  C CB   . LEU A 1 13  ? -8.103  -0.841  8.971   1.00 0.00 ? 13  LEU A CB   3  
ATOM 4074  C CG   . LEU A 1 13  ? -8.983  -0.287  7.830   1.00 0.00 ? 13  LEU A CG   3  
ATOM 4075  C CD1  . LEU A 1 13  ? -9.541  -1.428  6.974   1.00 0.00 ? 13  LEU A CD1  3  
ATOM 4076  C CD2  . LEU A 1 13  ? -10.110 0.557   8.439   1.00 0.00 ? 13  LEU A CD2  3  
ATOM 4077  H H    . LEU A 1 13  ? -6.352  0.676   7.330   1.00 0.00 ? 13  LEU A H    3  
ATOM 4078  H HA   . LEU A 1 13  ? -6.123  -1.164  9.647   1.00 0.00 ? 13  LEU A HA   3  
ATOM 4079  H HB2  . LEU A 1 13  ? -8.478  -1.816  9.293   1.00 0.00 ? 13  LEU A HB2  3  
ATOM 4080  H HB3  . LEU A 1 13  ? -8.212  -0.191  9.834   1.00 0.00 ? 13  LEU A HB3  3  
ATOM 4081  H HG   . LEU A 1 13  ? -8.403  0.366   7.181   1.00 0.00 ? 13  LEU A HG   3  
ATOM 4082  H HD11 . LEU A 1 13  ? -8.722  -2.004  6.548   1.00 0.00 ? 13  LEU A HD11 3  
ATOM 4083  H HD12 . LEU A 1 13  ? -10.162 -2.086  7.580   1.00 0.00 ? 13  LEU A HD12 3  
ATOM 4084  H HD13 . LEU A 1 13  ? -10.144 -1.027  6.164   1.00 0.00 ? 13  LEU A HD13 3  
ATOM 4085  H HD21 . LEU A 1 13  ? -9.697  1.487   8.837   1.00 0.00 ? 13  LEU A HD21 3  
ATOM 4086  H HD22 . LEU A 1 13  ? -10.848 0.802   7.682   1.00 0.00 ? 13  LEU A HD22 3  
ATOM 4087  H HD23 . LEU A 1 13  ? -10.584 0.012   9.255   1.00 0.00 ? 13  LEU A HD23 3  
ATOM 4088  N N    . ILE A 1 14  ? -6.058  -3.248  8.419   1.00 0.00 ? 14  ILE A N    3  
ATOM 4089  C CA   . ILE A 1 14  ? -5.354  -4.442  7.961   1.00 0.00 ? 14  ILE A CA   3  
ATOM 4090  C C    . ILE A 1 14  ? -6.331  -5.617  7.999   1.00 0.00 ? 14  ILE A C    3  
ATOM 4091  O O    . ILE A 1 14  ? -6.974  -5.839  9.027   1.00 0.00 ? 14  ILE A O    3  
ATOM 4092  C CB   . ILE A 1 14  ? -4.156  -4.712  8.915   1.00 0.00 ? 14  ILE A CB   3  
ATOM 4093  C CG1  . ILE A 1 14  ? -3.150  -3.537  8.957   1.00 0.00 ? 14  ILE A CG1  3  
ATOM 4094  C CG2  . ILE A 1 14  ? -3.409  -5.998  8.519   1.00 0.00 ? 14  ILE A CG2  3  
ATOM 4095  C CD1  . ILE A 1 14  ? -2.192  -3.588  10.154  1.00 0.00 ? 14  ILE A CD1  3  
ATOM 4096  H H    . ILE A 1 14  ? -6.331  -3.247  9.398   1.00 0.00 ? 14  ILE A H    3  
ATOM 4097  H HA   . ILE A 1 14  ? -4.995  -4.298  6.943   1.00 0.00 ? 14  ILE A HA   3  
ATOM 4098  H HB   . ILE A 1 14  ? -4.554  -4.852  9.922   1.00 0.00 ? 14  ILE A HB   3  
ATOM 4099  H HG12 . ILE A 1 14  ? -2.566  -3.538  8.037   1.00 0.00 ? 14  ILE A HG12 3  
ATOM 4100  H HG13 . ILE A 1 14  ? -3.676  -2.584  9.021   1.00 0.00 ? 14  ILE A HG13 3  
ATOM 4101  H HG21 . ILE A 1 14  ? -2.633  -6.229  9.250   1.00 0.00 ? 14  ILE A HG21 3  
ATOM 4102  H HG22 . ILE A 1 14  ? -4.087  -6.849  8.488   1.00 0.00 ? 14  ILE A HG22 3  
ATOM 4103  H HG23 . ILE A 1 14  ? -2.953  -5.871  7.537   1.00 0.00 ? 14  ILE A HG23 3  
ATOM 4104  H HD11 . ILE A 1 14  ? -2.763  -3.587  11.083  1.00 0.00 ? 14  ILE A HD11 3  
ATOM 4105  H HD12 . ILE A 1 14  ? -1.561  -4.474  10.106  1.00 0.00 ? 14  ILE A HD12 3  
ATOM 4106  H HD13 . ILE A 1 14  ? -1.556  -2.705  10.132  1.00 0.00 ? 14  ILE A HD13 3  
ATOM 4107  N N    . GLU A 1 15  ? -6.419  -6.372  6.907   1.00 0.00 ? 15  GLU A N    3  
ATOM 4108  C CA   . GLU A 1 15  ? -7.128  -7.645  6.870   1.00 0.00 ? 15  GLU A CA   3  
ATOM 4109  C C    . GLU A 1 15  ? -6.130  -8.737  7.272   1.00 0.00 ? 15  GLU A C    3  
ATOM 4110  O O    . GLU A 1 15  ? -5.079  -8.887  6.644   1.00 0.00 ? 15  GLU A O    3  
ATOM 4111  C CB   . GLU A 1 15  ? -7.706  -7.890  5.469   1.00 0.00 ? 15  GLU A CB   3  
ATOM 4112  C CG   . GLU A 1 15  ? -8.578  -9.151  5.428   1.00 0.00 ? 15  GLU A CG   3  
ATOM 4113  C CD   . GLU A 1 15  ? -9.340  -9.278  4.094   1.00 0.00 ? 15  GLU A CD   3  
ATOM 4114  O OE1  . GLU A 1 15  ? -8.735  -9.090  3.011   1.00 0.00 ? 15  GLU A OE1  3  
ATOM 4115  O OE2  . GLU A 1 15  ? -10.558 -9.580  4.124   1.00 0.00 ? 15  GLU A OE2  3  
ATOM 4116  H H    . GLU A 1 15  ? -5.828  -6.145  6.114   1.00 0.00 ? 15  GLU A H    3  
ATOM 4117  H HA   . GLU A 1 15  ? -7.955  -7.626  7.583   1.00 0.00 ? 15  GLU A HA   3  
ATOM 4118  H HB2  . GLU A 1 15  ? -8.321  -7.037  5.188   1.00 0.00 ? 15  GLU A HB2  3  
ATOM 4119  H HB3  . GLU A 1 15  ? -6.895  -7.981  4.745   1.00 0.00 ? 15  GLU A HB3  3  
ATOM 4120  H HG2  . GLU A 1 15  ? -7.953  -10.035 5.565   1.00 0.00 ? 15  GLU A HG2  3  
ATOM 4121  H HG3  . GLU A 1 15  ? -9.298  -9.105  6.249   1.00 0.00 ? 15  GLU A HG3  3  
ATOM 4122  N N    . ILE A 1 16  ? -6.436  -9.470  8.341   1.00 0.00 ? 16  ILE A N    3  
ATOM 4123  C CA   . ILE A 1 16  ? -5.599  -10.531 8.914   1.00 0.00 ? 16  ILE A CA   3  
ATOM 4124  C C    . ILE A 1 16  ? -6.286  -11.876 8.668   1.00 0.00 ? 16  ILE A C    3  
ATOM 4125  O O    . ILE A 1 16  ? -7.443  -12.083 9.045   1.00 0.00 ? 16  ILE A O    3  
ATOM 4126  C CB   . ILE A 1 16  ? -5.342  -10.267 10.420  1.00 0.00 ? 16  ILE A CB   3  
ATOM 4127  C CG1  . ILE A 1 16  ? -4.684  -8.879  10.632  1.00 0.00 ? 16  ILE A CG1  3  
ATOM 4128  C CG2  . ILE A 1 16  ? -4.452  -11.389 10.994  1.00 0.00 ? 16  ILE A CG2  3  
ATOM 4129  C CD1  . ILE A 1 16  ? -4.483  -8.473  12.096  1.00 0.00 ? 16  ILE A CD1  3  
ATOM 4130  H H    . ILE A 1 16  ? -7.310  -9.265  8.821   1.00 0.00 ? 16  ILE A H    3  
ATOM 4131  H HA   . ILE A 1 16  ? -4.632  -10.560 8.409   1.00 0.00 ? 16  ILE A HA   3  
ATOM 4132  H HB   . ILE A 1 16  ? -6.299  -10.277 10.946  1.00 0.00 ? 16  ILE A HB   3  
ATOM 4133  H HG12 . ILE A 1 16  ? -3.717  -8.859  10.129  1.00 0.00 ? 16  ILE A HG12 3  
ATOM 4134  H HG13 . ILE A 1 16  ? -5.309  -8.110  10.183  1.00 0.00 ? 16  ILE A HG13 3  
ATOM 4135  H HG21 . ILE A 1 16  ? -3.496  -11.407 10.470  1.00 0.00 ? 16  ILE A HG21 3  
ATOM 4136  H HG22 . ILE A 1 16  ? -4.277  -11.231 12.059  1.00 0.00 ? 16  ILE A HG22 3  
ATOM 4137  H HG23 . ILE A 1 16  ? -4.942  -12.355 10.888  1.00 0.00 ? 16  ILE A HG23 3  
ATOM 4138  H HD11 . ILE A 1 16  ? -4.095  -7.454  12.135  1.00 0.00 ? 16  ILE A HD11 3  
ATOM 4139  H HD12 . ILE A 1 16  ? -5.437  -8.514  12.623  1.00 0.00 ? 16  ILE A HD12 3  
ATOM 4140  H HD13 . ILE A 1 16  ? -3.764  -9.128  12.583  1.00 0.00 ? 16  ILE A HD13 3  
ATOM 4141  N N    . PHE A 1 17  ? -5.571  -12.800 8.027   1.00 0.00 ? 17  PHE A N    3  
ATOM 4142  C CA   . PHE A 1 17  ? -6.075  -14.096 7.577   1.00 0.00 ? 17  PHE A CA   3  
ATOM 4143  C C    . PHE A 1 17  ? -5.857  -15.144 8.679   1.00 0.00 ? 17  PHE A C    3  
ATOM 4144  O O    . PHE A 1 17  ? -5.064  -16.075 8.515   1.00 0.00 ? 17  PHE A O    3  
ATOM 4145  C CB   . PHE A 1 17  ? -5.397  -14.452 6.237   1.00 0.00 ? 17  PHE A CB   3  
ATOM 4146  C CG   . PHE A 1 17  ? -5.744  -13.544 5.062   1.00 0.00 ? 17  PHE A CG   3  
ATOM 4147  C CD1  . PHE A 1 17  ? -5.225  -12.237 4.979   1.00 0.00 ? 17  PHE A CD1  3  
ATOM 4148  C CD2  . PHE A 1 17  ? -6.586  -14.017 4.035   1.00 0.00 ? 17  PHE A CD2  3  
ATOM 4149  C CE1  . PHE A 1 17  ? -5.565  -11.399 3.902   1.00 0.00 ? 17  PHE A CE1  3  
ATOM 4150  C CE2  . PHE A 1 17  ? -6.923  -13.183 2.953   1.00 0.00 ? 17  PHE A CE2  3  
ATOM 4151  C CZ   . PHE A 1 17  ? -6.419  -11.871 2.889   1.00 0.00 ? 17  PHE A CZ   3  
ATOM 4152  H H    . PHE A 1 17  ? -4.609  -12.579 7.793   1.00 0.00 ? 17  PHE A H    3  
ATOM 4153  H HA   . PHE A 1 17  ? -7.149  -14.027 7.409   1.00 0.00 ? 17  PHE A HA   3  
ATOM 4154  H HB2  . PHE A 1 17  ? -4.314  -14.447 6.375   1.00 0.00 ? 17  PHE A HB2  3  
ATOM 4155  H HB3  . PHE A 1 17  ? -5.678  -15.473 5.970   1.00 0.00 ? 17  PHE A HB3  3  
ATOM 4156  H HD1  . PHE A 1 17  ? -4.567  -11.864 5.747   1.00 0.00 ? 17  PHE A HD1  3  
ATOM 4157  H HD2  . PHE A 1 17  ? -6.986  -15.022 4.080   1.00 0.00 ? 17  PHE A HD2  3  
ATOM 4158  H HE1  . PHE A 1 17  ? -5.179  -10.388 3.858   1.00 0.00 ? 17  PHE A HE1  3  
ATOM 4159  H HE2  . PHE A 1 17  ? -7.575  -13.552 2.173   1.00 0.00 ? 17  PHE A HE2  3  
ATOM 4160  H HZ   . PHE A 1 17  ? -6.687  -11.230 2.061   1.00 0.00 ? 17  PHE A HZ   3  
ATOM 4161  N N    . ARG A 1 18  ? -6.522  -14.948 9.828   1.00 0.00 ? 18  ARG A N    3  
ATOM 4162  C CA   . ARG A 1 18  ? -6.276  -15.712 11.061  1.00 0.00 ? 18  ARG A CA   3  
ATOM 4163  C C    . ARG A 1 18  ? -6.353  -17.235 10.889  1.00 0.00 ? 18  ARG A C    3  
ATOM 4164  O O    . ARG A 1 18  ? -5.375  -17.925 11.176  1.00 0.00 ? 18  ARG A O    3  
ATOM 4165  C CB   . ARG A 1 18  ? -7.156  -15.205 12.228  1.00 0.00 ? 18  ARG A CB   3  
ATOM 4166  C CG   . ARG A 1 18  ? -6.297  -14.664 13.388  1.00 0.00 ? 18  ARG A CG   3  
ATOM 4167  C CD   . ARG A 1 18  ? -5.468  -15.749 14.095  1.00 0.00 ? 18  ARG A CD   3  
ATOM 4168  N NE   . ARG A 1 18  ? -4.449  -15.149 14.973  1.00 0.00 ? 18  ARG A NE   3  
ATOM 4169  C CZ   . ARG A 1 18  ? -3.587  -15.796 15.749  1.00 0.00 ? 18  ARG A CZ   3  
ATOM 4170  N NH1  . ARG A 1 18  ? -3.578  -17.111 15.847  1.00 0.00 ? 18  ARG A NH1  3  
ATOM 4171  N NH2  . ARG A 1 18  ? -2.708  -15.111 16.448  1.00 0.00 ? 18  ARG A NH2  3  
ATOM 4172  H H    . ARG A 1 18  ? -7.144  -14.149 9.876   1.00 0.00 ? 18  ARG A H    3  
ATOM 4173  H HA   . ARG A 1 18  ? -5.249  -15.515 11.341  1.00 0.00 ? 18  ARG A HA   3  
ATOM 4174  H HB2  . ARG A 1 18  ? -7.804  -14.400 11.882  1.00 0.00 ? 18  ARG A HB2  3  
ATOM 4175  H HB3  . ARG A 1 18  ? -7.798  -16.002 12.602  1.00 0.00 ? 18  ARG A HB3  3  
ATOM 4176  H HG2  . ARG A 1 18  ? -5.628  -13.898 12.994  1.00 0.00 ? 18  ARG A HG2  3  
ATOM 4177  H HG3  . ARG A 1 18  ? -6.952  -14.196 14.123  1.00 0.00 ? 18  ARG A HG3  3  
ATOM 4178  H HD2  . ARG A 1 18  ? -6.139  -16.382 14.682  1.00 0.00 ? 18  ARG A HD2  3  
ATOM 4179  H HD3  . ARG A 1 18  ? -4.959  -16.366 13.355  1.00 0.00 ? 18  ARG A HD3  3  
ATOM 4180  H HE   . ARG A 1 18  ? -4.360  -14.137 14.938  1.00 0.00 ? 18  ARG A HE   3  
ATOM 4181  H HH11 . ARG A 1 18  ? -4.235  -17.666 15.324  1.00 0.00 ? 18  ARG A HH11 3  
ATOM 4182  H HH12 . ARG A 1 18  ? -2.916  -17.580 16.447  1.00 0.00 ? 18  ARG A HH12 3  
ATOM 4183  H HH21 . ARG A 1 18  ? -2.687  -14.102 16.388  1.00 0.00 ? 18  ARG A HH21 3  
ATOM 4184  H HH22 . ARG A 1 18  ? -2.055  -15.574 17.063  1.00 0.00 ? 18  ARG A HH22 3  
ATOM 4185  N N    . LEU A 1 19  ? -7.507  -17.771 10.490  1.00 0.00 ? 19  LEU A N    3  
ATOM 4186  C CA   . LEU A 1 19  ? -7.807  -19.201 10.659  1.00 0.00 ? 19  LEU A CA   3  
ATOM 4187  C C    . LEU A 1 19  ? -8.720  -19.662 9.513   1.00 0.00 ? 19  LEU A C    3  
ATOM 4188  O O    . LEU A 1 19  ? -8.422  -19.366 8.356   1.00 0.00 ? 19  LEU A O    3  
ATOM 4189  C CB   . LEU A 1 19  ? -8.342  -19.371 12.109  1.00 0.00 ? 19  LEU A CB   3  
ATOM 4190  C CG   . LEU A 1 19  ? -7.277  -19.541 13.219  1.00 0.00 ? 19  LEU A CG   3  
ATOM 4191  C CD1  . LEU A 1 19  ? -7.981  -19.646 14.578  1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4192  C CD2  . LEU A 1 19  ? -6.397  -20.785 13.011  1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4193  H H    . LEU A 1 19  ? -8.270  -17.154 10.216  1.00 0.00 ? 19  LEU A H    3  
ATOM 4194  H HA   . LEU A 1 19  ? -6.897  -19.794 10.533  1.00 0.00 ? 19  LEU A HA   3  
ATOM 4195  H HB2  . LEU A 1 19  ? -8.918  -18.472 12.347  1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4196  H HB3  . LEU A 1 19  ? -8.997  -20.237 12.173  1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4197  H HG   . LEU A 1 19  ? -6.643  -18.657 13.258  1.00 0.00 ? 19  LEU A HG   3  
ATOM 4198  H HD11 . LEU A 1 19  ? -7.247  -19.811 15.369  1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4199  H HD12 . LEU A 1 19  ? -8.510  -18.718 14.786  1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4200  H HD13 . LEU A 1 19  ? -8.697  -20.467 14.572  1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4201  H HD21 . LEU A 1 19  ? -5.746  -20.650 12.146  1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4202  H HD22 . LEU A 1 19  ? -5.766  -20.947 13.884  1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4203  H HD23 . LEU A 1 19  ? -7.017  -21.667 12.853  1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4204  N N    . GLY A 1 20  ? -9.842  -20.335 9.794   1.00 0.00 ? 20  GLY A N    3  
ATOM 4205  C CA   . GLY A 1 20  ? -10.894 -20.634 8.806   1.00 0.00 ? 20  GLY A CA   3  
ATOM 4206  C C    . GLY A 1 20  ? -11.770 -19.406 8.523   1.00 0.00 ? 20  GLY A C    3  
ATOM 4207  O O    . GLY A 1 20  ? -12.975 -19.537 8.312   1.00 0.00 ? 20  GLY A O    3  
ATOM 4208  H H    . GLY A 1 20  ? -10.031 -20.568 10.758  1.00 0.00 ? 20  GLY A H    3  
ATOM 4209  H HA2  . GLY A 1 20  ? -10.441 -20.942 7.862   1.00 0.00 ? 20  GLY A HA2  3  
ATOM 4210  H HA3  . GLY A 1 20  ? -11.528 -21.434 9.185   1.00 0.00 ? 20  GLY A HA3  3  
ATOM 4211  N N    . TYR A 1 21  ? -11.153 -18.222 8.567   1.00 0.00 ? 21  TYR A N    3  
ATOM 4212  C CA   . TYR A 1 21  ? -11.744 -16.885 8.547   1.00 0.00 ? 21  TYR A CA   3  
ATOM 4213  C C    . TYR A 1 21  ? -10.671 -15.780 8.484   1.00 0.00 ? 21  TYR A C    3  
ATOM 4214  O O    . TYR A 1 21  ? -9.525  -15.977 8.905   1.00 0.00 ? 21  TYR A O    3  
ATOM 4215  C CB   . TYR A 1 21  ? -12.651 -16.678 9.773   1.00 0.00 ? 21  TYR A CB   3  
ATOM 4216  C CG   . TYR A 1 21  ? -12.027 -16.886 11.144  1.00 0.00 ? 21  TYR A CG   3  
ATOM 4217  C CD1  . TYR A 1 21  ? -11.303 -15.844 11.759  1.00 0.00 ? 21  TYR A CD1  3  
ATOM 4218  C CD2  . TYR A 1 21  ? -12.252 -18.089 11.841  1.00 0.00 ? 21  TYR A CD2  3  
ATOM 4219  C CE1  . TYR A 1 21  ? -10.832 -15.993 13.077  1.00 0.00 ? 21  TYR A CE1  3  
ATOM 4220  C CE2  . TYR A 1 21  ? -11.792 -18.239 13.163  1.00 0.00 ? 21  TYR A CE2  3  
ATOM 4221  C CZ   . TYR A 1 21  ? -11.098 -17.182 13.793  1.00 0.00 ? 21  TYR A CZ   3  
ATOM 4222  O OH   . TYR A 1 21  ? -10.704 -17.298 15.091  1.00 0.00 ? 21  TYR A OH   3  
ATOM 4223  H H    . TYR A 1 21  ? -10.147 -18.251 8.653   1.00 0.00 ? 21  TYR A H    3  
ATOM 4224  H HA   . TYR A 1 21  ? -12.361 -16.798 7.651   1.00 0.00 ? 21  TYR A HA   3  
ATOM 4225  H HB2  . TYR A 1 21  ? -13.026 -15.657 9.741   1.00 0.00 ? 21  TYR A HB2  3  
ATOM 4226  H HB3  . TYR A 1 21  ? -13.510 -17.338 9.683   1.00 0.00 ? 21  TYR A HB3  3  
ATOM 4227  H HD1  . TYR A 1 21  ? -11.134 -14.916 11.230  1.00 0.00 ? 21  TYR A HD1  3  
ATOM 4228  H HD2  . TYR A 1 21  ? -12.812 -18.888 11.373  1.00 0.00 ? 21  TYR A HD2  3  
ATOM 4229  H HE1  . TYR A 1 21  ? -10.299 -15.185 13.560  1.00 0.00 ? 21  TYR A HE1  3  
ATOM 4230  H HE2  . TYR A 1 21  ? -11.985 -19.151 13.706  1.00 0.00 ? 21  TYR A HE2  3  
ATOM 4231  H HH   . TYR A 1 21  ? -11.023 -18.126 15.502  1.00 0.00 ? 21  TYR A HH   3  
ATOM 4232  N N    . GLU A 1 22  ? -11.085 -14.597 8.022   1.00 0.00 ? 22  GLU A N    3  
ATOM 4233  C CA   . GLU A 1 22  ? -10.319 -13.349 8.049   1.00 0.00 ? 22  GLU A CA   3  
ATOM 4234  C C    . GLU A 1 22  ? -10.989 -12.346 9.010   1.00 0.00 ? 22  GLU A C    3  
ATOM 4235  O O    . GLU A 1 22  ? -12.201 -12.407 9.226   1.00 0.00 ? 22  GLU A O    3  
ATOM 4236  C CB   . GLU A 1 22  ? -10.237 -12.713 6.648   1.00 0.00 ? 22  GLU A CB   3  
ATOM 4237  C CG   . GLU A 1 22  ? -9.630  -13.597 5.549   1.00 0.00 ? 22  GLU A CG   3  
ATOM 4238  C CD   . GLU A 1 22  ? -10.575 -14.705 5.055   1.00 0.00 ? 22  GLU A CD   3  
ATOM 4239  O OE1  . GLU A 1 22  ? -11.675 -14.394 4.537   1.00 0.00 ? 22  GLU A OE1  3  
ATOM 4240  O OE2  . GLU A 1 22  ? -10.219 -15.903 5.163   1.00 0.00 ? 22  GLU A OE2  3  
ATOM 4241  H H    . GLU A 1 22  ? -12.051 -14.521 7.729   1.00 0.00 ? 22  GLU A H    3  
ATOM 4242  H HA   . GLU A 1 22  ? -9.308  -13.550 8.398   1.00 0.00 ? 22  GLU A HA   3  
ATOM 4243  H HB2  . GLU A 1 22  ? -11.230 -12.388 6.339   1.00 0.00 ? 22  GLU A HB2  3  
ATOM 4244  H HB3  . GLU A 1 22  ? -9.614  -11.821 6.730   1.00 0.00 ? 22  GLU A HB3  3  
ATOM 4245  H HG2  . GLU A 1 22  ? -9.375  -12.958 4.702   1.00 0.00 ? 22  GLU A HG2  3  
ATOM 4246  H HG3  . GLU A 1 22  ? -8.708  -14.037 5.919   1.00 0.00 ? 22  GLU A HG3  3  
ATOM 4247  N N    . HIS A 1 23  ? -10.229 -11.392 9.554   1.00 0.00 ? 23  HIS A N    3  
ATOM 4248  C CA   . HIS A 1 23  ? -10.768 -10.304 10.388  1.00 0.00 ? 23  HIS A CA   3  
ATOM 4249  C C    . HIS A 1 23  ? -9.934  -9.007  10.296  1.00 0.00 ? 23  HIS A C    3  
ATOM 4250  O O    . HIS A 1 23  ? -8.807  -9.016  9.794   1.00 0.00 ? 23  HIS A O    3  
ATOM 4251  C CB   . HIS A 1 23  ? -10.968 -10.790 11.840  1.00 0.00 ? 23  HIS A CB   3  
ATOM 4252  C CG   . HIS A 1 23  ? -9.717  -10.895 12.682  1.00 0.00 ? 23  HIS A CG   3  
ATOM 4253  N ND1  . HIS A 1 23  ? -9.567  -10.384 13.951  1.00 0.00 ? 23  HIS A ND1  3  
ATOM 4254  C CD2  . HIS A 1 23  ? -8.550  -11.541 12.371  1.00 0.00 ? 23  HIS A CD2  3  
ATOM 4255  C CE1  . HIS A 1 23  ? -8.335  -10.701 14.385  1.00 0.00 ? 23  HIS A CE1  3  
ATOM 4256  N NE2  . HIS A 1 23  ? -7.671  -11.406 13.453  1.00 0.00 ? 23  HIS A NE2  3  
ATOM 4257  H H    . HIS A 1 23  ? -9.228  -11.389 9.360   1.00 0.00 ? 23  HIS A H    3  
ATOM 4258  H HA   . HIS A 1 23  ? -11.757 -10.050 9.997   1.00 0.00 ? 23  HIS A HA   3  
ATOM 4259  H HB2  . HIS A 1 23  ? -11.648 -10.099 12.338  1.00 0.00 ? 23  HIS A HB2  3  
ATOM 4260  H HB3  . HIS A 1 23  ? -11.459 -11.765 11.830  1.00 0.00 ? 23  HIS A HB3  3  
ATOM 4261  H HD1  . HIS A 1 23  ? -10.289 -9.913  14.492  1.00 0.00 ? 23  HIS A HD1  3  
ATOM 4262  H HD2  . HIS A 1 23  ? -8.351  -12.085 11.456  1.00 0.00 ? 23  HIS A HD2  3  
ATOM 4263  H HE1  . HIS A 1 23  ? -7.937  -10.441 15.359  1.00 0.00 ? 23  HIS A HE1  3  
ATOM 4264  N N    . TRP A 1 24  ? -10.499 -7.883  10.756  1.00 0.00 ? 24  TRP A N    3  
ATOM 4265  C CA   . TRP A 1 24  ? -9.895  -6.550  10.632  1.00 0.00 ? 24  TRP A CA   3  
ATOM 4266  C C    . TRP A 1 24  ? -9.148  -6.083  11.890  1.00 0.00 ? 24  TRP A C    3  
ATOM 4267  O O    . TRP A 1 24  ? -9.560  -6.360  13.021  1.00 0.00 ? 24  TRP A O    3  
ATOM 4268  C CB   . TRP A 1 24  ? -10.986 -5.520  10.311  1.00 0.00 ? 24  TRP A CB   3  
ATOM 4269  C CG   . TRP A 1 24  ? -11.626 -5.621  8.965   1.00 0.00 ? 24  TRP A CG   3  
ATOM 4270  C CD1  . TRP A 1 24  ? -12.915 -5.948  8.747   1.00 0.00 ? 24  TRP A CD1  3  
ATOM 4271  C CD2  . TRP A 1 24  ? -11.059 -5.331  7.651   1.00 0.00 ? 24  TRP A CD2  3  
ATOM 4272  N NE1  . TRP A 1 24  ? -13.182 -5.914  7.391   1.00 0.00 ? 24  TRP A NE1  3  
ATOM 4273  C CE2  . TRP A 1 24  ? -12.075 -5.522  6.665   1.00 0.00 ? 24  TRP A CE2  3  
ATOM 4274  C CE3  . TRP A 1 24  ? -9.797  -4.900  7.192   1.00 0.00 ? 24  TRP A CE3  3  
ATOM 4275  C CZ2  . TRP A 1 24  ? -11.848 -5.300  5.299   1.00 0.00 ? 24  TRP A CZ2  3  
ATOM 4276  C CZ3  . TRP A 1 24  ? -9.556  -4.668  5.823   1.00 0.00 ? 24  TRP A CZ3  3  
ATOM 4277  C CH2  . TRP A 1 24  ? -10.576 -4.870  4.876   1.00 0.00 ? 24  TRP A CH2  3  
ATOM 4278  H H    . TRP A 1 24  ? -11.420 -7.936  11.168  1.00 0.00 ? 24  TRP A H    3  
ATOM 4279  H HA   . TRP A 1 24  ? -9.190  -6.555  9.803   1.00 0.00 ? 24  TRP A HA   3  
ATOM 4280  H HB2  . TRP A 1 24  ? -11.769 -5.572  11.072  1.00 0.00 ? 24  TRP A HB2  3  
ATOM 4281  H HB3  . TRP A 1 24  ? -10.543 -4.526  10.376  1.00 0.00 ? 24  TRP A HB3  3  
ATOM 4282  H HD1  . TRP A 1 24  ? -13.628 -6.174  9.528   1.00 0.00 ? 24  TRP A HD1  3  
ATOM 4283  H HE1  . TRP A 1 24  ? -14.088 -6.131  6.999   1.00 0.00 ? 24  TRP A HE1  3  
ATOM 4284  H HE3  . TRP A 1 24  ? -9.012  -4.725  7.911   1.00 0.00 ? 24  TRP A HE3  3  
ATOM 4285  H HZ2  . TRP A 1 24  ? -12.642 -5.454  4.584   1.00 0.00 ? 24  TRP A HZ2  3  
ATOM 4286  H HZ3  . TRP A 1 24  ? -8.580  -4.330  5.501   1.00 0.00 ? 24  TRP A HZ3  3  
ATOM 4287  H HH2  . TRP A 1 24  ? -10.382 -4.691  3.826   1.00 0.00 ? 24  TRP A HH2  3  
ATOM 4288  N N    . ALA A 1 25  ? -8.112  -5.263  11.681  1.00 0.00 ? 25  ALA A N    3  
ATOM 4289  C CA   . ALA A 1 25  ? -7.405  -4.536  12.738  1.00 0.00 ? 25  ALA A CA   3  
ATOM 4290  C C    . ALA A 1 25  ? -6.921  -3.148  12.280  1.00 0.00 ? 25  ALA A C    3  
ATOM 4291  O O    . ALA A 1 25  ? -6.444  -3.003  11.160  1.00 0.00 ? 25  ALA A O    3  
ATOM 4292  C CB   . ALA A 1 25  ? -6.234  -5.403  13.223  1.00 0.00 ? 25  ALA A CB   3  
ATOM 4293  H H    . ALA A 1 25  ? -7.773  -5.163  10.727  1.00 0.00 ? 25  ALA A H    3  
ATOM 4294  H HA   . ALA A 1 25  ? -8.105  -4.374  13.558  1.00 0.00 ? 25  ALA A HA   3  
ATOM 4295  H HB1  . ALA A 1 25  ? -5.754  -4.931  14.075  1.00 0.00 ? 25  ALA A HB1  3  
ATOM 4296  H HB2  . ALA A 1 25  ? -6.595  -6.393  13.512  1.00 0.00 ? 25  ALA A HB2  3  
ATOM 4297  H HB3  . ALA A 1 25  ? -5.504  -5.517  12.420  1.00 0.00 ? 25  ALA A HB3  3  
ATOM 4298  N N    . LEU A 1 26  ? -7.022  -2.139  13.149  1.00 0.00 ? 26  LEU A N    3  
ATOM 4299  C CA   . LEU A 1 26  ? -6.594  -0.749  12.939  1.00 0.00 ? 26  LEU A CA   3  
ATOM 4300  C C    . LEU A 1 26  ? -5.258  -0.523  13.662  1.00 0.00 ? 26  LEU A C    3  
ATOM 4301  O O    . LEU A 1 26  ? -5.200  -0.632  14.885  1.00 0.00 ? 26  LEU A O    3  
ATOM 4302  C CB   . LEU A 1 26  ? -7.713  0.153   13.511  1.00 0.00 ? 26  LEU A CB   3  
ATOM 4303  C CG   . LEU A 1 26  ? -7.734  1.649   13.128  1.00 0.00 ? 26  LEU A CG   3  
ATOM 4304  C CD1  . LEU A 1 26  ? -6.423  2.405   13.378  1.00 0.00 ? 26  LEU A CD1  3  
ATOM 4305  C CD2  . LEU A 1 26  ? -8.160  1.845   11.668  1.00 0.00 ? 26  LEU A CD2  3  
ATOM 4306  H H    . LEU A 1 26  ? -7.412  -2.357  14.061  1.00 0.00 ? 26  LEU A H    3  
ATOM 4307  H HA   . LEU A 1 26  ? -6.467  -0.549  11.873  1.00 0.00 ? 26  LEU A HA   3  
ATOM 4308  H HB2  . LEU A 1 26  ? -8.673  -0.272  13.208  1.00 0.00 ? 26  LEU A HB2  3  
ATOM 4309  H HB3  . LEU A 1 26  ? -7.688  0.090   14.599  1.00 0.00 ? 26  LEU A HB3  3  
ATOM 4310  H HG   . LEU A 1 26  ? -8.492  2.110   13.759  1.00 0.00 ? 26  LEU A HG   3  
ATOM 4311  H HD11 . LEU A 1 26  ? -5.671  2.122   12.642  1.00 0.00 ? 26  LEU A HD11 3  
ATOM 4312  H HD12 . LEU A 1 26  ? -6.604  3.478   13.303  1.00 0.00 ? 26  LEU A HD12 3  
ATOM 4313  H HD13 . LEU A 1 26  ? -6.055  2.180   14.376  1.00 0.00 ? 26  LEU A HD13 3  
ATOM 4314  H HD21 . LEU A 1 26  ? -8.343  2.898   11.476  1.00 0.00 ? 26  LEU A HD21 3  
ATOM 4315  H HD22 . LEU A 1 26  ? -7.367  1.507   11.001  1.00 0.00 ? 26  LEU A HD22 3  
ATOM 4316  H HD23 . LEU A 1 26  ? -9.078  1.293   11.462  1.00 0.00 ? 26  LEU A HD23 3  
ATOM 4317  N N    . TYR A 1 27  ? -4.193  -0.203  12.929  1.00 0.00 ? 27  TYR A N    3  
ATOM 4318  C CA   . TYR A 1 27  ? -2.842  0.024   13.463  1.00 0.00 ? 27  TYR A CA   3  
ATOM 4319  C C    . TYR A 1 27  ? -2.719  1.405   14.145  1.00 0.00 ? 27  TYR A C    3  
ATOM 4320  O O    . TYR A 1 27  ? -2.365  2.403   13.517  1.00 0.00 ? 27  TYR A O    3  
ATOM 4321  C CB   . TYR A 1 27  ? -1.872  -0.201  12.294  1.00 0.00 ? 27  TYR A CB   3  
ATOM 4322  C CG   . TYR A 1 27  ? -0.400  -0.361  12.627  1.00 0.00 ? 27  TYR A CG   3  
ATOM 4323  C CD1  . TYR A 1 27  ? 0.087   -1.592  13.113  1.00 0.00 ? 27  TYR A CD1  3  
ATOM 4324  C CD2  . TYR A 1 27  ? 0.506   0.672   12.330  1.00 0.00 ? 27  TYR A CD2  3  
ATOM 4325  C CE1  . TYR A 1 27  ? 1.470   -1.794  13.284  1.00 0.00 ? 27  TYR A CE1  3  
ATOM 4326  C CE2  . TYR A 1 27  ? 1.889   0.481   12.490  1.00 0.00 ? 27  TYR A CE2  3  
ATOM 4327  C CZ   . TYR A 1 27  ? 2.377   -0.759  12.952  1.00 0.00 ? 27  TYR A CZ   3  
ATOM 4328  O OH   . TYR A 1 27  ? 3.721   -0.955  13.054  1.00 0.00 ? 27  TYR A OH   3  
ATOM 4329  H H    . TYR A 1 27  ? -4.308  -0.118  11.925  1.00 0.00 ? 27  TYR A H    3  
ATOM 4330  H HA   . TYR A 1 27  ? -2.625  -0.727  14.221  1.00 0.00 ? 27  TYR A HA   3  
ATOM 4331  H HB2  . TYR A 1 27  ? -2.174  -1.116  11.787  1.00 0.00 ? 27  TYR A HB2  3  
ATOM 4332  H HB3  . TYR A 1 27  ? -1.995  0.606   11.574  1.00 0.00 ? 27  TYR A HB3  3  
ATOM 4333  H HD1  . TYR A 1 27  ? -0.601  -2.398  13.314  1.00 0.00 ? 27  TYR A HD1  3  
ATOM 4334  H HD2  . TYR A 1 27  ? 0.138   1.606   11.955  1.00 0.00 ? 27  TYR A HD2  3  
ATOM 4335  H HE1  . TYR A 1 27  ? 1.835   -2.748  13.633  1.00 0.00 ? 27  TYR A HE1  3  
ATOM 4336  H HE2  . TYR A 1 27  ? 2.584   1.270   12.242  1.00 0.00 ? 27  TYR A HE2  3  
ATOM 4337  H HH   . TYR A 1 27  ? 3.952   -1.842  13.346  1.00 0.00 ? 27  TYR A HH   3  
ATOM 4338  N N    . ILE A 1 28  ? -3.062  1.482   15.437  1.00 0.00 ? 28  ILE A N    3  
ATOM 4339  C CA   . ILE A 1 28  ? -3.136  2.748   16.208  1.00 0.00 ? 28  ILE A CA   3  
ATOM 4340  C C    . ILE A 1 28  ? -1.772  3.339   16.591  1.00 0.00 ? 28  ILE A C    3  
ATOM 4341  O O    . ILE A 1 28  ? -1.680  4.542   16.846  1.00 0.00 ? 28  ILE A O    3  
ATOM 4342  C CB   . ILE A 1 28  ? -3.994  2.599   17.488  1.00 0.00 ? 28  ILE A CB   3  
ATOM 4343  C CG1  . ILE A 1 28  ? -3.574  1.398   18.367  1.00 0.00 ? 28  ILE A CG1  3  
ATOM 4344  C CG2  . ILE A 1 28  ? -5.483  2.554   17.114  1.00 0.00 ? 28  ILE A CG2  3  
ATOM 4345  C CD1  . ILE A 1 28  ? -4.023  1.540   19.827  1.00 0.00 ? 28  ILE A CD1  3  
ATOM 4346  H H    . ILE A 1 28  ? -3.291  0.605   15.896  1.00 0.00 ? 28  ILE A H    3  
ATOM 4347  H HA   . ILE A 1 28  ? -3.600  3.508   15.579  1.00 0.00 ? 28  ILE A HA   3  
ATOM 4348  H HB   . ILE A 1 28  ? -3.852  3.505   18.084  1.00 0.00 ? 28  ILE A HB   3  
ATOM 4349  H HG12 . ILE A 1 28  ? -3.984  0.475   17.955  1.00 0.00 ? 28  ILE A HG12 3  
ATOM 4350  H HG13 . ILE A 1 28  ? -2.490  1.310   18.371  1.00 0.00 ? 28  ILE A HG13 3  
ATOM 4351  H HG21 . ILE A 1 28  ? -5.715  1.630   16.583  1.00 0.00 ? 28  ILE A HG21 3  
ATOM 4352  H HG22 . ILE A 1 28  ? -6.100  2.626   18.010  1.00 0.00 ? 28  ILE A HG22 3  
ATOM 4353  H HG23 . ILE A 1 28  ? -5.728  3.403   16.476  1.00 0.00 ? 28  ILE A HG23 3  
ATOM 4354  H HD11 . ILE A 1 28  ? -3.780  0.628   20.372  1.00 0.00 ? 28  ILE A HD11 3  
ATOM 4355  H HD12 . ILE A 1 28  ? -3.505  2.382   20.292  1.00 0.00 ? 28  ILE A HD12 3  
ATOM 4356  H HD13 . ILE A 1 28  ? -5.097  1.709   19.884  1.00 0.00 ? 28  ILE A HD13 3  
ATOM 4357  N N    . GLY A 1 29  ? -0.726  2.513   16.652  1.00 0.00 ? 29  GLY A N    3  
ATOM 4358  C CA   . GLY A 1 29  ? 0.638   2.923   16.991  1.00 0.00 ? 29  GLY A CA   3  
ATOM 4359  C C    . GLY A 1 29  ? 1.671   2.054   16.291  1.00 0.00 ? 29  GLY A C    3  
ATOM 4360  O O    . GLY A 1 29  ? 1.316   1.103   15.599  1.00 0.00 ? 29  GLY A O    3  
ATOM 4361  H H    . GLY A 1 29  ? -0.862  1.545   16.386  1.00 0.00 ? 29  GLY A H    3  
ATOM 4362  H HA2  . GLY A 1 29  ? 0.807   3.965   16.720  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 4363  H HA3  . GLY A 1 29  ? 0.786   2.824   18.066  1.00 0.00 ? 29  GLY A HA3  3  
ATOM 4364  N N    . ASP A 1 30  ? 2.949   2.368   16.495  1.00 0.00 ? 30  ASP A N    3  
ATOM 4365  C CA   . ASP A 1 30  ? 4.070   1.638   15.901  1.00 0.00 ? 30  ASP A CA   3  
ATOM 4366  C C    . ASP A 1 30  ? 4.215   0.232   16.534  1.00 0.00 ? 30  ASP A C    3  
ATOM 4367  O O    . ASP A 1 30  ? 5.001   0.015   17.459  1.00 0.00 ? 30  ASP A O    3  
ATOM 4368  C CB   . ASP A 1 30  ? 5.347   2.487   16.021  1.00 0.00 ? 30  ASP A CB   3  
ATOM 4369  C CG   . ASP A 1 30  ? 6.578   1.796   15.411  1.00 0.00 ? 30  ASP A CG   3  
ATOM 4370  O OD1  . ASP A 1 30  ? 6.495   1.329   14.250  1.00 0.00 ? 30  ASP A OD1  3  
ATOM 4371  O OD2  . ASP A 1 30  ? 7.641   1.761   16.077  1.00 0.00 ? 30  ASP A OD2  3  
ATOM 4372  H H    . ASP A 1 30  ? 3.160   3.161   17.085  1.00 0.00 ? 30  ASP A H    3  
ATOM 4373  H HA   . ASP A 1 30  ? 3.850   1.524   14.835  1.00 0.00 ? 30  ASP A HA   3  
ATOM 4374  H HB2  . ASP A 1 30  ? 5.192   3.434   15.501  1.00 0.00 ? 30  ASP A HB2  3  
ATOM 4375  H HB3  . ASP A 1 30  ? 5.533   2.711   17.073  1.00 0.00 ? 30  ASP A HB3  3  
ATOM 4376  N N    . GLY A 1 31  ? 3.405   -0.711  16.043  1.00 0.00 ? 31  GLY A N    3  
ATOM 4377  C CA   . GLY A 1 31  ? 3.276   -2.099  16.500  1.00 0.00 ? 31  GLY A CA   3  
ATOM 4378  C C    . GLY A 1 31  ? 1.953   -2.421  17.200  1.00 0.00 ? 31  GLY A C    3  
ATOM 4379  O O    . GLY A 1 31  ? 1.656   -3.598  17.394  1.00 0.00 ? 31  GLY A O    3  
ATOM 4380  H H    . GLY A 1 31  ? 2.757   -0.403  15.327  1.00 0.00 ? 31  GLY A H    3  
ATOM 4381  H HA2  . GLY A 1 31  ? 3.336   -2.754  15.634  1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4382  H HA3  . GLY A 1 31  ? 4.085   -2.338  17.190  1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4383  N N    . TYR A 1 32  ? 1.145   -1.418  17.556  1.00 0.00 ? 32  TYR A N    3  
ATOM 4384  C CA   . TYR A 1 32  ? -0.100  -1.577  18.327  1.00 0.00 ? 32  TYR A CA   3  
ATOM 4385  C C    . TYR A 1 32  ? -1.364  -1.508  17.454  1.00 0.00 ? 32  TYR A C    3  
ATOM 4386  O O    . TYR A 1 32  ? -1.464  -0.672  16.557  1.00 0.00 ? 32  TYR A O    3  
ATOM 4387  C CB   . TYR A 1 32  ? -0.152  -0.519  19.438  1.00 0.00 ? 32  TYR A CB   3  
ATOM 4388  C CG   . TYR A 1 32  ? 0.858   -0.764  20.541  1.00 0.00 ? 32  TYR A CG   3  
ATOM 4389  C CD1  . TYR A 1 32  ? 0.590   -1.730  21.530  1.00 0.00 ? 32  TYR A CD1  3  
ATOM 4390  C CD2  . TYR A 1 32  ? 2.070   -0.046  20.568  1.00 0.00 ? 32  TYR A CD2  3  
ATOM 4391  C CE1  . TYR A 1 32  ? 1.528   -1.977  22.552  1.00 0.00 ? 32  TYR A CE1  3  
ATOM 4392  C CE2  . TYR A 1 32  ? 3.014   -0.291  21.584  1.00 0.00 ? 32  TYR A CE2  3  
ATOM 4393  C CZ   . TYR A 1 32  ? 2.744   -1.257  22.582  1.00 0.00 ? 32  TYR A CZ   3  
ATOM 4394  O OH   . TYR A 1 32  ? 3.659   -1.488  23.562  1.00 0.00 ? 32  TYR A OH   3  
ATOM 4395  H H    . TYR A 1 32  ? 1.412   -0.485  17.273  1.00 0.00 ? 32  TYR A H    3  
ATOM 4396  H HA   . TYR A 1 32  ? -0.088  -2.553  18.814  1.00 0.00 ? 32  TYR A HA   3  
ATOM 4397  H HB2  . TYR A 1 32  ? 0.006   0.471   19.008  1.00 0.00 ? 32  TYR A HB2  3  
ATOM 4398  H HB3  . TYR A 1 32  ? -1.147  -0.523  19.885  1.00 0.00 ? 32  TYR A HB3  3  
ATOM 4399  H HD1  . TYR A 1 32  ? -0.333  -2.293  21.503  1.00 0.00 ? 32  TYR A HD1  3  
ATOM 4400  H HD2  . TYR A 1 32  ? 2.283   0.689   19.804  1.00 0.00 ? 32  TYR A HD2  3  
ATOM 4401  H HE1  . TYR A 1 32  ? 1.320   -2.722  23.307  1.00 0.00 ? 32  TYR A HE1  3  
ATOM 4402  H HE2  . TYR A 1 32  ? 3.945   0.257   21.606  1.00 0.00 ? 32  TYR A HE2  3  
ATOM 4403  H HH   . TYR A 1 32  ? 3.369   -2.155  24.195  1.00 0.00 ? 32  TYR A HH   3  
ATOM 4404  N N    . VAL A 1 33  ? -2.354  -2.358  17.752  1.00 0.00 ? 33  VAL A N    3  
ATOM 4405  C CA   . VAL A 1 33  ? -3.590  -2.508  16.968  1.00 0.00 ? 33  VAL A CA   3  
ATOM 4406  C C    . VAL A 1 33  ? -4.852  -2.590  17.822  1.00 0.00 ? 33  VAL A C    3  
ATOM 4407  O O    . VAL A 1 33  ? -4.835  -3.110  18.934  1.00 0.00 ? 33  VAL A O    3  
ATOM 4408  C CB   . VAL A 1 33  ? -3.574  -3.763  16.064  1.00 0.00 ? 33  VAL A CB   3  
ATOM 4409  C CG1  . VAL A 1 33  ? -2.594  -3.617  14.899  1.00 0.00 ? 33  VAL A CG1  3  
ATOM 4410  C CG2  . VAL A 1 33  ? -3.262  -5.075  16.805  1.00 0.00 ? 33  VAL A CG2  3  
ATOM 4411  H H    . VAL A 1 33  ? -2.240  -2.980  18.559  1.00 0.00 ? 33  VAL A H    3  
ATOM 4412  H HA   . VAL A 1 33  ? -3.678  -1.635  16.332  1.00 0.00 ? 33  VAL A HA   3  
ATOM 4413  H HB   . VAL A 1 33  ? -4.564  -3.867  15.624  1.00 0.00 ? 33  VAL A HB   3  
ATOM 4414  H HG11 . VAL A 1 33  ? -2.581  -4.539  14.322  1.00 0.00 ? 33  VAL A HG11 3  
ATOM 4415  H HG12 . VAL A 1 33  ? -2.925  -2.819  14.242  1.00 0.00 ? 33  VAL A HG12 3  
ATOM 4416  H HG13 . VAL A 1 33  ? -1.591  -3.406  15.269  1.00 0.00 ? 33  VAL A HG13 3  
ATOM 4417  H HG21 . VAL A 1 33  ? -3.322  -5.913  16.108  1.00 0.00 ? 33  VAL A HG21 3  
ATOM 4418  H HG22 . VAL A 1 33  ? -2.259  -5.044  17.224  1.00 0.00 ? 33  VAL A HG22 3  
ATOM 4419  H HG23 . VAL A 1 33  ? -3.976  -5.247  17.611  1.00 0.00 ? 33  VAL A HG23 3  
ATOM 4420  N N    . ILE A 1 34  ? -5.957  -2.104  17.255  1.00 0.00 ? 34  ILE A N    3  
ATOM 4421  C CA   . ILE A 1 34  ? -7.322  -2.293  17.768  1.00 0.00 ? 34  ILE A CA   3  
ATOM 4422  C C    . ILE A 1 34  ? -8.000  -3.265  16.801  1.00 0.00 ? 34  ILE A C    3  
ATOM 4423  O O    . ILE A 1 34  ? -8.029  -3.008  15.602  1.00 0.00 ? 34  ILE A O    3  
ATOM 4424  C CB   . ILE A 1 34  ? -8.082  -0.952  17.846  1.00 0.00 ? 34  ILE A CB   3  
ATOM 4425  C CG1  . ILE A 1 34  ? -7.387  0.059   18.781  1.00 0.00 ? 34  ILE A CG1  3  
ATOM 4426  C CG2  . ILE A 1 34  ? -9.544  -1.169  18.279  1.00 0.00 ? 34  ILE A CG2  3  
ATOM 4427  C CD1  . ILE A 1 34  ? -7.138  -0.414  20.219  1.00 0.00 ? 34  ILE A CD1  3  
ATOM 4428  H H    . ILE A 1 34  ? -5.857  -1.652  16.344  1.00 0.00 ? 34  ILE A H    3  
ATOM 4429  H HA   . ILE A 1 34  ? -7.291  -2.747  18.758  1.00 0.00 ? 34  ILE A HA   3  
ATOM 4430  H HB   . ILE A 1 34  ? -8.099  -0.512  16.848  1.00 0.00 ? 34  ILE A HB   3  
ATOM 4431  H HG12 . ILE A 1 34  ? -6.420  0.300   18.349  1.00 0.00 ? 34  ILE A HG12 3  
ATOM 4432  H HG13 . ILE A 1 34  ? -7.975  0.975   18.808  1.00 0.00 ? 34  ILE A HG13 3  
ATOM 4433  H HG21 . ILE A 1 34  ? -10.036 -0.207  18.429  1.00 0.00 ? 34  ILE A HG21 3  
ATOM 4434  H HG22 . ILE A 1 34  ? -10.089 -1.705  17.503  1.00 0.00 ? 34  ILE A HG22 3  
ATOM 4435  H HG23 . ILE A 1 34  ? -9.588  -1.743  19.207  1.00 0.00 ? 34  ILE A HG23 3  
ATOM 4436  H HD11 . ILE A 1 34  ? -6.847  0.437   20.837  1.00 0.00 ? 34  ILE A HD11 3  
ATOM 4437  H HD12 . ILE A 1 34  ? -8.031  -0.863  20.645  1.00 0.00 ? 34  ILE A HD12 3  
ATOM 4438  H HD13 . ILE A 1 34  ? -6.331  -1.144  20.223  1.00 0.00 ? 34  ILE A HD13 3  
ATOM 4439  N N    . HIS A 1 35  ? -8.509  -4.392  17.274  1.00 0.00 ? 35  HIS A N    3  
ATOM 4440  C CA   . HIS A 1 35  ? -8.984  -5.480  16.415  1.00 0.00 ? 35  HIS A CA   3  
ATOM 4441  C C    . HIS A 1 35  ? -10.301 -6.068  16.930  1.00 0.00 ? 35  HIS A C    3  
ATOM 4442  O O    . HIS A 1 35  ? -10.548 -6.096  18.135  1.00 0.00 ? 35  HIS A O    3  
ATOM 4443  C CB   . HIS A 1 35  ? -7.887  -6.559  16.320  1.00 0.00 ? 35  HIS A CB   3  
ATOM 4444  C CG   . HIS A 1 35  ? -7.585  -7.251  17.629  1.00 0.00 ? 35  HIS A CG   3  
ATOM 4445  N ND1  . HIS A 1 35  ? -8.043  -8.488  18.027  1.00 0.00 ? 35  HIS A ND1  3  
ATOM 4446  C CD2  . HIS A 1 35  ? -6.827  -6.756  18.656  1.00 0.00 ? 35  HIS A CD2  3  
ATOM 4447  C CE1  . HIS A 1 35  ? -7.566  -8.731  19.258  1.00 0.00 ? 35  HIS A CE1  3  
ATOM 4448  N NE2  . HIS A 1 35  ? -6.821  -7.698  19.691  1.00 0.00 ? 35  HIS A NE2  3  
ATOM 4449  H H    . HIS A 1 35  ? -8.542  -4.543  18.281  1.00 0.00 ? 35  HIS A H    3  
ATOM 4450  H HA   . HIS A 1 35  ? -9.179  -5.100  15.410  1.00 0.00 ? 35  HIS A HA   3  
ATOM 4451  H HB2  . HIS A 1 35  ? -8.188  -7.310  15.587  1.00 0.00 ? 35  HIS A HB2  3  
ATOM 4452  H HB3  . HIS A 1 35  ? -6.967  -6.096  15.961  1.00 0.00 ? 35  HIS A HB3  3  
ATOM 4453  H HD1  . HIS A 1 35  ? -8.651  -9.104  17.506  1.00 0.00 ? 35  HIS A HD1  3  
ATOM 4454  H HD2  . HIS A 1 35  ? -6.324  -5.796  18.669  1.00 0.00 ? 35  HIS A HD2  3  
ATOM 4455  H HE1  . HIS A 1 35  ? -7.766  -9.629  19.830  1.00 0.00 ? 35  HIS A HE1  3  
ATOM 4456  N N    . LEU A 1 36  ? -11.138 -6.571  16.017  1.00 0.00 ? 36  LEU A N    3  
ATOM 4457  C CA   . LEU A 1 36  ? -12.386 -7.242  16.370  1.00 0.00 ? 36  LEU A CA   3  
ATOM 4458  C C    . LEU A 1 36  ? -12.140 -8.740  16.565  1.00 0.00 ? 36  LEU A C    3  
ATOM 4459  O O    . LEU A 1 36  ? -11.732 -9.432  15.632  1.00 0.00 ? 36  LEU A O    3  
ATOM 4460  C CB   . LEU A 1 36  ? -13.420 -6.950  15.266  1.00 0.00 ? 36  LEU A CB   3  
ATOM 4461  C CG   . LEU A 1 36  ? -14.802 -7.603  15.477  1.00 0.00 ? 36  LEU A CG   3  
ATOM 4462  C CD1  . LEU A 1 36  ? -15.459 -7.139  16.783  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 4463  C CD2  . LEU A 1 36  ? -15.707 -7.247  14.291  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 4464  H H    . LEU A 1 36  ? -10.886 -6.528  15.037  1.00 0.00 ? 36  LEU A H    3  
ATOM 4465  H HA   . LEU A 1 36  ? -12.753 -6.833  17.314  1.00 0.00 ? 36  LEU A HA   3  
ATOM 4466  H HB2  . LEU A 1 36  ? -13.556 -5.868  15.207  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 4467  H HB3  . LEU A 1 36  ? -13.021 -7.288  14.309  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 4468  H HG   . LEU A 1 36  ? -14.691 -8.689  15.508  1.00 0.00 ? 36  LEU A HG   3  
ATOM 4469  H HD11 . LEU A 1 36  ? -16.490 -7.487  16.823  1.00 0.00 ? 36  LEU A HD11 3  
ATOM 4470  H HD12 . LEU A 1 36  ? -14.923 -7.554  17.632  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 4471  H HD13 . LEU A 1 36  ? -15.449 -6.053  16.841  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 4472  H HD21 . LEU A 1 36  ? -16.666 -7.754  14.389  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 4473  H HD22 . LEU A 1 36  ? -15.866 -6.169  14.249  1.00 0.00 ? 36  LEU A HD22 3  
ATOM 4474  H HD23 . LEU A 1 36  ? -15.227 -7.574  13.368  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 4475  N N    . ALA A 1 37  ? -12.403 -9.243  17.769  1.00 0.00 ? 37  ALA A N    3  
ATOM 4476  C CA   . ALA A 1 37  ? -12.442 -10.672 18.068  1.00 0.00 ? 37  ALA A CA   3  
ATOM 4477  C C    . ALA A 1 37  ? -13.817 -11.225 17.620  1.00 0.00 ? 37  ALA A C    3  
ATOM 4478  O O    . ALA A 1 37  ? -14.834 -10.598 17.941  1.00 0.00 ? 37  ALA A O    3  
ATOM 4479  C CB   . ALA A 1 37  ? -12.192 -10.861 19.572  1.00 0.00 ? 37  ALA A CB   3  
ATOM 4480  H H    . ALA A 1 37  ? -12.707 -8.609  18.504  1.00 0.00 ? 37  ALA A H    3  
ATOM 4481  H HA   . ALA A 1 37  ? -11.639 -11.167 17.520  1.00 0.00 ? 37  ALA A HA   3  
ATOM 4482  H HB1  . ALA A 1 37  ? -12.980 -10.378 20.149  1.00 0.00 ? 37  ALA A HB1  3  
ATOM 4483  H HB2  . ALA A 1 37  ? -12.177 -11.925 19.813  1.00 0.00 ? 37  ALA A HB2  3  
ATOM 4484  H HB3  . ALA A 1 37  ? -11.232 -10.421 19.842  1.00 0.00 ? 37  ALA A HB3  3  
ATOM 4485  N N    . PRO A 1 38  ? -13.877 -12.342 16.864  1.00 0.00 ? 38  PRO A N    3  
ATOM 4486  C CA   . PRO A 1 38  ? -15.105 -12.811 16.220  1.00 0.00 ? 38  PRO A CA   3  
ATOM 4487  C C    . PRO A 1 38  ? -16.104 -13.435 17.220  1.00 0.00 ? 38  PRO A C    3  
ATOM 4488  O O    . PRO A 1 38  ? -15.694 -13.885 18.293  1.00 0.00 ? 38  PRO A O    3  
ATOM 4489  C CB   . PRO A 1 38  ? -14.645 -13.828 15.168  1.00 0.00 ? 38  PRO A CB   3  
ATOM 4490  C CG   . PRO A 1 38  ? -13.360 -14.393 15.768  1.00 0.00 ? 38  PRO A CG   3  
ATOM 4491  C CD   . PRO A 1 38  ? -12.751 -13.179 16.463  1.00 0.00 ? 38  PRO A CD   3  
ATOM 4492  H HA   . PRO A 1 38  ? -15.577 -11.966 15.717  1.00 0.00 ? 38  PRO A HA   3  
ATOM 4493  H HB2  . PRO A 1 38  ? -15.380 -14.613 14.990  1.00 0.00 ? 38  PRO A HB2  3  
ATOM 4494  H HB3  . PRO A 1 38  ? -14.415 -13.308 14.236  1.00 0.00 ? 38  PRO A HB3  3  
ATOM 4495  H HG2  . PRO A 1 38  ? -13.601 -15.156 16.508  1.00 0.00 ? 38  PRO A HG2  3  
ATOM 4496  H HG3  . PRO A 1 38  ? -12.696 -14.794 15.001  1.00 0.00 ? 38  PRO A HG3  3  
ATOM 4497  H HD2  . PRO A 1 38  ? -12.167 -13.500 17.325  1.00 0.00 ? 38  PRO A HD2  3  
ATOM 4498  H HD3  . PRO A 1 38  ? -12.122 -12.629 15.758  1.00 0.00 ? 38  PRO A HD3  3  
ATOM 4499  N N    . PRO A 1 39  ? -17.405 -13.505 16.861  1.00 0.00 ? 39  PRO A N    3  
ATOM 4500  C CA   . PRO A 1 39  ? -18.452 -14.096 17.696  1.00 0.00 ? 39  PRO A CA   3  
ATOM 4501  C C    . PRO A 1 39  ? -18.472 -15.634 17.656  1.00 0.00 ? 39  PRO A C    3  
ATOM 4502  O O    . PRO A 1 39  ? -19.142 -16.248 18.481  1.00 0.00 ? 39  PRO A O    3  
ATOM 4503  C CB   . PRO A 1 39  ? -19.763 -13.524 17.146  1.00 0.00 ? 39  PRO A CB   3  
ATOM 4504  C CG   . PRO A 1 39  ? -19.466 -13.340 15.658  1.00 0.00 ? 39  PRO A CG   3  
ATOM 4505  C CD   . PRO A 1 39  ? -17.982 -12.971 15.633  1.00 0.00 ? 39  PRO A CD   3  
ATOM 4506  H HA   . PRO A 1 39  ? -18.327 -13.782 18.732  1.00 0.00 ? 39  PRO A HA   3  
ATOM 4507  H HB2  . PRO A 1 39  ? -20.610 -14.191 17.305  1.00 0.00 ? 39  PRO A HB2  3  
ATOM 4508  H HB3  . PRO A 1 39  ? -19.966 -12.555 17.600  1.00 0.00 ? 39  PRO A HB3  3  
ATOM 4509  H HG2  . PRO A 1 39  ? -19.614 -14.287 15.138  1.00 0.00 ? 39  PRO A HG2  3  
ATOM 4510  H HG3  . PRO A 1 39  ? -20.079 -12.558 15.212  1.00 0.00 ? 39  PRO A HG3  3  
ATOM 4511  H HD2  . PRO A 1 39  ? -17.505 -13.405 14.752  1.00 0.00 ? 39  PRO A HD2  3  
ATOM 4512  H HD3  . PRO A 1 39  ? -17.878 -11.886 15.616  1.00 0.00 ? 39  PRO A HD3  3  
ATOM 4513  N N    . SER A 1 40  ? -17.760 -16.277 16.724  1.00 0.00 ? 40  SER A N    3  
ATOM 4514  C CA   . SER A 1 40  ? -17.691 -17.739 16.613  1.00 0.00 ? 40  SER A CA   3  
ATOM 4515  C C    . SER A 1 40  ? -16.461 -18.200 15.813  1.00 0.00 ? 40  SER A C    3  
ATOM 4516  O O    . SER A 1 40  ? -15.992 -17.497 14.911  1.00 0.00 ? 40  SER A O    3  
ATOM 4517  C CB   . SER A 1 40  ? -18.980 -18.292 15.985  1.00 0.00 ? 40  SER A CB   3  
ATOM 4518  O OG   . SER A 1 40  ? -19.101 -19.683 16.233  1.00 0.00 ? 40  SER A OG   3  
ATOM 4519  H H    . SER A 1 40  ? -17.218 -15.745 16.057  1.00 0.00 ? 40  SER A H    3  
ATOM 4520  H HA   . SER A 1 40  ? -17.603 -18.147 17.617  1.00 0.00 ? 40  SER A HA   3  
ATOM 4521  H HB2  . SER A 1 40  ? -19.844 -17.783 16.415  1.00 0.00 ? 40  SER A HB2  3  
ATOM 4522  H HB3  . SER A 1 40  ? -18.965 -18.104 14.910  1.00 0.00 ? 40  SER A HB3  3  
ATOM 4523  H HG   . SER A 1 40  ? -19.842 -20.026 15.710  1.00 0.00 ? 40  SER A HG   3  
ATOM 4524  N N    . GLU A 1 41  ? -15.942 -19.382 16.150  1.00 0.00 ? 41  GLU A N    3  
ATOM 4525  C CA   . GLU A 1 41  ? -14.797 -20.017 15.491  1.00 0.00 ? 41  GLU A CA   3  
ATOM 4526  C C    . GLU A 1 41  ? -15.180 -20.744 14.185  1.00 0.00 ? 41  GLU A C    3  
ATOM 4527  O O    . GLU A 1 41  ? -16.355 -20.899 13.843  1.00 0.00 ? 41  GLU A O    3  
ATOM 4528  C CB   . GLU A 1 41  ? -14.109 -20.988 16.472  1.00 0.00 ? 41  GLU A CB   3  
ATOM 4529  C CG   . GLU A 1 41  ? -13.450 -20.273 17.659  1.00 0.00 ? 41  GLU A CG   3  
ATOM 4530  C CD   . GLU A 1 41  ? -12.385 -19.253 17.222  1.00 0.00 ? 41  GLU A CD   3  
ATOM 4531  O OE1  . GLU A 1 41  ? -11.601 -19.552 16.287  1.00 0.00 ? 41  GLU A OE1  3  
ATOM 4532  O OE2  . GLU A 1 41  ? -12.310 -18.162 17.835  1.00 0.00 ? 41  GLU A OE2  3  
ATOM 4533  H H    . GLU A 1 41  ? -16.391 -19.893 16.903  1.00 0.00 ? 41  GLU A H    3  
ATOM 4534  H HA   . GLU A 1 41  ? -14.081 -19.244 15.215  1.00 0.00 ? 41  GLU A HA   3  
ATOM 4535  H HB2  . GLU A 1 41  ? -14.846 -21.698 16.849  1.00 0.00 ? 41  GLU A HB2  3  
ATOM 4536  H HB3  . GLU A 1 41  ? -13.338 -21.557 15.951  1.00 0.00 ? 41  GLU A HB3  3  
ATOM 4537  H HG2  . GLU A 1 41  ? -14.222 -19.778 18.249  1.00 0.00 ? 41  GLU A HG2  3  
ATOM 4538  H HG3  . GLU A 1 41  ? -12.975 -21.017 18.297  1.00 0.00 ? 41  GLU A HG3  3  
ATOM 4539  N N    . TYR A 1 42  ? -14.164 -21.218 13.450  1.00 0.00 ? 42  TYR A N    3  
ATOM 4540  C CA   . TYR A 1 42  ? -14.305 -22.009 12.220  1.00 0.00 ? 42  TYR A CA   3  
ATOM 4541  C C    . TYR A 1 42  ? -15.287 -23.201 12.393  1.00 0.00 ? 42  TYR A C    3  
ATOM 4542  O O    . TYR A 1 42  ? -15.048 -24.043 13.268  1.00 0.00 ? 42  TYR A O    3  
ATOM 4543  C CB   . TYR A 1 42  ? -12.896 -22.487 11.818  1.00 0.00 ? 42  TYR A CB   3  
ATOM 4544  C CG   . TYR A 1 42  ? -12.846 -23.601 10.785  1.00 0.00 ? 42  TYR A CG   3  
ATOM 4545  C CD1  . TYR A 1 42  ? -13.334 -23.387 9.481   1.00 0.00 ? 42  TYR A CD1  3  
ATOM 4546  C CD2  . TYR A 1 42  ? -12.314 -24.859 11.133  1.00 0.00 ? 42  TYR A CD2  3  
ATOM 4547  C CE1  . TYR A 1 42  ? -13.304 -24.423 8.531   1.00 0.00 ? 42  TYR A CE1  3  
ATOM 4548  C CE2  . TYR A 1 42  ? -12.271 -25.900 10.185  1.00 0.00 ? 42  TYR A CE2  3  
ATOM 4549  C CZ   . TYR A 1 42  ? -12.771 -25.685 8.880   1.00 0.00 ? 42  TYR A CZ   3  
ATOM 4550  O OH   . TYR A 1 42  ? -12.737 -26.695 7.966   1.00 0.00 ? 42  TYR A OH   3  
ATOM 4551  H H    . TYR A 1 42  ? -13.225 -21.071 13.793  1.00 0.00 ? 42  TYR A H    3  
ATOM 4552  H HA   . TYR A 1 42  ? -14.665 -21.344 11.435  1.00 0.00 ? 42  TYR A HA   3  
ATOM 4553  H HB2  . TYR A 1 42  ? -12.331 -21.632 11.442  1.00 0.00 ? 42  TYR A HB2  3  
ATOM 4554  H HB3  . TYR A 1 42  ? -12.382 -22.835 12.714  1.00 0.00 ? 42  TYR A HB3  3  
ATOM 4555  H HD1  . TYR A 1 42  ? -13.723 -22.417 9.197   1.00 0.00 ? 42  TYR A HD1  3  
ATOM 4556  H HD2  . TYR A 1 42  ? -11.925 -25.023 12.129  1.00 0.00 ? 42  TYR A HD2  3  
ATOM 4557  H HE1  . TYR A 1 42  ? -13.676 -24.250 7.530   1.00 0.00 ? 42  TYR A HE1  3  
ATOM 4558  H HE2  . TYR A 1 42  ? -11.850 -26.861 10.446  1.00 0.00 ? 42  TYR A HE2  3  
ATOM 4559  H HH   . TYR A 1 42  ? -13.106 -26.437 7.113   1.00 0.00 ? 42  TYR A HH   3  
ATOM 4560  N N    . PRO A 1 43  ? -16.350 -23.324 11.564  1.00 0.00 ? 43  PRO A N    3  
ATOM 4561  C CA   . PRO A 1 43  ? -17.437 -24.286 11.773  1.00 0.00 ? 43  PRO A CA   3  
ATOM 4562  C C    . PRO A 1 43  ? -17.021 -25.761 11.654  1.00 0.00 ? 43  PRO A C    3  
ATOM 4563  O O    . PRO A 1 43  ? -17.711 -26.617 12.206  1.00 0.00 ? 43  PRO A O    3  
ATOM 4564  C CB   . PRO A 1 43  ? -18.526 -23.925 10.757  1.00 0.00 ? 43  PRO A CB   3  
ATOM 4565  C CG   . PRO A 1 43  ? -17.768 -23.190 9.654   1.00 0.00 ? 43  PRO A CG   3  
ATOM 4566  C CD   . PRO A 1 43  ? -16.687 -22.454 10.441  1.00 0.00 ? 43  PRO A CD   3  
ATOM 4567  H HA   . PRO A 1 43  ? -17.851 -24.137 12.769  1.00 0.00 ? 43  PRO A HA   3  
ATOM 4568  H HB2  . PRO A 1 43  ? -19.042 -24.802 10.368  1.00 0.00 ? 43  PRO A HB2  3  
ATOM 4569  H HB3  . PRO A 1 43  ? -19.239 -23.239 11.221  1.00 0.00 ? 43  PRO A HB3  3  
ATOM 4570  H HG2  . PRO A 1 43  ? -17.307 -23.911 8.977   1.00 0.00 ? 43  PRO A HG2  3  
ATOM 4571  H HG3  . PRO A 1 43  ? -18.414 -22.502 9.108   1.00 0.00 ? 43  PRO A HG3  3  
ATOM 4572  H HD2  . PRO A 1 43  ? -15.835 -22.264 9.793   1.00 0.00 ? 43  PRO A HD2  3  
ATOM 4573  H HD3  . PRO A 1 43  ? -17.086 -21.511 10.821  1.00 0.00 ? 43  PRO A HD3  3  
ATOM 4574  N N    . GLY A 1 44  ? -15.889 -26.069 11.002  1.00 0.00 ? 44  GLY A N    3  
ATOM 4575  C CA   . GLY A 1 44  ? -15.340 -27.433 10.943  1.00 0.00 ? 44  GLY A CA   3  
ATOM 4576  C C    . GLY A 1 44  ? -14.643 -27.896 12.228  1.00 0.00 ? 44  GLY A C    3  
ATOM 4577  O O    . GLY A 1 44  ? -14.278 -29.067 12.334  1.00 0.00 ? 44  GLY A O    3  
ATOM 4578  H H    . GLY A 1 44  ? -15.385 -25.340 10.513  1.00 0.00 ? 44  GLY A H    3  
ATOM 4579  H HA2  . GLY A 1 44  ? -16.148 -28.135 10.743  1.00 0.00 ? 44  GLY A HA2  3  
ATOM 4580  H HA3  . GLY A 1 44  ? -14.605 -27.478 10.144  1.00 0.00 ? 44  GLY A HA3  3  
ATOM 4581  N N    . ALA A 1 45  ? -14.453 -26.984 13.189  1.00 0.00 ? 45  ALA A N    3  
ATOM 4582  C CA   . ALA A 1 45  ? -13.983 -27.212 14.569  1.00 0.00 ? 45  ALA A CA   3  
ATOM 4583  C C    . ALA A 1 45  ? -12.518 -27.699 14.694  1.00 0.00 ? 45  ALA A C    3  
ATOM 4584  O O    . ALA A 1 45  ? -12.086 -28.090 15.783  1.00 0.00 ? 45  ALA A O    3  
ATOM 4585  C CB   . ALA A 1 45  ? -14.979 -28.140 15.291  1.00 0.00 ? 45  ALA A CB   3  
ATOM 4586  H H    . ALA A 1 45  ? -14.807 -26.059 12.977  1.00 0.00 ? 45  ALA A H    3  
ATOM 4587  H HA   . ALA A 1 45  ? -14.014 -26.244 15.077  1.00 0.00 ? 45  ALA A HA   3  
ATOM 4588  H HB1  . ALA A 1 45  ? -14.901 -29.158 14.909  1.00 0.00 ? 45  ALA A HB1  3  
ATOM 4589  H HB2  . ALA A 1 45  ? -14.766 -28.150 16.360  1.00 0.00 ? 45  ALA A HB2  3  
ATOM 4590  H HB3  . ALA A 1 45  ? -15.997 -27.782 15.141  1.00 0.00 ? 45  ALA A HB3  3  
ATOM 4591  N N    . GLY A 1 46  ? -11.749 -27.682 13.595  1.00 0.00 ? 46  GLY A N    3  
ATOM 4592  C CA   . GLY A 1 46  ? -10.381 -28.218 13.515  1.00 0.00 ? 46  GLY A CA   3  
ATOM 4593  C C    . GLY A 1 46  ? -9.263  -27.220 13.835  1.00 0.00 ? 46  GLY A C    3  
ATOM 4594  O O    . GLY A 1 46  ? -8.091  -27.595 13.796  1.00 0.00 ? 46  GLY A O    3  
ATOM 4595  H H    . GLY A 1 46  ? -12.181 -27.384 12.733  1.00 0.00 ? 46  GLY A H    3  
ATOM 4596  H HA2  . GLY A 1 46  ? -10.278 -29.057 14.206  1.00 0.00 ? 46  GLY A HA2  3  
ATOM 4597  H HA3  . GLY A 1 46  ? -10.206 -28.568 12.495  1.00 0.00 ? 46  GLY A HA3  3  
ATOM 4598  N N    . SER A 1 47  ? -9.586  -25.959 14.124  1.00 0.00 ? 47  SER A N    3  
ATOM 4599  C CA   . SER A 1 47  ? -8.603  -24.917 14.449  1.00 0.00 ? 47  SER A CA   3  
ATOM 4600  C C    . SER A 1 47  ? -8.170  -24.953 15.928  1.00 0.00 ? 47  SER A C    3  
ATOM 4601  O O    . SER A 1 47  ? -8.985  -25.166 16.827  1.00 0.00 ? 47  SER A O    3  
ATOM 4602  C CB   . SER A 1 47  ? -9.159  -23.529 14.076  1.00 0.00 ? 47  SER A CB   3  
ATOM 4603  O OG   . SER A 1 47  ? -10.407 -23.239 14.692  1.00 0.00 ? 47  SER A OG   3  
ATOM 4604  H H    . SER A 1 47  ? -10.562 -25.715 14.207  1.00 0.00 ? 47  SER A H    3  
ATOM 4605  H HA   . SER A 1 47  ? -7.709  -25.077 13.842  1.00 0.00 ? 47  SER A HA   3  
ATOM 4606  H HB2  . SER A 1 47  ? -8.429  -22.767 14.352  1.00 0.00 ? 47  SER A HB2  3  
ATOM 4607  H HB3  . SER A 1 47  ? -9.292  -23.494 12.993  1.00 0.00 ? 47  SER A HB3  3  
ATOM 4608  H HG   . SER A 1 47  ? -10.252 -22.691 15.487  1.00 0.00 ? 47  SER A HG   3  
ATOM 4609  N N    . SER A 1 48  ? -6.892  -24.669 16.212  1.00 0.00 ? 48  SER A N    3  
ATOM 4610  C CA   . SER A 1 48  ? -6.312  -24.715 17.572  1.00 0.00 ? 48  SER A CA   3  
ATOM 4611  C C    . SER A 1 48  ? -6.974  -23.741 18.572  1.00 0.00 ? 48  SER A C    3  
ATOM 4612  O O    . SER A 1 48  ? -6.769  -23.836 19.781  1.00 0.00 ? 48  SER A O    3  
ATOM 4613  C CB   . SER A 1 48  ? -4.804  -24.426 17.498  1.00 0.00 ? 48  SER A CB   3  
ATOM 4614  O OG   . SER A 1 48  ? -4.152  -25.289 16.572  1.00 0.00 ? 48  SER A OG   3  
ATOM 4615  H H    . SER A 1 48  ? -6.229  -24.550 15.456  1.00 0.00 ? 48  SER A H    3  
ATOM 4616  H HA   . SER A 1 48  ? -6.444  -25.719 17.975  1.00 0.00 ? 48  SER A HA   3  
ATOM 4617  H HB2  . SER A 1 48  ? -4.662  -23.390 17.186  1.00 0.00 ? 48  SER A HB2  3  
ATOM 4618  H HB3  . SER A 1 48  ? -4.365  -24.556 18.490  1.00 0.00 ? 48  SER A HB3  3  
ATOM 4619  H HG   . SER A 1 48  ? -3.201  -25.094 16.588  1.00 0.00 ? 48  SER A HG   3  
ATOM 4620  N N    . SER A 1 49  ? -7.801  -22.815 18.082  1.00 0.00 ? 49  SER A N    3  
ATOM 4621  C CA   . SER A 1 49  ? -8.676  -21.947 18.873  1.00 0.00 ? 49  SER A CA   3  
ATOM 4622  C C    . SER A 1 49  ? -9.843  -22.685 19.567  1.00 0.00 ? 49  SER A C    3  
ATOM 4623  O O    . SER A 1 49  ? -10.465 -22.106 20.463  1.00 0.00 ? 49  SER A O    3  
ATOM 4624  C CB   . SER A 1 49  ? -9.248  -20.867 17.944  1.00 0.00 ? 49  SER A CB   3  
ATOM 4625  O OG   . SER A 1 49  ? -9.951  -21.428 16.841  1.00 0.00 ? 49  SER A OG   3  
ATOM 4626  H H    . SER A 1 49  ? -7.909  -22.763 17.079  1.00 0.00 ? 49  SER A H    3  
ATOM 4627  H HA   . SER A 1 49  ? -8.091  -21.456 19.655  1.00 0.00 ? 49  SER A HA   3  
ATOM 4628  H HB2  . SER A 1 49  ? -9.923  -20.230 18.516  1.00 0.00 ? 49  SER A HB2  3  
ATOM 4629  H HB3  . SER A 1 49  ? -8.432  -20.247 17.570  1.00 0.00 ? 49  SER A HB3  3  
ATOM 4630  H HG   . SER A 1 49  ? -10.568 -20.703 16.535  1.00 0.00 ? 49  SER A HG   3  
ATOM 4631  N N    . VAL A 1 50  ? -10.166 -23.932 19.182  1.00 0.00 ? 50  VAL A N    3  
ATOM 4632  C CA   . VAL A 1 50  ? -11.353 -24.654 19.672  1.00 0.00 ? 50  VAL A CA   3  
ATOM 4633  C C    . VAL A 1 50  ? -11.200 -26.180 19.656  1.00 0.00 ? 50  VAL A C    3  
ATOM 4634  O O    . VAL A 1 50  ? -10.733 -26.766 18.682  1.00 0.00 ? 50  VAL A O    3  
ATOM 4635  C CB   . VAL A 1 50  ? -12.630 -24.207 18.915  1.00 0.00 ? 50  VAL A CB   3  
ATOM 4636  C CG1  . VAL A 1 50  ? -12.565 -24.400 17.390  1.00 0.00 ? 50  VAL A CG1  3  
ATOM 4637  C CG2  . VAL A 1 50  ? -13.888 -24.902 19.454  1.00 0.00 ? 50  VAL A CG2  3  
ATOM 4638  H H    . VAL A 1 50  ? -9.636  -24.355 18.416  1.00 0.00 ? 50  VAL A H    3  
ATOM 4639  H HA   . VAL A 1 50  ? -11.494 -24.368 20.715  1.00 0.00 ? 50  VAL A HA   3  
ATOM 4640  H HB   . VAL A 1 50  ? -12.761 -23.140 19.101  1.00 0.00 ? 50  VAL A HB   3  
ATOM 4641  H HG11 . VAL A 1 50  ? -12.481 -25.457 17.142  1.00 0.00 ? 50  VAL A HG11 3  
ATOM 4642  H HG12 . VAL A 1 50  ? -13.469 -24.005 16.926  1.00 0.00 ? 50  VAL A HG12 3  
ATOM 4643  H HG13 . VAL A 1 50  ? -11.711 -23.860 16.983  1.00 0.00 ? 50  VAL A HG13 3  
ATOM 4644  H HG21 . VAL A 1 50  ? -14.770 -24.422 19.037  1.00 0.00 ? 50  VAL A HG21 3  
ATOM 4645  H HG22 . VAL A 1 50  ? -13.896 -25.956 19.173  1.00 0.00 ? 50  VAL A HG22 3  
ATOM 4646  H HG23 . VAL A 1 50  ? -13.925 -24.816 20.541  1.00 0.00 ? 50  VAL A HG23 3  
ATOM 4647  N N    . PHE A 1 51  ? -11.653 -26.814 20.747  1.00 0.00 ? 51  PHE A N    3  
ATOM 4648  C CA   . PHE A 1 51  ? -11.722 -28.274 20.918  1.00 0.00 ? 51  PHE A CA   3  
ATOM 4649  C C    . PHE A 1 51  ? -13.059 -28.731 21.552  1.00 0.00 ? 51  PHE A C    3  
ATOM 4650  O O    . PHE A 1 51  ? -13.174 -29.866 22.017  1.00 0.00 ? 51  PHE A O    3  
ATOM 4651  C CB   . PHE A 1 51  ? -10.508 -28.732 21.751  1.00 0.00 ? 51  PHE A CB   3  
ATOM 4652  C CG   . PHE A 1 51  ? -9.158  -28.409 21.134  1.00 0.00 ? 51  PHE A CG   3  
ATOM 4653  C CD1  . PHE A 1 51  ? -8.652  -29.202 20.086  1.00 0.00 ? 51  PHE A CD1  3  
ATOM 4654  C CD2  . PHE A 1 51  ? -8.407  -27.314 21.602  1.00 0.00 ? 51  PHE A CD2  3  
ATOM 4655  C CE1  . PHE A 1 51  ? -7.403  -28.908 19.511  1.00 0.00 ? 51  PHE A CE1  3  
ATOM 4656  C CE2  . PHE A 1 51  ? -7.158  -27.020 21.027  1.00 0.00 ? 51  PHE A CE2  3  
ATOM 4657  C CZ   . PHE A 1 51  ? -6.652  -27.817 19.983  1.00 0.00 ? 51  PHE A CZ   3  
ATOM 4658  H H    . PHE A 1 51  ? -11.916 -26.248 21.542  1.00 0.00 ? 51  PHE A H    3  
ATOM 4659  H HA   . PHE A 1 51  ? -11.669 -28.748 19.935  1.00 0.00 ? 51  PHE A HA   3  
ATOM 4660  H HB2  . PHE A 1 51  ? -10.564 -28.280 22.743  1.00 0.00 ? 51  PHE A HB2  3  
ATOM 4661  H HB3  . PHE A 1 51  ? -10.559 -29.814 21.885  1.00 0.00 ? 51  PHE A HB3  3  
ATOM 4662  H HD1  . PHE A 1 51  ? -9.224  -30.041 19.720  1.00 0.00 ? 51  PHE A HD1  3  
ATOM 4663  H HD2  . PHE A 1 51  ? -8.785  -26.697 22.405  1.00 0.00 ? 51  PHE A HD2  3  
ATOM 4664  H HE1  . PHE A 1 51  ? -7.020  -29.522 18.708  1.00 0.00 ? 51  PHE A HE1  3  
ATOM 4665  H HE2  . PHE A 1 51  ? -6.583  -26.180 21.392  1.00 0.00 ? 51  PHE A HE2  3  
ATOM 4666  H HZ   . PHE A 1 51  ? -5.689  -27.591 19.547  1.00 0.00 ? 51  PHE A HZ   3  
ATOM 4667  N N    . SER A 1 52  ? -14.076 -27.860 21.597  1.00 0.00 ? 52  SER A N    3  
ATOM 4668  C CA   . SER A 1 52  ? -15.349 -28.094 22.308  1.00 0.00 ? 52  SER A CA   3  
ATOM 4669  C C    . SER A 1 52  ? -16.474 -27.162 21.804  1.00 0.00 ? 52  SER A C    3  
ATOM 4670  O O    . SER A 1 52  ? -17.268 -27.570 20.955  1.00 0.00 ? 52  SER A O    3  
ATOM 4671  C CB   . SER A 1 52  ? -15.132 -27.985 23.833  1.00 0.00 ? 52  SER A CB   3  
ATOM 4672  O OG   . SER A 1 52  ? -14.625 -26.707 24.216  1.00 0.00 ? 52  SER A OG   3  
ATOM 4673  H H    . SER A 1 52  ? -13.949 -26.964 21.155  1.00 0.00 ? 52  SER A H    3  
ATOM 4674  H HA   . SER A 1 52  ? -15.685 -29.115 22.105  1.00 0.00 ? 52  SER A HA   3  
ATOM 4675  H HB2  . SER A 1 52  ? -16.082 -28.165 24.342  1.00 0.00 ? 52  SER A HB2  3  
ATOM 4676  H HB3  . SER A 1 52  ? -14.426 -28.755 24.146  1.00 0.00 ? 52  SER A HB3  3  
ATOM 4677  H HG   . SER A 1 52  ? -14.343 -26.757 25.145  1.00 0.00 ? 52  SER A HG   3  
ATOM 4678  N N    . VAL A 1 53  ? -16.545 -25.923 22.308  1.00 0.00 ? 53  VAL A N    3  
ATOM 4679  C CA   . VAL A 1 53  ? -17.585 -24.918 21.998  1.00 0.00 ? 53  VAL A CA   3  
ATOM 4680  C C    . VAL A 1 53  ? -17.011 -23.831 21.077  1.00 0.00 ? 53  VAL A C    3  
ATOM 4681  O O    . VAL A 1 53  ? -16.002 -23.204 21.403  1.00 0.00 ? 53  VAL A O    3  
ATOM 4682  C CB   . VAL A 1 53  ? -18.165 -24.283 23.287  1.00 0.00 ? 53  VAL A CB   3  
ATOM 4683  C CG1  . VAL A 1 53  ? -19.230 -23.217 22.970  1.00 0.00 ? 53  VAL A CG1  3  
ATOM 4684  C CG2  . VAL A 1 53  ? -18.801 -25.355 24.190  1.00 0.00 ? 53  VAL A CG2  3  
ATOM 4685  H H    . VAL A 1 53  ? -15.840 -25.691 23.012  1.00 0.00 ? 53  VAL A H    3  
ATOM 4686  H HA   . VAL A 1 53  ? -18.406 -25.413 21.477  1.00 0.00 ? 53  VAL A HA   3  
ATOM 4687  H HB   . VAL A 1 53  ? -17.357 -23.809 23.847  1.00 0.00 ? 53  VAL A HB   3  
ATOM 4688  H HG11 . VAL A 1 53  ? -19.653 -22.829 23.896  1.00 0.00 ? 53  VAL A HG11 3  
ATOM 4689  H HG12 . VAL A 1 53  ? -18.782 -22.385 22.427  1.00 0.00 ? 53  VAL A HG12 3  
ATOM 4690  H HG13 . VAL A 1 53  ? -20.030 -23.653 22.369  1.00 0.00 ? 53  VAL A HG13 3  
ATOM 4691  H HG21 . VAL A 1 53  ? -19.595 -25.878 23.653  1.00 0.00 ? 53  VAL A HG21 3  
ATOM 4692  H HG22 . VAL A 1 53  ? -18.049 -26.079 24.504  1.00 0.00 ? 53  VAL A HG22 3  
ATOM 4693  H HG23 . VAL A 1 53  ? -19.221 -24.888 25.083  1.00 0.00 ? 53  VAL A HG23 3  
ATOM 4694  N N    . LEU A 1 54  ? -17.668 -23.608 19.932  1.00 0.00 ? 54  LEU A N    3  
ATOM 4695  C CA   . LEU A 1 54  ? -17.216 -22.684 18.883  1.00 0.00 ? 54  LEU A CA   3  
ATOM 4696  C C    . LEU A 1 54  ? -17.716 -21.248 19.093  1.00 0.00 ? 54  LEU A C    3  
ATOM 4697  O O    . LEU A 1 54  ? -17.037 -20.305 18.689  1.00 0.00 ? 54  LEU A O    3  
ATOM 4698  C CB   . LEU A 1 54  ? -17.701 -23.198 17.510  1.00 0.00 ? 54  LEU A CB   3  
ATOM 4699  C CG   . LEU A 1 54  ? -16.959 -24.419 16.921  1.00 0.00 ? 54  LEU A CG   3  
ATOM 4700  C CD1  . LEU A 1 54  ? -17.199 -25.733 17.685  1.00 0.00 ? 54  LEU A CD1  3  
ATOM 4701  C CD2  . LEU A 1 54  ? -17.416 -24.608 15.469  1.00 0.00 ? 54  LEU A CD2  3  
ATOM 4702  H H    . LEU A 1 54  ? -18.477 -24.185 19.734  1.00 0.00 ? 54  LEU A H    3  
ATOM 4703  H HA   . LEU A 1 54  ? -16.127 -22.634 18.877  1.00 0.00 ? 54  LEU A HA   3  
ATOM 4704  H HB2  . LEU A 1 54  ? -18.771 -23.410 17.556  1.00 0.00 ? 54  LEU A HB2  3  
ATOM 4705  H HB3  . LEU A 1 54  ? -17.571 -22.376 16.801  1.00 0.00 ? 54  LEU A HB3  3  
ATOM 4706  H HG   . LEU A 1 54  ? -15.890 -24.208 16.907  1.00 0.00 ? 54  LEU A HG   3  
ATOM 4707  H HD11 . LEU A 1 54  ? -16.750 -26.567 17.145  1.00 0.00 ? 54  LEU A HD11 3  
ATOM 4708  H HD12 . LEU A 1 54  ? -16.739 -25.694 18.669  1.00 0.00 ? 54  LEU A HD12 3  
ATOM 4709  H HD13 . LEU A 1 54  ? -18.268 -25.916 17.791  1.00 0.00 ? 54  LEU A HD13 3  
ATOM 4710  H HD21 . LEU A 1 54  ? -17.232 -23.691 14.912  1.00 0.00 ? 54  LEU A HD21 3  
ATOM 4711  H HD22 . LEU A 1 54  ? -16.859 -25.422 15.002  1.00 0.00 ? 54  LEU A HD22 3  
ATOM 4712  H HD23 . LEU A 1 54  ? -18.481 -24.841 15.436  1.00 0.00 ? 54  LEU A HD23 3  
ATOM 4713  N N    . SER A 1 55  ? -18.901 -21.071 19.678  1.00 0.00 ? 55  SER A N    3  
ATOM 4714  C CA   . SER A 1 55  ? -19.611 -19.784 19.758  1.00 0.00 ? 55  SER A CA   3  
ATOM 4715  C C    . SER A 1 55  ? -19.367 -18.998 21.064  1.00 0.00 ? 55  SER A C    3  
ATOM 4716  O O    . SER A 1 55  ? -19.085 -19.562 22.125  1.00 0.00 ? 55  SER A O    3  
ATOM 4717  C CB   . SER A 1 55  ? -21.116 -20.016 19.537  1.00 0.00 ? 55  SER A CB   3  
ATOM 4718  O OG   . SER A 1 55  ? -21.643 -20.995 20.426  1.00 0.00 ? 55  SER A OG   3  
ATOM 4719  H H    . SER A 1 55  ? -19.394 -21.879 20.027  1.00 0.00 ? 55  SER A H    3  
ATOM 4720  H HA   . SER A 1 55  ? -19.272 -19.149 18.940  1.00 0.00 ? 55  SER A HA   3  
ATOM 4721  H HB2  . SER A 1 55  ? -21.650 -19.072 19.671  1.00 0.00 ? 55  SER A HB2  3  
ATOM 4722  H HB3  . SER A 1 55  ? -21.264 -20.350 18.508  1.00 0.00 ? 55  SER A HB3  3  
ATOM 4723  H HG   . SER A 1 55  ? -22.592 -21.097 20.246  1.00 0.00 ? 55  SER A HG   3  
ATOM 4724  N N    . ASN A 1 56  ? -19.513 -17.669 20.974  1.00 0.00 ? 56  ASN A N    3  
ATOM 4725  C CA   . ASN A 1 56  ? -19.359 -16.683 22.053  1.00 0.00 ? 56  ASN A CA   3  
ATOM 4726  C C    . ASN A 1 56  ? -20.009 -15.338 21.622  1.00 0.00 ? 56  ASN A C    3  
ATOM 4727  O O    . ASN A 1 56  ? -21.003 -15.342 20.896  1.00 0.00 ? 56  ASN A O    3  
ATOM 4728  C CB   . ASN A 1 56  ? -17.861 -16.571 22.424  1.00 0.00 ? 56  ASN A CB   3  
ATOM 4729  C CG   . ASN A 1 56  ? -17.656 -16.014 23.830  1.00 0.00 ? 56  ASN A CG   3  
ATOM 4730  O OD1  . ASN A 1 56  ? -17.473 -14.817 24.016  1.00 0.00 ? 56  ASN A OD1  3  
ATOM 4731  N ND2  . ASN A 1 56  ? -17.728 -16.849 24.852  1.00 0.00 ? 56  ASN A ND2  3  
ATOM 4732  H H    . ASN A 1 56  ? -19.732 -17.280 20.062  1.00 0.00 ? 56  ASN A H    3  
ATOM 4733  H HA   . ASN A 1 56  ? -19.903 -17.048 22.925  1.00 0.00 ? 56  ASN A HA   3  
ATOM 4734  H HB2  . ASN A 1 56  ? -17.391 -17.555 22.387  1.00 0.00 ? 56  ASN A HB2  3  
ATOM 4735  H HB3  . ASN A 1 56  ? -17.340 -15.945 21.697  1.00 0.00 ? 56  ASN A HB3  3  
ATOM 4736  H HD21 . ASN A 1 56  ? -17.893 -17.833 24.695  1.00 0.00 ? 56  ASN A HD21 3  
ATOM 4737  H HD22 . ASN A 1 56  ? -17.601 -16.493 25.788  1.00 0.00 ? 56  ASN A HD22 3  
ATOM 4738  N N    . SER A 1 57  ? -19.469 -14.188 22.025  1.00 0.00 ? 57  SER A N    3  
ATOM 4739  C CA   . SER A 1 57  ? -19.841 -12.849 21.532  1.00 0.00 ? 57  SER A CA   3  
ATOM 4740  C C    . SER A 1 57  ? -18.614 -12.161 20.897  1.00 0.00 ? 57  SER A C    3  
ATOM 4741  O O    . SER A 1 57  ? -17.473 -12.472 21.253  1.00 0.00 ? 57  SER A O    3  
ATOM 4742  C CB   . SER A 1 57  ? -20.357 -11.970 22.682  1.00 0.00 ? 57  SER A CB   3  
ATOM 4743  O OG   . SER A 1 57  ? -21.423 -12.590 23.391  1.00 0.00 ? 57  SER A OG   3  
ATOM 4744  H H    . SER A 1 57  ? -18.659 -14.225 22.636  1.00 0.00 ? 57  SER A H    3  
ATOM 4745  H HA   . SER A 1 57  ? -20.634 -12.924 20.783  1.00 0.00 ? 57  SER A HA   3  
ATOM 4746  H HB2  . SER A 1 57  ? -19.532 -11.771 23.370  1.00 0.00 ? 57  SER A HB2  3  
ATOM 4747  H HB3  . SER A 1 57  ? -20.703 -11.022 22.265  1.00 0.00 ? 57  SER A HB3  3  
ATOM 4748  H HG   . SER A 1 57  ? -21.610 -12.063 24.183  1.00 0.00 ? 57  SER A HG   3  
ATOM 4749  N N    . ALA A 1 58  ? -18.824 -11.215 19.972  1.00 0.00 ? 58  ALA A N    3  
ATOM 4750  C CA   . ALA A 1 58  ? -17.736 -10.424 19.391  1.00 0.00 ? 58  ALA A CA   3  
ATOM 4751  C C    . ALA A 1 58  ? -17.316 -9.280  20.330  1.00 0.00 ? 58  ALA A C    3  
ATOM 4752  O O    . ALA A 1 58  ? -18.150 -8.739  21.060  1.00 0.00 ? 58  ALA A O    3  
ATOM 4753  C CB   . ALA A 1 58  ? -18.171 -9.894  18.019  1.00 0.00 ? 58  ALA A CB   3  
ATOM 4754  H H    . ALA A 1 58  ? -19.770 -10.896 19.779  1.00 0.00 ? 58  ALA A H    3  
ATOM 4755  H HA   . ALA A 1 58  ? -16.876 -11.077 19.248  1.00 0.00 ? 58  ALA A HA   3  
ATOM 4756  H HB1  . ALA A 1 58  ? -18.918 -9.110  18.139  1.00 0.00 ? 58  ALA A HB1  3  
ATOM 4757  H HB2  . ALA A 1 58  ? -17.305 -9.489  17.494  1.00 0.00 ? 58  ALA A HB2  3  
ATOM 4758  H HB3  . ALA A 1 58  ? -18.594 -10.697 17.419  1.00 0.00 ? 58  ALA A HB3  3  
ATOM 4759  N N    . GLU A 1 59  ? -16.047 -8.872  20.281  1.00 0.00 ? 59  GLU A N    3  
ATOM 4760  C CA   . GLU A 1 59  ? -15.486 -7.845  21.168  1.00 0.00 ? 59  GLU A CA   3  
ATOM 4761  C C    . GLU A 1 59  ? -14.359 -7.082  20.466  1.00 0.00 ? 59  GLU A C    3  
ATOM 4762  O O    . GLU A 1 59  ? -13.483 -7.698  19.864  1.00 0.00 ? 59  GLU A O    3  
ATOM 4763  C CB   . GLU A 1 59  ? -14.981 -8.509  22.466  1.00 0.00 ? 59  GLU A CB   3  
ATOM 4764  C CG   . GLU A 1 59  ? -14.526 -7.504  23.534  1.00 0.00 ? 59  GLU A CG   3  
ATOM 4765  C CD   . GLU A 1 59  ? -14.088 -8.212  24.828  1.00 0.00 ? 59  GLU A CD   3  
ATOM 4766  O OE1  . GLU A 1 59  ? -14.894 -8.972  25.416  1.00 0.00 ? 59  GLU A OE1  3  
ATOM 4767  O OE2  . GLU A 1 59  ? -12.942 -7.993  25.284  1.00 0.00 ? 59  GLU A OE2  3  
ATOM 4768  H H    . GLU A 1 59  ? -15.423 -9.322  19.619  1.00 0.00 ? 59  GLU A H    3  
ATOM 4769  H HA   . GLU A 1 59  ? -16.269 -7.138  21.432  1.00 0.00 ? 59  GLU A HA   3  
ATOM 4770  H HB2  . GLU A 1 59  ? -15.792 -9.109  22.882  1.00 0.00 ? 59  GLU A HB2  3  
ATOM 4771  H HB3  . GLU A 1 59  ? -14.146 -9.173  22.232  1.00 0.00 ? 59  GLU A HB3  3  
ATOM 4772  H HG2  . GLU A 1 59  ? -13.693 -6.916  23.144  1.00 0.00 ? 59  GLU A HG2  3  
ATOM 4773  H HG3  . GLU A 1 59  ? -15.342 -6.817  23.764  1.00 0.00 ? 59  GLU A HG3  3  
ATOM 4774  N N    . VAL A 1 60  ? -14.364 -5.752  20.554  1.00 0.00 ? 60  VAL A N    3  
ATOM 4775  C CA   . VAL A 1 60  ? -13.274 -4.895  20.058  1.00 0.00 ? 60  VAL A CA   3  
ATOM 4776  C C    . VAL A 1 60  ? -12.192 -4.792  21.144  1.00 0.00 ? 60  VAL A C    3  
ATOM 4777  O O    . VAL A 1 60  ? -12.476 -4.357  22.261  1.00 0.00 ? 60  VAL A O    3  
ATOM 4778  C CB   . VAL A 1 60  ? -13.769 -3.488  19.652  1.00 0.00 ? 60  VAL A CB   3  
ATOM 4779  C CG1  . VAL A 1 60  ? -12.631 -2.697  18.987  1.00 0.00 ? 60  VAL A CG1  3  
ATOM 4780  C CG2  . VAL A 1 60  ? -14.950 -3.533  18.666  1.00 0.00 ? 60  VAL A CG2  3  
ATOM 4781  H H    . VAL A 1 60  ? -15.137 -5.311  21.058  1.00 0.00 ? 60  VAL A H    3  
ATOM 4782  H HA   . VAL A 1 60  ? -12.848 -5.365  19.170  1.00 0.00 ? 60  VAL A HA   3  
ATOM 4783  H HB   . VAL A 1 60  ? -14.094 -2.964  20.549  1.00 0.00 ? 60  VAL A HB   3  
ATOM 4784  H HG11 . VAL A 1 60  ? -11.778 -2.620  19.656  1.00 0.00 ? 60  VAL A HG11 3  
ATOM 4785  H HG12 . VAL A 1 60  ? -12.308 -3.205  18.077  1.00 0.00 ? 60  VAL A HG12 3  
ATOM 4786  H HG13 . VAL A 1 60  ? -12.967 -1.691  18.738  1.00 0.00 ? 60  VAL A HG13 3  
ATOM 4787  H HG21 . VAL A 1 60  ? -15.808 -4.035  19.112  1.00 0.00 ? 60  VAL A HG21 3  
ATOM 4788  H HG22 . VAL A 1 60  ? -15.249 -2.520  18.398  1.00 0.00 ? 60  VAL A HG22 3  
ATOM 4789  H HG23 . VAL A 1 60  ? -14.658 -4.064  17.759  1.00 0.00 ? 60  VAL A HG23 3  
ATOM 4790  N N    . LYS A 1 61  ? -10.957 -5.190  20.818  1.00 0.00 ? 61  LYS A N    3  
ATOM 4791  C CA   . LYS A 1 61  ? -9.831  -5.364  21.757  1.00 0.00 ? 61  LYS A CA   3  
ATOM 4792  C C    . LYS A 1 61  ? -8.555  -4.614  21.310  1.00 0.00 ? 61  LYS A C    3  
ATOM 4793  O O    . LYS A 1 61  ? -8.380  -4.333  20.123  1.00 0.00 ? 61  LYS A O    3  
ATOM 4794  C CB   . LYS A 1 61  ? -9.548  -6.876  21.894  1.00 0.00 ? 61  LYS A CB   3  
ATOM 4795  C CG   . LYS A 1 61  ? -10.737 -7.652  22.487  1.00 0.00 ? 61  LYS A CG   3  
ATOM 4796  C CD   . LYS A 1 61  ? -10.432 -9.141  22.722  1.00 0.00 ? 61  LYS A CD   3  
ATOM 4797  C CE   . LYS A 1 61  ? -9.486  -9.341  23.917  1.00 0.00 ? 61  LYS A CE   3  
ATOM 4798  N NZ   . LYS A 1 61  ? -9.255  -10.783 24.205  1.00 0.00 ? 61  LYS A NZ   3  
ATOM 4799  H H    . LYS A 1 61  ? -10.819 -5.532  19.869  1.00 0.00 ? 61  LYS A H    3  
ATOM 4800  H HA   . LYS A 1 61  ? -10.113 -4.981  22.741  1.00 0.00 ? 61  LYS A HA   3  
ATOM 4801  H HB2  . LYS A 1 61  ? -9.324  -7.291  20.909  1.00 0.00 ? 61  LYS A HB2  3  
ATOM 4802  H HB3  . LYS A 1 61  ? -8.671  -7.017  22.529  1.00 0.00 ? 61  LYS A HB3  3  
ATOM 4803  H HG2  . LYS A 1 61  ? -11.037 -7.190  23.426  1.00 0.00 ? 61  LYS A HG2  3  
ATOM 4804  H HG3  . LYS A 1 61  ? -11.577 -7.596  21.794  1.00 0.00 ? 61  LYS A HG3  3  
ATOM 4805  H HD2  . LYS A 1 61  ? -11.376 -9.649  22.925  1.00 0.00 ? 61  LYS A HD2  3  
ATOM 4806  H HD3  . LYS A 1 61  ? -9.992  -9.570  21.818  1.00 0.00 ? 61  LYS A HD3  3  
ATOM 4807  H HE2  . LYS A 1 61  ? -8.533  -8.845  23.709  1.00 0.00 ? 61  LYS A HE2  3  
ATOM 4808  H HE3  . LYS A 1 61  ? -9.927  -8.859  24.796  1.00 0.00 ? 61  LYS A HE3  3  
ATOM 4809  H HZ1  . LYS A 1 61  ? -8.825  -11.256 23.418  1.00 0.00 ? 61  LYS A HZ1  3  
ATOM 4810  H HZ2  . LYS A 1 61  ? -8.642  -10.895 25.003  1.00 0.00 ? 61  LYS A HZ2  3  
ATOM 4811  H HZ3  . LYS A 1 61  ? -10.123 -11.255 24.422  1.00 0.00 ? 61  LYS A HZ3  3  
ATOM 4812  N N    . ARG A 1 62  ? -7.654  -4.293  22.256  1.00 0.00 ? 62  ARG A N    3  
ATOM 4813  C CA   . ARG A 1 62  ? -6.305  -3.746  21.994  1.00 0.00 ? 62  ARG A CA   3  
ATOM 4814  C C    . ARG A 1 62  ? -5.235  -4.835  22.173  1.00 0.00 ? 62  ARG A C    3  
ATOM 4815  O O    . ARG A 1 62  ? -5.306  -5.619  23.119  1.00 0.00 ? 62  ARG A O    3  
ATOM 4816  C CB   . ARG A 1 62  ? -6.024  -2.538  22.916  1.00 0.00 ? 62  ARG A CB   3  
ATOM 4817  C CG   . ARG A 1 62  ? -4.634  -1.919  22.667  1.00 0.00 ? 62  ARG A CG   3  
ATOM 4818  C CD   . ARG A 1 62  ? -4.448  -0.583  23.394  1.00 0.00 ? 62  ARG A CD   3  
ATOM 4819  N NE   . ARG A 1 62  ? -3.075  -0.075  23.197  1.00 0.00 ? 62  ARG A NE   3  
ATOM 4820  C CZ   . ARG A 1 62  ? -2.629  1.144   23.482  1.00 0.00 ? 62  ARG A CZ   3  
ATOM 4821  N NH1  . ARG A 1 62  ? -3.417  2.075   23.976  1.00 0.00 ? 62  ARG A NH1  3  
ATOM 4822  N NH2  . ARG A 1 62  ? -1.366  1.444   23.276  1.00 0.00 ? 62  ARG A NH2  3  
ATOM 4823  H H    . ARG A 1 62  ? -7.865  -4.556  23.210  1.00 0.00 ? 62  ARG A H    3  
ATOM 4824  H HA   . ARG A 1 62  ? -6.266  -3.389  20.964  1.00 0.00 ? 62  ARG A HA   3  
ATOM 4825  H HB2  . ARG A 1 62  ? -6.778  -1.776  22.729  1.00 0.00 ? 62  ARG A HB2  3  
ATOM 4826  H HB3  . ARG A 1 62  ? -6.098  -2.844  23.958  1.00 0.00 ? 62  ARG A HB3  3  
ATOM 4827  H HG2  . ARG A 1 62  ? -3.866  -2.612  23.014  1.00 0.00 ? 62  ARG A HG2  3  
ATOM 4828  H HG3  . ARG A 1 62  ? -4.493  -1.754  21.597  1.00 0.00 ? 62  ARG A HG3  3  
ATOM 4829  H HD2  . ARG A 1 62  ? -5.171  0.132   22.996  1.00 0.00 ? 62  ARG A HD2  3  
ATOM 4830  H HD3  . ARG A 1 62  ? -4.630  -0.722  24.460  1.00 0.00 ? 62  ARG A HD3  3  
ATOM 4831  H HE   . ARG A 1 62  ? -2.399  -0.741  22.849  1.00 0.00 ? 62  ARG A HE   3  
ATOM 4832  H HH11 . ARG A 1 62  ? -4.383  1.869   24.174  1.00 0.00 ? 62  ARG A HH11 3  
ATOM 4833  H HH12 . ARG A 1 62  ? -3.059  2.994   24.191  1.00 0.00 ? 62  ARG A HH12 3  
ATOM 4834  H HH21 . ARG A 1 62  ? -0.720  0.754   22.925  1.00 0.00 ? 62  ARG A HH21 3  
ATOM 4835  H HH22 . ARG A 1 62  ? -1.015  2.364   23.493  1.00 0.00 ? 62  ARG A HH22 3  
ATOM 4836  N N    . GLU A 1 63  ? -4.233  -4.844  21.289  1.00 0.00 ? 63  GLU A N    3  
ATOM 4837  C CA   . GLU A 1 63  ? -3.157  -5.843  21.229  1.00 0.00 ? 63  GLU A CA   3  
ATOM 4838  C C    . GLU A 1 63  ? -2.039  -5.351  20.288  1.00 0.00 ? 63  GLU A C    3  
ATOM 4839  O O    . GLU A 1 63  ? -2.142  -4.271  19.704  1.00 0.00 ? 63  GLU A O    3  
ATOM 4840  C CB   . GLU A 1 63  ? -3.775  -7.193  20.796  1.00 0.00 ? 63  GLU A CB   3  
ATOM 4841  C CG   . GLU A 1 63  ? -2.889  -8.440  20.857  1.00 0.00 ? 63  GLU A CG   3  
ATOM 4842  C CD   . GLU A 1 63  ? -2.114  -8.541  22.179  1.00 0.00 ? 63  GLU A CD   3  
ATOM 4843  O OE1  . GLU A 1 63  ? -2.670  -9.029  23.190  1.00 0.00 ? 63  GLU A OE1  3  
ATOM 4844  O OE2  . GLU A 1 63  ? -0.945  -8.086  22.207  1.00 0.00 ? 63  GLU A OE2  3  
ATOM 4845  H H    . GLU A 1 63  ? -4.230  -4.139  20.558  1.00 0.00 ? 63  GLU A H    3  
ATOM 4846  H HA   . GLU A 1 63  ? -2.731  -5.958  22.225  1.00 0.00 ? 63  GLU A HA   3  
ATOM 4847  H HB2  . GLU A 1 63  ? -4.634  -7.404  21.431  1.00 0.00 ? 63  GLU A HB2  3  
ATOM 4848  H HB3  . GLU A 1 63  ? -4.137  -7.086  19.775  1.00 0.00 ? 63  GLU A HB3  3  
ATOM 4849  H HG2  . GLU A 1 63  ? -3.526  -9.315  20.733  1.00 0.00 ? 63  GLU A HG2  3  
ATOM 4850  H HG3  . GLU A 1 63  ? -2.200  -8.422  20.017  1.00 0.00 ? 63  GLU A HG3  3  
ATOM 4851  N N    . ARG A 1 64  ? -0.965  -6.125  20.130  1.00 0.00 ? 64  ARG A N    3  
ATOM 4852  C CA   . ARG A 1 64  ? 0.139   -5.864  19.200  1.00 0.00 ? 64  ARG A CA   3  
ATOM 4853  C C    . ARG A 1 64  ? -0.073  -6.637  17.890  1.00 0.00 ? 64  ARG A C    3  
ATOM 4854  O O    . ARG A 1 64  ? -0.512  -7.791  17.920  1.00 0.00 ? 64  ARG A O    3  
ATOM 4855  C CB   . ARG A 1 64  ? 1.462   -6.272  19.868  1.00 0.00 ? 64  ARG A CB   3  
ATOM 4856  C CG   . ARG A 1 64  ? 1.775   -5.425  21.123  1.00 0.00 ? 64  ARG A CG   3  
ATOM 4857  C CD   . ARG A 1 64  ? 2.539   -6.230  22.181  1.00 0.00 ? 64  ARG A CD   3  
ATOM 4858  N NE   . ARG A 1 64  ? 1.691   -7.302  22.731  1.00 0.00 ? 64  ARG A NE   3  
ATOM 4859  C CZ   . ARG A 1 64  ? 2.030   -8.298  23.533  1.00 0.00 ? 64  ARG A CZ   3  
ATOM 4860  N NH1  . ARG A 1 64  ? 3.244   -8.444  24.023  1.00 0.00 ? 64  ARG A NH1  3  
ATOM 4861  N NH2  . ARG A 1 64  ? 1.092   -9.164  23.833  1.00 0.00 ? 64  ARG A NH2  3  
ATOM 4862  H H    . ARG A 1 64  ? -0.920  -6.978  20.684  1.00 0.00 ? 64  ARG A H    3  
ATOM 4863  H HA   . ARG A 1 64  ? 0.179   -4.800  18.979  1.00 0.00 ? 64  ARG A HA   3  
ATOM 4864  H HB2  . ARG A 1 64  ? 1.395   -7.331  20.128  1.00 0.00 ? 64  ARG A HB2  3  
ATOM 4865  H HB3  . ARG A 1 64  ? 2.283   -6.155  19.160  1.00 0.00 ? 64  ARG A HB3  3  
ATOM 4866  H HG2  . ARG A 1 64  ? 2.367   -4.559  20.823  1.00 0.00 ? 64  ARG A HG2  3  
ATOM 4867  H HG3  . ARG A 1 64  ? 0.854   -5.053  21.578  1.00 0.00 ? 64  ARG A HG3  3  
ATOM 4868  H HD2  . ARG A 1 64  ? 3.438   -6.654  21.733  1.00 0.00 ? 64  ARG A HD2  3  
ATOM 4869  H HD3  . ARG A 1 64  ? 2.835   -5.558  22.988  1.00 0.00 ? 64  ARG A HD3  3  
ATOM 4870  H HE   . ARG A 1 64  ? 0.712   -7.319  22.440  1.00 0.00 ? 64  ARG A HE   3  
ATOM 4871  H HH11 . ARG A 1 64  ? 3.962   -7.774  23.802  1.00 0.00 ? 64  ARG A HH11 3  
ATOM 4872  H HH12 . ARG A 1 64  ? 3.459   -9.216  24.638  1.00 0.00 ? 64  ARG A HH12 3  
ATOM 4873  H HH21 . ARG A 1 64  ? 0.172   -9.019  23.411  1.00 0.00 ? 64  ARG A HH21 3  
ATOM 4874  H HH22 . ARG A 1 64  ? 1.266   -9.954  24.434  1.00 0.00 ? 64  ARG A HH22 3  
ATOM 4875  N N    . LEU A 1 65  ? 0.276   -6.050  16.737  1.00 0.00 ? 65  LEU A N    3  
ATOM 4876  C CA   . LEU A 1 65  ? 0.047   -6.662  15.412  1.00 0.00 ? 65  LEU A CA   3  
ATOM 4877  C C    . LEU A 1 65  ? 0.680   -8.055  15.331  1.00 0.00 ? 65  LEU A C    3  
ATOM 4878  O O    . LEU A 1 65  ? -0.015  -9.013  15.004  1.00 0.00 ? 65  LEU A O    3  
ATOM 4879  C CB   . LEU A 1 65  ? 0.581   -5.721  14.307  1.00 0.00 ? 65  LEU A CB   3  
ATOM 4880  C CG   . LEU A 1 65  ? 0.385   -6.254  12.866  1.00 0.00 ? 65  LEU A CG   3  
ATOM 4881  C CD1  . LEU A 1 65  ? -1.093  -6.379  12.471  1.00 0.00 ? 65  LEU A CD1  3  
ATOM 4882  C CD2  . LEU A 1 65  ? 1.082   -5.321  11.871  1.00 0.00 ? 65  LEU A CD2  3  
ATOM 4883  H H    . LEU A 1 65  ? 0.683   -5.120  16.783  1.00 0.00 ? 65  LEU A H    3  
ATOM 4884  H HA   . LEU A 1 65  ? -1.030  -6.794  15.278  1.00 0.00 ? 65  LEU A HA   3  
ATOM 4885  H HB2  . LEU A 1 65  ? 0.084   -4.754  14.390  1.00 0.00 ? 65  LEU A HB2  3  
ATOM 4886  H HB3  . LEU A 1 65  ? 1.648   -5.556  14.476  1.00 0.00 ? 65  LEU A HB3  3  
ATOM 4887  H HG   . LEU A 1 65  ? 0.853   -7.232  12.780  1.00 0.00 ? 65  LEU A HG   3  
ATOM 4888  H HD11 . LEU A 1 65  ? -1.618  -7.045  13.154  1.00 0.00 ? 65  LEU A HD11 3  
ATOM 4889  H HD12 . LEU A 1 65  ? -1.568  -5.401  12.487  1.00 0.00 ? 65  LEU A HD12 3  
ATOM 4890  H HD13 . LEU A 1 65  ? -1.170  -6.791  11.463  1.00 0.00 ? 65  LEU A HD13 3  
ATOM 4891  H HD21 . LEU A 1 65  ? 0.986   -5.719  10.861  1.00 0.00 ? 65  LEU A HD21 3  
ATOM 4892  H HD22 . LEU A 1 65  ? 0.633   -4.328  11.907  1.00 0.00 ? 65  LEU A HD22 3  
ATOM 4893  H HD23 . LEU A 1 65  ? 2.143   -5.247  12.113  1.00 0.00 ? 65  LEU A HD23 3  
ATOM 4894  N N    . GLU A 1 66  ? 1.951   -8.180  15.717  1.00 0.00 ? 66  GLU A N    3  
ATOM 4895  C CA   . GLU A 1 66  ? 2.675   -9.460  15.711  1.00 0.00 ? 66  GLU A CA   3  
ATOM 4896  C C    . GLU A 1 66  ? 2.019   -10.551 16.585  1.00 0.00 ? 66  GLU A C    3  
ATOM 4897  O O    . GLU A 1 66  ? 2.171   -11.733 16.286  1.00 0.00 ? 66  GLU A O    3  
ATOM 4898  C CB   . GLU A 1 66  ? 4.147   -9.248  16.107  1.00 0.00 ? 66  GLU A CB   3  
ATOM 4899  C CG   . GLU A 1 66  ? 4.354   -8.770  17.551  1.00 0.00 ? 66  GLU A CG   3  
ATOM 4900  C CD   . GLU A 1 66  ? 5.844   -8.543  17.842  1.00 0.00 ? 66  GLU A CD   3  
ATOM 4901  O OE1  . GLU A 1 66  ? 6.541   -9.503  18.254  1.00 0.00 ? 66  GLU A OE1  3  
ATOM 4902  O OE2  . GLU A 1 66  ? 6.328   -7.402  17.666  1.00 0.00 ? 66  GLU A OE2  3  
ATOM 4903  H H    . GLU A 1 66  ? 2.466   -7.341  15.949  1.00 0.00 ? 66  GLU A H    3  
ATOM 4904  H HA   . GLU A 1 66  ? 2.672   -9.833  14.685  1.00 0.00 ? 66  GLU A HA   3  
ATOM 4905  H HB2  . GLU A 1 66  ? 4.683   -10.188 15.973  1.00 0.00 ? 66  GLU A HB2  3  
ATOM 4906  H HB3  . GLU A 1 66  ? 4.584   -8.516  15.426  1.00 0.00 ? 66  GLU A HB3  3  
ATOM 4907  H HG2  . GLU A 1 66  ? 3.809   -7.840  17.712  1.00 0.00 ? 66  GLU A HG2  3  
ATOM 4908  H HG3  . GLU A 1 66  ? 3.964   -9.519  18.244  1.00 0.00 ? 66  GLU A HG3  3  
ATOM 4909  N N    . ASP A 1 67  ? 1.250   -10.180 17.620  1.00 0.00 ? 67  ASP A N    3  
ATOM 4910  C CA   . ASP A 1 67  ? 0.504   -11.126 18.459  1.00 0.00 ? 67  ASP A CA   3  
ATOM 4911  C C    . ASP A 1 67  ? -0.863  -11.466 17.840  1.00 0.00 ? 67  ASP A C    3  
ATOM 4912  O O    . ASP A 1 67  ? -1.231  -12.641 17.782  1.00 0.00 ? 67  ASP A O    3  
ATOM 4913  C CB   . ASP A 1 67  ? 0.353   -10.549 19.872  1.00 0.00 ? 67  ASP A CB   3  
ATOM 4914  C CG   . ASP A 1 67  ? -0.283  -11.571 20.827  1.00 0.00 ? 67  ASP A CG   3  
ATOM 4915  O OD1  . ASP A 1 67  ? 0.476   -12.349 21.456  1.00 0.00 ? 67  ASP A OD1  3  
ATOM 4916  O OD2  . ASP A 1 67  ? -1.531  -11.603 20.941  1.00 0.00 ? 67  ASP A OD2  3  
ATOM 4917  H H    . ASP A 1 67  ? 1.119   -9.193  17.797  1.00 0.00 ? 67  ASP A H    3  
ATOM 4918  H HA   . ASP A 1 67  ? 1.075   -12.055 18.539  1.00 0.00 ? 67  ASP A HA   3  
ATOM 4919  H HB2  . ASP A 1 67  ? 1.338   -10.273 20.254  1.00 0.00 ? 67  ASP A HB2  3  
ATOM 4920  H HB3  . ASP A 1 67  ? -0.256  -9.647  19.838  1.00 0.00 ? 67  ASP A HB3  3  
ATOM 4921  N N    . VAL A 1 68  ? -1.583  -10.465 17.305  1.00 0.00 ? 68  VAL A N    3  
ATOM 4922  C CA   . VAL A 1 68  ? -2.830  -10.699 16.544  1.00 0.00 ? 68  VAL A CA   3  
ATOM 4923  C C    . VAL A 1 68  ? -2.576  -11.577 15.317  1.00 0.00 ? 68  VAL A C    3  
ATOM 4924  O O    . VAL A 1 68  ? -3.357  -12.486 15.042  1.00 0.00 ? 68  VAL A O    3  
ATOM 4925  C CB   . VAL A 1 68  ? -3.562  -9.400  16.131  1.00 0.00 ? 68  VAL A CB   3  
ATOM 4926  C CG1  . VAL A 1 68  ? -4.894  -9.698  15.413  1.00 0.00 ? 68  VAL A CG1  3  
ATOM 4927  C CG2  . VAL A 1 68  ? -3.883  -8.539  17.361  1.00 0.00 ? 68  VAL A CG2  3  
ATOM 4928  H H    . VAL A 1 68  ? -1.248  -9.516  17.453  1.00 0.00 ? 68  VAL A H    3  
ATOM 4929  H HA   . VAL A 1 68  ? -3.496  -11.249 17.191  1.00 0.00 ? 68  VAL A HA   3  
ATOM 4930  H HB   . VAL A 1 68  ? -2.922  -8.827  15.459  1.00 0.00 ? 68  VAL A HB   3  
ATOM 4931  H HG11 . VAL A 1 68  ? -5.542  -10.290 16.060  1.00 0.00 ? 68  VAL A HG11 3  
ATOM 4932  H HG12 . VAL A 1 68  ? -5.398  -8.763  15.161  1.00 0.00 ? 68  VAL A HG12 3  
ATOM 4933  H HG13 . VAL A 1 68  ? -4.717  -10.253 14.491  1.00 0.00 ? 68  VAL A HG13 3  
ATOM 4934  H HG21 . VAL A 1 68  ? -2.962  -8.159  17.795  1.00 0.00 ? 68  VAL A HG21 3  
ATOM 4935  H HG22 . VAL A 1 68  ? -4.503  -7.692  17.074  1.00 0.00 ? 68  VAL A HG22 3  
ATOM 4936  H HG23 . VAL A 1 68  ? -4.417  -9.135  18.105  1.00 0.00 ? 68  VAL A HG23 3  
ATOM 4937  N N    . VAL A 1 69  ? -1.469  -11.349 14.615  1.00 0.00 ? 69  VAL A N    3  
ATOM 4938  C CA   . VAL A 1 69  ? -1.104  -12.070 13.394  1.00 0.00 ? 69  VAL A CA   3  
ATOM 4939  C C    . VAL A 1 69  ? -0.454  -13.419 13.709  1.00 0.00 ? 69  VAL A C    3  
ATOM 4940  O O    . VAL A 1 69  ? -0.829  -14.420 13.107  1.00 0.00 ? 69  VAL A O    3  
ATOM 4941  C CB   . VAL A 1 69  ? -0.169  -11.195 12.532  1.00 0.00 ? 69  VAL A CB   3  
ATOM 4942  C CG1  . VAL A 1 69  ? 0.358   -11.920 11.291  1.00 0.00 ? 69  VAL A CG1  3  
ATOM 4943  C CG2  . VAL A 1 69  ? -0.922  -9.930  12.073  1.00 0.00 ? 69  VAL A CG2  3  
ATOM 4944  H H    . VAL A 1 69  ? -0.885  -10.559 14.898  1.00 0.00 ? 69  VAL A H    3  
ATOM 4945  H HA   . VAL A 1 69  ? -2.013  -12.256 12.819  1.00 0.00 ? 69  VAL A HA   3  
ATOM 4946  H HB   . VAL A 1 69  ? 0.683   -10.895 13.141  1.00 0.00 ? 69  VAL A HB   3  
ATOM 4947  H HG11 . VAL A 1 69  ? -0.476  -12.226 10.659  1.00 0.00 ? 69  VAL A HG11 3  
ATOM 4948  H HG12 . VAL A 1 69  ? 1.012   -11.254 10.735  1.00 0.00 ? 69  VAL A HG12 3  
ATOM 4949  H HG13 . VAL A 1 69  ? 0.938   -12.796 11.577  1.00 0.00 ? 69  VAL A HG13 3  
ATOM 4950  H HG21 . VAL A 1 69  ? -0.228  -9.243  11.587  1.00 0.00 ? 69  VAL A HG21 3  
ATOM 4951  H HG22 . VAL A 1 69  ? -1.713  -10.196 11.375  1.00 0.00 ? 69  VAL A HG22 3  
ATOM 4952  H HG23 . VAL A 1 69  ? -1.383  -9.432  12.927  1.00 0.00 ? 69  VAL A HG23 3  
ATOM 4953  N N    . GLY A 1 70  ? 0.525   -13.477 14.621  1.00 0.00 ? 70  GLY A N    3  
ATOM 4954  C CA   . GLY A 1 70  ? 1.315   -14.691 14.856  1.00 0.00 ? 70  GLY A CA   3  
ATOM 4955  C C    . GLY A 1 70  ? 2.093   -15.078 13.591  1.00 0.00 ? 70  GLY A C    3  
ATOM 4956  O O    . GLY A 1 70  ? 2.925   -14.304 13.110  1.00 0.00 ? 70  GLY A O    3  
ATOM 4957  H H    . GLY A 1 70  ? 0.813   -12.636 15.111  1.00 0.00 ? 70  GLY A H    3  
ATOM 4958  H HA2  . GLY A 1 70  ? 2.025   -14.518 15.665  1.00 0.00 ? 70  GLY A HA2  3  
ATOM 4959  H HA3  . GLY A 1 70  ? 0.655   -15.516 15.134  1.00 0.00 ? 70  GLY A HA3  3  
ATOM 4960  N N    . GLY A 1 71  ? 1.794   -16.261 13.038  1.00 0.00 ? 71  GLY A N    3  
ATOM 4961  C CA   . GLY A 1 71  ? 2.348   -16.766 11.770  1.00 0.00 ? 71  GLY A CA   3  
ATOM 4962  C C    . GLY A 1 71  ? 1.462   -16.536 10.535  1.00 0.00 ? 71  GLY A C    3  
ATOM 4963  O O    . GLY A 1 71  ? 1.834   -16.971 9.445   1.00 0.00 ? 71  GLY A O    3  
ATOM 4964  H H    . GLY A 1 71  ? 1.120   -16.844 13.517  1.00 0.00 ? 71  GLY A H    3  
ATOM 4965  H HA2  . GLY A 1 71  ? 3.315   -16.299 11.573  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 4966  H HA3  . GLY A 1 71  ? 2.484   -17.844 11.861  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 4967  N N    . CYS A 1 72  ? 0.294   -15.898 10.685  1.00 0.00 ? 72  CYS A N    3  
ATOM 4968  C CA   . CYS A 1 72  ? -0.703  -15.704 9.618   1.00 0.00 ? 72  CYS A CA   3  
ATOM 4969  C C    . CYS A 1 72  ? -0.270  -14.678 8.546   1.00 0.00 ? 72  CYS A C    3  
ATOM 4970  O O    . CYS A 1 72  ? 0.656   -13.885 8.743   1.00 0.00 ? 72  CYS A O    3  
ATOM 4971  C CB   . CYS A 1 72  ? -2.034  -15.283 10.269  1.00 0.00 ? 72  CYS A CB   3  
ATOM 4972  S SG   . CYS A 1 72  ? -2.555  -16.536 11.481  1.00 0.00 ? 72  CYS A SG   3  
ATOM 4973  H H    . CYS A 1 72  ? 0.044   -15.570 11.609  1.00 0.00 ? 72  CYS A H    3  
ATOM 4974  H HA   . CYS A 1 72  ? -0.850  -16.658 9.104   1.00 0.00 ? 72  CYS A HA   3  
ATOM 4975  H HB2  . CYS A 1 72  ? -1.907  -14.320 10.771  1.00 0.00 ? 72  CYS A HB2  3  
ATOM 4976  H HB3  . CYS A 1 72  ? -2.813  -15.157 9.511   1.00 0.00 ? 72  CYS A HB3  3  
ATOM 4977  H HG   . CYS A 1 72  ? -2.976  -17.465 10.612  1.00 0.00 ? 72  CYS A HG   3  
ATOM 4978  N N    . CYS A 1 73  ? -0.990  -14.664 7.419   1.00 0.00 ? 73  CYS A N    3  
ATOM 4979  C CA   . CYS A 1 73  ? -0.872  -13.628 6.385   1.00 0.00 ? 73  CYS A CA   3  
ATOM 4980  C C    . CYS A 1 73  ? -1.702  -12.382 6.754   1.00 0.00 ? 73  CYS A C    3  
ATOM 4981  O O    . CYS A 1 73  ? -2.689  -12.471 7.491   1.00 0.00 ? 73  CYS A O    3  
ATOM 4982  C CB   . CYS A 1 73  ? -1.300  -14.218 5.028   1.00 0.00 ? 73  CYS A CB   3  
ATOM 4983  S SG   . CYS A 1 73  ? -0.252  -15.644 4.594   1.00 0.00 ? 73  CYS A SG   3  
ATOM 4984  H H    . CYS A 1 73  ? -1.715  -15.358 7.307   1.00 0.00 ? 73  CYS A H    3  
ATOM 4985  H HA   . CYS A 1 73  ? 0.172   -13.312 6.312   1.00 0.00 ? 73  CYS A HA   3  
ATOM 4986  H HB2  . CYS A 1 73  ? -2.343  -14.537 5.071   1.00 0.00 ? 73  CYS A HB2  3  
ATOM 4987  H HB3  . CYS A 1 73  ? -1.213  -13.458 4.244   1.00 0.00 ? 73  CYS A HB3  3  
ATOM 4988  H HG   . CYS A 1 73  ? 0.920   -14.993 4.551   1.00 0.00 ? 73  CYS A HG   3  
ATOM 4989  N N    . TYR A 1 74  ? -1.330  -11.223 6.205   1.00 0.00 ? 74  TYR A N    3  
ATOM 4990  C CA   . TYR A 1 74  ? -2.031  -9.947  6.421   1.00 0.00 ? 74  TYR A CA   3  
ATOM 4991  C C    . TYR A 1 74  ? -1.710  -8.887  5.352   1.00 0.00 ? 74  TYR A C    3  
ATOM 4992  O O    . TYR A 1 74  ? -0.645  -8.933  4.725   1.00 0.00 ? 74  TYR A O    3  
ATOM 4993  C CB   . TYR A 1 74  ? -1.749  -9.407  7.836   1.00 0.00 ? 74  TYR A CB   3  
ATOM 4994  C CG   . TYR A 1 74  ? -0.337  -8.896  8.072   1.00 0.00 ? 74  TYR A CG   3  
ATOM 4995  C CD1  . TYR A 1 74  ? 0.705   -9.798  8.358   1.00 0.00 ? 74  TYR A CD1  3  
ATOM 4996  C CD2  . TYR A 1 74  ? -0.066  -7.514  8.017   1.00 0.00 ? 74  TYR A CD2  3  
ATOM 4997  C CE1  . TYR A 1 74  ? 2.005   -9.320  8.618   1.00 0.00 ? 74  TYR A CE1  3  
ATOM 4998  C CE2  . TYR A 1 74  ? 1.226   -7.029  8.279   1.00 0.00 ? 74  TYR A CE2  3  
ATOM 4999  C CZ   . TYR A 1 74  ? 2.266   -7.931  8.591   1.00 0.00 ? 74  TYR A CZ   3  
ATOM 5000  O OH   . TYR A 1 74  ? 3.514   -7.466  8.860   1.00 0.00 ? 74  TYR A OH   3  
ATOM 5001  H H    . TYR A 1 74  ? -0.517  -11.213 5.603   1.00 0.00 ? 74  TYR A H    3  
ATOM 5002  H HA   . TYR A 1 74  ? -3.095  -10.157 6.355   1.00 0.00 ? 74  TYR A HA   3  
ATOM 5003  H HB2  . TYR A 1 74  ? -2.447  -8.596  8.031   1.00 0.00 ? 74  TYR A HB2  3  
ATOM 5004  H HB3  . TYR A 1 74  ? -1.962  -10.183 8.573   1.00 0.00 ? 74  TYR A HB3  3  
ATOM 5005  H HD1  . TYR A 1 74  ? 0.505   -10.862 8.391   1.00 0.00 ? 74  TYR A HD1  3  
ATOM 5006  H HD2  . TYR A 1 74  ? -0.853  -6.817  7.776   1.00 0.00 ? 74  TYR A HD2  3  
ATOM 5007  H HE1  . TYR A 1 74  ? 2.802   -10.014 8.846   1.00 0.00 ? 74  TYR A HE1  3  
ATOM 5008  H HE2  . TYR A 1 74  ? 1.420   -5.964  8.248   1.00 0.00 ? 74  TYR A HE2  3  
ATOM 5009  H HH   . TYR A 1 74  ? 3.554   -6.506  8.831   1.00 0.00 ? 74  TYR A HH   3  
ATOM 5010  N N    . ARG A 1 75  ? -2.605  -7.907  5.163   1.00 0.00 ? 75  ARG A N    3  
ATOM 5011  C CA   . ARG A 1 75  ? -2.445  -6.825  4.171   1.00 0.00 ? 75  ARG A CA   3  
ATOM 5012  C C    . ARG A 1 75  ? -3.197  -5.552  4.588   1.00 0.00 ? 75  ARG A C    3  
ATOM 5013  O O    . ARG A 1 75  ? -4.315  -5.648  5.086   1.00 0.00 ? 75  ARG A O    3  
ATOM 5014  C CB   . ARG A 1 75  ? -2.944  -7.336  2.794   1.00 0.00 ? 75  ARG A CB   3  
ATOM 5015  C CG   . ARG A 1 75  ? -2.232  -6.678  1.600   1.00 0.00 ? 75  ARG A CG   3  
ATOM 5016  C CD   . ARG A 1 75  ? -0.849  -7.299  1.354   1.00 0.00 ? 75  ARG A CD   3  
ATOM 5017  N NE   . ARG A 1 75  ? -0.075  -6.524  0.368   1.00 0.00 ? 75  ARG A NE   3  
ATOM 5018  C CZ   . ARG A 1 75  ? 1.201   -6.729  0.057   1.00 0.00 ? 75  ARG A CZ   3  
ATOM 5019  N NH1  . ARG A 1 75  ? 1.867   -7.771  0.503   1.00 0.00 ? 75  ARG A NH1  3  
ATOM 5020  N NH2  . ARG A 1 75  ? 1.840   -5.871  -0.707  1.00 0.00 ? 75  ARG A NH2  3  
ATOM 5021  H H    . ARG A 1 75  ? -3.479  -7.955  5.688   1.00 0.00 ? 75  ARG A H    3  
ATOM 5022  H HA   . ARG A 1 75  ? -1.382  -6.592  4.099   1.00 0.00 ? 75  ARG A HA   3  
ATOM 5023  H HB2  . ARG A 1 75  ? -2.796  -8.414  2.721   1.00 0.00 ? 75  ARG A HB2  3  
ATOM 5024  H HB3  . ARG A 1 75  ? -4.018  -7.157  2.709   1.00 0.00 ? 75  ARG A HB3  3  
ATOM 5025  H HG2  . ARG A 1 75  ? -2.841  -6.822  0.705   1.00 0.00 ? 75  ARG A HG2  3  
ATOM 5026  H HG3  . ARG A 1 75  ? -2.138  -5.607  1.774   1.00 0.00 ? 75  ARG A HG3  3  
ATOM 5027  H HD2  . ARG A 1 75  ? -0.294  -7.330  2.293   1.00 0.00 ? 75  ARG A HD2  3  
ATOM 5028  H HD3  . ARG A 1 75  ? -0.981  -8.321  0.991   1.00 0.00 ? 75  ARG A HD3  3  
ATOM 5029  H HE   . ARG A 1 75  ? -0.539  -5.734  -0.061  1.00 0.00 ? 75  ARG A HE   3  
ATOM 5030  H HH11 . ARG A 1 75  ? 1.397   -8.491  1.027   1.00 0.00 ? 75  ARG A HH11 3  
ATOM 5031  H HH12 . ARG A 1 75  ? 2.875   -7.823  0.386   1.00 0.00 ? 75  ARG A HH12 3  
ATOM 5032  H HH21 . ARG A 1 75  ? 1.367   -5.060  -1.079  1.00 0.00 ? 75  ARG A HH21 3  
ATOM 5033  H HH22 . ARG A 1 75  ? 2.809   -6.025  -0.945  1.00 0.00 ? 75  ARG A HH22 3  
ATOM 5034  N N    . VAL A 1 76  ? -2.613  -4.365  4.376   1.00 0.00 ? 76  VAL A N    3  
ATOM 5035  C CA   . VAL A 1 76  ? -3.319  -3.067  4.540   1.00 0.00 ? 76  VAL A CA   3  
ATOM 5036  C C    . VAL A 1 76  ? -4.319  -2.897  3.391   1.00 0.00 ? 76  VAL A C    3  
ATOM 5037  O O    . VAL A 1 76  ? -3.968  -3.111  2.231   1.00 0.00 ? 76  VAL A O    3  
ATOM 5038  C CB   . VAL A 1 76  ? -2.353  -1.853  4.596   1.00 0.00 ? 76  VAL A CB   3  
ATOM 5039  C CG1  . VAL A 1 76  ? -3.096  -0.504  4.669   1.00 0.00 ? 76  VAL A CG1  3  
ATOM 5040  C CG2  . VAL A 1 76  ? -1.426  -1.932  5.819   1.00 0.00 ? 76  VAL A CG2  3  
ATOM 5041  H H    . VAL A 1 76  ? -1.686  -4.363  3.959   1.00 0.00 ? 76  VAL A H    3  
ATOM 5042  H HA   . VAL A 1 76  ? -3.865  -3.096  5.483   1.00 0.00 ? 76  VAL A HA   3  
ATOM 5043  H HB   . VAL A 1 76  ? -1.737  -1.861  3.697   1.00 0.00 ? 76  VAL A HB   3  
ATOM 5044  H HG11 . VAL A 1 76  ? -2.382  0.314   4.787   1.00 0.00 ? 76  VAL A HG11 3  
ATOM 5045  H HG12 . VAL A 1 76  ? -3.662  -0.324  3.755   1.00 0.00 ? 76  VAL A HG12 3  
ATOM 5046  H HG13 . VAL A 1 76  ? -3.781  -0.497  5.518   1.00 0.00 ? 76  VAL A HG13 3  
ATOM 5047  H HG21 . VAL A 1 76  ? -0.677  -1.141  5.765   1.00 0.00 ? 76  VAL A HG21 3  
ATOM 5048  H HG22 . VAL A 1 76  ? -2.000  -1.803  6.736   1.00 0.00 ? 76  VAL A HG22 3  
ATOM 5049  H HG23 . VAL A 1 76  ? -0.906  -2.891  5.851   1.00 0.00 ? 76  VAL A HG23 3  
ATOM 5050  N N    . ASN A 1 77  ? -5.554  -2.494  3.712   1.00 0.00 ? 77  ASN A N    3  
ATOM 5051  C CA   . ASN A 1 77  ? -6.637  -2.290  2.742   1.00 0.00 ? 77  ASN A CA   3  
ATOM 5052  C C    . ASN A 1 77  ? -7.720  -1.340  3.295   1.00 0.00 ? 77  ASN A C    3  
ATOM 5053  O O    . ASN A 1 77  ? -8.838  -1.744  3.610   1.00 0.00 ? 77  ASN A O    3  
ATOM 5054  C CB   . ASN A 1 77  ? -7.197  -3.658  2.288   1.00 0.00 ? 77  ASN A CB   3  
ATOM 5055  C CG   . ASN A 1 77  ? -8.145  -3.520  1.096   1.00 0.00 ? 77  ASN A CG   3  
ATOM 5056  O OD1  . ASN A 1 77  ? -9.355  -3.676  1.208   1.00 0.00 ? 77  ASN A OD1  3  
ATOM 5057  N ND2  . ASN A 1 77  ? -7.618  -3.213  -0.078  1.00 0.00 ? 77  ASN A ND2  3  
ATOM 5058  H H    . ASN A 1 77  ? -5.761  -2.338  4.695   1.00 0.00 ? 77  ASN A H    3  
ATOM 5059  H HA   . ASN A 1 77  ? -6.210  -1.799  1.866   1.00 0.00 ? 77  ASN A HA   3  
ATOM 5060  H HB2  . ASN A 1 77  ? -6.375  -4.309  1.992   1.00 0.00 ? 77  ASN A HB2  3  
ATOM 5061  H HB3  . ASN A 1 77  ? -7.717  -4.140  3.116   1.00 0.00 ? 77  ASN A HB3  3  
ATOM 5062  H HD21 . ASN A 1 77  ? -6.620  -3.099  -0.182  1.00 0.00 ? 77  ASN A HD21 3  
ATOM 5063  H HD22 . ASN A 1 77  ? -8.232  -3.107  -0.873  1.00 0.00 ? 77  ASN A HD22 3  
ATOM 5064  N N    . ASN A 1 78  ? -7.394  -0.048  3.431   1.00 0.00 ? 78  ASN A N    3  
ATOM 5065  C CA   . ASN A 1 78  ? -8.314  0.976   3.947   1.00 0.00 ? 78  ASN A CA   3  
ATOM 5066  C C    . ASN A 1 78  ? -9.305  1.461   2.866   1.00 0.00 ? 78  ASN A C    3  
ATOM 5067  O O    . ASN A 1 78  ? -9.325  2.630   2.489   1.00 0.00 ? 78  ASN A O    3  
ATOM 5068  C CB   . ASN A 1 78  ? -7.530  2.114   4.631   1.00 0.00 ? 78  ASN A CB   3  
ATOM 5069  C CG   . ASN A 1 78  ? -8.399  2.886   5.618   1.00 0.00 ? 78  ASN A CG   3  
ATOM 5070  O OD1  . ASN A 1 78  ? -9.591  2.625   5.768   1.00 0.00 ? 78  ASN A OD1  3  
ATOM 5071  N ND2  . ASN A 1 78  ? -7.816  3.818   6.339   1.00 0.00 ? 78  ASN A ND2  3  
ATOM 5072  H H    . ASN A 1 78  ? -6.480  0.247   3.124   1.00 0.00 ? 78  ASN A H    3  
ATOM 5073  H HA   . ASN A 1 78  ? -8.911  0.497   4.722   1.00 0.00 ? 78  ASN A HA   3  
ATOM 5074  H HB2  . ASN A 1 78  ? -6.690  1.698   5.185   1.00 0.00 ? 78  ASN A HB2  3  
ATOM 5075  H HB3  . ASN A 1 78  ? -7.129  2.812   3.893   1.00 0.00 ? 78  ASN A HB3  3  
ATOM 5076  H HD21 . ASN A 1 78  ? -6.827  4.020   6.183   1.00 0.00 ? 78  ASN A HD21 3  
ATOM 5077  H HD22 . ASN A 1 78  ? -8.360  4.340   7.005   1.00 0.00 ? 78  ASN A HD22 3  
ATOM 5078  N N    . SER A 1 79  ? -10.113 0.527   2.360   1.00 0.00 ? 79  SER A N    3  
ATOM 5079  C CA   . SER A 1 79  ? -10.995 0.672   1.186   1.00 0.00 ? 79  SER A CA   3  
ATOM 5080  C C    . SER A 1 79  ? -11.768 1.993   1.121   1.00 0.00 ? 79  SER A C    3  
ATOM 5081  O O    . SER A 1 79  ? -11.479 2.828   0.266   1.00 0.00 ? 79  SER A O    3  
ATOM 5082  C CB   . SER A 1 79  ? -11.931 -0.544  1.093   1.00 0.00 ? 79  SER A CB   3  
ATOM 5083  O OG   . SER A 1 79  ? -12.659 -0.741  2.299   1.00 0.00 ? 79  SER A OG   3  
ATOM 5084  H H    . SER A 1 79  ? -9.985  -0.416  2.715   1.00 0.00 ? 79  SER A H    3  
ATOM 5085  H HA   . SER A 1 79  ? -10.378 0.664   0.294   1.00 0.00 ? 79  SER A HA   3  
ATOM 5086  H HB2  . SER A 1 79  ? -12.627 -0.397  0.264   1.00 0.00 ? 79  SER A HB2  3  
ATOM 5087  H HB3  . SER A 1 79  ? -11.334 -1.434  0.887   1.00 0.00 ? 79  SER A HB3  3  
ATOM 5088  H HG   . SER A 1 79  ? -13.229 -1.519  2.181   1.00 0.00 ? 79  SER A HG   3  
ATOM 5089  N N    . LEU A 1 80  ? -12.716 2.220   2.037   1.00 0.00 ? 80  LEU A N    3  
ATOM 5090  C CA   . LEU A 1 80  ? -13.564 3.418   2.061   1.00 0.00 ? 80  LEU A CA   3  
ATOM 5091  C C    . LEU A 1 80  ? -12.760 4.726   2.157   1.00 0.00 ? 80  LEU A C    3  
ATOM 5092  O O    . LEU A 1 80  ? -13.213 5.771   1.693   1.00 0.00 ? 80  LEU A O    3  
ATOM 5093  C CB   . LEU A 1 80  ? -14.522 3.283   3.255   1.00 0.00 ? 80  LEU A CB   3  
ATOM 5094  C CG   . LEU A 1 80  ? -15.662 4.311   3.292   1.00 0.00 ? 80  LEU A CG   3  
ATOM 5095  C CD1  . LEU A 1 80  ? -16.692 3.964   2.213   1.00 0.00 ? 80  LEU A CD1  3  
ATOM 5096  C CD2  . LEU A 1 80  ? -16.324 4.310   4.674   1.00 0.00 ? 80  LEU A CD2  3  
ATOM 5097  H H    . LEU A 1 80  ? -12.925 1.458   2.668   1.00 0.00 ? 80  LEU A H    3  
ATOM 5098  H HA   . LEU A 1 80  ? -14.136 3.446   1.132   1.00 0.00 ? 80  LEU A HA   3  
ATOM 5099  H HB2  . LEU A 1 80  ? -14.970 2.287   3.250   1.00 0.00 ? 80  LEU A HB2  3  
ATOM 5100  H HB3  . LEU A 1 80  ? -13.931 3.402   4.157   1.00 0.00 ? 80  LEU A HB3  3  
ATOM 5101  H HG   . LEU A 1 80  ? -15.267 5.306   3.118   1.00 0.00 ? 80  LEU A HG   3  
ATOM 5102  H HD11 . LEU A 1 80  ? -17.073 2.953   2.362   1.00 0.00 ? 80  LEU A HD11 3  
ATOM 5103  H HD12 . LEU A 1 80  ? -17.527 4.661   2.277   1.00 0.00 ? 80  LEU A HD12 3  
ATOM 5104  H HD13 . LEU A 1 80  ? -16.231 4.038   1.226   1.00 0.00 ? 80  LEU A HD13 3  
ATOM 5105  H HD21 . LEU A 1 80  ? -16.680 3.307   4.906   1.00 0.00 ? 80  LEU A HD21 3  
ATOM 5106  H HD22 . LEU A 1 80  ? -15.609 4.623   5.435   1.00 0.00 ? 80  LEU A HD22 3  
ATOM 5107  H HD23 . LEU A 1 80  ? -17.166 5.003   4.689   1.00 0.00 ? 80  LEU A HD23 3  
ATOM 5108  N N    . ASP A 1 81  ? -11.564 4.679   2.742   1.00 0.00 ? 81  ASP A N    3  
ATOM 5109  C CA   . ASP A 1 81  ? -10.699 5.847   2.846   1.00 0.00 ? 81  ASP A CA   3  
ATOM 5110  C C    . ASP A 1 81  ? -10.055 6.193   1.499   1.00 0.00 ? 81  ASP A C    3  
ATOM 5111  O O    . ASP A 1 81  ? -10.156 7.332   1.039   1.00 0.00 ? 81  ASP A O    3  
ATOM 5112  C CB   . ASP A 1 81  ? -9.673  5.625   3.961   1.00 0.00 ? 81  ASP A CB   3  
ATOM 5113  C CG   . ASP A 1 81  ? -9.182  6.963   4.514   1.00 0.00 ? 81  ASP A CG   3  
ATOM 5114  O OD1  . ASP A 1 81  ? -10.013 7.641   5.162   1.00 0.00 ? 81  ASP A OD1  3  
ATOM 5115  O OD2  . ASP A 1 81  ? -7.997  7.313   4.305   1.00 0.00 ? 81  ASP A OD2  3  
ATOM 5116  H H    . ASP A 1 81  ? -11.197 3.785   3.033   1.00 0.00 ? 81  ASP A H    3  
ATOM 5117  H HA   . ASP A 1 81  ? -11.323 6.689   3.125   1.00 0.00 ? 81  ASP A HA   3  
ATOM 5118  H HB2  . ASP A 1 81  ? -10.150 5.083   4.780   1.00 0.00 ? 81  ASP A HB2  3  
ATOM 5119  H HB3  . ASP A 1 81  ? -8.838  5.030   3.590   1.00 0.00 ? 81  ASP A HB3  3  
ATOM 5120  N N    . HIS A 1 82  ? -9.477  5.206   0.811   1.00 0.00 ? 82  HIS A N    3  
ATOM 5121  C CA   . HIS A 1 82  ? -8.905  5.419   -0.523  1.00 0.00 ? 82  HIS A CA   3  
ATOM 5122  C C    . HIS A 1 82  ? -9.960  5.462   -1.657  1.00 0.00 ? 82  HIS A C    3  
ATOM 5123  O O    . HIS A 1 82  ? -9.624  5.818   -2.791  1.00 0.00 ? 82  HIS A O    3  
ATOM 5124  C CB   . HIS A 1 82  ? -7.750  4.435   -0.761  1.00 0.00 ? 82  HIS A CB   3  
ATOM 5125  C CG   . HIS A 1 82  ? -8.112  2.980   -0.947  1.00 0.00 ? 82  HIS A CG   3  
ATOM 5126  N ND1  . HIS A 1 82  ? -8.803  2.426   -2.003  1.00 0.00 ? 82  HIS A ND1  3  
ATOM 5127  C CD2  . HIS A 1 82  ? -7.640  1.937   -0.194  1.00 0.00 ? 82  HIS A CD2  3  
ATOM 5128  C CE1  . HIS A 1 82  ? -8.761  1.088   -1.879  1.00 0.00 ? 82  HIS A CE1  3  
ATOM 5129  N NE2  . HIS A 1 82  ? -8.060  0.735   -0.783  1.00 0.00 ? 82  HIS A NE2  3  
ATOM 5130  H H    . HIS A 1 82  ? -9.473  4.269   1.206   1.00 0.00 ? 82  HIS A H    3  
ATOM 5131  H HA   . HIS A 1 82  ? -8.451  6.413   -0.527  1.00 0.00 ? 82  HIS A HA   3  
ATOM 5132  H HB2  . HIS A 1 82  ? -7.208  4.761   -1.650  1.00 0.00 ? 82  HIS A HB2  3  
ATOM 5133  H HB3  . HIS A 1 82  ? -7.057  4.525   0.079   1.00 0.00 ? 82  HIS A HB3  3  
ATOM 5134  H HD1  . HIS A 1 82  ? -9.234  2.929   -2.770  1.00 0.00 ? 82  HIS A HD1  3  
ATOM 5135  H HD2  . HIS A 1 82  ? -7.004  2.032   0.679   1.00 0.00 ? 82  HIS A HD2  3  
ATOM 5136  H HE1  . HIS A 1 82  ? -9.213  0.394   -2.576  1.00 0.00 ? 82  HIS A HE1  3  
ATOM 5137  N N    . GLU A 1 83  ? -11.235 5.156   -1.370  1.00 0.00 ? 83  GLU A N    3  
ATOM 5138  C CA   . GLU A 1 83  ? -12.366 5.362   -2.287  1.00 0.00 ? 83  GLU A CA   3  
ATOM 5139  C C    . GLU A 1 83  ? -12.627 6.844   -2.610  1.00 0.00 ? 83  GLU A C    3  
ATOM 5140  O O    . GLU A 1 83  ? -13.053 7.151   -3.727  1.00 0.00 ? 83  GLU A O    3  
ATOM 5141  C CB   . GLU A 1 83  ? -13.653 4.717   -1.744  1.00 0.00 ? 83  GLU A CB   3  
ATOM 5142  C CG   . GLU A 1 83  ? -13.769 3.222   -2.061  1.00 0.00 ? 83  GLU A CG   3  
ATOM 5143  C CD   . GLU A 1 83  ? -14.137 2.974   -3.533  1.00 0.00 ? 83  GLU A CD   3  
ATOM 5144  O OE1  . GLU A 1 83  ? -15.341 3.037   -3.879  1.00 0.00 ? 83  GLU A OE1  3  
ATOM 5145  O OE2  . GLU A 1 83  ? -13.231 2.687   -4.351  1.00 0.00 ? 83  GLU A OE2  3  
ATOM 5146  H H    . GLU A 1 83  ? -11.426 4.732   -0.469  1.00 0.00 ? 83  GLU A H    3  
ATOM 5147  H HA   . GLU A 1 83  ? -12.134 4.875   -3.223  1.00 0.00 ? 83  GLU A HA   3  
ATOM 5148  H HB2  . GLU A 1 83  ? -13.700 4.862   -0.668  1.00 0.00 ? 83  GLU A HB2  3  
ATOM 5149  H HB3  . GLU A 1 83  ? -14.517 5.217   -2.179  1.00 0.00 ? 83  GLU A HB3  3  
ATOM 5150  H HG2  . GLU A 1 83  ? -12.829 2.725   -1.838  1.00 0.00 ? 83  GLU A HG2  3  
ATOM 5151  H HG3  . GLU A 1 83  ? -14.543 2.789   -1.425  1.00 0.00 ? 83  GLU A HG3  3  
ATOM 5152  N N    . TYR A 1 84  ? -12.357 7.768   -1.670  1.00 0.00 ? 84  TYR A N    3  
ATOM 5153  C CA   . TYR A 1 84  ? -12.654 9.203   -1.865  1.00 0.00 ? 84  TYR A CA   3  
ATOM 5154  C C    . TYR A 1 84  ? -11.727 10.228  -1.175  1.00 0.00 ? 84  TYR A C    3  
ATOM 5155  O O    . TYR A 1 84  ? -11.562 11.333  -1.699  1.00 0.00 ? 84  TYR A O    3  
ATOM 5156  C CB   . TYR A 1 84  ? -14.106 9.542   -1.437  1.00 0.00 ? 84  TYR A CB   3  
ATOM 5157  C CG   . TYR A 1 84  ? -15.084 8.415   -1.142  1.00 0.00 ? 84  TYR A CG   3  
ATOM 5158  C CD1  . TYR A 1 84  ? -15.895 7.877   -2.161  1.00 0.00 ? 84  TYR A CD1  3  
ATOM 5159  C CD2  . TYR A 1 84  ? -15.250 7.974   0.185   1.00 0.00 ? 84  TYR A CD2  3  
ATOM 5160  C CE1  . TYR A 1 84  ? -16.850 6.885   -1.857  1.00 0.00 ? 84  TYR A CE1  3  
ATOM 5161  C CE2  . TYR A 1 84  ? -16.208 6.993   0.497   1.00 0.00 ? 84  TYR A CE2  3  
ATOM 5162  C CZ   . TYR A 1 84  ? -17.009 6.435   -0.525  1.00 0.00 ? 84  TYR A CZ   3  
ATOM 5163  O OH   . TYR A 1 84  ? -17.932 5.475   -0.234  1.00 0.00 ? 84  TYR A OH   3  
ATOM 5164  H H    . TYR A 1 84  ? -12.020 7.430   -0.782  1.00 0.00 ? 84  TYR A H    3  
ATOM 5165  H HA   . TYR A 1 84  ? -12.579 9.417   -2.932  1.00 0.00 ? 84  TYR A HA   3  
ATOM 5166  H HB2  . TYR A 1 84  ? -14.068 10.155  -0.534  1.00 0.00 ? 84  TYR A HB2  3  
ATOM 5167  H HB3  . TYR A 1 84  ? -14.540 10.183  -2.206  1.00 0.00 ? 84  TYR A HB3  3  
ATOM 5168  H HD1  . TYR A 1 84  ? -15.783 8.222   -3.180  1.00 0.00 ? 84  TYR A HD1  3  
ATOM 5169  H HD2  . TYR A 1 84  ? -14.645 8.399   0.976   1.00 0.00 ? 84  TYR A HD2  3  
ATOM 5170  H HE1  . TYR A 1 84  ? -17.468 6.469   -2.640  1.00 0.00 ? 84  TYR A HE1  3  
ATOM 5171  H HE2  . TYR A 1 84  ? -16.332 6.688   1.524   1.00 0.00 ? 84  TYR A HE2  3  
ATOM 5172  H HH   . TYR A 1 84  ? -17.902 5.190   0.690   1.00 0.00 ? 84  TYR A HH   3  
ATOM 5173  N N    . GLN A 1 85  ? -11.228 9.959   0.039   1.00 0.00 ? 85  GLN A N    3  
ATOM 5174  C CA   . GLN A 1 85  ? -11.188 10.999  1.083   1.00 0.00 ? 85  GLN A CA   3  
ATOM 5175  C C    . GLN A 1 85  ? -9.792  11.236  1.729   1.00 0.00 ? 85  GLN A C    3  
ATOM 5176  O O    . GLN A 1 85  ? -9.093  10.271  2.043   1.00 0.00 ? 85  GLN A O    3  
ATOM 5177  C CB   . GLN A 1 85  ? -12.259 10.665  2.138   1.00 0.00 ? 85  GLN A CB   3  
ATOM 5178  C CG   . GLN A 1 85  ? -12.079 9.285   2.797   1.00 0.00 ? 85  GLN A CG   3  
ATOM 5179  C CD   . GLN A 1 85  ? -13.110 8.943   3.872   1.00 0.00 ? 85  GLN A CD   3  
ATOM 5180  O OE1  . GLN A 1 85  ? -14.204 9.489   3.925   1.00 0.00 ? 85  GLN A OE1  3  
ATOM 5181  N NE2  . GLN A 1 85  ? -12.757 8.108   4.827   1.00 0.00 ? 85  GLN A NE2  3  
ATOM 5182  H H    . GLN A 1 85  ? -11.197 8.996   0.357   1.00 0.00 ? 85  GLN A H    3  
ATOM 5183  H HA   . GLN A 1 85  ? -11.523 11.933  0.637   1.00 0.00 ? 85  GLN A HA   3  
ATOM 5184  H HB2  . GLN A 1 85  ? -12.252 11.443  2.899   1.00 0.00 ? 85  GLN A HB2  3  
ATOM 5185  H HB3  . GLN A 1 85  ? -13.236 10.684  1.651   1.00 0.00 ? 85  GLN A HB3  3  
ATOM 5186  H HG2  . GLN A 1 85  ? -12.157 8.516   2.035   1.00 0.00 ? 85  GLN A HG2  3  
ATOM 5187  H HG3  . GLN A 1 85  ? -11.087 9.244   3.247   1.00 0.00 ? 85  GLN A HG3  3  
ATOM 5188  H HE21 . GLN A 1 85  ? -11.781 7.803   4.891   1.00 0.00 ? 85  GLN A HE21 3  
ATOM 5189  H HE22 . GLN A 1 85  ? -13.448 7.768   5.481   1.00 0.00 ? 85  GLN A HE22 3  
ATOM 5190  N N    . PRO A 1 86  ? -9.396  12.505  1.992   1.00 0.00 ? 86  PRO A N    3  
ATOM 5191  C CA   . PRO A 1 86  ? -8.140  12.886  2.653   1.00 0.00 ? 86  PRO A CA   3  
ATOM 5192  C C    . PRO A 1 86  ? -8.331  13.085  4.174   1.00 0.00 ? 86  PRO A C    3  
ATOM 5193  O O    . PRO A 1 86  ? -8.043  14.149  4.727   1.00 0.00 ? 86  PRO A O    3  
ATOM 5194  C CB   . PRO A 1 86  ? -7.735  14.177  1.937   1.00 0.00 ? 86  PRO A CB   3  
ATOM 5195  C CG   . PRO A 1 86  ? -9.084  14.869  1.749   1.00 0.00 ? 86  PRO A CG   3  
ATOM 5196  C CD   . PRO A 1 86  ? -10.026 13.706  1.447   1.00 0.00 ? 86  PRO A CD   3  
ATOM 5197  H HA   . PRO A 1 86  ? -7.375  12.126  2.490   1.00 0.00 ? 86  PRO A HA   3  
ATOM 5198  H HB2  . PRO A 1 86  ? -7.027  14.779  2.507   1.00 0.00 ? 86  PRO A HB2  3  
ATOM 5199  H HB3  . PRO A 1 86  ? -7.310  13.930  0.963   1.00 0.00 ? 86  PRO A HB3  3  
ATOM 5200  H HG2  . PRO A 1 86  ? -9.394  15.349  2.677   1.00 0.00 ? 86  PRO A HG2  3  
ATOM 5201  H HG3  . PRO A 1 86  ? -9.064  15.587  0.929   1.00 0.00 ? 86  PRO A HG3  3  
ATOM 5202  H HD2  . PRO A 1 86  ? -11.001 13.881  1.907   1.00 0.00 ? 86  PRO A HD2  3  
ATOM 5203  H HD3  . PRO A 1 86  ? -10.123 13.607  0.364   1.00 0.00 ? 86  PRO A HD3  3  
ATOM 5204  N N    . ARG A 1 87  ? -8.861  12.070  4.865   1.00 0.00 ? 87  ARG A N    3  
ATOM 5205  C CA   . ARG A 1 87  ? -9.213  12.113  6.290   1.00 0.00 ? 87  ARG A CA   3  
ATOM 5206  C C    . ARG A 1 87  ? -8.056  12.495  7.246   1.00 0.00 ? 87  ARG A C    3  
ATOM 5207  O O    . ARG A 1 87  ? -6.912  12.094  7.004   1.00 0.00 ? 87  ARG A O    3  
ATOM 5208  C CB   . ARG A 1 87  ? -9.774  10.727  6.670   1.00 0.00 ? 87  ARG A CB   3  
ATOM 5209  C CG   . ARG A 1 87  ? -11.258 10.755  7.052   1.00 0.00 ? 87  ARG A CG   3  
ATOM 5210  C CD   . ARG A 1 87  ? -12.212 11.173  5.928   1.00 0.00 ? 87  ARG A CD   3  
ATOM 5211  N NE   . ARG A 1 87  ? -12.624 12.590  5.953   1.00 0.00 ? 87  ARG A NE   3  
ATOM 5212  C CZ   . ARG A 1 87  ? -13.671 13.111  5.312   1.00 0.00 ? 87  ARG A CZ   3  
ATOM 5213  N NH1  . ARG A 1 87  ? -14.481 12.386  4.564   1.00 0.00 ? 87  ARG A NH1  3  
ATOM 5214  N NH2  . ARG A 1 87  ? -13.922 14.398  5.411   1.00 0.00 ? 87  ARG A NH2  3  
ATOM 5215  H H    . ARG A 1 87  ? -9.069  11.213  4.376   1.00 0.00 ? 87  ARG A H    3  
ATOM 5216  H HA   . ARG A 1 87  ? -9.996  12.862  6.381   1.00 0.00 ? 87  ARG A HA   3  
ATOM 5217  H HB2  . ARG A 1 87  ? -9.621  10.015  5.852   1.00 0.00 ? 87  ARG A HB2  3  
ATOM 5218  H HB3  . ARG A 1 87  ? -9.215  10.320  7.516   1.00 0.00 ? 87  ARG A HB3  3  
ATOM 5219  H HG2  . ARG A 1 87  ? -11.538 9.742   7.348   1.00 0.00 ? 87  ARG A HG2  3  
ATOM 5220  H HG3  . ARG A 1 87  ? -11.393 11.394  7.913   1.00 0.00 ? 87  ARG A HG3  3  
ATOM 5221  H HD2  . ARG A 1 87  ? -11.736 10.954  4.975   1.00 0.00 ? 87  ARG A HD2  3  
ATOM 5222  H HD3  . ARG A 1 87  ? -13.110 10.563  6.033   1.00 0.00 ? 87  ARG A HD3  3  
ATOM 5223  H HE   . ARG A 1 87  ? -12.053 13.233  6.489   1.00 0.00 ? 87  ARG A HE   3  
ATOM 5224  H HH11 . ARG A 1 87  ? -14.353 11.387  4.438   1.00 0.00 ? 87  ARG A HH11 3  
ATOM 5225  H HH12 . ARG A 1 87  ? -15.265 12.824  4.100   1.00 0.00 ? 87  ARG A HH12 3  
ATOM 5226  H HH21 . ARG A 1 87  ? -13.336 15.006  5.962   1.00 0.00 ? 87  ARG A HH21 3  
ATOM 5227  H HH22 . ARG A 1 87  ? -14.715 14.805  4.936   1.00 0.00 ? 87  ARG A HH22 3  
ATOM 5228  N N    . PRO A 1 88  ? -8.351  13.182  8.376   1.00 0.00 ? 88  PRO A N    3  
ATOM 5229  C CA   . PRO A 1 88  ? -7.397  13.415  9.466   1.00 0.00 ? 88  PRO A CA   3  
ATOM 5230  C C    . PRO A 1 88  ? -7.169  12.103  10.226  1.00 0.00 ? 88  PRO A C    3  
ATOM 5231  O O    . PRO A 1 88  ? -7.968  11.693  11.066  1.00 0.00 ? 88  PRO A O    3  
ATOM 5232  C CB   . PRO A 1 88  ? -8.028  14.506  10.337  1.00 0.00 ? 88  PRO A CB   3  
ATOM 5233  C CG   . PRO A 1 88  ? -9.526  14.271  10.150  1.00 0.00 ? 88  PRO A CG   3  
ATOM 5234  C CD   . PRO A 1 88  ? -9.607  13.866  8.682   1.00 0.00 ? 88  PRO A CD   3  
ATOM 5235  H HA   . PRO A 1 88  ? -6.447  13.783  9.074   1.00 0.00 ? 88  PRO A HA   3  
ATOM 5236  H HB2  . PRO A 1 88  ? -7.725  14.435  11.381  1.00 0.00 ? 88  PRO A HB2  3  
ATOM 5237  H HB3  . PRO A 1 88  ? -7.761  15.488  9.939   1.00 0.00 ? 88  PRO A HB3  3  
ATOM 5238  H HG2  . PRO A 1 88  ? -9.855  13.432  10.765  1.00 0.00 ? 88  PRO A HG2  3  
ATOM 5239  H HG3  . PRO A 1 88  ? -10.112 15.165  10.360  1.00 0.00 ? 88  PRO A HG3  3  
ATOM 5240  H HD2  . PRO A 1 88  ? -10.472 13.225  8.534   1.00 0.00 ? 88  PRO A HD2  3  
ATOM 5241  H HD3  . PRO A 1 88  ? -9.688  14.761  8.061   1.00 0.00 ? 88  PRO A HD3  3  
ATOM 5242  N N    . VAL A 1 89  ? -6.053  11.435  9.928   1.00 0.00 ? 89  VAL A N    3  
ATOM 5243  C CA   . VAL A 1 89  ? -5.760  10.056  10.379  1.00 0.00 ? 89  VAL A CA   3  
ATOM 5244  C C    . VAL A 1 89  ? -5.674  9.924   11.910  1.00 0.00 ? 89  VAL A C    3  
ATOM 5245  O O    . VAL A 1 89  ? -6.010  8.874   12.456  1.00 0.00 ? 89  VAL A O    3  
ATOM 5246  C CB   . VAL A 1 89  ? -4.494  9.541   9.647   1.00 0.00 ? 89  VAL A CB   3  
ATOM 5247  C CG1  . VAL A 1 89  ? -4.009  8.171   10.131  1.00 0.00 ? 89  VAL A CG1  3  
ATOM 5248  C CG2  . VAL A 1 89  ? -4.769  9.428   8.133   1.00 0.00 ? 89  VAL A CG2  3  
ATOM 5249  H H    . VAL A 1 89  ? -5.436  11.846  9.227   1.00 0.00 ? 89  VAL A H    3  
ATOM 5250  H HA   . VAL A 1 89  ? -6.599  9.433   10.064  1.00 0.00 ? 89  VAL A HA   3  
ATOM 5251  H HB   . VAL A 1 89  ? -3.693  10.264  9.798   1.00 0.00 ? 89  VAL A HB   3  
ATOM 5252  H HG11 . VAL A 1 89  ? -3.126  7.878   9.565   1.00 0.00 ? 89  VAL A HG11 3  
ATOM 5253  H HG12 . VAL A 1 89  ? -3.723  8.201   11.184  1.00 0.00 ? 89  VAL A HG12 3  
ATOM 5254  H HG13 . VAL A 1 89  ? -4.801  7.439   9.974   1.00 0.00 ? 89  VAL A HG13 3  
ATOM 5255  H HG21 . VAL A 1 89  ? -4.968  10.406  7.699   1.00 0.00 ? 89  VAL A HG21 3  
ATOM 5256  H HG22 . VAL A 1 89  ? -3.900  9.009   7.623   1.00 0.00 ? 89  VAL A HG22 3  
ATOM 5257  H HG23 . VAL A 1 89  ? -5.634  8.783   7.948   1.00 0.00 ? 89  VAL A HG23 3  
ATOM 5258  N N    . GLU A 1 90  ? -5.349  11.012  12.625  1.00 0.00 ? 90  GLU A N    3  
ATOM 5259  C CA   . GLU A 1 90  ? -5.354  11.055  14.100  1.00 0.00 ? 90  GLU A CA   3  
ATOM 5260  C C    . GLU A 1 90  ? -6.759  10.841  14.686  1.00 0.00 ? 90  GLU A C    3  
ATOM 5261  O O    . GLU A 1 90  ? -6.909  10.225  15.742  1.00 0.00 ? 90  GLU A O    3  
ATOM 5262  C CB   . GLU A 1 90  ? -4.811  12.405  14.606  1.00 0.00 ? 90  GLU A CB   3  
ATOM 5263  C CG   . GLU A 1 90  ? -3.419  12.742  14.059  1.00 0.00 ? 90  GLU A CG   3  
ATOM 5264  C CD   . GLU A 1 90  ? -2.835  13.973  14.762  1.00 0.00 ? 90  GLU A CD   3  
ATOM 5265  O OE1  . GLU A 1 90  ? -3.097  15.113  14.312  1.00 0.00 ? 90  GLU A OE1  3  
ATOM 5266  O OE2  . GLU A 1 90  ? -2.103  13.809  15.768  1.00 0.00 ? 90  GLU A OE2  3  
ATOM 5267  H H    . GLU A 1 90  ? -5.068  11.844  12.120  1.00 0.00 ? 90  GLU A H    3  
ATOM 5268  H HA   . GLU A 1 90  ? -4.705  10.261  14.474  1.00 0.00 ? 90  GLU A HA   3  
ATOM 5269  H HB2  . GLU A 1 90  ? -5.497  13.203  14.319  1.00 0.00 ? 90  GLU A HB2  3  
ATOM 5270  H HB3  . GLU A 1 90  ? -4.762  12.372  15.694  1.00 0.00 ? 90  GLU A HB3  3  
ATOM 5271  H HG2  . GLU A 1 90  ? -2.759  11.886  14.206  1.00 0.00 ? 90  GLU A HG2  3  
ATOM 5272  H HG3  . GLU A 1 90  ? -3.498  12.944  12.990  1.00 0.00 ? 90  GLU A HG3  3  
ATOM 5273  N N    . VAL A 1 91  ? -7.803  11.305  13.991  1.00 0.00 ? 91  VAL A N    3  
ATOM 5274  C CA   . VAL A 1 91  ? -9.200  11.188  14.458  1.00 0.00 ? 91  VAL A CA   3  
ATOM 5275  C C    . VAL A 1 91  ? -9.688  9.742   14.309  1.00 0.00 ? 91  VAL A C    3  
ATOM 5276  O O    . VAL A 1 91  ? -10.394 9.241   15.176  1.00 0.00 ? 91  VAL A O    3  
ATOM 5277  C CB   . VAL A 1 91  ? -10.136 12.178  13.721  1.00 0.00 ? 91  VAL A CB   3  
ATOM 5278  C CG1  . VAL A 1 91  ? -11.570 12.141  14.273  1.00 0.00 ? 91  VAL A CG1  3  
ATOM 5279  C CG2  . VAL A 1 91  ? -9.604  13.621  13.843  1.00 0.00 ? 91  VAL A CG2  3  
ATOM 5280  H H    . VAL A 1 91  ? -7.622  11.765  13.099  1.00 0.00 ? 91  VAL A H    3  
ATOM 5281  H HA   . VAL A 1 91  ? -9.213  11.442  15.518  1.00 0.00 ? 91  VAL A HA   3  
ATOM 5282  H HB   . VAL A 1 91  ? -10.166 11.912  12.666  1.00 0.00 ? 91  VAL A HB   3  
ATOM 5283  H HG11 . VAL A 1 91  ? -12.184 12.880  13.756  1.00 0.00 ? 91  VAL A HG11 3  
ATOM 5284  H HG12 . VAL A 1 91  ? -12.013 11.157  14.114  1.00 0.00 ? 91  VAL A HG12 3  
ATOM 5285  H HG13 . VAL A 1 91  ? -11.569 12.364  15.339  1.00 0.00 ? 91  VAL A HG13 3  
ATOM 5286  H HG21 . VAL A 1 91  ? -8.605  13.707  13.415  1.00 0.00 ? 91  VAL A HG21 3  
ATOM 5287  H HG22 . VAL A 1 91  ? -10.261 14.308  13.310  1.00 0.00 ? 91  VAL A HG22 3  
ATOM 5288  H HG23 . VAL A 1 91  ? -9.557  13.911  14.892  1.00 0.00 ? 91  VAL A HG23 3  
ATOM 5289  N N    . ILE A 1 92  ? -9.235  9.032   13.267  1.00 0.00 ? 92  ILE A N    3  
ATOM 5290  C CA   . ILE A 1 92  ? -9.501  7.592   13.082  1.00 0.00 ? 92  ILE A CA   3  
ATOM 5291  C C    . ILE A 1 92  ? -8.805  6.765   14.174  1.00 0.00 ? 92  ILE A C    3  
ATOM 5292  O O    . ILE A 1 92  ? -9.439  5.911   14.791  1.00 0.00 ? 92  ILE A O    3  
ATOM 5293  C CB   . ILE A 1 92  ? -9.103  7.182   11.641  1.00 0.00 ? 92  ILE A CB   3  
ATOM 5294  C CG1  . ILE A 1 92  ? -10.025 7.894   10.619  1.00 0.00 ? 92  ILE A CG1  3  
ATOM 5295  C CG2  . ILE A 1 92  ? -9.180  5.654   11.459  1.00 0.00 ? 92  ILE A CG2  3  
ATOM 5296  C CD1  . ILE A 1 92  ? -9.441  7.944   9.206   1.00 0.00 ? 92  ILE A CD1  3  
ATOM 5297  H H    . ILE A 1 92  ? -8.672  9.513   12.575  1.00 0.00 ? 92  ILE A H    3  
ATOM 5298  H HA   . ILE A 1 92  ? -10.571 7.400   13.201  1.00 0.00 ? 92  ILE A HA   3  
ATOM 5299  H HB   . ILE A 1 92  ? -8.070  7.490   11.459  1.00 0.00 ? 92  ILE A HB   3  
ATOM 5300  H HG12 . ILE A 1 92  ? -10.993 7.394   10.594  1.00 0.00 ? 92  ILE A HG12 3  
ATOM 5301  H HG13 . ILE A 1 92  ? -10.204 8.928   10.919  1.00 0.00 ? 92  ILE A HG13 3  
ATOM 5302  H HG21 . ILE A 1 92  ? -10.176 5.293   11.712  1.00 0.00 ? 92  ILE A HG21 3  
ATOM 5303  H HG22 . ILE A 1 92  ? -8.956  5.382   10.428  1.00 0.00 ? 92  ILE A HG22 3  
ATOM 5304  H HG23 . ILE A 1 92  ? -8.449  5.161   12.100  1.00 0.00 ? 92  ILE A HG23 3  
ATOM 5305  H HD11 . ILE A 1 92  ? -8.545  8.569   9.200   1.00 0.00 ? 92  ILE A HD11 3  
ATOM 5306  H HD12 . ILE A 1 92  ? -9.202  6.948   8.840   1.00 0.00 ? 92  ILE A HD12 3  
ATOM 5307  H HD13 . ILE A 1 92  ? -10.178 8.386   8.538   1.00 0.00 ? 92  ILE A HD13 3  
ATOM 5308  N N    . ILE A 1 93  ? -7.541  7.073   14.489  1.00 0.00 ? 93  ILE A N    3  
ATOM 5309  C CA   . ILE A 1 93  ? -6.810  6.472   15.623  1.00 0.00 ? 93  ILE A CA   3  
ATOM 5310  C C    . ILE A 1 93  ? -7.516  6.762   16.957  1.00 0.00 ? 93  ILE A C    3  
ATOM 5311  O O    . ILE A 1 93  ? -7.621  5.884   17.811  1.00 0.00 ? 93  ILE A O    3  
ATOM 5312  C CB   . ILE A 1 93  ? -5.333  6.957   15.607  1.00 0.00 ? 93  ILE A CB   3  
ATOM 5313  C CG1  . ILE A 1 93  ? -4.598  6.337   14.395  1.00 0.00 ? 93  ILE A CG1  3  
ATOM 5314  C CG2  . ILE A 1 93  ? -4.603  6.622   16.922  1.00 0.00 ? 93  ILE A CG2  3  
ATOM 5315  C CD1  . ILE A 1 93  ? -3.184  6.882   14.139  1.00 0.00 ? 93  ILE A CD1  3  
ATOM 5316  H H    . ILE A 1 93  ? -7.062  7.765   13.917  1.00 0.00 ? 93  ILE A H    3  
ATOM 5317  H HA   . ILE A 1 93  ? -6.833  5.386   15.517  1.00 0.00 ? 93  ILE A HA   3  
ATOM 5318  H HB   . ILE A 1 93  ? -5.326  8.042   15.495  1.00 0.00 ? 93  ILE A HB   3  
ATOM 5319  H HG12 . ILE A 1 93  ? -4.537  5.258   14.528  1.00 0.00 ? 93  ILE A HG12 3  
ATOM 5320  H HG13 . ILE A 1 93  ? -5.180  6.524   13.493  1.00 0.00 ? 93  ILE A HG13 3  
ATOM 5321  H HG21 . ILE A 1 93  ? -5.069  7.147   17.755  1.00 0.00 ? 93  ILE A HG21 3  
ATOM 5322  H HG22 . ILE A 1 93  ? -4.626  5.550   17.107  1.00 0.00 ? 93  ILE A HG22 3  
ATOM 5323  H HG23 . ILE A 1 93  ? -3.569  6.960   16.883  1.00 0.00 ? 93  ILE A HG23 3  
ATOM 5324  H HD11 . ILE A 1 93  ? -2.524  6.654   14.972  1.00 0.00 ? 93  ILE A HD11 3  
ATOM 5325  H HD12 . ILE A 1 93  ? -2.757  6.420   13.248  1.00 0.00 ? 93  ILE A HD12 3  
ATOM 5326  H HD13 . ILE A 1 93  ? -3.236  7.963   13.988  1.00 0.00 ? 93  ILE A HD13 3  
ATOM 5327  N N    . SER A 1 94  ? -8.037  7.975   17.140  1.00 0.00 ? 94  SER A N    3  
ATOM 5328  C CA   . SER A 1 94  ? -8.767  8.363   18.353  1.00 0.00 ? 94  SER A CA   3  
ATOM 5329  C C    . SER A 1 94  ? -10.089 7.585   18.481  1.00 0.00 ? 94  SER A C    3  
ATOM 5330  O O    . SER A 1 94  ? -10.417 7.060   19.546  1.00 0.00 ? 94  SER A O    3  
ATOM 5331  C CB   . SER A 1 94  ? -9.028  9.878   18.354  1.00 0.00 ? 94  SER A CB   3  
ATOM 5332  O OG   . SER A 1 94  ? -7.821  10.625  18.253  1.00 0.00 ? 94  SER A OG   3  
ATOM 5333  H H    . SER A 1 94  ? -7.897  8.665   16.415  1.00 0.00 ? 94  SER A H    3  
ATOM 5334  H HA   . SER A 1 94  ? -8.158  8.121   19.222  1.00 0.00 ? 94  SER A HA   3  
ATOM 5335  H HB2  . SER A 1 94  ? -9.682  10.138  17.523  1.00 0.00 ? 94  SER A HB2  3  
ATOM 5336  H HB3  . SER A 1 94  ? -9.537  10.146  19.284  1.00 0.00 ? 94  SER A HB3  3  
ATOM 5337  H HG   . SER A 1 94  ? -7.457  10.508  17.351  1.00 0.00 ? 94  SER A HG   3  
ATOM 5338  N N    . SER A 1 95  ? -10.825 7.441   17.382  1.00 0.00 ? 95  SER A N    3  
ATOM 5339  C CA   . SER A 1 95  ? -12.060 6.664   17.321  1.00 0.00 ? 95  SER A CA   3  
ATOM 5340  C C    . SER A 1 95  ? -11.832 5.173   17.569  1.00 0.00 ? 95  SER A C    3  
ATOM 5341  O O    . SER A 1 95  ? -12.653 4.546   18.232  1.00 0.00 ? 95  SER A O    3  
ATOM 5342  C CB   . SER A 1 95  ? -12.745 6.884   15.969  1.00 0.00 ? 95  SER A CB   3  
ATOM 5343  O OG   . SER A 1 95  ? -13.350 8.164   15.947  1.00 0.00 ? 95  SER A OG   3  
ATOM 5344  H H    . SER A 1 95  ? -10.545 7.928   16.539  1.00 0.00 ? 95  SER A H    3  
ATOM 5345  H HA   . SER A 1 95  ? -12.733 7.020   18.097  1.00 0.00 ? 95  SER A HA   3  
ATOM 5346  H HB2  . SER A 1 95  ? -12.005 6.804   15.171  1.00 0.00 ? 95  SER A HB2  3  
ATOM 5347  H HB3  . SER A 1 95  ? -13.511 6.122   15.822  1.00 0.00 ? 95  SER A HB3  3  
ATOM 5348  H HG   . SER A 1 95  ? -13.842 8.253   15.101  1.00 0.00 ? 95  SER A HG   3  
ATOM 5349  N N    . ALA A 1 96  ? -10.708 4.593   17.138  1.00 0.00 ? 96  ALA A N    3  
ATOM 5350  C CA   . ALA A 1 96  ? -10.334 3.222   17.494  1.00 0.00 ? 96  ALA A CA   3  
ATOM 5351  C C    . ALA A 1 96  ? -10.132 3.060   19.011  1.00 0.00 ? 96  ALA A C    3  
ATOM 5352  O O    . ALA A 1 96  ? -10.695 2.153   19.630  1.00 0.00 ? 96  ALA A O    3  
ATOM 5353  C CB   . ALA A 1 96  ? -9.089  2.860   16.677  1.00 0.00 ? 96  ALA A CB   3  
ATOM 5354  H H    . ALA A 1 96  ? -10.074 5.132   16.550  1.00 0.00 ? 96  ALA A H    3  
ATOM 5355  H HA   . ALA A 1 96  ? -11.144 2.549   17.211  1.00 0.00 ? 96  ALA A HA   3  
ATOM 5356  H HB1  . ALA A 1 96  ? -8.871  1.798   16.779  1.00 0.00 ? 96  ALA A HB1  3  
ATOM 5357  H HB2  . ALA A 1 96  ? -9.267  3.079   15.623  1.00 0.00 ? 96  ALA A HB2  3  
ATOM 5358  H HB3  . ALA A 1 96  ? -8.233  3.443   17.019  1.00 0.00 ? 96  ALA A HB3  3  
ATOM 5359  N N    . LYS A 1 97  ? -9.423  4.006   19.637  1.00 0.00 ? 97  LYS A N    3  
ATOM 5360  C CA   . LYS A 1 97  ? -9.255  4.071   21.095  1.00 0.00 ? 97  LYS A CA   3  
ATOM 5361  C C    . LYS A 1 97  ? -10.565 4.378   21.863  1.00 0.00 ? 97  LYS A C    3  
ATOM 5362  O O    . LYS A 1 97  ? -10.611 4.171   23.079  1.00 0.00 ? 97  LYS A O    3  
ATOM 5363  C CB   . LYS A 1 97  ? -8.121  5.054   21.439  1.00 0.00 ? 97  LYS A CB   3  
ATOM 5364  C CG   . LYS A 1 97  ? -6.753  4.534   20.954  1.00 0.00 ? 97  LYS A CG   3  
ATOM 5365  C CD   . LYS A 1 97  ? -5.581  5.414   21.414  1.00 0.00 ? 97  LYS A CD   3  
ATOM 5366  C CE   . LYS A 1 97  ? -5.682  6.849   20.872  1.00 0.00 ? 97  LYS A CE   3  
ATOM 5367  N NZ   . LYS A 1 97  ? -4.498  7.671   21.256  1.00 0.00 ? 97  LYS A NZ   3  
ATOM 5368  H H    . LYS A 1 97  ? -8.983  4.727   19.068  1.00 0.00 ? 97  LYS A H    3  
ATOM 5369  H HA   . LYS A 1 97  ? -8.946  3.082   21.442  1.00 0.00 ? 97  LYS A HA   3  
ATOM 5370  H HB2  . LYS A 1 97  ? -8.337  6.025   20.991  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 5371  H HB3  . LYS A 1 97  ? -8.077  5.174   22.524  1.00 0.00 ? 97  LYS A HB3  3  
ATOM 5372  H HG2  . LYS A 1 97  ? -6.595  3.528   21.349  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 5373  H HG3  . LYS A 1 97  ? -6.743  4.474   19.867  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 5374  H HD2  . LYS A 1 97  ? -5.556  5.432   22.506  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 5375  H HD3  . LYS A 1 97  ? -4.654  4.958   21.058  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 5376  H HE2  . LYS A 1 97  ? -5.774  6.804   19.782  1.00 0.00 ? 97  LYS A HE2  3  
ATOM 5377  H HE3  . LYS A 1 97  ? -6.590  7.311   21.275  1.00 0.00 ? 97  LYS A HE3  3  
ATOM 5378  H HZ1  . LYS A 1 97  ? -4.578  8.616   20.901  1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 5379  H HZ2  . LYS A 1 97  ? -4.409  7.731   22.262  1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 5380  H HZ3  . LYS A 1 97  ? -3.640  7.272   20.892  1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 5381  N N    . GLU A 1 98  ? -11.631 4.819   21.182  1.00 0.00 ? 98  GLU A N    3  
ATOM 5382  C CA   . GLU A 1 98  ? -12.986 4.926   21.735  1.00 0.00 ? 98  GLU A CA   3  
ATOM 5383  C C    . GLU A 1 98  ? -13.827 3.654   21.489  1.00 0.00 ? 98  GLU A C    3  
ATOM 5384  O O    . GLU A 1 98  ? -14.596 3.247   22.361  1.00 0.00 ? 98  GLU A O    3  
ATOM 5385  C CB   . GLU A 1 98  ? -13.709 6.165   21.185  1.00 0.00 ? 98  GLU A CB   3  
ATOM 5386  C CG   . GLU A 1 98  ? -13.150 7.463   21.779  1.00 0.00 ? 98  GLU A CG   3  
ATOM 5387  C CD   . GLU A 1 98  ? -13.964 8.678   21.317  1.00 0.00 ? 98  GLU A CD   3  
ATOM 5388  O OE1  . GLU A 1 98  ? -14.963 9.028   21.992  1.00 0.00 ? 98  GLU A OE1  3  
ATOM 5389  O OE2  . GLU A 1 98  ? -13.610 9.296   20.286  1.00 0.00 ? 98  GLU A OE2  3  
ATOM 5390  H H    . GLU A 1 98  ? -11.484 5.132   20.235  1.00 0.00 ? 98  GLU A H    3  
ATOM 5391  H HA   . GLU A 1 98  ? -12.903 5.043   22.806  1.00 0.00 ? 98  GLU A HA   3  
ATOM 5392  H HB2  . GLU A 1 98  ? -13.633 6.191   20.099  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 5393  H HB3  . GLU A 1 98  ? -14.765 6.097   21.454  1.00 0.00 ? 98  GLU A HB3  3  
ATOM 5394  H HG2  . GLU A 1 98  ? -13.192 7.402   22.868  1.00 0.00 ? 98  GLU A HG2  3  
ATOM 5395  H HG3  . GLU A 1 98  ? -12.107 7.586   21.489  1.00 0.00 ? 98  GLU A HG3  3  
ATOM 5396  N N    . MET A 1 99  ? -13.664 3.001   20.331  1.00 0.00 ? 99  MET A N    3  
ATOM 5397  C CA   . MET A 1 99  ? -14.364 1.761   19.951  1.00 0.00 ? 99  MET A CA   3  
ATOM 5398  C C    . MET A 1 99  ? -13.876 0.525   20.711  1.00 0.00 ? 99  MET A C    3  
ATOM 5399  O O    . MET A 1 99  ? -14.663 -0.387  20.954  1.00 0.00 ? 99  MET A O    3  
ATOM 5400  C CB   . MET A 1 99  ? -14.245 1.527   18.434  1.00 0.00 ? 99  MET A CB   3  
ATOM 5401  C CG   . MET A 1 99  ? -15.198 2.426   17.635  1.00 0.00 ? 99  MET A CG   3  
ATOM 5402  S SD   . MET A 1 99  ? -16.970 2.074   17.820  1.00 0.00 ? 99  MET A SD   3  
ATOM 5403  C CE   . MET A 1 99  ? -17.066 0.486   16.950  1.00 0.00 ? 99  MET A CE   3  
ATOM 5404  H H    . MET A 1 99  ? -13.083 3.449   19.631  1.00 0.00 ? 99  MET A H    3  
ATOM 5405  H HA   . MET A 1 99  ? -15.416 1.867   20.205  1.00 0.00 ? 99  MET A HA   3  
ATOM 5406  H HB2  . MET A 1 99  ? -13.219 1.714   18.119  1.00 0.00 ? 99  MET A HB2  3  
ATOM 5407  H HB3  . MET A 1 99  ? -14.478 0.485   18.205  1.00 0.00 ? 99  MET A HB3  3  
ATOM 5408  H HG2  . MET A 1 99  ? -15.017 3.463   17.915  1.00 0.00 ? 99  MET A HG2  3  
ATOM 5409  H HG3  . MET A 1 99  ? -14.954 2.337   16.577  1.00 0.00 ? 99  MET A HG3  3  
ATOM 5410  H HE1  . MET A 1 99  ? -16.520 -0.281  17.503  1.00 0.00 ? 99  MET A HE1  3  
ATOM 5411  H HE2  . MET A 1 99  ? -18.111 0.180   16.866  1.00 0.00 ? 99  MET A HE2  3  
ATOM 5412  H HE3  . MET A 1 99  ? -16.644 0.582   15.947  1.00 0.00 ? 99  MET A HE3  3  
ATOM 5413  N N    . VAL A 1 100 ? -12.605 0.477   21.111  1.00 0.00 ? 100 VAL A N    3  
ATOM 5414  C CA   . VAL A 1 100 ? -12.095 -0.576  22.006  1.00 0.00 ? 100 VAL A CA   3  
ATOM 5415  C C    . VAL A 1 100 ? -12.928 -0.660  23.295  1.00 0.00 ? 100 VAL A C    3  
ATOM 5416  O O    . VAL A 1 100 ? -13.189 0.344   23.959  1.00 0.00 ? 100 VAL A O    3  
ATOM 5417  C CB   . VAL A 1 100 ? -10.581 -0.451  22.275  1.00 0.00 ? 100 VAL A CB   3  
ATOM 5418  C CG1  . VAL A 1 100 ? -10.178 0.805   23.056  1.00 0.00 ? 100 VAL A CG1  3  
ATOM 5419  C CG2  . VAL A 1 100 ? -10.051 -1.701  22.984  1.00 0.00 ? 100 VAL A CG2  3  
ATOM 5420  H H    . VAL A 1 100 ? -11.982 1.205   20.773  1.00 0.00 ? 100 VAL A H    3  
ATOM 5421  H HA   . VAL A 1 100 ? -12.233 -1.513  21.472  1.00 0.00 ? 100 VAL A HA   3  
ATOM 5422  H HB   . VAL A 1 100 ? -10.098 -0.395  21.302  1.00 0.00 ? 100 VAL A HB   3  
ATOM 5423  H HG11 . VAL A 1 100 ? -10.539 0.753   24.082  1.00 0.00 ? 100 VAL A HG11 3  
ATOM 5424  H HG12 . VAL A 1 100 ? -9.091  0.898   23.068  1.00 0.00 ? 100 VAL A HG12 3  
ATOM 5425  H HG13 . VAL A 1 100 ? -10.599 1.678   22.564  1.00 0.00 ? 100 VAL A HG13 3  
ATOM 5426  H HG21 . VAL A 1 100 ? -10.500 -1.801  23.970  1.00 0.00 ? 100 VAL A HG21 3  
ATOM 5427  H HG22 . VAL A 1 100 ? -10.293 -2.580  22.389  1.00 0.00 ? 100 VAL A HG22 3  
ATOM 5428  H HG23 . VAL A 1 100 ? -8.972  -1.633  23.095  1.00 0.00 ? 100 VAL A HG23 3  
ATOM 5429  N N    . GLY A 1 101 ? -13.373 -1.881  23.603  1.00 0.00 ? 101 GLY A N    3  
ATOM 5430  C CA   . GLY A 1 101 ? -14.309 -2.198  24.688  1.00 0.00 ? 101 GLY A CA   3  
ATOM 5431  C C    . GLY A 1 101 ? -15.759 -2.413  24.234  1.00 0.00 ? 101 GLY A C    3  
ATOM 5432  O O    . GLY A 1 101 ? -16.571 -2.874  25.036  1.00 0.00 ? 101 GLY A O    3  
ATOM 5433  H H    . GLY A 1 101 ? -13.078 -2.643  23.000  1.00 0.00 ? 101 GLY A H    3  
ATOM 5434  H HA2  . GLY A 1 101 ? -13.987 -3.126  25.162  1.00 0.00 ? 101 GLY A HA2  3  
ATOM 5435  H HA3  . GLY A 1 101 ? -14.309 -1.398  25.428  1.00 0.00 ? 101 GLY A HA3  3  
ATOM 5436  N N    . GLN A 1 102 ? -16.102 -2.125  22.972  1.00 0.00 ? 102 GLN A N    3  
ATOM 5437  C CA   . GLN A 1 102 ? -17.409 -2.443  22.397  1.00 0.00 ? 102 GLN A CA   3  
ATOM 5438  C C    . GLN A 1 102 ? -17.557 -3.953  22.169  1.00 0.00 ? 102 GLN A C    3  
ATOM 5439  O O    . GLN A 1 102 ? -16.603 -4.653  21.821  1.00 0.00 ? 102 GLN A O    3  
ATOM 5440  C CB   . GLN A 1 102 ? -17.625 -1.686  21.071  1.00 0.00 ? 102 GLN A CB   3  
ATOM 5441  C CG   . GLN A 1 102 ? -17.848 -0.173  21.250  1.00 0.00 ? 102 GLN A CG   3  
ATOM 5442  C CD   . GLN A 1 102 ? -19.193 0.142   21.904  1.00 0.00 ? 102 GLN A CD   3  
ATOM 5443  O OE1  . GLN A 1 102 ? -19.290 0.415   23.095  1.00 0.00 ? 102 GLN A OE1  3  
ATOM 5444  N NE2  . GLN A 1 102 ? -20.288 0.077   21.171  1.00 0.00 ? 102 GLN A NE2  3  
ATOM 5445  H H    . GLN A 1 102 ? -15.416 -1.723  22.349  1.00 0.00 ? 102 GLN A H    3  
ATOM 5446  H HA   . GLN A 1 102 ? -18.184 -2.140  23.108  1.00 0.00 ? 102 GLN A HA   3  
ATOM 5447  H HB2  . GLN A 1 102 ? -16.764 -1.852  20.423  1.00 0.00 ? 102 GLN A HB2  3  
ATOM 5448  H HB3  . GLN A 1 102 ? -18.497 -2.100  20.559  1.00 0.00 ? 102 GLN A HB3  3  
ATOM 5449  H HG2  . GLN A 1 102 ? -17.050 0.255   21.854  1.00 0.00 ? 102 GLN A HG2  3  
ATOM 5450  H HG3  . GLN A 1 102 ? -17.819 0.299   20.267  1.00 0.00 ? 102 GLN A HG3  3  
ATOM 5451  H HE21 . GLN A 1 102 ? -20.239 -0.151  20.188  1.00 0.00 ? 102 GLN A HE21 3  
ATOM 5452  H HE22 . GLN A 1 102 ? -21.175 0.267   21.613  1.00 0.00 ? 102 GLN A HE22 3  
ATOM 5453  N N    . LYS A 1 103 ? -18.788 -4.431  22.347  1.00 0.00 ? 103 LYS A N    3  
ATOM 5454  C CA   . LYS A 1 103 ? -19.215 -5.822  22.132  1.00 0.00 ? 103 LYS A CA   3  
ATOM 5455  C C    . LYS A 1 103 ? -20.417 -5.903  21.171  1.00 0.00 ? 103 LYS A C    3  
ATOM 5456  O O    . LYS A 1 103 ? -21.313 -5.053  21.217  1.00 0.00 ? 103 LYS A O    3  
ATOM 5457  C CB   . LYS A 1 103 ? -19.586 -6.460  23.484  1.00 0.00 ? 103 LYS A CB   3  
ATOM 5458  C CG   . LYS A 1 103 ? -18.385 -6.622  24.427  1.00 0.00 ? 103 LYS A CG   3  
ATOM 5459  C CD   . LYS A 1 103 ? -18.834 -7.190  25.778  1.00 0.00 ? 103 LYS A CD   3  
ATOM 5460  C CE   . LYS A 1 103 ? -17.629 -7.323  26.718  1.00 0.00 ? 103 LYS A CE   3  
ATOM 5461  N NZ   . LYS A 1 103 ? -18.015 -7.859  28.052  1.00 0.00 ? 103 LYS A NZ   3  
ATOM 5462  H H    . LYS A 1 103 ? -19.496 -3.765  22.617  1.00 0.00 ? 103 LYS A H    3  
ATOM 5463  H HA   . LYS A 1 103 ? -18.398 -6.388  21.687  1.00 0.00 ? 103 LYS A HA   3  
ATOM 5464  H HB2  . LYS A 1 103 ? -20.346 -5.843  23.970  1.00 0.00 ? 103 LYS A HB2  3  
ATOM 5465  H HB3  . LYS A 1 103 ? -20.014 -7.450  23.300  1.00 0.00 ? 103 LYS A HB3  3  
ATOM 5466  H HG2  . LYS A 1 103 ? -17.667 -7.299  23.968  1.00 0.00 ? 103 LYS A HG2  3  
ATOM 5467  H HG3  . LYS A 1 103 ? -17.909 -5.653  24.591  1.00 0.00 ? 103 LYS A HG3  3  
ATOM 5468  H HD2  . LYS A 1 103 ? -19.571 -6.518  26.223  1.00 0.00 ? 103 LYS A HD2  3  
ATOM 5469  H HD3  . LYS A 1 103 ? -19.292 -8.169  25.621  1.00 0.00 ? 103 LYS A HD3  3  
ATOM 5470  H HE2  . LYS A 1 103 ? -16.896 -7.985  26.251  1.00 0.00 ? 103 LYS A HE2  3  
ATOM 5471  H HE3  . LYS A 1 103 ? -17.164 -6.338  26.832  1.00 0.00 ? 103 LYS A HE3  3  
ATOM 5472  H HZ1  . LYS A 1 103 ? -18.681 -7.252  28.512  1.00 0.00 ? 103 LYS A HZ1  3  
ATOM 5473  H HZ2  . LYS A 1 103 ? -18.433 -8.776  27.971  1.00 0.00 ? 103 LYS A HZ2  3  
ATOM 5474  H HZ3  . LYS A 1 103 ? -17.206 -7.943  28.653  1.00 0.00 ? 103 LYS A HZ3  3  
ATOM 5475  N N    . MET A 1 104 ? -20.458 -6.945  20.332  1.00 0.00 ? 104 MET A N    3  
ATOM 5476  C CA   . MET A 1 104 ? -21.495 -7.167  19.305  1.00 0.00 ? 104 MET A CA   3  
ATOM 5477  C C    . MET A 1 104 ? -21.865 -8.656  19.195  1.00 0.00 ? 104 MET A C    3  
ATOM 5478  O O    . MET A 1 104 ? -21.080 -9.519  19.589  1.00 0.00 ? 104 MET A O    3  
ATOM 5479  C CB   . MET A 1 104 ? -21.033 -6.614  17.939  1.00 0.00 ? 104 MET A CB   3  
ATOM 5480  C CG   . MET A 1 104 ? -20.800 -5.090  17.930  1.00 0.00 ? 104 MET A CG   3  
ATOM 5481  S SD   . MET A 1 104 ? -19.146 -4.514  18.406  1.00 0.00 ? 104 MET A SD   3  
ATOM 5482  C CE   . MET A 1 104 ? -18.284 -4.885  16.862  1.00 0.00 ? 104 MET A CE   3  
ATOM 5483  H H    . MET A 1 104 ? -19.726 -7.646  20.417  1.00 0.00 ? 104 MET A H    3  
ATOM 5484  H HA   . MET A 1 104 ? -22.398 -6.625  19.584  1.00 0.00 ? 104 MET A HA   3  
ATOM 5485  H HB2  . MET A 1 104 ? -20.125 -7.123  17.617  1.00 0.00 ? 104 MET A HB2  3  
ATOM 5486  H HB3  . MET A 1 104 ? -21.812 -6.833  17.207  1.00 0.00 ? 104 MET A HB3  3  
ATOM 5487  H HG2  . MET A 1 104 ? -20.993 -4.727  16.920  1.00 0.00 ? 104 MET A HG2  3  
ATOM 5488  H HG3  . MET A 1 104 ? -21.533 -4.620  18.586  1.00 0.00 ? 104 MET A HG3  3  
ATOM 5489  H HE1  . MET A 1 104 ? -17.244 -4.570  16.934  1.00 0.00 ? 104 MET A HE1  3  
ATOM 5490  H HE2  . MET A 1 104 ? -18.330 -5.955  16.668  1.00 0.00 ? 104 MET A HE2  3  
ATOM 5491  H HE3  . MET A 1 104 ? -18.765 -4.358  16.036  1.00 0.00 ? 104 MET A HE3  3  
ATOM 5492  N N    . LYS A 1 105 ? -23.053 -8.977  18.662  1.00 0.00 ? 105 LYS A N    3  
ATOM 5493  C CA   . LYS A 1 105 ? -23.542 -10.371 18.581  1.00 0.00 ? 105 LYS A CA   3  
ATOM 5494  C C    . LYS A 1 105 ? -24.690 -10.604 17.575  1.00 0.00 ? 105 LYS A C    3  
ATOM 5495  O O    . LYS A 1 105 ? -24.718 -11.630 16.896  1.00 0.00 ? 105 LYS A O    3  
ATOM 5496  C CB   . LYS A 1 105 ? -23.975 -10.811 19.999  1.00 0.00 ? 105 LYS A CB   3  
ATOM 5497  C CG   . LYS A 1 105 ? -23.950 -12.338 20.158  1.00 0.00 ? 105 LYS A CG   3  
ATOM 5498  C CD   . LYS A 1 105 ? -24.355 -12.741 21.580  1.00 0.00 ? 105 LYS A CD   3  
ATOM 5499  C CE   . LYS A 1 105 ? -24.030 -14.221 21.816  1.00 0.00 ? 105 LYS A CE   3  
ATOM 5500  N NZ   . LYS A 1 105 ? -24.384 -14.653 23.193  1.00 0.00 ? 105 LYS A NZ   3  
ATOM 5501  H H    . LYS A 1 105 ? -23.649 -8.227  18.337  1.00 0.00 ? 105 LYS A H    3  
ATOM 5502  H HA   . LYS A 1 105 ? -22.708 -11.002 18.264  1.00 0.00 ? 105 LYS A HA   3  
ATOM 5503  H HB2  . LYS A 1 105 ? -23.293 -10.393 20.741  1.00 0.00 ? 105 LYS A HB2  3  
ATOM 5504  H HB3  . LYS A 1 105 ? -24.974 -10.431 20.218  1.00 0.00 ? 105 LYS A HB3  3  
ATOM 5505  H HG2  . LYS A 1 105 ? -24.633 -12.803 19.447  1.00 0.00 ? 105 LYS A HG2  3  
ATOM 5506  H HG3  . LYS A 1 105 ? -22.936 -12.692 19.958  1.00 0.00 ? 105 LYS A HG3  3  
ATOM 5507  H HD2  . LYS A 1 105 ? -23.805 -12.131 22.297  1.00 0.00 ? 105 LYS A HD2  3  
ATOM 5508  H HD3  . LYS A 1 105 ? -25.425 -12.568 21.719  1.00 0.00 ? 105 LYS A HD3  3  
ATOM 5509  H HE2  . LYS A 1 105 ? -24.574 -14.826 21.085  1.00 0.00 ? 105 LYS A HE2  3  
ATOM 5510  H HE3  . LYS A 1 105 ? -22.958 -14.366 21.646  1.00 0.00 ? 105 LYS A HE3  3  
ATOM 5511  H HZ1  . LYS A 1 105 ? -25.373 -14.525 23.373  1.00 0.00 ? 105 LYS A HZ1  3  
ATOM 5512  H HZ2  . LYS A 1 105 ? -24.174 -15.633 23.332  1.00 0.00 ? 105 LYS A HZ2  3  
ATOM 5513  H HZ3  . LYS A 1 105 ? -23.869 -14.123 23.884  1.00 0.00 ? 105 LYS A HZ3  3  
ATOM 5514  N N    . TYR A 1 106 ? -25.638 -9.663  17.475  1.00 0.00 ? 106 TYR A N    3  
ATOM 5515  C CA   . TYR A 1 106 ? -26.895 -9.844  16.724  1.00 0.00 ? 106 TYR A CA   3  
ATOM 5516  C C    . TYR A 1 106 ? -26.731 -9.839  15.187  1.00 0.00 ? 106 TYR A C    3  
ATOM 5517  O O    . TYR A 1 106 ? -27.442 -10.555 14.481  1.00 0.00 ? 106 TYR A O    3  
ATOM 5518  C CB   . TYR A 1 106 ? -27.867 -8.740  17.169  1.00 0.00 ? 106 TYR A CB   3  
ATOM 5519  C CG   . TYR A 1 106 ? -29.245 -8.823  16.538  1.00 0.00 ? 106 TYR A CG   3  
ATOM 5520  C CD1  . TYR A 1 106 ? -30.183 -9.759  17.014  1.00 0.00 ? 106 TYR A CD1  3  
ATOM 5521  C CD2  . TYR A 1 106 ? -29.588 -7.970  15.468  1.00 0.00 ? 106 TYR A CD2  3  
ATOM 5522  C CE1  . TYR A 1 106 ? -31.460 -9.852  16.426  1.00 0.00 ? 106 TYR A CE1  3  
ATOM 5523  C CE2  . TYR A 1 106 ? -30.863 -8.056  14.876  1.00 0.00 ? 106 TYR A CE2  3  
ATOM 5524  C CZ   . TYR A 1 106 ? -31.804 -8.996  15.354  1.00 0.00 ? 106 TYR A CZ   3  
ATOM 5525  O OH   . TYR A 1 106 ? -33.036 -9.077  14.777  1.00 0.00 ? 106 TYR A OH   3  
ATOM 5526  H H    . TYR A 1 106 ? -25.578 -8.865  18.094  1.00 0.00 ? 106 TYR A H    3  
ATOM 5527  H HA   . TYR A 1 106 ? -27.332 -10.806 16.997  1.00 0.00 ? 106 TYR A HA   3  
ATOM 5528  H HB2  . TYR A 1 106 ? -27.986 -8.800  18.251  1.00 0.00 ? 106 TYR A HB2  3  
ATOM 5529  H HB3  . TYR A 1 106 ? -27.427 -7.770  16.935  1.00 0.00 ? 106 TYR A HB3  3  
ATOM 5530  H HD1  . TYR A 1 106 ? -29.922 -10.411 17.839  1.00 0.00 ? 106 TYR A HD1  3  
ATOM 5531  H HD2  . TYR A 1 106 ? -28.870 -7.249  15.100  1.00 0.00 ? 106 TYR A HD2  3  
ATOM 5532  H HE1  . TYR A 1 106 ? -32.171 -10.576 16.795  1.00 0.00 ? 106 TYR A HE1  3  
ATOM 5533  H HE2  . TYR A 1 106 ? -31.125 -7.398  14.057  1.00 0.00 ? 106 TYR A HE2  3  
ATOM 5534  H HH   . TYR A 1 106 ? -33.589 -9.752  15.187  1.00 0.00 ? 106 TYR A HH   3  
ATOM 5535  N N    . SER A 1 107 ? -25.804 -9.034  14.665  1.00 0.00 ? 107 SER A N    3  
ATOM 5536  C CA   . SER A 1 107 ? -25.596 -8.837  13.219  1.00 0.00 ? 107 SER A CA   3  
ATOM 5537  C C    . SER A 1 107 ? -24.961 -10.054 12.507  1.00 0.00 ? 107 SER A C    3  
ATOM 5538  O O    . SER A 1 107 ? -24.358 -10.927 13.142  1.00 0.00 ? 107 SER A O    3  
ATOM 5539  C CB   . SER A 1 107 ? -24.726 -7.586  12.993  1.00 0.00 ? 107 SER A CB   3  
ATOM 5540  O OG   . SER A 1 107 ? -25.319 -6.441  13.594  1.00 0.00 ? 107 SER A OG   3  
ATOM 5541  H H    . SER A 1 107 ? -25.274 -8.453  15.298  1.00 0.00 ? 107 SER A H    3  
ATOM 5542  H HA   . SER A 1 107 ? -26.566 -8.657  12.748  1.00 0.00 ? 107 SER A HA   3  
ATOM 5543  H HB2  . SER A 1 107 ? -23.740 -7.754  13.431  1.00 0.00 ? 107 SER A HB2  3  
ATOM 5544  H HB3  . SER A 1 107 ? -24.609 -7.415  11.923  1.00 0.00 ? 107 SER A HB3  3  
ATOM 5545  H HG   . SER A 1 107 ? -24.776 -5.663  13.396  1.00 0.00 ? 107 SER A HG   3  
ATOM 5546  N N    . ILE A 1 108 ? -25.056 -10.100 11.166  1.00 0.00 ? 108 ILE A N    3  
ATOM 5547  C CA   . ILE A 1 108 ? -24.350 -11.091 10.321  1.00 0.00 ? 108 ILE A CA   3  
ATOM 5548  C C    . ILE A 1 108 ? -22.834 -10.872 10.469  1.00 0.00 ? 108 ILE A C    3  
ATOM 5549  O O    . ILE A 1 108 ? -22.382 -9.735  10.374  1.00 0.00 ? 108 ILE A O    3  
ATOM 5550  C CB   . ILE A 1 108 ? -24.828 -10.982 8.846   1.00 0.00 ? 108 ILE A CB   3  
ATOM 5551  C CG1  . ILE A 1 108 ? -26.339 -11.311 8.741   1.00 0.00 ? 108 ILE A CG1  3  
ATOM 5552  C CG2  . ILE A 1 108 ? -24.012 -11.913 7.923   1.00 0.00 ? 108 ILE A CG2  3  
ATOM 5553  C CD1  . ILE A 1 108 ? -26.947 -11.085 7.350   1.00 0.00 ? 108 ILE A CD1  3  
ATOM 5554  H H    . ILE A 1 108 ? -25.561 -9.358  10.696  1.00 0.00 ? 108 ILE A H    3  
ATOM 5555  H HA   . ILE A 1 108 ? -24.592 -12.092 10.685  1.00 0.00 ? 108 ILE A HA   3  
ATOM 5556  H HB   . ILE A 1 108 ? -24.672 -9.953  8.509   1.00 0.00 ? 108 ILE A HB   3  
ATOM 5557  H HG12 . ILE A 1 108 ? -26.505 -12.349 9.030   1.00 0.00 ? 108 ILE A HG12 3  
ATOM 5558  H HG13 . ILE A 1 108 ? -26.902 -10.685 9.434   1.00 0.00 ? 108 ILE A HG13 3  
ATOM 5559  H HG21 . ILE A 1 108 ? -24.145 -12.953 8.228   1.00 0.00 ? 108 ILE A HG21 3  
ATOM 5560  H HG22 . ILE A 1 108 ? -24.330 -11.799 6.888   1.00 0.00 ? 108 ILE A HG22 3  
ATOM 5561  H HG23 . ILE A 1 108 ? -22.954 -11.657 7.954   1.00 0.00 ? 108 ILE A HG23 3  
ATOM 5562  H HD11 . ILE A 1 108 ? -26.729 -10.074 7.008   1.00 0.00 ? 108 ILE A HD11 3  
ATOM 5563  H HD12 . ILE A 1 108 ? -26.558 -11.808 6.633   1.00 0.00 ? 108 ILE A HD12 3  
ATOM 5564  H HD13 . ILE A 1 108 ? -28.030 -11.213 7.407   1.00 0.00 ? 108 ILE A HD13 3  
ATOM 5565  N N    . VAL A 1 109 ? -22.041 -11.934 10.664  1.00 0.00 ? 109 VAL A N    3  
ATOM 5566  C CA   . VAL A 1 109 ? -20.609 -11.833 11.040  1.00 0.00 ? 109 VAL A CA   3  
ATOM 5567  C C    . VAL A 1 109 ? -19.776 -11.026 10.036  1.00 0.00 ? 109 VAL A C    3  
ATOM 5568  O O    . VAL A 1 109 ? -18.981 -10.179 10.439  1.00 0.00 ? 109 VAL A O    3  
ATOM 5569  C CB   . VAL A 1 109 ? -19.957 -13.222 11.275  1.00 0.00 ? 109 VAL A CB   3  
ATOM 5570  C CG1  . VAL A 1 109 ? -18.532 -13.085 11.835  1.00 0.00 ? 109 VAL A CG1  3  
ATOM 5571  C CG2  . VAL A 1 109 ? -20.786 -14.073 12.254  1.00 0.00 ? 109 VAL A CG2  3  
ATOM 5572  H H    . VAL A 1 109 ? -22.484 -12.844 10.706  1.00 0.00 ? 109 VAL A H    3  
ATOM 5573  H HA   . VAL A 1 109 ? -20.584 -11.293 11.989  1.00 0.00 ? 109 VAL A HA   3  
ATOM 5574  H HB   . VAL A 1 109 ? -19.910 -13.757 10.327  1.00 0.00 ? 109 VAL A HB   3  
ATOM 5575  H HG11 . VAL A 1 109 ? -18.130 -14.070 12.079  1.00 0.00 ? 109 VAL A HG11 3  
ATOM 5576  H HG12 . VAL A 1 109 ? -17.877 -12.627 11.093  1.00 0.00 ? 109 VAL A HG12 3  
ATOM 5577  H HG13 . VAL A 1 109 ? -18.535 -12.470 12.736  1.00 0.00 ? 109 VAL A HG13 3  
ATOM 5578  H HG21 . VAL A 1 109 ? -20.252 -14.994 12.498  1.00 0.00 ? 109 VAL A HG21 3  
ATOM 5579  H HG22 . VAL A 1 109 ? -20.979 -13.511 13.167  1.00 0.00 ? 109 VAL A HG22 3  
ATOM 5580  H HG23 . VAL A 1 109 ? -21.737 -14.351 11.799  1.00 0.00 ? 109 VAL A HG23 3  
ATOM 5581  N N    . SER A 1 110 ? -19.981 -11.228 8.732   1.00 0.00 ? 110 SER A N    3  
ATOM 5582  C CA   . SER A 1 110 ? -19.292 -10.455 7.686   1.00 0.00 ? 110 SER A CA   3  
ATOM 5583  C C    . SER A 1 110 ? -19.623 -8.960  7.796   1.00 0.00 ? 110 SER A C    3  
ATOM 5584  O O    . SER A 1 110 ? -18.719 -8.122  7.870   1.00 0.00 ? 110 SER A O    3  
ATOM 5585  C CB   . SER A 1 110 ? -19.672 -10.992 6.295   1.00 0.00 ? 110 SER A CB   3  
ATOM 5586  O OG   . SER A 1 110 ? -19.409 -12.384 6.194   1.00 0.00 ? 110 SER A OG   3  
ATOM 5587  H H    . SER A 1 110 ? -20.594 -11.981 8.439   1.00 0.00 ? 110 SER A H    3  
ATOM 5588  H HA   . SER A 1 110 ? -18.213 -10.563 7.807   1.00 0.00 ? 110 SER A HA   3  
ATOM 5589  H HB2  . SER A 1 110 ? -20.732 -10.808 6.110   1.00 0.00 ? 110 SER A HB2  3  
ATOM 5590  H HB3  . SER A 1 110 ? -19.093 -10.456 5.539   1.00 0.00 ? 110 SER A HB3  3  
ATOM 5591  H HG   . SER A 1 110 ? -19.623 -12.676 5.293   1.00 0.00 ? 110 SER A HG   3  
ATOM 5592  N N    . ARG A 1 111 ? -20.914 -8.622  7.930   1.00 0.00 ? 111 ARG A N    3  
ATOM 5593  C CA   . ARG A 1 111 ? -21.346 -7.228  8.086   1.00 0.00 ? 111 ARG A CA   3  
ATOM 5594  C C    . ARG A 1 111 ? -20.895 -6.629  9.415   1.00 0.00 ? 111 ARG A C    3  
ATOM 5595  O O    . ARG A 1 111 ? -20.515 -5.469  9.449   1.00 0.00 ? 111 ARG A O    3  
ATOM 5596  C CB   . ARG A 1 111 ? -22.868 -7.094  7.903   1.00 0.00 ? 111 ARG A CB   3  
ATOM 5597  C CG   . ARG A 1 111 ? -23.262 -5.647  7.539   1.00 0.00 ? 111 ARG A CG   3  
ATOM 5598  C CD   . ARG A 1 111 ? -22.977 -5.291  6.070   1.00 0.00 ? 111 ARG A CD   3  
ATOM 5599  N NE   . ARG A 1 111 ? -23.885 -6.014  5.157   1.00 0.00 ? 111 ARG A NE   3  
ATOM 5600  C CZ   . ARG A 1 111 ? -23.577 -6.913  4.226   1.00 0.00 ? 111 ARG A CZ   3  
ATOM 5601  N NH1  . ARG A 1 111 ? -22.341 -7.267  3.943   1.00 0.00 ? 111 ARG A NH1  3  
ATOM 5602  N NH2  . ARG A 1 111 ? -24.548 -7.487  3.549   1.00 0.00 ? 111 ARG A NH2  3  
ATOM 5603  H H    . ARG A 1 111 ? -21.610 -9.353  7.970   1.00 0.00 ? 111 ARG A H    3  
ATOM 5604  H HA   . ARG A 1 111 ? -20.849 -6.662  7.304   1.00 0.00 ? 111 ARG A HA   3  
ATOM 5605  H HB2  . ARG A 1 111 ? -23.208 -7.774  7.120   1.00 0.00 ? 111 ARG A HB2  3  
ATOM 5606  H HB3  . ARG A 1 111 ? -23.370 -7.382  8.829   1.00 0.00 ? 111 ARG A HB3  3  
ATOM 5607  H HG2  . ARG A 1 111 ? -24.328 -5.520  7.726   1.00 0.00 ? 111 ARG A HG2  3  
ATOM 5608  H HG3  . ARG A 1 111 ? -22.728 -4.939  8.180   1.00 0.00 ? 111 ARG A HG3  3  
ATOM 5609  H HD2  . ARG A 1 111 ? -23.148 -4.220  5.940   1.00 0.00 ? 111 ARG A HD2  3  
ATOM 5610  H HD3  . ARG A 1 111 ? -21.934 -5.489  5.832   1.00 0.00 ? 111 ARG A HD3  3  
ATOM 5611  H HE   . ARG A 1 111 ? -24.866 -5.796  5.265   1.00 0.00 ? 111 ARG A HE   3  
ATOM 5612  H HH11 . ARG A 1 111 ? -21.538 -6.810  4.379   1.00 0.00 ? 111 ARG A HH11 3  
ATOM 5613  H HH12 . ARG A 1 111 ? -22.158 -7.947  3.224   1.00 0.00 ? 111 ARG A HH12 3  
ATOM 5614  H HH21 . ARG A 1 111 ? -25.512 -7.253  3.731   1.00 0.00 ? 111 ARG A HH21 3  
ATOM 5615  H HH22 . ARG A 1 111 ? -24.341 -8.167  2.835   1.00 0.00 ? 111 ARG A HH22 3  
ATOM 5616  N N    . ASN A 1 112 ? -20.836 -7.407  10.490  1.00 0.00 ? 112 ASN A N    3  
ATOM 5617  C CA   . ASN A 1 112 ? -20.306 -6.977  11.788  1.00 0.00 ? 112 ASN A CA   3  
ATOM 5618  C C    . ASN A 1 112 ? -18.827 -6.542  11.690  1.00 0.00 ? 112 ASN A C    3  
ATOM 5619  O O    . ASN A 1 112 ? -18.434 -5.534  12.274  1.00 0.00 ? 112 ASN A O    3  
ATOM 5620  C CB   . ASN A 1 112 ? -20.506 -8.123  12.792  1.00 0.00 ? 112 ASN A CB   3  
ATOM 5621  C CG   . ASN A 1 112 ? -20.085 -7.748  14.208  1.00 0.00 ? 112 ASN A CG   3  
ATOM 5622  O OD1  . ASN A 1 112 ? -20.411 -6.682  14.711  1.00 0.00 ? 112 ASN A OD1  3  
ATOM 5623  N ND2  . ASN A 1 112 ? -19.343 -8.612  14.879  1.00 0.00 ? 112 ASN A ND2  3  
ATOM 5624  H H    . ASN A 1 112 ? -21.217 -8.345  10.397  1.00 0.00 ? 112 ASN A H    3  
ATOM 5625  H HA   . ASN A 1 112 ? -20.883 -6.114  12.128  1.00 0.00 ? 112 ASN A HA   3  
ATOM 5626  H HB2  . ASN A 1 112 ? -21.558 -8.416  12.812  1.00 0.00 ? 112 ASN A HB2  3  
ATOM 5627  H HB3  . ASN A 1 112 ? -19.930 -8.989  12.466  1.00 0.00 ? 112 ASN A HB3  3  
ATOM 5628  H HD21 . ASN A 1 112 ? -19.092 -9.499  14.471  1.00 0.00 ? 112 ASN A HD21 3  
ATOM 5629  H HD22 . ASN A 1 112 ? -19.050 -8.374  15.812  1.00 0.00 ? 112 ASN A HD22 3  
ATOM 5630  N N    . CYS A 1 113 ? -18.026 -7.250  10.883  1.00 0.00 ? 113 CYS A N    3  
ATOM 5631  C CA   . CYS A 1 113 ? -16.632 -6.902  10.584  1.00 0.00 ? 113 CYS A CA   3  
ATOM 5632  C C    . CYS A 1 113 ? -16.530 -5.633  9.712   1.00 0.00 ? 113 CYS A C    3  
ATOM 5633  O O    . CYS A 1 113 ? -15.805 -4.701  10.065  1.00 0.00 ? 113 CYS A O    3  
ATOM 5634  C CB   . CYS A 1 113 ? -15.952 -8.133  9.953   1.00 0.00 ? 113 CYS A CB   3  
ATOM 5635  S SG   . CYS A 1 113 ? -15.887 -9.507  11.145  1.00 0.00 ? 113 CYS A SG   3  
ATOM 5636  H H    . CYS A 1 113 ? -18.421 -8.063  10.427  1.00 0.00 ? 113 CYS A H    3  
ATOM 5637  H HA   . CYS A 1 113 ? -16.113 -6.665  11.517  1.00 0.00 ? 113 CYS A HA   3  
ATOM 5638  H HB2  . CYS A 1 113 ? -16.482 -8.453  9.053   1.00 0.00 ? 113 CYS A HB2  3  
ATOM 5639  H HB3  . CYS A 1 113 ? -14.926 -7.884  9.668   1.00 0.00 ? 113 CYS A HB3  3  
ATOM 5640  H HG   . CYS A 1 113 ? -17.179 -9.863  11.081  1.00 0.00 ? 113 CYS A HG   3  
ATOM 5641  N N    . GLU A 1 114 ? -17.293 -5.561  8.617   1.00 0.00 ? 114 GLU A N    3  
ATOM 5642  C CA   . GLU A 1 114 ? -17.333 -4.378  7.743   1.00 0.00 ? 114 GLU A CA   3  
ATOM 5643  C C    . GLU A 1 114 ? -17.850 -3.134  8.481   1.00 0.00 ? 114 GLU A C    3  
ATOM 5644  O O    . GLU A 1 114 ? -17.243 -2.068  8.417   1.00 0.00 ? 114 GLU A O    3  
ATOM 5645  C CB   . GLU A 1 114 ? -18.233 -4.644  6.524   1.00 0.00 ? 114 GLU A CB   3  
ATOM 5646  C CG   . GLU A 1 114 ? -17.681 -5.705  5.566   1.00 0.00 ? 114 GLU A CG   3  
ATOM 5647  C CD   . GLU A 1 114 ? -18.643 -5.926  4.389   1.00 0.00 ? 114 GLU A CD   3  
ATOM 5648  O OE1  . GLU A 1 114 ? -19.805 -6.339  4.621   1.00 0.00 ? 114 GLU A OE1  3  
ATOM 5649  O OE2  . GLU A 1 114 ? -18.241 -5.686  3.226   1.00 0.00 ? 114 GLU A OE2  3  
ATOM 5650  H H    . GLU A 1 114 ? -17.835 -6.381  8.356   1.00 0.00 ? 114 GLU A H    3  
ATOM 5651  H HA   . GLU A 1 114 ? -16.316 -4.164  7.403   1.00 0.00 ? 114 GLU A HA   3  
ATOM 5652  H HB2  . GLU A 1 114 ? -19.221 -4.951  6.875   1.00 0.00 ? 114 GLU A HB2  3  
ATOM 5653  H HB3  . GLU A 1 114 ? -18.350 -3.715  5.963   1.00 0.00 ? 114 GLU A HB3  3  
ATOM 5654  H HG2  . GLU A 1 114 ? -16.711 -5.372  5.196   1.00 0.00 ? 114 GLU A HG2  3  
ATOM 5655  H HG3  . GLU A 1 114 ? -17.534 -6.649  6.093   1.00 0.00 ? 114 GLU A HG3  3  
ATOM 5656  N N    . HIS A 1 115 ? -18.950 -3.248  9.224   1.00 0.00 ? 115 HIS A N    3  
ATOM 5657  C CA   . HIS A 1 115 ? -19.560 -2.144  9.965   1.00 0.00 ? 115 HIS A CA   3  
ATOM 5658  C C    . HIS A 1 115 ? -18.637 -1.641  11.092  1.00 0.00 ? 115 HIS A C    3  
ATOM 5659  O O    . HIS A 1 115 ? -18.597 -0.441  11.361  1.00 0.00 ? 115 HIS A O    3  
ATOM 5660  C CB   . HIS A 1 115 ? -20.937 -2.574  10.497  1.00 0.00 ? 115 HIS A CB   3  
ATOM 5661  C CG   . HIS A 1 115 ? -21.734 -1.451  11.122  1.00 0.00 ? 115 HIS A CG   3  
ATOM 5662  N ND1  . HIS A 1 115 ? -22.492 -1.531  12.272  1.00 0.00 ? 115 HIS A ND1  3  
ATOM 5663  C CD2  . HIS A 1 115 ? -21.892 -0.179  10.630  1.00 0.00 ? 115 HIS A CD2  3  
ATOM 5664  C CE1  . HIS A 1 115 ? -23.073 -0.335  12.471  1.00 0.00 ? 115 HIS A CE1  3  
ATOM 5665  N NE2  . HIS A 1 115 ? -22.736 0.528   11.493  1.00 0.00 ? 115 HIS A NE2  3  
ATOM 5666  H H    . HIS A 1 115 ? -19.434 -4.143  9.233   1.00 0.00 ? 115 HIS A H    3  
ATOM 5667  H HA   . HIS A 1 115 ? -19.724 -1.330  9.258   1.00 0.00 ? 115 HIS A HA   3  
ATOM 5668  H HB2  . HIS A 1 115 ? -21.527 -2.975  9.670   1.00 0.00 ? 115 HIS A HB2  3  
ATOM 5669  H HB3  . HIS A 1 115 ? -20.802 -3.369  11.236  1.00 0.00 ? 115 HIS A HB3  3  
ATOM 5670  H HD1  . HIS A 1 115 ? -22.619 -2.349  12.855  1.00 0.00 ? 115 HIS A HD1  3  
ATOM 5671  H HD2  . HIS A 1 115 ? -21.450 0.207   9.719   1.00 0.00 ? 115 HIS A HD2  3  
ATOM 5672  H HE1  . HIS A 1 115 ? -23.727 -0.103  13.304  1.00 0.00 ? 115 HIS A HE1  3  
ATOM 5673  N N    . PHE A 1 116 ? -17.835 -2.521  11.710  1.00 0.00 ? 116 PHE A N    3  
ATOM 5674  C CA   . PHE A 1 116 ? -16.775 -2.134  12.645  1.00 0.00 ? 116 PHE A CA   3  
ATOM 5675  C C    . PHE A 1 116 ? -15.776 -1.174  11.975  1.00 0.00 ? 116 PHE A C    3  
ATOM 5676  O O    . PHE A 1 116 ? -15.654 -0.031  12.417  1.00 0.00 ? 116 PHE A O    3  
ATOM 5677  C CB   . PHE A 1 116 ? -16.122 -3.402  13.228  1.00 0.00 ? 116 PHE A CB   3  
ATOM 5678  C CG   . PHE A 1 116 ? -14.726 -3.217  13.797  1.00 0.00 ? 116 PHE A CG   3  
ATOM 5679  C CD1  . PHE A 1 116 ? -14.521 -2.406  14.928  1.00 0.00 ? 116 PHE A CD1  3  
ATOM 5680  C CD2  . PHE A 1 116 ? -13.627 -3.845  13.175  1.00 0.00 ? 116 PHE A CD2  3  
ATOM 5681  C CE1  . PHE A 1 116 ? -13.225 -2.219  15.437  1.00 0.00 ? 116 PHE A CE1  3  
ATOM 5682  C CE2  . PHE A 1 116 ? -12.331 -3.668  13.696  1.00 0.00 ? 116 PHE A CE2  3  
ATOM 5683  C CZ   . PHE A 1 116 ? -12.132 -2.859  14.829  1.00 0.00 ? 116 PHE A CZ   3  
ATOM 5684  H H    . PHE A 1 116 ? -17.935 -3.506  11.490  1.00 0.00 ? 116 PHE A H    3  
ATOM 5685  H HA   . PHE A 1 116 ? -17.227 -1.583  13.472  1.00 0.00 ? 116 PHE A HA   3  
ATOM 5686  H HB2  . PHE A 1 116 ? -16.772 -3.798  14.013  1.00 0.00 ? 116 PHE A HB2  3  
ATOM 5687  H HB3  . PHE A 1 116 ? -16.072 -4.172  12.462  1.00 0.00 ? 116 PHE A HB3  3  
ATOM 5688  H HD1  . PHE A 1 116 ? -15.359 -1.912  15.402  1.00 0.00 ? 116 PHE A HD1  3  
ATOM 5689  H HD2  . PHE A 1 116 ? -13.770 -4.467  12.299  1.00 0.00 ? 116 PHE A HD2  3  
ATOM 5690  H HE1  . PHE A 1 116 ? -13.074 -1.579  16.295  1.00 0.00 ? 116 PHE A HE1  3  
ATOM 5691  H HE2  . PHE A 1 116 ? -11.486 -4.148  13.221  1.00 0.00 ? 116 PHE A HE2  3  
ATOM 5692  H HZ   . PHE A 1 116 ? -11.135 -2.713  15.224  1.00 0.00 ? 116 PHE A HZ   3  
ATOM 5693  N N    . VAL A 1 117 ? -15.124 -1.572  10.874  1.00 0.00 ? 117 VAL A N    3  
ATOM 5694  C CA   . VAL A 1 117 ? -14.156 -0.674  10.191  1.00 0.00 ? 117 VAL A CA   3  
ATOM 5695  C C    . VAL A 1 117 ? -14.816 0.539   9.509   1.00 0.00 ? 117 VAL A C    3  
ATOM 5696  O O    . VAL A 1 117 ? -14.195 1.597   9.388   1.00 0.00 ? 117 VAL A O    3  
ATOM 5697  C CB   . VAL A 1 117 ? -13.212 -1.404  9.206   1.00 0.00 ? 117 VAL A CB   3  
ATOM 5698  C CG1  . VAL A 1 117 ? -12.218 -2.279  9.985   1.00 0.00 ? 117 VAL A CG1  3  
ATOM 5699  C CG2  . VAL A 1 117 ? -13.933 -2.225  8.128   1.00 0.00 ? 117 VAL A CG2  3  
ATOM 5700  H H    . VAL A 1 117 ? -15.279 -2.526  10.545  1.00 0.00 ? 117 VAL A H    3  
ATOM 5701  H HA   . VAL A 1 117 ? -13.518 -0.259  10.972  1.00 0.00 ? 117 VAL A HA   3  
ATOM 5702  H HB   . VAL A 1 117 ? -12.640 -0.646  8.679   1.00 0.00 ? 117 VAL A HB   3  
ATOM 5703  H HG11 . VAL A 1 117 ? -11.499 -2.719  9.295   1.00 0.00 ? 117 VAL A HG11 3  
ATOM 5704  H HG12 . VAL A 1 117 ? -11.663 -1.680  10.710  1.00 0.00 ? 117 VAL A HG12 3  
ATOM 5705  H HG13 . VAL A 1 117 ? -12.741 -3.078  10.511  1.00 0.00 ? 117 VAL A HG13 3  
ATOM 5706  H HG21 . VAL A 1 117 ? -14.618 -1.589  7.566   1.00 0.00 ? 117 VAL A HG21 3  
ATOM 5707  H HG22 . VAL A 1 117 ? -13.201 -2.641  7.436   1.00 0.00 ? 117 VAL A HG22 3  
ATOM 5708  H HG23 . VAL A 1 117 ? -14.487 -3.042  8.582   1.00 0.00 ? 117 VAL A HG23 3  
ATOM 5709  N N    . THR A 1 118 ? -16.094 0.428   9.123   1.00 0.00 ? 118 THR A N    3  
ATOM 5710  C CA   . THR A 1 118 ? -16.878 1.555   8.585   1.00 0.00 ? 118 THR A CA   3  
ATOM 5711  C C    . THR A 1 118 ? -17.161 2.573   9.685   1.00 0.00 ? 118 THR A C    3  
ATOM 5712  O O    . THR A 1 118 ? -16.978 3.752   9.436   1.00 0.00 ? 118 THR A O    3  
ATOM 5713  C CB   . THR A 1 118 ? -18.145 1.073   7.860   1.00 0.00 ? 118 THR A CB   3  
ATOM 5714  O OG1  . THR A 1 118 ? -17.772 0.087   6.921   1.00 0.00 ? 118 THR A OG1  3  
ATOM 5715  C CG2  . THR A 1 118 ? -18.823 2.182   7.048   1.00 0.00 ? 118 THR A CG2  3  
ATOM 5716  H H    . THR A 1 118 ? -16.543 -0.482  9.215   1.00 0.00 ? 118 THR A H    3  
ATOM 5717  H HA   . THR A 1 118 ? -16.274 2.092   7.858   1.00 0.00 ? 118 THR A HA   3  
ATOM 5718  H HB   . THR A 1 118 ? -18.854 0.662   8.580   1.00 0.00 ? 118 THR A HB   3  
ATOM 5719  H HG1  . THR A 1 118 ? -17.572 -0.737  7.402   1.00 0.00 ? 118 THR A HG1  3  
ATOM 5720  H HG21 . THR A 1 118 ? -19.779 1.831   6.661   1.00 0.00 ? 118 THR A HG21 3  
ATOM 5721  H HG22 . THR A 1 118 ? -18.996 3.052   7.671   1.00 0.00 ? 118 THR A HG22 3  
ATOM 5722  H HG23 . THR A 1 118 ? -18.206 2.480   6.204   1.00 0.00 ? 118 THR A HG23 3  
ATOM 5723  N N    . GLN A 1 119 ? -17.472 2.165   10.913  1.00 0.00 ? 119 GLN A N    3  
ATOM 5724  C CA   . GLN A 1 119 ? -17.592 3.101   12.042  1.00 0.00 ? 119 GLN A CA   3  
ATOM 5725  C C    . GLN A 1 119 ? -16.256 3.755   12.433  1.00 0.00 ? 119 GLN A C    3  
ATOM 5726  O O    . GLN A 1 119 ? -16.271 4.882   12.927  1.00 0.00 ? 119 GLN A O    3  
ATOM 5727  C CB   . GLN A 1 119 ? -18.214 2.388   13.249  1.00 0.00 ? 119 GLN A CB   3  
ATOM 5728  C CG   . GLN A 1 119 ? -19.721 2.153   13.067  1.00 0.00 ? 119 GLN A CG   3  
ATOM 5729  C CD   . GLN A 1 119 ? -20.241 1.153   14.098  1.00 0.00 ? 119 GLN A CD   3  
ATOM 5730  O OE1  . GLN A 1 119 ? -20.889 1.490   15.084  1.00 0.00 ? 119 GLN A OE1  3  
ATOM 5731  N NE2  . GLN A 1 119 ? -19.932 -0.116  13.916  1.00 0.00 ? 119 GLN A NE2  3  
ATOM 5732  H H    . GLN A 1 119 ? -17.628 1.175   11.081  1.00 0.00 ? 119 GLN A H    3  
ATOM 5733  H HA   . GLN A 1 119 ? -18.246 3.925   11.756  1.00 0.00 ? 119 GLN A HA   3  
ATOM 5734  H HB2  . GLN A 1 119 ? -17.695 1.442   13.411  1.00 0.00 ? 119 GLN A HB2  3  
ATOM 5735  H HB3  . GLN A 1 119 ? -18.073 3.009   14.136  1.00 0.00 ? 119 GLN A HB3  3  
ATOM 5736  H HG2  . GLN A 1 119 ? -20.255 3.102   13.169  1.00 0.00 ? 119 GLN A HG2  3  
ATOM 5737  H HG3  . GLN A 1 119 ? -19.920 1.758   12.070  1.00 0.00 ? 119 GLN A HG3  3  
ATOM 5738  H HE21 . GLN A 1 119 ? -19.436 -0.361  13.067  1.00 0.00 ? 119 GLN A HE21 3  
ATOM 5739  H HE22 . GLN A 1 119 ? -20.256 -0.802  14.579  1.00 0.00 ? 119 GLN A HE22 3  
ATOM 5740  N N    . LEU A 1 120 ? -15.104 3.107   12.188  1.00 0.00 ? 120 LEU A N    3  
ATOM 5741  C CA   . LEU A 1 120 ? -13.788 3.722   12.430  1.00 0.00 ? 120 LEU A CA   3  
ATOM 5742  C C    . LEU A 1 120 ? -13.485 4.887   11.474  1.00 0.00 ? 120 LEU A C    3  
ATOM 5743  O O    . LEU A 1 120 ? -12.901 5.880   11.910  1.00 0.00 ? 120 LEU A O    3  
ATOM 5744  C CB   . LEU A 1 120 ? -12.672 2.658   12.373  1.00 0.00 ? 120 LEU A CB   3  
ATOM 5745  C CG   . LEU A 1 120 ? -12.714 1.606   13.499  1.00 0.00 ? 120 LEU A CG   3  
ATOM 5746  C CD1  . LEU A 1 120 ? -11.586 0.590   13.293  1.00 0.00 ? 120 LEU A CD1  3  
ATOM 5747  C CD2  . LEU A 1 120 ? -12.554 2.245   14.882  1.00 0.00 ? 120 LEU A CD2  3  
ATOM 5748  H H    . LEU A 1 120 ? -15.144 2.148   11.860  1.00 0.00 ? 120 LEU A H    3  
ATOM 5749  H HA   . LEU A 1 120 ? -13.798 4.169   13.424  1.00 0.00 ? 120 LEU A HA   3  
ATOM 5750  H HB2  . LEU A 1 120 ? -12.712 2.147   11.411  1.00 0.00 ? 120 LEU A HB2  3  
ATOM 5751  H HB3  . LEU A 1 120 ? -11.707 3.171   12.426  1.00 0.00 ? 120 LEU A HB3  3  
ATOM 5752  H HG   . LEU A 1 120 ? -13.662 1.076   13.468  1.00 0.00 ? 120 LEU A HG   3  
ATOM 5753  H HD11 . LEU A 1 120 ? -11.676 0.121   12.316  1.00 0.00 ? 120 LEU A HD11 3  
ATOM 5754  H HD12 . LEU A 1 120 ? -10.625 1.096   13.359  1.00 0.00 ? 120 LEU A HD12 3  
ATOM 5755  H HD13 . LEU A 1 120 ? -11.633 -0.179  14.064  1.00 0.00 ? 120 LEU A HD13 3  
ATOM 5756  H HD21 . LEU A 1 120 ? -13.398 2.896   15.100  1.00 0.00 ? 120 LEU A HD21 3  
ATOM 5757  H HD22 . LEU A 1 120 ? -12.513 1.463   15.642  1.00 0.00 ? 120 LEU A HD22 3  
ATOM 5758  H HD23 . LEU A 1 120 ? -11.635 2.833   14.909  1.00 0.00 ? 120 LEU A HD23 3  
ATOM 5759  N N    . ARG A 1 121 ? -13.872 4.787   10.191  1.00 0.00 ? 121 ARG A N    3  
ATOM 5760  C CA   . ARG A 1 121 ? -13.507 5.760   9.145   1.00 0.00 ? 121 ARG A CA   3  
ATOM 5761  C C    . ARG A 1 121 ? -14.605 6.115   8.124   1.00 0.00 ? 121 ARG A C    3  
ATOM 5762  O O    . ARG A 1 121 ? -14.309 6.407   6.968   1.00 0.00 ? 121 ARG A O    3  
ATOM 5763  C CB   . ARG A 1 121 ? -12.158 5.322   8.551   1.00 0.00 ? 121 ARG A CB   3  
ATOM 5764  C CG   . ARG A 1 121 ? -12.009 3.902   7.977   1.00 0.00 ? 121 ARG A CG   3  
ATOM 5765  C CD   . ARG A 1 121 ? -12.900 3.568   6.776   1.00 0.00 ? 121 ARG A CD   3  
ATOM 5766  N NE   . ARG A 1 121 ? -12.432 2.323   6.135   1.00 0.00 ? 121 ARG A NE   3  
ATOM 5767  C CZ   . ARG A 1 121 ? -13.133 1.258   5.757   1.00 0.00 ? 121 ARG A CZ   3  
ATOM 5768  N NH1  . ARG A 1 121 ? -14.440 1.190   5.876   1.00 0.00 ? 121 ARG A NH1  3  
ATOM 5769  N NH2  . ARG A 1 121 ? -12.518 0.231   5.219   1.00 0.00 ? 121 ARG A NH2  3  
ATOM 5770  H H    . ARG A 1 121 ? -14.196 3.879   9.881   1.00 0.00 ? 121 ARG A H    3  
ATOM 5771  H HA   . ARG A 1 121 ? -13.319 6.711   9.645   1.00 0.00 ? 121 ARG A HA   3  
ATOM 5772  H HB2  . ARG A 1 121 ? -11.832 6.047   7.808   1.00 0.00 ? 121 ARG A HB2  3  
ATOM 5773  H HB3  . ARG A 1 121 ? -11.469 5.359   9.386   1.00 0.00 ? 121 ARG A HB3  3  
ATOM 5774  H HG2  . ARG A 1 121 ? -10.967 3.800   7.671   1.00 0.00 ? 121 ARG A HG2  3  
ATOM 5775  H HG3  . ARG A 1 121 ? -12.182 3.171   8.765   1.00 0.00 ? 121 ARG A HG3  3  
ATOM 5776  H HD2  . ARG A 1 121 ? -13.932 3.476   7.118   1.00 0.00 ? 121 ARG A HD2  3  
ATOM 5777  H HD3  . ARG A 1 121 ? -12.832 4.380   6.049   1.00 0.00 ? 121 ARG A HD3  3  
ATOM 5778  H HE   . ARG A 1 121 ? -11.426 2.294   5.975   1.00 0.00 ? 121 ARG A HE   3  
ATOM 5779  H HH11 . ARG A 1 121 ? -14.958 1.977   6.223   1.00 0.00 ? 121 ARG A HH11 3  
ATOM 5780  H HH12 . ARG A 1 121 ? -14.951 0.371   5.569   1.00 0.00 ? 121 ARG A HH12 3  
ATOM 5781  H HH21 . ARG A 1 121 ? -11.519 0.227   5.097   1.00 0.00 ? 121 ARG A HH21 3  
ATOM 5782  H HH22 . ARG A 1 121 ? -13.040 -0.563  4.866   1.00 0.00 ? 121 ARG A HH22 3  
ATOM 5783  N N    . TYR A 1 122 ? -15.867 6.150   8.563   1.00 0.00 ? 122 TYR A N    3  
ATOM 5784  C CA   . TYR A 1 122 ? -17.090 6.400   7.761   1.00 0.00 ? 122 TYR A CA   3  
ATOM 5785  C C    . TYR A 1 122 ? -16.992 7.689   6.923   1.00 0.00 ? 122 TYR A C    3  
ATOM 5786  O O    . TYR A 1 122 ? -17.423 7.752   5.771   1.00 0.00 ? 122 TYR A O    3  
ATOM 5787  C CB   . TYR A 1 122 ? -18.293 6.496   8.736   1.00 0.00 ? 122 TYR A CB   3  
ATOM 5788  C CG   . TYR A 1 122 ? -19.535 5.696   8.364   1.00 0.00 ? 122 TYR A CG   3  
ATOM 5789  C CD1  . TYR A 1 122 ? -20.099 5.795   7.077   1.00 0.00 ? 122 TYR A CD1  3  
ATOM 5790  C CD2  . TYR A 1 122 ? -20.147 4.863   9.325   1.00 0.00 ? 122 TYR A CD2  3  
ATOM 5791  C CE1  . TYR A 1 122 ? -21.248 5.053   6.742   1.00 0.00 ? 122 TYR A CE1  3  
ATOM 5792  C CE2  . TYR A 1 122 ? -21.293 4.113   8.999   1.00 0.00 ? 122 TYR A CE2  3  
ATOM 5793  C CZ   . TYR A 1 122 ? -21.848 4.205   7.703   1.00 0.00 ? 122 TYR A CZ   3  
ATOM 5794  O OH   . TYR A 1 122 ? -22.956 3.485   7.375   1.00 0.00 ? 122 TYR A OH   3  
ATOM 5795  H H    . TYR A 1 122 ? -16.024 5.856   9.518   1.00 0.00 ? 122 TYR A H    3  
ATOM 5796  H HA   . TYR A 1 122 ? -17.244 5.552   7.089   1.00 0.00 ? 122 TYR A HA   3  
ATOM 5797  H HB2  . TYR A 1 122 ? -17.974 6.179   9.732   1.00 0.00 ? 122 TYR A HB2  3  
ATOM 5798  H HB3  . TYR A 1 122 ? -18.589 7.540   8.852   1.00 0.00 ? 122 TYR A HB3  3  
ATOM 5799  H HD1  . TYR A 1 122 ? -19.658 6.448   6.336   1.00 0.00 ? 122 TYR A HD1  3  
ATOM 5800  H HD2  . TYR A 1 122 ? -19.729 4.778   10.317  1.00 0.00 ? 122 TYR A HD2  3  
ATOM 5801  H HE1  . TYR A 1 122 ? -21.677 5.127   5.752   1.00 0.00 ? 122 TYR A HE1  3  
ATOM 5802  H HE2  . TYR A 1 122 ? -21.745 3.465   9.737   1.00 0.00 ? 122 TYR A HE2  3  
ATOM 5803  H HH   . TYR A 1 122 ? -23.282 2.953   8.110   1.00 0.00 ? 122 TYR A HH   3  
ATOM 5804  N N    . GLY A 1 123 ? -16.395 8.710   7.547   1.00 0.00 ? 123 GLY A N    3  
ATOM 5805  C CA   . GLY A 1 123 ? -16.161 10.058  6.996   1.00 0.00 ? 123 GLY A CA   3  
ATOM 5806  C C    . GLY A 1 123 ? -15.384 10.935  7.973   1.00 0.00 ? 123 GLY A C    3  
ATOM 5807  O O    . GLY A 1 123 ? -15.779 12.059  8.245   1.00 0.00 ? 123 GLY A O    3  
ATOM 5808  H H    . GLY A 1 123 ? -16.128 8.515   8.507   1.00 0.00 ? 123 GLY A H    3  
ATOM 5809  H HA2  . GLY A 1 123 ? -15.608 9.970   6.064   1.00 0.00 ? 123 GLY A HA2  3  
ATOM 5810  H HA3  . GLY A 1 123 ? -17.120 10.531  6.781   1.00 0.00 ? 123 GLY A HA3  3  
ATOM 5811  N N    . LYS A 1 124 ? -14.334 10.331  8.558   1.00 0.00 ? 124 LYS A N    3  
ATOM 5812  C CA   . LYS A 1 124 ? -13.489 10.761  9.702   1.00 0.00 ? 124 LYS A CA   3  
ATOM 5813  C C    . LYS A 1 124 ? -14.062 10.204  11.028  1.00 0.00 ? 124 LYS A C    3  
ATOM 5814  O O    . LYS A 1 124 ? -13.312 10.015  11.985  1.00 0.00 ? 124 LYS A O    3  
ATOM 5815  C CB   . LYS A 1 124 ? -13.172 12.279  9.707   1.00 0.00 ? 124 LYS A CB   3  
ATOM 5816  C CG   . LYS A 1 124 ? -14.026 13.142  10.657  1.00 0.00 ? 124 LYS A CG   3  
ATOM 5817  C CD   . LYS A 1 124 ? -13.747 14.637  10.448  1.00 0.00 ? 124 LYS A CD   3  
ATOM 5818  C CE   . LYS A 1 124 ? -14.498 15.529  11.452  1.00 0.00 ? 124 LYS A CE   3  
ATOM 5819  N NZ   . LYS A 1 124 ? -15.974 15.512  11.252  1.00 0.00 ? 124 LYS A NZ   3  
ATOM 5820  H H    . LYS A 1 124 ? -14.088 9.426   8.164   1.00 0.00 ? 124 LYS A H    3  
ATOM 5821  H HA   . LYS A 1 124 ? -12.530 10.246  9.594   1.00 0.00 ? 124 LYS A HA   3  
ATOM 5822  H HB2  . LYS A 1 124 ? -12.129 12.390  10.013  1.00 0.00 ? 124 LYS A HB2  3  
ATOM 5823  H HB3  . LYS A 1 124 ? -13.235 12.664  8.684   1.00 0.00 ? 124 LYS A HB3  3  
ATOM 5824  H HG2  . LYS A 1 124 ? -15.084 12.942  10.488  1.00 0.00 ? 124 LYS A HG2  3  
ATOM 5825  H HG3  . LYS A 1 124 ? -13.789 12.882  11.688  1.00 0.00 ? 124 LYS A HG3  3  
ATOM 5826  H HD2  . LYS A 1 124 ? -12.679 14.813  10.574  1.00 0.00 ? 124 LYS A HD2  3  
ATOM 5827  H HD3  . LYS A 1 124 ? -14.022 14.925  9.430   1.00 0.00 ? 124 LYS A HD3  3  
ATOM 5828  H HE2  . LYS A 1 124 ? -14.251 15.206  12.470  1.00 0.00 ? 124 LYS A HE2  3  
ATOM 5829  H HE3  . LYS A 1 124 ? -14.134 16.556  11.341  1.00 0.00 ? 124 LYS A HE3  3  
ATOM 5830  H HZ1  . LYS A 1 124 ? -16.219 15.812  10.318  1.00 0.00 ? 124 LYS A HZ1  3  
ATOM 5831  H HZ2  . LYS A 1 124 ? -16.360 14.586  11.397  1.00 0.00 ? 124 LYS A HZ2  3  
ATOM 5832  H HZ3  . LYS A 1 124 ? -16.431 16.138  11.905  1.00 0.00 ? 124 LYS A HZ3  3  
ATOM 5833  N N    . SER A 1 125 ? -15.369 9.886   11.007  1.00 0.00 ? 125 SER A N    3  
ATOM 5834  C CA   . SER A 1 125 ? -16.243 9.157   11.958  1.00 0.00 ? 125 SER A CA   3  
ATOM 5835  C C    . SER A 1 125 ? -17.019 10.083  12.913  1.00 0.00 ? 125 SER A C    3  
ATOM 5836  O O    . SER A 1 125 ? -18.118 9.679   13.359  1.00 0.00 ? 125 SER A O    3  
ATOM 5837  C CB   . SER A 1 125 ? -15.556 8.012   12.704  1.00 0.00 ? 125 SER A CB   3  
ATOM 5838  O OG   . SER A 1 125 ? -14.625 8.510   13.635  1.00 0.00 ? 125 SER A OG   3  
ATOM 5839  O OXT  . SER A 1 125 ? -16.567 11.226  13.166  1.00 0.00 ? 125 SER A OXT  3  
ATOM 5840  H H    . SER A 1 125 ? -15.855 10.260  10.204  1.00 0.00 ? 125 SER A H    3  
ATOM 5841  H HA   . SER A 1 125 ? -17.002 8.666   11.343  1.00 0.00 ? 125 SER A HA   3  
ATOM 5842  H HB2  . SER A 1 125 ? -16.314 7.429   13.228  1.00 0.00 ? 125 SER A HB2  3  
ATOM 5843  H HB3  . SER A 1 125 ? -15.064 7.366   11.974  1.00 0.00 ? 125 SER A HB3  3  
ATOM 5844  H HG   . SER A 1 125 ? -14.073 9.140   13.125  1.00 0.00 ? 125 SER A HG   3  
ATOM 5845  N N    . MET A 1 1   ? 18.480  3.393   0.437   1.00 0.00 ? 1   MET A N    4  
ATOM 5846  C CA   . MET A 1 1   ? 18.456  3.051   1.892   1.00 0.00 ? 1   MET A CA   4  
ATOM 5847  C C    . MET A 1 1   ? 17.678  1.749   2.142   1.00 0.00 ? 1   MET A C    4  
ATOM 5848  O O    . MET A 1 1   ? 16.824  1.371   1.339   1.00 0.00 ? 1   MET A O    4  
ATOM 5849  C CB   . MET A 1 1   ? 17.871  4.194   2.759   1.00 0.00 ? 1   MET A CB   4  
ATOM 5850  C CG   . MET A 1 1   ? 18.742  5.460   2.790   1.00 0.00 ? 1   MET A CG   4  
ATOM 5851  S SD   . MET A 1 1   ? 20.425  5.214   3.429   1.00 0.00 ? 1   MET A SD   4  
ATOM 5852  C CE   . MET A 1 1   ? 21.051  6.914   3.322   1.00 0.00 ? 1   MET A CE   4  
ATOM 5853  H H1   . MET A 1 1   ? 17.548  3.575   0.098   1.00 0.00 ? 1   MET A H1   4  
ATOM 5854  H H2   . MET A 1 1   ? 19.052  4.207   0.265   1.00 0.00 ? 1   MET A H2   4  
ATOM 5855  H H3   . MET A 1 1   ? 18.864  2.627   -0.096  1.00 0.00 ? 1   MET A H3   4  
ATOM 5856  H HA   . MET A 1 1   ? 19.483  2.869   2.219   1.00 0.00 ? 1   MET A HA   4  
ATOM 5857  H HB2  . MET A 1 1   ? 16.875  4.458   2.396   1.00 0.00 ? 1   MET A HB2  4  
ATOM 5858  H HB3  . MET A 1 1   ? 17.762  3.848   3.789   1.00 0.00 ? 1   MET A HB3  4  
ATOM 5859  H HG2  . MET A 1 1   ? 18.799  5.885   1.786   1.00 0.00 ? 1   MET A HG2  4  
ATOM 5860  H HG3  . MET A 1 1   ? 18.243  6.193   3.427   1.00 0.00 ? 1   MET A HG3  4  
ATOM 5861  H HE1  . MET A 1 1   ? 21.029  7.251   2.285   1.00 0.00 ? 1   MET A HE1  4  
ATOM 5862  H HE2  . MET A 1 1   ? 20.430  7.574   3.928   1.00 0.00 ? 1   MET A HE2  4  
ATOM 5863  H HE3  . MET A 1 1   ? 22.077  6.950   3.689   1.00 0.00 ? 1   MET A HE3  4  
ATOM 5864  N N    . ALA A 1 2   ? 17.958  1.060   3.255   1.00 0.00 ? 2   ALA A N    4  
ATOM 5865  C CA   . ALA A 1 2   ? 17.268  -0.174  3.652   1.00 0.00 ? 2   ALA A CA   4  
ATOM 5866  C C    . ALA A 1 2   ? 15.804  0.074   4.076   1.00 0.00 ? 2   ALA A C    4  
ATOM 5867  O O    . ALA A 1 2   ? 15.453  1.148   4.572   1.00 0.00 ? 2   ALA A O    4  
ATOM 5868  C CB   . ALA A 1 2   ? 18.079  -0.849  4.770   1.00 0.00 ? 2   ALA A CB   4  
ATOM 5869  H H    . ALA A 1 2   ? 18.659  1.422   3.887   1.00 0.00 ? 2   ALA A H    4  
ATOM 5870  H HA   . ALA A 1 2   ? 17.251  -0.853  2.794   1.00 0.00 ? 2   ALA A HA   4  
ATOM 5871  H HB1  . ALA A 1 2   ? 18.103  -0.207  5.654   1.00 0.00 ? 2   ALA A HB1  4  
ATOM 5872  H HB2  . ALA A 1 2   ? 17.620  -1.803  5.038   1.00 0.00 ? 2   ALA A HB2  4  
ATOM 5873  H HB3  . ALA A 1 2   ? 19.101  -1.036  4.429   1.00 0.00 ? 2   ALA A HB3  4  
ATOM 5874  N N    . SER A 1 3   ? 14.950  -0.935  3.904   1.00 0.00 ? 3   SER A N    4  
ATOM 5875  C CA   . SER A 1 3   ? 13.504  -0.895  4.202   1.00 0.00 ? 3   SER A CA   4  
ATOM 5876  C C    . SER A 1 3   ? 12.870  -2.309  4.174   1.00 0.00 ? 3   SER A C    4  
ATOM 5877  O O    . SER A 1 3   ? 13.413  -3.202  3.505   1.00 0.00 ? 3   SER A O    4  
ATOM 5878  C CB   . SER A 1 3   ? 12.776  0.050   3.219   1.00 0.00 ? 3   SER A CB   4  
ATOM 5879  O OG   . SER A 1 3   ? 13.008  -0.278  1.854   1.00 0.00 ? 3   SER A OG   4  
ATOM 5880  H H    . SER A 1 3   ? 15.309  -1.803  3.523   1.00 0.00 ? 3   SER A H    4  
ATOM 5881  H HA   . SER A 1 3   ? 13.374  -0.490  5.209   1.00 0.00 ? 3   SER A HA   4  
ATOM 5882  H HB2  . SER A 1 3   ? 11.704  0.014   3.411   1.00 0.00 ? 3   SER A HB2  4  
ATOM 5883  H HB3  . SER A 1 3   ? 13.107  1.076   3.396   1.00 0.00 ? 3   SER A HB3  4  
ATOM 5884  H HG   . SER A 1 3   ? 13.950  -0.137  1.667   1.00 0.00 ? 3   SER A HG   4  
ATOM 5885  N N    . PRO A 1 4   ? 11.741  -2.541  4.882   1.00 0.00 ? 4   PRO A N    4  
ATOM 5886  C CA   . PRO A 1 4   ? 11.039  -3.825  4.888   1.00 0.00 ? 4   PRO A CA   4  
ATOM 5887  C C    . PRO A 1 4   ? 10.272  -4.056  3.577   1.00 0.00 ? 4   PRO A C    4  
ATOM 5888  O O    . PRO A 1 4   ? 9.901   -3.117  2.873   1.00 0.00 ? 4   PRO A O    4  
ATOM 5889  C CB   . PRO A 1 4   ? 10.093  -3.766  6.094   1.00 0.00 ? 4   PRO A CB   4  
ATOM 5890  C CG   . PRO A 1 4   ? 9.756   -2.281  6.189   1.00 0.00 ? 4   PRO A CG   4  
ATOM 5891  C CD   . PRO A 1 4   ? 11.070  -1.611  5.788   1.00 0.00 ? 4   PRO A CD   4  
ATOM 5892  H HA   . PRO A 1 4   ? 11.751  -4.639  5.031   1.00 0.00 ? 4   PRO A HA   4  
ATOM 5893  H HB2  . PRO A 1 4   ? 9.200   -4.378  5.952   1.00 0.00 ? 4   PRO A HB2  4  
ATOM 5894  H HB3  . PRO A 1 4   ? 10.626  -4.076  6.993   1.00 0.00 ? 4   PRO A HB3  4  
ATOM 5895  H HG2  . PRO A 1 4   ? 8.982   -2.031  5.463   1.00 0.00 ? 4   PRO A HG2  4  
ATOM 5896  H HG3  . PRO A 1 4   ? 9.445   -1.995  7.195   1.00 0.00 ? 4   PRO A HG3  4  
ATOM 5897  H HD2  . PRO A 1 4   ? 10.861  -0.655  5.307   1.00 0.00 ? 4   PRO A HD2  4  
ATOM 5898  H HD3  . PRO A 1 4   ? 11.685  -1.459  6.675   1.00 0.00 ? 4   PRO A HD3  4  
ATOM 5899  N N    . HIS A 1 5   ? 9.998   -5.326  3.261   1.00 0.00 ? 5   HIS A N    4  
ATOM 5900  C CA   . HIS A 1 5   ? 9.294   -5.716  2.028   1.00 0.00 ? 5   HIS A CA   4  
ATOM 5901  C C    . HIS A 1 5   ? 7.779   -5.404  2.048   1.00 0.00 ? 5   HIS A C    4  
ATOM 5902  O O    . HIS A 1 5   ? 7.135   -5.396  0.993   1.00 0.00 ? 5   HIS A O    4  
ATOM 5903  C CB   . HIS A 1 5   ? 9.554   -7.207  1.754   1.00 0.00 ? 5   HIS A CB   4  
ATOM 5904  C CG   . HIS A 1 5   ? 8.899   -8.150  2.738   1.00 0.00 ? 5   HIS A CG   4  
ATOM 5905  N ND1  . HIS A 1 5   ? 7.630   -8.677  2.636   1.00 0.00 ? 5   HIS A ND1  4  
ATOM 5906  C CD2  . HIS A 1 5   ? 9.455   -8.663  3.881   1.00 0.00 ? 5   HIS A CD2  4  
ATOM 5907  C CE1  . HIS A 1 5   ? 7.421   -9.474  3.697   1.00 0.00 ? 5   HIS A CE1  4  
ATOM 5908  N NE2  . HIS A 1 5   ? 8.509   -9.500  4.490   1.00 0.00 ? 5   HIS A NE2  4  
ATOM 5909  H H    . HIS A 1 5   ? 10.341  -6.065  3.864   1.00 0.00 ? 5   HIS A H    4  
ATOM 5910  H HA   . HIS A 1 5   ? 9.720   -5.146  1.198   1.00 0.00 ? 5   HIS A HA   4  
ATOM 5911  H HB2  . HIS A 1 5   ? 9.184   -7.444  0.755   1.00 0.00 ? 5   HIS A HB2  4  
ATOM 5912  H HB3  . HIS A 1 5   ? 10.631  -7.387  1.750   1.00 0.00 ? 5   HIS A HB3  4  
ATOM 5913  H HD1  . HIS A 1 5   ? 6.975   -8.520  1.879   1.00 0.00 ? 5   HIS A HD1  4  
ATOM 5914  H HD2  . HIS A 1 5   ? 10.456  -8.465  4.242   1.00 0.00 ? 5   HIS A HD2  4  
ATOM 5915  H HE1  . HIS A 1 5   ? 6.508   -10.029 3.878   1.00 0.00 ? 5   HIS A HE1  4  
ATOM 5916  N N    . GLN A 1 6   ? 7.205   -5.143  3.230   1.00 0.00 ? 6   GLN A N    4  
ATOM 5917  C CA   . GLN A 1 6   ? 5.783   -4.852  3.453   1.00 0.00 ? 6   GLN A CA   4  
ATOM 5918  C C    . GLN A 1 6   ? 5.602   -4.150  4.814   1.00 0.00 ? 6   GLN A C    4  
ATOM 5919  O O    . GLN A 1 6   ? 6.219   -4.546  5.802   1.00 0.00 ? 6   GLN A O    4  
ATOM 5920  C CB   . GLN A 1 6   ? 4.978   -6.170  3.358   1.00 0.00 ? 6   GLN A CB   4  
ATOM 5921  C CG   . GLN A 1 6   ? 3.456   -5.967  3.404   1.00 0.00 ? 6   GLN A CG   4  
ATOM 5922  C CD   . GLN A 1 6   ? 2.693   -7.239  3.025   1.00 0.00 ? 6   GLN A CD   4  
ATOM 5923  O OE1  . GLN A 1 6   ? 2.178   -7.375  1.921   1.00 0.00 ? 6   GLN A OE1  4  
ATOM 5924  N NE2  . GLN A 1 6   ? 2.583   -8.219  3.896   1.00 0.00 ? 6   GLN A NE2  4  
ATOM 5925  H H    . GLN A 1 6   ? 7.801   -5.151  4.045   1.00 0.00 ? 6   GLN A H    4  
ATOM 5926  H HA   . GLN A 1 6   ? 5.443   -4.174  2.665   1.00 0.00 ? 6   GLN A HA   4  
ATOM 5927  H HB2  . GLN A 1 6   ? 5.215   -6.658  2.414   1.00 0.00 ? 6   GLN A HB2  4  
ATOM 5928  H HB3  . GLN A 1 6   ? 5.280   -6.838  4.168   1.00 0.00 ? 6   GLN A HB3  4  
ATOM 5929  H HG2  . GLN A 1 6   ? 3.158   -5.649  4.405   1.00 0.00 ? 6   GLN A HG2  4  
ATOM 5930  H HG3  . GLN A 1 6   ? 3.179   -5.177  2.703   1.00 0.00 ? 6   GLN A HG3  4  
ATOM 5931  H HE21 . GLN A 1 6   ? 2.966   -8.143  4.825   1.00 0.00 ? 6   GLN A HE21 4  
ATOM 5932  H HE22 . GLN A 1 6   ? 1.963   -8.988  3.669   1.00 0.00 ? 6   GLN A HE22 4  
ATOM 5933  N N    . GLU A 1 7   ? 4.754   -3.113  4.878   1.00 0.00 ? 7   GLU A N    4  
ATOM 5934  C CA   . GLU A 1 7   ? 4.568   -2.268  6.069   1.00 0.00 ? 7   GLU A CA   4  
ATOM 5935  C C    . GLU A 1 7   ? 3.190   -1.575  6.047   1.00 0.00 ? 7   GLU A C    4  
ATOM 5936  O O    . GLU A 1 7   ? 2.875   -0.917  5.046   1.00 0.00 ? 7   GLU A O    4  
ATOM 5937  C CB   . GLU A 1 7   ? 5.683   -1.202  6.123   1.00 0.00 ? 7   GLU A CB   4  
ATOM 5938  C CG   . GLU A 1 7   ? 5.612   -0.294  7.360   1.00 0.00 ? 7   GLU A CG   4  
ATOM 5939  C CD   . GLU A 1 7   ? 6.675   0.808   7.290   1.00 0.00 ? 7   GLU A CD   4  
ATOM 5940  O OE1  . GLU A 1 7   ? 6.413   1.852   6.642   1.00 0.00 ? 7   GLU A OE1  4  
ATOM 5941  O OE2  . GLU A 1 7   ? 7.766   0.649   7.887   1.00 0.00 ? 7   GLU A OE2  4  
ATOM 5942  H H    . GLU A 1 7   ? 4.271   -2.820  4.038   1.00 0.00 ? 7   GLU A H    4  
ATOM 5943  H HA   . GLU A 1 7   ? 4.660   -2.893  6.956   1.00 0.00 ? 7   GLU A HA   4  
ATOM 5944  H HB2  . GLU A 1 7   ? 6.652   -1.698  6.117   1.00 0.00 ? 7   GLU A HB2  4  
ATOM 5945  H HB3  . GLU A 1 7   ? 5.617   -0.577  5.230   1.00 0.00 ? 7   GLU A HB3  4  
ATOM 5946  H HG2  . GLU A 1 7   ? 4.631   0.180   7.422   1.00 0.00 ? 7   GLU A HG2  4  
ATOM 5947  H HG3  . GLU A 1 7   ? 5.752   -0.898  8.259   1.00 0.00 ? 7   GLU A HG3  4  
ATOM 5948  N N    . PRO A 1 8   ? 2.387   -1.661  7.130   1.00 0.00 ? 8   PRO A N    4  
ATOM 5949  C CA   . PRO A 1 8   ? 1.175   -0.868  7.286   1.00 0.00 ? 8   PRO A CA   4  
ATOM 5950  C C    . PRO A 1 8   ? 1.525   0.546   7.761   1.00 0.00 ? 8   PRO A C    4  
ATOM 5951  O O    . PRO A 1 8   ? 2.349   0.737   8.655   1.00 0.00 ? 8   PRO A O    4  
ATOM 5952  C CB   . PRO A 1 8   ? 0.334   -1.623  8.315   1.00 0.00 ? 8   PRO A CB   4  
ATOM 5953  C CG   . PRO A 1 8   ? 1.386   -2.248  9.230   1.00 0.00 ? 8   PRO A CG   4  
ATOM 5954  C CD   . PRO A 1 8   ? 2.551   -2.545  8.281   1.00 0.00 ? 8   PRO A CD   4  
ATOM 5955  H HA   . PRO A 1 8   ? 0.627   -0.809  6.345   1.00 0.00 ? 8   PRO A HA   4  
ATOM 5956  H HB2  . PRO A 1 8   ? -0.347  -0.962  8.856   1.00 0.00 ? 8   PRO A HB2  4  
ATOM 5957  H HB3  . PRO A 1 8   ? -0.224  -2.410  7.811   1.00 0.00 ? 8   PRO A HB3  4  
ATOM 5958  H HG2  . PRO A 1 8   ? 1.704   -1.524  9.980   1.00 0.00 ? 8   PRO A HG2  4  
ATOM 5959  H HG3  . PRO A 1 8   ? 1.016   -3.154  9.706   1.00 0.00 ? 8   PRO A HG3  4  
ATOM 5960  H HD2  . PRO A 1 8   ? 3.498   -2.363  8.789   1.00 0.00 ? 8   PRO A HD2  4  
ATOM 5961  H HD3  . PRO A 1 8   ? 2.499   -3.586  7.952   1.00 0.00 ? 8   PRO A HD3  4  
ATOM 5962  N N    . LYS A 1 9   ? 0.881   1.553   7.167   1.00 0.00 ? 9   LYS A N    4  
ATOM 5963  C CA   . LYS A 1 9   ? 1.015   2.957   7.582   1.00 0.00 ? 9   LYS A CA   4  
ATOM 5964  C C    . LYS A 1 9   ? 0.038   3.289   8.734   1.00 0.00 ? 9   LYS A C    4  
ATOM 5965  O O    . LYS A 1 9   ? -0.978  2.603   8.892   1.00 0.00 ? 9   LYS A O    4  
ATOM 5966  C CB   . LYS A 1 9   ? 0.837   3.862   6.345   1.00 0.00 ? 9   LYS A CB   4  
ATOM 5967  C CG   . LYS A 1 9   ? 2.145   4.086   5.560   1.00 0.00 ? 9   LYS A CG   4  
ATOM 5968  C CD   . LYS A 1 9   ? 2.840   2.791   5.101   1.00 0.00 ? 9   LYS A CD   4  
ATOM 5969  C CE   . LYS A 1 9   ? 4.011   3.054   4.142   1.00 0.00 ? 9   LYS A CE   4  
ATOM 5970  N NZ   . LYS A 1 9   ? 5.203   3.622   4.828   1.00 0.00 ? 9   LYS A NZ   4  
ATOM 5971  H H    . LYS A 1 9   ? 0.206   1.338   6.445   1.00 0.00 ? 9   LYS A H    4  
ATOM 5972  H HA   . LYS A 1 9   ? 2.023   3.114   7.976   1.00 0.00 ? 9   LYS A HA   4  
ATOM 5973  H HB2  . LYS A 1 9   ? 0.080   3.439   5.683   1.00 0.00 ? 9   LYS A HB2  4  
ATOM 5974  H HB3  . LYS A 1 9   ? 0.471   4.842   6.658   1.00 0.00 ? 9   LYS A HB3  4  
ATOM 5975  H HG2  . LYS A 1 9   ? 1.914   4.691   4.682   1.00 0.00 ? 9   LYS A HG2  4  
ATOM 5976  H HG3  . LYS A 1 9   ? 2.833   4.654   6.189   1.00 0.00 ? 9   LYS A HG3  4  
ATOM 5977  H HD2  . LYS A 1 9   ? 3.204   2.235   5.967   1.00 0.00 ? 9   LYS A HD2  4  
ATOM 5978  H HD3  . LYS A 1 9   ? 2.105   2.173   4.582   1.00 0.00 ? 9   LYS A HD3  4  
ATOM 5979  H HE2  . LYS A 1 9   ? 4.287   2.104   3.672   1.00 0.00 ? 9   LYS A HE2  4  
ATOM 5980  H HE3  . LYS A 1 9   ? 3.676   3.728   3.349   1.00 0.00 ? 9   LYS A HE3  4  
ATOM 5981  H HZ1  . LYS A 1 9   ? 5.569   2.973   5.529   1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 5982  H HZ2  . LYS A 1 9   ? 5.950   3.794   4.169   1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 5983  H HZ3  . LYS A 1 9   ? 4.987   4.498   5.284   1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 5984  N N    . PRO A 1 10  ? 0.334   4.301   9.577   1.00 0.00 ? 10  PRO A N    4  
ATOM 5985  C CA   . PRO A 1 10  ? -0.503  4.622   10.729  1.00 0.00 ? 10  PRO A CA   4  
ATOM 5986  C C    . PRO A 1 10  ? -1.878  5.099   10.238  1.00 0.00 ? 10  PRO A C    4  
ATOM 5987  O O    . PRO A 1 10  ? -1.977  6.012   9.419   1.00 0.00 ? 10  PRO A O    4  
ATOM 5988  C CB   . PRO A 1 10  ? 0.292   5.654   11.541  1.00 0.00 ? 10  PRO A CB   4  
ATOM 5989  C CG   . PRO A 1 10  ? 1.140   6.351   10.478  1.00 0.00 ? 10  PRO A CG   4  
ATOM 5990  C CD   . PRO A 1 10  ? 1.475   5.207   9.518   1.00 0.00 ? 10  PRO A CD   4  
ATOM 5991  H HA   . PRO A 1 10  ? -0.641  3.737   11.345  1.00 0.00 ? 10  PRO A HA   4  
ATOM 5992  H HB2  . PRO A 1 10  ? -0.350  6.351   12.082  1.00 0.00 ? 10  PRO A HB2  4  
ATOM 5993  H HB3  . PRO A 1 10  ? 0.964   5.137   12.234  1.00 0.00 ? 10  PRO A HB3  4  
ATOM 5994  H HG2  . PRO A 1 10  ? 0.537   7.100   9.966   1.00 0.00 ? 10  PRO A HG2  4  
ATOM 5995  H HG3  . PRO A 1 10  ? 2.036   6.800   10.904  1.00 0.00 ? 10  PRO A HG3  4  
ATOM 5996  H HD2  . PRO A 1 10  ? 1.634   5.599   8.510   1.00 0.00 ? 10  PRO A HD2  4  
ATOM 5997  H HD3  . PRO A 1 10  ? 2.372   4.691   9.865   1.00 0.00 ? 10  PRO A HD3  4  
ATOM 5998  N N    . GLY A 1 11  ? -2.932  4.419   10.703  1.00 0.00 ? 11  GLY A N    4  
ATOM 5999  C CA   . GLY A 1 11  ? -4.331  4.629   10.306  1.00 0.00 ? 11  GLY A CA   4  
ATOM 6000  C C    . GLY A 1 11  ? -4.802  3.795   9.109   1.00 0.00 ? 11  GLY A C    4  
ATOM 6001  O O    . GLY A 1 11  ? -5.973  3.896   8.751   1.00 0.00 ? 11  GLY A O    4  
ATOM 6002  H H    . GLY A 1 11  ? -2.748  3.665   11.359  1.00 0.00 ? 11  GLY A H    4  
ATOM 6003  H HA2  . GLY A 1 11  ? -4.973  4.359   11.142  1.00 0.00 ? 11  GLY A HA2  4  
ATOM 6004  H HA3  . GLY A 1 11  ? -4.485  5.674   10.051  1.00 0.00 ? 11  GLY A HA3  4  
ATOM 6005  N N    . ASP A 1 12  ? -3.935  2.992   8.489   1.00 0.00 ? 12  ASP A N    4  
ATOM 6006  C CA   . ASP A 1 12  ? -4.281  2.061   7.404   1.00 0.00 ? 12  ASP A CA   4  
ATOM 6007  C C    . ASP A 1 12  ? -4.630  0.659   7.944   1.00 0.00 ? 12  ASP A C    4  
ATOM 6008  O O    . ASP A 1 12  ? -4.238  0.272   9.051   1.00 0.00 ? 12  ASP A O    4  
ATOM 6009  C CB   . ASP A 1 12  ? -3.156  1.996   6.356   1.00 0.00 ? 12  ASP A CB   4  
ATOM 6010  C CG   . ASP A 1 12  ? -3.094  3.262   5.488   1.00 0.00 ? 12  ASP A CG   4  
ATOM 6011  O OD1  . ASP A 1 12  ? -2.807  4.367   6.005   1.00 0.00 ? 12  ASP A OD1  4  
ATOM 6012  O OD2  . ASP A 1 12  ? -3.409  3.174   4.278   1.00 0.00 ? 12  ASP A OD2  4  
ATOM 6013  H H    . ASP A 1 12  ? -2.984  2.963   8.838   1.00 0.00 ? 12  ASP A H    4  
ATOM 6014  H HA   . ASP A 1 12  ? -5.166  2.434   6.883   1.00 0.00 ? 12  ASP A HA   4  
ATOM 6015  H HB2  . ASP A 1 12  ? -2.196  1.821   6.837   1.00 0.00 ? 12  ASP A HB2  4  
ATOM 6016  H HB3  . ASP A 1 12  ? -3.342  1.145   5.702   1.00 0.00 ? 12  ASP A HB3  4  
ATOM 6017  N N    . LEU A 1 13  ? -5.399  -0.093  7.146   1.00 0.00 ? 13  LEU A N    4  
ATOM 6018  C CA   . LEU A 1 13  ? -5.968  -1.389  7.516   1.00 0.00 ? 13  LEU A CA   4  
ATOM 6019  C C    . LEU A 1 13  ? -5.377  -2.566  6.729   1.00 0.00 ? 13  LEU A C    4  
ATOM 6020  O O    . LEU A 1 13  ? -4.767  -2.406  5.673   1.00 0.00 ? 13  LEU A O    4  
ATOM 6021  C CB   . LEU A 1 13  ? -7.509  -1.343  7.454   1.00 0.00 ? 13  LEU A CB   4  
ATOM 6022  C CG   . LEU A 1 13  ? -8.141  -1.256  6.047   1.00 0.00 ? 13  LEU A CG   4  
ATOM 6023  C CD1  . LEU A 1 13  ? -9.585  -1.756  6.150   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 6024  C CD2  . LEU A 1 13  ? -8.156  0.177   5.493   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 6025  H H    . LEU A 1 13  ? -5.607  0.253   6.221   1.00 0.00 ? 13  LEU A H    4  
ATOM 6026  H HA   . LEU A 1 13  ? -5.708  -1.579  8.556   1.00 0.00 ? 13  LEU A HA   4  
ATOM 6027  H HB2  . LEU A 1 13  ? -7.864  -2.253  7.940   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 6028  H HB3  . LEU A 1 13  ? -7.872  -0.509  8.056   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 6029  H HG   . LEU A 1 13  ? -7.603  -1.906  5.359   1.00 0.00 ? 13  LEU A HG   4  
ATOM 6030  H HD11 . LEU A 1 13  ? -10.166 -1.076  6.772   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 6031  H HD12 . LEU A 1 13  ? -10.030 -1.818  5.157   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 6032  H HD13 . LEU A 1 13  ? -9.593  -2.748  6.600   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 6033  H HD21 . LEU A 1 13  ? -8.640  0.850   6.204   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 6034  H HD22 . LEU A 1 13  ? -7.144  0.527   5.302   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 6035  H HD23 . LEU A 1 13  ? -8.702  0.201   4.549   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 6036  N N    . ILE A 1 14  ? -5.549  -3.766  7.280   1.00 0.00 ? 14  ILE A N    4  
ATOM 6037  C CA   . ILE A 1 14  ? -4.745  -4.954  6.976   1.00 0.00 ? 14  ILE A CA   4  
ATOM 6038  C C    . ILE A 1 14  ? -5.619  -6.218  7.011   1.00 0.00 ? 14  ILE A C    4  
ATOM 6039  O O    . ILE A 1 14  ? -6.344  -6.434  7.982   1.00 0.00 ? 14  ILE A O    4  
ATOM 6040  C CB   . ILE A 1 14  ? -3.605  -5.128  8.020   1.00 0.00 ? 14  ILE A CB   4  
ATOM 6041  C CG1  . ILE A 1 14  ? -2.948  -3.818  8.528   1.00 0.00 ? 14  ILE A CG1  4  
ATOM 6042  C CG2  . ILE A 1 14  ? -2.531  -6.063  7.431   1.00 0.00 ? 14  ILE A CG2  4  
ATOM 6043  C CD1  . ILE A 1 14  ? -1.914  -4.049  9.639   1.00 0.00 ? 14  ILE A CD1  4  
ATOM 6044  H H    . ILE A 1 14  ? -6.124  -3.807  8.120   1.00 0.00 ? 14  ILE A H    4  
ATOM 6045  H HA   . ILE A 1 14  ? -4.309  -4.853  5.984   1.00 0.00 ? 14  ILE A HA   4  
ATOM 6046  H HB   . ILE A 1 14  ? -4.040  -5.608  8.896   1.00 0.00 ? 14  ILE A HB   4  
ATOM 6047  H HG12 . ILE A 1 14  ? -2.474  -3.297  7.696   1.00 0.00 ? 14  ILE A HG12 4  
ATOM 6048  H HG13 . ILE A 1 14  ? -3.715  -3.169  8.951   1.00 0.00 ? 14  ILE A HG13 4  
ATOM 6049  H HG21 . ILE A 1 14  ? -2.986  -6.970  7.038   1.00 0.00 ? 14  ILE A HG21 4  
ATOM 6050  H HG22 . ILE A 1 14  ? -1.993  -5.560  6.625   1.00 0.00 ? 14  ILE A HG22 4  
ATOM 6051  H HG23 . ILE A 1 14  ? -1.823  -6.372  8.201   1.00 0.00 ? 14  ILE A HG23 4  
ATOM 6052  H HD11 . ILE A 1 14  ? -2.352  -4.643  10.441  1.00 0.00 ? 14  ILE A HD11 4  
ATOM 6053  H HD12 . ILE A 1 14  ? -1.031  -4.552  9.248   1.00 0.00 ? 14  ILE A HD12 4  
ATOM 6054  H HD13 . ILE A 1 14  ? -1.607  -3.090  10.051  1.00 0.00 ? 14  ILE A HD13 4  
ATOM 6055  N N    . GLU A 1 15  ? -5.511  -7.059  5.986   1.00 0.00 ? 15  GLU A N    4  
ATOM 6056  C CA   . GLU A 1 15  ? -6.083  -8.406  5.946   1.00 0.00 ? 15  GLU A CA   4  
ATOM 6057  C C    . GLU A 1 15  ? -5.015  -9.380  6.461   1.00 0.00 ? 15  GLU A C    4  
ATOM 6058  O O    . GLU A 1 15  ? -3.913  -9.426  5.909   1.00 0.00 ? 15  GLU A O    4  
ATOM 6059  C CB   . GLU A 1 15  ? -6.469  -8.784  4.503   1.00 0.00 ? 15  GLU A CB   4  
ATOM 6060  C CG   . GLU A 1 15  ? -7.564  -7.894  3.912   1.00 0.00 ? 15  GLU A CG   4  
ATOM 6061  C CD   . GLU A 1 15  ? -7.873  -8.302  2.464   1.00 0.00 ? 15  GLU A CD   4  
ATOM 6062  O OE1  . GLU A 1 15  ? -8.736  -9.187  2.246   1.00 0.00 ? 15  GLU A OE1  4  
ATOM 6063  O OE2  . GLU A 1 15  ? -7.252  -7.739  1.530   1.00 0.00 ? 15  GLU A OE2  4  
ATOM 6064  H H    . GLU A 1 15  ? -4.849  -6.829  5.253   1.00 0.00 ? 15  GLU A H    4  
ATOM 6065  H HA   . GLU A 1 15  ? -6.972  -8.461  6.577   1.00 0.00 ? 15  GLU A HA   4  
ATOM 6066  H HB2  . GLU A 1 15  ? -5.585  -8.718  3.864   1.00 0.00 ? 15  GLU A HB2  4  
ATOM 6067  H HB3  . GLU A 1 15  ? -6.819  -9.818  4.493   1.00 0.00 ? 15  GLU A HB3  4  
ATOM 6068  H HG2  . GLU A 1 15  ? -8.466  -7.982  4.520   1.00 0.00 ? 15  GLU A HG2  4  
ATOM 6069  H HG3  . GLU A 1 15  ? -7.235  -6.856  3.925   1.00 0.00 ? 15  GLU A HG3  4  
ATOM 6070  N N    . ILE A 1 16  ? -5.301  -10.140 7.522   1.00 0.00 ? 16  ILE A N    4  
ATOM 6071  C CA   . ILE A 1 16  ? -4.316  -10.995 8.213   1.00 0.00 ? 16  ILE A CA   4  
ATOM 6072  C C    . ILE A 1 16  ? -4.832  -12.433 8.314   1.00 0.00 ? 16  ILE A C    4  
ATOM 6073  O O    . ILE A 1 16  ? -5.869  -12.709 8.925   1.00 0.00 ? 16  ILE A O    4  
ATOM 6074  C CB   . ILE A 1 16  ? -3.947  -10.414 9.606   1.00 0.00 ? 16  ILE A CB   4  
ATOM 6075  C CG1  . ILE A 1 16  ? -3.554  -8.920  9.488   1.00 0.00 ? 16  ILE A CG1  4  
ATOM 6076  C CG2  . ILE A 1 16  ? -2.802  -11.238 10.230  1.00 0.00 ? 16  ILE A CG2  4  
ATOM 6077  C CD1  . ILE A 1 16  ? -2.956  -8.272  10.741  1.00 0.00 ? 16  ILE A CD1  4  
ATOM 6078  H H    . ILE A 1 16  ? -6.225  -10.041 7.947   1.00 0.00 ? 16  ILE A H    4  
ATOM 6079  H HA   . ILE A 1 16  ? -3.390  -11.033 7.633   1.00 0.00 ? 16  ILE A HA   4  
ATOM 6080  H HB   . ILE A 1 16  ? -4.818  -10.488 10.261  1.00 0.00 ? 16  ILE A HB   4  
ATOM 6081  H HG12 . ILE A 1 16  ? -2.831  -8.807  8.682   1.00 0.00 ? 16  ILE A HG12 4  
ATOM 6082  H HG13 . ILE A 1 16  ? -4.445  -8.346  9.223   1.00 0.00 ? 16  ILE A HG13 4  
ATOM 6083  H HG21 . ILE A 1 16  ? -1.883  -11.116 9.654   1.00 0.00 ? 16  ILE A HG21 4  
ATOM 6084  H HG22 . ILE A 1 16  ? -2.627  -10.925 11.256  1.00 0.00 ? 16  ILE A HG22 4  
ATOM 6085  H HG23 . ILE A 1 16  ? -3.053  -12.295 10.264  1.00 0.00 ? 16  ILE A HG23 4  
ATOM 6086  H HD11 . ILE A 1 16  ? -3.611  -8.438  11.596  1.00 0.00 ? 16  ILE A HD11 4  
ATOM 6087  H HD12 . ILE A 1 16  ? -1.966  -8.678  10.943  1.00 0.00 ? 16  ILE A HD12 4  
ATOM 6088  H HD13 . ILE A 1 16  ? -2.852  -7.200  10.577  1.00 0.00 ? 16  ILE A HD13 4  
ATOM 6089  N N    . PHE A 1 17  ? -4.044  -13.372 7.790   1.00 0.00 ? 17  PHE A N    4  
ATOM 6090  C CA   . PHE A 1 17  ? -4.268  -14.817 7.859   1.00 0.00 ? 17  PHE A CA   4  
ATOM 6091  C C    . PHE A 1 17  ? -3.779  -15.381 9.209   1.00 0.00 ? 17  PHE A C    4  
ATOM 6092  O O    . PHE A 1 17  ? -2.999  -16.334 9.263   1.00 0.00 ? 17  PHE A O    4  
ATOM 6093  C CB   . PHE A 1 17  ? -3.595  -15.481 6.645   1.00 0.00 ? 17  PHE A CB   4  
ATOM 6094  C CG   . PHE A 1 17  ? -4.181  -15.072 5.304   1.00 0.00 ? 17  PHE A CG   4  
ATOM 6095  C CD1  . PHE A 1 17  ? -3.679  -13.950 4.615   1.00 0.00 ? 17  PHE A CD1  4  
ATOM 6096  C CD2  . PHE A 1 17  ? -5.239  -15.814 4.743   1.00 0.00 ? 17  PHE A CD2  4  
ATOM 6097  C CE1  . PHE A 1 17  ? -4.230  -13.568 3.379   1.00 0.00 ? 17  PHE A CE1  4  
ATOM 6098  C CE2  . PHE A 1 17  ? -5.784  -15.437 3.502   1.00 0.00 ? 17  PHE A CE2  4  
ATOM 6099  C CZ   . PHE A 1 17  ? -5.281  -14.314 2.820   1.00 0.00 ? 17  PHE A CZ   4  
ATOM 6100  H H    . PHE A 1 17  ? -3.176  -13.075 7.361   1.00 0.00 ? 17  PHE A H    4  
ATOM 6101  H HA   . PHE A 1 17  ? -5.342  -15.011 7.799   1.00 0.00 ? 17  PHE A HA   4  
ATOM 6102  H HB2  . PHE A 1 17  ? -2.529  -15.247 6.657   1.00 0.00 ? 17  PHE A HB2  4  
ATOM 6103  H HB3  . PHE A 1 17  ? -3.691  -16.564 6.746   1.00 0.00 ? 17  PHE A HB3  4  
ATOM 6104  H HD1  . PHE A 1 17  ? -2.874  -13.371 5.036   1.00 0.00 ? 17  PHE A HD1  4  
ATOM 6105  H HD2  . PHE A 1 17  ? -5.635  -16.675 5.264   1.00 0.00 ? 17  PHE A HD2  4  
ATOM 6106  H HE1  . PHE A 1 17  ? -3.840  -12.705 2.857   1.00 0.00 ? 17  PHE A HE1  4  
ATOM 6107  H HE2  . PHE A 1 17  ? -6.596  -16.009 3.075   1.00 0.00 ? 17  PHE A HE2  4  
ATOM 6108  H HZ   . PHE A 1 17  ? -5.704  -14.021 1.868   1.00 0.00 ? 17  PHE A HZ   4  
ATOM 6109  N N    . ARG A 1 18  ? -4.233  -14.766 10.313  1.00 0.00 ? 18  ARG A N    4  
ATOM 6110  C CA   . ARG A 1 18  ? -3.942  -15.194 11.691  1.00 0.00 ? 18  ARG A CA   4  
ATOM 6111  C C    . ARG A 1 18  ? -4.395  -16.627 11.948  1.00 0.00 ? 18  ARG A C    4  
ATOM 6112  O O    . ARG A 1 18  ? -3.699  -17.409 12.596  1.00 0.00 ? 18  ARG A O    4  
ATOM 6113  C CB   . ARG A 1 18  ? -4.611  -14.207 12.669  1.00 0.00 ? 18  ARG A CB   4  
ATOM 6114  C CG   . ARG A 1 18  ? -4.343  -14.472 14.162  1.00 0.00 ? 18  ARG A CG   4  
ATOM 6115  C CD   . ARG A 1 18  ? -2.856  -14.689 14.469  1.00 0.00 ? 18  ARG A CD   4  
ATOM 6116  N NE   . ARG A 1 18  ? -2.551  -14.429 15.888  1.00 0.00 ? 18  ARG A NE   4  
ATOM 6117  C CZ   . ARG A 1 18  ? -1.361  -14.081 16.373  1.00 0.00 ? 18  ARG A CZ   4  
ATOM 6118  N NH1  . ARG A 1 18  ? -0.272  -14.109 15.635  1.00 0.00 ? 18  ARG A NH1  4  
ATOM 6119  N NH2  . ARG A 1 18  ? -1.257  -13.675 17.618  1.00 0.00 ? 18  ARG A NH2  4  
ATOM 6120  H H    . ARG A 1 18  ? -4.851  -13.971 10.180  1.00 0.00 ? 18  ARG A H    4  
ATOM 6121  H HA   . ARG A 1 18  ? -2.877  -15.179 11.855  1.00 0.00 ? 18  ARG A HA   4  
ATOM 6122  H HB2  . ARG A 1 18  ? -4.260  -13.201 12.436  1.00 0.00 ? 18  ARG A HB2  4  
ATOM 6123  H HB3  . ARG A 1 18  ? -5.689  -14.235 12.511  1.00 0.00 ? 18  ARG A HB3  4  
ATOM 6124  H HG2  . ARG A 1 18  ? -4.704  -13.610 14.726  1.00 0.00 ? 18  ARG A HG2  4  
ATOM 6125  H HG3  . ARG A 1 18  ? -4.907  -15.346 14.492  1.00 0.00 ? 18  ARG A HG3  4  
ATOM 6126  H HD2  . ARG A 1 18  ? -2.593  -15.719 14.208  1.00 0.00 ? 18  ARG A HD2  4  
ATOM 6127  H HD3  . ARG A 1 18  ? -2.276  -14.003 13.850  1.00 0.00 ? 18  ARG A HD3  4  
ATOM 6128  H HE   . ARG A 1 18  ? -3.334  -14.437 16.528  1.00 0.00 ? 18  ARG A HE   4  
ATOM 6129  H HH11 . ARG A 1 18  ? -0.315  -14.409 14.675  1.00 0.00 ? 18  ARG A HH11 4  
ATOM 6130  H HH12 . ARG A 1 18  ? 0.599   -13.728 15.995  1.00 0.00 ? 18  ARG A HH12 4  
ATOM 6131  H HH21 . ARG A 1 18  ? -2.065  -13.648 18.220  1.00 0.00 ? 18  ARG A HH21 4  
ATOM 6132  H HH22 . ARG A 1 18  ? -0.368  -13.333 17.991  1.00 0.00 ? 18  ARG A HH22 4  
ATOM 6133  N N    . LEU A 1 19  ? -5.571  -16.942 11.416  1.00 0.00 ? 19  LEU A N    4  
ATOM 6134  C CA   . LEU A 1 19  ? -6.347  -18.139 11.679  1.00 0.00 ? 19  LEU A CA   4  
ATOM 6135  C C    . LEU A 1 19  ? -7.320  -18.349 10.504  1.00 0.00 ? 19  LEU A C    4  
ATOM 6136  O O    . LEU A 1 19  ? -7.467  -17.459 9.658   1.00 0.00 ? 19  LEU A O    4  
ATOM 6137  C CB   . LEU A 1 19  ? -7.076  -17.911 13.027  1.00 0.00 ? 19  LEU A CB   4  
ATOM 6138  C CG   . LEU A 1 19  ? -6.376  -18.474 14.280  1.00 0.00 ? 19  LEU A CG   4  
ATOM 6139  C CD1  . LEU A 1 19  ? -7.128  -18.002 15.533  1.00 0.00 ? 19  LEU A CD1  4  
ATOM 6140  C CD2  . LEU A 1 19  ? -6.312  -20.010 14.272  1.00 0.00 ? 19  LEU A CD2  4  
ATOM 6141  H H    . LEU A 1 19  ? -6.034  -16.243 10.851  1.00 0.00 ? 19  LEU A H    4  
ATOM 6142  H HA   . LEU A 1 19  ? -5.664  -18.988 11.731  1.00 0.00 ? 19  LEU A HA   4  
ATOM 6143  H HB2  . LEU A 1 19  ? -7.172  -16.831 13.163  1.00 0.00 ? 19  LEU A HB2  4  
ATOM 6144  H HB3  . LEU A 1 19  ? -8.082  -18.333 12.983  1.00 0.00 ? 19  LEU A HB3  4  
ATOM 6145  H HG   . LEU A 1 19  ? -5.363  -18.076 14.336  1.00 0.00 ? 19  LEU A HG   4  
ATOM 6146  H HD11 . LEU A 1 19  ? -7.147  -16.913 15.565  1.00 0.00 ? 19  LEU A HD11 4  
ATOM 6147  H HD12 . LEU A 1 19  ? -8.153  -18.374 15.522  1.00 0.00 ? 19  LEU A HD12 4  
ATOM 6148  H HD13 . LEU A 1 19  ? -6.620  -18.369 16.429  1.00 0.00 ? 19  LEU A HD13 4  
ATOM 6149  H HD21 . LEU A 1 19  ? -5.859  -20.364 15.200  1.00 0.00 ? 19  LEU A HD21 4  
ATOM 6150  H HD22 . LEU A 1 19  ? -7.317  -20.424 14.186  1.00 0.00 ? 19  LEU A HD22 4  
ATOM 6151  H HD23 . LEU A 1 19  ? -5.704  -20.363 13.440  1.00 0.00 ? 19  LEU A HD23 4  
ATOM 6152  N N    . GLY A 1 20  ? -8.022  -19.485 10.472  1.00 0.00 ? 20  GLY A N    4  
ATOM 6153  C CA   . GLY A 1 20  ? -8.927  -19.867 9.371   1.00 0.00 ? 20  GLY A CA   4  
ATOM 6154  C C    . GLY A 1 20  ? -10.139 -18.948 9.164   1.00 0.00 ? 20  GLY A C    4  
ATOM 6155  O O    . GLY A 1 20  ? -10.847 -19.086 8.167   1.00 0.00 ? 20  GLY A O    4  
ATOM 6156  H H    . GLY A 1 20  ? -7.866  -20.160 11.209  1.00 0.00 ? 20  GLY A H    4  
ATOM 6157  H HA2  . GLY A 1 20  ? -8.359  -19.857 8.441   1.00 0.00 ? 20  GLY A HA2  4  
ATOM 6158  H HA3  . GLY A 1 20  ? -9.298  -20.878 9.545   1.00 0.00 ? 20  GLY A HA3  4  
ATOM 6159  N N    . TYR A 1 21  ? -10.364 -17.987 10.065  1.00 0.00 ? 21  TYR A N    4  
ATOM 6160  C CA   . TYR A 1 21  ? -11.394 -16.952 9.931   1.00 0.00 ? 21  TYR A CA   4  
ATOM 6161  C C    . TYR A 1 21  ? -11.042 -15.864 8.892   1.00 0.00 ? 21  TYR A C    4  
ATOM 6162  O O    . TYR A 1 21  ? -11.942 -15.384 8.202   1.00 0.00 ? 21  TYR A O    4  
ATOM 6163  C CB   . TYR A 1 21  ? -11.588 -16.317 11.319  1.00 0.00 ? 21  TYR A CB   4  
ATOM 6164  C CG   . TYR A 1 21  ? -12.564 -15.150 11.365  1.00 0.00 ? 21  TYR A CG   4  
ATOM 6165  C CD1  . TYR A 1 21  ? -13.899 -15.318 10.949  1.00 0.00 ? 21  TYR A CD1  4  
ATOM 6166  C CD2  . TYR A 1 21  ? -12.133 -13.890 11.827  1.00 0.00 ? 21  TYR A CD2  4  
ATOM 6167  C CE1  . TYR A 1 21  ? -14.792 -14.231 10.978  1.00 0.00 ? 21  TYR A CE1  4  
ATOM 6168  C CE2  . TYR A 1 21  ? -13.023 -12.802 11.878  1.00 0.00 ? 21  TYR A CE2  4  
ATOM 6169  C CZ   . TYR A 1 21  ? -14.360 -12.971 11.453  1.00 0.00 ? 21  TYR A CZ   4  
ATOM 6170  O OH   . TYR A 1 21  ? -15.230 -11.927 11.508  1.00 0.00 ? 21  TYR A OH   4  
ATOM 6171  H H    . TYR A 1 21  ? -9.748  -17.936 10.866  1.00 0.00 ? 21  TYR A H    4  
ATOM 6172  H HA   . TYR A 1 21  ? -12.331 -17.415 9.623   1.00 0.00 ? 21  TYR A HA   4  
ATOM 6173  H HB2  . TYR A 1 21  ? -11.940 -17.084 12.008  1.00 0.00 ? 21  TYR A HB2  4  
ATOM 6174  H HB3  . TYR A 1 21  ? -10.612 -15.977 11.679  1.00 0.00 ? 21  TYR A HB3  4  
ATOM 6175  H HD1  . TYR A 1 21  ? -14.241 -16.281 10.596  1.00 0.00 ? 21  TYR A HD1  4  
ATOM 6176  H HD2  . TYR A 1 21  ? -11.111 -13.758 12.141  1.00 0.00 ? 21  TYR A HD2  4  
ATOM 6177  H HE1  . TYR A 1 21  ? -15.810 -14.364 10.646  1.00 0.00 ? 21  TYR A HE1  4  
ATOM 6178  H HE2  . TYR A 1 21  ? -12.683 -11.843 12.241  1.00 0.00 ? 21  TYR A HE2  4  
ATOM 6179  H HH   . TYR A 1 21  ? -14.815 -11.121 11.824  1.00 0.00 ? 21  TYR A HH   4  
ATOM 6180  N N    . GLU A 1 22  ? -9.749  -15.506 8.785   1.00 0.00 ? 22  GLU A N    4  
ATOM 6181  C CA   . GLU A 1 22  ? -9.196  -14.360 8.033   1.00 0.00 ? 22  GLU A CA   4  
ATOM 6182  C C    . GLU A 1 22  ? -9.625  -13.043 8.712   1.00 0.00 ? 22  GLU A C    4  
ATOM 6183  O O    . GLU A 1 22  ? -10.787 -12.636 8.646   1.00 0.00 ? 22  GLU A O    4  
ATOM 6184  C CB   . GLU A 1 22  ? -9.565  -14.370 6.533   1.00 0.00 ? 22  GLU A CB   4  
ATOM 6185  C CG   . GLU A 1 22  ? -9.081  -15.632 5.804   1.00 0.00 ? 22  GLU A CG   4  
ATOM 6186  C CD   . GLU A 1 22  ? -9.606  -15.681 4.358   1.00 0.00 ? 22  GLU A CD   4  
ATOM 6187  O OE1  . GLU A 1 22  ? -9.347  -14.736 3.574   1.00 0.00 ? 22  GLU A OE1  4  
ATOM 6188  O OE2  . GLU A 1 22  ? -10.277 -16.674 3.989   1.00 0.00 ? 22  GLU A OE2  4  
ATOM 6189  H H    . GLU A 1 22  ? -9.088  -16.057 9.316   1.00 0.00 ? 22  GLU A H    4  
ATOM 6190  H HA   . GLU A 1 22  ? -8.108  -14.427 8.090   1.00 0.00 ? 22  GLU A HA   4  
ATOM 6191  H HB2  . GLU A 1 22  ? -10.641 -14.275 6.401   1.00 0.00 ? 22  GLU A HB2  4  
ATOM 6192  H HB3  . GLU A 1 22  ? -9.097  -13.502 6.069   1.00 0.00 ? 22  GLU A HB3  4  
ATOM 6193  H HG2  . GLU A 1 22  ? -7.991  -15.645 5.801   1.00 0.00 ? 22  GLU A HG2  4  
ATOM 6194  H HG3  . GLU A 1 22  ? -9.433  -16.519 6.336   1.00 0.00 ? 22  GLU A HG3  4  
ATOM 6195  N N    . HIS A 1 23  ? -8.693  -12.370 9.394   1.00 0.00 ? 23  HIS A N    4  
ATOM 6196  C CA   . HIS A 1 23  ? -9.004  -11.232 10.270  1.00 0.00 ? 23  HIS A CA   4  
ATOM 6197  C C    . HIS A 1 23  ? -8.709  -9.859  9.636   1.00 0.00 ? 23  HIS A C    4  
ATOM 6198  O O    . HIS A 1 23  ? -7.760  -9.702  8.864   1.00 0.00 ? 23  HIS A O    4  
ATOM 6199  C CB   . HIS A 1 23  ? -8.183  -11.355 11.567  1.00 0.00 ? 23  HIS A CB   4  
ATOM 6200  C CG   . HIS A 1 23  ? -8.572  -12.500 12.470  1.00 0.00 ? 23  HIS A CG   4  
ATOM 6201  N ND1  . HIS A 1 23  ? -9.176  -12.391 13.703  1.00 0.00 ? 23  HIS A ND1  4  
ATOM 6202  C CD2  . HIS A 1 23  ? -8.307  -13.829 12.269  1.00 0.00 ? 23  HIS A CD2  4  
ATOM 6203  C CE1  . HIS A 1 23  ? -9.239  -13.622 14.241  1.00 0.00 ? 23  HIS A CE1  4  
ATOM 6204  N NE2  . HIS A 1 23  ? -8.729  -14.539 13.400  1.00 0.00 ? 23  HIS A NE2  4  
ATOM 6205  H H    . HIS A 1 23  ? -7.713  -12.630 9.294   1.00 0.00 ? 23  HIS A H    4  
ATOM 6206  H HA   . HIS A 1 23  ? -10.062 -11.252 10.539  1.00 0.00 ? 23  HIS A HA   4  
ATOM 6207  H HB2  . HIS A 1 23  ? -7.125  -11.450 11.313  1.00 0.00 ? 23  HIS A HB2  4  
ATOM 6208  H HB3  . HIS A 1 23  ? -8.293  -10.431 12.140  1.00 0.00 ? 23  HIS A HB3  4  
ATOM 6209  H HD1  . HIS A 1 23  ? -9.541  -11.541 14.123  1.00 0.00 ? 23  HIS A HD1  4  
ATOM 6210  H HD2  . HIS A 1 23  ? -7.814  -14.252 11.403  1.00 0.00 ? 23  HIS A HD2  4  
ATOM 6211  H HE1  . HIS A 1 23  ? -9.654  -13.844 15.216  1.00 0.00 ? 23  HIS A HE1  4  
ATOM 6212  N N    . TRP A 1 24  ? -9.493  -8.849  10.032  1.00 0.00 ? 24  TRP A N    4  
ATOM 6213  C CA   . TRP A 1 24  ? -9.227  -7.439  9.736   1.00 0.00 ? 24  TRP A CA   4  
ATOM 6214  C C    . TRP A 1 24  ? -8.469  -6.804  10.912  1.00 0.00 ? 24  TRP A C    4  
ATOM 6215  O O    . TRP A 1 24  ? -8.851  -6.994  12.070  1.00 0.00 ? 24  TRP A O    4  
ATOM 6216  C CB   . TRP A 1 24  ? -10.545 -6.677  9.524   1.00 0.00 ? 24  TRP A CB   4  
ATOM 6217  C CG   . TRP A 1 24  ? -11.098 -6.639  8.130   1.00 0.00 ? 24  TRP A CG   4  
ATOM 6218  C CD1  . TRP A 1 24  ? -12.355 -6.979  7.773   1.00 0.00 ? 24  TRP A CD1  4  
ATOM 6219  C CD2  . TRP A 1 24  ? -10.476 -6.125  6.913   1.00 0.00 ? 24  TRP A CD2  4  
ATOM 6220  N NE1  . TRP A 1 24  ? -12.539 -6.762  6.425   1.00 0.00 ? 24  TRP A NE1  4  
ATOM 6221  C CE2  . TRP A 1 24  ? -11.415 -6.225  5.842   1.00 0.00 ? 24  TRP A CE2  4  
ATOM 6222  C CE3  . TRP A 1 24  ? -9.230  -5.531  6.617   1.00 0.00 ? 24  TRP A CE3  4  
ATOM 6223  C CZ2  . TRP A 1 24  ? -11.120 -5.790  4.541   1.00 0.00 ? 24  TRP A CZ2  4  
ATOM 6224  C CZ3  . TRP A 1 24  ? -8.921  -5.095  5.317   1.00 0.00 ? 24  TRP A CZ3  4  
ATOM 6225  C CH2  . TRP A 1 24  ? -9.860  -5.229  4.278   1.00 0.00 ? 24  TRP A CH2  4  
ATOM 6226  H H    . TRP A 1 24  ? -10.261 -9.043  10.657  1.00 0.00 ? 24  TRP A H    4  
ATOM 6227  H HA   . TRP A 1 24  ? -8.618  -7.354  8.836   1.00 0.00 ? 24  TRP A HA   4  
ATOM 6228  H HB2  . TRP A 1 24  ? -11.305 -7.054  10.212  1.00 0.00 ? 24  TRP A HB2  4  
ATOM 6229  H HB3  . TRP A 1 24  ? -10.363 -5.641  9.804   1.00 0.00 ? 24  TRP A HB3  4  
ATOM 6230  H HD1  . TRP A 1 24  ? -13.109 -7.338  8.453   1.00 0.00 ? 24  TRP A HD1  4  
ATOM 6231  H HE1  . TRP A 1 24  ? -13.409 -6.958  5.947   1.00 0.00 ? 24  TRP A HE1  4  
ATOM 6232  H HE3  . TRP A 1 24  ? -8.515  -5.395  7.411   1.00 0.00 ? 24  TRP A HE3  4  
ATOM 6233  H HZ2  . TRP A 1 24  ? -11.858 -5.884  3.756   1.00 0.00 ? 24  TRP A HZ2  4  
ATOM 6234  H HZ3  . TRP A 1 24  ? -7.955  -4.651  5.123   1.00 0.00 ? 24  TRP A HZ3  4  
ATOM 6235  H HH2  . TRP A 1 24  ? -9.620  -4.889  3.284   1.00 0.00 ? 24  TRP A HH2  4  
ATOM 6236  N N    . ALA A 1 25  ? -7.447  -5.997  10.618  1.00 0.00 ? 25  ALA A N    4  
ATOM 6237  C CA   . ALA A 1 25  ? -6.736  -5.179  11.601  1.00 0.00 ? 25  ALA A CA   4  
ATOM 6238  C C    . ALA A 1 25  ? -6.479  -3.748  11.100  1.00 0.00 ? 25  ALA A C    4  
ATOM 6239  O O    . ALA A 1 25  ? -6.476  -3.495  9.898   1.00 0.00 ? 25  ALA A O    4  
ATOM 6240  C CB   . ALA A 1 25  ? -5.427  -5.889  11.975  1.00 0.00 ? 25  ALA A CB   4  
ATOM 6241  H H    . ALA A 1 25  ? -7.145  -5.940  9.649   1.00 0.00 ? 25  ALA A H    4  
ATOM 6242  H HA   . ALA A 1 25  ? -7.352  -5.094  12.497  1.00 0.00 ? 25  ALA A HA   4  
ATOM 6243  H HB1  . ALA A 1 25  ? -4.917  -5.345  12.773  1.00 0.00 ? 25  ALA A HB1  4  
ATOM 6244  H HB2  . ALA A 1 25  ? -5.641  -6.903  12.319  1.00 0.00 ? 25  ALA A HB2  4  
ATOM 6245  H HB3  . ALA A 1 25  ? -4.776  -5.938  11.103  1.00 0.00 ? 25  ALA A HB3  4  
ATOM 6246  N N    . LEU A 1 26  ? -6.243  -2.824  12.033  1.00 0.00 ? 26  LEU A N    4  
ATOM 6247  C CA   . LEU A 1 26  ? -5.950  -1.402  11.825  1.00 0.00 ? 26  LEU A CA   4  
ATOM 6248  C C    . LEU A 1 26  ? -4.677  -1.068  12.606  1.00 0.00 ? 26  LEU A C    4  
ATOM 6249  O O    . LEU A 1 26  ? -4.648  -1.238  13.826  1.00 0.00 ? 26  LEU A O    4  
ATOM 6250  C CB   . LEU A 1 26  ? -7.160  -0.615  12.374  1.00 0.00 ? 26  LEU A CB   4  
ATOM 6251  C CG   . LEU A 1 26  ? -7.305  0.884   12.024  1.00 0.00 ? 26  LEU A CG   4  
ATOM 6252  C CD1  . LEU A 1 26  ? -6.066  1.752   12.282  1.00 0.00 ? 26  LEU A CD1  4  
ATOM 6253  C CD2  . LEU A 1 26  ? -7.748  1.050   10.563  1.00 0.00 ? 26  LEU A CD2  4  
ATOM 6254  H H    . LEU A 1 26  ? -6.325  -3.126  13.001  1.00 0.00 ? 26  LEU A H    4  
ATOM 6255  H HA   . LEU A 1 26  ? -5.814  -1.189  10.764  1.00 0.00 ? 26  LEU A HA   4  
ATOM 6256  H HB2  . LEU A 1 26  ? -8.063  -1.118  12.024  1.00 0.00 ? 26  LEU A HB2  4  
ATOM 6257  H HB3  . LEU A 1 26  ? -7.166  -0.702  13.462  1.00 0.00 ? 26  LEU A HB3  4  
ATOM 6258  H HG   . LEU A 1 26  ? -8.093  1.271   12.673  1.00 0.00 ? 26  LEU A HG   4  
ATOM 6259  H HD11 . LEU A 1 26  ? -5.294  1.547   11.540  1.00 0.00 ? 26  LEU A HD11 4  
ATOM 6260  H HD12 . LEU A 1 26  ? -6.347  2.804   12.212  1.00 0.00 ? 26  LEU A HD12 4  
ATOM 6261  H HD13 . LEU A 1 26  ? -5.676  1.562   13.281  1.00 0.00 ? 26  LEU A HD13 4  
ATOM 6262  H HD21 . LEU A 1 26  ? -8.654  0.471   10.378  1.00 0.00 ? 26  LEU A HD21 4  
ATOM 6263  H HD22 . LEU A 1 26  ? -7.953  2.099   10.348  1.00 0.00 ? 26  LEU A HD22 4  
ATOM 6264  H HD23 . LEU A 1 26  ? -6.961  0.703   9.894   1.00 0.00 ? 26  LEU A HD23 4  
ATOM 6265  N N    . TYR A 1 27  ? -3.633  -0.577  11.942  1.00 0.00 ? 27  TYR A N    4  
ATOM 6266  C CA   . TYR A 1 27  ? -2.398  -0.143  12.605  1.00 0.00 ? 27  TYR A CA   4  
ATOM 6267  C C    . TYR A 1 27  ? -2.595  1.241   13.244  1.00 0.00 ? 27  TYR A C    4  
ATOM 6268  O O    . TYR A 1 27  ? -2.500  2.271   12.577  1.00 0.00 ? 27  TYR A O    4  
ATOM 6269  C CB   . TYR A 1 27  ? -1.256  -0.169  11.580  1.00 0.00 ? 27  TYR A CB   4  
ATOM 6270  C CG   . TYR A 1 27  ? 0.153   -0.005  12.119  1.00 0.00 ? 27  TYR A CG   4  
ATOM 6271  C CD1  . TYR A 1 27  ? 0.715   -0.995  12.947  1.00 0.00 ? 27  TYR A CD1  4  
ATOM 6272  C CD2  . TYR A 1 27  ? 0.945   1.076   11.692  1.00 0.00 ? 27  TYR A CD2  4  
ATOM 6273  C CE1  . TYR A 1 27  ? 2.077   -0.932  13.299  1.00 0.00 ? 27  TYR A CE1  4  
ATOM 6274  C CE2  . TYR A 1 27  ? 2.306   1.147   12.036  1.00 0.00 ? 27  TYR A CE2  4  
ATOM 6275  C CZ   . TYR A 1 27  ? 2.883   0.121   12.816  1.00 0.00 ? 27  TYR A CZ   4  
ATOM 6276  O OH   . TYR A 1 27  ? 4.222   0.123   13.060  1.00 0.00 ? 27  TYR A OH   4  
ATOM 6277  H H    . TYR A 1 27  ? -3.725  -0.406  10.946  1.00 0.00 ? 27  TYR A H    4  
ATOM 6278  H HA   . TYR A 1 27  ? -2.152  -0.852  13.396  1.00 0.00 ? 27  TYR A HA   4  
ATOM 6279  H HB2  . TYR A 1 27  ? -1.279  -1.132  11.075  1.00 0.00 ? 27  TYR A HB2  4  
ATOM 6280  H HB3  . TYR A 1 27  ? -1.436  0.595   10.823  1.00 0.00 ? 27  TYR A HB3  4  
ATOM 6281  H HD1  . TYR A 1 27  ? 0.117   -1.832  13.275  1.00 0.00 ? 27  TYR A HD1  4  
ATOM 6282  H HD2  . TYR A 1 27  ? 0.522   1.821   11.041  1.00 0.00 ? 27  TYR A HD2  4  
ATOM 6283  H HE1  . TYR A 1 27  ? 2.520   -1.715  13.895  1.00 0.00 ? 27  TYR A HE1  4  
ATOM 6284  H HE2  . TYR A 1 27  ? 2.920   1.955   11.659  1.00 0.00 ? 27  TYR A HE2  4  
ATOM 6285  H HH   . TYR A 1 27  ? 4.671   0.868   12.648  1.00 0.00 ? 27  TYR A HH   4  
ATOM 6286  N N    . ILE A 1 28  ? -2.881  1.289   14.550  1.00 0.00 ? 28  ILE A N    4  
ATOM 6287  C CA   . ILE A 1 28  ? -3.158  2.552   15.277  1.00 0.00 ? 28  ILE A CA   4  
ATOM 6288  C C    . ILE A 1 28  ? -1.917  3.419   15.537  1.00 0.00 ? 28  ILE A C    4  
ATOM 6289  O O    . ILE A 1 28  ? -2.050  4.534   16.043  1.00 0.00 ? 28  ILE A O    4  
ATOM 6290  C CB   . ILE A 1 28  ? -3.980  2.322   16.565  1.00 0.00 ? 28  ILE A CB   4  
ATOM 6291  C CG1  . ILE A 1 28  ? -3.401  1.215   17.469  1.00 0.00 ? 28  ILE A CG1  4  
ATOM 6292  C CG2  . ILE A 1 28  ? -5.442  2.060   16.171  1.00 0.00 ? 28  ILE A CG2  4  
ATOM 6293  C CD1  . ILE A 1 28  ? -3.898  1.305   18.917  1.00 0.00 ? 28  ILE A CD1  4  
ATOM 6294  H H    . ILE A 1 28  ? -2.928  0.406   15.047  1.00 0.00 ? 28  ILE A H    4  
ATOM 6295  H HA   . ILE A 1 28  ? -3.764  3.177   14.618  1.00 0.00 ? 28  ILE A HA   4  
ATOM 6296  H HB   . ILE A 1 28  ? -3.976  3.252   17.136  1.00 0.00 ? 28  ILE A HB   4  
ATOM 6297  H HG12 . ILE A 1 28  ? -3.661  0.235   17.068  1.00 0.00 ? 28  ILE A HG12 4  
ATOM 6298  H HG13 . ILE A 1 28  ? -2.317  1.308   17.485  1.00 0.00 ? 28  ILE A HG13 4  
ATOM 6299  H HG21 . ILE A 1 28  ? -6.067  2.065   17.060  1.00 0.00 ? 28  ILE A HG21 4  
ATOM 6300  H HG22 . ILE A 1 28  ? -5.802  2.853   15.511  1.00 0.00 ? 28  ILE A HG22 4  
ATOM 6301  H HG23 . ILE A 1 28  ? -5.534  1.102   15.659  1.00 0.00 ? 28  ILE A HG23 4  
ATOM 6302  H HD11 . ILE A 1 28  ? -3.482  2.194   19.390  1.00 0.00 ? 28  ILE A HD11 4  
ATOM 6303  H HD12 . ILE A 1 28  ? -4.984  1.355   18.953  1.00 0.00 ? 28  ILE A HD12 4  
ATOM 6304  H HD13 . ILE A 1 28  ? -3.570  0.426   19.471  1.00 0.00 ? 28  ILE A HD13 4  
ATOM 6305  N N    . GLY A 1 29  ? -0.730  2.938   15.163  1.00 0.00 ? 29  GLY A N    4  
ATOM 6306  C CA   . GLY A 1 29  ? 0.508   3.715   15.137  1.00 0.00 ? 29  GLY A CA   4  
ATOM 6307  C C    . GLY A 1 29  ? 1.686   3.038   15.820  1.00 0.00 ? 29  GLY A C    4  
ATOM 6308  O O    . GLY A 1 29  ? 1.554   2.448   16.894  1.00 0.00 ? 29  GLY A O    4  
ATOM 6309  H H    . GLY A 1 29  ? -0.697  1.993   14.810  1.00 0.00 ? 29  GLY A H    4  
ATOM 6310  H HA2  . GLY A 1 29  ? 0.770   3.874   14.094  1.00 0.00 ? 29  GLY A HA2  4  
ATOM 6311  H HA3  . GLY A 1 29  ? 0.372   4.695   15.595  1.00 0.00 ? 29  GLY A HA3  4  
ATOM 6312  N N    . ASP A 1 30  ? 2.833   3.142   15.142  1.00 0.00 ? 30  ASP A N    4  
ATOM 6313  C CA   . ASP A 1 30  ? 4.208   2.817   15.555  1.00 0.00 ? 30  ASP A CA   4  
ATOM 6314  C C    . ASP A 1 30  ? 4.519   1.344   15.914  1.00 0.00 ? 30  ASP A C    4  
ATOM 6315  O O    . ASP A 1 30  ? 5.683   0.934   15.882  1.00 0.00 ? 30  ASP A O    4  
ATOM 6316  C CB   . ASP A 1 30  ? 4.618   3.765   16.696  1.00 0.00 ? 30  ASP A CB   4  
ATOM 6317  C CG   . ASP A 1 30  ? 6.128   3.735   16.988  1.00 0.00 ? 30  ASP A CG   4  
ATOM 6318  O OD1  . ASP A 1 30  ? 6.919   4.167   16.114  1.00 0.00 ? 30  ASP A OD1  4  
ATOM 6319  O OD2  . ASP A 1 30  ? 6.518   3.320   18.105  1.00 0.00 ? 30  ASP A OD2  4  
ATOM 6320  H H    . ASP A 1 30  ? 2.768   3.626   14.258  1.00 0.00 ? 30  ASP A H    4  
ATOM 6321  H HA   . ASP A 1 30  ? 4.805   3.054   14.673  1.00 0.00 ? 30  ASP A HA   4  
ATOM 6322  H HB2  . ASP A 1 30  ? 4.340   4.787   16.424  1.00 0.00 ? 30  ASP A HB2  4  
ATOM 6323  H HB3  . ASP A 1 30  ? 4.063   3.500   17.599  1.00 0.00 ? 30  ASP A HB3  4  
ATOM 6324  N N    . GLY A 1 31  ? 3.500   0.544   16.238  1.00 0.00 ? 31  GLY A N    4  
ATOM 6325  C CA   . GLY A 1 31  ? 3.614   -0.881  16.561  1.00 0.00 ? 31  GLY A CA   4  
ATOM 6326  C C    . GLY A 1 31  ? 2.313   -1.554  16.995  1.00 0.00 ? 31  GLY A C    4  
ATOM 6327  O O    . GLY A 1 31  ? 2.220   -2.777  16.922  1.00 0.00 ? 31  GLY A O    4  
ATOM 6328  H H    . GLY A 1 31  ? 2.585   0.972   16.254  1.00 0.00 ? 31  GLY A H    4  
ATOM 6329  H HA2  . GLY A 1 31  ? 4.008   -1.413  15.694  1.00 0.00 ? 31  GLY A HA2  4  
ATOM 6330  H HA3  . GLY A 1 31  ? 4.342   -1.002  17.362  1.00 0.00 ? 31  GLY A HA3  4  
ATOM 6331  N N    . TYR A 1 32  ? 1.303   -0.797  17.436  1.00 0.00 ? 32  TYR A N    4  
ATOM 6332  C CA   . TYR A 1 32  ? 0.039   -1.352  17.943  1.00 0.00 ? 32  TYR A CA   4  
ATOM 6333  C C    . TYR A 1 32  ? -1.029  -1.547  16.848  1.00 0.00 ? 32  TYR A C    4  
ATOM 6334  O O    . TYR A 1 32  ? -1.123  -0.759  15.904  1.00 0.00 ? 32  TYR A O    4  
ATOM 6335  C CB   . TYR A 1 32  ? -0.487  -0.460  19.076  1.00 0.00 ? 32  TYR A CB   4  
ATOM 6336  C CG   . TYR A 1 32  ? 0.342   -0.535  20.343  1.00 0.00 ? 32  TYR A CG   4  
ATOM 6337  C CD1  . TYR A 1 32  ? 0.105   -1.563  21.276  1.00 0.00 ? 32  TYR A CD1  4  
ATOM 6338  C CD2  . TYR A 1 32  ? 1.355   0.413   20.584  1.00 0.00 ? 32  TYR A CD2  4  
ATOM 6339  C CE1  . TYR A 1 32  ? 0.873   -1.640  22.455  1.00 0.00 ? 32  TYR A CE1  4  
ATOM 6340  C CE2  . TYR A 1 32  ? 2.131   0.340   21.757  1.00 0.00 ? 32  TYR A CE2  4  
ATOM 6341  C CZ   . TYR A 1 32  ? 1.893   -0.691  22.696  1.00 0.00 ? 32  TYR A CZ   4  
ATOM 6342  O OH   . TYR A 1 32  ? 2.654   -0.777  23.823  1.00 0.00 ? 32  TYR A OH   4  
ATOM 6343  H H    . TYR A 1 32  ? 1.421   0.209   17.461  1.00 0.00 ? 32  TYR A H    4  
ATOM 6344  H HA   . TYR A 1 32  ? 0.243   -2.330  18.380  1.00 0.00 ? 32  TYR A HA   4  
ATOM 6345  H HB2  . TYR A 1 32  ? -0.529  0.573   18.731  1.00 0.00 ? 32  TYR A HB2  4  
ATOM 6346  H HB3  . TYR A 1 32  ? -1.502  -0.767  19.322  1.00 0.00 ? 32  TYR A HB3  4  
ATOM 6347  H HD1  . TYR A 1 32  ? -0.664  -2.301  21.086  1.00 0.00 ? 32  TYR A HD1  4  
ATOM 6348  H HD2  . TYR A 1 32  ? 1.543   1.198   19.861  1.00 0.00 ? 32  TYR A HD2  4  
ATOM 6349  H HE1  . TYR A 1 32  ? 0.684   -2.426  23.173  1.00 0.00 ? 32  TYR A HE1  4  
ATOM 6350  H HE2  . TYR A 1 32  ? 2.913   1.065   21.933  1.00 0.00 ? 32  TYR A HE2  4  
ATOM 6351  H HH   . TYR A 1 32  ? 3.288   -0.050  23.888  1.00 0.00 ? 32  TYR A HH   4  
ATOM 6352  N N    . VAL A 1 33  ? -1.873  -2.573  17.010  1.00 0.00 ? 33  VAL A N    4  
ATOM 6353  C CA   . VAL A 1 33  ? -3.007  -2.891  16.120  1.00 0.00 ? 33  VAL A CA   4  
ATOM 6354  C C    . VAL A 1 33  ? -4.317  -3.050  16.891  1.00 0.00 ? 33  VAL A C    4  
ATOM 6355  O O    . VAL A 1 33  ? -4.327  -3.555  18.010  1.00 0.00 ? 33  VAL A O    4  
ATOM 6356  C CB   . VAL A 1 33  ? -2.781  -4.170  15.271  1.00 0.00 ? 33  VAL A CB   4  
ATOM 6357  C CG1  . VAL A 1 33  ? -1.643  -3.969  14.262  1.00 0.00 ? 33  VAL A CG1  4  
ATOM 6358  C CG2  . VAL A 1 33  ? -2.511  -5.455  16.080  1.00 0.00 ? 33  VAL A CG2  4  
ATOM 6359  H H    . VAL A 1 33  ? -1.751  -3.156  17.843  1.00 0.00 ? 33  VAL A H    4  
ATOM 6360  H HA   . VAL A 1 33  ? -3.131  -2.054  15.438  1.00 0.00 ? 33  VAL A HA   4  
ATOM 6361  H HB   . VAL A 1 33  ? -3.687  -4.341  14.691  1.00 0.00 ? 33  VAL A HB   4  
ATOM 6362  H HG11 . VAL A 1 33  ? -1.543  -4.860  13.645  1.00 0.00 ? 33  VAL A HG11 4  
ATOM 6363  H HG12 . VAL A 1 33  ? -1.872  -3.122  13.615  1.00 0.00 ? 33  VAL A HG12 4  
ATOM 6364  H HG13 . VAL A 1 33  ? -0.701  -3.786  14.780  1.00 0.00 ? 33  VAL A HG13 4  
ATOM 6365  H HG21 . VAL A 1 33  ? -3.301  -5.644  16.809  1.00 0.00 ? 33  VAL A HG21 4  
ATOM 6366  H HG22 . VAL A 1 33  ? -2.478  -6.309  15.403  1.00 0.00 ? 33  VAL A HG22 4  
ATOM 6367  H HG23 . VAL A 1 33  ? -1.555  -5.392  16.598  1.00 0.00 ? 33  VAL A HG23 4  
ATOM 6368  N N    . ILE A 1 34  ? -5.423  -2.652  16.260  1.00 0.00 ? 34  ILE A N    4  
ATOM 6369  C CA   . ILE A 1 34  ? -6.806  -2.919  16.703  1.00 0.00 ? 34  ILE A CA   4  
ATOM 6370  C C    . ILE A 1 34  ? -7.414  -3.892  15.689  1.00 0.00 ? 34  ILE A C    4  
ATOM 6371  O O    . ILE A 1 34  ? -7.167  -3.755  14.496  1.00 0.00 ? 34  ILE A O    4  
ATOM 6372  C CB   . ILE A 1 34  ? -7.623  -1.606  16.779  1.00 0.00 ? 34  ILE A CB   4  
ATOM 6373  C CG1  . ILE A 1 34  ? -7.002  -0.571  17.740  1.00 0.00 ? 34  ILE A CG1  4  
ATOM 6374  C CG2  . ILE A 1 34  ? -9.094  -1.867  17.162  1.00 0.00 ? 34  ILE A CG2  4  
ATOM 6375  C CD1  . ILE A 1 34  ? -6.926  -0.959  19.220  1.00 0.00 ? 34  ILE A CD1  4  
ATOM 6376  H H    . ILE A 1 34  ? -5.305  -2.232  15.336  1.00 0.00 ? 34  ILE A H    4  
ATOM 6377  H HA   . ILE A 1 34  ? -6.806  -3.396  17.684  1.00 0.00 ? 34  ILE A HA   4  
ATOM 6378  H HB   . ILE A 1 34  ? -7.619  -1.155  15.785  1.00 0.00 ? 34  ILE A HB   4  
ATOM 6379  H HG12 . ILE A 1 34  ? -5.990  -0.364  17.405  1.00 0.00 ? 34  ILE A HG12 4  
ATOM 6380  H HG13 . ILE A 1 34  ? -7.572  0.352   17.662  1.00 0.00 ? 34  ILE A HG13 4  
ATOM 6381  H HG21 . ILE A 1 34  ? -9.153  -2.465  18.071  1.00 0.00 ? 34  ILE A HG21 4  
ATOM 6382  H HG22 . ILE A 1 34  ? -9.616  -0.923  17.323  1.00 0.00 ? 34  ILE A HG22 4  
ATOM 6383  H HG23 . ILE A 1 34  ? -9.602  -2.400  16.355  1.00 0.00 ? 34  ILE A HG23 4  
ATOM 6384  H HD11 . ILE A 1 34  ? -6.238  -1.791  19.351  1.00 0.00 ? 34  ILE A HD11 4  
ATOM 6385  H HD12 . ILE A 1 34  ? -6.579  -0.102  19.803  1.00 0.00 ? 34  ILE A HD12 4  
ATOM 6386  H HD13 . ILE A 1 34  ? -7.905  -1.236  19.590  1.00 0.00 ? 34  ILE A HD13 4  
ATOM 6387  N N    . HIS A 1 35  ? -8.187  -4.883  16.121  1.00 0.00 ? 35  HIS A N    4  
ATOM 6388  C CA   . HIS A 1 35  ? -8.634  -5.988  15.258  1.00 0.00 ? 35  HIS A CA   4  
ATOM 6389  C C    . HIS A 1 35  ? -9.897  -6.672  15.808  1.00 0.00 ? 35  HIS A C    4  
ATOM 6390  O O    . HIS A 1 35  ? -10.174 -6.580  17.002  1.00 0.00 ? 35  HIS A O    4  
ATOM 6391  C CB   . HIS A 1 35  ? -7.474  -6.993  15.106  1.00 0.00 ? 35  HIS A CB   4  
ATOM 6392  C CG   . HIS A 1 35  ? -6.973  -7.531  16.425  1.00 0.00 ? 35  HIS A CG   4  
ATOM 6393  N ND1  . HIS A 1 35  ? -7.316  -8.731  17.005  1.00 0.00 ? 35  HIS A ND1  4  
ATOM 6394  C CD2  . HIS A 1 35  ? -6.150  -6.880  17.304  1.00 0.00 ? 35  HIS A CD2  4  
ATOM 6395  C CE1  . HIS A 1 35  ? -6.720  -8.795  18.207  1.00 0.00 ? 35  HIS A CE1  4  
ATOM 6396  N NE2  . HIS A 1 35  ? -6.011  -7.677  18.442  1.00 0.00 ? 35  HIS A NE2  4  
ATOM 6397  H H    . HIS A 1 35  ? -8.378  -4.969  17.118  1.00 0.00 ? 35  HIS A H    4  
ATOM 6398  H HA   . HIS A 1 35  ? -8.888  -5.594  14.271  1.00 0.00 ? 35  HIS A HA   4  
ATOM 6399  H HB2  . HIS A 1 35  ? -7.790  -7.829  14.479  1.00 0.00 ? 35  HIS A HB2  4  
ATOM 6400  H HB3  . HIS A 1 35  ? -6.642  -6.503  14.598  1.00 0.00 ? 35  HIS A HB3  4  
ATOM 6401  H HD1  . HIS A 1 35  ? -7.911  -9.445  16.611  1.00 0.00 ? 35  HIS A HD1  4  
ATOM 6402  H HD2  . HIS A 1 35  ? -5.725  -5.897  17.159  1.00 0.00 ? 35  HIS A HD2  4  
ATOM 6403  H HE1  . HIS A 1 35  ? -6.816  -9.625  18.897  1.00 0.00 ? 35  HIS A HE1  4  
ATOM 6404  N N    . LEU A 1 36  ? -10.651 -7.377  14.953  1.00 0.00 ? 36  LEU A N    4  
ATOM 6405  C CA   . LEU A 1 36  ? -11.856 -8.112  15.360  1.00 0.00 ? 36  LEU A CA   4  
ATOM 6406  C C    . LEU A 1 36  ? -11.553 -9.604  15.560  1.00 0.00 ? 36  LEU A C    4  
ATOM 6407  O O    . LEU A 1 36  ? -10.889 -10.236 14.735  1.00 0.00 ? 36  LEU A O    4  
ATOM 6408  C CB   . LEU A 1 36  ? -12.962 -7.892  14.305  1.00 0.00 ? 36  LEU A CB   4  
ATOM 6409  C CG   . LEU A 1 36  ? -14.382 -8.282  14.772  1.00 0.00 ? 36  LEU A CG   4  
ATOM 6410  C CD1  . LEU A 1 36  ? -14.957 -7.247  15.746  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 6411  C CD2  . LEU A 1 36  ? -15.332 -8.379  13.572  1.00 0.00 ? 36  LEU A CD2  4  
ATOM 6412  H H    . LEU A 1 36  ? -10.372 -7.432  13.982  1.00 0.00 ? 36  LEU A H    4  
ATOM 6413  H HA   . LEU A 1 36  ? -12.199 -7.712  16.314  1.00 0.00 ? 36  LEU A HA   4  
ATOM 6414  H HB2  . LEU A 1 36  ? -12.978 -6.838  14.032  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 6415  H HB3  . LEU A 1 36  ? -12.704 -8.460  13.407  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 6416  H HG   . LEU A 1 36  ? -14.351 -9.255  15.260  1.00 0.00 ? 36  LEU A HG   4  
ATOM 6417  H HD11 . LEU A 1 36  ? -15.059 -6.284  15.243  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 6418  H HD12 . LEU A 1 36  ? -15.937 -7.568  16.104  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 6419  H HD13 . LEU A 1 36  ? -14.300 -7.128  16.601  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 6420  H HD21 . LEU A 1 36  ? -15.367 -7.426  13.050  1.00 0.00 ? 36  LEU A HD21 4  
ATOM 6421  H HD22 . LEU A 1 36  ? -14.990 -9.156  12.892  1.00 0.00 ? 36  LEU A HD22 4  
ATOM 6422  H HD23 . LEU A 1 36  ? -16.336 -8.636  13.909  1.00 0.00 ? 36  LEU A HD23 4  
ATOM 6423  N N    . ALA A 1 37  ? -12.080 -10.173 16.642  1.00 0.00 ? 37  ALA A N    4  
ATOM 6424  C CA   . ALA A 1 37  ? -12.106 -11.609 16.918  1.00 0.00 ? 37  ALA A CA   4  
ATOM 6425  C C    . ALA A 1 37  ? -13.522 -12.170 16.632  1.00 0.00 ? 37  ALA A C    4  
ATOM 6426  O O    . ALA A 1 37  ? -14.507 -11.484 16.938  1.00 0.00 ? 37  ALA A O    4  
ATOM 6427  C CB   . ALA A 1 37  ? -11.690 -11.824 18.378  1.00 0.00 ? 37  ALA A CB   4  
ATOM 6428  H H    . ALA A 1 37  ? -12.564 -9.569  17.302  1.00 0.00 ? 37  ALA A H    4  
ATOM 6429  H HA   . ALA A 1 37  ? -11.378 -12.108 16.275  1.00 0.00 ? 37  ALA A HA   4  
ATOM 6430  H HB1  . ALA A 1 37  ? -11.708 -12.888 18.619  1.00 0.00 ? 37  ALA A HB1  4  
ATOM 6431  H HB2  . ALA A 1 37  ? -10.677 -11.445 18.529  1.00 0.00 ? 37  ALA A HB2  4  
ATOM 6432  H HB3  . ALA A 1 37  ? -12.372 -11.295 19.048  1.00 0.00 ? 37  ALA A HB3  4  
ATOM 6433  N N    . PRO A 1 38  ? -13.650 -13.384 16.056  1.00 0.00 ? 38  PRO A N    4  
ATOM 6434  C CA   . PRO A 1 38  ? -14.933 -13.955 15.645  1.00 0.00 ? 38  PRO A CA   4  
ATOM 6435  C C    . PRO A 1 38  ? -15.786 -14.416 16.847  1.00 0.00 ? 38  PRO A C    4  
ATOM 6436  O O    . PRO A 1 38  ? -15.253 -14.579 17.948  1.00 0.00 ? 38  PRO A O    4  
ATOM 6437  C CB   . PRO A 1 38  ? -14.581 -15.135 14.729  1.00 0.00 ? 38  PRO A CB   4  
ATOM 6438  C CG   . PRO A 1 38  ? -13.220 -15.592 15.249  1.00 0.00 ? 38  PRO A CG   4  
ATOM 6439  C CD   . PRO A 1 38  ? -12.563 -14.275 15.662  1.00 0.00 ? 38  PRO A CD   4  
ATOM 6440  H HA   . PRO A 1 38  ? -15.480 -13.204 15.075  1.00 0.00 ? 38  PRO A HA   4  
ATOM 6441  H HB2  . PRO A 1 38  ? -15.316 -15.937 14.767  1.00 0.00 ? 38  PRO A HB2  4  
ATOM 6442  H HB3  . PRO A 1 38  ? -14.474 -14.776 13.708  1.00 0.00 ? 38  PRO A HB3  4  
ATOM 6443  H HG2  . PRO A 1 38  ? -13.355 -16.227 16.126  1.00 0.00 ? 38  PRO A HG2  4  
ATOM 6444  H HG3  . PRO A 1 38  ? -12.641 -16.112 14.484  1.00 0.00 ? 38  PRO A HG3  4  
ATOM 6445  H HD2  . PRO A 1 38  ? -11.868 -14.446 16.486  1.00 0.00 ? 38  PRO A HD2  4  
ATOM 6446  H HD3  . PRO A 1 38  ? -12.043 -13.846 14.805  1.00 0.00 ? 38  PRO A HD3  4  
ATOM 6447  N N    . PRO A 1 39  ? -17.099 -14.676 16.646  1.00 0.00 ? 39  PRO A N    4  
ATOM 6448  C CA   . PRO A 1 39  ? -17.981 -15.209 17.683  1.00 0.00 ? 39  PRO A CA   4  
ATOM 6449  C C    . PRO A 1 39  ? -17.725 -16.673 18.082  1.00 0.00 ? 39  PRO A C    4  
ATOM 6450  O O    . PRO A 1 39  ? -18.415 -17.180 18.964  1.00 0.00 ? 39  PRO A O    4  
ATOM 6451  C CB   . PRO A 1 39  ? -19.410 -15.052 17.154  1.00 0.00 ? 39  PRO A CB   4  
ATOM 6452  C CG   . PRO A 1 39  ? -19.303 -14.196 15.893  1.00 0.00 ? 39  PRO A CG   4  
ATOM 6453  C CD   . PRO A 1 39  ? -17.863 -14.399 15.433  1.00 0.00 ? 39  PRO A CD   4  
ATOM 6454  H HA   . PRO A 1 39  ? -17.866 -14.592 18.573  1.00 0.00 ? 39  PRO A HA   4  
ATOM 6455  H HB2  . PRO A 1 39  ? -19.827 -16.025 16.890  1.00 0.00 ? 39  PRO A HB2  4  
ATOM 6456  H HB3  . PRO A 1 39  ? -20.034 -14.580 17.912  1.00 0.00 ? 39  PRO A HB3  4  
ATOM 6457  H HG2  . PRO A 1 39  ? -20.013 -14.511 15.128  1.00 0.00 ? 39  PRO A HG2  4  
ATOM 6458  H HG3  . PRO A 1 39  ? -19.459 -13.147 16.139  1.00 0.00 ? 39  PRO A HG3  4  
ATOM 6459  H HD2  . PRO A 1 39  ? -17.811 -15.257 14.763  1.00 0.00 ? 39  PRO A HD2  4  
ATOM 6460  H HD3  . PRO A 1 39  ? -17.528 -13.498 14.920  1.00 0.00 ? 39  PRO A HD3  4  
ATOM 6461  N N    . SER A 1 40  ? -16.780 -17.374 17.444  1.00 0.00 ? 40  SER A N    4  
ATOM 6462  C CA   . SER A 1 40  ? -16.422 -18.769 17.753  1.00 0.00 ? 40  SER A CA   4  
ATOM 6463  C C    . SER A 1 40  ? -15.999 -18.950 19.227  1.00 0.00 ? 40  SER A C    4  
ATOM 6464  O O    . SER A 1 40  ? -15.195 -18.169 19.747  1.00 0.00 ? 40  SER A O    4  
ATOM 6465  C CB   . SER A 1 40  ? -15.280 -19.232 16.833  1.00 0.00 ? 40  SER A CB   4  
ATOM 6466  O OG   . SER A 1 40  ? -15.585 -18.992 15.463  1.00 0.00 ? 40  SER A OG   4  
ATOM 6467  H H    . SER A 1 40  ? -16.266 -16.937 16.695  1.00 0.00 ? 40  SER A H    4  
ATOM 6468  H HA   . SER A 1 40  ? -17.289 -19.404 17.558  1.00 0.00 ? 40  SER A HA   4  
ATOM 6469  H HB2  . SER A 1 40  ? -14.367 -18.690 17.094  1.00 0.00 ? 40  SER A HB2  4  
ATOM 6470  H HB3  . SER A 1 40  ? -15.110 -20.298 16.988  1.00 0.00 ? 40  SER A HB3  4  
ATOM 6471  H HG   . SER A 1 40  ? -14.890 -19.390 14.918  1.00 0.00 ? 40  SER A HG   4  
ATOM 6472  N N    . GLU A 1 41  ? -16.535 -19.963 19.920  1.00 0.00 ? 41  GLU A N    4  
ATOM 6473  C CA   . GLU A 1 41  ? -16.319 -20.142 21.361  1.00 0.00 ? 41  GLU A CA   4  
ATOM 6474  C C    . GLU A 1 41  ? -14.914 -20.659 21.696  1.00 0.00 ? 41  GLU A C    4  
ATOM 6475  O O    . GLU A 1 41  ? -14.433 -21.643 21.126  1.00 0.00 ? 41  GLU A O    4  
ATOM 6476  C CB   . GLU A 1 41  ? -17.360 -21.092 21.979  1.00 0.00 ? 41  GLU A CB   4  
ATOM 6477  C CG   . GLU A 1 41  ? -18.785 -20.530 22.001  1.00 0.00 ? 41  GLU A CG   4  
ATOM 6478  C CD   . GLU A 1 41  ? -18.911 -19.204 22.769  1.00 0.00 ? 41  GLU A CD   4  
ATOM 6479  O OE1  . GLU A 1 41  ? -18.143 -18.959 23.728  1.00 0.00 ? 41  GLU A OE1  4  
ATOM 6480  O OE2  . GLU A 1 41  ? -19.794 -18.397 22.403  1.00 0.00 ? 41  GLU A OE2  4  
ATOM 6481  H H    . GLU A 1 41  ? -17.160 -20.608 19.455  1.00 0.00 ? 41  GLU A H    4  
ATOM 6482  H HA   . GLU A 1 41  ? -16.430 -19.170 21.841  1.00 0.00 ? 41  GLU A HA   4  
ATOM 6483  H HB2  . GLU A 1 41  ? -17.360 -22.033 21.424  1.00 0.00 ? 41  GLU A HB2  4  
ATOM 6484  H HB3  . GLU A 1 41  ? -17.070 -21.311 23.007  1.00 0.00 ? 41  GLU A HB3  4  
ATOM 6485  H HG2  . GLU A 1 41  ? -19.122 -20.389 20.972  1.00 0.00 ? 41  GLU A HG2  4  
ATOM 6486  H HG3  . GLU A 1 41  ? -19.442 -21.267 22.468  1.00 0.00 ? 41  GLU A HG3  4  
ATOM 6487  N N    . TYR A 1 42  ? -14.279 -20.013 22.680  1.00 0.00 ? 42  TYR A N    4  
ATOM 6488  C CA   . TYR A 1 42  ? -13.038 -20.482 23.303  1.00 0.00 ? 42  TYR A CA   4  
ATOM 6489  C C    . TYR A 1 42  ? -13.221 -21.758 24.172  1.00 0.00 ? 42  TYR A C    4  
ATOM 6490  O O    . TYR A 1 42  ? -12.462 -22.715 23.967  1.00 0.00 ? 42  TYR A O    4  
ATOM 6491  C CB   . TYR A 1 42  ? -12.369 -19.320 24.058  1.00 0.00 ? 42  TYR A CB   4  
ATOM 6492  C CG   . TYR A 1 42  ? -11.126 -19.720 24.830  1.00 0.00 ? 42  TYR A CG   4  
ATOM 6493  C CD1  . TYR A 1 42  ? -9.911  -19.926 24.148  1.00 0.00 ? 42  TYR A CD1  4  
ATOM 6494  C CD2  . TYR A 1 42  ? -11.186 -19.909 26.227  1.00 0.00 ? 42  TYR A CD2  4  
ATOM 6495  C CE1  . TYR A 1 42  ? -8.761  -20.323 24.854  1.00 0.00 ? 42  TYR A CE1  4  
ATOM 6496  C CE2  . TYR A 1 42  ? -10.037 -20.301 26.939  1.00 0.00 ? 42  TYR A CE2  4  
ATOM 6497  C CZ   . TYR A 1 42  ? -8.819  -20.513 26.253  1.00 0.00 ? 42  TYR A CZ   4  
ATOM 6498  O OH   . TYR A 1 42  ? -7.700  -20.897 26.930  1.00 0.00 ? 42  TYR A OH   4  
ATOM 6499  H H    . TYR A 1 42  ? -14.711 -19.182 23.061  1.00 0.00 ? 42  TYR A H    4  
ATOM 6500  H HA   . TYR A 1 42  ? -12.367 -20.767 22.508  1.00 0.00 ? 42  TYR A HA   4  
ATOM 6501  H HB2  . TYR A 1 42  ? -12.095 -18.554 23.331  1.00 0.00 ? 42  TYR A HB2  4  
ATOM 6502  H HB3  . TYR A 1 42  ? -13.081 -18.862 24.739  1.00 0.00 ? 42  TYR A HB3  4  
ATOM 6503  H HD1  . TYR A 1 42  ? -9.864  -19.788 23.075  1.00 0.00 ? 42  TYR A HD1  4  
ATOM 6504  H HD2  . TYR A 1 42  ? -12.115 -19.752 26.757  1.00 0.00 ? 42  TYR A HD2  4  
ATOM 6505  H HE1  . TYR A 1 42  ? -7.829  -20.488 24.330  1.00 0.00 ? 42  TYR A HE1  4  
ATOM 6506  H HE2  . TYR A 1 42  ? -10.089 -20.438 28.012  1.00 0.00 ? 42  TYR A HE2  4  
ATOM 6507  H HH   . TYR A 1 42  ? -7.857  -21.000 27.875  1.00 0.00 ? 42  TYR A HH   4  
ATOM 6508  N N    . PRO A 1 43  ? -14.195 -21.817 25.107  1.00 0.00 ? 43  PRO A N    4  
ATOM 6509  C CA   . PRO A 1 43  ? -14.514 -23.018 25.879  1.00 0.00 ? 43  PRO A CA   4  
ATOM 6510  C C    . PRO A 1 43  ? -15.329 -24.023 25.047  1.00 0.00 ? 43  PRO A C    4  
ATOM 6511  O O    . PRO A 1 43  ? -15.868 -23.691 23.991  1.00 0.00 ? 43  PRO A O    4  
ATOM 6512  C CB   . PRO A 1 43  ? -15.307 -22.513 27.092  1.00 0.00 ? 43  PRO A CB   4  
ATOM 6513  C CG   . PRO A 1 43  ? -16.045 -21.297 26.536  1.00 0.00 ? 43  PRO A CG   4  
ATOM 6514  C CD   . PRO A 1 43  ? -15.031 -20.713 25.557  1.00 0.00 ? 43  PRO A CD   4  
ATOM 6515  H HA   . PRO A 1 43  ? -13.598 -23.501 26.226  1.00 0.00 ? 43  PRO A HA   4  
ATOM 6516  H HB2  . PRO A 1 43  ? -15.999 -23.259 27.484  1.00 0.00 ? 43  PRO A HB2  4  
ATOM 6517  H HB3  . PRO A 1 43  ? -14.615 -22.188 27.871  1.00 0.00 ? 43  PRO A HB3  4  
ATOM 6518  H HG2  . PRO A 1 43  ? -16.937 -21.617 25.994  1.00 0.00 ? 43  PRO A HG2  4  
ATOM 6519  H HG3  . PRO A 1 43  ? -16.301 -20.585 27.316  1.00 0.00 ? 43  PRO A HG3  4  
ATOM 6520  H HD2  . PRO A 1 43  ? -15.551 -20.246 24.724  1.00 0.00 ? 43  PRO A HD2  4  
ATOM 6521  H HD3  . PRO A 1 43  ? -14.406 -19.981 26.067  1.00 0.00 ? 43  PRO A HD3  4  
ATOM 6522  N N    . GLY A 1 44  ? -15.474 -25.252 25.564  1.00 0.00 ? 44  GLY A N    4  
ATOM 6523  C CA   . GLY A 1 44  ? -16.268 -26.337 24.959  1.00 0.00 ? 44  GLY A CA   4  
ATOM 6524  C C    . GLY A 1 44  ? -17.779 -26.199 25.177  1.00 0.00 ? 44  GLY A C    4  
ATOM 6525  O O    . GLY A 1 44  ? -18.485 -27.204 25.275  1.00 0.00 ? 44  GLY A O    4  
ATOM 6526  H H    . GLY A 1 44  ? -15.008 -25.456 26.439  1.00 0.00 ? 44  GLY A H    4  
ATOM 6527  H HA2  . GLY A 1 44  ? -16.098 -26.346 23.881  1.00 0.00 ? 44  GLY A HA2  4  
ATOM 6528  H HA3  . GLY A 1 44  ? -15.950 -27.289 25.384  1.00 0.00 ? 44  GLY A HA3  4  
ATOM 6529  N N    . ALA A 1 45  ? -18.272 -24.963 25.297  1.00 0.00 ? 45  ALA A N    4  
ATOM 6530  C CA   . ALA A 1 45  ? -19.662 -24.627 25.589  1.00 0.00 ? 45  ALA A CA   4  
ATOM 6531  C C    . ALA A 1 45  ? -20.589 -24.837 24.372  1.00 0.00 ? 45  ALA A C    4  
ATOM 6532  O O    . ALA A 1 45  ? -20.261 -24.431 23.252  1.00 0.00 ? 45  ALA A O    4  
ATOM 6533  C CB   . ALA A 1 45  ? -19.708 -23.184 26.100  1.00 0.00 ? 45  ALA A CB   4  
ATOM 6534  H H    . ALA A 1 45  ? -17.628 -24.203 25.130  1.00 0.00 ? 45  ALA A H    4  
ATOM 6535  H HA   . ALA A 1 45  ? -20.007 -25.278 26.391  1.00 0.00 ? 45  ALA A HA   4  
ATOM 6536  H HB1  . ALA A 1 45  ? -19.093 -23.084 26.996  1.00 0.00 ? 45  ALA A HB1  4  
ATOM 6537  H HB2  . ALA A 1 45  ? -19.333 -22.503 25.334  1.00 0.00 ? 45  ALA A HB2  4  
ATOM 6538  H HB3  . ALA A 1 45  ? -20.734 -22.911 26.338  1.00 0.00 ? 45  ALA A HB3  4  
ATOM 6539  N N    . GLY A 1 46  ? -21.764 -25.430 24.617  1.00 0.00 ? 46  GLY A N    4  
ATOM 6540  C CA   . GLY A 1 46  ? -22.778 -25.753 23.603  1.00 0.00 ? 46  GLY A CA   4  
ATOM 6541  C C    . GLY A 1 46  ? -22.560 -27.141 22.993  1.00 0.00 ? 46  GLY A C    4  
ATOM 6542  O O    . GLY A 1 46  ? -21.423 -27.543 22.738  1.00 0.00 ? 46  GLY A O    4  
ATOM 6543  H H    . GLY A 1 46  ? -21.935 -25.763 25.559  1.00 0.00 ? 46  GLY A H    4  
ATOM 6544  H HA2  . GLY A 1 46  ? -23.760 -25.736 24.071  1.00 0.00 ? 46  GLY A HA2  4  
ATOM 6545  H HA3  . GLY A 1 46  ? -22.756 -25.023 22.793  1.00 0.00 ? 46  GLY A HA3  4  
ATOM 6546  N N    . SER A 1 47  ? -23.656 -27.875 22.767  1.00 0.00 ? 47  SER A N    4  
ATOM 6547  C CA   . SER A 1 47  ? -23.661 -29.235 22.179  1.00 0.00 ? 47  SER A CA   4  
ATOM 6548  C C    . SER A 1 47  ? -22.862 -30.258 23.023  1.00 0.00 ? 47  SER A C    4  
ATOM 6549  O O    . SER A 1 47  ? -22.301 -31.226 22.502  1.00 0.00 ? 47  SER A O    4  
ATOM 6550  C CB   . SER A 1 47  ? -23.198 -29.203 20.707  1.00 0.00 ? 47  SER A CB   4  
ATOM 6551  O OG   . SER A 1 47  ? -24.003 -28.325 19.924  1.00 0.00 ? 47  SER A OG   4  
ATOM 6552  H H    . SER A 1 47  ? -24.554 -27.447 22.938  1.00 0.00 ? 47  SER A H    4  
ATOM 6553  H HA   . SER A 1 47  ? -24.692 -29.595 22.178  1.00 0.00 ? 47  SER A HA   4  
ATOM 6554  H HB2  . SER A 1 47  ? -22.155 -28.884 20.658  1.00 0.00 ? 47  SER A HB2  4  
ATOM 6555  H HB3  . SER A 1 47  ? -23.269 -30.210 20.290  1.00 0.00 ? 47  SER A HB3  4  
ATOM 6556  H HG   . SER A 1 47  ? -23.660 -28.324 19.015  1.00 0.00 ? 47  SER A HG   4  
ATOM 6557  N N    . SER A 1 48  ? -22.774 -30.034 24.339  1.00 0.00 ? 48  SER A N    4  
ATOM 6558  C CA   . SER A 1 48  ? -21.900 -30.761 25.273  1.00 0.00 ? 48  SER A CA   4  
ATOM 6559  C C    . SER A 1 48  ? -22.491 -30.809 26.702  1.00 0.00 ? 48  SER A C    4  
ATOM 6560  O O    . SER A 1 48  ? -23.635 -30.413 26.938  1.00 0.00 ? 48  SER A O    4  
ATOM 6561  C CB   . SER A 1 48  ? -20.512 -30.083 25.270  1.00 0.00 ? 48  SER A CB   4  
ATOM 6562  O OG   . SER A 1 48  ? -20.529 -28.869 26.007  1.00 0.00 ? 48  SER A OG   4  
ATOM 6563  H H    . SER A 1 48  ? -23.269 -29.238 24.712  1.00 0.00 ? 48  SER A H    4  
ATOM 6564  H HA   . SER A 1 48  ? -21.773 -31.792 24.939  1.00 0.00 ? 48  SER A HA   4  
ATOM 6565  H HB2  . SER A 1 48  ? -19.775 -30.756 25.710  1.00 0.00 ? 48  SER A HB2  4  
ATOM 6566  H HB3  . SER A 1 48  ? -20.211 -29.883 24.239  1.00 0.00 ? 48  SER A HB3  4  
ATOM 6567  H HG   . SER A 1 48  ? -19.779 -28.317 25.706  1.00 0.00 ? 48  SER A HG   4  
ATOM 6568  N N    . SER A 1 49  ? -21.702 -31.242 27.694  1.00 0.00 ? 49  SER A N    4  
ATOM 6569  C CA   . SER A 1 49  ? -22.098 -31.261 29.116  1.00 0.00 ? 49  SER A CA   4  
ATOM 6570  C C    . SER A 1 49  ? -21.985 -29.873 29.803  1.00 0.00 ? 49  SER A C    4  
ATOM 6571  O O    . SER A 1 49  ? -22.151 -29.764 31.022  1.00 0.00 ? 49  SER A O    4  
ATOM 6572  C CB   . SER A 1 49  ? -21.265 -32.334 29.844  1.00 0.00 ? 49  SER A CB   4  
ATOM 6573  O OG   . SER A 1 49  ? -21.907 -32.805 31.019  1.00 0.00 ? 49  SER A OG   4  
ATOM 6574  H H    . SER A 1 49  ? -20.771 -31.572 27.468  1.00 0.00 ? 49  SER A H    4  
ATOM 6575  H HA   . SER A 1 49  ? -23.145 -31.559 29.183  1.00 0.00 ? 49  SER A HA   4  
ATOM 6576  H HB2  . SER A 1 49  ? -21.124 -33.187 29.175  1.00 0.00 ? 49  SER A HB2  4  
ATOM 6577  H HB3  . SER A 1 49  ? -20.282 -31.925 30.087  1.00 0.00 ? 49  SER A HB3  4  
ATOM 6578  H HG   . SER A 1 49  ? -21.344 -33.482 31.424  1.00 0.00 ? 49  SER A HG   4  
ATOM 6579  N N    . VAL A 1 50  ? -21.690 -28.800 29.051  1.00 0.00 ? 50  VAL A N    4  
ATOM 6580  C CA   . VAL A 1 50  ? -21.463 -27.437 29.575  1.00 0.00 ? 50  VAL A CA   4  
ATOM 6581  C C    . VAL A 1 50  ? -21.943 -26.360 28.591  1.00 0.00 ? 50  VAL A C    4  
ATOM 6582  O O    . VAL A 1 50  ? -21.874 -26.543 27.379  1.00 0.00 ? 50  VAL A O    4  
ATOM 6583  C CB   . VAL A 1 50  ? -19.978 -27.246 29.992  1.00 0.00 ? 50  VAL A CB   4  
ATOM 6584  C CG1  . VAL A 1 50  ? -18.988 -27.358 28.820  1.00 0.00 ? 50  VAL A CG1  4  
ATOM 6585  C CG2  . VAL A 1 50  ? -19.746 -25.908 30.712  1.00 0.00 ? 50  VAL A CG2  4  
ATOM 6586  H H    . VAL A 1 50  ? -21.600 -28.937 28.044  1.00 0.00 ? 50  VAL A H    4  
ATOM 6587  H HA   . VAL A 1 50  ? -22.070 -27.329 30.474  1.00 0.00 ? 50  VAL A HA   4  
ATOM 6588  H HB   . VAL A 1 50  ? -19.729 -28.036 30.704  1.00 0.00 ? 50  VAL A HB   4  
ATOM 6589  H HG11 . VAL A 1 50  ? -19.169 -26.570 28.092  1.00 0.00 ? 50  VAL A HG11 4  
ATOM 6590  H HG12 . VAL A 1 50  ? -17.965 -27.258 29.188  1.00 0.00 ? 50  VAL A HG12 4  
ATOM 6591  H HG13 . VAL A 1 50  ? -19.086 -28.329 28.338  1.00 0.00 ? 50  VAL A HG13 4  
ATOM 6592  H HG21 . VAL A 1 50  ? -19.848 -25.079 30.014  1.00 0.00 ? 50  VAL A HG21 4  
ATOM 6593  H HG22 . VAL A 1 50  ? -20.464 -25.791 31.524  1.00 0.00 ? 50  VAL A HG22 4  
ATOM 6594  H HG23 . VAL A 1 50  ? -18.740 -25.886 31.131  1.00 0.00 ? 50  VAL A HG23 4  
ATOM 6595  N N    . PHE A 1 51  ? -22.431 -25.231 29.120  1.00 0.00 ? 51  PHE A N    4  
ATOM 6596  C CA   . PHE A 1 51  ? -23.008 -24.116 28.348  1.00 0.00 ? 51  PHE A CA   4  
ATOM 6597  C C    . PHE A 1 51  ? -22.437 -22.734 28.739  1.00 0.00 ? 51  PHE A C    4  
ATOM 6598  O O    . PHE A 1 51  ? -22.980 -21.697 28.361  1.00 0.00 ? 51  PHE A O    4  
ATOM 6599  C CB   . PHE A 1 51  ? -24.542 -24.183 28.472  1.00 0.00 ? 51  PHE A CB   4  
ATOM 6600  C CG   . PHE A 1 51  ? -25.149 -25.445 27.885  1.00 0.00 ? 51  PHE A CG   4  
ATOM 6601  C CD1  . PHE A 1 51  ? -25.434 -25.513 26.508  1.00 0.00 ? 51  PHE A CD1  4  
ATOM 6602  C CD2  . PHE A 1 51  ? -25.391 -26.566 28.704  1.00 0.00 ? 51  PHE A CD2  4  
ATOM 6603  C CE1  . PHE A 1 51  ? -25.965 -26.692 25.954  1.00 0.00 ? 51  PHE A CE1  4  
ATOM 6604  C CE2  . PHE A 1 51  ? -25.916 -27.747 28.147  1.00 0.00 ? 51  PHE A CE2  4  
ATOM 6605  C CZ   . PHE A 1 51  ? -26.201 -27.811 26.771  1.00 0.00 ? 51  PHE A CZ   4  
ATOM 6606  H H    . PHE A 1 51  ? -22.524 -25.188 30.129  1.00 0.00 ? 51  PHE A H    4  
ATOM 6607  H HA   . PHE A 1 51  ? -22.750 -24.253 27.297  1.00 0.00 ? 51  PHE A HA   4  
ATOM 6608  H HB2  . PHE A 1 51  ? -24.823 -24.101 29.524  1.00 0.00 ? 51  PHE A HB2  4  
ATOM 6609  H HB3  . PHE A 1 51  ? -24.979 -23.329 27.954  1.00 0.00 ? 51  PHE A HB3  4  
ATOM 6610  H HD1  . PHE A 1 51  ? -25.250 -24.657 25.872  1.00 0.00 ? 51  PHE A HD1  4  
ATOM 6611  H HD2  . PHE A 1 51  ? -25.167 -26.527 29.760  1.00 0.00 ? 51  PHE A HD2  4  
ATOM 6612  H HE1  . PHE A 1 51  ? -26.190 -26.740 24.897  1.00 0.00 ? 51  PHE A HE1  4  
ATOM 6613  H HE2  . PHE A 1 51  ? -26.096 -28.609 28.778  1.00 0.00 ? 51  PHE A HE2  4  
ATOM 6614  H HZ   . PHE A 1 51  ? -26.602 -28.720 26.342  1.00 0.00 ? 51  PHE A HZ   4  
ATOM 6615  N N    . SER A 1 52  ? -21.323 -22.699 29.475  1.00 0.00 ? 52  SER A N    4  
ATOM 6616  C CA   . SER A 1 52  ? -20.649 -21.483 29.969  1.00 0.00 ? 52  SER A CA   4  
ATOM 6617  C C    . SER A 1 52  ? -19.908 -20.716 28.848  1.00 0.00 ? 52  SER A C    4  
ATOM 6618  O O    . SER A 1 52  ? -18.680 -20.604 28.852  1.00 0.00 ? 52  SER A O    4  
ATOM 6619  C CB   . SER A 1 52  ? -19.696 -21.858 31.120  1.00 0.00 ? 52  SER A CB   4  
ATOM 6620  O OG   . SER A 1 52  ? -20.380 -22.560 32.152  1.00 0.00 ? 52  SER A OG   4  
ATOM 6621  H H    . SER A 1 52  ? -20.935 -23.580 29.781  1.00 0.00 ? 52  SER A H    4  
ATOM 6622  H HA   . SER A 1 52  ? -21.398 -20.801 30.383  1.00 0.00 ? 52  SER A HA   4  
ATOM 6623  H HB2  . SER A 1 52  ? -18.894 -22.487 30.730  1.00 0.00 ? 52  SER A HB2  4  
ATOM 6624  H HB3  . SER A 1 52  ? -19.261 -20.945 31.529  1.00 0.00 ? 52  SER A HB3  4  
ATOM 6625  H HG   . SER A 1 52  ? -19.759 -22.707 32.886  1.00 0.00 ? 52  SER A HG   4  
ATOM 6626  N N    . VAL A 1 53  ? -20.659 -20.212 27.861  1.00 0.00 ? 53  VAL A N    4  
ATOM 6627  C CA   . VAL A 1 53  ? -20.150 -19.446 26.704  1.00 0.00 ? 53  VAL A CA   4  
ATOM 6628  C C    . VAL A 1 53  ? -19.374 -18.182 27.112  1.00 0.00 ? 53  VAL A C    4  
ATOM 6629  O O    . VAL A 1 53  ? -19.646 -17.575 28.150  1.00 0.00 ? 53  VAL A O    4  
ATOM 6630  C CB   . VAL A 1 53  ? -21.272 -19.059 25.708  1.00 0.00 ? 53  VAL A CB   4  
ATOM 6631  C CG1  . VAL A 1 53  ? -21.820 -20.303 24.991  1.00 0.00 ? 53  VAL A CG1  4  
ATOM 6632  C CG2  . VAL A 1 53  ? -22.431 -18.291 26.372  1.00 0.00 ? 53  VAL A CG2  4  
ATOM 6633  H H    . VAL A 1 53  ? -21.658 -20.409 27.913  1.00 0.00 ? 53  VAL A H    4  
ATOM 6634  H HA   . VAL A 1 53  ? -19.452 -20.097 26.172  1.00 0.00 ? 53  VAL A HA   4  
ATOM 6635  H HB   . VAL A 1 53  ? -20.845 -18.404 24.953  1.00 0.00 ? 53  VAL A HB   4  
ATOM 6636  H HG11 . VAL A 1 53  ? -21.007 -20.831 24.495  1.00 0.00 ? 53  VAL A HG11 4  
ATOM 6637  H HG12 . VAL A 1 53  ? -22.302 -20.977 25.698  1.00 0.00 ? 53  VAL A HG12 4  
ATOM 6638  H HG13 . VAL A 1 53  ? -22.551 -20.001 24.240  1.00 0.00 ? 53  VAL A HG13 4  
ATOM 6639  H HG21 . VAL A 1 53  ? -22.057 -17.390 26.856  1.00 0.00 ? 53  VAL A HG21 4  
ATOM 6640  H HG22 . VAL A 1 53  ? -23.154 -17.991 25.614  1.00 0.00 ? 53  VAL A HG22 4  
ATOM 6641  H HG23 . VAL A 1 53  ? -22.930 -18.917 27.111  1.00 0.00 ? 53  VAL A HG23 4  
ATOM 6642  N N    . LEU A 1 54  ? -18.416 -17.783 26.268  1.00 0.00 ? 54  LEU A N    4  
ATOM 6643  C CA   . LEU A 1 54  ? -17.506 -16.655 26.493  1.00 0.00 ? 54  LEU A CA   4  
ATOM 6644  C C    . LEU A 1 54  ? -17.429 -15.702 25.286  1.00 0.00 ? 54  LEU A C    4  
ATOM 6645  O O    . LEU A 1 54  ? -17.274 -14.494 25.471  1.00 0.00 ? 54  LEU A O    4  
ATOM 6646  C CB   . LEU A 1 54  ? -16.120 -17.245 26.833  1.00 0.00 ? 54  LEU A CB   4  
ATOM 6647  C CG   . LEU A 1 54  ? -15.043 -16.218 27.247  1.00 0.00 ? 54  LEU A CG   4  
ATOM 6648  C CD1  . LEU A 1 54  ? -15.437 -15.423 28.502  1.00 0.00 ? 54  LEU A CD1  4  
ATOM 6649  C CD2  . LEU A 1 54  ? -13.721 -16.953 27.506  1.00 0.00 ? 54  LEU A CD2  4  
ATOM 6650  H H    . LEU A 1 54  ? -18.289 -18.331 25.416  1.00 0.00 ? 54  LEU A H    4  
ATOM 6651  H HA   . LEU A 1 54  ? -17.867 -16.068 27.339  1.00 0.00 ? 54  LEU A HA   4  
ATOM 6652  H HB2  . LEU A 1 54  ? -16.236 -17.961 27.648  1.00 0.00 ? 54  LEU A HB2  4  
ATOM 6653  H HB3  . LEU A 1 54  ? -15.756 -17.792 25.960  1.00 0.00 ? 54  LEU A HB3  4  
ATOM 6654  H HG   . LEU A 1 54  ? -14.877 -15.515 26.431  1.00 0.00 ? 54  LEU A HG   4  
ATOM 6655  H HD11 . LEU A 1 54  ? -15.663 -16.102 29.325  1.00 0.00 ? 54  LEU A HD11 4  
ATOM 6656  H HD12 . LEU A 1 54  ? -14.618 -14.767 28.798  1.00 0.00 ? 54  LEU A HD12 4  
ATOM 6657  H HD13 . LEU A 1 54  ? -16.309 -14.801 28.299  1.00 0.00 ? 54  LEU A HD13 4  
ATOM 6658  H HD21 . LEU A 1 54  ? -12.952 -16.236 27.798  1.00 0.00 ? 54  LEU A HD21 4  
ATOM 6659  H HD22 . LEU A 1 54  ? -13.847 -17.690 28.300  1.00 0.00 ? 54  LEU A HD22 4  
ATOM 6660  H HD23 . LEU A 1 54  ? -13.396 -17.455 26.595  1.00 0.00 ? 54  LEU A HD23 4  
ATOM 6661  N N    . SER A 1 55  ? -17.564 -16.209 24.060  1.00 0.00 ? 55  SER A N    4  
ATOM 6662  C CA   . SER A 1 55  ? -17.568 -15.391 22.840  1.00 0.00 ? 55  SER A CA   4  
ATOM 6663  C C    . SER A 1 55  ? -18.946 -14.761 22.609  1.00 0.00 ? 55  SER A C    4  
ATOM 6664  O O    . SER A 1 55  ? -19.086 -13.548 22.783  1.00 0.00 ? 55  SER A O    4  
ATOM 6665  C CB   . SER A 1 55  ? -17.086 -16.205 21.633  1.00 0.00 ? 55  SER A CB   4  
ATOM 6666  O OG   . SER A 1 55  ? -15.739 -16.611 21.799  1.00 0.00 ? 55  SER A OG   4  
ATOM 6667  H H    . SER A 1 55  ? -17.725 -17.213 23.959  1.00 0.00 ? 55  SER A H    4  
ATOM 6668  H HA   . SER A 1 55  ? -16.877 -14.556 22.932  1.00 0.00 ? 55  SER A HA   4  
ATOM 6669  H HB2  . SER A 1 55  ? -17.715 -17.082 21.505  1.00 0.00 ? 55  SER A HB2  4  
ATOM 6670  H HB3  . SER A 1 55  ? -17.159 -15.586 20.738  1.00 0.00 ? 55  SER A HB3  4  
ATOM 6671  H HG   . SER A 1 55  ? -15.499 -17.156 21.018  1.00 0.00 ? 55  SER A HG   4  
ATOM 6672  N N    . ASN A 1 56  ? -19.951 -15.567 22.239  1.00 0.00 ? 56  ASN A N    4  
ATOM 6673  C CA   . ASN A 1 56  ? -21.337 -15.211 21.893  1.00 0.00 ? 56  ASN A CA   4  
ATOM 6674  C C    . ASN A 1 56  ? -21.434 -14.343 20.623  1.00 0.00 ? 56  ASN A C    4  
ATOM 6675  O O    . ASN A 1 56  ? -22.084 -14.720 19.649  1.00 0.00 ? 56  ASN A O    4  
ATOM 6676  C CB   . ASN A 1 56  ? -22.048 -14.547 23.095  1.00 0.00 ? 56  ASN A CB   4  
ATOM 6677  C CG   . ASN A 1 56  ? -23.556 -14.357 22.904  1.00 0.00 ? 56  ASN A CG   4  
ATOM 6678  O OD1  . ASN A 1 56  ? -24.146 -14.703 21.885  1.00 0.00 ? 56  ASN A OD1  4  
ATOM 6679  N ND2  . ASN A 1 56  ? -24.229 -13.797 23.894  1.00 0.00 ? 56  ASN A ND2  4  
ATOM 6680  H H    . ASN A 1 56  ? -19.748 -16.566 22.209  1.00 0.00 ? 56  ASN A H    4  
ATOM 6681  H HA   . ASN A 1 56  ? -21.856 -16.147 21.685  1.00 0.00 ? 56  ASN A HA   4  
ATOM 6682  H HB2  . ASN A 1 56  ? -21.893 -15.165 23.980  1.00 0.00 ? 56  ASN A HB2  4  
ATOM 6683  H HB3  . ASN A 1 56  ? -21.607 -13.566 23.286  1.00 0.00 ? 56  ASN A HB3  4  
ATOM 6684  H HD21 . ASN A 1 56  ? -23.755 -13.511 24.739  1.00 0.00 ? 56  ASN A HD21 4  
ATOM 6685  H HD22 . ASN A 1 56  ? -25.227 -13.671 23.798  1.00 0.00 ? 56  ASN A HD22 4  
ATOM 6686  N N    . SER A 1 57  ? -20.778 -13.187 20.627  1.00 0.00 ? 57  SER A N    4  
ATOM 6687  C CA   . SER A 1 57  ? -20.730 -12.185 19.557  1.00 0.00 ? 57  SER A CA   4  
ATOM 6688  C C    . SER A 1 57  ? -19.268 -11.966 19.107  1.00 0.00 ? 57  SER A C    4  
ATOM 6689  O O    . SER A 1 57  ? -18.335 -12.399 19.791  1.00 0.00 ? 57  SER A O    4  
ATOM 6690  C CB   . SER A 1 57  ? -21.298 -10.859 20.101  1.00 0.00 ? 57  SER A CB   4  
ATOM 6691  O OG   . SER A 1 57  ? -22.621 -11.020 20.595  1.00 0.00 ? 57  SER A OG   4  
ATOM 6692  H H    . SER A 1 57  ? -20.185 -13.023 21.436  1.00 0.00 ? 57  SER A H    4  
ATOM 6693  H HA   . SER A 1 57  ? -21.337 -12.515 18.708  1.00 0.00 ? 57  SER A HA   4  
ATOM 6694  H HB2  . SER A 1 57  ? -20.657 -10.510 20.910  1.00 0.00 ? 57  SER A HB2  4  
ATOM 6695  H HB3  . SER A 1 57  ? -21.297 -10.105 19.314  1.00 0.00 ? 57  SER A HB3  4  
ATOM 6696  H HG   . SER A 1 57  ? -22.918 -10.185 20.989  1.00 0.00 ? 57  SER A HG   4  
ATOM 6697  N N    . ALA A 1 58  ? -19.038 -11.257 17.992  1.00 0.00 ? 58  ALA A N    4  
ATOM 6698  C CA   . ALA A 1 58  ? -17.686 -10.819 17.617  1.00 0.00 ? 58  ALA A CA   4  
ATOM 6699  C C    . ALA A 1 58  ? -17.193 -9.739  18.597  1.00 0.00 ? 58  ALA A C    4  
ATOM 6700  O O    . ALA A 1 58  ? -18.017 -9.056  19.202  1.00 0.00 ? 58  ALA A O    4  
ATOM 6701  C CB   . ALA A 1 58  ? -17.697 -10.319 16.168  1.00 0.00 ? 58  ALA A CB   4  
ATOM 6702  H H    . ALA A 1 58  ? -19.818 -10.834 17.495  1.00 0.00 ? 58  ALA A H    4  
ATOM 6703  H HA   . ALA A 1 58  ? -17.005 -11.668 17.685  1.00 0.00 ? 58  ALA A HA   4  
ATOM 6704  H HB1  . ALA A 1 58  ? -18.303 -9.416  16.086  1.00 0.00 ? 58  ALA A HB1  4  
ATOM 6705  H HB2  . ALA A 1 58  ? -16.678 -10.086 15.856  1.00 0.00 ? 58  ALA A HB2  4  
ATOM 6706  H HB3  . ALA A 1 58  ? -18.095 -11.092 15.509  1.00 0.00 ? 58  ALA A HB3  4  
ATOM 6707  N N    . GLU A 1 59  ? -15.878 -9.569  18.755  1.00 0.00 ? 59  GLU A N    4  
ATOM 6708  C CA   . GLU A 1 59  ? -15.280 -8.716  19.797  1.00 0.00 ? 59  GLU A CA   4  
ATOM 6709  C C    . GLU A 1 59  ? -14.100 -7.909  19.240  1.00 0.00 ? 59  GLU A C    4  
ATOM 6710  O O    . GLU A 1 59  ? -13.215 -8.495  18.615  1.00 0.00 ? 59  GLU A O    4  
ATOM 6711  C CB   . GLU A 1 59  ? -14.840 -9.620  20.967  1.00 0.00 ? 59  GLU A CB   4  
ATOM 6712  C CG   . GLU A 1 59  ? -14.380 -8.868  22.221  1.00 0.00 ? 59  GLU A CG   4  
ATOM 6713  C CD   . GLU A 1 59  ? -14.183 -9.844  23.393  1.00 0.00 ? 59  GLU A CD   4  
ATOM 6714  O OE1  . GLU A 1 59  ? -15.187 -10.412 23.885  1.00 0.00 ? 59  GLU A OE1  4  
ATOM 6715  O OE2  . GLU A 1 59  ? -13.022 -10.037 23.824  1.00 0.00 ? 59  GLU A OE2  4  
ATOM 6716  H H    . GLU A 1 59  ? -15.252 -10.136 18.191  1.00 0.00 ? 59  GLU A H    4  
ATOM 6717  H HA   . GLU A 1 59  ? -16.026 -8.014  20.167  1.00 0.00 ? 59  GLU A HA   4  
ATOM 6718  H HB2  . GLU A 1 59  ? -15.691 -10.246 21.241  1.00 0.00 ? 59  GLU A HB2  4  
ATOM 6719  H HB3  . GLU A 1 59  ? -14.025 -10.274 20.644  1.00 0.00 ? 59  GLU A HB3  4  
ATOM 6720  H HG2  . GLU A 1 59  ? -13.447 -8.346  22.008  1.00 0.00 ? 59  GLU A HG2  4  
ATOM 6721  H HG3  . GLU A 1 59  ? -15.121 -8.122  22.501  1.00 0.00 ? 59  GLU A HG3  4  
ATOM 6722  N N    . VAL A 1 60  ? -14.068 -6.589  19.463  1.00 0.00 ? 60  VAL A N    4  
ATOM 6723  C CA   . VAL A 1 60  ? -12.939 -5.726  19.054  1.00 0.00 ? 60  VAL A CA   4  
ATOM 6724  C C    . VAL A 1 60  ? -11.852 -5.729  20.139  1.00 0.00 ? 60  VAL A C    4  
ATOM 6725  O O    . VAL A 1 60  ? -12.145 -5.485  21.310  1.00 0.00 ? 60  VAL A O    4  
ATOM 6726  C CB   . VAL A 1 60  ? -13.350 -4.263  18.760  1.00 0.00 ? 60  VAL A CB   4  
ATOM 6727  C CG1  . VAL A 1 60  ? -12.183 -3.510  18.090  1.00 0.00 ? 60  VAL A CG1  4  
ATOM 6728  C CG2  . VAL A 1 60  ? -14.566 -4.154  17.829  1.00 0.00 ? 60  VAL A CG2  4  
ATOM 6729  H H    . VAL A 1 60  ? -14.854 -6.162  19.962  1.00 0.00 ? 60  VAL A H    4  
ATOM 6730  H HA   . VAL A 1 60  ? -12.521 -6.135  18.132  1.00 0.00 ? 60  VAL A HA   4  
ATOM 6731  H HB   . VAL A 1 60  ? -13.601 -3.768  19.701  1.00 0.00 ? 60  VAL A HB   4  
ATOM 6732  H HG11 . VAL A 1 60  ? -12.474 -2.478  17.890  1.00 0.00 ? 60  VAL A HG11 4  
ATOM 6733  H HG12 . VAL A 1 60  ? -11.310 -3.496  18.740  1.00 0.00 ? 60  VAL A HG12 4  
ATOM 6734  H HG13 . VAL A 1 60  ? -11.906 -3.998  17.156  1.00 0.00 ? 60  VAL A HG13 4  
ATOM 6735  H HG21 . VAL A 1 60  ? -14.335 -4.602  16.866  1.00 0.00 ? 60  VAL A HG21 4  
ATOM 6736  H HG22 . VAL A 1 60  ? -15.432 -4.651  18.264  1.00 0.00 ? 60  VAL A HG22 4  
ATOM 6737  H HG23 . VAL A 1 60  ? -14.813 -3.104  17.687  1.00 0.00 ? 60  VAL A HG23 4  
ATOM 6738  N N    . LYS A 1 61  ? -10.600 -5.990  19.743  1.00 0.00 ? 61  LYS A N    4  
ATOM 6739  C CA   . LYS A 1 61  ? -9.449  -6.248  20.629  1.00 0.00 ? 61  LYS A CA   4  
ATOM 6740  C C    . LYS A 1 61  ? -8.161  -5.525  20.146  1.00 0.00 ? 61  LYS A C    4  
ATOM 6741  O O    . LYS A 1 61  ? -8.135  -4.945  19.054  1.00 0.00 ? 61  LYS A O    4  
ATOM 6742  C CB   . LYS A 1 61  ? -9.264  -7.782  20.744  1.00 0.00 ? 61  LYS A CB   4  
ATOM 6743  C CG   . LYS A 1 61  ? -10.546 -8.499  21.214  1.00 0.00 ? 61  LYS A CG   4  
ATOM 6744  C CD   . LYS A 1 61  ? -10.396 -10.013 21.411  1.00 0.00 ? 61  LYS A CD   4  
ATOM 6745  C CE   . LYS A 1 61  ? -9.619  -10.452 22.660  1.00 0.00 ? 61  LYS A CE   4  
ATOM 6746  N NZ   . LYS A 1 61  ? -10.244 -9.975  23.927  1.00 0.00 ? 61  LYS A NZ   4  
ATOM 6747  H H    . LYS A 1 61  ? -10.456 -6.160  18.751  1.00 0.00 ? 61  LYS A H    4  
ATOM 6748  H HA   . LYS A 1 61  ? -9.669  -5.859  21.626  1.00 0.00 ? 61  LYS A HA   4  
ATOM 6749  H HB2  . LYS A 1 61  ? -8.987  -8.179  19.765  1.00 0.00 ? 61  LYS A HB2  4  
ATOM 6750  H HB3  . LYS A 1 61  ? -8.457  -8.001  21.447  1.00 0.00 ? 61  LYS A HB3  4  
ATOM 6751  H HG2  . LYS A 1 61  ? -10.904 -8.037  22.133  1.00 0.00 ? 61  LYS A HG2  4  
ATOM 6752  H HG3  . LYS A 1 61  ? -11.315 -8.374  20.453  1.00 0.00 ? 61  LYS A HG3  4  
ATOM 6753  H HD2  . LYS A 1 61  ? -11.395 -10.448 21.460  1.00 0.00 ? 61  LYS A HD2  4  
ATOM 6754  H HD3  . LYS A 1 61  ? -9.901  -10.431 20.537  1.00 0.00 ? 61  LYS A HD3  4  
ATOM 6755  H HE2  . LYS A 1 61  ? -9.611  -11.544 22.659  1.00 0.00 ? 61  LYS A HE2  4  
ATOM 6756  H HE3  . LYS A 1 61  ? -8.586  -10.104 22.592  1.00 0.00 ? 61  LYS A HE3  4  
ATOM 6757  H HZ1  . LYS A 1 61  ? -10.122 -8.977  24.048  1.00 0.00 ? 61  LYS A HZ1  4  
ATOM 6758  H HZ2  . LYS A 1 61  ? -11.249 -10.167 23.931  1.00 0.00 ? 61  LYS A HZ2  4  
ATOM 6759  H HZ3  . LYS A 1 61  ? -9.833  -10.431 24.731  1.00 0.00 ? 61  LYS A HZ3  4  
ATOM 6760  N N    . ARG A 1 62  ? -7.110  -5.517  20.983  1.00 0.00 ? 62  ARG A N    4  
ATOM 6761  C CA   . ARG A 1 62  ? -5.821  -4.824  20.753  1.00 0.00 ? 62  ARG A CA   4  
ATOM 6762  C C    . ARG A 1 62  ? -4.620  -5.776  20.917  1.00 0.00 ? 62  ARG A C    4  
ATOM 6763  O O    . ARG A 1 62  ? -4.598  -6.593  21.839  1.00 0.00 ? 62  ARG A O    4  
ATOM 6764  C CB   . ARG A 1 62  ? -5.699  -3.633  21.725  1.00 0.00 ? 62  ARG A CB   4  
ATOM 6765  C CG   . ARG A 1 62  ? -4.408  -2.806  21.555  1.00 0.00 ? 62  ARG A CG   4  
ATOM 6766  C CD   . ARG A 1 62  ? -4.401  -1.529  22.404  1.00 0.00 ? 62  ARG A CD   4  
ATOM 6767  N NE   . ARG A 1 62  ? -4.361  -1.827  23.851  1.00 0.00 ? 62  ARG A NE   4  
ATOM 6768  C CZ   . ARG A 1 62  ? -4.460  -0.947  24.844  1.00 0.00 ? 62  ARG A CZ   4  
ATOM 6769  N NH1  . ARG A 1 62  ? -4.617  0.343   24.623  1.00 0.00 ? 62  ARG A NH1  4  
ATOM 6770  N NH2  . ARG A 1 62  ? -4.399  -1.361  26.092  1.00 0.00 ? 62  ARG A NH2  4  
ATOM 6771  H H    . ARG A 1 62  ? -7.201  -6.033  21.847  1.00 0.00 ? 62  ARG A H    4  
ATOM 6772  H HA   . ARG A 1 62  ? -5.814  -4.435  19.736  1.00 0.00 ? 62  ARG A HA   4  
ATOM 6773  H HB2  . ARG A 1 62  ? -6.550  -2.970  21.563  1.00 0.00 ? 62  ARG A HB2  4  
ATOM 6774  H HB3  . ARG A 1 62  ? -5.757  -4.005  22.749  1.00 0.00 ? 62  ARG A HB3  4  
ATOM 6775  H HG2  . ARG A 1 62  ? -3.543  -3.410  21.831  1.00 0.00 ? 62  ARG A HG2  4  
ATOM 6776  H HG3  . ARG A 1 62  ? -4.301  -2.520  20.509  1.00 0.00 ? 62  ARG A HG3  4  
ATOM 6777  H HD2  . ARG A 1 62  ? -3.520  -0.943  22.137  1.00 0.00 ? 62  ARG A HD2  4  
ATOM 6778  H HD3  . ARG A 1 62  ? -5.290  -0.942  22.169  1.00 0.00 ? 62  ARG A HD3  4  
ATOM 6779  H HE   . ARG A 1 62  ? -4.211  -2.793  24.112  1.00 0.00 ? 62  ARG A HE   4  
ATOM 6780  H HH11 . ARG A 1 62  ? -4.663  0.698   23.681  1.00 0.00 ? 62  ARG A HH11 4  
ATOM 6781  H HH12 . ARG A 1 62  ? -4.689  0.989   25.393  1.00 0.00 ? 62  ARG A HH12 4  
ATOM 6782  H HH21 . ARG A 1 62  ? -4.280  -2.339  26.305  1.00 0.00 ? 62  ARG A HH21 4  
ATOM 6783  H HH22 . ARG A 1 62  ? -4.476  -0.707  26.857  1.00 0.00 ? 62  ARG A HH22 4  
ATOM 6784  N N    . GLU A 1 63  ? -3.593  -5.591  20.080  1.00 0.00 ? 63  GLU A N    4  
ATOM 6785  C CA   . GLU A 1 63  ? -2.330  -6.344  20.067  1.00 0.00 ? 63  GLU A CA   4  
ATOM 6786  C C    . GLU A 1 63  ? -1.198  -5.492  19.472  1.00 0.00 ? 63  GLU A C    4  
ATOM 6787  O O    . GLU A 1 63  ? -1.423  -4.361  19.035  1.00 0.00 ? 63  GLU A O    4  
ATOM 6788  C CB   . GLU A 1 63  ? -2.482  -7.623  19.216  1.00 0.00 ? 63  GLU A CB   4  
ATOM 6789  C CG   . GLU A 1 63  ? -3.210  -8.799  19.864  1.00 0.00 ? 63  GLU A CG   4  
ATOM 6790  C CD   . GLU A 1 63  ? -2.504  -9.388  21.101  1.00 0.00 ? 63  GLU A CD   4  
ATOM 6791  O OE1  . GLU A 1 63  ? -1.306  -9.104  21.345  1.00 0.00 ? 63  GLU A OE1  4  
ATOM 6792  O OE2  . GLU A 1 63  ? -3.153  -10.172 21.836  1.00 0.00 ? 63  GLU A OE2  4  
ATOM 6793  H H    . GLU A 1 63  ? -3.678  -4.847  19.395  1.00 0.00 ? 63  GLU A H    4  
ATOM 6794  H HA   . GLU A 1 63  ? -2.043  -6.607  21.085  1.00 0.00 ? 63  GLU A HA   4  
ATOM 6795  H HB2  . GLU A 1 63  ? -3.004  -7.362  18.299  1.00 0.00 ? 63  GLU A HB2  4  
ATOM 6796  H HB3  . GLU A 1 63  ? -1.502  -7.997  18.930  1.00 0.00 ? 63  GLU A HB3  4  
ATOM 6797  H HG2  . GLU A 1 63  ? -4.214  -8.488  20.130  1.00 0.00 ? 63  GLU A HG2  4  
ATOM 6798  H HG3  . GLU A 1 63  ? -3.296  -9.571  19.100  1.00 0.00 ? 63  GLU A HG3  4  
ATOM 6799  N N    . ARG A 1 64  ? 0.015   -6.053  19.408  1.00 0.00 ? 64  ARG A N    4  
ATOM 6800  C CA   . ARG A 1 64  ? 1.165   -5.495  18.684  1.00 0.00 ? 64  ARG A CA   4  
ATOM 6801  C C    . ARG A 1 64  ? 1.372   -6.240  17.354  1.00 0.00 ? 64  ARG A C    4  
ATOM 6802  O O    . ARG A 1 64  ? 1.252   -7.467  17.289  1.00 0.00 ? 64  ARG A O    4  
ATOM 6803  C CB   . ARG A 1 64  ? 2.421   -5.553  19.569  1.00 0.00 ? 64  ARG A CB   4  
ATOM 6804  C CG   . ARG A 1 64  ? 2.248   -4.690  20.833  1.00 0.00 ? 64  ARG A CG   4  
ATOM 6805  C CD   . ARG A 1 64  ? 3.526   -4.679  21.681  1.00 0.00 ? 64  ARG A CD   4  
ATOM 6806  N NE   . ARG A 1 64  ? 3.327   -3.927  22.935  1.00 0.00 ? 64  ARG A NE   4  
ATOM 6807  C CZ   . ARG A 1 64  ? 2.946   -4.409  24.115  1.00 0.00 ? 64  ARG A CZ   4  
ATOM 6808  N NH1  . ARG A 1 64  ? 2.719   -5.691  24.315  1.00 0.00 ? 64  ARG A NH1  4  
ATOM 6809  N NH2  . ARG A 1 64  ? 2.777   -3.587  25.127  1.00 0.00 ? 64  ARG A NH2  4  
ATOM 6810  H H    . ARG A 1 64  ? 0.124   -6.981  19.802  1.00 0.00 ? 64  ARG A H    4  
ATOM 6811  H HA   . ARG A 1 64  ? 0.965   -4.447  18.459  1.00 0.00 ? 64  ARG A HA   4  
ATOM 6812  H HB2  . ARG A 1 64  ? 2.623   -6.586  19.855  1.00 0.00 ? 64  ARG A HB2  4  
ATOM 6813  H HB3  . ARG A 1 64  ? 3.271   -5.173  19.001  1.00 0.00 ? 64  ARG A HB3  4  
ATOM 6814  H HG2  . ARG A 1 64  ? 2.004   -3.670  20.538  1.00 0.00 ? 64  ARG A HG2  4  
ATOM 6815  H HG3  . ARG A 1 64  ? 1.425   -5.081  21.436  1.00 0.00 ? 64  ARG A HG3  4  
ATOM 6816  H HD2  . ARG A 1 64  ? 3.837   -5.702  21.895  1.00 0.00 ? 64  ARG A HD2  4  
ATOM 6817  H HD3  . ARG A 1 64  ? 4.327   -4.204  21.107  1.00 0.00 ? 64  ARG A HD3  4  
ATOM 6818  H HE   . ARG A 1 64  ? 3.482   -2.929  22.880  1.00 0.00 ? 64  ARG A HE   4  
ATOM 6819  H HH11 . ARG A 1 64  ? 2.832   -6.348  23.560  1.00 0.00 ? 64  ARG A HH11 4  
ATOM 6820  H HH12 . ARG A 1 64  ? 2.428   -6.030  25.220  1.00 0.00 ? 64  ARG A HH12 4  
ATOM 6821  H HH21 . ARG A 1 64  ? 2.905   -2.593  24.998  1.00 0.00 ? 64  ARG A HH21 4  
ATOM 6822  H HH22 . ARG A 1 64  ? 2.500   -3.930  26.035  1.00 0.00 ? 64  ARG A HH22 4  
ATOM 6823  N N    . LEU A 1 65  ? 1.712   -5.503  16.292  1.00 0.00 ? 65  LEU A N    4  
ATOM 6824  C CA   . LEU A 1 65  ? 1.832   -6.010  14.916  1.00 0.00 ? 65  LEU A CA   4  
ATOM 6825  C C    . LEU A 1 65  ? 2.781   -7.209  14.837  1.00 0.00 ? 65  LEU A C    4  
ATOM 6826  O O    . LEU A 1 65  ? 2.402   -8.236  14.283  1.00 0.00 ? 65  LEU A O    4  
ATOM 6827  C CB   . LEU A 1 65  ? 2.297   -4.853  14.002  1.00 0.00 ? 65  LEU A CB   4  
ATOM 6828  C CG   . LEU A 1 65  ? 2.383   -5.220  12.502  1.00 0.00 ? 65  LEU A CG   4  
ATOM 6829  C CD1  . LEU A 1 65  ? 0.985   -5.412  11.888  1.00 0.00 ? 65  LEU A CD1  4  
ATOM 6830  C CD2  . LEU A 1 65  ? 3.131   -4.126  11.732  1.00 0.00 ? 65  LEU A CD2  4  
ATOM 6831  H H    . LEU A 1 65  ? 1.836   -4.506  16.438  1.00 0.00 ? 65  LEU A H    4  
ATOM 6832  H HA   . LEU A 1 65  ? 0.848   -6.357  14.588  1.00 0.00 ? 65  LEU A HA   4  
ATOM 6833  H HB2  . LEU A 1 65  ? 1.613   -4.010  14.113  1.00 0.00 ? 65  LEU A HB2  4  
ATOM 6834  H HB3  . LEU A 1 65  ? 3.283   -4.515  14.334  1.00 0.00 ? 65  LEU A HB3  4  
ATOM 6835  H HG   . LEU A 1 65  ? 2.949   -6.143  12.387  1.00 0.00 ? 65  LEU A HG   4  
ATOM 6836  H HD11 . LEU A 1 65  ? 1.078   -5.646  10.825  1.00 0.00 ? 65  LEU A HD11 4  
ATOM 6837  H HD12 . LEU A 1 65  ? 0.461   -6.233  12.376  1.00 0.00 ? 65  LEU A HD12 4  
ATOM 6838  H HD13 . LEU A 1 65  ? 0.397   -4.499  11.995  1.00 0.00 ? 65  LEU A HD13 4  
ATOM 6839  H HD21 . LEU A 1 65  ? 3.237   -4.419  10.686  1.00 0.00 ? 65  LEU A HD21 4  
ATOM 6840  H HD22 . LEU A 1 65  ? 2.587   -3.184  11.788  1.00 0.00 ? 65  LEU A HD22 4  
ATOM 6841  H HD23 . LEU A 1 65  ? 4.127   -3.988  12.155  1.00 0.00 ? 65  LEU A HD23 4  
ATOM 6842  N N    . GLU A 1 66  ? 3.970   -7.120  15.440  1.00 0.00 ? 66  GLU A N    4  
ATOM 6843  C CA   . GLU A 1 66  ? 4.988   -8.179  15.375  1.00 0.00 ? 66  GLU A CA   4  
ATOM 6844  C C    . GLU A 1 66  ? 4.509   -9.534  15.931  1.00 0.00 ? 66  GLU A C    4  
ATOM 6845  O O    . GLU A 1 66  ? 4.873   -10.572 15.379  1.00 0.00 ? 66  GLU A O    4  
ATOM 6846  C CB   . GLU A 1 66  ? 6.290   -7.718  16.054  1.00 0.00 ? 66  GLU A CB   4  
ATOM 6847  C CG   . GLU A 1 66  ? 6.180   -7.462  17.565  1.00 0.00 ? 66  GLU A CG   4  
ATOM 6848  C CD   . GLU A 1 66  ? 7.507   -6.934  18.126  1.00 0.00 ? 66  GLU A CD   4  
ATOM 6849  O OE1  . GLU A 1 66  ? 8.360   -7.751  18.549  1.00 0.00 ? 66  GLU A OE1  4  
ATOM 6850  O OE2  . GLU A 1 66  ? 7.704   -5.697  18.155  1.00 0.00 ? 66  GLU A OE2  4  
ATOM 6851  H H    . GLU A 1 66  ? 4.226   -6.236  15.861  1.00 0.00 ? 66  GLU A H    4  
ATOM 6852  H HA   . GLU A 1 66  ? 5.218   -8.337  14.319  1.00 0.00 ? 66  GLU A HA   4  
ATOM 6853  H HB2  . GLU A 1 66  ? 7.056   -8.477  15.886  1.00 0.00 ? 66  GLU A HB2  4  
ATOM 6854  H HB3  . GLU A 1 66  ? 6.622   -6.799  15.569  1.00 0.00 ? 66  GLU A HB3  4  
ATOM 6855  H HG2  . GLU A 1 66  ? 5.390   -6.734  17.760  1.00 0.00 ? 66  GLU A HG2  4  
ATOM 6856  H HG3  . GLU A 1 66  ? 5.918   -8.388  18.074  1.00 0.00 ? 66  GLU A HG3  4  
ATOM 6857  N N    . ASP A 1 67  ? 3.641   -9.556  16.956  1.00 0.00 ? 67  ASP A N    4  
ATOM 6858  C CA   . ASP A 1 67  ? 3.047   -10.808 17.449  1.00 0.00 ? 67  ASP A CA   4  
ATOM 6859  C C    . ASP A 1 67  ? 1.988   -11.316 16.466  1.00 0.00 ? 67  ASP A C    4  
ATOM 6860  O O    . ASP A 1 67  ? 1.982   -12.493 16.109  1.00 0.00 ? 67  ASP A O    4  
ATOM 6861  C CB   . ASP A 1 67  ? 2.441   -10.602 18.842  1.00 0.00 ? 67  ASP A CB   4  
ATOM 6862  C CG   . ASP A 1 67  ? 1.937   -11.934 19.426  1.00 0.00 ? 67  ASP A CG   4  
ATOM 6863  O OD1  . ASP A 1 67  ? 0.825   -12.378 19.050  1.00 0.00 ? 67  ASP A OD1  4  
ATOM 6864  O OD2  . ASP A 1 67  ? 2.664   -12.539 20.249  1.00 0.00 ? 67  ASP A OD2  4  
ATOM 6865  H H    . ASP A 1 67  ? 3.328   -8.683  17.360  1.00 0.00 ? 67  ASP A H    4  
ATOM 6866  H HA   . ASP A 1 67  ? 3.831   -11.564 17.534  1.00 0.00 ? 67  ASP A HA   4  
ATOM 6867  H HB2  . ASP A 1 67  ? 3.201   -10.177 19.501  1.00 0.00 ? 67  ASP A HB2  4  
ATOM 6868  H HB3  . ASP A 1 67  ? 1.615   -9.891  18.784  1.00 0.00 ? 67  ASP A HB3  4  
ATOM 6869  N N    . VAL A 1 68  ? 1.126   -10.408 15.995  1.00 0.00 ? 68  VAL A N    4  
ATOM 6870  C CA   . VAL A 1 68  ? 0.025   -10.701 15.057  1.00 0.00 ? 68  VAL A CA   4  
ATOM 6871  C C    . VAL A 1 68  ? 0.528   -11.185 13.689  1.00 0.00 ? 68  VAL A C    4  
ATOM 6872  O O    . VAL A 1 68  ? -0.109  -12.029 13.063  1.00 0.00 ? 68  VAL A O    4  
ATOM 6873  C CB   . VAL A 1 68  ? -0.930  -9.492  14.948  1.00 0.00 ? 68  VAL A CB   4  
ATOM 6874  C CG1  . VAL A 1 68  ? -2.055  -9.691  13.922  1.00 0.00 ? 68  VAL A CG1  4  
ATOM 6875  C CG2  . VAL A 1 68  ? -1.569  -9.240  16.322  1.00 0.00 ? 68  VAL A CG2  4  
ATOM 6876  H H    . VAL A 1 68  ? 1.208   -9.467  16.375  1.00 0.00 ? 68  VAL A H    4  
ATOM 6877  H HA   . VAL A 1 68  ? -0.545  -11.513 15.482  1.00 0.00 ? 68  VAL A HA   4  
ATOM 6878  H HB   . VAL A 1 68  ? -0.357  -8.609  14.665  1.00 0.00 ? 68  VAL A HB   4  
ATOM 6879  H HG11 . VAL A 1 68  ? -2.735  -8.839  13.945  1.00 0.00 ? 68  VAL A HG11 4  
ATOM 6880  H HG12 . VAL A 1 68  ? -1.624  -9.752  12.926  1.00 0.00 ? 68  VAL A HG12 4  
ATOM 6881  H HG13 . VAL A 1 68  ? -2.607  -10.607 14.137  1.00 0.00 ? 68  VAL A HG13 4  
ATOM 6882  H HG21 . VAL A 1 68  ? -2.119  -10.121 16.652  1.00 0.00 ? 68  VAL A HG21 4  
ATOM 6883  H HG22 . VAL A 1 68  ? -0.800  -9.007  17.057  1.00 0.00 ? 68  VAL A HG22 4  
ATOM 6884  H HG23 . VAL A 1 68  ? -2.259  -8.400  16.263  1.00 0.00 ? 68  VAL A HG23 4  
ATOM 6885  N N    . VAL A 1 69  ? 1.690   -10.695 13.257  1.00 0.00 ? 69  VAL A N    4  
ATOM 6886  C CA   . VAL A 1 69  ? 2.365   -11.057 12.001  1.00 0.00 ? 69  VAL A CA   4  
ATOM 6887  C C    . VAL A 1 69  ? 3.305   -12.266 12.163  1.00 0.00 ? 69  VAL A C    4  
ATOM 6888  O O    . VAL A 1 69  ? 3.588   -12.945 11.175  1.00 0.00 ? 69  VAL A O    4  
ATOM 6889  C CB   . VAL A 1 69  ? 3.102   -9.811  11.456  1.00 0.00 ? 69  VAL A CB   4  
ATOM 6890  C CG1  . VAL A 1 69  ? 4.050   -10.093 10.283  1.00 0.00 ? 69  VAL A CG1  4  
ATOM 6891  C CG2  . VAL A 1 69  ? 2.047   -8.777  11.019  1.00 0.00 ? 69  VAL A CG2  4  
ATOM 6892  H H    . VAL A 1 69  ? 2.104   -9.945  13.811  1.00 0.00 ? 69  VAL A H    4  
ATOM 6893  H HA   . VAL A 1 69  ? 1.602   -11.337 11.272  1.00 0.00 ? 69  VAL A HA   4  
ATOM 6894  H HB   . VAL A 1 69  ? 3.701   -9.382  12.261  1.00 0.00 ? 69  VAL A HB   4  
ATOM 6895  H HG11 . VAL A 1 69  ? 4.900   -10.680 10.629  1.00 0.00 ? 69  VAL A HG11 4  
ATOM 6896  H HG12 . VAL A 1 69  ? 3.522   -10.643 9.506   1.00 0.00 ? 69  VAL A HG12 4  
ATOM 6897  H HG13 . VAL A 1 69  ? 4.430   -9.154  9.876   1.00 0.00 ? 69  VAL A HG13 4  
ATOM 6898  H HG21 . VAL A 1 69  ? 1.444   -9.180  10.204  1.00 0.00 ? 69  VAL A HG21 4  
ATOM 6899  H HG22 . VAL A 1 69  ? 1.381   -8.535  11.852  1.00 0.00 ? 69  VAL A HG22 4  
ATOM 6900  H HG23 . VAL A 1 69  ? 2.535   -7.863  10.682  1.00 0.00 ? 69  VAL A HG23 4  
ATOM 6901  N N    . GLY A 1 70  ? 3.745   -12.595 13.387  1.00 0.00 ? 70  GLY A N    4  
ATOM 6902  C CA   . GLY A 1 70  ? 4.596   -13.762 13.663  1.00 0.00 ? 70  GLY A CA   4  
ATOM 6903  C C    . GLY A 1 70  ? 3.927   -15.071 13.235  1.00 0.00 ? 70  GLY A C    4  
ATOM 6904  O O    . GLY A 1 70  ? 2.865   -15.430 13.749  1.00 0.00 ? 70  GLY A O    4  
ATOM 6905  H H    . GLY A 1 70  ? 3.509   -11.996 14.169  1.00 0.00 ? 70  GLY A H    4  
ATOM 6906  H HA2  . GLY A 1 70  ? 5.535   -13.653 13.118  1.00 0.00 ? 70  GLY A HA2  4  
ATOM 6907  H HA3  . GLY A 1 70  ? 4.816   -13.819 14.729  1.00 0.00 ? 70  GLY A HA3  4  
ATOM 6908  N N    . GLY A 1 71  ? 4.531   -15.760 12.258  1.00 0.00 ? 71  GLY A N    4  
ATOM 6909  C CA   . GLY A 1 71  ? 4.016   -17.009 11.676  1.00 0.00 ? 71  GLY A CA   4  
ATOM 6910  C C    . GLY A 1 71  ? 2.803   -16.842 10.746  1.00 0.00 ? 71  GLY A C    4  
ATOM 6911  O O    . GLY A 1 71  ? 2.211   -17.847 10.350  1.00 0.00 ? 71  GLY A O    4  
ATOM 6912  H H    . GLY A 1 71  ? 5.404   -15.400 11.894  1.00 0.00 ? 71  GLY A H    4  
ATOM 6913  H HA2  . GLY A 1 71  ? 4.807   -17.483 11.096  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 6914  H HA3  . GLY A 1 71  ? 3.711   -17.677 12.483  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 6915  N N    . CYS A 1 72  ? 2.414   -15.602 10.418  1.00 0.00 ? 72  CYS A N    4  
ATOM 6916  C CA   . CYS A 1 72  ? 1.176   -15.266 9.697   1.00 0.00 ? 72  CYS A CA   4  
ATOM 6917  C C    . CYS A 1 72  ? 1.447   -14.512 8.382   1.00 0.00 ? 72  CYS A C    4  
ATOM 6918  O O    . CYS A 1 72  ? 2.334   -13.655 8.313   1.00 0.00 ? 72  CYS A O    4  
ATOM 6919  C CB   . CYS A 1 72  ? 0.290   -14.389 10.604  1.00 0.00 ? 72  CYS A CB   4  
ATOM 6920  S SG   . CYS A 1 72  ? -0.075  -15.257 12.162  1.00 0.00 ? 72  CYS A SG   4  
ATOM 6921  H H    . CYS A 1 72  ? 2.992   -14.828 10.727  1.00 0.00 ? 72  CYS A H    4  
ATOM 6922  H HA   . CYS A 1 72  ? 0.628   -16.179 9.456   1.00 0.00 ? 72  CYS A HA   4  
ATOM 6923  H HB2  . CYS A 1 72  ? 0.801   -13.445 10.815  1.00 0.00 ? 72  CYS A HB2  4  
ATOM 6924  H HB3  . CYS A 1 72  ? -0.643  -14.143 10.081  1.00 0.00 ? 72  CYS A HB3  4  
ATOM 6925  H HG   . CYS A 1 72  ? 1.198   -15.413 12.562  1.00 0.00 ? 72  CYS A HG   4  
ATOM 6926  N N    . CYS A 1 73  ? 0.636   -14.790 7.358   1.00 0.00 ? 73  CYS A N    4  
ATOM 6927  C CA   . CYS A 1 73  ? 0.604   -14.009 6.117   1.00 0.00 ? 73  CYS A CA   4  
ATOM 6928  C C    . CYS A 1 73  ? -0.329  -12.798 6.291   1.00 0.00 ? 73  CYS A C    4  
ATOM 6929  O O    . CYS A 1 73  ? -1.291  -12.855 7.059   1.00 0.00 ? 73  CYS A O    4  
ATOM 6930  C CB   . CYS A 1 73  ? 0.171   -14.913 4.943   1.00 0.00 ? 73  CYS A CB   4  
ATOM 6931  S SG   . CYS A 1 73  ? 1.346   -16.287 4.735   1.00 0.00 ? 73  CYS A SG   4  
ATOM 6932  H H    . CYS A 1 73  ? -0.062  -15.509 7.480   1.00 0.00 ? 73  CYS A H    4  
ATOM 6933  H HA   . CYS A 1 73  ? 1.604   -13.623 5.905   1.00 0.00 ? 73  CYS A HA   4  
ATOM 6934  H HB2  . CYS A 1 73  ? -0.828  -15.314 5.125   1.00 0.00 ? 73  CYS A HB2  4  
ATOM 6935  H HB3  . CYS A 1 73  ? 0.134   -14.326 4.019   1.00 0.00 ? 73  CYS A HB3  4  
ATOM 6936  H HG   . CYS A 1 73  ? 2.434   -15.541 4.493   1.00 0.00 ? 73  CYS A HG   4  
ATOM 6937  N N    . TYR A 1 74  ? -0.079  -11.711 5.562   1.00 0.00 ? 74  TYR A N    4  
ATOM 6938  C CA   . TYR A 1 74  ? -0.892  -10.488 5.619   1.00 0.00 ? 74  TYR A CA   4  
ATOM 6939  C C    . TYR A 1 74  ? -0.752  -9.615  4.361   1.00 0.00 ? 74  TYR A C    4  
ATOM 6940  O O    . TYR A 1 74  ? 0.229   -9.746  3.627   1.00 0.00 ? 74  TYR A O    4  
ATOM 6941  C CB   . TYR A 1 74  ? -0.571  -9.683  6.895   1.00 0.00 ? 74  TYR A CB   4  
ATOM 6942  C CG   . TYR A 1 74  ? 0.783   -8.994  6.937   1.00 0.00 ? 74  TYR A CG   4  
ATOM 6943  C CD1  . TYR A 1 74  ? 1.962   -9.743  7.112   1.00 0.00 ? 74  TYR A CD1  4  
ATOM 6944  C CD2  . TYR A 1 74  ? 0.864   -7.590  6.817   1.00 0.00 ? 74  TYR A CD2  4  
ATOM 6945  C CE1  . TYR A 1 74  ? 3.211   -9.099  7.162   1.00 0.00 ? 74  TYR A CE1  4  
ATOM 6946  C CE2  . TYR A 1 74  ? 2.110   -6.934  6.898   1.00 0.00 ? 74  TYR A CE2  4  
ATOM 6947  C CZ   . TYR A 1 74  ? 3.290   -7.692  7.077   1.00 0.00 ? 74  TYR A CZ   4  
ATOM 6948  O OH   . TYR A 1 74  ? 4.504   -7.081  7.121   1.00 0.00 ? 74  TYR A OH   4  
ATOM 6949  H H    . TYR A 1 74  ? 0.724   -11.708 4.944   1.00 0.00 ? 74  TYR A H    4  
ATOM 6950  H HA   . TYR A 1 74  ? -1.935  -10.796 5.672   1.00 0.00 ? 74  TYR A HA   4  
ATOM 6951  H HB2  . TYR A 1 74  ? -1.340  -8.919  7.005   1.00 0.00 ? 74  TYR A HB2  4  
ATOM 6952  H HB3  . TYR A 1 74  ? -0.651  -10.333 7.765   1.00 0.00 ? 74  TYR A HB3  4  
ATOM 6953  H HD1  . TYR A 1 74  ? 1.915   -10.819 7.219   1.00 0.00 ? 74  TYR A HD1  4  
ATOM 6954  H HD2  . TYR A 1 74  ? -0.035  -7.010  6.670   1.00 0.00 ? 74  TYR A HD2  4  
ATOM 6955  H HE1  . TYR A 1 74  ? 4.115   -9.678  7.285   1.00 0.00 ? 74  TYR A HE1  4  
ATOM 6956  H HE2  . TYR A 1 74  ? 2.158   -5.856  6.821   1.00 0.00 ? 74  TYR A HE2  4  
ATOM 6957  H HH   . TYR A 1 74  ? 4.443   -6.124  7.059   1.00 0.00 ? 74  TYR A HH   4  
ATOM 6958  N N    . ARG A 1 75  ? -1.710  -8.705  4.143   1.00 0.00 ? 75  ARG A N    4  
ATOM 6959  C CA   . ARG A 1 75  ? -1.709  -7.689  3.075   1.00 0.00 ? 75  ARG A CA   4  
ATOM 6960  C C    . ARG A 1 75  ? -2.353  -6.387  3.570   1.00 0.00 ? 75  ARG A C    4  
ATOM 6961  O O    . ARG A 1 75  ? -3.371  -6.431  4.254   1.00 0.00 ? 75  ARG A O    4  
ATOM 6962  C CB   . ARG A 1 75  ? -2.484  -8.200  1.836   1.00 0.00 ? 75  ARG A CB   4  
ATOM 6963  C CG   . ARG A 1 75  ? -1.836  -9.370  1.074   1.00 0.00 ? 75  ARG A CG   4  
ATOM 6964  C CD   . ARG A 1 75  ? -0.454  -9.016  0.507   1.00 0.00 ? 75  ARG A CD   4  
ATOM 6965  N NE   . ARG A 1 75  ? 0.129   -10.138 -0.248  1.00 0.00 ? 75  ARG A NE   4  
ATOM 6966  C CZ   . ARG A 1 75  ? 1.422   -10.332 -0.490  1.00 0.00 ? 75  ARG A CZ   4  
ATOM 6967  N NH1  . ARG A 1 75  ? 2.356   -9.522  -0.030  1.00 0.00 ? 75  ARG A NH1  4  
ATOM 6968  N NH2  . ARG A 1 75  ? 1.800   -11.364 -1.213  1.00 0.00 ? 75  ARG A NH2  4  
ATOM 6969  H H    . ARG A 1 75  ? -2.507  -8.716  4.777   1.00 0.00 ? 75  ARG A H    4  
ATOM 6970  H HA   . ARG A 1 75  ? -0.680  -7.467  2.796   1.00 0.00 ? 75  ARG A HA   4  
ATOM 6971  H HB2  . ARG A 1 75  ? -3.482  -8.512  2.149   1.00 0.00 ? 75  ARG A HB2  4  
ATOM 6972  H HB3  . ARG A 1 75  ? -2.609  -7.374  1.133   1.00 0.00 ? 75  ARG A HB3  4  
ATOM 6973  H HG2  . ARG A 1 75  ? -1.750  -10.234 1.734   1.00 0.00 ? 75  ARG A HG2  4  
ATOM 6974  H HG3  . ARG A 1 75  ? -2.492  -9.641  0.247   1.00 0.00 ? 75  ARG A HG3  4  
ATOM 6975  H HD2  . ARG A 1 75  ? -0.542  -8.148  -0.149  1.00 0.00 ? 75  ARG A HD2  4  
ATOM 6976  H HD3  . ARG A 1 75  ? 0.208   -8.763  1.331   1.00 0.00 ? 75  ARG A HD3  4  
ATOM 6977  H HE   . ARG A 1 75  ? -0.522  -10.808 -0.632  1.00 0.00 ? 75  ARG A HE   4  
ATOM 6978  H HH11 . ARG A 1 75  ? 2.105   -8.725  0.550   1.00 0.00 ? 75  ARG A HH11 4  
ATOM 6979  H HH12 . ARG A 1 75  ? 3.328   -9.684  -0.240  1.00 0.00 ? 75  ARG A HH12 4  
ATOM 6980  H HH21 . ARG A 1 75  ? 1.119   -12.004 -1.594  1.00 0.00 ? 75  ARG A HH21 4  
ATOM 6981  H HH22 . ARG A 1 75  ? 2.777   -11.531 -1.401  1.00 0.00 ? 75  ARG A HH22 4  
ATOM 6982  N N    . VAL A 1 76  ? -1.793  -5.232  3.209   1.00 0.00 ? 76  VAL A N    4  
ATOM 6983  C CA   . VAL A 1 76  ? -2.411  -3.914  3.472   1.00 0.00 ? 76  VAL A CA   4  
ATOM 6984  C C    . VAL A 1 76  ? -3.476  -3.653  2.401   1.00 0.00 ? 76  VAL A C    4  
ATOM 6985  O O    . VAL A 1 76  ? -3.249  -3.949  1.227   1.00 0.00 ? 76  VAL A O    4  
ATOM 6986  C CB   . VAL A 1 76  ? -1.366  -2.771  3.498   1.00 0.00 ? 76  VAL A CB   4  
ATOM 6987  C CG1  . VAL A 1 76  ? -2.000  -1.389  3.750   1.00 0.00 ? 76  VAL A CG1  4  
ATOM 6988  C CG2  . VAL A 1 76  ? -0.314  -3.033  4.590   1.00 0.00 ? 76  VAL A CG2  4  
ATOM 6989  H H    . VAL A 1 76  ? -0.974  -5.273  2.609   1.00 0.00 ? 76  VAL A H    4  
ATOM 6990  H HA   . VAL A 1 76  ? -2.891  -3.947  4.453   1.00 0.00 ? 76  VAL A HA   4  
ATOM 6991  H HB   . VAL A 1 76  ? -0.860  -2.745  2.533   1.00 0.00 ? 76  VAL A HB   4  
ATOM 6992  H HG11 . VAL A 1 76  ? -2.700  -1.136  2.953   1.00 0.00 ? 76  VAL A HG11 4  
ATOM 6993  H HG12 . VAL A 1 76  ? -2.526  -1.384  4.705   1.00 0.00 ? 76  VAL A HG12 4  
ATOM 6994  H HG13 . VAL A 1 76  ? -1.224  -0.624  3.771   1.00 0.00 ? 76  VAL A HG13 4  
ATOM 6995  H HG21 . VAL A 1 76  ? 0.422   -2.230  4.589   1.00 0.00 ? 76  VAL A HG21 4  
ATOM 6996  H HG22 . VAL A 1 76  ? -0.796  -3.078  5.566   1.00 0.00 ? 76  VAL A HG22 4  
ATOM 6997  H HG23 . VAL A 1 76  ? 0.212   -3.970  4.406   1.00 0.00 ? 76  VAL A HG23 4  
ATOM 6998  N N    . ASN A 1 77  ? -4.630  -3.112  2.801   1.00 0.00 ? 77  ASN A N    4  
ATOM 6999  C CA   . ASN A 1 77  ? -5.770  -2.869  1.910   1.00 0.00 ? 77  ASN A CA   4  
ATOM 7000  C C    . ASN A 1 77  ? -6.269  -1.413  1.961   1.00 0.00 ? 77  ASN A C    4  
ATOM 7001  O O    . ASN A 1 77  ? -6.349  -0.800  3.025   1.00 0.00 ? 77  ASN A O    4  
ATOM 7002  C CB   . ASN A 1 77  ? -6.904  -3.839  2.274   1.00 0.00 ? 77  ASN A CB   4  
ATOM 7003  C CG   . ASN A 1 77  ? -8.044  -3.757  1.264   1.00 0.00 ? 77  ASN A CG   4  
ATOM 7004  O OD1  . ASN A 1 77  ? -8.935  -2.924  1.378   1.00 0.00 ? 77  ASN A OD1  4  
ATOM 7005  N ND2  . ASN A 1 77  ? -8.006  -4.549  0.209   1.00 0.00 ? 77  ASN A ND2  4  
ATOM 7006  H H    . ASN A 1 77  ? -4.731  -2.850  3.780   1.00 0.00 ? 77  ASN A H    4  
ATOM 7007  H HA   . ASN A 1 77  ? -5.473  -3.084  0.881   1.00 0.00 ? 77  ASN A HA   4  
ATOM 7008  H HB2  . ASN A 1 77  ? -6.520  -4.858  2.307   1.00 0.00 ? 77  ASN A HB2  4  
ATOM 7009  H HB3  . ASN A 1 77  ? -7.288  -3.585  3.261   1.00 0.00 ? 77  ASN A HB3  4  
ATOM 7010  H HD21 . ASN A 1 77  ? -7.291  -5.257  0.135   1.00 0.00 ? 77  ASN A HD21 4  
ATOM 7011  H HD22 . ASN A 1 77  ? -8.742  -4.492  -0.478  1.00 0.00 ? 77  ASN A HD22 4  
ATOM 7012  N N    . ASN A 1 78  ? -6.665  -0.889  0.793   1.00 0.00 ? 78  ASN A N    4  
ATOM 7013  C CA   . ASN A 1 78  ? -7.230  0.455   0.614   1.00 0.00 ? 78  ASN A CA   4  
ATOM 7014  C C    . ASN A 1 78  ? -8.439  0.434   -0.356  1.00 0.00 ? 78  ASN A C    4  
ATOM 7015  O O    . ASN A 1 78  ? -8.580  1.319   -1.192  1.00 0.00 ? 78  ASN A O    4  
ATOM 7016  C CB   . ASN A 1 78  ? -6.103  1.407   0.150   1.00 0.00 ? 78  ASN A CB   4  
ATOM 7017  C CG   . ASN A 1 78  ? -5.012  1.583   1.205   1.00 0.00 ? 78  ASN A CG   4  
ATOM 7018  O OD1  . ASN A 1 78  ? -4.043  0.833   1.256   1.00 0.00 ? 78  ASN A OD1  4  
ATOM 7019  N ND2  . ASN A 1 78  ? -5.136  2.572   2.072   1.00 0.00 ? 78  ASN A ND2  4  
ATOM 7020  H H    . ASN A 1 78  ? -6.505  -1.437  -0.043  1.00 0.00 ? 78  ASN A H    4  
ATOM 7021  H HA   . ASN A 1 78  ? -7.607  0.813   1.573   1.00 0.00 ? 78  ASN A HA   4  
ATOM 7022  H HB2  . ASN A 1 78  ? -5.655  1.025   -0.770  1.00 0.00 ? 78  ASN A HB2  4  
ATOM 7023  H HB3  . ASN A 1 78  ? -6.523  2.391   -0.071  1.00 0.00 ? 78  ASN A HB3  4  
ATOM 7024  H HD21 . ASN A 1 78  ? -5.892  3.243   1.983   1.00 0.00 ? 78  ASN A HD21 4  
ATOM 7025  H HD22 . ASN A 1 78  ? -4.438  2.672   2.806   1.00 0.00 ? 78  ASN A HD22 4  
ATOM 7026  N N    . SER A 1 79  ? -9.307  -0.583  -0.288  1.00 0.00 ? 79  SER A N    4  
ATOM 7027  C CA   . SER A 1 79  ? -10.368 -0.828  -1.293  1.00 0.00 ? 79  SER A CA   4  
ATOM 7028  C C    . SER A 1 79  ? -11.337 0.354   -1.471  1.00 0.00 ? 79  SER A C    4  
ATOM 7029  O O    . SER A 1 79  ? -11.283 1.045   -2.491  1.00 0.00 ? 79  SER A O    4  
ATOM 7030  C CB   . SER A 1 79  ? -11.098 -2.147  -0.982  1.00 0.00 ? 79  SER A CB   4  
ATOM 7031  O OG   . SER A 1 79  ? -12.069 -2.446  -1.975  1.00 0.00 ? 79  SER A OG   4  
ATOM 7032  H H    . SER A 1 79  ? -9.158  -1.294  0.427   1.00 0.00 ? 79  SER A H    4  
ATOM 7033  H HA   . SER A 1 79  ? -9.892  -0.949  -2.259  1.00 0.00 ? 79  SER A HA   4  
ATOM 7034  H HB2  . SER A 1 79  ? -10.364 -2.955  -0.952  1.00 0.00 ? 79  SER A HB2  4  
ATOM 7035  H HB3  . SER A 1 79  ? -11.580 -2.087  -0.004  1.00 0.00 ? 79  SER A HB3  4  
ATOM 7036  H HG   . SER A 1 79  ? -12.475 -3.305  -1.773  1.00 0.00 ? 79  SER A HG   4  
ATOM 7037  N N    . LEU A 1 80  ? -12.175 0.651   -0.472  1.00 0.00 ? 80  LEU A N    4  
ATOM 7038  C CA   . LEU A 1 80  ? -13.045 1.838   -0.510  1.00 0.00 ? 80  LEU A CA   4  
ATOM 7039  C C    . LEU A 1 80  ? -12.256 3.142   -0.315  1.00 0.00 ? 80  LEU A C    4  
ATOM 7040  O O    . LEU A 1 80  ? -12.625 4.194   -0.831  1.00 0.00 ? 80  LEU A O    4  
ATOM 7041  C CB   . LEU A 1 80  ? -14.168 1.692   0.533   1.00 0.00 ? 80  LEU A CB   4  
ATOM 7042  C CG   . LEU A 1 80  ? -15.142 0.517   0.297   1.00 0.00 ? 80  LEU A CG   4  
ATOM 7043  C CD1  . LEU A 1 80  ? -16.330 0.662   1.260   1.00 0.00 ? 80  LEU A CD1  4  
ATOM 7044  C CD2  . LEU A 1 80  ? -15.654 0.448   -1.152  1.00 0.00 ? 80  LEU A CD2  4  
ATOM 7045  H H    . LEU A 1 80  ? -12.194 0.038   0.330   1.00 0.00 ? 80  LEU A H    4  
ATOM 7046  H HA   . LEU A 1 80  ? -13.497 1.920   -1.499  1.00 0.00 ? 80  LEU A HA   4  
ATOM 7047  H HB2  . LEU A 1 80  ? -13.730 1.593   1.529   1.00 0.00 ? 80  LEU A HB2  4  
ATOM 7048  H HB3  . LEU A 1 80  ? -14.743 2.616   0.524   1.00 0.00 ? 80  LEU A HB3  4  
ATOM 7049  H HG   . LEU A 1 80  ? -14.630 -0.417  0.527   1.00 0.00 ? 80  LEU A HG   4  
ATOM 7050  H HD11 . LEU A 1 80  ? -15.975 0.726   2.287   1.00 0.00 ? 80  LEU A HD11 4  
ATOM 7051  H HD12 . LEU A 1 80  ? -16.896 1.566   1.027   1.00 0.00 ? 80  LEU A HD12 4  
ATOM 7052  H HD13 . LEU A 1 80  ? -16.989 -0.204  1.168   1.00 0.00 ? 80  LEU A HD13 4  
ATOM 7053  H HD21 . LEU A 1 80  ? -16.448 -0.297  -1.227  1.00 0.00 ? 80  LEU A HD21 4  
ATOM 7054  H HD22 . LEU A 1 80  ? -16.035 1.419   -1.465  1.00 0.00 ? 80  LEU A HD22 4  
ATOM 7055  H HD23 . LEU A 1 80  ? -14.844 0.153   -1.820  1.00 0.00 ? 80  LEU A HD23 4  
ATOM 7056  N N    . ASP A 1 81  ? -11.122 3.067   0.379   1.00 0.00 ? 81  ASP A N    4  
ATOM 7057  C CA   . ASP A 1 81  ? -10.250 4.213   0.632   1.00 0.00 ? 81  ASP A CA   4  
ATOM 7058  C C    . ASP A 1 81  ? -9.696  4.842   -0.660  1.00 0.00 ? 81  ASP A C    4  
ATOM 7059  O O    . ASP A 1 81  ? -9.713  6.064   -0.804  1.00 0.00 ? 81  ASP A O    4  
ATOM 7060  C CB   . ASP A 1 81  ? -9.138  3.736   1.571   1.00 0.00 ? 81  ASP A CB   4  
ATOM 7061  C CG   . ASP A 1 81  ? -8.231  4.871   2.032   1.00 0.00 ? 81  ASP A CG   4  
ATOM 7062  O OD1  . ASP A 1 81  ? -8.751  5.812   2.671   1.00 0.00 ? 81  ASP A OD1  4  
ATOM 7063  O OD2  . ASP A 1 81  ? -6.997  4.758   1.852   1.00 0.00 ? 81  ASP A OD2  4  
ATOM 7064  H H    . ASP A 1 81  ? -10.908 2.189   0.829   1.00 0.00 ? 81  ASP A H    4  
ATOM 7065  H HA   . ASP A 1 81  ? -10.845 4.976   1.132   1.00 0.00 ? 81  ASP A HA   4  
ATOM 7066  H HB2  . ASP A 1 81  ? -9.589  3.278   2.455   1.00 0.00 ? 81  ASP A HB2  4  
ATOM 7067  H HB3  . ASP A 1 81  ? -8.546  2.980   1.062   1.00 0.00 ? 81  ASP A HB3  4  
ATOM 7068  N N    . HIS A 1 82  ? -9.275  4.031   -1.635  1.00 0.00 ? 82  HIS A N    4  
ATOM 7069  C CA   . HIS A 1 82  ? -8.815  4.528   -2.936  1.00 0.00 ? 82  HIS A CA   4  
ATOM 7070  C C    . HIS A 1 82  ? -9.975  4.906   -3.893  1.00 0.00 ? 82  HIS A C    4  
ATOM 7071  O O    . HIS A 1 82  ? -9.730  5.513   -4.939  1.00 0.00 ? 82  HIS A O    4  
ATOM 7072  C CB   . HIS A 1 82  ? -7.791  3.546   -3.549  1.00 0.00 ? 82  HIS A CB   4  
ATOM 7073  C CG   . HIS A 1 82  ? -8.320  2.560   -4.567  1.00 0.00 ? 82  HIS A CG   4  
ATOM 7074  N ND1  . HIS A 1 82  ? -9.373  1.686   -4.417  1.00 0.00 ? 82  HIS A ND1  4  
ATOM 7075  C CD2  . HIS A 1 82  ? -7.809  2.350   -5.822  1.00 0.00 ? 82  HIS A CD2  4  
ATOM 7076  C CE1  . HIS A 1 82  ? -9.498  0.978   -5.551  1.00 0.00 ? 82  HIS A CE1  4  
ATOM 7077  N NE2  . HIS A 1 82  ? -8.559  1.342   -6.446  1.00 0.00 ? 82  HIS A NE2  4  
ATOM 7078  H H    . HIS A 1 82  ? -9.257  3.030   -1.465  1.00 0.00 ? 82  HIS A H    4  
ATOM 7079  H HA   . HIS A 1 82  ? -8.275  5.460   -2.754  1.00 0.00 ? 82  HIS A HA   4  
ATOM 7080  H HB2  . HIS A 1 82  ? -7.029  4.145   -4.054  1.00 0.00 ? 82  HIS A HB2  4  
ATOM 7081  H HB3  . HIS A 1 82  ? -7.276  2.992   -2.759  1.00 0.00 ? 82  HIS A HB3  4  
ATOM 7082  H HD1  . HIS A 1 82  ? -9.969  1.590   -3.602  1.00 0.00 ? 82  HIS A HD1  4  
ATOM 7083  H HD2  . HIS A 1 82  ? -6.961  2.873   -6.249  1.00 0.00 ? 82  HIS A HD2  4  
ATOM 7084  H HE1  . HIS A 1 82  ? -10.255 0.221   -5.717  1.00 0.00 ? 82  HIS A HE1  4  
ATOM 7085  N N    . GLU A 1 83  ? -11.232 4.590   -3.537  1.00 0.00 ? 83  GLU A N    4  
ATOM 7086  C CA   . GLU A 1 83  ? -12.417 4.961   -4.323  1.00 0.00 ? 83  GLU A CA   4  
ATOM 7087  C C    . GLU A 1 83  ? -12.894 6.396   -4.052  1.00 0.00 ? 83  GLU A C    4  
ATOM 7088  O O    . GLU A 1 83  ? -13.349 7.074   -4.979  1.00 0.00 ? 83  GLU A O    4  
ATOM 7089  C CB   . GLU A 1 83  ? -13.586 3.983   -4.080  1.00 0.00 ? 83  GLU A CB   4  
ATOM 7090  C CG   . GLU A 1 83  ? -13.386 2.612   -4.735  1.00 0.00 ? 83  GLU A CG   4  
ATOM 7091  C CD   . GLU A 1 83  ? -13.650 2.663   -6.247  1.00 0.00 ? 83  GLU A CD   4  
ATOM 7092  O OE1  . GLU A 1 83  ? -14.831 2.562   -6.659  1.00 0.00 ? 83  GLU A OE1  4  
ATOM 7093  O OE2  . GLU A 1 83  ? -12.689 2.794   -7.041  1.00 0.00 ? 83  GLU A OE2  4  
ATOM 7094  H H    . GLU A 1 83  ? -11.380 4.140   -2.643  1.00 0.00 ? 83  GLU A H    4  
ATOM 7095  H HA   . GLU A 1 83  ? -12.164 4.911   -5.372  1.00 0.00 ? 83  GLU A HA   4  
ATOM 7096  H HB2  . GLU A 1 83  ? -13.745 3.849   -3.012  1.00 0.00 ? 83  GLU A HB2  4  
ATOM 7097  H HB3  . GLU A 1 83  ? -14.504 4.414   -4.479  1.00 0.00 ? 83  GLU A HB3  4  
ATOM 7098  H HG2  . GLU A 1 83  ? -12.374 2.253   -4.548  1.00 0.00 ? 83  GLU A HG2  4  
ATOM 7099  H HG3  . GLU A 1 83  ? -14.078 1.902   -4.279  1.00 0.00 ? 83  GLU A HG3  4  
ATOM 7100  N N    . TYR A 1 84  ? -12.790 6.872   -2.804  1.00 0.00 ? 84  TYR A N    4  
ATOM 7101  C CA   . TYR A 1 84  ? -13.420 8.135   -2.380  1.00 0.00 ? 84  TYR A CA   4  
ATOM 7102  C C    . TYR A 1 84  ? -12.470 9.292   -2.011  1.00 0.00 ? 84  TYR A C    4  
ATOM 7103  O O    . TYR A 1 84  ? -12.771 10.447  -2.322  1.00 0.00 ? 84  TYR A O    4  
ATOM 7104  C CB   . TYR A 1 84  ? -14.315 7.853   -1.160  1.00 0.00 ? 84  TYR A CB   4  
ATOM 7105  C CG   . TYR A 1 84  ? -15.271 6.679   -1.237  1.00 0.00 ? 84  TYR A CG   4  
ATOM 7106  C CD1  . TYR A 1 84  ? -16.024 6.423   -2.401  1.00 0.00 ? 84  TYR A CD1  4  
ATOM 7107  C CD2  . TYR A 1 84  ? -15.420 5.853   -0.107  1.00 0.00 ? 84  TYR A CD2  4  
ATOM 7108  C CE1  . TYR A 1 84  ? -16.900 5.324   -2.439  1.00 0.00 ? 84  TYR A CE1  4  
ATOM 7109  C CE2  . TYR A 1 84  ? -16.303 4.763   -0.133  1.00 0.00 ? 84  TYR A CE2  4  
ATOM 7110  C CZ   . TYR A 1 84  ? -17.040 4.487   -1.309  1.00 0.00 ? 84  TYR A CZ   4  
ATOM 7111  O OH   . TYR A 1 84  ? -17.884 3.421   -1.362  1.00 0.00 ? 84  TYR A OH   4  
ATOM 7112  H H    . TYR A 1 84  ? -12.453 6.230   -2.098  1.00 0.00 ? 84  TYR A H    4  
ATOM 7113  H HA   . TYR A 1 84  ? -14.065 8.506   -3.179  1.00 0.00 ? 84  TYR A HA   4  
ATOM 7114  H HB2  . TYR A 1 84  ? -13.666 7.677   -0.306  1.00 0.00 ? 84  TYR A HB2  4  
ATOM 7115  H HB3  . TYR A 1 84  ? -14.901 8.751   -0.948  1.00 0.00 ? 84  TYR A HB3  4  
ATOM 7116  H HD1  . TYR A 1 84  ? -15.929 7.062   -3.266  1.00 0.00 ? 84  TYR A HD1  4  
ATOM 7117  H HD2  . TYR A 1 84  ? -14.852 6.054   0.789   1.00 0.00 ? 84  TYR A HD2  4  
ATOM 7118  H HE1  . TYR A 1 84  ? -17.466 5.113   -3.335  1.00 0.00 ? 84  TYR A HE1  4  
ATOM 7119  H HE2  . TYR A 1 84  ? -16.398 4.145   0.748   1.00 0.00 ? 84  TYR A HE2  4  
ATOM 7120  H HH   . TYR A 1 84  ? -17.868 2.909   -0.549  1.00 0.00 ? 84  TYR A HH   4  
ATOM 7121  N N    . GLN A 1 85  ? -11.408 9.028   -1.234  1.00 0.00 ? 85  GLN A N    4  
ATOM 7122  C CA   . GLN A 1 85  ? -11.097 9.898   -0.086  1.00 0.00 ? 85  GLN A CA   4  
ATOM 7123  C C    . GLN A 1 85  ? -9.598  10.163  0.191   1.00 0.00 ? 85  GLN A C    4  
ATOM 7124  O O    . GLN A 1 85  ? -8.753  9.323   -0.130  1.00 0.00 ? 85  GLN A O    4  
ATOM 7125  C CB   . GLN A 1 85  ? -11.753 9.273   1.164   1.00 0.00 ? 85  GLN A CB   4  
ATOM 7126  C CG   . GLN A 1 85  ? -11.305 7.826   1.458   1.00 0.00 ? 85  GLN A CG   4  
ATOM 7127  C CD   . GLN A 1 85  ? -12.042 7.190   2.633   1.00 0.00 ? 85  GLN A CD   4  
ATOM 7128  O OE1  . GLN A 1 85  ? -13.246 7.323   2.801   1.00 0.00 ? 85  GLN A OE1  4  
ATOM 7129  N NE2  . GLN A 1 85  ? -11.366 6.445   3.475   1.00 0.00 ? 85  GLN A NE2  4  
ATOM 7130  H H    . GLN A 1 85  ? -11.131 8.062   -1.133  1.00 0.00 ? 85  GLN A H    4  
ATOM 7131  H HA   . GLN A 1 85  ? -11.579 10.862  -0.250  1.00 0.00 ? 85  GLN A HA   4  
ATOM 7132  H HB2  . GLN A 1 85  ? -11.520 9.885   2.034   1.00 0.00 ? 85  GLN A HB2  4  
ATOM 7133  H HB3  . GLN A 1 85  ? -12.833 9.289   1.018   1.00 0.00 ? 85  GLN A HB3  4  
ATOM 7134  H HG2  . GLN A 1 85  ? -11.498 7.191   0.596   1.00 0.00 ? 85  GLN A HG2  4  
ATOM 7135  H HG3  . GLN A 1 85  ? -10.233 7.819   1.656   1.00 0.00 ? 85  GLN A HG3  4  
ATOM 7136  H HE21 . GLN A 1 85  ? -10.377 6.265   3.296   1.00 0.00 ? 85  GLN A HE21 4  
ATOM 7137  H HE22 . GLN A 1 85  ? -11.879 5.969   4.197   1.00 0.00 ? 85  GLN A HE22 4  
ATOM 7138  N N    . PRO A 1 86  ? -9.272  11.302  0.851   1.00 0.00 ? 86  PRO A N    4  
ATOM 7139  C CA   . PRO A 1 86  ? -7.942  11.604  1.380   1.00 0.00 ? 86  PRO A CA   4  
ATOM 7140  C C    . PRO A 1 86  ? -7.715  11.049  2.802   1.00 0.00 ? 86  PRO A C    4  
ATOM 7141  O O    . PRO A 1 86  ? -6.557  10.892  3.189   1.00 0.00 ? 86  PRO A O    4  
ATOM 7142  C CB   . PRO A 1 86  ? -7.870  13.133  1.386   1.00 0.00 ? 86  PRO A CB   4  
ATOM 7143  C CG   . PRO A 1 86  ? -9.304  13.546  1.714   1.00 0.00 ? 86  PRO A CG   4  
ATOM 7144  C CD   . PRO A 1 86  ? -10.135 12.474  1.006   1.00 0.00 ? 86  PRO A CD   4  
ATOM 7145  H HA   . PRO A 1 86  ? -7.171  11.204  0.721   1.00 0.00 ? 86  PRO A HA   4  
ATOM 7146  H HB2  . PRO A 1 86  ? -7.158  13.514  2.121   1.00 0.00 ? 86  PRO A HB2  4  
ATOM 7147  H HB3  . PRO A 1 86  ? -7.604  13.489  0.389   1.00 0.00 ? 86  PRO A HB3  4  
ATOM 7148  H HG2  . PRO A 1 86  ? -9.469  13.493  2.794   1.00 0.00 ? 86  PRO A HG2  4  
ATOM 7149  H HG3  . PRO A 1 86  ? -9.534  14.541  1.341   1.00 0.00 ? 86  PRO A HG3  4  
ATOM 7150  H HD2  . PRO A 1 86  ? -11.022 12.235  1.592   1.00 0.00 ? 86  PRO A HD2  4  
ATOM 7151  H HD3  . PRO A 1 86  ? -10.422 12.841  0.019   1.00 0.00 ? 86  PRO A HD3  4  
ATOM 7152  N N    . ARG A 1 87  ? -8.794  10.767  3.567   1.00 0.00 ? 87  ARG A N    4  
ATOM 7153  C CA   . ARG A 1 87  ? -8.833  10.145  4.897   1.00 0.00 ? 87  ARG A CA   4  
ATOM 7154  C C    . ARG A 1 87  ? -8.268  11.013  6.056   1.00 0.00 ? 87  ARG A C    4  
ATOM 7155  O O    . ARG A 1 87  ? -7.065  11.287  6.092   1.00 0.00 ? 87  ARG A O    4  
ATOM 7156  C CB   . ARG A 1 87  ? -8.205  8.744   4.819   1.00 0.00 ? 87  ARG A CB   4  
ATOM 7157  C CG   . ARG A 1 87  ? -8.210  8.011   6.169   1.00 0.00 ? 87  ARG A CG   4  
ATOM 7158  C CD   . ARG A 1 87  ? -8.200  6.485   6.015   1.00 0.00 ? 87  ARG A CD   4  
ATOM 7159  N NE   . ARG A 1 87  ? -7.244  6.024   4.994   1.00 0.00 ? 87  ARG A NE   4  
ATOM 7160  C CZ   . ARG A 1 87  ? -5.995  5.600   5.129   1.00 0.00 ? 87  ARG A CZ   4  
ATOM 7161  N NH1  . ARG A 1 87  ? -5.363  5.526   6.275   1.00 0.00 ? 87  ARG A NH1  4  
ATOM 7162  N NH2  . ARG A 1 87  ? -5.344  5.208   4.065   1.00 0.00 ? 87  ARG A NH2  4  
ATOM 7163  H H    . ARG A 1 87  ? -9.703  10.891  3.151   1.00 0.00 ? 87  ARG A H    4  
ATOM 7164  H HA   . ARG A 1 87  ? -9.888  9.965   5.090   1.00 0.00 ? 87  ARG A HA   4  
ATOM 7165  H HB2  . ARG A 1 87  ? -8.790  8.179   4.089   1.00 0.00 ? 87  ARG A HB2  4  
ATOM 7166  H HB3  . ARG A 1 87  ? -7.176  8.801   4.463   1.00 0.00 ? 87  ARG A HB3  4  
ATOM 7167  H HG2  . ARG A 1 87  ? -7.339  8.320   6.752   1.00 0.00 ? 87  ARG A HG2  4  
ATOM 7168  H HG3  . ARG A 1 87  ? -9.113  8.284   6.713   1.00 0.00 ? 87  ARG A HG3  4  
ATOM 7169  H HD2  . ARG A 1 87  ? -7.983  6.023   6.977   1.00 0.00 ? 87  ARG A HD2  4  
ATOM 7170  H HD3  . ARG A 1 87  ? -9.214  6.191   5.725   1.00 0.00 ? 87  ARG A HD3  4  
ATOM 7171  H HE   . ARG A 1 87  ? -7.612  6.023   4.043   1.00 0.00 ? 87  ARG A HE   4  
ATOM 7172  H HH11 . ARG A 1 87  ? -5.833  5.720   7.142   1.00 0.00 ? 87  ARG A HH11 4  
ATOM 7173  H HH12 . ARG A 1 87  ? -4.400  5.192   6.286   1.00 0.00 ? 87  ARG A HH12 4  
ATOM 7174  H HH21 . ARG A 1 87  ? -5.822  5.183   3.168   1.00 0.00 ? 87  ARG A HH21 4  
ATOM 7175  H HH22 . ARG A 1 87  ? -4.453  4.727   4.173   1.00 0.00 ? 87  ARG A HH22 4  
ATOM 7176  N N    . PRO A 1 88  ? -9.100  11.380  7.062   1.00 0.00 ? 88  PRO A N    4  
ATOM 7177  C CA   . PRO A 1 88  ? -8.646  12.005  8.305   1.00 0.00 ? 88  PRO A CA   4  
ATOM 7178  C C    . PRO A 1 88  ? -8.048  10.916  9.211   1.00 0.00 ? 88  PRO A C    4  
ATOM 7179  O O    . PRO A 1 88  ? -8.743  10.278  9.997   1.00 0.00 ? 88  PRO A O    4  
ATOM 7180  C CB   . PRO A 1 88  ? -9.890  12.692  8.882   1.00 0.00 ? 88  PRO A CB   4  
ATOM 7181  C CG   . PRO A 1 88  ? -11.040 11.797  8.423   1.00 0.00 ? 88  PRO A CG   4  
ATOM 7182  C CD   . PRO A 1 88  ? -10.557 11.270  7.074   1.00 0.00 ? 88  PRO A CD   4  
ATOM 7183  H HA   . PRO A 1 88  ? -7.891  12.766  8.107   1.00 0.00 ? 88  PRO A HA   4  
ATOM 7184  H HB2  . PRO A 1 88  ? -9.854  12.791  9.965   1.00 0.00 ? 88  PRO A HB2  4  
ATOM 7185  H HB3  . PRO A 1 88  ? -10.000 13.676  8.421   1.00 0.00 ? 88  PRO A HB3  4  
ATOM 7186  H HG2  . PRO A 1 88  ? -11.169 10.961  9.111   1.00 0.00 ? 88  PRO A HG2  4  
ATOM 7187  H HG3  . PRO A 1 88  ? -11.969 12.360  8.328   1.00 0.00 ? 88  PRO A HG3  4  
ATOM 7188  H HD2  . PRO A 1 88  ? -10.877 10.232  6.964   1.00 0.00 ? 88  PRO A HD2  4  
ATOM 7189  H HD3  . PRO A 1 88  ? -10.966 11.887  6.273   1.00 0.00 ? 88  PRO A HD3  4  
ATOM 7190  N N    . VAL A 1 89  ? -6.744  10.664  9.051   1.00 0.00 ? 89  VAL A N    4  
ATOM 7191  C CA   . VAL A 1 89  ? -6.030  9.522   9.660   1.00 0.00 ? 89  VAL A CA   4  
ATOM 7192  C C    . VAL A 1 89  ? -6.136  9.496   11.190  1.00 0.00 ? 89  VAL A C    4  
ATOM 7193  O O    . VAL A 1 89  ? -6.326  8.426   11.765  1.00 0.00 ? 89  VAL A O    4  
ATOM 7194  C CB   . VAL A 1 89  ? -4.555  9.504   9.174   1.00 0.00 ? 89  VAL A CB   4  
ATOM 7195  C CG1  . VAL A 1 89  ? -3.582  8.762   10.101  1.00 0.00 ? 89  VAL A CG1  4  
ATOM 7196  C CG2  . VAL A 1 89  ? -4.505  8.876   7.769   1.00 0.00 ? 89  VAL A CG2  4  
ATOM 7197  H H    . VAL A 1 89  ? -6.241  11.238  8.375   1.00 0.00 ? 89  VAL A H    4  
ATOM 7198  H HA   . VAL A 1 89  ? -6.513  8.610   9.298   1.00 0.00 ? 89  VAL A HA   4  
ATOM 7199  H HB   . VAL A 1 89  ? -4.208  10.534  9.099   1.00 0.00 ? 89  VAL A HB   4  
ATOM 7200  H HG11 . VAL A 1 89  ? -3.482  9.292   11.048  1.00 0.00 ? 89  VAL A HG11 4  
ATOM 7201  H HG12 . VAL A 1 89  ? -3.949  7.757   10.296  1.00 0.00 ? 89  VAL A HG12 4  
ATOM 7202  H HG13 . VAL A 1 89  ? -2.598  8.707   9.638   1.00 0.00 ? 89  VAL A HG13 4  
ATOM 7203  H HG21 . VAL A 1 89  ? -5.149  9.428   7.080   1.00 0.00 ? 89  VAL A HG21 4  
ATOM 7204  H HG22 . VAL A 1 89  ? -3.486  8.907   7.381   1.00 0.00 ? 89  VAL A HG22 4  
ATOM 7205  H HG23 . VAL A 1 89  ? -4.838  7.836   7.809   1.00 0.00 ? 89  VAL A HG23 4  
ATOM 7206  N N    . GLU A 1 90  ? -6.078  10.653  11.853  1.00 0.00 ? 90  GLU A N    4  
ATOM 7207  C CA   . GLU A 1 90  ? -6.219  10.737  13.311  1.00 0.00 ? 90  GLU A CA   4  
ATOM 7208  C C    . GLU A 1 90  ? -7.647  10.395  13.765  1.00 0.00 ? 90  GLU A C    4  
ATOM 7209  O O    . GLU A 1 90  ? -7.812  9.662   14.737  1.00 0.00 ? 90  GLU A O    4  
ATOM 7210  C CB   . GLU A 1 90  ? -5.707  12.087  13.856  1.00 0.00 ? 90  GLU A CB   4  
ATOM 7211  C CG   . GLU A 1 90  ? -6.619  13.307  13.693  1.00 0.00 ? 90  GLU A CG   4  
ATOM 7212  C CD   . GLU A 1 90  ? -6.866  13.671  12.228  1.00 0.00 ? 90  GLU A CD   4  
ATOM 7213  O OE1  . GLU A 1 90  ? -7.734  13.016  11.605  1.00 0.00 ? 90  GLU A OE1  4  
ATOM 7214  O OE2  . GLU A 1 90  ? -6.174  14.571  11.693  1.00 0.00 ? 90  GLU A OE2  4  
ATOM 7215  H H    . GLU A 1 90  ? -6.033  11.512  11.317  1.00 0.00 ? 90  GLU A H    4  
ATOM 7216  H HA   . GLU A 1 90  ? -5.564  9.979   13.742  1.00 0.00 ? 90  GLU A HA   4  
ATOM 7217  H HB2  . GLU A 1 90  ? -5.530  11.958  14.925  1.00 0.00 ? 90  GLU A HB2  4  
ATOM 7218  H HB3  . GLU A 1 90  ? -4.744  12.306  13.390  1.00 0.00 ? 90  GLU A HB3  4  
ATOM 7219  H HG2  . GLU A 1 90  ? -7.567  13.116  14.194  1.00 0.00 ? 90  GLU A HG2  4  
ATOM 7220  H HG3  . GLU A 1 90  ? -6.146  14.151  14.197  1.00 0.00 ? 90  GLU A HG3  4  
ATOM 7221  N N    . VAL A 1 91  ? -8.678  10.822  13.026  1.00 0.00 ? 91  VAL A N    4  
ATOM 7222  C CA   . VAL A 1 91  ? -10.076 10.418  13.276  1.00 0.00 ? 91  VAL A CA   4  
ATOM 7223  C C    . VAL A 1 91  ? -10.264 8.904   13.079  1.00 0.00 ? 91  VAL A C    4  
ATOM 7224  O O    . VAL A 1 91  ? -10.973 8.283   13.871  1.00 0.00 ? 91  VAL A O    4  
ATOM 7225  C CB   . VAL A 1 91  ? -11.071 11.224  12.403  1.00 0.00 ? 91  VAL A CB   4  
ATOM 7226  C CG1  . VAL A 1 91  ? -12.509 10.672  12.438  1.00 0.00 ? 91  VAL A CG1  4  
ATOM 7227  C CG2  . VAL A 1 91  ? -11.117 12.695  12.851  1.00 0.00 ? 91  VAL A CG2  4  
ATOM 7228  H H    . VAL A 1 91  ? -8.460  11.492  12.270  1.00 0.00 ? 91  VAL A H    4  
ATOM 7229  H HA   . VAL A 1 91  ? -10.303 10.644  14.320  1.00 0.00 ? 91  VAL A HA   4  
ATOM 7230  H HB   . VAL A 1 91  ? -10.736 11.187  11.373  1.00 0.00 ? 91  VAL A HB   4  
ATOM 7231  H HG11 . VAL A 1 91  ? -13.174 11.324  11.866  1.00 0.00 ? 91  VAL A HG11 4  
ATOM 7232  H HG12 . VAL A 1 91  ? -12.547 9.679   11.991  1.00 0.00 ? 91  VAL A HG12 4  
ATOM 7233  H HG13 . VAL A 1 91  ? -12.866 10.619  13.465  1.00 0.00 ? 91  VAL A HG13 4  
ATOM 7234  H HG21 . VAL A 1 91  ? -10.123 13.135  12.815  1.00 0.00 ? 91  VAL A HG21 4  
ATOM 7235  H HG22 . VAL A 1 91  ? -11.773 13.263  12.191  1.00 0.00 ? 91  VAL A HG22 4  
ATOM 7236  H HG23 . VAL A 1 91  ? -11.495 12.759  13.872  1.00 0.00 ? 91  VAL A HG23 4  
ATOM 7237  N N    . ILE A 1 92  ? -9.609  8.285   12.084  1.00 0.00 ? 92  ILE A N    4  
ATOM 7238  C CA   . ILE A 1 92  ? -9.686  6.821   11.873  1.00 0.00 ? 92  ILE A CA   4  
ATOM 7239  C C    . ILE A 1 92  ? -9.060  6.075   13.066  1.00 0.00 ? 92  ILE A C    4  
ATOM 7240  O O    . ILE A 1 92  ? -9.671  5.162   13.622  1.00 0.00 ? 92  ILE A O    4  
ATOM 7241  C CB   . ILE A 1 92  ? -9.016  6.409   10.537  1.00 0.00 ? 92  ILE A CB   4  
ATOM 7242  C CG1  . ILE A 1 92  ? -9.535  7.135   9.271   1.00 0.00 ? 92  ILE A CG1  4  
ATOM 7243  C CG2  . ILE A 1 92  ? -9.114  4.886   10.314  1.00 0.00 ? 92  ILE A CG2  4  
ATOM 7244  C CD1  . ILE A 1 92  ? -10.958 7.709   9.245   1.00 0.00 ? 92  ILE A CD1  4  
ATOM 7245  H H    . ILE A 1 92  ? -9.076  8.860   11.435  1.00 0.00 ? 92  ILE A H    4  
ATOM 7246  H HA   . ILE A 1 92  ? -10.733 6.512   11.841  1.00 0.00 ? 92  ILE A HA   4  
ATOM 7247  H HB   . ILE A 1 92  ? -7.950  6.636   10.612  1.00 0.00 ? 92  ILE A HB   4  
ATOM 7248  H HG12 . ILE A 1 92  ? -8.849  7.949   9.051   1.00 0.00 ? 92  ILE A HG12 4  
ATOM 7249  H HG13 . ILE A 1 92  ? -9.480  6.445   8.436   1.00 0.00 ? 92  ILE A HG13 4  
ATOM 7250  H HG21 . ILE A 1 92  ? -8.578  4.603   9.408   1.00 0.00 ? 92  ILE A HG21 4  
ATOM 7251  H HG22 . ILE A 1 92  ? -8.663  4.342   11.145  1.00 0.00 ? 92  ILE A HG22 4  
ATOM 7252  H HG23 . ILE A 1 92  ? -10.153 4.586   10.209  1.00 0.00 ? 92  ILE A HG23 4  
ATOM 7253  H HD11 . ILE A 1 92  ? -11.175 8.062   8.233   1.00 0.00 ? 92  ILE A HD11 4  
ATOM 7254  H HD12 . ILE A 1 92  ? -11.681 6.942   9.520   1.00 0.00 ? 92  ILE A HD12 4  
ATOM 7255  H HD13 . ILE A 1 92  ? -11.041 8.557   9.919   1.00 0.00 ? 92  ILE A HD13 4  
ATOM 7256  N N    . ILE A 1 93  ? -7.865  6.503   13.493  1.00 0.00 ? 93  ILE A N    4  
ATOM 7257  C CA   . ILE A 1 93  ? -7.160  5.958   14.672  1.00 0.00 ? 93  ILE A CA   4  
ATOM 7258  C C    . ILE A 1 93  ? -7.985  6.171   15.953  1.00 0.00 ? 93  ILE A C    4  
ATOM 7259  O O    . ILE A 1 93  ? -8.085  5.267   16.779  1.00 0.00 ? 93  ILE A O    4  
ATOM 7260  C CB   . ILE A 1 93  ? -5.737  6.577   14.762  1.00 0.00 ? 93  ILE A CB   4  
ATOM 7261  C CG1  . ILE A 1 93  ? -4.861  6.060   13.594  1.00 0.00 ? 93  ILE A CG1  4  
ATOM 7262  C CG2  . ILE A 1 93  ? -5.067  6.268   16.116  1.00 0.00 ? 93  ILE A CG2  4  
ATOM 7263  C CD1  . ILE A 1 93  ? -3.528  6.801   13.421  1.00 0.00 ? 93  ILE A CD1  4  
ATOM 7264  H H    . ILE A 1 93  ? -7.437  7.272   12.984  1.00 0.00 ? 93  ILE A H    4  
ATOM 7265  H HA   . ILE A 1 93  ? -7.065  4.874   14.561  1.00 0.00 ? 93  ILE A HA   4  
ATOM 7266  H HB   . ILE A 1 93  ? -5.825  7.662   14.678  1.00 0.00 ? 93  ILE A HB   4  
ATOM 7267  H HG12 . ILE A 1 93  ? -4.661  5.000   13.735  1.00 0.00 ? 93  ILE A HG12 4  
ATOM 7268  H HG13 . ILE A 1 93  ? -5.405  6.167   12.657  1.00 0.00 ? 93  ILE A HG13 4  
ATOM 7269  H HG21 . ILE A 1 93  ? -4.062  6.686   16.155  1.00 0.00 ? 93  ILE A HG21 4  
ATOM 7270  H HG22 . ILE A 1 93  ? -5.630  6.723   16.929  1.00 0.00 ? 93  ILE A HG22 4  
ATOM 7271  H HG23 . ILE A 1 93  ? -5.016  5.192   16.267  1.00 0.00 ? 93  ILE A HG23 4  
ATOM 7272  H HD11 . ILE A 1 93  ? -3.714  7.868   13.280  1.00 0.00 ? 93  ILE A HD11 4  
ATOM 7273  H HD12 . ILE A 1 93  ? -2.890  6.657   14.292  1.00 0.00 ? 93  ILE A HD12 4  
ATOM 7274  H HD13 . ILE A 1 93  ? -2.998  6.411   12.554  1.00 0.00 ? 93  ILE A HD13 4  
ATOM 7275  N N    . SER A 1 94  ? -8.614  7.333   16.107  1.00 0.00 ? 94  SER A N    4  
ATOM 7276  C CA   . SER A 1 94  ? -9.484  7.635   17.246  1.00 0.00 ? 94  SER A CA   4  
ATOM 7277  C C    . SER A 1 94  ? -10.711 6.709   17.276  1.00 0.00 ? 94  SER A C    4  
ATOM 7278  O O    . SER A 1 94  ? -11.038 6.158   18.324  1.00 0.00 ? 94  SER A O    4  
ATOM 7279  C CB   . SER A 1 94  ? -9.896  9.115   17.207  1.00 0.00 ? 94  SER A CB   4  
ATOM 7280  O OG   . SER A 1 94  ? -10.570 9.503   18.395  1.00 0.00 ? 94  SER A OG   4  
ATOM 7281  H H    . SER A 1 94  ? -8.475  8.058   15.410  1.00 0.00 ? 94  SER A H    4  
ATOM 7282  H HA   . SER A 1 94  ? -8.921  7.469   18.163  1.00 0.00 ? 94  SER A HA   4  
ATOM 7283  H HB2  . SER A 1 94  ? -9.001  9.730   17.101  1.00 0.00 ? 94  SER A HB2  4  
ATOM 7284  H HB3  . SER A 1 94  ? -10.544 9.287   16.346  1.00 0.00 ? 94  SER A HB3  4  
ATOM 7285  H HG   . SER A 1 94  ? -10.802 10.442  18.332  1.00 0.00 ? 94  SER A HG   4  
ATOM 7286  N N    . SER A 1 95  ? -11.349 6.453   16.126  1.00 0.00 ? 95  SER A N    4  
ATOM 7287  C CA   . SER A 1 95  ? -12.474 5.518   16.030  1.00 0.00 ? 95  SER A CA   4  
ATOM 7288  C C    . SER A 1 95  ? -12.092 4.099   16.483  1.00 0.00 ? 95  SER A C    4  
ATOM 7289  O O    . SER A 1 95  ? -12.840 3.460   17.226  1.00 0.00 ? 95  SER A O    4  
ATOM 7290  C CB   . SER A 1 95  ? -13.027 5.484   14.594  1.00 0.00 ? 95  SER A CB   4  
ATOM 7291  O OG   . SER A 1 95  ? -14.317 4.890   14.594  1.00 0.00 ? 95  SER A OG   4  
ATOM 7292  H H    . SER A 1 95  ? -11.034 6.914   15.281  1.00 0.00 ? 95  SER A H    4  
ATOM 7293  H HA   . SER A 1 95  ? -13.269 5.871   16.687  1.00 0.00 ? 95  SER A HA   4  
ATOM 7294  H HB2  . SER A 1 95  ? -13.107 6.504   14.213  1.00 0.00 ? 95  SER A HB2  4  
ATOM 7295  H HB3  . SER A 1 95  ? -12.345 4.924   13.955  1.00 0.00 ? 95  SER A HB3  4  
ATOM 7296  H HG   . SER A 1 95  ? -14.557 4.575   13.699  1.00 0.00 ? 95  SER A HG   4  
ATOM 7297  N N    . ALA A 1 96  ? -10.892 3.629   16.118  1.00 0.00 ? 96  ALA A N    4  
ATOM 7298  C CA   . ALA A 1 96  ? -10.358 2.343   16.567  1.00 0.00 ? 96  ALA A CA   4  
ATOM 7299  C C    . ALA A 1 96  ? -10.137 2.311   18.090  1.00 0.00 ? 96  ALA A C    4  
ATOM 7300  O O    . ALA A 1 96  ? -10.673 1.442   18.784  1.00 0.00 ? 96  ALA A O    4  
ATOM 7301  C CB   . ALA A 1 96  ? -9.073  2.069   15.767  1.00 0.00 ? 96  ALA A CB   4  
ATOM 7302  H H    . ALA A 1 96  ? -10.312 4.203   15.516  1.00 0.00 ? 96  ALA A H    4  
ATOM 7303  H HA   . ALA A 1 96  ? -11.089 1.566   16.347  1.00 0.00 ? 96  ALA A HA   4  
ATOM 7304  H HB1  . ALA A 1 96  ? -8.786  1.026   15.887  1.00 0.00 ? 96  ALA A HB1  4  
ATOM 7305  H HB2  . ALA A 1 96  ? -9.235  2.257   14.703  1.00 0.00 ? 96  ALA A HB2  4  
ATOM 7306  H HB3  . ALA A 1 96  ? -8.264  2.710   16.115  1.00 0.00 ? 96  ALA A HB3  4  
ATOM 7307  N N    . LYS A 1 97  ? -9.413  3.298   18.630  1.00 0.00 ? 97  LYS A N    4  
ATOM 7308  C CA   . LYS A 1 97  ? -9.168  3.436   20.072  1.00 0.00 ? 97  LYS A CA   4  
ATOM 7309  C C    . LYS A 1 97  ? -10.453 3.688   20.895  1.00 0.00 ? 97  LYS A C    4  
ATOM 7310  O O    . LYS A 1 97  ? -10.478 3.373   22.087  1.00 0.00 ? 97  LYS A O    4  
ATOM 7311  C CB   . LYS A 1 97  ? -8.145  4.557   20.314  1.00 0.00 ? 97  LYS A CB   4  
ATOM 7312  C CG   . LYS A 1 97  ? -6.733  4.251   19.782  1.00 0.00 ? 97  LYS A CG   4  
ATOM 7313  C CD   . LYS A 1 97  ? -5.807  5.442   20.083  1.00 0.00 ? 97  LYS A CD   4  
ATOM 7314  C CE   . LYS A 1 97  ? -4.366  5.156   19.638  1.00 0.00 ? 97  LYS A CE   4  
ATOM 7315  N NZ   . LYS A 1 97  ? -3.452  6.285   19.976  1.00 0.00 ? 97  LYS A NZ   4  
ATOM 7316  H H    . LYS A 1 97  ? -9.018  3.998   18.006  1.00 0.00 ? 97  LYS A H    4  
ATOM 7317  H HA   . LYS A 1 97  ? -8.743  2.501   20.441  1.00 0.00 ? 97  LYS A HA   4  
ATOM 7318  H HB2  . LYS A 1 97  ? -8.513  5.481   19.861  1.00 0.00 ? 97  LYS A HB2  4  
ATOM 7319  H HB3  . LYS A 1 97  ? -8.063  4.705   21.391  1.00 0.00 ? 97  LYS A HB3  4  
ATOM 7320  H HG2  . LYS A 1 97  ? -6.350  3.355   20.273  1.00 0.00 ? 97  LYS A HG2  4  
ATOM 7321  H HG3  . LYS A 1 97  ? -6.760  4.074   18.707  1.00 0.00 ? 97  LYS A HG3  4  
ATOM 7322  H HD2  . LYS A 1 97  ? -6.183  6.326   19.560  1.00 0.00 ? 97  LYS A HD2  4  
ATOM 7323  H HD3  . LYS A 1 97  ? -5.820  5.641   21.156  1.00 0.00 ? 97  LYS A HD3  4  
ATOM 7324  H HE2  . LYS A 1 97  ? -4.019  4.243   20.134  1.00 0.00 ? 97  LYS A HE2  4  
ATOM 7325  H HE3  . LYS A 1 97  ? -4.358  4.981   18.557  1.00 0.00 ? 97  LYS A HE3  4  
ATOM 7326  H HZ1  . LYS A 1 97  ? -2.506  6.086   19.676  1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 7327  H HZ2  . LYS A 1 97  ? -3.746  7.143   19.529  1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 7328  H HZ3  . LYS A 1 97  ? -3.427  6.450   20.975  1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 7329  N N    . GLU A 1 98  ? -11.524 4.205   20.284  1.00 0.00 ? 98  GLU A N    4  
ATOM 7330  C CA   . GLU A 1 98  ? -12.852 4.298   20.892  1.00 0.00 ? 98  GLU A CA   4  
ATOM 7331  C C    . GLU A 1 98  ? -13.600 2.957   20.870  1.00 0.00 ? 98  GLU A C    4  
ATOM 7332  O O    . GLU A 1 98  ? -14.112 2.533   21.906  1.00 0.00 ? 98  GLU A O    4  
ATOM 7333  C CB   . GLU A 1 98  ? -13.708 5.386   20.222  1.00 0.00 ? 98  GLU A CB   4  
ATOM 7334  C CG   . GLU A 1 98  ? -13.327 6.803   20.669  1.00 0.00 ? 98  GLU A CG   4  
ATOM 7335  C CD   . GLU A 1 98  ? -14.302 7.851   20.108  1.00 0.00 ? 98  GLU A CD   4  
ATOM 7336  O OE1  . GLU A 1 98  ? -14.436 7.975   18.867  1.00 0.00 ? 98  GLU A OE1  4  
ATOM 7337  O OE2  . GLU A 1 98  ? -14.949 8.565   20.912  1.00 0.00 ? 98  GLU A OE2  4  
ATOM 7338  H H    . GLU A 1 98  ? -11.399 4.595   19.358  1.00 0.00 ? 98  GLU A H    4  
ATOM 7339  H HA   . GLU A 1 98  ? -12.726 4.565   21.931  1.00 0.00 ? 98  GLU A HA   4  
ATOM 7340  H HB2  . GLU A 1 98  ? -13.637 5.304   19.137  1.00 0.00 ? 98  GLU A HB2  4  
ATOM 7341  H HB3  . GLU A 1 98  ? -14.750 5.225   20.502  1.00 0.00 ? 98  GLU A HB3  4  
ATOM 7342  H HG2  . GLU A 1 98  ? -13.353 6.839   21.761  1.00 0.00 ? 98  GLU A HG2  4  
ATOM 7343  H HG3  . GLU A 1 98  ? -12.313 7.043   20.353  1.00 0.00 ? 98  GLU A HG3  4  
ATOM 7344  N N    . MET A 1 99  ? -13.673 2.286   19.712  1.00 0.00 ? 99  MET A N    4  
ATOM 7345  C CA   . MET A 1 99  ? -14.528 1.099   19.544  1.00 0.00 ? 99  MET A CA   4  
ATOM 7346  C C    . MET A 1 99  ? -13.895 -0.208  20.027  1.00 0.00 ? 99  MET A C    4  
ATOM 7347  O O    . MET A 1 99  ? -14.599 -1.201  20.192  1.00 0.00 ? 99  MET A O    4  
ATOM 7348  C CB   . MET A 1 99  ? -15.103 1.009   18.125  1.00 0.00 ? 99  MET A CB   4  
ATOM 7349  C CG   . MET A 1 99  ? -14.275 0.247   17.082  1.00 0.00 ? 99  MET A CG   4  
ATOM 7350  S SD   . MET A 1 99  ? -15.120 0.060   15.486  1.00 0.00 ? 99  MET A SD   4  
ATOM 7351  C CE   . MET A 1 99  ? -16.502 -1.030  15.936  1.00 0.00 ? 99  MET A CE   4  
ATOM 7352  H H    . MET A 1 99  ? -13.236 2.695   18.890  1.00 0.00 ? 99  MET A H    4  
ATOM 7353  H HA   . MET A 1 99  ? -15.393 1.247   20.195  1.00 0.00 ? 99  MET A HA   4  
ATOM 7354  H HB2  . MET A 1 99  ? -16.059 0.506   18.220  1.00 0.00 ? 99  MET A HB2  4  
ATOM 7355  H HB3  . MET A 1 99  ? -15.292 2.018   17.759  1.00 0.00 ? 99  MET A HB3  4  
ATOM 7356  H HG2  . MET A 1 99  ? -13.342 0.788   16.920  1.00 0.00 ? 99  MET A HG2  4  
ATOM 7357  H HG3  . MET A 1 99  ? -14.036 -0.749  17.456  1.00 0.00 ? 99  MET A HG3  4  
ATOM 7358  H HE1  . MET A 1 99  ? -16.116 -1.958  16.356  1.00 0.00 ? 99  MET A HE1  4  
ATOM 7359  H HE2  . MET A 1 99  ? -17.153 -0.553  16.669  1.00 0.00 ? 99  MET A HE2  4  
ATOM 7360  H HE3  . MET A 1 99  ? -17.088 -1.260  15.046  1.00 0.00 ? 99  MET A HE3  4  
ATOM 7361  N N    . VAL A 1 100 ? -12.588 -0.234  20.273  1.00 0.00 ? 100 VAL A N    4  
ATOM 7362  C CA   . VAL A 1 100 ? -11.942 -1.368  20.951  1.00 0.00 ? 100 VAL A CA   4  
ATOM 7363  C C    . VAL A 1 100 ? -12.618 -1.632  22.306  1.00 0.00 ? 100 VAL A C    4  
ATOM 7364  O O    . VAL A 1 100 ? -12.787 -0.730  23.129  1.00 0.00 ? 100 VAL A O    4  
ATOM 7365  C CB   . VAL A 1 100 ? -10.412 -1.227  21.051  1.00 0.00 ? 100 VAL A CB   4  
ATOM 7366  C CG1  . VAL A 1 100 ? -9.935  -0.053  21.916  1.00 0.00 ? 100 VAL A CG1  4  
ATOM 7367  C CG2  . VAL A 1 100 ? -9.786  -2.539  21.543  1.00 0.00 ? 100 VAL A CG2  4  
ATOM 7368  H H    . VAL A 1 100 ? -12.046 0.562   19.958  1.00 0.00 ? 100 VAL A H    4  
ATOM 7369  H HA   . VAL A 1 100 ? -12.129 -2.238  20.329  1.00 0.00 ? 100 VAL A HA   4  
ATOM 7370  H HB   . VAL A 1 100 ? -10.054 -1.051  20.038  1.00 0.00 ? 100 VAL A HB   4  
ATOM 7371  H HG11 . VAL A 1 100 ? -10.167 -0.227  22.967  1.00 0.00 ? 100 VAL A HG11 4  
ATOM 7372  H HG12 . VAL A 1 100 ? -8.855  0.063   21.812  1.00 0.00 ? 100 VAL A HG12 4  
ATOM 7373  H HG13 . VAL A 1 100 ? -10.420 0.860   21.581  1.00 0.00 ? 100 VAL A HG13 4  
ATOM 7374  H HG21 . VAL A 1 100 ? -10.081 -3.359  20.889  1.00 0.00 ? 100 VAL A HG21 4  
ATOM 7375  H HG22 . VAL A 1 100 ? -8.701  -2.454  21.525  1.00 0.00 ? 100 VAL A HG22 4  
ATOM 7376  H HG23 . VAL A 1 100 ? -10.107 -2.759  22.561  1.00 0.00 ? 100 VAL A HG23 4  
ATOM 7377  N N    . GLY A 1 101 ? -13.056 -2.882  22.484  1.00 0.00 ? 101 GLY A N    4  
ATOM 7378  C CA   . GLY A 1 101 ? -13.911 -3.334  23.588  1.00 0.00 ? 101 GLY A CA   4  
ATOM 7379  C C    . GLY A 1 101 ? -15.397 -3.473  23.221  1.00 0.00 ? 101 GLY A C    4  
ATOM 7380  O O    . GLY A 1 101 ? -16.155 -4.018  24.020  1.00 0.00 ? 101 GLY A O    4  
ATOM 7381  H H    . GLY A 1 101 ? -12.838 -3.553  21.758  1.00 0.00 ? 101 GLY A H    4  
ATOM 7382  H HA2  . GLY A 1 101 ? -13.571 -4.320  23.904  1.00 0.00 ? 101 GLY A HA2  4  
ATOM 7383  H HA3  . GLY A 1 101 ? -13.839 -2.642  24.427  1.00 0.00 ? 101 GLY A HA3  4  
ATOM 7384  N N    . GLN A 1 102 ? -15.830 -3.027  22.032  1.00 0.00 ? 102 GLN A N    4  
ATOM 7385  C CA   . GLN A 1 102 ? -17.168 -3.299  21.506  1.00 0.00 ? 102 GLN A CA   4  
ATOM 7386  C C    . GLN A 1 102 ? -17.308 -4.772  21.113  1.00 0.00 ? 102 GLN A C    4  
ATOM 7387  O O    . GLN A 1 102 ? -16.344 -5.449  20.733  1.00 0.00 ? 102 GLN A O    4  
ATOM 7388  C CB   . GLN A 1 102 ? -17.488 -2.426  20.273  1.00 0.00 ? 102 GLN A CB   4  
ATOM 7389  C CG   . GLN A 1 102 ? -17.729 -0.938  20.567  1.00 0.00 ? 102 GLN A CG   4  
ATOM 7390  C CD   . GLN A 1 102 ? -19.024 -0.703  21.348  1.00 0.00 ? 102 GLN A CD   4  
ATOM 7391  O OE1  . GLN A 1 102 ? -19.034 -0.565  22.566  1.00 0.00 ? 102 GLN A OE1  4  
ATOM 7392  N NE2  . GLN A 1 102 ? -20.168 -0.675  20.692  1.00 0.00 ? 102 GLN A NE2  4  
ATOM 7393  H H    . GLN A 1 102 ? -15.190 -2.550  21.414  1.00 0.00 ? 102 GLN A H    4  
ATOM 7394  H HA   . GLN A 1 102 ? -17.902 -3.099  22.291  1.00 0.00 ? 102 GLN A HA   4  
ATOM 7395  H HB2  . GLN A 1 102 ? -16.682 -2.525  19.546  1.00 0.00 ? 102 GLN A HB2  4  
ATOM 7396  H HB3  . GLN A 1 102 ? -18.390 -2.809  19.794  1.00 0.00 ? 102 GLN A HB3  4  
ATOM 7397  H HG2  . GLN A 1 102 ? -16.893 -0.525  21.131  1.00 0.00 ? 102 GLN A HG2  4  
ATOM 7398  H HG3  . GLN A 1 102 ? -17.787 -0.411  19.613  1.00 0.00 ? 102 GLN A HG3  4  
ATOM 7399  H HE21 . GLN A 1 102 ? -20.193 -0.785  19.688  1.00 0.00 ? 102 GLN A HE21 4  
ATOM 7400  H HE22 . GLN A 1 102 ? -21.018 -0.524  21.214  1.00 0.00 ? 102 GLN A HE22 4  
ATOM 7401  N N    . LYS A 1 103 ? -18.561 -5.227  21.153  1.00 0.00 ? 103 LYS A N    4  
ATOM 7402  C CA   . LYS A 1 103 ? -19.004 -6.521  20.630  1.00 0.00 ? 103 LYS A CA   4  
ATOM 7403  C C    . LYS A 1 103 ? -20.199 -6.371  19.671  1.00 0.00 ? 103 LYS A C    4  
ATOM 7404  O O    . LYS A 1 103 ? -21.083 -5.542  19.908  1.00 0.00 ? 103 LYS A O    4  
ATOM 7405  C CB   . LYS A 1 103 ? -19.338 -7.474  21.795  1.00 0.00 ? 103 LYS A CB   4  
ATOM 7406  C CG   . LYS A 1 103 ? -18.098 -7.728  22.669  1.00 0.00 ? 103 LYS A CG   4  
ATOM 7407  C CD   . LYS A 1 103 ? -18.296 -8.784  23.759  1.00 0.00 ? 103 LYS A CD   4  
ATOM 7408  C CE   . LYS A 1 103 ? -18.476 -10.194 23.167  1.00 0.00 ? 103 LYS A CE   4  
ATOM 7409  N NZ   . LYS A 1 103 ? -17.897 -11.235 24.058  1.00 0.00 ? 103 LYS A NZ   4  
ATOM 7410  H H    . LYS A 1 103 ? -19.271 -4.598  21.501  1.00 0.00 ? 103 LYS A H    4  
ATOM 7411  H HA   . LYS A 1 103 ? -18.181 -6.933  20.055  1.00 0.00 ? 103 LYS A HA   4  
ATOM 7412  H HB2  . LYS A 1 103 ? -20.136 -7.051  22.409  1.00 0.00 ? 103 LYS A HB2  4  
ATOM 7413  H HB3  . LYS A 1 103 ? -19.684 -8.420  21.382  1.00 0.00 ? 103 LYS A HB3  4  
ATOM 7414  H HG2  . LYS A 1 103 ? -17.283 -8.046  22.024  1.00 0.00 ? 103 LYS A HG2  4  
ATOM 7415  H HG3  . LYS A 1 103 ? -17.806 -6.797  23.156  1.00 0.00 ? 103 LYS A HG3  4  
ATOM 7416  H HD2  . LYS A 1 103 ? -17.407 -8.760  24.391  1.00 0.00 ? 103 LYS A HD2  4  
ATOM 7417  H HD3  . LYS A 1 103 ? -19.158 -8.521  24.376  1.00 0.00 ? 103 LYS A HD3  4  
ATOM 7418  H HE2  . LYS A 1 103 ? -19.544 -10.378 23.005  1.00 0.00 ? 103 LYS A HE2  4  
ATOM 7419  H HE3  . LYS A 1 103 ? -17.976 -10.241 22.196  1.00 0.00 ? 103 LYS A HE3  4  
ATOM 7420  H HZ1  . LYS A 1 103 ? -18.086 -12.166 23.698  1.00 0.00 ? 103 LYS A HZ1  4  
ATOM 7421  H HZ2  . LYS A 1 103 ? -16.884 -11.107 24.123  1.00 0.00 ? 103 LYS A HZ2  4  
ATOM 7422  H HZ3  . LYS A 1 103 ? -18.282 -11.179 24.992  1.00 0.00 ? 103 LYS A HZ3  4  
ATOM 7423  N N    . MET A 1 104 ? -20.237 -7.171  18.597  1.00 0.00 ? 104 MET A N    4  
ATOM 7424  C CA   . MET A 1 104 ? -21.206 -7.027  17.492  1.00 0.00 ? 104 MET A CA   4  
ATOM 7425  C C    . MET A 1 104 ? -21.724 -8.371  16.969  1.00 0.00 ? 104 MET A C    4  
ATOM 7426  O O    . MET A 1 104 ? -21.006 -9.373  16.964  1.00 0.00 ? 104 MET A O    4  
ATOM 7427  C CB   . MET A 1 104 ? -20.587 -6.231  16.328  1.00 0.00 ? 104 MET A CB   4  
ATOM 7428  C CG   . MET A 1 104 ? -20.203 -4.787  16.690  1.00 0.00 ? 104 MET A CG   4  
ATOM 7429  S SD   . MET A 1 104 ? -18.512 -4.549  17.303  1.00 0.00 ? 104 MET A SD   4  
ATOM 7430  C CE   . MET A 1 104 ? -17.626 -4.757  15.739  1.00 0.00 ? 104 MET A CE   4  
ATOM 7431  H H    . MET A 1 104 ? -19.500 -7.862  18.499  1.00 0.00 ? 104 MET A H    4  
ATOM 7432  H HA   . MET A 1 104 ? -22.076 -6.468  17.843  1.00 0.00 ? 104 MET A HA   4  
ATOM 7433  H HB2  . MET A 1 104 ? -19.709 -6.756  15.961  1.00 0.00 ? 104 MET A HB2  4  
ATOM 7434  H HB3  . MET A 1 104 ? -21.317 -6.181  15.516  1.00 0.00 ? 104 MET A HB3  4  
ATOM 7435  H HG2  . MET A 1 104 ? -20.320 -4.168  15.799  1.00 0.00 ? 104 MET A HG2  4  
ATOM 7436  H HG3  . MET A 1 104 ? -20.908 -4.404  17.432  1.00 0.00 ? 104 MET A HG3  4  
ATOM 7437  H HE1  . MET A 1 104 ? -17.988 -4.031  15.012  1.00 0.00 ? 104 MET A HE1  4  
ATOM 7438  H HE2  . MET A 1 104 ? -16.561 -4.600  15.899  1.00 0.00 ? 104 MET A HE2  4  
ATOM 7439  H HE3  . MET A 1 104 ? -17.787 -5.763  15.350  1.00 0.00 ? 104 MET A HE3  4  
ATOM 7440  N N    . LYS A 1 105 ? -22.968 -8.381  16.484  1.00 0.00 ? 105 LYS A N    4  
ATOM 7441  C CA   . LYS A 1 105 ? -23.689 -9.569  15.991  1.00 0.00 ? 105 LYS A CA   4  
ATOM 7442  C C    . LYS A 1 105 ? -24.776 -9.178  14.957  1.00 0.00 ? 105 LYS A C    4  
ATOM 7443  O O    . LYS A 1 105 ? -24.622 -8.173  14.262  1.00 0.00 ? 105 LYS A O    4  
ATOM 7444  C CB   . LYS A 1 105 ? -24.225 -10.345 17.221  1.00 0.00 ? 105 LYS A CB   4  
ATOM 7445  C CG   . LYS A 1 105 ? -24.195 -11.865 17.004  1.00 0.00 ? 105 LYS A CG   4  
ATOM 7446  C CD   . LYS A 1 105 ? -24.831 -12.608 18.184  1.00 0.00 ? 105 LYS A CD   4  
ATOM 7447  C CE   . LYS A 1 105 ? -24.603 -14.112 18.004  1.00 0.00 ? 105 LYS A CE   4  
ATOM 7448  N NZ   . LYS A 1 105 ? -25.180 -14.900 19.130  1.00 0.00 ? 105 LYS A NZ   4  
ATOM 7449  H H    . LYS A 1 105 ? -23.478 -7.506  16.480  1.00 0.00 ? 105 LYS A H    4  
ATOM 7450  H HA   . LYS A 1 105 ? -22.980 -10.205 15.459  1.00 0.00 ? 105 LYS A HA   4  
ATOM 7451  H HB2  . LYS A 1 105 ? -23.600 -10.135 18.092  1.00 0.00 ? 105 LYS A HB2  4  
ATOM 7452  H HB3  . LYS A 1 105 ? -25.237 -10.014 17.467  1.00 0.00 ? 105 LYS A HB3  4  
ATOM 7453  H HG2  . LYS A 1 105 ? -24.731 -12.124 16.091  1.00 0.00 ? 105 LYS A HG2  4  
ATOM 7454  H HG3  . LYS A 1 105 ? -23.156 -12.180 16.893  1.00 0.00 ? 105 LYS A HG3  4  
ATOM 7455  H HD2  . LYS A 1 105 ? -24.372 -12.278 19.118  1.00 0.00 ? 105 LYS A HD2  4  
ATOM 7456  H HD3  . LYS A 1 105 ? -25.902 -12.397 18.214  1.00 0.00 ? 105 LYS A HD3  4  
ATOM 7457  H HE2  . LYS A 1 105 ? -25.048 -14.428 17.055  1.00 0.00 ? 105 LYS A HE2  4  
ATOM 7458  H HE3  . LYS A 1 105 ? -23.523 -14.285 17.949  1.00 0.00 ? 105 LYS A HE3  4  
ATOM 7459  H HZ1  . LYS A 1 105 ? -26.175 -14.739 19.217  1.00 0.00 ? 105 LYS A HZ1  4  
ATOM 7460  H HZ2  . LYS A 1 105 ? -25.037 -15.890 18.978  1.00 0.00 ? 105 LYS A HZ2  4  
ATOM 7461  H HZ3  . LYS A 1 105 ? -24.738 -14.663 20.013  1.00 0.00 ? 105 LYS A HZ3  4  
ATOM 7462  N N    . TYR A 1 106 ? -25.854 -9.965  14.828  1.00 0.00 ? 106 TYR A N    4  
ATOM 7463  C CA   . TYR A 1 106 ? -27.065 -9.754  14.003  1.00 0.00 ? 106 TYR A CA   4  
ATOM 7464  C C    . TYR A 1 106 ? -26.828 -9.931  12.489  1.00 0.00 ? 106 TYR A C    4  
ATOM 7465  O O    . TYR A 1 106 ? -27.515 -10.722 11.840  1.00 0.00 ? 106 TYR A O    4  
ATOM 7466  C CB   . TYR A 1 106 ? -27.722 -8.399  14.326  1.00 0.00 ? 106 TYR A CB   4  
ATOM 7467  C CG   . TYR A 1 106 ? -29.071 -8.201  13.659  1.00 0.00 ? 106 TYR A CG   4  
ATOM 7468  C CD1  . TYR A 1 106 ? -30.225 -8.787  14.212  1.00 0.00 ? 106 TYR A CD1  4  
ATOM 7469  C CD2  . TYR A 1 106 ? -29.171 -7.445  12.473  1.00 0.00 ? 106 TYR A CD2  4  
ATOM 7470  C CE1  . TYR A 1 106 ? -31.476 -8.622  13.588  1.00 0.00 ? 106 TYR A CE1  4  
ATOM 7471  C CE2  . TYR A 1 106 ? -30.421 -7.270  11.843  1.00 0.00 ? 106 TYR A CE2  4  
ATOM 7472  C CZ   . TYR A 1 106 ? -31.577 -7.863  12.401  1.00 0.00 ? 106 TYR A CZ   4  
ATOM 7473  O OH   . TYR A 1 106 ? -32.787 -7.705  11.798  1.00 0.00 ? 106 TYR A OH   4  
ATOM 7474  H H    . TYR A 1 106 ? -25.876 -10.787 15.415  1.00 0.00 ? 106 TYR A H    4  
ATOM 7475  H HA   . TYR A 1 106 ? -27.783 -10.528 14.282  1.00 0.00 ? 106 TYR A HA   4  
ATOM 7476  H HB2  . TYR A 1 106 ? -27.863 -8.332  15.405  1.00 0.00 ? 106 TYR A HB2  4  
ATOM 7477  H HB3  . TYR A 1 106 ? -27.066 -7.580  14.028  1.00 0.00 ? 106 TYR A HB3  4  
ATOM 7478  H HD1  . TYR A 1 106 ? -30.149 -9.368  15.123  1.00 0.00 ? 106 TYR A HD1  4  
ATOM 7479  H HD2  . TYR A 1 106 ? -28.285 -6.996  12.043  1.00 0.00 ? 106 TYR A HD2  4  
ATOM 7480  H HE1  . TYR A 1 106 ? -32.361 -9.076  14.014  1.00 0.00 ? 106 TYR A HE1  4  
ATOM 7481  H HE2  . TYR A 1 106 ? -30.494 -6.688  10.935  1.00 0.00 ? 106 TYR A HE2  4  
ATOM 7482  H HH   . TYR A 1 106 ? -32.735 -7.166  10.999  1.00 0.00 ? 106 TYR A HH   4  
ATOM 7483  N N    . SER A 1 107 ? -25.851 -9.224  11.923  1.00 0.00 ? 107 SER A N    4  
ATOM 7484  C CA   . SER A 1 107 ? -25.391 -9.391  10.536  1.00 0.00 ? 107 SER A CA   4  
ATOM 7485  C C    . SER A 1 107 ? -24.653 -10.732 10.318  1.00 0.00 ? 107 SER A C    4  
ATOM 7486  O O    . SER A 1 107 ? -24.185 -11.362 11.273  1.00 0.00 ? 107 SER A O    4  
ATOM 7487  C CB   . SER A 1 107 ? -24.451 -8.227  10.160  1.00 0.00 ? 107 SER A CB   4  
ATOM 7488  O OG   . SER A 1 107 ? -25.021 -6.955  10.449  1.00 0.00 ? 107 SER A OG   4  
ATOM 7489  H H    . SER A 1 107 ? -25.339 -8.579  12.516  1.00 0.00 ? 107 SER A H    4  
ATOM 7490  H HA   . SER A 1 107 ? -26.256 -9.374  9.868   1.00 0.00 ? 107 SER A HA   4  
ATOM 7491  H HB2  . SER A 1 107 ? -23.523 -8.329  10.727  1.00 0.00 ? 107 SER A HB2  4  
ATOM 7492  H HB3  . SER A 1 107 ? -24.210 -8.284  9.098   1.00 0.00 ? 107 SER A HB3  4  
ATOM 7493  H HG   . SER A 1 107 ? -25.748 -6.776  9.831   1.00 0.00 ? 107 SER A HG   4  
ATOM 7494  N N    . ILE A 1 108 ? -24.496 -11.159 9.054   1.00 0.00 ? 108 ILE A N    4  
ATOM 7495  C CA   . ILE A 1 108 ? -23.631 -12.303 8.692   1.00 0.00 ? 108 ILE A CA   4  
ATOM 7496  C C    . ILE A 1 108 ? -22.166 -11.984 9.043   1.00 0.00 ? 108 ILE A C    4  
ATOM 7497  O O    . ILE A 1 108 ? -21.741 -10.841 8.894   1.00 0.00 ? 108 ILE A O    4  
ATOM 7498  C CB   . ILE A 1 108 ? -23.858 -12.696 7.206   1.00 0.00 ? 108 ILE A CB   4  
ATOM 7499  C CG1  . ILE A 1 108 ? -23.227 -14.074 6.899   1.00 0.00 ? 108 ILE A CG1  4  
ATOM 7500  C CG2  . ILE A 1 108 ? -23.355 -11.616 6.224   1.00 0.00 ? 108 ILE A CG2  4  
ATOM 7501  C CD1  . ILE A 1 108 ? -23.606 -14.640 5.524   1.00 0.00 ? 108 ILE A CD1  4  
ATOM 7502  H H    . ILE A 1 108 ? -24.916 -10.628 8.301   1.00 0.00 ? 108 ILE A H    4  
ATOM 7503  H HA   . ILE A 1 108 ? -23.946 -13.146 9.312   1.00 0.00 ? 108 ILE A HA   4  
ATOM 7504  H HB   . ILE A 1 108 ? -24.936 -12.796 7.056   1.00 0.00 ? 108 ILE A HB   4  
ATOM 7505  H HG12 . ILE A 1 108 ? -22.140 -14.003 6.952   1.00 0.00 ? 108 ILE A HG12 4  
ATOM 7506  H HG13 . ILE A 1 108 ? -23.560 -14.788 7.654   1.00 0.00 ? 108 ILE A HG13 4  
ATOM 7507  H HG21 . ILE A 1 108 ? -23.698 -11.841 5.213   1.00 0.00 ? 108 ILE A HG21 4  
ATOM 7508  H HG22 . ILE A 1 108 ? -23.752 -10.639 6.496   1.00 0.00 ? 108 ILE A HG22 4  
ATOM 7509  H HG23 . ILE A 1 108 ? -22.267 -11.574 6.227   1.00 0.00 ? 108 ILE A HG23 4  
ATOM 7510  H HD11 . ILE A 1 108 ? -23.201 -15.647 5.423   1.00 0.00 ? 108 ILE A HD11 4  
ATOM 7511  H HD12 . ILE A 1 108 ? -24.691 -14.688 5.422   1.00 0.00 ? 108 ILE A HD12 4  
ATOM 7512  H HD13 . ILE A 1 108 ? -23.191 -14.026 4.724   1.00 0.00 ? 108 ILE A HD13 4  
ATOM 7513  N N    . VAL A 1 109 ? -21.377 -12.967 9.488   1.00 0.00 ? 109 VAL A N    4  
ATOM 7514  C CA   . VAL A 1 109 ? -20.031 -12.724 10.068  1.00 0.00 ? 109 VAL A CA   4  
ATOM 7515  C C    . VAL A 1 109 ? -19.045 -12.018 9.115   1.00 0.00 ? 109 VAL A C    4  
ATOM 7516  O O    . VAL A 1 109 ? -18.188 -11.261 9.560   1.00 0.00 ? 109 VAL A O    4  
ATOM 7517  C CB   . VAL A 1 109 ? -19.440 -14.015 10.684  1.00 0.00 ? 109 VAL A CB   4  
ATOM 7518  C CG1  . VAL A 1 109 ? -18.798 -14.950 9.643   1.00 0.00 ? 109 VAL A CG1  4  
ATOM 7519  C CG2  . VAL A 1 109 ? -18.455 -13.688 11.816  1.00 0.00 ? 109 VAL A CG2  4  
ATOM 7520  H H    . VAL A 1 109 ? -21.792 -13.887 9.607   1.00 0.00 ? 109 VAL A H    4  
ATOM 7521  H HA   . VAL A 1 109 ? -20.210 -12.044 10.900  1.00 0.00 ? 109 VAL A HA   4  
ATOM 7522  H HB   . VAL A 1 109 ? -20.263 -14.564 11.141  1.00 0.00 ? 109 VAL A HB   4  
ATOM 7523  H HG11 . VAL A 1 109 ? -19.515 -15.174 8.852   1.00 0.00 ? 109 VAL A HG11 4  
ATOM 7524  H HG12 . VAL A 1 109 ? -17.914 -14.489 9.202   1.00 0.00 ? 109 VAL A HG12 4  
ATOM 7525  H HG13 . VAL A 1 109 ? -18.506 -15.885 10.123  1.00 0.00 ? 109 VAL A HG13 4  
ATOM 7526  H HG21 . VAL A 1 109 ? -18.070 -14.611 12.254  1.00 0.00 ? 109 VAL A HG21 4  
ATOM 7527  H HG22 . VAL A 1 109 ? -17.626 -13.097 11.438  1.00 0.00 ? 109 VAL A HG22 4  
ATOM 7528  H HG23 . VAL A 1 109 ? -18.965 -13.119 12.595  1.00 0.00 ? 109 VAL A HG23 4  
ATOM 7529  N N    . SER A 1 110 ? -19.210 -12.186 7.797   1.00 0.00 ? 110 SER A N    4  
ATOM 7530  C CA   . SER A 1 110 ? -18.445 -11.426 6.792   1.00 0.00 ? 110 SER A CA   4  
ATOM 7531  C C    . SER A 1 110 ? -18.767 -9.923  6.869   1.00 0.00 ? 110 SER A C    4  
ATOM 7532  O O    . SER A 1 110 ? -17.863 -9.094  7.028   1.00 0.00 ? 110 SER A O    4  
ATOM 7533  C CB   . SER A 1 110 ? -18.728 -11.996 5.391   1.00 0.00 ? 110 SER A CB   4  
ATOM 7534  O OG   . SER A 1 110 ? -17.924 -11.358 4.409   1.00 0.00 ? 110 SER A OG   4  
ATOM 7535  H H    . SER A 1 110 ? -19.911 -12.845 7.482   1.00 0.00 ? 110 SER A H    4  
ATOM 7536  H HA   . SER A 1 110 ? -17.378 -11.540 6.993   1.00 0.00 ? 110 SER A HA   4  
ATOM 7537  H HB2  . SER A 1 110 ? -18.503 -13.066 5.399   1.00 0.00 ? 110 SER A HB2  4  
ATOM 7538  H HB3  . SER A 1 110 ? -19.784 -11.862 5.145   1.00 0.00 ? 110 SER A HB3  4  
ATOM 7539  H HG   . SER A 1 110 ? -18.087 -11.783 3.551   1.00 0.00 ? 110 SER A HG   4  
ATOM 7540  N N    . ARG A 1 111 ? -20.060 -9.560  6.892   1.00 0.00 ? 111 ARG A N    4  
ATOM 7541  C CA   . ARG A 1 111 ? -20.486 -8.172  7.104   1.00 0.00 ? 111 ARG A CA   4  
ATOM 7542  C C    . ARG A 1 111 ? -20.196 -7.698  8.523   1.00 0.00 ? 111 ARG A C    4  
ATOM 7543  O O    . ARG A 1 111 ? -19.896 -6.529  8.690   1.00 0.00 ? 111 ARG A O    4  
ATOM 7544  C CB   . ARG A 1 111 ? -21.961 -7.967  6.719   1.00 0.00 ? 111 ARG A CB   4  
ATOM 7545  C CG   . ARG A 1 111 ? -22.438 -6.498  6.809   1.00 0.00 ? 111 ARG A CG   4  
ATOM 7546  C CD   . ARG A 1 111 ? -21.661 -5.456  5.980   1.00 0.00 ? 111 ARG A CD   4  
ATOM 7547  N NE   . ARG A 1 111 ? -21.406 -5.853  4.585   1.00 0.00 ? 111 ARG A NE   4  
ATOM 7548  C CZ   . ARG A 1 111 ? -22.254 -5.963  3.575   1.00 0.00 ? 111 ARG A CZ   4  
ATOM 7549  N NH1  . ARG A 1 111 ? -23.559 -5.831  3.703   1.00 0.00 ? 111 ARG A NH1  4  
ATOM 7550  N NH2  . ARG A 1 111 ? -21.743 -6.210  2.392   1.00 0.00 ? 111 ARG A NH2  4  
ATOM 7551  H H    . ARG A 1 111 ? -20.771 -10.281 6.869   1.00 0.00 ? 111 ARG A H    4  
ATOM 7552  H HA   . ARG A 1 111 ? -19.891 -7.556  6.437   1.00 0.00 ? 111 ARG A HA   4  
ATOM 7553  H HB2  . ARG A 1 111 ? -22.110 -8.318  5.698   1.00 0.00 ? 111 ARG A HB2  4  
ATOM 7554  H HB3  . ARG A 1 111 ? -22.590 -8.577  7.372   1.00 0.00 ? 111 ARG A HB3  4  
ATOM 7555  H HG2  . ARG A 1 111 ? -23.486 -6.466  6.513   1.00 0.00 ? 111 ARG A HG2  4  
ATOM 7556  H HG3  . ARG A 1 111 ? -22.387 -6.160  7.848   1.00 0.00 ? 111 ARG A HG3  4  
ATOM 7557  H HD2  . ARG A 1 111 ? -22.214 -4.515  5.992   1.00 0.00 ? 111 ARG A HD2  4  
ATOM 7558  H HD3  . ARG A 1 111 ? -20.701 -5.275  6.463   1.00 0.00 ? 111 ARG A HD3  4  
ATOM 7559  H HE   . ARG A 1 111 ? -20.429 -5.949  4.309   1.00 0.00 ? 111 ARG A HE   4  
ATOM 7560  H HH11 . ARG A 1 111 ? -23.963 -5.630  4.602   1.00 0.00 ? 111 ARG A HH11 4  
ATOM 7561  H HH12 . ARG A 1 111 ? -24.167 -5.918  2.900   1.00 0.00 ? 111 ARG A HH12 4  
ATOM 7562  H HH21 . ARG A 1 111 ? -20.727 -6.239  2.319   1.00 0.00 ? 111 ARG A HH21 4  
ATOM 7563  H HH22 . ARG A 1 111 ? -22.320 -6.303  1.573   1.00 0.00 ? 111 ARG A HH22 4  
ATOM 7564  N N    . ASN A 1 112 ? -20.170 -8.558  9.538   1.00 0.00 ? 112 ASN A N    4  
ATOM 7565  C CA   . ASN A 1 112 ? -19.725 -8.183  10.891  1.00 0.00 ? 112 ASN A CA   4  
ATOM 7566  C C    . ASN A 1 112 ? -18.283 -7.621  10.870  1.00 0.00 ? 112 ASN A C    4  
ATOM 7567  O O    . ASN A 1 112 ? -18.012 -6.569  11.441  1.00 0.00 ? 112 ASN A O    4  
ATOM 7568  C CB   . ASN A 1 112 ? -19.893 -9.404  11.818  1.00 0.00 ? 112 ASN A CB   4  
ATOM 7569  C CG   . ASN A 1 112 ? -19.912 -9.069  13.305  1.00 0.00 ? 112 ASN A CG   4  
ATOM 7570  O OD1  . ASN A 1 112 ? -19.455 -8.023  13.743  1.00 0.00 ? 112 ASN A OD1  4  
ATOM 7571  N ND2  . ASN A 1 112 ? -20.442 -9.964  14.121  1.00 0.00 ? 112 ASN A ND2  4  
ATOM 7572  H H    . ASN A 1 112 ? -20.503 -9.500  9.360   1.00 0.00 ? 112 ASN A H    4  
ATOM 7573  H HA   . ASN A 1 112 ? -20.374 -7.386  11.256  1.00 0.00 ? 112 ASN A HA   4  
ATOM 7574  H HB2  . ASN A 1 112 ? -20.843 -9.892  11.582  1.00 0.00 ? 112 ASN A HB2  4  
ATOM 7575  H HB3  . ASN A 1 112 ? -19.091 -10.122 11.652  1.00 0.00 ? 112 ASN A HB3  4  
ATOM 7576  H HD21 . ASN A 1 112 ? -20.805 -10.835 13.759  1.00 0.00 ? 112 ASN A HD21 4  
ATOM 7577  H HD22 . ASN A 1 112 ? -20.471 -9.759  15.114  1.00 0.00 ? 112 ASN A HD22 4  
ATOM 7578  N N    . CYS A 1 113 ? -17.385 -8.251  10.100  1.00 0.00 ? 113 CYS A N    4  
ATOM 7579  C CA   . CYS A 1 113 ? -15.998 -7.809  9.889   1.00 0.00 ? 113 CYS A CA   4  
ATOM 7580  C C    . CYS A 1 113 ? -15.892 -6.570  8.962   1.00 0.00 ? 113 CYS A C    4  
ATOM 7581  O O    . CYS A 1 113 ? -15.214 -5.595  9.294   1.00 0.00 ? 113 CYS A O    4  
ATOM 7582  C CB   . CYS A 1 113 ? -15.200 -9.038  9.400   1.00 0.00 ? 113 CYS A CB   4  
ATOM 7583  S SG   . CYS A 1 113 ? -13.621 -9.148  10.301  1.00 0.00 ? 113 CYS A SG   4  
ATOM 7584  H H    . CYS A 1 113 ? -17.688 -9.099  9.635   1.00 0.00 ? 113 CYS A H    4  
ATOM 7585  H HA   . CYS A 1 113 ? -15.589 -7.500  10.852  1.00 0.00 ? 113 CYS A HA   4  
ATOM 7586  H HB2  . CYS A 1 113 ? -15.756 -9.962  9.598   1.00 0.00 ? 113 CYS A HB2  4  
ATOM 7587  H HB3  . CYS A 1 113 ? -15.022 -8.985  8.322   1.00 0.00 ? 113 CYS A HB3  4  
ATOM 7588  H HG   . CYS A 1 113 ? -13.131 -10.213 9.647   1.00 0.00 ? 113 CYS A HG   4  
ATOM 7589  N N    . GLU A 1 114 ? -16.618 -6.557  7.838   1.00 0.00 ? 114 GLU A N    4  
ATOM 7590  C CA   . GLU A 1 114 ? -16.652 -5.420  6.897   1.00 0.00 ? 114 GLU A CA   4  
ATOM 7591  C C    . GLU A 1 114 ? -17.304 -4.162  7.507   1.00 0.00 ? 114 GLU A C    4  
ATOM 7592  O O    . GLU A 1 114 ? -16.789 -3.055  7.367   1.00 0.00 ? 114 GLU A O    4  
ATOM 7593  C CB   . GLU A 1 114 ? -17.360 -5.872  5.607   1.00 0.00 ? 114 GLU A CB   4  
ATOM 7594  C CG   . GLU A 1 114 ? -17.300 -4.837  4.479   1.00 0.00 ? 114 GLU A CG   4  
ATOM 7595  C CD   . GLU A 1 114 ? -17.833 -5.424  3.159   1.00 0.00 ? 114 GLU A CD   4  
ATOM 7596  O OE1  . GLU A 1 114 ? -19.002 -5.879  3.125   1.00 0.00 ? 114 GLU A OE1  4  
ATOM 7597  O OE2  . GLU A 1 114 ? -17.089 -5.415  2.150   1.00 0.00 ? 114 GLU A OE2  4  
ATOM 7598  H H    . GLU A 1 114 ? -17.108 -7.411  7.580   1.00 0.00 ? 114 GLU A H    4  
ATOM 7599  H HA   . GLU A 1 114 ? -15.625 -5.163  6.633   1.00 0.00 ? 114 GLU A HA   4  
ATOM 7600  H HB2  . GLU A 1 114 ? -16.884 -6.789  5.254   1.00 0.00 ? 114 GLU A HB2  4  
ATOM 7601  H HB3  . GLU A 1 114 ? -18.403 -6.089  5.833   1.00 0.00 ? 114 GLU A HB3  4  
ATOM 7602  H HG2  . GLU A 1 114 ? -17.897 -3.964  4.746   1.00 0.00 ? 114 GLU A HG2  4  
ATOM 7603  H HG3  . GLU A 1 114 ? -16.264 -4.516  4.345   1.00 0.00 ? 114 GLU A HG3  4  
ATOM 7604  N N    . HIS A 1 115 ? -18.400 -4.312  8.254   1.00 0.00 ? 115 HIS A N    4  
ATOM 7605  C CA   . HIS A 1 115 ? -19.042 -3.220  8.994   1.00 0.00 ? 115 HIS A CA   4  
ATOM 7606  C C    . HIS A 1 115 ? -18.123 -2.707  10.117  1.00 0.00 ? 115 HIS A C    4  
ATOM 7607  O O    . HIS A 1 115 ? -18.066 -1.501  10.362  1.00 0.00 ? 115 HIS A O    4  
ATOM 7608  C CB   . HIS A 1 115 ? -20.393 -3.689  9.557   1.00 0.00 ? 115 HIS A CB   4  
ATOM 7609  C CG   . HIS A 1 115 ? -21.198 -2.608  10.251  1.00 0.00 ? 115 HIS A CG   4  
ATOM 7610  N ND1  . HIS A 1 115 ? -22.039 -2.797  11.326  1.00 0.00 ? 115 HIS A ND1  4  
ATOM 7611  C CD2  . HIS A 1 115 ? -21.262 -1.275  9.929   1.00 0.00 ? 115 HIS A CD2  4  
ATOM 7612  C CE1  . HIS A 1 115 ? -22.585 -1.611  11.646  1.00 0.00 ? 115 HIS A CE1  4  
ATOM 7613  N NE2  . HIS A 1 115 ? -22.139 -0.645  10.823  1.00 0.00 ? 115 HIS A NE2  4  
ATOM 7614  H H    . HIS A 1 115 ? -18.805 -5.237  8.347   1.00 0.00 ? 115 HIS A H    4  
ATOM 7615  H HA   . HIS A 1 115 ? -19.248 -2.413  8.293   1.00 0.00 ? 115 HIS A HA   4  
ATOM 7616  H HB2  . HIS A 1 115 ? -21.008 -4.075  8.742   1.00 0.00 ? 115 HIS A HB2  4  
ATOM 7617  H HB3  . HIS A 1 115 ? -20.224 -4.500  10.269  1.00 0.00 ? 115 HIS A HB3  4  
ATOM 7618  H HD1  . HIS A 1 115 ? -22.237 -3.678  11.786  1.00 0.00 ? 115 HIS A HD1  4  
ATOM 7619  H HD2  . HIS A 1 115 ? -20.727 -0.791  9.122   1.00 0.00 ? 115 HIS A HD2  4  
ATOM 7620  H HE1  . HIS A 1 115 ? -23.296 -1.460  12.451  1.00 0.00 ? 115 HIS A HE1  4  
ATOM 7621  N N    . PHE A 1 116 ? -17.363 -3.596  10.774  1.00 0.00 ? 116 PHE A N    4  
ATOM 7622  C CA   . PHE A 1 116 ? -16.314 -3.217  11.723  1.00 0.00 ? 116 PHE A CA   4  
ATOM 7623  C C    . PHE A 1 116 ? -15.278 -2.302  11.051  1.00 0.00 ? 116 PHE A C    4  
ATOM 7624  O O    . PHE A 1 116 ? -15.137 -1.159  11.479  1.00 0.00 ? 116 PHE A O    4  
ATOM 7625  C CB   . PHE A 1 116 ? -15.698 -4.476  12.354  1.00 0.00 ? 116 PHE A CB   4  
ATOM 7626  C CG   . PHE A 1 116 ? -14.288 -4.295  12.882  1.00 0.00 ? 116 PHE A CG   4  
ATOM 7627  C CD1  . PHE A 1 116 ? -14.066 -3.498  14.018  1.00 0.00 ? 116 PHE A CD1  4  
ATOM 7628  C CD2  . PHE A 1 116 ? -13.195 -4.879  12.209  1.00 0.00 ? 116 PHE A CD2  4  
ATOM 7629  C CE1  . PHE A 1 116 ? -12.759 -3.293  14.489  1.00 0.00 ? 116 PHE A CE1  4  
ATOM 7630  C CE2  . PHE A 1 116 ? -11.888 -4.682  12.688  1.00 0.00 ? 116 PHE A CE2  4  
ATOM 7631  C CZ   . PHE A 1 116 ? -11.672 -3.896  13.834  1.00 0.00 ? 116 PHE A CZ   4  
ATOM 7632  H H    . PHE A 1 116 ? -17.487 -4.584  10.578  1.00 0.00 ? 116 PHE A H    4  
ATOM 7633  H HA   . PHE A 1 116 ? -16.764 -2.631  12.528  1.00 0.00 ? 116 PHE A HA   4  
ATOM 7634  H HB2  . PHE A 1 116 ? -16.341 -4.814  13.167  1.00 0.00 ? 116 PHE A HB2  4  
ATOM 7635  H HB3  . PHE A 1 116 ? -15.689 -5.289  11.636  1.00 0.00 ? 116 PHE A HB3  4  
ATOM 7636  H HD1  . PHE A 1 116 ? -14.897 -3.028  14.521  1.00 0.00 ? 116 PHE A HD1  4  
ATOM 7637  H HD2  . PHE A 1 116 ? -13.356 -5.478  11.320  1.00 0.00 ? 116 PHE A HD2  4  
ATOM 7638  H HE1  . PHE A 1 116 ? -12.598 -2.655  15.347  1.00 0.00 ? 116 PHE A HE1  4  
ATOM 7639  H HE2  . PHE A 1 116 ? -11.049 -5.130  12.175  1.00 0.00 ? 116 PHE A HE2  4  
ATOM 7640  H HZ   . PHE A 1 116 ? -10.667 -3.734  14.199  1.00 0.00 ? 116 PHE A HZ   4  
ATOM 7641  N N    . VAL A 1 117 ? -14.616 -2.725  9.965   1.00 0.00 ? 117 VAL A N    4  
ATOM 7642  C CA   . VAL A 1 117 ? -13.620 -1.830  9.327   1.00 0.00 ? 117 VAL A CA   4  
ATOM 7643  C C    . VAL A 1 117 ? -14.237 -0.574  8.708   1.00 0.00 ? 117 VAL A C    4  
ATOM 7644  O O    . VAL A 1 117 ? -13.569 0.455   8.699   1.00 0.00 ? 117 VAL A O    4  
ATOM 7645  C CB   . VAL A 1 117 ? -12.673 -2.502  8.313   1.00 0.00 ? 117 VAL A CB   4  
ATOM 7646  C CG1  . VAL A 1 117 ? -11.668 -3.387  9.053   1.00 0.00 ? 117 VAL A CG1  4  
ATOM 7647  C CG2  . VAL A 1 117 ? -13.389 -3.271  7.195   1.00 0.00 ? 117 VAL A CG2  4  
ATOM 7648  H H    . VAL A 1 117 ? -14.751 -3.690  9.649   1.00 0.00 ? 117 VAL A H    4  
ATOM 7649  H HA   . VAL A 1 117 ? -12.982 -1.470  10.136  1.00 0.00 ? 117 VAL A HA   4  
ATOM 7650  H HB   . VAL A 1 117 ? -12.098 -1.711  7.836   1.00 0.00 ? 117 VAL A HB   4  
ATOM 7651  H HG11 . VAL A 1 117 ? -10.936 -3.771  8.346   1.00 0.00 ? 117 VAL A HG11 4  
ATOM 7652  H HG12 . VAL A 1 117 ? -11.128 -2.804  9.805   1.00 0.00 ? 117 VAL A HG12 4  
ATOM 7653  H HG13 . VAL A 1 117 ? -12.186 -4.214  9.537   1.00 0.00 ? 117 VAL A HG13 4  
ATOM 7654  H HG21 . VAL A 1 117 ? -14.113 -2.625  6.699   1.00 0.00 ? 117 VAL A HG21 4  
ATOM 7655  H HG22 . VAL A 1 117 ? -12.656 -3.609  6.463   1.00 0.00 ? 117 VAL A HG22 4  
ATOM 7656  H HG23 . VAL A 1 117 ? -13.899 -4.139  7.605   1.00 0.00 ? 117 VAL A HG23 4  
ATOM 7657  N N    . THR A 1 118 ? -15.507 -0.598  8.276   1.00 0.00 ? 118 THR A N    4  
ATOM 7658  C CA   . THR A 1 118 ? -16.212 0.622   7.824   1.00 0.00 ? 118 THR A CA   4  
ATOM 7659  C C    . THR A 1 118 ? -16.484 1.571   8.986   1.00 0.00 ? 118 THR A C    4  
ATOM 7660  O O    . THR A 1 118 ? -16.356 2.766   8.783   1.00 0.00 ? 118 THR A O    4  
ATOM 7661  C CB   . THR A 1 118 ? -17.489 0.322   7.031   1.00 0.00 ? 118 THR A CB   4  
ATOM 7662  O OG1  . THR A 1 118 ? -17.224 -0.705  6.098   1.00 0.00 ? 118 THR A OG1  4  
ATOM 7663  C CG2  . THR A 1 118 ? -17.953 1.527   6.210   1.00 0.00 ? 118 THR A CG2  4  
ATOM 7664  H H    . THR A 1 118 ? -16.001 -1.486  8.281   1.00 0.00 ? 118 THR A H    4  
ATOM 7665  H HA   . THR A 1 118 ? -15.561 1.184   7.154   1.00 0.00 ? 118 THR A HA   4  
ATOM 7666  H HB   . THR A 1 118 ? -18.286 0.054   7.721   1.00 0.00 ? 118 THR A HB   4  
ATOM 7667  H HG1  . THR A 1 118 ? -17.140 -1.558  6.565   1.00 0.00 ? 118 THR A HG1  4  
ATOM 7668  H HG21 . THR A 1 118 ? -17.169 1.842   5.519   1.00 0.00 ? 118 THR A HG21 4  
ATOM 7669  H HG22 . THR A 1 118 ? -18.839 1.250   5.638   1.00 0.00 ? 118 THR A HG22 4  
ATOM 7670  H HG23 . THR A 1 118 ? -18.211 2.357   6.869   1.00 0.00 ? 118 THR A HG23 4  
ATOM 7671  N N    . GLN A 1 119 ? -16.748 1.083   10.202  1.00 0.00 ? 119 GLN A N    4  
ATOM 7672  C CA   . GLN A 1 119 ? -16.808 1.924   11.411  1.00 0.00 ? 119 GLN A CA   4  
ATOM 7673  C C    . GLN A 1 119 ? -15.436 2.530   11.783  1.00 0.00 ? 119 GLN A C    4  
ATOM 7674  O O    . GLN A 1 119 ? -15.389 3.592   12.409  1.00 0.00 ? 119 GLN A O    4  
ATOM 7675  C CB   . GLN A 1 119 ? -17.409 1.138   12.585  1.00 0.00 ? 119 GLN A CB   4  
ATOM 7676  C CG   . GLN A 1 119 ? -18.934 1.013   12.448  1.00 0.00 ? 119 GLN A CG   4  
ATOM 7677  C CD   . GLN A 1 119 ? -19.480 -0.071  13.368  1.00 0.00 ? 119 GLN A CD   4  
ATOM 7678  O OE1  . GLN A 1 119 ? -20.011 0.178   14.445  1.00 0.00 ? 119 GLN A OE1  4  
ATOM 7679  N NE2  . GLN A 1 119 ? -19.334 -1.319  12.980  1.00 0.00 ? 119 GLN A NE2  4  
ATOM 7680  H H    . GLN A 1 119 ? -16.873 0.081   10.310  1.00 0.00 ? 119 GLN A H    4  
ATOM 7681  H HA   . GLN A 1 119 ? -17.471 2.768   11.220  1.00 0.00 ? 119 GLN A HA   4  
ATOM 7682  H HB2  . GLN A 1 119 ? -16.950 0.152   12.645  1.00 0.00 ? 119 GLN A HB2  4  
ATOM 7683  H HB3  . GLN A 1 119 ? -17.196 1.661   13.520  1.00 0.00 ? 119 GLN A HB3  4  
ATOM 7684  H HG2  . GLN A 1 119 ? -19.405 1.968   12.683  1.00 0.00 ? 119 GLN A HG2  4  
ATOM 7685  H HG3  . GLN A 1 119 ? -19.192 0.755   11.420  1.00 0.00 ? 119 GLN A HG3  4  
ATOM 7686  H HE21 . GLN A 1 119 ? -18.937 -1.484  12.061  1.00 0.00 ? 119 GLN A HE21 4  
ATOM 7687  H HE22 . GLN A 1 119 ? -19.728 -2.052  13.548  1.00 0.00 ? 119 GLN A HE22 4  
ATOM 7688  N N    . LEU A 1 120 ? -14.322 1.924   11.349  1.00 0.00 ? 120 LEU A N    4  
ATOM 7689  C CA   . LEU A 1 120 ? -12.991 2.536   11.465  1.00 0.00 ? 120 LEU A CA   4  
ATOM 7690  C C    . LEU A 1 120 ? -12.791 3.665   10.439  1.00 0.00 ? 120 LEU A C    4  
ATOM 7691  O O    . LEU A 1 120 ? -12.631 4.817   10.842  1.00 0.00 ? 120 LEU A O    4  
ATOM 7692  C CB   . LEU A 1 120 ? -11.890 1.459   11.415  1.00 0.00 ? 120 LEU A CB   4  
ATOM 7693  C CG   . LEU A 1 120 ? -12.051 0.346   12.475  1.00 0.00 ? 120 LEU A CG   4  
ATOM 7694  C CD1  . LEU A 1 120 ? -10.859 -0.607  12.387  1.00 0.00 ? 120 LEU A CD1  4  
ATOM 7695  C CD2  . LEU A 1 120 ? -12.129 0.918   13.892  1.00 0.00 ? 120 LEU A CD2  4  
ATOM 7696  H H    . LEU A 1 120 ? -14.402 0.994   10.948  1.00 0.00 ? 120 LEU A H    4  
ATOM 7697  H HA   . LEU A 1 120 ? -12.926 3.023   12.440  1.00 0.00 ? 120 LEU A HA   4  
ATOM 7698  H HB2  . LEU A 1 120 ? -11.857 0.998   10.429  1.00 0.00 ? 120 LEU A HB2  4  
ATOM 7699  H HB3  . LEU A 1 120 ? -10.931 1.956   11.572  1.00 0.00 ? 120 LEU A HB3  4  
ATOM 7700  H HG   . LEU A 1 120 ? -12.957 -0.225  12.286  1.00 0.00 ? 120 LEU A HG   4  
ATOM 7701  H HD11 . LEU A 1 120 ? -10.760 -1.000  11.375  1.00 0.00 ? 120 LEU A HD11 4  
ATOM 7702  H HD12 . LEU A 1 120 ? -9.955  -0.073  12.662  1.00 0.00 ? 120 LEU A HD12 4  
ATOM 7703  H HD13 . LEU A 1 120 ? -10.999 -1.435  13.077  1.00 0.00 ? 120 LEU A HD13 4  
ATOM 7704  H HD21 . LEU A 1 120 ? -11.293 1.594   14.047  1.00 0.00 ? 120 LEU A HD21 4  
ATOM 7705  H HD22 . LEU A 1 120 ? -13.056 1.470   14.030  1.00 0.00 ? 120 LEU A HD22 4  
ATOM 7706  H HD23 . LEU A 1 120 ? -12.089 0.112   14.625  1.00 0.00 ? 120 LEU A HD23 4  
ATOM 7707  N N    . ARG A 1 121 ? -12.854 3.369   9.129   1.00 0.00 ? 121 ARG A N    4  
ATOM 7708  C CA   . ARG A 1 121 ? -12.732 4.367   8.037   1.00 0.00 ? 121 ARG A CA   4  
ATOM 7709  C C    . ARG A 1 121 ? -13.967 5.288   7.877   1.00 0.00 ? 121 ARG A C    4  
ATOM 7710  O O    . ARG A 1 121 ? -14.006 6.126   6.975   1.00 0.00 ? 121 ARG A O    4  
ATOM 7711  C CB   . ARG A 1 121 ? -12.326 3.699   6.703   1.00 0.00 ? 121 ARG A CB   4  
ATOM 7712  C CG   . ARG A 1 121 ? -13.399 2.753   6.145   1.00 0.00 ? 121 ARG A CG   4  
ATOM 7713  C CD   . ARG A 1 121 ? -13.000 2.039   4.851   1.00 0.00 ? 121 ARG A CD   4  
ATOM 7714  N NE   . ARG A 1 121 ? -14.019 1.017   4.526   1.00 0.00 ? 121 ARG A NE   4  
ATOM 7715  C CZ   . ARG A 1 121 ? -13.842 -0.281  4.296   1.00 0.00 ? 121 ARG A CZ   4  
ATOM 7716  N NH1  . ARG A 1 121 ? -12.648 -0.807  4.121   1.00 0.00 ? 121 ARG A NH1  4  
ATOM 7717  N NH2  . ARG A 1 121 ? -14.888 -1.077  4.236   1.00 0.00 ? 121 ARG A NH2  4  
ATOM 7718  H H    . ARG A 1 121 ? -13.007 2.399   8.877   1.00 0.00 ? 121 ARG A H    4  
ATOM 7719  H HA   . ARG A 1 121 ? -11.905 5.025   8.309   1.00 0.00 ? 121 ARG A HA   4  
ATOM 7720  H HB2  . ARG A 1 121 ? -12.115 4.476   5.965   1.00 0.00 ? 121 ARG A HB2  4  
ATOM 7721  H HB3  . ARG A 1 121 ? -11.404 3.138   6.862   1.00 0.00 ? 121 ARG A HB3  4  
ATOM 7722  H HG2  . ARG A 1 121 ? -13.584 1.992   6.889   1.00 0.00 ? 121 ARG A HG2  4  
ATOM 7723  H HG3  . ARG A 1 121 ? -14.326 3.299   5.981   1.00 0.00 ? 121 ARG A HG3  4  
ATOM 7724  H HD2  . ARG A 1 121 ? -12.933 2.763   4.037   1.00 0.00 ? 121 ARG A HD2  4  
ATOM 7725  H HD3  . ARG A 1 121 ? -12.020 1.579   4.993   1.00 0.00 ? 121 ARG A HD3  4  
ATOM 7726  H HE   . ARG A 1 121 ? -14.972 1.355   4.491   1.00 0.00 ? 121 ARG A HE   4  
ATOM 7727  H HH11 . ARG A 1 121 ? -11.832 -0.216  4.122   1.00 0.00 ? 121 ARG A HH11 4  
ATOM 7728  H HH12 . ARG A 1 121 ? -12.538 -1.794  3.935   1.00 0.00 ? 121 ARG A HH12 4  
ATOM 7729  H HH21 . ARG A 1 121 ? -15.812 -0.739  4.483   1.00 0.00 ? 121 ARG A HH21 4  
ATOM 7730  H HH22 . ARG A 1 121 ? -14.784 -2.057  4.019   1.00 0.00 ? 121 ARG A HH22 4  
ATOM 7731  N N    . TYR A 1 122 ? -14.948 5.182   8.782   1.00 0.00 ? 122 TYR A N    4  
ATOM 7732  C CA   . TYR A 1 122 ? -16.221 5.921   8.807   1.00 0.00 ? 122 TYR A CA   4  
ATOM 7733  C C    . TYR A 1 122 ? -16.017 7.451   8.732   1.00 0.00 ? 122 TYR A C    4  
ATOM 7734  O O    . TYR A 1 122 ? -16.889 8.200   8.290   1.00 0.00 ? 122 TYR A O    4  
ATOM 7735  C CB   . TYR A 1 122 ? -16.939 5.607   10.127  1.00 0.00 ? 122 TYR A CB   4  
ATOM 7736  C CG   . TYR A 1 122 ? -18.447 5.757   10.091  1.00 0.00 ? 122 TYR A CG   4  
ATOM 7737  C CD1  . TYR A 1 122 ? -19.253 4.661   9.720   1.00 0.00 ? 122 TYR A CD1  4  
ATOM 7738  C CD2  . TYR A 1 122 ? -19.051 6.975   10.464  1.00 0.00 ? 122 TYR A CD2  4  
ATOM 7739  C CE1  . TYR A 1 122 ? -20.655 4.784   9.705   1.00 0.00 ? 122 TYR A CE1  4  
ATOM 7740  C CE2  . TYR A 1 122 ? -20.453 7.106   10.450  1.00 0.00 ? 122 TYR A CE2  4  
ATOM 7741  C CZ   . TYR A 1 122 ? -21.260 6.009   10.067  1.00 0.00 ? 122 TYR A CZ   4  
ATOM 7742  O OH   . TYR A 1 122 ? -22.617 6.137   10.058  1.00 0.00 ? 122 TYR A OH   4  
ATOM 7743  H H    . TYR A 1 122 ? -14.871 4.430   9.447   1.00 0.00 ? 122 TYR A H    4  
ATOM 7744  H HA   . TYR A 1 122 ? -16.829 5.533   7.979   1.00 0.00 ? 122 TYR A HA   4  
ATOM 7745  H HB2  . TYR A 1 122 ? -16.722 4.587   10.412  1.00 0.00 ? 122 TYR A HB2  4  
ATOM 7746  H HB3  . TYR A 1 122 ? -16.532 6.233   10.924  1.00 0.00 ? 122 TYR A HB3  4  
ATOM 7747  H HD1  . TYR A 1 122 ? -18.797 3.717   9.450   1.00 0.00 ? 122 TYR A HD1  4  
ATOM 7748  H HD2  . TYR A 1 122 ? -18.439 7.815   10.763  1.00 0.00 ? 122 TYR A HD2  4  
ATOM 7749  H HE1  . TYR A 1 122 ? -21.268 3.939   9.414   1.00 0.00 ? 122 TYR A HE1  4  
ATOM 7750  H HE2  . TYR A 1 122 ? -20.917 8.039   10.737  1.00 0.00 ? 122 TYR A HE2  4  
ATOM 7751  H HH   . TYR A 1 122 ? -23.060 5.326   9.781   1.00 0.00 ? 122 TYR A HH   4  
ATOM 7752  N N    . GLY A 1 123 ? -14.824 7.896   9.170   1.00 0.00 ? 123 GLY A N    4  
ATOM 7753  C CA   . GLY A 1 123 ? -14.325 9.275   9.159   1.00 0.00 ? 123 GLY A CA   4  
ATOM 7754  C C    . GLY A 1 123 ? -14.428 9.979   7.805   1.00 0.00 ? 123 GLY A C    4  
ATOM 7755  O O    . GLY A 1 123 ? -14.511 11.206  7.772   1.00 0.00 ? 123 GLY A O    4  
ATOM 7756  H H    . GLY A 1 123 ? -14.217 7.189   9.572   1.00 0.00 ? 123 GLY A H    4  
ATOM 7757  H HA2  . GLY A 1 123 ? -14.885 9.861   9.888   1.00 0.00 ? 123 GLY A HA2  4  
ATOM 7758  H HA3  . GLY A 1 123 ? -13.267 9.261   9.441   1.00 0.00 ? 123 GLY A HA3  4  
ATOM 7759  N N    . LYS A 1 124 ? -14.459 9.220   6.701   1.00 0.00 ? 124 LYS A N    4  
ATOM 7760  C CA   . LYS A 1 124 ? -14.762 9.763   5.367   1.00 0.00 ? 124 LYS A CA   4  
ATOM 7761  C C    . LYS A 1 124 ? -15.547 8.809   4.433   1.00 0.00 ? 124 LYS A C    4  
ATOM 7762  O O    . LYS A 1 124 ? -16.201 9.290   3.500   1.00 0.00 ? 124 LYS A O    4  
ATOM 7763  C CB   . LYS A 1 124 ? -13.435 10.265  4.753   1.00 0.00 ? 124 LYS A CB   4  
ATOM 7764  C CG   . LYS A 1 124 ? -13.582 11.194  3.531   1.00 0.00 ? 124 LYS A CG   4  
ATOM 7765  C CD   . LYS A 1 124 ? -14.405 12.464  3.803   1.00 0.00 ? 124 LYS A CD   4  
ATOM 7766  C CE   . LYS A 1 124 ? -14.338 13.410  2.594   1.00 0.00 ? 124 LYS A CE   4  
ATOM 7767  N NZ   . LYS A 1 124 ? -15.148 14.641  2.805   1.00 0.00 ? 124 LYS A NZ   4  
ATOM 7768  H H    . LYS A 1 124 ? -14.333 8.220   6.809   1.00 0.00 ? 124 LYS A H    4  
ATOM 7769  H HA   . LYS A 1 124 ? -15.420 10.620  5.514   1.00 0.00 ? 124 LYS A HA   4  
ATOM 7770  H HB2  . LYS A 1 124 ? -12.892 10.825  5.516   1.00 0.00 ? 124 LYS A HB2  4  
ATOM 7771  H HB3  . LYS A 1 124 ? -12.812 9.405   4.487   1.00 0.00 ? 124 LYS A HB3  4  
ATOM 7772  H HG2  . LYS A 1 124 ? -12.578 11.504  3.236   1.00 0.00 ? 124 LYS A HG2  4  
ATOM 7773  H HG3  . LYS A 1 124 ? -14.027 10.643  2.703   1.00 0.00 ? 124 LYS A HG3  4  
ATOM 7774  H HD2  . LYS A 1 124 ? -15.449 12.196  3.985   1.00 0.00 ? 124 LYS A HD2  4  
ATOM 7775  H HD3  . LYS A 1 124 ? -14.009 12.973  4.685   1.00 0.00 ? 124 LYS A HD3  4  
ATOM 7776  H HE2  . LYS A 1 124 ? -13.292 13.680  2.416   1.00 0.00 ? 124 LYS A HE2  4  
ATOM 7777  H HE3  . LYS A 1 124 ? -14.702 12.877  1.711   1.00 0.00 ? 124 LYS A HE3  4  
ATOM 7778  H HZ1  . LYS A 1 124 ? -16.124 14.418  2.948   1.00 0.00 ? 124 LYS A HZ1  4  
ATOM 7779  H HZ2  . LYS A 1 124 ? -14.826 15.164  3.609   1.00 0.00 ? 124 LYS A HZ2  4  
ATOM 7780  H HZ3  . LYS A 1 124 ? -15.090 15.254  2.001   1.00 0.00 ? 124 LYS A HZ3  4  
ATOM 7781  N N    . SER A 1 125 ? -15.544 7.492   4.693   1.00 0.00 ? 125 SER A N    4  
ATOM 7782  C CA   . SER A 1 125 ? -16.295 6.485   3.907   1.00 0.00 ? 125 SER A CA   4  
ATOM 7783  C C    . SER A 1 125 ? -17.803 6.504   4.192   1.00 0.00 ? 125 SER A C    4  
ATOM 7784  O O    . SER A 1 125 ? -18.590 6.534   3.218   1.00 0.00 ? 125 SER A O    4  
ATOM 7785  C CB   . SER A 1 125 ? -15.743 5.085   4.156   1.00 0.00 ? 125 SER A CB   4  
ATOM 7786  O OG   . SER A 1 125 ? -14.383 5.074   3.775   1.00 0.00 ? 125 SER A OG   4  
ATOM 7787  O OXT  . SER A 1 125 ? -18.198 6.472   5.381   1.00 0.00 ? 125 SER A OXT  4  
ATOM 7788  H H    . SER A 1 125 ? -15.001 7.158   5.476   1.00 0.00 ? 125 SER A H    4  
ATOM 7789  H HA   . SER A 1 125 ? -16.178 6.706   2.848   1.00 0.00 ? 125 SER A HA   4  
ATOM 7790  H HB2  . SER A 1 125 ? -15.850 4.829   5.212   1.00 0.00 ? 125 SER A HB2  4  
ATOM 7791  H HB3  . SER A 1 125 ? -16.305 4.363   3.559   1.00 0.00 ? 125 SER A HB3  4  
ATOM 7792  H HG   . SER A 1 125 ? -14.170 5.964   3.425   1.00 0.00 ? 125 SER A HG   4  
ATOM 7793  N N    . MET A 1 1   ? 15.293  -13.902 -6.838  1.00 0.00 ? 1   MET A N    5  
ATOM 7794  C CA   . MET A 1 1   ? 14.648  -12.564 -6.670  1.00 0.00 ? 1   MET A CA   5  
ATOM 7795  C C    . MET A 1 1   ? 14.463  -12.221 -5.185  1.00 0.00 ? 1   MET A C    5  
ATOM 7796  O O    . MET A 1 1   ? 14.350  -13.117 -4.346  1.00 0.00 ? 1   MET A O    5  
ATOM 7797  C CB   . MET A 1 1   ? 13.288  -12.468 -7.403  1.00 0.00 ? 1   MET A CB   5  
ATOM 7798  C CG   . MET A 1 1   ? 13.415  -12.525 -8.932  1.00 0.00 ? 1   MET A CG   5  
ATOM 7799  S SD   . MET A 1 1   ? 11.836  -12.314 -9.806  1.00 0.00 ? 1   MET A SD   5  
ATOM 7800  C CE   . MET A 1 1   ? 12.416  -12.444 -11.520 1.00 0.00 ? 1   MET A CE   5  
ATOM 7801  H H1   . MET A 1 1   ? 15.473  -14.099 -7.810  1.00 0.00 ? 1   MET A H1   5  
ATOM 7802  H H2   . MET A 1 1   ? 16.174  -13.935 -6.345  1.00 0.00 ? 1   MET A H2   5  
ATOM 7803  H H3   . MET A 1 1   ? 14.703  -14.632 -6.464  1.00 0.00 ? 1   MET A H3   5  
ATOM 7804  H HA   . MET A 1 1   ? 15.315  -11.809 -7.092  1.00 0.00 ? 1   MET A HA   5  
ATOM 7805  H HB2  . MET A 1 1   ? 12.632  -13.272 -7.069  1.00 0.00 ? 1   MET A HB2  5  
ATOM 7806  H HB3  . MET A 1 1   ? 12.812  -11.521 -7.148  1.00 0.00 ? 1   MET A HB3  5  
ATOM 7807  H HG2  . MET A 1 1   ? 14.094  -11.739 -9.259  1.00 0.00 ? 1   MET A HG2  5  
ATOM 7808  H HG3  . MET A 1 1   ? 13.835  -13.489 -9.225  1.00 0.00 ? 1   MET A HG3  5  
ATOM 7809  H HE1  . MET A 1 1   ? 12.887  -13.414 -11.682 1.00 0.00 ? 1   MET A HE1  5  
ATOM 7810  H HE2  . MET A 1 1   ? 11.572  -12.336 -12.200 1.00 0.00 ? 1   MET A HE2  5  
ATOM 7811  H HE3  . MET A 1 1   ? 13.137  -11.653 -11.724 1.00 0.00 ? 1   MET A HE3  5  
ATOM 7812  N N    . ALA A 1 2   ? 14.412  -10.925 -4.848  1.00 0.00 ? 2   ALA A N    5  
ATOM 7813  C CA   . ALA A 1 2   ? 14.172  -10.433 -3.484  1.00 0.00 ? 2   ALA A CA   5  
ATOM 7814  C C    . ALA A 1 2   ? 12.700  -10.590 -3.042  1.00 0.00 ? 2   ALA A C    5  
ATOM 7815  O O    . ALA A 1 2   ? 11.789  -10.663 -3.871  1.00 0.00 ? 2   ALA A O    5  
ATOM 7816  C CB   . ALA A 1 2   ? 14.632  -8.970  -3.411  1.00 0.00 ? 2   ALA A CB   5  
ATOM 7817  H H    . ALA A 1 2   ? 14.501  -10.228 -5.578  1.00 0.00 ? 2   ALA A H    5  
ATOM 7818  H HA   . ALA A 1 2   ? 14.784  -11.014 -2.788  1.00 0.00 ? 2   ALA A HA   5  
ATOM 7819  H HB1  . ALA A 1 2   ? 15.685  -8.898  -3.690  1.00 0.00 ? 2   ALA A HB1  5  
ATOM 7820  H HB2  . ALA A 1 2   ? 14.037  -8.353  -4.085  1.00 0.00 ? 2   ALA A HB2  5  
ATOM 7821  H HB3  . ALA A 1 2   ? 14.514  -8.589  -2.394  1.00 0.00 ? 2   ALA A HB3  5  
ATOM 7822  N N    . SER A 1 3   ? 12.459  -10.618 -1.731  1.00 0.00 ? 3   SER A N    5  
ATOM 7823  C CA   . SER A 1 3   ? 11.115  -10.757 -1.145  1.00 0.00 ? 3   SER A CA   5  
ATOM 7824  C C    . SER A 1 3   ? 10.246  -9.488  -1.332  1.00 0.00 ? 3   SER A C    5  
ATOM 7825  O O    . SER A 1 3   ? 10.783  -8.371  -1.317  1.00 0.00 ? 3   SER A O    5  
ATOM 7826  C CB   . SER A 1 3   ? 11.226  -11.080 0.356   1.00 0.00 ? 3   SER A CB   5  
ATOM 7827  O OG   . SER A 1 3   ? 11.973  -12.271 0.581   1.00 0.00 ? 3   SER A OG   5  
ATOM 7828  H H    . SER A 1 3   ? 13.238  -10.569 -1.093  1.00 0.00 ? 3   SER A H    5  
ATOM 7829  H HA   . SER A 1 3   ? 10.620  -11.603 -1.627  1.00 0.00 ? 3   SER A HA   5  
ATOM 7830  H HB2  . SER A 1 3   ? 11.708  -10.246 0.870   1.00 0.00 ? 3   SER A HB2  5  
ATOM 7831  H HB3  . SER A 1 3   ? 10.223  -11.206 0.771   1.00 0.00 ? 3   SER A HB3  5  
ATOM 7832  H HG   . SER A 1 3   ? 12.010  -12.442 1.536   1.00 0.00 ? 3   SER A HG   5  
ATOM 7833  N N    . PRO A 1 4   ? 8.909   -9.628  -1.464  1.00 0.00 ? 4   PRO A N    5  
ATOM 7834  C CA   . PRO A 1 4   ? 7.981   -8.498  -1.537  1.00 0.00 ? 4   PRO A CA   5  
ATOM 7835  C C    . PRO A 1 4   ? 7.794   -7.831  -0.163  1.00 0.00 ? 4   PRO A C    5  
ATOM 7836  O O    . PRO A 1 4   ? 8.097   -8.417  0.878   1.00 0.00 ? 4   PRO A O    5  
ATOM 7837  C CB   . PRO A 1 4   ? 6.670   -9.086  -2.066  1.00 0.00 ? 4   PRO A CB   5  
ATOM 7838  C CG   . PRO A 1 4   ? 6.689   -10.510 -1.512  1.00 0.00 ? 4   PRO A CG   5  
ATOM 7839  C CD   . PRO A 1 4   ? 8.171   -10.882 -1.572  1.00 0.00 ? 4   PRO A CD   5  
ATOM 7840  H HA   . PRO A 1 4   ? 8.350   -7.755  -2.244  1.00 0.00 ? 4   PRO A HA   5  
ATOM 7841  H HB2  . PRO A 1 4   ? 5.793   -8.532  -1.727  1.00 0.00 ? 4   PRO A HB2  5  
ATOM 7842  H HB3  . PRO A 1 4   ? 6.698   -9.115  -3.158  1.00 0.00 ? 4   PRO A HB3  5  
ATOM 7843  H HG2  . PRO A 1 4   ? 6.354   -10.504 -0.475  1.00 0.00 ? 4   PRO A HG2  5  
ATOM 7844  H HG3  . PRO A 1 4   ? 6.075   -11.189 -2.107  1.00 0.00 ? 4   PRO A HG3  5  
ATOM 7845  H HD2  . PRO A 1 4   ? 8.413   -11.561 -0.753  1.00 0.00 ? 4   PRO A HD2  5  
ATOM 7846  H HD3  . PRO A 1 4   ? 8.391   -11.353 -2.531  1.00 0.00 ? 4   PRO A HD3  5  
ATOM 7847  N N    . HIS A 1 5   ? 7.259   -6.605  -0.157  1.00 0.00 ? 5   HIS A N    5  
ATOM 7848  C CA   . HIS A 1 5   ? 7.013   -5.807  1.050   1.00 0.00 ? 5   HIS A CA   5  
ATOM 7849  C C    . HIS A 1 5   ? 5.916   -4.740  0.819   1.00 0.00 ? 5   HIS A C    5  
ATOM 7850  O O    . HIS A 1 5   ? 5.726   -4.255  -0.301  1.00 0.00 ? 5   HIS A O    5  
ATOM 7851  C CB   . HIS A 1 5   ? 8.340   -5.166  1.505   1.00 0.00 ? 5   HIS A CB   5  
ATOM 7852  C CG   . HIS A 1 5   ? 8.234   -4.381  2.789   1.00 0.00 ? 5   HIS A CG   5  
ATOM 7853  N ND1  . HIS A 1 5   ? 8.226   -4.900  4.065   1.00 0.00 ? 5   HIS A ND1  5  
ATOM 7854  C CD2  . HIS A 1 5   ? 8.100   -3.023  2.903   1.00 0.00 ? 5   HIS A CD2  5  
ATOM 7855  C CE1  . HIS A 1 5   ? 8.091   -3.875  4.927   1.00 0.00 ? 5   HIS A CE1  5  
ATOM 7856  N NE2  . HIS A 1 5   ? 8.006   -2.704  4.265   1.00 0.00 ? 5   HIS A NE2  5  
ATOM 7857  H H    . HIS A 1 5   ? 7.003   -6.181  -1.042  1.00 0.00 ? 5   HIS A H    5  
ATOM 7858  H HA   . HIS A 1 5   ? 6.663   -6.476  1.840   1.00 0.00 ? 5   HIS A HA   5  
ATOM 7859  H HB2  . HIS A 1 5   ? 9.087   -5.947  1.646   1.00 0.00 ? 5   HIS A HB2  5  
ATOM 7860  H HB3  . HIS A 1 5   ? 8.696   -4.502  0.717   1.00 0.00 ? 5   HIS A HB3  5  
ATOM 7861  H HD1  . HIS A 1 5   ? 8.337   -5.873  4.322   1.00 0.00 ? 5   HIS A HD1  5  
ATOM 7862  H HD2  . HIS A 1 5   ? 8.064   -2.320  2.080   1.00 0.00 ? 5   HIS A HD2  5  
ATOM 7863  H HE1  . HIS A 1 5   ? 8.053   -3.981  6.007   1.00 0.00 ? 5   HIS A HE1  5  
ATOM 7864  N N    . GLN A 1 6   ? 5.210   -4.352  1.889   1.00 0.00 ? 6   GLN A N    5  
ATOM 7865  C CA   . GLN A 1 6   ? 4.140   -3.347  1.901   1.00 0.00 ? 6   GLN A CA   5  
ATOM 7866  C C    . GLN A 1 6   ? 3.947   -2.851  3.346   1.00 0.00 ? 6   GLN A C    5  
ATOM 7867  O O    . GLN A 1 6   ? 3.842   -3.667  4.264   1.00 0.00 ? 6   GLN A O    5  
ATOM 7868  C CB   . GLN A 1 6   ? 2.859   -3.976  1.323   1.00 0.00 ? 6   GLN A CB   5  
ATOM 7869  C CG   . GLN A 1 6   ? 1.634   -3.052  1.377   1.00 0.00 ? 6   GLN A CG   5  
ATOM 7870  C CD   . GLN A 1 6   ? 0.415   -3.681  0.703   1.00 0.00 ? 6   GLN A CD   5  
ATOM 7871  O OE1  . GLN A 1 6   ? -0.138  -3.158  -0.256  1.00 0.00 ? 6   GLN A OE1  5  
ATOM 7872  N NE2  . GLN A 1 6   ? -0.054  -4.821  1.165   1.00 0.00 ? 6   GLN A NE2  5  
ATOM 7873  H H    . GLN A 1 6   ? 5.436   -4.765  2.785   1.00 0.00 ? 6   GLN A H    5  
ATOM 7874  H HA   . GLN A 1 6   ? 4.433   -2.501  1.274   1.00 0.00 ? 6   GLN A HA   5  
ATOM 7875  H HB2  . GLN A 1 6   ? 3.035   -4.245  0.280   1.00 0.00 ? 6   GLN A HB2  5  
ATOM 7876  H HB3  . GLN A 1 6   ? 2.638   -4.893  1.870   1.00 0.00 ? 6   GLN A HB3  5  
ATOM 7877  H HG2  . GLN A 1 6   ? 1.377   -2.840  2.417   1.00 0.00 ? 6   GLN A HG2  5  
ATOM 7878  H HG3  . GLN A 1 6   ? 1.866   -2.112  0.876   1.00 0.00 ? 6   GLN A HG3  5  
ATOM 7879  H HE21 . GLN A 1 6   ? 0.357   -5.278  1.964   1.00 0.00 ? 6   GLN A HE21 5  
ATOM 7880  H HE22 . GLN A 1 6   ? -0.897  -5.196  0.743   1.00 0.00 ? 6   GLN A HE22 5  
ATOM 7881  N N    . GLU A 1 7   ? 3.885   -1.530  3.557   1.00 0.00 ? 7   GLU A N    5  
ATOM 7882  C CA   . GLU A 1 7   ? 3.922   -0.926  4.896   1.00 0.00 ? 7   GLU A CA   5  
ATOM 7883  C C    . GLU A 1 7   ? 2.568   -0.300  5.288   1.00 0.00 ? 7   GLU A C    5  
ATOM 7884  O O    . GLU A 1 7   ? 2.136   0.658   4.631   1.00 0.00 ? 7   GLU A O    5  
ATOM 7885  C CB   . GLU A 1 7   ? 5.018   0.157   4.945   1.00 0.00 ? 7   GLU A CB   5  
ATOM 7886  C CG   . GLU A 1 7   ? 5.305   0.634   6.373   1.00 0.00 ? 7   GLU A CG   5  
ATOM 7887  C CD   . GLU A 1 7   ? 6.386   1.724   6.374   1.00 0.00 ? 7   GLU A CD   5  
ATOM 7888  O OE1  . GLU A 1 7   ? 6.093   2.858   5.923   1.00 0.00 ? 7   GLU A OE1  5  
ATOM 7889  O OE2  . GLU A 1 7   ? 7.525   1.459   6.827   1.00 0.00 ? 7   GLU A OE2  5  
ATOM 7890  H H    . GLU A 1 7   ? 3.869   -0.902  2.763   1.00 0.00 ? 7   GLU A H    5  
ATOM 7891  H HA   . GLU A 1 7   ? 4.211   -1.686  5.619   1.00 0.00 ? 7   GLU A HA   5  
ATOM 7892  H HB2  . GLU A 1 7   ? 5.938   -0.251  4.525   1.00 0.00 ? 7   GLU A HB2  5  
ATOM 7893  H HB3  . GLU A 1 7   ? 4.713   1.020   4.348   1.00 0.00 ? 7   GLU A HB3  5  
ATOM 7894  H HG2  . GLU A 1 7   ? 4.395   1.042   6.818   1.00 0.00 ? 7   GLU A HG2  5  
ATOM 7895  H HG3  . GLU A 1 7   ? 5.630   -0.215  6.979   1.00 0.00 ? 7   GLU A HG3  5  
ATOM 7896  N N    . PRO A 1 8   ? 1.899   -0.793  6.352   1.00 0.00 ? 8   PRO A N    5  
ATOM 7897  C CA   . PRO A 1 8   ? 0.746   -0.124  6.934   1.00 0.00 ? 8   PRO A CA   5  
ATOM 7898  C C    . PRO A 1 8   ? 1.250   1.001   7.849   1.00 0.00 ? 8   PRO A C    5  
ATOM 7899  O O    . PRO A 1 8   ? 2.239   0.844   8.567   1.00 0.00 ? 8   PRO A O    5  
ATOM 7900  C CB   . PRO A 1 8   ? -0.007  -1.206  7.699   1.00 0.00 ? 8   PRO A CB   5  
ATOM 7901  C CG   . PRO A 1 8   ? 1.108   -2.143  8.160   1.00 0.00 ? 8   PRO A CG   5  
ATOM 7902  C CD   . PRO A 1 8   ? 2.157   -2.046  7.052   1.00 0.00 ? 8   PRO A CD   5  
ATOM 7903  H HA   . PRO A 1 8   ? 0.102   0.288   6.156   1.00 0.00 ? 8   PRO A HA   5  
ATOM 7904  H HB2  . PRO A 1 8   ? -0.576  -0.796  8.536   1.00 0.00 ? 8   PRO A HB2  5  
ATOM 7905  H HB3  . PRO A 1 8   ? -0.664  -1.738  7.012   1.00 0.00 ? 8   PRO A HB3  5  
ATOM 7906  H HG2  . PRO A 1 8   ? 1.532   -1.775  9.092   1.00 0.00 ? 8   PRO A HG2  5  
ATOM 7907  H HG3  . PRO A 1 8   ? 0.743   -3.161  8.277   1.00 0.00 ? 8   PRO A HG3  5  
ATOM 7908  H HD2  . PRO A 1 8   ? 3.155   -2.057  7.492   1.00 0.00 ? 8   PRO A HD2  5  
ATOM 7909  H HD3  . PRO A 1 8   ? 2.037   -2.879  6.358   1.00 0.00 ? 8   PRO A HD3  5  
ATOM 7910  N N    . LYS A 1 9   ? 0.585   2.156   7.821   1.00 0.00 ? 9   LYS A N    5  
ATOM 7911  C CA   . LYS A 1 9   ? 1.011   3.331   8.596   1.00 0.00 ? 9   LYS A CA   5  
ATOM 7912  C C    . LYS A 1 9   ? 0.450   3.293   10.043  1.00 0.00 ? 9   LYS A C    5  
ATOM 7913  O O    . LYS A 1 9   ? -0.642  2.754   10.255  1.00 0.00 ? 9   LYS A O    5  
ATOM 7914  C CB   . LYS A 1 9   ? 0.613   4.605   7.824   1.00 0.00 ? 9   LYS A CB   5  
ATOM 7915  C CG   . LYS A 1 9   ? 1.163   4.683   6.381   1.00 0.00 ? 9   LYS A CG   5  
ATOM 7916  C CD   . LYS A 1 9   ? 2.694   4.536   6.273   1.00 0.00 ? 9   LYS A CD   5  
ATOM 7917  C CE   . LYS A 1 9   ? 3.149   4.851   4.841   1.00 0.00 ? 9   LYS A CE   5  
ATOM 7918  N NZ   . LYS A 1 9   ? 4.631   4.939   4.748   1.00 0.00 ? 9   LYS A NZ   5  
ATOM 7919  H H    . LYS A 1 9   ? -0.235  2.240   7.234   1.00 0.00 ? 9   LYS A H    5  
ATOM 7920  H HA   . LYS A 1 9   ? 2.098   3.311   8.674   1.00 0.00 ? 9   LYS A HA   5  
ATOM 7921  H HB2  . LYS A 1 9   ? -0.476  4.662   7.776   1.00 0.00 ? 9   LYS A HB2  5  
ATOM 7922  H HB3  . LYS A 1 9   ? 0.968   5.477   8.375   1.00 0.00 ? 9   LYS A HB3  5  
ATOM 7923  H HG2  . LYS A 1 9   ? 0.685   3.918   5.767   1.00 0.00 ? 9   LYS A HG2  5  
ATOM 7924  H HG3  . LYS A 1 9   ? 0.877   5.652   5.971   1.00 0.00 ? 9   LYS A HG3  5  
ATOM 7925  H HD2  . LYS A 1 9   ? 3.169   5.229   6.970   1.00 0.00 ? 9   LYS A HD2  5  
ATOM 7926  H HD3  . LYS A 1 9   ? 2.992   3.508   6.510   1.00 0.00 ? 9   LYS A HD3  5  
ATOM 7927  H HE2  . LYS A 1 9   ? 2.775   4.070   4.171   1.00 0.00 ? 9   LYS A HE2  5  
ATOM 7928  H HE3  . LYS A 1 9   ? 2.707   5.799   4.529   1.00 0.00 ? 9   LYS A HE3  5  
ATOM 7929  H HZ1  . LYS A 1 9   ? 5.080   4.106   5.131   1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 7930  H HZ2  . LYS A 1 9   ? 4.931   5.047   3.789   1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 7931  H HZ3  . LYS A 1 9   ? 4.978   5.733   5.269   1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 7932  N N    . PRO A 1 10  ? 1.163   3.846   11.049  1.00 0.00 ? 10  PRO A N    5  
ATOM 7933  C CA   . PRO A 1 10  ? 0.729   3.821   12.446  1.00 0.00 ? 10  PRO A CA   5  
ATOM 7934  C C    . PRO A 1 10  ? -0.565  4.630   12.607  1.00 0.00 ? 10  PRO A C    5  
ATOM 7935  O O    . PRO A 1 10  ? -0.679  5.762   12.138  1.00 0.00 ? 10  PRO A O    5  
ATOM 7936  C CB   . PRO A 1 10  ? 1.923   4.332   13.265  1.00 0.00 ? 10  PRO A CB   5  
ATOM 7937  C CG   . PRO A 1 10  ? 2.625   5.266   12.283  1.00 0.00 ? 10  PRO A CG   5  
ATOM 7938  C CD   . PRO A 1 10  ? 2.437   4.551   10.942  1.00 0.00 ? 10  PRO A CD   5  
ATOM 7939  H HA   . PRO A 1 10  ? 0.522   2.808   12.781  1.00 0.00 ? 10  PRO A HA   5  
ATOM 7940  H HB2  . PRO A 1 10  ? 1.616   4.846   14.175  1.00 0.00 ? 10  PRO A HB2  5  
ATOM 7941  H HB3  . PRO A 1 10  ? 2.595   3.495   13.499  1.00 0.00 ? 10  PRO A HB3  5  
ATOM 7942  H HG2  . PRO A 1 10  ? 2.109   6.227   12.267  1.00 0.00 ? 10  PRO A HG2  5  
ATOM 7943  H HG3  . PRO A 1 10  ? 3.680   5.396   12.532  1.00 0.00 ? 10  PRO A HG3  5  
ATOM 7944  H HD2  . PRO A 1 10  ? 2.436   5.279   10.130  1.00 0.00 ? 10  PRO A HD2  5  
ATOM 7945  H HD3  . PRO A 1 10  ? 3.240   3.826   10.798  1.00 0.00 ? 10  PRO A HD3  5  
ATOM 7946  N N    . GLY A 1 11  ? -1.556  3.979   13.223  1.00 0.00 ? 11  GLY A N    5  
ATOM 7947  C CA   . GLY A 1 11  ? -2.930  4.459   13.384  1.00 0.00 ? 11  GLY A CA   5  
ATOM 7948  C C    . GLY A 1 11  ? -3.878  4.099   12.243  1.00 0.00 ? 11  GLY A C    5  
ATOM 7949  O O    . GLY A 1 11  ? -5.047  4.478   12.318  1.00 0.00 ? 11  GLY A O    5  
ATOM 7950  H H    . GLY A 1 11  ? -1.352  3.044   13.566  1.00 0.00 ? 11  GLY A H    5  
ATOM 7951  H HA2  . GLY A 1 11  ? -3.349  4.014   14.284  1.00 0.00 ? 11  GLY A HA2  5  
ATOM 7952  H HA3  . GLY A 1 11  ? -2.937  5.544   13.471  1.00 0.00 ? 11  GLY A HA3  5  
ATOM 7953  N N    . ASP A 1 12  ? -3.414  3.402   11.199  1.00 0.00 ? 12  ASP A N    5  
ATOM 7954  C CA   . ASP A 1 12  ? -4.220  3.128   10.005  1.00 0.00 ? 12  ASP A CA   5  
ATOM 7955  C C    . ASP A 1 12  ? -4.827  1.714   9.910   1.00 0.00 ? 12  ASP A C    5  
ATOM 7956  O O    . ASP A 1 12  ? -4.437  0.781   10.612  1.00 0.00 ? 12  ASP A O    5  
ATOM 7957  C CB   . ASP A 1 12  ? -3.507  3.592   8.720   1.00 0.00 ? 12  ASP A CB   5  
ATOM 7958  C CG   . ASP A 1 12  ? -4.453  4.484   7.902   1.00 0.00 ? 12  ASP A CG   5  
ATOM 7959  O OD1  . ASP A 1 12  ? -5.643  4.115   7.771   1.00 0.00 ? 12  ASP A OD1  5  
ATOM 7960  O OD2  . ASP A 1 12  ? -4.073  5.613   7.520   1.00 0.00 ? 12  ASP A OD2  5  
ATOM 7961  H H    . ASP A 1 12  ? -2.439  3.128   11.189  1.00 0.00 ? 12  ASP A H    5  
ATOM 7962  H HA   . ASP A 1 12  ? -5.092  3.770   10.099  1.00 0.00 ? 12  ASP A HA   5  
ATOM 7963  H HB2  . ASP A 1 12  ? -2.615  4.168   8.976   1.00 0.00 ? 12  ASP A HB2  5  
ATOM 7964  H HB3  . ASP A 1 12  ? -3.197  2.727   8.130   1.00 0.00 ? 12  ASP A HB3  5  
ATOM 7965  N N    . LEU A 1 13  ? -5.824  1.603   9.027   1.00 0.00 ? 13  LEU A N    5  
ATOM 7966  C CA   . LEU A 1 13  ? -6.751  0.486   8.864   1.00 0.00 ? 13  LEU A CA   5  
ATOM 7967  C C    . LEU A 1 13  ? -6.400  -0.434  7.703   1.00 0.00 ? 13  LEU A C    5  
ATOM 7968  O O    . LEU A 1 13  ? -6.573  -0.089  6.537   1.00 0.00 ? 13  LEU A O    5  
ATOM 7969  C CB   . LEU A 1 13  ? -8.148  1.080   8.629   1.00 0.00 ? 13  LEU A CB   5  
ATOM 7970  C CG   . LEU A 1 13  ? -8.687  1.844   9.842   1.00 0.00 ? 13  LEU A CG   5  
ATOM 7971  C CD1  . LEU A 1 13  ? -9.935  2.628   9.432   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 7972  C CD2  . LEU A 1 13  ? -9.022  0.854   10.964  1.00 0.00 ? 13  LEU A CD2  5  
ATOM 7973  H H    . LEU A 1 13  ? -5.978  2.406   8.421   1.00 0.00 ? 13  LEU A H    5  
ATOM 7974  H HA   . LEU A 1 13  ? -6.755  -0.119  9.770   1.00 0.00 ? 13  LEU A HA   5  
ATOM 7975  H HB2  . LEU A 1 13  ? -8.097  1.754   7.774   1.00 0.00 ? 13  LEU A HB2  5  
ATOM 7976  H HB3  . LEU A 1 13  ? -8.844  0.277   8.385   1.00 0.00 ? 13  LEU A HB3  5  
ATOM 7977  H HG   . LEU A 1 13  ? -7.928  2.554   10.175  1.00 0.00 ? 13  LEU A HG   5  
ATOM 7978  H HD11 . LEU A 1 13  ? -9.689  3.332   8.630   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 7979  H HD12 . LEU A 1 13  ? -10.703 1.938   9.082   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 7980  H HD13 . LEU A 1 13  ? -10.315 3.184   10.288  1.00 0.00 ? 13  LEU A HD13 5  
ATOM 7981  H HD21 . LEU A 1 13  ? -8.117  0.369   11.330  1.00 0.00 ? 13  LEU A HD21 5  
ATOM 7982  H HD22 . LEU A 1 13  ? -9.509  1.372   11.789  1.00 0.00 ? 13  LEU A HD22 5  
ATOM 7983  H HD23 . LEU A 1 13  ? -9.681  0.079   10.578  1.00 0.00 ? 13  LEU A HD23 5  
ATOM 7984  N N    . ILE A 1 14  ? -5.974  -1.644  8.040   1.00 0.00 ? 14  ILE A N    5  
ATOM 7985  C CA   . ILE A 1 14  ? -5.573  -2.687  7.097   1.00 0.00 ? 14  ILE A CA   5  
ATOM 7986  C C    . ILE A 1 14  ? -6.722  -3.683  6.900   1.00 0.00 ? 14  ILE A C    5  
ATOM 7987  O O    . ILE A 1 14  ? -7.288  -4.164  7.881   1.00 0.00 ? 14  ILE A O    5  
ATOM 7988  C CB   . ILE A 1 14  ? -4.324  -3.450  7.610   1.00 0.00 ? 14  ILE A CB   5  
ATOM 7989  C CG1  . ILE A 1 14  ? -3.365  -2.644  8.519   1.00 0.00 ? 14  ILE A CG1  5  
ATOM 7990  C CG2  . ILE A 1 14  ? -3.577  -4.008  6.381   1.00 0.00 ? 14  ILE A CG2  5  
ATOM 7991  C CD1  . ILE A 1 14  ? -2.259  -3.513  9.126   1.00 0.00 ? 14  ILE A CD1  5  
ATOM 7992  H H    . ILE A 1 14  ? -5.970  -1.878  9.029   1.00 0.00 ? 14  ILE A H    5  
ATOM 7993  H HA   . ILE A 1 14  ? -5.340  -2.223  6.135   1.00 0.00 ? 14  ILE A HA   5  
ATOM 7994  H HB   . ILE A 1 14  ? -4.676  -4.287  8.212   1.00 0.00 ? 14  ILE A HB   5  
ATOM 7995  H HG12 . ILE A 1 14  ? -2.921  -1.823  7.959   1.00 0.00 ? 14  ILE A HG12 5  
ATOM 7996  H HG13 . ILE A 1 14  ? -3.914  -2.221  9.360   1.00 0.00 ? 14  ILE A HG13 5  
ATOM 7997  H HG21 . ILE A 1 14  ? -4.270  -4.532  5.723   1.00 0.00 ? 14  ILE A HG21 5  
ATOM 7998  H HG22 . ILE A 1 14  ? -3.106  -3.195  5.824   1.00 0.00 ? 14  ILE A HG22 5  
ATOM 7999  H HG23 . ILE A 1 14  ? -2.808  -4.719  6.688   1.00 0.00 ? 14  ILE A HG23 5  
ATOM 8000  H HD11 . ILE A 1 14  ? -1.685  -2.927  9.843   1.00 0.00 ? 14  ILE A HD11 5  
ATOM 8001  H HD12 . ILE A 1 14  ? -2.696  -4.365  9.648   1.00 0.00 ? 14  ILE A HD12 5  
ATOM 8002  H HD13 . ILE A 1 14  ? -1.584  -3.866  8.349   1.00 0.00 ? 14  ILE A HD13 5  
ATOM 8003  N N    . GLU A 1 15  ? -7.045  -4.023  5.652   1.00 0.00 ? 15  GLU A N    5  
ATOM 8004  C CA   . GLU A 1 15  ? -7.941  -5.127  5.314   1.00 0.00 ? 15  GLU A CA   5  
ATOM 8005  C C    . GLU A 1 15  ? -7.053  -6.339  5.002   1.00 0.00 ? 15  GLU A C    5  
ATOM 8006  O O    . GLU A 1 15  ? -6.243  -6.299  4.072   1.00 0.00 ? 15  GLU A O    5  
ATOM 8007  C CB   . GLU A 1 15  ? -8.831  -4.798  4.105   1.00 0.00 ? 15  GLU A CB   5  
ATOM 8008  C CG   . GLU A 1 15  ? -9.872  -3.725  4.432   1.00 0.00 ? 15  GLU A CG   5  
ATOM 8009  C CD   . GLU A 1 15  ? -10.890 -3.583  3.290   1.00 0.00 ? 15  GLU A CD   5  
ATOM 8010  O OE1  . GLU A 1 15  ? -11.846 -4.393  3.222   1.00 0.00 ? 15  GLU A OE1  5  
ATOM 8011  O OE2  . GLU A 1 15  ? -10.744 -2.659  2.454   1.00 0.00 ? 15  GLU A OE2  5  
ATOM 8012  H H    . GLU A 1 15  ? -6.548  -3.584  4.885   1.00 0.00 ? 15  GLU A H    5  
ATOM 8013  H HA   . GLU A 1 15  ? -8.586  -5.371  6.158   1.00 0.00 ? 15  GLU A HA   5  
ATOM 8014  H HB2  . GLU A 1 15  ? -8.221  -4.468  3.263   1.00 0.00 ? 15  GLU A HB2  5  
ATOM 8015  H HB3  . GLU A 1 15  ? -9.354  -5.710  3.810   1.00 0.00 ? 15  GLU A HB3  5  
ATOM 8016  H HG2  . GLU A 1 15  ? -10.397 -4.003  5.348   1.00 0.00 ? 15  GLU A HG2  5  
ATOM 8017  H HG3  . GLU A 1 15  ? -9.364  -2.773  4.595   1.00 0.00 ? 15  GLU A HG3  5  
ATOM 8018  N N    . ILE A 1 16  ? -7.173  -7.401  5.800   1.00 0.00 ? 16  ILE A N    5  
ATOM 8019  C CA   . ILE A 1 16  ? -6.403  -8.645  5.693   1.00 0.00 ? 16  ILE A CA   5  
ATOM 8020  C C    . ILE A 1 16  ? -7.251  -9.706  4.990   1.00 0.00 ? 16  ILE A C    5  
ATOM 8021  O O    . ILE A 1 16  ? -8.299  -10.106 5.501   1.00 0.00 ? 16  ILE A O    5  
ATOM 8022  C CB   . ILE A 1 16  ? -5.983  -9.153  7.097   1.00 0.00 ? 16  ILE A CB   5  
ATOM 8023  C CG1  . ILE A 1 16  ? -5.380  -8.072  8.027   1.00 0.00 ? 16  ILE A CG1  5  
ATOM 8024  C CG2  . ILE A 1 16  ? -5.021  -10.350 6.952   1.00 0.00 ? 16  ILE A CG2  5  
ATOM 8025  C CD1  . ILE A 1 16  ? -4.104  -7.399  7.517   1.00 0.00 ? 16  ILE A CD1  5  
ATOM 8026  H H    . ILE A 1 16  ? -7.837  -7.336  6.571   1.00 0.00 ? 16  ILE A H    5  
ATOM 8027  H HA   . ILE A 1 16  ? -5.505  -8.471  5.095   1.00 0.00 ? 16  ILE A HA   5  
ATOM 8028  H HB   . ILE A 1 16  ? -6.878  -9.516  7.606   1.00 0.00 ? 16  ILE A HB   5  
ATOM 8029  H HG12 . ILE A 1 16  ? -6.122  -7.295  8.210   1.00 0.00 ? 16  ILE A HG12 5  
ATOM 8030  H HG13 . ILE A 1 16  ? -5.164  -8.527  8.993   1.00 0.00 ? 16  ILE A HG13 5  
ATOM 8031  H HG21 . ILE A 1 16  ? -5.512  -11.175 6.430   1.00 0.00 ? 16  ILE A HG21 5  
ATOM 8032  H HG22 . ILE A 1 16  ? -4.131  -10.060 6.392   1.00 0.00 ? 16  ILE A HG22 5  
ATOM 8033  H HG23 . ILE A 1 16  ? -4.730  -10.708 7.939   1.00 0.00 ? 16  ILE A HG23 5  
ATOM 8034  H HD11 . ILE A 1 16  ? -4.302  -6.893  6.574   1.00 0.00 ? 16  ILE A HD11 5  
ATOM 8035  H HD12 . ILE A 1 16  ? -3.774  -6.659  8.247   1.00 0.00 ? 16  ILE A HD12 5  
ATOM 8036  H HD13 . ILE A 1 16  ? -3.312  -8.134  7.388   1.00 0.00 ? 16  ILE A HD13 5  
ATOM 8037  N N    . PHE A 1 17  ? -6.778  -10.219 3.855   1.00 0.00 ? 17  PHE A N    5  
ATOM 8038  C CA   . PHE A 1 17  ? -7.401  -11.318 3.114   1.00 0.00 ? 17  PHE A CA   5  
ATOM 8039  C C    . PHE A 1 17  ? -6.995  -12.660 3.749   1.00 0.00 ? 17  PHE A C    5  
ATOM 8040  O O    . PHE A 1 17  ? -6.298  -13.475 3.137   1.00 0.00 ? 17  PHE A O    5  
ATOM 8041  C CB   . PHE A 1 17  ? -7.019  -11.222 1.625   1.00 0.00 ? 17  PHE A CB   5  
ATOM 8042  C CG   . PHE A 1 17  ? -7.559  -10.003 0.893   1.00 0.00 ? 17  PHE A CG   5  
ATOM 8043  C CD1  . PHE A 1 17  ? -6.963  -8.737  1.067   1.00 0.00 ? 17  PHE A CD1  5  
ATOM 8044  C CD2  . PHE A 1 17  ? -8.654  -10.135 0.015   1.00 0.00 ? 17  PHE A CD2  5  
ATOM 8045  C CE1  . PHE A 1 17  ? -7.465  -7.612  0.388   1.00 0.00 ? 17  PHE A CE1  5  
ATOM 8046  C CE2  . PHE A 1 17  ? -9.154  -9.009  -0.668  1.00 0.00 ? 17  PHE A CE2  5  
ATOM 8047  C CZ   . PHE A 1 17  ? -8.560  -7.747  -0.482  1.00 0.00 ? 17  PHE A CZ   5  
ATOM 8048  H H    . PHE A 1 17  ? -5.879  -9.892  3.519   1.00 0.00 ? 17  PHE A H    5  
ATOM 8049  H HA   . PHE A 1 17  ? -8.489  -11.234 3.188   1.00 0.00 ? 17  PHE A HA   5  
ATOM 8050  H HB2  . PHE A 1 17  ? -5.933  -11.230 1.542   1.00 0.00 ? 17  PHE A HB2  5  
ATOM 8051  H HB3  . PHE A 1 17  ? -7.387  -12.118 1.121   1.00 0.00 ? 17  PHE A HB3  5  
ATOM 8052  H HD1  . PHE A 1 17  ? -6.122  -8.623  1.732   1.00 0.00 ? 17  PHE A HD1  5  
ATOM 8053  H HD2  . PHE A 1 17  ? -9.118  -11.100 -0.136  1.00 0.00 ? 17  PHE A HD2  5  
ATOM 8054  H HE1  . PHE A 1 17  ? -7.008  -6.643  0.538   1.00 0.00 ? 17  PHE A HE1  5  
ATOM 8055  H HE2  . PHE A 1 17  ? -9.999  -9.116  -1.335  1.00 0.00 ? 17  PHE A HE2  5  
ATOM 8056  H HZ   . PHE A 1 17  ? -8.947  -6.883  -1.007  1.00 0.00 ? 17  PHE A HZ   5  
ATOM 8057  N N    . ARG A 1 18  ? -7.394  -12.871 5.011   1.00 0.00 ? 18  ARG A N    5  
ATOM 8058  C CA   . ARG A 1 18  ? -7.028  -14.052 5.811   1.00 0.00 ? 18  ARG A CA   5  
ATOM 8059  C C    . ARG A 1 18  ? -7.541  -15.365 5.214   1.00 0.00 ? 18  ARG A C    5  
ATOM 8060  O O    . ARG A 1 18  ? -6.898  -16.401 5.403   1.00 0.00 ? 18  ARG A O    5  
ATOM 8061  C CB   . ARG A 1 18  ? -7.498  -13.843 7.266   1.00 0.00 ? 18  ARG A CB   5  
ATOM 8062  C CG   . ARG A 1 18  ? -7.219  -15.017 8.223   1.00 0.00 ? 18  ARG A CG   5  
ATOM 8063  C CD   . ARG A 1 18  ? -5.745  -15.453 8.263   1.00 0.00 ? 18  ARG A CD   5  
ATOM 8064  N NE   . ARG A 1 18  ? -5.565  -16.656 9.097   1.00 0.00 ? 18  ARG A NE   5  
ATOM 8065  C CZ   . ARG A 1 18  ? -5.684  -17.920 8.700   1.00 0.00 ? 18  ARG A CZ   5  
ATOM 8066  N NH1  . ARG A 1 18  ? -6.021  -18.247 7.467   1.00 0.00 ? 18  ARG A NH1  5  
ATOM 8067  N NH2  . ARG A 1 18  ? -5.462  -18.893 9.557   1.00 0.00 ? 18  ARG A NH2  5  
ATOM 8068  H H    . ARG A 1 18  ? -7.935  -12.135 5.455   1.00 0.00 ? 18  ARG A H    5  
ATOM 8069  H HA   . ARG A 1 18  ? -5.949  -14.148 5.805   1.00 0.00 ? 18  ARG A HA   5  
ATOM 8070  H HB2  . ARG A 1 18  ? -7.013  -12.950 7.664   1.00 0.00 ? 18  ARG A HB2  5  
ATOM 8071  H HB3  . ARG A 1 18  ? -8.571  -13.666 7.265   1.00 0.00 ? 18  ARG A HB3  5  
ATOM 8072  H HG2  . ARG A 1 18  ? -7.523  -14.724 9.229   1.00 0.00 ? 18  ARG A HG2  5  
ATOM 8073  H HG3  . ARG A 1 18  ? -7.833  -15.870 7.931   1.00 0.00 ? 18  ARG A HG3  5  
ATOM 8074  H HD2  . ARG A 1 18  ? -5.393  -15.664 7.254   1.00 0.00 ? 18  ARG A HD2  5  
ATOM 8075  H HD3  . ARG A 1 18  ? -5.141  -14.638 8.665   1.00 0.00 ? 18  ARG A HD3  5  
ATOM 8076  H HE   . ARG A 1 18  ? -5.310  -16.494 10.062  1.00 0.00 ? 18  ARG A HE   5  
ATOM 8077  H HH11 . ARG A 1 18  ? -6.216  -17.529 6.777   1.00 0.00 ? 18  ARG A HH11 5  
ATOM 8078  H HH12 . ARG A 1 18  ? -6.103  -19.215 7.196   1.00 0.00 ? 18  ARG A HH12 5  
ATOM 8079  H HH21 . ARG A 1 18  ? -5.201  -18.689 10.510  1.00 0.00 ? 18  ARG A HH21 5  
ATOM 8080  H HH22 . ARG A 1 18  ? -5.550  -19.860 9.278   1.00 0.00 ? 18  ARG A HH22 5  
ATOM 8081  N N    . LEU A 1 19  ? -8.665  -15.320 4.497   1.00 0.00 ? 19  LEU A N    5  
ATOM 8082  C CA   . LEU A 1 19  ? -9.328  -16.480 3.897   1.00 0.00 ? 19  LEU A CA   5  
ATOM 8083  C C    . LEU A 1 19  ? -10.372 -16.026 2.858   1.00 0.00 ? 19  LEU A C    5  
ATOM 8084  O O    . LEU A 1 19  ? -10.150 -15.013 2.191   1.00 0.00 ? 19  LEU A O    5  
ATOM 8085  C CB   . LEU A 1 19  ? -9.797  -17.440 5.026   1.00 0.00 ? 19  LEU A CB   5  
ATOM 8086  C CG   . LEU A 1 19  ? -10.559 -16.842 6.234   1.00 0.00 ? 19  LEU A CG   5  
ATOM 8087  C CD1  . LEU A 1 19  ? -11.878 -16.163 5.859   1.00 0.00 ? 19  LEU A CD1  5  
ATOM 8088  C CD2  . LEU A 1 19  ? -10.836 -17.953 7.259   1.00 0.00 ? 19  LEU A CD2  5  
ATOM 8089  H H    . LEU A 1 19  ? -9.114  -14.422 4.378   1.00 0.00 ? 19  LEU A H    5  
ATOM 8090  H HA   . LEU A 1 19  ? -8.570  -17.015 3.319   1.00 0.00 ? 19  LEU A HA   5  
ATOM 8091  H HB2  . LEU A 1 19  ? -10.371 -18.261 4.598   1.00 0.00 ? 19  LEU A HB2  5  
ATOM 8092  H HB3  . LEU A 1 19  ? -8.887  -17.882 5.438   1.00 0.00 ? 19  LEU A HB3  5  
ATOM 8093  H HG   . LEU A 1 19  ? -9.925  -16.101 6.721   1.00 0.00 ? 19  LEU A HG   5  
ATOM 8094  H HD11 . LEU A 1 19  ? -12.532 -16.861 5.333   1.00 0.00 ? 19  LEU A HD11 5  
ATOM 8095  H HD12 . LEU A 1 19  ? -12.386 -15.818 6.759   1.00 0.00 ? 19  LEU A HD12 5  
ATOM 8096  H HD13 . LEU A 1 19  ? -11.671 -15.298 5.235   1.00 0.00 ? 19  LEU A HD13 5  
ATOM 8097  H HD21 . LEU A 1 19  ? -9.897  -18.406 7.577   1.00 0.00 ? 19  LEU A HD21 5  
ATOM 8098  H HD22 . LEU A 1 19  ? -11.331 -17.533 8.136   1.00 0.00 ? 19  LEU A HD22 5  
ATOM 8099  H HD23 . LEU A 1 19  ? -11.474 -18.720 6.818   1.00 0.00 ? 19  LEU A HD23 5  
ATOM 8100  N N    . GLY A 1 20  ? -11.511 -16.719 2.723   1.00 0.00 ? 20  GLY A N    5  
ATOM 8101  C CA   . GLY A 1 20  ? -12.632 -16.353 1.833   1.00 0.00 ? 20  GLY A CA   5  
ATOM 8102  C C    . GLY A 1 20  ? -13.468 -15.155 2.312   1.00 0.00 ? 20  GLY A C    5  
ATOM 8103  O O    . GLY A 1 20  ? -14.671 -15.096 2.052   1.00 0.00 ? 20  GLY A O    5  
ATOM 8104  H H    . GLY A 1 20  ? -11.623 -17.551 3.287   1.00 0.00 ? 20  GLY A H    5  
ATOM 8105  H HA2  . GLY A 1 20  ? -12.232 -16.093 0.852   1.00 0.00 ? 20  GLY A HA2  5  
ATOM 8106  H HA3  . GLY A 1 20  ? -13.299 -17.209 1.730   1.00 0.00 ? 20  GLY A HA3  5  
ATOM 8107  N N    . TYR A 1 21  ? -12.832 -14.216 3.012   1.00 0.00 ? 21  TYR A N    5  
ATOM 8108  C CA   . TYR A 1 21  ? -13.384 -13.020 3.660   1.00 0.00 ? 21  TYR A CA   5  
ATOM 8109  C C    . TYR A 1 21  ? -12.240 -12.081 4.104   1.00 0.00 ? 21  TYR A C    5  
ATOM 8110  O O    . TYR A 1 21  ? -11.113 -12.538 4.345   1.00 0.00 ? 21  TYR A O    5  
ATOM 8111  C CB   . TYR A 1 21  ? -14.248 -13.432 4.867   1.00 0.00 ? 21  TYR A CB   5  
ATOM 8112  C CG   . TYR A 1 21  ? -15.064 -12.310 5.484   1.00 0.00 ? 21  TYR A CG   5  
ATOM 8113  C CD1  . TYR A 1 21  ? -16.118 -11.732 4.749   1.00 0.00 ? 21  TYR A CD1  5  
ATOM 8114  C CD2  . TYR A 1 21  ? -14.787 -11.854 6.789   1.00 0.00 ? 21  TYR A CD2  5  
ATOM 8115  C CE1  . TYR A 1 21  ? -16.891 -10.698 5.311   1.00 0.00 ? 21  TYR A CE1  5  
ATOM 8116  C CE2  . TYR A 1 21  ? -15.556 -10.822 7.359   1.00 0.00 ? 21  TYR A CE2  5  
ATOM 8117  C CZ   . TYR A 1 21  ? -16.610 -10.239 6.620   1.00 0.00 ? 21  TYR A CZ   5  
ATOM 8118  O OH   . TYR A 1 21  ? -17.361 -9.242  7.168   1.00 0.00 ? 21  TYR A OH   5  
ATOM 8119  H H    . TYR A 1 21  ? -11.830 -14.330 3.097   1.00 0.00 ? 21  TYR A H    5  
ATOM 8120  H HA   . TYR A 1 21  ? -14.010 -12.491 2.938   1.00 0.00 ? 21  TYR A HA   5  
ATOM 8121  H HB2  . TYR A 1 21  ? -14.948 -14.211 4.561   1.00 0.00 ? 21  TYR A HB2  5  
ATOM 8122  H HB3  . TYR A 1 21  ? -13.599 -13.861 5.631   1.00 0.00 ? 21  TYR A HB3  5  
ATOM 8123  H HD1  . TYR A 1 21  ? -16.341 -12.086 3.751   1.00 0.00 ? 21  TYR A HD1  5  
ATOM 8124  H HD2  . TYR A 1 21  ? -13.979 -12.296 7.357   1.00 0.00 ? 21  TYR A HD2  5  
ATOM 8125  H HE1  . TYR A 1 21  ? -17.702 -10.260 4.742   1.00 0.00 ? 21  TYR A HE1  5  
ATOM 8126  H HE2  . TYR A 1 21  ? -15.342 -10.468 8.359   1.00 0.00 ? 21  TYR A HE2  5  
ATOM 8127  H HH   . TYR A 1 21  ? -18.048 -8.939  6.569   1.00 0.00 ? 21  TYR A HH   5  
ATOM 8128  N N    . GLU A 1 22  ? -12.523 -10.779 4.227   1.00 0.00 ? 22  GLU A N    5  
ATOM 8129  C CA   . GLU A 1 22  ? -11.540 -9.759  4.608   1.00 0.00 ? 22  GLU A CA   5  
ATOM 8130  C C    . GLU A 1 22  ? -11.747 -9.319  6.064   1.00 0.00 ? 22  GLU A C    5  
ATOM 8131  O O    . GLU A 1 22  ? -12.848 -8.939  6.467   1.00 0.00 ? 22  GLU A O    5  
ATOM 8132  C CB   . GLU A 1 22  ? -11.598 -8.537  3.673   1.00 0.00 ? 22  GLU A CB   5  
ATOM 8133  C CG   . GLU A 1 22  ? -11.152 -8.838  2.235   1.00 0.00 ? 22  GLU A CG   5  
ATOM 8134  C CD   . GLU A 1 22  ? -12.220 -9.596  1.421   1.00 0.00 ? 22  GLU A CD   5  
ATOM 8135  O OE1  . GLU A 1 22  ? -13.287 -9.006  1.120   1.00 0.00 ? 22  GLU A OE1  5  
ATOM 8136  O OE2  . GLU A 1 22  ? -12.002 -10.780 1.070   1.00 0.00 ? 22  GLU A OE2  5  
ATOM 8137  H H    . GLU A 1 22  ? -13.473 -10.474 4.076   1.00 0.00 ? 22  GLU A H    5  
ATOM 8138  H HA   . GLU A 1 22  ? -10.541 -10.182 4.519   1.00 0.00 ? 22  GLU A HA   5  
ATOM 8139  H HB2  . GLU A 1 22  ? -12.604 -8.116  3.666   1.00 0.00 ? 22  GLU A HB2  5  
ATOM 8140  H HB3  . GLU A 1 22  ? -10.922 -7.782  4.076   1.00 0.00 ? 22  GLU A HB3  5  
ATOM 8141  H HG2  . GLU A 1 22  ? -10.948 -7.890  1.734   1.00 0.00 ? 22  GLU A HG2  5  
ATOM 8142  H HG3  . GLU A 1 22  ? -10.221 -9.402  2.265   1.00 0.00 ? 22  GLU A HG3  5  
ATOM 8143  N N    . HIS A 1 23  ? -10.674 -9.347  6.854   1.00 0.00 ? 23  HIS A N    5  
ATOM 8144  C CA   . HIS A 1 23  ? -10.675 -9.013  8.281   1.00 0.00 ? 23  HIS A CA   5  
ATOM 8145  C C    . HIS A 1 23  ? -9.961  -7.668  8.529   1.00 0.00 ? 23  HIS A C    5  
ATOM 8146  O O    . HIS A 1 23  ? -8.867  -7.447  8.008   1.00 0.00 ? 23  HIS A O    5  
ATOM 8147  C CB   . HIS A 1 23  ? -9.965  -10.136 9.060   1.00 0.00 ? 23  HIS A CB   5  
ATOM 8148  C CG   . HIS A 1 23  ? -10.677 -11.470 9.063   1.00 0.00 ? 23  HIS A CG   5  
ATOM 8149  N ND1  . HIS A 1 23  ? -11.165 -12.122 10.174  1.00 0.00 ? 23  HIS A ND1  5  
ATOM 8150  C CD2  . HIS A 1 23  ? -10.899 -12.294 7.990   1.00 0.00 ? 23  HIS A CD2  5  
ATOM 8151  C CE1  . HIS A 1 23  ? -11.663 -13.309 9.780   1.00 0.00 ? 23  HIS A CE1  5  
ATOM 8152  N NE2  . HIS A 1 23  ? -11.522 -13.463 8.451   1.00 0.00 ? 23  HIS A NE2  5  
ATOM 8153  H H    . HIS A 1 23  ? -9.784  -9.620  6.440   1.00 0.00 ? 23  HIS A H    5  
ATOM 8154  H HA   . HIS A 1 23  ? -11.699 -8.933  8.650   1.00 0.00 ? 23  HIS A HA   5  
ATOM 8155  H HB2  . HIS A 1 23  ? -8.963  -10.277 8.654   1.00 0.00 ? 23  HIS A HB2  5  
ATOM 8156  H HB3  . HIS A 1 23  ? -9.847  -9.811  10.095  1.00 0.00 ? 23  HIS A HB3  5  
ATOM 8157  H HD1  . HIS A 1 23  ? -11.127 -11.785 11.127  1.00 0.00 ? 23  HIS A HD1  5  
ATOM 8158  H HD2  . HIS A 1 23  ? -10.612 -12.089 6.967   1.00 0.00 ? 23  HIS A HD2  5  
ATOM 8159  H HE1  . HIS A 1 23  ? -12.104 -14.042 10.446  1.00 0.00 ? 23  HIS A HE1  5  
ATOM 8160  N N    . TRP A 1 24  ? -10.533 -6.778  9.346   1.00 0.00 ? 24  TRP A N    5  
ATOM 8161  C CA   . TRP A 1 24  ? -9.898  -5.498  9.682   1.00 0.00 ? 24  TRP A CA   5  
ATOM 8162  C C    . TRP A 1 24  ? -8.811  -5.617  10.765  1.00 0.00 ? 24  TRP A C    5  
ATOM 8163  O O    . TRP A 1 24  ? -8.975  -6.340  11.752  1.00 0.00 ? 24  TRP A O    5  
ATOM 8164  C CB   . TRP A 1 24  ? -10.949 -4.499  10.174  1.00 0.00 ? 24  TRP A CB   5  
ATOM 8165  C CG   . TRP A 1 24  ? -11.841 -3.879  9.145   1.00 0.00 ? 24  TRP A CG   5  
ATOM 8166  C CD1  . TRP A 1 24  ? -13.175 -4.064  9.069   1.00 0.00 ? 24  TRP A CD1  5  
ATOM 8167  C CD2  . TRP A 1 24  ? -11.526 -2.882  8.118   1.00 0.00 ? 24  TRP A CD2  5  
ATOM 8168  N NE1  . TRP A 1 24  ? -13.708 -3.288  8.062   1.00 0.00 ? 24  TRP A NE1  5  
ATOM 8169  C CE2  . TRP A 1 24  ? -12.739 -2.520  7.455   1.00 0.00 ? 24  TRP A CE2  5  
ATOM 8170  C CE3  . TRP A 1 24  ? -10.351 -2.214  7.707   1.00 0.00 ? 24  TRP A CE3  5  
ATOM 8171  C CZ2  . TRP A 1 24  ? -12.785 -1.554  6.437   1.00 0.00 ? 24  TRP A CZ2  5  
ATOM 8172  C CZ3  . TRP A 1 24  ? -10.384 -1.245  6.683   1.00 0.00 ? 24  TRP A CZ3  5  
ATOM 8173  C CH2  . TRP A 1 24  ? -11.595 -0.914  6.048   1.00 0.00 ? 24  TRP A CH2  5  
ATOM 8174  H H    . TRP A 1 24  ? -11.433 -6.986  9.758   1.00 0.00 ? 24  TRP A H    5  
ATOM 8175  H HA   . TRP A 1 24  ? -9.435  -5.085  8.784   1.00 0.00 ? 24  TRP A HA   5  
ATOM 8176  H HB2  . TRP A 1 24  ? -11.561 -4.971  10.946  1.00 0.00 ? 24  TRP A HB2  5  
ATOM 8177  H HB3  . TRP A 1 24  ? -10.412 -3.685  10.657  1.00 0.00 ? 24  TRP A HB3  5  
ATOM 8178  H HD1  . TRP A 1 24  ? -13.742 -4.701  9.729   1.00 0.00 ? 24  TRP A HD1  5  
ATOM 8179  H HE1  . TRP A 1 24  ? -14.696 -3.277  7.841   1.00 0.00 ? 24  TRP A HE1  5  
ATOM 8180  H HE3  . TRP A 1 24  ? -9.411  -2.454  8.183   1.00 0.00 ? 24  TRP A HE3  5  
ATOM 8181  H HZ2  . TRP A 1 24  ? -13.722 -1.310  5.959   1.00 0.00 ? 24  TRP A HZ2  5  
ATOM 8182  H HZ3  . TRP A 1 24  ? -9.471  -0.754  6.375   1.00 0.00 ? 24  TRP A HZ3  5  
ATOM 8183  H HH2  . TRP A 1 24  ? -11.610 -0.167  5.265   1.00 0.00 ? 24  TRP A HH2  5  
ATOM 8184  N N    . ALA A 1 25  ? -7.758  -4.807  10.631  1.00 0.00 ? 25  ALA A N    5  
ATOM 8185  C CA   . ALA A 1 25  ? -6.723  -4.591  11.641  1.00 0.00 ? 25  ALA A CA   5  
ATOM 8186  C C    . ALA A 1 25  ? -6.306  -3.110  11.715  1.00 0.00 ? 25  ALA A C    5  
ATOM 8187  O O    . ALA A 1 25  ? -6.261  -2.424  10.698  1.00 0.00 ? 25  ALA A O    5  
ATOM 8188  C CB   . ALA A 1 25  ? -5.531  -5.508  11.328  1.00 0.00 ? 25  ALA A CB   5  
ATOM 8189  H H    . ALA A 1 25  ? -7.656  -4.310  9.747   1.00 0.00 ? 25  ALA A H    5  
ATOM 8190  H HA   . ALA A 1 25  ? -7.131  -4.863  12.612  1.00 0.00 ? 25  ALA A HA   5  
ATOM 8191  H HB1  . ALA A 1 25  ? -5.851  -6.552  11.325  1.00 0.00 ? 25  ALA A HB1  5  
ATOM 8192  H HB2  . ALA A 1 25  ? -5.123  -5.261  10.346  1.00 0.00 ? 25  ALA A HB2  5  
ATOM 8193  H HB3  . ALA A 1 25  ? -4.751  -5.381  12.079  1.00 0.00 ? 25  ALA A HB3  5  
ATOM 8194  N N    . LEU A 1 26  ? -5.979  -2.624  12.913  1.00 0.00 ? 26  LEU A N    5  
ATOM 8195  C CA   . LEU A 1 26  ? -5.428  -1.292  13.188  1.00 0.00 ? 26  LEU A CA   5  
ATOM 8196  C C    . LEU A 1 26  ? -3.961  -1.463  13.597  1.00 0.00 ? 26  LEU A C    5  
ATOM 8197  O O    . LEU A 1 26  ? -3.682  -2.089  14.618  1.00 0.00 ? 26  LEU A O    5  
ATOM 8198  C CB   . LEU A 1 26  ? -6.271  -0.652  14.318  1.00 0.00 ? 26  LEU A CB   5  
ATOM 8199  C CG   . LEU A 1 26  ? -6.122  0.864   14.590  1.00 0.00 ? 26  LEU A CG   5  
ATOM 8200  C CD1  . LEU A 1 26  ? -4.685  1.373   14.732  1.00 0.00 ? 26  LEU A CD1  5  
ATOM 8201  C CD2  . LEU A 1 26  ? -6.865  1.694   13.541  1.00 0.00 ? 26  LEU A CD2  5  
ATOM 8202  H H    . LEU A 1 26  ? -6.070  -3.254  13.706  1.00 0.00 ? 26  LEU A H    5  
ATOM 8203  H HA   . LEU A 1 26  ? -5.486  -0.671  12.294  1.00 0.00 ? 26  LEU A HA   5  
ATOM 8204  H HB2  . LEU A 1 26  ? -7.322  -0.844  14.100  1.00 0.00 ? 26  LEU A HB2  5  
ATOM 8205  H HB3  . LEU A 1 26  ? -6.057  -1.182  15.247  1.00 0.00 ? 26  LEU A HB3  5  
ATOM 8206  H HG   . LEU A 1 26  ? -6.611  1.053   15.546  1.00 0.00 ? 26  LEU A HG   5  
ATOM 8207  H HD11 . LEU A 1 26  ? -4.131  0.734   15.418  1.00 0.00 ? 26  LEU A HD11 5  
ATOM 8208  H HD12 . LEU A 1 26  ? -4.189  1.396   13.762  1.00 0.00 ? 26  LEU A HD12 5  
ATOM 8209  H HD13 . LEU A 1 26  ? -4.702  2.384   15.140  1.00 0.00 ? 26  LEU A HD13 5  
ATOM 8210  H HD21 . LEU A 1 26  ? -7.916  1.394   13.521  1.00 0.00 ? 26  LEU A HD21 5  
ATOM 8211  H HD22 . LEU A 1 26  ? -6.812  2.751   13.802  1.00 0.00 ? 26  LEU A HD22 5  
ATOM 8212  H HD23 . LEU A 1 26  ? -6.424  1.544   12.555  1.00 0.00 ? 26  LEU A HD23 5  
ATOM 8213  N N    . TYR A 1 27  ? -3.027  -0.897  12.834  1.00 0.00 ? 27  TYR A N    5  
ATOM 8214  C CA   . TYR A 1 27  ? -1.595  -0.896  13.169  1.00 0.00 ? 27  TYR A CA   5  
ATOM 8215  C C    . TYR A 1 27  ? -1.305  0.097   14.312  1.00 0.00 ? 27  TYR A C    5  
ATOM 8216  O O    . TYR A 1 27  ? -1.125  1.292   14.085  1.00 0.00 ? 27  TYR A O    5  
ATOM 8217  C CB   . TYR A 1 27  ? -0.803  -0.580  11.890  1.00 0.00 ? 27  TYR A CB   5  
ATOM 8218  C CG   . TYR A 1 27  ? 0.678   -0.905  11.911  1.00 0.00 ? 27  TYR A CG   5  
ATOM 8219  C CD1  . TYR A 1 27  ? 1.105   -2.246  11.941  1.00 0.00 ? 27  TYR A CD1  5  
ATOM 8220  C CD2  . TYR A 1 27  ? 1.633   0.121   11.779  1.00 0.00 ? 27  TYR A CD2  5  
ATOM 8221  C CE1  . TYR A 1 27  ? 2.470   -2.559  11.809  1.00 0.00 ? 27  TYR A CE1  5  
ATOM 8222  C CE2  . TYR A 1 27  ? 2.999   -0.182  11.633  1.00 0.00 ? 27  TYR A CE2  5  
ATOM 8223  C CZ   . TYR A 1 27  ? 3.420   -1.530  11.622  1.00 0.00 ? 27  TYR A CZ   5  
ATOM 8224  O OH   . TYR A 1 27  ? 4.722   -1.840  11.385  1.00 0.00 ? 27  TYR A OH   5  
ATOM 8225  H H    . TYR A 1 27  ? -3.320  -0.397  11.999  1.00 0.00 ? 27  TYR A H    5  
ATOM 8226  H HA   . TYR A 1 27  ? -1.309  -1.892  13.505  1.00 0.00 ? 27  TYR A HA   5  
ATOM 8227  H HB2  . TYR A 1 27  ? -1.235  -1.149  11.071  1.00 0.00 ? 27  TYR A HB2  5  
ATOM 8228  H HB3  . TYR A 1 27  ? -0.937  0.471   11.634  1.00 0.00 ? 27  TYR A HB3  5  
ATOM 8229  H HD1  . TYR A 1 27  ? 0.379   -3.041  12.017  1.00 0.00 ? 27  TYR A HD1  5  
ATOM 8230  H HD2  . TYR A 1 27  ? 1.311   1.143   11.730  1.00 0.00 ? 27  TYR A HD2  5  
ATOM 8231  H HE1  . TYR A 1 27  ? 2.796   -3.588  11.804  1.00 0.00 ? 27  TYR A HE1  5  
ATOM 8232  H HE2  . TYR A 1 27  ? 3.715   0.612   11.475  1.00 0.00 ? 27  TYR A HE2  5  
ATOM 8233  H HH   . TYR A 1 27  ? 5.267   -1.060  11.245  1.00 0.00 ? 27  TYR A HH   5  
ATOM 8234  N N    . ILE A 1 28  ? -1.276  -0.372  15.566  1.00 0.00 ? 28  ILE A N    5  
ATOM 8235  C CA   . ILE A 1 28  ? -1.101  0.501   16.753  1.00 0.00 ? 28  ILE A CA   5  
ATOM 8236  C C    . ILE A 1 28  ? 0.330   1.030   16.939  1.00 0.00 ? 28  ILE A C    5  
ATOM 8237  O O    . ILE A 1 28  ? 0.544   1.917   17.766  1.00 0.00 ? 28  ILE A O    5  
ATOM 8238  C CB   . ILE A 1 28  ? -1.637  -0.142  18.052  1.00 0.00 ? 28  ILE A CB   5  
ATOM 8239  C CG1  . ILE A 1 28  ? -1.079  -1.559  18.308  1.00 0.00 ? 28  ILE A CG1  5  
ATOM 8240  C CG2  . ILE A 1 28  ? -3.174  -0.111  18.022  1.00 0.00 ? 28  ILE A CG2  5  
ATOM 8241  C CD1  . ILE A 1 28  ? -1.252  -2.017  19.763  1.00 0.00 ? 28  ILE A CD1  5  
ATOM 8242  H H    . ILE A 1 28  ? -1.415  -1.371  15.696  1.00 0.00 ? 28  ILE A H    5  
ATOM 8243  H HA   . ILE A 1 28  ? -1.685  1.408   16.585  1.00 0.00 ? 28  ILE A HA   5  
ATOM 8244  H HB   . ILE A 1 28  ? -1.331  0.487   18.889  1.00 0.00 ? 28  ILE A HB   5  
ATOM 8245  H HG12 . ILE A 1 28  ? -1.573  -2.277  17.650  1.00 0.00 ? 28  ILE A HG12 5  
ATOM 8246  H HG13 . ILE A 1 28  ? -0.012  -1.567  18.080  1.00 0.00 ? 28  ILE A HG13 5  
ATOM 8247  H HG21 . ILE A 1 28  ? -3.575  -0.415  18.988  1.00 0.00 ? 28  ILE A HG21 5  
ATOM 8248  H HG22 . ILE A 1 28  ? -3.523  0.903   17.826  1.00 0.00 ? 28  ILE A HG22 5  
ATOM 8249  H HG23 . ILE A 1 28  ? -3.553  -0.772  17.239  1.00 0.00 ? 28  ILE A HG23 5  
ATOM 8250  H HD11 . ILE A 1 28  ? -2.303  -2.024  20.041  1.00 0.00 ? 28  ILE A HD11 5  
ATOM 8251  H HD12 . ILE A 1 28  ? -0.850  -3.024  19.877  1.00 0.00 ? 28  ILE A HD12 5  
ATOM 8252  H HD13 . ILE A 1 28  ? -0.710  -1.343  20.429  1.00 0.00 ? 28  ILE A HD13 5  
ATOM 8253  N N    . GLY A 1 29  ? 1.293   0.530   16.156  1.00 0.00 ? 29  GLY A N    5  
ATOM 8254  C CA   . GLY A 1 29  ? 2.645   1.088   16.072  1.00 0.00 ? 29  GLY A CA   5  
ATOM 8255  C C    . GLY A 1 29  ? 3.747   0.044   15.945  1.00 0.00 ? 29  GLY A C    5  
ATOM 8256  O O    . GLY A 1 29  ? 3.762   -0.956  16.663  1.00 0.00 ? 29  GLY A O    5  
ATOM 8257  H H    . GLY A 1 29  ? 1.053   -0.236  15.542  1.00 0.00 ? 29  GLY A H    5  
ATOM 8258  H HA2  . GLY A 1 29  ? 2.680   1.737   15.196  1.00 0.00 ? 29  GLY A HA2  5  
ATOM 8259  H HA3  . GLY A 1 29  ? 2.869   1.707   16.939  1.00 0.00 ? 29  GLY A HA3  5  
ATOM 8260  N N    . ASP A 1 30  ? 4.656   0.309   15.006  1.00 0.00 ? 30  ASP A N    5  
ATOM 8261  C CA   . ASP A 1 30  ? 5.951   -0.341  14.742  1.00 0.00 ? 30  ASP A CA   5  
ATOM 8262  C C    . ASP A 1 30  ? 5.925   -1.833  14.327  1.00 0.00 ? 30  ASP A C    5  
ATOM 8263  O O    . ASP A 1 30  ? 6.895   -2.328  13.744  1.00 0.00 ? 30  ASP A O    5  
ATOM 8264  C CB   . ASP A 1 30  ? 6.867   -0.118  15.959  1.00 0.00 ? 30  ASP A CB   5  
ATOM 8265  C CG   . ASP A 1 30  ? 8.333   -0.483  15.680  1.00 0.00 ? 30  ASP A CG   5  
ATOM 8266  O OD1  . ASP A 1 30  ? 8.989   0.229   14.880  1.00 0.00 ? 30  ASP A OD1  5  
ATOM 8267  O OD2  . ASP A 1 30  ? 8.838   -1.462  16.283  1.00 0.00 ? 30  ASP A OD2  5  
ATOM 8268  H H    . ASP A 1 30  ? 4.494   1.155   14.474  1.00 0.00 ? 30  ASP A H    5  
ATOM 8269  H HA   . ASP A 1 30  ? 6.362   0.214   13.896  1.00 0.00 ? 30  ASP A HA   5  
ATOM 8270  H HB2  . ASP A 1 30  ? 6.822   0.934   16.250  1.00 0.00 ? 30  ASP A HB2  5  
ATOM 8271  H HB3  . ASP A 1 30  ? 6.500   -0.708  16.800  1.00 0.00 ? 30  ASP A HB3  5  
ATOM 8272  N N    . GLY A 1 31  ? 4.832   -2.547  14.607  1.00 0.00 ? 31  GLY A N    5  
ATOM 8273  C CA   . GLY A 1 31  ? 4.627   -3.958  14.268  1.00 0.00 ? 31  GLY A CA   5  
ATOM 8274  C C    . GLY A 1 31  ? 3.390   -4.592  14.899  1.00 0.00 ? 31  GLY A C    5  
ATOM 8275  O O    . GLY A 1 31  ? 2.895   -5.591  14.388  1.00 0.00 ? 31  GLY A O    5  
ATOM 8276  H H    . GLY A 1 31  ? 4.094   -2.057  15.091  1.00 0.00 ? 31  GLY A H    5  
ATOM 8277  H HA2  . GLY A 1 31  ? 4.559   -4.054  13.186  1.00 0.00 ? 31  GLY A HA2  5  
ATOM 8278  H HA3  . GLY A 1 31  ? 5.500   -4.529  14.582  1.00 0.00 ? 31  GLY A HA3  5  
ATOM 8279  N N    . TYR A 1 32  ? 2.860   -4.030  15.991  1.00 0.00 ? 32  TYR A N    5  
ATOM 8280  C CA   . TYR A 1 32  ? 1.667   -4.559  16.670  1.00 0.00 ? 32  TYR A CA   5  
ATOM 8281  C C    . TYR A 1 32  ? 0.351   -4.120  16.003  1.00 0.00 ? 32  TYR A C    5  
ATOM 8282  O O    . TYR A 1 32  ? 0.226   -2.989  15.529  1.00 0.00 ? 32  TYR A O    5  
ATOM 8283  C CB   . TYR A 1 32  ? 1.705   -4.171  18.155  1.00 0.00 ? 32  TYR A CB   5  
ATOM 8284  C CG   . TYR A 1 32  ? 2.768   -4.915  18.942  1.00 0.00 ? 32  TYR A CG   5  
ATOM 8285  C CD1  . TYR A 1 32  ? 2.489   -6.204  19.443  1.00 0.00 ? 32  TYR A CD1  5  
ATOM 8286  C CD2  . TYR A 1 32  ? 4.037   -4.341  19.153  1.00 0.00 ? 32  TYR A CD2  5  
ATOM 8287  C CE1  . TYR A 1 32  ? 3.472   -6.916  20.157  1.00 0.00 ? 32  TYR A CE1  5  
ATOM 8288  C CE2  . TYR A 1 32  ? 5.023   -5.046  19.870  1.00 0.00 ? 32  TYR A CE2  5  
ATOM 8289  C CZ   . TYR A 1 32  ? 4.742   -6.335  20.378  1.00 0.00 ? 32  TYR A CZ   5  
ATOM 8290  O OH   . TYR A 1 32  ? 5.705   -7.016  21.060  1.00 0.00 ? 32  TYR A OH   5  
ATOM 8291  H H    . TYR A 1 32  ? 3.296   -3.199  16.372  1.00 0.00 ? 32  TYR A H    5  
ATOM 8292  H HA   . TYR A 1 32  ? 1.707   -5.647  16.629  1.00 0.00 ? 32  TYR A HA   5  
ATOM 8293  H HB2  . TYR A 1 32  ? 1.867   -3.095  18.247  1.00 0.00 ? 32  TYR A HB2  5  
ATOM 8294  H HB3  . TYR A 1 32  ? 0.737   -4.398  18.605  1.00 0.00 ? 32  TYR A HB3  5  
ATOM 8295  H HD1  . TYR A 1 32  ? 1.520   -6.652  19.275  1.00 0.00 ? 32  TYR A HD1  5  
ATOM 8296  H HD2  . TYR A 1 32  ? 4.252   -3.354  18.764  1.00 0.00 ? 32  TYR A HD2  5  
ATOM 8297  H HE1  . TYR A 1 32  ? 3.255   -7.905  20.537  1.00 0.00 ? 32  TYR A HE1  5  
ATOM 8298  H HE2  . TYR A 1 32  ? 5.993   -4.598  20.045  1.00 0.00 ? 32  TYR A HE2  5  
ATOM 8299  H HH   . TYR A 1 32  ? 5.402   -7.876  21.372  1.00 0.00 ? 32  TYR A HH   5  
ATOM 8300  N N    . VAL A 1 33  ? -0.648  -5.008  16.002  1.00 0.00 ? 33  VAL A N    5  
ATOM 8301  C CA   . VAL A 1 33  ? -1.988  -4.775  15.439  1.00 0.00 ? 33  VAL A CA   5  
ATOM 8302  C C    . VAL A 1 33  ? -3.100  -5.142  16.422  1.00 0.00 ? 33  VAL A C    5  
ATOM 8303  O O    . VAL A 1 33  ? -2.979  -6.095  17.190  1.00 0.00 ? 33  VAL A O    5  
ATOM 8304  C CB   . VAL A 1 33  ? -2.229  -5.535  14.111  1.00 0.00 ? 33  VAL A CB   5  
ATOM 8305  C CG1  . VAL A 1 33  ? -1.395  -4.955  12.961  1.00 0.00 ? 33  VAL A CG1  5  
ATOM 8306  C CG2  . VAL A 1 33  ? -1.962  -7.048  14.191  1.00 0.00 ? 33  VAL A CG2  5  
ATOM 8307  H H    . VAL A 1 33  ? -0.486  -5.917  16.446  1.00 0.00 ? 33  VAL A H    5  
ATOM 8308  H HA   . VAL A 1 33  ? -2.076  -3.714  15.231  1.00 0.00 ? 33  VAL A HA   5  
ATOM 8309  H HB   . VAL A 1 33  ? -3.276  -5.403  13.838  1.00 0.00 ? 33  VAL A HB   5  
ATOM 8310  H HG11 . VAL A 1 33  ? -1.673  -3.916  12.802  1.00 0.00 ? 33  VAL A HG11 5  
ATOM 8311  H HG12 . VAL A 1 33  ? -0.332  -5.024  13.187  1.00 0.00 ? 33  VAL A HG12 5  
ATOM 8312  H HG13 . VAL A 1 33  ? -1.601  -5.503  12.041  1.00 0.00 ? 33  VAL A HG13 5  
ATOM 8313  H HG21 . VAL A 1 33  ? -0.910  -7.234  14.400  1.00 0.00 ? 33  VAL A HG21 5  
ATOM 8314  H HG22 . VAL A 1 33  ? -2.574  -7.512  14.963  1.00 0.00 ? 33  VAL A HG22 5  
ATOM 8315  H HG23 . VAL A 1 33  ? -2.211  -7.507  13.235  1.00 0.00 ? 33  VAL A HG23 5  
ATOM 8316  N N    . ILE A 1 34  ? -4.196  -4.383  16.371  1.00 0.00 ? 34  ILE A N    5  
ATOM 8317  C CA   . ILE A 1 34  ? -5.476  -4.668  17.052  1.00 0.00 ? 34  ILE A CA   5  
ATOM 8318  C C    . ILE A 1 34  ? -6.487  -5.097  15.981  1.00 0.00 ? 34  ILE A C    5  
ATOM 8319  O O    . ILE A 1 34  ? -6.512  -4.508  14.907  1.00 0.00 ? 34  ILE A O    5  
ATOM 8320  C CB   . ILE A 1 34  ? -5.967  -3.412  17.815  1.00 0.00 ? 34  ILE A CB   5  
ATOM 8321  C CG1  . ILE A 1 34  ? -4.971  -2.952  18.902  1.00 0.00 ? 34  ILE A CG1  5  
ATOM 8322  C CG2  . ILE A 1 34  ? -7.369  -3.616  18.422  1.00 0.00 ? 34  ILE A CG2  5  
ATOM 8323  C CD1  . ILE A 1 34  ? -4.729  -3.934  20.049  1.00 0.00 ? 34  ILE A CD1  5  
ATOM 8324  H H    . ILE A 1 34  ? -4.188  -3.602  15.713  1.00 0.00 ? 34  ILE A H    5  
ATOM 8325  H HA   . ILE A 1 34  ? -5.353  -5.491  17.758  1.00 0.00 ? 34  ILE A HA   5  
ATOM 8326  H HB   . ILE A 1 34  ? -6.049  -2.598  17.095  1.00 0.00 ? 34  ILE A HB   5  
ATOM 8327  H HG12 . ILE A 1 34  ? -4.005  -2.758  18.438  1.00 0.00 ? 34  ILE A HG12 5  
ATOM 8328  H HG13 . ILE A 1 34  ? -5.333  -2.017  19.329  1.00 0.00 ? 34  ILE A HG13 5  
ATOM 8329  H HG21 . ILE A 1 34  ? -7.391  -4.526  19.023  1.00 0.00 ? 34  ILE A HG21 5  
ATOM 8330  H HG22 . ILE A 1 34  ? -7.630  -2.765  19.054  1.00 0.00 ? 34  ILE A HG22 5  
ATOM 8331  H HG23 . ILE A 1 34  ? -8.119  -3.693  17.633  1.00 0.00 ? 34  ILE A HG23 5  
ATOM 8332  H HD11 . ILE A 1 34  ? -4.205  -4.805  19.667  1.00 0.00 ? 34  ILE A HD11 5  
ATOM 8333  H HD12 . ILE A 1 34  ? -4.118  -3.446  20.812  1.00 0.00 ? 34  ILE A HD12 5  
ATOM 8334  H HD13 . ILE A 1 34  ? -5.673  -4.238  20.496  1.00 0.00 ? 34  ILE A HD13 5  
ATOM 8335  N N    . HIS A 1 35  ? -7.314  -6.107  16.229  1.00 0.00 ? 35  HIS A N    5  
ATOM 8336  C CA   . HIS A 1 35  ? -8.176  -6.708  15.199  1.00 0.00 ? 35  HIS A CA   5  
ATOM 8337  C C    . HIS A 1 35  ? -9.436  -7.353  15.803  1.00 0.00 ? 35  HIS A C    5  
ATOM 8338  O O    . HIS A 1 35  ? -9.384  -7.894  16.905  1.00 0.00 ? 35  HIS A O    5  
ATOM 8339  C CB   . HIS A 1 35  ? -7.348  -7.732  14.394  1.00 0.00 ? 35  HIS A CB   5  
ATOM 8340  C CG   . HIS A 1 35  ? -6.793  -8.865  15.228  1.00 0.00 ? 35  HIS A CG   5  
ATOM 8341  N ND1  . HIS A 1 35  ? -7.314  -10.137 15.331  1.00 0.00 ? 35  HIS A ND1  5  
ATOM 8342  C CD2  . HIS A 1 35  ? -5.703  -8.810  16.058  1.00 0.00 ? 35  HIS A CD2  5  
ATOM 8343  C CE1  . HIS A 1 35  ? -6.560  -10.824 16.207  1.00 0.00 ? 35  HIS A CE1  5  
ATOM 8344  N NE2  . HIS A 1 35  ? -5.572  -10.052 16.691  1.00 0.00 ? 35  HIS A NE2  5  
ATOM 8345  H H    . HIS A 1 35  ? -7.277  -6.570  17.136  1.00 0.00 ? 35  HIS A H    5  
ATOM 8346  H HA   . HIS A 1 35  ? -8.507  -5.928  14.508  1.00 0.00 ? 35  HIS A HA   5  
ATOM 8347  H HB2  . HIS A 1 35  ? -7.965  -8.149  13.600  1.00 0.00 ? 35  HIS A HB2  5  
ATOM 8348  H HB3  . HIS A 1 35  ? -6.513  -7.216  13.916  1.00 0.00 ? 35  HIS A HB3  5  
ATOM 8349  H HD1  . HIS A 1 35  ? -8.122  -10.502 14.846  1.00 0.00 ? 35  HIS A HD1  5  
ATOM 8350  H HD2  . HIS A 1 35  ? -5.071  -7.946  16.215  1.00 0.00 ? 35  HIS A HD2  5  
ATOM 8351  H HE1  . HIS A 1 35  ? -6.736  -11.854 16.494  1.00 0.00 ? 35  HIS A HE1  5  
ATOM 8352  N N    . LEU A 1 36  ? -10.568 -7.318  15.086  1.00 0.00 ? 36  LEU A N    5  
ATOM 8353  C CA   . LEU A 1 36  ? -11.831 -7.927  15.521  1.00 0.00 ? 36  LEU A CA   5  
ATOM 8354  C C    . LEU A 1 36  ? -11.942 -9.352  14.962  1.00 0.00 ? 36  LEU A C    5  
ATOM 8355  O O    . LEU A 1 36  ? -11.965 -9.558  13.747  1.00 0.00 ? 36  LEU A O    5  
ATOM 8356  C CB   . LEU A 1 36  ? -12.985 -6.981  15.108  1.00 0.00 ? 36  LEU A CB   5  
ATOM 8357  C CG   . LEU A 1 36  ? -14.448 -7.352  15.445  1.00 0.00 ? 36  LEU A CG   5  
ATOM 8358  C CD1  . LEU A 1 36  ? -15.075 -8.328  14.441  1.00 0.00 ? 36  LEU A CD1  5  
ATOM 8359  C CD2  . LEU A 1 36  ? -14.616 -7.882  16.873  1.00 0.00 ? 36  LEU A CD2  5  
ATOM 8360  H H    . LEU A 1 36  ? -10.554 -6.880  14.176  1.00 0.00 ? 36  LEU A H    5  
ATOM 8361  H HA   . LEU A 1 36  ? -11.836 -7.996  16.610  1.00 0.00 ? 36  LEU A HA   5  
ATOM 8362  H HB2  . LEU A 1 36  ? -12.792 -6.041  15.622  1.00 0.00 ? 36  LEU A HB2  5  
ATOM 8363  H HB3  . LEU A 1 36  ? -12.919 -6.782  14.038  1.00 0.00 ? 36  LEU A HB3  5  
ATOM 8364  H HG   . LEU A 1 36  ? -15.020 -6.426  15.378  1.00 0.00 ? 36  LEU A HG   5  
ATOM 8365  H HD11 . LEU A 1 36  ? -14.973 -7.933  13.429  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 8366  H HD12 . LEU A 1 36  ? -14.595 -9.302  14.495  1.00 0.00 ? 36  LEU A HD12 5  
ATOM 8367  H HD13 . LEU A 1 36  ? -16.134 -8.449  14.661  1.00 0.00 ? 36  LEU A HD13 5  
ATOM 8368  H HD21 . LEU A 1 36  ? -14.113 -7.218  17.576  1.00 0.00 ? 36  LEU A HD21 5  
ATOM 8369  H HD22 . LEU A 1 36  ? -15.675 -7.925  17.126  1.00 0.00 ? 36  LEU A HD22 5  
ATOM 8370  H HD23 . LEU A 1 36  ? -14.196 -8.882  16.957  1.00 0.00 ? 36  LEU A HD23 5  
ATOM 8371  N N    . ALA A 1 37  ? -12.022 -10.339 15.857  1.00 0.00 ? 37  ALA A N    5  
ATOM 8372  C CA   . ALA A 1 37  ? -12.342 -11.728 15.541  1.00 0.00 ? 37  ALA A CA   5  
ATOM 8373  C C    . ALA A 1 37  ? -13.880 -11.875 15.418  1.00 0.00 ? 37  ALA A C    5  
ATOM 8374  O O    . ALA A 1 37  ? -14.574 -11.567 16.392  1.00 0.00 ? 37  ALA A O    5  
ATOM 8375  C CB   . ALA A 1 37  ? -11.757 -12.620 16.648  1.00 0.00 ? 37  ALA A CB   5  
ATOM 8376  H H    . ALA A 1 37  ? -11.977 -10.091 16.843  1.00 0.00 ? 37  ALA A H    5  
ATOM 8377  H HA   . ALA A 1 37  ? -11.857 -11.999 14.602  1.00 0.00 ? 37  ALA A HA   5  
ATOM 8378  H HB1  . ALA A 1 37  ? -10.677 -12.467 16.713  1.00 0.00 ? 37  ALA A HB1  5  
ATOM 8379  H HB2  . ALA A 1 37  ? -12.206 -12.372 17.611  1.00 0.00 ? 37  ALA A HB2  5  
ATOM 8380  H HB3  . ALA A 1 37  ? -11.952 -13.669 16.424  1.00 0.00 ? 37  ALA A HB3  5  
ATOM 8381  N N    . PRO A 1 38  ? -14.426 -12.288 14.251  1.00 0.00 ? 38  PRO A N    5  
ATOM 8382  C CA   . PRO A 1 38  ? -15.870 -12.323 13.995  1.00 0.00 ? 38  PRO A CA   5  
ATOM 8383  C C    . PRO A 1 38  ? -16.566 -13.488 14.730  1.00 0.00 ? 38  PRO A C    5  
ATOM 8384  O O    . PRO A 1 38  ? -15.883 -14.413 15.186  1.00 0.00 ? 38  PRO A O    5  
ATOM 8385  C CB   . PRO A 1 38  ? -16.001 -12.447 12.470  1.00 0.00 ? 38  PRO A CB   5  
ATOM 8386  C CG   . PRO A 1 38  ? -14.741 -13.203 12.068  1.00 0.00 ? 38  PRO A CG   5  
ATOM 8387  C CD   . PRO A 1 38  ? -13.698 -12.668 13.046  1.00 0.00 ? 38  PRO A CD   5  
ATOM 8388  H HA   . PRO A 1 38  ? -16.320 -11.382 14.317  1.00 0.00 ? 38  PRO A HA   5  
ATOM 8389  H HB2  . PRO A 1 38  ? -16.894 -12.990 12.158  1.00 0.00 ? 38  PRO A HB2  5  
ATOM 8390  H HB3  . PRO A 1 38  ? -15.987 -11.453 12.021  1.00 0.00 ? 38  PRO A HB3  5  
ATOM 8391  H HG2  . PRO A 1 38  ? -14.887 -14.272 12.233  1.00 0.00 ? 38  PRO A HG2  5  
ATOM 8392  H HG3  . PRO A 1 38  ? -14.464 -13.005 11.033  1.00 0.00 ? 38  PRO A HG3  5  
ATOM 8393  H HD2  . PRO A 1 38  ? -12.957 -13.440 13.259  1.00 0.00 ? 38  PRO A HD2  5  
ATOM 8394  H HD3  . PRO A 1 38  ? -13.218 -11.785 12.618  1.00 0.00 ? 38  PRO A HD3  5  
ATOM 8395  N N    . PRO A 1 39  ? -17.915 -13.474 14.836  1.00 0.00 ? 39  PRO A N    5  
ATOM 8396  C CA   . PRO A 1 39  ? -18.668 -14.558 15.462  1.00 0.00 ? 39  PRO A CA   5  
ATOM 8397  C C    . PRO A 1 39  ? -18.687 -15.790 14.538  1.00 0.00 ? 39  PRO A C    5  
ATOM 8398  O O    . PRO A 1 39  ? -18.930 -15.678 13.336  1.00 0.00 ? 39  PRO A O    5  
ATOM 8399  C CB   . PRO A 1 39  ? -20.064 -13.983 15.713  1.00 0.00 ? 39  PRO A CB   5  
ATOM 8400  C CG   . PRO A 1 39  ? -20.246 -12.973 14.580  1.00 0.00 ? 39  PRO A CG   5  
ATOM 8401  C CD   . PRO A 1 39  ? -18.829 -12.455 14.319  1.00 0.00 ? 39  PRO A CD   5  
ATOM 8402  H HA   . PRO A 1 39  ? -18.218 -14.822 16.418  1.00 0.00 ? 39  PRO A HA   5  
ATOM 8403  H HB2  . PRO A 1 39  ? -20.836 -14.754 15.692  1.00 0.00 ? 39  PRO A HB2  5  
ATOM 8404  H HB3  . PRO A 1 39  ? -20.079 -13.465 16.670  1.00 0.00 ? 39  PRO A HB3  5  
ATOM 8405  H HG2  . PRO A 1 39  ? -20.616 -13.486 13.691  1.00 0.00 ? 39  PRO A HG2  5  
ATOM 8406  H HG3  . PRO A 1 39  ? -20.927 -12.167 14.861  1.00 0.00 ? 39  PRO A HG3  5  
ATOM 8407  H HD2  . PRO A 1 39  ? -18.692 -12.305 13.248  1.00 0.00 ? 39  PRO A HD2  5  
ATOM 8408  H HD3  . PRO A 1 39  ? -18.680 -11.509 14.835  1.00 0.00 ? 39  PRO A HD3  5  
ATOM 8409  N N    . SER A 1 40  ? -18.416 -16.975 15.096  1.00 0.00 ? 40  SER A N    5  
ATOM 8410  C CA   . SER A 1 40  ? -18.180 -18.223 14.340  1.00 0.00 ? 40  SER A CA   5  
ATOM 8411  C C    . SER A 1 40  ? -18.167 -19.465 15.261  1.00 0.00 ? 40  SER A C    5  
ATOM 8412  O O    . SER A 1 40  ? -18.480 -19.367 16.451  1.00 0.00 ? 40  SER A O    5  
ATOM 8413  C CB   . SER A 1 40  ? -16.866 -18.099 13.533  1.00 0.00 ? 40  SER A CB   5  
ATOM 8414  O OG   . SER A 1 40  ? -16.756 -19.111 12.538  1.00 0.00 ? 40  SER A OG   5  
ATOM 8415  H H    . SER A 1 40  ? -18.274 -17.025 16.097  1.00 0.00 ? 40  SER A H    5  
ATOM 8416  H HA   . SER A 1 40  ? -18.993 -18.359 13.623  1.00 0.00 ? 40  SER A HA   5  
ATOM 8417  H HB2  . SER A 1 40  ? -16.833 -17.128 13.035  1.00 0.00 ? 40  SER A HB2  5  
ATOM 8418  H HB3  . SER A 1 40  ? -16.017 -18.162 14.218  1.00 0.00 ? 40  SER A HB3  5  
ATOM 8419  H HG   . SER A 1 40  ? -15.965 -18.934 12.004  1.00 0.00 ? 40  SER A HG   5  
ATOM 8420  N N    . GLU A 1 41  ? -17.812 -20.638 14.729  1.00 0.00 ? 41  GLU A N    5  
ATOM 8421  C CA   . GLU A 1 41  ? -17.657 -21.891 15.478  1.00 0.00 ? 41  GLU A CA   5  
ATOM 8422  C C    . GLU A 1 41  ? -16.467 -21.863 16.465  1.00 0.00 ? 41  GLU A C    5  
ATOM 8423  O O    . GLU A 1 41  ? -15.549 -21.044 16.354  1.00 0.00 ? 41  GLU A O    5  
ATOM 8424  C CB   . GLU A 1 41  ? -17.563 -23.085 14.508  1.00 0.00 ? 41  GLU A CB   5  
ATOM 8425  C CG   . GLU A 1 41  ? -16.319 -23.068 13.607  1.00 0.00 ? 41  GLU A CG   5  
ATOM 8426  C CD   . GLU A 1 41  ? -16.318 -24.275 12.659  1.00 0.00 ? 41  GLU A CD   5  
ATOM 8427  O OE1  . GLU A 1 41  ? -16.952 -24.202 11.578  1.00 0.00 ? 41  GLU A OE1  5  
ATOM 8428  O OE2  . GLU A 1 41  ? -15.674 -25.303 12.979  1.00 0.00 ? 41  GLU A OE2  5  
ATOM 8429  H H    . GLU A 1 41  ? -17.514 -20.628 13.761  1.00 0.00 ? 41  GLU A H    5  
ATOM 8430  H HA   . GLU A 1 41  ? -18.564 -22.036 16.070  1.00 0.00 ? 41  GLU A HA   5  
ATOM 8431  H HB2  . GLU A 1 41  ? -17.558 -24.010 15.085  1.00 0.00 ? 41  GLU A HB2  5  
ATOM 8432  H HB3  . GLU A 1 41  ? -18.456 -23.091 13.880  1.00 0.00 ? 41  GLU A HB3  5  
ATOM 8433  H HG2  . GLU A 1 41  ? -16.302 -22.145 13.024  1.00 0.00 ? 41  GLU A HG2  5  
ATOM 8434  H HG3  . GLU A 1 41  ? -15.421 -23.094 14.225  1.00 0.00 ? 41  GLU A HG3  5  
ATOM 8435  N N    . TYR A 1 42  ? -16.476 -22.792 17.427  1.00 0.00 ? 42  TYR A N    5  
ATOM 8436  C CA   . TYR A 1 42  ? -15.529 -22.864 18.554  1.00 0.00 ? 42  TYR A CA   5  
ATOM 8437  C C    . TYR A 1 42  ? -15.299 -24.325 19.041  1.00 0.00 ? 42  TYR A C    5  
ATOM 8438  O O    . TYR A 1 42  ? -16.035 -25.221 18.606  1.00 0.00 ? 42  TYR A O    5  
ATOM 8439  C CB   . TYR A 1 42  ? -16.031 -21.909 19.660  1.00 0.00 ? 42  TYR A CB   5  
ATOM 8440  C CG   . TYR A 1 42  ? -17.353 -22.277 20.308  1.00 0.00 ? 42  TYR A CG   5  
ATOM 8441  C CD1  . TYR A 1 42  ? -17.369 -23.084 21.461  1.00 0.00 ? 42  TYR A CD1  5  
ATOM 8442  C CD2  . TYR A 1 42  ? -18.565 -21.771 19.797  1.00 0.00 ? 42  TYR A CD2  5  
ATOM 8443  C CE1  . TYR A 1 42  ? -18.586 -23.394 22.097  1.00 0.00 ? 42  TYR A CE1  5  
ATOM 8444  C CE2  . TYR A 1 42  ? -19.786 -22.054 20.443  1.00 0.00 ? 42  TYR A CE2  5  
ATOM 8445  C CZ   . TYR A 1 42  ? -19.798 -22.876 21.595  1.00 0.00 ? 42  TYR A CZ   5  
ATOM 8446  O OH   . TYR A 1 42  ? -20.971 -23.153 22.234  1.00 0.00 ? 42  TYR A OH   5  
ATOM 8447  H H    . TYR A 1 42  ? -17.224 -23.473 17.425  1.00 0.00 ? 42  TYR A H    5  
ATOM 8448  H HA   . TYR A 1 42  ? -14.564 -22.490 18.207  1.00 0.00 ? 42  TYR A HA   5  
ATOM 8449  H HB2  . TYR A 1 42  ? -15.279 -21.822 20.440  1.00 0.00 ? 42  TYR A HB2  5  
ATOM 8450  H HB3  . TYR A 1 42  ? -16.125 -20.909 19.235  1.00 0.00 ? 42  TYR A HB3  5  
ATOM 8451  H HD1  . TYR A 1 42  ? -16.443 -23.462 21.872  1.00 0.00 ? 42  TYR A HD1  5  
ATOM 8452  H HD2  . TYR A 1 42  ? -18.556 -21.148 18.914  1.00 0.00 ? 42  TYR A HD2  5  
ATOM 8453  H HE1  . TYR A 1 42  ? -18.593 -24.020 22.979  1.00 0.00 ? 42  TYR A HE1  5  
ATOM 8454  H HE2  . TYR A 1 42  ? -20.706 -21.630 20.069  1.00 0.00 ? 42  TYR A HE2  5  
ATOM 8455  H HH   . TYR A 1 42  ? -21.733 -22.721 21.835  1.00 0.00 ? 42  TYR A HH   5  
ATOM 8456  N N    . PRO A 1 43  ? -14.283 -24.594 19.899  1.00 0.00 ? 43  PRO A N    5  
ATOM 8457  C CA   . PRO A 1 43  ? -13.939 -25.941 20.367  1.00 0.00 ? 43  PRO A CA   5  
ATOM 8458  C C    . PRO A 1 43  ? -15.117 -26.700 20.993  1.00 0.00 ? 43  PRO A C    5  
ATOM 8459  O O    . PRO A 1 43  ? -16.002 -26.102 21.606  1.00 0.00 ? 43  PRO A O    5  
ATOM 8460  C CB   . PRO A 1 43  ? -12.788 -25.768 21.361  1.00 0.00 ? 43  PRO A CB   5  
ATOM 8461  C CG   . PRO A 1 43  ? -12.100 -24.506 20.853  1.00 0.00 ? 43  PRO A CG   5  
ATOM 8462  C CD   . PRO A 1 43  ? -13.279 -23.654 20.383  1.00 0.00 ? 43  PRO A CD   5  
ATOM 8463  H HA   . PRO A 1 43  ? -13.571 -26.502 19.508  1.00 0.00 ? 43  PRO A HA   5  
ATOM 8464  H HB2  . PRO A 1 43  ? -13.179 -25.590 22.364  1.00 0.00 ? 43  PRO A HB2  5  
ATOM 8465  H HB3  . PRO A 1 43  ? -12.116 -26.629 21.357  1.00 0.00 ? 43  PRO A HB3  5  
ATOM 8466  H HG2  . PRO A 1 43  ? -11.530 -24.014 21.640  1.00 0.00 ? 43  PRO A HG2  5  
ATOM 8467  H HG3  . PRO A 1 43  ? -11.459 -24.750 20.005  1.00 0.00 ? 43  PRO A HG3  5  
ATOM 8468  H HD2  . PRO A 1 43  ? -13.674 -23.100 21.238  1.00 0.00 ? 43  PRO A HD2  5  
ATOM 8469  H HD3  . PRO A 1 43  ? -12.945 -22.969 19.606  1.00 0.00 ? 43  PRO A HD3  5  
ATOM 8470  N N    . GLY A 1 44  ? -15.112 -28.029 20.830  1.00 0.00 ? 44  GLY A N    5  
ATOM 8471  C CA   . GLY A 1 44  ? -16.239 -28.920 21.161  1.00 0.00 ? 44  GLY A CA   5  
ATOM 8472  C C    . GLY A 1 44  ? -17.013 -29.410 19.931  1.00 0.00 ? 44  GLY A C    5  
ATOM 8473  O O    . GLY A 1 44  ? -17.839 -30.318 20.037  1.00 0.00 ? 44  GLY A O    5  
ATOM 8474  H H    . GLY A 1 44  ? -14.304 -28.452 20.387  1.00 0.00 ? 44  GLY A H    5  
ATOM 8475  H HA2  . GLY A 1 44  ? -15.847 -29.805 21.660  1.00 0.00 ? 44  GLY A HA2  5  
ATOM 8476  H HA3  . GLY A 1 44  ? -16.943 -28.403 21.806  1.00 0.00 ? 44  GLY A HA3  5  
ATOM 8477  N N    . ALA A 1 45  ? -16.728 -28.829 18.767  1.00 0.00 ? 45  ALA A N    5  
ATOM 8478  C CA   . ALA A 1 45  ? -17.189 -29.278 17.452  1.00 0.00 ? 45  ALA A CA   5  
ATOM 8479  C C    . ALA A 1 45  ? -16.603 -30.651 17.045  1.00 0.00 ? 45  ALA A C    5  
ATOM 8480  O O    . ALA A 1 45  ? -15.600 -31.114 17.601  1.00 0.00 ? 45  ALA A O    5  
ATOM 8481  C CB   . ALA A 1 45  ? -16.803 -28.194 16.436  1.00 0.00 ? 45  ALA A CB   5  
ATOM 8482  H H    . ALA A 1 45  ? -16.086 -28.054 18.805  1.00 0.00 ? 45  ALA A H    5  
ATOM 8483  H HA   . ALA A 1 45  ? -18.277 -29.372 17.475  1.00 0.00 ? 45  ALA A HA   5  
ATOM 8484  H HB1  . ALA A 1 45  ? -17.178 -27.222 16.755  1.00 0.00 ? 45  ALA A HB1  5  
ATOM 8485  H HB2  . ALA A 1 45  ? -15.717 -28.136 16.344  1.00 0.00 ? 45  ALA A HB2  5  
ATOM 8486  H HB3  . ALA A 1 45  ? -17.224 -28.433 15.460  1.00 0.00 ? 45  ALA A HB3  5  
ATOM 8487  N N    . GLY A 1 46  ? -17.209 -31.278 16.030  1.00 0.00 ? 46  GLY A N    5  
ATOM 8488  C CA   . GLY A 1 46  ? -16.758 -32.554 15.457  1.00 0.00 ? 46  GLY A CA   5  
ATOM 8489  C C    . GLY A 1 46  ? -17.633 -33.062 14.312  1.00 0.00 ? 46  GLY A C    5  
ATOM 8490  O O    . GLY A 1 46  ? -18.787 -32.660 14.163  1.00 0.00 ? 46  GLY A O    5  
ATOM 8491  H H    . GLY A 1 46  ? -18.016 -30.838 15.609  1.00 0.00 ? 46  GLY A H    5  
ATOM 8492  H HA2  . GLY A 1 46  ? -15.735 -32.440 15.095  1.00 0.00 ? 46  GLY A HA2  5  
ATOM 8493  H HA3  . GLY A 1 46  ? -16.730 -33.315 16.241  1.00 0.00 ? 46  GLY A HA3  5  
ATOM 8494  N N    . SER A 1 47  ? -17.088 -33.978 13.511  1.00 0.00 ? 47  SER A N    5  
ATOM 8495  C CA   . SER A 1 47  ? -17.794 -34.643 12.399  1.00 0.00 ? 47  SER A CA   5  
ATOM 8496  C C    . SER A 1 47  ? -18.680 -35.823 12.855  1.00 0.00 ? 47  SER A C    5  
ATOM 8497  O O    . SER A 1 47  ? -19.476 -36.352 12.076  1.00 0.00 ? 47  SER A O    5  
ATOM 8498  C CB   . SER A 1 47  ? -16.759 -35.123 11.369  1.00 0.00 ? 47  SER A CB   5  
ATOM 8499  O OG   . SER A 1 47  ? -15.775 -35.965 11.961  1.00 0.00 ? 47  SER A OG   5  
ATOM 8500  H H    . SER A 1 47  ? -16.123 -34.249 13.667  1.00 0.00 ? 47  SER A H    5  
ATOM 8501  H HA   . SER A 1 47  ? -18.450 -33.927 11.903  1.00 0.00 ? 47  SER A HA   5  
ATOM 8502  H HB2  . SER A 1 47  ? -17.271 -35.664 10.571  1.00 0.00 ? 47  SER A HB2  5  
ATOM 8503  H HB3  . SER A 1 47  ? -16.268 -34.253 10.933  1.00 0.00 ? 47  SER A HB3  5  
ATOM 8504  H HG   . SER A 1 47  ? -15.153 -36.240 11.267  1.00 0.00 ? 47  SER A HG   5  
ATOM 8505  N N    . SER A 1 48  ? -18.560 -36.243 14.117  1.00 0.00 ? 48  SER A N    5  
ATOM 8506  C CA   . SER A 1 48  ? -19.269 -37.338 14.800  1.00 0.00 ? 48  SER A CA   5  
ATOM 8507  C C    . SER A 1 48  ? -18.937 -37.315 16.308  1.00 0.00 ? 48  SER A C    5  
ATOM 8508  O O    . SER A 1 48  ? -18.049 -36.580 16.743  1.00 0.00 ? 48  SER A O    5  
ATOM 8509  C CB   . SER A 1 48  ? -18.881 -38.703 14.194  1.00 0.00 ? 48  SER A CB   5  
ATOM 8510  O OG   . SER A 1 48  ? -19.449 -38.875 12.904  1.00 0.00 ? 48  SER A OG   5  
ATOM 8511  H H    . SER A 1 48  ? -17.876 -35.761 14.690  1.00 0.00 ? 48  SER A H    5  
ATOM 8512  H HA   . SER A 1 48  ? -20.347 -37.200 14.698  1.00 0.00 ? 48  SER A HA   5  
ATOM 8513  H HB2  . SER A 1 48  ? -17.794 -38.772 14.129  1.00 0.00 ? 48  SER A HB2  5  
ATOM 8514  H HB3  . SER A 1 48  ? -19.237 -39.506 14.841  1.00 0.00 ? 48  SER A HB3  5  
ATOM 8515  H HG   . SER A 1 48  ? -19.436 -37.989 12.476  1.00 0.00 ? 48  SER A HG   5  
ATOM 8516  N N    . SER A 1 49  ? -19.671 -38.074 17.131  1.00 0.00 ? 49  SER A N    5  
ATOM 8517  C CA   . SER A 1 49  ? -19.403 -38.368 18.563  1.00 0.00 ? 49  SER A CA   5  
ATOM 8518  C C    . SER A 1 49  ? -19.599 -37.182 19.534  1.00 0.00 ? 49  SER A C    5  
ATOM 8519  O O    . SER A 1 49  ? -19.954 -37.395 20.695  1.00 0.00 ? 49  SER A O    5  
ATOM 8520  C CB   . SER A 1 49  ? -17.995 -38.964 18.755  1.00 0.00 ? 49  SER A CB   5  
ATOM 8521  O OG   . SER A 1 49  ? -17.807 -40.124 17.951  1.00 0.00 ? 49  SER A OG   5  
ATOM 8522  H H    . SER A 1 49  ? -20.419 -38.616 16.714  1.00 0.00 ? 49  SER A H    5  
ATOM 8523  H HA   . SER A 1 49  ? -20.110 -39.132 18.887  1.00 0.00 ? 49  SER A HA   5  
ATOM 8524  H HB2  . SER A 1 49  ? -17.240 -38.218 18.504  1.00 0.00 ? 49  SER A HB2  5  
ATOM 8525  H HB3  . SER A 1 49  ? -17.868 -39.235 19.803  1.00 0.00 ? 49  SER A HB3  5  
ATOM 8526  H HG   . SER A 1 49  ? -16.911 -40.467 18.106  1.00 0.00 ? 49  SER A HG   5  
ATOM 8527  N N    . VAL A 1 50  ? -19.404 -35.940 19.077  1.00 0.00 ? 50  VAL A N    5  
ATOM 8528  C CA   . VAL A 1 50  ? -19.557 -34.696 19.851  1.00 0.00 ? 50  VAL A CA   5  
ATOM 8529  C C    . VAL A 1 50  ? -19.845 -33.507 18.922  1.00 0.00 ? 50  VAL A C    5  
ATOM 8530  O O    . VAL A 1 50  ? -19.325 -33.446 17.805  1.00 0.00 ? 50  VAL A O    5  
ATOM 8531  C CB   . VAL A 1 50  ? -18.321 -34.441 20.756  1.00 0.00 ? 50  VAL A CB   5  
ATOM 8532  C CG1  . VAL A 1 50  ? -17.054 -34.059 19.968  1.00 0.00 ? 50  VAL A CG1  5  
ATOM 8533  C CG2  . VAL A 1 50  ? -18.612 -33.381 21.831  1.00 0.00 ? 50  VAL A CG2  5  
ATOM 8534  H H    . VAL A 1 50  ? -19.027 -35.871 18.130  1.00 0.00 ? 50  VAL A H    5  
ATOM 8535  H HA   . VAL A 1 50  ? -20.424 -34.825 20.500  1.00 0.00 ? 50  VAL A HA   5  
ATOM 8536  H HB   . VAL A 1 50  ? -18.098 -35.367 21.286  1.00 0.00 ? 50  VAL A HB   5  
ATOM 8537  H HG11 . VAL A 1 50  ? -16.838 -34.816 19.212  1.00 0.00 ? 50  VAL A HG11 5  
ATOM 8538  H HG12 . VAL A 1 50  ? -17.178 -33.091 19.481  1.00 0.00 ? 50  VAL A HG12 5  
ATOM 8539  H HG13 . VAL A 1 50  ? -16.202 -33.999 20.645  1.00 0.00 ? 50  VAL A HG13 5  
ATOM 8540  H HG21 . VAL A 1 50  ? -19.495 -33.665 22.408  1.00 0.00 ? 50  VAL A HG21 5  
ATOM 8541  H HG22 . VAL A 1 50  ? -17.763 -33.303 22.513  1.00 0.00 ? 50  VAL A HG22 5  
ATOM 8542  H HG23 . VAL A 1 50  ? -18.785 -32.407 21.377  1.00 0.00 ? 50  VAL A HG23 5  
ATOM 8543  N N    . PHE A 1 51  ? -20.674 -32.567 19.392  1.00 0.00 ? 51  PHE A N    5  
ATOM 8544  C CA   . PHE A 1 51  ? -21.044 -31.336 18.681  1.00 0.00 ? 51  PHE A CA   5  
ATOM 8545  C C    . PHE A 1 51  ? -21.460 -30.230 19.674  1.00 0.00 ? 51  PHE A C    5  
ATOM 8546  O O    . PHE A 1 51  ? -22.498 -29.583 19.550  1.00 0.00 ? 51  PHE A O    5  
ATOM 8547  C CB   . PHE A 1 51  ? -22.105 -31.646 17.603  1.00 0.00 ? 51  PHE A CB   5  
ATOM 8548  C CG   . PHE A 1 51  ? -22.251 -30.555 16.555  1.00 0.00 ? 51  PHE A CG   5  
ATOM 8549  C CD1  . PHE A 1 51  ? -21.245 -30.387 15.584  1.00 0.00 ? 51  PHE A CD1  5  
ATOM 8550  C CD2  . PHE A 1 51  ? -23.376 -29.706 16.544  1.00 0.00 ? 51  PHE A CD2  5  
ATOM 8551  C CE1  . PHE A 1 51  ? -21.357 -29.374 14.616  1.00 0.00 ? 51  PHE A CE1  5  
ATOM 8552  C CE2  . PHE A 1 51  ? -23.487 -28.693 15.575  1.00 0.00 ? 51  PHE A CE2  5  
ATOM 8553  C CZ   . PHE A 1 51  ? -22.480 -28.526 14.608  1.00 0.00 ? 51  PHE A CZ   5  
ATOM 8554  H H    . PHE A 1 51  ? -21.090 -32.717 20.302  1.00 0.00 ? 51  PHE A H    5  
ATOM 8555  H HA   . PHE A 1 51  ? -20.148 -30.972 18.173  1.00 0.00 ? 51  PHE A HA   5  
ATOM 8556  H HB2  . PHE A 1 51  ? -21.826 -32.562 17.081  1.00 0.00 ? 51  PHE A HB2  5  
ATOM 8557  H HB3  . PHE A 1 51  ? -23.067 -31.831 18.083  1.00 0.00 ? 51  PHE A HB3  5  
ATOM 8558  H HD1  . PHE A 1 51  ? -20.384 -31.040 15.583  1.00 0.00 ? 51  PHE A HD1  5  
ATOM 8559  H HD2  . PHE A 1 51  ? -24.155 -29.827 17.283  1.00 0.00 ? 51  PHE A HD2  5  
ATOM 8560  H HE1  . PHE A 1 51  ? -20.581 -29.250 13.874  1.00 0.00 ? 51  PHE A HE1  5  
ATOM 8561  H HE2  . PHE A 1 51  ? -24.350 -28.041 15.576  1.00 0.00 ? 51  PHE A HE2  5  
ATOM 8562  H HZ   . PHE A 1 51  ? -22.570 -27.749 13.861  1.00 0.00 ? 51  PHE A HZ   5  
ATOM 8563  N N    . SER A 1 52  ? -20.632 -30.011 20.695  1.00 0.00 ? 52  SER A N    5  
ATOM 8564  C CA   . SER A 1 52  ? -20.819 -28.998 21.748  1.00 0.00 ? 52  SER A CA   5  
ATOM 8565  C C    . SER A 1 52  ? -20.490 -27.581 21.221  1.00 0.00 ? 52  SER A C    5  
ATOM 8566  O O    . SER A 1 52  ? -19.558 -26.927 21.691  1.00 0.00 ? 52  SER A O    5  
ATOM 8567  C CB   . SER A 1 52  ? -19.972 -29.370 22.982  1.00 0.00 ? 52  SER A CB   5  
ATOM 8568  O OG   . SER A 1 52  ? -20.330 -30.649 23.488  1.00 0.00 ? 52  SER A OG   5  
ATOM 8569  H H    . SER A 1 52  ? -19.767 -30.543 20.723  1.00 0.00 ? 52  SER A H    5  
ATOM 8570  H HA   . SER A 1 52  ? -21.863 -28.995 22.067  1.00 0.00 ? 52  SER A HA   5  
ATOM 8571  H HB2  . SER A 1 52  ? -18.914 -29.378 22.710  1.00 0.00 ? 52  SER A HB2  5  
ATOM 8572  H HB3  . SER A 1 52  ? -20.127 -28.621 23.762  1.00 0.00 ? 52  SER A HB3  5  
ATOM 8573  H HG   . SER A 1 52  ? -19.807 -30.823 24.288  1.00 0.00 ? 52  SER A HG   5  
ATOM 8574  N N    . VAL A 1 53  ? -21.233 -27.130 20.202  1.00 0.00 ? 53  VAL A N    5  
ATOM 8575  C CA   . VAL A 1 53  ? -20.959 -25.914 19.413  1.00 0.00 ? 53  VAL A CA   5  
ATOM 8576  C C    . VAL A 1 53  ? -22.247 -25.373 18.768  1.00 0.00 ? 53  VAL A C    5  
ATOM 8577  O O    . VAL A 1 53  ? -23.167 -26.138 18.476  1.00 0.00 ? 53  VAL A O    5  
ATOM 8578  C CB   . VAL A 1 53  ? -19.860 -26.198 18.350  1.00 0.00 ? 53  VAL A CB   5  
ATOM 8579  C CG1  . VAL A 1 53  ? -20.334 -27.162 17.246  1.00 0.00 ? 53  VAL A CG1  5  
ATOM 8580  C CG2  . VAL A 1 53  ? -19.317 -24.912 17.703  1.00 0.00 ? 53  VAL A CG2  5  
ATOM 8581  H H    . VAL A 1 53  ? -21.977 -27.745 19.867  1.00 0.00 ? 53  VAL A H    5  
ATOM 8582  H HA   . VAL A 1 53  ? -20.583 -25.149 20.093  1.00 0.00 ? 53  VAL A HA   5  
ATOM 8583  H HB   . VAL A 1 53  ? -19.017 -26.672 18.856  1.00 0.00 ? 53  VAL A HB   5  
ATOM 8584  H HG11 . VAL A 1 53  ? -19.521 -27.362 16.549  1.00 0.00 ? 53  VAL A HG11 5  
ATOM 8585  H HG12 . VAL A 1 53  ? -20.656 -28.105 17.685  1.00 0.00 ? 53  VAL A HG12 5  
ATOM 8586  H HG13 . VAL A 1 53  ? -21.160 -26.725 16.686  1.00 0.00 ? 53  VAL A HG13 5  
ATOM 8587  H HG21 . VAL A 1 53  ? -20.069 -24.442 17.070  1.00 0.00 ? 53  VAL A HG21 5  
ATOM 8588  H HG22 . VAL A 1 53  ? -19.002 -24.219 18.481  1.00 0.00 ? 53  VAL A HG22 5  
ATOM 8589  H HG23 . VAL A 1 53  ? -18.455 -25.155 17.084  1.00 0.00 ? 53  VAL A HG23 5  
ATOM 8590  N N    . LEU A 1 54  ? -22.285 -24.056 18.522  1.00 0.00 ? 54  LEU A N    5  
ATOM 8591  C CA   . LEU A 1 54  ? -23.333 -23.372 17.750  1.00 0.00 ? 54  LEU A CA   5  
ATOM 8592  C C    . LEU A 1 54  ? -22.735 -22.132 17.069  1.00 0.00 ? 54  LEU A C    5  
ATOM 8593  O O    . LEU A 1 54  ? -22.477 -22.152 15.869  1.00 0.00 ? 54  LEU A O    5  
ATOM 8594  C CB   . LEU A 1 54  ? -24.539 -23.073 18.673  1.00 0.00 ? 54  LEU A CB   5  
ATOM 8595  C CG   . LEU A 1 54  ? -25.715 -22.336 17.991  1.00 0.00 ? 54  LEU A CG   5  
ATOM 8596  C CD1  . LEU A 1 54  ? -26.301 -23.138 16.821  1.00 0.00 ? 54  LEU A CD1  5  
ATOM 8597  C CD2  . LEU A 1 54  ? -26.816 -22.063 19.028  1.00 0.00 ? 54  LEU A CD2  5  
ATOM 8598  H H    . LEU A 1 54  ? -21.488 -23.504 18.813  1.00 0.00 ? 54  LEU A H    5  
ATOM 8599  H HA   . LEU A 1 54  ? -23.660 -24.041 16.951  1.00 0.00 ? 54  LEU A HA   5  
ATOM 8600  H HB2  . LEU A 1 54  ? -24.913 -24.017 19.070  1.00 0.00 ? 54  LEU A HB2  5  
ATOM 8601  H HB3  . LEU A 1 54  ? -24.200 -22.484 19.525  1.00 0.00 ? 54  LEU A HB3  5  
ATOM 8602  H HG   . LEU A 1 54  ? -25.367 -21.374 17.612  1.00 0.00 ? 54  LEU A HG   5  
ATOM 8603  H HD11 . LEU A 1 54  ? -26.602 -24.133 17.157  1.00 0.00 ? 54  LEU A HD11 5  
ATOM 8604  H HD12 . LEU A 1 54  ? -27.168 -22.614 16.417  1.00 0.00 ? 54  LEU A HD12 5  
ATOM 8605  H HD13 . LEU A 1 54  ? -25.565 -23.234 16.023  1.00 0.00 ? 54  LEU A HD13 5  
ATOM 8606  H HD21 . LEU A 1 54  ? -27.635 -21.513 18.564  1.00 0.00 ? 54  LEU A HD21 5  
ATOM 8607  H HD22 . LEU A 1 54  ? -27.196 -23.004 19.429  1.00 0.00 ? 54  LEU A HD22 5  
ATOM 8608  H HD23 . LEU A 1 54  ? -26.414 -21.464 19.844  1.00 0.00 ? 54  LEU A HD23 5  
ATOM 8609  N N    . SER A 1 55  ? -22.455 -21.075 17.833  1.00 0.00 ? 55  SER A N    5  
ATOM 8610  C CA   . SER A 1 55  ? -21.694 -19.878 17.422  1.00 0.00 ? 55  SER A CA   5  
ATOM 8611  C C    . SER A 1 55  ? -21.300 -19.026 18.643  1.00 0.00 ? 55  SER A C    5  
ATOM 8612  O O    . SER A 1 55  ? -22.131 -18.734 19.506  1.00 0.00 ? 55  SER A O    5  
ATOM 8613  C CB   . SER A 1 55  ? -22.482 -19.010 16.424  1.00 0.00 ? 55  SER A CB   5  
ATOM 8614  O OG   . SER A 1 55  ? -22.506 -19.591 15.129  1.00 0.00 ? 55  SER A OG   5  
ATOM 8615  H H    . SER A 1 55  ? -22.778 -21.095 18.793  1.00 0.00 ? 55  SER A H    5  
ATOM 8616  H HA   . SER A 1 55  ? -20.773 -20.198 16.932  1.00 0.00 ? 55  SER A HA   5  
ATOM 8617  H HB2  . SER A 1 55  ? -23.504 -18.877 16.788  1.00 0.00 ? 55  SER A HB2  5  
ATOM 8618  H HB3  . SER A 1 55  ? -22.010 -18.029 16.350  1.00 0.00 ? 55  SER A HB3  5  
ATOM 8619  H HG   . SER A 1 55  ? -22.590 -20.560 15.247  1.00 0.00 ? 55  SER A HG   5  
ATOM 8620  N N    . ASN A 1 56  ? -20.027 -18.625 18.719  1.00 0.00 ? 56  ASN A N    5  
ATOM 8621  C CA   . ASN A 1 56  ? -19.484 -17.756 19.768  1.00 0.00 ? 56  ASN A CA   5  
ATOM 8622  C C    . ASN A 1 56  ? -19.751 -16.267 19.473  1.00 0.00 ? 56  ASN A C    5  
ATOM 8623  O O    . ASN A 1 56  ? -20.143 -15.890 18.368  1.00 0.00 ? 56  ASN A O    5  
ATOM 8624  C CB   . ASN A 1 56  ? -17.965 -18.009 19.871  1.00 0.00 ? 56  ASN A CB   5  
ATOM 8625  C CG   . ASN A 1 56  ? -17.334 -17.603 21.203  1.00 0.00 ? 56  ASN A CG   5  
ATOM 8626  O OD1  . ASN A 1 56  ? -17.992 -17.138 22.128  1.00 0.00 ? 56  ASN A OD1  5  
ATOM 8627  N ND2  . ASN A 1 56  ? -16.031 -17.768 21.339  1.00 0.00 ? 56  ASN A ND2  5  
ATOM 8628  H H    . ASN A 1 56  ? -19.392 -18.884 17.970  1.00 0.00 ? 56  ASN A H    5  
ATOM 8629  H HA   . ASN A 1 56  ? -19.951 -18.023 20.718  1.00 0.00 ? 56  ASN A HA   5  
ATOM 8630  H HB2  . ASN A 1 56  ? -17.760 -19.067 19.725  1.00 0.00 ? 56  ASN A HB2  5  
ATOM 8631  H HB3  . ASN A 1 56  ? -17.471 -17.453 19.071  1.00 0.00 ? 56  ASN A HB3  5  
ATOM 8632  H HD21 . ASN A 1 56  ? -15.483 -18.149 20.582  1.00 0.00 ? 56  ASN A HD21 5  
ATOM 8633  H HD22 . ASN A 1 56  ? -15.593 -17.509 22.212  1.00 0.00 ? 56  ASN A HD22 5  
ATOM 8634  N N    . SER A 1 57  ? -19.498 -15.397 20.449  1.00 0.00 ? 57  SER A N    5  
ATOM 8635  C CA   . SER A 1 57  ? -19.488 -13.943 20.255  1.00 0.00 ? 57  SER A CA   5  
ATOM 8636  C C    . SER A 1 57  ? -18.193 -13.462 19.565  1.00 0.00 ? 57  SER A C    5  
ATOM 8637  O O    . SER A 1 57  ? -17.176 -14.163 19.554  1.00 0.00 ? 57  SER A O    5  
ATOM 8638  C CB   . SER A 1 57  ? -19.683 -13.233 21.604  1.00 0.00 ? 57  SER A CB   5  
ATOM 8639  O OG   . SER A 1 57  ? -20.867 -13.681 22.253  1.00 0.00 ? 57  SER A OG   5  
ATOM 8640  H H    . SER A 1 57  ? -19.165 -15.755 21.339  1.00 0.00 ? 57  SER A H    5  
ATOM 8641  H HA   . SER A 1 57  ? -20.317 -13.675 19.599  1.00 0.00 ? 57  SER A HA   5  
ATOM 8642  H HB2  . SER A 1 57  ? -18.820 -13.444 22.242  1.00 0.00 ? 57  SER A HB2  5  
ATOM 8643  H HB3  . SER A 1 57  ? -19.744 -12.157 21.440  1.00 0.00 ? 57  SER A HB3  5  
ATOM 8644  H HG   . SER A 1 57  ? -20.870 -13.332 23.161  1.00 0.00 ? 57  SER A HG   5  
ATOM 8645  N N    . ALA A 1 58  ? -18.220 -12.249 19.001  1.00 0.00 ? 58  ALA A N    5  
ATOM 8646  C CA   . ALA A 1 58  ? -17.046 -11.581 18.441  1.00 0.00 ? 58  ALA A CA   5  
ATOM 8647  C C    . ALA A 1 58  ? -16.174 -10.972 19.553  1.00 0.00 ? 58  ALA A C    5  
ATOM 8648  O O    . ALA A 1 58  ? -16.678 -10.679 20.639  1.00 0.00 ? 58  ALA A O    5  
ATOM 8649  C CB   . ALA A 1 58  ? -17.538 -10.508 17.462  1.00 0.00 ? 58  ALA A CB   5  
ATOM 8650  H H    . ALA A 1 58  ? -19.048 -11.670 19.118  1.00 0.00 ? 58  ALA A H    5  
ATOM 8651  H HA   . ALA A 1 58  ? -16.443 -12.314 17.897  1.00 0.00 ? 58  ALA A HA   5  
ATOM 8652  H HB1  . ALA A 1 58  ? -18.275 -10.938 16.789  1.00 0.00 ? 58  ALA A HB1  5  
ATOM 8653  H HB2  . ALA A 1 58  ? -18.009 -9.692  18.008  1.00 0.00 ? 58  ALA A HB2  5  
ATOM 8654  H HB3  . ALA A 1 58  ? -16.702 -10.115 16.883  1.00 0.00 ? 58  ALA A HB3  5  
ATOM 8655  N N    . GLU A 1 59  ? -14.893 -10.709 19.281  1.00 0.00 ? 59  GLU A N    5  
ATOM 8656  C CA   . GLU A 1 59  ? -13.964 -10.137 20.266  1.00 0.00 ? 59  GLU A CA   5  
ATOM 8657  C C    . GLU A 1 59  ? -12.838 -9.332  19.602  1.00 0.00 ? 59  GLU A C    5  
ATOM 8658  O O    . GLU A 1 59  ? -12.274 -9.767  18.601  1.00 0.00 ? 59  GLU A O    5  
ATOM 8659  C CB   . GLU A 1 59  ? -13.402 -11.257 21.167  1.00 0.00 ? 59  GLU A CB   5  
ATOM 8660  C CG   . GLU A 1 59  ? -12.554 -10.714 22.321  1.00 0.00 ? 59  GLU A CG   5  
ATOM 8661  C CD   . GLU A 1 59  ? -12.140 -11.836 23.283  1.00 0.00 ? 59  GLU A CD   5  
ATOM 8662  O OE1  . GLU A 1 59  ? -11.276 -12.672 22.920  1.00 0.00 ? 59  GLU A OE1  5  
ATOM 8663  O OE2  . GLU A 1 59  ? -12.682 -11.879 24.414  1.00 0.00 ? 59  GLU A OE2  5  
ATOM 8664  H H    . GLU A 1 59  ? -14.535 -10.940 18.359  1.00 0.00 ? 59  GLU A H    5  
ATOM 8665  H HA   . GLU A 1 59  ? -14.524 -9.454  20.897  1.00 0.00 ? 59  GLU A HA   5  
ATOM 8666  H HB2  . GLU A 1 59  ? -14.232 -11.821 21.595  1.00 0.00 ? 59  GLU A HB2  5  
ATOM 8667  H HB3  . GLU A 1 59  ? -12.797 -11.935 20.563  1.00 0.00 ? 59  GLU A HB3  5  
ATOM 8668  H HG2  . GLU A 1 59  ? -11.655 -10.241 21.924  1.00 0.00 ? 59  GLU A HG2  5  
ATOM 8669  H HG3  . GLU A 1 59  ? -13.126 -9.956  22.861  1.00 0.00 ? 59  GLU A HG3  5  
ATOM 8670  N N    . VAL A 1 60  ? -12.489 -8.177  20.175  1.00 0.00 ? 60  VAL A N    5  
ATOM 8671  C CA   . VAL A 1 60  ? -11.317 -7.372  19.787  1.00 0.00 ? 60  VAL A CA   5  
ATOM 8672  C C    . VAL A 1 60  ? -10.062 -7.935  20.471  1.00 0.00 ? 60  VAL A C    5  
ATOM 8673  O O    . VAL A 1 60  ? -10.027 -8.067  21.694  1.00 0.00 ? 60  VAL A O    5  
ATOM 8674  C CB   . VAL A 1 60  ? -11.480 -5.883  20.159  1.00 0.00 ? 60  VAL A CB   5  
ATOM 8675  C CG1  . VAL A 1 60  ? -10.313 -5.048  19.604  1.00 0.00 ? 60  VAL A CG1  5  
ATOM 8676  C CG2  . VAL A 1 60  ? -12.791 -5.289  19.618  1.00 0.00 ? 60  VAL A CG2  5  
ATOM 8677  H H    . VAL A 1 60  ? -13.030 -7.873  20.988  1.00 0.00 ? 60  VAL A H    5  
ATOM 8678  H HA   . VAL A 1 60  ? -11.204 -7.431  18.706  1.00 0.00 ? 60  VAL A HA   5  
ATOM 8679  H HB   . VAL A 1 60  ? -11.497 -5.801  21.245  1.00 0.00 ? 60  VAL A HB   5  
ATOM 8680  H HG11 . VAL A 1 60  ? -10.267 -5.144  18.519  1.00 0.00 ? 60  VAL A HG11 5  
ATOM 8681  H HG12 . VAL A 1 60  ? -10.445 -3.997  19.862  1.00 0.00 ? 60  VAL A HG12 5  
ATOM 8682  H HG13 . VAL A 1 60  ? -9.369  -5.391  20.026  1.00 0.00 ? 60  VAL A HG13 5  
ATOM 8683  H HG21 . VAL A 1 60  ? -12.842 -4.228  19.860  1.00 0.00 ? 60  VAL A HG21 5  
ATOM 8684  H HG22 . VAL A 1 60  ? -12.838 -5.412  18.536  1.00 0.00 ? 60  VAL A HG22 5  
ATOM 8685  H HG23 . VAL A 1 60  ? -13.645 -5.784  20.076  1.00 0.00 ? 60  VAL A HG23 5  
ATOM 8686  N N    . LYS A 1 61  ? -9.030  -8.248  19.686  1.00 0.00 ? 61  LYS A N    5  
ATOM 8687  C CA   . LYS A 1 61  ? -7.810  -8.959  20.104  1.00 0.00 ? 61  LYS A CA   5  
ATOM 8688  C C    . LYS A 1 61  ? -6.526  -8.282  19.556  1.00 0.00 ? 61  LYS A C    5  
ATOM 8689  O O    . LYS A 1 61  ? -6.603  -7.287  18.827  1.00 0.00 ? 61  LYS A O    5  
ATOM 8690  C CB   . LYS A 1 61  ? -7.936  -10.442 19.675  1.00 0.00 ? 61  LYS A CB   5  
ATOM 8691  C CG   . LYS A 1 61  ? -9.209  -11.113 20.227  1.00 0.00 ? 61  LYS A CG   5  
ATOM 8692  C CD   . LYS A 1 61  ? -9.308  -12.617 19.935  1.00 0.00 ? 61  LYS A CD   5  
ATOM 8693  C CE   . LYS A 1 61  ? -8.379  -13.510 20.775  1.00 0.00 ? 61  LYS A CE   5  
ATOM 8694  N NZ   . LYS A 1 61  ? -8.662  -13.409 22.234  1.00 0.00 ? 61  LYS A NZ   5  
ATOM 8695  H H    . LYS A 1 61  ? -9.150  -8.100  18.685  1.00 0.00 ? 61  LYS A H    5  
ATOM 8696  H HA   . LYS A 1 61  ? -7.731  -8.929  21.195  1.00 0.00 ? 61  LYS A HA   5  
ATOM 8697  H HB2  . LYS A 1 61  ? -7.967  -10.501 18.585  1.00 0.00 ? 61  LYS A HB2  5  
ATOM 8698  H HB3  . LYS A 1 61  ? -7.065  -10.997 20.024  1.00 0.00 ? 61  LYS A HB3  5  
ATOM 8699  H HG2  . LYS A 1 61  ? -9.276  -10.939 21.302  1.00 0.00 ? 61  LYS A HG2  5  
ATOM 8700  H HG3  . LYS A 1 61  ? -10.077 -10.650 19.761  1.00 0.00 ? 61  LYS A HG3  5  
ATOM 8701  H HD2  . LYS A 1 61  ? -10.339 -12.931 20.117  1.00 0.00 ? 61  LYS A HD2  5  
ATOM 8702  H HD3  . LYS A 1 61  ? -9.100  -12.785 18.876  1.00 0.00 ? 61  LYS A HD3  5  
ATOM 8703  H HE2  . LYS A 1 61  ? -8.542  -14.545 20.451  1.00 0.00 ? 61  LYS A HE2  5  
ATOM 8704  H HE3  . LYS A 1 61  ? -7.332  -13.260 20.570  1.00 0.00 ? 61  LYS A HE3  5  
ATOM 8705  H HZ1  . LYS A 1 61  ? -8.282  -12.559 22.627  1.00 0.00 ? 61  LYS A HZ1  5  
ATOM 8706  H HZ2  . LYS A 1 61  ? -9.669  -13.394 22.417  1.00 0.00 ? 61  LYS A HZ2  5  
ATOM 8707  H HZ3  . LYS A 1 61  ? -8.259  -14.188 22.739  1.00 0.00 ? 61  LYS A HZ3  5  
ATOM 8708  N N    . ARG A 1 62  ? -5.349  -8.787  19.957  1.00 0.00 ? 62  ARG A N    5  
ATOM 8709  C CA   . ARG A 1 62  ? -4.025  -8.173  19.726  1.00 0.00 ? 62  ARG A CA   5  
ATOM 8710  C C    . ARG A 1 62  ? -2.946  -9.221  19.397  1.00 0.00 ? 62  ARG A C    5  
ATOM 8711  O O    . ARG A 1 62  ? -2.925  -10.287 20.013  1.00 0.00 ? 62  ARG A O    5  
ATOM 8712  C CB   . ARG A 1 62  ? -3.635  -7.369  20.985  1.00 0.00 ? 62  ARG A CB   5  
ATOM 8713  C CG   . ARG A 1 62  ? -2.268  -6.660  20.887  1.00 0.00 ? 62  ARG A CG   5  
ATOM 8714  C CD   . ARG A 1 62  ? -2.004  -5.729  22.082  1.00 0.00 ? 62  ARG A CD   5  
ATOM 8715  N NE   . ARG A 1 62  ? -1.900  -6.477  23.352  1.00 0.00 ? 62  ARG A NE   5  
ATOM 8716  C CZ   . ARG A 1 62  ? -1.905  -5.966  24.579  1.00 0.00 ? 62  ARG A CZ   5  
ATOM 8717  N NH1  . ARG A 1 62  ? -1.992  -4.669  24.791  1.00 0.00 ? 62  ARG A NH1  5  
ATOM 8718  N NH2  . ARG A 1 62  ? -1.823  -6.764  25.621  1.00 0.00 ? 62  ARG A NH2  5  
ATOM 8719  H H    . ARG A 1 62  ? -5.368  -9.632  20.514  1.00 0.00 ? 62  ARG A H    5  
ATOM 8720  H HA   . ARG A 1 62  ? -4.102  -7.480  18.888  1.00 0.00 ? 62  ARG A HA   5  
ATOM 8721  H HB2  . ARG A 1 62  ? -4.403  -6.619  21.159  1.00 0.00 ? 62  ARG A HB2  5  
ATOM 8722  H HB3  . ARG A 1 62  ? -3.628  -8.041  21.846  1.00 0.00 ? 62  ARG A HB3  5  
ATOM 8723  H HG2  . ARG A 1 62  ? -1.466  -7.396  20.837  1.00 0.00 ? 62  ARG A HG2  5  
ATOM 8724  H HG3  . ARG A 1 62  ? -2.237  -6.063  19.977  1.00 0.00 ? 62  ARG A HG3  5  
ATOM 8725  H HD2  . ARG A 1 62  ? -1.069  -5.196  21.908  1.00 0.00 ? 62  ARG A HD2  5  
ATOM 8726  H HD3  . ARG A 1 62  ? -2.813  -4.999  22.148  1.00 0.00 ? 62  ARG A HD3  5  
ATOM 8727  H HE   . ARG A 1 62  ? -1.778  -7.478  23.278  1.00 0.00 ? 62  ARG A HE   5  
ATOM 8728  H HH11 . ARG A 1 62  ? -2.015  -4.028  24.019  1.00 0.00 ? 62  ARG A HH11 5  
ATOM 8729  H HH12 . ARG A 1 62  ? -1.987  -4.302  25.731  1.00 0.00 ? 62  ARG A HH12 5  
ATOM 8730  H HH21 . ARG A 1 62  ? -1.762  -7.763  25.501  1.00 0.00 ? 62  ARG A HH21 5  
ATOM 8731  H HH22 . ARG A 1 62  ? -1.819  -6.388  26.557  1.00 0.00 ? 62  ARG A HH22 5  
ATOM 8732  N N    . GLU A 1 63  ? -2.014  -8.864  18.504  1.00 0.00 ? 63  GLU A N    5  
ATOM 8733  C CA   . GLU A 1 63  ? -0.813  -9.612  18.082  1.00 0.00 ? 63  GLU A CA   5  
ATOM 8734  C C    . GLU A 1 63  ? -0.030  -8.776  17.051  1.00 0.00 ? 63  GLU A C    5  
ATOM 8735  O O    . GLU A 1 63  ? -0.269  -7.570  16.940  1.00 0.00 ? 63  GLU A O    5  
ATOM 8736  C CB   . GLU A 1 63  ? -1.128  -11.061 17.631  1.00 0.00 ? 63  GLU A CB   5  
ATOM 8737  C CG   . GLU A 1 63  ? -2.138  -11.171 16.484  1.00 0.00 ? 63  GLU A CG   5  
ATOM 8738  C CD   . GLU A 1 63  ? -2.589  -12.627 16.256  1.00 0.00 ? 63  GLU A CD   5  
ATOM 8739  O OE1  . GLU A 1 63  ? -3.065  -13.288 17.212  1.00 0.00 ? 63  GLU A OE1  5  
ATOM 8740  O OE2  . GLU A 1 63  ? -2.489  -13.124 15.110  1.00 0.00 ? 63  GLU A OE2  5  
ATOM 8741  H H    . GLU A 1 63  ? -2.113  -7.947  18.075  1.00 0.00 ? 63  GLU A H    5  
ATOM 8742  H HA   . GLU A 1 63  ? -0.151  -9.704  18.943  1.00 0.00 ? 63  GLU A HA   5  
ATOM 8743  H HB2  . GLU A 1 63  ? -0.205  -11.556 17.328  1.00 0.00 ? 63  GLU A HB2  5  
ATOM 8744  H HB3  . GLU A 1 63  ? -1.496  -11.622 18.486  1.00 0.00 ? 63  GLU A HB3  5  
ATOM 8745  H HG2  . GLU A 1 63  ? -3.012  -10.570 16.717  1.00 0.00 ? 63  GLU A HG2  5  
ATOM 8746  H HG3  . GLU A 1 63  ? -1.689  -10.767 15.579  1.00 0.00 ? 63  GLU A HG3  5  
ATOM 8747  N N    . ARG A 1 64  ? 0.923   -9.368  16.323  1.00 0.00 ? 64  ARG A N    5  
ATOM 8748  C CA   . ARG A 1 64  ? 1.797   -8.655  15.377  1.00 0.00 ? 64  ARG A CA   5  
ATOM 8749  C C    . ARG A 1 64  ? 1.423   -8.860  13.903  1.00 0.00 ? 64  ARG A C    5  
ATOM 8750  O O    . ARG A 1 64  ? 0.934   -9.918  13.499  1.00 0.00 ? 64  ARG A O    5  
ATOM 8751  C CB   . ARG A 1 64  ? 3.260   -9.045  15.619  1.00 0.00 ? 64  ARG A CB   5  
ATOM 8752  C CG   . ARG A 1 64  ? 3.769   -8.462  16.949  1.00 0.00 ? 64  ARG A CG   5  
ATOM 8753  C CD   . ARG A 1 64  ? 5.255   -8.767  17.186  1.00 0.00 ? 64  ARG A CD   5  
ATOM 8754  N NE   . ARG A 1 64  ? 6.103   -8.226  16.107  1.00 0.00 ? 64  ARG A NE   5  
ATOM 8755  C CZ   . ARG A 1 64  ? 6.629   -7.017  15.992  1.00 0.00 ? 64  ARG A CZ   5  
ATOM 8756  N NH1  . ARG A 1 64  ? 6.507   -6.078  16.910  1.00 0.00 ? 64  ARG A NH1  5  
ATOM 8757  N NH2  . ARG A 1 64  ? 7.297   -6.765  14.892  1.00 0.00 ? 64  ARG A NH2  5  
ATOM 8758  H H    . ARG A 1 64  ? 1.087   -10.356 16.469  1.00 0.00 ? 64  ARG A H    5  
ATOM 8759  H HA   . ARG A 1 64  ? 1.717   -7.584  15.570  1.00 0.00 ? 64  ARG A HA   5  
ATOM 8760  H HB2  . ARG A 1 64  ? 3.361   -10.133 15.623  1.00 0.00 ? 64  ARG A HB2  5  
ATOM 8761  H HB3  . ARG A 1 64  ? 3.862   -8.648  14.803  1.00 0.00 ? 64  ARG A HB3  5  
ATOM 8762  H HG2  . ARG A 1 64  ? 3.627   -7.380  16.942  1.00 0.00 ? 64  ARG A HG2  5  
ATOM 8763  H HG3  . ARG A 1 64  ? 3.182   -8.878  17.771  1.00 0.00 ? 64  ARG A HG3  5  
ATOM 8764  H HD2  . ARG A 1 64  ? 5.558   -8.353  18.150  1.00 0.00 ? 64  ARG A HD2  5  
ATOM 8765  H HD3  . ARG A 1 64  ? 5.392   -9.849  17.236  1.00 0.00 ? 64  ARG A HD3  5  
ATOM 8766  H HE   . ARG A 1 64  ? 6.295   -8.843  15.317  1.00 0.00 ? 64  ARG A HE   5  
ATOM 8767  H HH11 . ARG A 1 64  ? 5.988   -6.260  17.755  1.00 0.00 ? 64  ARG A HH11 5  
ATOM 8768  H HH12 . ARG A 1 64  ? 6.961   -5.185  16.797  1.00 0.00 ? 64  ARG A HH12 5  
ATOM 8769  H HH21 . ARG A 1 64  ? 7.320   -7.503  14.186  1.00 0.00 ? 64  ARG A HH21 5  
ATOM 8770  H HH22 . ARG A 1 64  ? 7.748   -5.880  14.729  1.00 0.00 ? 64  ARG A HH22 5  
ATOM 8771  N N    . LEU A 1 65  ? 1.713   -7.838  13.091  1.00 0.00 ? 65  LEU A N    5  
ATOM 8772  C CA   . LEU A 1 65  ? 1.416   -7.762  11.658  1.00 0.00 ? 65  LEU A CA   5  
ATOM 8773  C C    . LEU A 1 65  ? 1.908   -9.005  10.918  1.00 0.00 ? 65  LEU A C    5  
ATOM 8774  O O    . LEU A 1 65  ? 1.092   -9.688  10.315  1.00 0.00 ? 65  LEU A O    5  
ATOM 8775  C CB   . LEU A 1 65  ? 2.052   -6.478  11.090  1.00 0.00 ? 65  LEU A CB   5  
ATOM 8776  C CG   . LEU A 1 65  ? 1.806   -6.270  9.578   1.00 0.00 ? 65  LEU A CG   5  
ATOM 8777  C CD1  . LEU A 1 65  ? 0.340   -5.912  9.304   1.00 0.00 ? 65  LEU A CD1  5  
ATOM 8778  C CD2  . LEU A 1 65  ? 2.733   -5.175  9.040   1.00 0.00 ? 65  LEU A CD2  5  
ATOM 8779  H H    . LEU A 1 65  ? 2.174   -7.034  13.506  1.00 0.00 ? 65  LEU A H    5  
ATOM 8780  H HA   . LEU A 1 65  ? 0.332   -7.718  11.531  1.00 0.00 ? 65  LEU A HA   5  
ATOM 8781  H HB2  . LEU A 1 65  ? 1.659   -5.617  11.634  1.00 0.00 ? 65  LEU A HB2  5  
ATOM 8782  H HB3  . LEU A 1 65  ? 3.129   -6.513  11.267  1.00 0.00 ? 65  LEU A HB3  5  
ATOM 8783  H HG   . LEU A 1 65  ? 2.044   -7.181  9.034   1.00 0.00 ? 65  LEU A HG   5  
ATOM 8784  H HD11 . LEU A 1 65  ? -0.314  -6.727  9.612   1.00 0.00 ? 65  LEU A HD11 5  
ATOM 8785  H HD12 . LEU A 1 65  ? 0.073   -5.014  9.861   1.00 0.00 ? 65  LEU A HD12 5  
ATOM 8786  H HD13 . LEU A 1 65  ? 0.197   -5.735  8.235   1.00 0.00 ? 65  LEU A HD13 5  
ATOM 8787  H HD21 . LEU A 1 65  ? 2.540   -4.233  9.547   1.00 0.00 ? 65  LEU A HD21 5  
ATOM 8788  H HD22 . LEU A 1 65  ? 3.775   -5.461  9.199   1.00 0.00 ? 65  LEU A HD22 5  
ATOM 8789  H HD23 . LEU A 1 65  ? 2.572   -5.045  7.971   1.00 0.00 ? 65  LEU A HD23 5  
ATOM 8790  N N    . GLU A 1 66  ? 3.203   -9.318  10.987  1.00 0.00 ? 66  GLU A N    5  
ATOM 8791  C CA   . GLU A 1 66  ? 3.824   -10.413 10.238  1.00 0.00 ? 66  GLU A CA   5  
ATOM 8792  C C    . GLU A 1 66  ? 3.179   -11.785 10.512  1.00 0.00 ? 66  GLU A C    5  
ATOM 8793  O O    . GLU A 1 66  ? 3.050   -12.589 9.588   1.00 0.00 ? 66  GLU A O    5  
ATOM 8794  C CB   . GLU A 1 66  ? 5.350   -10.429 10.465  1.00 0.00 ? 66  GLU A CB   5  
ATOM 8795  C CG   . GLU A 1 66  ? 5.844   -10.605 11.916  1.00 0.00 ? 66  GLU A CG   5  
ATOM 8796  C CD   . GLU A 1 66  ? 6.038   -9.297  12.707  1.00 0.00 ? 66  GLU A CD   5  
ATOM 8797  O OE1  . GLU A 1 66  ? 5.266   -8.332  12.517  1.00 0.00 ? 66  GLU A OE1  5  
ATOM 8798  O OE2  . GLU A 1 66  ? 6.952   -9.239  13.563  1.00 0.00 ? 66  GLU A OE2  5  
ATOM 8799  H H    . GLU A 1 66  ? 3.822   -8.718  11.536  1.00 0.00 ? 66  GLU A H    5  
ATOM 8800  H HA   . GLU A 1 66  ? 3.671   -10.217 9.176   1.00 0.00 ? 66  GLU A HA   5  
ATOM 8801  H HB2  . GLU A 1 66  ? 5.752   -11.254 9.876   1.00 0.00 ? 66  GLU A HB2  5  
ATOM 8802  H HB3  . GLU A 1 66  ? 5.777   -9.516  10.056  1.00 0.00 ? 66  GLU A HB3  5  
ATOM 8803  H HG2  . GLU A 1 66  ? 5.172   -11.266 12.460  1.00 0.00 ? 66  GLU A HG2  5  
ATOM 8804  H HG3  . GLU A 1 66  ? 6.811   -11.109 11.862  1.00 0.00 ? 66  GLU A HG3  5  
ATOM 8805  N N    . ASP A 1 67  ? 2.692   -12.042 11.733  1.00 0.00 ? 67  ASP A N    5  
ATOM 8806  C CA   . ASP A 1 67  ? 1.979   -13.290 12.049  1.00 0.00 ? 67  ASP A CA   5  
ATOM 8807  C C    . ASP A 1 67  ? 0.539   -13.290 11.494  1.00 0.00 ? 67  ASP A C    5  
ATOM 8808  O O    . ASP A 1 67  ? 0.027   -14.339 11.105  1.00 0.00 ? 67  ASP A O    5  
ATOM 8809  C CB   . ASP A 1 67  ? 2.004   -13.519 13.567  1.00 0.00 ? 67  ASP A CB   5  
ATOM 8810  C CG   . ASP A 1 67  ? 1.605   -14.960 13.936  1.00 0.00 ? 67  ASP A CG   5  
ATOM 8811  O OD1  . ASP A 1 67  ? 2.288   -15.911 13.487  1.00 0.00 ? 67  ASP A OD1  5  
ATOM 8812  O OD2  . ASP A 1 67  ? 0.635   -15.139 14.708  1.00 0.00 ? 67  ASP A OD2  5  
ATOM 8813  H H    . ASP A 1 67  ? 2.821   -11.362 12.468  1.00 0.00 ? 67  ASP A H    5  
ATOM 8814  H HA   . ASP A 1 67  ? 2.512   -14.118 11.576  1.00 0.00 ? 67  ASP A HA   5  
ATOM 8815  H HB2  . ASP A 1 67  ? 3.014   -13.340 13.942  1.00 0.00 ? 67  ASP A HB2  5  
ATOM 8816  H HB3  . ASP A 1 67  ? 1.333   -12.808 14.048  1.00 0.00 ? 67  ASP A HB3  5  
ATOM 8817  N N    . VAL A 1 68  ? -0.083  -12.107 11.392  1.00 0.00 ? 68  VAL A N    5  
ATOM 8818  C CA   . VAL A 1 68  ? -1.386  -11.887 10.746  1.00 0.00 ? 68  VAL A CA   5  
ATOM 8819  C C    . VAL A 1 68  ? -1.284  -11.969 9.208   1.00 0.00 ? 68  VAL A C    5  
ATOM 8820  O O    . VAL A 1 68  ? -2.115  -12.623 8.584   1.00 0.00 ? 68  VAL A O    5  
ATOM 8821  C CB   . VAL A 1 68  ? -2.018  -10.548 11.204  1.00 0.00 ? 68  VAL A CB   5  
ATOM 8822  C CG1  . VAL A 1 68  ? -3.253  -10.141 10.386  1.00 0.00 ? 68  VAL A CG1  5  
ATOM 8823  C CG2  . VAL A 1 68  ? -2.431  -10.629 12.681  1.00 0.00 ? 68  VAL A CG2  5  
ATOM 8824  H H    . VAL A 1 68  ? 0.403   -11.304 11.774  1.00 0.00 ? 68  VAL A H    5  
ATOM 8825  H HA   . VAL A 1 68  ? -2.042  -12.686 11.084  1.00 0.00 ? 68  VAL A HA   5  
ATOM 8826  H HB   . VAL A 1 68  ? -1.284  -9.751  11.106  1.00 0.00 ? 68  VAL A HB   5  
ATOM 8827  H HG11 . VAL A 1 68  ? -3.699  -9.242  10.814  1.00 0.00 ? 68  VAL A HG11 5  
ATOM 8828  H HG12 . VAL A 1 68  ? -2.960  -9.913  9.363   1.00 0.00 ? 68  VAL A HG12 5  
ATOM 8829  H HG13 . VAL A 1 68  ? -3.991  -10.943 10.391  1.00 0.00 ? 68  VAL A HG13 5  
ATOM 8830  H HG21 . VAL A 1 68  ? -2.872  -9.687  13.002  1.00 0.00 ? 68  VAL A HG21 5  
ATOM 8831  H HG22 . VAL A 1 68  ? -3.167  -11.420 12.820  1.00 0.00 ? 68  VAL A HG22 5  
ATOM 8832  H HG23 . VAL A 1 68  ? -1.564  -10.838 13.299  1.00 0.00 ? 68  VAL A HG23 5  
ATOM 8833  N N    . VAL A 1 69  ? -0.275  -11.332 8.592   1.00 0.00 ? 69  VAL A N    5  
ATOM 8834  C CA   . VAL A 1 69  ? -0.085  -11.288 7.137   1.00 0.00 ? 69  VAL A CA   5  
ATOM 8835  C C    . VAL A 1 69  ? 0.662   -12.505 6.565   1.00 0.00 ? 69  VAL A C    5  
ATOM 8836  O O    . VAL A 1 69  ? 0.761   -12.634 5.346   1.00 0.00 ? 69  VAL A O    5  
ATOM 8837  C CB   . VAL A 1 69  ? 0.597   -9.976  6.685   1.00 0.00 ? 69  VAL A CB   5  
ATOM 8838  C CG1  . VAL A 1 69  ? -0.267  -8.755  7.046   1.00 0.00 ? 69  VAL A CG1  5  
ATOM 8839  C CG2  . VAL A 1 69  ? 2.046   -9.755  7.136   1.00 0.00 ? 69  VAL A CG2  5  
ATOM 8840  H H    . VAL A 1 69  ? 0.354   -10.757 9.146   1.00 0.00 ? 69  VAL A H    5  
ATOM 8841  H HA   . VAL A 1 69  ? -1.079  -11.290 6.688   1.00 0.00 ? 69  VAL A HA   5  
ATOM 8842  H HB   . VAL A 1 69  ? 0.654   -10.031 5.618   1.00 0.00 ? 69  VAL A HB   5  
ATOM 8843  H HG11 . VAL A 1 69  ? 0.203   -7.844  6.680   1.00 0.00 ? 69  VAL A HG11 5  
ATOM 8844  H HG12 . VAL A 1 69  ? -1.244  -8.853  6.576   1.00 0.00 ? 69  VAL A HG12 5  
ATOM 8845  H HG13 . VAL A 1 69  ? -0.388  -8.677  8.126   1.00 0.00 ? 69  VAL A HG13 5  
ATOM 8846  H HG21 . VAL A 1 69  ? 2.063   -9.355  8.140   1.00 0.00 ? 69  VAL A HG21 5  
ATOM 8847  H HG22 . VAL A 1 69  ? 2.614   -10.686 7.088   1.00 0.00 ? 69  VAL A HG22 5  
ATOM 8848  H HG23 . VAL A 1 69  ? 2.523   -9.024  6.483   1.00 0.00 ? 69  VAL A HG23 5  
ATOM 8849  N N    . GLY A 1 70  ? 1.175   -13.411 7.408   1.00 0.00 ? 70  GLY A N    5  
ATOM 8850  C CA   . GLY A 1 70  ? 1.875   -14.630 6.982   1.00 0.00 ? 70  GLY A CA   5  
ATOM 8851  C C    . GLY A 1 70  ? 0.990   -15.514 6.098   1.00 0.00 ? 70  GLY A C    5  
ATOM 8852  O O    . GLY A 1 70  ? -0.052  -16.004 6.538   1.00 0.00 ? 70  GLY A O    5  
ATOM 8853  H H    . GLY A 1 70  ? 1.151   -13.216 8.403   1.00 0.00 ? 70  GLY A H    5  
ATOM 8854  H HA2  . GLY A 1 70  ? 2.769   -14.351 6.421   1.00 0.00 ? 70  GLY A HA2  5  
ATOM 8855  H HA3  . GLY A 1 70  ? 2.183   -15.206 7.857   1.00 0.00 ? 70  GLY A HA3  5  
ATOM 8856  N N    . GLY A 1 71  ? 1.392   -15.683 4.831   1.00 0.00 ? 71  GLY A N    5  
ATOM 8857  C CA   . GLY A 1 71  ? 0.654   -16.443 3.809   1.00 0.00 ? 71  GLY A CA   5  
ATOM 8858  C C    . GLY A 1 71  ? -0.594  -15.744 3.254   1.00 0.00 ? 71  GLY A C    5  
ATOM 8859  O O    . GLY A 1 71  ? -1.357  -16.376 2.521   1.00 0.00 ? 71  GLY A O    5  
ATOM 8860  H H    . GLY A 1 71  ? 2.259   -15.243 4.552   1.00 0.00 ? 71  GLY A H    5  
ATOM 8861  H HA2  . GLY A 1 71  ? 1.320   -16.640 2.967   1.00 0.00 ? 71  GLY A HA2  5  
ATOM 8862  H HA3  . GLY A 1 71  ? 0.329   -17.394 4.234   1.00 0.00 ? 71  GLY A HA3  5  
ATOM 8863  N N    . CYS A 1 72  ? -0.823  -14.473 3.607   1.00 0.00 ? 72  CYS A N    5  
ATOM 8864  C CA   . CYS A 1 72  ? -2.042  -13.708 3.307   1.00 0.00 ? 72  CYS A CA   5  
ATOM 8865  C C    . CYS A 1 72  ? -1.748  -12.406 2.533   1.00 0.00 ? 72  CYS A C    5  
ATOM 8866  O O    . CYS A 1 72  ? -0.687  -11.794 2.694   1.00 0.00 ? 72  CYS A O    5  
ATOM 8867  C CB   . CYS A 1 72  ? -2.753  -13.366 4.630   1.00 0.00 ? 72  CYS A CB   5  
ATOM 8868  S SG   . CYS A 1 72  ? -3.142  -14.873 5.572   1.00 0.00 ? 72  CYS A SG   5  
ATOM 8869  H H    . CYS A 1 72  ? -0.118  -14.005 4.162   1.00 0.00 ? 72  CYS A H    5  
ATOM 8870  H HA   . CYS A 1 72  ? -2.716  -14.314 2.695   1.00 0.00 ? 72  CYS A HA   5  
ATOM 8871  H HB2  . CYS A 1 72  ? -2.115  -12.711 5.231   1.00 0.00 ? 72  CYS A HB2  5  
ATOM 8872  H HB3  . CYS A 1 72  ? -3.678  -12.823 4.417   1.00 0.00 ? 72  CYS A HB3  5  
ATOM 8873  H HG   . CYS A 1 72  ? -1.878  -15.262 5.805   1.00 0.00 ? 72  CYS A HG   5  
ATOM 8874  N N    . CYS A 1 73  ? -2.717  -11.953 1.731   1.00 0.00 ? 73  CYS A N    5  
ATOM 8875  C CA   . CYS A 1 73  ? -2.700  -10.628 1.092   1.00 0.00 ? 73  CYS A CA   5  
ATOM 8876  C C    . CYS A 1 73  ? -3.300  -9.565  2.031   1.00 0.00 ? 73  CYS A C    5  
ATOM 8877  O O    . CYS A 1 73  ? -4.059  -9.886  2.949   1.00 0.00 ? 73  CYS A O    5  
ATOM 8878  C CB   . CYS A 1 73  ? -3.429  -10.699 -0.264  1.00 0.00 ? 73  CYS A CB   5  
ATOM 8879  S SG   . CYS A 1 73  ? -2.545  -11.843 -1.369  1.00 0.00 ? 73  CYS A SG   5  
ATOM 8880  H H    . CYS A 1 73  ? -3.559  -12.502 1.643   1.00 0.00 ? 73  CYS A H    5  
ATOM 8881  H HA   . CYS A 1 73  ? -1.667  -10.332 0.903   1.00 0.00 ? 73  CYS A HA   5  
ATOM 8882  H HB2  . CYS A 1 73  ? -4.458  -11.039 -0.127  1.00 0.00 ? 73  CYS A HB2  5  
ATOM 8883  H HB3  . CYS A 1 73  ? -3.461  -9.706  -0.721  1.00 0.00 ? 73  CYS A HB3  5  
ATOM 8884  H HG   . CYS A 1 73  ? -3.350  -11.712 -2.435  1.00 0.00 ? 73  CYS A HG   5  
ATOM 8885  N N    . TYR A 1 74  ? -2.996  -8.290  1.786   1.00 0.00 ? 74  TYR A N    5  
ATOM 8886  C CA   . TYR A 1 74  ? -3.493  -7.150  2.577   1.00 0.00 ? 74  TYR A CA   5  
ATOM 8887  C C    . TYR A 1 74  ? -3.373  -5.799  1.847   1.00 0.00 ? 74  TYR A C    5  
ATOM 8888  O O    . TYR A 1 74  ? -2.681  -5.704  0.833   1.00 0.00 ? 74  TYR A O    5  
ATOM 8889  C CB   . TYR A 1 74  ? -2.810  -7.112  3.961   1.00 0.00 ? 74  TYR A CB   5  
ATOM 8890  C CG   . TYR A 1 74  ? -1.313  -6.852  3.978   1.00 0.00 ? 74  TYR A CG   5  
ATOM 8891  C CD1  . TYR A 1 74  ? -0.412  -7.906  3.730   1.00 0.00 ? 74  TYR A CD1  5  
ATOM 8892  C CD2  . TYR A 1 74  ? -0.813  -5.574  4.302   1.00 0.00 ? 74  TYR A CD2  5  
ATOM 8893  C CE1  . TYR A 1 74  ? 0.976   -7.692  3.821   1.00 0.00 ? 74  TYR A CE1  5  
ATOM 8894  C CE2  . TYR A 1 74  ? 0.574   -5.354  4.402   1.00 0.00 ? 74  TYR A CE2  5  
ATOM 8895  C CZ   . TYR A 1 74  ? 1.473   -6.420  4.174   1.00 0.00 ? 74  TYR A CZ   5  
ATOM 8896  O OH   . TYR A 1 74  ? 2.813   -6.225  4.287   1.00 0.00 ? 74  TYR A OH   5  
ATOM 8897  H H    . TYR A 1 74  ? -2.375  -8.084  1.014   1.00 0.00 ? 74  TYR A H    5  
ATOM 8898  H HA   . TYR A 1 74  ? -4.556  -7.314  2.745   1.00 0.00 ? 74  TYR A HA   5  
ATOM 8899  H HB2  . TYR A 1 74  ? -3.301  -6.343  4.556   1.00 0.00 ? 74  TYR A HB2  5  
ATOM 8900  H HB3  . TYR A 1 74  ? -2.998  -8.055  4.476   1.00 0.00 ? 74  TYR A HB3  5  
ATOM 8901  H HD1  . TYR A 1 74  ? -0.785  -8.893  3.492   1.00 0.00 ? 74  TYR A HD1  5  
ATOM 8902  H HD2  . TYR A 1 74  ? -1.496  -4.758  4.504   1.00 0.00 ? 74  TYR A HD2  5  
ATOM 8903  H HE1  . TYR A 1 74  ? 1.666   -8.506  3.639   1.00 0.00 ? 74  TYR A HE1  5  
ATOM 8904  H HE2  . TYR A 1 74  ? 0.949   -4.376  4.673   1.00 0.00 ? 74  TYR A HE2  5  
ATOM 8905  H HH   . TYR A 1 74  ? 3.045   -5.302  4.470   1.00 0.00 ? 74  TYR A HH   5  
ATOM 8906  N N    . ARG A 1 75  ? -4.016  -4.747  2.380   1.00 0.00 ? 75  ARG A N    5  
ATOM 8907  C CA   . ARG A 1 75  ? -3.969  -3.352  1.884   1.00 0.00 ? 75  ARG A CA   5  
ATOM 8908  C C    . ARG A 1 75  ? -4.570  -2.394  2.934   1.00 0.00 ? 75  ARG A C    5  
ATOM 8909  O O    . ARG A 1 75  ? -5.457  -2.810  3.672   1.00 0.00 ? 75  ARG A O    5  
ATOM 8910  C CB   . ARG A 1 75  ? -4.745  -3.269  0.544   1.00 0.00 ? 75  ARG A CB   5  
ATOM 8911  C CG   . ARG A 1 75  ? -4.485  -2.016  -0.310  1.00 0.00 ? 75  ARG A CG   5  
ATOM 8912  C CD   . ARG A 1 75  ? -3.048  -1.952  -0.851  1.00 0.00 ? 75  ARG A CD   5  
ATOM 8913  N NE   . ARG A 1 75  ? -2.879  -0.830  -1.788  1.00 0.00 ? 75  ARG A NE   5  
ATOM 8914  C CZ   . ARG A 1 75  ? -1.761  -0.510  -2.433  1.00 0.00 ? 75  ARG A CZ   5  
ATOM 8915  N NH1  . ARG A 1 75  ? -0.636  -1.173  -2.251  1.00 0.00 ? 75  ARG A NH1  5  
ATOM 8916  N NH2  . ARG A 1 75  ? -1.761  0.498   -3.280  1.00 0.00 ? 75  ARG A NH2  5  
ATOM 8917  H H    . ARG A 1 75  ? -4.625  -4.933  3.172   1.00 0.00 ? 75  ARG A H    5  
ATOM 8918  H HA   . ARG A 1 75  ? -2.919  -3.093  1.723   1.00 0.00 ? 75  ARG A HA   5  
ATOM 8919  H HB2  . ARG A 1 75  ? -4.509  -4.135  -0.076  1.00 0.00 ? 75  ARG A HB2  5  
ATOM 8920  H HB3  . ARG A 1 75  ? -5.815  -3.325  0.760   1.00 0.00 ? 75  ARG A HB3  5  
ATOM 8921  H HG2  . ARG A 1 75  ? -5.169  -2.046  -1.158  1.00 0.00 ? 75  ARG A HG2  5  
ATOM 8922  H HG3  . ARG A 1 75  ? -4.702  -1.116  0.267   1.00 0.00 ? 75  ARG A HG3  5  
ATOM 8923  H HD2  . ARG A 1 75  ? -2.356  -1.830  -0.015  1.00 0.00 ? 75  ARG A HD2  5  
ATOM 8924  H HD3  . ARG A 1 75  ? -2.823  -2.890  -1.365  1.00 0.00 ? 75  ARG A HD3  5  
ATOM 8925  H HE   . ARG A 1 75  ? -3.700  -0.271  -1.980  1.00 0.00 ? 75  ARG A HE   5  
ATOM 8926  H HH11 . ARG A 1 75  ? -0.595  -1.942  -1.587  1.00 0.00 ? 75  ARG A HH11 5  
ATOM 8927  H HH12 . ARG A 1 75  ? 0.202   -0.913  -2.746  1.00 0.00 ? 75  ARG A HH12 5  
ATOM 8928  H HH21 . ARG A 1 75  ? -2.604  1.026   -3.450  1.00 0.00 ? 75  ARG A HH21 5  
ATOM 8929  H HH22 . ARG A 1 75  ? -0.920  0.751   -3.779  1.00 0.00 ? 75  ARG A HH22 5  
ATOM 8930  N N    . VAL A 1 76  ? -4.125  -1.134  3.015   1.00 0.00 ? 76  VAL A N    5  
ATOM 8931  C CA   . VAL A 1 76  ? -4.778  -0.104  3.866   1.00 0.00 ? 76  VAL A CA   5  
ATOM 8932  C C    . VAL A 1 76  ? -5.908  0.585   3.089   1.00 0.00 ? 76  VAL A C    5  
ATOM 8933  O O    . VAL A 1 76  ? -5.745  0.888   1.908   1.00 0.00 ? 76  VAL A O    5  
ATOM 8934  C CB   . VAL A 1 76  ? -3.772  0.921   4.453   1.00 0.00 ? 76  VAL A CB   5  
ATOM 8935  C CG1  . VAL A 1 76  ? -4.412  2.127   5.172   1.00 0.00 ? 76  VAL A CG1  5  
ATOM 8936  C CG2  . VAL A 1 76  ? -2.851  0.220   5.465   1.00 0.00 ? 76  VAL A CG2  5  
ATOM 8937  H H    . VAL A 1 76  ? -3.381  -0.845  2.389   1.00 0.00 ? 76  VAL A H    5  
ATOM 8938  H HA   . VAL A 1 76  ? -5.222  -0.624  4.705   1.00 0.00 ? 76  VAL A HA   5  
ATOM 8939  H HB   . VAL A 1 76  ? -3.161  1.302   3.637   1.00 0.00 ? 76  VAL A HB   5  
ATOM 8940  H HG11 . VAL A 1 76  ? -3.628  2.791   5.535   1.00 0.00 ? 76  VAL A HG11 5  
ATOM 8941  H HG12 . VAL A 1 76  ? -5.036  2.695   4.482   1.00 0.00 ? 76  VAL A HG12 5  
ATOM 8942  H HG13 . VAL A 1 76  ? -5.011  1.808   6.027   1.00 0.00 ? 76  VAL A HG13 5  
ATOM 8943  H HG21 . VAL A 1 76  ? -2.118  0.929   5.853   1.00 0.00 ? 76  VAL A HG21 5  
ATOM 8944  H HG22 . VAL A 1 76  ? -3.439  -0.166  6.297   1.00 0.00 ? 76  VAL A HG22 5  
ATOM 8945  H HG23 . VAL A 1 76  ? -2.314  -0.602  4.991   1.00 0.00 ? 76  VAL A HG23 5  
ATOM 8946  N N    . ASN A 1 77  ? -7.041  0.834   3.756   1.00 0.00 ? 77  ASN A N    5  
ATOM 8947  C CA   . ASN A 1 77  ? -8.232  1.475   3.184   1.00 0.00 ? 77  ASN A CA   5  
ATOM 8948  C C    . ASN A 1 77  ? -8.775  2.601   4.092   1.00 0.00 ? 77  ASN A C    5  
ATOM 8949  O O    . ASN A 1 77  ? -9.005  2.404   5.285   1.00 0.00 ? 77  ASN A O    5  
ATOM 8950  C CB   . ASN A 1 77  ? -9.296  0.393   2.921   1.00 0.00 ? 77  ASN A CB   5  
ATOM 8951  C CG   . ASN A 1 77  ? -10.581 0.903   2.266   1.00 0.00 ? 77  ASN A CG   5  
ATOM 8952  O OD1  . ASN A 1 77  ? -10.769 2.081   1.987   1.00 0.00 ? 77  ASN A OD1  5  
ATOM 8953  N ND2  . ASN A 1 77  ? -11.531 0.033   2.010   1.00 0.00 ? 77  ASN A ND2  5  
ATOM 8954  H H    . ASN A 1 77  ? -7.079  0.560   4.738   1.00 0.00 ? 77  ASN A H    5  
ATOM 8955  H HA   . ASN A 1 77  ? -7.969  1.918   2.222   1.00 0.00 ? 77  ASN A HA   5  
ATOM 8956  H HB2  . ASN A 1 77  ? -8.865  -0.365  2.266   1.00 0.00 ? 77  ASN A HB2  5  
ATOM 8957  H HB3  . ASN A 1 77  ? -9.557  -0.095  3.863   1.00 0.00 ? 77  ASN A HB3  5  
ATOM 8958  H HD21 . ASN A 1 77  ? -11.360 -0.957  2.194   1.00 0.00 ? 77  ASN A HD21 5  
ATOM 8959  H HD22 . ASN A 1 77  ? -12.383 0.354   1.580   1.00 0.00 ? 77  ASN A HD22 5  
ATOM 8960  N N    . ASN A 1 78  ? -9.025  3.773   3.490   1.00 0.00 ? 78  ASN A N    5  
ATOM 8961  C CA   . ASN A 1 78  ? -9.509  4.996   4.141   1.00 0.00 ? 78  ASN A CA   5  
ATOM 8962  C C    . ASN A 1 78  ? -10.817 5.535   3.530   1.00 0.00 ? 78  ASN A C    5  
ATOM 8963  O O    . ASN A 1 78  ? -11.091 6.725   3.613   1.00 0.00 ? 78  ASN A O    5  
ATOM 8964  C CB   . ASN A 1 78  ? -8.371  6.031   4.066   1.00 0.00 ? 78  ASN A CB   5  
ATOM 8965  C CG   . ASN A 1 78  ? -7.231  5.659   4.999   1.00 0.00 ? 78  ASN A CG   5  
ATOM 8966  O OD1  . ASN A 1 78  ? -6.098  5.468   4.579   1.00 0.00 ? 78  ASN A OD1  5  
ATOM 8967  N ND2  . ASN A 1 78  ? -7.507  5.518   6.281   1.00 0.00 ? 78  ASN A ND2  5  
ATOM 8968  H H    . ASN A 1 78  ? -8.821  3.832   2.499   1.00 0.00 ? 78  ASN A H    5  
ATOM 8969  H HA   . ASN A 1 78  ? -9.735  4.782   5.193   1.00 0.00 ? 78  ASN A HA   5  
ATOM 8970  H HB2  . ASN A 1 78  ? -8.000  6.106   3.042   1.00 0.00 ? 78  ASN A HB2  5  
ATOM 8971  H HB3  . ASN A 1 78  ? -8.727  7.015   4.358   1.00 0.00 ? 78  ASN A HB3  5  
ATOM 8972  H HD21 . ASN A 1 78  ? -8.451  5.625   6.636   1.00 0.00 ? 78  ASN A HD21 5  
ATOM 8973  H HD22 . ASN A 1 78  ? -6.778  5.100   6.849   1.00 0.00 ? 78  ASN A HD22 5  
ATOM 8974  N N    . SER A 1 79  ? -11.646 4.689   2.913   1.00 0.00 ? 79  SER A N    5  
ATOM 8975  C CA   . SER A 1 79  ? -12.825 5.131   2.133   1.00 0.00 ? 79  SER A CA   5  
ATOM 8976  C C    . SER A 1 79  ? -13.876 5.915   2.947   1.00 0.00 ? 79  SER A C    5  
ATOM 8977  O O    . SER A 1 79  ? -14.640 6.683   2.360   1.00 0.00 ? 79  SER A O    5  
ATOM 8978  C CB   . SER A 1 79  ? -13.486 3.928   1.436   1.00 0.00 ? 79  SER A CB   5  
ATOM 8979  O OG   . SER A 1 79  ? -12.634 3.354   0.450   1.00 0.00 ? 79  SER A OG   5  
ATOM 8980  H H    . SER A 1 79  ? -11.370 3.711   2.860   1.00 0.00 ? 79  SER A H    5  
ATOM 8981  H HA   . SER A 1 79  ? -12.481 5.813   1.356   1.00 0.00 ? 79  SER A HA   5  
ATOM 8982  H HB2  . SER A 1 79  ? -13.752 3.176   2.180   1.00 0.00 ? 79  SER A HB2  5  
ATOM 8983  H HB3  . SER A 1 79  ? -14.403 4.263   0.947   1.00 0.00 ? 79  SER A HB3  5  
ATOM 8984  H HG   . SER A 1 79  ? -11.908 2.874   0.894   1.00 0.00 ? 79  SER A HG   5  
ATOM 8985  N N    . LEU A 1 80  ? -13.900 5.770   4.284   1.00 0.00 ? 80  LEU A N    5  
ATOM 8986  C CA   . LEU A 1 80  ? -14.697 6.620   5.187   1.00 0.00 ? 80  LEU A CA   5  
ATOM 8987  C C    . LEU A 1 80  ? -13.910 7.817   5.734   1.00 0.00 ? 80  LEU A C    5  
ATOM 8988  O O    . LEU A 1 80  ? -14.455 8.913   5.788   1.00 0.00 ? 80  LEU A O    5  
ATOM 8989  C CB   . LEU A 1 80  ? -15.285 5.766   6.326   1.00 0.00 ? 80  LEU A CB   5  
ATOM 8990  C CG   . LEU A 1 80  ? -16.709 5.246   6.046   1.00 0.00 ? 80  LEU A CG   5  
ATOM 8991  C CD1  . LEU A 1 80  ? -17.078 4.197   7.107   1.00 0.00 ? 80  LEU A CD1  5  
ATOM 8992  C CD2  . LEU A 1 80  ? -17.748 6.380   6.081   1.00 0.00 ? 80  LEU A CD2  5  
ATOM 8993  H H    . LEU A 1 80  ? -13.303 5.064   4.689   1.00 0.00 ? 80  LEU A H    5  
ATOM 8994  H HA   . LEU A 1 80  ? -15.515 7.061   4.618   1.00 0.00 ? 80  LEU A HA   5  
ATOM 8995  H HB2  . LEU A 1 80  ? -14.627 4.918   6.505   1.00 0.00 ? 80  LEU A HB2  5  
ATOM 8996  H HB3  . LEU A 1 80  ? -15.316 6.359   7.244   1.00 0.00 ? 80  LEU A HB3  5  
ATOM 8997  H HG   . LEU A 1 80  ? -16.731 4.774   5.064   1.00 0.00 ? 80  LEU A HG   5  
ATOM 8998  H HD11 . LEU A 1 80  ? -16.940 4.610   8.110   1.00 0.00 ? 80  LEU A HD11 5  
ATOM 8999  H HD12 . LEU A 1 80  ? -18.115 3.885   6.983   1.00 0.00 ? 80  LEU A HD12 5  
ATOM 9000  H HD13 . LEU A 1 80  ? -16.439 3.324   6.989   1.00 0.00 ? 80  LEU A HD13 5  
ATOM 9001  H HD21 . LEU A 1 80  ? -17.751 6.844   7.064   1.00 0.00 ? 80  LEU A HD21 5  
ATOM 9002  H HD22 . LEU A 1 80  ? -17.529 7.139   5.330   1.00 0.00 ? 80  LEU A HD22 5  
ATOM 9003  H HD23 . LEU A 1 80  ? -18.741 5.975   5.879   1.00 0.00 ? 80  LEU A HD23 5  
ATOM 9004  N N    . ASP A 1 81  ? -12.627 7.658   6.080   1.00 0.00 ? 81  ASP A N    5  
ATOM 9005  C CA   . ASP A 1 81  ? -11.765 8.772   6.526   1.00 0.00 ? 81  ASP A CA   5  
ATOM 9006  C C    . ASP A 1 81  ? -11.664 9.878   5.462   1.00 0.00 ? 81  ASP A C    5  
ATOM 9007  O O    . ASP A 1 81  ? -11.655 11.063  5.789   1.00 0.00 ? 81  ASP A O    5  
ATOM 9008  C CB   . ASP A 1 81  ? -10.349 8.262   6.836   1.00 0.00 ? 81  ASP A CB   5  
ATOM 9009  C CG   . ASP A 1 81  ? -10.303 7.153   7.875   1.00 0.00 ? 81  ASP A CG   5  
ATOM 9010  O OD1  . ASP A 1 81  ? -10.396 5.968   7.473   1.00 0.00 ? 81  ASP A OD1  5  
ATOM 9011  O OD2  . ASP A 1 81  ? -10.167 7.491   9.070   1.00 0.00 ? 81  ASP A OD2  5  
ATOM 9012  H H    . ASP A 1 81  ? -12.225 6.733   6.020   1.00 0.00 ? 81  ASP A H    5  
ATOM 9013  H HA   . ASP A 1 81  ? -12.202 9.217   7.422   1.00 0.00 ? 81  ASP A HA   5  
ATOM 9014  H HB2  . ASP A 1 81  ? -9.897  7.897   5.920   1.00 0.00 ? 81  ASP A HB2  5  
ATOM 9015  H HB3  . ASP A 1 81  ? -9.741  9.100   7.185   1.00 0.00 ? 81  ASP A HB3  5  
ATOM 9016  N N    . HIS A 1 82  ? -11.669 9.463   4.191   1.00 0.00 ? 82  HIS A N    5  
ATOM 9017  C CA   . HIS A 1 82  ? -11.759 10.291  2.984   1.00 0.00 ? 82  HIS A CA   5  
ATOM 9018  C C    . HIS A 1 82  ? -12.965 11.261  3.003   1.00 0.00 ? 82  HIS A C    5  
ATOM 9019  O O    . HIS A 1 82  ? -12.895 12.348  2.421   1.00 0.00 ? 82  HIS A O    5  
ATOM 9020  C CB   . HIS A 1 82  ? -11.851 9.317   1.789   1.00 0.00 ? 82  HIS A CB   5  
ATOM 9021  C CG   . HIS A 1 82  ? -11.946 9.989   0.440   1.00 0.00 ? 82  HIS A CG   5  
ATOM 9022  N ND1  . HIS A 1 82  ? -13.103 10.358  -0.209  1.00 0.00 ? 82  HIS A ND1  5  
ATOM 9023  C CD2  . HIS A 1 82  ? -10.899 10.335  -0.373  1.00 0.00 ? 82  HIS A CD2  5  
ATOM 9024  C CE1  . HIS A 1 82  ? -12.761 10.918  -1.383  1.00 0.00 ? 82  HIS A CE1  5  
ATOM 9025  N NE2  . HIS A 1 82  ? -11.422 10.923  -1.535  1.00 0.00 ? 82  HIS A NE2  5  
ATOM 9026  H H    . HIS A 1 82  ? -11.625 8.457   4.052   1.00 0.00 ? 82  HIS A H    5  
ATOM 9027  H HA   . HIS A 1 82  ? -10.851 10.889  2.886   1.00 0.00 ? 82  HIS A HA   5  
ATOM 9028  H HB2  . HIS A 1 82  ? -10.973 8.664   1.785   1.00 0.00 ? 82  HIS A HB2  5  
ATOM 9029  H HB3  . HIS A 1 82  ? -12.727 8.672   1.909   1.00 0.00 ? 82  HIS A HB3  5  
ATOM 9030  H HD1  . HIS A 1 82  ? -14.059 10.263  0.143   1.00 0.00 ? 82  HIS A HD1  5  
ATOM 9031  H HD2  . HIS A 1 82  ? -9.850  10.176  -0.153  1.00 0.00 ? 82  HIS A HD2  5  
ATOM 9032  H HE1  . HIS A 1 82  ? -13.470 11.306  -2.105  1.00 0.00 ? 82  HIS A HE1  5  
ATOM 9033  N N    . GLU A 1 83  ? -14.054 10.894  3.689   1.00 0.00 ? 83  GLU A N    5  
ATOM 9034  C CA   . GLU A 1 83  ? -15.272 11.698  3.803   1.00 0.00 ? 83  GLU A CA   5  
ATOM 9035  C C    . GLU A 1 83  ? -15.224 12.701  4.972   1.00 0.00 ? 83  GLU A C    5  
ATOM 9036  O O    . GLU A 1 83  ? -16.045 13.622  5.010   1.00 0.00 ? 83  GLU A O    5  
ATOM 9037  C CB   . GLU A 1 83  ? -16.506 10.787  3.967   1.00 0.00 ? 83  GLU A CB   5  
ATOM 9038  C CG   . GLU A 1 83  ? -16.656 9.715   2.878   1.00 0.00 ? 83  GLU A CG   5  
ATOM 9039  C CD   . GLU A 1 83  ? -16.752 10.323  1.469   1.00 0.00 ? 83  GLU A CD   5  
ATOM 9040  O OE1  . GLU A 1 83  ? -17.818 10.893  1.132   1.00 0.00 ? 83  GLU A OE1  5  
ATOM 9041  O OE2  . GLU A 1 83  ? -15.778 10.221  0.685   1.00 0.00 ? 83  GLU A OE2  5  
ATOM 9042  H H    . GLU A 1 83  ? -14.014 10.036  4.226   1.00 0.00 ? 83  GLU A H    5  
ATOM 9043  H HA   . GLU A 1 83  ? -15.398 12.266  2.885   1.00 0.00 ? 83  GLU A HA   5  
ATOM 9044  H HB2  . GLU A 1 83  ? -16.470 10.298  4.940   1.00 0.00 ? 83  GLU A HB2  5  
ATOM 9045  H HB3  . GLU A 1 83  ? -17.400 11.410  3.956   1.00 0.00 ? 83  GLU A HB3  5  
ATOM 9046  H HG2  . GLU A 1 83  ? -15.813 9.026   2.930   1.00 0.00 ? 83  GLU A HG2  5  
ATOM 9047  H HG3  . GLU A 1 83  ? -17.561 9.140   3.082   1.00 0.00 ? 83  GLU A HG3  5  
ATOM 9048  N N    . TYR A 1 84  ? -14.280 12.544  5.912   1.00 0.00 ? 84  TYR A N    5  
ATOM 9049  C CA   . TYR A 1 84  ? -14.262 13.288  7.177   1.00 0.00 ? 84  TYR A CA   5  
ATOM 9050  C C    . TYR A 1 84  ? -12.995 14.123  7.451   1.00 0.00 ? 84  TYR A C    5  
ATOM 9051  O O    . TYR A 1 84  ? -13.105 15.337  7.636   1.00 0.00 ? 84  TYR A O    5  
ATOM 9052  C CB   . TYR A 1 84  ? -14.491 12.302  8.339   1.00 0.00 ? 84  TYR A CB   5  
ATOM 9053  C CG   . TYR A 1 84  ? -15.739 11.438  8.274   1.00 0.00 ? 84  TYR A CG   5  
ATOM 9054  C CD1  . TYR A 1 84  ? -16.993 11.996  7.952   1.00 0.00 ? 84  TYR A CD1  5  
ATOM 9055  C CD2  . TYR A 1 84  ? -15.638 10.065  8.577   1.00 0.00 ? 84  TYR A CD2  5  
ATOM 9056  C CE1  . TYR A 1 84  ? -18.139 11.178  7.902   1.00 0.00 ? 84  TYR A CE1  5  
ATOM 9057  C CE2  . TYR A 1 84  ? -16.781 9.244   8.540   1.00 0.00 ? 84  TYR A CE2  5  
ATOM 9058  C CZ   . TYR A 1 84  ? -18.036 9.798   8.191   1.00 0.00 ? 84  TYR A CZ   5  
ATOM 9059  O OH   . TYR A 1 84  ? -19.146 9.011   8.136   1.00 0.00 ? 84  TYR A OH   5  
ATOM 9060  H H    . TYR A 1 84  ? -13.615 11.790  5.794   1.00 0.00 ? 84  TYR A H    5  
ATOM 9061  H HA   . TYR A 1 84  ? -15.091 13.995  7.189   1.00 0.00 ? 84  TYR A HA   5  
ATOM 9062  H HB2  . TYR A 1 84  ? -13.628 11.641  8.405   1.00 0.00 ? 84  TYR A HB2  5  
ATOM 9063  H HB3  . TYR A 1 84  ? -14.535 12.880  9.265   1.00 0.00 ? 84  TYR A HB3  5  
ATOM 9064  H HD1  . TYR A 1 84  ? -17.085 13.051  7.736   1.00 0.00 ? 84  TYR A HD1  5  
ATOM 9065  H HD2  . TYR A 1 84  ? -14.684 9.633   8.841   1.00 0.00 ? 84  TYR A HD2  5  
ATOM 9066  H HE1  . TYR A 1 84  ? -19.099 11.601  7.648   1.00 0.00 ? 84  TYR A HE1  5  
ATOM 9067  H HE2  . TYR A 1 84  ? -16.686 8.194   8.785   1.00 0.00 ? 84  TYR A HE2  5  
ATOM 9068  H HH   . TYR A 1 84  ? -18.952 8.091   8.336   1.00 0.00 ? 84  TYR A HH   5  
ATOM 9069  N N    . GLN A 1 85  ? -11.820 13.491  7.612   1.00 0.00 ? 85  GLN A N    5  
ATOM 9070  C CA   . GLN A 1 85  ? -10.916 13.890  8.706   1.00 0.00 ? 85  GLN A CA   5  
ATOM 9071  C C    . GLN A 1 85  ? -9.400  13.962  8.380   1.00 0.00 ? 85  GLN A C    5  
ATOM 9072  O O    . GLN A 1 85  ? -8.912  13.158  7.581   1.00 0.00 ? 85  GLN A O    5  
ATOM 9073  C CB   . GLN A 1 85  ? -11.190 12.975  9.909   1.00 0.00 ? 85  GLN A CB   5  
ATOM 9074  C CG   . GLN A 1 85  ? -10.833 11.488  9.733   1.00 0.00 ? 85  GLN A CG   5  
ATOM 9075  C CD   . GLN A 1 85  ? -11.244 10.657  10.947  1.00 0.00 ? 85  GLN A CD   5  
ATOM 9076  O OE1  . GLN A 1 85  ? -11.856 11.114  11.901  1.00 0.00 ? 85  GLN A OE1  5  
ATOM 9077  N NE2  . GLN A 1 85  ? -10.930 9.393   10.991  1.00 0.00 ? 85  GLN A NE2  5  
ATOM 9078  H H    . GLN A 1 85  ? -11.745 12.543  7.274   1.00 0.00 ? 85  GLN A H    5  
ATOM 9079  H HA   . GLN A 1 85  ? -11.223 14.878  9.040   1.00 0.00 ? 85  GLN A HA   5  
ATOM 9080  H HB2  . GLN A 1 85  ? -10.633 13.362  10.761  1.00 0.00 ? 85  GLN A HB2  5  
ATOM 9081  H HB3  . GLN A 1 85  ? -12.252 13.052  10.140  1.00 0.00 ? 85  GLN A HB3  5  
ATOM 9082  H HG2  . GLN A 1 85  ? -11.337 11.081  8.858   1.00 0.00 ? 85  GLN A HG2  5  
ATOM 9083  H HG3  . GLN A 1 85  ? -9.759  11.384  9.587   1.00 0.00 ? 85  GLN A HG3  5  
ATOM 9084  H HE21 . GLN A 1 85  ? -10.520 8.903   10.196  1.00 0.00 ? 85  GLN A HE21 5  
ATOM 9085  H HE22 . GLN A 1 85  ? -11.265 8.902   11.809  1.00 0.00 ? 85  GLN A HE22 5  
ATOM 9086  N N    . PRO A 1 86  ? -8.642  14.861  9.059   1.00 0.00 ? 86  PRO A N    5  
ATOM 9087  C CA   . PRO A 1 86  ? -7.176  14.942  9.008   1.00 0.00 ? 86  PRO A CA   5  
ATOM 9088  C C    . PRO A 1 86  ? -6.459  13.892  9.874   1.00 0.00 ? 86  PRO A C    5  
ATOM 9089  O O    . PRO A 1 86  ? -5.243  13.752  9.746   1.00 0.00 ? 86  PRO A O    5  
ATOM 9090  C CB   . PRO A 1 86  ? -6.831  16.344  9.520   1.00 0.00 ? 86  PRO A CB   5  
ATOM 9091  C CG   . PRO A 1 86  ? -7.940  16.628  10.527  1.00 0.00 ? 86  PRO A CG   5  
ATOM 9092  C CD   . PRO A 1 86  ? -9.149  15.958  9.882   1.00 0.00 ? 86  PRO A CD   5  
ATOM 9093  H HA   . PRO A 1 86  ? -6.831  14.837  7.977   1.00 0.00 ? 86  PRO A HA   5  
ATOM 9094  H HB2  . PRO A 1 86  ? -5.846  16.374  9.993   1.00 0.00 ? 86  PRO A HB2  5  
ATOM 9095  H HB3  . PRO A 1 86  ? -6.886  17.061  8.703   1.00 0.00 ? 86  PRO A HB3  5  
ATOM 9096  H HG2  . PRO A 1 86  ? -7.714  16.144  11.481  1.00 0.00 ? 86  PRO A HG2  5  
ATOM 9097  H HG3  . PRO A 1 86  ? -8.098  17.699  10.670  1.00 0.00 ? 86  PRO A HG3  5  
ATOM 9098  H HD2  . PRO A 1 86  ? -9.829  15.599  10.655  1.00 0.00 ? 86  PRO A HD2  5  
ATOM 9099  H HD3  . PRO A 1 86  ? -9.659  16.677  9.242   1.00 0.00 ? 86  PRO A HD3  5  
ATOM 9100  N N    . ARG A 1 87  ? -7.189  13.180  10.755  1.00 0.00 ? 87  ARG A N    5  
ATOM 9101  C CA   . ARG A 1 87  ? -6.764  11.999  11.528  1.00 0.00 ? 87  ARG A CA   5  
ATOM 9102  C C    . ARG A 1 87  ? -5.948  12.340  12.807  1.00 0.00 ? 87  ARG A C    5  
ATOM 9103  O O    . ARG A 1 87  ? -4.724  12.486  12.731  1.00 0.00 ? 87  ARG A O    5  
ATOM 9104  C CB   . ARG A 1 87  ? -6.026  11.030  10.576  1.00 0.00 ? 87  ARG A CB   5  
ATOM 9105  C CG   . ARG A 1 87  ? -6.124  9.547   10.955  1.00 0.00 ? 87  ARG A CG   5  
ATOM 9106  C CD   . ARG A 1 87  ? -7.502  8.976   10.585  1.00 0.00 ? 87  ARG A CD   5  
ATOM 9107  N NE   . ARG A 1 87  ? -7.499  7.502   10.576  1.00 0.00 ? 87  ARG A NE   5  
ATOM 9108  C CZ   . ARG A 1 87  ? -6.942  6.705   9.665   1.00 0.00 ? 87  ARG A CZ   5  
ATOM 9109  N NH1  . ARG A 1 87  ? -6.214  7.150   8.665   1.00 0.00 ? 87  ARG A NH1  5  
ATOM 9110  N NH2  . ARG A 1 87  ? -7.104  5.407   9.745   1.00 0.00 ? 87  ARG A NH2  5  
ATOM 9111  H H    . ARG A 1 87  ? -8.177  13.361  10.768  1.00 0.00 ? 87  ARG A H    5  
ATOM 9112  H HA   . ARG A 1 87  ? -7.682  11.495  11.827  1.00 0.00 ? 87  ARG A HA   5  
ATOM 9113  H HB2  . ARG A 1 87  ? -6.454  11.153  9.580   1.00 0.00 ? 87  ARG A HB2  5  
ATOM 9114  H HB3  . ARG A 1 87  ? -4.973  11.302  10.510  1.00 0.00 ? 87  ARG A HB3  5  
ATOM 9115  H HG2  . ARG A 1 87  ? -5.351  9.013   10.405  1.00 0.00 ? 87  ARG A HG2  5  
ATOM 9116  H HG3  . ARG A 1 87  ? -5.933  9.411   12.020  1.00 0.00 ? 87  ARG A HG3  5  
ATOM 9117  H HD2  . ARG A 1 87  ? -8.240  9.345   11.307  1.00 0.00 ? 87  ARG A HD2  5  
ATOM 9118  H HD3  . ARG A 1 87  ? -7.798  9.331   9.596   1.00 0.00 ? 87  ARG A HD3  5  
ATOM 9119  H HE   . ARG A 1 87  ? -8.051  7.053   11.292  1.00 0.00 ? 87  ARG A HE   5  
ATOM 9120  H HH11 . ARG A 1 87  ? -6.065  8.135   8.536   1.00 0.00 ? 87  ARG A HH11 5  
ATOM 9121  H HH12 . ARG A 1 87  ? -5.705  6.494   8.074   1.00 0.00 ? 87  ARG A HH12 5  
ATOM 9122  H HH21 . ARG A 1 87  ? -7.612  4.988   10.507  1.00 0.00 ? 87  ARG A HH21 5  
ATOM 9123  H HH22 . ARG A 1 87  ? -6.683  4.827   9.023   1.00 0.00 ? 87  ARG A HH22 5  
ATOM 9124  N N    . PRO A 1 88  ? -6.581  12.405  14.003  1.00 0.00 ? 88  PRO A N    5  
ATOM 9125  C CA   . PRO A 1 88  ? -5.883  12.500  15.291  1.00 0.00 ? 88  PRO A CA   5  
ATOM 9126  C C    . PRO A 1 88  ? -5.338  11.114  15.653  1.00 0.00 ? 88  PRO A C    5  
ATOM 9127  O O    . PRO A 1 88  ? -5.934  10.363  16.422  1.00 0.00 ? 88  PRO A O    5  
ATOM 9128  C CB   . PRO A 1 88  ? -6.927  13.031  16.279  1.00 0.00 ? 88  PRO A CB   5  
ATOM 9129  C CG   . PRO A 1 88  ? -8.225  12.434  15.745  1.00 0.00 ? 88  PRO A CG   5  
ATOM 9130  C CD   . PRO A 1 88  ? -8.020  12.471  14.228  1.00 0.00 ? 88  PRO A CD   5  
ATOM 9131  H HA   . PRO A 1 88  ? -5.057  13.211  15.239  1.00 0.00 ? 88  PRO A HA   5  
ATOM 9132  H HB2  . PRO A 1 88  ? -6.729  12.727  17.304  1.00 0.00 ? 88  PRO A HB2  5  
ATOM 9133  H HB3  . PRO A 1 88  ? -6.975  14.119  16.211  1.00 0.00 ? 88  PRO A HB3  5  
ATOM 9134  H HG2  . PRO A 1 88  ? -8.320  11.402  16.077  1.00 0.00 ? 88  PRO A HG2  5  
ATOM 9135  H HG3  . PRO A 1 88  ? -9.089  13.017  16.063  1.00 0.00 ? 88  PRO A HG3  5  
ATOM 9136  H HD2  . PRO A 1 88  ? -8.545  11.634  13.769  1.00 0.00 ? 88  PRO A HD2  5  
ATOM 9137  H HD3  . PRO A 1 88  ? -8.394  13.418  13.833  1.00 0.00 ? 88  PRO A HD3  5  
ATOM 9138  N N    . VAL A 1 89  ? -4.193  10.758  15.068  1.00 0.00 ? 89  VAL A N    5  
ATOM 9139  C CA   . VAL A 1 89  ? -3.633  9.393   15.115  1.00 0.00 ? 89  VAL A CA   5  
ATOM 9140  C C    . VAL A 1 89  ? -3.345  8.895   16.538  1.00 0.00 ? 89  VAL A C    5  
ATOM 9141  O O    . VAL A 1 89  ? -3.522  7.710   16.796  1.00 0.00 ? 89  VAL A O    5  
ATOM 9142  C CB   . VAL A 1 89  ? -2.414  9.299   14.159  1.00 0.00 ? 89  VAL A CB   5  
ATOM 9143  C CG1  . VAL A 1 89  ? -1.456  8.134   14.446  1.00 0.00 ? 89  VAL A CG1  5  
ATOM 9144  C CG2  . VAL A 1 89  ? -2.937  9.200   12.712  1.00 0.00 ? 89  VAL A CG2  5  
ATOM 9145  H H    . VAL A 1 89  ? -3.742  11.441  14.454  1.00 0.00 ? 89  VAL A H    5  
ATOM 9146  H HA   . VAL A 1 89  ? -4.403  8.728   14.720  1.00 0.00 ? 89  VAL A HA   5  
ATOM 9147  H HB   . VAL A 1 89  ? -1.837  10.219  14.250  1.00 0.00 ? 89  VAL A HB   5  
ATOM 9148  H HG11 . VAL A 1 89  ? -0.967  8.281   15.409  1.00 0.00 ? 89  VAL A HG11 5  
ATOM 9149  H HG12 . VAL A 1 89  ? -1.999  7.194   14.458  1.00 0.00 ? 89  VAL A HG12 5  
ATOM 9150  H HG13 . VAL A 1 89  ? -0.684  8.095   13.678  1.00 0.00 ? 89  VAL A HG13 5  
ATOM 9151  H HG21 . VAL A 1 89  ? -2.105  9.171   12.010  1.00 0.00 ? 89  VAL A HG21 5  
ATOM 9152  H HG22 . VAL A 1 89  ? -3.547  8.303   12.586  1.00 0.00 ? 89  VAL A HG22 5  
ATOM 9153  H HG23 . VAL A 1 89  ? -3.556  10.065  12.473  1.00 0.00 ? 89  VAL A HG23 5  
ATOM 9154  N N    . GLU A 1 90  ? -3.026  9.778   17.493  1.00 0.00 ? 90  GLU A N    5  
ATOM 9155  C CA   . GLU A 1 90  ? -2.836  9.382   18.906  1.00 0.00 ? 90  GLU A CA   5  
ATOM 9156  C C    . GLU A 1 90  ? -4.165  8.975   19.558  1.00 0.00 ? 90  GLU A C    5  
ATOM 9157  O O    . GLU A 1 90  ? -4.237  7.990   20.293  1.00 0.00 ? 90  GLU A O    5  
ATOM 9158  C CB   . GLU A 1 90  ? -2.203  10.523  19.722  1.00 0.00 ? 90  GLU A CB   5  
ATOM 9159  C CG   . GLU A 1 90  ? -0.905  11.058  19.111  1.00 0.00 ? 90  GLU A CG   5  
ATOM 9160  C CD   . GLU A 1 90  ? -0.202  12.033  20.065  1.00 0.00 ? 90  GLU A CD   5  
ATOM 9161  O OE1  . GLU A 1 90  ? -0.523  13.245  20.045  1.00 0.00 ? 90  GLU A OE1  5  
ATOM 9162  O OE2  . GLU A 1 90  ? 0.675   11.593  20.848  1.00 0.00 ? 90  GLU A OE2  5  
ATOM 9163  H H    . GLU A 1 90  ? -2.900  10.749  17.224  1.00 0.00 ? 90  GLU A H    5  
ATOM 9164  H HA   . GLU A 1 90  ? -2.172  8.517   18.939  1.00 0.00 ? 90  GLU A HA   5  
ATOM 9165  H HB2  . GLU A 1 90  ? -2.910  11.348  19.804  1.00 0.00 ? 90  GLU A HB2  5  
ATOM 9166  H HB3  . GLU A 1 90  ? -1.993  10.152  20.726  1.00 0.00 ? 90  GLU A HB3  5  
ATOM 9167  H HG2  . GLU A 1 90  ? -0.240  10.220  18.885  1.00 0.00 ? 90  GLU A HG2  5  
ATOM 9168  H HG3  . GLU A 1 90  ? -1.142  11.576  18.179  1.00 0.00 ? 90  GLU A HG3  5  
ATOM 9169  N N    . VAL A 1 91  ? -5.248  9.693   19.249  1.00 0.00 ? 91  VAL A N    5  
ATOM 9170  C CA   . VAL A 1 91  ? -6.597  9.399   19.772  1.00 0.00 ? 91  VAL A CA   5  
ATOM 9171  C C    . VAL A 1 91  ? -7.136  8.104   19.152  1.00 0.00 ? 91  VAL A C    5  
ATOM 9172  O O    . VAL A 1 91  ? -7.809  7.317   19.812  1.00 0.00 ? 91  VAL A O    5  
ATOM 9173  C CB   . VAL A 1 91  ? -7.558  10.588  19.527  1.00 0.00 ? 91  VAL A CB   5  
ATOM 9174  C CG1  . VAL A 1 91  ? -8.977  10.333  20.062  1.00 0.00 ? 91  VAL A CG1  5  
ATOM 9175  C CG2  . VAL A 1 91  ? -7.007  11.880  20.161  1.00 0.00 ? 91  VAL A CG2  5  
ATOM 9176  H H    . VAL A 1 91  ? -5.137  10.461  18.588  1.00 0.00 ? 91  VAL A H    5  
ATOM 9177  H HA   . VAL A 1 91  ? -6.506  9.248   20.847  1.00 0.00 ? 91  VAL A HA   5  
ATOM 9178  H HB   . VAL A 1 91  ? -7.629  10.750  18.453  1.00 0.00 ? 91  VAL A HB   5  
ATOM 9179  H HG11 . VAL A 1 91  ? -9.594  11.218  19.907  1.00 0.00 ? 91  VAL A HG11 5  
ATOM 9180  H HG12 . VAL A 1 91  ? -9.439  9.502   19.526  1.00 0.00 ? 91  VAL A HG12 5  
ATOM 9181  H HG13 . VAL A 1 91  ? -8.941  10.102  21.128  1.00 0.00 ? 91  VAL A HG13 5  
ATOM 9182  H HG21 . VAL A 1 91  ? -7.682  12.713  19.965  1.00 0.00 ? 91  VAL A HG21 5  
ATOM 9183  H HG22 . VAL A 1 91  ? -6.897  11.754  21.239  1.00 0.00 ? 91  VAL A HG22 5  
ATOM 9184  H HG23 . VAL A 1 91  ? -6.033  12.134  19.736  1.00 0.00 ? 91  VAL A HG23 5  
ATOM 9185  N N    . ILE A 1 92  ? -6.788  7.847   17.885  1.00 0.00 ? 92  ILE A N    5  
ATOM 9186  C CA   . ILE A 1 92  ? -7.225  6.658   17.137  1.00 0.00 ? 92  ILE A CA   5  
ATOM 9187  C C    . ILE A 1 92  ? -6.439  5.400   17.562  1.00 0.00 ? 92  ILE A C    5  
ATOM 9188  O O    . ILE A 1 92  ? -7.046  4.352   17.776  1.00 0.00 ? 92  ILE A O    5  
ATOM 9189  C CB   . ILE A 1 92  ? -7.183  7.017   15.630  1.00 0.00 ? 92  ILE A CB   5  
ATOM 9190  C CG1  . ILE A 1 92  ? -8.295  8.079   15.392  1.00 0.00 ? 92  ILE A CG1  5  
ATOM 9191  C CG2  . ILE A 1 92  ? -7.333  5.780   14.729  1.00 0.00 ? 92  ILE A CG2  5  
ATOM 9192  C CD1  . ILE A 1 92  ? -8.323  8.710   14.002  1.00 0.00 ? 92  ILE A CD1  5  
ATOM 9193  H H    . ILE A 1 92  ? -6.275  8.569   17.383  1.00 0.00 ? 92  ILE A H    5  
ATOM 9194  H HA   . ILE A 1 92  ? -8.264  6.433   17.393  1.00 0.00 ? 92  ILE A HA   5  
ATOM 9195  H HB   . ILE A 1 92  ? -6.213  7.467   15.401  1.00 0.00 ? 92  ILE A HB   5  
ATOM 9196  H HG12 . ILE A 1 92  ? -9.268  7.638   15.595  1.00 0.00 ? 92  ILE A HG12 5  
ATOM 9197  H HG13 . ILE A 1 92  ? -8.180  8.906   16.094  1.00 0.00 ? 92  ILE A HG13 5  
ATOM 9198  H HG21 . ILE A 1 92  ? -8.255  5.250   14.954  1.00 0.00 ? 92  ILE A HG21 5  
ATOM 9199  H HG22 . ILE A 1 92  ? -7.329  6.070   13.677  1.00 0.00 ? 92  ILE A HG22 5  
ATOM 9200  H HG23 . ILE A 1 92  ? -6.490  5.103   14.883  1.00 0.00 ? 92  ILE A HG23 5  
ATOM 9201  H HD11 . ILE A 1 92  ? -7.368  9.199   13.811  1.00 0.00 ? 92  ILE A HD11 5  
ATOM 9202  H HD12 . ILE A 1 92  ? -8.523  7.955   13.245  1.00 0.00 ? 92  ILE A HD12 5  
ATOM 9203  H HD13 . ILE A 1 92  ? -9.118  9.459   13.954  1.00 0.00 ? 92  ILE A HD13 5  
ATOM 9204  N N    . ILE A 1 93  ? -5.124  5.512   17.805  1.00 0.00 ? 93  ILE A N    5  
ATOM 9205  C CA   . ILE A 1 93  ? -4.321  4.432   18.416  1.00 0.00 ? 93  ILE A CA   5  
ATOM 9206  C C    . ILE A 1 93  ? -4.774  4.158   19.855  1.00 0.00 ? 93  ILE A C    5  
ATOM 9207  O O    . ILE A 1 93  ? -4.955  3.003   20.223  1.00 0.00 ? 93  ILE A O    5  
ATOM 9208  C CB   . ILE A 1 93  ? -2.806  4.761   18.315  1.00 0.00 ? 93  ILE A CB   5  
ATOM 9209  C CG1  . ILE A 1 93  ? -2.356  4.632   16.840  1.00 0.00 ? 93  ILE A CG1  5  
ATOM 9210  C CG2  . ILE A 1 93  ? -1.959  3.840   19.216  1.00 0.00 ? 93  ILE A CG2  5  
ATOM 9211  C CD1  . ILE A 1 93  ? -0.949  5.174   16.560  1.00 0.00 ? 93  ILE A CD1  5  
ATOM 9212  H H    . ILE A 1 93  ? -4.656  6.388   17.580  1.00 0.00 ? 93  ILE A H    5  
ATOM 9213  H HA   . ILE A 1 93  ? -4.505  3.498   17.878  1.00 0.00 ? 93  ILE A HA   5  
ATOM 9214  H HB   . ILE A 1 93  ? -2.647  5.787   18.651  1.00 0.00 ? 93  ILE A HB   5  
ATOM 9215  H HG12 . ILE A 1 93  ? -2.397  3.586   16.537  1.00 0.00 ? 93  ILE A HG12 5  
ATOM 9216  H HG13 . ILE A 1 93  ? -3.047  5.187   16.208  1.00 0.00 ? 93  ILE A HG13 5  
ATOM 9217  H HG21 . ILE A 1 93  ? -0.900  4.071   19.118  1.00 0.00 ? 93  ILE A HG21 5  
ATOM 9218  H HG22 . ILE A 1 93  ? -2.218  3.988   20.264  1.00 0.00 ? 93  ILE A HG22 5  
ATOM 9219  H HG23 . ILE A 1 93  ? -2.125  2.794   18.953  1.00 0.00 ? 93  ILE A HG23 5  
ATOM 9220  H HD11 . ILE A 1 93  ? -0.901  6.218   16.867  1.00 0.00 ? 93  ILE A HD11 5  
ATOM 9221  H HD12 . ILE A 1 93  ? -0.194  4.594   17.086  1.00 0.00 ? 93  ILE A HD12 5  
ATOM 9222  H HD13 . ILE A 1 93  ? -0.736  5.101   15.494  1.00 0.00 ? 93  ILE A HD13 5  
ATOM 9223  N N    . SER A 1 94  ? -4.992  5.189   20.673  1.00 0.00 ? 94  SER A N    5  
ATOM 9224  C CA   . SER A 1 94  ? -5.427  4.977   22.060  1.00 0.00 ? 94  SER A CA   5  
ATOM 9225  C C    . SER A 1 94  ? -6.856  4.412   22.147  1.00 0.00 ? 94  SER A C    5  
ATOM 9226  O O    . SER A 1 94  ? -7.138  3.613   23.038  1.00 0.00 ? 94  SER A O    5  
ATOM 9227  C CB   . SER A 1 94  ? -5.229  6.239   22.914  1.00 0.00 ? 94  SER A CB   5  
ATOM 9228  O OG   . SER A 1 94  ? -5.853  7.387   22.370  1.00 0.00 ? 94  SER A OG   5  
ATOM 9229  H H    . SER A 1 94  ? -4.836  6.140   20.351  1.00 0.00 ? 94  SER A H    5  
ATOM 9230  H HA   . SER A 1 94  ? -4.776  4.215   22.488  1.00 0.00 ? 94  SER A HA   5  
ATOM 9231  H HB2  . SER A 1 94  ? -5.633  6.052   23.910  1.00 0.00 ? 94  SER A HB2  5  
ATOM 9232  H HB3  . SER A 1 94  ? -4.160  6.434   23.011  1.00 0.00 ? 94  SER A HB3  5  
ATOM 9233  H HG   . SER A 1 94  ? -5.299  7.714   21.632  1.00 0.00 ? 94  SER A HG   5  
ATOM 9234  N N    . SER A 1 95  ? -7.741  4.720   21.189  1.00 0.00 ? 95  SER A N    5  
ATOM 9235  C CA   . SER A 1 95  ? -9.049  4.060   21.068  1.00 0.00 ? 95  SER A CA   5  
ATOM 9236  C C    . SER A 1 95  ? -8.890  2.545   20.861  1.00 0.00 ? 95  SER A C    5  
ATOM 9237  O O    . SER A 1 95  ? -9.510  1.761   21.577  1.00 0.00 ? 95  SER A O    5  
ATOM 9238  C CB   . SER A 1 95  ? -9.879  4.684   19.928  1.00 0.00 ? 95  SER A CB   5  
ATOM 9239  O OG   . SER A 1 95  ? -11.200 4.157   19.937  1.00 0.00 ? 95  SER A OG   5  
ATOM 9240  H H    . SER A 1 95  ? -7.501  5.436   20.517  1.00 0.00 ? 95  SER A H    5  
ATOM 9241  H HA   . SER A 1 95  ? -9.598  4.206   21.997  1.00 0.00 ? 95  SER A HA   5  
ATOM 9242  H HB2  . SER A 1 95  ? -9.924  5.765   20.070  1.00 0.00 ? 95  SER A HB2  5  
ATOM 9243  H HB3  . SER A 1 95  ? -9.401  4.474   18.969  1.00 0.00 ? 95  SER A HB3  5  
ATOM 9244  H HG   . SER A 1 95  ? -11.717 4.511   19.191  1.00 0.00 ? 95  SER A HG   5  
ATOM 9245  N N    . ALA A 1 96  ? -8.003  2.104   19.958  1.00 0.00 ? 96  ALA A N    5  
ATOM 9246  C CA   . ALA A 1 96  ? -7.727  0.679   19.734  1.00 0.00 ? 96  ALA A CA   5  
ATOM 9247  C C    . ALA A 1 96  ? -7.147  -0.010  20.982  1.00 0.00 ? 96  ALA A C    5  
ATOM 9248  O O    . ALA A 1 96  ? -7.630  -1.066  21.402  1.00 0.00 ? 96  ALA A O    5  
ATOM 9249  C CB   . ALA A 1 96  ? -6.807  0.581   18.512  1.00 0.00 ? 96  ALA A CB   5  
ATOM 9250  H H    . ALA A 1 96  ? -7.480  2.783   19.415  1.00 0.00 ? 96  ALA A H    5  
ATOM 9251  H HA   . ALA A 1 96  ? -8.658  0.163   19.506  1.00 0.00 ? 96  ALA A HA   5  
ATOM 9252  H HB1  . ALA A 1 96  ? -7.240  1.151   17.692  1.00 0.00 ? 96  ALA A HB1  5  
ATOM 9253  H HB2  . ALA A 1 96  ? -5.825  0.995   18.743  1.00 0.00 ? 96  ALA A HB2  5  
ATOM 9254  H HB3  . ALA A 1 96  ? -6.700  -0.458  18.205  1.00 0.00 ? 96  ALA A HB3  5  
ATOM 9255  N N    . LYS A 1 97  ? -6.170  0.623   21.638  1.00 0.00 ? 97  LYS A N    5  
ATOM 9256  C CA   . LYS A 1 97  ? -5.567  0.120   22.879  1.00 0.00 ? 97  LYS A CA   5  
ATOM 9257  C C    . LYS A 1 97  ? -6.537  0.129   24.087  1.00 0.00 ? 97  LYS A C    5  
ATOM 9258  O O    . LYS A 1 97  ? -6.272  -0.562  25.071  1.00 0.00 ? 97  LYS A O    5  
ATOM 9259  C CB   . LYS A 1 97  ? -4.266  0.890   23.166  1.00 0.00 ? 97  LYS A CB   5  
ATOM 9260  C CG   . LYS A 1 97  ? -3.185  0.660   22.094  1.00 0.00 ? 97  LYS A CG   5  
ATOM 9261  C CD   . LYS A 1 97  ? -1.921  1.500   22.329  1.00 0.00 ? 97  LYS A CD   5  
ATOM 9262  C CE   . LYS A 1 97  ? -1.194  1.111   23.629  1.00 0.00 ? 97  LYS A CE   5  
ATOM 9263  N NZ   . LYS A 1 97  ? 0.067   1.882   23.813  1.00 0.00 ? 97  LYS A NZ   5  
ATOM 9264  H H    . LYS A 1 97  ? -5.808  1.487   21.240  1.00 0.00 ? 97  LYS A H    5  
ATOM 9265  H HA   . LYS A 1 97  ? -5.305  -0.932  22.728  1.00 0.00 ? 97  LYS A HA   5  
ATOM 9266  H HB2  . LYS A 1 97  ? -4.490  1.953   23.238  1.00 0.00 ? 97  LYS A HB2  5  
ATOM 9267  H HB3  . LYS A 1 97  ? -3.879  0.547   24.126  1.00 0.00 ? 97  LYS A HB3  5  
ATOM 9268  H HG2  . LYS A 1 97  ? -2.915  -0.397  22.079  1.00 0.00 ? 97  LYS A HG2  5  
ATOM 9269  H HG3  . LYS A 1 97  ? -3.582  0.920   21.113  1.00 0.00 ? 97  LYS A HG3  5  
ATOM 9270  H HD2  . LYS A 1 97  ? -1.250  1.348   21.481  1.00 0.00 ? 97  LYS A HD2  5  
ATOM 9271  H HD3  . LYS A 1 97  ? -2.197  2.556   22.364  1.00 0.00 ? 97  LYS A HD3  5  
ATOM 9272  H HE2  . LYS A 1 97  ? -1.859  1.291   24.480  1.00 0.00 ? 97  LYS A HE2  5  
ATOM 9273  H HE3  . LYS A 1 97  ? -0.968  0.039   23.599  1.00 0.00 ? 97  LYS A HE3  5  
ATOM 9274  H HZ1  . LYS A 1 97  ? -0.118  2.875   23.881  1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 9275  H HZ2  . LYS A 1 97  ? 0.537   1.604   24.666  1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 9276  H HZ3  . LYS A 1 97  ? 0.709   1.732   23.046  1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 9277  N N    . GLU A 1 98  ? -7.664  0.849   24.016  1.00 0.00 ? 98  GLU A N    5  
ATOM 9278  C CA   . GLU A 1 98  ? -8.770  0.776   24.976  1.00 0.00 ? 98  GLU A CA   5  
ATOM 9279  C C    . GLU A 1 98  ? -9.819  -0.281  24.574  1.00 0.00 ? 98  GLU A C    5  
ATOM 9280  O O    . GLU A 1 98  ? -10.332 -0.999  25.432  1.00 0.00 ? 98  GLU A O    5  
ATOM 9281  C CB   . GLU A 1 98  ? -9.436  2.154   25.134  1.00 0.00 ? 98  GLU A CB   5  
ATOM 9282  C CG   . GLU A 1 98  ? -8.607  3.133   25.979  1.00 0.00 ? 98  GLU A CG   5  
ATOM 9283  C CD   . GLU A 1 98  ? -8.583  2.740   27.465  1.00 0.00 ? 98  GLU A CD   5  
ATOM 9284  O OE1  . GLU A 1 98  ? -9.596  2.968   28.171  1.00 0.00 ? 98  GLU A OE1  5  
ATOM 9285  O OE2  . GLU A 1 98  ? -7.551  2.209   27.942  1.00 0.00 ? 98  GLU A OE2  5  
ATOM 9286  H H    . GLU A 1 98  ? -7.748  1.520   23.269  1.00 0.00 ? 98  GLU A H    5  
ATOM 9287  H HA   . GLU A 1 98  ? -8.367  0.479   25.935  1.00 0.00 ? 98  GLU A HA   5  
ATOM 9288  H HB2  . GLU A 1 98  ? -9.608  2.588   24.149  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 9289  H HB3  . GLU A 1 98  ? -10.407 2.030   25.614  1.00 0.00 ? 98  GLU A HB3  5  
ATOM 9290  H HG2  . GLU A 1 98  ? -7.587  3.184   25.594  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 9291  H HG3  . GLU A 1 98  ? -9.046  4.127   25.885  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 9292  N N    . MET A 1 99  ? -10.113 -0.411  23.271  1.00 0.00 ? 99  MET A N    5  
ATOM 9293  C CA   . MET A 1 99  ? -11.074 -1.376  22.705  1.00 0.00 ? 99  MET A CA   5  
ATOM 9294  C C    . MET A 1 99  ? -10.603 -2.834  22.766  1.00 0.00 ? 99  MET A C    5  
ATOM 9295  O O    . MET A 1 99  ? -11.440 -3.735  22.789  1.00 0.00 ? 99  MET A O    5  
ATOM 9296  C CB   . MET A 1 99  ? -11.405 -0.996  21.252  1.00 0.00 ? 99  MET A CB   5  
ATOM 9297  C CG   . MET A 1 99  ? -12.380 0.187   21.173  1.00 0.00 ? 99  MET A CG   5  
ATOM 9298  S SD   . MET A 1 99  ? -14.075 -0.123  21.751  1.00 0.00 ? 99  MET A SD   5  
ATOM 9299  C CE   . MET A 1 99  ? -14.608 -1.353  20.530  1.00 0.00 ? 99  MET A CE   5  
ATOM 9300  H H    . MET A 1 99  ? -9.710  0.275   22.642  1.00 0.00 ? 99  MET A H    5  
ATOM 9301  H HA   . MET A 1 99  ? -11.991 -1.333  23.291  1.00 0.00 ? 99  MET A HA   5  
ATOM 9302  H HB2  . MET A 1 99  ? -10.484 -0.752  20.722  1.00 0.00 ? 99  MET A HB2  5  
ATOM 9303  H HB3  . MET A 1 99  ? -11.855 -1.850  20.742  1.00 0.00 ? 99  MET A HB3  5  
ATOM 9304  H HG2  . MET A 1 99  ? -11.970 1.021   21.746  1.00 0.00 ? 99  MET A HG2  5  
ATOM 9305  H HG3  . MET A 1 99  ? -12.437 0.521   20.139  1.00 0.00 ? 99  MET A HG3  5  
ATOM 9306  H HE1  . MET A 1 99  ? -14.405 -0.988  19.520  1.00 0.00 ? 99  MET A HE1  5  
ATOM 9307  H HE2  . MET A 1 99  ? -14.080 -2.295  20.691  1.00 0.00 ? 99  MET A HE2  5  
ATOM 9308  H HE3  . MET A 1 99  ? -15.678 -1.532  20.638  1.00 0.00 ? 99  MET A HE3  5  
ATOM 9309  N N    . VAL A 1 100 ? -9.295  -3.092  22.810  1.00 0.00 ? 100 VAL A N    5  
ATOM 9310  C CA   . VAL A 1 100 ? -8.739  -4.435  23.050  1.00 0.00 ? 100 VAL A CA   5  
ATOM 9311  C C    . VAL A 1 100 ? -9.397  -5.118  24.263  1.00 0.00 ? 100 VAL A C    5  
ATOM 9312  O O    . VAL A 1 100 ? -9.486  -4.553  25.354  1.00 0.00 ? 100 VAL A O    5  
ATOM 9313  C CB   . VAL A 1 100 ? -7.198  -4.412  23.157  1.00 0.00 ? 100 VAL A CB   5  
ATOM 9314  C CG1  . VAL A 1 100 ? -6.661  -3.801  24.457  1.00 0.00 ? 100 VAL A CG1  5  
ATOM 9315  C CG2  . VAL A 1 100 ? -6.610  -5.816  22.960  1.00 0.00 ? 100 VAL A CG2  5  
ATOM 9316  H H    . VAL A 1 100 ? -8.665  -2.316  22.628  1.00 0.00 ? 100 VAL A H    5  
ATOM 9317  H HA   . VAL A 1 100 ? -8.984  -5.020  22.164  1.00 0.00 ? 100 VAL A HA   5  
ATOM 9318  H HB   . VAL A 1 100 ? -6.836  -3.788  22.345  1.00 0.00 ? 100 VAL A HB   5  
ATOM 9319  H HG11 . VAL A 1 100 ? -5.600  -3.573  24.341  1.00 0.00 ? 100 VAL A HG11 5  
ATOM 9320  H HG12 . VAL A 1 100 ? -7.202  -2.883  24.680  1.00 0.00 ? 100 VAL A HG12 5  
ATOM 9321  H HG13 . VAL A 1 100 ? -6.790  -4.494  25.290  1.00 0.00 ? 100 VAL A HG13 5  
ATOM 9322  H HG21 . VAL A 1 100 ? -6.957  -6.492  23.741  1.00 0.00 ? 100 VAL A HG21 5  
ATOM 9323  H HG22 . VAL A 1 100 ? -6.909  -6.211  21.989  1.00 0.00 ? 100 VAL A HG22 5  
ATOM 9324  H HG23 . VAL A 1 100 ? -5.523  -5.764  22.999  1.00 0.00 ? 100 VAL A HG23 5  
ATOM 9325  N N    . GLY A 1 101 ? -9.893  -6.337  24.041  1.00 0.00 ? 101 GLY A N    5  
ATOM 9326  C CA   . GLY A 1 101 ? -10.607 -7.152  25.032  1.00 0.00 ? 101 GLY A CA   5  
ATOM 9327  C C    . GLY A 1 101 ? -12.130 -6.970  25.049  1.00 0.00 ? 101 GLY A C    5  
ATOM 9328  O O    . GLY A 1 101 ? -12.803 -7.697  25.780  1.00 0.00 ? 101 GLY A O    5  
ATOM 9329  H H    . GLY A 1 101 ? -9.788  -6.720  23.106  1.00 0.00 ? 101 GLY A H    5  
ATOM 9330  H HA2  . GLY A 1 101 ? -10.414 -8.203  24.816  1.00 0.00 ? 101 GLY A HA2  5  
ATOM 9331  H HA3  . GLY A 1 101 ? -10.237 -6.920  26.032  1.00 0.00 ? 101 GLY A HA3  5  
ATOM 9332  N N    . GLN A 1 102 ? -12.695 -6.042  24.263  1.00 0.00 ? 102 GLN A N    5  
ATOM 9333  C CA   . GLN A 1 102 ? -14.143 -5.882  24.120  1.00 0.00 ? 102 GLN A CA   5  
ATOM 9334  C C    . GLN A 1 102 ? -14.732 -7.015  23.274  1.00 0.00 ? 102 GLN A C    5  
ATOM 9335  O O    . GLN A 1 102 ? -14.183 -7.396  22.239  1.00 0.00 ? 102 GLN A O    5  
ATOM 9336  C CB   . GLN A 1 102 ? -14.488 -4.526  23.474  1.00 0.00 ? 102 GLN A CB   5  
ATOM 9337  C CG   . GLN A 1 102 ? -14.198 -3.314  24.375  1.00 0.00 ? 102 GLN A CG   5  
ATOM 9338  C CD   . GLN A 1 102 ? -15.139 -3.231  25.579  1.00 0.00 ? 102 GLN A CD   5  
ATOM 9339  O OE1  . GLN A 1 102 ? -14.819 -3.652  26.684  1.00 0.00 ? 102 GLN A OE1  5  
ATOM 9340  N NE2  . GLN A 1 102 ? -16.348 -2.727  25.412  1.00 0.00 ? 102 GLN A NE2  5  
ATOM 9341  H H    . GLN A 1 102 ? -12.109 -5.455  23.690  1.00 0.00 ? 102 GLN A H    5  
ATOM 9342  H HA   . GLN A 1 102 ? -14.603 -5.930  25.110  1.00 0.00 ? 102 GLN A HA   5  
ATOM 9343  H HB2  . GLN A 1 102 ? -13.934 -4.420  22.542  1.00 0.00 ? 102 GLN A HB2  5  
ATOM 9344  H HB3  . GLN A 1 102 ? -15.550 -4.515  23.221  1.00 0.00 ? 102 GLN A HB3  5  
ATOM 9345  H HG2  . GLN A 1 102 ? -13.168 -3.344  24.729  1.00 0.00 ? 102 GLN A HG2  5  
ATOM 9346  H HG3  . GLN A 1 102 ? -14.319 -2.412  23.774  1.00 0.00 ? 102 GLN A HG3  5  
ATOM 9347  H HE21 . GLN A 1 102 ? -16.641 -2.379  24.512  1.00 0.00 ? 102 GLN A HE21 5  
ATOM 9348  H HE22 . GLN A 1 102 ? -16.965 -2.681  26.210  1.00 0.00 ? 102 GLN A HE22 5  
ATOM 9349  N N    . LYS A 1 103 ? -15.894 -7.512  23.704  1.00 0.00 ? 103 LYS A N    5  
ATOM 9350  C CA   . LYS A 1 103 ? -16.747 -8.446  22.958  1.00 0.00 ? 103 LYS A CA   5  
ATOM 9351  C C    . LYS A 1 103 ? -17.900 -7.726  22.229  1.00 0.00 ? 103 LYS A C    5  
ATOM 9352  O O    . LYS A 1 103 ? -18.334 -6.643  22.633  1.00 0.00 ? 103 LYS A O    5  
ATOM 9353  C CB   . LYS A 1 103 ? -17.287 -9.530  23.913  1.00 0.00 ? 103 LYS A CB   5  
ATOM 9354  C CG   . LYS A 1 103 ? -16.220 -10.566 24.303  1.00 0.00 ? 103 LYS A CG   5  
ATOM 9355  C CD   . LYS A 1 103 ? -16.837 -11.608 25.251  1.00 0.00 ? 103 LYS A CD   5  
ATOM 9356  C CE   . LYS A 1 103 ? -15.932 -12.822 25.512  1.00 0.00 ? 103 LYS A CE   5  
ATOM 9357  N NZ   . LYS A 1 103 ? -14.681 -12.475 26.237  1.00 0.00 ? 103 LYS A NZ   5  
ATOM 9358  H H    . LYS A 1 103 ? -16.262 -7.139  24.566  1.00 0.00 ? 103 LYS A H    5  
ATOM 9359  H HA   . LYS A 1 103 ? -16.145 -8.935  22.198  1.00 0.00 ? 103 LYS A HA   5  
ATOM 9360  H HB2  . LYS A 1 103 ? -17.689 -9.059  24.814  1.00 0.00 ? 103 LYS A HB2  5  
ATOM 9361  H HB3  . LYS A 1 103 ? -18.101 -10.065 23.418  1.00 0.00 ? 103 LYS A HB3  5  
ATOM 9362  H HG2  . LYS A 1 103 ? -15.862 -11.064 23.402  1.00 0.00 ? 103 LYS A HG2  5  
ATOM 9363  H HG3  . LYS A 1 103 ? -15.386 -10.069 24.797  1.00 0.00 ? 103 LYS A HG3  5  
ATOM 9364  H HD2  . LYS A 1 103 ? -17.092 -11.133 26.202  1.00 0.00 ? 103 LYS A HD2  5  
ATOM 9365  H HD3  . LYS A 1 103 ? -17.762 -11.980 24.806  1.00 0.00 ? 103 LYS A HD3  5  
ATOM 9366  H HE2  . LYS A 1 103 ? -16.501 -13.545 26.107  1.00 0.00 ? 103 LYS A HE2  5  
ATOM 9367  H HE3  . LYS A 1 103 ? -15.690 -13.296 24.556  1.00 0.00 ? 103 LYS A HE3  5  
ATOM 9368  H HZ1  . LYS A 1 103 ? -14.861 -11.877 27.033  1.00 0.00 ? 103 LYS A HZ1  5  
ATOM 9369  H HZ2  . LYS A 1 103 ? -14.222 -13.312 26.570  1.00 0.00 ? 103 LYS A HZ2  5  
ATOM 9370  H HZ3  . LYS A 1 103 ? -14.017 -12.018 25.611  1.00 0.00 ? 103 LYS A HZ3  5  
ATOM 9371  N N    . MET A 1 104 ? -18.414 -8.356  21.168  1.00 0.00 ? 104 MET A N    5  
ATOM 9372  C CA   . MET A 1 104 ? -19.510 -7.868  20.307  1.00 0.00 ? 104 MET A CA   5  
ATOM 9373  C C    . MET A 1 104 ? -20.403 -9.024  19.824  1.00 0.00 ? 104 MET A C    5  
ATOM 9374  O O    . MET A 1 104 ? -19.976 -10.177 19.811  1.00 0.00 ? 104 MET A O    5  
ATOM 9375  C CB   . MET A 1 104 ? -18.919 -7.090  19.109  1.00 0.00 ? 104 MET A CB   5  
ATOM 9376  C CG   . MET A 1 104 ? -18.691 -5.609  19.438  1.00 0.00 ? 104 MET A CG   5  
ATOM 9377  S SD   . MET A 1 104 ? -17.783 -4.692  18.163  1.00 0.00 ? 104 MET A SD   5  
ATOM 9378  C CE   . MET A 1 104 ? -16.097 -5.093  18.684  1.00 0.00 ? 104 MET A CE   5  
ATOM 9379  H H    . MET A 1 104 ? -18.017 -9.264  20.947  1.00 0.00 ? 104 MET A H    5  
ATOM 9380  H HA   . MET A 1 104 ? -20.155 -7.198  20.878  1.00 0.00 ? 104 MET A HA   5  
ATOM 9381  H HB2  . MET A 1 104 ? -17.975 -7.543  18.805  1.00 0.00 ? 104 MET A HB2  5  
ATOM 9382  H HB3  . MET A 1 104 ? -19.599 -7.148  18.259  1.00 0.00 ? 104 MET A HB3  5  
ATOM 9383  H HG2  . MET A 1 104 ? -19.666 -5.133  19.565  1.00 0.00 ? 104 MET A HG2  5  
ATOM 9384  H HG3  . MET A 1 104 ? -18.153 -5.514  20.382  1.00 0.00 ? 104 MET A HG3  5  
ATOM 9385  H HE1  . MET A 1 104 ? -15.897 -4.626  19.650  1.00 0.00 ? 104 MET A HE1  5  
ATOM 9386  H HE2  . MET A 1 104 ? -15.980 -6.172  18.779  1.00 0.00 ? 104 MET A HE2  5  
ATOM 9387  H HE3  . MET A 1 104 ? -15.381 -4.716  17.953  1.00 0.00 ? 104 MET A HE3  5  
ATOM 9388  N N    . LYS A 1 105 ? -21.638 -8.720  19.410  1.00 0.00 ? 105 LYS A N    5  
ATOM 9389  C CA   . LYS A 1 105 ? -22.647 -9.728  19.011  1.00 0.00 ? 105 LYS A CA   5  
ATOM 9390  C C    . LYS A 1 105 ? -23.766 -9.170  18.104  1.00 0.00 ? 105 LYS A C    5  
ATOM 9391  O O    . LYS A 1 105 ? -24.289 -9.893  17.256  1.00 0.00 ? 105 LYS A O    5  
ATOM 9392  C CB   . LYS A 1 105 ? -23.256 -10.351 20.292  1.00 0.00 ? 105 LYS A CB   5  
ATOM 9393  C CG   . LYS A 1 105 ? -22.925 -11.844 20.464  1.00 0.00 ? 105 LYS A CG   5  
ATOM 9394  C CD   . LYS A 1 105 ? -23.739 -12.766 19.537  1.00 0.00 ? 105 LYS A CD   5  
ATOM 9395  C CE   . LYS A 1 105 ? -23.355 -14.258 19.644  1.00 0.00 ? 105 LYS A CE   5  
ATOM 9396  N NZ   . LYS A 1 105 ? -23.449 -14.798 21.031  1.00 0.00 ? 105 LYS A NZ   5  
ATOM 9397  H H    . LYS A 1 105 ? -21.907 -7.745  19.426  1.00 0.00 ? 105 LYS A H    5  
ATOM 9398  H HA   . LYS A 1 105 ? -22.139 -10.509 18.438  1.00 0.00 ? 105 LYS A HA   5  
ATOM 9399  H HB2  . LYS A 1 105 ? -22.879 -9.824  21.170  1.00 0.00 ? 105 LYS A HB2  5  
ATOM 9400  H HB3  . LYS A 1 105 ? -24.341 -10.225 20.299  1.00 0.00 ? 105 LYS A HB3  5  
ATOM 9401  H HG2  . LYS A 1 105 ? -21.864 -11.994 20.279  1.00 0.00 ? 105 LYS A HG2  5  
ATOM 9402  H HG3  . LYS A 1 105 ? -23.139 -12.111 21.500  1.00 0.00 ? 105 LYS A HG3  5  
ATOM 9403  H HD2  . LYS A 1 105 ? -24.803 -12.654 19.762  1.00 0.00 ? 105 LYS A HD2  5  
ATOM 9404  H HD3  . LYS A 1 105 ? -23.579 -12.459 18.502  1.00 0.00 ? 105 LYS A HD3  5  
ATOM 9405  H HE2  . LYS A 1 105 ? -24.028 -14.825 18.990  1.00 0.00 ? 105 LYS A HE2  5  
ATOM 9406  H HE3  . LYS A 1 105 ? -22.342 -14.400 19.257  1.00 0.00 ? 105 LYS A HE3  5  
ATOM 9407  H HZ1  . LYS A 1 105 ? -23.312 -15.803 21.037  1.00 0.00 ? 105 LYS A HZ1  5  
ATOM 9408  H HZ2  . LYS A 1 105 ? -22.740 -14.394 21.637  1.00 0.00 ? 105 LYS A HZ2  5  
ATOM 9409  H HZ3  . LYS A 1 105 ? -24.361 -14.620 21.434  1.00 0.00 ? 105 LYS A HZ3  5  
ATOM 9410  N N    . TYR A 1 106 ? -24.148 -7.900  18.287  1.00 0.00 ? 106 TYR A N    5  
ATOM 9411  C CA   . TYR A 1 106 ? -25.243 -7.246  17.553  1.00 0.00 ? 106 TYR A CA   5  
ATOM 9412  C C    . TYR A 1 106 ? -24.927 -6.981  16.063  1.00 0.00 ? 106 TYR A C    5  
ATOM 9413  O O    . TYR A 1 106 ? -23.771 -6.771  15.689  1.00 0.00 ? 106 TYR A O    5  
ATOM 9414  C CB   . TYR A 1 106 ? -25.603 -5.944  18.291  1.00 0.00 ? 106 TYR A CB   5  
ATOM 9415  C CG   . TYR A 1 106 ? -26.771 -5.181  17.696  1.00 0.00 ? 106 TYR A CG   5  
ATOM 9416  C CD1  . TYR A 1 106 ? -28.079 -5.685  17.833  1.00 0.00 ? 106 TYR A CD1  5  
ATOM 9417  C CD2  . TYR A 1 106 ? -26.550 -3.984  16.985  1.00 0.00 ? 106 TYR A CD2  5  
ATOM 9418  C CE1  . TYR A 1 106 ? -29.167 -5.001  17.256  1.00 0.00 ? 106 TYR A CE1  5  
ATOM 9419  C CE2  . TYR A 1 106 ? -27.633 -3.296  16.405  1.00 0.00 ? 106 TYR A CE2  5  
ATOM 9420  C CZ   . TYR A 1 106 ? -28.946 -3.801  16.538  1.00 0.00 ? 106 TYR A CZ   5  
ATOM 9421  O OH   . TYR A 1 106 ? -29.990 -3.131  15.978  1.00 0.00 ? 106 TYR A OH   5  
ATOM 9422  H H    . TYR A 1 106 ? -23.705 -7.372  19.022  1.00 0.00 ? 106 TYR A H    5  
ATOM 9423  H HA   . TYR A 1 106 ? -26.116 -7.901  17.592  1.00 0.00 ? 106 TYR A HA   5  
ATOM 9424  H HB2  . TYR A 1 106 ? -25.851 -6.187  19.326  1.00 0.00 ? 106 TYR A HB2  5  
ATOM 9425  H HB3  . TYR A 1 106 ? -24.725 -5.296  18.302  1.00 0.00 ? 106 TYR A HB3  5  
ATOM 9426  H HD1  . TYR A 1 106 ? -28.252 -6.600  18.380  1.00 0.00 ? 106 TYR A HD1  5  
ATOM 9427  H HD2  . TYR A 1 106 ? -25.545 -3.595  16.875  1.00 0.00 ? 106 TYR A HD2  5  
ATOM 9428  H HE1  . TYR A 1 106 ? -30.170 -5.392  17.360  1.00 0.00 ? 106 TYR A HE1  5  
ATOM 9429  H HE2  . TYR A 1 106 ? -27.465 -2.380  15.853  1.00 0.00 ? 106 TYR A HE2  5  
ATOM 9430  H HH   . TYR A 1 106 ? -30.837 -3.564  16.140  1.00 0.00 ? 106 TYR A HH   5  
ATOM 9431  N N    . SER A 1 107 ? -25.972 -6.949  15.226  1.00 0.00 ? 107 SER A N    5  
ATOM 9432  C CA   . SER A 1 107 ? -25.953 -6.567  13.798  1.00 0.00 ? 107 SER A CA   5  
ATOM 9433  C C    . SER A 1 107 ? -25.387 -7.665  12.865  1.00 0.00 ? 107 SER A C    5  
ATOM 9434  O O    . SER A 1 107 ? -25.022 -8.764  13.296  1.00 0.00 ? 107 SER A O    5  
ATOM 9435  C CB   . SER A 1 107 ? -25.245 -5.210  13.591  1.00 0.00 ? 107 SER A CB   5  
ATOM 9436  O OG   . SER A 1 107 ? -25.669 -4.604  12.379  1.00 0.00 ? 107 SER A OG   5  
ATOM 9437  H H    . SER A 1 107 ? -26.881 -7.159  15.615  1.00 0.00 ? 107 SER A H    5  
ATOM 9438  H HA   . SER A 1 107 ? -26.991 -6.420  13.487  1.00 0.00 ? 107 SER A HA   5  
ATOM 9439  H HB2  . SER A 1 107 ? -25.503 -4.548  14.417  1.00 0.00 ? 107 SER A HB2  5  
ATOM 9440  H HB3  . SER A 1 107 ? -24.161 -5.347  13.574  1.00 0.00 ? 107 SER A HB3  5  
ATOM 9441  H HG   . SER A 1 107 ? -25.509 -3.648  12.435  1.00 0.00 ? 107 SER A HG   5  
ATOM 9442  N N    . ILE A 1 108 ? -25.325 -7.372  11.562  1.00 0.00 ? 108 ILE A N    5  
ATOM 9443  C CA   . ILE A 1 108 ? -24.681 -8.223  10.539  1.00 0.00 ? 108 ILE A CA   5  
ATOM 9444  C C    . ILE A 1 108 ? -23.149 -8.087  10.609  1.00 0.00 ? 108 ILE A C    5  
ATOM 9445  O O    . ILE A 1 108 ? -22.649 -7.015  10.944  1.00 0.00 ? 108 ILE A O    5  
ATOM 9446  C CB   . ILE A 1 108 ? -25.242 -7.917  9.124   1.00 0.00 ? 108 ILE A CB   5  
ATOM 9447  C CG1  . ILE A 1 108 ? -25.029 -6.444  8.697   1.00 0.00 ? 108 ILE A CG1  5  
ATOM 9448  C CG2  . ILE A 1 108 ? -26.727 -8.325  9.065   1.00 0.00 ? 108 ILE A CG2  5  
ATOM 9449  C CD1  . ILE A 1 108 ? -25.481 -6.134  7.266   1.00 0.00 ? 108 ILE A CD1  5  
ATOM 9450  H H    . ILE A 1 108 ? -25.591 -6.428  11.298  1.00 0.00 ? 108 ILE A H    5  
ATOM 9451  H HA   . ILE A 1 108 ? -24.918 -9.266  10.773  1.00 0.00 ? 108 ILE A HA   5  
ATOM 9452  H HB   . ILE A 1 108 ? -24.706 -8.546  8.410   1.00 0.00 ? 108 ILE A HB   5  
ATOM 9453  H HG12 . ILE A 1 108 ? -25.562 -5.777  9.376   1.00 0.00 ? 108 ILE A HG12 5  
ATOM 9454  H HG13 . ILE A 1 108 ? -23.965 -6.212  8.755   1.00 0.00 ? 108 ILE A HG13 5  
ATOM 9455  H HG21 . ILE A 1 108 ? -26.849 -9.347  9.428   1.00 0.00 ? 108 ILE A HG21 5  
ATOM 9456  H HG22 . ILE A 1 108 ? -27.330 -7.654  9.678   1.00 0.00 ? 108 ILE A HG22 5  
ATOM 9457  H HG23 . ILE A 1 108 ? -27.091 -8.291  8.036   1.00 0.00 ? 108 ILE A HG23 5  
ATOM 9458  H HD11 . ILE A 1 108 ? -25.021 -6.833  6.568   1.00 0.00 ? 108 ILE A HD11 5  
ATOM 9459  H HD12 . ILE A 1 108 ? -26.565 -6.203  7.187   1.00 0.00 ? 108 ILE A HD12 5  
ATOM 9460  H HD13 . ILE A 1 108 ? -25.176 -5.122  7.001   1.00 0.00 ? 108 ILE A HD13 5  
ATOM 9461  N N    . VAL A 1 109 ? -22.391 -9.137  10.267  1.00 0.00 ? 109 VAL A N    5  
ATOM 9462  C CA   . VAL A 1 109 ? -20.925 -9.187  10.504  1.00 0.00 ? 109 VAL A CA   5  
ATOM 9463  C C    . VAL A 1 109 ? -20.170 -8.071  9.764   1.00 0.00 ? 109 VAL A C    5  
ATOM 9464  O O    . VAL A 1 109 ? -19.229 -7.504  10.316  1.00 0.00 ? 109 VAL A O    5  
ATOM 9465  C CB   . VAL A 1 109 ? -20.319 -10.577 10.176  1.00 0.00 ? 109 VAL A CB   5  
ATOM 9466  C CG1  . VAL A 1 109 ? -18.808 -10.647 10.476  1.00 0.00 ? 109 VAL A CG1  5  
ATOM 9467  C CG2  . VAL A 1 109 ? -21.008 -11.685 10.994  1.00 0.00 ? 109 VAL A CG2  5  
ATOM 9468  H H    . VAL A 1 109 ? -22.865 -9.982  9.965   1.00 0.00 ? 109 VAL A H    5  
ATOM 9469  H HA   . VAL A 1 109 ? -20.779 -9.027  11.571  1.00 0.00 ? 109 VAL A HA   5  
ATOM 9470  H HB   . VAL A 1 109 ? -20.471 -10.786 9.119   1.00 0.00 ? 109 VAL A HB   5  
ATOM 9471  H HG11 . VAL A 1 109 ? -18.619 -10.380 11.517  1.00 0.00 ? 109 VAL A HG11 5  
ATOM 9472  H HG12 . VAL A 1 109 ? -18.436 -11.656 10.299  1.00 0.00 ? 109 VAL A HG12 5  
ATOM 9473  H HG13 . VAL A 1 109 ? -18.259 -9.967  9.827   1.00 0.00 ? 109 VAL A HG13 5  
ATOM 9474  H HG21 . VAL A 1 109 ? -22.058 -11.773 10.719  1.00 0.00 ? 109 VAL A HG21 5  
ATOM 9475  H HG22 . VAL A 1 109 ? -20.532 -12.646 10.794  1.00 0.00 ? 109 VAL A HG22 5  
ATOM 9476  H HG23 . VAL A 1 109 ? -20.932 -11.466 12.062  1.00 0.00 ? 109 VAL A HG23 5  
ATOM 9477  N N    . SER A 1 110 ? -20.614 -7.696  8.561   1.00 0.00 ? 110 SER A N    5  
ATOM 9478  C CA   . SER A 1 110 ? -20.037 -6.586  7.784   1.00 0.00 ? 110 SER A CA   5  
ATOM 9479  C C    . SER A 1 110 ? -20.217 -5.227  8.478   1.00 0.00 ? 110 SER A C    5  
ATOM 9480  O O    . SER A 1 110 ? -19.245 -4.486  8.645   1.00 0.00 ? 110 SER A O    5  
ATOM 9481  C CB   . SER A 1 110 ? -20.655 -6.574  6.378   1.00 0.00 ? 110 SER A CB   5  
ATOM 9482  O OG   . SER A 1 110 ? -22.075 -6.598  6.430   1.00 0.00 ? 110 SER A OG   5  
ATOM 9483  H H    . SER A 1 110 ? -21.424 -8.163  8.167   1.00 0.00 ? 110 SER A H    5  
ATOM 9484  H HA   . SER A 1 110 ? -18.962 -6.740  7.677   1.00 0.00 ? 110 SER A HA   5  
ATOM 9485  H HB2  . SER A 1 110 ? -20.320 -5.685  5.841   1.00 0.00 ? 110 SER A HB2  5  
ATOM 9486  H HB3  . SER A 1 110 ? -20.308 -7.455  5.832   1.00 0.00 ? 110 SER A HB3  5  
ATOM 9487  H HG   . SER A 1 110 ? -22.413 -6.597  5.521   1.00 0.00 ? 110 SER A HG   5  
ATOM 9488  N N    . ARG A 1 111 ? -21.424 -4.912  8.970   1.00 0.00 ? 111 ARG A N    5  
ATOM 9489  C CA   . ARG A 1 111 ? -21.626 -3.700  9.772   1.00 0.00 ? 111 ARG A CA   5  
ATOM 9490  C C    . ARG A 1 111 ? -20.915 -3.803  11.119  1.00 0.00 ? 111 ARG A C    5  
ATOM 9491  O O    . ARG A 1 111 ? -20.339 -2.822  11.563  1.00 0.00 ? 111 ARG A O    5  
ATOM 9492  C CB   . ARG A 1 111 ? -23.113 -3.355  9.959   1.00 0.00 ? 111 ARG A CB   5  
ATOM 9493  C CG   . ARG A 1 111 ? -23.314 -1.948  10.576  1.00 0.00 ? 111 ARG A CG   5  
ATOM 9494  C CD   . ARG A 1 111 ? -22.892 -0.788  9.662   1.00 0.00 ? 111 ARG A CD   5  
ATOM 9495  N NE   . ARG A 1 111 ? -23.704 -0.708  8.432   1.00 0.00 ? 111 ARG A NE   5  
ATOM 9496  C CZ   . ARG A 1 111 ? -23.403 -0.002  7.346   1.00 0.00 ? 111 ARG A CZ   5  
ATOM 9497  N NH1  . ARG A 1 111 ? -22.303 0.719   7.265   1.00 0.00 ? 111 ARG A NH1  5  
ATOM 9498  N NH2  . ARG A 1 111 ? -24.220 -0.010  6.314   1.00 0.00 ? 111 ARG A NH2  5  
ATOM 9499  H H    . ARG A 1 111 ? -22.190 -5.560  8.831   1.00 0.00 ? 111 ARG A H    5  
ATOM 9500  H HA   . ARG A 1 111 ? -21.156 -2.887  9.225   1.00 0.00 ? 111 ARG A HA   5  
ATOM 9501  H HB2  . ARG A 1 111 ? -23.620 -3.404  8.995   1.00 0.00 ? 111 ARG A HB2  5  
ATOM 9502  H HB3  . ARG A 1 111 ? -23.567 -4.100  10.613  1.00 0.00 ? 111 ARG A HB3  5  
ATOM 9503  H HG2  . ARG A 1 111 ? -24.368 -1.824  10.832  1.00 0.00 ? 111 ARG A HG2  5  
ATOM 9504  H HG3  . ARG A 1 111 ? -22.734 -1.854  11.502  1.00 0.00 ? 111 ARG A HG3  5  
ATOM 9505  H HD2  . ARG A 1 111 ? -23.002 0.146   10.216  1.00 0.00 ? 111 ARG A HD2  5  
ATOM 9506  H HD3  . ARG A 1 111 ? -21.841 -0.907  9.408   1.00 0.00 ? 111 ARG A HD3  5  
ATOM 9507  H HE   . ARG A 1 111 ? -24.581 -1.212  8.430   1.00 0.00 ? 111 ARG A HE   5  
ATOM 9508  H HH11 . ARG A 1 111 ? -21.651 0.761   8.052   1.00 0.00 ? 111 ARG A HH11 5  
ATOM 9509  H HH12 . ARG A 1 111 ? -22.104 1.257   6.438   1.00 0.00 ? 111 ARG A HH12 5  
ATOM 9510  H HH21 . ARG A 1 111 ? -25.079 -0.543  6.341   1.00 0.00 ? 111 ARG A HH21 5  
ATOM 9511  H HH22 . ARG A 1 111 ? -24.001 0.514   5.481   1.00 0.00 ? 111 ARG A HH22 5  
ATOM 9512  N N    . ASN A 1 112 ? -20.884 -4.972  11.750  1.00 0.00 ? 112 ASN A N    5  
ATOM 9513  C CA   . ASN A 1 112 ? -20.213 -5.174  13.036  1.00 0.00 ? 112 ASN A CA   5  
ATOM 9514  C C    . ASN A 1 112 ? -18.709 -4.847  12.955  1.00 0.00 ? 112 ASN A C    5  
ATOM 9515  O O    . ASN A 1 112 ? -18.204 -4.097  13.786  1.00 0.00 ? 112 ASN A O    5  
ATOM 9516  C CB   . ASN A 1 112 ? -20.479 -6.605  13.525  1.00 0.00 ? 112 ASN A CB   5  
ATOM 9517  C CG   . ASN A 1 112 ? -19.905 -6.842  14.916  1.00 0.00 ? 112 ASN A CG   5  
ATOM 9518  O OD1  . ASN A 1 112 ? -20.270 -6.182  15.876  1.00 0.00 ? 112 ASN A OD1  5  
ATOM 9519  N ND2  . ASN A 1 112 ? -18.971 -7.769  15.056  1.00 0.00 ? 112 ASN A ND2  5  
ATOM 9520  H H    . ASN A 1 112 ? -21.407 -5.742  11.345  1.00 0.00 ? 112 ASN A H    5  
ATOM 9521  H HA   . ASN A 1 112 ? -20.654 -4.488  13.761  1.00 0.00 ? 112 ASN A HA   5  
ATOM 9522  H HB2  . ASN A 1 112 ? -21.554 -6.785  13.561  1.00 0.00 ? 112 ASN A HB2  5  
ATOM 9523  H HB3  . ASN A 1 112 ? -20.041 -7.314  12.826  1.00 0.00 ? 112 ASN A HB3  5  
ATOM 9524  H HD21 . ASN A 1 112 ? -18.679 -8.331  14.270  1.00 0.00 ? 112 ASN A HD21 5  
ATOM 9525  H HD22 . ASN A 1 112 ? -18.579 -7.914  15.973  1.00 0.00 ? 112 ASN A HD22 5  
ATOM 9526  N N    . CYS A 1 113 ? -17.999 -5.332  11.926  1.00 0.00 ? 113 CYS A N    5  
ATOM 9527  C CA   . CYS A 1 113 ? -16.575 -5.030  11.731  1.00 0.00 ? 113 CYS A CA   5  
ATOM 9528  C C    . CYS A 1 113 ? -16.330 -3.579  11.242  1.00 0.00 ? 113 CYS A C    5  
ATOM 9529  O O    . CYS A 1 113 ? -15.410 -2.926  11.739  1.00 0.00 ? 113 CYS A O    5  
ATOM 9530  C CB   . CYS A 1 113 ? -15.942 -6.136  10.865  1.00 0.00 ? 113 CYS A CB   5  
ATOM 9531  S SG   . CYS A 1 113 ? -16.410 -5.997  9.115   1.00 0.00 ? 113 CYS A SG   5  
ATOM 9532  H H    . CYS A 1 113 ? -18.457 -5.944  11.254  1.00 0.00 ? 113 CYS A H    5  
ATOM 9533  H HA   . CYS A 1 113 ? -16.089 -5.100  12.709  1.00 0.00 ? 113 CYS A HA   5  
ATOM 9534  H HB2  . CYS A 1 113 ? -14.854 -6.088  10.957  1.00 0.00 ? 113 CYS A HB2  5  
ATOM 9535  H HB3  . CYS A 1 113 ? -16.252 -7.117  11.240  1.00 0.00 ? 113 CYS A HB3  5  
ATOM 9536  H HG   . CYS A 1 113 ? -15.785 -7.101  8.679   1.00 0.00 ? 113 CYS A HG   5  
ATOM 9537  N N    . GLU A 1 114 ? -17.191 -3.031  10.373  1.00 0.00 ? 114 GLU A N    5  
ATOM 9538  C CA   . GLU A 1 114 ? -17.160 -1.607  9.997   1.00 0.00 ? 114 GLU A CA   5  
ATOM 9539  C C    . GLU A 1 114 ? -17.369 -0.700  11.221  1.00 0.00 ? 114 GLU A C    5  
ATOM 9540  O O    . GLU A 1 114 ? -16.513 0.122   11.528  1.00 0.00 ? 114 GLU A O    5  
ATOM 9541  C CB   . GLU A 1 114 ? -18.183 -1.315  8.884   1.00 0.00 ? 114 GLU A CB   5  
ATOM 9542  C CG   . GLU A 1 114 ? -18.135 0.131   8.358   1.00 0.00 ? 114 GLU A CG   5  
ATOM 9543  C CD   . GLU A 1 114 ? -18.990 1.116   9.175   1.00 0.00 ? 114 GLU A CD   5  
ATOM 9544  O OE1  . GLU A 1 114 ? -20.237 0.995   9.131   1.00 0.00 ? 114 GLU A OE1  5  
ATOM 9545  O OE2  . GLU A 1 114 ? -18.428 2.032   9.822   1.00 0.00 ? 114 GLU A OE2  5  
ATOM 9546  H H    . GLU A 1 114 ? -17.885 -3.631  9.936   1.00 0.00 ? 114 GLU A H    5  
ATOM 9547  H HA   . GLU A 1 114 ? -16.173 -1.389  9.591   1.00 0.00 ? 114 GLU A HA   5  
ATOM 9548  H HB2  . GLU A 1 114 ? -17.960 -1.978  8.047   1.00 0.00 ? 114 GLU A HB2  5  
ATOM 9549  H HB3  . GLU A 1 114 ? -19.191 -1.544  9.234   1.00 0.00 ? 114 GLU A HB3  5  
ATOM 9550  H HG2  . GLU A 1 114 ? -17.100 0.468   8.312   1.00 0.00 ? 114 GLU A HG2  5  
ATOM 9551  H HG3  . GLU A 1 114 ? -18.519 0.129   7.336   1.00 0.00 ? 114 GLU A HG3  5  
ATOM 9552  N N    . HIS A 1 115 ? -18.452 -0.896  11.974  1.00 0.00 ? 115 HIS A N    5  
ATOM 9553  C CA   . HIS A 1 115 ? -18.774 -0.134  13.181  1.00 0.00 ? 115 HIS A CA   5  
ATOM 9554  C C    . HIS A 1 115 ? -17.624 -0.203  14.209  1.00 0.00 ? 115 HIS A C    5  
ATOM 9555  O O    . HIS A 1 115 ? -17.280 0.801   14.836  1.00 0.00 ? 115 HIS A O    5  
ATOM 9556  C CB   . HIS A 1 115 ? -20.091 -0.663  13.777  1.00 0.00 ? 115 HIS A CB   5  
ATOM 9557  C CG   . HIS A 1 115 ? -20.588 0.117   14.975  1.00 0.00 ? 115 HIS A CG   5  
ATOM 9558  N ND1  . HIS A 1 115 ? -21.190 -0.411  16.097  1.00 0.00 ? 115 HIS A ND1  5  
ATOM 9559  C CD2  . HIS A 1 115 ? -20.576 1.480   15.133  1.00 0.00 ? 115 HIS A CD2  5  
ATOM 9560  C CE1  . HIS A 1 115 ? -21.525 0.608   16.909  1.00 0.00 ? 115 HIS A CE1  5  
ATOM 9561  N NE2  . HIS A 1 115 ? -21.166 1.786   16.366  1.00 0.00 ? 115 HIS A NE2  5  
ATOM 9562  H H    . HIS A 1 115 ? -19.120 -1.600  11.681  1.00 0.00 ? 115 HIS A H    5  
ATOM 9563  H HA   . HIS A 1 115 ? -18.940 0.898   12.886  1.00 0.00 ? 115 HIS A HA   5  
ATOM 9564  H HB2  . HIS A 1 115 ? -20.869 -0.617  13.010  1.00 0.00 ? 115 HIS A HB2  5  
ATOM 9565  H HB3  . HIS A 1 115 ? -19.962 -1.707  14.067  1.00 0.00 ? 115 HIS A HB3  5  
ATOM 9566  H HD1  . HIS A 1 115 ? -21.376 -1.390  16.278  1.00 0.00 ? 115 HIS A HD1  5  
ATOM 9567  H HD2  . HIS A 1 115 ? -20.186 2.198   14.421  1.00 0.00 ? 115 HIS A HD2  5  
ATOM 9568  H HE1  . HIS A 1 115 ? -22.018 0.494   17.869  1.00 0.00 ? 115 HIS A HE1  5  
ATOM 9569  N N    . PHE A 1 116 ? -16.991 -1.377  14.354  1.00 0.00 ? 116 PHE A N    5  
ATOM 9570  C CA   . PHE A 1 116 ? -15.759 -1.556  15.117  1.00 0.00 ? 116 PHE A CA   5  
ATOM 9571  C C    . PHE A 1 116 ? -14.646 -0.629  14.605  1.00 0.00 ? 116 PHE A C    5  
ATOM 9572  O O    . PHE A 1 116 ? -14.172 0.200   15.382  1.00 0.00 ? 116 PHE A O    5  
ATOM 9573  C CB   . PHE A 1 116 ? -15.354 -3.041  15.103  1.00 0.00 ? 116 PHE A CB   5  
ATOM 9574  C CG   . PHE A 1 116 ? -13.872 -3.295  15.316  1.00 0.00 ? 116 PHE A CG   5  
ATOM 9575  C CD1  . PHE A 1 116 ? -13.296 -3.085  16.582  1.00 0.00 ? 116 PHE A CD1  5  
ATOM 9576  C CD2  . PHE A 1 116 ? -13.056 -3.676  14.232  1.00 0.00 ? 116 PHE A CD2  5  
ATOM 9577  C CE1  . PHE A 1 116 ? -11.917 -3.273  16.769  1.00 0.00 ? 116 PHE A CE1  5  
ATOM 9578  C CE2  . PHE A 1 116 ? -11.673 -3.858  14.418  1.00 0.00 ? 116 PHE A CE2  5  
ATOM 9579  C CZ   . PHE A 1 116 ? -11.108 -3.672  15.692  1.00 0.00 ? 116 PHE A CZ   5  
ATOM 9580  H H    . PHE A 1 116 ? -17.356 -2.181  13.855  1.00 0.00 ? 116 PHE A H    5  
ATOM 9581  H HA   . PHE A 1 116 ? -15.950 -1.277  16.156  1.00 0.00 ? 116 PHE A HA   5  
ATOM 9582  H HB2  . PHE A 1 116 ? -15.925 -3.570  15.869  1.00 0.00 ? 116 PHE A HB2  5  
ATOM 9583  H HB3  . PHE A 1 116 ? -15.646 -3.485  14.157  1.00 0.00 ? 116 PHE A HB3  5  
ATOM 9584  H HD1  . PHE A 1 116 ? -13.911 -2.762  17.411  1.00 0.00 ? 116 PHE A HD1  5  
ATOM 9585  H HD2  . PHE A 1 116 ? -13.484 -3.819  13.250  1.00 0.00 ? 116 PHE A HD2  5  
ATOM 9586  H HE1  . PHE A 1 116 ? -11.480 -3.095  17.740  1.00 0.00 ? 116 PHE A HE1  5  
ATOM 9587  H HE2  . PHE A 1 116 ? -11.048 -4.146  13.583  1.00 0.00 ? 116 PHE A HE2  5  
ATOM 9588  H HZ   . PHE A 1 116 ? -10.048 -3.814  15.839  1.00 0.00 ? 116 PHE A HZ   5  
ATOM 9589  N N    . VAL A 1 117 ? -14.242 -0.702  13.328  1.00 0.00 ? 117 VAL A N    5  
ATOM 9590  C CA   . VAL A 1 117 ? -13.141 0.164   12.854  1.00 0.00 ? 117 VAL A CA   5  
ATOM 9591  C C    . VAL A 1 117 ? -13.487 1.649   12.885  1.00 0.00 ? 117 VAL A C    5  
ATOM 9592  O O    . VAL A 1 117 ? -12.597 2.439   13.192  1.00 0.00 ? 117 VAL A O    5  
ATOM 9593  C CB   . VAL A 1 117 ? -12.538 -0.187  11.481  1.00 0.00 ? 117 VAL A CB   5  
ATOM 9594  C CG1  . VAL A 1 117 ? -11.715 -1.470  11.582  1.00 0.00 ? 117 VAL A CG1  5  
ATOM 9595  C CG2  . VAL A 1 117 ? -13.537 -0.263  10.322  1.00 0.00 ? 117 VAL A CG2  5  
ATOM 9596  H H    . VAL A 1 117 ? -14.693 -1.371  12.699  1.00 0.00 ? 117 VAL A H    5  
ATOM 9597  H HA   . VAL A 1 117 ? -12.331 0.032   13.572  1.00 0.00 ? 117 VAL A HA   5  
ATOM 9598  H HB   . VAL A 1 117 ? -11.845 0.614   11.230  1.00 0.00 ? 117 VAL A HB   5  
ATOM 9599  H HG11 . VAL A 1 117 ? -12.365 -2.325  11.769  1.00 0.00 ? 117 VAL A HG11 5  
ATOM 9600  H HG12 . VAL A 1 117 ? -11.184 -1.612  10.644  1.00 0.00 ? 117 VAL A HG12 5  
ATOM 9601  H HG13 . VAL A 1 117 ? -10.979 -1.387  12.387  1.00 0.00 ? 117 VAL A HG13 5  
ATOM 9602  H HG21 . VAL A 1 117 ? -14.174 -1.132  10.440  1.00 0.00 ? 117 VAL A HG21 5  
ATOM 9603  H HG22 . VAL A 1 117 ? -14.141 0.641   10.286  1.00 0.00 ? 117 VAL A HG22 5  
ATOM 9604  H HG23 . VAL A 1 117 ? -12.991 -0.349  9.383   1.00 0.00 ? 117 VAL A HG23 5  
ATOM 9605  N N    . THR A 1 118 ? -14.744 2.052   12.653  1.00 0.00 ? 118 THR A N    5  
ATOM 9606  C CA   . THR A 1 118 ? -15.156 3.456   12.790  1.00 0.00 ? 118 THR A CA   5  
ATOM 9607  C C    . THR A 1 118 ? -15.127 3.908   14.244  1.00 0.00 ? 118 THR A C    5  
ATOM 9608  O O    . THR A 1 118 ? -14.743 5.043   14.475  1.00 0.00 ? 118 THR A O    5  
ATOM 9609  C CB   . THR A 1 118 ? -16.465 3.751   12.058  1.00 0.00 ? 118 THR A CB   5  
ATOM 9610  O OG1  . THR A 1 118 ? -16.299 3.282   10.733  1.00 0.00 ? 118 THR A OG1  5  
ATOM 9611  C CG2  . THR A 1 118 ? -16.768 5.248   11.967  1.00 0.00 ? 118 THR A CG2  5  
ATOM 9612  H H    . THR A 1 118 ? -15.434 1.373   12.341  1.00 0.00 ? 118 THR A H    5  
ATOM 9613  H HA   . THR A 1 118 ? -14.417 4.067   12.296  1.00 0.00 ? 118 THR A HA   5  
ATOM 9614  H HB   . THR A 1 118 ? -17.286 3.262   12.572  1.00 0.00 ? 118 THR A HB   5  
ATOM 9615  H HG1  . THR A 1 118 ? -17.138 2.833   10.460  1.00 0.00 ? 118 THR A HG1  5  
ATOM 9616  H HG21 . THR A 1 118 ? -15.929 5.784   11.520  1.00 0.00 ? 118 THR A HG21 5  
ATOM 9617  H HG22 . THR A 1 118 ? -17.656 5.402   11.353  1.00 0.00 ? 118 THR A HG22 5  
ATOM 9618  H HG23 . THR A 1 118 ? -16.963 5.650   12.960  1.00 0.00 ? 118 THR A HG23 5  
ATOM 9619  N N    . GLN A 1 119 ? -15.392 3.045   15.228  1.00 0.00 ? 119 GLN A N    5  
ATOM 9620  C CA   . GLN A 1 119 ? -15.155 3.369   16.644  1.00 0.00 ? 119 GLN A CA   5  
ATOM 9621  C C    . GLN A 1 119 ? -13.653 3.533   16.965  1.00 0.00 ? 119 GLN A C    5  
ATOM 9622  O O    . GLN A 1 119 ? -13.307 4.283   17.880  1.00 0.00 ? 119 GLN A O    5  
ATOM 9623  C CB   . GLN A 1 119 ? -15.801 2.314   17.553  1.00 0.00 ? 119 GLN A CB   5  
ATOM 9624  C CG   . GLN A 1 119 ? -17.320 2.520   17.674  1.00 0.00 ? 119 GLN A CG   5  
ATOM 9625  C CD   . GLN A 1 119 ? -17.981 1.294   18.298  1.00 0.00 ? 119 GLN A CD   5  
ATOM 9626  O OE1  . GLN A 1 119 ? -18.352 1.265   19.466  1.00 0.00 ? 119 GLN A OE1  5  
ATOM 9627  N NE2  . GLN A 1 119 ? -18.109 0.227   17.538  1.00 0.00 ? 119 GLN A NE2  5  
ATOM 9628  H H    . GLN A 1 119 ? -15.734 2.121   14.989  1.00 0.00 ? 119 GLN A H    5  
ATOM 9629  H HA   . GLN A 1 119 ? -15.621 4.327   16.875  1.00 0.00 ? 119 GLN A HA   5  
ATOM 9630  H HB2  . GLN A 1 119 ? -15.586 1.318   17.169  1.00 0.00 ? 119 GLN A HB2  5  
ATOM 9631  H HB3  . GLN A 1 119 ? -15.376 2.383   18.555  1.00 0.00 ? 119 GLN A HB3  5  
ATOM 9632  H HG2  . GLN A 1 119 ? -17.526 3.398   18.286  1.00 0.00 ? 119 GLN A HG2  5  
ATOM 9633  H HG3  . GLN A 1 119 ? -17.751 2.682   16.687  1.00 0.00 ? 119 GLN A HG3  5  
ATOM 9634  H HE21 . GLN A 1 119 ? -17.842 0.310   16.563  1.00 0.00 ? 119 GLN A HE21 5  
ATOM 9635  H HE22 . GLN A 1 119 ? -18.559 -0.590  17.915  1.00 0.00 ? 119 GLN A HE22 5  
ATOM 9636  N N    . LEU A 1 120 ? -12.746 2.904   16.196  1.00 0.00 ? 120 LEU A N    5  
ATOM 9637  C CA   . LEU A 1 120 ? -11.306 3.182   16.297  1.00 0.00 ? 120 LEU A CA   5  
ATOM 9638  C C    . LEU A 1 120 ? -10.967 4.556   15.695  1.00 0.00 ? 120 LEU A C    5  
ATOM 9639  O O    . LEU A 1 120 ? -10.436 5.408   16.404  1.00 0.00 ? 120 LEU A O    5  
ATOM 9640  C CB   . LEU A 1 120 ? -10.456 2.048   15.685  1.00 0.00 ? 120 LEU A CB   5  
ATOM 9641  C CG   . LEU A 1 120 ? -10.752 0.626   16.211  1.00 0.00 ? 120 LEU A CG   5  
ATOM 9642  C CD1  . LEU A 1 120 ? -9.651  -0.324  15.729  1.00 0.00 ? 120 LEU A CD1  5  
ATOM 9643  C CD2  . LEU A 1 120 ? -10.862 0.574   17.739  1.00 0.00 ? 120 LEU A CD2  5  
ATOM 9644  H H    . LEU A 1 120 ? -13.071 2.232   15.508  1.00 0.00 ? 120 LEU A H    5  
ATOM 9645  H HA   . LEU A 1 120 ? -11.045 3.250   17.354  1.00 0.00 ? 120 LEU A HA   5  
ATOM 9646  H HB2  . LEU A 1 120 ? -10.560 2.042   14.600  1.00 0.00 ? 120 LEU A HB2  5  
ATOM 9647  H HB3  . LEU A 1 120 ? -9.411  2.283   15.900  1.00 0.00 ? 120 LEU A HB3  5  
ATOM 9648  H HG   . LEU A 1 120 ? -11.695 0.281   15.796  1.00 0.00 ? 120 LEU A HG   5  
ATOM 9649  H HD11 . LEU A 1 120 ? -9.624  -0.335  14.640  1.00 0.00 ? 120 LEU A HD11 5  
ATOM 9650  H HD12 . LEU A 1 120 ? -8.687  -0.009  16.119  1.00 0.00 ? 120 LEU A HD12 5  
ATOM 9651  H HD13 . LEU A 1 120 ? -9.846  -1.333  16.087  1.00 0.00 ? 120 LEU A HD13 5  
ATOM 9652  H HD21 . LEU A 1 120 ? -10.857 -0.458  18.087  1.00 0.00 ? 120 LEU A HD21 5  
ATOM 9653  H HD22 . LEU A 1 120 ? -10.033 1.122   18.179  1.00 0.00 ? 120 LEU A HD22 5  
ATOM 9654  H HD23 . LEU A 1 120 ? -11.797 1.033   18.051  1.00 0.00 ? 120 LEU A HD23 5  
ATOM 9655  N N    . ARG A 1 121 ? -11.314 4.795   14.419  1.00 0.00 ? 121 ARG A N    5  
ATOM 9656  C CA   . ARG A 1 121 ? -11.070 6.070   13.708  1.00 0.00 ? 121 ARG A CA   5  
ATOM 9657  C C    . ARG A 1 121 ? -12.022 7.223   14.086  1.00 0.00 ? 121 ARG A C    5  
ATOM 9658  O O    . ARG A 1 121 ? -11.940 8.286   13.478  1.00 0.00 ? 121 ARG A O    5  
ATOM 9659  C CB   . ARG A 1 121 ? -10.992 5.871   12.177  1.00 0.00 ? 121 ARG A CB   5  
ATOM 9660  C CG   . ARG A 1 121 ? -12.322 5.439   11.549  1.00 0.00 ? 121 ARG A CG   5  
ATOM 9661  C CD   . ARG A 1 121 ? -12.360 5.537   10.028  1.00 0.00 ? 121 ARG A CD   5  
ATOM 9662  N NE   . ARG A 1 121 ? -13.420 4.655   9.511   1.00 0.00 ? 121 ARG A NE   5  
ATOM 9663  C CZ   . ARG A 1 121 ? -13.293 3.767   8.536   1.00 0.00 ? 121 ARG A CZ   5  
ATOM 9664  N NH1  . ARG A 1 121 ? -12.295 3.802   7.676   1.00 0.00 ? 121 ARG A NH1  5  
ATOM 9665  N NH2  . ARG A 1 121 ? -14.208 2.828   8.426   1.00 0.00 ? 121 ARG A NH2  5  
ATOM 9666  H H    . ARG A 1 121 ? -11.767 4.042   13.914  1.00 0.00 ? 121 ARG A H    5  
ATOM 9667  H HA   . ARG A 1 121 ? -10.082 6.402   14.011  1.00 0.00 ? 121 ARG A HA   5  
ATOM 9668  H HB2  . ARG A 1 121 ? -10.664 6.802   11.716  1.00 0.00 ? 121 ARG A HB2  5  
ATOM 9669  H HB3  . ARG A 1 121 ? -10.238 5.117   11.956  1.00 0.00 ? 121 ARG A HB3  5  
ATOM 9670  H HG2  . ARG A 1 121 ? -12.459 4.396   11.801  1.00 0.00 ? 121 ARG A HG2  5  
ATOM 9671  H HG3  . ARG A 1 121 ? -13.151 6.022   11.950  1.00 0.00 ? 121 ARG A HG3  5  
ATOM 9672  H HD2  . ARG A 1 121 ? -12.548 6.569   9.729   1.00 0.00 ? 121 ARG A HD2  5  
ATOM 9673  H HD3  . ARG A 1 121 ? -11.388 5.223   9.646   1.00 0.00 ? 121 ARG A HD3  5  
ATOM 9674  H HE   . ARG A 1 121 ? -14.291 4.639   10.026  1.00 0.00 ? 121 ARG A HE   5  
ATOM 9675  H HH11 . ARG A 1 121 ? -11.598 4.551   7.715   1.00 0.00 ? 121 ARG A HH11 5  
ATOM 9676  H HH12 . ARG A 1 121 ? -12.190 3.080   6.979   1.00 0.00 ? 121 ARG A HH12 5  
ATOM 9677  H HH21 . ARG A 1 121 ? -14.976 2.789   9.089   1.00 0.00 ? 121 ARG A HH21 5  
ATOM 9678  H HH22 . ARG A 1 121 ? -14.151 2.135   7.694   1.00 0.00 ? 121 ARG A HH22 5  
ATOM 9679  N N    . TYR A 1 122 ? -12.895 7.040   15.078  1.00 0.00 ? 122 TYR A N    5  
ATOM 9680  C CA   . TYR A 1 122 ? -14.003 7.934   15.454  1.00 0.00 ? 122 TYR A CA   5  
ATOM 9681  C C    . TYR A 1 122 ? -13.545 9.367   15.801  1.00 0.00 ? 122 TYR A C    5  
ATOM 9682  O O    . TYR A 1 122 ? -14.326 10.313  15.721  1.00 0.00 ? 122 TYR A O    5  
ATOM 9683  C CB   . TYR A 1 122 ? -14.691 7.335   16.697  1.00 0.00 ? 122 TYR A CB   5  
ATOM 9684  C CG   . TYR A 1 122 ? -16.158 7.690   16.851  1.00 0.00 ? 122 TYR A CG   5  
ATOM 9685  C CD1  . TYR A 1 122 ? -17.151 6.868   16.273  1.00 0.00 ? 122 TYR A CD1  5  
ATOM 9686  C CD2  . TYR A 1 122 ? -16.541 8.821   17.600  1.00 0.00 ? 122 TYR A CD2  5  
ATOM 9687  C CE1  . TYR A 1 122 ? -18.516 7.181   16.430  1.00 0.00 ? 122 TYR A CE1  5  
ATOM 9688  C CE2  . TYR A 1 122 ? -17.903 9.143   17.758  1.00 0.00 ? 122 TYR A CE2  5  
ATOM 9689  C CZ   . TYR A 1 122 ? -18.896 8.324   17.172  1.00 0.00 ? 122 TYR A CZ   5  
ATOM 9690  O OH   . TYR A 1 122 ? -20.212 8.634   17.331  1.00 0.00 ? 122 TYR A OH   5  
ATOM 9691  H H    . TYR A 1 122 ? -12.929 6.121   15.487  1.00 0.00 ? 122 TYR A H    5  
ATOM 9692  H HA   . TYR A 1 122 ? -14.725 7.923   14.625  1.00 0.00 ? 122 TYR A HA   5  
ATOM 9693  H HB2  . TYR A 1 122 ? -14.625 6.256   16.658  1.00 0.00 ? 122 TYR A HB2  5  
ATOM 9694  H HB3  . TYR A 1 122 ? -14.148 7.637   17.593  1.00 0.00 ? 122 TYR A HB3  5  
ATOM 9695  H HD1  . TYR A 1 122 ? -16.871 5.989   15.708  1.00 0.00 ? 122 TYR A HD1  5  
ATOM 9696  H HD2  . TYR A 1 122 ? -15.787 9.449   18.052  1.00 0.00 ? 122 TYR A HD2  5  
ATOM 9697  H HE1  . TYR A 1 122 ? -19.272 6.549   15.983  1.00 0.00 ? 122 TYR A HE1  5  
ATOM 9698  H HE2  . TYR A 1 122 ? -18.193 10.013  18.328  1.00 0.00 ? 122 TYR A HE2  5  
ATOM 9699  H HH   . TYR A 1 122 ? -20.796 8.004   16.894  1.00 0.00 ? 122 TYR A HH   5  
ATOM 9700  N N    . GLY A 1 123 ? -12.263 9.491   16.190  1.00 0.00 ? 123 GLY A N    5  
ATOM 9701  C CA   . GLY A 1 123 ? -11.585 10.659  16.780  1.00 0.00 ? 123 GLY A CA   5  
ATOM 9702  C C    . GLY A 1 123 ? -11.928 12.036  16.210  1.00 0.00 ? 123 GLY A C    5  
ATOM 9703  O O    . GLY A 1 123 ? -11.990 13.007  16.967  1.00 0.00 ? 123 GLY A O    5  
ATOM 9704  H H    . GLY A 1 123 ? -11.745 8.618   16.197  1.00 0.00 ? 123 GLY A H    5  
ATOM 9705  H HA2  . GLY A 1 123 ? -11.794 10.679  17.849  1.00 0.00 ? 123 GLY A HA2  5  
ATOM 9706  H HA3  . GLY A 1 123 ? -10.511 10.514  16.653  1.00 0.00 ? 123 GLY A HA3  5  
ATOM 9707  N N    . LYS A 1 124 ? -12.156 12.134  14.898  1.00 0.00 ? 124 LYS A N    5  
ATOM 9708  C CA   . LYS A 1 124 ? -12.521 13.386  14.212  1.00 0.00 ? 124 LYS A CA   5  
ATOM 9709  C C    . LYS A 1 124 ? -13.625 13.184  13.141  1.00 0.00 ? 124 LYS A C    5  
ATOM 9710  O O    . LYS A 1 124 ? -13.842 14.040  12.278  1.00 0.00 ? 124 LYS A O    5  
ATOM 9711  C CB   . LYS A 1 124 ? -11.191 13.989  13.701  1.00 0.00 ? 124 LYS A CB   5  
ATOM 9712  C CG   . LYS A 1 124 ? -11.225 15.416  13.120  1.00 0.00 ? 124 LYS A CG   5  
ATOM 9713  C CD   . LYS A 1 124 ? -11.889 16.479  14.010  1.00 0.00 ? 124 LYS A CD   5  
ATOM 9714  C CE   . LYS A 1 124 ? -11.206 16.606  15.383  1.00 0.00 ? 124 LYS A CE   5  
ATOM 9715  N NZ   . LYS A 1 124 ? -11.803 17.705  16.191  1.00 0.00 ? 124 LYS A NZ   5  
ATOM 9716  H H    . LYS A 1 124 ? -12.025 11.309  14.324  1.00 0.00 ? 124 LYS A H    5  
ATOM 9717  H HA   . LYS A 1 124 ? -12.958 14.066  14.945  1.00 0.00 ? 124 LYS A HA   5  
ATOM 9718  H HB2  . LYS A 1 124 ? -10.498 14.011  14.542  1.00 0.00 ? 124 LYS A HB2  5  
ATOM 9719  H HB3  . LYS A 1 124 ? -10.757 13.302  12.972  1.00 0.00 ? 124 LYS A HB3  5  
ATOM 9720  H HG2  . LYS A 1 124 ? -10.192 15.718  12.944  1.00 0.00 ? 124 LYS A HG2  5  
ATOM 9721  H HG3  . LYS A 1 124 ? -11.724 15.408  12.152  1.00 0.00 ? 124 LYS A HG3  5  
ATOM 9722  H HD2  . LYS A 1 124 ? -11.824 17.439  13.491  1.00 0.00 ? 124 LYS A HD2  5  
ATOM 9723  H HD3  . LYS A 1 124 ? -12.946 16.242  14.141  1.00 0.00 ? 124 LYS A HD3  5  
ATOM 9724  H HE2  . LYS A 1 124 ? -11.297 15.659  15.922  1.00 0.00 ? 124 LYS A HE2  5  
ATOM 9725  H HE3  . LYS A 1 124 ? -10.141 16.802  15.230  1.00 0.00 ? 124 LYS A HE3  5  
ATOM 9726  H HZ1  . LYS A 1 124 ? -11.340 17.783  17.089  1.00 0.00 ? 124 LYS A HZ1  5  
ATOM 9727  H HZ2  . LYS A 1 124 ? -11.712 18.595  15.722  1.00 0.00 ? 124 LYS A HZ2  5  
ATOM 9728  H HZ3  . LYS A 1 124 ? -12.788 17.541  16.367  1.00 0.00 ? 124 LYS A HZ3  5  
ATOM 9729  N N    . SER A 1 125 ? -14.332 12.044  13.202  1.00 0.00 ? 125 SER A N    5  
ATOM 9730  C CA   . SER A 1 125 ? -15.402 11.631  12.273  1.00 0.00 ? 125 SER A CA   5  
ATOM 9731  C C    . SER A 1 125 ? -16.764 12.235  12.638  1.00 0.00 ? 125 SER A C    5  
ATOM 9732  O O    . SER A 1 125 ? -17.251 11.997  13.768  1.00 0.00 ? 125 SER A O    5  
ATOM 9733  C CB   . SER A 1 125 ? -15.485 10.110  12.228  1.00 0.00 ? 125 SER A CB   5  
ATOM 9734  O OG   . SER A 1 125 ? -14.256 9.606   11.742  1.00 0.00 ? 125 SER A OG   5  
ATOM 9735  O OXT  . SER A 1 125 ? -17.339 12.971  11.800  1.00 0.00 ? 125 SER A OXT  5  
ATOM 9736  H H    . SER A 1 125 ? -14.147 11.431  13.986  1.00 0.00 ? 125 SER A H    5  
ATOM 9737  H HA   . SER A 1 125 ? -15.168 11.981  11.273  1.00 0.00 ? 125 SER A HA   5  
ATOM 9738  H HB2  . SER A 1 125 ? -15.691 9.722   13.229  1.00 0.00 ? 125 SER A HB2  5  
ATOM 9739  H HB3  . SER A 1 125 ? -16.305 9.809   11.568  1.00 0.00 ? 125 SER A HB3  5  
ATOM 9740  H HG   . SER A 1 125 ? -13.553 10.226  12.006  1.00 0.00 ? 125 SER A HG   5  
ATOM 9741  N N    . MET A 1 1   ? 8.877   -8.662  -10.263 1.00 0.00 ? 1   MET A N    6  
ATOM 9742  C CA   . MET A 1 1   ? 7.865   -7.897  -11.045 1.00 0.00 ? 1   MET A CA   6  
ATOM 9743  C C    . MET A 1 1   ? 6.860   -7.201  -10.108 1.00 0.00 ? 1   MET A C    6  
ATOM 9744  O O    . MET A 1 1   ? 7.068   -6.035  -9.773  1.00 0.00 ? 1   MET A O    6  
ATOM 9745  C CB   . MET A 1 1   ? 7.207   -8.765  -12.147 1.00 0.00 ? 1   MET A CB   6  
ATOM 9746  C CG   . MET A 1 1   ? 6.243   -7.982  -13.060 1.00 0.00 ? 1   MET A CG   6  
ATOM 9747  S SD   . MET A 1 1   ? 6.949   -6.565  -13.958 1.00 0.00 ? 1   MET A SD   6  
ATOM 9748  C CE   . MET A 1 1   ? 7.983   -7.417  -15.182 1.00 0.00 ? 1   MET A CE   6  
ATOM 9749  H H1   . MET A 1 1   ? 9.337   -8.064  -9.594  1.00 0.00 ? 1   MET A H1   6  
ATOM 9750  H H2   . MET A 1 1   ? 8.450   -9.429  -9.766  1.00 0.00 ? 1   MET A H2   6  
ATOM 9751  H H3   . MET A 1 1   ? 9.586   -9.036  -10.877 1.00 0.00 ? 1   MET A H3   6  
ATOM 9752  H HA   . MET A 1 1   ? 8.395   -7.093  -11.561 1.00 0.00 ? 1   MET A HA   6  
ATOM 9753  H HB2  . MET A 1 1   ? 7.987   -9.196  -12.774 1.00 0.00 ? 1   MET A HB2  6  
ATOM 9754  H HB3  . MET A 1 1   ? 6.660   -9.595  -11.696 1.00 0.00 ? 1   MET A HB3  6  
ATOM 9755  H HG2  . MET A 1 1   ? 5.824   -8.676  -13.792 1.00 0.00 ? 1   MET A HG2  6  
ATOM 9756  H HG3  . MET A 1 1   ? 5.412   -7.617  -12.459 1.00 0.00 ? 1   MET A HG3  6  
ATOM 9757  H HE1  . MET A 1 1   ? 7.365   -8.091  -15.780 1.00 0.00 ? 1   MET A HE1  6  
ATOM 9758  H HE2  . MET A 1 1   ? 8.446   -6.684  -15.843 1.00 0.00 ? 1   MET A HE2  6  
ATOM 9759  H HE3  . MET A 1 1   ? 8.767   -7.992  -14.685 1.00 0.00 ? 1   MET A HE3  6  
ATOM 9760  N N    . ALA A 1 2   ? 5.787   -7.877  -9.672  1.00 0.00 ? 2   ALA A N    6  
ATOM 9761  C CA   . ALA A 1 2   ? 4.757   -7.305  -8.789  1.00 0.00 ? 2   ALA A CA   6  
ATOM 9762  C C    . ALA A 1 2   ? 5.189   -7.267  -7.309  1.00 0.00 ? 2   ALA A C    6  
ATOM 9763  O O    . ALA A 1 2   ? 6.048   -8.038  -6.874  1.00 0.00 ? 2   ALA A O    6  
ATOM 9764  C CB   . ALA A 1 2   ? 3.465   -8.114  -8.977  1.00 0.00 ? 2   ALA A CB   6  
ATOM 9765  H H    . ALA A 1 2   ? 5.661   -8.841  -9.950  1.00 0.00 ? 2   ALA A H    6  
ATOM 9766  H HA   . ALA A 1 2   ? 4.553   -6.276  -9.099  1.00 0.00 ? 2   ALA A HA   6  
ATOM 9767  H HB1  . ALA A 1 2   ? 3.615   -9.146  -8.656  1.00 0.00 ? 2   ALA A HB1  6  
ATOM 9768  H HB2  . ALA A 1 2   ? 2.660   -7.675  -8.387  1.00 0.00 ? 2   ALA A HB2  6  
ATOM 9769  H HB3  . ALA A 1 2   ? 3.174   -8.103  -10.027 1.00 0.00 ? 2   ALA A HB3  6  
ATOM 9770  N N    . SER A 1 3   ? 4.567   -6.385  -6.523  1.00 0.00 ? 3   SER A N    6  
ATOM 9771  C CA   . SER A 1 3   ? 4.805   -6.240  -5.073  1.00 0.00 ? 3   SER A CA   6  
ATOM 9772  C C    . SER A 1 3   ? 3.754   -7.000  -4.226  1.00 0.00 ? 3   SER A C    6  
ATOM 9773  O O    . SER A 1 3   ? 2.604   -7.143  -4.666  1.00 0.00 ? 3   SER A O    6  
ATOM 9774  C CB   . SER A 1 3   ? 4.789   -4.749  -4.686  1.00 0.00 ? 3   SER A CB   6  
ATOM 9775  O OG   . SER A 1 3   ? 5.826   -4.036  -5.352  1.00 0.00 ? 3   SER A OG   6  
ATOM 9776  H H    . SER A 1 3   ? 3.860   -5.796  -6.938  1.00 0.00 ? 3   SER A H    6  
ATOM 9777  H HA   . SER A 1 3   ? 5.797   -6.627  -4.836  1.00 0.00 ? 3   SER A HA   6  
ATOM 9778  H HB2  . SER A 1 3   ? 3.821   -4.318  -4.946  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9779  H HB3  . SER A 1 3   ? 4.932   -4.653  -3.611  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9780  H HG   . SER A 1 3   ? 5.770   -3.103  -5.095  1.00 0.00 ? 3   SER A HG   6  
ATOM 9781  N N    . PRO A 1 4   ? 4.108   -7.465  -3.006  1.00 0.00 ? 4   PRO A N    6  
ATOM 9782  C CA   . PRO A 1 4   ? 3.187   -8.144  -2.094  1.00 0.00 ? 4   PRO A CA   6  
ATOM 9783  C C    . PRO A 1 4   ? 2.239   -7.157  -1.388  1.00 0.00 ? 4   PRO A C    6  
ATOM 9784  O O    . PRO A 1 4   ? 2.498   -5.956  -1.317  1.00 0.00 ? 4   PRO A O    6  
ATOM 9785  C CB   . PRO A 1 4   ? 4.080   -8.883  -1.094  1.00 0.00 ? 4   PRO A CB   6  
ATOM 9786  C CG   . PRO A 1 4   ? 5.298   -7.967  -0.994  1.00 0.00 ? 4   PRO A CG   6  
ATOM 9787  C CD   . PRO A 1 4   ? 5.444   -7.432  -2.420  1.00 0.00 ? 4   PRO A CD   6  
ATOM 9788  H HA   . PRO A 1 4   ? 2.584   -8.873  -2.642  1.00 0.00 ? 4   PRO A HA   6  
ATOM 9789  H HB2  . PRO A 1 4   ? 3.605   -9.028  -0.122  1.00 0.00 ? 4   PRO A HB2  6  
ATOM 9790  H HB3  . PRO A 1 4   ? 4.380   -9.846  -1.514  1.00 0.00 ? 4   PRO A HB3  6  
ATOM 9791  H HG2  . PRO A 1 4   ? 5.089   -7.143  -0.313  1.00 0.00 ? 4   PRO A HG2  6  
ATOM 9792  H HG3  . PRO A 1 4   ? 6.187   -8.511  -0.671  1.00 0.00 ? 4   PRO A HG3  6  
ATOM 9793  H HD2  . PRO A 1 4   ? 5.846   -6.419  -2.395  1.00 0.00 ? 4   PRO A HD2  6  
ATOM 9794  H HD3  . PRO A 1 4   ? 6.102   -8.091  -2.988  1.00 0.00 ? 4   PRO A HD3  6  
ATOM 9795  N N    . HIS A 1 5   ? 1.156   -7.688  -0.808  1.00 0.00 ? 5   HIS A N    6  
ATOM 9796  C CA   . HIS A 1 5   ? 0.134   -6.917  -0.077  1.00 0.00 ? 5   HIS A CA   6  
ATOM 9797  C C    . HIS A 1 5   ? 0.494   -6.678  1.411   1.00 0.00 ? 5   HIS A C    6  
ATOM 9798  O O    . HIS A 1 5   ? -0.381  -6.365  2.227   1.00 0.00 ? 5   HIS A O    6  
ATOM 9799  C CB   . HIS A 1 5   ? -1.222  -7.635  -0.229  1.00 0.00 ? 5   HIS A CB   6  
ATOM 9800  C CG   . HIS A 1 5   ? -1.667  -7.796  -1.665  1.00 0.00 ? 5   HIS A CG   6  
ATOM 9801  N ND1  . HIS A 1 5   ? -1.875  -8.988  -2.328  1.00 0.00 ? 5   HIS A ND1  6  
ATOM 9802  C CD2  . HIS A 1 5   ? -1.955  -6.789  -2.548  1.00 0.00 ? 5   HIS A CD2  6  
ATOM 9803  C CE1  . HIS A 1 5   ? -2.274  -8.702  -3.579  1.00 0.00 ? 5   HIS A CE1  6  
ATOM 9804  N NE2  . HIS A 1 5   ? -2.338  -7.370  -3.766  1.00 0.00 ? 5   HIS A NE2  6  
ATOM 9805  H H    . HIS A 1 5   ? 0.996   -8.682  -0.921  1.00 0.00 ? 5   HIS A H    6  
ATOM 9806  H HA   . HIS A 1 5   ? 0.044   -5.925  -0.531  1.00 0.00 ? 5   HIS A HA   6  
ATOM 9807  H HB2  . HIS A 1 5   ? -1.169  -8.614  0.248   1.00 0.00 ? 5   HIS A HB2  6  
ATOM 9808  H HB3  . HIS A 1 5   ? -1.991  -7.061  0.291   1.00 0.00 ? 5   HIS A HB3  6  
ATOM 9809  H HD1  . HIS A 1 5   ? -1.764  -9.920  -1.945  1.00 0.00 ? 5   HIS A HD1  6  
ATOM 9810  H HD2  . HIS A 1 5   ? -1.895  -5.728  -2.337  1.00 0.00 ? 5   HIS A HD2  6  
ATOM 9811  H HE1  . HIS A 1 5   ? -2.516  -9.447  -4.329  1.00 0.00 ? 5   HIS A HE1  6  
ATOM 9812  N N    . GLN A 1 6   ? 1.760   -6.880  1.797   1.00 0.00 ? 6   GLN A N    6  
ATOM 9813  C CA   . GLN A 1 6   ? 2.231   -6.844  3.184   1.00 0.00 ? 6   GLN A CA   6  
ATOM 9814  C C    . GLN A 1 6   ? 3.276   -5.729  3.395   1.00 0.00 ? 6   GLN A C    6  
ATOM 9815  O O    . GLN A 1 6   ? 4.454   -5.894  3.078   1.00 0.00 ? 6   GLN A O    6  
ATOM 9816  C CB   . GLN A 1 6   ? 2.800   -8.228  3.547   1.00 0.00 ? 6   GLN A CB   6  
ATOM 9817  C CG   . GLN A 1 6   ? 3.215   -8.322  5.026   1.00 0.00 ? 6   GLN A CG   6  
ATOM 9818  C CD   . GLN A 1 6   ? 3.878   -9.661  5.343   1.00 0.00 ? 6   GLN A CD   6  
ATOM 9819  O OE1  . GLN A 1 6   ? 5.088   -9.767  5.518   1.00 0.00 ? 6   GLN A OE1  6  
ATOM 9820  N NE2  . GLN A 1 6   ? 3.128   -10.743 5.389   1.00 0.00 ? 6   GLN A NE2  6  
ATOM 9821  H H    . GLN A 1 6   ? 2.440   -7.099  1.081   1.00 0.00 ? 6   GLN A H    6  
ATOM 9822  H HA   . GLN A 1 6   ? 1.389   -6.660  3.854   1.00 0.00 ? 6   GLN A HA   6  
ATOM 9823  H HB2  . GLN A 1 6   ? 2.041   -8.986  3.346   1.00 0.00 ? 6   GLN A HB2  6  
ATOM 9824  H HB3  . GLN A 1 6   ? 3.666   -8.444  2.917   1.00 0.00 ? 6   GLN A HB3  6  
ATOM 9825  H HG2  . GLN A 1 6   ? 3.910   -7.520  5.273   1.00 0.00 ? 6   GLN A HG2  6  
ATOM 9826  H HG3  . GLN A 1 6   ? 2.330   -8.198  5.648   1.00 0.00 ? 6   GLN A HG3  6  
ATOM 9827  H HE21 . GLN A 1 6   ? 2.128   -10.653 5.246   1.00 0.00 ? 6   GLN A HE21 6  
ATOM 9828  H HE22 . GLN A 1 6   ? 3.570   -11.630 5.573   1.00 0.00 ? 6   GLN A HE22 6  
ATOM 9829  N N    . GLU A 1 7   ? 2.833   -4.616  3.990   1.00 0.00 ? 7   GLU A N    6  
ATOM 9830  C CA   . GLU A 1 7   ? 3.649   -3.506  4.506   1.00 0.00 ? 7   GLU A CA   6  
ATOM 9831  C C    . GLU A 1 7   ? 2.722   -2.565  5.299   1.00 0.00 ? 7   GLU A C    6  
ATOM 9832  O O    . GLU A 1 7   ? 1.934   -1.854  4.668   1.00 0.00 ? 7   GLU A O    6  
ATOM 9833  C CB   . GLU A 1 7   ? 4.388   -2.737  3.394   1.00 0.00 ? 7   GLU A CB   6  
ATOM 9834  C CG   . GLU A 1 7   ? 5.308   -1.657  3.983   1.00 0.00 ? 7   GLU A CG   6  
ATOM 9835  C CD   . GLU A 1 7   ? 6.024   -0.888  2.865   1.00 0.00 ? 7   GLU A CD   6  
ATOM 9836  O OE1  . GLU A 1 7   ? 5.363   -0.044  2.213   1.00 0.00 ? 7   GLU A OE1  6  
ATOM 9837  O OE2  . GLU A 1 7   ? 7.235   -1.118  2.636   1.00 0.00 ? 7   GLU A OE2  6  
ATOM 9838  H H    . GLU A 1 7   ? 1.833   -4.519  4.120   1.00 0.00 ? 7   GLU A H    6  
ATOM 9839  H HA   . GLU A 1 7   ? 4.415   -3.922  5.163   1.00 0.00 ? 7   GLU A HA   6  
ATOM 9840  H HB2  . GLU A 1 7   ? 5.001   -3.417  2.808   1.00 0.00 ? 7   GLU A HB2  6  
ATOM 9841  H HB3  . GLU A 1 7   ? 3.660   -2.269  2.729   1.00 0.00 ? 7   GLU A HB3  6  
ATOM 9842  H HG2  . GLU A 1 7   ? 4.722   -0.951  4.578   1.00 0.00 ? 7   GLU A HG2  6  
ATOM 9843  H HG3  . GLU A 1 7   ? 6.040   -2.128  4.642   1.00 0.00 ? 7   GLU A HG3  6  
ATOM 9844  N N    . PRO A 1 8   ? 2.765   -2.568  6.647   1.00 0.00 ? 8   PRO A N    6  
ATOM 9845  C CA   . PRO A 1 8   ? 1.919   -1.718  7.478   1.00 0.00 ? 8   PRO A CA   6  
ATOM 9846  C C    . PRO A 1 8   ? 2.155   -0.223  7.246   1.00 0.00 ? 8   PRO A C    6  
ATOM 9847  O O    . PRO A 1 8   ? 3.287   0.262   7.299   1.00 0.00 ? 8   PRO A O    6  
ATOM 9848  C CB   . PRO A 1 8   ? 2.217   -2.103  8.929   1.00 0.00 ? 8   PRO A CB   6  
ATOM 9849  C CG   . PRO A 1 8   ? 2.747   -3.527  8.821   1.00 0.00 ? 8   PRO A CG   6  
ATOM 9850  C CD   . PRO A 1 8   ? 3.491   -3.508  7.489   1.00 0.00 ? 8   PRO A CD   6  
ATOM 9851  H HA   . PRO A 1 8   ? 0.878   -1.960  7.273   1.00 0.00 ? 8   PRO A HA   6  
ATOM 9852  H HB2  . PRO A 1 8   ? 3.002   -1.464  9.334   1.00 0.00 ? 8   PRO A HB2  6  
ATOM 9853  H HB3  . PRO A 1 8   ? 1.320   -2.049  9.542   1.00 0.00 ? 8   PRO A HB3  6  
ATOM 9854  H HG2  . PRO A 1 8   ? 3.411   -3.771  9.651   1.00 0.00 ? 8   PRO A HG2  6  
ATOM 9855  H HG3  . PRO A 1 8   ? 1.911   -4.226  8.772   1.00 0.00 ? 8   PRO A HG3  6  
ATOM 9856  H HD2  . PRO A 1 8   ? 4.511   -3.151  7.640   1.00 0.00 ? 8   PRO A HD2  6  
ATOM 9857  H HD3  . PRO A 1 8   ? 3.501   -4.511  7.062   1.00 0.00 ? 8   PRO A HD3  6  
ATOM 9858  N N    . LYS A 1 9   ? 1.061   0.512   7.024   1.00 0.00 ? 9   LYS A N    6  
ATOM 9859  C CA   . LYS A 1 9   ? 1.027   1.981   6.997   1.00 0.00 ? 9   LYS A CA   6  
ATOM 9860  C C    . LYS A 1 9   ? 0.335   2.468   8.283   1.00 0.00 ? 9   LYS A C    6  
ATOM 9861  O O    . LYS A 1 9   ? -0.664  1.859   8.686   1.00 0.00 ? 9   LYS A O    6  
ATOM 9862  C CB   . LYS A 1 9   ? 0.235   2.483   5.775   1.00 0.00 ? 9   LYS A CB   6  
ATOM 9863  C CG   . LYS A 1 9   ? 1.051   2.629   4.489   1.00 0.00 ? 9   LYS A CG   6  
ATOM 9864  C CD   . LYS A 1 9   ? 1.634   1.300   3.998   1.00 0.00 ? 9   LYS A CD   6  
ATOM 9865  C CE   . LYS A 1 9   ? 2.001   1.471   2.516   1.00 0.00 ? 9   LYS A CE   6  
ATOM 9866  N NZ   . LYS A 1 9   ? 2.604   0.247   1.931   1.00 0.00 ? 9   LYS A NZ   6  
ATOM 9867  H H    . LYS A 1 9   ? 0.168   0.039   6.993   1.00 0.00 ? 9   LYS A H    6  
ATOM 9868  H HA   . LYS A 1 9   ? 2.041   2.383   6.957   1.00 0.00 ? 9   LYS A HA   6  
ATOM 9869  H HB2  . LYS A 1 9   ? -0.605  1.816   5.579   1.00 0.00 ? 9   LYS A HB2  6  
ATOM 9870  H HB3  . LYS A 1 9   ? -0.175  3.470   6.000   1.00 0.00 ? 9   LYS A HB3  6  
ATOM 9871  H HG2  . LYS A 1 9   ? 0.379   3.030   3.724   1.00 0.00 ? 9   LYS A HG2  6  
ATOM 9872  H HG3  . LYS A 1 9   ? 1.859   3.345   4.642   1.00 0.00 ? 9   LYS A HG3  6  
ATOM 9873  H HD2  . LYS A 1 9   ? 2.507   1.042   4.606   1.00 0.00 ? 9   LYS A HD2  6  
ATOM 9874  H HD3  . LYS A 1 9   ? 0.887   0.513   4.115   1.00 0.00 ? 9   LYS A HD3  6  
ATOM 9875  H HE2  . LYS A 1 9   ? 1.087   1.725   1.967   1.00 0.00 ? 9   LYS A HE2  6  
ATOM 9876  H HE3  . LYS A 1 9   ? 2.695   2.313   2.407   1.00 0.00 ? 9   LYS A HE3  6  
ATOM 9877  H HZ1  . LYS A 1 9   ? 2.080   -0.580  2.185   1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 9878  H HZ2  . LYS A 1 9   ? 2.625   0.310   0.921   1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 9879  H HZ3  . LYS A 1 9   ? 3.573   0.140   2.232   1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 9880  N N    . PRO A 1 10  ? 0.802   3.554   8.927   1.00 0.00 ? 10  PRO A N    6  
ATOM 9881  C CA   . PRO A 1 10  ? 0.175   4.035   10.142  1.00 0.00 ? 10  PRO A CA   6  
ATOM 9882  C C    . PRO A 1 10  ? -1.209  4.614   9.822   1.00 0.00 ? 10  PRO A C    6  
ATOM 9883  O O    . PRO A 1 10  ? -1.383  5.353   8.855   1.00 0.00 ? 10  PRO A O    6  
ATOM 9884  C CB   . PRO A 1 10  ? 1.181   4.998   10.783  1.00 0.00 ? 10  PRO A CB   6  
ATOM 9885  C CG   . PRO A 1 10  ? 1.909   5.563   9.565   1.00 0.00 ? 10  PRO A CG   6  
ATOM 9886  C CD   . PRO A 1 10  ? 1.959   4.379   8.597   1.00 0.00 ? 10  PRO A CD   6  
ATOM 9887  H HA   . PRO A 1 10  ? 0.033   3.187   10.799  1.00 0.00 ? 10  PRO A HA   6  
ATOM 9888  H HB2  . PRO A 1 10  ? 0.696   5.775   11.372  1.00 0.00 ? 10  PRO A HB2  6  
ATOM 9889  H HB3  . PRO A 1 10  ? 1.888   4.425   11.398  1.00 0.00 ? 10  PRO A HB3  6  
ATOM 9890  H HG2  . PRO A 1 10  ? 1.317   6.366   9.129   1.00 0.00 ? 10  PRO A HG2  6  
ATOM 9891  H HG3  . PRO A 1 10  ? 2.910   5.918   9.821   1.00 0.00 ? 10  PRO A HG3  6  
ATOM 9892  H HD2  . PRO A 1 10  ? 1.916   4.734   7.565   1.00 0.00 ? 10  PRO A HD2  6  
ATOM 9893  H HD3  . PRO A 1 10  ? 2.876   3.810   8.766   1.00 0.00 ? 10  PRO A HD3  6  
ATOM 9894  N N    . GLY A 1 11  ? -2.208  4.189   10.604  1.00 0.00 ? 11  GLY A N    6  
ATOM 9895  C CA   . GLY A 1 11  ? -3.629  4.486   10.380  1.00 0.00 ? 11  GLY A CA   6  
ATOM 9896  C C    . GLY A 1 11  ? -4.300  3.623   9.313   1.00 0.00 ? 11  GLY A C    6  
ATOM 9897  O O    . GLY A 1 11  ? -5.382  3.984   8.855   1.00 0.00 ? 11  GLY A O    6  
ATOM 9898  H H    . GLY A 1 11  ? -1.969  3.611   11.407  1.00 0.00 ? 11  GLY A H    6  
ATOM 9899  H HA2  . GLY A 1 11  ? -4.173  4.337   11.310  1.00 0.00 ? 11  GLY A HA2  6  
ATOM 9900  H HA3  . GLY A 1 11  ? -3.742  5.519   10.059  1.00 0.00 ? 11  GLY A HA3  6  
ATOM 9901  N N    . ASP A 1 12  ? -3.672  2.533   8.868   1.00 0.00 ? 12  ASP A N    6  
ATOM 9902  C CA   . ASP A 1 12  ? -4.209  1.602   7.865   1.00 0.00 ? 12  ASP A CA   6  
ATOM 9903  C C    . ASP A 1 12  ? -4.641  0.250   8.465   1.00 0.00 ? 12  ASP A C    6  
ATOM 9904  O O    . ASP A 1 12  ? -4.356  -0.062  9.627   1.00 0.00 ? 12  ASP A O    6  
ATOM 9905  C CB   . ASP A 1 12  ? -3.216  1.452   6.700   1.00 0.00 ? 12  ASP A CB   6  
ATOM 9906  C CG   . ASP A 1 12  ? -3.943  1.499   5.348   1.00 0.00 ? 12  ASP A CG   6  
ATOM 9907  O OD1  . ASP A 1 12  ? -4.797  0.620   5.096   1.00 0.00 ? 12  ASP A OD1  6  
ATOM 9908  O OD2  . ASP A 1 12  ? -3.704  2.475   4.596   1.00 0.00 ? 12  ASP A OD2  6  
ATOM 9909  H H    . ASP A 1 12  ? -2.758  2.318   9.251   1.00 0.00 ? 12  ASP A H    6  
ATOM 9910  H HA   . ASP A 1 12  ? -5.117  2.040   7.441   1.00 0.00 ? 12  ASP A HA   6  
ATOM 9911  H HB2  . ASP A 1 12  ? -2.508  2.281   6.736   1.00 0.00 ? 12  ASP A HB2  6  
ATOM 9912  H HB3  . ASP A 1 12  ? -2.656  0.519   6.800   1.00 0.00 ? 12  ASP A HB3  6  
ATOM 9913  N N    . LEU A 1 13  ? -5.346  -0.542  7.651   1.00 0.00 ? 13  LEU A N    6  
ATOM 9914  C CA   . LEU A 1 13  ? -6.066  -1.755  8.044   1.00 0.00 ? 13  LEU A CA   6  
ATOM 9915  C C    . LEU A 1 13  ? -5.349  -3.046  7.669   1.00 0.00 ? 13  LEU A C    6  
ATOM 9916  O O    . LEU A 1 13  ? -5.265  -3.425  6.501   1.00 0.00 ? 13  LEU A O    6  
ATOM 9917  C CB   . LEU A 1 13  ? -7.461  -1.723  7.398   1.00 0.00 ? 13  LEU A CB   6  
ATOM 9918  C CG   . LEU A 1 13  ? -8.265  -0.456  7.696   1.00 0.00 ? 13  LEU A CG   6  
ATOM 9919  C CD1  . LEU A 1 13  ? -9.624  -0.526  6.989   1.00 0.00 ? 13  LEU A CD1  6  
ATOM 9920  C CD2  . LEU A 1 13  ? -8.458  -0.289  9.208   1.00 0.00 ? 13  LEU A CD2  6  
ATOM 9921  H H    . LEU A 1 13  ? -5.419  -0.253  6.679   1.00 0.00 ? 13  LEU A H    6  
ATOM 9922  H HA   . LEU A 1 13  ? -6.186  -1.760  9.128   1.00 0.00 ? 13  LEU A HA   6  
ATOM 9923  H HB2  . LEU A 1 13  ? -7.339  -1.790  6.320   1.00 0.00 ? 13  LEU A HB2  6  
ATOM 9924  H HB3  . LEU A 1 13  ? -8.028  -2.592  7.737   1.00 0.00 ? 13  LEU A HB3  6  
ATOM 9925  H HG   . LEU A 1 13  ? -7.701  0.388   7.293   1.00 0.00 ? 13  LEU A HG   6  
ATOM 9926  H HD11 . LEU A 1 13  ? -9.479  -0.569  5.912   1.00 0.00 ? 13  LEU A HD11 6  
ATOM 9927  H HD12 . LEU A 1 13  ? -10.162 -1.420  7.306   1.00 0.00 ? 13  LEU A HD12 6  
ATOM 9928  H HD13 . LEU A 1 13  ? -10.215 0.359   7.228   1.00 0.00 ? 13  LEU A HD13 6  
ATOM 9929  H HD21 . LEU A 1 13  ? -9.084  0.575   9.419   1.00 0.00 ? 13  LEU A HD21 6  
ATOM 9930  H HD22 . LEU A 1 13  ? -8.914  -1.186  9.624   1.00 0.00 ? 13  LEU A HD22 6  
ATOM 9931  H HD23 . LEU A 1 13  ? -7.492  -0.152  9.691   1.00 0.00 ? 13  LEU A HD23 6  
ATOM 9932  N N    . ILE A 1 14  ? -4.884  -3.746  8.695   1.00 0.00 ? 14  ILE A N    6  
ATOM 9933  C CA   . ILE A 1 14  ? -4.141  -5.008  8.588   1.00 0.00 ? 14  ILE A CA   6  
ATOM 9934  C C    . ILE A 1 14  ? -5.097  -6.196  8.790   1.00 0.00 ? 14  ILE A C    6  
ATOM 9935  O O    . ILE A 1 14  ? -5.821  -6.238  9.784   1.00 0.00 ? 14  ILE A O    6  
ATOM 9936  C CB   . ILE A 1 14  ? -2.977  -5.064  9.615   1.00 0.00 ? 14  ILE A CB   6  
ATOM 9937  C CG1  . ILE A 1 14  ? -2.181  -3.737  9.702   1.00 0.00 ? 14  ILE A CG1  6  
ATOM 9938  C CG2  . ILE A 1 14  ? -2.035  -6.233  9.257   1.00 0.00 ? 14  ILE A CG2  6  
ATOM 9939  C CD1  . ILE A 1 14  ? -1.059  -3.756  10.742  1.00 0.00 ? 14  ILE A CD1  6  
ATOM 9940  H H    . ILE A 1 14  ? -5.113  -3.389  9.621   1.00 0.00 ? 14  ILE A H    6  
ATOM 9941  H HA   . ILE A 1 14  ? -3.718  -5.071  7.588   1.00 0.00 ? 14  ILE A HA   6  
ATOM 9942  H HB   . ILE A 1 14  ? -3.402  -5.258  10.599  1.00 0.00 ? 14  ILE A HB   6  
ATOM 9943  H HG12 . ILE A 1 14  ? -1.752  -3.497  8.730   1.00 0.00 ? 14  ILE A HG12 6  
ATOM 9944  H HG13 . ILE A 1 14  ? -2.852  -2.924  9.986   1.00 0.00 ? 14  ILE A HG13 6  
ATOM 9945  H HG21 . ILE A 1 14  ? -1.487  -6.004  8.343   1.00 0.00 ? 14  ILE A HG21 6  
ATOM 9946  H HG22 . ILE A 1 14  ? -1.327  -6.413  10.067  1.00 0.00 ? 14  ILE A HG22 6  
ATOM 9947  H HG23 . ILE A 1 14  ? -2.599  -7.154  9.103   1.00 0.00 ? 14  ILE A HG23 6  
ATOM 9948  H HD11 . ILE A 1 14  ? -1.463  -4.012  11.721  1.00 0.00 ? 14  ILE A HD11 6  
ATOM 9949  H HD12 . ILE A 1 14  ? -0.280  -4.461  10.459  1.00 0.00 ? 14  ILE A HD12 6  
ATOM 9950  H HD13 . ILE A 1 14  ? -0.612  -2.767  10.797  1.00 0.00 ? 14  ILE A HD13 6  
ATOM 9951  N N    . GLU A 1 15  ? -5.073  -7.162  7.873   1.00 0.00 ? 15  GLU A N    6  
ATOM 9952  C CA   . GLU A 1 15  ? -5.734  -8.463  7.997   1.00 0.00 ? 15  GLU A CA   6  
ATOM 9953  C C    . GLU A 1 15  ? -4.690  -9.466  8.501   1.00 0.00 ? 15  GLU A C    6  
ATOM 9954  O O    . GLU A 1 15  ? -3.659  -9.654  7.853   1.00 0.00 ? 15  GLU A O    6  
ATOM 9955  C CB   . GLU A 1 15  ? -6.264  -8.950  6.637   1.00 0.00 ? 15  GLU A CB   6  
ATOM 9956  C CG   . GLU A 1 15  ? -7.355  -8.058  6.051   1.00 0.00 ? 15  GLU A CG   6  
ATOM 9957  C CD   . GLU A 1 15  ? -7.911  -8.662  4.753   1.00 0.00 ? 15  GLU A CD   6  
ATOM 9958  O OE1  . GLU A 1 15  ? -7.251  -8.538  3.691   1.00 0.00 ? 15  GLU A OE1  6  
ATOM 9959  O OE2  . GLU A 1 15  ? -9.013  -9.263  4.782   1.00 0.00 ? 15  GLU A OE2  6  
ATOM 9960  H H    . GLU A 1 15  ? -4.402  -7.070  7.122   1.00 0.00 ? 15  GLU A H    6  
ATOM 9961  H HA   . GLU A 1 15  ? -6.564  -8.410  8.705   1.00 0.00 ? 15  GLU A HA   6  
ATOM 9962  H HB2  . GLU A 1 15  ? -5.439  -9.005  5.924   1.00 0.00 ? 15  GLU A HB2  6  
ATOM 9963  H HB3  . GLU A 1 15  ? -6.675  -9.952  6.767   1.00 0.00 ? 15  GLU A HB3  6  
ATOM 9964  H HG2  . GLU A 1 15  ? -8.157  -7.950  6.783   1.00 0.00 ? 15  GLU A HG2  6  
ATOM 9965  H HG3  . GLU A 1 15  ? -6.936  -7.075  5.838   1.00 0.00 ? 15  GLU A HG3  6  
ATOM 9966  N N    . ILE A 1 16  ? -4.927  -10.100 9.651   1.00 0.00 ? 16  ILE A N    6  
ATOM 9967  C CA   . ILE A 1 16  ? -3.972  -11.007 10.311  1.00 0.00 ? 16  ILE A CA   6  
ATOM 9968  C C    . ILE A 1 16  ? -4.598  -12.392 10.479  1.00 0.00 ? 16  ILE A C    6  
ATOM 9969  O O    . ILE A 1 16  ? -5.621  -12.524 11.150  1.00 0.00 ? 16  ILE A O    6  
ATOM 9970  C CB   . ILE A 1 16  ? -3.543  -10.428 11.686  1.00 0.00 ? 16  ILE A CB   6  
ATOM 9971  C CG1  . ILE A 1 16  ? -2.906  -9.023  11.533  1.00 0.00 ? 16  ILE A CG1  6  
ATOM 9972  C CG2  . ILE A 1 16  ? -2.569  -11.414 12.366  1.00 0.00 ? 16  ILE A CG2  6  
ATOM 9973  C CD1  . ILE A 1 16  ? -2.640  -8.306  12.862  1.00 0.00 ? 16  ILE A CD1  6  
ATOM 9974  H H    . ILE A 1 16  ? -5.777  -9.850  10.160  1.00 0.00 ? 16  ILE A H    6  
ATOM 9975  H HA   . ILE A 1 16  ? -3.079  -11.121 9.692   1.00 0.00 ? 16  ILE A HA   6  
ATOM 9976  H HB   . ILE A 1 16  ? -4.431  -10.334 12.317  1.00 0.00 ? 16  ILE A HB   6  
ATOM 9977  H HG12 . ILE A 1 16  ? -1.968  -9.102  10.983  1.00 0.00 ? 16  ILE A HG12 6  
ATOM 9978  H HG13 . ILE A 1 16  ? -3.578  -8.378  10.967  1.00 0.00 ? 16  ILE A HG13 6  
ATOM 9979  H HG21 . ILE A 1 16  ? -2.157  -10.993 13.278  1.00 0.00 ? 16  ILE A HG21 6  
ATOM 9980  H HG22 . ILE A 1 16  ? -3.091  -12.331 12.642  1.00 0.00 ? 16  ILE A HG22 6  
ATOM 9981  H HG23 . ILE A 1 16  ? -1.752  -11.661 11.689  1.00 0.00 ? 16  ILE A HG23 6  
ATOM 9982  H HD11 . ILE A 1 16  ? -2.343  -7.277  12.662  1.00 0.00 ? 16  ILE A HD11 6  
ATOM 9983  H HD12 . ILE A 1 16  ? -3.548  -8.298  13.465  1.00 0.00 ? 16  ILE A HD12 6  
ATOM 9984  H HD13 . ILE A 1 16  ? -1.837  -8.798  13.409  1.00 0.00 ? 16  ILE A HD13 6  
ATOM 9985  N N    . PHE A 1 17  ? -3.975  -13.436 9.928   1.00 0.00 ? 17  PHE A N    6  
ATOM 9986  C CA   . PHE A 1 17  ? -4.449  -14.824 10.000  1.00 0.00 ? 17  PHE A CA   6  
ATOM 9987  C C    . PHE A 1 17  ? -4.154  -15.452 11.379  1.00 0.00 ? 17  PHE A C    6  
ATOM 9988  O O    . PHE A 1 17  ? -3.315  -16.343 11.522  1.00 0.00 ? 17  PHE A O    6  
ATOM 9989  C CB   . PHE A 1 17  ? -3.845  -15.604 8.818   1.00 0.00 ? 17  PHE A CB   6  
ATOM 9990  C CG   . PHE A 1 17  ? -4.429  -16.992 8.611   1.00 0.00 ? 17  PHE A CG   6  
ATOM 9991  C CD1  . PHE A 1 17  ? -5.747  -17.138 8.137   1.00 0.00 ? 17  PHE A CD1  6  
ATOM 9992  C CD2  . PHE A 1 17  ? -3.649  -18.140 8.855   1.00 0.00 ? 17  PHE A CD2  6  
ATOM 9993  C CE1  . PHE A 1 17  ? -6.280  -18.417 7.899   1.00 0.00 ? 17  PHE A CE1  6  
ATOM 9994  C CE2  . PHE A 1 17  ? -4.185  -19.421 8.627   1.00 0.00 ? 17  PHE A CE2  6  
ATOM 9995  C CZ   . PHE A 1 17  ? -5.497  -19.559 8.140   1.00 0.00 ? 17  PHE A CZ   6  
ATOM 9996  H H    . PHE A 1 17  ? -3.107  -13.273 9.428   1.00 0.00 ? 17  PHE A H    6  
ATOM 9997  H HA   . PHE A 1 17  ? -5.532  -14.822 9.871   1.00 0.00 ? 17  PHE A HA   6  
ATOM 9998  H HB2  . PHE A 1 17  ? -4.013  -15.036 7.900   1.00 0.00 ? 17  PHE A HB2  6  
ATOM 9999  H HB3  . PHE A 1 17  ? -2.765  -15.679 8.955   1.00 0.00 ? 17  PHE A HB3  6  
ATOM 10000 H HD1  . PHE A 1 17  ? -6.349  -16.264 7.944   1.00 0.00 ? 17  PHE A HD1  6  
ATOM 10001 H HD2  . PHE A 1 17  ? -2.635  -18.043 9.216   1.00 0.00 ? 17  PHE A HD2  6  
ATOM 10002 H HE1  . PHE A 1 17  ? -7.290  -18.521 7.528   1.00 0.00 ? 17  PHE A HE1  6  
ATOM 10003 H HE2  . PHE A 1 17  ? -3.584  -20.302 8.816   1.00 0.00 ? 17  PHE A HE2  6  
ATOM 10004 H HZ   . PHE A 1 17  ? -5.903  -20.544 7.952   1.00 0.00 ? 17  PHE A HZ   6  
ATOM 10005 N N    . ARG A 1 18  ? -4.830  -14.946 12.417  1.00 0.00 ? 18  ARG A N    6  
ATOM 10006 C CA   . ARG A 1 18  ? -4.567  -15.260 13.828  1.00 0.00 ? 18  ARG A CA   6  
ATOM 10007 C C    . ARG A 1 18  ? -4.836  -16.730 14.188  1.00 0.00 ? 18  ARG A C    6  
ATOM 10008 O O    . ARG A 1 18  ? -4.014  -17.349 14.866  1.00 0.00 ? 18  ARG A O    6  
ATOM 10009 C CB   . ARG A 1 18  ? -5.400  -14.293 14.692  1.00 0.00 ? 18  ARG A CB   6  
ATOM 10010 C CG   . ARG A 1 18  ? -5.284  -14.485 16.216  1.00 0.00 ? 18  ARG A CG   6  
ATOM 10011 C CD   . ARG A 1 18  ? -3.836  -14.452 16.713  1.00 0.00 ? 18  ARG A CD   6  
ATOM 10012 N NE   . ARG A 1 18  ? -3.753  -14.465 18.184  1.00 0.00 ? 18  ARG A NE   6  
ATOM 10013 C CZ   . ARG A 1 18  ? -2.677  -14.168 18.908  1.00 0.00 ? 18  ARG A CZ   6  
ATOM 10014 N NH1  . ARG A 1 18  ? -1.551  -13.784 18.346  1.00 0.00 ? 18  ARG A NH1  6  
ATOM 10015 N NH2  . ARG A 1 18  ? -2.722  -14.245 20.220  1.00 0.00 ? 18  ARG A NH2  6  
ATOM 10016 H H    . ARG A 1 18  ? -5.487  -14.197 12.211  1.00 0.00 ? 18  ARG A H    6  
ATOM 10017 H HA   . ARG A 1 18  ? -3.517  -15.071 14.030  1.00 0.00 ? 18  ARG A HA   6  
ATOM 10018 H HB2  . ARG A 1 18  ? -5.100  -13.269 14.450  1.00 0.00 ? 18  ARG A HB2  6  
ATOM 10019 H HB3  . ARG A 1 18  ? -6.449  -14.400 14.419  1.00 0.00 ? 18  ARG A HB3  6  
ATOM 10020 H HG2  . ARG A 1 18  ? -5.839  -13.686 16.707  1.00 0.00 ? 18  ARG A HG2  6  
ATOM 10021 H HG3  . ARG A 1 18  ? -5.735  -15.435 16.500  1.00 0.00 ? 18  ARG A HG3  6  
ATOM 10022 H HD2  . ARG A 1 18  ? -3.302  -15.320 16.320  1.00 0.00 ? 18  ARG A HD2  6  
ATOM 10023 H HD3  . ARG A 1 18  ? -3.382  -13.538 16.333  1.00 0.00 ? 18  ARG A HD3  6  
ATOM 10024 H HE   . ARG A 1 18  ? -4.588  -14.749 18.682  1.00 0.00 ? 18  ARG A HE   6  
ATOM 10025 H HH11 . ARG A 1 18  ? -1.501  -13.673 17.344  1.00 0.00 ? 18  ARG A HH11 6  
ATOM 10026 H HH12 . ARG A 1 18  ? -0.752  -13.499 18.900  1.00 0.00 ? 18  ARG A HH12 6  
ATOM 10027 H HH21 . ARG A 1 18  ? -3.568  -14.533 20.691  1.00 0.00 ? 18  ARG A HH21 6  
ATOM 10028 H HH22 . ARG A 1 18  ? -1.915  -14.015 20.778  1.00 0.00 ? 18  ARG A HH22 6  
ATOM 10029 N N    . LEU A 1 19  ? -5.989  -17.270 13.777  1.00 0.00 ? 19  LEU A N    6  
ATOM 10030 C CA   . LEU A 1 19  ? -6.587  -18.457 14.413  1.00 0.00 ? 19  LEU A CA   6  
ATOM 10031 C C    . LEU A 1 19  ? -7.382  -19.331 13.412  1.00 0.00 ? 19  LEU A C    6  
ATOM 10032 O O    . LEU A 1 19  ? -8.453  -19.859 13.723  1.00 0.00 ? 19  LEU A O    6  
ATOM 10033 C CB   . LEU A 1 19  ? -7.400  -17.956 15.640  1.00 0.00 ? 19  LEU A CB   6  
ATOM 10034 C CG   . LEU A 1 19  ? -6.700  -18.180 16.997  1.00 0.00 ? 19  LEU A CG   6  
ATOM 10035 C CD1  . LEU A 1 19  ? -7.469  -17.439 18.100  1.00 0.00 ? 19  LEU A CD1  6  
ATOM 10036 C CD2  . LEU A 1 19  ? -6.607  -19.671 17.363  1.00 0.00 ? 19  LEU A CD2  6  
ATOM 10037 H H    . LEU A 1 19  ? -6.596  -16.685 13.218  1.00 0.00 ? 19  LEU A H    6  
ATOM 10038 H HA   . LEU A 1 19  ? -5.769  -19.090 14.762  1.00 0.00 ? 19  LEU A HA   6  
ATOM 10039 H HB2  . LEU A 1 19  ? -7.584  -16.886 15.521  1.00 0.00 ? 19  LEU A HB2  6  
ATOM 10040 H HB3  . LEU A 1 19  ? -8.376  -18.437 15.685  1.00 0.00 ? 19  LEU A HB3  6  
ATOM 10041 H HG   . LEU A 1 19  ? -5.690  -17.766 16.948  1.00 0.00 ? 19  LEU A HG   6  
ATOM 10042 H HD11 . LEU A 1 19  ? -6.960  -17.568 19.057  1.00 0.00 ? 19  LEU A HD11 6  
ATOM 10043 H HD12 . LEU A 1 19  ? -7.507  -16.374 17.871  1.00 0.00 ? 19  LEU A HD12 6  
ATOM 10044 H HD13 . LEU A 1 19  ? -8.484  -17.829 18.177  1.00 0.00 ? 19  LEU A HD13 6  
ATOM 10045 H HD21 . LEU A 1 19  ? -6.001  -20.206 16.634  1.00 0.00 ? 19  LEU A HD21 6  
ATOM 10046 H HD22 . LEU A 1 19  ? -6.138  -19.781 18.343  1.00 0.00 ? 19  LEU A HD22 6  
ATOM 10047 H HD23 . LEU A 1 19  ? -7.605  -20.113 17.392  1.00 0.00 ? 19  LEU A HD23 6  
ATOM 10048 N N    . GLY A 1 20  ? -6.874  -19.456 12.177  1.00 0.00 ? 20  GLY A N    6  
ATOM 10049 C CA   . GLY A 1 20  ? -7.577  -20.116 11.058  1.00 0.00 ? 20  GLY A CA   6  
ATOM 10050 C C    . GLY A 1 20  ? -8.588  -19.196 10.358  1.00 0.00 ? 20  GLY A C    6  
ATOM 10051 O O    . GLY A 1 20  ? -9.462  -19.667 9.628   1.00 0.00 ? 20  GLY A O    6  
ATOM 10052 H H    . GLY A 1 20  ? -5.961  -19.059 11.995  1.00 0.00 ? 20  GLY A H    6  
ATOM 10053 H HA2  . GLY A 1 20  ? -6.845  -20.431 10.315  1.00 0.00 ? 20  GLY A HA2  6  
ATOM 10054 H HA3  . GLY A 1 20  ? -8.122  -20.989 11.422  1.00 0.00 ? 20  GLY A HA3  6  
ATOM 10055 N N    . TYR A 1 21  ? -8.470  -17.886 10.594  1.00 0.00 ? 21  TYR A N    6  
ATOM 10056 C CA   . TYR A 1 21  ? -9.386  -16.812 10.193  1.00 0.00 ? 21  TYR A CA   6  
ATOM 10057 C C    . TYR A 1 21  ? -8.655  -15.456 10.271  1.00 0.00 ? 21  TYR A C    6  
ATOM 10058 O O    . TYR A 1 21  ? -7.766  -15.287 11.113  1.00 0.00 ? 21  TYR A O    6  
ATOM 10059 C CB   . TYR A 1 21  ? -10.614 -16.852 11.121  1.00 0.00 ? 21  TYR A CB   6  
ATOM 10060 C CG   . TYR A 1 21  ? -11.682 -15.807 10.848  1.00 0.00 ? 21  TYR A CG   6  
ATOM 10061 C CD1  . TYR A 1 21  ? -12.443 -15.868 9.663   1.00 0.00 ? 21  TYR A CD1  6  
ATOM 10062 C CD2  . TYR A 1 21  ? -11.944 -14.796 11.795  1.00 0.00 ? 21  TYR A CD2  6  
ATOM 10063 C CE1  . TYR A 1 21  ? -13.468 -14.930 9.428   1.00 0.00 ? 21  TYR A CE1  6  
ATOM 10064 C CE2  . TYR A 1 21  ? -12.960 -13.851 11.562  1.00 0.00 ? 21  TYR A CE2  6  
ATOM 10065 C CZ   . TYR A 1 21  ? -13.729 -13.919 10.380  1.00 0.00 ? 21  TYR A CZ   6  
ATOM 10066 O OH   . TYR A 1 21  ? -14.727 -13.019 10.170  1.00 0.00 ? 21  TYR A OH   6  
ATOM 10067 H H    . TYR A 1 21  ? -7.695  -17.603 11.171  1.00 0.00 ? 21  TYR A H    6  
ATOM 10068 H HA   . TYR A 1 21  ? -9.709  -16.981 9.164   1.00 0.00 ? 21  TYR A HA   6  
ATOM 10069 H HB2  . TYR A 1 21  ? -11.085 -17.834 11.040  1.00 0.00 ? 21  TYR A HB2  6  
ATOM 10070 H HB3  . TYR A 1 21  ? -10.277 -16.749 12.154  1.00 0.00 ? 21  TYR A HB3  6  
ATOM 10071 H HD1  . TYR A 1 21  ? -12.251 -16.649 8.938   1.00 0.00 ? 21  TYR A HD1  6  
ATOM 10072 H HD2  . TYR A 1 21  ? -11.375 -14.754 12.714  1.00 0.00 ? 21  TYR A HD2  6  
ATOM 10073 H HE1  . TYR A 1 21  ? -14.056 -14.986 8.522   1.00 0.00 ? 21  TYR A HE1  6  
ATOM 10074 H HE2  . TYR A 1 21  ? -13.159 -13.078 12.290  1.00 0.00 ? 21  TYR A HE2  6  
ATOM 10075 H HH   . TYR A 1 21  ? -15.221 -13.192 9.357   1.00 0.00 ? 21  TYR A HH   6  
ATOM 10076 N N    . GLU A 1 22  ? -8.985  -14.508 9.387   1.00 0.00 ? 22  GLU A N    6  
ATOM 10077 C CA   . GLU A 1 22  ? -8.316  -13.202 9.332   1.00 0.00 ? 22  GLU A CA   6  
ATOM 10078 C C    . GLU A 1 22  ? -9.015  -12.175 10.236  1.00 0.00 ? 22  GLU A C    6  
ATOM 10079 O O    . GLU A 1 22  ? -10.173 -11.813 10.023  1.00 0.00 ? 22  GLU A O    6  
ATOM 10080 C CB   . GLU A 1 22  ? -8.180  -12.688 7.890   1.00 0.00 ? 22  GLU A CB   6  
ATOM 10081 C CG   . GLU A 1 22  ? -7.209  -13.565 7.086   1.00 0.00 ? 22  GLU A CG   6  
ATOM 10082 C CD   . GLU A 1 22  ? -6.926  -12.989 5.691   1.00 0.00 ? 22  GLU A CD   6  
ATOM 10083 O OE1  . GLU A 1 22  ? -7.780  -13.152 4.787   1.00 0.00 ? 22  GLU A OE1  6  
ATOM 10084 O OE2  . GLU A 1 22  ? -5.824  -12.431 5.481   1.00 0.00 ? 22  GLU A OE2  6  
ATOM 10085 H H    . GLU A 1 22  ? -9.749  -14.677 8.746   1.00 0.00 ? 22  GLU A H    6  
ATOM 10086 H HA   . GLU A 1 22  ? -7.304  -13.328 9.704   1.00 0.00 ? 22  GLU A HA   6  
ATOM 10087 H HB2  . GLU A 1 22  ? -9.156  -12.671 7.401   1.00 0.00 ? 22  GLU A HB2  6  
ATOM 10088 H HB3  . GLU A 1 22  ? -7.785  -11.673 7.923   1.00 0.00 ? 22  GLU A HB3  6  
ATOM 10089 H HG2  . GLU A 1 22  ? -6.272  -13.656 7.637   1.00 0.00 ? 22  GLU A HG2  6  
ATOM 10090 H HG3  . GLU A 1 22  ? -7.638  -14.564 6.978   1.00 0.00 ? 22  GLU A HG3  6  
ATOM 10091 N N    . HIS A 1 23  ? -8.292  -11.698 11.247  1.00 0.00 ? 23  HIS A N    6  
ATOM 10092 C CA   . HIS A 1 23  ? -8.723  -10.662 12.189  1.00 0.00 ? 23  HIS A CA   6  
ATOM 10093 C C    . HIS A 1 23  ? -8.240  -9.278  11.706  1.00 0.00 ? 23  HIS A C    6  
ATOM 10094 O O    . HIS A 1 23  ? -7.131  -9.158  11.178  1.00 0.00 ? 23  HIS A O    6  
ATOM 10095 C CB   . HIS A 1 23  ? -8.118  -10.948 13.580  1.00 0.00 ? 23  HIS A CB   6  
ATOM 10096 C CG   . HIS A 1 23  ? -8.541  -12.219 14.291  1.00 0.00 ? 23  HIS A CG   6  
ATOM 10097 N ND1  . HIS A 1 23  ? -8.370  -12.455 15.638  1.00 0.00 ? 23  HIS A ND1  6  
ATOM 10098 C CD2  . HIS A 1 23  ? -9.086  -13.362 13.761  1.00 0.00 ? 23  HIS A CD2  6  
ATOM 10099 C CE1  . HIS A 1 23  ? -8.795  -13.705 15.906  1.00 0.00 ? 23  HIS A CE1  6  
ATOM 10100 N NE2  . HIS A 1 23  ? -9.243  -14.302 14.788  1.00 0.00 ? 23  HIS A NE2  6  
ATOM 10101 H H    . HIS A 1 23  ? -7.332  -12.025 11.333  1.00 0.00 ? 23  HIS A H    6  
ATOM 10102 H HA   . HIS A 1 23  ? -9.814  -10.648 12.265  1.00 0.00 ? 23  HIS A HA   6  
ATOM 10103 H HB2  . HIS A 1 23  ? -7.030  -10.963 13.486  1.00 0.00 ? 23  HIS A HB2  6  
ATOM 10104 H HB3  . HIS A 1 23  ? -8.374  -10.112 14.233  1.00 0.00 ? 23  HIS A HB3  6  
ATOM 10105 H HD1  . HIS A 1 23  ? -7.984  -11.806 16.312  1.00 0.00 ? 23  HIS A HD1  6  
ATOM 10106 H HD2  . HIS A 1 23  ? -9.330  -13.525 12.723  1.00 0.00 ? 23  HIS A HD2  6  
ATOM 10107 H HE1  . HIS A 1 23  ? -8.772  -14.166 16.887  1.00 0.00 ? 23  HIS A HE1  6  
ATOM 10108 N N    . TRP A 1 24  ? -9.029  -8.219  11.932  1.00 0.00 ? 24  TRP A N    6  
ATOM 10109 C CA   . TRP A 1 24  ? -8.626  -6.841  11.618  1.00 0.00 ? 24  TRP A CA   6  
ATOM 10110 C C    . TRP A 1 24  ? -7.785  -6.184  12.721  1.00 0.00 ? 24  TRP A C    6  
ATOM 10111 O O    . TRP A 1 24  ? -8.065  -6.335  13.916  1.00 0.00 ? 24  TRP A O    6  
ATOM 10112 C CB   . TRP A 1 24  ? -9.855  -5.965  11.355  1.00 0.00 ? 24  TRP A CB   6  
ATOM 10113 C CG   . TRP A 1 24  ? -10.526 -6.132  10.028  1.00 0.00 ? 24  TRP A CG   6  
ATOM 10114 C CD1  . TRP A 1 24  ? -11.817 -6.482  9.864   1.00 0.00 ? 24  TRP A CD1  6  
ATOM 10115 C CD2  . TRP A 1 24  ? -10.024 -5.839  8.686   1.00 0.00 ? 24  TRP A CD2  6  
ATOM 10116 N NE1  . TRP A 1 24  ? -12.138 -6.496  8.521   1.00 0.00 ? 24  TRP A NE1  6  
ATOM 10117 C CE2  . TRP A 1 24  ? -11.074 -6.079  7.749   1.00 0.00 ? 24  TRP A CE2  6  
ATOM 10118 C CE3  . TRP A 1 24  ? -8.805  -5.350  8.170   1.00 0.00 ? 24  TRP A CE3  6  
ATOM 10119 C CZ2  . TRP A 1 24  ? -10.919 -5.866  6.370   1.00 0.00 ? 24  TRP A CZ2  6  
ATOM 10120 C CZ3  . TRP A 1 24  ? -8.642  -5.125  6.790   1.00 0.00 ? 24  TRP A CZ3  6  
ATOM 10121 C CH2  . TRP A 1 24  ? -9.690  -5.389  5.889   1.00 0.00 ? 24  TRP A CH2  6  
ATOM 10122 H H    . TRP A 1 24  ? -9.931  -8.355  12.366  1.00 0.00 ? 24  TRP A H    6  
ATOM 10123 H HA   . TRP A 1 24  ? -8.027  -6.852  10.709  1.00 0.00 ? 24  TRP A HA   6  
ATOM 10124 H HB2  . TRP A 1 24  ? -10.583 -6.118  12.154  1.00 0.00 ? 24  TRP A HB2  6  
ATOM 10125 H HB3  . TRP A 1 24  ? -9.537  -4.925  11.411  1.00 0.00 ? 24  TRP A HB3  6  
ATOM 10126 H HD1  . TRP A 1 24  ? -12.482 -6.686  10.685  1.00 0.00 ? 24  TRP A HD1  6  
ATOM 10127 H HE1  . TRP A 1 24  ? -13.052 -6.741  8.161   1.00 0.00 ? 24  TRP A HE1  6  
ATOM 10128 H HE3  . TRP A 1 24  ? -7.993  -5.132  8.844   1.00 0.00 ? 24  TRP A HE3  6  
ATOM 10129 H HZ2  . TRP A 1 24  ? -11.739 -6.059  5.692   1.00 0.00 ? 24  TRP A HZ2  6  
ATOM 10130 H HZ3  . TRP A 1 24  ? -7.700  -4.749  6.415   1.00 0.00 ? 24  TRP A HZ3  6  
ATOM 10131 H HH2  . TRP A 1 24  ? -9.554  -5.218  4.832   1.00 0.00 ? 24  TRP A HH2  6  
ATOM 10132 N N    . ALA A 1 25  ? -6.826  -5.354  12.303  1.00 0.00 ? 25  ALA A N    6  
ATOM 10133 C CA   . ALA A 1 25  ? -6.054  -4.467  13.172  1.00 0.00 ? 25  ALA A CA   6  
ATOM 10134 C C    . ALA A 1 25  ? -5.741  -3.107  12.517  1.00 0.00 ? 25  ALA A C    6  
ATOM 10135 O O    . ALA A 1 25  ? -5.624  -3.005  11.297  1.00 0.00 ? 25  ALA A O    6  
ATOM 10136 C CB   . ALA A 1 25  ? -4.779  -5.208  13.604  1.00 0.00 ? 25  ALA A CB   6  
ATOM 10137 H H    . ALA A 1 25  ? -6.596  -5.360  11.312  1.00 0.00 ? 25  ALA A H    6  
ATOM 10138 H HA   . ALA A 1 25  ? -6.660  -4.256  14.053  1.00 0.00 ? 25  ALA A HA   6  
ATOM 10139 H HB1  . ALA A 1 25  ? -4.141  -5.386  12.739  1.00 0.00 ? 25  ALA A HB1  6  
ATOM 10140 H HB2  . ALA A 1 25  ? -4.236  -4.611  14.337  1.00 0.00 ? 25  ALA A HB2  6  
ATOM 10141 H HB3  . ALA A 1 25  ? -5.036  -6.170  14.049  1.00 0.00 ? 25  ALA A HB3  6  
ATOM 10142 N N    . LEU A 1 26  ? -5.587  -2.071  13.346  1.00 0.00 ? 26  LEU A N    6  
ATOM 10143 C CA   . LEU A 1 26  ? -5.244  -0.692  12.988  1.00 0.00 ? 26  LEU A CA   6  
ATOM 10144 C C    . LEU A 1 26  ? -3.828  -0.395  13.492  1.00 0.00 ? 26  LEU A C    6  
ATOM 10145 O O    . LEU A 1 26  ? -3.583  -0.467  14.698  1.00 0.00 ? 26  LEU A O    6  
ATOM 10146 C CB   . LEU A 1 26  ? -6.291  0.228   13.658  1.00 0.00 ? 26  LEU A CB   6  
ATOM 10147 C CG   . LEU A 1 26  ? -6.422  1.686   13.167  1.00 0.00 ? 26  LEU A CG   6  
ATOM 10148 C CD1  . LEU A 1 26  ? -5.118  2.490   13.212  1.00 0.00 ? 26  LEU A CD1  6  
ATOM 10149 C CD2  . LEU A 1 26  ? -7.026  1.749   11.761  1.00 0.00 ? 26  LEU A CD2  6  
ATOM 10150 H H    . LEU A 1 26  ? -5.710  -2.258  14.339  1.00 0.00 ? 26  LEU A H    6  
ATOM 10151 H HA   . LEU A 1 26  ? -5.281  -0.568  11.905  1.00 0.00 ? 26  LEU A HA   6  
ATOM 10152 H HB2  . LEU A 1 26  ? -7.272  -0.234  13.544  1.00 0.00 ? 26  LEU A HB2  6  
ATOM 10153 H HB3  . LEU A 1 26  ? -6.096  0.255   14.730  1.00 0.00 ? 26  LEU A HB3  6  
ATOM 10154 H HG   . LEU A 1 26  ? -7.112  2.178   13.848  1.00 0.00 ? 26  LEU A HG   6  
ATOM 10155 H HD11 . LEU A 1 26  ? -4.451  2.183   12.408  1.00 0.00 ? 26  LEU A HD11 6  
ATOM 10156 H HD12 . LEU A 1 26  ? -5.347  3.550   13.093  1.00 0.00 ? 26  LEU A HD12 6  
ATOM 10157 H HD13 . LEU A 1 26  ? -4.624  2.347   14.170  1.00 0.00 ? 26  LEU A HD13 6  
ATOM 10158 H HD21 . LEU A 1 26  ? -7.247  2.785   11.500  1.00 0.00 ? 26  LEU A HD21 6  
ATOM 10159 H HD22 . LEU A 1 26  ? -6.323  1.346   11.031  1.00 0.00 ? 26  LEU A HD22 6  
ATOM 10160 H HD23 . LEU A 1 26  ? -7.953  1.174   11.719  1.00 0.00 ? 26  LEU A HD23 6  
ATOM 10161 N N    . TYR A 1 27  ? -2.895  -0.051  12.602  1.00 0.00 ? 27  TYR A N    6  
ATOM 10162 C CA   . TYR A 1 27  ? -1.506  0.296   12.967  1.00 0.00 ? 27  TYR A CA   6  
ATOM 10163 C C    . TYR A 1 27  ? -1.423  1.690   13.631  1.00 0.00 ? 27  TYR A C    6  
ATOM 10164 O O    . TYR A 1 27  ? -1.345  2.713   12.948  1.00 0.00 ? 27  TYR A O    6  
ATOM 10165 C CB   . TYR A 1 27  ? -0.636  0.176   11.700  1.00 0.00 ? 27  TYR A CB   6  
ATOM 10166 C CG   . TYR A 1 27  ? 0.846   -0.103  11.900  1.00 0.00 ? 27  TYR A CG   6  
ATOM 10167 C CD1  . TYR A 1 27  ? 1.261   -1.334  12.443  1.00 0.00 ? 27  TYR A CD1  6  
ATOM 10168 C CD2  . TYR A 1 27  ? 1.819   0.802   11.426  1.00 0.00 ? 27  TYR A CD2  6  
ATOM 10169 C CE1  . TYR A 1 27  ? 2.628   -1.671  12.483  1.00 0.00 ? 27  TYR A CE1  6  
ATOM 10170 C CE2  . TYR A 1 27  ? 3.185   0.474   11.457  1.00 0.00 ? 27  TYR A CE2  6  
ATOM 10171 C CZ   . TYR A 1 27  ? 3.592   -0.775  11.970  1.00 0.00 ? 27  TYR A CZ   6  
ATOM 10172 O OH   . TYR A 1 27  ? 4.908   -1.130  11.953  1.00 0.00 ? 27  TYR A OH   6  
ATOM 10173 H H    . TYR A 1 27  ? -3.148  -0.046  11.618  1.00 0.00 ? 27  TYR A H    6  
ATOM 10174 H HA   . TYR A 1 27  ? -1.144  -0.436  13.688  1.00 0.00 ? 27  TYR A HA   6  
ATOM 10175 H HB2  . TYR A 1 27  ? -1.030  -0.632  11.087  1.00 0.00 ? 27  TYR A HB2  6  
ATOM 10176 H HB3  . TYR A 1 27  ? -0.761  1.072   11.104  1.00 0.00 ? 27  TYR A HB3  6  
ATOM 10177 H HD1  . TYR A 1 27  ? 0.529   -2.047  12.791  1.00 0.00 ? 27  TYR A HD1  6  
ATOM 10178 H HD2  . TYR A 1 27  ? 1.523   1.744   11.004  1.00 0.00 ? 27  TYR A HD2  6  
ATOM 10179 H HE1  . TYR A 1 27  ? 2.941   -2.629  12.874  1.00 0.00 ? 27  TYR A HE1  6  
ATOM 10180 H HE2  . TYR A 1 27  ? 3.919   1.168   11.066  1.00 0.00 ? 27  TYR A HE2  6  
ATOM 10181 H HH   . TYR A 1 27  ? 5.476   -0.457  11.565  1.00 0.00 ? 27  TYR A HH   6  
ATOM 10182 N N    . ILE A 1 28  ? -1.484  1.759   14.968  1.00 0.00 ? 28  ILE A N    6  
ATOM 10183 C CA   . ILE A 1 28  ? -1.481  3.037   15.726  1.00 0.00 ? 28  ILE A CA   6  
ATOM 10184 C C    . ILE A 1 28  ? -0.090  3.647   15.947  1.00 0.00 ? 28  ILE A C    6  
ATOM 10185 O O    . ILE A 1 28  ? 0.017   4.848   16.206  1.00 0.00 ? 28  ILE A O    6  
ATOM 10186 C CB   . ILE A 1 28  ? -2.210  2.911   17.082  1.00 0.00 ? 28  ILE A CB   6  
ATOM 10187 C CG1  . ILE A 1 28  ? -1.676  1.743   17.943  1.00 0.00 ? 28  ILE A CG1  6  
ATOM 10188 C CG2  . ILE A 1 28  ? -3.725  2.811   16.847  1.00 0.00 ? 28  ILE A CG2  6  
ATOM 10189 C CD1  . ILE A 1 28  ? -1.961  1.917   19.440  1.00 0.00 ? 28  ILE A CD1  6  
ATOM 10190 H H    . ILE A 1 28  ? -1.566  0.882   15.472  1.00 0.00 ? 28  ILE A H    6  
ATOM 10191 H HA   . ILE A 1 28  ? -2.010  3.788   15.137  1.00 0.00 ? 28  ILE A HA   6  
ATOM 10192 H HB   . ILE A 1 28  ? -2.036  3.838   17.633  1.00 0.00 ? 28  ILE A HB   6  
ATOM 10193 H HG12 . ILE A 1 28  ? -2.119  0.806   17.605  1.00 0.00 ? 28  ILE A HG12 6  
ATOM 10194 H HG13 . ILE A 1 28  ? -0.594  1.669   17.834  1.00 0.00 ? 28  ILE A HG13 6  
ATOM 10195 H HG21 . ILE A 1 28  ? -4.061  3.617   16.195  1.00 0.00 ? 28  ILE A HG21 6  
ATOM 10196 H HG22 . ILE A 1 28  ? -3.976  1.854   16.387  1.00 0.00 ? 28  ILE A HG22 6  
ATOM 10197 H HG23 . ILE A 1 28  ? -4.249  2.913   17.794  1.00 0.00 ? 28  ILE A HG23 6  
ATOM 10198 H HD11 . ILE A 1 28  ? -3.019  2.101   19.610  1.00 0.00 ? 28  ILE A HD11 6  
ATOM 10199 H HD12 . ILE A 1 28  ? -1.659  1.013   19.974  1.00 0.00 ? 28  ILE A HD12 6  
ATOM 10200 H HD13 . ILE A 1 28  ? -1.392  2.763   19.827  1.00 0.00 ? 28  ILE A HD13 6  
ATOM 10201 N N    . GLY A 1 29  ? 0.965   2.838   15.858  1.00 0.00 ? 29  GLY A N    6  
ATOM 10202 C CA   . GLY A 1 29  ? 2.359   3.260   16.003  1.00 0.00 ? 29  GLY A CA   6  
ATOM 10203 C C    . GLY A 1 29  ? 3.296   2.284   15.314  1.00 0.00 ? 29  GLY A C    6  
ATOM 10204 O O    . GLY A 1 29  ? 2.845   1.293   14.744  1.00 0.00 ? 29  GLY A O    6  
ATOM 10205 H H    . GLY A 1 29  ? 0.810   1.866   15.615  1.00 0.00 ? 29  GLY A H    6  
ATOM 10206 H HA2  . GLY A 1 29  ? 2.505   4.256   15.581  1.00 0.00 ? 29  GLY A HA2  6  
ATOM 10207 H HA3  . GLY A 1 29  ? 2.618   3.305   17.061  1.00 0.00 ? 29  GLY A HA3  6  
ATOM 10208 N N    . ASP A 1 30  ? 4.601   2.538   15.382  1.00 0.00 ? 30  ASP A N    6  
ATOM 10209 C CA   . ASP A 1 30  ? 5.596   1.675   14.745  1.00 0.00 ? 30  ASP A CA   6  
ATOM 10210 C C    . ASP A 1 30  ? 5.676   0.308   15.463  1.00 0.00 ? 30  ASP A C    6  
ATOM 10211 O O    . ASP A 1 30  ? 6.320   0.150   16.507  1.00 0.00 ? 30  ASP A O    6  
ATOM 10212 C CB   . ASP A 1 30  ? 6.954   2.386   14.686  1.00 0.00 ? 30  ASP A CB   6  
ATOM 10213 C CG   . ASP A 1 30  ? 8.019   1.532   13.979  1.00 0.00 ? 30  ASP A CG   6  
ATOM 10214 O OD1  . ASP A 1 30  ? 7.746   1.046   12.855  1.00 0.00 ? 30  ASP A OD1  6  
ATOM 10215 O OD2  . ASP A 1 30  ? 9.130   1.369   14.538  1.00 0.00 ? 30  ASP A OD2  6  
ATOM 10216 H H    . ASP A 1 30  ? 4.917   3.366   15.870  1.00 0.00 ? 30  ASP A H    6  
ATOM 10217 H HA   . ASP A 1 30  ? 5.260   1.519   13.710  1.00 0.00 ? 30  ASP A HA   6  
ATOM 10218 H HB2  . ASP A 1 30  ? 6.836   3.326   14.141  1.00 0.00 ? 30  ASP A HB2  6  
ATOM 10219 H HB3  . ASP A 1 30  ? 7.286   2.622   15.699  1.00 0.00 ? 30  ASP A HB3  6  
ATOM 10220 N N    . GLY A 1 31  ? 4.964   -0.674  14.910  1.00 0.00 ? 31  GLY A N    6  
ATOM 10221 C CA   . GLY A 1 31  ? 4.787   -2.021  15.450  1.00 0.00 ? 31  GLY A CA   6  
ATOM 10222 C C    . GLY A 1 31  ? 3.665   -2.148  16.481  1.00 0.00 ? 31  GLY A C    6  
ATOM 10223 O O    . GLY A 1 31  ? 3.442   -3.253  16.959  1.00 0.00 ? 31  GLY A O    6  
ATOM 10224 H H    . GLY A 1 31  ? 4.445   -0.444  14.074  1.00 0.00 ? 31  GLY A H    6  
ATOM 10225 H HA2  . GLY A 1 31  ? 4.543   -2.694  14.629  1.00 0.00 ? 31  GLY A HA2  6  
ATOM 10226 H HA3  . GLY A 1 31  ? 5.710   -2.344  15.923  1.00 0.00 ? 31  GLY A HA3  6  
ATOM 10227 N N    . TYR A 1 32  ? 2.948   -1.075  16.824  1.00 0.00 ? 32  TYR A N    6  
ATOM 10228 C CA   . TYR A 1 32  ? 1.812   -1.092  17.763  1.00 0.00 ? 32  TYR A CA   6  
ATOM 10229 C C    . TYR A 1 32  ? 0.457   -1.109  17.034  1.00 0.00 ? 32  TYR A C    6  
ATOM 10230 O O    . TYR A 1 32  ? 0.264   -0.389  16.052  1.00 0.00 ? 32  TYR A O    6  
ATOM 10231 C CB   . TYR A 1 32  ? 1.898   0.114   18.706  1.00 0.00 ? 32  TYR A CB   6  
ATOM 10232 C CG   . TYR A 1 32  ? 2.984   -0.002  19.757  1.00 0.00 ? 32  TYR A CG   6  
ATOM 10233 C CD1  . TYR A 1 32  ? 2.768   -0.800  20.898  1.00 0.00 ? 32  TYR A CD1  6  
ATOM 10234 C CD2  . TYR A 1 32  ? 4.202   0.688   19.600  1.00 0.00 ? 32  TYR A CD2  6  
ATOM 10235 C CE1  . TYR A 1 32  ? 3.764   -0.898  21.888  1.00 0.00 ? 32  TYR A CE1  6  
ATOM 10236 C CE2  . TYR A 1 32  ? 5.200   0.598   20.591  1.00 0.00 ? 32  TYR A CE2  6  
ATOM 10237 C CZ   . TYR A 1 32  ? 4.982   -0.198  21.739  1.00 0.00 ? 32  TYR A CZ   6  
ATOM 10238 O OH   . TYR A 1 32  ? 5.944   -0.309  22.697  1.00 0.00 ? 32  TYR A OH   6  
ATOM 10239 H H    . TYR A 1 32  ? 3.141   -0.214  16.324  1.00 0.00 ? 32  TYR A H    6  
ATOM 10240 H HA   . TYR A 1 32  ? 1.871   -1.987  18.382  1.00 0.00 ? 32  TYR A HA   6  
ATOM 10241 H HB2  . TYR A 1 32  ? 2.044   1.025   18.123  1.00 0.00 ? 32  TYR A HB2  6  
ATOM 10242 H HB3  . TYR A 1 32  ? 0.950   0.214   19.237  1.00 0.00 ? 32  TYR A HB3  6  
ATOM 10243 H HD1  . TYR A 1 32  ? 1.838   -1.344  21.019  1.00 0.00 ? 32  TYR A HD1  6  
ATOM 10244 H HD2  . TYR A 1 32  ? 4.370   1.295   18.718  1.00 0.00 ? 32  TYR A HD2  6  
ATOM 10245 H HE1  . TYR A 1 32  ? 3.598   -1.511  22.764  1.00 0.00 ? 32  TYR A HE1  6  
ATOM 10246 H HE2  . TYR A 1 32  ? 6.131   1.137   20.473  1.00 0.00 ? 32  TYR A HE2  6  
ATOM 10247 H HH   . TYR A 1 32  ? 6.727   0.218   22.504  1.00 0.00 ? 32  TYR A HH   6  
ATOM 10248 N N    . VAL A 1 33  ? -0.502  -1.898  17.535  1.00 0.00 ? 33  VAL A N    6  
ATOM 10249 C CA   . VAL A 1 33  ? -1.806  -2.132  16.888  1.00 0.00 ? 33  VAL A CA   6  
ATOM 10250 C C    . VAL A 1 33  ? -2.987  -2.144  17.857  1.00 0.00 ? 33  VAL A C    6  
ATOM 10251 O O    . VAL A 1 33  ? -2.866  -2.541  19.013  1.00 0.00 ? 33  VAL A O    6  
ATOM 10252 C CB   . VAL A 1 33  ? -1.847  -3.457  16.085  1.00 0.00 ? 33  VAL A CB   6  
ATOM 10253 C CG1  . VAL A 1 33  ? -0.980  -3.380  14.822  1.00 0.00 ? 33  VAL A CG1  6  
ATOM 10254 C CG2  . VAL A 1 33  ? -1.448  -4.706  16.894  1.00 0.00 ? 33  VAL A CG2  6  
ATOM 10255 H H    . VAL A 1 33  ? -0.305  -2.434  18.387  1.00 0.00 ? 33  VAL A H    6  
ATOM 10256 H HA   . VAL A 1 33  ? -1.974  -1.313  16.194  1.00 0.00 ? 33  VAL A HA   6  
ATOM 10257 H HB   . VAL A 1 33  ? -2.870  -3.606  15.751  1.00 0.00 ? 33  VAL A HB   6  
ATOM 10258 H HG11 . VAL A 1 33  ? -1.338  -2.572  14.188  1.00 0.00 ? 33  VAL A HG11 6  
ATOM 10259 H HG12 . VAL A 1 33  ? 0.063   -3.205  15.087  1.00 0.00 ? 33  VAL A HG12 6  
ATOM 10260 H HG13 . VAL A 1 33  ? -1.063  -4.314  14.268  1.00 0.00 ? 33  VAL A HG13 6  
ATOM 10261 H HG21 . VAL A 1 33  ? -1.575  -5.598  16.281  1.00 0.00 ? 33  VAL A HG21 6  
ATOM 10262 H HG22 . VAL A 1 33  ? -0.405  -4.645  17.199  1.00 0.00 ? 33  VAL A HG22 6  
ATOM 10263 H HG23 . VAL A 1 33  ? -2.072  -4.811  17.784  1.00 0.00 ? 33  VAL A HG23 6  
ATOM 10264 N N    . ILE A 1 34  ? -4.145  -1.731  17.344  1.00 0.00 ? 34  ILE A N    6  
ATOM 10265 C CA   . ILE A 1 34  ? -5.458  -1.878  17.992  1.00 0.00 ? 34  ILE A CA   6  
ATOM 10266 C C    . ILE A 1 34  ? -6.205  -2.923  17.166  1.00 0.00 ? 34  ILE A C    6  
ATOM 10267 O O    . ILE A 1 34  ? -6.244  -2.806  15.947  1.00 0.00 ? 34  ILE A O    6  
ATOM 10268 C CB   . ILE A 1 34  ? -6.217  -0.535  18.034  1.00 0.00 ? 34  ILE A CB   6  
ATOM 10269 C CG1  . ILE A 1 34  ? -5.455  0.531   18.844  1.00 0.00 ? 34  ILE A CG1  6  
ATOM 10270 C CG2  . ILE A 1 34  ? -7.645  -0.716  18.582  1.00 0.00 ? 34  ILE A CG2  6  
ATOM 10271 C CD1  . ILE A 1 34  ? -5.231  0.218   20.326  1.00 0.00 ? 34  ILE A CD1  6  
ATOM 10272 H H    . ILE A 1 34  ? -4.132  -1.387  16.382  1.00 0.00 ? 34  ILE A H    6  
ATOM 10273 H HA   . ILE A 1 34  ? -5.346  -2.259  19.007  1.00 0.00 ? 34  ILE A HA   6  
ATOM 10274 H HB   . ILE A 1 34  ? -6.302  -0.161  17.012  1.00 0.00 ? 34  ILE A HB   6  
ATOM 10275 H HG12 . ILE A 1 34  ? -4.477  0.662   18.390  1.00 0.00 ? 34  ILE A HG12 6  
ATOM 10276 H HG13 . ILE A 1 34  ? -5.988  1.478   18.770  1.00 0.00 ? 34  ILE A HG13 6  
ATOM 10277 H HG21 . ILE A 1 34  ? -8.116  0.259   18.723  1.00 0.00 ? 34  ILE A HG21 6  
ATOM 10278 H HG22 . ILE A 1 34  ? -8.252  -1.286  17.876  1.00 0.00 ? 34  ILE A HG22 6  
ATOM 10279 H HG23 . ILE A 1 34  ? -7.622  -1.241  19.537  1.00 0.00 ? 34  ILE A HG23 6  
ATOM 10280 H HD11 . ILE A 1 34  ? -4.578  -0.647  20.423  1.00 0.00 ? 34  ILE A HD11 6  
ATOM 10281 H HD12 . ILE A 1 34  ? -4.760  1.074   20.809  1.00 0.00 ? 34  ILE A HD12 6  
ATOM 10282 H HD13 . ILE A 1 34  ? -6.174  0.026   20.823  1.00 0.00 ? 34  ILE A HD13 6  
ATOM 10283 N N    . HIS A 1 35  ? -6.768  -3.957  17.776  1.00 0.00 ? 35  HIS A N    6  
ATOM 10284 C CA   . HIS A 1 35  ? -7.309  -5.107  17.047  1.00 0.00 ? 35  HIS A CA   6  
ATOM 10285 C C    . HIS A 1 35  ? -8.557  -5.682  17.728  1.00 0.00 ? 35  HIS A C    6  
ATOM 10286 O O    . HIS A 1 35  ? -8.683  -5.623  18.949  1.00 0.00 ? 35  HIS A O    6  
ATOM 10287 C CB   . HIS A 1 35  ? -6.197  -6.165  16.910  1.00 0.00 ? 35  HIS A CB   6  
ATOM 10288 C CG   . HIS A 1 35  ? -5.710  -6.745  18.218  1.00 0.00 ? 35  HIS A CG   6  
ATOM 10289 N ND1  . HIS A 1 35  ? -6.027  -7.983  18.732  1.00 0.00 ? 35  HIS A ND1  6  
ATOM 10290 C CD2  . HIS A 1 35  ? -4.862  -6.146  19.114  1.00 0.00 ? 35  HIS A CD2  6  
ATOM 10291 C CE1  . HIS A 1 35  ? -5.394  -8.119  19.911  1.00 0.00 ? 35  HIS A CE1  6  
ATOM 10292 N NE2  . HIS A 1 35  ? -4.679  -7.017  20.194  1.00 0.00 ? 35  HIS A NE2  6  
ATOM 10293 H H    . HIS A 1 35  ? -6.762  -4.003  18.792  1.00 0.00 ? 35  HIS A H    6  
ATOM 10294 H HA   . HIS A 1 35  ? -7.612  -4.794  16.046  1.00 0.00 ? 35  HIS A HA   6  
ATOM 10295 H HB2  . HIS A 1 35  ? -6.556  -6.980  16.278  1.00 0.00 ? 35  HIS A HB2  6  
ATOM 10296 H HB3  . HIS A 1 35  ? -5.342  -5.714  16.407  1.00 0.00 ? 35  HIS A HB3  6  
ATOM 10297 H HD1  . HIS A 1 35  ? -6.630  -8.676  18.306  1.00 0.00 ? 35  HIS A HD1  6  
ATOM 10298 H HD2  . HIS A 1 35  ? -4.418  -5.165  19.008  1.00 0.00 ? 35  HIS A HD2  6  
ATOM 10299 H HE1  . HIS A 1 35  ? -5.461  -8.995  20.544  1.00 0.00 ? 35  HIS A HE1  6  
ATOM 10300 N N    . LEU A 1 36  ? -9.478  -6.248  16.945  1.00 0.00 ? 36  LEU A N    6  
ATOM 10301 C CA   . LEU A 1 36  ? -10.692 -6.879  17.463  1.00 0.00 ? 36  LEU A CA   6  
ATOM 10302 C C    . LEU A 1 36  ? -10.447 -8.366  17.722  1.00 0.00 ? 36  LEU A C    6  
ATOM 10303 O O    . LEU A 1 36  ? -10.073 -9.108  16.814  1.00 0.00 ? 36  LEU A O    6  
ATOM 10304 C CB   . LEU A 1 36  ? -11.841 -6.645  16.463  1.00 0.00 ? 36  LEU A CB   6  
ATOM 10305 C CG   . LEU A 1 36  ? -13.196 -7.276  16.850  1.00 0.00 ? 36  LEU A CG   6  
ATOM 10306 C CD1  . LEU A 1 36  ? -13.695 -6.749  18.202  1.00 0.00 ? 36  LEU A CD1  6  
ATOM 10307 C CD2  . LEU A 1 36  ? -14.230 -6.971  15.763  1.00 0.00 ? 36  LEU A CD2  6  
ATOM 10308 H H    . LEU A 1 36  ? -9.315  -6.297  15.949  1.00 0.00 ? 36  LEU A H    6  
ATOM 10309 H HA   . LEU A 1 36  ? -10.961 -6.407  18.412  1.00 0.00 ? 36  LEU A HA   6  
ATOM 10310 H HB2  . LEU A 1 36  ? -11.991 -5.569  16.366  1.00 0.00 ? 36  LEU A HB2  6  
ATOM 10311 H HB3  . LEU A 1 36  ? -11.541 -7.031  15.486  1.00 0.00 ? 36  LEU A HB3  6  
ATOM 10312 H HG   . LEU A 1 36  ? -13.090 -8.359  16.915  1.00 0.00 ? 36  LEU A HG   6  
ATOM 10313 H HD11 . LEU A 1 36  ? -14.761 -6.946  18.318  1.00 0.00 ? 36  LEU A HD11 6  
ATOM 10314 H HD12 . LEU A 1 36  ? -13.162 -7.250  19.004  1.00 0.00 ? 36  LEU A HD12 6  
ATOM 10315 H HD13 . LEU A 1 36  ? -13.526 -5.677  18.273  1.00 0.00 ? 36  LEU A HD13 6  
ATOM 10316 H HD21 . LEU A 1 36  ? -14.421 -5.901  15.722  1.00 0.00 ? 36  LEU A HD21 6  
ATOM 10317 H HD22 . LEU A 1 36  ? -13.860 -7.311  14.796  1.00 0.00 ? 36  LEU A HD22 6  
ATOM 10318 H HD23 . LEU A 1 36  ? -15.159 -7.495  15.982  1.00 0.00 ? 36  LEU A HD23 6  
ATOM 10319 N N    . ALA A 1 37  ? -10.690 -8.805  18.954  1.00 0.00 ? 37  ALA A N    6  
ATOM 10320 C CA   . ALA A 1 37  ? -10.734 -10.208 19.348  1.00 0.00 ? 37  ALA A CA   6  
ATOM 10321 C C    . ALA A 1 37  ? -12.184 -10.712 19.123  1.00 0.00 ? 37  ALA A C    6  
ATOM 10322 O O    . ALA A 1 37  ? -13.074 -10.212 19.819  1.00 0.00 ? 37  ALA A O    6  
ATOM 10323 C CB   . ALA A 1 37  ? -10.282 -10.293 20.815  1.00 0.00 ? 37  ALA A CB   6  
ATOM 10324 H H    . ALA A 1 37  ? -10.958 -8.121  19.660  1.00 0.00 ? 37  ALA A H    6  
ATOM 10325 H HA   . ALA A 1 37  ? -10.024 -10.786 18.759  1.00 0.00 ? 37  ALA A HA   6  
ATOM 10326 H HB1  . ALA A 1 37  ? -9.270  -9.895  20.906  1.00 0.00 ? 37  ALA A HB1  6  
ATOM 10327 H HB2  . ALA A 1 37  ? -10.944 -9.708  21.458  1.00 0.00 ? 37  ALA A HB2  6  
ATOM 10328 H HB3  . ALA A 1 37  ? -10.288 -11.332 21.148  1.00 0.00 ? 37  ALA A HB3  6  
ATOM 10329 N N    . PRO A 1 38  ? -12.454 -11.613 18.148  1.00 0.00 ? 38  PRO A N    6  
ATOM 10330 C CA   . PRO A 1 38  ? -13.812 -12.016 17.754  1.00 0.00 ? 38  PRO A CA   6  
ATOM 10331 C C    . PRO A 1 38  ? -14.610 -12.714 18.875  1.00 0.00 ? 38  PRO A C    6  
ATOM 10332 O O    . PRO A 1 38  ? -14.016 -13.158 19.863  1.00 0.00 ? 38  PRO A O    6  
ATOM 10333 C CB   . PRO A 1 38  ? -13.642 -12.946 16.541  1.00 0.00 ? 38  PRO A CB   6  
ATOM 10334 C CG   . PRO A 1 38  ? -12.288 -12.558 15.969  1.00 0.00 ? 38  PRO A CG   6  
ATOM 10335 C CD   . PRO A 1 38  ? -11.496 -12.205 17.222  1.00 0.00 ? 38  PRO A CD   6  
ATOM 10336 H HA   . PRO A 1 38  ? -14.345 -11.119 17.435  1.00 0.00 ? 38  PRO A HA   6  
ATOM 10337 H HB2  . PRO A 1 38  ? -13.610 -13.986 16.870  1.00 0.00 ? 38  PRO A HB2  6  
ATOM 10338 H HB3  . PRO A 1 38  ? -14.427 -12.807 15.796  1.00 0.00 ? 38  PRO A HB3  6  
ATOM 10339 H HG2  . PRO A 1 38  ? -11.835 -13.378 15.412  1.00 0.00 ? 38  PRO A HG2  6  
ATOM 10340 H HG3  . PRO A 1 38  ? -12.391 -11.675 15.334  1.00 0.00 ? 38  PRO A HG3  6  
ATOM 10341 H HD2  . PRO A 1 38  ? -11.079 -13.113 17.660  1.00 0.00 ? 38  PRO A HD2  6  
ATOM 10342 H HD3  . PRO A 1 38  ? -10.703 -11.515 16.949  1.00 0.00 ? 38  PRO A HD3  6  
ATOM 10343 N N    . PRO A 1 39  ? -15.946 -12.856 18.726  1.00 0.00 ? 39  PRO A N    6  
ATOM 10344 C CA   . PRO A 1 39  ? -16.791 -13.541 19.701  1.00 0.00 ? 39  PRO A CA   6  
ATOM 10345 C C    . PRO A 1 39  ? -16.628 -15.066 19.602  1.00 0.00 ? 39  PRO A C    6  
ATOM 10346 O O    . PRO A 1 39  ? -16.191 -15.603 18.585  1.00 0.00 ? 39  PRO A O    6  
ATOM 10347 C CB   . PRO A 1 39  ? -18.219 -13.094 19.376  1.00 0.00 ? 39  PRO A CB   6  
ATOM 10348 C CG   . PRO A 1 39  ? -18.186 -12.862 17.867  1.00 0.00 ? 39  PRO A CG   6  
ATOM 10349 C CD   . PRO A 1 39  ? -16.743 -12.456 17.569  1.00 0.00 ? 39  PRO A CD   6  
ATOM 10350 H HA   . PRO A 1 39  ? -16.533 -13.221 20.713  1.00 0.00 ? 39  PRO A HA   6  
ATOM 10351 H HB2  . PRO A 1 39  ? -18.965 -13.844 19.656  1.00 0.00 ? 39  PRO A HB2  6  
ATOM 10352 H HB3  . PRO A 1 39  ? -18.426 -12.150 19.884  1.00 0.00 ? 39  PRO A HB3  6  
ATOM 10353 H HG2  . PRO A 1 39  ? -18.405 -13.796 17.351  1.00 0.00 ? 39  PRO A HG2  6  
ATOM 10354 H HG3  . PRO A 1 39  ? -18.886 -12.086 17.552  1.00 0.00 ? 39  PRO A HG3  6  
ATOM 10355 H HD2  . PRO A 1 39  ? -16.411 -12.975 16.673  1.00 0.00 ? 39  PRO A HD2  6  
ATOM 10356 H HD3  . PRO A 1 39  ? -16.681 -11.379 17.411  1.00 0.00 ? 39  PRO A HD3  6  
ATOM 10357 N N    . SER A 1 40  ? -17.011 -15.781 20.664  1.00 0.00 ? 40  SER A N    6  
ATOM 10358 C CA   . SER A 1 40  ? -16.867 -17.250 20.757  1.00 0.00 ? 40  SER A CA   6  
ATOM 10359 C C    . SER A 1 40  ? -17.973 -18.032 20.008  1.00 0.00 ? 40  SER A C    6  
ATOM 10360 O O    . SER A 1 40  ? -18.022 -19.263 20.077  1.00 0.00 ? 40  SER A O    6  
ATOM 10361 C CB   . SER A 1 40  ? -16.802 -17.678 22.234  1.00 0.00 ? 40  SER A CB   6  
ATOM 10362 O OG   . SER A 1 40  ? -15.776 -16.989 22.947  1.00 0.00 ? 40  SER A OG   6  
ATOM 10363 H H    . SER A 1 40  ? -17.338 -15.293 21.489  1.00 0.00 ? 40  SER A H    6  
ATOM 10364 H HA   . SER A 1 40  ? -15.922 -17.539 20.294  1.00 0.00 ? 40  SER A HA   6  
ATOM 10365 H HB2  . SER A 1 40  ? -17.764 -17.471 22.704  1.00 0.00 ? 40  SER A HB2  6  
ATOM 10366 H HB3  . SER A 1 40  ? -16.619 -18.751 22.295  1.00 0.00 ? 40  SER A HB3  6  
ATOM 10367 H HG   . SER A 1 40  ? -14.916 -17.356 22.686  1.00 0.00 ? 40  SER A HG   6  
ATOM 10368 N N    . GLU A 1 41  ? -18.855 -17.331 19.285  1.00 0.00 ? 41  GLU A N    6  
ATOM 10369 C CA   . GLU A 1 41  ? -19.948 -17.888 18.481  1.00 0.00 ? 41  GLU A CA   6  
ATOM 10370 C C    . GLU A 1 41  ? -19.896 -17.366 17.035  1.00 0.00 ? 41  GLU A C    6  
ATOM 10371 O O    . GLU A 1 41  ? -19.449 -16.247 16.772  1.00 0.00 ? 41  GLU A O    6  
ATOM 10372 C CB   . GLU A 1 41  ? -21.316 -17.504 19.073  1.00 0.00 ? 41  GLU A CB   6  
ATOM 10373 C CG   . GLU A 1 41  ? -21.519 -17.944 20.527  1.00 0.00 ? 41  GLU A CG   6  
ATOM 10374 C CD   . GLU A 1 41  ? -22.902 -17.507 21.020  1.00 0.00 ? 41  GLU A CD   6  
ATOM 10375 O OE1  . GLU A 1 41  ? -23.029 -16.342 21.468  1.00 0.00 ? 41  GLU A OE1  6  
ATOM 10376 O OE2  . GLU A 1 41  ? -23.858 -18.314 20.970  1.00 0.00 ? 41  GLU A OE2  6  
ATOM 10377 H H    . GLU A 1 41  ? -18.688 -16.336 19.202  1.00 0.00 ? 41  GLU A H    6  
ATOM 10378 H HA   . GLU A 1 41  ? -19.875 -18.976 18.459  1.00 0.00 ? 41  GLU A HA   6  
ATOM 10379 H HB2  . GLU A 1 41  ? -21.436 -16.423 19.015  1.00 0.00 ? 41  GLU A HB2  6  
ATOM 10380 H HB3  . GLU A 1 41  ? -22.093 -17.965 18.461  1.00 0.00 ? 41  GLU A HB3  6  
ATOM 10381 H HG2  . GLU A 1 41  ? -21.425 -19.026 20.597  1.00 0.00 ? 41  GLU A HG2  6  
ATOM 10382 H HG3  . GLU A 1 41  ? -20.754 -17.487 21.158  1.00 0.00 ? 41  GLU A HG3  6  
ATOM 10383 N N    . TYR A 1 42  ? -20.421 -18.164 16.104  1.00 0.00 ? 42  TYR A N    6  
ATOM 10384 C CA   . TYR A 1 42  ? -20.489 -17.890 14.659  1.00 0.00 ? 42  TYR A CA   6  
ATOM 10385 C C    . TYR A 1 42  ? -21.568 -18.780 13.992  1.00 0.00 ? 42  TYR A C    6  
ATOM 10386 O O    . TYR A 1 42  ? -21.932 -19.810 14.574  1.00 0.00 ? 42  TYR A O    6  
ATOM 10387 C CB   . TYR A 1 42  ? -19.085 -18.076 14.036  1.00 0.00 ? 42  TYR A CB   6  
ATOM 10388 C CG   . TYR A 1 42  ? -18.451 -19.445 14.221  1.00 0.00 ? 42  TYR A CG   6  
ATOM 10389 C CD1  . TYR A 1 42  ? -18.658 -20.460 13.265  1.00 0.00 ? 42  TYR A CD1  6  
ATOM 10390 C CD2  . TYR A 1 42  ? -17.632 -19.696 15.340  1.00 0.00 ? 42  TYR A CD2  6  
ATOM 10391 C CE1  . TYR A 1 42  ? -18.058 -21.723 13.430  1.00 0.00 ? 42  TYR A CE1  6  
ATOM 10392 C CE2  . TYR A 1 42  ? -17.034 -20.959 15.515  1.00 0.00 ? 42  TYR A CE2  6  
ATOM 10393 C CZ   . TYR A 1 42  ? -17.248 -21.980 14.559  1.00 0.00 ? 42  TYR A CZ   6  
ATOM 10394 O OH   . TYR A 1 42  ? -16.685 -23.208 14.726  1.00 0.00 ? 42  TYR A OH   6  
ATOM 10395 H H    . TYR A 1 42  ? -20.797 -19.054 16.404  1.00 0.00 ? 42  TYR A H    6  
ATOM 10396 H HA   . TYR A 1 42  ? -20.785 -16.848 14.522  1.00 0.00 ? 42  TYR A HA   6  
ATOM 10397 H HB2  . TYR A 1 42  ? -19.127 -17.868 12.969  1.00 0.00 ? 42  TYR A HB2  6  
ATOM 10398 H HB3  . TYR A 1 42  ? -18.414 -17.331 14.463  1.00 0.00 ? 42  TYR A HB3  6  
ATOM 10399 H HD1  . TYR A 1 42  ? -19.274 -20.271 12.395  1.00 0.00 ? 42  TYR A HD1  6  
ATOM 10400 H HD2  . TYR A 1 42  ? -17.464 -18.917 16.073  1.00 0.00 ? 42  TYR A HD2  6  
ATOM 10401 H HE1  . TYR A 1 42  ? -18.219 -22.500 12.693  1.00 0.00 ? 42  TYR A HE1  6  
ATOM 10402 H HE2  . TYR A 1 42  ? -16.411 -21.143 16.379  1.00 0.00 ? 42  TYR A HE2  6  
ATOM 10403 H HH   . TYR A 1 42  ? -16.139 -23.260 15.518  1.00 0.00 ? 42  TYR A HH   6  
ATOM 10404 N N    . PRO A 1 43  ? -22.102 -18.423 12.803  1.00 0.00 ? 43  PRO A N    6  
ATOM 10405 C CA   . PRO A 1 43  ? -23.109 -19.235 12.124  1.00 0.00 ? 43  PRO A CA   6  
ATOM 10406 C C    . PRO A 1 43  ? -22.529 -20.609 11.760  1.00 0.00 ? 43  PRO A C    6  
ATOM 10407 O O    . PRO A 1 43  ? -21.536 -20.708 11.038  1.00 0.00 ? 43  PRO A O    6  
ATOM 10408 C CB   . PRO A 1 43  ? -23.558 -18.424 10.902  1.00 0.00 ? 43  PRO A CB   6  
ATOM 10409 C CG   . PRO A 1 43  ? -22.391 -17.472 10.643  1.00 0.00 ? 43  PRO A CG   6  
ATOM 10410 C CD   . PRO A 1 43  ? -21.848 -17.203 12.046  1.00 0.00 ? 43  PRO A CD   6  
ATOM 10411 H HA   . PRO A 1 43  ? -23.970 -19.369 12.783  1.00 0.00 ? 43  PRO A HA   6  
ATOM 10412 H HB2  . PRO A 1 43  ? -23.763 -19.057 10.039  1.00 0.00 ? 43  PRO A HB2  6  
ATOM 10413 H HB3  . PRO A 1 43  ? -24.445 -17.844 11.162  1.00 0.00 ? 43  PRO A HB3  6  
ATOM 10414 H HG2  . PRO A 1 43  ? -21.630 -17.980 10.047  1.00 0.00 ? 43  PRO A HG2  6  
ATOM 10415 H HG3  . PRO A 1 43  ? -22.717 -16.554 10.153  1.00 0.00 ? 43  PRO A HG3  6  
ATOM 10416 H HD2  . PRO A 1 43  ? -20.786 -16.962 11.984  1.00 0.00 ? 43  PRO A HD2  6  
ATOM 10417 H HD3  . PRO A 1 43  ? -22.397 -16.374 12.495  1.00 0.00 ? 43  PRO A HD3  6  
ATOM 10418 N N    . GLY A 1 44  ? -23.150 -21.669 12.296  1.00 0.00 ? 44  GLY A N    6  
ATOM 10419 C CA   . GLY A 1 44  ? -22.707 -23.061 12.132  1.00 0.00 ? 44  GLY A CA   6  
ATOM 10420 C C    . GLY A 1 44  ? -21.679 -23.553 13.159  1.00 0.00 ? 44  GLY A C    6  
ATOM 10421 O O    . GLY A 1 44  ? -21.076 -24.606 12.948  1.00 0.00 ? 44  GLY A O    6  
ATOM 10422 H H    . GLY A 1 44  ? -23.980 -21.509 12.854  1.00 0.00 ? 44  GLY A H    6  
ATOM 10423 H HA2  . GLY A 1 44  ? -23.576 -23.703 12.249  1.00 0.00 ? 44  GLY A HA2  6  
ATOM 10424 H HA3  . GLY A 1 44  ? -22.270 -23.191 11.143  1.00 0.00 ? 44  GLY A HA3  6  
ATOM 10425 N N    . ALA A 1 45  ? -21.482 -22.822 14.259  1.00 0.00 ? 45  ALA A N    6  
ATOM 10426 C CA   . ALA A 1 45  ? -20.608 -23.224 15.370  1.00 0.00 ? 45  ALA A CA   6  
ATOM 10427 C C    . ALA A 1 45  ? -21.102 -24.490 16.105  1.00 0.00 ? 45  ALA A C    6  
ATOM 10428 O O    . ALA A 1 45  ? -22.298 -24.789 16.120  1.00 0.00 ? 45  ALA A O    6  
ATOM 10429 C CB   . ALA A 1 45  ? -20.462 -22.047 16.345  1.00 0.00 ? 45  ALA A CB   6  
ATOM 10430 H H    . ALA A 1 45  ? -21.989 -21.950 14.330  1.00 0.00 ? 45  ALA A H    6  
ATOM 10431 H HA   . ALA A 1 45  ? -19.623 -23.456 14.960  1.00 0.00 ? 45  ALA A HA   6  
ATOM 10432 H HB1  . ALA A 1 45  ? -19.768 -22.310 17.144  1.00 0.00 ? 45  ALA A HB1  6  
ATOM 10433 H HB2  . ALA A 1 45  ? -20.065 -21.183 15.817  1.00 0.00 ? 45  ALA A HB2  6  
ATOM 10434 H HB3  . ALA A 1 45  ? -21.431 -21.792 16.776  1.00 0.00 ? 45  ALA A HB3  6  
ATOM 10435 N N    . GLY A 1 46  ? -20.171 -25.190 16.767  1.00 0.00 ? 46  GLY A N    6  
ATOM 10436 C CA   . GLY A 1 46  ? -20.416 -26.412 17.545  1.00 0.00 ? 46  GLY A CA   6  
ATOM 10437 C C    . GLY A 1 46  ? -20.176 -27.680 16.725  1.00 0.00 ? 46  GLY A C    6  
ATOM 10438 O O    . GLY A 1 46  ? -20.836 -27.911 15.715  1.00 0.00 ? 46  GLY A O    6  
ATOM 10439 H H    . GLY A 1 46  ? -19.215 -24.862 16.711  1.00 0.00 ? 46  GLY A H    6  
ATOM 10440 H HA2  . GLY A 1 46  ? -19.745 -26.424 18.406  1.00 0.00 ? 46  GLY A HA2  6  
ATOM 10441 H HA3  . GLY A 1 46  ? -21.446 -26.440 17.895  1.00 0.00 ? 46  GLY A HA3  6  
ATOM 10442 N N    . SER A 1 47  ? -19.242 -28.521 17.174  1.00 0.00 ? 47  SER A N    6  
ATOM 10443 C CA   . SER A 1 47  ? -18.786 -29.711 16.431  1.00 0.00 ? 47  SER A CA   6  
ATOM 10444 C C    . SER A 1 47  ? -19.651 -30.967 16.658  1.00 0.00 ? 47  SER A C    6  
ATOM 10445 O O    . SER A 1 47  ? -19.687 -31.855 15.803  1.00 0.00 ? 47  SER A O    6  
ATOM 10446 C CB   . SER A 1 47  ? -17.325 -30.000 16.810  1.00 0.00 ? 47  SER A CB   6  
ATOM 10447 O OG   . SER A 1 47  ? -17.152 -30.124 18.217  1.00 0.00 ? 47  SER A OG   6  
ATOM 10448 H H    . SER A 1 47  ? -18.715 -28.276 18.004  1.00 0.00 ? 47  SER A H    6  
ATOM 10449 H HA   . SER A 1 47  ? -18.809 -29.501 15.360  1.00 0.00 ? 47  SER A HA   6  
ATOM 10450 H HB2  . SER A 1 47  ? -17.002 -30.918 16.317  1.00 0.00 ? 47  SER A HB2  6  
ATOM 10451 H HB3  . SER A 1 47  ? -16.702 -29.178 16.447  1.00 0.00 ? 47  SER A HB3  6  
ATOM 10452 H HG   . SER A 1 47  ? -16.217 -30.318 18.395  1.00 0.00 ? 47  SER A HG   6  
ATOM 10453 N N    . SER A 1 48  ? -20.372 -31.062 17.782  1.00 0.00 ? 48  SER A N    6  
ATOM 10454 C CA   . SER A 1 48  ? -21.180 -32.243 18.140  1.00 0.00 ? 48  SER A CA   6  
ATOM 10455 C C    . SER A 1 48  ? -22.555 -32.302 17.441  1.00 0.00 ? 48  SER A C    6  
ATOM 10456 O O    . SER A 1 48  ? -23.150 -33.377 17.334  1.00 0.00 ? 48  SER A O    6  
ATOM 10457 C CB   . SER A 1 48  ? -21.362 -32.294 19.664  1.00 0.00 ? 48  SER A CB   6  
ATOM 10458 O OG   . SER A 1 48  ? -21.970 -31.114 20.177  1.00 0.00 ? 48  SER A OG   6  
ATOM 10459 H H    . SER A 1 48  ? -20.281 -30.332 18.475  1.00 0.00 ? 48  SER A H    6  
ATOM 10460 H HA   . SER A 1 48  ? -20.642 -33.146 17.848  1.00 0.00 ? 48  SER A HA   6  
ATOM 10461 H HB2  . SER A 1 48  ? -21.973 -33.160 19.918  1.00 0.00 ? 48  SER A HB2  6  
ATOM 10462 H HB3  . SER A 1 48  ? -20.383 -32.418 20.129  1.00 0.00 ? 48  SER A HB3  6  
ATOM 10463 H HG   . SER A 1 48  ? -22.101 -31.254 21.129  1.00 0.00 ? 48  SER A HG   6  
ATOM 10464 N N    . SER A 1 49  ? -23.052 -31.167 16.935  1.00 0.00 ? 49  SER A N    6  
ATOM 10465 C CA   . SER A 1 49  ? -24.366 -31.010 16.285  1.00 0.00 ? 49  SER A CA   6  
ATOM 10466 C C    . SER A 1 49  ? -24.516 -29.591 15.703  1.00 0.00 ? 49  SER A C    6  
ATOM 10467 O O    . SER A 1 49  ? -24.356 -29.396 14.495  1.00 0.00 ? 49  SER A O    6  
ATOM 10468 C CB   . SER A 1 49  ? -25.526 -31.356 17.251  1.00 0.00 ? 49  SER A CB   6  
ATOM 10469 O OG   . SER A 1 49  ? -25.508 -30.570 18.440  1.00 0.00 ? 49  SER A OG   6  
ATOM 10470 H H    . SER A 1 49  ? -22.473 -30.344 17.020  1.00 0.00 ? 49  SER A H    6  
ATOM 10471 H HA   . SER A 1 49  ? -24.427 -31.706 15.449  1.00 0.00 ? 49  SER A HA   6  
ATOM 10472 H HB2  . SER A 1 49  ? -26.473 -31.194 16.731  1.00 0.00 ? 49  SER A HB2  6  
ATOM 10473 H HB3  . SER A 1 49  ? -25.474 -32.411 17.516  1.00 0.00 ? 49  SER A HB3  6  
ATOM 10474 H HG   . SER A 1 49  ? -26.130 -30.962 19.075  1.00 0.00 ? 49  SER A HG   6  
ATOM 10475 N N    . VAL A 1 50  ? -24.789 -28.610 16.571  1.00 0.00 ? 50  VAL A N    6  
ATOM 10476 C CA   . VAL A 1 50  ? -24.989 -27.177 16.296  1.00 0.00 ? 50  VAL A CA   6  
ATOM 10477 C C    . VAL A 1 50  ? -25.178 -26.419 17.621  1.00 0.00 ? 50  VAL A C    6  
ATOM 10478 O O    . VAL A 1 50  ? -25.711 -26.975 18.580  1.00 0.00 ? 50  VAL A O    6  
ATOM 10479 C CB   . VAL A 1 50  ? -26.147 -26.901 15.296  1.00 0.00 ? 50  VAL A CB   6  
ATOM 10480 C CG1  . VAL A 1 50  ? -27.507 -27.429 15.785  1.00 0.00 ? 50  VAL A CG1  6  
ATOM 10481 C CG2  . VAL A 1 50  ? -26.263 -25.406 14.949  1.00 0.00 ? 50  VAL A CG2  6  
ATOM 10482 H H    . VAL A 1 50  ? -24.946 -28.920 17.534  1.00 0.00 ? 50  VAL A H    6  
ATOM 10483 H HA   . VAL A 1 50  ? -24.067 -26.816 15.836  1.00 0.00 ? 50  VAL A HA   6  
ATOM 10484 H HB   . VAL A 1 50  ? -25.924 -27.410 14.359  1.00 0.00 ? 50  VAL A HB   6  
ATOM 10485 H HG11 . VAL A 1 50  ? -27.451 -28.505 15.955  1.00 0.00 ? 50  VAL A HG11 6  
ATOM 10486 H HG12 . VAL A 1 50  ? -27.798 -26.938 16.710  1.00 0.00 ? 50  VAL A HG12 6  
ATOM 10487 H HG13 . VAL A 1 50  ? -28.270 -27.238 15.031  1.00 0.00 ? 50  VAL A HG13 6  
ATOM 10488 H HG21 . VAL A 1 50  ? -26.982 -25.271 14.140  1.00 0.00 ? 50  VAL A HG21 6  
ATOM 10489 H HG22 . VAL A 1 50  ? -26.602 -24.828 15.809  1.00 0.00 ? 50  VAL A HG22 6  
ATOM 10490 H HG23 . VAL A 1 50  ? -25.293 -25.026 14.625  1.00 0.00 ? 50  VAL A HG23 6  
ATOM 10491 N N    . PHE A 1 51  ? -24.680 -25.177 17.668  1.00 0.00 ? 51  PHE A N    6  
ATOM 10492 C CA   . PHE A 1 51  ? -24.685 -24.233 18.798  1.00 0.00 ? 51  PHE A CA   6  
ATOM 10493 C C    . PHE A 1 51  ? -23.939 -24.715 20.063  1.00 0.00 ? 51  PHE A C    6  
ATOM 10494 O O    . PHE A 1 51  ? -24.009 -24.079 21.113  1.00 0.00 ? 51  PHE A O    6  
ATOM 10495 C CB   . PHE A 1 51  ? -26.089 -23.634 19.054  1.00 0.00 ? 51  PHE A CB   6  
ATOM 10496 C CG   . PHE A 1 51  ? -27.194 -24.564 19.528  1.00 0.00 ? 51  PHE A CG   6  
ATOM 10497 C CD1  . PHE A 1 51  ? -27.229 -25.018 20.863  1.00 0.00 ? 51  PHE A CD1  6  
ATOM 10498 C CD2  . PHE A 1 51  ? -28.227 -24.940 18.644  1.00 0.00 ? 51  PHE A CD2  6  
ATOM 10499 C CE1  . PHE A 1 51  ? -28.271 -25.854 21.302  1.00 0.00 ? 51  PHE A CE1  6  
ATOM 10500 C CE2  . PHE A 1 51  ? -29.265 -25.782 19.082  1.00 0.00 ? 51  PHE A CE2  6  
ATOM 10501 C CZ   . PHE A 1 51  ? -29.288 -26.240 20.411  1.00 0.00 ? 51  PHE A CZ   6  
ATOM 10502 H H    . PHE A 1 51  ? -24.180 -24.865 16.841  1.00 0.00 ? 51  PHE A H    6  
ATOM 10503 H HA   . PHE A 1 51  ? -24.080 -23.395 18.449  1.00 0.00 ? 51  PHE A HA   6  
ATOM 10504 H HB2  . PHE A 1 51  ? -25.991 -22.833 19.790  1.00 0.00 ? 51  PHE A HB2  6  
ATOM 10505 H HB3  . PHE A 1 51  ? -26.416 -23.155 18.130  1.00 0.00 ? 51  PHE A HB3  6  
ATOM 10506 H HD1  . PHE A 1 51  ? -26.466 -24.715 21.563  1.00 0.00 ? 51  PHE A HD1  6  
ATOM 10507 H HD2  . PHE A 1 51  ? -28.225 -24.586 17.623  1.00 0.00 ? 51  PHE A HD2  6  
ATOM 10508 H HE1  . PHE A 1 51  ? -28.293 -26.198 22.328  1.00 0.00 ? 51  PHE A HE1  6  
ATOM 10509 H HE2  . PHE A 1 51  ? -30.052 -26.073 18.396  1.00 0.00 ? 51  PHE A HE2  6  
ATOM 10510 H HZ   . PHE A 1 51  ? -30.090 -26.881 20.749  1.00 0.00 ? 51  PHE A HZ   6  
ATOM 10511 N N    . SER A 1 52  ? -23.159 -25.794 19.964  1.00 0.00 ? 52  SER A N    6  
ATOM 10512 C CA   . SER A 1 52  ? -22.406 -26.473 21.038  1.00 0.00 ? 52  SER A CA   6  
ATOM 10513 C C    . SER A 1 52  ? -21.193 -25.671 21.588  1.00 0.00 ? 52  SER A C    6  
ATOM 10514 O O    . SER A 1 52  ? -20.116 -26.226 21.819  1.00 0.00 ? 52  SER A O    6  
ATOM 10515 C CB   . SER A 1 52  ? -21.956 -27.863 20.537  1.00 0.00 ? 52  SER A CB   6  
ATOM 10516 O OG   . SER A 1 52  ? -22.917 -28.503 19.707  1.00 0.00 ? 52  SER A OG   6  
ATOM 10517 H H    . SER A 1 52  ? -23.225 -26.315 19.101  1.00 0.00 ? 52  SER A H    6  
ATOM 10518 H HA   . SER A 1 52  ? -23.082 -26.637 21.881  1.00 0.00 ? 52  SER A HA   6  
ATOM 10519 H HB2  . SER A 1 52  ? -21.037 -27.759 19.961  1.00 0.00 ? 52  SER A HB2  6  
ATOM 10520 H HB3  . SER A 1 52  ? -21.744 -28.493 21.403  1.00 0.00 ? 52  SER A HB3  6  
ATOM 10521 H HG   . SER A 1 52  ? -22.737 -29.463 19.741  1.00 0.00 ? 52  SER A HG   6  
ATOM 10522 N N    . VAL A 1 53  ? -21.343 -24.354 21.767  1.00 0.00 ? 53  VAL A N    6  
ATOM 10523 C CA   . VAL A 1 53  ? -20.298 -23.386 22.153  1.00 0.00 ? 53  VAL A CA   6  
ATOM 10524 C C    . VAL A 1 53  ? -20.820 -22.390 23.198  1.00 0.00 ? 53  VAL A C    6  
ATOM 10525 O O    . VAL A 1 53  ? -22.019 -22.113 23.259  1.00 0.00 ? 53  VAL A O    6  
ATOM 10526 C CB   . VAL A 1 53  ? -19.743 -22.609 20.932  1.00 0.00 ? 53  VAL A CB   6  
ATOM 10527 C CG1  . VAL A 1 53  ? -18.887 -23.512 20.029  1.00 0.00 ? 53  VAL A CG1  6  
ATOM 10528 C CG2  . VAL A 1 53  ? -20.848 -21.953 20.079  1.00 0.00 ? 53  VAL A CG2  6  
ATOM 10529 H H    . VAL A 1 53  ? -22.285 -23.984 21.636  1.00 0.00 ? 53  VAL A H    6  
ATOM 10530 H HA   . VAL A 1 53  ? -19.470 -23.930 22.613  1.00 0.00 ? 53  VAL A HA   6  
ATOM 10531 H HB   . VAL A 1 53  ? -19.092 -21.818 21.308  1.00 0.00 ? 53  VAL A HB   6  
ATOM 10532 H HG11 . VAL A 1 53  ? -18.095 -23.980 20.615  1.00 0.00 ? 53  VAL A HG11 6  
ATOM 10533 H HG12 . VAL A 1 53  ? -19.502 -24.286 19.573  1.00 0.00 ? 53  VAL A HG12 6  
ATOM 10534 H HG13 . VAL A 1 53  ? -18.428 -22.916 19.241  1.00 0.00 ? 53  VAL A HG13 6  
ATOM 10535 H HG21 . VAL A 1 53  ? -21.500 -21.346 20.705  1.00 0.00 ? 53  VAL A HG21 6  
ATOM 10536 H HG22 . VAL A 1 53  ? -20.395 -21.306 19.329  1.00 0.00 ? 53  VAL A HG22 6  
ATOM 10537 H HG23 . VAL A 1 53  ? -21.445 -22.712 19.572  1.00 0.00 ? 53  VAL A HG23 6  
ATOM 10538 N N    . LEU A 1 54  ? -19.910 -21.848 24.019  1.00 0.00 ? 54  LEU A N    6  
ATOM 10539 C CA   . LEU A 1 54  ? -20.205 -20.840 25.044  1.00 0.00 ? 54  LEU A CA   6  
ATOM 10540 C C    . LEU A 1 54  ? -20.495 -19.468 24.406  1.00 0.00 ? 54  LEU A C    6  
ATOM 10541 O O    . LEU A 1 54  ? -19.792 -19.038 23.490  1.00 0.00 ? 54  LEU A O    6  
ATOM 10542 C CB   . LEU A 1 54  ? -19.014 -20.790 26.025  1.00 0.00 ? 54  LEU A CB   6  
ATOM 10543 C CG   . LEU A 1 54  ? -19.157 -19.808 27.206  1.00 0.00 ? 54  LEU A CG   6  
ATOM 10544 C CD1  . LEU A 1 54  ? -20.343 -20.158 28.120  1.00 0.00 ? 54  LEU A CD1  6  
ATOM 10545 C CD2  . LEU A 1 54  ? -17.860 -19.811 28.028  1.00 0.00 ? 54  LEU A CD2  6  
ATOM 10546 H H    . LEU A 1 54  ? -18.943 -22.128 23.909  1.00 0.00 ? 54  LEU A H    6  
ATOM 10547 H HA   . LEU A 1 54  ? -21.095 -21.162 25.587  1.00 0.00 ? 54  LEU A HA   6  
ATOM 10548 H HB2  . LEU A 1 54  ? -18.850 -21.793 26.428  1.00 0.00 ? 54  LEU A HB2  6  
ATOM 10549 H HB3  . LEU A 1 54  ? -18.121 -20.511 25.459  1.00 0.00 ? 54  LEU A HB3  6  
ATOM 10550 H HG   . LEU A 1 54  ? -19.299 -18.799 26.819  1.00 0.00 ? 54  LEU A HG   6  
ATOM 10551 H HD11 . LEU A 1 54  ? -21.283 -20.078 27.574  1.00 0.00 ? 54  LEU A HD11 6  
ATOM 10552 H HD12 . LEU A 1 54  ? -20.236 -21.175 28.499  1.00 0.00 ? 54  LEU A HD12 6  
ATOM 10553 H HD13 . LEU A 1 54  ? -20.371 -19.464 28.960  1.00 0.00 ? 54  LEU A HD13 6  
ATOM 10554 H HD21 . LEU A 1 54  ? -17.939 -19.095 28.847  1.00 0.00 ? 54  LEU A HD21 6  
ATOM 10555 H HD22 . LEU A 1 54  ? -17.679 -20.802 28.439  1.00 0.00 ? 54  LEU A HD22 6  
ATOM 10556 H HD23 . LEU A 1 54  ? -17.017 -19.524 27.396  1.00 0.00 ? 54  LEU A HD23 6  
ATOM 10557 N N    . SER A 1 55  ? -21.508 -18.761 24.903  1.00 0.00 ? 55  SER A N    6  
ATOM 10558 C CA   . SER A 1 55  ? -21.821 -17.387 24.483  1.00 0.00 ? 55  SER A CA   6  
ATOM 10559 C C    . SER A 1 55  ? -20.871 -16.351 25.113  1.00 0.00 ? 55  SER A C    6  
ATOM 10560 O O    . SER A 1 55  ? -20.548 -16.406 26.306  1.00 0.00 ? 55  SER A O    6  
ATOM 10561 C CB   . SER A 1 55  ? -23.296 -17.058 24.773  1.00 0.00 ? 55  SER A CB   6  
ATOM 10562 O OG   . SER A 1 55  ? -23.668 -17.354 26.115  1.00 0.00 ? 55  SER A OG   6  
ATOM 10563 H H    . SER A 1 55  ? -22.048 -19.136 25.668  1.00 0.00 ? 55  SER A H    6  
ATOM 10564 H HA   . SER A 1 55  ? -21.682 -17.314 23.406  1.00 0.00 ? 55  SER A HA   6  
ATOM 10565 H HB2  . SER A 1 55  ? -23.473 -16.002 24.562  1.00 0.00 ? 55  SER A HB2  6  
ATOM 10566 H HB3  . SER A 1 55  ? -23.916 -17.650 24.097  1.00 0.00 ? 55  SER A HB3  6  
ATOM 10567 H HG   . SER A 1 55  ? -24.607 -17.128 26.231  1.00 0.00 ? 55  SER A HG   6  
ATOM 10568 N N    . ASN A 1 56  ? -20.406 -15.398 24.296  1.00 0.00 ? 56  ASN A N    6  
ATOM 10569 C CA   . ASN A 1 56  ? -19.371 -14.416 24.642  1.00 0.00 ? 56  ASN A CA   6  
ATOM 10570 C C    . ASN A 1 56  ? -19.303 -13.312 23.579  1.00 0.00 ? 56  ASN A C    6  
ATOM 10571 O O    . ASN A 1 56  ? -19.458 -13.596 22.390  1.00 0.00 ? 56  ASN A O    6  
ATOM 10572 C CB   . ASN A 1 56  ? -18.010 -15.125 24.697  1.00 0.00 ? 56  ASN A CB   6  
ATOM 10573 C CG   . ASN A 1 56  ? -16.880 -14.290 25.283  1.00 0.00 ? 56  ASN A CG   6  
ATOM 10574 O OD1  . ASN A 1 56  ? -17.083 -13.363 26.063  1.00 0.00 ? 56  ASN A OD1  6  
ATOM 10575 N ND2  . ASN A 1 56  ? -15.651 -14.610 24.920  1.00 0.00 ? 56  ASN A ND2  6  
ATOM 10576 H H    . ASN A 1 56  ? -20.720 -15.398 23.333  1.00 0.00 ? 56  ASN A H    6  
ATOM 10577 H HA   . ASN A 1 56  ? -19.603 -13.977 25.614  1.00 0.00 ? 56  ASN A HA   6  
ATOM 10578 H HB2  . ASN A 1 56  ? -18.080 -16.048 25.274  1.00 0.00 ? 56  ASN A HB2  6  
ATOM 10579 H HB3  . ASN A 1 56  ? -17.747 -15.372 23.672  1.00 0.00 ? 56  ASN A HB3  6  
ATOM 10580 H HD21 . ASN A 1 56  ? -15.506 -15.391 24.289  1.00 0.00 ? 56  ASN A HD21 6  
ATOM 10581 H HD22 . ASN A 1 56  ? -14.877 -14.068 25.276  1.00 0.00 ? 56  ASN A HD22 6  
ATOM 10582 N N    . SER A 1 57  ? -19.042 -12.068 23.967  1.00 0.00 ? 57  SER A N    6  
ATOM 10583 C CA   . SER A 1 57  ? -18.894 -10.948 23.031  1.00 0.00 ? 57  SER A CA   6  
ATOM 10584 C C    . SER A 1 57  ? -17.442 -10.737 22.547  1.00 0.00 ? 57  SER A C    6  
ATOM 10585 O O    . SER A 1 57  ? -16.484 -11.263 23.121  1.00 0.00 ? 57  SER A O    6  
ATOM 10586 C CB   . SER A 1 57  ? -19.478 -9.670  23.664  1.00 0.00 ? 57  SER A CB   6  
ATOM 10587 O OG   . SER A 1 57  ? -18.954 -9.433  24.964  1.00 0.00 ? 57  SER A OG   6  
ATOM 10588 H H    . SER A 1 57  ? -18.854 -11.876 24.943  1.00 0.00 ? 57  SER A H    6  
ATOM 10589 H HA   . SER A 1 57  ? -19.489 -11.181 22.149  1.00 0.00 ? 57  SER A HA   6  
ATOM 10590 H HB2  . SER A 1 57  ? -19.272 -8.812  23.023  1.00 0.00 ? 57  SER A HB2  6  
ATOM 10591 H HB3  . SER A 1 57  ? -20.559 -9.786  23.735  1.00 0.00 ? 57  SER A HB3  6  
ATOM 10592 H HG   . SER A 1 57  ? -19.474 -8.731  25.384  1.00 0.00 ? 57  SER A HG   6  
ATOM 10593 N N    . ALA A 1 58  ? -17.282 -9.966  21.462  1.00 0.00 ? 58  ALA A N    6  
ATOM 10594 C CA   . ALA A 1 58  ? -15.987 -9.547  20.924  1.00 0.00 ? 58  ALA A CA   6  
ATOM 10595 C C    . ALA A 1 58  ? -15.420 -8.360  21.728  1.00 0.00 ? 58  ALA A C    6  
ATOM 10596 O O    . ALA A 1 58  ? -16.199 -7.588  22.285  1.00 0.00 ? 58  ALA A O    6  
ATOM 10597 C CB   . ALA A 1 58  ? -16.205 -9.172  19.451  1.00 0.00 ? 58  ALA A CB   6  
ATOM 10598 H H    . ALA A 1 58  ? -18.095 -9.506  21.064  1.00 0.00 ? 58  ALA A H    6  
ATOM 10599 H HA   . ALA A 1 58  ? -15.287 -10.381 20.987  1.00 0.00 ? 58  ALA A HA   6  
ATOM 10600 H HB1  . ALA A 1 58  ? -16.816 -9.928  18.963  1.00 0.00 ? 58  ALA A HB1  6  
ATOM 10601 H HB2  . ALA A 1 58  ? -16.719 -8.210  19.375  1.00 0.00 ? 58  ALA A HB2  6  
ATOM 10602 H HB3  . ALA A 1 58  ? -15.248 -9.113  18.936  1.00 0.00 ? 58  ALA A HB3  6  
ATOM 10603 N N    . GLU A 1 59  ? -14.094 -8.172  21.752  1.00 0.00 ? 59  GLU A N    6  
ATOM 10604 C CA   . GLU A 1 59  ? -13.429 -7.088  22.499  1.00 0.00 ? 59  GLU A CA   6  
ATOM 10605 C C    . GLU A 1 59  ? -12.380 -6.370  21.635  1.00 0.00 ? 59  GLU A C    6  
ATOM 10606 O O    . GLU A 1 59  ? -11.574 -7.029  20.982  1.00 0.00 ? 59  GLU A O    6  
ATOM 10607 C CB   . GLU A 1 59  ? -12.759 -7.649  23.771  1.00 0.00 ? 59  GLU A CB   6  
ATOM 10608 C CG   . GLU A 1 59  ? -12.340 -6.542  24.748  1.00 0.00 ? 59  GLU A CG   6  
ATOM 10609 C CD   . GLU A 1 59  ? -11.733 -7.135  26.028  1.00 0.00 ? 59  GLU A CD   6  
ATOM 10610 O OE1  . GLU A 1 59  ? -12.497 -7.563  26.924  1.00 0.00 ? 59  GLU A OE1  6  
ATOM 10611 O OE2  . GLU A 1 59  ? -10.484 -7.184  26.141  1.00 0.00 ? 59  GLU A OE2  6  
ATOM 10612 H H    . GLU A 1 59  ? -13.515 -8.804  21.207  1.00 0.00 ? 59  GLU A H    6  
ATOM 10613 H HA   . GLU A 1 59  ? -14.174 -6.352  22.806  1.00 0.00 ? 59  GLU A HA   6  
ATOM 10614 H HB2  . GLU A 1 59  ? -13.462 -8.307  24.281  1.00 0.00 ? 59  GLU A HB2  6  
ATOM 10615 H HB3  . GLU A 1 59  ? -11.875 -8.237  23.502  1.00 0.00 ? 59  GLU A HB3  6  
ATOM 10616 H HG2  . GLU A 1 59  ? -11.609 -5.893  24.268  1.00 0.00 ? 59  GLU A HG2  6  
ATOM 10617 H HG3  . GLU A 1 59  ? -13.209 -5.937  25.010  1.00 0.00 ? 59  GLU A HG3  6  
ATOM 10618 N N    . VAL A 1 60  ? -12.351 -5.034  21.666  1.00 0.00 ? 60  VAL A N    6  
ATOM 10619 C CA   . VAL A 1 60  ? -11.267 -4.235  21.058  1.00 0.00 ? 60  VAL A CA   6  
ATOM 10620 C C    . VAL A 1 60  ? -10.079 -4.168  22.030  1.00 0.00 ? 60  VAL A C    6  
ATOM 10621 O O    . VAL A 1 60  ? -10.245 -3.751  23.175  1.00 0.00 ? 60  VAL A O    6  
ATOM 10622 C CB   . VAL A 1 60  ? -11.724 -2.809  20.682  1.00 0.00 ? 60  VAL A CB   6  
ATOM 10623 C CG1  . VAL A 1 60  ? -10.632 -2.089  19.866  1.00 0.00 ? 60  VAL A CG1  6  
ATOM 10624 C CG2  . VAL A 1 60  ? -13.015 -2.806  19.849  1.00 0.00 ? 60  VAL A CG2  6  
ATOM 10625 H H    . VAL A 1 60  ? -13.072 -4.547  22.205  1.00 0.00 ? 60  VAL A H    6  
ATOM 10626 H HA   . VAL A 1 60  ? -10.955 -4.730  20.138  1.00 0.00 ? 60  VAL A HA   6  
ATOM 10627 H HB   . VAL A 1 60  ? -11.912 -2.244  21.598  1.00 0.00 ? 60  VAL A HB   6  
ATOM 10628 H HG11 . VAL A 1 60  ? -10.441 -2.625  18.935  1.00 0.00 ? 60  VAL A HG11 6  
ATOM 10629 H HG12 . VAL A 1 60  ? -10.944 -1.069  19.639  1.00 0.00 ? 60  VAL A HG12 6  
ATOM 10630 H HG13 . VAL A 1 60  ? -9.704  -2.041  20.431  1.00 0.00 ? 60  VAL A HG13 6  
ATOM 10631 H HG21 . VAL A 1 60  ? -12.867 -3.371  18.930  1.00 0.00 ? 60  VAL A HG21 6  
ATOM 10632 H HG22 . VAL A 1 60  ? -13.837 -3.242  20.414  1.00 0.00 ? 60  VAL A HG22 6  
ATOM 10633 H HG23 . VAL A 1 60  ? -13.289 -1.781  19.603  1.00 0.00 ? 60  VAL A HG23 6  
ATOM 10634 N N    . LYS A 1 61  ? -8.882  -4.559  21.575  1.00 0.00 ? 61  LYS A N    6  
ATOM 10635 C CA   . LYS A 1 61  ? -7.662  -4.743  22.385  1.00 0.00 ? 61  LYS A CA   6  
ATOM 10636 C C    . LYS A 1 61  ? -6.437  -3.989  21.806  1.00 0.00 ? 61  LYS A C    6  
ATOM 10637 O O    . LYS A 1 61  ? -6.398  -3.690  20.611  1.00 0.00 ? 61  LYS A O    6  
ATOM 10638 C CB   . LYS A 1 61  ? -7.386  -6.260  22.499  1.00 0.00 ? 61  LYS A CB   6  
ATOM 10639 C CG   . LYS A 1 61  ? -8.558  -7.041  23.127  1.00 0.00 ? 61  LYS A CG   6  
ATOM 10640 C CD   . LYS A 1 61  ? -8.223  -8.524  23.354  1.00 0.00 ? 61  LYS A CD   6  
ATOM 10641 C CE   . LYS A 1 61  ? -7.419  -8.754  24.643  1.00 0.00 ? 61  LYS A CE   6  
ATOM 10642 N NZ   . LYS A 1 61  ? -8.282  -8.834  25.853  1.00 0.00 ? 61  LYS A NZ   6  
ATOM 10643 H H    . LYS A 1 61  ? -8.843  -4.898  20.616  1.00 0.00 ? 61  LYS A H    6  
ATOM 10644 H HA   . LYS A 1 61  ? -7.830  -4.352  23.392  1.00 0.00 ? 61  LYS A HA   6  
ATOM 10645 H HB2  . LYS A 1 61  ? -7.211  -6.665  21.499  1.00 0.00 ? 61  LYS A HB2  6  
ATOM 10646 H HB3  . LYS A 1 61  ? -6.484  -6.423  23.091  1.00 0.00 ? 61  LYS A HB3  6  
ATOM 10647 H HG2  . LYS A 1 61  ? -8.845  -6.573  24.065  1.00 0.00 ? 61  LYS A HG2  6  
ATOM 10648 H HG3  . LYS A 1 61  ? -9.408  -6.998  22.448  1.00 0.00 ? 61  LYS A HG3  6  
ATOM 10649 H HD2  . LYS A 1 61  ? -9.146  -9.105  23.395  1.00 0.00 ? 61  LYS A HD2  6  
ATOM 10650 H HD3  . LYS A 1 61  ? -7.635  -8.884  22.504  1.00 0.00 ? 61  LYS A HD3  6  
ATOM 10651 H HE2  . LYS A 1 61  ? -6.867  -9.693  24.539  1.00 0.00 ? 61  LYS A HE2  6  
ATOM 10652 H HE3  . LYS A 1 61  ? -6.698  -7.942  24.754  1.00 0.00 ? 61  LYS A HE3  6  
ATOM 10653 H HZ1  . LYS A 1 61  ? -8.932  -8.048  25.910  1.00 0.00 ? 61  LYS A HZ1  6  
ATOM 10654 H HZ2  . LYS A 1 61  ? -8.842  -9.676  25.847  1.00 0.00 ? 61  LYS A HZ2  6  
ATOM 10655 H HZ3  . LYS A 1 61  ? -7.723  -8.842  26.697  1.00 0.00 ? 61  LYS A HZ3  6  
ATOM 10656 N N    . ARG A 1 62  ? -5.435  -3.678  22.648  1.00 0.00 ? 62  ARG A N    6  
ATOM 10657 C CA   . ARG A 1 62  ? -4.143  -3.055  22.268  1.00 0.00 ? 62  ARG A CA   6  
ATOM 10658 C C    . ARG A 1 62  ? -2.982  -4.044  22.444  1.00 0.00 ? 62  ARG A C    6  
ATOM 10659 O O    . ARG A 1 62  ? -2.922  -4.744  23.456  1.00 0.00 ? 62  ARG A O    6  
ATOM 10660 C CB   . ARG A 1 62  ? -3.890  -1.791  23.115  1.00 0.00 ? 62  ARG A CB   6  
ATOM 10661 C CG   . ARG A 1 62  ? -2.591  -1.053  22.738  1.00 0.00 ? 62  ARG A CG   6  
ATOM 10662 C CD   . ARG A 1 62  ? -2.463  0.312   23.435  1.00 0.00 ? 62  ARG A CD   6  
ATOM 10663 N NE   . ARG A 1 62  ? -2.386  0.185   24.905  1.00 0.00 ? 62  ARG A NE   6  
ATOM 10664 C CZ   . ARG A 1 62  ? -1.308  -0.096  25.635  1.00 0.00 ? 62  ARG A CZ   6  
ATOM 10665 N NH1  . ARG A 1 62  ? -0.125  -0.313  25.096  1.00 0.00 ? 62  ARG A NH1  6  
ATOM 10666 N NH2  . ARG A 1 62  ? -1.414  -0.164  26.945  1.00 0.00 ? 62  ARG A NH2  6  
ATOM 10667 H H    . ARG A 1 62  ? -5.537  -3.958  23.616  1.00 0.00 ? 62  ARG A H    6  
ATOM 10668 H HA   . ARG A 1 62  ? -4.188  -2.761  21.219  1.00 0.00 ? 62  ARG A HA   6  
ATOM 10669 H HB2  . ARG A 1 62  ? -4.719  -1.101  22.971  1.00 0.00 ? 62  ARG A HB2  6  
ATOM 10670 H HB3  . ARG A 1 62  ? -3.857  -2.061  24.173  1.00 0.00 ? 62  ARG A HB3  6  
ATOM 10671 H HG2  . ARG A 1 62  ? -1.729  -1.666  23.007  1.00 0.00 ? 62  ARG A HG2  6  
ATOM 10672 H HG3  . ARG A 1 62  ? -2.572  -0.890  21.660  1.00 0.00 ? 62  ARG A HG3  6  
ATOM 10673 H HD2  . ARG A 1 62  ? -1.576  0.827   23.062  1.00 0.00 ? 62  ARG A HD2  6  
ATOM 10674 H HD3  . ARG A 1 62  ? -3.327  0.927   23.174  1.00 0.00 ? 62  ARG A HD3  6  
ATOM 10675 H HE   . ARG A 1 62  ? -3.244  0.368   25.411  1.00 0.00 ? 62  ARG A HE   6  
ATOM 10676 H HH11 . ARG A 1 62  ? -0.004  -0.255  24.098  1.00 0.00 ? 62  ARG A HH11 6  
ATOM 10677 H HH12 . ARG A 1 62  ? 0.675   -0.519  25.674  1.00 0.00 ? 62  ARG A HH12 6  
ATOM 10678 H HH21 . ARG A 1 62  ? -2.302  -0.011  27.399  1.00 0.00 ? 62  ARG A HH21 6  
ATOM 10679 H HH22 . ARG A 1 62  ? -0.610  -0.366  27.517  1.00 0.00 ? 62  ARG A HH22 6  
ATOM 10680 N N    . GLU A 1 63  ? -2.044  -4.064  21.490  1.00 0.00 ? 63  GLU A N    6  
ATOM 10681 C CA   . GLU A 1 63  ? -0.941  -5.035  21.415  1.00 0.00 ? 63  GLU A CA   6  
ATOM 10682 C C    . GLU A 1 63  ? 0.078   -4.619  20.341  1.00 0.00 ? 63  GLU A C    6  
ATOM 10683 O O    . GLU A 1 63  ? -0.156  -3.653  19.611  1.00 0.00 ? 63  GLU A O    6  
ATOM 10684 C CB   . GLU A 1 63  ? -1.556  -6.425  21.130  1.00 0.00 ? 63  GLU A CB   6  
ATOM 10685 C CG   . GLU A 1 63  ? -0.637  -7.639  21.231  1.00 0.00 ? 63  GLU A CG   6  
ATOM 10686 C CD   . GLU A 1 63  ? 0.198   -7.625  22.520  1.00 0.00 ? 63  GLU A CD   6  
ATOM 10687 O OE1  . GLU A 1 63  ? -0.320  -8.027  23.589  1.00 0.00 ? 63  GLU A OE1  6  
ATOM 10688 O OE2  . GLU A 1 63  ? 1.361   -7.158  22.473  1.00 0.00 ? 63  GLU A OE2  6  
ATOM 10689 H H    . GLU A 1 63  ? -2.140  -3.431  20.702  1.00 0.00 ? 63  GLU A H    6  
ATOM 10690 H HA   . GLU A 1 63  ? -0.424  -5.048  22.377  1.00 0.00 ? 63  GLU A HA   6  
ATOM 10691 H HB2  . GLU A 1 63  ? -2.366  -6.609  21.831  1.00 0.00 ? 63  GLU A HB2  6  
ATOM 10692 H HB3  . GLU A 1 63  ? -1.985  -6.403  20.129  1.00 0.00 ? 63  GLU A HB3  6  
ATOM 10693 H HG2  . GLU A 1 63  ? -1.267  -8.532  21.208  1.00 0.00 ? 63  GLU A HG2  6  
ATOM 10694 H HG3  . GLU A 1 63  ? 0.010   -7.663  20.359  1.00 0.00 ? 63  GLU A HG3  6  
ATOM 10695 N N    . ARG A 1 64  ? 1.208   -5.321  20.221  1.00 0.00 ? 64  ARG A N    6  
ATOM 10696 C CA   . ARG A 1 64  ? 2.152   -5.167  19.105  1.00 0.00 ? 64  ARG A CA   6  
ATOM 10697 C C    . ARG A 1 64  ? 1.876   -6.155  17.966  1.00 0.00 ? 64  ARG A C    6  
ATOM 10698 O O    . ARG A 1 64  ? 1.521   -7.313  18.196  1.00 0.00 ? 64  ARG A O    6  
ATOM 10699 C CB   . ARG A 1 64  ? 3.605   -5.296  19.588  1.00 0.00 ? 64  ARG A CB   6  
ATOM 10700 C CG   . ARG A 1 64  ? 4.023   -4.038  20.363  1.00 0.00 ? 64  ARG A CG   6  
ATOM 10701 C CD   . ARG A 1 64  ? 5.518   -4.011  20.708  1.00 0.00 ? 64  ARG A CD   6  
ATOM 10702 N NE   . ARG A 1 64  ? 6.377   -4.086  19.510  1.00 0.00 ? 64  ARG A NE   6  
ATOM 10703 C CZ   . ARG A 1 64  ? 6.703   -3.126  18.656  1.00 0.00 ? 64  ARG A CZ   6  
ATOM 10704 N NH1  . ARG A 1 64  ? 6.267   -1.885  18.758  1.00 0.00 ? 64  ARG A NH1  6  
ATOM 10705 N NH2  . ARG A 1 64  ? 7.497   -3.450  17.663  1.00 0.00 ? 64  ARG A NH2  6  
ATOM 10706 H H    . ARG A 1 64  ? 1.398   -6.048  20.909  1.00 0.00 ? 64  ARG A H    6  
ATOM 10707 H HA   . ARG A 1 64  ? 2.028   -4.167  18.695  1.00 0.00 ? 64  ARG A HA   6  
ATOM 10708 H HB2  . ARG A 1 64  ? 3.721   -6.182  20.217  1.00 0.00 ? 64  ARG A HB2  6  
ATOM 10709 H HB3  . ARG A 1 64  ? 4.252   -5.399  18.716  1.00 0.00 ? 64  ARG A HB3  6  
ATOM 10710 H HG2  . ARG A 1 64  ? 3.791   -3.160  19.760  1.00 0.00 ? 64  ARG A HG2  6  
ATOM 10711 H HG3  . ARG A 1 64  ? 3.437   -3.990  21.282  1.00 0.00 ? 64  ARG A HG3  6  
ATOM 10712 H HD2  . ARG A 1 64  ? 5.738   -3.100  21.265  1.00 0.00 ? 64  ARG A HD2  6  
ATOM 10713 H HD3  . ARG A 1 64  ? 5.743   -4.856  21.362  1.00 0.00 ? 64  ARG A HD3  6  
ATOM 10714 H HE   . ARG A 1 64  ? 6.782   -4.995  19.293  1.00 0.00 ? 64  ARG A HE   6  
ATOM 10715 H HH11 . ARG A 1 64  ? 5.651   -1.623  19.510  1.00 0.00 ? 64  ARG A HH11 6  
ATOM 10716 H HH12 . ARG A 1 64  ? 6.518   -1.186  18.064  1.00 0.00 ? 64  ARG A HH12 6  
ATOM 10717 H HH21 . ARG A 1 64  ? 7.783   -4.428  17.591  1.00 0.00 ? 64  ARG A HH21 6  
ATOM 10718 H HH22 . ARG A 1 64  ? 7.835   -2.765  17.006  1.00 0.00 ? 64  ARG A HH22 6  
ATOM 10719 N N    . LEU A 1 65  ? 2.098   -5.719  16.721  1.00 0.00 ? 65  LEU A N    6  
ATOM 10720 C CA   . LEU A 1 65  ? 1.824   -6.488  15.498  1.00 0.00 ? 65  LEU A CA   6  
ATOM 10721 C C    . LEU A 1 65  ? 2.505   -7.857  15.545  1.00 0.00 ? 65  LEU A C    6  
ATOM 10722 O O    . LEU A 1 65  ? 1.823   -8.861  15.386  1.00 0.00 ? 65  LEU A O    6  
ATOM 10723 C CB   . LEU A 1 65  ? 2.250   -5.654  14.267  1.00 0.00 ? 65  LEU A CB   6  
ATOM 10724 C CG   . LEU A 1 65  ? 2.014   -6.350  12.909  1.00 0.00 ? 65  LEU A CG   6  
ATOM 10725 C CD1  . LEU A 1 65  ? 0.531   -6.648  12.658  1.00 0.00 ? 65  LEU A CD1  6  
ATOM 10726 C CD2  . LEU A 1 65  ? 2.537   -5.461  11.776  1.00 0.00 ? 65  LEU A CD2  6  
ATOM 10727 H H    . LEU A 1 65  ? 2.448   -4.770  16.616  1.00 0.00 ? 65  LEU A H    6  
ATOM 10728 H HA   . LEU A 1 65  ? 0.747   -6.668  15.450  1.00 0.00 ? 65  LEU A HA   6  
ATOM 10729 H HB2  . LEU A 1 65  ? 1.702   -4.708  14.270  1.00 0.00 ? 65  LEU A HB2  6  
ATOM 10730 H HB3  . LEU A 1 65  ? 3.314   -5.419  14.351  1.00 0.00 ? 65  LEU A HB3  6  
ATOM 10731 H HG   . LEU A 1 65  ? 2.570   -7.288  12.879  1.00 0.00 ? 65  LEU A HG   6  
ATOM 10732 H HD11 . LEU A 1 65  ? -0.042  -5.723  12.671  1.00 0.00 ? 65  LEU A HD11 6  
ATOM 10733 H HD12 . LEU A 1 65  ? 0.406   -7.126  11.686  1.00 0.00 ? 65  LEU A HD12 6  
ATOM 10734 H HD13 . LEU A 1 65  ? 0.144   -7.316  13.425  1.00 0.00 ? 65  LEU A HD13 6  
ATOM 10735 H HD21 . LEU A 1 65  ? 3.593   -5.247  11.933  1.00 0.00 ? 65  LEU A HD21 6  
ATOM 10736 H HD22 . LEU A 1 65  ? 2.421   -5.975  10.822  1.00 0.00 ? 65  LEU A HD22 6  
ATOM 10737 H HD23 . LEU A 1 65  ? 1.976   -4.528  11.748  1.00 0.00 ? 65  LEU A HD23 6  
ATOM 10738 N N    . GLU A 1 66  ? 3.803   -7.896  15.858  1.00 0.00 ? 66  GLU A N    6  
ATOM 10739 C CA   . GLU A 1 66  ? 4.605   -9.130  15.970  1.00 0.00 ? 66  GLU A CA   6  
ATOM 10740 C C    . GLU A 1 66  ? 4.029   -10.169 16.964  1.00 0.00 ? 66  GLU A C    6  
ATOM 10741 O O    . GLU A 1 66  ? 4.152   -11.375 16.737  1.00 0.00 ? 66  GLU A O    6  
ATOM 10742 C CB   . GLU A 1 66  ? 6.058   -8.758  16.327  1.00 0.00 ? 66  GLU A CB   6  
ATOM 10743 C CG   . GLU A 1 66  ? 6.226   -8.148  17.730  1.00 0.00 ? 66  GLU A CG   6  
ATOM 10744 C CD   . GLU A 1 66  ? 7.603   -7.490  17.908  1.00 0.00 ? 66  GLU A CD   6  
ATOM 10745 O OE1  . GLU A 1 66  ? 8.630   -8.210  17.934  1.00 0.00 ? 66  GLU A OE1  6  
ATOM 10746 O OE2  . GLU A 1 66  ? 7.656   -6.244  18.037  1.00 0.00 ? 66  GLU A OE2  6  
ATOM 10747 H H    . GLU A 1 66  ? 4.289   -7.012  15.951  1.00 0.00 ? 66  GLU A H    6  
ATOM 10748 H HA   . GLU A 1 66  ? 4.617   -9.600  14.981  1.00 0.00 ? 66  GLU A HA   6  
ATOM 10749 H HB2  . GLU A 1 66  ? 6.675   -9.654  16.256  1.00 0.00 ? 66  GLU A HB2  6  
ATOM 10750 H HB3  . GLU A 1 66  ? 6.415   -8.042  15.584  1.00 0.00 ? 66  GLU A HB3  6  
ATOM 10751 H HG2  . GLU A 1 66  ? 5.455   -7.398  17.903  1.00 0.00 ? 66  GLU A HG2  6  
ATOM 10752 H HG3  . GLU A 1 66  ? 6.106   -8.931  18.480  1.00 0.00 ? 66  GLU A HG3  6  
ATOM 10753 N N    . ASP A 1 67  ? 3.345   -9.724  18.026  1.00 0.00 ? 67  ASP A N    6  
ATOM 10754 C CA   . ASP A 1 67  ? 2.647   -10.606 18.969  1.00 0.00 ? 67  ASP A CA   6  
ATOM 10755 C C    . ASP A 1 67  ? 1.275   -11.048 18.429  1.00 0.00 ? 67  ASP A C    6  
ATOM 10756 O O    . ASP A 1 67  ? 0.919   -12.219 18.559  1.00 0.00 ? 67  ASP A O    6  
ATOM 10757 C CB   . ASP A 1 67  ? 2.508   -9.902  20.322  1.00 0.00 ? 67  ASP A CB   6  
ATOM 10758 C CG   . ASP A 1 67  ? 1.926   -10.844 21.387  1.00 0.00 ? 67  ASP A CG   6  
ATOM 10759 O OD1  . ASP A 1 67  ? 2.720   -11.560 22.045  1.00 0.00 ? 67  ASP A OD1  6  
ATOM 10760 O OD2  . ASP A 1 67  ? 0.684   -10.866 21.566  1.00 0.00 ? 67  ASP A OD2  6  
ATOM 10761 H H    . ASP A 1 67  ? 3.273   -8.726  18.171  1.00 0.00 ? 67  ASP A H    6  
ATOM 10762 H HA   . ASP A 1 67  ? 3.250   -11.504 19.127  1.00 0.00 ? 67  ASP A HA   6  
ATOM 10763 H HB2  . ASP A 1 67  ? 3.494   -9.561  20.647  1.00 0.00 ? 67  ASP A HB2  6  
ATOM 10764 H HB3  . ASP A 1 67  ? 1.868   -9.027  20.213  1.00 0.00 ? 67  ASP A HB3  6  
ATOM 10765 N N    . VAL A 1 68  ? 0.528   -10.143 17.779  1.00 0.00 ? 68  VAL A N    6  
ATOM 10766 C CA   . VAL A 1 68  ? -0.763  -10.469 17.140  1.00 0.00 ? 68  VAL A CA   6  
ATOM 10767 C C    . VAL A 1 68  ? -0.577  -11.424 15.947  1.00 0.00 ? 68  VAL A C    6  
ATOM 10768 O O    . VAL A 1 68  ? -1.348  -12.373 15.816  1.00 0.00 ? 68  VAL A O    6  
ATOM 10769 C CB   . VAL A 1 68  ? -1.591  -9.222  16.727  1.00 0.00 ? 68  VAL A CB   6  
ATOM 10770 C CG1  . VAL A 1 68  ? -2.986  -9.612  16.198  1.00 0.00 ? 68  VAL A CG1  6  
ATOM 10771 C CG2  . VAL A 1 68  ? -1.823  -8.266  17.906  1.00 0.00 ? 68  VAL A CG2  6  
ATOM 10772 H H    . VAL A 1 68  ? 0.870   -9.184  17.774  1.00 0.00 ? 68  VAL A H    6  
ATOM 10773 H HA   . VAL A 1 68  ? -1.345  -10.992 17.893  1.00 0.00 ? 68  VAL A HA   6  
ATOM 10774 H HB   . VAL A 1 68  ? -1.056  -8.684  15.944  1.00 0.00 ? 68  VAL A HB   6  
ATOM 10775 H HG11 . VAL A 1 68  ? -3.527  -10.184 16.954  1.00 0.00 ? 68  VAL A HG11 6  
ATOM 10776 H HG12 . VAL A 1 68  ? -3.558  -8.717  15.953  1.00 0.00 ? 68  VAL A HG12 6  
ATOM 10777 H HG13 . VAL A 1 68  ? -2.900  -10.214 15.296  1.00 0.00 ? 68  VAL A HG13 6  
ATOM 10778 H HG21 . VAL A 1 68  ? -0.884  -7.843  18.240  1.00 0.00 ? 68  VAL A HG21 6  
ATOM 10779 H HG22 . VAL A 1 68  ? -2.471  -7.442  17.608  1.00 0.00 ? 68  VAL A HG22 6  
ATOM 10780 H HG23 . VAL A 1 68  ? -2.294  -8.796  18.736  1.00 0.00 ? 68  VAL A HG23 6  
ATOM 10781 N N    . VAL A 1 69  ? 0.449   -11.241 15.109  1.00 0.00 ? 69  VAL A N    6  
ATOM 10782 C CA   . VAL A 1 69  ? 0.742   -12.134 13.978  1.00 0.00 ? 69  VAL A CA   6  
ATOM 10783 C C    . VAL A 1 69  ? 1.258   -13.503 14.440  1.00 0.00 ? 69  VAL A C    6  
ATOM 10784 O O    . VAL A 1 69  ? 0.843   -14.515 13.883  1.00 0.00 ? 69  VAL A O    6  
ATOM 10785 C CB   . VAL A 1 69  ? 1.707   -11.474 12.963  1.00 0.00 ? 69  VAL A CB   6  
ATOM 10786 C CG1  . VAL A 1 69  ? 1.099   -10.190 12.372  1.00 0.00 ? 69  VAL A CG1  6  
ATOM 10787 C CG2  . VAL A 1 69  ? 3.112   -11.240 13.511  1.00 0.00 ? 69  VAL A CG2  6  
ATOM 10788 H H    . VAL A 1 69  ? 1.048   -10.427 15.218  1.00 0.00 ? 69  VAL A H    6  
ATOM 10789 H HA   . VAL A 1 69  ? -0.196  -12.305 13.450  1.00 0.00 ? 69  VAL A HA   6  
ATOM 10790 H HB   . VAL A 1 69  ? 1.849   -12.156 12.154  1.00 0.00 ? 69  VAL A HB   6  
ATOM 10791 H HG11 . VAL A 1 69  ? 0.198   -10.437 11.816  1.00 0.00 ? 69  VAL A HG11 6  
ATOM 10792 H HG12 . VAL A 1 69  ? 0.838   -9.487  13.159  1.00 0.00 ? 69  VAL A HG12 6  
ATOM 10793 H HG13 . VAL A 1 69  ? 1.808   -9.708  11.700  1.00 0.00 ? 69  VAL A HG13 6  
ATOM 10794 H HG21 . VAL A 1 69  ? 3.025   -10.802 14.491  1.00 0.00 ? 69  VAL A HG21 6  
ATOM 10795 H HG22 . VAL A 1 69  ? 3.643   -12.187 13.596  1.00 0.00 ? 69  VAL A HG22 6  
ATOM 10796 H HG23 . VAL A 1 69  ? 3.680   -10.580 12.855  1.00 0.00 ? 69  VAL A HG23 6  
ATOM 10797 N N    . GLY A 1 70  ? 2.123   -13.564 15.466  1.00 0.00 ? 70  GLY A N    6  
ATOM 10798 C CA   . GLY A 1 70  ? 2.564   -14.822 16.093  1.00 0.00 ? 70  GLY A CA   6  
ATOM 10799 C C    . GLY A 1 70  ? 3.346   -15.769 15.169  1.00 0.00 ? 70  GLY A C    6  
ATOM 10800 O O    . GLY A 1 70  ? 3.415   -16.967 15.442  1.00 0.00 ? 70  GLY A O    6  
ATOM 10801 H H    . GLY A 1 70  ? 2.450   -12.701 15.889  1.00 0.00 ? 70  GLY A H    6  
ATOM 10802 H HA2  . GLY A 1 70  ? 3.201   -14.582 16.946  1.00 0.00 ? 70  GLY A HA2  6  
ATOM 10803 H HA3  . GLY A 1 70  ? 1.685   -15.364 16.446  1.00 0.00 ? 70  GLY A HA3  6  
ATOM 10804 N N    . GLY A 1 71  ? 3.887   -15.250 14.058  1.00 0.00 ? 71  GLY A N    6  
ATOM 10805 C CA   . GLY A 1 71  ? 4.543   -16.021 12.989  1.00 0.00 ? 71  GLY A CA   6  
ATOM 10806 C C    . GLY A 1 71  ? 3.623   -16.403 11.817  1.00 0.00 ? 71  GLY A C    6  
ATOM 10807 O O    . GLY A 1 71  ? 4.118   -16.895 10.801  1.00 0.00 ? 71  GLY A O    6  
ATOM 10808 H H    . GLY A 1 71  ? 3.827   -14.249 13.941  1.00 0.00 ? 71  GLY A H    6  
ATOM 10809 H HA2  . GLY A 1 71  ? 5.352   -15.420 12.573  1.00 0.00 ? 71  GLY A HA2  6  
ATOM 10810 H HA3  . GLY A 1 71  ? 4.957   -16.942 13.399  1.00 0.00 ? 71  GLY A HA3  6  
ATOM 10811 N N    . CYS A 1 72  ? 2.309   -16.172 11.926  1.00 0.00 ? 72  CYS A N    6  
ATOM 10812 C CA   . CYS A 1 72  ? 1.321   -16.392 10.860  1.00 0.00 ? 72  CYS A CA   6  
ATOM 10813 C C    . CYS A 1 72  ? 1.330   -15.259 9.809   1.00 0.00 ? 72  CYS A C    6  
ATOM 10814 O O    . CYS A 1 72  ? 1.944   -14.206 10.003  1.00 0.00 ? 72  CYS A O    6  
ATOM 10815 C CB   . CYS A 1 72  ? -0.072  -16.568 11.498  1.00 0.00 ? 72  CYS A CB   6  
ATOM 10816 S SG   . CYS A 1 72  ? -0.068  -17.951 12.682  1.00 0.00 ? 72  CYS A SG   6  
ATOM 10817 H H    . CYS A 1 72  ? 1.966   -15.781 12.793  1.00 0.00 ? 72  CYS A H    6  
ATOM 10818 H HA   . CYS A 1 72  ? 1.575   -17.317 10.335  1.00 0.00 ? 72  CYS A HA   6  
ATOM 10819 H HB2  . CYS A 1 72  ? -0.372  -15.649 12.008  1.00 0.00 ? 72  CYS A HB2  6  
ATOM 10820 H HB3  . CYS A 1 72  ? -0.816  -16.774 10.724  1.00 0.00 ? 72  CYS A HB3  6  
ATOM 10821 H HG   . CYS A 1 72  ? -1.364  -17.869 13.021  1.00 0.00 ? 72  CYS A HG   6  
ATOM 10822 N N    . CYS A 1 73  ? 0.626   -15.475 8.692   1.00 0.00 ? 73  CYS A N    6  
ATOM 10823 C CA   . CYS A 1 73  ? 0.526   -14.509 7.587   1.00 0.00 ? 73  CYS A CA   6  
ATOM 10824 C C    . CYS A 1 73  ? -0.332  -13.275 7.934   1.00 0.00 ? 73  CYS A C    6  
ATOM 10825 O O    . CYS A 1 73  ? -1.251  -13.333 8.753   1.00 0.00 ? 73  CYS A O    6  
ATOM 10826 C CB   . CYS A 1 73  ? -0.011  -15.231 6.337   1.00 0.00 ? 73  CYS A CB   6  
ATOM 10827 S SG   . CYS A 1 73  ? 1.228   -16.412 5.715   1.00 0.00 ? 73  CYS A SG   6  
ATOM 10828 H H    . CYS A 1 73  ? 0.120   -16.344 8.610   1.00 0.00 ? 73  CYS A H    6  
ATOM 10829 H HA   . CYS A 1 73  ? 1.531   -14.141 7.365   1.00 0.00 ? 73  CYS A HA   6  
ATOM 10830 H HB2  . CYS A 1 73  ? -0.952  -15.744 6.564   1.00 0.00 ? 73  CYS A HB2  6  
ATOM 10831 H HB3  . CYS A 1 73  ? -0.211  -14.498 5.551   1.00 0.00 ? 73  CYS A HB3  6  
ATOM 10832 H HG   . CYS A 1 73  ? 1.314   -17.189 6.803   1.00 0.00 ? 73  CYS A HG   6  
ATOM 10833 N N    . TYR A 1 74  ? -0.069  -12.169 7.231   1.00 0.00 ? 74  TYR A N    6  
ATOM 10834 C CA   . TYR A 1 74  ? -0.820  -10.908 7.328   1.00 0.00 ? 74  TYR A CA   6  
ATOM 10835 C C    . TYR A 1 74  ? -0.664  -10.026 6.074   1.00 0.00 ? 74  TYR A C    6  
ATOM 10836 O O    . TYR A 1 74  ? 0.324   -10.145 5.347   1.00 0.00 ? 74  TYR A O    6  
ATOM 10837 C CB   . TYR A 1 74  ? -0.442  -10.148 8.613   1.00 0.00 ? 74  TYR A CB   6  
ATOM 10838 C CG   . TYR A 1 74  ? 0.964   -9.579  8.651   1.00 0.00 ? 74  TYR A CG   6  
ATOM 10839 C CD1  . TYR A 1 74  ? 2.055   -10.401 8.994   1.00 0.00 ? 74  TYR A CD1  6  
ATOM 10840 C CD2  . TYR A 1 74  ? 1.181   -8.215  8.370   1.00 0.00 ? 74  TYR A CD2  6  
ATOM 10841 C CE1  . TYR A 1 74  ? 3.354   -9.862  9.069   1.00 0.00 ? 74  TYR A CE1  6  
ATOM 10842 C CE2  . TYR A 1 74  ? 2.477   -7.666  8.443   1.00 0.00 ? 74  TYR A CE2  6  
ATOM 10843 C CZ   . TYR A 1 74  ? 3.569   -8.493  8.795   1.00 0.00 ? 74  TYR A CZ   6  
ATOM 10844 O OH   . TYR A 1 74  ? 4.827   -7.978  8.876   1.00 0.00 ? 74  TYR A OH   6  
ATOM 10845 H H    . TYR A 1 74  ? 0.687   -12.207 6.562   1.00 0.00 ? 74  TYR A H    6  
ATOM 10846 H HA   . TYR A 1 74  ? -1.874  -11.174 7.402   1.00 0.00 ? 74  TYR A HA   6  
ATOM 10847 H HB2  . TYR A 1 74  ? -1.143  -9.325  8.746   1.00 0.00 ? 74  TYR A HB2  6  
ATOM 10848 H HB3  . TYR A 1 74  ? -0.573  -10.807 9.470   1.00 0.00 ? 74  TYR A HB3  6  
ATOM 10849 H HD1  . TYR A 1 74  ? 1.897   -11.446 9.222   1.00 0.00 ? 74  TYR A HD1  6  
ATOM 10850 H HD2  . TYR A 1 74  ? 0.349   -7.578  8.108   1.00 0.00 ? 74  TYR A HD2  6  
ATOM 10851 H HE1  . TYR A 1 74  ? 4.191   -10.492 9.340   1.00 0.00 ? 74  TYR A HE1  6  
ATOM 10852 H HE2  . TYR A 1 74  ? 2.636   -6.617  8.235   1.00 0.00 ? 74  TYR A HE2  6  
ATOM 10853 H HH   . TYR A 1 74  ? 4.861   -7.037  8.675   1.00 0.00 ? 74  TYR A HH   6  
ATOM 10854 N N    . ARG A 1 75  ? -1.656  -9.167  5.810   1.00 0.00 ? 75  ARG A N    6  
ATOM 10855 C CA   . ARG A 1 75  ? -1.764  -8.285  4.627   1.00 0.00 ? 75  ARG A CA   6  
ATOM 10856 C C    . ARG A 1 75  ? -2.353  -6.929  5.039   1.00 0.00 ? 75  ARG A C    6  
ATOM 10857 O O    . ARG A 1 75  ? -2.906  -6.829  6.129   1.00 0.00 ? 75  ARG A O    6  
ATOM 10858 C CB   . ARG A 1 75  ? -2.667  -8.895  3.529   1.00 0.00 ? 75  ARG A CB   6  
ATOM 10859 C CG   . ARG A 1 75  ? -2.227  -10.272 3.010   1.00 0.00 ? 75  ARG A CG   6  
ATOM 10860 C CD   . ARG A 1 75  ? -2.870  -11.407 3.814   1.00 0.00 ? 75  ARG A CD   6  
ATOM 10861 N NE   . ARG A 1 75  ? -2.294  -12.708 3.432   1.00 0.00 ? 75  ARG A NE   6  
ATOM 10862 C CZ   . ARG A 1 75  ? -2.751  -13.914 3.751   1.00 0.00 ? 75  ARG A CZ   6  
ATOM 10863 N NH1  . ARG A 1 75  ? -3.833  -14.090 4.479   1.00 0.00 ? 75  ARG A NH1  6  
ATOM 10864 N NH2  . ARG A 1 75  ? -2.106  -14.981 3.330   1.00 0.00 ? 75  ARG A NH2  6  
ATOM 10865 H H    . ARG A 1 75  ? -2.414  -9.115  6.492   1.00 0.00 ? 75  ARG A H    6  
ATOM 10866 H HA   . ARG A 1 75  ? -0.771  -8.133  4.207   1.00 0.00 ? 75  ARG A HA   6  
ATOM 10867 H HB2  . ARG A 1 75  ? -3.698  -8.953  3.888   1.00 0.00 ? 75  ARG A HB2  6  
ATOM 10868 H HB3  . ARG A 1 75  ? -2.661  -8.217  2.671   1.00 0.00 ? 75  ARG A HB3  6  
ATOM 10869 H HG2  . ARG A 1 75  ? -2.541  -10.375 1.972   1.00 0.00 ? 75  ARG A HG2  6  
ATOM 10870 H HG3  . ARG A 1 75  ? -1.140  -10.348 3.047   1.00 0.00 ? 75  ARG A HG3  6  
ATOM 10871 H HD2  . ARG A 1 75  ? -2.710  -11.229 4.876   1.00 0.00 ? 75  ARG A HD2  6  
ATOM 10872 H HD3  . ARG A 1 75  ? -3.942  -11.398 3.623   1.00 0.00 ? 75  ARG A HD3  6  
ATOM 10873 H HE   . ARG A 1 75  ? -1.468  -12.672 2.849   1.00 0.00 ? 75  ARG A HE   6  
ATOM 10874 H HH11 . ARG A 1 75  ? -4.405  -13.296 4.779   1.00 0.00 ? 75  ARG A HH11 6  
ATOM 10875 H HH12 . ARG A 1 75  ? -4.163  -15.019 4.686   1.00 0.00 ? 75  ARG A HH12 6  
ATOM 10876 H HH21 . ARG A 1 75  ? -1.282  -14.892 2.755   1.00 0.00 ? 75  ARG A HH21 6  
ATOM 10877 H HH22 . ARG A 1 75  ? -2.446  -15.908 3.546   1.00 0.00 ? 75  ARG A HH22 6  
ATOM 10878 N N    . VAL A 1 76  ? -2.299  -5.910  4.182   1.00 0.00 ? 76  VAL A N    6  
ATOM 10879 C CA   . VAL A 1 76  ? -3.015  -4.629  4.385   1.00 0.00 ? 76  VAL A CA   6  
ATOM 10880 C C    . VAL A 1 76  ? -4.002  -4.402  3.240   1.00 0.00 ? 76  VAL A C    6  
ATOM 10881 O O    . VAL A 1 76  ? -3.660  -4.599  2.072   1.00 0.00 ? 76  VAL A O    6  
ATOM 10882 C CB   . VAL A 1 76  ? -2.052  -3.429  4.541   1.00 0.00 ? 76  VAL A CB   6  
ATOM 10883 C CG1  . VAL A 1 76  ? -2.763  -2.112  4.935   1.00 0.00 ? 76  VAL A CG1  6  
ATOM 10884 C CG2  . VAL A 1 76  ? -0.998  -3.766  5.610   1.00 0.00 ? 76  VAL A CG2  6  
ATOM 10885 H H    . VAL A 1 76  ? -1.763  -6.040  3.317   1.00 0.00 ? 76  VAL A H    6  
ATOM 10886 H HA   . VAL A 1 76  ? -3.582  -4.704  5.308   1.00 0.00 ? 76  VAL A HA   6  
ATOM 10887 H HB   . VAL A 1 76  ? -1.533  -3.268  3.597   1.00 0.00 ? 76  VAL A HB   6  
ATOM 10888 H HG11 . VAL A 1 76  ? -2.052  -1.286  4.907   1.00 0.00 ? 76  VAL A HG11 6  
ATOM 10889 H HG12 . VAL A 1 76  ? -3.580  -1.873  4.249   1.00 0.00 ? 76  VAL A HG12 6  
ATOM 10890 H HG13 . VAL A 1 76  ? -3.171  -2.167  5.944   1.00 0.00 ? 76  VAL A HG13 6  
ATOM 10891 H HG21 . VAL A 1 76  ? -0.358  -4.582  5.269   1.00 0.00 ? 76  VAL A HG21 6  
ATOM 10892 H HG22 . VAL A 1 76  ? -0.378  -2.892  5.799   1.00 0.00 ? 76  VAL A HG22 6  
ATOM 10893 H HG23 . VAL A 1 76  ? -1.489  -4.073  6.534   1.00 0.00 ? 76  VAL A HG23 6  
ATOM 10894 N N    . ASN A 1 77  ? -5.227  -3.996  3.582   1.00 0.00 ? 77  ASN A N    6  
ATOM 10895 C CA   . ASN A 1 77  ? -6.331  -3.787  2.642   1.00 0.00 ? 77  ASN A CA   6  
ATOM 10896 C C    . ASN A 1 77  ? -7.407  -2.850  3.223   1.00 0.00 ? 77  ASN A C    6  
ATOM 10897 O O    . ASN A 1 77  ? -7.936  -3.085  4.306   1.00 0.00 ? 77  ASN A O    6  
ATOM 10898 C CB   . ASN A 1 77  ? -6.949  -5.145  2.264   1.00 0.00 ? 77  ASN A CB   6  
ATOM 10899 C CG   . ASN A 1 77  ? -8.218  -4.973  1.433   1.00 0.00 ? 77  ASN A CG   6  
ATOM 10900 O OD1  . ASN A 1 77  ? -9.331  -5.110  1.922   1.00 0.00 ? 77  ASN A OD1  6  
ATOM 10901 N ND2  . ASN A 1 77  ? -8.097  -4.586  0.175   1.00 0.00 ? 77  ASN A ND2  6  
ATOM 10902 H H    . ASN A 1 77  ? -5.416  -3.847  4.571   1.00 0.00 ? 77  ASN A H    6  
ATOM 10903 H HA   . ASN A 1 77  ? -5.933  -3.328  1.737   1.00 0.00 ? 77  ASN A HA   6  
ATOM 10904 H HB2  . ASN A 1 77  ? -6.229  -5.737  1.701   1.00 0.00 ? 77  ASN A HB2  6  
ATOM 10905 H HB3  . ASN A 1 77  ? -7.204  -5.689  3.174   1.00 0.00 ? 77  ASN A HB3  6  
ATOM 10906 H HD21 . ASN A 1 77  ? -7.191  -4.489  -0.256  1.00 0.00 ? 77  ASN A HD21 6  
ATOM 10907 H HD22 . ASN A 1 77  ? -8.948  -4.411  -0.351  1.00 0.00 ? 77  ASN A HD22 6  
ATOM 10908 N N    . ASN A 1 78  ? -7.784  -1.824  2.456   1.00 0.00 ? 78  ASN A N    6  
ATOM 10909 C CA   . ASN A 1 78  ? -8.793  -0.821  2.815   1.00 0.00 ? 78  ASN A CA   6  
ATOM 10910 C C    . ASN A 1 78  ? -9.681  -0.489  1.602   1.00 0.00 ? 78  ASN A C    6  
ATOM 10911 O O    . ASN A 1 78  ? -9.780  0.657   1.178   1.00 0.00 ? 78  ASN A O    6  
ATOM 10912 C CB   . ASN A 1 78  ? -8.110  0.409   3.455   1.00 0.00 ? 78  ASN A CB   6  
ATOM 10913 C CG   . ASN A 1 78  ? -7.124  1.171   2.560   1.00 0.00 ? 78  ASN A CG   6  
ATOM 10914 O OD1  . ASN A 1 78  ? -6.704  0.730   1.495   1.00 0.00 ? 78  ASN A OD1  6  
ATOM 10915 N ND2  . ASN A 1 78  ? -6.734  2.362   2.978   1.00 0.00 ? 78  ASN A ND2  6  
ATOM 10916 H H    . ASN A 1 78  ? -7.290  -1.680  1.585   1.00 0.00 ? 78  ASN A H    6  
ATOM 10917 H HA   . ASN A 1 78  ? -9.458  -1.249  3.568   1.00 0.00 ? 78  ASN A HA   6  
ATOM 10918 H HB2  . ASN A 1 78  ? -8.884  1.108   3.786   1.00 0.00 ? 78  ASN A HB2  6  
ATOM 10919 H HB3  . ASN A 1 78  ? -7.576  0.088   4.350   1.00 0.00 ? 78  ASN A HB3  6  
ATOM 10920 H HD21 . ASN A 1 78  ? -7.055  2.721   3.861   1.00 0.00 ? 78  ASN A HD21 6  
ATOM 10921 H HD22 . ASN A 1 78  ? -6.065  2.867   2.423   1.00 0.00 ? 78  ASN A HD22 6  
ATOM 10922 N N    . SER A 1 79  ? -10.331 -1.502  1.020   1.00 0.00 ? 79  SER A N    6  
ATOM 10923 C CA   . SER A 1 79  ? -11.044 -1.410  -0.268  1.00 0.00 ? 79  SER A CA   6  
ATOM 10924 C C    . SER A 1 79  ? -12.010 -0.226  -0.399  1.00 0.00 ? 79  SER A C    6  
ATOM 10925 O O    . SER A 1 79  ? -12.010 0.434   -1.431  1.00 0.00 ? 79  SER A O    6  
ATOM 10926 C CB   . SER A 1 79  ? -11.794 -2.723  -0.551  1.00 0.00 ? 79  SER A CB   6  
ATOM 10927 O OG   . SER A 1 79  ? -10.895 -3.820  -0.626  1.00 0.00 ? 79  SER A OG   6  
ATOM 10928 H H    . SER A 1 79  ? -10.210 -2.433  1.407   1.00 0.00 ? 79  SER A H    6  
ATOM 10929 H HA   . SER A 1 79  ? -10.306 -1.277  -1.054  1.00 0.00 ? 79  SER A HA   6  
ATOM 10930 H HB2  . SER A 1 79  ? -12.524 -2.904  0.241   1.00 0.00 ? 79  SER A HB2  6  
ATOM 10931 H HB3  . SER A 1 79  ? -12.325 -2.637  -1.502  1.00 0.00 ? 79  SER A HB3  6  
ATOM 10932 H HG   . SER A 1 79  ? -11.415 -4.622  -0.792  1.00 0.00 ? 79  SER A HG   6  
ATOM 10933 N N    . LEU A 1 80  ? -12.774 0.110   0.646   1.00 0.00 ? 80  LEU A N    6  
ATOM 10934 C CA   . LEU A 1 80  ? -13.692 1.264   0.621   1.00 0.00 ? 80  LEU A CA   6  
ATOM 10935 C C    . LEU A 1 80  ? -12.965 2.619   0.626   1.00 0.00 ? 80  LEU A C    6  
ATOM 10936 O O    . LEU A 1 80  ? -13.411 3.557   -0.028  1.00 0.00 ? 80  LEU A O    6  
ATOM 10937 C CB   . LEU A 1 80  ? -14.667 1.182   1.806   1.00 0.00 ? 80  LEU A CB   6  
ATOM 10938 C CG   . LEU A 1 80  ? -15.599 -0.045  1.825   1.00 0.00 ? 80  LEU A CG   6  
ATOM 10939 C CD1  . LEU A 1 80  ? -16.514 0.059   3.058   1.00 0.00 ? 80  LEU A CD1  6  
ATOM 10940 C CD2  . LEU A 1 80  ? -16.435 -0.146  0.538   1.00 0.00 ? 80  LEU A CD2  6  
ATOM 10941 H H    . LEU A 1 80  ? -12.714 -0.462  1.477   1.00 0.00 ? 80  LEU A H    6  
ATOM 10942 H HA   . LEU A 1 80  ? -14.266 1.240   -0.308  1.00 0.00 ? 80  LEU A HA   6  
ATOM 10943 H HB2  . LEU A 1 80  ? -14.092 1.206   2.734   1.00 0.00 ? 80  LEU A HB2  6  
ATOM 10944 H HB3  . LEU A 1 80  ? -15.295 2.073   1.774   1.00 0.00 ? 80  LEU A HB3  6  
ATOM 10945 H HG   . LEU A 1 80  ? -14.997 -0.950  1.922   1.00 0.00 ? 80  LEU A HG   6  
ATOM 10946 H HD11 . LEU A 1 80  ? -17.152 0.941   2.982   1.00 0.00 ? 80  LEU A HD11 6  
ATOM 10947 H HD12 . LEU A 1 80  ? -17.139 -0.830  3.123   1.00 0.00 ? 80  LEU A HD12 6  
ATOM 10948 H HD13 . LEU A 1 80  ? -15.910 0.134   3.966   1.00 0.00 ? 80  LEU A HD13 6  
ATOM 10949 H HD21 . LEU A 1 80  ? -16.981 0.782   0.370   1.00 0.00 ? 80  LEU A HD21 6  
ATOM 10950 H HD22 . LEU A 1 80  ? -15.789 -0.330  -0.321  1.00 0.00 ? 80  LEU A HD22 6  
ATOM 10951 H HD23 . LEU A 1 80  ? -17.142 -0.969  0.618   1.00 0.00 ? 80  LEU A HD23 6  
ATOM 10952 N N    . ASP A 1 81  ? -11.825 2.712   1.315   1.00 0.00 ? 81  ASP A N    6  
ATOM 10953 C CA   . ASP A 1 81  ? -10.958 3.899   1.299   1.00 0.00 ? 81  ASP A CA   6  
ATOM 10954 C C    . ASP A 1 81  ? -10.169 4.013   -0.025  1.00 0.00 ? 81  ASP A C    6  
ATOM 10955 O O    . ASP A 1 81  ? -9.820  5.106   -0.468  1.00 0.00 ? 81  ASP A O    6  
ATOM 10956 C CB   . ASP A 1 81  ? -10.013 3.825   2.506   1.00 0.00 ? 81  ASP A CB   6  
ATOM 10957 C CG   . ASP A 1 81  ? -9.711  5.202   3.097   1.00 0.00 ? 81  ASP A CG   6  
ATOM 10958 O OD1  . ASP A 1 81  ? -10.581 5.702   3.850   1.00 0.00 ? 81  ASP A OD1  6  
ATOM 10959 O OD2  . ASP A 1 81  ? -8.592  5.725   2.892   1.00 0.00 ? 81  ASP A OD2  6  
ATOM 10960 H H    . ASP A 1 81  ? -11.490 1.887   1.793   1.00 0.00 ? 81  ASP A H    6  
ATOM 10961 H HA   . ASP A 1 81  ? -11.585 4.786   1.389   1.00 0.00 ? 81  ASP A HA   6  
ATOM 10962 H HB2  . ASP A 1 81  ? -10.464 3.218   3.294   1.00 0.00 ? 81  ASP A HB2  6  
ATOM 10963 H HB3  . ASP A 1 81  ? -9.092  3.330   2.205   1.00 0.00 ? 81  ASP A HB3  6  
ATOM 10964 N N    . HIS A 1 82  ? -9.915  2.877   -0.682  1.00 0.00 ? 82  HIS A N    6  
ATOM 10965 C CA   . HIS A 1 82  ? -9.379  2.821   -2.046  1.00 0.00 ? 82  HIS A CA   6  
ATOM 10966 C C    . HIS A 1 82  ? -10.449 3.215   -3.091  1.00 0.00 ? 82  HIS A C    6  
ATOM 10967 O O    . HIS A 1 82  ? -10.122 3.805   -4.125  1.00 0.00 ? 82  HIS A O    6  
ATOM 10968 C CB   . HIS A 1 82  ? -8.880  1.393   -2.319  1.00 0.00 ? 82  HIS A CB   6  
ATOM 10969 C CG   . HIS A 1 82  ? -7.902  1.282   -3.466  1.00 0.00 ? 82  HIS A CG   6  
ATOM 10970 N ND1  . HIS A 1 82  ? -7.947  1.964   -4.663  1.00 0.00 ? 82  HIS A ND1  6  
ATOM 10971 C CD2  . HIS A 1 82  ? -6.803  0.467   -3.517  1.00 0.00 ? 82  HIS A CD2  6  
ATOM 10972 C CE1  . HIS A 1 82  ? -6.903  1.572   -5.411  1.00 0.00 ? 82  HIS A CE1  6  
ATOM 10973 N NE2  . HIS A 1 82  ? -6.168  0.656   -4.753  1.00 0.00 ? 82  HIS A NE2  6  
ATOM 10974 H H    . HIS A 1 82  ? -10.141 2.009   -0.208  1.00 0.00 ? 82  HIS A H    6  
ATOM 10975 H HA   . HIS A 1 82  ? -8.540  3.517   -2.132  1.00 0.00 ? 82  HIS A HA   6  
ATOM 10976 H HB2  . HIS A 1 82  ? -8.389  1.008   -1.423  1.00 0.00 ? 82  HIS A HB2  6  
ATOM 10977 H HB3  . HIS A 1 82  ? -9.740  0.758   -2.539  1.00 0.00 ? 82  HIS A HB3  6  
ATOM 10978 H HD1  . HIS A 1 82  ? -8.639  2.661   -4.926  1.00 0.00 ? 82  HIS A HD1  6  
ATOM 10979 H HD2  . HIS A 1 82  ? -6.485  -0.209  -2.733  1.00 0.00 ? 82  HIS A HD2  6  
ATOM 10980 H HE1  . HIS A 1 82  ? -6.683  1.953   -6.403  1.00 0.00 ? 82  HIS A HE1  6  
ATOM 10981 N N    . GLU A 1 83  ? -11.719 2.881   -2.831  1.00 0.00 ? 83  GLU A N    6  
ATOM 10982 C CA   . GLU A 1 83  ? -12.865 3.172   -3.694  1.00 0.00 ? 83  GLU A CA   6  
ATOM 10983 C C    . GLU A 1 83  ? -13.139 4.686   -3.800  1.00 0.00 ? 83  GLU A C    6  
ATOM 10984 O O    . GLU A 1 83  ? -13.537 5.179   -4.860  1.00 0.00 ? 83  GLU A O    6  
ATOM 10985 C CB   . GLU A 1 83  ? -14.098 2.408   -3.180  1.00 0.00 ? 83  GLU A CB   6  
ATOM 10986 C CG   . GLU A 1 83  ? -15.190 2.215   -4.233  1.00 0.00 ? 83  GLU A CG   6  
ATOM 10987 C CD   . GLU A 1 83  ? -14.759 1.267   -5.363  1.00 0.00 ? 83  GLU A CD   6  
ATOM 10988 O OE1  . GLU A 1 83  ? -14.788 0.030   -5.164  1.00 0.00 ? 83  GLU A OE1  6  
ATOM 10989 O OE2  . GLU A 1 83  ? -14.406 1.745   -6.468  1.00 0.00 ? 83  GLU A OE2  6  
ATOM 10990 H H    . GLU A 1 83  ? -11.900 2.324   -2.005  1.00 0.00 ? 83  GLU A H    6  
ATOM 10991 H HA   . GLU A 1 83  ? -12.625 2.793   -4.681  1.00 0.00 ? 83  GLU A HA   6  
ATOM 10992 H HB2  . GLU A 1 83  ? -13.805 1.417   -2.842  1.00 0.00 ? 83  GLU A HB2  6  
ATOM 10993 H HB3  . GLU A 1 83  ? -14.526 2.938   -2.329  1.00 0.00 ? 83  GLU A HB3  6  
ATOM 10994 H HG2  . GLU A 1 83  ? -16.056 1.792   -3.730  1.00 0.00 ? 83  GLU A HG2  6  
ATOM 10995 H HG3  . GLU A 1 83  ? -15.469 3.184   -4.643  1.00 0.00 ? 83  GLU A HG3  6  
ATOM 10996 N N    . TYR A 1 84  ? -12.867 5.429   -2.720  1.00 0.00 ? 84  TYR A N    6  
ATOM 10997 C CA   . TYR A 1 84  ? -13.076 6.874   -2.598  1.00 0.00 ? 84  TYR A CA   6  
ATOM 10998 C C    . TYR A 1 84  ? -12.408 7.498   -1.355  1.00 0.00 ? 84  TYR A C    6  
ATOM 10999 O O    . TYR A 1 84  ? -12.340 6.883   -0.292  1.00 0.00 ? 84  TYR A O    6  
ATOM 11000 C CB   . TYR A 1 84  ? -14.581 7.228   -2.605  1.00 0.00 ? 84  TYR A CB   6  
ATOM 11001 C CG   . TYR A 1 84  ? -15.508 6.247   -1.901  1.00 0.00 ? 84  TYR A CG   6  
ATOM 11002 C CD1  . TYR A 1 84  ? -15.613 6.247   -0.497  1.00 0.00 ? 84  TYR A CD1  6  
ATOM 11003 C CD2  . TYR A 1 84  ? -16.269 5.330   -2.656  1.00 0.00 ? 84  TYR A CD2  6  
ATOM 11004 C CE1  . TYR A 1 84  ? -16.434 5.308   0.152   1.00 0.00 ? 84  TYR A CE1  6  
ATOM 11005 C CE2  . TYR A 1 84  ? -17.085 4.379   -2.013  1.00 0.00 ? 84  TYR A CE2  6  
ATOM 11006 C CZ   . TYR A 1 84  ? -17.155 4.355   -0.602  1.00 0.00 ? 84  TYR A CZ   6  
ATOM 11007 O OH   . TYR A 1 84  ? -17.915 3.416   0.025   1.00 0.00 ? 84  TYR A OH   6  
ATOM 11008 H H    . TYR A 1 84  ? -12.577 4.937   -1.887  1.00 0.00 ? 84  TYR A H    6  
ATOM 11009 H HA   . TYR A 1 84  ? -12.624 7.347   -3.472  1.00 0.00 ? 84  TYR A HA   6  
ATOM 11010 H HB2  . TYR A 1 84  ? -14.709 8.207   -2.140  1.00 0.00 ? 84  TYR A HB2  6  
ATOM 11011 H HB3  . TYR A 1 84  ? -14.908 7.325   -3.641  1.00 0.00 ? 84  TYR A HB3  6  
ATOM 11012 H HD1  . TYR A 1 84  ? -15.047 6.955   0.089   1.00 0.00 ? 84  TYR A HD1  6  
ATOM 11013 H HD2  . TYR A 1 84  ? -16.203 5.336   -3.736  1.00 0.00 ? 84  TYR A HD2  6  
ATOM 11014 H HE1  . TYR A 1 84  ? -16.503 5.312   1.228   1.00 0.00 ? 84  TYR A HE1  6  
ATOM 11015 H HE2  . TYR A 1 84  ? -17.649 3.663   -2.594  1.00 0.00 ? 84  TYR A HE2  6  
ATOM 11016 H HH   . TYR A 1 84  ? -17.852 3.473   0.983   1.00 0.00 ? 84  TYR A HH   6  
ATOM 11017 N N    . GLN A 1 85  ? -12.028 8.780   -1.493  1.00 0.00 ? 85  GLN A N    6  
ATOM 11018 C CA   . GLN A 1 85  ? -11.895 9.789   -0.428  1.00 0.00 ? 85  GLN A CA   6  
ATOM 11019 C C    . GLN A 1 85  ? -10.581 9.713   0.406   1.00 0.00 ? 85  GLN A C    6  
ATOM 11020 O O    . GLN A 1 85  ? -10.034 8.623   0.602   1.00 0.00 ? 85  GLN A O    6  
ATOM 11021 C CB   . GLN A 1 85  ? -13.225 9.860   0.375   1.00 0.00 ? 85  GLN A CB   6  
ATOM 11022 C CG   . GLN A 1 85  ? -13.234 9.709   1.901   1.00 0.00 ? 85  GLN A CG   6  
ATOM 11023 C CD   . GLN A 1 85  ? -12.885 8.320   2.463   1.00 0.00 ? 85  GLN A CD   6  
ATOM 11024 O OE1  . GLN A 1 85  ? -13.666 7.375   2.390   1.00 0.00 ? 85  GLN A OE1  6  
ATOM 11025 N NE2  . GLN A 1 85  ? -11.743 8.153   3.107   1.00 0.00 ? 85  GLN A NE2  6  
ATOM 11026 H H    . GLN A 1 85  ? -12.089 9.155   -2.428  1.00 0.00 ? 85  GLN A H    6  
ATOM 11027 H HA   . GLN A 1 85  ? -11.839 10.739  -0.965  1.00 0.00 ? 85  GLN A HA   6  
ATOM 11028 H HB2  . GLN A 1 85  ? -13.652 10.843  0.167   1.00 0.00 ? 85  GLN A HB2  6  
ATOM 11029 H HB3  . GLN A 1 85  ? -13.947 9.155   -0.031  1.00 0.00 ? 85  GLN A HB3  6  
ATOM 11030 H HG2  . GLN A 1 85  ? -12.592 10.471  2.319   1.00 0.00 ? 85  GLN A HG2  6  
ATOM 11031 H HG3  . GLN A 1 85  ? -14.241 9.947   2.236   1.00 0.00 ? 85  GLN A HG3  6  
ATOM 11032 H HE21 . GLN A 1 85  ? -11.108 8.929   3.202   1.00 0.00 ? 85  GLN A HE21 6  
ATOM 11033 H HE22 . GLN A 1 85  ? -11.441 7.215   3.371   1.00 0.00 ? 85  GLN A HE22 6  
ATOM 11034 N N    . PRO A 1 86  ? -10.049 10.857  0.901   1.00 0.00 ? 86  PRO A N    6  
ATOM 11035 C CA   . PRO A 1 86  ? -8.923  10.910  1.840   1.00 0.00 ? 86  PRO A CA   6  
ATOM 11036 C C    . PRO A 1 86  ? -9.410  10.686  3.278   1.00 0.00 ? 86  PRO A C    6  
ATOM 11037 O O    . PRO A 1 86  ? -10.603 10.791  3.540   1.00 0.00 ? 86  PRO A O    6  
ATOM 11038 C CB   . PRO A 1 86  ? -8.344  12.318  1.669   1.00 0.00 ? 86  PRO A CB   6  
ATOM 11039 C CG   . PRO A 1 86  ? -9.591  13.160  1.403   1.00 0.00 ? 86  PRO A CG   6  
ATOM 11040 C CD   . PRO A 1 86  ? -10.481 12.216  0.587   1.00 0.00 ? 86  PRO A CD   6  
ATOM 11041 H HA   . PRO A 1 86  ? -8.164  10.166  1.591   1.00 0.00 ? 86  PRO A HA   6  
ATOM 11042 H HB2  . PRO A 1 86  ? -7.803  12.657  2.553   1.00 0.00 ? 86  PRO A HB2  6  
ATOM 11043 H HB3  . PRO A 1 86  ? -7.692  12.343  0.795   1.00 0.00 ? 86  PRO A HB3  6  
ATOM 11044 H HG2  . PRO A 1 86  ? -10.084 13.406  2.346   1.00 0.00 ? 86  PRO A HG2  6  
ATOM 11045 H HG3  . PRO A 1 86  ? -9.353  14.070  0.850   1.00 0.00 ? 86  PRO A HG3  6  
ATOM 11046 H HD2  . PRO A 1 86  ? -11.529 12.369  0.853   1.00 0.00 ? 86  PRO A HD2  6  
ATOM 11047 H HD3  . PRO A 1 86  ? -10.330 12.410  -0.475  1.00 0.00 ? 86  PRO A HD3  6  
ATOM 11048 N N    . ARG A 1 87  ? -8.517  10.406  4.235   1.00 0.00 ? 87  ARG A N    6  
ATOM 11049 C CA   . ARG A 1 87  ? -8.906  10.207  5.643   1.00 0.00 ? 87  ARG A CA   6  
ATOM 11050 C C    . ARG A 1 87  ? -7.954  10.890  6.653   1.00 0.00 ? 87  ARG A C    6  
ATOM 11051 O O    . ARG A 1 87  ? -6.745  10.936  6.399   1.00 0.00 ? 87  ARG A O    6  
ATOM 11052 C CB   . ARG A 1 87  ? -9.099  8.694   5.875   1.00 0.00 ? 87  ARG A CB   6  
ATOM 11053 C CG   . ARG A 1 87  ? -7.813  7.893   6.127   1.00 0.00 ? 87  ARG A CG   6  
ATOM 11054 C CD   . ARG A 1 87  ? -8.145  6.406   6.283   1.00 0.00 ? 87  ARG A CD   6  
ATOM 11055 N NE   . ARG A 1 87  ? -6.934  5.607   6.543   1.00 0.00 ? 87  ARG A NE   6  
ATOM 11056 C CZ   . ARG A 1 87  ? -6.060  5.167   5.643   1.00 0.00 ? 87  ARG A CZ   6  
ATOM 11057 N NH1  . ARG A 1 87  ? -6.208  5.343   4.348   1.00 0.00 ? 87  ARG A NH1  6  
ATOM 11058 N NH2  . ARG A 1 87  ? -5.002  4.513   6.052   1.00 0.00 ? 87  ARG A NH2  6  
ATOM 11059 H H    . ARG A 1 87  ? -7.550  10.250  3.986   1.00 0.00 ? 87  ARG A H    6  
ATOM 11060 H HA   . ARG A 1 87  ? -9.884  10.667  5.777   1.00 0.00 ? 87  ARG A HA   6  
ATOM 11061 H HB2  . ARG A 1 87  ? -9.780  8.552   6.710   1.00 0.00 ? 87  ARG A HB2  6  
ATOM 11062 H HB3  . ARG A 1 87  ? -9.576  8.283   4.985   1.00 0.00 ? 87  ARG A HB3  6  
ATOM 11063 H HG2  . ARG A 1 87  ? -7.125  8.029   5.290   1.00 0.00 ? 87  ARG A HG2  6  
ATOM 11064 H HG3  . ARG A 1 87  ? -7.336  8.238   7.044   1.00 0.00 ? 87  ARG A HG3  6  
ATOM 11065 H HD2  . ARG A 1 87  ? -8.851  6.285   7.106   1.00 0.00 ? 87  ARG A HD2  6  
ATOM 11066 H HD3  . ARG A 1 87  ? -8.641  6.049   5.388   1.00 0.00 ? 87  ARG A HD3  6  
ATOM 11067 H HE   . ARG A 1 87  ? -6.744  5.379   7.514   1.00 0.00 ? 87  ARG A HE   6  
ATOM 11068 H HH11 . ARG A 1 87  ? -7.072  5.729   3.964   1.00 0.00 ? 87  ARG A HH11 6  
ATOM 11069 H HH12 . ARG A 1 87  ? -5.476  5.068   3.713   1.00 0.00 ? 87  ARG A HH12 6  
ATOM 11070 H HH21 . ARG A 1 87  ? -4.875  4.338   7.042   1.00 0.00 ? 87  ARG A HH21 6  
ATOM 11071 H HH22 . ARG A 1 87  ? -4.396  4.039   5.384   1.00 0.00 ? 87  ARG A HH22 6  
ATOM 11072 N N    . PRO A 1 88  ? -8.454  11.390  7.806   1.00 0.00 ? 88  PRO A N    6  
ATOM 11073 C CA   . PRO A 1 88  ? -7.644  12.050  8.832   1.00 0.00 ? 88  PRO A CA   6  
ATOM 11074 C C    . PRO A 1 88  ? -6.919  10.992  9.669   1.00 0.00 ? 88  PRO A C    6  
ATOM 11075 O O    . PRO A 1 88  ? -7.378  10.593  10.737  1.00 0.00 ? 88  PRO A O    6  
ATOM 11076 C CB   . PRO A 1 88  ? -8.631  12.903  9.632   1.00 0.00 ? 88  PRO A CB   6  
ATOM 11077 C CG   . PRO A 1 88  ? -9.911  12.071  9.591   1.00 0.00 ? 88  PRO A CG   6  
ATOM 11078 C CD   . PRO A 1 88  ? -9.865  11.475  8.182   1.00 0.00 ? 88  PRO A CD   6  
ATOM 11079 H HA   . PRO A 1 88  ? -6.909  12.715  8.375   1.00 0.00 ? 88  PRO A HA   6  
ATOM 11080 H HB2  . PRO A 1 88  ? -8.289  13.100  10.646  1.00 0.00 ? 88  PRO A HB2  6  
ATOM 11081 H HB3  . PRO A 1 88  ? -8.799  13.848  9.111   1.00 0.00 ? 88  PRO A HB3  6  
ATOM 11082 H HG2  . PRO A 1 88  ? -9.866  11.274  10.334  1.00 0.00 ? 88  PRO A HG2  6  
ATOM 11083 H HG3  . PRO A 1 88  ? -10.796 12.689  9.744   1.00 0.00 ? 88  PRO A HG3  6  
ATOM 11084 H HD2  . PRO A 1 88  ? -10.347 10.498  8.172   1.00 0.00 ? 88  PRO A HD2  6  
ATOM 11085 H HD3  . PRO A 1 88  ? -10.362 12.162  7.498   1.00 0.00 ? 88  PRO A HD3  6  
ATOM 11086 N N    . VAL A 1 89  ? -5.780  10.515  9.166   1.00 0.00 ? 89  VAL A N    6  
ATOM 11087 C CA   . VAL A 1 89  ? -5.052  9.348   9.704   1.00 0.00 ? 89  VAL A CA   6  
ATOM 11088 C C    . VAL A 1 89  ? -4.708  9.484   11.194  1.00 0.00 ? 89  VAL A C    6  
ATOM 11089 O O    . VAL A 1 89  ? -4.852  8.517   11.933  1.00 0.00 ? 89  VAL A O    6  
ATOM 11090 C CB   . VAL A 1 89  ? -3.822  9.054   8.804   1.00 0.00 ? 89  VAL A CB   6  
ATOM 11091 C CG1  . VAL A 1 89  ? -2.649  8.358   9.508   1.00 0.00 ? 89  VAL A CG1  6  
ATOM 11092 C CG2  . VAL A 1 89  ? -4.291  8.227   7.589   1.00 0.00 ? 89  VAL A CG2  6  
ATOM 11093 H H    . VAL A 1 89  ? -5.474  10.898  8.267   1.00 0.00 ? 89  VAL A H    6  
ATOM 11094 H HA   . VAL A 1 89  ? -5.727  8.493   9.627   1.00 0.00 ? 89  VAL A HA   6  
ATOM 11095 H HB   . VAL A 1 89  ? -3.439  10.005  8.431   1.00 0.00 ? 89  VAL A HB   6  
ATOM 11096 H HG11 . VAL A 1 89  ? -2.990  7.461   10.013  1.00 0.00 ? 89  VAL A HG11 6  
ATOM 11097 H HG12 . VAL A 1 89  ? -1.879  8.098   8.778   1.00 0.00 ? 89  VAL A HG12 6  
ATOM 11098 H HG13 . VAL A 1 89  ? -2.204  9.032   10.244  1.00 0.00 ? 89  VAL A HG13 6  
ATOM 11099 H HG21 . VAL A 1 89  ? -4.694  7.267   7.914   1.00 0.00 ? 89  VAL A HG21 6  
ATOM 11100 H HG22 . VAL A 1 89  ? -5.072  8.760   7.041   1.00 0.00 ? 89  VAL A HG22 6  
ATOM 11101 H HG23 . VAL A 1 89  ? -3.459  8.054   6.907   1.00 0.00 ? 89  VAL A HG23 6  
ATOM 11102 N N    . GLU A 1 90  ? -4.363  10.684  11.675  1.00 0.00 ? 90  GLU A N    6  
ATOM 11103 C CA   . GLU A 1 90  ? -4.035  10.908  13.097  1.00 0.00 ? 90  GLU A CA   6  
ATOM 11104 C C    . GLU A 1 90  ? -5.286  10.845  13.988  1.00 0.00 ? 90  GLU A C    6  
ATOM 11105 O O    . GLU A 1 90  ? -5.249  10.313  15.096  1.00 0.00 ? 90  GLU A O    6  
ATOM 11106 C CB   . GLU A 1 90  ? -3.324  12.255  13.288  1.00 0.00 ? 90  GLU A CB   6  
ATOM 11107 C CG   . GLU A 1 90  ? -2.066  12.380  12.422  1.00 0.00 ? 90  GLU A CG   6  
ATOM 11108 C CD   . GLU A 1 90  ? -1.259  13.632  12.794  1.00 0.00 ? 90  GLU A CD   6  
ATOM 11109 O OE1  . GLU A 1 90  ? -1.537  14.722  12.238  1.00 0.00 ? 90  GLU A OE1  6  
ATOM 11110 O OE2  . GLU A 1 90  ? -0.340  13.537  13.642  1.00 0.00 ? 90  GLU A OE2  6  
ATOM 11111 H H    . GLU A 1 90  ? -4.295  11.461  11.026  1.00 0.00 ? 90  GLU A H    6  
ATOM 11112 H HA   . GLU A 1 90  ? -3.353  10.122  13.425  1.00 0.00 ? 90  GLU A HA   6  
ATOM 11113 H HB2  . GLU A 1 90  ? -4.005  13.070  13.039  1.00 0.00 ? 90  GLU A HB2  6  
ATOM 11114 H HB3  . GLU A 1 90  ? -3.042  12.354  14.338  1.00 0.00 ? 90  GLU A HB3  6  
ATOM 11115 H HG2  . GLU A 1 90  ? -1.451  11.488  12.549  1.00 0.00 ? 90  GLU A HG2  6  
ATOM 11116 H HG3  . GLU A 1 90  ? -2.371  12.448  11.379  1.00 0.00 ? 90  GLU A HG3  6  
ATOM 11117 N N    . VAL A 1 91  ? -6.422  11.330  13.479  1.00 0.00 ? 91  VAL A N    6  
ATOM 11118 C CA   . VAL A 1 91  ? -7.715  11.314  14.190  1.00 0.00 ? 91  VAL A CA   6  
ATOM 11119 C C    . VAL A 1 91  ? -8.301  9.895   14.189  1.00 0.00 ? 91  VAL A C    6  
ATOM 11120 O O    . VAL A 1 91  ? -8.948  9.495   15.149  1.00 0.00 ? 91  VAL A O    6  
ATOM 11121 C CB   . VAL A 1 91  ? -8.698  12.335  13.575  1.00 0.00 ? 91  VAL A CB   6  
ATOM 11122 C CG1  . VAL A 1 91  ? -10.027 12.414  14.344  1.00 0.00 ? 91  VAL A CG1  6  
ATOM 11123 C CG2  . VAL A 1 91  ? -8.066  13.742  13.528  1.00 0.00 ? 91  VAL A CG2  6  
ATOM 11124 H H    . VAL A 1 91  ? -6.391  11.720  12.539  1.00 0.00 ? 91  VAL A H    6  
ATOM 11125 H HA   . VAL A 1 91  ? -7.529  11.608  15.226  1.00 0.00 ? 91  VAL A HA   6  
ATOM 11126 H HB   . VAL A 1 91  ? -8.908  12.024  12.557  1.00 0.00 ? 91  VAL A HB   6  
ATOM 11127 H HG11 . VAL A 1 91  ? -10.664 13.188  13.912  1.00 0.00 ? 91  VAL A HG11 6  
ATOM 11128 H HG12 . VAL A 1 91  ? -10.557 11.465  14.278  1.00 0.00 ? 91  VAL A HG12 6  
ATOM 11129 H HG13 . VAL A 1 91  ? -9.843  12.651  15.392  1.00 0.00 ? 91  VAL A HG13 6  
ATOM 11130 H HG21 . VAL A 1 91  ? -7.164  13.742  12.908  1.00 0.00 ? 91  VAL A HG21 6  
ATOM 11131 H HG22 . VAL A 1 91  ? -8.771  14.447  13.091  1.00 0.00 ? 91  VAL A HG22 6  
ATOM 11132 H HG23 . VAL A 1 91  ? -7.800  14.071  14.535  1.00 0.00 ? 91  VAL A HG23 6  
ATOM 11133 N N    . ILE A 1 92  ? -8.009  9.095   13.159  1.00 0.00 ? 92  ILE A N    6  
ATOM 11134 C CA   . ILE A 1 92  ? -8.364  7.663   13.091  1.00 0.00 ? 92  ILE A CA   6  
ATOM 11135 C C    . ILE A 1 92  ? -7.506  6.823   14.050  1.00 0.00 ? 92  ILE A C    6  
ATOM 11136 O O    . ILE A 1 92  ? -8.047  6.004   14.790  1.00 0.00 ? 92  ILE A O    6  
ATOM 11137 C CB   . ILE A 1 92  ? -8.311  7.230   11.606  1.00 0.00 ? 92  ILE A CB   6  
ATOM 11138 C CG1  . ILE A 1 92  ? -9.558  7.846   10.924  1.00 0.00 ? 92  ILE A CG1  6  
ATOM 11139 C CG2  . ILE A 1 92  ? -8.235  5.701   11.434  1.00 0.00 ? 92  ILE A CG2  6  
ATOM 11140 C CD1  . ILE A 1 92  ? -9.527  7.797   9.399   1.00 0.00 ? 92  ILE A CD1  6  
ATOM 11141 H H    . ILE A 1 92  ? -7.549  9.517   12.354  1.00 0.00 ? 92  ILE A H    6  
ATOM 11142 H HA   . ILE A 1 92  ? -9.393  7.523   13.441  1.00 0.00 ? 92  ILE A HA   6  
ATOM 11143 H HB   . ILE A 1 92  ? -7.416  7.651   11.145  1.00 0.00 ? 92  ILE A HB   6  
ATOM 11144 H HG12 . ILE A 1 92  ? -10.452 7.337   11.278  1.00 0.00 ? 92  ILE A HG12 6  
ATOM 11145 H HG13 . ILE A 1 92  ? -9.652  8.896   11.201  1.00 0.00 ? 92  ILE A HG13 6  
ATOM 11146 H HG21 . ILE A 1 92  ? -7.289  5.329   11.828  1.00 0.00 ? 92  ILE A HG21 6  
ATOM 11147 H HG22 . ILE A 1 92  ? -9.049  5.215   11.966  1.00 0.00 ? 92  ILE A HG22 6  
ATOM 11148 H HG23 . ILE A 1 92  ? -8.278  5.425   10.380  1.00 0.00 ? 92  ILE A HG23 6  
ATOM 11149 H HD11 . ILE A 1 92  ? -8.649  8.331   9.036   1.00 0.00 ? 92  ILE A HD11 6  
ATOM 11150 H HD12 . ILE A 1 92  ? -9.506  6.765   9.061   1.00 0.00 ? 92  ILE A HD12 6  
ATOM 11151 H HD13 . ILE A 1 92  ? -10.426 8.276   9.008   1.00 0.00 ? 92  ILE A HD13 6  
ATOM 11152 N N    . ILE A 1 93  ? -6.198  7.092   14.127  1.00 0.00 ? 93  ILE A N    6  
ATOM 11153 C CA   . ILE A 1 93  ? -5.301  6.520   15.155  1.00 0.00 ? 93  ILE A CA   6  
ATOM 11154 C C    . ILE A 1 93  ? -5.778  6.913   16.563  1.00 0.00 ? 93  ILE A C    6  
ATOM 11155 O O    . ILE A 1 93  ? -5.786  6.088   17.473  1.00 0.00 ? 93  ILE A O    6  
ATOM 11156 C CB   . ILE A 1 93  ? -3.840  6.960   14.860  1.00 0.00 ? 93  ILE A CB   6  
ATOM 11157 C CG1  . ILE A 1 93  ? -3.303  6.184   13.635  1.00 0.00 ? 93  ILE A CG1  6  
ATOM 11158 C CG2  . ILE A 1 93  ? -2.917  6.780   16.082  1.00 0.00 ? 93  ILE A CG2  6  
ATOM 11159 C CD1  . ILE A 1 93  ? -1.966  6.714   13.102  1.00 0.00 ? 93  ILE A CD1  6  
ATOM 11160 H H    . ILE A 1 93  ? -5.804  7.744   13.451  1.00 0.00 ? 93  ILE A H    6  
ATOM 11161 H HA   . ILE A 1 93  ? -5.361  5.430   15.114  1.00 0.00 ? 93  ILE A HA   6  
ATOM 11162 H HB   . ILE A 1 93  ? -3.842  8.024   14.617  1.00 0.00 ? 93  ILE A HB   6  
ATOM 11163 H HG12 . ILE A 1 93  ? -3.198  5.130   13.887  1.00 0.00 ? 93  ILE A HG12 6  
ATOM 11164 H HG13 . ILE A 1 93  ? -4.025  6.247   12.823  1.00 0.00 ? 93  ILE A HG13 6  
ATOM 11165 H HG21 . ILE A 1 93  ? -1.892  7.049   15.838  1.00 0.00 ? 93  ILE A HG21 6  
ATOM 11166 H HG22 . ILE A 1 93  ? -3.231  7.438   16.891  1.00 0.00 ? 93  ILE A HG22 6  
ATOM 11167 H HG23 . ILE A 1 93  ? -2.943  5.747   16.423  1.00 0.00 ? 93  ILE A HG23 6  
ATOM 11168 H HD11 . ILE A 1 93  ? -1.165  6.531   13.816  1.00 0.00 ? 93  ILE A HD11 6  
ATOM 11169 H HD12 . ILE A 1 93  ? -1.708  6.201   12.177  1.00 0.00 ? 93  ILE A HD12 6  
ATOM 11170 H HD13 . ILE A 1 93  ? -2.047  7.782   12.902  1.00 0.00 ? 93  ILE A HD13 6  
ATOM 11171 N N    . SER A 1 94  ? -6.220  8.158   16.747  1.00 0.00 ? 94  SER A N    6  
ATOM 11172 C CA   . SER A 1 94  ? -6.794  8.625   18.016  1.00 0.00 ? 94  SER A CA   6  
ATOM 11173 C C    . SER A 1 94  ? -8.122  7.912   18.340  1.00 0.00 ? 94  SER A C    6  
ATOM 11174 O O    . SER A 1 94  ? -8.328  7.476   19.468  1.00 0.00 ? 94  SER A O    6  
ATOM 11175 C CB   . SER A 1 94  ? -6.992  10.151  17.988  1.00 0.00 ? 94  SER A CB   6  
ATOM 11176 O OG   . SER A 1 94  ? -5.780  10.845  17.697  1.00 0.00 ? 94  SER A OG   6  
ATOM 11177 H H    . SER A 1 94  ? -6.108  8.818   15.989  1.00 0.00 ? 94  SER A H    6  
ATOM 11178 H HA   . SER A 1 94  ? -6.098  8.392   18.820  1.00 0.00 ? 94  SER A HA   6  
ATOM 11179 H HB2  . SER A 1 94  ? -7.746  10.407  17.244  1.00 0.00 ? 94  SER A HB2  6  
ATOM 11180 H HB3  . SER A 1 94  ? -7.359  10.473  18.964  1.00 0.00 ? 94  SER A HB3  6  
ATOM 11181 H HG   . SER A 1 94  ? -5.560  10.702  16.752  1.00 0.00 ? 94  SER A HG   6  
ATOM 11182 N N    . SER A 1 95  ? -9.000  7.723   17.349  1.00 0.00 ? 95  SER A N    6  
ATOM 11183 C CA   . SER A 1 95  ? -10.285 7.026   17.497  1.00 0.00 ? 95  SER A CA   6  
ATOM 11184 C C    . SER A 1 95  ? -10.090 5.562   17.921  1.00 0.00 ? 95  SER A C    6  
ATOM 11185 O O    . SER A 1 95  ? -10.775 5.081   18.825  1.00 0.00 ? 95  SER A O    6  
ATOM 11186 C CB   . SER A 1 95  ? -11.077 7.109   16.182  1.00 0.00 ? 95  SER A CB   6  
ATOM 11187 O OG   . SER A 1 95  ? -12.396 6.607   16.336  1.00 0.00 ? 95  SER A OG   6  
ATOM 11188 H H    . SER A 1 95  ? -8.788  8.123   16.444  1.00 0.00 ? 95  SER A H    6  
ATOM 11189 H HA   . SER A 1 95  ? -10.865 7.521   18.273  1.00 0.00 ? 95  SER A HA   6  
ATOM 11190 H HB2  . SER A 1 95  ? -11.134 8.152   15.866  1.00 0.00 ? 95  SER A HB2  6  
ATOM 11191 H HB3  . SER A 1 95  ? -10.558 6.535   15.415  1.00 0.00 ? 95  SER A HB3  6  
ATOM 11192 H HG   . SER A 1 95  ? -12.827 6.583   15.468  1.00 0.00 ? 95  SER A HG   6  
ATOM 11193 N N    . ALA A 1 96  ? -9.096  4.868   17.351  1.00 0.00 ? 96  ALA A N    6  
ATOM 11194 C CA   . ALA A 1 96  ? -8.707  3.521   17.766  1.00 0.00 ? 96  ALA A CA   6  
ATOM 11195 C C    . ALA A 1 96  ? -8.340  3.480   19.263  1.00 0.00 ? 96  ALA A C    6  
ATOM 11196 O O    . ALA A 1 96  ? -8.907  2.701   20.037  1.00 0.00 ? 96  ALA A O    6  
ATOM 11197 C CB   . ALA A 1 96  ? -7.554  3.073   16.853  1.00 0.00 ? 96  ALA A CB   6  
ATOM 11198 H H    . ALA A 1 96  ? -8.568  5.306   16.599  1.00 0.00 ? 96  ALA A H    6  
ATOM 11199 H HA   . ALA A 1 96  ? -9.556  2.854   17.621  1.00 0.00 ? 96  ALA A HA   6  
ATOM 11200 H HB1  . ALA A 1 96  ? -7.403  1.999   16.956  1.00 0.00 ? 96  ALA A HB1  6  
ATOM 11201 H HB2  . ALA A 1 96  ? -7.796  3.293   15.812  1.00 0.00 ? 96  ALA A HB2  6  
ATOM 11202 H HB3  . ALA A 1 96  ? -6.636  3.603   17.111  1.00 0.00 ? 96  ALA A HB3  6  
ATOM 11203 N N    . LYS A 1 97  ? -7.463  4.394   19.694  1.00 0.00 ? 97  LYS A N    6  
ATOM 11204 C CA   . LYS A 1 97  ? -7.062  4.559   21.098  1.00 0.00 ? 97  LYS A CA   6  
ATOM 11205 C C    . LYS A 1 97  ? -8.194  5.071   22.022  1.00 0.00 ? 97  LYS A C    6  
ATOM 11206 O O    . LYS A 1 97  ? -8.078  4.933   23.242  1.00 0.00 ? 97  LYS A O    6  
ATOM 11207 C CB   . LYS A 1 97  ? -5.825  5.474   21.163  1.00 0.00 ? 97  LYS A CB   6  
ATOM 11208 C CG   . LYS A 1 97  ? -4.585  4.812   20.532  1.00 0.00 ? 97  LYS A CG   6  
ATOM 11209 C CD   . LYS A 1 97  ? -3.302  5.634   20.718  1.00 0.00 ? 97  LYS A CD   6  
ATOM 11210 C CE   . LYS A 1 97  ? -3.394  7.013   20.042  1.00 0.00 ? 97  LYS A CE   6  
ATOM 11211 N NZ   . LYS A 1 97  ? -2.125  7.782   20.181  1.00 0.00 ? 97  LYS A NZ   6  
ATOM 11212 H H    . LYS A 1 97  ? -7.056  5.025   19.006  1.00 0.00 ? 97  LYS A H    6  
ATOM 11213 H HA   . LYS A 1 97  ? -6.776  3.581   21.489  1.00 0.00 ? 97  LYS A HA   6  
ATOM 11214 H HB2  . LYS A 1 97  ? -6.048  6.418   20.663  1.00 0.00 ? 97  LYS A HB2  6  
ATOM 11215 H HB3  . LYS A 1 97  ? -5.601  5.687   22.210  1.00 0.00 ? 97  LYS A HB3  6  
ATOM 11216 H HG2  . LYS A 1 97  ? -4.434  3.838   21.001  1.00 0.00 ? 97  LYS A HG2  6  
ATOM 11217 H HG3  . LYS A 1 97  ? -4.754  4.650   19.468  1.00 0.00 ? 97  LYS A HG3  6  
ATOM 11218 H HD2  . LYS A 1 97  ? -3.104  5.758   21.785  1.00 0.00 ? 97  LYS A HD2  6  
ATOM 11219 H HD3  . LYS A 1 97  ? -2.472  5.075   20.280  1.00 0.00 ? 97  LYS A HD3  6  
ATOM 11220 H HE2  . LYS A 1 97  ? -3.634  6.868   18.984  1.00 0.00 ? 97  LYS A HE2  6  
ATOM 11221 H HE3  . LYS A 1 97  ? -4.214  7.575   20.499  1.00 0.00 ? 97  LYS A HE3  6  
ATOM 11222 H HZ1  . LYS A 1 97  ? -1.893  7.931   21.155  1.00 0.00 ? 97  LYS A HZ1  6  
ATOM 11223 H HZ2  . LYS A 1 97  ? -1.350  7.295   19.748  1.00 0.00 ? 97  LYS A HZ2  6  
ATOM 11224 H HZ3  . LYS A 1 97  ? -2.200  8.692   19.746  1.00 0.00 ? 97  LYS A HZ3  6  
ATOM 11225 N N    . GLU A 1 98  ? -9.292  5.603   21.473  1.00 0.00 ? 98  GLU A N    6  
ATOM 11226 C CA   . GLU A 1 98  ? -10.514 5.926   22.217  1.00 0.00 ? 98  GLU A CA   6  
ATOM 11227 C C    . GLU A 1 98  ? -11.466 4.726   22.361  1.00 0.00 ? 98  GLU A C    6  
ATOM 11228 O O    . GLU A 1 98  ? -12.000 4.504   23.450  1.00 0.00 ? 98  GLU A O    6  
ATOM 11229 C CB   . GLU A 1 98  ? -11.252 7.123   21.588  1.00 0.00 ? 98  GLU A CB   6  
ATOM 11230 C CG   . GLU A 1 98  ? -10.560 8.458   21.887  1.00 0.00 ? 98  GLU A CG   6  
ATOM 11231 C CD   . GLU A 1 98  ? -11.339 9.627   21.271  1.00 0.00 ? 98  GLU A CD   6  
ATOM 11232 O OE1  . GLU A 1 98  ? -11.194 9.886   20.052  1.00 0.00 ? 98  GLU A OE1  6  
ATOM 11233 O OE2  . GLU A 1 98  ? -12.101 10.302  22.005  1.00 0.00 ? 98  GLU A OE2  6  
ATOM 11234 H H    . GLU A 1 98  ? -9.272  5.810   20.486  1.00 0.00 ? 98  GLU A H    6  
ATOM 11235 H HA   . GLU A 1 98  ? -10.224 6.209   23.218  1.00 0.00 ? 98  GLU A HA   6  
ATOM 11236 H HB2  . GLU A 1 98  ? -11.337 6.987   20.512  1.00 0.00 ? 98  GLU A HB2  6  
ATOM 11237 H HB3  . GLU A 1 98  ? -12.257 7.169   22.007  1.00 0.00 ? 98  GLU A HB3  6  
ATOM 11238 H HG2  . GLU A 1 98  ? -10.501 8.590   22.969  1.00 0.00 ? 98  GLU A HG2  6  
ATOM 11239 H HG3  . GLU A 1 98  ? -9.542  8.451   21.498  1.00 0.00 ? 98  GLU A HG3  6  
ATOM 11240 N N    . MET A 1 99  ? -11.671 3.938   21.297  1.00 0.00 ? 99  MET A N    6  
ATOM 11241 C CA   . MET A 1 99  ? -12.611 2.807   21.310  1.00 0.00 ? 99  MET A CA   6  
ATOM 11242 C C    . MET A 1 99  ? -12.033 1.542   21.943  1.00 0.00 ? 99  MET A C    6  
ATOM 11243 O O    . MET A 1 99  ? -12.790 0.724   22.459  1.00 0.00 ? 99  MET A O    6  
ATOM 11244 C CB   . MET A 1 99  ? -13.185 2.553   19.908  1.00 0.00 ? 99  MET A CB   6  
ATOM 11245 C CG   . MET A 1 99  ? -12.235 1.878   18.912  1.00 0.00 ? 99  MET A CG   6  
ATOM 11246 S SD   . MET A 1 99  ? -12.928 1.650   17.250  1.00 0.00 ? 99  MET A SD   6  
ATOM 11247 C CE   . MET A 1 99  ? -14.364 0.603   17.613  1.00 0.00 ? 99  MET A CE   6  
ATOM 11248 H H    . MET A 1 99  ? -11.227 4.195   20.419  1.00 0.00 ? 99  MET A H    6  
ATOM 11249 H HA   . MET A 1 99  ? -13.464 3.068   21.940  1.00 0.00 ? 99  MET A HA   6  
ATOM 11250 H HB2  . MET A 1 99  ? -14.058 1.917   20.028  1.00 0.00 ? 99  MET A HB2  6  
ATOM 11251 H HB3  . MET A 1 99  ? -13.521 3.505   19.491  1.00 0.00 ? 99  MET A HB3  6  
ATOM 11252 H HG2  . MET A 1 99  ? -11.346 2.498   18.820  1.00 0.00 ? 99  MET A HG2  6  
ATOM 11253 H HG3  . MET A 1 99  ? -11.939 0.901   19.294  1.00 0.00 ? 99  MET A HG3  6  
ATOM 11254 H HE1  . MET A 1 99  ? -15.117 1.171   18.162  1.00 0.00 ? 99  MET A HE1  6  
ATOM 11255 H HE2  . MET A 1 99  ? -14.801 0.258   16.677  1.00 0.00 ? 99  MET A HE2  6  
ATOM 11256 H HE3  . MET A 1 99  ? -14.066 -0.257  18.211  1.00 0.00 ? 99  MET A HE3  6  
ATOM 11257 N N    . VAL A 1 100 ? -10.710 1.373   21.942  1.00 0.00 ? 100 VAL A N    6  
ATOM 11258 C CA   . VAL A 1 100 ? -10.053 0.244   22.616  1.00 0.00 ? 100 VAL A CA   6  
ATOM 11259 C C    . VAL A 1 100 ? -10.533 0.076   24.063  1.00 0.00 ? 100 VAL A C    6  
ATOM 11260 O O    . VAL A 1 100 ? -10.580 1.028   24.844  1.00 0.00 ? 100 VAL A O    6  
ATOM 11261 C CB   . VAL A 1 100 ? -8.521  0.284   22.499  1.00 0.00 ? 100 VAL A CB   6  
ATOM 11262 C CG1  . VAL A 1 100 ? -7.861  1.448   23.242  1.00 0.00 ? 100 VAL A CG1  6  
ATOM 11263 C CG2  . VAL A 1 100 ? -7.918  -1.045  22.962  1.00 0.00 ? 100 VAL A CG2  6  
ATOM 11264 H H    . VAL A 1 100 ? -10.152 2.042   21.419  1.00 0.00 ? 100 VAL A H    6  
ATOM 11265 H HA   . VAL A 1 100 ? -10.376 -0.639  22.070  1.00 0.00 ? 100 VAL A HA   6  
ATOM 11266 H HB   . VAL A 1 100 ? -8.293  0.394   21.443  1.00 0.00 ? 100 VAL A HB   6  
ATOM 11267 H HG11 . VAL A 1 100 ? -8.341  2.378   22.950  1.00 0.00 ? 100 VAL A HG11 6  
ATOM 11268 H HG12 . VAL A 1 100 ? -7.950  1.320   24.322  1.00 0.00 ? 100 VAL A HG12 6  
ATOM 11269 H HG13 . VAL A 1 100 ? -6.802  1.494   22.984  1.00 0.00 ? 100 VAL A HG13 6  
ATOM 11270 H HG21 . VAL A 1 100 ? -8.382  -1.866  22.419  1.00 0.00 ? 100 VAL A HG21 6  
ATOM 11271 H HG22 . VAL A 1 100 ? -6.856  -1.055  22.751  1.00 0.00 ? 100 VAL A HG22 6  
ATOM 11272 H HG23 . VAL A 1 100 ? -8.067  -1.192  24.032  1.00 0.00 ? 100 VAL A HG23 6  
ATOM 11273 N N    . GLY A 1 101 ? -10.936 -1.157  24.374  1.00 0.00 ? 101 GLY A N    6  
ATOM 11274 C CA   . GLY A 1 101 ? -11.618 -1.548  25.611  1.00 0.00 ? 101 GLY A CA   6  
ATOM 11275 C C    . GLY A 1 101 ? -13.124 -1.780  25.445  1.00 0.00 ? 101 GLY A C    6  
ATOM 11276 O O    . GLY A 1 101 ? -13.718 -2.408  26.322  1.00 0.00 ? 101 GLY A O    6  
ATOM 11277 H H    . GLY A 1 101 ? -10.811 -1.872  23.668  1.00 0.00 ? 101 GLY A H    6  
ATOM 11278 H HA2  . GLY A 1 101 ? -11.190 -2.489  25.956  1.00 0.00 ? 101 GLY A HA2  6  
ATOM 11279 H HA3  . GLY A 1 101 ? -11.484 -0.783  26.378  1.00 0.00 ? 101 GLY A HA3  6  
ATOM 11280 N N    . GLN A 1 102 ? -13.753 -1.321  24.350  1.00 0.00 ? 102 GLN A N    6  
ATOM 11281 C CA   . GLN A 1 102 ? -15.163 -1.599  24.074  1.00 0.00 ? 102 GLN A CA   6  
ATOM 11282 C C    . GLN A 1 102 ? -15.377 -3.013  23.509  1.00 0.00 ? 102 GLN A C    6  
ATOM 11283 O O    . GLN A 1 102 ? -14.451 -3.690  23.045  1.00 0.00 ? 102 GLN A O    6  
ATOM 11284 C CB   . GLN A 1 102 ? -15.828 -0.486  23.229  1.00 0.00 ? 102 GLN A CB   6  
ATOM 11285 C CG   . GLN A 1 102 ? -15.667 -0.541  21.693  1.00 0.00 ? 102 GLN A CG   6  
ATOM 11286 C CD   . GLN A 1 102 ? -16.573 0.470   20.981  1.00 0.00 ? 102 GLN A CD   6  
ATOM 11287 O OE1  . GLN A 1 102 ? -17.341 0.137   20.086  1.00 0.00 ? 102 GLN A OE1  6  
ATOM 11288 N NE2  . GLN A 1 102 ? -16.539 1.737   21.344  1.00 0.00 ? 102 GLN A NE2  6  
ATOM 11289 H H    . GLN A 1 102 ? -13.244 -0.775  23.668  1.00 0.00 ? 102 GLN A H    6  
ATOM 11290 H HA   . GLN A 1 102 ? -15.682 -1.582  25.037  1.00 0.00 ? 102 GLN A HA   6  
ATOM 11291 H HB2  . GLN A 1 102 ? -16.900 -0.526  23.437  1.00 0.00 ? 102 GLN A HB2  6  
ATOM 11292 H HB3  . GLN A 1 102 ? -15.472 0.478   23.593  1.00 0.00 ? 102 GLN A HB3  6  
ATOM 11293 H HG2  . GLN A 1 102 ? -14.642 -0.326  21.404  1.00 0.00 ? 102 GLN A HG2  6  
ATOM 11294 H HG3  . GLN A 1 102 ? -15.918 -1.536  21.333  1.00 0.00 ? 102 GLN A HG3  6  
ATOM 11295 H HE21 . GLN A 1 102 ? -15.943 2.041   22.098  1.00 0.00 ? 102 GLN A HE21 6  
ATOM 11296 H HE22 . GLN A 1 102 ? -17.161 2.383   20.879  1.00 0.00 ? 102 GLN A HE22 6  
ATOM 11297 N N    . LYS A 1 103 ? -16.639 -3.439  23.565  1.00 0.00 ? 103 LYS A N    6  
ATOM 11298 C CA   . LYS A 1 103 ? -17.111 -4.772  23.173  1.00 0.00 ? 103 LYS A CA   6  
ATOM 11299 C C    . LYS A 1 103 ? -18.299 -4.715  22.195  1.00 0.00 ? 103 LYS A C    6  
ATOM 11300 O O    . LYS A 1 103 ? -19.115 -3.789  22.257  1.00 0.00 ? 103 LYS A O    6  
ATOM 11301 C CB   . LYS A 1 103 ? -17.516 -5.560  24.436  1.00 0.00 ? 103 LYS A CB   6  
ATOM 11302 C CG   . LYS A 1 103 ? -16.336 -5.864  25.372  1.00 0.00 ? 103 LYS A CG   6  
ATOM 11303 C CD   . LYS A 1 103 ? -16.816 -6.637  26.608  1.00 0.00 ? 103 LYS A CD   6  
ATOM 11304 C CE   . LYS A 1 103 ? -15.633 -6.922  27.539  1.00 0.00 ? 103 LYS A CE   6  
ATOM 11305 N NZ   . LYS A 1 103 ? -16.054 -7.634  28.777  1.00 0.00 ? 103 LYS A NZ   6  
ATOM 11306 H H    . LYS A 1 103 ? -17.323 -2.791  23.931  1.00 0.00 ? 103 LYS A H    6  
ATOM 11307 H HA   . LYS A 1 103 ? -16.301 -5.288  22.666  1.00 0.00 ? 103 LYS A HA   6  
ATOM 11308 H HB2  . LYS A 1 103 ? -18.270 -4.991  24.983  1.00 0.00 ? 103 LYS A HB2  6  
ATOM 11309 H HB3  . LYS A 1 103 ? -17.962 -6.505  24.132  1.00 0.00 ? 103 LYS A HB3  6  
ATOM 11310 H HG2  . LYS A 1 103 ? -15.601 -6.465  24.833  1.00 0.00 ? 103 LYS A HG2  6  
ATOM 11311 H HG3  . LYS A 1 103 ? -15.869 -4.933  25.694  1.00 0.00 ? 103 LYS A HG3  6  
ATOM 11312 H HD2  . LYS A 1 103 ? -17.562 -6.040  27.137  1.00 0.00 ? 103 LYS A HD2  6  
ATOM 11313 H HD3  . LYS A 1 103 ? -17.268 -7.580  26.292  1.00 0.00 ? 103 LYS A HD3  6  
ATOM 11314 H HE2  . LYS A 1 103 ? -14.902 -7.531  26.997  1.00 0.00 ? 103 LYS A HE2  6  
ATOM 11315 H HE3  . LYS A 1 103 ? -15.147 -5.977  27.803  1.00 0.00 ? 103 LYS A HE3  6  
ATOM 11316 H HZ1  . LYS A 1 103 ? -16.712 -7.082  29.311  1.00 0.00 ? 103 LYS A HZ1  6  
ATOM 11317 H HZ2  . LYS A 1 103 ? -16.483 -8.523  28.559  1.00 0.00 ? 103 LYS A HZ2  6  
ATOM 11318 H HZ3  . LYS A 1 103 ? -15.255 -7.816  29.375  1.00 0.00 ? 103 LYS A HZ3  6  
ATOM 11319 N N    . MET A 1 104 ? -18.426 -5.727  21.323  1.00 0.00 ? 104 MET A N    6  
ATOM 11320 C CA   . MET A 1 104 ? -19.474 -5.825  20.287  1.00 0.00 ? 104 MET A CA   6  
ATOM 11321 C C    . MET A 1 104 ? -19.987 -7.262  20.107  1.00 0.00 ? 104 MET A C    6  
ATOM 11322 O O    . MET A 1 104 ? -19.293 -8.224  20.434  1.00 0.00 ? 104 MET A O    6  
ATOM 11323 C CB   . MET A 1 104 ? -18.976 -5.279  18.932  1.00 0.00 ? 104 MET A CB   6  
ATOM 11324 C CG   . MET A 1 104 ? -18.495 -3.821  18.978  1.00 0.00 ? 104 MET A CG   6  
ATOM 11325 S SD   . MET A 1 104 ? -16.746 -3.588  19.397  1.00 0.00 ? 104 MET A SD   6  
ATOM 11326 C CE   . MET A 1 104 ? -16.041 -4.065  17.805  1.00 0.00 ? 104 MET A CE   6  
ATOM 11327 H H    . MET A 1 104 ? -17.749 -6.481  21.382  1.00 0.00 ? 104 MET A H    6  
ATOM 11328 H HA   . MET A 1 104 ? -20.326 -5.214  20.586  1.00 0.00 ? 104 MET A HA   6  
ATOM 11329 H HB2  . MET A 1 104 ? -18.178 -5.920  18.551  1.00 0.00 ? 104 MET A HB2  6  
ATOM 11330 H HB3  . MET A 1 104 ? -19.804 -5.324  18.224  1.00 0.00 ? 104 MET A HB3  6  
ATOM 11331 H HG2  . MET A 1 104 ? -18.668 -3.366  18.001  1.00 0.00 ? 104 MET A HG2  6  
ATOM 11332 H HG3  . MET A 1 104 ? -19.108 -3.268  19.693  1.00 0.00 ? 104 MET A HG3  6  
ATOM 11333 H HE1  . MET A 1 104 ? -14.959 -3.941  17.825  1.00 0.00 ? 104 MET A HE1  6  
ATOM 11334 H HE2  . MET A 1 104 ? -16.279 -5.107  17.593  1.00 0.00 ? 104 MET A HE2  6  
ATOM 11335 H HE3  . MET A 1 104 ? -16.457 -3.432  17.020  1.00 0.00 ? 104 MET A HE3  6  
ATOM 11336 N N    . LYS A 1 105 ? -21.190 -7.422  19.542  1.00 0.00 ? 105 LYS A N    6  
ATOM 11337 C CA   . LYS A 1 105 ? -21.816 -8.741  19.296  1.00 0.00 ? 105 LYS A CA   6  
ATOM 11338 C C    . LYS A 1 105 ? -22.842 -8.760  18.134  1.00 0.00 ? 105 LYS A C    6  
ATOM 11339 O O    . LYS A 1 105 ? -23.370 -9.816  17.790  1.00 0.00 ? 105 LYS A O    6  
ATOM 11340 C CB   . LYS A 1 105 ? -22.416 -9.209  20.644  1.00 0.00 ? 105 LYS A CB   6  
ATOM 11341 C CG   . LYS A 1 105 ? -22.887 -10.673 20.741  1.00 0.00 ? 105 LYS A CG   6  
ATOM 11342 C CD   . LYS A 1 105 ? -21.872 -11.694 20.194  1.00 0.00 ? 105 LYS A CD   6  
ATOM 11343 C CE   . LYS A 1 105 ? -22.028 -13.086 20.826  1.00 0.00 ? 105 LYS A CE   6  
ATOM 11344 N NZ   . LYS A 1 105 ? -23.343 -13.725 20.536  1.00 0.00 ? 105 LYS A NZ   6  
ATOM 11345 H H    . LYS A 1 105 ? -21.750 -6.592  19.401  1.00 0.00 ? 105 LYS A H    6  
ATOM 11346 H HA   . LYS A 1 105 ? -21.022 -9.430  19.000  1.00 0.00 ? 105 LYS A HA   6  
ATOM 11347 H HB2  . LYS A 1 105 ? -21.662 -9.074  21.421  1.00 0.00 ? 105 LYS A HB2  6  
ATOM 11348 H HB3  . LYS A 1 105 ? -23.255 -8.561  20.900  1.00 0.00 ? 105 LYS A HB3  6  
ATOM 11349 H HG2  . LYS A 1 105 ? -23.068 -10.883 21.796  1.00 0.00 ? 105 LYS A HG2  6  
ATOM 11350 H HG3  . LYS A 1 105 ? -23.835 -10.793 20.215  1.00 0.00 ? 105 LYS A HG3  6  
ATOM 11351 H HD2  . LYS A 1 105 ? -21.969 -11.769 19.109  1.00 0.00 ? 105 LYS A HD2  6  
ATOM 11352 H HD3  . LYS A 1 105 ? -20.861 -11.346 20.410  1.00 0.00 ? 105 LYS A HD3  6  
ATOM 11353 H HE2  . LYS A 1 105 ? -21.220 -13.726 20.449  1.00 0.00 ? 105 LYS A HE2  6  
ATOM 11354 H HE3  . LYS A 1 105 ? -21.884 -12.996 21.907  1.00 0.00 ? 105 LYS A HE3  6  
ATOM 11355 H HZ1  . LYS A 1 105 ? -24.111 -13.210 20.952  1.00 0.00 ? 105 LYS A HZ1  6  
ATOM 11356 H HZ2  . LYS A 1 105 ? -23.505 -13.797 19.539  1.00 0.00 ? 105 LYS A HZ2  6  
ATOM 11357 H HZ3  . LYS A 1 105 ? -23.363 -14.676 20.916  1.00 0.00 ? 105 LYS A HZ3  6  
ATOM 11358 N N    . TYR A 1 106 ? -23.125 -7.610  17.509  1.00 0.00 ? 106 TYR A N    6  
ATOM 11359 C CA   . TYR A 1 106 ? -24.128 -7.482  16.438  1.00 0.00 ? 106 TYR A CA   6  
ATOM 11360 C C    . TYR A 1 106 ? -23.652 -8.064  15.092  1.00 0.00 ? 106 TYR A C    6  
ATOM 11361 O O    . TYR A 1 106 ? -22.493 -7.892  14.715  1.00 0.00 ? 106 TYR A O    6  
ATOM 11362 C CB   . TYR A 1 106 ? -24.519 -6.002  16.286  1.00 0.00 ? 106 TYR A CB   6  
ATOM 11363 C CG   . TYR A 1 106 ? -24.996 -5.344  17.570  1.00 0.00 ? 106 TYR A CG   6  
ATOM 11364 C CD1  . TYR A 1 106 ? -26.242 -5.698  18.122  1.00 0.00 ? 106 TYR A CD1  6  
ATOM 11365 C CD2  . TYR A 1 106 ? -24.180 -4.403  18.233  1.00 0.00 ? 106 TYR A CD2  6  
ATOM 11366 C CE1  . TYR A 1 106 ? -26.675 -5.118  19.330  1.00 0.00 ? 106 TYR A CE1  6  
ATOM 11367 C CE2  . TYR A 1 106 ? -24.605 -3.822  19.441  1.00 0.00 ? 106 TYR A CE2  6  
ATOM 11368 C CZ   . TYR A 1 106 ? -25.856 -4.175  19.995  1.00 0.00 ? 106 TYR A CZ   6  
ATOM 11369 O OH   . TYR A 1 106 ? -26.262 -3.613  21.168  1.00 0.00 ? 106 TYR A OH   6  
ATOM 11370 H H    . TYR A 1 106 ? -22.656 -6.770  17.808  1.00 0.00 ? 106 TYR A H    6  
ATOM 11371 H HA   . TYR A 1 106 ? -25.022 -8.028  16.743  1.00 0.00 ? 106 TYR A HA   6  
ATOM 11372 H HB2  . TYR A 1 106 ? -23.662 -5.448  15.900  1.00 0.00 ? 106 TYR A HB2  6  
ATOM 11373 H HB3  . TYR A 1 106 ? -25.316 -5.926  15.546  1.00 0.00 ? 106 TYR A HB3  6  
ATOM 11374 H HD1  . TYR A 1 106 ? -26.868 -6.421  17.617  1.00 0.00 ? 106 TYR A HD1  6  
ATOM 11375 H HD2  . TYR A 1 106 ? -23.222 -4.122  17.812  1.00 0.00 ? 106 TYR A HD2  6  
ATOM 11376 H HE1  . TYR A 1 106 ? -27.635 -5.394  19.748  1.00 0.00 ? 106 TYR A HE1  6  
ATOM 11377 H HE2  . TYR A 1 106 ? -23.977 -3.102  19.946  1.00 0.00 ? 106 TYR A HE2  6  
ATOM 11378 H HH   . TYR A 1 106 ? -27.128 -3.930  21.448  1.00 0.00 ? 106 TYR A HH   6  
ATOM 11379 N N    . SER A 1 107 ? -24.562 -8.711  14.356  1.00 0.00 ? 107 SER A N    6  
ATOM 11380 C CA   . SER A 1 107 ? -24.353 -9.284  13.008  1.00 0.00 ? 107 SER A CA   6  
ATOM 11381 C C    . SER A 1 107 ? -23.454 -10.548 12.987  1.00 0.00 ? 107 SER A C    6  
ATOM 11382 O O    . SER A 1 107 ? -23.044 -11.069 14.029  1.00 0.00 ? 107 SER A O    6  
ATOM 11383 C CB   . SER A 1 107 ? -23.860 -8.200  12.031  1.00 0.00 ? 107 SER A CB   6  
ATOM 11384 O OG   . SER A 1 107 ? -24.170 -8.566  10.695  1.00 0.00 ? 107 SER A OG   6  
ATOM 11385 H H    . SER A 1 107 ? -25.487 -8.818  14.751  1.00 0.00 ? 107 SER A H    6  
ATOM 11386 H HA   . SER A 1 107 ? -25.326 -9.609  12.634  1.00 0.00 ? 107 SER A HA   6  
ATOM 11387 H HB2  . SER A 1 107 ? -24.368 -7.260  12.261  1.00 0.00 ? 107 SER A HB2  6  
ATOM 11388 H HB3  . SER A 1 107 ? -22.781 -8.050  12.143  1.00 0.00 ? 107 SER A HB3  6  
ATOM 11389 H HG   . SER A 1 107 ? -24.319 -7.757  10.179  1.00 0.00 ? 107 SER A HG   6  
ATOM 11390 N N    . ILE A 1 108 ? -23.162 -11.069 11.786  1.00 0.00 ? 108 ILE A N    6  
ATOM 11391 C CA   . ILE A 1 108 ? -22.245 -12.209 11.564  1.00 0.00 ? 108 ILE A CA   6  
ATOM 11392 C C    . ILE A 1 108 ? -20.775 -11.777 11.721  1.00 0.00 ? 108 ILE A C    6  
ATOM 11393 O O    . ILE A 1 108 ? -20.449 -10.628 11.440  1.00 0.00 ? 108 ILE A O    6  
ATOM 11394 C CB   . ILE A 1 108 ? -22.515 -12.890 10.194  1.00 0.00 ? 108 ILE A CB   6  
ATOM 11395 C CG1  . ILE A 1 108 ? -22.340 -11.918 9.001   1.00 0.00 ? 108 ILE A CG1  6  
ATOM 11396 C CG2  . ILE A 1 108 ? -23.916 -13.535 10.208  1.00 0.00 ? 108 ILE A CG2  6  
ATOM 11397 C CD1  . ILE A 1 108 ? -22.427 -12.600 7.630   1.00 0.00 ? 108 ILE A CD1  6  
ATOM 11398 H H    . ILE A 1 108 ? -23.496 -10.554 10.975  1.00 0.00 ? 108 ILE A H    6  
ATOM 11399 H HA   . ILE A 1 108 ? -22.440 -12.944 12.351  1.00 0.00 ? 108 ILE A HA   6  
ATOM 11400 H HB   . ILE A 1 108 ? -21.789 -13.697 10.075  1.00 0.00 ? 108 ILE A HB   6  
ATOM 11401 H HG12 . ILE A 1 108 ? -23.094 -11.133 9.046   1.00 0.00 ? 108 ILE A HG12 6  
ATOM 11402 H HG13 . ILE A 1 108 ? -21.358 -11.448 9.064   1.00 0.00 ? 108 ILE A HG13 6  
ATOM 11403 H HG21 . ILE A 1 108 ? -24.693 -12.767 10.218  1.00 0.00 ? 108 ILE A HG21 6  
ATOM 11404 H HG22 . ILE A 1 108 ? -24.050 -14.166 9.331   1.00 0.00 ? 108 ILE A HG22 6  
ATOM 11405 H HG23 . ILE A 1 108 ? -24.027 -14.166 11.091  1.00 0.00 ? 108 ILE A HG23 6  
ATOM 11406 H HD11 . ILE A 1 108 ? -21.714 -13.424 7.578   1.00 0.00 ? 108 ILE A HD11 6  
ATOM 11407 H HD12 . ILE A 1 108 ? -23.435 -12.972 7.455   1.00 0.00 ? 108 ILE A HD12 6  
ATOM 11408 H HD13 . ILE A 1 108 ? -22.187 -11.874 6.851   1.00 0.00 ? 108 ILE A HD13 6  
ATOM 11409 N N    . VAL A 1 109 ? -19.874 -12.691 12.110  1.00 0.00 ? 109 VAL A N    6  
ATOM 11410 C CA   . VAL A 1 109 ? -18.482 -12.348 12.508  1.00 0.00 ? 109 VAL A CA   6  
ATOM 11411 C C    . VAL A 1 109 ? -17.704 -11.529 11.472  1.00 0.00 ? 109 VAL A C    6  
ATOM 11412 O O    . VAL A 1 109 ? -17.002 -10.595 11.847  1.00 0.00 ? 109 VAL A O    6  
ATOM 11413 C CB   . VAL A 1 109 ? -17.640 -13.576 12.943  1.00 0.00 ? 109 VAL A CB   6  
ATOM 11414 C CG1  . VAL A 1 109 ? -18.191 -14.164 14.249  1.00 0.00 ? 109 VAL A CG1  6  
ATOM 11415 C CG2  . VAL A 1 109 ? -17.549 -14.685 11.878  1.00 0.00 ? 109 VAL A CG2  6  
ATOM 11416 H H    . VAL A 1 109 ? -20.218 -13.623 12.307  1.00 0.00 ? 109 VAL A H    6  
ATOM 11417 H HA   . VAL A 1 109 ? -18.577 -11.710 13.388  1.00 0.00 ? 109 VAL A HA   6  
ATOM 11418 H HB   . VAL A 1 109 ? -16.626 -13.232 13.150  1.00 0.00 ? 109 VAL A HB   6  
ATOM 11419 H HG11 . VAL A 1 109 ? -17.505 -14.920 14.628  1.00 0.00 ? 109 VAL A HG11 6  
ATOM 11420 H HG12 . VAL A 1 109 ? -18.284 -13.371 14.992  1.00 0.00 ? 109 VAL A HG12 6  
ATOM 11421 H HG13 . VAL A 1 109 ? -19.170 -14.614 14.085  1.00 0.00 ? 109 VAL A HG13 6  
ATOM 11422 H HG21 . VAL A 1 109 ? -17.104 -14.300 10.962  1.00 0.00 ? 109 VAL A HG21 6  
ATOM 11423 H HG22 . VAL A 1 109 ? -16.923 -15.500 12.250  1.00 0.00 ? 109 VAL A HG22 6  
ATOM 11424 H HG23 . VAL A 1 109 ? -18.536 -15.086 11.647  1.00 0.00 ? 109 VAL A HG23 6  
ATOM 11425 N N    . SER A 1 110 ? -17.864 -11.802 10.173  1.00 0.00 ? 110 SER A N    6  
ATOM 11426 C CA   . SER A 1 110 ? -17.171 -11.041 9.117   1.00 0.00 ? 110 SER A CA   6  
ATOM 11427 C C    . SER A 1 110 ? -17.725 -9.615  8.981   1.00 0.00 ? 110 SER A C    6  
ATOM 11428 O O    . SER A 1 110 ? -16.949 -8.661  8.864   1.00 0.00 ? 110 SER A O    6  
ATOM 11429 C CB   . SER A 1 110 ? -17.238 -11.806 7.789   1.00 0.00 ? 110 SER A CB   6  
ATOM 11430 O OG   . SER A 1 110 ? -16.598 -13.070 7.925   1.00 0.00 ? 110 SER A OG   6  
ATOM 11431 H H    . SER A 1 110 ? -18.414 -12.611 9.903   1.00 0.00 ? 110 SER A H    6  
ATOM 11432 H HA   . SER A 1 110 ? -16.117 -10.938 9.376   1.00 0.00 ? 110 SER A HA   6  
ATOM 11433 H HB2  . SER A 1 110 ? -18.281 -11.947 7.500   1.00 0.00 ? 110 SER A HB2  6  
ATOM 11434 H HB3  . SER A 1 110 ? -16.732 -11.228 7.013   1.00 0.00 ? 110 SER A HB3  6  
ATOM 11435 H HG   . SER A 1 110 ? -16.696 -13.556 7.090   1.00 0.00 ? 110 SER A HG   6  
ATOM 11436 N N    . ARG A 1 111 ? -19.050 -9.434  9.104   1.00 0.00 ? 111 ARG A N    6  
ATOM 11437 C CA   . ARG A 1 111 ? -19.653 -8.095  9.128   1.00 0.00 ? 111 ARG A CA   6  
ATOM 11438 C C    . ARG A 1 111 ? -19.359 -7.368  10.437  1.00 0.00 ? 111 ARG A C    6  
ATOM 11439 O O    . ARG A 1 111 ? -19.087 -6.178  10.406  1.00 0.00 ? 111 ARG A O    6  
ATOM 11440 C CB   . ARG A 1 111 ? -21.161 -8.143  8.839   1.00 0.00 ? 111 ARG A CB   6  
ATOM 11441 C CG   . ARG A 1 111 ? -21.721 -6.755  8.442   1.00 0.00 ? 111 ARG A CG   6  
ATOM 11442 C CD   . ARG A 1 111 ? -21.382 -6.346  7.000   1.00 0.00 ? 111 ARG A CD   6  
ATOM 11443 N NE   . ARG A 1 111 ? -22.071 -7.194  6.009   1.00 0.00 ? 111 ARG A NE   6  
ATOM 11444 C CZ   . ARG A 1 111 ? -21.797 -7.272  4.713   1.00 0.00 ? 111 ARG A CZ   6  
ATOM 11445 N NH1  . ARG A 1 111 ? -20.836 -6.570  4.156   1.00 0.00 ? 111 ARG A NH1  6  
ATOM 11446 N NH2  . ARG A 1 111 ? -22.503 -8.076  3.944   1.00 0.00 ? 111 ARG A NH2  6  
ATOM 11447 H H    . ARG A 1 111 ? -19.637 -10.238 9.301   1.00 0.00 ? 111 ARG A H    6  
ATOM 11448 H HA   . ARG A 1 111 ? -19.181 -7.525  8.337   1.00 0.00 ? 111 ARG A HA   6  
ATOM 11449 H HB2  . ARG A 1 111 ? -21.356 -8.856  8.036   1.00 0.00 ? 111 ARG A HB2  6  
ATOM 11450 H HB3  . ARG A 1 111 ? -21.679 -8.498  9.731   1.00 0.00 ? 111 ARG A HB3  6  
ATOM 11451 H HG2  . ARG A 1 111 ? -22.806 -6.773  8.548   1.00 0.00 ? 111 ARG A HG2  6  
ATOM 11452 H HG3  . ARG A 1 111 ? -21.340 -5.980  9.116   1.00 0.00 ? 111 ARG A HG3  6  
ATOM 11453 H HD2  . ARG A 1 111 ? -21.686 -5.308  6.853   1.00 0.00 ? 111 ARG A HD2  6  
ATOM 11454 H HD3  . ARG A 1 111 ? -20.306 -6.403  6.853   1.00 0.00 ? 111 ARG A HD3  6  
ATOM 11455 H HE   . ARG A 1 111 ? -22.845 -7.750  6.350   1.00 0.00 ? 111 ARG A HE   6  
ATOM 11456 H HH11 . ARG A 1 111 ? -20.274 -5.923  4.715   1.00 0.00 ? 111 ARG A HH11 6  
ATOM 11457 H HH12 . ARG A 1 111 ? -20.643 -6.645  3.170   1.00 0.00 ? 111 ARG A HH12 6  
ATOM 11458 H HH21 . ARG A 1 111 ? -23.255 -8.629  4.325   1.00 0.00 ? 111 ARG A HH21 6  
ATOM 11459 H HH22 . ARG A 1 111 ? -22.307 -8.141  2.955   1.00 0.00 ? 111 ARG A HH22 6  
ATOM 11460 N N    . ASN A 1 112 ? -19.309 -8.064  11.569  1.00 0.00 ? 112 ASN A N    6  
ATOM 11461 C CA   . ASN A 1 112 ? -18.890 -7.505  12.863  1.00 0.00 ? 112 ASN A CA   6  
ATOM 11462 C C    . ASN A 1 112 ? -17.464 -6.916  12.782  1.00 0.00 ? 112 ASN A C    6  
ATOM 11463 O O    . ASN A 1 112 ? -17.228 -5.792  13.218  1.00 0.00 ? 112 ASN A O    6  
ATOM 11464 C CB   . ASN A 1 112 ? -19.023 -8.604  13.930  1.00 0.00 ? 112 ASN A CB   6  
ATOM 11465 C CG   . ASN A 1 112 ? -18.841 -8.065  15.340  1.00 0.00 ? 112 ASN A CG   6  
ATOM 11466 O OD1  . ASN A 1 112 ? -17.751 -8.067  15.889  1.00 0.00 ? 112 ASN A OD1  6  
ATOM 11467 N ND2  . ASN A 1 112 ? -19.900 -7.579  15.959  1.00 0.00 ? 112 ASN A ND2  6  
ATOM 11468 H H    . ASN A 1 112 ? -19.586 -9.040  11.520  1.00 0.00 ? 112 ASN A H    6  
ATOM 11469 H HA   . ASN A 1 112 ? -19.569 -6.693  13.126  1.00 0.00 ? 112 ASN A HA   6  
ATOM 11470 H HB2  . ASN A 1 112 ? -20.011 -9.061  13.852  1.00 0.00 ? 112 ASN A HB2  6  
ATOM 11471 H HB3  . ASN A 1 112 ? -18.279 -9.382  13.760  1.00 0.00 ? 112 ASN A HB3  6  
ATOM 11472 H HD21 . ASN A 1 112 ? -20.808 -7.605  15.502  1.00 0.00 ? 112 ASN A HD21 6  
ATOM 11473 H HD22 . ASN A 1 112 ? -19.791 -7.226  16.895  1.00 0.00 ? 112 ASN A HD22 6  
ATOM 11474 N N    . CYS A 1 113 ? -16.556 -7.627  12.102  1.00 0.00 ? 113 CYS A N    6  
ATOM 11475 C CA   . CYS A 1 113 ? -15.213 -7.168  11.726  1.00 0.00 ? 113 CYS A CA   6  
ATOM 11476 C C    . CYS A 1 113 ? -15.231 -5.944  10.779  1.00 0.00 ? 113 CYS A C    6  
ATOM 11477 O O    . CYS A 1 113 ? -14.598 -4.929  11.074  1.00 0.00 ? 113 CYS A O    6  
ATOM 11478 C CB   . CYS A 1 113 ? -14.476 -8.399  11.144  1.00 0.00 ? 113 CYS A CB   6  
ATOM 11479 S SG   . CYS A 1 113 ? -13.282 -9.018  12.368  1.00 0.00 ? 113 CYS A SG   6  
ATOM 11480 H H    . CYS A 1 113 ? -16.813 -8.573  11.847  1.00 0.00 ? 113 CYS A H    6  
ATOM 11481 H HA   . CYS A 1 113 ? -14.693 -6.836  12.627  1.00 0.00 ? 113 CYS A HA   6  
ATOM 11482 H HB2  . CYS A 1 113 ? -15.179 -9.203  10.909  1.00 0.00 ? 113 CYS A HB2  6  
ATOM 11483 H HB3  . CYS A 1 113 ? -13.953 -8.151  10.217  1.00 0.00 ? 113 CYS A HB3  6  
ATOM 11484 H HG   . CYS A 1 113 ? -12.835 -10.057 11.647  1.00 0.00 ? 113 CYS A HG   6  
ATOM 11485 N N    . GLU A 1 114 ? -15.978 -5.997  9.671   1.00 0.00 ? 114 GLU A N    6  
ATOM 11486 C CA   . GLU A 1 114 ? -16.102 -4.873  8.724   1.00 0.00 ? 114 GLU A CA   6  
ATOM 11487 C C    . GLU A 1 114 ? -16.718 -3.618  9.381   1.00 0.00 ? 114 GLU A C    6  
ATOM 11488 O O    . GLU A 1 114 ? -16.200 -2.510  9.252   1.00 0.00 ? 114 GLU A O    6  
ATOM 11489 C CB   . GLU A 1 114 ? -16.939 -5.331  7.519   1.00 0.00 ? 114 GLU A CB   6  
ATOM 11490 C CG   . GLU A 1 114 ? -17.003 -4.284  6.400   1.00 0.00 ? 114 GLU A CG   6  
ATOM 11491 C CD   . GLU A 1 114 ? -17.857 -4.797  5.233   1.00 0.00 ? 114 GLU A CD   6  
ATOM 11492 O OE1  . GLU A 1 114 ? -19.105 -4.705  5.310   1.00 0.00 ? 114 GLU A OE1  6  
ATOM 11493 O OE2  . GLU A 1 114 ? -17.290 -5.311  4.241   1.00 0.00 ? 114 GLU A OE2  6  
ATOM 11494 H H    . GLU A 1 114 ? -16.425 -6.879  9.436   1.00 0.00 ? 114 GLU A H    6  
ATOM 11495 H HA   . GLU A 1 114 ? -15.103 -4.618  8.368   1.00 0.00 ? 114 GLU A HA   6  
ATOM 11496 H HB2  . GLU A 1 114 ? -16.499 -6.241  7.112   1.00 0.00 ? 114 GLU A HB2  6  
ATOM 11497 H HB3  . GLU A 1 114 ? -17.952 -5.560  7.850   1.00 0.00 ? 114 GLU A HB3  6  
ATOM 11498 H HG2  . GLU A 1 114 ? -17.444 -3.359  6.778   1.00 0.00 ? 114 GLU A HG2  6  
ATOM 11499 H HG3  . GLU A 1 114 ? -15.992 -4.061  6.053   1.00 0.00 ? 114 GLU A HG3  6  
ATOM 11500 N N    . HIS A 1 115 ? -17.796 -3.787  10.145  1.00 0.00 ? 115 HIS A N    6  
ATOM 11501 C CA   . HIS A 1 115 ? -18.462 -2.748  10.938  1.00 0.00 ? 115 HIS A CA   6  
ATOM 11502 C C    . HIS A 1 115 ? -17.477 -2.088  11.928  1.00 0.00 ? 115 HIS A C    6  
ATOM 11503 O O    . HIS A 1 115 ? -17.462 -0.864  12.079  1.00 0.00 ? 115 HIS A O    6  
ATOM 11504 C CB   . HIS A 1 115 ? -19.649 -3.414  11.658  1.00 0.00 ? 115 HIS A CB   6  
ATOM 11505 C CG   . HIS A 1 115 ? -20.472 -2.520  12.555  1.00 0.00 ? 115 HIS A CG   6  
ATOM 11506 N ND1  . HIS A 1 115 ? -21.113 -1.350  12.205  1.00 0.00 ? 115 HIS A ND1  6  
ATOM 11507 C CD2  . HIS A 1 115 ? -20.799 -2.782  13.860  1.00 0.00 ? 115 HIS A CD2  6  
ATOM 11508 C CE1  . HIS A 1 115 ? -21.796 -0.915  13.279  1.00 0.00 ? 115 HIS A CE1  6  
ATOM 11509 N NE2  . HIS A 1 115 ? -21.633 -1.755  14.320  1.00 0.00 ? 115 HIS A NE2  6  
ATOM 11510 H H    . HIS A 1 115 ? -18.196 -4.720  10.184  1.00 0.00 ? 115 HIS A H    6  
ATOM 11511 H HA   . HIS A 1 115 ? -18.854 -1.989  10.258  1.00 0.00 ? 115 HIS A HA   6  
ATOM 11512 H HB2  . HIS A 1 115 ? -20.322 -3.829  10.906  1.00 0.00 ? 115 HIS A HB2  6  
ATOM 11513 H HB3  . HIS A 1 115 ? -19.276 -4.240  12.263  1.00 0.00 ? 115 HIS A HB3  6  
ATOM 11514 H HD1  . HIS A 1 115 ? -21.103 -0.904  11.297  1.00 0.00 ? 115 HIS A HD1  6  
ATOM 11515 H HD2  . HIS A 1 115 ? -20.483 -3.652  14.427  1.00 0.00 ? 115 HIS A HD2  6  
ATOM 11516 H HE1  . HIS A 1 115 ? -22.399 -0.015  13.297  1.00 0.00 ? 115 HIS A HE1  6  
ATOM 11517 N N    . PHE A 1 116 ? -16.603 -2.888  12.555  1.00 0.00 ? 116 PHE A N    6  
ATOM 11518 C CA   . PHE A 1 116 ? -15.503 -2.417  13.398  1.00 0.00 ? 116 PHE A CA   6  
ATOM 11519 C C    . PHE A 1 116 ? -14.483 -1.587  12.604  1.00 0.00 ? 116 PHE A C    6  
ATOM 11520 O O    . PHE A 1 116 ? -14.237 -0.445  12.989  1.00 0.00 ? 116 PHE A O    6  
ATOM 11521 C CB   . PHE A 1 116 ? -14.873 -3.621  14.116  1.00 0.00 ? 116 PHE A CB   6  
ATOM 11522 C CG   . PHE A 1 116 ? -13.482 -3.382  14.676  1.00 0.00 ? 116 PHE A CG   6  
ATOM 11523 C CD1  . PHE A 1 116 ? -13.302 -2.556  15.800  1.00 0.00 ? 116 PHE A CD1  6  
ATOM 11524 C CD2  . PHE A 1 116 ? -12.360 -3.978  14.061  1.00 0.00 ? 116 PHE A CD2  6  
ATOM 11525 C CE1  . PHE A 1 116 ? -12.012 -2.336  16.313  1.00 0.00 ? 116 PHE A CE1  6  
ATOM 11526 C CE2  . PHE A 1 116 ? -11.071 -3.765  14.582  1.00 0.00 ? 116 PHE A CE2  6  
ATOM 11527 C CZ   . PHE A 1 116 ? -10.898 -2.955  15.719  1.00 0.00 ? 116 PHE A CZ   6  
ATOM 11528 H H    . PHE A 1 116 ? -16.686 -3.889  12.421  1.00 0.00 ? 116 PHE A H    6  
ATOM 11529 H HA   . PHE A 1 116 ? -15.910 -1.758  14.164  1.00 0.00 ? 116 PHE A HA   6  
ATOM 11530 H HB2  . PHE A 1 116 ? -15.541 -3.923  14.925  1.00 0.00 ? 116 PHE A HB2  6  
ATOM 11531 H HB3  . PHE A 1 116 ? -14.826 -4.476  13.448  1.00 0.00 ? 116 PHE A HB3  6  
ATOM 11532 H HD1  . PHE A 1 116 ? -14.155 -2.087  16.268  1.00 0.00 ? 116 PHE A HD1  6  
ATOM 11533 H HD2  . PHE A 1 116 ? -12.484 -4.610  13.193  1.00 0.00 ? 116 PHE A HD2  6  
ATOM 11534 H HE1  . PHE A 1 116 ? -11.877 -1.692  17.168  1.00 0.00 ? 116 PHE A HE1  6  
ATOM 11535 H HE2  . PHE A 1 116 ? -10.214 -4.225  14.111  1.00 0.00 ? 116 PHE A HE2  6  
ATOM 11536 H HZ   . PHE A 1 116 ? -9.908  -2.789  16.121  1.00 0.00 ? 116 PHE A HZ   6  
ATOM 11537 N N    . VAL A 1 117 ? -13.937 -2.073  11.480  1.00 0.00 ? 117 VAL A N    6  
ATOM 11538 C CA   . VAL A 1 117 ? -12.969 -1.247  10.710  1.00 0.00 ? 117 VAL A CA   6  
ATOM 11539 C C    . VAL A 1 117 ? -13.594 -0.032  10.012  1.00 0.00 ? 117 VAL A C    6  
ATOM 11540 O O    . VAL A 1 117 ? -12.881 0.938   9.759   1.00 0.00 ? 117 VAL A O    6  
ATOM 11541 C CB   . VAL A 1 117 ? -12.064 -2.016  9.728   1.00 0.00 ? 117 VAL A CB   6  
ATOM 11542 C CG1  . VAL A 1 117 ? -11.022 -2.825  10.507  1.00 0.00 ? 117 VAL A CG1  6  
ATOM 11543 C CG2  . VAL A 1 117 ? -12.825 -2.895  8.731   1.00 0.00 ? 117 VAL A CG2  6  
ATOM 11544 H H    . VAL A 1 117 ? -14.155 -3.034  11.200  1.0