data_2LKX
# 
_entry.id   2LKX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LKX         
RCSB  RCSB102507   
BMRB  18015        
WWPDB D_1000102507 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2012-05-02 
_pdbx_database_PDB_obs_spr.pdb_id           2LKX 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1YZ8 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          18015 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LKX 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Baird-Titus, J.M.' 1 
'Doerdelmann, T.'   2 
'Chaney, B.A.'      3 
'Clark-Baldwin, K.' 4 
'Dave, V.'          5 
'Ma, J.'            6 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            44 
_citation.page_first                7497 
_citation.page_last                 7511 
_citation.year                      2005 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15895993 
_citation.pdbx_database_id_DOI      10.1021/bi0473253 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chaney, B.A.'      1 
primary 'Clark-Baldwin, K.' 2 
primary 'Dave, V.'          3 
primary 'Ma, J.'            4 
primary 'Rance, M.'         5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Pituitary homeobox 3'                                  8486.523 1 ? ? 'Homeobox DNA binding domain residues 62-121' 
? 
2 polymer syn 
;DNA (5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3')
;
3887.537 1 ? ? ?                                             ? 
3 polymer syn 
;DNA (5'-D(*CP*GP*GP*GP*GP*AP*TP*TP*AP*GP*AP*GP*C)-3')
;
4056.646 1 ? ? ?                                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Homeobox protein PITX3, Paired-like homeodomain transcription factor 3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD 
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD A ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DT)(DC)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DG)'               GCTCTAATCCCCG B ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DG)(DA)(DG)(DC)'               CGGGGATTAGAGC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  GLN n 
1 4  ARG n 
1 5  ARG n 
1 6  GLN n 
1 7  ARG n 
1 8  THR n 
1 9  HIS n 
1 10 PHE n 
1 11 THR n 
1 12 SER n 
1 13 GLN n 
1 14 GLN n 
1 15 LEU n 
1 16 GLN n 
1 17 GLU n 
1 18 LEU n 
1 19 GLU n 
1 20 ALA n 
1 21 THR n 
1 22 PHE n 
1 23 GLN n 
1 24 ARG n 
1 25 ASN n 
1 26 ARG n 
1 27 TYR n 
1 28 PRO n 
1 29 ASP n 
1 30 MET n 
1 31 SER n 
1 32 THR n 
1 33 ARG n 
1 34 GLU n 
1 35 GLU n 
1 36 ILE n 
1 37 ALA n 
1 38 VAL n 
1 39 TRP n 
1 40 THR n 
1 41 ASN n 
1 42 LEU n 
1 43 THR n 
1 44 GLU n 
1 45 ALA n 
1 46 ARG n 
1 47 VAL n 
1 48 ARG n 
1 49 VAL n 
1 50 TRP n 
1 51 PHE n 
1 52 LYS n 
1 53 ASN n 
1 54 ARG n 
1 55 ARG n 
1 56 ALA n 
1 57 LYS n 
1 58 TRP n 
1 59 ARG n 
1 60 LYS n 
1 61 ARG n 
1 62 GLU n 
1 63 GLU n 
1 64 PHE n 
1 65 ILE n 
1 66 VAL n 
1 67 THR n 
1 68 ASP n 
2 1  DG  n 
2 2  DC  n 
2 3  DT  n 
2 4  DC  n 
2 5  DT  n 
2 6  DA  n 
2 7  DA  n 
2 8  DT  n 
2 9  DC  n 
2 10 DC  n 
2 11 DC  n 
2 12 DC  n 
2 13 DG  n 
3 1  DC  n 
3 2  DG  n 
3 3  DG  n 
3 4  DG  n 
3 5  DG  n 
3 6  DA  n 
3 7  DT  n 
3 8  DT  n 
3 9  DA  n 
3 10 DG  n 
3 11 DA  n 
3 12 DG  n 
3 13 DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PITX3, PTX3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pGEX-1lambdat-PITX2HD 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PITX3_HUMAN O75364 1 QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRE 62 ? 
2 PDB 2LKX        2LKX   2 ?                                                            ?  ? 
3 PDB 2LKX        2LKX   3 ?                                                            ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LKX A 3 ? 62 ? O75364 62 ? 121 ? 1  60 
2 2 2LKX B 1 ? 13 ? 2LKX   67 ? 79  ? 67 79 
3 3 2LKX C 1 ? 13 ? 2LKX   80 ? 92  ? 80 92 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LKX GLY A 1  ? UNP O75364 ? ? 'EXPRESSION TAG' -2 1 
1 2LKX SER A 2  ? UNP O75364 ? ? 'EXPRESSION TAG' -1 2 
1 2LKX GLU A 63 ? UNP O75364 ? ? 'EXPRESSION TAG' 61 3 
1 2LKX PHE A 64 ? UNP O75364 ? ? 'EXPRESSION TAG' 62 4 
1 2LKX ILE A 65 ? UNP O75364 ? ? 'EXPRESSION TAG' 63 5 
1 2LKX VAL A 66 ? UNP O75364 ? ? 'EXPRESSION TAG' 64 6 
1 2LKX THR A 67 ? UNP O75364 ? ? 'EXPRESSION TAG' 65 7 
1 2LKX ASP A 68 ? UNP O75364 ? ? 'EXPRESSION TAG' 66 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-15N HSQC'            
1 2  2 '3D 1H-15N NOESY'           
1 3  1 '2D 1H-13C HSQC aliphatic'  
1 4  1 '2D 1H-13C HSQC aromatic'   
1 5  1 '3D CBCA(CO)NH'             
1 6  1 '3D C(CO)NH'                
1 7  1 '3D HNCO'                   
1 8  1 '3D HNCA'                   
1 9  1 '3D HNCACB'                 
1 10 1 '3D H(CCO)NH'               
1 11 1 '3D HCCH-TOCSY'             
1 12 1 '3D 1H-13C NOESY aliphatic' 
1 13 1 '3D 1H-13C NOESY aromatic'  
1 14 1 '3D HBHA(CO)NH'             
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;1 mM [U-99% 13C; U-99% 15N] pitx2 homeodomain, 1 mM DNA (5'-D(P*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*C)-3'), 1 mM DNA (5'-D(P*GP*GP*GP*GP*AP*TP*TP*AP*GP*AP*G)-3'), 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;1 mM [U-99% 15N] pitx2 homeodomain, 1 mM DNA (5'-D(P*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*C)-3'), 1 mM DNA (5'-D(P*GP*GP*GP*GP*AP*TP*TP*AP*GP*AP*G)-3'), 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Varian INOVA 1 'Varian INOVA' 
600 Varian INOVA 2 'Varian INOVA' 
500 Varian INOVA 3 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2LKX 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             17 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LKX 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LKX 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich'                                   'structure solution' CYANA ? 1 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' refinement           AMBER ? 2 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LKX 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LKX 
_struct.title                     'NMR structure of the homeodomain of Pitx2 in complex with a TAATCC DNA binding site' 
_struct.pdbx_descriptor           'Pituitary homeobox 3/DNA' 
_struct.pdbx_model_details        'closest to the average, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LKX 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'TRANSCRIPTION-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 11 ? GLN A 23 ? THR A 9  GLN A 21 1 ? 13 
HELX_P HELX_P2 2 ASP A 29 ? ASN A 41 ? ASP A 27 ASN A 39 1 ? 13 
HELX_P HELX_P3 3 THR A 43 ? GLU A 63 ? THR A 41 GLU A 61 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DG 1  N1 ? ? ? 1_555 C DC 13 N3 ? ? B DG 67 C DC 92 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DG 1  N2 ? ? ? 1_555 C DC 13 O2 ? ? B DG 67 C DC 92 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DG 1  O6 ? ? ? 1_555 C DC 13 N4 ? ? B DG 67 C DC 92 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DC 2  N3 ? ? ? 1_555 C DG 12 N1 ? ? B DC 68 C DG 91 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DC 2  N4 ? ? ? 1_555 C DG 12 O6 ? ? B DC 68 C DG 91 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DC 2  O2 ? ? ? 1_555 C DG 12 N2 ? ? B DC 68 C DG 91 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DT 3  N3 ? ? ? 1_555 C DA 11 N1 ? ? B DT 69 C DA 90 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DT 3  O4 ? ? ? 1_555 C DA 11 N6 ? ? B DT 69 C DA 90 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DC 4  N3 ? ? ? 1_555 C DG 10 N1 ? ? B DC 70 C DG 89 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DC 4  N4 ? ? ? 1_555 C DG 10 O6 ? ? B DC 70 C DG 89 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DC 4  O2 ? ? ? 1_555 C DG 10 N2 ? ? B DC 70 C DG 89 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 9  N1 ? ? B DT 71 C DA 88 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 9  N6 ? ? B DT 71 C DA 88 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 8  N3 ? ? B DA 72 C DT 87 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 8  O4 ? ? B DA 72 C DT 87 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT 7  N3 ? ? B DA 73 C DT 86 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog17 hydrog ? ? B DT 8  N3 ? ? ? 1_555 C DA 6  N1 ? ? B DT 74 C DA 85 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DT 8  O4 ? ? ? 1_555 C DA 6  N6 ? ? B DT 74 C DA 85 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 5  N1 ? ? B DC 75 C DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 5  O6 ? ? B DC 75 C DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 5  N2 ? ? B DC 75 C DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DC 10 N3 ? ? ? 1_555 C DG 4  N1 ? ? B DC 76 C DG 83 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DC 10 N4 ? ? ? 1_555 C DG 4  O6 ? ? B DC 76 C DG 83 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DC 10 O2 ? ? ? 1_555 C DG 4  N2 ? ? B DC 76 C DG 83 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? B DC 11 N3 ? ? ? 1_555 C DG 3  N1 ? ? B DC 77 C DG 82 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? B DC 11 N4 ? ? ? 1_555 C DG 3  O6 ? ? B DC 77 C DG 82 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DC 11 O2 ? ? ? 1_555 C DG 3  N2 ? ? B DC 77 C DG 82 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DC 12 N3 ? ? ? 1_555 C DG 2  N1 ? ? B DC 78 C DG 81 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DC 12 N4 ? ? ? 1_555 C DG 2  O6 ? ? B DC 78 C DG 81 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DC 12 O2 ? ? ? 1_555 C DG 2  N2 ? ? B DC 78 C DG 81 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DG 13 N1 ? ? ? 1_555 C DC 1  N3 ? ? B DG 79 C DC 80 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? B DG 13 N2 ? ? ? 1_555 C DC 1  O2 ? ? B DG 79 C DC 80 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? B DG 13 O6 ? ? ? 1_555 C DC 1  N4 ? ? B DG 79 C DC 80 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    2LKX 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N      . GLY A 1 1  ? 39.765 28.485 46.550 1.00 0.00 ? -2 GLY A N      1  
ATOM 2     C CA     . GLY A 1 1  ? 38.435 27.852 46.561 1.00 0.00 ? -2 GLY A CA     1  
ATOM 3     C C      . GLY A 1 1  ? 38.439 26.551 47.347 1.00 0.00 ? -2 GLY A C      1  
ATOM 4     O O      . GLY A 1 1  ? 39.487 26.111 47.829 1.00 0.00 ? -2 GLY A O      1  
ATOM 5     H H1     . GLY A 1 1  ? 39.768 29.294 45.943 1.00 0.00 ? -2 GLY A H1     1  
ATOM 6     H H2     . GLY A 1 1  ? 40.458 27.832 46.206 1.00 0.00 ? -2 GLY A H2     1  
ATOM 7     H H3     . GLY A 1 1  ? 40.025 28.773 47.486 1.00 0.00 ? -2 GLY A H3     1  
ATOM 8     H HA2    . GLY A 1 1  ? 37.717 28.536 47.012 1.00 0.00 ? -2 GLY A HA2    1  
ATOM 9     H HA3    . GLY A 1 1  ? 38.130 27.640 45.539 1.00 0.00 ? -2 GLY A HA3    1  
ATOM 10    N N      . SER A 1 2  ? 37.261 25.930 47.484 1.00 0.00 ? -1 SER A N      1  
ATOM 11    C CA     . SER A 1 2  ? 37.047 24.705 48.281 1.00 0.00 ? -1 SER A CA     1  
ATOM 12    C C      . SER A 1 2  ? 36.447 23.524 47.506 1.00 0.00 ? -1 SER A C      1  
ATOM 13    O O      . SER A 1 2  ? 36.710 22.373 47.867 1.00 0.00 ? -1 SER A O      1  
ATOM 14    C CB     . SER A 1 2  ? 36.154 25.013 49.490 1.00 0.00 ? -1 SER A CB     1  
ATOM 15    O OG     . SER A 1 2  ? 34.861 25.439 49.090 1.00 0.00 ? -1 SER A OG     1  
ATOM 16    H H      . SER A 1 2  ? 36.450 26.330 47.019 1.00 0.00 ? -1 SER A H      1  
ATOM 17    H HA     . SER A 1 2  ? 38.003 24.363 48.678 1.00 0.00 ? -1 SER A HA     1  
ATOM 18    H HB2    . SER A 1 2  ? 36.056 24.111 50.095 1.00 0.00 ? -1 SER A HB2    1  
ATOM 19    H HB3    . SER A 1 2  ? 36.624 25.787 50.098 1.00 0.00 ? -1 SER A HB3    1  
ATOM 20    H HG     . SER A 1 2  ? 34.221 25.081 49.741 1.00 0.00 ? -1 SER A HG     1  
ATOM 21    N N      . GLN A 1 3  ? 35.654 23.775 46.458 1.00 0.00 ? 1  GLN A N      1  
ATOM 22    C CA     . GLN A 1 3  ? 34.845 22.766 45.747 1.00 0.00 ? 1  GLN A CA     1  
ATOM 23    C C      . GLN A 1 3  ? 35.448 22.366 44.378 1.00 0.00 ? 1  GLN A C      1  
ATOM 24    O O      . GLN A 1 3  ? 34.756 21.815 43.518 1.00 0.00 ? 1  GLN A O      1  
ATOM 25    C CB     . GLN A 1 3  ? 33.389 23.285 45.687 1.00 0.00 ? 1  GLN A CB     1  
ATOM 26    C CG     . GLN A 1 3  ? 32.317 22.204 45.443 1.00 0.00 ? 1  GLN A CG     1  
ATOM 27    C CD     . GLN A 1 3  ? 30.897 22.767 45.497 1.00 0.00 ? 1  GLN A CD     1  
ATOM 28    O OE1    . GLN A 1 3  ? 30.107 22.475 46.390 1.00 0.00 ? 1  GLN A OE1    1  
ATOM 29    N NE2    . GLN A 1 3  ? 30.505 23.576 44.540 1.00 0.00 ? 1  GLN A NE2    1  
ATOM 30    H H      . GLN A 1 3  ? 35.493 24.747 46.213 1.00 0.00 ? 1  GLN A H      1  
ATOM 31    H HA     . GLN A 1 3  ? 34.835 21.853 46.344 1.00 0.00 ? 1  GLN A HA     1  
ATOM 32    H HB2    . GLN A 1 3  ? 33.153 23.758 46.642 1.00 0.00 ? 1  GLN A HB2    1  
ATOM 33    H HB3    . GLN A 1 3  ? 33.321 24.051 44.915 1.00 0.00 ? 1  GLN A HB3    1  
ATOM 34    H HG2    . GLN A 1 3  ? 32.458 21.751 44.465 1.00 0.00 ? 1  GLN A HG2    1  
ATOM 35    H HG3    . GLN A 1 3  ? 32.413 21.427 46.201 1.00 0.00 ? 1  GLN A HG3    1  
ATOM 36    H HE21   . GLN A 1 3  ? 31.158 23.835 43.804 1.00 0.00 ? 1  GLN A HE21   1  
ATOM 37    H HE22   . GLN A 1 3  ? 29.575 23.975 44.591 1.00 0.00 ? 1  GLN A HE22   1  
ATOM 38    N N      . ARG A 1 4  ? 36.739 22.662 44.150 1.00 0.00 ? 2  ARG A N      1  
ATOM 39    C CA     . ARG A 1 4  ? 37.417 22.558 42.844 1.00 0.00 ? 2  ARG A CA     1  
ATOM 40    C C      . ARG A 1 4  ? 36.607 23.287 41.765 1.00 0.00 ? 2  ARG A C      1  
ATOM 41    O O      . ARG A 1 4  ? 36.288 24.465 41.948 1.00 0.00 ? 2  ARG A O      1  
ATOM 42    C CB     . ARG A 1 4  ? 37.824 21.098 42.537 1.00 0.00 ? 2  ARG A CB     1  
ATOM 43    C CG     . ARG A 1 4  ? 38.854 20.575 43.555 1.00 0.00 ? 2  ARG A CG     1  
ATOM 44    C CD     . ARG A 1 4  ? 39.300 19.132 43.285 1.00 0.00 ? 2  ARG A CD     1  
ATOM 45    N NE     . ARG A 1 4  ? 39.963 18.963 41.977 1.00 0.00 ? 2  ARG A NE     1  
ATOM 46    C CZ     . ARG A 1 4  ? 41.243 19.122 41.693 1.00 0.00 ? 2  ARG A CZ     1  
ATOM 47    N NH1    . ARG A 1 4  ? 42.094 19.639 42.523 1.00 0.00 ? 2  ARG A NH1    1  
ATOM 48    N NH2    . ARG A 1 4  ? 41.710 18.775 40.533 1.00 0.00 1 2  ARG A NH2    1  
ATOM 49    H H      . ARG A 1 4  ? 37.257 23.118 44.894 1.00 0.00 ? 2  ARG A H      1  
ATOM 50    H HA     . ARG A 1 4  ? 38.344 23.130 42.903 1.00 0.00 ? 2  ARG A HA     1  
ATOM 51    H HB2    . ARG A 1 4  ? 36.944 20.454 42.545 1.00 0.00 ? 2  ARG A HB2    1  
ATOM 52    H HB3    . ARG A 1 4  ? 38.276 21.061 41.545 1.00 0.00 ? 2  ARG A HB3    1  
ATOM 53    H HG2    . ARG A 1 4  ? 39.729 21.221 43.539 1.00 0.00 ? 2  ARG A HG2    1  
ATOM 54    H HG3    . ARG A 1 4  ? 38.424 20.610 44.556 1.00 0.00 ? 2  ARG A HG3    1  
ATOM 55    H HD2    . ARG A 1 4  ? 39.974 18.816 44.083 1.00 0.00 ? 2  ARG A HD2    1  
ATOM 56    H HD3    . ARG A 1 4  ? 38.421 18.485 43.327 1.00 0.00 ? 2  ARG A HD3    1  
ATOM 57    H HE     . ARG A 1 4  ? 39.381 18.626 41.224 1.00 0.00 ? 2  ARG A HE     1  
ATOM 58    H HH11   . ARG A 1 4  ? 41.795 19.951 43.434 1.00 0.00 ? 2  ARG A HH11   1  
ATOM 59    H HH12   . ARG A 1 4  ? 43.036 19.833 42.213 1.00 0.00 ? 2  ARG A HH12   1  
ATOM 60    H HH21   . ARG A 1 4  ? 41.082 18.368 39.846 1.00 0.00 ? 2  ARG A HH21   1  
ATOM 61    H HH22   . ARG A 1 4  ? 42.709 18.775 40.372 1.00 0.00 ? 2  ARG A HH22   1  
ATOM 62    N N      . ARG A 1 5  ? 36.287 22.640 40.641 1.00 0.00 ? 3  ARG A N      1  
ATOM 63    C CA     . ARG A 1 5  ? 35.556 23.249 39.515 1.00 0.00 ? 3  ARG A CA     1  
ATOM 64    C C      . ARG A 1 5  ? 34.439 22.310 39.053 1.00 0.00 ? 3  ARG A C      1  
ATOM 65    O O      . ARG A 1 5  ? 34.629 21.100 39.035 1.00 0.00 ? 3  ARG A O      1  
ATOM 66    C CB     . ARG A 1 5  ? 36.564 23.645 38.406 1.00 0.00 ? 3  ARG A CB     1  
ATOM 67    C CG     . ARG A 1 5  ? 37.585 24.670 38.949 1.00 0.00 ? 3  ARG A CG     1  
ATOM 68    C CD     . ARG A 1 5  ? 38.579 25.249 37.938 1.00 0.00 ? 3  ARG A CD     1  
ATOM 69    N NE     . ARG A 1 5  ? 39.756 25.801 38.648 1.00 0.00 ? 3  ARG A NE     1  
ATOM 70    C CZ     . ARG A 1 5  ? 40.507 26.824 38.284 1.00 0.00 ? 3  ARG A CZ     1  
ATOM 71    N NH1    . ARG A 1 5  ? 40.241 27.580 37.269 1.00 0.00 ? 3  ARG A NH1    1  
ATOM 72    N NH2    . ARG A 1 5  ? 41.576 27.159 38.938 1.00 0.00 1 3  ARG A NH2    1  
ATOM 73    H H      . ARG A 1 5  ? 36.563 21.669 40.561 1.00 0.00 ? 3  ARG A H      1  
ATOM 74    H HA     . ARG A 1 5  ? 35.063 24.158 39.867 1.00 0.00 ? 3  ARG A HA     1  
ATOM 75    H HB2    . ARG A 1 5  ? 37.094 22.754 38.061 1.00 0.00 ? 3  ARG A HB2    1  
ATOM 76    H HB3    . ARG A 1 5  ? 36.031 24.073 37.558 1.00 0.00 ? 3  ARG A HB3    1  
ATOM 77    H HG2    . ARG A 1 5  ? 37.053 25.501 39.417 1.00 0.00 ? 3  ARG A HG2    1  
ATOM 78    H HG3    . ARG A 1 5  ? 38.172 24.171 39.717 1.00 0.00 ? 3  ARG A HG3    1  
ATOM 79    H HD2    . ARG A 1 5  ? 38.916 24.462 37.261 1.00 0.00 ? 3  ARG A HD2    1  
ATOM 80    H HD3    . ARG A 1 5  ? 38.078 26.019 37.347 1.00 0.00 ? 3  ARG A HD3    1  
ATOM 81    H HE     . ARG A 1 5  ? 40.034 25.343 39.514 1.00 0.00 ? 3  ARG A HE     1  
ATOM 82    H HH11   . ARG A 1 5  ? 39.502 27.357 36.619 1.00 0.00 ? 3  ARG A HH11   1  
ATOM 83    H HH12   . ARG A 1 5  ? 40.918 28.289 37.027 1.00 0.00 ? 3  ARG A HH12   1  
ATOM 84    H HH21   . ARG A 1 5  ? 41.934 26.567 39.684 1.00 0.00 ? 3  ARG A HH21   1  
ATOM 85    H HH22   . ARG A 1 5  ? 42.140 27.918 38.583 1.00 0.00 ? 3  ARG A HH22   1  
ATOM 86    N N      . GLN A 1 6  ? 33.260 22.848 38.736 1.00 0.00 ? 4  GLN A N      1  
ATOM 87    C CA     . GLN A 1 6  ? 32.086 22.046 38.331 1.00 0.00 ? 4  GLN A CA     1  
ATOM 88    C C      . GLN A 1 6  ? 32.200 21.613 36.859 1.00 0.00 ? 4  GLN A C      1  
ATOM 89    O O      . GLN A 1 6  ? 32.246 20.420 36.558 1.00 0.00 ? 4  GLN A O      1  
ATOM 90    C CB     . GLN A 1 6  ? 30.798 22.860 38.569 1.00 0.00 ? 4  GLN A CB     1  
ATOM 91    C CG     . GLN A 1 6  ? 30.540 23.218 40.037 1.00 0.00 ? 4  GLN A CG     1  
ATOM 92    C CD     . GLN A 1 6  ? 29.755 22.161 40.802 1.00 0.00 ? 4  GLN A CD     1  
ATOM 93    O OE1    . GLN A 1 6  ? 28.544 22.272 40.964 1.00 0.00 ? 4  GLN A OE1    1  
ATOM 94    N NE2    . GLN A 1 6  ? 30.391 21.131 41.313 1.00 0.00 ? 4  GLN A NE2    1  
ATOM 95    H H      . GLN A 1 6  ? 33.130 23.836 38.927 1.00 0.00 ? 4  GLN A H      1  
ATOM 96    H HA     . GLN A 1 6  ? 32.031 21.131 38.932 1.00 0.00 ? 4  GLN A HA     1  
ATOM 97    H HB2    . GLN A 1 6  ? 30.860 23.789 38.001 1.00 0.00 ? 4  GLN A HB2    1  
ATOM 98    H HB3    . GLN A 1 6  ? 29.941 22.307 38.178 1.00 0.00 ? 4  GLN A HB3    1  
ATOM 99    H HG2    . GLN A 1 6  ? 31.491 23.372 40.542 1.00 0.00 ? 4  GLN A HG2    1  
ATOM 100   H HG3    . GLN A 1 6  ? 29.975 24.149 40.074 1.00 0.00 ? 4  GLN A HG3    1  
ATOM 101   H HE21   . GLN A 1 6  ? 31.404 21.066 41.279 1.00 0.00 ? 4  GLN A HE21   1  
ATOM 102   H HE22   . GLN A 1 6  ? 29.865 20.450 41.841 1.00 0.00 ? 4  GLN A HE22   1  
ATOM 103   N N      . ARG A 1 7  ? 32.326 22.612 35.971 1.00 0.00 ? 5  ARG A N      1  
ATOM 104   C CA     . ARG A 1 7  ? 32.455 22.520 34.510 1.00 0.00 ? 5  ARG A CA     1  
ATOM 105   C C      . ARG A 1 7  ? 31.210 21.959 33.794 1.00 0.00 ? 5  ARG A C      1  
ATOM 106   O O      . ARG A 1 7  ? 30.598 20.985 34.239 1.00 0.00 ? 5  ARG A O      1  
ATOM 107   C CB     . ARG A 1 7  ? 33.789 21.832 34.141 1.00 0.00 ? 5  ARG A CB     1  
ATOM 108   C CG     . ARG A 1 7  ? 34.170 22.054 32.677 1.00 0.00 ? 5  ARG A CG     1  
ATOM 109   C CD     . ARG A 1 7  ? 35.498 21.403 32.269 1.00 0.00 ? 5  ARG A CD     1  
ATOM 110   N NE     . ARG A 1 7  ? 35.661 21.461 30.804 1.00 0.00 ? 5  ARG A NE     1  
ATOM 111   C CZ     . ARG A 1 7  ? 35.025 20.720 29.916 1.00 0.00 ? 5  ARG A CZ     1  
ATOM 112   N NH1    . ARG A 1 7  ? 34.302 19.684 30.231 1.00 0.00 ? 5  ARG A NH1    1  
ATOM 113   N NH2    . ARG A 1 7  ? 35.093 21.031 28.658 1.00 0.00 1 5  ARG A NH2    1  
ATOM 114   H H      . ARG A 1 7  ? 32.195 23.546 36.333 1.00 0.00 ? 5  ARG A H      1  
ATOM 115   H HA     . ARG A 1 7  ? 32.549 23.548 34.163 1.00 0.00 ? 5  ARG A HA     1  
ATOM 116   H HB2    . ARG A 1 7  ? 34.589 22.233 34.770 1.00 0.00 ? 5  ARG A HB2    1  
ATOM 117   H HB3    . ARG A 1 7  ? 33.710 20.763 34.333 1.00 0.00 ? 5  ARG A HB3    1  
ATOM 118   H HG2    . ARG A 1 7  ? 33.386 21.631 32.057 1.00 0.00 ? 5  ARG A HG2    1  
ATOM 119   H HG3    . ARG A 1 7  ? 34.231 23.124 32.478 1.00 0.00 ? 5  ARG A HG3    1  
ATOM 120   H HD2    . ARG A 1 7  ? 36.322 21.926 32.757 1.00 0.00 ? 5  ARG A HD2    1  
ATOM 121   H HD3    . ARG A 1 7  ? 35.520 20.364 32.598 1.00 0.00 ? 5  ARG A HD3    1  
ATOM 122   H HE     . ARG A 1 7  ? 36.254 22.188 30.419 1.00 0.00 ? 5  ARG A HE     1  
ATOM 123   H HH11   . ARG A 1 7  ? 34.203 19.398 31.202 1.00 0.00 ? 5  ARG A HH11   1  
ATOM 124   H HH12   . ARG A 1 7  ? 33.759 19.204 29.527 1.00 0.00 ? 5  ARG A HH12   1  
ATOM 125   H HH21   . ARG A 1 7  ? 35.657 21.813 28.365 1.00 0.00 ? 5  ARG A HH21   1  
ATOM 126   H HH22   . ARG A 1 7  ? 34.512 20.522 27.996 1.00 0.00 ? 5  ARG A HH22   1  
ATOM 127   N N      . THR A 1 8  ? 30.874 22.587 32.662 1.00 0.00 ? 6  THR A N      1  
ATOM 128   C CA     . THR A 1 8  ? 29.932 22.115 31.613 1.00 0.00 ? 6  THR A CA     1  
ATOM 129   C C      . THR A 1 8  ? 28.540 21.701 32.132 1.00 0.00 ? 6  THR A C      1  
ATOM 130   O O      . THR A 1 8  ? 28.082 22.249 33.138 1.00 0.00 ? 6  THR A O      1  
ATOM 131   C CB     . THR A 1 8  ? 30.608 21.097 30.654 1.00 0.00 ? 6  THR A CB     1  
ATOM 132   O OG1    . THR A 1 8  ? 31.417 20.177 31.341 1.00 0.00 ? 6  THR A OG1    1  
ATOM 133   C CG2    . THR A 1 8  ? 31.528 21.796 29.656 1.00 0.00 ? 6  THR A CG2    1  
ATOM 134   H H      . THR A 1 8  ? 31.388 23.430 32.473 1.00 0.00 ? 6  THR A H      1  
ATOM 135   H HA     . THR A 1 8  ? 29.707 22.980 30.990 1.00 0.00 ? 6  THR A HA     1  
ATOM 136   H HB     . THR A 1 8  ? 29.866 20.551 30.076 1.00 0.00 ? 6  THR A HB     1  
ATOM 137   H HG1    . THR A 1 8  ? 30.877 19.388 31.544 1.00 0.00 ? 6  THR A HG1    1  
ATOM 138   H HG21   . THR A 1 8  ? 32.330 22.327 30.161 1.00 0.00 ? 6  THR A HG21   1  
ATOM 139   H HG22   . THR A 1 8  ? 31.959 21.052 28.991 1.00 0.00 ? 6  THR A HG22   1  
ATOM 140   H HG23   . THR A 1 8  ? 30.951 22.490 29.048 1.00 0.00 ? 6  THR A HG23   1  
ATOM 141   N N      . HIS A 1 9  ? 27.813 20.838 31.410 1.00 0.00 ? 7  HIS A N      1  
ATOM 142   C CA     . HIS A 1 9  ? 26.376 20.556 31.578 1.00 0.00 ? 7  HIS A CA     1  
ATOM 143   C C      . HIS A 1 9  ? 25.440 21.767 31.371 1.00 0.00 ? 7  HIS A C      1  
ATOM 144   O O      . HIS A 1 9  ? 24.376 21.848 31.986 1.00 0.00 ? 7  HIS A O      1  
ATOM 145   C CB     . HIS A 1 9  ? 26.094 19.749 32.862 1.00 0.00 ? 7  HIS A CB     1  
ATOM 146   C CG     . HIS A 1 9  ? 26.783 18.408 32.920 1.00 0.00 ? 7  HIS A CG     1  
ATOM 147   N ND1    . HIS A 1 9  ? 26.794 17.447 31.903 1.00 0.00 ? 7  HIS A ND1    1  
ATOM 148   C CD2    . HIS A 1 9  ? 27.433 17.899 34.004 1.00 0.00 ? 7  HIS A CD2    1  
ATOM 149   C CE1    . HIS A 1 9  ? 27.425 16.374 32.409 1.00 0.00 ? 7  HIS A CE1    1  
ATOM 150   N NE2    . HIS A 1 9  ? 27.837 16.627 33.663 1.00 0.00 ? 7  HIS A NE2    1  
ATOM 151   H H      . HIS A 1 9  ? 28.244 20.442 30.585 1.00 0.00 ? 7  HIS A H      1  
ATOM 152   H HA     . HIS A 1 9  ? 26.110 19.890 30.759 1.00 0.00 ? 7  HIS A HA     1  
ATOM 153   H HB2    . HIS A 1 9  ? 26.376 20.338 33.734 1.00 0.00 ? 7  HIS A HB2    1  
ATOM 154   H HB3    . HIS A 1 9  ? 25.023 19.555 32.928 1.00 0.00 ? 7  HIS A HB3    1  
ATOM 155   H HD2    . HIS A 1 9  ? 27.559 18.392 34.959 1.00 0.00 ? 7  HIS A HD2    1  
ATOM 156   H HE1    . HIS A 1 9  ? 27.594 15.447 31.876 1.00 0.00 ? 7  HIS A HE1    1  
ATOM 157   H HE2    . HIS A 1 9  ? 28.348 15.976 34.260 1.00 0.00 ? 7  HIS A HE2    1  
ATOM 158   N N      . PHE A 1 10 ? 25.788 22.698 30.471 1.00 0.00 ? 8  PHE A N      1  
ATOM 159   C CA     . PHE A 1 10 ? 24.797 23.633 29.916 1.00 0.00 ? 8  PHE A CA     1  
ATOM 160   C C      . PHE A 1 10 ? 23.794 22.865 29.044 1.00 0.00 ? 8  PHE A C      1  
ATOM 161   O O      . PHE A 1 10 ? 24.195 22.063 28.191 1.00 0.00 ? 8  PHE A O      1  
ATOM 162   C CB     . PHE A 1 10 ? 25.463 24.740 29.081 1.00 0.00 ? 8  PHE A CB     1  
ATOM 163   C CG     . PHE A 1 10 ? 26.155 25.824 29.885 1.00 0.00 ? 8  PHE A CG     1  
ATOM 164   C CD1    . PHE A 1 10 ? 25.417 26.922 30.371 1.00 0.00 ? 8  PHE A CD1    1  
ATOM 165   C CD2    . PHE A 1 10 ? 27.537 25.748 30.133 1.00 0.00 ? 8  PHE A CD2    1  
ATOM 166   C CE1    . PHE A 1 10 ? 26.059 27.934 31.109 1.00 0.00 ? 8  PHE A CE1    1  
ATOM 167   C CE2    . PHE A 1 10 ? 28.174 26.756 30.879 1.00 0.00 ? 8  PHE A CE2    1  
ATOM 168   C CZ     . PHE A 1 10 ? 27.436 27.847 31.369 1.00 0.00 ? 8  PHE A CZ     1  
ATOM 169   H H      . PHE A 1 10 ? 26.663 22.584 29.968 1.00 0.00 ? 8  PHE A H      1  
ATOM 170   H HA     . PHE A 1 10 ? 24.247 24.103 30.732 1.00 0.00 ? 8  PHE A HA     1  
ATOM 171   H HB2    . PHE A 1 10 ? 26.172 24.292 28.384 1.00 0.00 ? 8  PHE A HB2    1  
ATOM 172   H HB3    . PHE A 1 10 ? 24.695 25.223 28.475 1.00 0.00 ? 8  PHE A HB3    1  
ATOM 173   H HD1    . PHE A 1 10 ? 24.354 26.987 30.185 1.00 0.00 ? 8  PHE A HD1    1  
ATOM 174   H HD2    . PHE A 1 10 ? 28.108 24.913 29.749 1.00 0.00 ? 8  PHE A HD2    1  
ATOM 175   H HE1    . PHE A 1 10 ? 25.496 28.777 31.484 1.00 0.00 ? 8  PHE A HE1    1  
ATOM 176   H HE2    . PHE A 1 10 ? 29.229 26.692 31.085 1.00 0.00 ? 8  PHE A HE2    1  
ATOM 177   H HZ     . PHE A 1 10 ? 27.929 28.618 31.946 1.00 0.00 ? 8  PHE A HZ     1  
ATOM 178   N N      . THR A 1 11 ? 22.497 23.119 29.233 1.00 0.00 ? 9  THR A N      1  
ATOM 179   C CA     . THR A 1 11 ? 21.442 22.545 28.381 1.00 0.00 ? 9  THR A CA     1  
ATOM 180   C C      . THR A 1 11 ? 21.293 23.352 27.087 1.00 0.00 ? 9  THR A C      1  
ATOM 181   O O      . THR A 1 11 ? 21.564 24.558 27.045 1.00 0.00 ? 9  THR A O      1  
ATOM 182   C CB     . THR A 1 11 ? 20.095 22.368 29.114 1.00 0.00 ? 9  THR A CB     1  
ATOM 183   O OG1    . THR A 1 11 ? 19.363 23.569 29.187 1.00 0.00 ? 9  THR A OG1    1  
ATOM 184   C CG2    . THR A 1 11 ? 20.251 21.842 30.542 1.00 0.00 ? 9  THR A CG2    1  
ATOM 185   H H      . THR A 1 11 ? 22.218 23.772 29.952 1.00 0.00 ? 9  THR A H      1  
ATOM 186   H HA     . THR A 1 11 ? 21.755 21.540 28.093 1.00 0.00 ? 9  THR A HA     1  
ATOM 187   H HB     . THR A 1 11 ? 19.501 21.647 28.557 1.00 0.00 ? 9  THR A HB     1  
ATOM 188   H HG1    . THR A 1 11 ? 18.517 23.359 29.627 1.00 0.00 ? 9  THR A HG1    1  
ATOM 189   H HG21   . THR A 1 11 ? 20.662 22.616 31.191 1.00 0.00 ? 9  THR A HG21   1  
ATOM 190   H HG22   . THR A 1 11 ? 19.279 21.535 30.927 1.00 0.00 ? 9  THR A HG22   1  
ATOM 191   H HG23   . THR A 1 11 ? 20.919 20.981 30.546 1.00 0.00 ? 9  THR A HG23   1  
ATOM 192   N N      . SER A 1 12 ? 20.855 22.704 26.007 1.00 0.00 ? 10 SER A N      1  
ATOM 193   C CA     . SER A 1 12 ? 20.665 23.339 24.695 1.00 0.00 ? 10 SER A CA     1  
ATOM 194   C C      . SER A 1 12 ? 19.685 24.517 24.723 1.00 0.00 ? 10 SER A C      1  
ATOM 195   O O      . SER A 1 12 ? 19.862 25.474 23.969 1.00 0.00 ? 10 SER A O      1  
ATOM 196   C CB     . SER A 1 12 ? 20.172 22.299 23.692 1.00 0.00 ? 10 SER A CB     1  
ATOM 197   O OG     . SER A 1 12 ? 21.113 21.251 23.596 1.00 0.00 ? 10 SER A OG     1  
ATOM 198   H H      . SER A 1 12 ? 20.671 21.708 26.077 1.00 0.00 ? 10 SER A H      1  
ATOM 199   H HA     . SER A 1 12 ? 21.626 23.718 24.347 1.00 0.00 ? 10 SER A HA     1  
ATOM 200   H HB2    . SER A 1 12 ? 19.213 21.900 24.020 1.00 0.00 ? 10 SER A HB2    1  
ATOM 201   H HB3    . SER A 1 12 ? 20.045 22.767 22.714 1.00 0.00 ? 10 SER A HB3    1  
ATOM 202   H HG     . SER A 1 12 ? 20.785 20.636 22.908 1.00 0.00 ? 10 SER A HG     1  
ATOM 203   N N      . GLN A 1 13 ? 18.700 24.508 25.629 1.00 0.00 ? 11 GLN A N      1  
ATOM 204   C CA     . GLN A 1 13 ? 17.808 25.653 25.834 1.00 0.00 ? 11 GLN A CA     1  
ATOM 205   C C      . GLN A 1 13 ? 18.574 26.907 26.292 1.00 0.00 ? 11 GLN A C      1  
ATOM 206   O O      . GLN A 1 13 ? 18.252 28.000 25.822 1.00 0.00 ? 11 GLN A O      1  
ATOM 207   C CB     . GLN A 1 13 ? 16.685 25.284 26.822 1.00 0.00 ? 11 GLN A CB     1  
ATOM 208   C CG     . GLN A 1 13 ? 15.760 26.459 27.206 1.00 0.00 ? 11 GLN A CG     1  
ATOM 209   C CD     . GLN A 1 13 ? 14.931 27.034 26.059 1.00 0.00 ? 11 GLN A CD     1  
ATOM 210   O OE1    . GLN A 1 13 ? 13.715 26.909 26.027 1.00 0.00 ? 11 GLN A OE1    1  
ATOM 211   N NE2    . GLN A 1 13 ? 15.510 27.738 25.115 1.00 0.00 ? 11 GLN A NE2    1  
ATOM 212   H H      . GLN A 1 13 ? 18.585 23.684 26.211 1.00 0.00 ? 11 GLN A H      1  
ATOM 213   H HA     . GLN A 1 13 ? 17.351 25.886 24.872 1.00 0.00 ? 11 GLN A HA     1  
ATOM 214   H HB2    . GLN A 1 13 ? 16.081 24.485 26.391 1.00 0.00 ? 11 GLN A HB2    1  
ATOM 215   H HB3    . GLN A 1 13 ? 17.141 24.906 27.739 1.00 0.00 ? 11 GLN A HB3    1  
ATOM 216   H HG2    . GLN A 1 13 ? 15.073 26.107 27.975 1.00 0.00 ? 11 GLN A HG2    1  
ATOM 217   H HG3    . GLN A 1 13 ? 16.348 27.265 27.644 1.00 0.00 ? 11 GLN A HG3    1  
ATOM 218   H HE21   . GLN A 1 13 ? 16.493 27.977 25.188 1.00 0.00 ? 11 GLN A HE21   1  
ATOM 219   H HE22   . GLN A 1 13 ? 14.957 28.010 24.308 1.00 0.00 ? 11 GLN A HE22   1  
ATOM 220   N N      . GLN A 1 14 ? 19.598 26.777 27.145 1.00 0.00 ? 12 GLN A N      1  
ATOM 221   C CA     . GLN A 1 14 ? 20.406 27.931 27.562 1.00 0.00 ? 12 GLN A CA     1  
ATOM 222   C C      . GLN A 1 14 ? 21.153 28.513 26.356 1.00 0.00 ? 12 GLN A C      1  
ATOM 223   O O      . GLN A 1 14 ? 21.126 29.721 26.119 1.00 0.00 ? 12 GLN A O      1  
ATOM 224   C CB     . GLN A 1 14 ? 21.422 27.572 28.665 1.00 0.00 ? 12 GLN A CB     1  
ATOM 225   C CG     . GLN A 1 14 ? 20.985 26.600 29.771 1.00 0.00 ? 12 GLN A CG     1  
ATOM 226   C CD     . GLN A 1 14 ? 19.796 27.033 30.626 1.00 0.00 ? 12 GLN A CD     1  
ATOM 227   O OE1    . GLN A 1 14 ? 18.854 27.676 30.185 1.00 0.00 ? 12 GLN A OE1    1  
ATOM 228   N NE2    . GLN A 1 14 ? 19.793 26.690 31.892 1.00 0.00 ? 12 GLN A NE2    1  
ATOM 229   H H      . GLN A 1 14 ? 19.862 25.853 27.469 1.00 0.00 ? 12 GLN A H      1  
ATOM 230   H HA     . GLN A 1 14 ? 19.736 28.701 27.947 1.00 0.00 ? 12 GLN A HA     1  
ATOM 231   H HB2    . GLN A 1 14 ? 22.300 27.124 28.195 1.00 0.00 ? 12 GLN A HB2    1  
ATOM 232   H HB3    . GLN A 1 14 ? 21.752 28.500 29.135 1.00 0.00 ? 12 GLN A HB3    1  
ATOM 233   H HG2    . GLN A 1 14 ? 20.767 25.631 29.337 1.00 0.00 ? 12 GLN A HG2    1  
ATOM 234   H HG3    . GLN A 1 14 ? 21.845 26.467 30.423 1.00 0.00 ? 12 GLN A HG3    1  
ATOM 235   H HE21   . GLN A 1 14 ? 20.568 26.142 32.263 1.00 0.00 ? 12 GLN A HE21   1  
ATOM 236   H HE22   . GLN A 1 14 ? 19.072 27.070 32.487 1.00 0.00 ? 12 GLN A HE22   1  
ATOM 237   N N      . LEU A 1 15 ? 21.775 27.637 25.557 1.00 0.00 ? 13 LEU A N      1  
ATOM 238   C CA     . LEU A 1 15 ? 22.539 28.016 24.366 1.00 0.00 ? 13 LEU A CA     1  
ATOM 239   C C      . LEU A 1 15 ? 21.664 28.751 23.336 1.00 0.00 ? 13 LEU A C      1  
ATOM 240   O O      . LEU A 1 15 ? 22.120 29.728 22.749 1.00 0.00 ? 13 LEU A O      1  
ATOM 241   C CB     . LEU A 1 15 ? 23.203 26.769 23.750 1.00 0.00 ? 13 LEU A CB     1  
ATOM 242   C CG     . LEU A 1 15 ? 24.134 25.975 24.688 1.00 0.00 ? 13 LEU A CG     1  
ATOM 243   C CD1    . LEU A 1 15 ? 24.734 24.791 23.931 1.00 0.00 ? 13 LEU A CD1    1  
ATOM 244   C CD2    . LEU A 1 15 ? 25.280 26.825 25.242 1.00 0.00 ? 13 LEU A CD2    1  
ATOM 245   H H      . LEU A 1 15 ? 21.717 26.655 25.801 1.00 0.00 ? 13 LEU A H      1  
ATOM 246   H HA     . LEU A 1 15 ? 23.322 28.713 24.662 1.00 0.00 ? 13 LEU A HA     1  
ATOM 247   H HB2    . LEU A 1 15 ? 22.420 26.099 23.393 1.00 0.00 ? 13 LEU A HB2    1  
ATOM 248   H HB3    . LEU A 1 15 ? 23.782 27.092 22.884 1.00 0.00 ? 13 LEU A HB3    1  
ATOM 249   H HG     . LEU A 1 15 ? 23.557 25.585 25.525 1.00 0.00 ? 13 LEU A HG     1  
ATOM 250   H HD11   . LEU A 1 15 ? 25.359 24.202 24.603 1.00 0.00 ? 13 LEU A HD11   1  
ATOM 251   H HD12   . LEU A 1 15 ? 23.938 24.152 23.550 1.00 0.00 ? 13 LEU A HD12   1  
ATOM 252   H HD13   . LEU A 1 15 ? 25.340 25.146 23.097 1.00 0.00 ? 13 LEU A HD13   1  
ATOM 253   H HD21   . LEU A 1 15 ? 25.855 27.254 24.421 1.00 0.00 ? 13 LEU A HD21   1  
ATOM 254   H HD22   . LEU A 1 15 ? 24.888 27.620 25.875 1.00 0.00 ? 13 LEU A HD22   1  
ATOM 255   H HD23   . LEU A 1 15 ? 25.937 26.200 25.848 1.00 0.00 ? 13 LEU A HD23   1  
ATOM 256   N N      . GLN A 1 16 ? 20.398 28.352 23.185 1.00 0.00 ? 14 GLN A N      1  
ATOM 257   C CA     . GLN A 1 16 ? 19.420 28.979 22.285 1.00 0.00 ? 14 GLN A CA     1  
ATOM 258   C C      . GLN A 1 16 ? 18.993 30.405 22.688 1.00 0.00 ? 14 GLN A C      1  
ATOM 259   O O      . GLN A 1 16 ? 18.506 31.144 21.834 1.00 0.00 ? 14 GLN A O      1  
ATOM 260   C CB     . GLN A 1 16 ? 18.193 28.059 22.181 1.00 0.00 ? 14 GLN A CB     1  
ATOM 261   C CG     . GLN A 1 16 ? 18.459 26.799 21.339 1.00 0.00 ? 14 GLN A CG     1  
ATOM 262   C CD     . GLN A 1 16 ? 18.056 26.992 19.882 1.00 0.00 ? 14 GLN A CD     1  
ATOM 263   O OE1    . GLN A 1 16 ? 16.946 26.650 19.482 1.00 0.00 ? 14 GLN A OE1    1  
ATOM 264   N NE2    . GLN A 1 16 ? 18.891 27.554 19.038 1.00 0.00 ? 14 GLN A NE2    1  
ATOM 265   H H      . GLN A 1 16 ? 20.113 27.514 23.679 1.00 0.00 ? 14 GLN A H      1  
ATOM 266   H HA     . GLN A 1 16 ? 19.870 29.068 21.295 1.00 0.00 ? 14 GLN A HA     1  
ATOM 267   H HB2    . GLN A 1 16 ? 17.893 27.757 23.184 1.00 0.00 ? 14 GLN A HB2    1  
ATOM 268   H HB3    . GLN A 1 16 ? 17.356 28.606 21.743 1.00 0.00 ? 14 GLN A HB3    1  
ATOM 269   H HG2    . GLN A 1 16 ? 19.506 26.509 21.398 1.00 0.00 ? 14 GLN A HG2    1  
ATOM 270   H HG3    . GLN A 1 16 ? 17.867 25.983 21.751 1.00 0.00 ? 14 GLN A HG3    1  
ATOM 271   H HE21   . GLN A 1 16 ? 19.832 27.834 19.306 1.00 0.00 ? 14 GLN A HE21   1  
ATOM 272   H HE22   . GLN A 1 16 ? 18.536 27.765 18.111 1.00 0.00 ? 14 GLN A HE22   1  
ATOM 273   N N      . GLU A 1 17 ? 19.183 30.835 23.939 1.00 0.00 ? 15 GLU A N      1  
ATOM 274   C CA     . GLU A 1 17 ? 19.054 32.254 24.326 1.00 0.00 ? 15 GLU A CA     1  
ATOM 275   C C      . GLU A 1 17 ? 20.407 32.978 24.337 1.00 0.00 ? 15 GLU A C      1  
ATOM 276   O O      . GLU A 1 17 ? 20.486 34.145 23.945 1.00 0.00 ? 15 GLU A O      1  
ATOM 277   C CB     . GLU A 1 17 ? 18.371 32.388 25.699 1.00 0.00 ? 15 GLU A CB     1  
ATOM 278   C CG     . GLU A 1 17 ? 16.854 32.151 25.652 1.00 0.00 ? 15 GLU A CG     1  
ATOM 279   C CD     . GLU A 1 17 ? 16.123 33.152 24.745 1.00 0.00 ? 15 GLU A CD     1  
ATOM 280   O OE1    . GLU A 1 17 ? 16.325 34.386 24.889 1.00 0.00 ? 15 GLU A OE1    1  
ATOM 281   O OE2    . GLU A 1 17 ? 15.333 32.702 23.879 1.00 0.00 ? 15 GLU A OE2    1  
ATOM 282   H H      . GLU A 1 17 ? 19.543 30.180 24.624 1.00 0.00 ? 15 GLU A H      1  
ATOM 283   H HA     . GLU A 1 17 ? 18.446 32.786 23.594 1.00 0.00 ? 15 GLU A HA     1  
ATOM 284   H HB2    . GLU A 1 17 ? 18.824 31.684 26.398 1.00 0.00 ? 15 GLU A HB2    1  
ATOM 285   H HB3    . GLU A 1 17 ? 18.545 33.393 26.085 1.00 0.00 ? 15 GLU A HB3    1  
ATOM 286   H HG2    . GLU A 1 17 ? 16.664 31.131 25.310 1.00 0.00 ? 15 GLU A HG2    1  
ATOM 287   H HG3    . GLU A 1 17 ? 16.459 32.241 26.666 1.00 0.00 ? 15 GLU A HG3    1  
ATOM 288   N N      . LEU A 1 18 ? 21.478 32.297 24.750 1.00 0.00 ? 16 LEU A N      1  
ATOM 289   C CA     . LEU A 1 18 ? 22.821 32.871 24.842 1.00 0.00 ? 16 LEU A CA     1  
ATOM 290   C C      . LEU A 1 18 ? 23.392 33.222 23.457 1.00 0.00 ? 16 LEU A C      1  
ATOM 291   O O      . LEU A 1 18 ? 23.851 34.346 23.261 1.00 0.00 ? 16 LEU A O      1  
ATOM 292   C CB     . LEU A 1 18 ? 23.723 31.902 25.632 1.00 0.00 ? 16 LEU A CB     1  
ATOM 293   C CG     . LEU A 1 18 ? 23.400 31.824 27.139 1.00 0.00 ? 16 LEU A CG     1  
ATOM 294   C CD1    . LEU A 1 18 ? 24.012 30.576 27.776 1.00 0.00 ? 16 LEU A CD1    1  
ATOM 295   C CD2    . LEU A 1 18 ? 23.954 33.039 27.887 1.00 0.00 ? 16 LEU A CD2    1  
ATOM 296   H H      . LEU A 1 18 ? 21.345 31.343 25.071 1.00 0.00 ? 16 LEU A H      1  
ATOM 297   H HA     . LEU A 1 18 ? 22.758 33.811 25.390 1.00 0.00 ? 16 LEU A HA     1  
ATOM 298   H HB2    . LEU A 1 18 ? 23.639 30.910 25.188 1.00 0.00 ? 16 LEU A HB2    1  
ATOM 299   H HB3    . LEU A 1 18 ? 24.756 32.223 25.528 1.00 0.00 ? 16 LEU A HB3    1  
ATOM 300   H HG     . LEU A 1 18 ? 22.321 31.788 27.286 1.00 0.00 ? 16 LEU A HG     1  
ATOM 301   H HD11   . LEU A 1 18 ? 23.717 30.514 28.823 1.00 0.00 ? 16 LEU A HD11   1  
ATOM 302   H HD12   . LEU A 1 18 ? 23.657 29.686 27.259 1.00 0.00 ? 16 LEU A HD12   1  
ATOM 303   H HD13   . LEU A 1 18 ? 25.096 30.614 27.711 1.00 0.00 ? 16 LEU A HD13   1  
ATOM 304   H HD21   . LEU A 1 18 ? 23.536 33.948 27.464 1.00 0.00 ? 16 LEU A HD21   1  
ATOM 305   H HD22   . LEU A 1 18 ? 23.678 32.976 28.939 1.00 0.00 ? 16 LEU A HD22   1  
ATOM 306   H HD23   . LEU A 1 18 ? 25.041 33.068 27.798 1.00 0.00 ? 16 LEU A HD23   1  
ATOM 307   N N      . GLU A 1 19 ? 23.288 32.330 22.466 1.00 0.00 ? 17 GLU A N      1  
ATOM 308   C CA     . GLU A 1 19 ? 23.759 32.586 21.092 1.00 0.00 ? 17 GLU A CA     1  
ATOM 309   C C      . GLU A 1 19 ? 22.891 33.627 20.362 1.00 0.00 ? 17 GLU A C      1  
ATOM 310   O O      . GLU A 1 19 ? 23.412 34.538 19.717 1.00 0.00 ? 17 GLU A O      1  
ATOM 311   C CB     . GLU A 1 19 ? 23.877 31.258 20.318 1.00 0.00 ? 17 GLU A CB     1  
ATOM 312   C CG     . GLU A 1 19 ? 22.554 30.719 19.742 1.00 0.00 ? 17 GLU A CG     1  
ATOM 313   C CD     . GLU A 1 19 ? 22.627 29.246 19.319 1.00 0.00 ? 17 GLU A CD     1  
ATOM 314   O OE1    . GLU A 1 19 ? 23.741 28.712 19.101 1.00 0.00 ? 17 GLU A OE1    1  
ATOM 315   O OE2    . GLU A 1 19 ? 21.560 28.588 19.196 1.00 0.00 ? 17 GLU A OE2    1  
ATOM 316   H H      . GLU A 1 19 ? 22.875 31.423 22.669 1.00 0.00 ? 17 GLU A H      1  
ATOM 317   H HA     . GLU A 1 19 ? 24.764 33.004 21.154 1.00 0.00 ? 17 GLU A HA     1  
ATOM 318   H HB2    . GLU A 1 19 ? 24.565 31.409 19.486 1.00 0.00 ? 17 GLU A HB2    1  
ATOM 319   H HB3    . GLU A 1 19 ? 24.319 30.513 20.982 1.00 0.00 ? 17 GLU A HB3    1  
ATOM 320   H HG2    . GLU A 1 19 ? 21.759 30.833 20.480 1.00 0.00 ? 17 GLU A HG2    1  
ATOM 321   H HG3    . GLU A 1 19 ? 22.291 31.322 18.872 1.00 0.00 ? 17 GLU A HG3    1  
ATOM 322   N N      . ALA A 1 20 ? 21.567 33.563 20.557 1.00 0.00 ? 18 ALA A N      1  
ATOM 323   C CA     . ALA A 1 20 ? 20.615 34.531 20.016 1.00 0.00 ? 18 ALA A CA     1  
ATOM 324   C C      . ALA A 1 20 ? 20.810 35.938 20.612 1.00 0.00 ? 18 ALA A C      1  
ATOM 325   O O      . ALA A 1 20 ? 20.430 36.930 19.992 1.00 0.00 ? 18 ALA A O      1  
ATOM 326   C CB     . ALA A 1 20 ? 19.199 34.000 20.257 1.00 0.00 ? 18 ALA A CB     1  
ATOM 327   H H      . ALA A 1 20 ? 21.201 32.791 21.095 1.00 0.00 ? 18 ALA A H      1  
ATOM 328   H HA     . ALA A 1 20 ? 20.772 34.608 18.939 1.00 0.00 ? 18 ALA A HA     1  
ATOM 329   H HB1    . ALA A 1 20 ? 18.995 33.936 21.326 1.00 0.00 ? 18 ALA A HB1    1  
ATOM 330   H HB2    . ALA A 1 20 ? 18.476 34.673 19.795 1.00 0.00 ? 18 ALA A HB2    1  
ATOM 331   H HB3    . ALA A 1 20 ? 19.091 33.011 19.807 1.00 0.00 ? 18 ALA A HB3    1  
ATOM 332   N N      . THR A 1 21 ? 21.450 36.042 21.782 1.00 0.00 ? 19 THR A N      1  
ATOM 333   C CA     . THR A 1 21 ? 21.890 37.319 22.361 1.00 0.00 ? 19 THR A CA     1  
ATOM 334   C C      . THR A 1 21 ? 23.288 37.713 21.859 1.00 0.00 ? 19 THR A C      1  
ATOM 335   O O      . THR A 1 21 ? 23.497 38.861 21.473 1.00 0.00 ? 19 THR A O      1  
ATOM 336   C CB     . THR A 1 21 ? 21.820 37.287 23.895 1.00 0.00 ? 19 THR A CB     1  
ATOM 337   O OG1    . THR A 1 21 ? 20.571 36.786 24.331 1.00 0.00 ? 19 THR A OG1    1  
ATOM 338   C CG2    . THR A 1 21 ? 21.963 38.690 24.480 1.00 0.00 ? 19 THR A CG2    1  
ATOM 339   H H      . THR A 1 21 ? 21.692 35.185 22.262 1.00 0.00 ? 19 THR A H      1  
ATOM 340   H HA     . THR A 1 21 ? 21.202 38.098 22.035 1.00 0.00 ? 19 THR A HA     1  
ATOM 341   H HB     . THR A 1 21 ? 22.611 36.647 24.288 1.00 0.00 ? 19 THR A HB     1  
ATOM 342   H HG1    . THR A 1 21 ? 20.566 35.830 24.123 1.00 0.00 ? 19 THR A HG1    1  
ATOM 343   H HG21   . THR A 1 21 ? 21.770 38.655 25.549 1.00 0.00 ? 19 THR A HG21   1  
ATOM 344   H HG22   . THR A 1 21 ? 22.972 39.068 24.312 1.00 0.00 ? 19 THR A HG22   1  
ATOM 345   H HG23   . THR A 1 21 ? 21.243 39.364 24.016 1.00 0.00 ? 19 THR A HG23   1  
ATOM 346   N N      . PHE A 1 22 ? 24.231 36.770 21.763 1.00 0.00 ? 20 PHE A N      1  
ATOM 347   C CA     . PHE A 1 22 ? 25.606 37.002 21.286 1.00 0.00 ? 20 PHE A CA     1  
ATOM 348   C C      . PHE A 1 22 ? 25.684 37.491 19.823 1.00 0.00 ? 20 PHE A C      1  
ATOM 349   O O      . PHE A 1 22 ? 26.635 38.181 19.453 1.00 0.00 ? 20 PHE A O      1  
ATOM 350   C CB     . PHE A 1 22 ? 26.405 35.704 21.490 1.00 0.00 ? 20 PHE A CB     1  
ATOM 351   C CG     . PHE A 1 22 ? 27.908 35.822 21.299 1.00 0.00 ? 20 PHE A CG     1  
ATOM 352   C CD1    . PHE A 1 22 ? 28.682 36.526 22.241 1.00 0.00 ? 20 PHE A CD1    1  
ATOM 353   C CD2    . PHE A 1 22 ? 28.543 35.190 20.212 1.00 0.00 ? 20 PHE A CD2    1  
ATOM 354   C CE1    . PHE A 1 22 ? 30.079 36.606 22.099 1.00 0.00 ? 20 PHE A CE1    1  
ATOM 355   C CE2    . PHE A 1 22 ? 29.941 35.264 20.072 1.00 0.00 ? 20 PHE A CE2    1  
ATOM 356   C CZ     . PHE A 1 22 ? 30.710 35.970 21.015 1.00 0.00 ? 20 PHE A CZ     1  
ATOM 357   H H      . PHE A 1 22 ? 24.007 35.833 22.085 1.00 0.00 ? 20 PHE A H      1  
ATOM 358   H HA     . PHE A 1 22 ? 26.052 37.781 21.906 1.00 0.00 ? 20 PHE A HA     1  
ATOM 359   H HB2    . PHE A 1 22 ? 26.237 35.349 22.507 1.00 0.00 ? 20 PHE A HB2    1  
ATOM 360   H HB3    . PHE A 1 22 ? 26.017 34.945 20.811 1.00 0.00 ? 20 PHE A HB3    1  
ATOM 361   H HD1    . PHE A 1 22 ? 28.201 36.998 23.083 1.00 0.00 ? 20 PHE A HD1    1  
ATOM 362   H HD2    . PHE A 1 22 ? 27.961 34.635 19.487 1.00 0.00 ? 20 PHE A HD2    1  
ATOM 363   H HE1    . PHE A 1 22 ? 30.664 37.148 22.828 1.00 0.00 ? 20 PHE A HE1    1  
ATOM 364   H HE2    . PHE A 1 22 ? 30.426 34.767 19.243 1.00 0.00 ? 20 PHE A HE2    1  
ATOM 365   H HZ     . PHE A 1 22 ? 31.784 36.017 20.906 1.00 0.00 ? 20 PHE A HZ     1  
ATOM 366   N N      . GLN A 1 23 ? 24.670 37.205 18.997 1.00 0.00 ? 21 GLN A N      1  
ATOM 367   C CA     . GLN A 1 23 ? 24.544 37.730 17.626 1.00 0.00 ? 21 GLN A CA     1  
ATOM 368   C C      . GLN A 1 23 ? 24.024 39.183 17.527 1.00 0.00 ? 21 GLN A C      1  
ATOM 369   O O      . GLN A 1 23 ? 24.094 39.776 16.444 1.00 0.00 ? 21 GLN A O      1  
ATOM 370   C CB     . GLN A 1 23 ? 23.717 36.747 16.780 1.00 0.00 ? 21 GLN A CB     1  
ATOM 371   C CG     . GLN A 1 23 ? 22.220 36.685 17.128 1.00 0.00 ? 21 GLN A CG     1  
ATOM 372   C CD     . GLN A 1 23 ? 21.361 37.587 16.248 1.00 0.00 ? 21 GLN A CD     1  
ATOM 373   O OE1    . GLN A 1 23 ? 20.819 38.598 16.672 1.00 0.00 ? 21 GLN A OE1    1  
ATOM 374   N NE2    . GLN A 1 23 ? 21.220 37.254 14.988 1.00 0.00 ? 21 GLN A NE2    1  
ATOM 375   H H      . GLN A 1 23 ? 23.993 36.516 19.310 1.00 0.00 ? 21 GLN A H      1  
ATOM 376   H HA     . GLN A 1 23 ? 25.545 37.742 17.191 1.00 0.00 ? 21 GLN A HA     1  
ATOM 377   H HB2    . GLN A 1 23 ? 23.835 36.996 15.725 1.00 0.00 ? 21 GLN A HB2    1  
ATOM 378   H HB3    . GLN A 1 23 ? 24.134 35.752 16.921 1.00 0.00 ? 21 GLN A HB3    1  
ATOM 379   H HG2    . GLN A 1 23 ? 21.875 35.660 16.990 1.00 0.00 ? 21 GLN A HG2    1  
ATOM 380   H HG3    . GLN A 1 23 ? 22.078 36.952 18.170 1.00 0.00 ? 21 GLN A HG3    1  
ATOM 381   H HE21   . GLN A 1 23 ? 21.644 36.398 14.644 1.00 0.00 ? 21 GLN A HE21   1  
ATOM 382   H HE22   . GLN A 1 23 ? 20.627 37.824 14.395 1.00 0.00 ? 21 GLN A HE22   1  
ATOM 383   N N      . ARG A 1 24 ? 23.543 39.770 18.637 1.00 0.00 ? 22 ARG A N      1  
ATOM 384   C CA     . ARG A 1 24 ? 23.054 41.167 18.733 1.00 0.00 ? 22 ARG A CA     1  
ATOM 385   C C      . ARG A 1 24 ? 23.800 42.038 19.755 1.00 0.00 ? 22 ARG A C      1  
ATOM 386   O O      . ARG A 1 24 ? 23.785 43.264 19.621 1.00 0.00 ? 22 ARG A O      1  
ATOM 387   C CB     . ARG A 1 24 ? 21.528 41.189 18.967 1.00 0.00 ? 22 ARG A CB     1  
ATOM 388   C CG     . ARG A 1 24 ? 21.046 40.433 20.219 1.00 0.00 ? 22 ARG A CG     1  
ATOM 389   C CD     . ARG A 1 24 ? 19.523 40.531 20.367 1.00 0.00 ? 22 ARG A CD     1  
ATOM 390   N NE     . ARG A 1 24 ? 19.013 39.846 21.579 1.00 0.00 ? 22 ARG A NE     1  
ATOM 391   C CZ     . ARG A 1 24 ? 18.192 38.805 21.612 1.00 0.00 ? 22 ARG A CZ     1  
ATOM 392   N NH1    . ARG A 1 24 ? 17.911 38.100 20.555 1.00 0.00 1 22 ARG A NH1    1  
ATOM 393   N NH2    . ARG A 1 24 ? 17.628 38.435 22.725 1.00 0.00 ? 22 ARG A NH2    1  
ATOM 394   H H      . ARG A 1 24 ? 23.502 39.200 19.474 1.00 0.00 ? 22 ARG A H      1  
ATOM 395   H HA     . ARG A 1 24 ? 23.228 41.659 17.775 1.00 0.00 ? 22 ARG A HA     1  
ATOM 396   H HB2    . ARG A 1 24 ? 21.201 42.228 19.038 1.00 0.00 ? 22 ARG A HB2    1  
ATOM 397   H HB3    . ARG A 1 24 ? 21.039 40.759 18.093 1.00 0.00 ? 22 ARG A HB3    1  
ATOM 398   H HG2    . ARG A 1 24 ? 21.313 39.384 20.123 1.00 0.00 ? 22 ARG A HG2    1  
ATOM 399   H HG3    . ARG A 1 24 ? 21.520 40.850 21.108 1.00 0.00 ? 22 ARG A HG3    1  
ATOM 400   H HD2    . ARG A 1 24 ? 19.251 41.586 20.431 1.00 0.00 ? 22 ARG A HD2    1  
ATOM 401   H HD3    . ARG A 1 24 ? 19.055 40.126 19.469 1.00 0.00 ? 22 ARG A HD3    1  
ATOM 402   H HE     . ARG A 1 24 ? 19.134 40.336 22.460 1.00 0.00 ? 22 ARG A HE     1  
ATOM 403   H HH11   . ARG A 1 24 ? 18.531 38.177 19.766 1.00 0.00 ? 22 ARG A HH11   1  
ATOM 404   H HH12   . ARG A 1 24 ? 17.268 37.317 20.603 1.00 0.00 ? 22 ARG A HH12   1  
ATOM 405   H HH21   . ARG A 1 24 ? 17.816 38.924 23.587 1.00 0.00 ? 22 ARG A HH21   1  
ATOM 406   H HH22   . ARG A 1 24 ? 16.998 37.638 22.733 1.00 0.00 ? 22 ARG A HH22   1  
ATOM 407   N N      . ASN A 1 25 ? 24.462 41.436 20.744 1.00 0.00 ? 23 ASN A N      1  
ATOM 408   C CA     . ASN A 1 25 ? 25.253 42.111 21.776 1.00 0.00 ? 23 ASN A CA     1  
ATOM 409   C C      . ASN A 1 25 ? 26.369 41.180 22.295 1.00 0.00 ? 23 ASN A C      1  
ATOM 410   O O      . ASN A 1 25 ? 26.097 40.245 23.047 1.00 0.00 ? 23 ASN A O      1  
ATOM 411   C CB     . ASN A 1 25 ? 24.285 42.536 22.900 1.00 0.00 ? 23 ASN A CB     1  
ATOM 412   C CG     . ASN A 1 25 ? 24.922 43.376 23.994 1.00 0.00 ? 23 ASN A CG     1  
ATOM 413   O OD1    . ASN A 1 25 ? 26.112 43.658 24.011 1.00 0.00 ? 23 ASN A OD1    1  
ATOM 414   N ND2    . ASN A 1 25 ? 24.125 43.829 24.931 1.00 0.00 ? 23 ASN A ND2    1  
ATOM 415   H H      . ASN A 1 25 ? 24.353 40.434 20.838 1.00 0.00 ? 23 ASN A H      1  
ATOM 416   H HA     . ASN A 1 25 ? 25.717 43.006 21.360 1.00 0.00 ? 23 ASN A HA     1  
ATOM 417   H HB2    . ASN A 1 25 ? 23.475 43.125 22.471 1.00 0.00 ? 23 ASN A HB2    1  
ATOM 418   H HB3    . ASN A 1 25 ? 23.845 41.651 23.359 1.00 0.00 ? 23 ASN A HB3    1  
ATOM 419   H HD21   . ASN A 1 25 ? 23.140 43.570 24.910 1.00 0.00 ? 23 ASN A HD21   1  
ATOM 420   H HD22   . ASN A 1 25 ? 24.508 44.444 25.628 1.00 0.00 ? 23 ASN A HD22   1  
ATOM 421   N N      . ARG A 1 26 ? 27.630 41.430 21.912 1.00 0.00 ? 24 ARG A N      1  
ATOM 422   C CA     . ARG A 1 26 ? 28.814 40.665 22.375 1.00 0.00 ? 24 ARG A CA     1  
ATOM 423   C C      . ARG A 1 26 ? 29.349 41.107 23.745 1.00 0.00 ? 24 ARG A C      1  
ATOM 424   O O      . ARG A 1 26 ? 30.143 40.380 24.349 1.00 0.00 ? 24 ARG A O      1  
ATOM 425   C CB     . ARG A 1 26 ? 29.934 40.739 21.319 1.00 0.00 ? 24 ARG A CB     1  
ATOM 426   C CG     . ARG A 1 26 ? 29.585 39.976 20.032 1.00 0.00 ? 24 ARG A CG     1  
ATOM 427   C CD     . ARG A 1 26 ? 30.651 40.172 18.946 1.00 0.00 ? 24 ARG A CD     1  
ATOM 428   N NE     . ARG A 1 26 ? 31.920 39.467 19.215 1.00 0.00 ? 24 ARG A NE     1  
ATOM 429   C CZ     . ARG A 1 26 ? 32.329 38.321 18.700 1.00 0.00 ? 24 ARG A CZ     1  
ATOM 430   N NH1    . ARG A 1 26 ? 31.555 37.506 18.043 1.00 0.00 ? 24 ARG A NH1    1  
ATOM 431   N NH2    . ARG A 1 26 ? 33.573 37.976 18.852 1.00 0.00 1 24 ARG A NH2    1  
ATOM 432   H H      . ARG A 1 26 ? 27.775 42.185 21.248 1.00 0.00 ? 24 ARG A H      1  
ATOM 433   H HA     . ARG A 1 26 ? 28.531 39.618 22.495 1.00 0.00 ? 24 ARG A HA     1  
ATOM 434   H HB2    . ARG A 1 26 ? 30.130 41.785 21.080 1.00 0.00 ? 24 ARG A HB2    1  
ATOM 435   H HB3    . ARG A 1 26 ? 30.847 40.307 21.734 1.00 0.00 ? 24 ARG A HB3    1  
ATOM 436   H HG2    . ARG A 1 26 ? 29.471 38.913 20.250 1.00 0.00 ? 24 ARG A HG2    1  
ATOM 437   H HG3    . ARG A 1 26 ? 28.638 40.350 19.641 1.00 0.00 ? 24 ARG A HG3    1  
ATOM 438   H HD2    . ARG A 1 26 ? 30.245 39.827 18.002 1.00 0.00 ? 24 ARG A HD2    1  
ATOM 439   H HD3    . ARG A 1 26 ? 30.850 41.239 18.833 1.00 0.00 ? 24 ARG A HD3    1  
ATOM 440   H HE     . ARG A 1 26 ? 32.644 39.989 19.697 1.00 0.00 ? 24 ARG A HE     1  
ATOM 441   H HH11   . ARG A 1 26 ? 30.567 37.723 17.957 1.00 0.00 ? 24 ARG A HH11   1  
ATOM 442   H HH12   . ARG A 1 26 ? 31.911 36.634 17.664 1.00 0.00 ? 24 ARG A HH12   1  
ATOM 443   H HH21   . ARG A 1 26 ? 34.203 38.642 19.291 1.00 0.00 ? 24 ARG A HH21   1  
ATOM 444   H HH22   . ARG A 1 26 ? 33.929 37.158 18.392 1.00 0.00 ? 24 ARG A HH22   1  
ATOM 445   N N      . TYR A 1 27 ? 28.928 42.275 24.238 1.00 0.00 ? 25 TYR A N      1  
ATOM 446   C CA     . TYR A 1 27 ? 29.438 42.904 25.464 1.00 0.00 ? 25 TYR A CA     1  
ATOM 447   C C      . TYR A 1 27 ? 28.308 43.465 26.369 1.00 0.00 ? 25 TYR A C      1  
ATOM 448   O O      . TYR A 1 27 ? 28.254 44.676 26.605 1.00 0.00 ? 25 TYR A O      1  
ATOM 449   C CB     . TYR A 1 27 ? 30.475 43.976 25.072 1.00 0.00 ? 25 TYR A CB     1  
ATOM 450   C CG     . TYR A 1 27 ? 31.715 43.463 24.350 1.00 0.00 ? 25 TYR A CG     1  
ATOM 451   C CD1    . TYR A 1 27 ? 32.809 42.987 25.093 1.00 0.00 ? 25 TYR A CD1    1  
ATOM 452   C CD2    . TYR A 1 27 ? 31.798 43.491 22.944 1.00 0.00 ? 25 TYR A CD2    1  
ATOM 453   C CE1    . TYR A 1 27 ? 33.978 42.554 24.438 1.00 0.00 ? 25 TYR A CE1    1  
ATOM 454   C CE2    . TYR A 1 27 ? 32.957 43.033 22.283 1.00 0.00 ? 25 TYR A CE2    1  
ATOM 455   C CZ     . TYR A 1 27 ? 34.059 42.567 23.031 1.00 0.00 ? 25 TYR A CZ     1  
ATOM 456   O OH     . TYR A 1 27 ? 35.180 42.126 22.396 1.00 0.00 ? 25 TYR A OH     1  
ATOM 457   H H      . TYR A 1 27 ? 28.262 42.800 23.687 1.00 0.00 ? 25 TYR A H      1  
ATOM 458   H HA     . TYR A 1 27 ? 29.959 42.157 26.062 1.00 0.00 ? 25 TYR A HA     1  
ATOM 459   H HB2    . TYR A 1 27 ? 29.991 44.730 24.450 1.00 0.00 ? 25 TYR A HB2    1  
ATOM 460   H HB3    . TYR A 1 27 ? 30.804 44.474 25.984 1.00 0.00 ? 25 TYR A HB3    1  
ATOM 461   H HD1    . TYR A 1 27 ? 32.750 42.961 26.171 1.00 0.00 ? 25 TYR A HD1    1  
ATOM 462   H HD2    . TYR A 1 27 ? 30.969 43.867 22.366 1.00 0.00 ? 25 TYR A HD2    1  
ATOM 463   H HE1    . TYR A 1 27 ? 34.811 42.191 25.009 1.00 0.00 ? 25 TYR A HE1    1  
ATOM 464   H HE2    . TYR A 1 27 ? 33.017 43.056 21.204 1.00 0.00 ? 25 TYR A HE2    1  
ATOM 465   H HH     . TYR A 1 27 ? 35.936 42.016 22.996 1.00 0.00 ? 25 TYR A HH     1  
ATOM 466   N N      . PRO A 1 28 ? 27.378 42.628 26.878 1.00 0.00 ? 26 PRO A N      1  
ATOM 467   C CA     . PRO A 1 28 ? 26.277 43.069 27.742 1.00 0.00 ? 26 PRO A CA     1  
ATOM 468   C C      . PRO A 1 28 ? 26.717 43.525 29.147 1.00 0.00 ? 26 PRO A C      1  
ATOM 469   O O      . PRO A 1 28 ? 27.530 42.874 29.812 1.00 0.00 ? 26 PRO A O      1  
ATOM 470   C CB     . PRO A 1 28 ? 25.320 41.873 27.822 1.00 0.00 ? 26 PRO A CB     1  
ATOM 471   C CG     . PRO A 1 28 ? 26.240 40.671 27.614 1.00 0.00 ? 26 PRO A CG     1  
ATOM 472   C CD     . PRO A 1 28 ? 27.256 41.201 26.607 1.00 0.00 ? 26 PRO A CD     1  
ATOM 473   H HA     . PRO A 1 28 ? 25.759 43.899 27.261 1.00 0.00 ? 26 PRO A HA     1  
ATOM 474   H HB2    . PRO A 1 28 ? 24.798 41.820 28.779 1.00 0.00 ? 26 PRO A HB2    1  
ATOM 475   H HB3    . PRO A 1 28 ? 24.601 41.922 27.004 1.00 0.00 ? 26 PRO A HB3    1  
ATOM 476   H HG2    . PRO A 1 28 ? 26.750 40.422 28.545 1.00 0.00 ? 26 PRO A HG2    1  
ATOM 477   H HG3    . PRO A 1 28 ? 25.698 39.807 27.229 1.00 0.00 ? 26 PRO A HG3    1  
ATOM 478   H HD2    . PRO A 1 28 ? 28.208 40.683 26.722 1.00 0.00 ? 26 PRO A HD2    1  
ATOM 479   H HD3    . PRO A 1 28 ? 26.869 41.058 25.597 1.00 0.00 ? 26 PRO A HD3    1  
ATOM 480   N N      . ASP A 1 29 ? 26.101 44.608 29.622 1.00 0.00 ? 27 ASP A N      1  
ATOM 481   C CA     . ASP A 1 29 ? 26.162 45.131 30.996 1.00 0.00 ? 27 ASP A CA     1  
ATOM 482   C C      . ASP A 1 29 ? 25.479 44.197 32.018 1.00 0.00 ? 27 ASP A C      1  
ATOM 483   O O      . ASP A 1 29 ? 24.588 43.427 31.652 1.00 0.00 ? 27 ASP A O      1  
ATOM 484   C CB     . ASP A 1 29 ? 25.466 46.501 30.975 1.00 0.00 ? 27 ASP A CB     1  
ATOM 485   C CG     . ASP A 1 29 ? 25.519 47.237 32.309 1.00 0.00 ? 27 ASP A CG     1  
ATOM 486   O OD1    . ASP A 1 29 ? 24.639 46.996 33.167 1.00 0.00 ? 27 ASP A OD1    1  
ATOM 487   O OD2    . ASP A 1 29 ? 26.425 48.084 32.480 1.00 0.00 ? 27 ASP A OD2    1  
ATOM 488   H H      . ASP A 1 29 ? 25.499 45.112 28.983 1.00 0.00 ? 27 ASP A H      1  
ATOM 489   H HA     . ASP A 1 29 ? 27.206 45.263 31.284 1.00 0.00 ? 27 ASP A HA     1  
ATOM 490   H HB2    . ASP A 1 29 ? 25.933 47.127 30.212 1.00 0.00 ? 27 ASP A HB2    1  
ATOM 491   H HB3    . ASP A 1 29 ? 24.421 46.358 30.702 1.00 0.00 ? 27 ASP A HB3    1  
ATOM 492   N N      . MET A 1 30 ? 25.839 44.273 33.309 1.00 0.00 ? 28 MET A N      1  
ATOM 493   C CA     . MET A 1 30 ? 25.232 43.442 34.366 1.00 0.00 ? 28 MET A CA     1  
ATOM 494   C C      . MET A 1 30 ? 23.698 43.541 34.428 1.00 0.00 ? 28 MET A C      1  
ATOM 495   O O      . MET A 1 30 ? 23.032 42.529 34.643 1.00 0.00 ? 28 MET A O      1  
ATOM 496   C CB     . MET A 1 30 ? 25.871 43.757 35.729 1.00 0.00 ? 28 MET A CB     1  
ATOM 497   C CG     . MET A 1 30 ? 25.296 44.982 36.450 1.00 0.00 ? 28 MET A CG     1  
ATOM 498   S SD     . MET A 1 30 ? 26.429 45.725 37.648 1.00 0.00 ? 28 MET A SD     1  
ATOM 499   C CE     . MET A 1 30 ? 27.100 47.010 36.560 1.00 0.00 ? 28 MET A CE     1  
ATOM 500   H H      . MET A 1 30 ? 26.595 44.901 33.569 1.00 0.00 ? 28 MET A H      1  
ATOM 501   H HA     . MET A 1 30 ? 25.472 42.406 34.137 1.00 0.00 ? 28 MET A HA     1  
ATOM 502   H HB2    . MET A 1 30 ? 25.742 42.893 36.380 1.00 0.00 ? 28 MET A HB2    1  
ATOM 503   H HB3    . MET A 1 30 ? 26.937 43.904 35.584 1.00 0.00 ? 28 MET A HB3    1  
ATOM 504   H HG2    . MET A 1 30 ? 25.035 45.747 35.718 1.00 0.00 ? 28 MET A HG2    1  
ATOM 505   H HG3    . MET A 1 30 ? 24.383 44.684 36.967 1.00 0.00 ? 28 MET A HG3    1  
ATOM 506   H HE1    . MET A 1 30 ? 27.343 46.588 35.586 1.00 0.00 ? 28 MET A HE1    1  
ATOM 507   H HE2    . MET A 1 30 ? 26.361 47.801 36.432 1.00 0.00 ? 28 MET A HE2    1  
ATOM 508   H HE3    . MET A 1 30 ? 27.999 47.432 36.996 1.00 0.00 ? 28 MET A HE3    1  
ATOM 509   N N      . SER A 1 31 ? 23.142 44.723 34.137 1.00 0.00 ? 29 SER A N      1  
ATOM 510   C CA     . SER A 1 31 ? 21.696 44.972 34.038 1.00 0.00 ? 29 SER A CA     1  
ATOM 511   C C      . SER A 1 31 ? 21.005 44.106 32.978 1.00 0.00 ? 29 SER A C      1  
ATOM 512   O O      . SER A 1 31 ? 19.835 43.771 33.144 1.00 0.00 ? 29 SER A O      1  
ATOM 513   C CB     . SER A 1 31 ? 21.431 46.450 33.726 1.00 0.00 ? 29 SER A CB     1  
ATOM 514   O OG     . SER A 1 31 ? 22.115 46.868 32.559 1.00 0.00 ? 29 SER A OG     1  
ATOM 515   H H      . SER A 1 31 ? 23.769 45.498 33.939 1.00 0.00 ? 29 SER A H      1  
ATOM 516   H HA     . SER A 1 31 ? 21.236 44.742 35.000 1.00 0.00 ? 29 SER A HA     1  
ATOM 517   H HB2    . SER A 1 31 ? 20.359 46.603 33.593 1.00 0.00 ? 29 SER A HB2    1  
ATOM 518   H HB3    . SER A 1 31 ? 21.767 47.064 34.559 1.00 0.00 ? 29 SER A HB3    1  
ATOM 519   H HG     . SER A 1 31 ? 23.070 46.947 32.795 1.00 0.00 ? 29 SER A HG     1  
ATOM 520   N N      . THR A 1 32 ? 21.730 43.694 31.933 1.00 0.00 ? 30 THR A N      1  
ATOM 521   C CA     . THR A 1 32 ? 21.283 42.756 30.892 1.00 0.00 ? 30 THR A CA     1  
ATOM 522   C C      . THR A 1 32 ? 21.699 41.318 31.205 1.00 0.00 ? 30 THR A C      1  
ATOM 523   O O      . THR A 1 32 ? 20.914 40.396 30.985 1.00 0.00 ? 30 THR A O      1  
ATOM 524   C CB     . THR A 1 32 ? 21.849 43.181 29.528 1.00 0.00 ? 30 THR A CB     1  
ATOM 525   O OG1    . THR A 1 32 ? 21.423 44.486 29.224 1.00 0.00 ? 30 THR A OG1    1  
ATOM 526   C CG2    . THR A 1 32 ? 21.411 42.288 28.367 1.00 0.00 ? 30 THR A CG2    1  
ATOM 527   H H      . THR A 1 32 ? 22.679 44.041 31.866 1.00 0.00 ? 30 THR A H      1  
ATOM 528   H HA     . THR A 1 32 ? 20.195 42.777 30.831 1.00 0.00 ? 30 THR A HA     1  
ATOM 529   H HB     . THR A 1 32 ? 22.938 43.177 29.575 1.00 0.00 ? 30 THR A HB     1  
ATOM 530   H HG1    . THR A 1 32 ? 20.439 44.479 29.242 1.00 0.00 ? 30 THR A HG1    1  
ATOM 531   H HG21   . THR A 1 32 ? 21.829 41.290 28.483 1.00 0.00 ? 30 THR A HG21   1  
ATOM 532   H HG22   . THR A 1 32 ? 20.324 42.222 28.329 1.00 0.00 ? 30 THR A HG22   1  
ATOM 533   H HG23   . THR A 1 32 ? 21.780 42.707 27.431 1.00 0.00 ? 30 THR A HG23   1  
ATOM 534   N N      . ARG A 1 33 ? 22.901 41.092 31.757 1.00 0.00 ? 31 ARG A N      1  
ATOM 535   C CA     . ARG A 1 33 ? 23.367 39.741 32.129 1.00 0.00 ? 31 ARG A CA     1  
ATOM 536   C C      . ARG A 1 33 ? 22.490 39.103 33.211 1.00 0.00 ? 31 ARG A C      1  
ATOM 537   O O      . ARG A 1 33 ? 22.278 37.892 33.163 1.00 0.00 ? 31 ARG A O      1  
ATOM 538   C CB     . ARG A 1 33 ? 24.850 39.746 32.541 1.00 0.00 ? 31 ARG A CB     1  
ATOM 539   C CG     . ARG A 1 33 ? 25.802 40.180 31.412 1.00 0.00 ? 31 ARG A CG     1  
ATOM 540   C CD     . ARG A 1 33 ? 27.290 39.942 31.724 1.00 0.00 ? 31 ARG A CD     1  
ATOM 541   N NE     . ARG A 1 33 ? 27.703 40.450 33.046 1.00 0.00 ? 31 ARG A NE     1  
ATOM 542   C CZ     . ARG A 1 33 ? 28.205 41.628 33.363 1.00 0.00 ? 31 ARG A CZ     1  
ATOM 543   N NH1    . ARG A 1 33 ? 28.380 42.609 32.524 1.00 0.00 ? 31 ARG A NH1    1  
ATOM 544   N NH2    . ARG A 1 33 ? 28.525 41.817 34.604 1.00 0.00 1 31 ARG A NH2    1  
ATOM 545   H H      . ARG A 1 33 ? 23.507 41.892 31.922 1.00 0.00 ? 31 ARG A H      1  
ATOM 546   H HA     . ARG A 1 33 ? 23.261 39.091 31.262 1.00 0.00 ? 31 ARG A HA     1  
ATOM 547   H HB2    . ARG A 1 33 ? 24.976 40.408 33.395 1.00 0.00 ? 31 ARG A HB2    1  
ATOM 548   H HB3    . ARG A 1 33 ? 25.122 38.734 32.844 1.00 0.00 ? 31 ARG A HB3    1  
ATOM 549   H HG2    . ARG A 1 33 ? 25.554 39.622 30.509 1.00 0.00 ? 31 ARG A HG2    1  
ATOM 550   H HG3    . ARG A 1 33 ? 25.659 41.236 31.204 1.00 0.00 ? 31 ARG A HG3    1  
ATOM 551   H HD2    . ARG A 1 33 ? 27.484 38.868 31.691 1.00 0.00 ? 31 ARG A HD2    1  
ATOM 552   H HD3    . ARG A 1 33 ? 27.889 40.408 30.941 1.00 0.00 ? 31 ARG A HD3    1  
ATOM 553   H HE     . ARG A 1 33 ? 27.630 39.810 33.834 1.00 0.00 ? 31 ARG A HE     1  
ATOM 554   H HH11   . ARG A 1 33 ? 28.109 42.509 31.553 1.00 0.00 ? 31 ARG A HH11   1  
ATOM 555   H HH12   . ARG A 1 33 ? 28.662 43.520 32.876 1.00 0.00 ? 31 ARG A HH12   1  
ATOM 556   H HH21   . ARG A 1 33 ? 28.362 41.051 35.252 1.00 0.00 ? 31 ARG A HH21   1  
ATOM 557   H HH22   . ARG A 1 33 ? 28.882 42.708 34.938 1.00 0.00 ? 31 ARG A HH22   1  
ATOM 558   N N      . GLU A 1 34 ? 21.907 39.888 34.123 1.00 0.00 ? 32 GLU A N      1  
ATOM 559   C CA     . GLU A 1 34 ? 20.914 39.357 35.064 1.00 0.00 ? 32 GLU A CA     1  
ATOM 560   C C      . GLU A 1 34 ? 19.562 39.021 34.405 1.00 0.00 ? 32 GLU A C      1  
ATOM 561   O O      . GLU A 1 34 ? 18.909 38.082 34.854 1.00 0.00 ? 32 GLU A O      1  
ATOM 562   C CB     . GLU A 1 34 ? 20.763 40.228 36.324 1.00 0.00 ? 32 GLU A CB     1  
ATOM 563   C CG     . GLU A 1 34 ? 19.867 41.474 36.194 1.00 0.00 ? 32 GLU A CG     1  
ATOM 564   C CD     . GLU A 1 34 ? 19.481 42.017 37.577 1.00 0.00 ? 32 GLU A CD     1  
ATOM 565   O OE1    . GLU A 1 34 ? 18.918 41.247 38.397 1.00 0.00 ? 32 GLU A OE1    1  
ATOM 566   O OE2    . GLU A 1 34 ? 19.718 43.215 37.868 1.00 0.00 ? 32 GLU A OE2    1  
ATOM 567   H H      . GLU A 1 34 ? 22.167 40.869 34.177 1.00 0.00 ? 32 GLU A H      1  
ATOM 568   H HA     . GLU A 1 34 ? 21.308 38.408 35.425 1.00 0.00 ? 32 GLU A HA     1  
ATOM 569   H HB2    . GLU A 1 34 ? 20.336 39.579 37.089 1.00 0.00 ? 32 GLU A HB2    1  
ATOM 570   H HB3    . GLU A 1 34 ? 21.750 40.531 36.676 1.00 0.00 ? 32 GLU A HB3    1  
ATOM 571   H HG2    . GLU A 1 34 ? 20.390 42.236 35.614 1.00 0.00 ? 32 GLU A HG2    1  
ATOM 572   H HG3    . GLU A 1 34 ? 18.945 41.220 35.670 1.00 0.00 ? 32 GLU A HG3    1  
ATOM 573   N N      . GLU A 1 35 ? 19.158 39.703 33.323 1.00 0.00 ? 33 GLU A N      1  
ATOM 574   C CA     . GLU A 1 35 ? 17.941 39.354 32.564 1.00 0.00 ? 33 GLU A CA     1  
ATOM 575   C C      . GLU A 1 35 ? 18.118 38.013 31.840 1.00 0.00 ? 33 GLU A C      1  
ATOM 576   O O      . GLU A 1 35 ? 17.283 37.123 31.977 1.00 0.00 ? 33 GLU A O      1  
ATOM 577   C CB     . GLU A 1 35 ? 17.545 40.456 31.558 1.00 0.00 ? 33 GLU A CB     1  
ATOM 578   C CG     . GLU A 1 35 ? 17.148 41.771 32.237 1.00 0.00 ? 33 GLU A CG     1  
ATOM 579   C CD     . GLU A 1 35 ? 16.455 42.762 31.285 1.00 0.00 ? 33 GLU A CD     1  
ATOM 580   O OE1    . GLU A 1 35 ? 15.343 42.435 30.816 1.00 0.00 ? 33 GLU A OE1    1  
ATOM 581   O OE2    . GLU A 1 35 ? 16.942 43.895 31.048 1.00 0.00 ? 33 GLU A OE2    1  
ATOM 582   H H      . GLU A 1 35 ? 19.747 40.442 32.966 1.00 0.00 ? 33 GLU A H      1  
ATOM 583   H HA     . GLU A 1 35 ? 17.113 39.225 33.264 1.00 0.00 ? 33 GLU A HA     1  
ATOM 584   H HB2    . GLU A 1 35 ? 18.358 40.644 30.859 1.00 0.00 ? 33 GLU A HB2    1  
ATOM 585   H HB3    . GLU A 1 35 ? 16.692 40.094 30.987 1.00 0.00 ? 33 GLU A HB3    1  
ATOM 586   H HG2    . GLU A 1 35 ? 16.463 41.543 33.054 1.00 0.00 ? 33 GLU A HG2    1  
ATOM 587   H HG3    . GLU A 1 35 ? 18.040 42.216 32.663 1.00 0.00 ? 33 GLU A HG3    1  
ATOM 588   N N      . ILE A 1 36 ? 19.254 37.819 31.159 1.00 0.00 ? 34 ILE A N      1  
ATOM 589   C CA     . ILE A 1 36 ? 19.624 36.541 30.520 1.00 0.00 ? 34 ILE A CA     1  
ATOM 590   C C      . ILE A 1 36 ? 19.590 35.389 31.544 1.00 0.00 ? 34 ILE A C      1  
ATOM 591   O O      . ILE A 1 36 ? 19.133 34.284 31.237 1.00 0.00 ? 34 ILE A O      1  
ATOM 592   C CB     . ILE A 1 36 ? 21.016 36.674 29.855 1.00 0.00 ? 34 ILE A CB     1  
ATOM 593   C CG1    . ILE A 1 36 ? 21.029 37.764 28.753 1.00 0.00 ? 34 ILE A CG1    1  
ATOM 594   C CG2    . ILE A 1 36 ? 21.477 35.336 29.249 1.00 0.00 ? 34 ILE A CG2    1  
ATOM 595   C CD1    . ILE A 1 36 ? 22.442 38.154 28.291 1.00 0.00 ? 34 ILE A CD1    1  
ATOM 596   H H      . ILE A 1 36 ? 19.901 38.599 31.099 1.00 0.00 ? 34 ILE A H      1  
ATOM 597   H HA     . ILE A 1 36 ? 18.893 36.308 29.748 1.00 0.00 ? 34 ILE A HA     1  
ATOM 598   H HB     . ILE A 1 36 ? 21.726 36.961 30.629 1.00 0.00 ? 34 ILE A HB     1  
ATOM 599   H HG12   . ILE A 1 36 ? 20.452 37.422 27.891 1.00 0.00 ? 34 ILE A HG12   1  
ATOM 600   H HG13   . ILE A 1 36 ? 20.553 38.670 29.120 1.00 0.00 ? 34 ILE A HG13   1  
ATOM 601   H HG21   . ILE A 1 36 ? 20.776 35.010 28.479 1.00 0.00 ? 34 ILE A HG21   1  
ATOM 602   H HG22   . ILE A 1 36 ? 22.465 35.448 28.811 1.00 0.00 ? 34 ILE A HG22   1  
ATOM 603   H HG23   . ILE A 1 36 ? 21.547 34.564 30.015 1.00 0.00 ? 34 ILE A HG23   1  
ATOM 604   H HD11   . ILE A 1 36 ? 22.387 39.056 27.684 1.00 0.00 ? 34 ILE A HD11   1  
ATOM 605   H HD12   . ILE A 1 36 ? 23.076 38.361 29.151 1.00 0.00 ? 34 ILE A HD12   1  
ATOM 606   H HD13   . ILE A 1 36 ? 22.885 37.358 27.694 1.00 0.00 ? 34 ILE A HD13   1  
ATOM 607   N N      . ALA A 1 37 ? 20.015 35.658 32.782 1.00 0.00 ? 35 ALA A N      1  
ATOM 608   C CA     . ALA A 1 37 ? 19.929 34.722 33.896 1.00 0.00 ? 35 ALA A CA     1  
ATOM 609   C C      . ALA A 1 37 ? 18.476 34.438 34.353 1.00 0.00 ? 35 ALA A C      1  
ATOM 610   O O      . ALA A 1 37 ? 18.162 33.285 34.656 1.00 0.00 ? 35 ALA A O      1  
ATOM 611   C CB     . ALA A 1 37 ? 20.824 35.260 35.016 1.00 0.00 ? 35 ALA A CB     1  
ATOM 612   H H      . ALA A 1 37 ? 20.406 36.574 32.961 1.00 0.00 ? 35 ALA A H      1  
ATOM 613   H HA     . ALA A 1 37 ? 20.346 33.767 33.575 1.00 0.00 ? 35 ALA A HA     1  
ATOM 614   H HB1    . ALA A 1 37 ? 21.867 35.240 34.700 1.00 0.00 ? 35 ALA A HB1    1  
ATOM 615   H HB2    . ALA A 1 37 ? 20.553 36.279 35.269 1.00 0.00 ? 35 ALA A HB2    1  
ATOM 616   H HB3    . ALA A 1 37 ? 20.704 34.653 35.903 1.00 0.00 ? 35 ALA A HB3    1  
ATOM 617   N N      . VAL A 1 38 ? 17.558 35.419 34.324 1.00 0.00 ? 36 VAL A N      1  
ATOM 618   C CA     . VAL A 1 38 ? 16.119 35.180 34.582 1.00 0.00 ? 36 VAL A CA     1  
ATOM 619   C C      . VAL A 1 38 ? 15.530 34.219 33.545 1.00 0.00 ? 36 VAL A C      1  
ATOM 620   O O      . VAL A 1 38 ? 14.837 33.276 33.935 1.00 0.00 ? 36 VAL A O      1  
ATOM 621   C CB     . VAL A 1 38 ? 15.274 36.479 34.636 1.00 0.00 ? 36 VAL A CB     1  
ATOM 622   C CG1    . VAL A 1 38 ? 13.776 36.191 34.830 1.00 0.00 ? 36 VAL A CG1    1  
ATOM 623   C CG2    . VAL A 1 38 ? 15.675 37.380 35.809 1.00 0.00 ? 36 VAL A CG2    1  
ATOM 624   H H      . VAL A 1 38 ? 17.846 36.346 34.028 1.00 0.00 ? 36 VAL A H      1  
ATOM 625   H HA     . VAL A 1 38 ? 16.030 34.694 35.553 1.00 0.00 ? 36 VAL A HA     1  
ATOM 626   H HB     . VAL A 1 38 ? 15.395 37.036 33.709 1.00 0.00 ? 36 VAL A HB     1  
ATOM 627   H HG11   . VAL A 1 38 ? 13.616 35.609 35.738 1.00 0.00 ? 36 VAL A HG11   1  
ATOM 628   H HG12   . VAL A 1 38 ? 13.226 37.129 34.902 1.00 0.00 ? 36 VAL A HG12   1  
ATOM 629   H HG13   . VAL A 1 38 ? 13.374 35.647 33.976 1.00 0.00 ? 36 VAL A HG13   1  
ATOM 630   H HG21   . VAL A 1 38 ? 15.585 36.840 36.751 1.00 0.00 ? 36 VAL A HG21   1  
ATOM 631   H HG22   . VAL A 1 38 ? 16.697 37.714 35.691 1.00 0.00 ? 36 VAL A HG22   1  
ATOM 632   H HG23   . VAL A 1 38 ? 15.039 38.264 35.837 1.00 0.00 ? 36 VAL A HG23   1  
ATOM 633   N N      . TRP A 1 39 ? 15.824 34.401 32.251 1.00 0.00 ? 37 TRP A N      1  
ATOM 634   C CA     . TRP A 1 39 ? 15.250 33.593 31.153 1.00 0.00 ? 37 TRP A CA     1  
ATOM 635   C C      . TRP A 1 39 ? 15.730 32.131 31.127 1.00 0.00 ? 37 TRP A C      1  
ATOM 636   O O      . TRP A 1 39 ? 15.113 31.295 30.469 1.00 0.00 ? 37 TRP A O      1  
ATOM 637   C CB     . TRP A 1 39 ? 15.541 34.256 29.794 1.00 0.00 ? 37 TRP A CB     1  
ATOM 638   C CG     . TRP A 1 39 ? 15.356 35.744 29.713 1.00 0.00 ? 37 TRP A CG     1  
ATOM 639   C CD1    . TRP A 1 39 ? 16.180 36.588 29.051 1.00 0.00 ? 37 TRP A CD1    1  
ATOM 640   C CD2    . TRP A 1 39 ? 14.355 36.594 30.360 1.00 0.00 ? 37 TRP A CD2    1  
ATOM 641   N NE1    . TRP A 1 39 ? 15.818 37.893 29.314 1.00 0.00 ? 37 TRP A NE1    1  
ATOM 642   C CE2    . TRP A 1 39 ? 14.727 37.957 30.157 1.00 0.00 ? 37 TRP A CE2    1  
ATOM 643   C CE3    . TRP A 1 39 ? 13.189 36.357 31.122 1.00 0.00 ? 37 TRP A CE3    1  
ATOM 644   C CZ2    . TRP A 1 39 ? 14.024 39.018 30.748 1.00 0.00 ? 37 TRP A CZ2    1  
ATOM 645   C CZ3    . TRP A 1 39 ? 12.465 37.416 31.700 1.00 0.00 ? 37 TRP A CZ3    1  
ATOM 646   C CH2    . TRP A 1 39 ? 12.892 38.743 31.533 1.00 0.00 ? 37 TRP A CH2    1  
ATOM 647   H H      . TRP A 1 39 ? 16.373 35.219 31.999 1.00 0.00 ? 37 TRP A H      1  
ATOM 648   H HA     . TRP A 1 39 ? 14.169 33.555 31.283 1.00 0.00 ? 37 TRP A HA     1  
ATOM 649   H HB2    . TRP A 1 39 ? 16.579 34.041 29.533 1.00 0.00 ? 37 TRP A HB2    1  
ATOM 650   H HB3    . TRP A 1 39 ? 14.912 33.790 29.036 1.00 0.00 ? 37 TRP A HB3    1  
ATOM 651   H HD1    . TRP A 1 39 ? 17.046 36.280 28.475 1.00 0.00 ? 37 TRP A HD1    1  
ATOM 652   H HE1    . TRP A 1 39 ? 16.388 38.689 29.027 1.00 0.00 ? 37 TRP A HE1    1  
ATOM 653   H HE3    . TRP A 1 39 ? 12.854 35.343 31.282 1.00 0.00 ? 37 TRP A HE3    1  
ATOM 654   H HZ2    . TRP A 1 39 ? 14.347 40.037 30.605 1.00 0.00 ? 37 TRP A HZ2    1  
ATOM 655   H HZ3    . TRP A 1 39 ? 11.587 37.205 32.299 1.00 0.00 ? 37 TRP A HZ3    1  
ATOM 656   H HH2    . TRP A 1 39 ? 12.346 39.548 32.005 1.00 0.00 ? 37 TRP A HH2    1  
ATOM 657   N N      . THR A 1 40 ? 16.818 31.821 31.836 1.00 0.00 ? 38 THR A N      1  
ATOM 658   C CA     . THR A 1 40 ? 17.488 30.503 31.856 1.00 0.00 ? 38 THR A CA     1  
ATOM 659   C C      . THR A 1 40 ? 17.457 29.809 33.230 1.00 0.00 ? 38 THR A C      1  
ATOM 660   O O      . THR A 1 40 ? 17.774 28.622 33.345 1.00 0.00 ? 38 THR A O      1  
ATOM 661   C CB     . THR A 1 40 ? 18.938 30.663 31.370 1.00 0.00 ? 38 THR A CB     1  
ATOM 662   O OG1    . THR A 1 40 ? 19.576 31.701 32.078 1.00 0.00 ? 38 THR A OG1    1  
ATOM 663   C CG2    . THR A 1 40 ? 19.025 31.021 29.886 1.00 0.00 ? 38 THR A CG2    1  
ATOM 664   H H      . THR A 1 40 ? 17.287 32.581 32.310 1.00 0.00 ? 38 THR A H      1  
ATOM 665   H HA     . THR A 1 40 ? 16.986 29.830 31.164 1.00 0.00 ? 38 THR A HA     1  
ATOM 666   H HB     . THR A 1 40 ? 19.482 29.735 31.539 1.00 0.00 ? 38 THR A HB     1  
ATOM 667   H HG1    . THR A 1 40 ? 19.392 32.537 31.613 1.00 0.00 ? 38 THR A HG1    1  
ATOM 668   H HG21   . THR A 1 40 ? 20.070 31.049 29.579 1.00 0.00 ? 38 THR A HG21   1  
ATOM 669   H HG22   . THR A 1 40 ? 18.507 30.262 29.299 1.00 0.00 ? 38 THR A HG22   1  
ATOM 670   H HG23   . THR A 1 40 ? 18.565 31.990 29.694 1.00 0.00 ? 38 THR A HG23   1  
ATOM 671   N N      . ASN A 1 41 ? 17.043 30.544 34.271 1.00 0.00 ? 39 ASN A N      1  
ATOM 672   C CA     . ASN A 1 41 ? 17.173 30.231 35.702 1.00 0.00 ? 39 ASN A CA     1  
ATOM 673   C C      . ASN A 1 41 ? 18.626 30.073 36.210 1.00 0.00 ? 39 ASN A C      1  
ATOM 674   O O      . ASN A 1 41 ? 18.907 29.370 37.187 1.00 0.00 ? 39 ASN A O      1  
ATOM 675   C CB     . ASN A 1 41 ? 16.178 29.136 36.140 1.00 0.00 ? 39 ASN A CB     1  
ATOM 676   C CG     . ASN A 1 41 ? 15.656 29.427 37.536 1.00 0.00 ? 39 ASN A CG     1  
ATOM 677   O OD1    . ASN A 1 41 ? 15.012 30.446 37.756 1.00 0.00 ? 39 ASN A OD1    1  
ATOM 678   N ND2    . ASN A 1 41 ? 15.916 28.596 38.515 1.00 0.00 ? 39 ASN A ND2    1  
ATOM 679   H H      . ASN A 1 41 ? 16.779 31.496 34.057 1.00 0.00 ? 39 ASN A H      1  
ATOM 680   H HA     . ASN A 1 41 ? 16.847 31.151 36.189 1.00 0.00 ? 39 ASN A HA     1  
ATOM 681   H HB2    . ASN A 1 41 ? 15.319 29.116 35.470 1.00 0.00 ? 39 ASN A HB2    1  
ATOM 682   H HB3    . ASN A 1 41 ? 16.660 28.159 36.108 1.00 0.00 ? 39 ASN A HB3    1  
ATOM 683   H HD21   . ASN A 1 41 ? 16.371 27.705 38.342 1.00 0.00 ? 39 ASN A HD21   1  
ATOM 684   H HD22   . ASN A 1 41 ? 15.675 28.878 39.459 1.00 0.00 ? 39 ASN A HD22   1  
ATOM 685   N N      . LEU A 1 42 ? 19.554 30.773 35.557 1.00 0.00 ? 40 LEU A N      1  
ATOM 686   C CA     . LEU A 1 42 ? 20.944 30.961 35.984 1.00 0.00 ? 40 LEU A CA     1  
ATOM 687   C C      . LEU A 1 42 ? 21.065 32.186 36.913 1.00 0.00 ? 40 LEU A C      1  
ATOM 688   O O      . LEU A 1 42 ? 20.075 32.751 37.384 1.00 0.00 ? 40 LEU A O      1  
ATOM 689   C CB     . LEU A 1 42 ? 21.829 31.045 34.714 1.00 0.00 ? 40 LEU A CB     1  
ATOM 690   C CG     . LEU A 1 42 ? 22.385 29.692 34.232 1.00 0.00 ? 40 LEU A CG     1  
ATOM 691   C CD1    . LEU A 1 42 ? 21.332 28.600 34.067 1.00 0.00 ? 40 LEU A CD1    1  
ATOM 692   C CD2    . LEU A 1 42 ? 23.073 29.886 32.881 1.00 0.00 ? 40 LEU A CD2    1  
ATOM 693   H H      . LEU A 1 42 ? 19.229 31.361 34.798 1.00 0.00 ? 40 LEU A H      1  
ATOM 694   H HA     . LEU A 1 42 ? 21.273 30.102 36.567 1.00 0.00 ? 40 LEU A HA     1  
ATOM 695   H HB2    . LEU A 1 42 ? 21.262 31.513 33.914 1.00 0.00 ? 40 LEU A HB2    1  
ATOM 696   H HB3    . LEU A 1 42 ? 22.690 31.687 34.886 1.00 0.00 ? 40 LEU A HB3    1  
ATOM 697   H HG     . LEU A 1 42 ? 23.125 29.347 34.955 1.00 0.00 ? 40 LEU A HG     1  
ATOM 698   H HD11   . LEU A 1 42 ? 20.896 28.339 35.030 1.00 0.00 ? 40 LEU A HD11   1  
ATOM 699   H HD12   . LEU A 1 42 ? 20.546 28.942 33.397 1.00 0.00 ? 40 LEU A HD12   1  
ATOM 700   H HD13   . LEU A 1 42 ? 21.795 27.702 33.659 1.00 0.00 ? 40 LEU A HD13   1  
ATOM 701   H HD21   . LEU A 1 42 ? 23.485 28.933 32.551 1.00 0.00 ? 40 LEU A HD21   1  
ATOM 702   H HD22   . LEU A 1 42 ? 22.352 30.239 32.143 1.00 0.00 ? 40 LEU A HD22   1  
ATOM 703   H HD23   . LEU A 1 42 ? 23.883 30.609 32.976 1.00 0.00 ? 40 LEU A HD23   1  
ATOM 704   N N      . THR A 1 43 ? 22.303 32.602 37.169 1.00 0.00 ? 41 THR A N      1  
ATOM 705   C CA     . THR A 1 43 ? 22.701 33.825 37.880 1.00 0.00 ? 41 THR A CA     1  
ATOM 706   C C      . THR A 1 43 ? 23.757 34.582 37.060 1.00 0.00 ? 41 THR A C      1  
ATOM 707   O O      . THR A 1 43 ? 24.393 34.002 36.176 1.00 0.00 ? 41 THR A O      1  
ATOM 708   C CB     . THR A 1 43 ? 23.196 33.490 39.296 1.00 0.00 ? 41 THR A CB     1  
ATOM 709   O OG1    . THR A 1 43 ? 23.956 32.295 39.309 1.00 0.00 ? 41 THR A OG1    1  
ATOM 710   C CG2    . THR A 1 43 ? 22.026 33.289 40.255 1.00 0.00 ? 41 THR A CG2    1  
ATOM 711   H H      . THR A 1 43 ? 23.060 32.068 36.771 1.00 0.00 ? 41 THR A H      1  
ATOM 712   H HA     . THR A 1 43 ? 21.842 34.489 37.977 1.00 0.00 ? 41 THR A HA     1  
ATOM 713   H HB     . THR A 1 43 ? 23.804 34.308 39.672 1.00 0.00 ? 41 THR A HB     1  
ATOM 714   H HG1    . THR A 1 43 ? 24.792 32.513 39.768 1.00 0.00 ? 41 THR A HG1    1  
ATOM 715   H HG21   . THR A 1 43 ? 21.412 34.188 40.280 1.00 0.00 ? 41 THR A HG21   1  
ATOM 716   H HG22   . THR A 1 43 ? 21.410 32.446 39.943 1.00 0.00 ? 41 THR A HG22   1  
ATOM 717   H HG23   . THR A 1 43 ? 22.408 33.113 41.256 1.00 0.00 ? 41 THR A HG23   1  
ATOM 718   N N      . GLU A 1 44 ? 23.934 35.885 37.300 1.00 0.00 ? 42 GLU A N      1  
ATOM 719   C CA     . GLU A 1 44 ? 24.696 36.803 36.432 1.00 0.00 ? 42 GLU A CA     1  
ATOM 720   C C      . GLU A 1 44 ? 26.131 36.336 36.145 1.00 0.00 ? 42 GLU A C      1  
ATOM 721   O O      . GLU A 1 44 ? 26.572 36.381 34.996 1.00 0.00 ? 42 GLU A O      1  
ATOM 722   C CB     . GLU A 1 44 ? 24.679 38.209 37.063 1.00 0.00 ? 42 GLU A CB     1  
ATOM 723   C CG     . GLU A 1 44 ? 25.472 39.270 36.278 1.00 0.00 ? 42 GLU A CG     1  
ATOM 724   C CD     . GLU A 1 44 ? 26.967 39.332 36.630 1.00 0.00 ? 42 GLU A CD     1  
ATOM 725   O OE1    . GLU A 1 44 ? 27.327 39.378 37.829 1.00 0.00 ? 42 GLU A OE1    1  
ATOM 726   O OE2    . GLU A 1 44 ? 27.817 39.426 35.713 1.00 0.00 ? 42 GLU A OE2    1  
ATOM 727   H H      . GLU A 1 44 ? 23.464 36.294 38.103 1.00 0.00 ? 42 GLU A H      1  
ATOM 728   H HA     . GLU A 1 44 ? 24.190 36.864 35.466 1.00 0.00 ? 42 GLU A HA     1  
ATOM 729   H HB2    . GLU A 1 44 ? 23.638 38.534 37.104 1.00 0.00 ? 42 GLU A HB2    1  
ATOM 730   H HB3    . GLU A 1 44 ? 25.047 38.159 38.088 1.00 0.00 ? 42 GLU A HB3    1  
ATOM 731   H HG2    . GLU A 1 44 ? 25.349 39.077 35.213 1.00 0.00 ? 42 GLU A HG2    1  
ATOM 732   H HG3    . GLU A 1 44 ? 25.035 40.249 36.483 1.00 0.00 ? 42 GLU A HG3    1  
ATOM 733   N N      . ALA A 1 45 ? 26.844 35.823 37.151 1.00 0.00 ? 43 ALA A N      1  
ATOM 734   C CA     . ALA A 1 45 ? 28.205 35.324 36.977 1.00 0.00 ? 43 ALA A CA     1  
ATOM 735   C C      . ALA A 1 45 ? 28.278 34.135 36.004 1.00 0.00 ? 43 ALA A C      1  
ATOM 736   O O      . ALA A 1 45 ? 29.237 34.035 35.244 1.00 0.00 ? 43 ALA A O      1  
ATOM 737   C CB     . ALA A 1 45 ? 28.771 34.954 38.348 1.00 0.00 ? 43 ALA A CB     1  
ATOM 738   H H      . ALA A 1 45 ? 26.436 35.807 38.080 1.00 0.00 ? 43 ALA A H      1  
ATOM 739   H HA     . ALA A 1 45 ? 28.817 36.127 36.561 1.00 0.00 ? 43 ALA A HA     1  
ATOM 740   H HB1    . ALA A 1 45 ? 29.792 34.588 38.235 1.00 0.00 ? 43 ALA A HB1    1  
ATOM 741   H HB2    . ALA A 1 45 ? 28.781 35.834 38.990 1.00 0.00 ? 43 ALA A HB2    1  
ATOM 742   H HB3    . ALA A 1 45 ? 28.165 34.174 38.806 1.00 0.00 ? 43 ALA A HB3    1  
ATOM 743   N N      . ARG A 1 46 ? 27.251 33.271 35.958 1.00 0.00 ? 44 ARG A N      1  
ATOM 744   C CA     . ARG A 1 46 ? 27.177 32.122 35.032 1.00 0.00 ? 44 ARG A CA     1  
ATOM 745   C C      . ARG A 1 46 ? 27.077 32.595 33.581 1.00 0.00 ? 44 ARG A C      1  
ATOM 746   O O      . ARG A 1 46 ? 27.766 32.077 32.705 1.00 0.00 ? 44 ARG A O      1  
ATOM 747   C CB     . ARG A 1 46 ? 25.995 31.199 35.392 1.00 0.00 ? 44 ARG A CB     1  
ATOM 748   C CG     . ARG A 1 46 ? 25.911 30.804 36.876 1.00 0.00 ? 44 ARG A CG     1  
ATOM 749   C CD     . ARG A 1 46 ? 27.095 29.952 37.362 1.00 0.00 ? 44 ARG A CD     1  
ATOM 750   N NE     . ARG A 1 46 ? 27.280 30.074 38.819 1.00 0.00 ? 44 ARG A NE     1  
ATOM 751   C CZ     . ARG A 1 46 ? 26.517 29.597 39.782 1.00 0.00 ? 44 ARG A CZ     1  
ATOM 752   N NH1    . ARG A 1 46 ? 25.478 28.844 39.581 1.00 0.00 1 44 ARG A NH1    1  
ATOM 753   N NH2    . ARG A 1 46 ? 26.797 29.889 41.015 1.00 0.00 ? 44 ARG A NH2    1  
ATOM 754   H H      . ARG A 1 46 ? 26.438 33.481 36.527 1.00 0.00 ? 44 ARG A H      1  
ATOM 755   H HA     . ARG A 1 46 ? 28.098 31.545 35.103 1.00 0.00 ? 44 ARG A HA     1  
ATOM 756   H HB2    . ARG A 1 46 ? 25.064 31.698 35.126 1.00 0.00 ? 44 ARG A HB2    1  
ATOM 757   H HB3    . ARG A 1 46 ? 26.063 30.293 34.788 1.00 0.00 ? 44 ARG A HB3    1  
ATOM 758   H HG2    . ARG A 1 46 ? 25.850 31.710 37.478 1.00 0.00 ? 44 ARG A HG2    1  
ATOM 759   H HG3    . ARG A 1 46 ? 24.987 30.248 37.038 1.00 0.00 ? 44 ARG A HG3    1  
ATOM 760   H HD2    . ARG A 1 46 ? 26.941 28.910 37.077 1.00 0.00 ? 44 ARG A HD2    1  
ATOM 761   H HD3    . ARG A 1 46 ? 28.013 30.294 36.882 1.00 0.00 ? 44 ARG A HD3    1  
ATOM 762   H HE     . ARG A 1 46 ? 28.040 30.664 39.137 1.00 0.00 ? 44 ARG A HE     1  
ATOM 763   H HH11   . ARG A 1 46 ? 25.239 28.525 38.644 1.00 0.00 ? 44 ARG A HH11   1  
ATOM 764   H HH12   . ARG A 1 46 ? 24.855 28.642 40.354 1.00 0.00 ? 44 ARG A HH12   1  
ATOM 765   H HH21   . ARG A 1 46 ? 27.597 30.478 41.210 1.00 0.00 ? 44 ARG A HH21   1  
ATOM 766   H HH22   . ARG A 1 46 ? 26.265 29.441 41.746 1.00 0.00 ? 44 ARG A HH22   1  
ATOM 767   N N      . VAL A 1 47 ? 26.288 33.648 33.347 1.00 0.00 ? 45 VAL A N      1  
ATOM 768   C CA     . VAL A 1 47 ? 26.206 34.334 32.048 1.00 0.00 ? 45 VAL A CA     1  
ATOM 769   C C      . VAL A 1 47 ? 27.543 35.001 31.709 1.00 0.00 ? 45 VAL A C      1  
ATOM 770   O O      . VAL A 1 47 ? 28.037 34.834 30.597 1.00 0.00 ? 45 VAL A O      1  
ATOM 771   C CB     . VAL A 1 47 ? 25.045 35.350 32.029 1.00 0.00 ? 45 VAL A CB     1  
ATOM 772   C CG1    . VAL A 1 47 ? 24.936 36.070 30.679 1.00 0.00 ? 45 VAL A CG1    1  
ATOM 773   C CG2    . VAL A 1 47 ? 23.703 34.655 32.302 1.00 0.00 ? 45 VAL A CG2    1  
ATOM 774   H H      . VAL A 1 47 ? 25.780 34.034 34.133 1.00 0.00 ? 45 VAL A H      1  
ATOM 775   H HA     . VAL A 1 47 ? 26.015 33.590 31.274 1.00 0.00 ? 45 VAL A HA     1  
ATOM 776   H HB     . VAL A 1 47 ? 25.205 36.102 32.801 1.00 0.00 ? 45 VAL A HB     1  
ATOM 777   H HG11   . VAL A 1 47 ? 24.090 36.754 30.699 1.00 0.00 ? 45 VAL A HG11   1  
ATOM 778   H HG12   . VAL A 1 47 ? 25.835 36.655 30.484 1.00 0.00 ? 45 VAL A HG12   1  
ATOM 779   H HG13   . VAL A 1 47 ? 24.797 35.346 29.876 1.00 0.00 ? 45 VAL A HG13   1  
ATOM 780   H HG21   . VAL A 1 47 ? 23.701 34.211 33.298 1.00 0.00 ? 45 VAL A HG21   1  
ATOM 781   H HG22   . VAL A 1 47 ? 22.896 35.384 32.260 1.00 0.00 ? 45 VAL A HG22   1  
ATOM 782   H HG23   . VAL A 1 47 ? 23.523 33.875 31.562 1.00 0.00 ? 45 VAL A HG23   1  
ATOM 783   N N      . ARG A 1 48 ? 28.177 35.695 32.663 1.00 0.00 ? 46 ARG A N      1  
ATOM 784   C CA     . ARG A 1 48 ? 29.465 36.381 32.454 1.00 0.00 ? 46 ARG A CA     1  
ATOM 785   C C      . ARG A 1 48 ? 30.604 35.419 32.098 1.00 0.00 ? 46 ARG A C      1  
ATOM 786   O O      . ARG A 1 48 ? 31.340 35.680 31.145 1.00 0.00 ? 46 ARG A O      1  
ATOM 787   C CB     . ARG A 1 48 ? 29.812 37.193 33.709 1.00 0.00 ? 46 ARG A CB     1  
ATOM 788   C CG     . ARG A 1 48 ? 30.855 38.283 33.415 1.00 0.00 ? 46 ARG A CG     1  
ATOM 789   C CD     . ARG A 1 48 ? 31.580 38.739 34.684 1.00 0.00 ? 46 ARG A CD     1  
ATOM 790   N NE     . ARG A 1 48 ? 30.653 39.119 35.763 1.00 0.00 ? 46 ARG A NE     1  
ATOM 791   C CZ     . ARG A 1 48 ? 30.997 39.565 36.952 1.00 0.00 ? 46 ARG A CZ     1  
ATOM 792   N NH1    . ARG A 1 48 ? 32.238 39.774 37.290 1.00 0.00 ? 46 ARG A NH1    1  
ATOM 793   N NH2    . ARG A 1 48 ? 30.070 39.816 37.821 1.00 0.00 1 46 ARG A NH2    1  
ATOM 794   H H      . ARG A 1 48 ? 27.708 35.808 33.558 1.00 0.00 ? 46 ARG A H      1  
ATOM 795   H HA     . ARG A 1 48 ? 29.362 37.067 31.609 1.00 0.00 ? 46 ARG A HA     1  
ATOM 796   H HB2    . ARG A 1 48 ? 28.910 37.674 34.087 1.00 0.00 ? 46 ARG A HB2    1  
ATOM 797   H HB3    . ARG A 1 48 ? 30.187 36.518 34.481 1.00 0.00 ? 46 ARG A HB3    1  
ATOM 798   H HG2    . ARG A 1 48 ? 31.607 37.906 32.722 1.00 0.00 ? 46 ARG A HG2    1  
ATOM 799   H HG3    . ARG A 1 48 ? 30.362 39.137 32.950 1.00 0.00 ? 46 ARG A HG3    1  
ATOM 800   H HD2    . ARG A 1 48 ? 32.215 37.921 35.032 1.00 0.00 ? 46 ARG A HD2    1  
ATOM 801   H HD3    . ARG A 1 48 ? 32.222 39.586 34.433 1.00 0.00 ? 46 ARG A HD3    1  
ATOM 802   H HE     . ARG A 1 48 ? 29.651 39.025 35.608 1.00 0.00 ? 46 ARG A HE     1  
ATOM 803   H HH11   . ARG A 1 48 ? 32.986 39.558 36.640 1.00 0.00 ? 46 ARG A HH11   1  
ATOM 804   H HH12   . ARG A 1 48 ? 32.464 40.201 38.173 1.00 0.00 ? 46 ARG A HH12   1  
ATOM 805   H HH21   . ARG A 1 48 ? 29.093 39.614 37.606 1.00 0.00 ? 46 ARG A HH21   1  
ATOM 806   H HH22   . ARG A 1 48 ? 30.292 40.199 38.730 1.00 0.00 ? 46 ARG A HH22   1  
ATOM 807   N N      . VAL A 1 49 ? 30.744 34.294 32.811 1.00 0.00 ? 47 VAL A N      1  
ATOM 808   C CA     . VAL A 1 49 ? 31.783 33.296 32.489 1.00 0.00 ? 47 VAL A CA     1  
ATOM 809   C C      . VAL A 1 49 ? 31.507 32.609 31.153 1.00 0.00 ? 47 VAL A C      1  
ATOM 810   O O      . VAL A 1 49 ? 32.461 32.345 30.423 1.00 0.00 ? 47 VAL A O      1  
ATOM 811   C CB     . VAL A 1 49 ? 32.070 32.272 33.607 1.00 0.00 ? 47 VAL A CB     1  
ATOM 812   C CG1    . VAL A 1 49 ? 32.493 32.967 34.907 1.00 0.00 ? 47 VAL A CG1    1  
ATOM 813   C CG2    . VAL A 1 49 ? 30.915 31.310 33.888 1.00 0.00 ? 47 VAL A CG2    1  
ATOM 814   H H      . VAL A 1 49 ? 30.134 34.139 33.608 1.00 0.00 ? 47 VAL A H      1  
ATOM 815   H HA     . VAL A 1 49 ? 32.713 33.842 32.355 1.00 0.00 ? 47 VAL A HA     1  
ATOM 816   H HB     . VAL A 1 49 ? 32.917 31.668 33.280 1.00 0.00 ? 47 VAL A HB     1  
ATOM 817   H HG11   . VAL A 1 49 ? 33.309 33.661 34.711 1.00 0.00 ? 47 VAL A HG11   1  
ATOM 818   H HG12   . VAL A 1 49 ? 31.664 33.521 35.338 1.00 0.00 ? 47 VAL A HG12   1  
ATOM 819   H HG13   . VAL A 1 49 ? 32.825 32.222 35.631 1.00 0.00 ? 47 VAL A HG13   1  
ATOM 820   H HG21   . VAL A 1 49 ? 30.031 31.868 34.171 1.00 0.00 ? 47 VAL A HG21   1  
ATOM 821   H HG22   . VAL A 1 49 ? 30.694 30.705 33.009 1.00 0.00 ? 47 VAL A HG22   1  
ATOM 822   H HG23   . VAL A 1 49 ? 31.186 30.637 34.701 1.00 0.00 ? 47 VAL A HG23   1  
ATOM 823   N N      . TRP A 1 50 ? 30.240 32.401 30.771 1.00 0.00 ? 48 TRP A N      1  
ATOM 824   C CA     . TRP A 1 50 ? 29.893 31.947 29.420 1.00 0.00 ? 48 TRP A CA     1  
ATOM 825   C C      . TRP A 1 50 ? 30.310 32.980 28.364 1.00 0.00 ? 48 TRP A C      1  
ATOM 826   O O      . TRP A 1 50 ? 30.972 32.618 27.397 1.00 0.00 ? 48 TRP A O      1  
ATOM 827   C CB     . TRP A 1 50 ? 28.396 31.614 29.328 1.00 0.00 ? 48 TRP A CB     1  
ATOM 828   C CG     . TRP A 1 50 ? 27.980 30.897 28.076 1.00 0.00 ? 48 TRP A CG     1  
ATOM 829   C CD1    . TRP A 1 50 ? 27.845 29.556 27.966 1.00 0.00 ? 48 TRP A CD1    1  
ATOM 830   C CD2    . TRP A 1 50 ? 27.656 31.436 26.751 1.00 0.00 ? 48 TRP A CD2    1  
ATOM 831   N NE1    . TRP A 1 50 ? 27.469 29.229 26.680 1.00 0.00 ? 48 TRP A NE1    1  
ATOM 832   C CE2    . TRP A 1 50 ? 27.304 30.347 25.895 1.00 0.00 ? 48 TRP A CE2    1  
ATOM 833   C CE3    . TRP A 1 50 ? 27.636 32.725 26.174 1.00 0.00 ? 48 TRP A CE3    1  
ATOM 834   C CZ2    . TRP A 1 50 ? 26.953 30.525 24.548 1.00 0.00 ? 48 TRP A CZ2    1  
ATOM 835   C CZ3    . TRP A 1 50 ? 27.293 32.917 24.821 1.00 0.00 ? 48 TRP A CZ3    1  
ATOM 836   C CH2    . TRP A 1 50 ? 26.948 31.823 24.007 1.00 0.00 ? 48 TRP A CH2    1  
ATOM 837   H H      . TRP A 1 50 ? 29.486 32.594 31.423 1.00 0.00 ? 48 TRP A H      1  
ATOM 838   H HA     . TRP A 1 50 ? 30.449 31.031 29.211 1.00 0.00 ? 48 TRP A HA     1  
ATOM 839   H HB2    . TRP A 1 50 ? 28.129 30.983 30.177 1.00 0.00 ? 48 TRP A HB2    1  
ATOM 840   H HB3    . TRP A 1 50 ? 27.811 32.530 29.409 1.00 0.00 ? 48 TRP A HB3    1  
ATOM 841   H HD1    . TRP A 1 50 ? 28.017 28.841 28.765 1.00 0.00 ? 48 TRP A HD1    1  
ATOM 842   H HE1    . TRP A 1 50 ? 27.447 28.261 26.344 1.00 0.00 ? 48 TRP A HE1    1  
ATOM 843   H HE3    . TRP A 1 50 ? 27.883 33.579 26.785 1.00 0.00 ? 48 TRP A HE3    1  
ATOM 844   H HZ2    . TRP A 1 50 ? 26.693 29.673 23.935 1.00 0.00 ? 48 TRP A HZ2    1  
ATOM 845   H HZ3    . TRP A 1 50 ? 27.274 33.919 24.409 1.00 0.00 ? 48 TRP A HZ3    1  
ATOM 846   H HH2    . TRP A 1 50 ? 26.672 31.982 22.972 1.00 0.00 ? 48 TRP A HH2    1  
ATOM 847   N N      . PHE A 1 51 ? 30.004 34.267 28.563 1.00 0.00 ? 49 PHE A N      1  
ATOM 848   C CA     . PHE A 1 51 ? 30.324 35.338 27.609 1.00 0.00 ? 49 PHE A CA     1  
ATOM 849   C C      . PHE A 1 51 ? 31.832 35.569 27.432 1.00 0.00 ? 49 PHE A C      1  
ATOM 850   O O      . PHE A 1 51 ? 32.289 35.635 26.287 1.00 0.00 ? 49 PHE A O      1  
ATOM 851   C CB     . PHE A 1 51 ? 29.592 36.635 27.995 1.00 0.00 ? 49 PHE A CB     1  
ATOM 852   C CG     . PHE A 1 51 ? 28.305 36.857 27.221 1.00 0.00 ? 49 PHE A CG     1  
ATOM 853   C CD1    . PHE A 1 51 ? 27.129 36.162 27.564 1.00 0.00 ? 49 PHE A CD1    1  
ATOM 854   C CD2    . PHE A 1 51 ? 28.292 37.741 26.125 1.00 0.00 ? 49 PHE A CD2    1  
ATOM 855   C CE1    . PHE A 1 51 ? 25.951 36.345 26.817 1.00 0.00 ? 49 PHE A CE1    1  
ATOM 856   C CE2    . PHE A 1 51 ? 27.114 37.928 25.383 1.00 0.00 ? 49 PHE A CE2    1  
ATOM 857   C CZ     . PHE A 1 51 ? 25.944 37.228 25.723 1.00 0.00 ? 49 PHE A CZ     1  
ATOM 858   H H      . PHE A 1 51 ? 29.457 34.509 29.383 1.00 0.00 ? 49 PHE A H      1  
ATOM 859   H HA     . PHE A 1 51 ? 29.957 35.035 26.627 1.00 0.00 ? 49 PHE A HA     1  
ATOM 860   H HB2    . PHE A 1 51 ? 29.382 36.646 29.065 1.00 0.00 ? 49 PHE A HB2    1  
ATOM 861   H HB3    . PHE A 1 51 ? 30.251 37.482 27.801 1.00 0.00 ? 49 PHE A HB3    1  
ATOM 862   H HD1    . PHE A 1 51 ? 27.130 35.475 28.396 1.00 0.00 ? 49 PHE A HD1    1  
ATOM 863   H HD2    . PHE A 1 51 ? 29.189 38.276 25.848 1.00 0.00 ? 49 PHE A HD2    1  
ATOM 864   H HE1    . PHE A 1 51 ? 25.054 35.803 27.078 1.00 0.00 ? 49 PHE A HE1    1  
ATOM 865   H HE2    . PHE A 1 51 ? 27.108 38.610 24.546 1.00 0.00 ? 49 PHE A HE2    1  
ATOM 866   H HZ     . PHE A 1 51 ? 25.043 37.369 25.143 1.00 0.00 ? 49 PHE A HZ     1  
ATOM 867   N N      . LYS A 1 52 ? 32.633 35.625 28.511 1.00 0.00 ? 50 LYS A N      1  
ATOM 868   C CA     . LYS A 1 52 ? 34.098 35.747 28.352 1.00 0.00 ? 50 LYS A CA     1  
ATOM 869   C C      . LYS A 1 52 ? 34.724 34.482 27.763 1.00 0.00 ? 50 LYS A C      1  
ATOM 870   O O      . LYS A 1 52 ? 35.601 34.602 26.915 1.00 0.00 ? 50 LYS A O      1  
ATOM 871   C CB     . LYS A 1 52 ? 34.817 36.278 29.607 1.00 0.00 ? 50 LYS A CB     1  
ATOM 872   C CG     . LYS A 1 52 ? 35.049 35.260 30.736 1.00 0.00 ? 50 LYS A CG     1  
ATOM 873   C CD     . LYS A 1 52 ? 35.816 35.881 31.916 1.00 0.00 ? 50 LYS A CD     1  
ATOM 874   C CE     . LYS A 1 52 ? 37.311 36.103 31.624 1.00 0.00 ? 50 LYS A CE     1  
ATOM 875   N NZ     . LYS A 1 52 ? 37.995 36.793 32.745 1.00 0.00 1 50 LYS A NZ     1  
ATOM 876   H H      . LYS A 1 52 ? 32.215 35.601 29.439 1.00 0.00 ? 50 LYS A H      1  
ATOM 877   H HA     . LYS A 1 52 ? 34.266 36.508 27.586 1.00 0.00 ? 50 LYS A HA     1  
ATOM 878   H HB2    . LYS A 1 52 ? 35.792 36.647 29.286 1.00 0.00 ? 50 LYS A HB2    1  
ATOM 879   H HB3    . LYS A 1 52 ? 34.254 37.127 30.000 1.00 0.00 ? 50 LYS A HB3    1  
ATOM 880   H HG2    . LYS A 1 52 ? 34.079 34.917 31.088 1.00 0.00 ? 50 LYS A HG2    1  
ATOM 881   H HG3    . LYS A 1 52 ? 35.605 34.399 30.365 1.00 0.00 ? 50 LYS A HG3    1  
ATOM 882   H HD2    . LYS A 1 52 ? 35.343 36.826 32.180 1.00 0.00 ? 50 LYS A HD2    1  
ATOM 883   H HD3    . LYS A 1 52 ? 35.731 35.214 32.771 1.00 0.00 ? 50 LYS A HD3    1  
ATOM 884   H HE2    . LYS A 1 52 ? 37.787 35.132 31.452 1.00 0.00 ? 50 LYS A HE2    1  
ATOM 885   H HE3    . LYS A 1 52 ? 37.424 36.700 30.714 1.00 0.00 ? 50 LYS A HE3    1  
ATOM 886   H HZ1    . LYS A 1 52 ? 38.991 36.883 32.558 1.00 0.00 ? 50 LYS A HZ1    1  
ATOM 887   H HZ2    . LYS A 1 52 ? 37.620 37.728 32.886 1.00 0.00 ? 50 LYS A HZ2    1  
ATOM 888   H HZ3    . LYS A 1 52 ? 37.869 36.307 33.627 1.00 0.00 ? 50 LYS A HZ3    1  
ATOM 889   N N      . ASN A 1 53 ? 34.220 33.281 28.085 1.00 0.00 ? 51 ASN A N      1  
ATOM 890   C CA     . ASN A 1 53 ? 34.647 32.071 27.374 1.00 0.00 ? 51 ASN A CA     1  
ATOM 891   C C      . ASN A 1 53 ? 34.227 32.084 25.896 1.00 0.00 ? 51 ASN A C      1  
ATOM 892   O O      . ASN A 1 53 ? 35.011 31.628 25.072 1.00 0.00 ? 51 ASN A O      1  
ATOM 893   C CB     . ASN A 1 53 ? 34.187 30.788 28.082 1.00 0.00 ? 51 ASN A CB     1  
ATOM 894   C CG     . ASN A 1 53 ? 35.101 30.409 29.232 1.00 0.00 ? 51 ASN A CG     1  
ATOM 895   O OD1    . ASN A 1 53 ? 36.219 29.949 29.038 1.00 0.00 ? 51 ASN A OD1    1  
ATOM 896   N ND2    . ASN A 1 53 ? 34.673 30.607 30.451 1.00 0.00 ? 51 ASN A ND2    1  
ATOM 897   H H      . ASN A 1 53 ? 33.485 33.214 28.777 1.00 0.00 ? 51 ASN A H      1  
ATOM 898   H HA     . ASN A 1 53 ? 35.737 32.058 27.366 1.00 0.00 ? 51 ASN A HA     1  
ATOM 899   H HB2    . ASN A 1 53 ? 33.153 30.878 28.413 1.00 0.00 ? 51 ASN A HB2    1  
ATOM 900   H HB3    . ASN A 1 53 ? 34.228 29.961 27.373 1.00 0.00 ? 51 ASN A HB3    1  
ATOM 901   H HD21   . ASN A 1 53 ? 33.782 31.068 30.587 1.00 0.00 ? 51 ASN A HD21   1  
ATOM 902   H HD22   . ASN A 1 53 ? 35.236 30.274 31.227 1.00 0.00 ? 51 ASN A HD22   1  
ATOM 903   N N      . ARG A 1 54 ? 33.073 32.657 25.524 1.00 0.00 ? 52 ARG A N      1  
ATOM 904   C CA     . ARG A 1 54 ? 32.644 32.779 24.118 1.00 0.00 ? 52 ARG A CA     1  
ATOM 905   C C      . ARG A 1 54 ? 33.578 33.661 23.302 1.00 0.00 ? 52 ARG A C      1  
ATOM 906   O O      . ARG A 1 54 ? 33.968 33.283 22.202 1.00 0.00 ? 52 ARG A O      1  
ATOM 907   C CB     . ARG A 1 54 ? 31.188 33.284 24.038 1.00 0.00 ? 52 ARG A CB     1  
ATOM 908   C CG     . ARG A 1 54 ? 30.416 32.749 22.817 1.00 0.00 ? 52 ARG A CG     1  
ATOM 909   C CD     . ARG A 1 54 ? 30.313 31.213 22.752 1.00 0.00 ? 52 ARG A CD     1  
ATOM 910   N NE     . ARG A 1 54 ? 30.011 30.609 24.066 1.00 0.00 ? 52 ARG A NE     1  
ATOM 911   C CZ     . ARG A 1 54 ? 30.814 29.886 24.830 1.00 0.00 ? 52 ARG A CZ     1  
ATOM 912   N NH1    . ARG A 1 54 ? 31.977 29.440 24.466 1.00 0.00 ? 52 ARG A NH1    1  
ATOM 913   N NH2    . ARG A 1 54 ? 30.478 29.566 26.040 1.00 0.00 1 52 ARG A NH2    1  
ATOM 914   H H      . ARG A 1 54 ? 32.426 32.943 26.253 1.00 0.00 ? 52 ARG A H      1  
ATOM 915   H HA     . ARG A 1 54 ? 32.720 31.793 23.663 1.00 0.00 ? 52 ARG A HA     1  
ATOM 916   H HB2    . ARG A 1 54 ? 30.643 32.991 24.933 1.00 0.00 ? 52 ARG A HB2    1  
ATOM 917   H HB3    . ARG A 1 54 ? 31.178 34.374 24.012 1.00 0.00 ? 52 ARG A HB3    1  
ATOM 918   H HG2    . ARG A 1 54 ? 29.408 33.164 22.846 1.00 0.00 ? 52 ARG A HG2    1  
ATOM 919   H HG3    . ARG A 1 54 ? 30.898 33.103 21.905 1.00 0.00 ? 52 ARG A HG3    1  
ATOM 920   H HD2    . ARG A 1 54 ? 29.526 30.948 22.042 1.00 0.00 ? 52 ARG A HD2    1  
ATOM 921   H HD3    . ARG A 1 54 ? 31.246 30.821 22.357 1.00 0.00 ? 52 ARG A HD3    1  
ATOM 922   H HE     . ARG A 1 54 ? 29.125 30.863 24.476 1.00 0.00 ? 52 ARG A HE     1  
ATOM 923   H HH11   . ARG A 1 54 ? 32.330 29.574 23.522 1.00 0.00 ? 52 ARG A HH11   1  
ATOM 924   H HH12   . ARG A 1 54 ? 32.490 28.873 25.137 1.00 0.00 ? 52 ARG A HH12   1  
ATOM 925   H HH21   . ARG A 1 54 ? 29.563 29.764 26.408 1.00 0.00 ? 52 ARG A HH21   1  
ATOM 926   H HH22   . ARG A 1 54 ? 31.144 28.998 26.558 1.00 0.00 ? 52 ARG A HH22   1  
ATOM 927   N N      . ARG A 1 55 ? 34.011 34.796 23.859 1.00 0.00 ? 53 ARG A N      1  
ATOM 928   C CA     . ARG A 1 55 ? 35.013 35.660 23.214 1.00 0.00 ? 53 ARG A CA     1  
ATOM 929   C C      . ARG A 1 55 ? 36.406 35.012 23.233 1.00 0.00 ? 53 ARG A C      1  
ATOM 930   O O      . ARG A 1 55 ? 37.051 34.952 22.189 1.00 0.00 ? 53 ARG A O      1  
ATOM 931   C CB     . ARG A 1 55 ? 34.971 37.071 23.821 1.00 0.00 ? 53 ARG A CB     1  
ATOM 932   C CG     . ARG A 1 55 ? 33.594 37.742 23.613 1.00 0.00 ? 53 ARG A CG     1  
ATOM 933   C CD     . ARG A 1 55 ? 33.553 39.201 24.086 1.00 0.00 ? 53 ARG A CD     1  
ATOM 934   N NE     . ARG A 1 55 ? 33.938 39.314 25.500 1.00 0.00 ? 53 ARG A NE     1  
ATOM 935   C CZ     . ARG A 1 55 ? 33.187 39.523 26.563 1.00 0.00 ? 53 ARG A CZ     1  
ATOM 936   N NH1    . ARG A 1 55 ? 31.930 39.870 26.525 1.00 0.00 1 53 ARG A NH1    1  
ATOM 937   N NH2    . ARG A 1 55 ? 33.738 39.381 27.726 1.00 0.00 ? 53 ARG A NH2    1  
ATOM 938   H H      . ARG A 1 55 ? 33.633 35.051 24.766 1.00 0.00 ? 53 ARG A H      1  
ATOM 939   H HA     . ARG A 1 55 ? 34.758 35.752 22.158 1.00 0.00 ? 53 ARG A HA     1  
ATOM 940   H HB2    . ARG A 1 55 ? 35.201 37.009 24.886 1.00 0.00 ? 53 ARG A HB2    1  
ATOM 941   H HB3    . ARG A 1 55 ? 35.730 37.683 23.332 1.00 0.00 ? 53 ARG A HB3    1  
ATOM 942   H HG2    . ARG A 1 55 ? 33.346 37.722 22.551 1.00 0.00 ? 53 ARG A HG2    1  
ATOM 943   H HG3    . ARG A 1 55 ? 32.828 37.186 24.154 1.00 0.00 ? 53 ARG A HG3    1  
ATOM 944   H HD2    . ARG A 1 55 ? 34.259 39.776 23.485 1.00 0.00 ? 53 ARG A HD2    1  
ATOM 945   H HD3    . ARG A 1 55 ? 32.556 39.609 23.919 1.00 0.00 ? 53 ARG A HD3    1  
ATOM 946   H HE     . ARG A 1 55 ? 34.934 39.229 25.686 1.00 0.00 ? 53 ARG A HE     1  
ATOM 947   H HH11   . ARG A 1 55 ? 31.472 40.022 25.632 1.00 0.00 ? 53 ARG A HH11   1  
ATOM 948   H HH12   . ARG A 1 55 ? 31.442 40.065 27.383 1.00 0.00 ? 53 ARG A HH12   1  
ATOM 949   H HH21   . ARG A 1 55 ? 34.705 39.068 27.762 1.00 0.00 ? 53 ARG A HH21   1  
ATOM 950   H HH22   . ARG A 1 55 ? 33.242 39.648 28.572 1.00 0.00 ? 53 ARG A HH22   1  
ATOM 951   N N      . ALA A 1 56 ? 36.817 34.394 24.341 1.00 0.00 ? 54 ALA A N      1  
ATOM 952   C CA     . ALA A 1 56 ? 38.093 33.678 24.428 1.00 0.00 ? 54 ALA A CA     1  
ATOM 953   C C      . ALA A 1 56 ? 38.185 32.469 23.481 1.00 0.00 ? 54 ALA A C      1  
ATOM 954   O O      . ALA A 1 56 ? 39.243 32.238 22.908 1.00 0.00 ? 54 ALA A O      1  
ATOM 955   C CB     . ALA A 1 56 ? 38.339 33.258 25.881 1.00 0.00 ? 54 ALA A CB     1  
ATOM 956   H H      . ALA A 1 56 ? 36.276 34.504 25.190 1.00 0.00 ? 54 ALA A H      1  
ATOM 957   H HA     . ALA A 1 56 ? 38.892 34.365 24.142 1.00 0.00 ? 54 ALA A HA     1  
ATOM 958   H HB1    . ALA A 1 56 ? 39.325 32.798 25.964 1.00 0.00 ? 54 ALA A HB1    1  
ATOM 959   H HB2    . ALA A 1 56 ? 38.310 34.134 26.530 1.00 0.00 ? 54 ALA A HB2    1  
ATOM 960   H HB3    . ALA A 1 56 ? 37.583 32.544 26.201 1.00 0.00 ? 54 ALA A HB3    1  
ATOM 961   N N      . LYS A 1 57 ? 37.108 31.699 23.268 1.00 0.00 ? 55 LYS A N      1  
ATOM 962   C CA     . LYS A 1 57 ? 37.086 30.523 22.374 1.00 0.00 ? 55 LYS A CA     1  
ATOM 963   C C      . LYS A 1 57 ? 36.637 30.841 20.943 1.00 0.00 ? 55 LYS A C      1  
ATOM 964   O O      . LYS A 1 57 ? 36.968 30.077 20.039 1.00 0.00 ? 55 LYS A O      1  
ATOM 965   C CB     . LYS A 1 57 ? 36.320 29.345 23.001 1.00 0.00 ? 55 LYS A CB     1  
ATOM 966   C CG     . LYS A 1 57 ? 37.150 28.531 24.011 1.00 0.00 ? 55 LYS A CG     1  
ATOM 967   C CD     . LYS A 1 57 ? 37.454 29.227 25.346 1.00 0.00 ? 55 LYS A CD     1  
ATOM 968   C CE     . LYS A 1 57 ? 38.186 28.249 26.273 1.00 0.00 ? 55 LYS A CE     1  
ATOM 969   N NZ     . LYS A 1 57 ? 38.350 28.791 27.638 1.00 0.00 1 55 LYS A NZ     1  
ATOM 970   H H      . LYS A 1 57 ? 36.269 31.900 23.804 1.00 0.00 ? 55 LYS A H      1  
ATOM 971   H HA     . LYS A 1 57 ? 38.109 30.178 22.238 1.00 0.00 ? 55 LYS A HA     1  
ATOM 972   H HB2    . LYS A 1 57 ? 35.398 29.690 23.466 1.00 0.00 ? 55 LYS A HB2    1  
ATOM 973   H HB3    . LYS A 1 57 ? 36.043 28.657 22.201 1.00 0.00 ? 55 LYS A HB3    1  
ATOM 974   H HG2    . LYS A 1 57 ? 36.590 27.621 24.224 1.00 0.00 ? 55 LYS A HG2    1  
ATOM 975   H HG3    . LYS A 1 57 ? 38.091 28.239 23.541 1.00 0.00 ? 55 LYS A HG3    1  
ATOM 976   H HD2    . LYS A 1 57 ? 38.082 30.101 25.183 1.00 0.00 ? 55 LYS A HD2    1  
ATOM 977   H HD3    . LYS A 1 57 ? 36.513 29.532 25.808 1.00 0.00 ? 55 LYS A HD3    1  
ATOM 978   H HE2    . LYS A 1 57 ? 37.609 27.325 26.326 1.00 0.00 ? 55 LYS A HE2    1  
ATOM 979   H HE3    . LYS A 1 57 ? 39.165 28.004 25.851 1.00 0.00 ? 55 LYS A HE3    1  
ATOM 980   H HZ1    . LYS A 1 57 ? 39.094 29.485 27.694 1.00 0.00 ? 55 LYS A HZ1    1  
ATOM 981   H HZ2    . LYS A 1 57 ? 37.492 29.199 28.000 1.00 0.00 ? 55 LYS A HZ2    1  
ATOM 982   H HZ3    . LYS A 1 57 ? 38.583 28.045 28.283 1.00 0.00 ? 55 LYS A HZ3    1  
ATOM 983   N N      . TRP A 1 58 ? 36.071 32.022 20.681 1.00 0.00 ? 56 TRP A N      1  
ATOM 984   C CA     . TRP A 1 58 ? 36.242 32.672 19.378 1.00 0.00 ? 56 TRP A CA     1  
ATOM 985   C C      . TRP A 1 58 ? 37.740 32.830 19.083 1.00 0.00 ? 56 TRP A C      1  
ATOM 986   O O      . TRP A 1 58 ? 38.245 32.235 18.129 1.00 0.00 ? 56 TRP A O      1  
ATOM 987   C CB     . TRP A 1 58 ? 35.501 34.017 19.314 1.00 0.00 ? 56 TRP A CB     1  
ATOM 988   C CG     . TRP A 1 58 ? 35.969 34.949 18.233 1.00 0.00 ? 56 TRP A CG     1  
ATOM 989   C CD1    . TRP A 1 58 ? 36.062 34.633 16.925 1.00 0.00 ? 56 TRP A CD1    1  
ATOM 990   C CD2    . TRP A 1 58 ? 36.470 36.319 18.342 1.00 0.00 ? 56 TRP A CD2    1  
ATOM 991   N NE1    . TRP A 1 58 ? 36.539 35.710 16.207 1.00 0.00 ? 56 TRP A NE1    1  
ATOM 992   C CE2    . TRP A 1 58 ? 36.811 36.781 17.031 1.00 0.00 ? 56 TRP A CE2    1  
ATOM 993   C CE3    . TRP A 1 58 ? 36.667 37.220 19.412 1.00 0.00 ? 56 TRP A CE3    1  
ATOM 994   C CZ2    . TRP A 1 58 ? 37.299 38.074 16.795 1.00 0.00 ? 56 TRP A CZ2    1  
ATOM 995   C CZ3    . TRP A 1 58 ? 37.166 38.518 19.186 1.00 0.00 ? 56 TRP A CZ3    1  
ATOM 996   C CH2    . TRP A 1 58 ? 37.479 38.946 17.883 1.00 0.00 ? 56 TRP A CH2    1  
ATOM 997   H H      . TRP A 1 58 ? 35.672 32.558 21.441 1.00 0.00 ? 56 TRP A H      1  
ATOM 998   H HA     . TRP A 1 58 ? 35.829 32.033 18.599 1.00 0.00 ? 56 TRP A HA     1  
ATOM 999   H HB2    . TRP A 1 58 ? 34.438 33.821 19.172 1.00 0.00 ? 56 TRP A HB2    1  
ATOM 1000  H HB3    . TRP A 1 58 ? 35.603 34.533 20.262 1.00 0.00 ? 56 TRP A HB3    1  
ATOM 1001  H HD1    . TRP A 1 58 ? 35.803 33.669 16.510 1.00 0.00 ? 56 TRP A HD1    1  
ATOM 1002  H HE1    . TRP A 1 58 ? 36.649 35.693 15.197 1.00 0.00 ? 56 TRP A HE1    1  
ATOM 1003  H HE3    . TRP A 1 58 ? 36.441 36.904 20.420 1.00 0.00 ? 56 TRP A HE3    1  
ATOM 1004  H HZ2    . TRP A 1 58 ? 37.531 38.396 15.792 1.00 0.00 ? 56 TRP A HZ2    1  
ATOM 1005  H HZ3    . TRP A 1 58 ? 37.310 39.196 20.018 1.00 0.00 ? 56 TRP A HZ3    1  
ATOM 1006  H HH2    . TRP A 1 58 ? 37.858 39.947 17.719 1.00 0.00 ? 56 TRP A HH2    1  
ATOM 1007  N N      . ARG A 1 59 ? 38.490 33.535 19.942 1.00 0.00 ? 57 ARG A N      1  
ATOM 1008  C CA     . ARG A 1 59 ? 39.915 33.797 19.688 1.00 0.00 ? 57 ARG A CA     1  
ATOM 1009  C C      . ARG A 1 59 ? 40.763 32.522 19.629 1.00 0.00 ? 57 ARG A C      1  
ATOM 1010  O O      . ARG A 1 59 ? 41.494 32.325 18.663 1.00 0.00 ? 57 ARG A O      1  
ATOM 1011  C CB     . ARG A 1 59 ? 40.481 34.817 20.685 1.00 0.00 ? 57 ARG A CB     1  
ATOM 1012  C CG     . ARG A 1 59 ? 39.793 36.185 20.532 1.00 0.00 ? 57 ARG A CG     1  
ATOM 1013  C CD     . ARG A 1 59 ? 40.627 37.309 21.141 1.00 0.00 ? 57 ARG A CD     1  
ATOM 1014  N NE     . ARG A 1 59 ? 41.792 37.587 20.287 1.00 0.00 ? 57 ARG A NE     1  
ATOM 1015  C CZ     . ARG A 1 59 ? 41.952 38.585 19.445 1.00 0.00 ? 57 ARG A CZ     1  
ATOM 1016  N NH1    . ARG A 1 59 ? 41.099 39.561 19.316 1.00 0.00 1 57 ARG A NH1    1  
ATOM 1017  N NH2    . ARG A 1 59 ? 43.013 38.585 18.707 1.00 0.00 ? 57 ARG A NH2    1  
ATOM 1018  H H      . ARG A 1 59 ? 38.030 34.000 20.722 1.00 0.00 ? 57 ARG A H      1  
ATOM 1019  H HA     . ARG A 1 59 ? 39.976 34.243 18.698 1.00 0.00 ? 57 ARG A HA     1  
ATOM 1020  H HB2    . ARG A 1 59 ? 40.363 34.459 21.709 1.00 0.00 ? 57 ARG A HB2    1  
ATOM 1021  H HB3    . ARG A 1 59 ? 41.549 34.922 20.483 1.00 0.00 ? 57 ARG A HB3    1  
ATOM 1022  H HG2    . ARG A 1 59 ? 39.624 36.407 19.476 1.00 0.00 ? 57 ARG A HG2    1  
ATOM 1023  H HG3    . ARG A 1 59 ? 38.831 36.165 21.034 1.00 0.00 ? 57 ARG A HG3    1  
ATOM 1024  H HD2    . ARG A 1 59 ? 40.002 38.195 21.244 1.00 0.00 ? 57 ARG A HD2    1  
ATOM 1025  H HD3    . ARG A 1 59 ? 40.958 37.011 22.136 1.00 0.00 ? 57 ARG A HD3    1  
ATOM 1026  H HE     . ARG A 1 59 ? 42.518 36.882 20.239 1.00 0.00 ? 57 ARG A HE     1  
ATOM 1027  H HH11   . ARG A 1 59 ? 40.267 39.582 19.874 1.00 0.00 ? 57 ARG A HH11   1  
ATOM 1028  H HH12   . ARG A 1 59 ? 41.311 40.356 18.727 1.00 0.00 ? 57 ARG A HH12   1  
ATOM 1029  H HH21   . ARG A 1 59 ? 43.632 37.793 18.762 1.00 0.00 ? 57 ARG A HH21   1  
ATOM 1030  H HH22   . ARG A 1 59 ? 43.144 39.295 17.997 1.00 0.00 ? 57 ARG A HH22   1  
ATOM 1031  N N      . LYS A 1 60 ? 40.576 31.584 20.555 1.00 0.00 ? 58 LYS A N      1  
ATOM 1032  C CA     . LYS A 1 60 ? 41.315 30.308 20.643 1.00 0.00 ? 58 LYS A CA     1  
ATOM 1033  C C      . LYS A 1 60 ? 40.883 29.243 19.611 1.00 0.00 ? 58 LYS A C      1  
ATOM 1034  O O      . LYS A 1 60 ? 41.371 28.113 19.658 1.00 0.00 ? 58 LYS A O      1  
ATOM 1035  C CB     . LYS A 1 60 ? 41.302 29.820 22.107 1.00 0.00 ? 58 LYS A CB     1  
ATOM 1036  C CG     . LYS A 1 60 ? 42.111 30.786 22.998 1.00 0.00 ? 58 LYS A CG     1  
ATOM 1037  C CD     . LYS A 1 60 ? 41.977 30.531 24.507 1.00 0.00 ? 58 LYS A CD     1  
ATOM 1038  C CE     . LYS A 1 60 ? 42.661 29.250 24.996 1.00 0.00 ? 58 LYS A CE     1  
ATOM 1039  N NZ     . LYS A 1 60 ? 44.102 29.225 24.658 1.00 0.00 1 58 LYS A NZ     1  
ATOM 1040  H H      . LYS A 1 60 ? 39.983 31.841 21.338 1.00 0.00 ? 58 LYS A H      1  
ATOM 1041  H HA     . LYS A 1 60 ? 42.359 30.514 20.393 1.00 0.00 ? 58 LYS A HA     1  
ATOM 1042  H HB2    . LYS A 1 60 ? 40.275 29.756 22.463 1.00 0.00 ? 58 LYS A HB2    1  
ATOM 1043  H HB3    . LYS A 1 60 ? 41.744 28.827 22.170 1.00 0.00 ? 58 LYS A HB3    1  
ATOM 1044  H HG2    . LYS A 1 60 ? 43.161 30.732 22.712 1.00 0.00 ? 58 LYS A HG2    1  
ATOM 1045  H HG3    . LYS A 1 60 ? 41.786 31.810 22.824 1.00 0.00 ? 58 LYS A HG3    1  
ATOM 1046  H HD2    . LYS A 1 60 ? 42.418 31.378 25.035 1.00 0.00 ? 58 LYS A HD2    1  
ATOM 1047  H HD3    . LYS A 1 60 ? 40.920 30.498 24.772 1.00 0.00 ? 58 LYS A HD3    1  
ATOM 1048  H HE2    . LYS A 1 60 ? 42.546 29.196 26.082 1.00 0.00 ? 58 LYS A HE2    1  
ATOM 1049  H HE3    . LYS A 1 60 ? 42.169 28.376 24.562 1.00 0.00 ? 58 LYS A HE3    1  
ATOM 1050  H HZ1    . LYS A 1 60 ? 44.244 28.926 23.695 1.00 0.00 ? 58 LYS A HZ1    1  
ATOM 1051  H HZ2    . LYS A 1 60 ? 44.535 30.139 24.792 1.00 0.00 ? 58 LYS A HZ2    1  
ATOM 1052  H HZ3    . LYS A 1 60 ? 44.609 28.568 25.246 1.00 0.00 ? 58 LYS A HZ3    1  
ATOM 1053  N N      . ARG A 1 61 ? 40.020 29.604 18.649 1.00 0.00 ? 59 ARG A N      1  
ATOM 1054  C CA     . ARG A 1 61 ? 39.682 28.799 17.453 1.00 0.00 ? 59 ARG A CA     1  
ATOM 1055  C C      . ARG A 1 61 ? 39.877 29.562 16.128 1.00 0.00 ? 59 ARG A C      1  
ATOM 1056  O O      . ARG A 1 61 ? 40.220 28.937 15.126 1.00 0.00 ? 59 ARG A O      1  
ATOM 1057  C CB     . ARG A 1 61 ? 38.243 28.258 17.575 1.00 0.00 ? 59 ARG A CB     1  
ATOM 1058  C CG     . ARG A 1 61 ? 38.034 27.323 18.787 1.00 0.00 ? 59 ARG A CG     1  
ATOM 1059  C CD     . ARG A 1 61 ? 36.582 26.833 18.923 1.00 0.00 ? 59 ARG A CD     1  
ATOM 1060  N NE     . ARG A 1 61 ? 36.212 25.928 17.819 1.00 0.00 ? 59 ARG A NE     1  
ATOM 1061  C CZ     . ARG A 1 61 ? 36.389 24.623 17.761 1.00 0.00 ? 59 ARG A CZ     1  
ATOM 1062  N NH1    . ARG A 1 61 ? 36.694 23.881 18.783 1.00 0.00 1 59 ARG A NH1    1  
ATOM 1063  N NH2    . ARG A 1 61 ? 36.267 24.016 16.621 1.00 0.00 ? 59 ARG A NH2    1  
ATOM 1064  H H      . ARG A 1 61 ? 39.598 30.517 18.740 1.00 0.00 ? 59 ARG A H      1  
ATOM 1065  H HA     . ARG A 1 61 ? 40.353 27.940 17.392 1.00 0.00 ? 59 ARG A HA     1  
ATOM 1066  H HB2    . ARG A 1 61 ? 37.552 29.099 17.645 1.00 0.00 ? 59 ARG A HB2    1  
ATOM 1067  H HB3    . ARG A 1 61 ? 38.005 27.704 16.665 1.00 0.00 ? 59 ARG A HB3    1  
ATOM 1068  H HG2    . ARG A 1 61 ? 38.697 26.463 18.697 1.00 0.00 ? 59 ARG A HG2    1  
ATOM 1069  H HG3    . ARG A 1 61 ? 38.293 27.849 19.706 1.00 0.00 ? 59 ARG A HG3    1  
ATOM 1070  H HD2    . ARG A 1 61 ? 36.470 26.322 19.880 1.00 0.00 ? 59 ARG A HD2    1  
ATOM 1071  H HD3    . ARG A 1 61 ? 35.911 27.694 18.930 1.00 0.00 ? 59 ARG A HD3    1  
ATOM 1072  H HE     . ARG A 1 61 ? 35.904 26.347 16.947 1.00 0.00 ? 59 ARG A HE     1  
ATOM 1073  H HH11   . ARG A 1 61 ? 36.568 24.249 19.725 1.00 0.00 ? 59 ARG A HH11   1  
ATOM 1074  H HH12   . ARG A 1 61 ? 36.853 22.897 18.624 1.00 0.00 ? 59 ARG A HH12   1  
ATOM 1075  H HH21   . ARG A 1 61 ? 36.023 24.573 15.808 1.00 0.00 ? 59 ARG A HH21   1  
ATOM 1076  H HH22   . ARG A 1 61 ? 36.495 23.036 16.561 1.00 0.00 ? 59 ARG A HH22   1  
ATOM 1077  N N      . GLU A 1 62 ? 39.701 30.885 16.115 1.00 0.00 ? 60 GLU A N      1  
ATOM 1078  C CA     . GLU A 1 62 ? 39.663 31.721 14.894 1.00 0.00 ? 60 GLU A CA     1  
ATOM 1079  C C      . GLU A 1 62 ? 40.544 32.995 14.949 1.00 0.00 ? 60 GLU A C      1  
ATOM 1080  O O      . GLU A 1 62 ? 40.873 33.538 13.897 1.00 0.00 ? 60 GLU A O      1  
ATOM 1081  C CB     . GLU A 1 62 ? 38.195 32.121 14.634 1.00 0.00 ? 60 GLU A CB     1  
ATOM 1082  C CG     . GLU A 1 62 ? 37.295 30.936 14.235 1.00 0.00 ? 60 GLU A CG     1  
ATOM 1083  C CD     . GLU A 1 62 ? 35.810 31.311 14.202 1.00 0.00 ? 60 GLU A CD     1  
ATOM 1084  O OE1    . GLU A 1 62 ? 35.261 31.706 15.255 1.00 0.00 ? 60 GLU A OE1    1  
ATOM 1085  O OE2    . GLU A 1 62 ? 35.153 31.164 13.145 1.00 0.00 ? 60 GLU A OE2    1  
ATOM 1086  H H      . GLU A 1 62 ? 39.337 31.308 16.959 1.00 0.00 ? 60 GLU A H      1  
ATOM 1087  H HA     . GLU A 1 62 ? 40.017 31.149 14.038 1.00 0.00 ? 60 GLU A HA     1  
ATOM 1088  H HB2    . GLU A 1 62 ? 37.798 32.594 15.533 1.00 0.00 ? 60 GLU A HB2    1  
ATOM 1089  H HB3    . GLU A 1 62 ? 38.164 32.860 13.837 1.00 0.00 ? 60 GLU A HB3    1  
ATOM 1090  H HG2    . GLU A 1 62 ? 37.609 30.578 13.251 1.00 0.00 ? 60 GLU A HG2    1  
ATOM 1091  H HG3    . GLU A 1 62 ? 37.419 30.118 14.948 1.00 0.00 ? 60 GLU A HG3    1  
ATOM 1092  N N      . GLU A 1 63 ? 40.929 33.463 16.145 1.00 0.00 ? 61 GLU A N      1  
ATOM 1093  C CA     . GLU A 1 63 ? 41.679 34.697 16.516 1.00 0.00 ? 61 GLU A CA     1  
ATOM 1094  C C      . GLU A 1 63 ? 41.092 36.039 16.030 1.00 0.00 ? 61 GLU A C      1  
ATOM 1095  O O      . GLU A 1 63 ? 40.938 36.971 16.817 1.00 0.00 ? 61 GLU A O      1  
ATOM 1096  C CB     . GLU A 1 63 ? 43.171 34.556 16.169 1.00 0.00 ? 61 GLU A CB     1  
ATOM 1097  C CG     . GLU A 1 63 ? 44.086 35.459 17.019 1.00 0.00 ? 61 GLU A CG     1  
ATOM 1098  C CD     . GLU A 1 63 ? 44.165 35.049 18.502 1.00 0.00 ? 61 GLU A CD     1  
ATOM 1099  O OE1    . GLU A 1 63 ? 44.473 33.865 18.784 1.00 0.00 ? 61 GLU A OE1    1  
ATOM 1100  O OE2    . GLU A 1 63 ? 43.982 35.925 19.387 1.00 0.00 ? 61 GLU A OE2    1  
ATOM 1101  H H      . GLU A 1 63 ? 40.696 32.871 16.931 1.00 0.00 ? 61 GLU A H      1  
ATOM 1102  H HA     . GLU A 1 63 ? 41.642 34.759 17.599 1.00 0.00 ? 61 GLU A HA     1  
ATOM 1103  H HB2    . GLU A 1 63 ? 43.486 33.525 16.309 1.00 0.00 ? 61 GLU A HB2    1  
ATOM 1104  H HB3    . GLU A 1 63 ? 43.318 34.799 15.116 1.00 0.00 ? 61 GLU A HB3    1  
ATOM 1105  H HG2    . GLU A 1 63 ? 45.094 35.411 16.602 1.00 0.00 ? 61 GLU A HG2    1  
ATOM 1106  H HG3    . GLU A 1 63 ? 43.750 36.494 16.935 1.00 0.00 ? 61 GLU A HG3    1  
ATOM 1107  N N      . PHE A 1 64 ? 40.747 36.133 14.749 1.00 0.00 ? 62 PHE A N      1  
ATOM 1108  C CA     . PHE A 1 64 ? 40.185 37.320 14.100 1.00 0.00 ? 62 PHE A CA     1  
ATOM 1109  C C      . PHE A 1 64 ? 38.969 37.014 13.214 1.00 0.00 ? 62 PHE A C      1  
ATOM 1110  O O      . PHE A 1 64 ? 38.163 37.913 12.980 1.00 0.00 ? 62 PHE A O      1  
ATOM 1111  C CB     . PHE A 1 64 ? 41.296 38.030 13.305 1.00 0.00 ? 62 PHE A CB     1  
ATOM 1112  C CG     . PHE A 1 64 ? 41.746 37.320 12.031 1.00 0.00 ? 62 PHE A CG     1  
ATOM 1113  C CD1    . PHE A 1 64 ? 42.560 36.169 12.097 1.00 0.00 ? 62 PHE A CD1    1  
ATOM 1114  C CD2    . PHE A 1 64 ? 41.342 37.806 10.771 1.00 0.00 ? 62 PHE A CD2    1  
ATOM 1115  C CE1    . PHE A 1 64 ? 42.934 35.492 10.923 1.00 0.00 ? 62 PHE A CE1    1  
ATOM 1116  C CE2    . PHE A 1 64 ? 41.733 37.144 9.594  1.00 0.00 ? 62 PHE A CE2    1  
ATOM 1117  C CZ     . PHE A 1 64 ? 42.521 35.981 9.670  1.00 0.00 ? 62 PHE A CZ     1  
ATOM 1118  H H      . PHE A 1 64 ? 40.928 35.316 14.177 1.00 0.00 ? 62 PHE A H      1  
ATOM 1119  H HA     . PHE A 1 64 ? 39.827 37.997 14.865 1.00 0.00 ? 62 PHE A HA     1  
ATOM 1120  H HB2    . PHE A 1 64 ? 40.938 39.022 13.037 1.00 0.00 ? 62 PHE A HB2    1  
ATOM 1121  H HB3    . PHE A 1 64 ? 42.165 38.171 13.948 1.00 0.00 ? 62 PHE A HB3    1  
ATOM 1122  H HD1    . PHE A 1 64 ? 42.891 35.796 13.052 1.00 0.00 ? 62 PHE A HD1    1  
ATOM 1123  H HD2    . PHE A 1 64 ? 40.726 38.692 10.704 1.00 0.00 ? 62 PHE A HD2    1  
ATOM 1124  H HE1    . PHE A 1 64 ? 43.532 34.594 10.984 1.00 0.00 ? 62 PHE A HE1    1  
ATOM 1125  H HE2    . PHE A 1 64 ? 41.419 37.522 8.631  1.00 0.00 ? 62 PHE A HE2    1  
ATOM 1126  H HZ     . PHE A 1 64 ? 42.802 35.455 8.763  1.00 0.00 ? 62 PHE A HZ     1  
ATOM 1127  N N      . ILE A 1 65 ? 38.807 35.768 12.749 1.00 0.00 ? 63 ILE A N      1  
ATOM 1128  C CA     . ILE A 1 65 ? 37.834 35.427 11.703 1.00 0.00 ? 63 ILE A CA     1  
ATOM 1129  C C      . ILE A 1 65 ? 36.399 35.413 12.262 1.00 0.00 ? 63 ILE A C      1  
ATOM 1130  O O      . ILE A 1 65 ? 36.086 34.739 13.249 1.00 0.00 ? 63 ILE A O      1  
ATOM 1131  C CB     . ILE A 1 65 ? 38.198 34.103 10.984 1.00 0.00 ? 63 ILE A CB     1  
ATOM 1132  C CG1    . ILE A 1 65 ? 39.690 34.032 10.571 1.00 0.00 ? 63 ILE A CG1    1  
ATOM 1133  C CG2    . ILE A 1 65 ? 37.323 33.944 9.729  1.00 0.00 ? 63 ILE A CG2    1  
ATOM 1134  C CD1    . ILE A 1 65 ? 40.131 32.677 9.998  1.00 0.00 ? 63 ILE A CD1    1  
ATOM 1135  H H      . ILE A 1 65 ? 39.487 35.066 13.010 1.00 0.00 ? 63 ILE A H      1  
ATOM 1136  H HA     . ILE A 1 65 ? 37.888 36.215 10.954 1.00 0.00 ? 63 ILE A HA     1  
ATOM 1137  H HB     . ILE A 1 65 ? 37.989 33.268 11.655 1.00 0.00 ? 63 ILE A HB     1  
ATOM 1138  H HG12   . ILE A 1 65 ? 39.895 34.810 9.835  1.00 0.00 ? 63 ILE A HG12   1  
ATOM 1139  H HG13   . ILE A 1 65 ? 40.321 34.218 11.438 1.00 0.00 ? 63 ILE A HG13   1  
ATOM 1140  H HG21   . ILE A 1 65 ? 37.578 34.705 8.992  1.00 0.00 ? 63 ILE A HG21   1  
ATOM 1141  H HG22   . ILE A 1 65 ? 37.474 32.958 9.287  1.00 0.00 ? 63 ILE A HG22   1  
ATOM 1142  H HG23   . ILE A 1 65 ? 36.269 34.029 9.975  1.00 0.00 ? 63 ILE A HG23   1  
ATOM 1143  H HD11   . ILE A 1 65 ? 39.665 32.497 9.030  1.00 0.00 ? 63 ILE A HD11   1  
ATOM 1144  H HD12   . ILE A 1 65 ? 41.213 32.682 9.864  1.00 0.00 ? 63 ILE A HD12   1  
ATOM 1145  H HD13   . ILE A 1 65 ? 39.865 31.877 10.690 1.00 0.00 ? 63 ILE A HD13   1  
ATOM 1146  N N      . VAL A 1 66 ? 35.504 36.136 11.591 1.00 0.00 ? 64 VAL A N      1  
ATOM 1147  C CA     . VAL A 1 66 ? 34.060 36.231 11.872 1.00 0.00 ? 64 VAL A CA     1  
ATOM 1148  C C      . VAL A 1 66 ? 33.290 36.143 10.543 1.00 0.00 ? 64 VAL A C      1  
ATOM 1149  O O      . VAL A 1 66 ? 33.809 36.553 9.499  1.00 0.00 ? 64 VAL A O      1  
ATOM 1150  C CB     . VAL A 1 66 ? 33.760 37.545 12.635 1.00 0.00 ? 64 VAL A CB     1  
ATOM 1151  C CG1    . VAL A 1 66 ? 32.271 37.728 12.933 1.00 0.00 ? 64 VAL A CG1    1  
ATOM 1152  C CG2    . VAL A 1 66 ? 34.489 37.608 13.987 1.00 0.00 ? 64 VAL A CG2    1  
ATOM 1153  H H      . VAL A 1 66 ? 35.853 36.736 10.851 1.00 0.00 ? 64 VAL A H      1  
ATOM 1154  H HA     . VAL A 1 66 ? 33.746 35.399 12.498 1.00 0.00 ? 64 VAL A HA     1  
ATOM 1155  H HB     . VAL A 1 66 ? 34.085 38.392 12.030 1.00 0.00 ? 64 VAL A HB     1  
ATOM 1156  H HG11   . VAL A 1 66 ? 31.880 36.866 13.475 1.00 0.00 ? 64 VAL A HG11   1  
ATOM 1157  H HG12   . VAL A 1 66 ? 32.116 38.626 13.535 1.00 0.00 ? 64 VAL A HG12   1  
ATOM 1158  H HG13   . VAL A 1 66 ? 31.726 37.862 12.002 1.00 0.00 ? 64 VAL A HG13   1  
ATOM 1159  H HG21   . VAL A 1 66 ? 34.201 36.762 14.610 1.00 0.00 ? 64 VAL A HG21   1  
ATOM 1160  H HG22   . VAL A 1 66 ? 35.566 37.602 13.836 1.00 0.00 ? 64 VAL A HG22   1  
ATOM 1161  H HG23   . VAL A 1 66 ? 34.236 38.535 14.504 1.00 0.00 ? 64 VAL A HG23   1  
ATOM 1162  N N      . THR A 1 67 ? 32.067 35.605 10.560 1.00 0.00 ? 65 THR A N      1  
ATOM 1163  C CA     . THR A 1 67 ? 31.117 35.651 9.422  1.00 0.00 ? 65 THR A CA     1  
ATOM 1164  C C      . THR A 1 67 ? 29.865 36.478 9.725  1.00 0.00 ? 65 THR A C      1  
ATOM 1165  O O      . THR A 1 67 ? 29.351 37.122 8.811  1.00 0.00 ? 65 THR A O      1  
ATOM 1166  C CB     . THR A 1 67 ? 30.704 34.252 8.939  1.00 0.00 ? 65 THR A CB     1  
ATOM 1167  O OG1    . THR A 1 67 ? 30.313 33.417 10.006 1.00 0.00 ? 65 THR A OG1    1  
ATOM 1168  C CG2    . THR A 1 67 ? 31.853 33.551 8.228  1.00 0.00 ? 65 THR A CG2    1  
ATOM 1169  H H      . THR A 1 67 ? 31.715 35.212 11.430 1.00 0.00 ? 65 THR A H      1  
ATOM 1170  H HA     . THR A 1 67 ? 31.594 36.147 8.579  1.00 0.00 ? 65 THR A HA     1  
ATOM 1171  H HB     . THR A 1 67 ? 29.874 34.343 8.237  1.00 0.00 ? 65 THR A HB     1  
ATOM 1172  H HG1    . THR A 1 67 ? 29.353 33.258 9.883  1.00 0.00 ? 65 THR A HG1    1  
ATOM 1173  H HG21   . THR A 1 67 ? 32.124 34.115 7.339  1.00 0.00 ? 65 THR A HG21   1  
ATOM 1174  H HG22   . THR A 1 67 ? 32.711 33.475 8.892  1.00 0.00 ? 65 THR A HG22   1  
ATOM 1175  H HG23   . THR A 1 67 ? 31.543 32.554 7.922  1.00 0.00 ? 65 THR A HG23   1  
ATOM 1176  N N      . ASP A 1 68 ? 29.430 36.520 10.989 1.00 0.00 ? 66 ASP A N      1  
ATOM 1177  C CA     . ASP A 1 68 ? 28.327 37.341 11.531 1.00 0.00 ? 66 ASP A CA     1  
ATOM 1178  C C      . ASP A 1 68 ? 27.055 37.353 10.666 1.00 0.00 ? 66 ASP A C      1  
ATOM 1179  O O      . ASP A 1 68 ? 26.312 36.352 10.719 1.00 0.00 ? 66 ASP A O      1  
ATOM 1180  C CB     . ASP A 1 68 ? 28.851 38.739 11.921 1.00 0.00 ? 66 ASP A CB     1  
ATOM 1181  C CG     . ASP A 1 68 ? 27.831 39.649 12.617 1.00 0.00 ? 66 ASP A CG     1  
ATOM 1182  O OD1    . ASP A 1 68 ? 26.853 39.157 13.245 1.00 0.00 ? 66 ASP A OD1    1  
ATOM 1183  O OD2    . ASP A 1 68 ? 28.031 40.889 12.594 1.00 0.00 ? 66 ASP A OD2    1  
ATOM 1184  O OXT    . ASP A 1 68 ? 26.805 38.352 9.952  1.00 0.00 ? 66 ASP A OXT    1  
ATOM 1185  H H      . ASP A 1 68 ? 29.912 35.925 11.656 1.00 0.00 ? 66 ASP A H      1  
ATOM 1186  H HA     . ASP A 1 68 ? 28.032 36.875 12.466 1.00 0.00 ? 66 ASP A HA     1  
ATOM 1187  H HB2    . ASP A 1 68 ? 29.679 38.611 12.615 1.00 0.00 ? 66 ASP A HB2    1  
ATOM 1188  H HB3    . ASP A 1 68 ? 29.237 39.240 11.032 1.00 0.00 ? 66 ASP A HB3    1  
ATOM 1189  O "O5'"  . DG  B 2 1  ? 52.147 12.927 28.726 1.00 0.00 ? 67 DG  B "O5'"  1  
ATOM 1190  C "C5'"  . DG  B 2 1  ? 52.682 12.271 27.581 1.00 0.00 ? 67 DG  B "C5'"  1  
ATOM 1191  C "C4'"  . DG  B 2 1  ? 51.853 12.461 26.294 1.00 0.00 ? 67 DG  B "C4'"  1  
ATOM 1192  O "O4'"  . DG  B 2 1  ? 50.590 11.812 26.415 1.00 0.00 ? 67 DG  B "O4'"  1  
ATOM 1193  C "C3'"  . DG  B 2 1  ? 51.589 13.933 25.940 1.00 0.00 ? 67 DG  B "C3'"  1  
ATOM 1194  O "O3'"  . DG  B 2 1  ? 51.726 14.118 24.536 1.00 0.00 ? 67 DG  B "O3'"  1  
ATOM 1195  C "C2'"  . DG  B 2 1  ? 50.151 14.129 26.411 1.00 0.00 ? 67 DG  B "C2'"  1  
ATOM 1196  C "C1'"  . DG  B 2 1  ? 49.554 12.746 26.158 1.00 0.00 ? 67 DG  B "C1'"  1  
ATOM 1197  N N9     . DG  B 2 1  ? 48.397 12.420 27.024 1.00 0.00 ? 67 DG  B N9     1  
ATOM 1198  C C8     . DG  B 2 1  ? 48.282 12.545 28.389 1.00 0.00 ? 67 DG  B C8     1  
ATOM 1199  N N7     . DG  B 2 1  ? 47.173 12.059 28.876 1.00 0.00 ? 67 DG  B N7     1  
ATOM 1200  C C5     . DG  B 2 1  ? 46.484 11.599 27.750 1.00 0.00 ? 67 DG  B C5     1  
ATOM 1201  C C6     . DG  B 2 1  ? 45.204 10.957 27.619 1.00 0.00 ? 67 DG  B C6     1  
ATOM 1202  O O6     . DG  B 2 1  ? 44.420 10.587 28.496 1.00 0.00 ? 67 DG  B O6     1  
ATOM 1203  N N1     . DG  B 2 1  ? 44.842 10.737 26.308 1.00 0.00 ? 67 DG  B N1     1  
ATOM 1204  C C2     . DG  B 2 1  ? 45.639 11.008 25.250 1.00 0.00 ? 67 DG  B C2     1  
ATOM 1205  N N2     . DG  B 2 1  ? 45.175 10.706 24.070 1.00 0.00 ? 67 DG  B N2     1  
ATOM 1206  N N3     . DG  B 2 1  ? 46.862 11.534 25.319 1.00 0.00 ? 67 DG  B N3     1  
ATOM 1207  C C4     . DG  B 2 1  ? 47.219 11.837 26.607 1.00 0.00 ? 67 DG  B C4     1  
ATOM 1208  H "H5'"  . DG  B 2 1  ? 52.760 11.201 27.782 1.00 0.00 ? 67 DG  B "H5'"  1  
ATOM 1209  H "H5''" . DG  B 2 1  ? 53.690 12.647 27.397 1.00 0.00 ? 67 DG  B "H5''" 1  
ATOM 1210  H "H4'"  . DG  B 2 1  ? 52.406 11.999 25.477 1.00 0.00 ? 67 DG  B "H4'"  1  
ATOM 1211  H "H3'"  . DG  B 2 1  ? 52.275 14.587 26.480 1.00 0.00 ? 67 DG  B "H3'"  1  
ATOM 1212  H "H2'"  . DG  B 2 1  ? 50.139 14.374 27.472 1.00 0.00 ? 67 DG  B "H2'"  1  
ATOM 1213  H "H2''" . DG  B 2 1  ? 49.633 14.898 25.844 1.00 0.00 ? 67 DG  B "H2''" 1  
ATOM 1214  H "H1'"  . DG  B 2 1  ? 49.261 12.685 25.106 1.00 0.00 ? 67 DG  B "H1'"  1  
ATOM 1215  H H8     . DG  B 2 1  ? 49.060 12.978 29.009 1.00 0.00 ? 67 DG  B H8     1  
ATOM 1216  H H1     . DG  B 2 1  ? 43.931 10.341 26.135 1.00 0.00 ? 67 DG  B H1     1  
ATOM 1217  H H21    . DG  B 2 1  ? 45.748 10.880 23.265 1.00 0.00 ? 67 DG  B H21    1  
ATOM 1218  H H22    . DG  B 2 1  ? 44.222 10.366 23.980 1.00 0.00 ? 67 DG  B H22    1  
ATOM 1219  H "HO5'" . DG  B 2 1  ? 52.716 12.704 29.505 1.00 0.00 ? 67 DG  B "HO5'" 1  
ATOM 1220  P P      . DC  B 2 2  ? 51.776 15.568 23.855 1.00 0.00 ? 68 DC  B P      1  
ATOM 1221  O OP1    . DC  B 2 2  ? 52.505 15.399 22.581 1.00 0.00 ? 68 DC  B OP1    1  
ATOM 1222  O OP2    . DC  B 2 2  ? 52.285 16.550 24.834 1.00 0.00 ? 68 DC  B OP2    1  
ATOM 1223  O "O5'"  . DC  B 2 2  ? 50.249 15.949 23.546 1.00 0.00 ? 68 DC  B "O5'"  1  
ATOM 1224  C "C5'"  . DC  B 2 2  ? 49.619 15.516 22.343 1.00 0.00 ? 68 DC  B "C5'"  1  
ATOM 1225  C "C4'"  . DC  B 2 2  ? 48.107 15.767 22.269 1.00 0.00 ? 68 DC  B "C4'"  1  
ATOM 1226  O "O4'"  . DC  B 2 2  ? 47.414 14.974 23.228 1.00 0.00 ? 68 DC  B "O4'"  1  
ATOM 1227  C "C3'"  . DC  B 2 2  ? 47.690 17.237 22.456 1.00 0.00 ? 68 DC  B "C3'"  1  
ATOM 1228  O "O3'"  . DC  B 2 2  ? 47.204 17.753 21.221 1.00 0.00 ? 68 DC  B "O3'"  1  
ATOM 1229  C "C2'"  . DC  B 2 2  ? 46.618 17.150 23.546 1.00 0.00 ? 68 DC  B "C2'"  1  
ATOM 1230  C "C1'"  . DC  B 2 2  ? 46.244 15.668 23.609 1.00 0.00 ? 68 DC  B "C1'"  1  
ATOM 1231  N N1     . DC  B 2 2  ? 45.803 15.222 24.963 1.00 0.00 ? 68 DC  B N1     1  
ATOM 1232  C C2     . DC  B 2 2  ? 44.561 14.590 25.109 1.00 0.00 ? 68 DC  B C2     1  
ATOM 1233  O O2     . DC  B 2 2  ? 43.852 14.314 24.139 1.00 0.00 ? 68 DC  B O2     1  
ATOM 1234  N N3     . DC  B 2 2  ? 44.093 14.255 26.333 1.00 0.00 ? 68 DC  B N3     1  
ATOM 1235  C C4     . DC  B 2 2  ? 44.838 14.520 27.388 1.00 0.00 ? 68 DC  B C4     1  
ATOM 1236  N N4     . DC  B 2 2  ? 44.353 14.151 28.535 1.00 0.00 ? 68 DC  B N4     1  
ATOM 1237  C C5     . DC  B 2 2  ? 46.127 15.110 27.305 1.00 0.00 ? 68 DC  B C5     1  
ATOM 1238  C C6     . DC  B 2 2  ? 46.583 15.449 26.073 1.00 0.00 ? 68 DC  B C6     1  
ATOM 1239  H "H5'"  . DC  B 2 2  ? 49.791 14.446 22.212 1.00 0.00 ? 68 DC  B "H5'"  1  
ATOM 1240  H "H5''" . DC  B 2 2  ? 50.075 16.040 21.505 1.00 0.00 ? 68 DC  B "H5''" 1  
ATOM 1241  H "H4'"  . DC  B 2 2  ? 47.775 15.460 21.274 1.00 0.00 ? 68 DC  B "H4'"  1  
ATOM 1242  H "H3'"  . DC  B 2 2  ? 48.535 17.835 22.803 1.00 0.00 ? 68 DC  B "H3'"  1  
ATOM 1243  H "H2'"  . DC  B 2 2  ? 47.045 17.499 24.483 1.00 0.00 ? 68 DC  B "H2'"  1  
ATOM 1244  H "H2''" . DC  B 2 2  ? 45.738 17.743 23.317 1.00 0.00 ? 68 DC  B "H2''" 1  
ATOM 1245  H "H1'"  . DC  B 2 2  ? 45.454 15.492 22.869 1.00 0.00 ? 68 DC  B "H1'"  1  
ATOM 1246  H H41    . DC  B 2 2  ? 43.430 13.734 28.560 1.00 0.00 ? 68 DC  B H41    1  
ATOM 1247  H H42    . DC  B 2 2  ? 44.876 14.288 29.380 1.00 0.00 ? 68 DC  B H42    1  
ATOM 1248  H H5     . DC  B 2 2  ? 46.734 15.293 28.179 1.00 0.00 ? 68 DC  B H5     1  
ATOM 1249  H H6     . DC  B 2 2  ? 47.559 15.908 25.953 1.00 0.00 ? 68 DC  B H6     1  
ATOM 1250  P P      . DT  B 2 3  ? 46.588 19.226 21.050 1.00 0.00 ? 69 DT  B P      1  
ATOM 1251  O OP1    . DT  B 2 3  ? 46.806 19.644 19.654 1.00 0.00 ? 69 DT  B OP1    1  
ATOM 1252  O OP2    . DT  B 2 3  ? 47.067 20.106 22.142 1.00 0.00 ? 69 DT  B OP2    1  
ATOM 1253  O "O5'"  . DT  B 2 3  ? 45.026 18.957 21.230 1.00 0.00 ? 69 DT  B "O5'"  1  
ATOM 1254  C "C5'"  . DT  B 2 3  ? 44.359 18.073 20.332 1.00 0.00 ? 69 DT  B "C5'"  1  
ATOM 1255  C "C4'"  . DT  B 2 3  ? 42.848 17.993 20.556 1.00 0.00 ? 69 DT  B "C4'"  1  
ATOM 1256  O "O4'"  . DT  B 2 3  ? 42.590 17.429 21.832 1.00 0.00 ? 69 DT  B "O4'"  1  
ATOM 1257  C "C3'"  . DT  B 2 3  ? 42.172 19.367 20.452 1.00 0.00 ? 69 DT  B "C3'"  1  
ATOM 1258  O "O3'"  . DT  B 2 3  ? 41.107 19.300 19.502 1.00 0.00 ? 69 DT  B "O3'"  1  
ATOM 1259  C "C2'"  . DT  B 2 3  ? 41.745 19.613 21.902 1.00 0.00 ? 69 DT  B "C2'"  1  
ATOM 1260  C "C1'"  . DT  B 2 3  ? 41.625 18.210 22.503 1.00 0.00 ? 69 DT  B "C1'"  1  
ATOM 1261  N N1     . DT  B 2 3  ? 41.928 18.128 23.959 1.00 0.00 ? 69 DT  B N1     1  
ATOM 1262  C C2     . DT  B 2 3  ? 40.986 17.543 24.819 1.00 0.00 ? 69 DT  B C2     1  
ATOM 1263  O O2     . DT  B 2 3  ? 39.824 17.284 24.495 1.00 0.00 ? 69 DT  B O2     1  
ATOM 1264  N N3     . DT  B 2 3  ? 41.407 17.278 26.105 1.00 0.00 ? 69 DT  B N3     1  
ATOM 1265  C C4     . DT  B 2 3  ? 42.636 17.602 26.635 1.00 0.00 ? 69 DT  B C4     1  
ATOM 1266  O O4     . DT  B 2 3  ? 42.885 17.292 27.799 1.00 0.00 ? 69 DT  B O4     1  
ATOM 1267  C C5     . DT  B 2 3  ? 43.535 18.301 25.717 1.00 0.00 ? 69 DT  B C5     1  
ATOM 1268  C C7     . DT  B 2 3  ? 44.892 18.788 26.196 1.00 0.00 ? 69 DT  B C7     1  
ATOM 1269  C C6     . DT  B 2 3  ? 43.165 18.528 24.429 1.00 0.00 ? 69 DT  B C6     1  
ATOM 1270  H "H5'"  . DT  B 2 3  ? 44.771 17.071 20.446 1.00 0.00 ? 69 DT  B "H5'"  1  
ATOM 1271  H "H5''" . DT  B 2 3  ? 44.533 18.400 19.306 1.00 0.00 ? 69 DT  B "H5''" 1  
ATOM 1272  H "H4'"  . DT  B 2 3  ? 42.418 17.332 19.805 1.00 0.00 ? 69 DT  B "H4'"  1  
ATOM 1273  H "H3'"  . DT  B 2 3  ? 42.895 20.124 20.142 1.00 0.00 ? 69 DT  B "H3'"  1  
ATOM 1274  H "H2'"  . DT  B 2 3  ? 42.524 20.190 22.399 1.00 0.00 ? 69 DT  B "H2'"  1  
ATOM 1275  H "H2''" . DT  B 2 3  ? 40.804 20.144 21.979 1.00 0.00 ? 69 DT  B "H2''" 1  
ATOM 1276  H "H1'"  . DT  B 2 3  ? 40.627 17.817 22.284 1.00 0.00 ? 69 DT  B "H1'"  1  
ATOM 1277  H H3     . DT  B 2 3  ? 40.739 16.849 26.732 1.00 0.00 ? 69 DT  B H3     1  
ATOM 1278  H H71    . DT  B 2 3  ? 45.482 17.945 26.550 1.00 0.00 ? 69 DT  B H71    1  
ATOM 1279  H H72    . DT  B 2 3  ? 45.431 19.309 25.404 1.00 0.00 ? 69 DT  B H72    1  
ATOM 1280  H H73    . DT  B 2 3  ? 44.753 19.473 27.033 1.00 0.00 ? 69 DT  B H73    1  
ATOM 1281  H H6     . DT  B 2 3  ? 43.854 19.010 23.745 1.00 0.00 ? 69 DT  B H6     1  
ATOM 1282  P P      . DC  B 2 4  ? 40.265 20.589 19.044 1.00 0.00 ? 70 DC  B P      1  
ATOM 1283  O OP1    . DC  B 2 4  ? 39.454 20.248 17.859 1.00 0.00 ? 70 DC  B OP1    1  
ATOM 1284  O OP2    . DC  B 2 4  ? 41.172 21.756 18.979 1.00 0.00 ? 70 DC  B OP2    1  
ATOM 1285  O "O5'"  . DC  B 2 4  ? 39.258 20.829 20.239 1.00 0.00 ? 70 DC  B "O5'"  1  
ATOM 1286  C "C5'"  . DC  B 2 4  ? 38.214 19.905 20.507 1.00 0.00 ? 70 DC  B "C5'"  1  
ATOM 1287  C "C4'"  . DC  B 2 4  ? 37.477 20.267 21.796 1.00 0.00 ? 70 DC  B "C4'"  1  
ATOM 1288  O "O4'"  . DC  B 2 4  ? 38.285 19.932 22.919 1.00 0.00 ? 70 DC  B "O4'"  1  
ATOM 1289  C "C3'"  . DC  B 2 4  ? 37.123 21.763 21.885 1.00 0.00 ? 70 DC  B "C3'"  1  
ATOM 1290  O "O3'"  . DC  B 2 4  ? 35.740 21.933 22.173 1.00 0.00 ? 70 DC  B "O3'"  1  
ATOM 1291  C "C2'"  . DC  B 2 4  ? 38.020 22.253 23.014 1.00 0.00 ? 70 DC  B "C2'"  1  
ATOM 1292  C "C1'"  . DC  B 2 4  ? 38.185 20.990 23.852 1.00 0.00 ? 70 DC  B "C1'"  1  
ATOM 1293  N N1     . DC  B 2 4  ? 39.336 20.949 24.802 1.00 0.00 ? 70 DC  B N1     1  
ATOM 1294  C C2     . DC  B 2 4  ? 39.144 20.287 26.019 1.00 0.00 ? 70 DC  B C2     1  
ATOM 1295  O O2     . DC  B 2 4  ? 38.076 19.731 26.278 1.00 0.00 ? 70 DC  B O2     1  
ATOM 1296  N N3     . DC  B 2 4  ? 40.116 20.239 26.955 1.00 0.00 ? 70 DC  B N3     1  
ATOM 1297  C C4     . DC  B 2 4  ? 41.269 20.815 26.694 1.00 0.00 ? 70 DC  B C4     1  
ATOM 1298  N N4     . DC  B 2 4  ? 42.167 20.746 27.627 1.00 0.00 ? 70 DC  B N4     1  
ATOM 1299  C C5     . DC  B 2 4  ? 41.550 21.461 25.460 1.00 0.00 ? 70 DC  B C5     1  
ATOM 1300  C C6     . DC  B 2 4  ? 40.563 21.514 24.531 1.00 0.00 ? 70 DC  B C6     1  
ATOM 1301  H "H5'"  . DC  B 2 4  ? 38.623 18.899 20.608 1.00 0.00 ? 70 DC  B "H5'"  1  
ATOM 1302  H "H5''" . DC  B 2 4  ? 37.501 19.902 19.683 1.00 0.00 ? 70 DC  B "H5''" 1  
ATOM 1303  H "H4'"  . DC  B 2 4  ? 36.560 19.683 21.830 1.00 0.00 ? 70 DC  B "H4'"  1  
ATOM 1304  H "H3'"  . DC  B 2 4  ? 37.376 22.272 20.951 1.00 0.00 ? 70 DC  B "H3'"  1  
ATOM 1305  H "H2'"  . DC  B 2 4  ? 38.962 22.589 22.590 1.00 0.00 ? 70 DC  B "H2'"  1  
ATOM 1306  H "H2''" . DC  B 2 4  ? 37.553 23.052 23.597 1.00 0.00 ? 70 DC  B "H2''" 1  
ATOM 1307  H "H1'"  . DC  B 2 4  ? 37.253 20.866 24.413 1.00 0.00 ? 70 DC  B "H1'"  1  
ATOM 1308  H H41    . DC  B 2 4  ? 43.059 21.216 27.486 1.00 0.00 ? 70 DC  B H41    1  
ATOM 1309  H H42    . DC  B 2 4  ? 41.957 20.243 28.480 1.00 0.00 ? 70 DC  B H42    1  
ATOM 1310  H H5     . DC  B 2 4  ? 42.516 21.899 25.261 1.00 0.00 ? 70 DC  B H5     1  
ATOM 1311  H H6     . DC  B 2 4  ? 40.744 21.986 23.572 1.00 0.00 ? 70 DC  B H6     1  
ATOM 1312  P P      . DT  B 2 5  ? 35.028 23.365 22.083 1.00 0.00 ? 71 DT  B P      1  
ATOM 1313  O OP1    . DT  B 2 5  ? 33.666 23.167 21.540 1.00 0.00 ? 71 DT  B OP1    1  
ATOM 1314  O OP2    . DT  B 2 5  ? 35.932 24.329 21.422 1.00 0.00 ? 71 DT  B OP2    1  
ATOM 1315  O "O5'"  . DT  B 2 5  ? 34.900 23.797 23.605 1.00 0.00 ? 71 DT  B "O5'"  1  
ATOM 1316  C "C5'"  . DT  B 2 5  ? 33.944 23.215 24.484 1.00 0.00 ? 71 DT  B "C5'"  1  
ATOM 1317  C "C4'"  . DT  B 2 5  ? 34.121 23.723 25.920 1.00 0.00 ? 71 DT  B "C4'"  1  
ATOM 1318  O "O4'"  . DT  B 2 5  ? 35.374 23.257 26.423 1.00 0.00 ? 71 DT  B "O4'"  1  
ATOM 1319  C "C3'"  . DT  B 2 5  ? 34.140 25.261 25.985 1.00 0.00 ? 71 DT  B "C3'"  1  
ATOM 1320  O "O3'"  . DT  B 2 5  ? 33.548 25.735 27.177 1.00 0.00 ? 71 DT  B "O3'"  1  
ATOM 1321  C "C2'"  . DT  B 2 5  ? 35.620 25.558 26.083 1.00 0.00 ? 71 DT  B "C2'"  1  
ATOM 1322  C "C1'"  . DT  B 2 5  ? 36.060 24.375 26.946 1.00 0.00 ? 71 DT  B "C1'"  1  
ATOM 1323  N N1     . DT  B 2 5  ? 37.526 24.133 27.039 1.00 0.00 ? 71 DT  B N1     1  
ATOM 1324  C C2     . DT  B 2 5  ? 37.987 23.567 28.235 1.00 0.00 ? 71 DT  B C2     1  
ATOM 1325  O O2     . DT  B 2 5  ? 37.240 23.123 29.108 1.00 0.00 ? 71 DT  B O2     1  
ATOM 1326  N N3     . DT  B 2 5  ? 39.347 23.530 28.418 1.00 0.00 ? 71 DT  B N3     1  
ATOM 1327  C C4     . DT  B 2 5  ? 40.295 24.004 27.543 1.00 0.00 ? 71 DT  B C4     1  
ATOM 1328  O O4     . DT  B 2 5  ? 41.478 23.952 27.871 1.00 0.00 ? 71 DT  B O4     1  
ATOM 1329  C C5     . DT  B 2 5  ? 39.755 24.514 26.282 1.00 0.00 ? 71 DT  B C5     1  
ATOM 1330  C C7     . DT  B 2 5  ? 40.684 25.007 25.189 1.00 0.00 ? 71 DT  B C7     1  
ATOM 1331  C C6     . DT  B 2 5  ? 38.414 24.552 26.065 1.00 0.00 ? 71 DT  B C6     1  
ATOM 1332  H "H5'"  . DT  B 2 5  ? 34.043 22.130 24.488 1.00 0.00 ? 71 DT  B "H5'"  1  
ATOM 1333  H "H5''" . DT  B 2 5  ? 32.940 23.467 24.152 1.00 0.00 ? 71 DT  B "H5''" 1  
ATOM 1334  H "H4'"  . DT  B 2 5  ? 33.304 23.346 26.537 1.00 0.00 ? 71 DT  B "H4'"  1  
ATOM 1335  H "H3'"  . DT  B 2 5  ? 33.709 25.723 25.093 1.00 0.00 ? 71 DT  B "H3'"  1  
ATOM 1336  H "H2'"  . DT  B 2 5  ? 36.054 25.530 25.087 1.00 0.00 ? 71 DT  B "H2'"  1  
ATOM 1337  H "H2''" . DT  B 2 5  ? 35.794 26.515 26.572 1.00 0.00 ? 71 DT  B "H2''" 1  
ATOM 1338  H "H1'"  . DT  B 2 5  ? 35.672 24.558 27.954 1.00 0.00 ? 71 DT  B "H1'"  1  
ATOM 1339  H H3     . DT  B 2 5  ? 39.679 23.151 29.295 1.00 0.00 ? 71 DT  B H3     1  
ATOM 1340  H H71    . DT  B 2 5  ? 41.436 24.247 24.985 1.00 0.00 ? 71 DT  B H71    1  
ATOM 1341  H H72    . DT  B 2 5  ? 40.139 25.226 24.271 1.00 0.00 ? 71 DT  B H72    1  
ATOM 1342  H H73    . DT  B 2 5  ? 41.193 25.907 25.527 1.00 0.00 ? 71 DT  B H73    1  
ATOM 1343  H H6     . DT  B 2 5  ? 38.047 24.916 25.114 1.00 0.00 ? 71 DT  B H6     1  
ATOM 1344  P P      . DA  B 2 6  ? 32.243 26.640 27.159 1.00 0.00 ? 72 DA  B P      1  
ATOM 1345  O OP1    . DA  B 2 6  ? 31.179 25.935 26.402 1.00 0.00 ? 72 DA  B OP1    1  
ATOM 1346  O OP2    . DA  B 2 6  ? 32.636 27.994 26.730 1.00 0.00 ? 72 DA  B OP2    1  
ATOM 1347  O "O5'"  . DA  B 2 6  ? 31.873 26.684 28.711 1.00 0.00 ? 72 DA  B "O5'"  1  
ATOM 1348  C "C5'"  . DA  B 2 6  ? 31.475 25.502 29.383 1.00 0.00 ? 72 DA  B "C5'"  1  
ATOM 1349  C "C4'"  . DA  B 2 6  ? 32.206 25.259 30.712 1.00 0.00 ? 72 DA  B "C4'"  1  
ATOM 1350  O "O4'"  . DA  B 2 6  ? 33.593 25.037 30.487 1.00 0.00 ? 72 DA  B "O4'"  1  
ATOM 1351  C "C3'"  . DA  B 2 6  ? 32.086 26.340 31.802 1.00 0.00 ? 72 DA  B "C3'"  1  
ATOM 1352  O "O3'"  . DA  B 2 6  ? 31.938 25.655 33.047 1.00 0.00 ? 72 DA  B "O3'"  1  
ATOM 1353  C "C2'"  . DA  B 2 6  ? 33.434 27.037 31.687 1.00 0.00 ? 72 DA  B "C2'"  1  
ATOM 1354  C "C1'"  . DA  B 2 6  ? 34.331 25.843 31.388 1.00 0.00 ? 72 DA  B "C1'"  1  
ATOM 1355  N N9     . DA  B 2 6  ? 35.641 26.189 30.802 1.00 0.00 ? 72 DA  B N9     1  
ATOM 1356  C C8     . DA  B 2 6  ? 35.928 26.677 29.552 1.00 0.00 ? 72 DA  B C8     1  
ATOM 1357  N N7     . DA  B 2 6  ? 37.211 26.724 29.271 1.00 0.00 ? 72 DA  B N7     1  
ATOM 1358  C C5     . DA  B 2 6  ? 37.806 26.273 30.465 1.00 0.00 ? 72 DA  B C5     1  
ATOM 1359  C C6     . DA  B 2 6  ? 39.131 26.052 30.922 1.00 0.00 ? 72 DA  B C6     1  
ATOM 1360  N N6     . DA  B 2 6  ? 40.236 26.217 30.222 1.00 0.00 ? 72 DA  B N6     1  
ATOM 1361  N N1     . DA  B 2 6  ? 39.373 25.629 32.160 1.00 0.00 ? 72 DA  B N1     1  
ATOM 1362  C C2     . DA  B 2 6  ? 38.342 25.390 32.958 1.00 0.00 ? 72 DA  B C2     1  
ATOM 1363  N N3     . DA  B 2 6  ? 37.053 25.514 32.671 1.00 0.00 ? 72 DA  B N3     1  
ATOM 1364  C C4     . DA  B 2 6  ? 36.854 25.969 31.403 1.00 0.00 ? 72 DA  B C4     1  
ATOM 1365  H "H5'"  . DA  B 2 6  ? 31.676 24.637 28.746 1.00 0.00 ? 72 DA  B "H5'"  1  
ATOM 1366  H "H5''" . DA  B 2 6  ? 30.402 25.538 29.553 1.00 0.00 ? 72 DA  B "H5''" 1  
ATOM 1367  H "H4'"  . DA  B 2 6  ? 31.789 24.345 31.111 1.00 0.00 ? 72 DA  B "H4'"  1  
ATOM 1368  H "H3'"  . DA  B 2 6  ? 31.264 27.030 31.613 1.00 0.00 ? 72 DA  B "H3'"  1  
ATOM 1369  H "H2'"  . DA  B 2 6  ? 33.431 27.741 30.854 1.00 0.00 ? 72 DA  B "H2'"  1  
ATOM 1370  H "H2''" . DA  B 2 6  ? 33.706 27.520 32.618 1.00 0.00 ? 72 DA  B "H2''" 1  
ATOM 1371  H "H1'"  . DA  B 2 6  ? 34.495 25.302 32.324 1.00 0.00 ? 72 DA  B "H1'"  1  
ATOM 1372  H H8     . DA  B 2 6  ? 35.144 26.948 28.853 1.00 0.00 ? 72 DA  B H8     1  
ATOM 1373  H H61    . DA  B 2 6  ? 40.222 26.524 29.260 1.00 0.00 ? 72 DA  B H61    1  
ATOM 1374  H H62    . DA  B 2 6  ? 41.114 25.972 30.661 1.00 0.00 ? 72 DA  B H62    1  
ATOM 1375  H H2     . DA  B 2 6  ? 38.579 25.039 33.955 1.00 0.00 ? 72 DA  B H2     1  
ATOM 1376  P P      . DA  B 2 7  ? 31.504 26.350 34.433 1.00 0.00 ? 73 DA  B P      1  
ATOM 1377  O OP1    . DA  B 2 7  ? 30.821 25.281 35.198 1.00 0.00 ? 73 DA  B OP1    1  
ATOM 1378  O OP2    . DA  B 2 7  ? 30.752 27.593 34.184 1.00 0.00 ? 73 DA  B OP2    1  
ATOM 1379  O "O5'"  . DA  B 2 7  ? 32.826 26.755 35.240 1.00 0.00 ? 73 DA  B "O5'"  1  
ATOM 1380  C "C5'"  . DA  B 2 7  ? 33.405 25.877 36.198 1.00 0.00 ? 73 DA  B "C5'"  1  
ATOM 1381  C "C4'"  . DA  B 2 7  ? 34.486 26.527 37.072 1.00 0.00 ? 73 DA  B "C4'"  1  
ATOM 1382  O "O4'"  . DA  B 2 7  ? 35.651 26.783 36.301 1.00 0.00 ? 73 DA  B "O4'"  1  
ATOM 1383  C "C3'"  . DA  B 2 7  ? 34.051 27.822 37.775 1.00 0.00 ? 73 DA  B "C3'"  1  
ATOM 1384  O "O3'"  . DA  B 2 7  ? 34.503 27.766 39.130 1.00 0.00 ? 73 DA  B "O3'"  1  
ATOM 1385  C "C2'"  . DA  B 2 7  ? 34.696 28.877 36.876 1.00 0.00 ? 73 DA  B "C2'"  1  
ATOM 1386  C "C1'"  . DA  B 2 7  ? 35.918 28.174 36.271 1.00 0.00 ? 73 DA  B "C1'"  1  
ATOM 1387  N N9     . DA  B 2 7  ? 36.241 28.592 34.881 1.00 0.00 ? 73 DA  B N9     1  
ATOM 1388  C C8     . DA  B 2 7  ? 35.398 29.056 33.899 1.00 0.00 ? 73 DA  B C8     1  
ATOM 1389  N N7     . DA  B 2 7  ? 35.989 29.397 32.784 1.00 0.00 ? 73 DA  B N7     1  
ATOM 1390  C C5     . DA  B 2 7  ? 37.339 29.128 33.052 1.00 0.00 ? 73 DA  B C5     1  
ATOM 1391  C C6     . DA  B 2 7  ? 38.549 29.265 32.327 1.00 0.00 ? 73 DA  B C6     1  
ATOM 1392  N N6     . DA  B 2 7  ? 38.646 29.710 31.087 1.00 0.00 ? 73 DA  B N6     1  
ATOM 1393  N N1     . DA  B 2 7  ? 39.721 28.939 32.869 1.00 0.00 ? 73 DA  B N1     1  
ATOM 1394  C C2     . DA  B 2 7  ? 39.716 28.461 34.106 1.00 0.00 ? 73 DA  B C2     1  
ATOM 1395  N N3     . DA  B 2 7  ? 38.676 28.276 34.914 1.00 0.00 ? 73 DA  B N3     1  
ATOM 1396  C C4     . DA  B 2 7  ? 37.500 28.628 34.319 1.00 0.00 ? 73 DA  B C4     1  
ATOM 1397  H "H5'"  . DA  B 2 7  ? 33.843 25.022 35.681 1.00 0.00 ? 73 DA  B "H5'"  1  
ATOM 1398  H "H5''" . DA  B 2 7  ? 32.625 25.519 36.870 1.00 0.00 ? 73 DA  B "H5''" 1  
ATOM 1399  H "H4'"  . DA  B 2 7  ? 34.745 25.810 37.847 1.00 0.00 ? 73 DA  B "H4'"  1  
ATOM 1400  H "H3'"  . DA  B 2 7  ? 32.966 27.934 37.757 1.00 0.00 ? 73 DA  B "H3'"  1  
ATOM 1401  H "H2'"  . DA  B 2 7  ? 33.967 29.145 36.114 1.00 0.00 ? 73 DA  B "H2'"  1  
ATOM 1402  H "H2''" . DA  B 2 7  ? 34.985 29.777 37.410 1.00 0.00 ? 73 DA  B "H2''" 1  
ATOM 1403  H "H1'"  . DA  B 2 7  ? 36.782 28.369 36.910 1.00 0.00 ? 73 DA  B "H1'"  1  
ATOM 1404  H H8     . DA  B 2 7  ? 34.325 29.118 34.033 1.00 0.00 ? 73 DA  B H8     1  
ATOM 1405  H H61    . DA  B 2 7  ? 37.809 29.992 30.596 1.00 0.00 ? 73 DA  B H61    1  
ATOM 1406  H H62    . DA  B 2 7  ? 39.571 29.823 30.707 1.00 0.00 ? 73 DA  B H62    1  
ATOM 1407  H H2     . DA  B 2 7  ? 40.680 28.192 34.512 1.00 0.00 ? 73 DA  B H2     1  
ATOM 1408  P P      . DT  B 2 8  ? 34.492 29.019 40.133 1.00 0.00 ? 74 DT  B P      1  
ATOM 1409  O OP1    . DT  B 2 8  ? 34.603 28.517 41.521 1.00 0.00 ? 74 DT  B OP1    1  
ATOM 1410  O OP2    . DT  B 2 8  ? 33.389 29.935 39.782 1.00 0.00 ? 74 DT  B OP2    1  
ATOM 1411  O "O5'"  . DT  B 2 8  ? 35.874 29.721 39.764 1.00 0.00 ? 74 DT  B "O5'"  1  
ATOM 1412  C "C5'"  . DT  B 2 8  ? 37.091 29.022 39.997 1.00 0.00 ? 74 DT  B "C5'"  1  
ATOM 1413  C "C4'"  . DT  B 2 8  ? 38.323 29.714 39.418 1.00 0.00 ? 74 DT  B "C4'"  1  
ATOM 1414  O "O4'"  . DT  B 2 8  ? 38.224 29.906 38.017 1.00 0.00 ? 74 DT  B "O4'"  1  
ATOM 1415  C "C3'"  . DT  B 2 8  ? 38.620 31.084 40.032 1.00 0.00 ? 74 DT  B "C3'"  1  
ATOM 1416  O "O3'"  . DT  B 2 8  ? 39.760 30.919 40.856 1.00 0.00 ? 74 DT  B "O3'"  1  
ATOM 1417  C "C2'"  . DT  B 2 8  ? 38.898 31.963 38.813 1.00 0.00 ? 74 DT  B "C2'"  1  
ATOM 1418  C "C1'"  . DT  B 2 8  ? 39.132 30.941 37.709 1.00 0.00 ? 74 DT  B "C1'"  1  
ATOM 1419  N N1     . DT  B 2 8  ? 38.895 31.494 36.351 1.00 0.00 ? 74 DT  B N1     1  
ATOM 1420  C C2     . DT  B 2 8  ? 40.004 31.773 35.544 1.00 0.00 ? 74 DT  B C2     1  
ATOM 1421  O O2     . DT  B 2 8  ? 41.166 31.580 35.896 1.00 0.00 ? 74 DT  B O2     1  
ATOM 1422  N N3     . DT  B 2 8  ? 39.745 32.292 34.298 1.00 0.00 ? 74 DT  B N3     1  
ATOM 1423  C C4     . DT  B 2 8  ? 38.507 32.602 33.788 1.00 0.00 ? 74 DT  B C4     1  
ATOM 1424  O O4     . DT  B 2 8  ? 38.434 33.086 32.660 1.00 0.00 ? 74 DT  B O4     1  
ATOM 1425  C C5     . DT  B 2 8  ? 37.391 32.301 34.689 1.00 0.00 ? 74 DT  B C5     1  
ATOM 1426  C C7     . DT  B 2 8  ? 35.960 32.556 34.259 1.00 0.00 ? 74 DT  B C7     1  
ATOM 1427  C C6     . DT  B 2 8  ? 37.616 31.763 35.917 1.00 0.00 ? 74 DT  B C6     1  
ATOM 1428  H "H5'"  . DT  B 2 8  ? 37.032 28.027 39.553 1.00 0.00 ? 74 DT  B "H5'"  1  
ATOM 1429  H "H5''" . DT  B 2 8  ? 37.240 28.902 41.072 1.00 0.00 ? 74 DT  B "H5''" 1  
ATOM 1430  H "H4'"  . DT  B 2 8  ? 39.183 29.070 39.612 1.00 0.00 ? 74 DT  B "H4'"  1  
ATOM 1431  H "H3'"  . DT  B 2 8  ? 37.767 31.460 40.602 1.00 0.00 ? 74 DT  B "H3'"  1  
ATOM 1432  H "H2'"  . DT  B 2 8  ? 38.026 32.579 38.596 1.00 0.00 ? 74 DT  B "H2'"  1  
ATOM 1433  H "H2''" . DT  B 2 8  ? 39.776 32.586 38.948 1.00 0.00 ? 74 DT  B "H2''" 1  
ATOM 1434  H "H1'"  . DT  B 2 8  ? 40.155 30.564 37.795 1.00 0.00 ? 74 DT  B "H1'"  1  
ATOM 1435  H H3     . DT  B 2 8  ? 40.544 32.490 33.712 1.00 0.00 ? 74 DT  B H3     1  
ATOM 1436  H H71    . DT  B 2 8  ? 35.759 33.624 34.322 1.00 0.00 ? 74 DT  B H71    1  
ATOM 1437  H H72    . DT  B 2 8  ? 35.823 32.228 33.227 1.00 0.00 ? 74 DT  B H72    1  
ATOM 1438  H H73    . DT  B 2 8  ? 35.264 32.017 34.901 1.00 0.00 ? 74 DT  B H73    1  
ATOM 1439  H H6     . DT  B 2 8  ? 36.788 31.542 36.579 1.00 0.00 ? 74 DT  B H6     1  
ATOM 1440  P P      . DC  B 2 9  ? 40.385 32.082 41.740 1.00 0.00 ? 75 DC  B P      1  
ATOM 1441  O OP1    . DC  B 2 9  ? 40.767 31.470 43.035 1.00 0.00 ? 75 DC  B OP1    1  
ATOM 1442  O OP2    . DC  B 2 9  ? 39.462 33.240 41.745 1.00 0.00 ? 75 DC  B OP2    1  
ATOM 1443  O "O5'"  . DC  B 2 9  ? 41.695 32.505 40.939 1.00 0.00 ? 75 DC  B "O5'"  1  
ATOM 1444  C "C5'"  . DC  B 2 9  ? 42.780 31.603 40.751 1.00 0.00 ? 75 DC  B "C5'"  1  
ATOM 1445  C "C4'"  . DC  B 2 9  ? 44.019 32.284 40.148 1.00 0.00 ? 75 DC  B "C4'"  1  
ATOM 1446  O "O4'"  . DC  B 2 9  ? 43.795 32.611 38.779 1.00 0.00 ? 75 DC  B "O4'"  1  
ATOM 1447  C "C3'"  . DC  B 2 9  ? 44.403 33.568 40.902 1.00 0.00 ? 75 DC  B "C3'"  1  
ATOM 1448  O "O3'"  . DC  B 2 9  ? 45.807 33.600 41.143 1.00 0.00 ? 75 DC  B "O3'"  1  
ATOM 1449  C "C2'"  . DC  B 2 9  ? 43.914 34.669 39.967 1.00 0.00 ? 75 DC  B "C2'"  1  
ATOM 1450  C "C1'"  . DC  B 2 9  ? 43.941 34.010 38.585 1.00 0.00 ? 75 DC  B "C1'"  1  
ATOM 1451  N N1     . DC  B 2 9  ? 42.870 34.480 37.658 1.00 0.00 ? 75 DC  B N1     1  
ATOM 1452  C C2     . DC  B 2 9  ? 43.206 34.820 36.341 1.00 0.00 ? 75 DC  B C2     1  
ATOM 1453  O O2     . DC  B 2 9  ? 44.373 34.818 35.945 1.00 0.00 ? 75 DC  B O2     1  
ATOM 1454  N N3     . DC  B 2 9  ? 42.258 35.153 35.437 1.00 0.00 ? 75 DC  B N3     1  
ATOM 1455  C C4     . DC  B 2 9  ? 41.006 35.182 35.836 1.00 0.00 ? 75 DC  B C4     1  
ATOM 1456  N N4     . DC  B 2 9  ? 40.126 35.487 34.934 1.00 0.00 ? 75 DC  B N4     1  
ATOM 1457  C C5     . DC  B 2 9  ? 40.591 34.870 37.155 1.00 0.00 ? 75 DC  B C5     1  
ATOM 1458  C C6     . DC  B 2 9  ? 41.551 34.519 38.045 1.00 0.00 ? 75 DC  B C6     1  
ATOM 1459  H "H5'"  . DC  B 2 9  ? 42.469 30.786 40.098 1.00 0.00 ? 75 DC  B "H5'"  1  
ATOM 1460  H "H5''" . DC  B 2 9  ? 43.061 31.172 41.712 1.00 0.00 ? 75 DC  B "H5''" 1  
ATOM 1461  H "H4'"  . DC  B 2 9  ? 44.848 31.577 40.211 1.00 0.00 ? 75 DC  B "H4'"  1  
ATOM 1462  H "H3'"  . DC  B 2 9  ? 43.865 33.617 41.851 1.00 0.00 ? 75 DC  B "H3'"  1  
ATOM 1463  H "H2'"  . DC  B 2 9  ? 42.911 34.964 40.269 1.00 0.00 ? 75 DC  B "H2'"  1  
ATOM 1464  H "H2''" . DC  B 2 9  ? 44.566 35.537 39.990 1.00 0.00 ? 75 DC  B "H2''" 1  
ATOM 1465  H "H1'"  . DC  B 2 9  ? 44.930 34.206 38.155 1.00 0.00 ? 75 DC  B "H1'"  1  
ATOM 1466  H H41    . DC  B 2 9  ? 39.167 35.622 35.223 1.00 0.00 ? 75 DC  B H41    1  
ATOM 1467  H H42    . DC  B 2 9  ? 40.459 35.680 33.999 1.00 0.00 ? 75 DC  B H42    1  
ATOM 1468  H H5     . DC  B 2 9  ? 39.557 34.899 37.458 1.00 0.00 ? 75 DC  B H5     1  
ATOM 1469  H H6     . DC  B 2 9  ? 41.283 34.249 39.061 1.00 0.00 ? 75 DC  B H6     1  
ATOM 1470  P P      . DC  B 2 10 ? 46.521 34.776 41.968 1.00 0.00 ? 76 DC  B P      1  
ATOM 1471  O OP1    . DC  B 2 10 ? 47.751 34.190 42.539 1.00 0.00 ? 76 DC  B OP1    1  
ATOM 1472  O OP2    . DC  B 2 10 ? 45.529 35.370 42.889 1.00 0.00 ? 76 DC  B OP2    1  
ATOM 1473  O "O5'"  . DC  B 2 10 ? 46.903 35.887 40.885 1.00 0.00 ? 76 DC  B "O5'"  1  
ATOM 1474  C "C5'"  . DC  B 2 10 ? 47.882 35.642 39.884 1.00 0.00 ? 76 DC  B "C5'"  1  
ATOM 1475  C "C4'"  . DC  B 2 10 ? 47.866 36.709 38.776 1.00 0.00 ? 76 DC  B "C4'"  1  
ATOM 1476  O "O4'"  . DC  B 2 10 ? 46.620 36.670 38.087 1.00 0.00 ? 76 DC  B "O4'"  1  
ATOM 1477  C "C3'"  . DC  B 2 10 ? 48.091 38.159 39.258 1.00 0.00 ? 76 DC  B "C3'"  1  
ATOM 1478  O "O3'"  . DC  B 2 10 ? 49.341 38.672 38.776 1.00 0.00 ? 76 DC  B "O3'"  1  
ATOM 1479  C "C2'"  . DC  B 2 10 ? 46.862 38.888 38.698 1.00 0.00 ? 76 DC  B "C2'"  1  
ATOM 1480  C "C1'"  . DC  B 2 10 ? 46.343 37.965 37.595 1.00 0.00 ? 76 DC  B "C1'"  1  
ATOM 1481  N N1     . DC  B 2 10 ? 44.881 38.117 37.346 1.00 0.00 ? 76 DC  B N1     1  
ATOM 1482  C C2     . DC  B 2 10 ? 44.408 38.483 36.077 1.00 0.00 ? 76 DC  B C2     1  
ATOM 1483  O O2     . DC  B 2 10 ? 45.171 38.723 35.137 1.00 0.00 ? 76 DC  B O2     1  
ATOM 1484  N N3     . DC  B 2 10 ? 43.082 38.600 35.835 1.00 0.00 ? 76 DC  B N3     1  
ATOM 1485  C C4     . DC  B 2 10 ? 42.241 38.377 36.828 1.00 0.00 ? 76 DC  B C4     1  
ATOM 1486  N N4     . DC  B 2 10 ? 40.974 38.465 36.566 1.00 0.00 ? 76 DC  B N4     1  
ATOM 1487  C C5     . DC  B 2 10 ? 42.656 38.023 38.138 1.00 0.00 ? 76 DC  B C5     1  
ATOM 1488  C C6     . DC  B 2 10 ? 43.983 37.903 38.364 1.00 0.00 ? 76 DC  B C6     1  
ATOM 1489  H "H5'"  . DC  B 2 10 ? 47.687 34.675 39.417 1.00 0.00 ? 76 DC  B "H5'"  1  
ATOM 1490  H "H5''" . DC  B 2 10 ? 48.872 35.610 40.341 1.00 0.00 ? 76 DC  B "H5''" 1  
ATOM 1491  H "H4'"  . DC  B 2 10 ? 48.650 36.461 38.062 1.00 0.00 ? 76 DC  B "H4'"  1  
ATOM 1492  H "H3'"  . DC  B 2 10 ? 48.066 38.203 40.351 1.00 0.00 ? 76 DC  B "H3'"  1  
ATOM 1493  H "H2'"  . DC  B 2 10 ? 46.135 38.995 39.500 1.00 0.00 ? 76 DC  B "H2'"  1  
ATOM 1494  H "H2''" . DC  B 2 10 ? 47.084 39.870 38.295 1.00 0.00 ? 76 DC  B "H2''" 1  
ATOM 1495  H "H1'"  . DC  B 2 10 ? 46.915 38.145 36.678 1.00 0.00 ? 76 DC  B "H1'"  1  
ATOM 1496  H H41    . DC  B 2 10 ? 40.320 38.257 37.309 1.00 0.00 ? 76 DC  B H41    1  
ATOM 1497  H H42    . DC  B 2 10 ? 40.683 38.663 35.616 1.00 0.00 ? 76 DC  B H42    1  
ATOM 1498  H H5     . DC  B 2 10 ? 41.950 37.848 38.936 1.00 0.00 ? 76 DC  B H5     1  
ATOM 1499  H H6     . DC  B 2 10 ? 44.354 37.631 39.345 1.00 0.00 ? 76 DC  B H6     1  
ATOM 1500  P P      . DC  B 2 11 ? 49.800 40.207 38.987 1.00 0.00 ? 77 DC  B P      1  
ATOM 1501  O OP1    . DC  B 2 11 ? 51.274 40.274 38.872 1.00 0.00 ? 77 DC  B OP1    1  
ATOM 1502  O OP2    . DC  B 2 11 ? 49.158 40.729 40.212 1.00 0.00 ? 77 DC  B OP2    1  
ATOM 1503  O "O5'"  . DC  B 2 11 ? 49.205 40.968 37.726 1.00 0.00 ? 77 DC  B "O5'"  1  
ATOM 1504  C "C5'"  . DC  B 2 11 ? 49.573 40.588 36.404 1.00 0.00 ? 77 DC  B "C5'"  1  
ATOM 1505  C "C4'"  . DC  B 2 11 ? 48.664 41.239 35.361 1.00 0.00 ? 77 DC  B "C4'"  1  
ATOM 1506  O "O4'"  . DC  B 2 11 ? 47.312 40.950 35.683 1.00 0.00 ? 77 DC  B "O4'"  1  
ATOM 1507  C "C3'"  . DC  B 2 11 ? 48.786 42.767 35.307 1.00 0.00 ? 77 DC  B "C3'"  1  
ATOM 1508  O "O3'"  . DC  B 2 11 ? 49.538 43.173 34.162 1.00 0.00 ? 77 DC  B "O3'"  1  
ATOM 1509  C "C2'"  . DC  B 2 11 ? 47.326 43.234 35.261 1.00 0.00 ? 77 DC  B "C2'"  1  
ATOM 1510  C "C1'"  . DC  B 2 11 ? 46.531 41.944 35.069 1.00 0.00 ? 77 DC  B "C1'"  1  
ATOM 1511  N N1     . DC  B 2 11 ? 45.168 42.008 35.663 1.00 0.00 ? 77 DC  B N1     1  
ATOM 1512  C C2     . DC  B 2 11 ? 44.075 42.206 34.818 1.00 0.00 ? 77 DC  B C2     1  
ATOM 1513  O O2     . DC  B 2 11 ? 44.231 42.411 33.612 1.00 0.00 ? 77 DC  B O2     1  
ATOM 1514  N N3     . DC  B 2 11 ? 42.813 42.211 35.294 1.00 0.00 ? 77 DC  B N3     1  
ATOM 1515  C C4     . DC  B 2 11 ? 42.632 42.070 36.592 1.00 0.00 ? 77 DC  B C4     1  
ATOM 1516  N N4     . DC  B 2 11 ? 41.397 42.093 36.995 1.00 0.00 ? 77 DC  B N4     1  
ATOM 1517  C C5     . DC  B 2 11 ? 43.705 41.929 37.519 1.00 0.00 ? 77 DC  B C5     1  
ATOM 1518  C C6     . DC  B 2 11 ? 44.965 41.895 37.018 1.00 0.00 ? 77 DC  B C6     1  
ATOM 1519  H "H5'"  . DC  B 2 11 ? 49.476 39.508 36.292 1.00 0.00 ? 77 DC  B "H5'"  1  
ATOM 1520  H "H5''" . DC  B 2 11 ? 50.609 40.866 36.209 1.00 0.00 ? 77 DC  B "H5''" 1  
ATOM 1521  H "H4'"  . DC  B 2 11 ? 48.896 40.834 34.374 1.00 0.00 ? 77 DC  B "H4'"  1  
ATOM 1522  H "H3'"  . DC  B 2 11 ? 49.255 43.122 36.227 1.00 0.00 ? 77 DC  B "H3'"  1  
ATOM 1523  H "H2'"  . DC  B 2 11 ? 47.069 43.713 36.206 1.00 0.00 ? 77 DC  B "H2'"  1  
ATOM 1524  H "H2''" . DC  B 2 11 ? 47.135 43.910 34.432 1.00 0.00 ? 77 DC  B "H2''" 1  
ATOM 1525  H "H1'"  . DC  B 2 11 ? 46.472 41.721 33.997 1.00 0.00 ? 77 DC  B "H1'"  1  
ATOM 1526  H H41    . DC  B 2 11 ? 41.181 42.113 37.978 1.00 0.00 ? 77 DC  B H41    1  
ATOM 1527  H H42    . DC  B 2 11 ? 40.665 42.108 36.298 1.00 0.00 ? 77 DC  B H42    1  
ATOM 1528  H H5     . DC  B 2 11 ? 43.535 41.830 38.580 1.00 0.00 ? 77 DC  B H5     1  
ATOM 1529  H H6     . DC  B 2 11 ? 45.826 41.768 37.666 1.00 0.00 ? 77 DC  B H6     1  
ATOM 1530  P P      . DC  B 2 12 ? 50.028 44.679 33.969 1.00 0.00 ? 78 DC  B P      1  
ATOM 1531  O OP1    . DC  B 2 12 ? 51.120 44.679 32.971 1.00 0.00 ? 78 DC  B OP1    1  
ATOM 1532  O OP2    . DC  B 2 12 ? 50.337 45.216 35.311 1.00 0.00 ? 78 DC  B OP2    1  
ATOM 1533  O "O5'"  . DC  B 2 12 ? 48.786 45.465 33.350 1.00 0.00 ? 78 DC  B "O5'"  1  
ATOM 1534  C "C5'"  . DC  B 2 12 ? 48.456 45.316 31.971 1.00 0.00 ? 78 DC  B "C5'"  1  
ATOM 1535  C "C4'"  . DC  B 2 12 ? 47.075 45.872 31.603 1.00 0.00 ? 78 DC  B "C4'"  1  
ATOM 1536  O "O4'"  . DC  B 2 12 ? 46.048 45.190 32.310 1.00 0.00 ? 78 DC  B "O4'"  1  
ATOM 1537  C "C3'"  . DC  B 2 12 ? 46.901 47.356 31.925 1.00 0.00 ? 78 DC  B "C3'"  1  
ATOM 1538  O "O3'"  . DC  B 2 12 ? 47.396 48.167 30.863 1.00 0.00 ? 78 DC  B "O3'"  1  
ATOM 1539  C "C2'"  . DC  B 2 12 ? 45.381 47.449 32.069 1.00 0.00 ? 78 DC  B "C2'"  1  
ATOM 1540  C "C1'"  . DC  B 2 12 ? 44.899 46.020 32.341 1.00 0.00 ? 78 DC  B "C1'"  1  
ATOM 1541  N N1     . DC  B 2 12 ? 44.205 45.906 33.655 1.00 0.00 ? 78 DC  B N1     1  
ATOM 1542  C C2     . DC  B 2 12 ? 42.806 45.815 33.691 1.00 0.00 ? 78 DC  B C2     1  
ATOM 1543  O O2     . DC  B 2 12 ? 42.133 45.839 32.658 1.00 0.00 ? 78 DC  B O2     1  
ATOM 1544  N N3     . DC  B 2 12 ? 42.142 45.708 34.865 1.00 0.00 ? 78 DC  B N3     1  
ATOM 1545  C C4     . DC  B 2 12 ? 42.846 45.724 35.981 1.00 0.00 ? 78 DC  B C4     1  
ATOM 1546  N N4     . DC  B 2 12 ? 42.172 45.605 37.085 1.00 0.00 ? 78 DC  B N4     1  
ATOM 1547  C C5     . DC  B 2 12 ? 44.262 45.855 36.016 1.00 0.00 ? 78 DC  B C5     1  
ATOM 1548  C C6     . DC  B 2 12 ? 44.913 45.952 34.832 1.00 0.00 ? 78 DC  B C6     1  
ATOM 1549  H "H5'"  . DC  B 2 12 ? 48.475 44.256 31.705 1.00 0.00 ? 78 DC  B "H5'"  1  
ATOM 1550  H "H5''" . DC  B 2 12 ? 49.205 45.830 31.368 1.00 0.00 ? 78 DC  B "H5''" 1  
ATOM 1551  H "H4'"  . DC  B 2 12 ? 46.916 45.738 30.529 1.00 0.00 ? 78 DC  B "H4'"  1  
ATOM 1552  H "H3'"  . DC  B 2 12 ? 47.389 47.584 32.875 1.00 0.00 ? 78 DC  B "H3'"  1  
ATOM 1553  H "H2'"  . DC  B 2 12 ? 45.117 48.136 32.872 1.00 0.00 ? 78 DC  B "H2'"  1  
ATOM 1554  H "H2''" . DC  B 2 12 ? 44.932 47.785 31.136 1.00 0.00 ? 78 DC  B "H2''" 1  
ATOM 1555  H "H1'"  . DC  B 2 12 ? 44.224 45.724 31.532 1.00 0.00 ? 78 DC  B "H1'"  1  
ATOM 1556  H H41    . DC  B 2 12 ? 42.645 45.645 37.965 1.00 0.00 ? 78 DC  B H41    1  
ATOM 1557  H H42    . DC  B 2 12 ? 41.167 45.493 37.024 1.00 0.00 ? 78 DC  B H42    1  
ATOM 1558  H H5     . DC  B 2 12 ? 44.816 45.898 36.942 1.00 0.00 ? 78 DC  B H5     1  
ATOM 1559  H H6     . DC  B 2 12 ? 45.993 46.065 34.795 1.00 0.00 ? 78 DC  B H6     1  
ATOM 1560  P P      . DG  B 2 13 ? 47.451 49.757 30.954 1.00 0.00 ? 79 DG  B P      1  
ATOM 1561  O OP1    . DG  B 2 13 ? 48.035 50.261 29.692 1.00 0.00 ? 79 DG  B OP1    1  
ATOM 1562  O OP2    . DG  B 2 13 ? 48.127 50.132 32.215 1.00 0.00 ? 79 DG  B OP2    1  
ATOM 1563  O "O5'"  . DG  B 2 13 ? 45.963 50.308 31.019 1.00 0.00 ? 79 DG  B "O5'"  1  
ATOM 1564  C "C5'"  . DG  B 2 13 ? 45.127 50.303 29.869 1.00 0.00 ? 79 DG  B "C5'"  1  
ATOM 1565  C "C4'"  . DG  B 2 13 ? 43.721 50.807 30.202 1.00 0.00 ? 79 DG  B "C4'"  1  
ATOM 1566  O "O4'"  . DG  B 2 13 ? 43.095 49.919 31.122 1.00 0.00 ? 79 DG  B "O4'"  1  
ATOM 1567  C "C3'"  . DG  B 2 13 ? 43.728 52.218 30.822 1.00 0.00 ? 79 DG  B "C3'"  1  
ATOM 1568  O "O3'"  . DG  B 2 13 ? 42.996 53.131 30.015 1.00 0.00 ? 79 DG  B "O3'"  1  
ATOM 1569  C "C2'"  . DG  B 2 13 ? 43.048 52.027 32.174 1.00 0.00 ? 79 DG  B "C2'"  1  
ATOM 1570  C "C1'"  . DG  B 2 13 ? 42.335 50.677 32.044 1.00 0.00 ? 79 DG  B "C1'"  1  
ATOM 1571  N N9     . DG  B 2 13 ? 42.218 49.956 33.336 1.00 0.00 ? 79 DG  B N9     1  
ATOM 1572  C C8     . DG  B 2 13 ? 43.160 49.793 34.325 1.00 0.00 ? 79 DG  B C8     1  
ATOM 1573  N N7     . DG  B 2 13 ? 42.700 49.263 35.426 1.00 0.00 ? 79 DG  B N7     1  
ATOM 1574  C C5     . DG  B 2 13 ? 41.343 49.055 35.146 1.00 0.00 ? 79 DG  B C5     1  
ATOM 1575  C C6     . DG  B 2 13 ? 40.268 48.555 35.959 1.00 0.00 ? 79 DG  B C6     1  
ATOM 1576  O O6     . DG  B 2 13 ? 40.280 48.179 37.132 1.00 0.00 ? 79 DG  B O6     1  
ATOM 1577  N N1     . DG  B 2 13 ? 39.055 48.520 35.304 1.00 0.00 ? 79 DG  B N1     1  
ATOM 1578  C C2     . DG  B 2 13 ? 38.886 48.882 34.014 1.00 0.00 ? 79 DG  B C2     1  
ATOM 1579  N N2     . DG  B 2 13 ? 37.692 48.736 33.511 1.00 0.00 ? 79 DG  B N2     1  
ATOM 1580  N N3     . DG  B 2 13 ? 39.848 49.330 33.210 1.00 0.00 ? 79 DG  B N3     1  
ATOM 1581  C C4     . DG  B 2 13 ? 41.056 49.422 33.847 1.00 0.00 ? 79 DG  B C4     1  
ATOM 1582  H "H5'"  . DG  B 2 13 ? 45.049 49.290 29.476 1.00 0.00 ? 79 DG  B "H5'"  1  
ATOM 1583  H "H5''" . DG  B 2 13 ? 45.553 50.939 29.091 1.00 0.00 ? 79 DG  B "H5''" 1  
ATOM 1584  H "H4'"  . DG  B 2 13 ? 43.138 50.830 29.280 1.00 0.00 ? 79 DG  B "H4'"  1  
ATOM 1585  H "H3'"  . DG  B 2 13 ? 44.751 52.571 30.974 1.00 0.00 ? 79 DG  B "H3'"  1  
ATOM 1586  H "HO3'" . DG  B 2 13 ? 42.882 53.992 30.491 1.00 0.00 ? 79 DG  B "HO3'" 1  
ATOM 1587  H "H2'"  . DG  B 2 13 ? 43.814 51.994 32.947 1.00 0.00 ? 79 DG  B "H2'"  1  
ATOM 1588  H "H2''" . DG  B 2 13 ? 42.336 52.824 32.399 1.00 0.00 ? 79 DG  B "H2''" 1  
ATOM 1589  H "H1'"  . DG  B 2 13 ? 41.332 50.848 31.642 1.00 0.00 ? 79 DG  B "H1'"  1  
ATOM 1590  H H8     . DG  B 2 13 ? 44.194 50.094 34.202 1.00 0.00 ? 79 DG  B H8     1  
ATOM 1591  H H1     . DG  B 2 13 ? 38.252 48.219 35.832 1.00 0.00 ? 79 DG  B H1     1  
ATOM 1592  H H21    . DG  B 2 13 ? 37.576 48.953 32.533 1.00 0.00 ? 79 DG  B H21    1  
ATOM 1593  H H22    . DG  B 2 13 ? 36.922 48.407 34.085 1.00 0.00 ? 79 DG  B H22    1  
ATOM 1594  O "O5'"  . DC  C 3 1  ? 29.347 47.874 39.078 1.00 0.00 ? 80 DC  C "O5'"  1  
ATOM 1595  C "C5'"  . DC  C 3 1  ? 30.680 48.137 38.659 1.00 0.00 ? 80 DC  C "C5'"  1  
ATOM 1596  C "C4'"  . DC  C 3 1  ? 30.873 47.998 37.137 1.00 0.00 ? 80 DC  C "C4'"  1  
ATOM 1597  O "O4'"  . DC  C 3 1  ? 32.156 48.521 36.815 1.00 0.00 ? 80 DC  C "O4'"  1  
ATOM 1598  C "C3'"  . DC  C 3 1  ? 30.804 46.562 36.601 1.00 0.00 ? 80 DC  C "C3'"  1  
ATOM 1599  O "O3'"  . DC  C 3 1  ? 30.181 46.482 35.318 1.00 0.00 ? 80 DC  C "O3'"  1  
ATOM 1600  C "C2'"  . DC  C 3 1  ? 32.276 46.163 36.540 1.00 0.00 ? 80 DC  C "C2'"  1  
ATOM 1601  C "C1'"  . DC  C 3 1  ? 33.002 47.494 36.325 1.00 0.00 ? 80 DC  C "C1'"  1  
ATOM 1602  N N1     . DC  C 3 1  ? 34.326 47.539 37.010 1.00 0.00 ? 80 DC  C N1     1  
ATOM 1603  C C2     . DC  C 3 1  ? 35.479 47.809 36.264 1.00 0.00 ? 80 DC  C C2     1  
ATOM 1604  O O2     . DC  C 3 1  ? 35.426 48.164 35.085 1.00 0.00 ? 80 DC  C O2     1  
ATOM 1605  N N3     . DC  C 3 1  ? 36.709 47.715 36.819 1.00 0.00 ? 80 DC  C N3     1  
ATOM 1606  C C4     . DC  C 3 1  ? 36.792 47.393 38.093 1.00 0.00 ? 80 DC  C C4     1  
ATOM 1607  N N4     . DC  C 3 1  ? 37.987 47.316 38.592 1.00 0.00 ? 80 DC  C N4     1  
ATOM 1608  C C5     . DC  C 3 1  ? 35.664 47.175 38.923 1.00 0.00 ? 80 DC  C C5     1  
ATOM 1609  C C6     . DC  C 3 1  ? 34.441 47.270 38.351 1.00 0.00 ? 80 DC  C C6     1  
ATOM 1610  H "H5'"  . DC  C 3 1  ? 31.366 47.467 39.173 1.00 0.00 ? 80 DC  C "H5'"  1  
ATOM 1611  H "H5''" . DC  C 3 1  ? 30.933 49.159 38.944 1.00 0.00 ? 80 DC  C "H5''" 1  
ATOM 1612  H "H4'"  . DC  C 3 1  ? 30.099 48.582 36.646 1.00 0.00 ? 80 DC  C "H4'"  1  
ATOM 1613  H "H3'"  . DC  C 3 1  ? 30.265 45.935 37.312 1.00 0.00 ? 80 DC  C "H3'"  1  
ATOM 1614  H "H2'"  . DC  C 3 1  ? 32.554 45.693 37.481 1.00 0.00 ? 80 DC  C "H2'"  1  
ATOM 1615  H "H2''" . DC  C 3 1  ? 32.495 45.478 35.725 1.00 0.00 ? 80 DC  C "H2''" 1  
ATOM 1616  H "H1'"  . DC  C 3 1  ? 33.131 47.642 35.247 1.00 0.00 ? 80 DC  C "H1'"  1  
ATOM 1617  H H41    . DC  C 3 1  ? 38.113 47.052 39.554 1.00 0.00 ? 80 DC  C H41    1  
ATOM 1618  H H42    . DC  C 3 1  ? 38.773 47.460 37.971 1.00 0.00 ? 80 DC  C H42    1  
ATOM 1619  H H5     . DC  C 3 1  ? 35.751 46.953 39.972 1.00 0.00 ? 80 DC  C H5     1  
ATOM 1620  H H6     . DC  C 3 1  ? 33.546 47.139 38.944 1.00 0.00 ? 80 DC  C H6     1  
ATOM 1621  H "HO5'" . DC  C 3 1  ? 28.780 48.598 38.697 1.00 0.00 ? 80 DC  C "HO5'" 1  
ATOM 1622  P P      . DG  C 3 2  ? 29.726 45.061 34.724 1.00 0.00 ? 81 DG  C P      1  
ATOM 1623  O OP1    . DG  C 3 2  ? 28.689 45.232 33.683 1.00 0.00 ? 81 DG  C OP1    1  
ATOM 1624  O OP2    . DG  C 3 2  ? 29.464 44.124 35.834 1.00 0.00 ? 81 DG  C OP2    1  
ATOM 1625  O "O5'"  . DG  C 3 2  ? 31.006 44.478 34.005 1.00 0.00 ? 81 DG  C "O5'"  1  
ATOM 1626  C "C5'"  . DG  C 3 2  ? 31.420 44.904 32.717 1.00 0.00 ? 81 DG  C "C5'"  1  
ATOM 1627  C "C4'"  . DG  C 3 2  ? 32.755 44.244 32.359 1.00 0.00 ? 81 DG  C "C4'"  1  
ATOM 1628  O "O4'"  . DG  C 3 2  ? 33.789 44.788 33.175 1.00 0.00 ? 81 DG  C "O4'"  1  
ATOM 1629  C "C3'"  . DG  C 3 2  ? 32.728 42.720 32.611 1.00 0.00 ? 81 DG  C "C3'"  1  
ATOM 1630  O "O3'"  . DG  C 3 2  ? 33.400 41.967 31.615 1.00 0.00 ? 81 DG  C "O3'"  1  
ATOM 1631  C "C2'"  . DG  C 3 2  ? 33.555 42.597 33.889 1.00 0.00 ? 81 DG  C "C2'"  1  
ATOM 1632  C "C1'"  . DG  C 3 2  ? 34.571 43.708 33.638 1.00 0.00 ? 81 DG  C "C1'"  1  
ATOM 1633  N N9     . DG  C 3 2  ? 35.422 44.081 34.790 1.00 0.00 ? 81 DG  C N9     1  
ATOM 1634  C C8     . DG  C 3 2  ? 35.242 43.850 36.134 1.00 0.00 ? 81 DG  C C8     1  
ATOM 1635  N N7     . DG  C 3 2  ? 36.283 44.131 36.872 1.00 0.00 ? 81 DG  C N7     1  
ATOM 1636  C C5     . DG  C 3 2  ? 37.242 44.560 35.935 1.00 0.00 ? 81 DG  C C5     1  
ATOM 1637  C C6     . DG  C 3 2  ? 38.629 44.933 36.066 1.00 0.00 ? 81 DG  C C6     1  
ATOM 1638  O O6     . DG  C 3 2  ? 39.345 44.960 37.066 1.00 0.00 ? 81 DG  C O6     1  
ATOM 1639  N N1     . DG  C 3 2  ? 39.228 45.281 34.874 1.00 0.00 ? 81 DG  C N1     1  
ATOM 1640  C C2     . DG  C 3 2  ? 38.590 45.286 33.682 1.00 0.00 ? 81 DG  C C2     1  
ATOM 1641  N N2     . DG  C 3 2  ? 39.315 45.567 32.635 1.00 0.00 ? 81 DG  C N2     1  
ATOM 1642  N N3     . DG  C 3 2  ? 37.318 44.943 33.499 1.00 0.00 ? 81 DG  C N3     1  
ATOM 1643  C C4     . DG  C 3 2  ? 36.698 44.579 34.668 1.00 0.00 ? 81 DG  C C4     1  
ATOM 1644  H "H5'"  . DG  C 3 2  ? 31.542 45.989 32.699 1.00 0.00 ? 81 DG  C "H5'"  1  
ATOM 1645  H "H5''" . DG  C 3 2  ? 30.674 44.619 31.973 1.00 0.00 ? 81 DG  C "H5''" 1  
ATOM 1646  H "H4'"  . DG  C 3 2  ? 32.977 44.445 31.312 1.00 0.00 ? 81 DG  C "H4'"  1  
ATOM 1647  H "H3'"  . DG  C 3 2  ? 31.711 42.349 32.758 1.00 0.00 ? 81 DG  C "H3'"  1  
ATOM 1648  H "H2'"  . DG  C 3 2  ? 32.940 42.816 34.762 1.00 0.00 ? 81 DG  C "H2'"  1  
ATOM 1649  H "H2''" . DG  C 3 2  ? 34.037 41.623 33.982 1.00 0.00 ? 81 DG  C "H2''" 1  
ATOM 1650  H "H1'"  . DG  C 3 2  ? 35.237 43.386 32.832 1.00 0.00 ? 81 DG  C "H1'"  1  
ATOM 1651  H H8     . DG  C 3 2  ? 34.318 43.459 36.541 1.00 0.00 ? 81 DG  C H8     1  
ATOM 1652  H H1     . DG  C 3 2  ? 40.217 45.481 34.895 1.00 0.00 ? 81 DG  C H1     1  
ATOM 1653  H H21    . DG  C 3 2  ? 38.896 45.465 31.719 1.00 0.00 ? 81 DG  C H21    1  
ATOM 1654  H H22    . DG  C 3 2  ? 40.313 45.723 32.731 1.00 0.00 ? 81 DG  C H22    1  
ATOM 1655  P P      . DG  C 3 3  ? 32.820 41.741 30.143 1.00 0.00 ? 82 DG  C P      1  
ATOM 1656  O OP1    . DG  C 3 3  ? 31.824 42.776 29.800 1.00 0.00 ? 82 DG  C OP1    1  
ATOM 1657  O OP2    . DG  C 3 3  ? 32.474 40.309 30.019 1.00 0.00 ? 82 DG  C OP2    1  
ATOM 1658  O "O5'"  . DG  C 3 3  ? 34.124 41.974 29.273 1.00 0.00 ? 82 DG  C "O5'"  1  
ATOM 1659  C "C5'"  . DG  C 3 3  ? 34.448 43.257 28.767 1.00 0.00 ? 82 DG  C "C5'"  1  
ATOM 1660  C "C4'"  . DG  C 3 3  ? 35.849 43.348 28.160 1.00 0.00 ? 82 DG  C "C4'"  1  
ATOM 1661  O "O4'"  . DG  C 3 3  ? 36.792 43.536 29.202 1.00 0.00 ? 82 DG  C "O4'"  1  
ATOM 1662  C "C3'"  . DG  C 3 3  ? 36.271 42.109 27.366 1.00 0.00 ? 82 DG  C "C3'"  1  
ATOM 1663  O "O3'"  . DG  C 3 3  ? 37.053 42.495 26.242 1.00 0.00 ? 82 DG  C "O3'"  1  
ATOM 1664  C "C2'"  . DG  C 3 3  ? 37.058 41.315 28.405 1.00 0.00 ? 82 DG  C "C2'"  1  
ATOM 1665  C "C1'"  . DG  C 3 3  ? 37.628 42.399 29.311 1.00 0.00 ? 82 DG  C "C1'"  1  
ATOM 1666  N N9     . DG  C 3 3  ? 37.685 42.013 30.734 1.00 0.00 ? 82 DG  C N9     1  
ATOM 1667  C C8     . DG  C 3 3  ? 36.683 41.555 31.548 1.00 0.00 ? 82 DG  C C8     1  
ATOM 1668  N N7     . DG  C 3 3  ? 37.018 41.439 32.808 1.00 0.00 ? 82 DG  C N7     1  
ATOM 1669  C C5     . DG  C 3 3  ? 38.368 41.829 32.817 1.00 0.00 ? 82 DG  C C5     1  
ATOM 1670  C C6     . DG  C 3 3  ? 39.332 41.953 33.879 1.00 0.00 ? 82 DG  C C6     1  
ATOM 1671  O O6     . DG  C 3 3  ? 39.187 41.790 35.092 1.00 0.00 ? 82 DG  C O6     1  
ATOM 1672  N N1     . DG  C 3 3  ? 40.588 42.321 33.441 1.00 0.00 ? 82 DG  C N1     1  
ATOM 1673  C C2     . DG  C 3 3  ? 40.884 42.583 32.147 1.00 0.00 ? 82 DG  C C2     1  
ATOM 1674  N N2     . DG  C 3 3  ? 42.124 42.818 31.845 1.00 0.00 ? 82 DG  C N2     1  
ATOM 1675  N N3     . DG  C 3 3  ? 40.026 42.532 31.140 1.00 0.00 ? 82 DG  C N3     1  
ATOM 1676  C C4     . DG  C 3 3  ? 38.781 42.146 31.542 1.00 0.00 ? 82 DG  C C4     1  
ATOM 1677  H "H5'"  . DG  C 3 3  ? 34.387 43.985 29.576 1.00 0.00 ? 82 DG  C "H5'"  1  
ATOM 1678  H "H5''" . DG  C 3 3  ? 33.725 43.536 28.004 1.00 0.00 ? 82 DG  C "H5''" 1  
ATOM 1679  H "H4'"  . DG  C 3 3  ? 35.866 44.216 27.500 1.00 0.00 ? 82 DG  C "H4'"  1  
ATOM 1680  H "H3'"  . DG  C 3 3  ? 35.395 41.546 27.044 1.00 0.00 ? 82 DG  C "H3'"  1  
ATOM 1681  H "H2'"  . DG  C 3 3  ? 36.384 40.658 28.954 1.00 0.00 ? 82 DG  C "H2'"  1  
ATOM 1682  H "H2''" . DG  C 3 3  ? 37.856 40.734 27.955 1.00 0.00 ? 82 DG  C "H2''" 1  
ATOM 1683  H "H1'"  . DG  C 3 3  ? 38.635 42.656 28.966 1.00 0.00 ? 82 DG  C "H1'"  1  
ATOM 1684  H H8     . DG  C 3 3  ? 35.695 41.346 31.166 1.00 0.00 ? 82 DG  C H8     1  
ATOM 1685  H H1     . DG  C 3 3  ? 41.328 42.361 34.123 1.00 0.00 ? 82 DG  C H1     1  
ATOM 1686  H H21    . DG  C 3 3  ? 42.329 42.931 30.862 1.00 0.00 ? 82 DG  C H21    1  
ATOM 1687  H H22    . DG  C 3 3  ? 42.844 42.754 32.554 1.00 0.00 ? 82 DG  C H22    1  
ATOM 1688  P P      . DG  C 3 4  ? 37.550 41.429 25.157 1.00 0.00 ? 83 DG  C P      1  
ATOM 1689  O OP1    . DG  C 3 4  ? 37.703 42.103 23.850 1.00 0.00 ? 83 DG  C OP1    1  
ATOM 1690  O OP2    . DG  C 3 4  ? 36.709 40.214 25.225 1.00 0.00 ? 83 DG  C OP2    1  
ATOM 1691  O "O5'"  . DG  C 3 4  ? 38.970 41.004 25.703 1.00 0.00 ? 83 DG  C "O5'"  1  
ATOM 1692  C "C5'"  . DG  C 3 4  ? 40.130 41.815 25.594 1.00 0.00 ? 83 DG  C "C5'"  1  
ATOM 1693  C "C4'"  . DG  C 3 4  ? 41.335 41.054 26.167 1.00 0.00 ? 83 DG  C "C4'"  1  
ATOM 1694  O "O4'"  . DG  C 3 4  ? 41.258 41.015 27.594 1.00 0.00 ? 83 DG  C "O4'"  1  
ATOM 1695  C "C3'"  . DG  C 3 4  ? 41.377 39.607 25.636 1.00 0.00 ? 83 DG  C "C3'"  1  
ATOM 1696  O "O3'"  . DG  C 3 4  ? 42.665 39.248 25.159 1.00 0.00 ? 83 DG  C "O3'"  1  
ATOM 1697  C "C2'"  . DG  C 3 4  ? 40.964 38.831 26.880 1.00 0.00 ? 83 DG  C "C2'"  1  
ATOM 1698  C "C1'"  . DG  C 3 4  ? 41.506 39.685 28.019 1.00 0.00 ? 83 DG  C "C1'"  1  
ATOM 1699  N N9     . DG  C 3 4  ? 40.857 39.404 29.329 1.00 0.00 ? 83 DG  C N9     1  
ATOM 1700  C C8     . DG  C 3 4  ? 39.546 39.080 29.586 1.00 0.00 ? 83 DG  C C8     1  
ATOM 1701  N N7     . DG  C 3 4  ? 39.258 38.906 30.847 1.00 0.00 ? 83 DG  C N7     1  
ATOM 1702  C C5     . DG  C 3 4  ? 40.493 39.093 31.478 1.00 0.00 ? 83 DG  C C5     1  
ATOM 1703  C C6     . DG  C 3 4  ? 40.860 38.991 32.863 1.00 0.00 ? 83 DG  C C6     1  
ATOM 1704  O O6     . DG  C 3 4  ? 40.145 38.728 33.829 1.00 0.00 ? 83 DG  C O6     1  
ATOM 1705  N N1     . DG  C 3 4  ? 42.206 39.186 33.093 1.00 0.00 ? 83 DG  C N1     1  
ATOM 1706  C C2     . DG  C 3 4  ? 43.112 39.396 32.110 1.00 0.00 ? 83 DG  C C2     1  
ATOM 1707  N N2     . DG  C 3 4  ? 44.368 39.355 32.463 1.00 0.00 ? 83 DG  C N2     1  
ATOM 1708  N N3     . DG  C 3 4  ? 42.827 39.508 30.812 1.00 0.00 ? 83 DG  C N3     1  
ATOM 1709  C C4     . DG  C 3 4  ? 41.486 39.359 30.556 1.00 0.00 ? 83 DG  C C4     1  
ATOM 1710  H "H5'"  . DG  C 3 4  ? 39.994 42.746 26.145 1.00 0.00 ? 83 DG  C "H5'"  1  
ATOM 1711  H "H5''" . DG  C 3 4  ? 40.325 42.048 24.546 1.00 0.00 ? 83 DG  C "H5''" 1  
ATOM 1712  H "H4'"  . DG  C 3 4  ? 42.248 41.571 25.879 1.00 0.00 ? 83 DG  C "H4'"  1  
ATOM 1713  H "H3'"  . DG  C 3 4  ? 40.647 39.457 24.838 1.00 0.00 ? 83 DG  C "H3'"  1  
ATOM 1714  H "H2'"  . DG  C 3 4  ? 39.877 38.793 26.908 1.00 0.00 ? 83 DG  C "H2'"  1  
ATOM 1715  H "H2''" . DG  C 3 4  ? 41.371 37.827 26.900 1.00 0.00 ? 83 DG  C "H2''" 1  
ATOM 1716  H "H1'"  . DG  C 3 4  ? 42.584 39.515 28.100 1.00 0.00 ? 83 DG  C "H1'"  1  
ATOM 1717  H H8     . DG  C 3 4  ? 38.807 38.984 28.804 1.00 0.00 ? 83 DG  C H8     1  
ATOM 1718  H H1     . DG  C 3 4  ? 42.528 39.074 34.043 1.00 0.00 ? 83 DG  C H1     1  
ATOM 1719  H H21    . DG  C 3 4  ? 45.074 39.299 31.739 1.00 0.00 ? 83 DG  C H21    1  
ATOM 1720  H H22    . DG  C 3 4  ? 44.612 39.161 33.428 1.00 0.00 ? 83 DG  C H22    1  
ATOM 1721  P P      . DG  C 3 5  ? 42.941 37.858 24.404 1.00 0.00 ? 84 DG  C P      1  
ATOM 1722  O OP1    . DG  C 3 5  ? 43.503 38.172 23.068 1.00 0.00 ? 84 DG  C OP1    1  
ATOM 1723  O OP2    . DG  C 3 5  ? 41.766 36.968 24.504 1.00 0.00 ? 84 DG  C OP2    1  
ATOM 1724  O "O5'"  . DG  C 3 5  ? 44.075 37.223 25.306 1.00 0.00 ? 84 DG  C "O5'"  1  
ATOM 1725  C "C5'"  . DG  C 3 5  ? 45.349 37.832 25.423 1.00 0.00 ? 84 DG  C "C5'"  1  
ATOM 1726  C "C4'"  . DG  C 3 5  ? 46.255 37.104 26.422 1.00 0.00 ? 84 DG  C "C4'"  1  
ATOM 1727  O "O4'"  . DG  C 3 5  ? 45.735 37.203 27.749 1.00 0.00 ? 84 DG  C "O4'"  1  
ATOM 1728  C "C3'"  . DG  C 3 5  ? 46.439 35.611 26.106 1.00 0.00 ? 84 DG  C "C3'"  1  
ATOM 1729  O "O3'"  . DG  C 3 5  ? 47.780 35.282 26.446 1.00 0.00 ? 84 DG  C "O3'"  1  
ATOM 1730  C "C2'"  . DG  C 3 5  ? 45.360 34.988 26.984 1.00 0.00 ? 84 DG  C "C2'"  1  
ATOM 1731  C "C1'"  . DG  C 3 5  ? 45.321 35.919 28.196 1.00 0.00 ? 84 DG  C "C1'"  1  
ATOM 1732  N N9     . DG  C 3 5  ? 43.991 35.997 28.857 1.00 0.00 ? 84 DG  C N9     1  
ATOM 1733  C C8     . DG  C 3 5  ? 42.735 36.015 28.303 1.00 0.00 ? 84 DG  C C8     1  
ATOM 1734  N N7     . DG  C 3 5  ? 41.755 36.029 29.171 1.00 0.00 ? 84 DG  C N7     1  
ATOM 1735  C C5     . DG  C 3 5  ? 42.416 36.005 30.408 1.00 0.00 ? 84 DG  C C5     1  
ATOM 1736  C C6     . DG  C 3 5  ? 41.928 35.977 31.766 1.00 0.00 ? 84 DG  C C6     1  
ATOM 1737  O O6     . DG  C 3 5  ? 40.769 35.997 32.190 1.00 0.00 ? 84 DG  C O6     1  
ATOM 1738  N N1     . DG  C 3 5  ? 42.937 35.922 32.709 1.00 0.00 ? 84 DG  C N1     1  
ATOM 1739  C C2     . DG  C 3 5  ? 44.256 35.925 32.406 1.00 0.00 ? 84 DG  C C2     1  
ATOM 1740  N N2     . DG  C 3 5  ? 45.109 35.843 33.387 1.00 0.00 ? 84 DG  C N2     1  
ATOM 1741  N N3     . DG  C 3 5  ? 44.754 35.977 31.176 1.00 0.00 ? 84 DG  C N3     1  
ATOM 1742  C C4     . DG  C 3 5  ? 43.782 36.001 30.215 1.00 0.00 ? 84 DG  C C4     1  
ATOM 1743  H "H5'"  . DG  C 3 5  ? 45.235 38.865 25.754 1.00 0.00 ? 84 DG  C "H5'"  1  
ATOM 1744  H "H5''" . DG  C 3 5  ? 45.839 37.837 24.450 1.00 0.00 ? 84 DG  C "H5''" 1  
ATOM 1745  H "H4'"  . DG  C 3 5  ? 47.223 37.603 26.388 1.00 0.00 ? 84 DG  C "H4'"  1  
ATOM 1746  H "H3'"  . DG  C 3 5  ? 46.245 35.394 25.054 1.00 0.00 ? 84 DG  C "H3'"  1  
ATOM 1747  H "H2'"  . DG  C 3 5  ? 44.416 35.002 26.447 1.00 0.00 ? 84 DG  C "H2'"  1  
ATOM 1748  H "H2''" . DG  C 3 5  ? 45.588 33.965 27.259 1.00 0.00 ? 84 DG  C "H2''" 1  
ATOM 1749  H "H1'"  . DG  C 3 5  ? 46.051 35.551 28.922 1.00 0.00 ? 84 DG  C "H1'"  1  
ATOM 1750  H H8     . DG  C 3 5  ? 42.582 36.030 27.231 1.00 0.00 ? 84 DG  C H8     1  
ATOM 1751  H H1     . DG  C 3 5  ? 42.670 35.818 33.676 1.00 0.00 ? 84 DG  C H1     1  
ATOM 1752  H H21    . DG  C 3 5  ? 46.083 35.823 33.145 1.00 0.00 ? 84 DG  C H21    1  
ATOM 1753  H H22    . DG  C 3 5  ? 44.790 35.710 34.341 1.00 0.00 ? 84 DG  C H22    1  
ATOM 1754  P P      . DA  C 3 6  ? 48.356 33.804 26.633 1.00 0.00 ? 85 DA  C P      1  
ATOM 1755  O OP1    . DA  C 3 6  ? 49.794 33.893 26.317 1.00 0.00 ? 85 DA  C OP1    1  
ATOM 1756  O OP2    . DA  C 3 6  ? 47.536 32.796 25.927 1.00 0.00 ? 85 DA  C OP2    1  
ATOM 1757  O "O5'"  . DA  C 3 6  ? 48.201 33.582 28.200 1.00 0.00 ? 85 DA  C "O5'"  1  
ATOM 1758  C "C5'"  . DA  C 3 6  ? 48.866 34.438 29.125 1.00 0.00 ? 85 DA  C "C5'"  1  
ATOM 1759  C "C4'"  . DA  C 3 6  ? 48.857 33.913 30.568 1.00 0.00 ? 85 DA  C "C4'"  1  
ATOM 1760  O "O4'"  . DA  C 3 6  ? 47.548 33.959 31.125 1.00 0.00 ? 85 DA  C "O4'"  1  
ATOM 1761  C "C3'"  . DA  C 3 6  ? 49.355 32.465 30.653 1.00 0.00 ? 85 DA  C "C3'"  1  
ATOM 1762  O "O3'"  . DA  C 3 6  ? 50.169 32.266 31.807 1.00 0.00 ? 85 DA  C "O3'"  1  
ATOM 1763  C "C2'"  . DA  C 3 6  ? 48.039 31.686 30.671 1.00 0.00 ? 85 DA  C "C2'"  1  
ATOM 1764  C "C1'"  . DA  C 3 6  ? 47.066 32.645 31.358 1.00 0.00 ? 85 DA  C "C1'"  1  
ATOM 1765  N N9     . DA  C 3 6  ? 45.682 32.544 30.837 1.00 0.00 ? 85 DA  C N9     1  
ATOM 1766  C C8     . DA  C 3 6  ? 45.261 32.511 29.530 1.00 0.00 ? 85 DA  C C8     1  
ATOM 1767  N N7     . DA  C 3 6  ? 43.963 32.557 29.373 1.00 0.00 ? 85 DA  C N7     1  
ATOM 1768  C C5     . DA  C 3 6  ? 43.493 32.577 30.697 1.00 0.00 ? 85 DA  C C5     1  
ATOM 1769  C C6     . DA  C 3 6  ? 42.215 32.627 31.309 1.00 0.00 ? 85 DA  C C6     1  
ATOM 1770  N N6     . DA  C 3 6  ? 41.060 32.737 30.683 1.00 0.00 ? 85 DA  C N6     1  
ATOM 1771  N N1     . DA  C 3 6  ? 42.088 32.595 32.632 1.00 0.00 ? 85 DA  C N1     1  
ATOM 1772  C C2     . DA  C 3 6  ? 43.184 32.532 33.370 1.00 0.00 ? 85 DA  C C2     1  
ATOM 1773  N N3     . DA  C 3 6  ? 44.445 32.495 32.954 1.00 0.00 ? 85 DA  C N3     1  
ATOM 1774  C C4     . DA  C 3 6  ? 44.532 32.531 31.592 1.00 0.00 ? 85 DA  C C4     1  
ATOM 1775  H "H5'"  . DA  C 3 6  ? 48.404 35.427 29.110 1.00 0.00 ? 85 DA  C "H5'"  1  
ATOM 1776  H "H5''" . DA  C 3 6  ? 49.909 34.549 28.823 1.00 0.00 ? 85 DA  C "H5''" 1  
ATOM 1777  H "H4'"  . DA  C 3 6  ? 49.520 34.554 31.148 1.00 0.00 ? 85 DA  C "H4'"  1  
ATOM 1778  H "H3'"  . DA  C 3 6  ? 49.925 32.225 29.755 1.00 0.00 ? 85 DA  C "H3'"  1  
ATOM 1779  H "H2'"  . DA  C 3 6  ? 47.736 31.482 29.647 1.00 0.00 ? 85 DA  C "H2'"  1  
ATOM 1780  H "H2''" . DA  C 3 6  ? 48.104 30.745 31.207 1.00 0.00 ? 85 DA  C "H2''" 1  
ATOM 1781  H "H1'"  . DA  C 3 6  ? 47.072 32.446 32.434 1.00 0.00 ? 85 DA  C "H1'"  1  
ATOM 1782  H H8     . DA  C 3 6  ? 45.958 32.474 28.702 1.00 0.00 ? 85 DA  C H8     1  
ATOM 1783  H H61    . DA  C 3 6  ? 41.055 32.889 29.681 1.00 0.00 ? 85 DA  C H61    1  
ATOM 1784  H H62    . DA  C 3 6  ? 40.231 32.858 31.248 1.00 0.00 ? 85 DA  C H62    1  
ATOM 1785  H H2     . DA  C 3 6  ? 43.038 32.511 34.441 1.00 0.00 ? 85 DA  C H2     1  
ATOM 1786  P P      . DT  C 3 7  ? 50.870 30.859 32.113 1.00 0.00 ? 86 DT  C P      1  
ATOM 1787  O OP1    . DT  C 3 7  ? 51.998 31.104 33.038 1.00 0.00 ? 86 DT  C OP1    1  
ATOM 1788  O OP2    . DT  C 3 7  ? 51.139 30.200 30.814 1.00 0.00 ? 86 DT  C OP2    1  
ATOM 1789  O "O5'"  . DT  C 3 7  ? 49.735 30.072 32.902 1.00 0.00 ? 86 DT  C "O5'"  1  
ATOM 1790  C "C5'"  . DT  C 3 7  ? 49.246 30.598 34.132 1.00 0.00 ? 86 DT  C "C5'"  1  
ATOM 1791  C "C4'"  . DT  C 3 7  ? 47.927 29.972 34.586 1.00 0.00 ? 86 DT  C "C4'"  1  
ATOM 1792  O "O4'"  . DT  C 3 7  ? 46.881 30.206 33.657 1.00 0.00 ? 86 DT  C "O4'"  1  
ATOM 1793  C "C3'"  . DT  C 3 7  ? 47.990 28.456 34.768 1.00 0.00 ? 86 DT  C "C3'"  1  
ATOM 1794  O "O3'"  . DT  C 3 7  ? 48.344 28.157 36.111 1.00 0.00 ? 86 DT  C "O3'"  1  
ATOM 1795  C "C2'"  . DT  C 3 7  ? 46.571 28.019 34.379 1.00 0.00 ? 86 DT  C "C2'"  1  
ATOM 1796  C "C1'"  . DT  C 3 7  ? 45.844 29.312 34.008 1.00 0.00 ? 86 DT  C "C1'"  1  
ATOM 1797  N N1     . DT  C 3 7  ? 44.869 29.141 32.893 1.00 0.00 ? 86 DT  C N1     1  
ATOM 1798  C C2     . DT  C 3 7  ? 43.505 29.076 33.203 1.00 0.00 ? 86 DT  C C2     1  
ATOM 1799  O O2     . DT  C 3 7  ? 43.078 29.021 34.354 1.00 0.00 ? 86 DT  C O2     1  
ATOM 1800  N N3     . DT  C 3 7  ? 42.621 29.054 32.145 1.00 0.00 ? 86 DT  C N3     1  
ATOM 1801  C C4     . DT  C 3 7  ? 42.966 29.047 30.811 1.00 0.00 ? 86 DT  C C4     1  
ATOM 1802  O O4     . DT  C 3 7  ? 42.075 29.063 29.958 1.00 0.00 ? 86 DT  C O4     1  
ATOM 1803  C C5     . DT  C 3 7  ? 44.407 29.030 30.557 1.00 0.00 ? 86 DT  C C5     1  
ATOM 1804  C C7     . DT  C 3 7  ? 44.922 28.973 29.133 1.00 0.00 ? 86 DT  C C7     1  
ATOM 1805  C C6     . DT  C 3 7  ? 45.298 29.073 31.584 1.00 0.00 ? 86 DT  C C6     1  
ATOM 1806  H "H5'"  . DT  C 3 7  ? 49.073 31.670 34.029 1.00 0.00 ? 86 DT  C "H5'"  1  
ATOM 1807  H "H5''" . DT  C 3 7  ? 49.993 30.456 34.911 1.00 0.00 ? 86 DT  C "H5''" 1  
ATOM 1808  H "H4'"  . DT  C 3 7  ? 47.654 30.418 35.544 1.00 0.00 ? 86 DT  C "H4'"  1  
ATOM 1809  H "H3'"  . DT  C 3 7  ? 48.715 28.032 34.071 1.00 0.00 ? 86 DT  C "H3'"  1  
ATOM 1810  H "H2'"  . DT  C 3 7  ? 46.631 27.351 33.524 1.00 0.00 ? 86 DT  C "H2'"  1  
ATOM 1811  H "H2''" . DT  C 3 7  ? 46.047 27.539 35.203 1.00 0.00 ? 86 DT  C "H2''" 1  
ATOM 1812  H "H1'"  . DT  C 3 7  ? 45.334 29.694 34.900 1.00 0.00 ? 86 DT  C "H1'"  1  
ATOM 1813  H H3     . DT  C 3 7  ? 41.635 29.045 32.366 1.00 0.00 ? 86 DT  C H3     1  
ATOM 1814  H H71    . DT  C 3 7  ? 46.011 28.956 29.108 1.00 0.00 ? 86 DT  C H71    1  
ATOM 1815  H H72    . DT  C 3 7  ? 44.536 28.073 28.657 1.00 0.00 ? 86 DT  C H72    1  
ATOM 1816  H H73    . DT  C 3 7  ? 44.560 29.836 28.575 1.00 0.00 ? 86 DT  C H73    1  
ATOM 1817  H H6     . DT  C 3 7  ? 46.363 29.079 31.384 1.00 0.00 ? 86 DT  C H6     1  
ATOM 1818  P P      . DT  C 3 8  ? 48.571 26.668 36.623 1.00 0.00 ? 87 DT  C P      1  
ATOM 1819  O OP1    . DT  C 3 8  ? 49.373 26.724 37.867 1.00 0.00 ? 87 DT  C OP1    1  
ATOM 1820  O OP2    . DT  C 3 8  ? 49.061 25.842 35.496 1.00 0.00 ? 87 DT  C OP2    1  
ATOM 1821  O "O5'"  . DT  C 3 8  ? 47.116 26.153 36.999 1.00 0.00 ? 87 DT  C "O5'"  1  
ATOM 1822  C "C5'"  . DT  C 3 8  ? 46.387 26.752 38.063 1.00 0.00 ? 87 DT  C "C5'"  1  
ATOM 1823  C "C4'"  . DT  C 3 8  ? 45.008 26.114 38.260 1.00 0.00 ? 87 DT  C "C4'"  1  
ATOM 1824  O "O4'"  . DT  C 3 8  ? 44.192 26.390 37.130 1.00 0.00 ? 87 DT  C "O4'"  1  
ATOM 1825  C "C3'"  . DT  C 3 8  ? 45.101 24.586 38.437 1.00 0.00 ? 87 DT  C "C3'"  1  
ATOM 1826  O "O3'"  . DT  C 3 8  ? 44.702 24.001 39.691 1.00 0.00 ? 87 DT  C "O3'"  1  
ATOM 1827  C "C2'"  . DT  C 3 8  ? 44.338 24.033 37.234 1.00 0.00 ? 87 DT  C "C2'"  1  
ATOM 1828  C "C1'"  . DT  C 3 8  ? 43.522 25.219 36.708 1.00 0.00 ? 87 DT  C "C1'"  1  
ATOM 1829  N N1     . DT  C 3 8  ? 43.392 25.270 35.222 1.00 0.00 ? 87 DT  C N1     1  
ATOM 1830  C C2     . DT  C 3 8  ? 42.112 25.428 34.672 1.00 0.00 ? 87 DT  C C2     1  
ATOM 1831  O O2     . DT  C 3 8  ? 41.076 25.464 35.329 1.00 0.00 ? 87 DT  C O2     1  
ATOM 1832  N N3     . DT  C 3 8  ? 42.031 25.531 33.304 1.00 0.00 ? 87 DT  C N3     1  
ATOM 1833  C C4     . DT  C 3 8  ? 43.083 25.457 32.424 1.00 0.00 ? 87 DT  C C4     1  
ATOM 1834  O O4     . DT  C 3 8  ? 42.861 25.567 31.218 1.00 0.00 ? 87 DT  C O4     1  
ATOM 1835  C C5     . DT  C 3 8  ? 44.388 25.267 33.048 1.00 0.00 ? 87 DT  C C5     1  
ATOM 1836  C C7     . DT  C 3 8  ? 45.626 25.153 32.176 1.00 0.00 ? 87 DT  C C7     1  
ATOM 1837  C C6     . DT  C 3 8  ? 44.506 25.194 34.403 1.00 0.00 ? 87 DT  C C6     1  
ATOM 1838  H "H5'"  . DT  C 3 8  ? 46.253 27.818 37.864 1.00 0.00 ? 87 DT  C "H5'"  1  
ATOM 1839  H "H5''" . DT  C 3 8  ? 46.949 26.643 38.990 1.00 0.00 ? 87 DT  C "H5''" 1  
ATOM 1840  H "H4'"  . DT  C 3 8  ? 44.564 26.577 39.131 1.00 0.00 ? 87 DT  C "H4'"  1  
ATOM 1841  H "H3'"  . DT  C 3 8  ? 46.146 24.305 38.298 1.00 0.00 ? 87 DT  C "H3'"  1  
ATOM 1842  H "H2'"  . DT  C 3 8  ? 45.055 23.681 36.494 1.00 0.00 ? 87 DT  C "H2'"  1  
ATOM 1843  H "H2''" . DT  C 3 8  ? 43.687 23.209 37.511 1.00 0.00 ? 87 DT  C "H2''" 1  
ATOM 1844  H "H1'"  . DT  C 3 8  ? 42.532 25.181 37.174 1.00 0.00 ? 87 DT  C "H1'"  1  
ATOM 1845  H H3     . DT  C 3 8  ? 41.101 25.612 32.917 1.00 0.00 ? 87 DT  C H3     1  
ATOM 1846  H H71    . DT  C 3 8  ? 46.523 25.055 32.785 1.00 0.00 ? 87 DT  C H71    1  
ATOM 1847  H H72    . DT  C 3 8  ? 45.533 24.278 31.532 1.00 0.00 ? 87 DT  C H72    1  
ATOM 1848  H H73    . DT  C 3 8  ? 45.711 26.036 31.542 1.00 0.00 ? 87 DT  C H73    1  
ATOM 1849  H H6     . DT  C 3 8  ? 45.486 25.082 34.854 1.00 0.00 ? 87 DT  C H6     1  
ATOM 1850  P P      . DA  C 3 9  ? 43.325 24.279 40.499 1.00 0.00 ? 88 DA  C P      1  
ATOM 1851  O OP1    . DA  C 3 9  ? 43.159 25.726 40.737 1.00 0.00 ? 88 DA  C OP1    1  
ATOM 1852  O OP2    . DA  C 3 9  ? 43.356 23.379 41.674 1.00 0.00 ? 88 DA  C OP2    1  
ATOM 1853  O "O5'"  . DA  C 3 9  ? 42.141 23.804 39.543 1.00 0.00 ? 88 DA  C "O5'"  1  
ATOM 1854  C "C5'"  . DA  C 3 9  ? 41.754 22.437 39.438 1.00 0.00 ? 88 DA  C "C5'"  1  
ATOM 1855  C "C4'"  . DA  C 3 9  ? 40.699 22.264 38.340 1.00 0.00 ? 88 DA  C "C4'"  1  
ATOM 1856  O "O4'"  . DA  C 3 9  ? 41.189 22.755 37.103 1.00 0.00 ? 88 DA  C "O4'"  1  
ATOM 1857  C "C3'"  . DA  C 3 9  ? 40.309 20.802 38.093 1.00 0.00 ? 88 DA  C "C3'"  1  
ATOM 1858  O "O3'"  . DA  C 3 9  ? 39.100 20.456 38.763 1.00 0.00 ? 88 DA  C "O3'"  1  
ATOM 1859  C "C2'"  . DA  C 3 9  ? 40.178 20.718 36.571 1.00 0.00 ? 88 DA  C "C2'"  1  
ATOM 1860  C "C1'"  . DA  C 3 9  ? 40.471 22.124 36.066 1.00 0.00 ? 88 DA  C "C1'"  1  
ATOM 1861  N N9     . DA  C 3 9  ? 41.264 22.101 34.821 1.00 0.00 ? 88 DA  C N9     1  
ATOM 1862  C C8     . DA  C 3 9  ? 42.623 21.972 34.670 1.00 0.00 ? 88 DA  C C8     1  
ATOM 1863  N N7     . DA  C 3 9  ? 43.039 22.050 33.432 1.00 0.00 ? 88 DA  C N7     1  
ATOM 1864  C C5     . DA  C 3 9  ? 41.838 22.198 32.711 1.00 0.00 ? 88 DA  C C5     1  
ATOM 1865  C C6     . DA  C 3 9  ? 41.491 22.351 31.346 1.00 0.00 ? 88 DA  C C6     1  
ATOM 1866  N N6     . DA  C 3 9  ? 42.340 22.390 30.339 1.00 0.00 ? 88 DA  C N6     1  
ATOM 1867  N N1     . DA  C 3 9  ? 40.218 22.457 30.963 1.00 0.00 ? 88 DA  C N1     1  
ATOM 1868  C C2     . DA  C 3 9  ? 39.283 22.424 31.899 1.00 0.00 ? 88 DA  C C2     1  
ATOM 1869  N N3     . DA  C 3 9  ? 39.441 22.312 33.211 1.00 0.00 ? 88 DA  C N3     1  
ATOM 1870  C C4     . DA  C 3 9  ? 40.756 22.204 33.550 1.00 0.00 ? 88 DA  C C4     1  
ATOM 1871  H "H5'"  . DA  C 3 9  ? 41.341 22.094 40.388 1.00 0.00 ? 88 DA  C "H5'"  1  
ATOM 1872  H "H5''" . DA  C 3 9  ? 42.622 21.824 39.191 1.00 0.00 ? 88 DA  C "H5''" 1  
ATOM 1873  H "H4'"  . DA  C 3 9  ? 39.805 22.813 38.624 1.00 0.00 ? 88 DA  C "H4'"  1  
ATOM 1874  H "H3'"  . DA  C 3 9  ? 41.129 20.158 38.410 1.00 0.00 ? 88 DA  C "H3'"  1  
ATOM 1875  H "H2'"  . DA  C 3 9  ? 40.915 20.009 36.194 1.00 0.00 ? 88 DA  C "H2'"  1  
ATOM 1876  H "H2''" . DA  C 3 9  ? 39.177 20.430 36.256 1.00 0.00 ? 88 DA  C "H2''" 1  
ATOM 1877  H "H1'"  . DA  C 3 9  ? 39.531 22.652 35.882 1.00 0.00 ? 88 DA  C "H1'"  1  
ATOM 1878  H H8     . DA  C 3 9  ? 43.287 21.836 35.514 1.00 0.00 ? 88 DA  C H8     1  
ATOM 1879  H H61    . DA  C 3 9  ? 43.306 22.146 30.504 1.00 0.00 ? 88 DA  C H61    1  
ATOM 1880  H H62    . DA  C 3 9  ? 41.974 22.511 29.407 1.00 0.00 ? 88 DA  C H62    1  
ATOM 1881  H H2     . DA  C 3 9  ? 38.263 22.516 31.552 1.00 0.00 ? 88 DA  C H2     1  
ATOM 1882  P P      . DG  C 3 10 ? 38.552 18.951 38.783 1.00 0.00 ? 89 DG  C P      1  
ATOM 1883  O OP1    . DG  C 3 10 ? 37.634 18.778 39.927 1.00 0.00 ? 89 DG  C OP1    1  
ATOM 1884  O OP2    . DG  C 3 10 ? 39.716 18.044 38.732 1.00 0.00 ? 89 DG  C OP2    1  
ATOM 1885  O "O5'"  . DG  C 3 10 ? 37.745 18.716 37.435 1.00 0.00 ? 89 DG  C "O5'"  1  
ATOM 1886  C "C5'"  . DG  C 3 10 ? 36.506 19.360 37.165 1.00 0.00 ? 89 DG  C "C5'"  1  
ATOM 1887  C "C4'"  . DG  C 3 10 ? 35.901 18.892 35.831 1.00 0.00 ? 89 DG  C "C4'"  1  
ATOM 1888  O "O4'"  . DG  C 3 10 ? 36.697 19.380 34.757 1.00 0.00 ? 89 DG  C "O4'"  1  
ATOM 1889  C "C3'"  . DG  C 3 10 ? 35.859 17.358 35.742 1.00 0.00 ? 89 DG  C "C3'"  1  
ATOM 1890  O "O3'"  . DG  C 3 10 ? 34.636 16.854 35.206 1.00 0.00 ? 89 DG  C "O3'"  1  
ATOM 1891  C "C2'"  . DG  C 3 10 ? 37.047 17.046 34.838 1.00 0.00 ? 89 DG  C "C2'"  1  
ATOM 1892  C "C1'"  . DG  C 3 10 ? 37.106 18.285 33.955 1.00 0.00 ? 89 DG  C "C1'"  1  
ATOM 1893  N N9     . DG  C 3 10 ? 38.445 18.520 33.368 1.00 0.00 ? 89 DG  C N9     1  
ATOM 1894  C C8     . DG  C 3 10 ? 39.676 18.561 33.973 1.00 0.00 ? 89 DG  C C8     1  
ATOM 1895  N N7     . DG  C 3 10 ? 40.677 18.788 33.158 1.00 0.00 ? 89 DG  C N7     1  
ATOM 1896  C C5     . DG  C 3 10 ? 40.050 18.901 31.903 1.00 0.00 ? 89 DG  C C5     1  
ATOM 1897  C C6     . DG  C 3 10 ? 40.563 19.150 30.578 1.00 0.00 ? 89 DG  C C6     1  
ATOM 1898  O O6     . DG  C 3 10 ? 41.722 19.353 30.207 1.00 0.00 ? 89 DG  C O6     1  
ATOM 1899  N N1     . DG  C 3 10 ? 39.584 19.161 29.605 1.00 0.00 ? 89 DG  C N1     1  
ATOM 1900  C C2     . DG  C 3 10 ? 38.277 18.914 29.851 1.00 0.00 ? 89 DG  C C2     1  
ATOM 1901  N N2     . DG  C 3 10 ? 37.461 18.879 28.841 1.00 0.00 ? 89 DG  C N2     1  
ATOM 1902  N N3     . DG  C 3 10 ? 37.754 18.683 31.042 1.00 0.00 ? 89 DG  C N3     1  
ATOM 1903  C C4     . DG  C 3 10 ? 38.691 18.703 32.033 1.00 0.00 ? 89 DG  C C4     1  
ATOM 1904  H "H5'"  . DG  C 3 10 ? 36.646 20.440 37.129 1.00 0.00 ? 89 DG  C "H5'"  1  
ATOM 1905  H "H5''" . DG  C 3 10 ? 35.795 19.137 37.960 1.00 0.00 ? 89 DG  C "H5''" 1  
ATOM 1906  H "H4'"  . DG  C 3 10 ? 34.888 19.284 35.742 1.00 0.00 ? 89 DG  C "H4'"  1  
ATOM 1907  H "H3'"  . DG  C 3 10 ? 36.023 16.939 36.733 1.00 0.00 ? 89 DG  C "H3'"  1  
ATOM 1908  H "H2'"  . DG  C 3 10 ? 37.946 16.970 35.446 1.00 0.00 ? 89 DG  C "H2'"  1  
ATOM 1909  H "H2''" . DG  C 3 10 ? 36.908 16.140 34.247 1.00 0.00 ? 89 DG  C "H2''" 1  
ATOM 1910  H "H1'"  . DG  C 3 10 ? 36.389 18.161 33.141 1.00 0.00 ? 89 DG  C "H1'"  1  
ATOM 1911  H H8     . DG  C 3 10 ? 39.783 18.421 35.040 1.00 0.00 ? 89 DG  C H8     1  
ATOM 1912  H H1     . DG  C 3 10 ? 39.865 19.355 28.659 1.00 0.00 ? 89 DG  C H1     1  
ATOM 1913  H H21    . DG  C 3 10 ? 36.501 18.652 29.033 1.00 0.00 ? 89 DG  C H21    1  
ATOM 1914  H H22    . DG  C 3 10 ? 37.781 19.124 27.913 1.00 0.00 ? 89 DG  C H22    1  
ATOM 1915  P P      . DA  C 3 11 ? 34.270 15.288 35.296 1.00 0.00 ? 90 DA  C P      1  
ATOM 1916  O OP1    . DA  C 3 11 ? 32.886 15.205 35.809 1.00 0.00 ? 90 DA  C OP1    1  
ATOM 1917  O OP2    . DA  C 3 11 ? 35.341 14.601 36.060 1.00 0.00 ? 90 DA  C OP2    1  
ATOM 1918  O "O5'"  . DA  C 3 11 ? 34.291 14.762 33.790 1.00 0.00 ? 90 DA  C "O5'"  1  
ATOM 1919  C "C5'"  . DA  C 3 11 ? 33.174 14.979 32.936 1.00 0.00 ? 90 DA  C "C5'"  1  
ATOM 1920  C "C4'"  . DA  C 3 11 ? 33.372 14.480 31.497 1.00 0.00 ? 90 DA  C "C4'"  1  
ATOM 1921  O "O4'"  . DA  C 3 11 ? 34.499 15.134 30.911 1.00 0.00 ? 90 DA  C "O4'"  1  
ATOM 1922  C "C3'"  . DA  C 3 11 ? 33.574 12.961 31.391 1.00 0.00 ? 90 DA  C "C3'"  1  
ATOM 1923  O "O3'"  . DA  C 3 11 ? 32.761 12.502 30.316 1.00 0.00 ? 90 DA  C "O3'"  1  
ATOM 1924  C "C2'"  . DA  C 3 11 ? 35.078 12.860 31.160 1.00 0.00 ? 90 DA  C "C2'"  1  
ATOM 1925  C "C1'"  . DA  C 3 11 ? 35.399 14.155 30.417 1.00 0.00 ? 90 DA  C "C1'"  1  
ATOM 1926  N N9     . DA  C 3 11 ? 36.808 14.587 30.596 1.00 0.00 ? 90 DA  C N9     1  
ATOM 1927  C C8     . DA  C 3 11 ? 37.601 14.488 31.717 1.00 0.00 ? 90 DA  C C8     1  
ATOM 1928  N N7     . DA  C 3 11 ? 38.848 14.845 31.543 1.00 0.00 ? 90 DA  C N7     1  
ATOM 1929  C C5     . DA  C 3 11 ? 38.862 15.245 30.195 1.00 0.00 ? 90 DA  C C5     1  
ATOM 1930  C C6     . DA  C 3 11 ? 39.843 15.769 29.319 1.00 0.00 ? 90 DA  C C6     1  
ATOM 1931  N N6     . DA  C 3 11 ? 41.090 16.018 29.652 1.00 0.00 ? 90 DA  C N6     1  
ATOM 1932  N N1     . DA  C 3 11 ? 39.555 16.076 28.055 1.00 0.00 ? 90 DA  C N1     1  
ATOM 1933  C C2     . DA  C 3 11 ? 38.313 15.883 27.642 1.00 0.00 ? 90 DA  C C2     1  
ATOM 1934  N N3     . DA  C 3 11 ? 37.280 15.409 28.329 1.00 0.00 ? 90 DA  C N3     1  
ATOM 1935  C C4     . DA  C 3 11 ? 37.628 15.103 29.617 1.00 0.00 ? 90 DA  C C4     1  
ATOM 1936  H "H5'"  . DA  C 3 11 ? 32.933 16.041 32.902 1.00 0.00 ? 90 DA  C "H5'"  1  
ATOM 1937  H "H5''" . DA  C 3 11 ? 32.307 14.472 33.357 1.00 0.00 ? 90 DA  C "H5''" 1  
ATOM 1938  H "H4'"  . DA  C 3 11 ? 32.477 14.748 30.934 1.00 0.00 ? 90 DA  C "H4'"  1  
ATOM 1939  H "H3'"  . DA  C 3 11 ? 33.295 12.469 32.326 1.00 0.00 ? 90 DA  C "H3'"  1  
ATOM 1940  H "H2'"  . DA  C 3 11 ? 35.562 12.838 32.135 1.00 0.00 ? 90 DA  C "H2'"  1  
ATOM 1941  H "H2''" . DA  C 3 11 ? 35.367 11.982 30.582 1.00 0.00 ? 90 DA  C "H2''" 1  
ATOM 1942  H "H1'"  . DA  C 3 11 ? 35.199 13.998 29.353 1.00 0.00 ? 90 DA  C "H1'"  1  
ATOM 1943  H H8     . DA  C 3 11 ? 37.220 14.127 32.664 1.00 0.00 ? 90 DA  C H8     1  
ATOM 1944  H H61    . DA  C 3 11 ? 41.410 15.786 30.583 1.00 0.00 ? 90 DA  C H61    1  
ATOM 1945  H H62    . DA  C 3 11 ? 41.713 16.412 28.960 1.00 0.00 ? 90 DA  C H62    1  
ATOM 1946  H H2     . DA  C 3 11 ? 38.120 16.157 26.613 1.00 0.00 ? 90 DA  C H2     1  
ATOM 1947  P P      . DG  C 3 12 ? 32.844 11.049 29.662 1.00 0.00 ? 91 DG  C P      1  
ATOM 1948  O OP1    . DG  C 3 12 ? 31.496 10.693 29.173 1.00 0.00 ? 91 DG  C OP1    1  
ATOM 1949  O OP2    . DG  C 3 12 ? 33.515 10.106 30.585 1.00 0.00 ? 91 DG  C OP2    1  
ATOM 1950  O "O5'"  . DG  C 3 12 ? 33.777 11.310 28.396 1.00 0.00 ? 91 DG  C "O5'"  1  
ATOM 1951  C "C5'"  . DG  C 3 12 ? 33.335 12.181 27.360 1.00 0.00 ? 91 DG  C "C5'"  1  
ATOM 1952  C "C4'"  . DG  C 3 12 ? 34.218 12.176 26.108 1.00 0.00 ? 91 DG  C "C4'"  1  
ATOM 1953  O "O4'"  . DG  C 3 12 ? 35.495 12.755 26.369 1.00 0.00 ? 91 DG  C "O4'"  1  
ATOM 1954  C "C3'"  . DG  C 3 12 ? 34.460 10.763 25.565 1.00 0.00 ? 91 DG  C "C3'"  1  
ATOM 1955  O "O3'"  . DG  C 3 12 ? 34.475 10.828 24.146 1.00 0.00 ? 91 DG  C "O3'"  1  
ATOM 1956  C "C2'"  . DG  C 3 12 ? 35.827 10.424 26.149 1.00 0.00 ? 91 DG  C "C2'"  1  
ATOM 1957  C "C1'"  . DG  C 3 12 ? 36.502 11.794 26.090 1.00 0.00 ? 91 DG  C "C1'"  1  
ATOM 1958  N N9     . DG  C 3 12 ? 37.609 11.961 27.054 1.00 0.00 ? 91 DG  C N9     1  
ATOM 1959  C C8     . DG  C 3 12 ? 37.661 11.619 28.385 1.00 0.00 ? 91 DG  C C8     1  
ATOM 1960  N N7     . DG  C 3 12 ? 38.812 11.870 28.953 1.00 0.00 ? 91 DG  C N7     1  
ATOM 1961  C C5     . DG  C 3 12 ? 39.586 12.412 27.917 1.00 0.00 ? 91 DG  C C5     1  
ATOM 1962  C C6     . DG  C 3 12 ? 40.956 12.851 27.869 1.00 0.00 ? 91 DG  C C6     1  
ATOM 1963  O O6     . DG  C 3 12 ? 41.810 12.848 28.754 1.00 0.00 ? 91 DG  C O6     1  
ATOM 1964  N N1     . DG  C 3 12 ? 41.343 13.317 26.632 1.00 0.00 ? 91 DG  C N1     1  
ATOM 1965  C C2     . DG  C 3 12 ? 40.532 13.351 25.552 1.00 0.00 ? 91 DG  C C2     1  
ATOM 1966  N N2     . DG  C 3 12 ? 41.045 13.787 24.436 1.00 0.00 ? 91 DG  C N2     1  
ATOM 1967  N N3     . DG  C 3 12 ? 39.263 12.951 25.537 1.00 0.00 ? 91 DG  C N3     1  
ATOM 1968  C C4     . DG  C 3 12 ? 38.847 12.483 26.756 1.00 0.00 ? 91 DG  C C4     1  
ATOM 1969  H "H5'"  . DG  C 3 12 ? 33.274 13.203 27.741 1.00 0.00 ? 91 DG  C "H5'"  1  
ATOM 1970  H "H5''" . DG  C 3 12 ? 32.334 11.875 27.047 1.00 0.00 ? 91 DG  C "H5''" 1  
ATOM 1971  H "H4'"  . DG  C 3 12 ? 33.707 12.762 25.342 1.00 0.00 ? 91 DG  C "H4'"  1  
ATOM 1972  H "H3'"  . DG  C 3 12 ? 33.693 10.070 25.912 1.00 0.00 ? 91 DG  C "H3'"  1  
ATOM 1973  H "H2'"  . DG  C 3 12 ? 35.714 10.064 27.173 1.00 0.00 ? 91 DG  C "H2'"  1  
ATOM 1974  H "H2''" . DG  C 3 12 ? 36.357 9.689  25.549 1.00 0.00 ? 91 DG  C "H2''" 1  
ATOM 1975  H "H1'"  . DG  C 3 12 ? 36.876 11.940 25.070 1.00 0.00 ? 91 DG  C "H1'"  1  
ATOM 1976  H H8     . DG  C 3 12 ? 36.819 11.179 28.908 1.00 0.00 ? 91 DG  C H8     1  
ATOM 1977  H H1     . DG  C 3 12 ? 42.299 13.622 26.534 1.00 0.00 ? 91 DG  C H1     1  
ATOM 1978  H H21    . DG  C 3 12 ? 40.451 13.776 23.615 1.00 0.00 ? 91 DG  C H21    1  
ATOM 1979  H H22    . DG  C 3 12 ? 42.014 14.084 24.392 1.00 0.00 ? 91 DG  C H22    1  
ATOM 1980  P P      . DC  C 3 13 ? 34.553 9.540  23.211 1.00 0.00 ? 92 DC  C P      1  
ATOM 1981  O OP1    . DC  C 3 13 ? 33.690 9.825  22.038 1.00 0.00 ? 92 DC  C OP1    1  
ATOM 1982  O OP2    . DC  C 3 13 ? 34.306 8.312  23.999 1.00 0.00 ? 92 DC  C OP2    1  
ATOM 1983  O "O5'"  . DC  C 3 13 ? 36.073 9.493  22.732 1.00 0.00 ? 92 DC  C "O5'"  1  
ATOM 1984  C "C5'"  . DC  C 3 13 ? 36.527 10.322 21.674 1.00 0.00 ? 92 DC  C "C5'"  1  
ATOM 1985  C "C4'"  . DC  C 3 13 ? 38.015 10.160 21.355 1.00 0.00 ? 92 DC  C "C4'"  1  
ATOM 1986  O "O4'"  . DC  C 3 13 ? 38.787 10.568 22.477 1.00 0.00 ? 92 DC  C "O4'"  1  
ATOM 1987  C "C3'"  . DC  C 3 13 ? 38.413 8.715  21.007 1.00 0.00 ? 92 DC  C "C3'"  1  
ATOM 1988  O "O3'"  . DC  C 3 13 ? 39.220 8.677  19.838 1.00 0.00 ? 92 DC  C "O3'"  1  
ATOM 1989  C "C2'"  . DC  C 3 13 ? 39.245 8.291  22.204 1.00 0.00 ? 92 DC  C "C2'"  1  
ATOM 1990  C "C1'"  . DC  C 3 13 ? 39.836 9.635  22.633 1.00 0.00 ? 92 DC  C "C1'"  1  
ATOM 1991  N N1     . DC  C 3 13 ? 40.328 9.646  24.036 1.00 0.00 ? 92 DC  C N1     1  
ATOM 1992  C C2     . DC  C 3 13 ? 41.658 10.001 24.293 1.00 0.00 ? 92 DC  C C2     1  
ATOM 1993  O O2     . DC  C 3 13 ? 42.435 10.312 23.380 1.00 0.00 ? 92 DC  C O2     1  
ATOM 1994  N N3     . DC  C 3 13 ? 42.142 10.004 25.557 1.00 0.00 ? 92 DC  C N3     1  
ATOM 1995  C C4     . DC  C 3 13 ? 41.336 9.638  26.536 1.00 0.00 ? 92 DC  C C4     1  
ATOM 1996  N N4     . DC  C 3 13 ? 41.816 9.702  27.741 1.00 0.00 ? 92 DC  C N4     1  
ATOM 1997  C C5     . DC  C 3 13 ? 39.975 9.280  26.342 1.00 0.00 ? 92 DC  C C5     1  
ATOM 1998  C C6     . DC  C 3 13 ? 39.499 9.298  25.074 1.00 0.00 ? 92 DC  C C6     1  
ATOM 1999  H "H5'"  . DC  C 3 13 ? 36.347 11.366 21.935 1.00 0.00 ? 92 DC  C "H5'"  1  
ATOM 2000  H "H5''" . DC  C 3 13 ? 35.963 10.080 20.773 1.00 0.00 ? 92 DC  C "H5''" 1  
ATOM 2001  H "H4'"  . DC  C 3 13 ? 38.257 10.801 20.505 1.00 0.00 ? 92 DC  C "H4'"  1  
ATOM 2002  H "H3'"  . DC  C 3 13 ? 37.537 8.071  20.896 1.00 0.00 ? 92 DC  C "H3'"  1  
ATOM 2003  H "HO3'" . DC  C 3 13 ? 38.637 8.923  19.085 1.00 0.00 ? 92 DC  C "HO3'" 1  
ATOM 2004  H "H2'"  . DC  C 3 13 ? 38.588 7.874  22.967 1.00 0.00 ? 92 DC  C "H2'"  1  
ATOM 2005  H "H2''" . DC  C 3 13 ? 40.018 7.572  21.933 1.00 0.00 ? 92 DC  C "H2''" 1  
ATOM 2006  H "H1'"  . DC  C 3 13 ? 40.638 9.890  21.932 1.00 0.00 ? 92 DC  C "H1'"  1  
ATOM 2007  H H41    . DC  C 3 13 ? 41.207 9.492  28.523 1.00 0.00 ? 92 DC  C H41    1  
ATOM 2008  H H42    . DC  C 3 13 ? 42.751 10.050 27.893 1.00 0.00 ? 92 DC  C H42    1  
ATOM 2009  H H5     . DC  C 3 13 ? 39.330 9.001  27.163 1.00 0.00 ? 92 DC  C H5     1  
ATOM 2010  H H6     . DC  C 3 13 ? 38.467 9.044  24.864 1.00 0.00 ? 92 DC  C H6     1  
ATOM 2011  N N      . GLY A 1 1  ? 42.776 26.457 49.950 1.00 0.00 ? -2 GLY A N      2  
ATOM 2012  C CA     . GLY A 1 1  ? 43.454 25.594 48.970 1.00 0.00 ? -2 GLY A CA     2  
ATOM 2013  C C      . GLY A 1 1  ? 42.586 24.412 48.569 1.00 0.00 ? -2 GLY A C      2  
ATOM 2014  O O      . GLY A 1 1  ? 41.695 24.012 49.319 1.00 0.00 ? -2 GLY A O      2  
ATOM 2015  H H1     . GLY A 1 1  ? 41.989 26.927 49.523 1.00 0.00 ? -2 GLY A H1     2  
ATOM 2016  H H2     . GLY A 1 1  ? 43.415 27.156 50.304 1.00 0.00 ? -2 GLY A H2     2  
ATOM 2017  H H3     . GLY A 1 1  ? 42.451 25.897 50.729 1.00 0.00 ? -2 GLY A H3     2  
ATOM 2018  H HA2    . GLY A 1 1  ? 43.699 26.178 48.084 1.00 0.00 ? -2 GLY A HA2    2  
ATOM 2019  H HA3    . GLY A 1 1  ? 44.373 25.212 49.411 1.00 0.00 ? -2 GLY A HA3    2  
ATOM 2020  N N      . SER A 1 2  ? 42.861 23.828 47.398 1.00 0.00 ? -1 SER A N      2  
ATOM 2021  C CA     . SER A 1 2  ? 42.155 22.668 46.815 1.00 0.00 ? -1 SER A CA     2  
ATOM 2022  C C      . SER A 1 2  ? 40.620 22.812 46.792 1.00 0.00 ? -1 SER A C      2  
ATOM 2023  O O      . SER A 1 2  ? 39.882 21.868 47.085 1.00 0.00 ? -1 SER A O      2  
ATOM 2024  C CB     . SER A 1 2  ? 42.611 21.354 47.466 1.00 0.00 ? -1 SER A CB     2  
ATOM 2025  O OG     . SER A 1 2  ? 44.009 21.156 47.309 1.00 0.00 ? -1 SER A OG     2  
ATOM 2026  H H      . SER A 1 2  ? 43.627 24.213 46.858 1.00 0.00 ? -1 SER A H      2  
ATOM 2027  H HA     . SER A 1 2  ? 42.454 22.616 45.772 1.00 0.00 ? -1 SER A HA     2  
ATOM 2028  H HB2    . SER A 1 2  ? 42.359 21.370 48.528 1.00 0.00 ? -1 SER A HB2    2  
ATOM 2029  H HB3    . SER A 1 2  ? 42.086 20.518 47.000 1.00 0.00 ? -1 SER A HB3    2  
ATOM 2030  H HG     . SER A 1 2  ? 44.215 20.314 47.782 1.00 0.00 ? -1 SER A HG     2  
ATOM 2031  N N      . GLN A 1 3  ? 40.132 24.023 46.512 1.00 0.00 ? 1  GLN A N      2  
ATOM 2032  C CA     . GLN A 1 3  ? 38.731 24.410 46.667 1.00 0.00 ? 1  GLN A CA     2  
ATOM 2033  C C      . GLN A 1 3  ? 38.296 25.387 45.562 1.00 0.00 ? 1  GLN A C      2  
ATOM 2034  O O      . GLN A 1 3  ? 38.264 26.604 45.760 1.00 0.00 ? 1  GLN A O      2  
ATOM 2035  C CB     . GLN A 1 3  ? 38.561 24.963 48.094 1.00 0.00 ? 1  GLN A CB     2  
ATOM 2036  C CG     . GLN A 1 3  ? 37.093 25.256 48.419 1.00 0.00 ? 1  GLN A CG     2  
ATOM 2037  C CD     . GLN A 1 3  ? 36.837 25.634 49.875 1.00 0.00 ? 1  GLN A CD     2  
ATOM 2038  O OE1    . GLN A 1 3  ? 37.693 25.597 50.753 1.00 0.00 ? 1  GLN A OE1    2  
ATOM 2039  N NE2    . GLN A 1 3  ? 35.607 25.984 50.164 1.00 0.00 ? 1  GLN A NE2    2  
ATOM 2040  H H      . GLN A 1 3  ? 40.795 24.766 46.307 1.00 0.00 ? 1  GLN A H      2  
ATOM 2041  H HA     . GLN A 1 3  ? 38.105 23.525 46.564 1.00 0.00 ? 1  GLN A HA     2  
ATOM 2042  H HB2    . GLN A 1 3  ? 38.925 24.216 48.802 1.00 0.00 ? 1  GLN A HB2    2  
ATOM 2043  H HB3    . GLN A 1 3  ? 39.152 25.873 48.218 1.00 0.00 ? 1  GLN A HB3    2  
ATOM 2044  H HG2    . GLN A 1 3  ? 36.734 26.071 47.792 1.00 0.00 ? 1  GLN A HG2    2  
ATOM 2045  H HG3    . GLN A 1 3  ? 36.503 24.373 48.189 1.00 0.00 ? 1  GLN A HG3    2  
ATOM 2046  H HE21   . GLN A 1 3  ? 34.909 25.961 49.434 1.00 0.00 ? 1  GLN A HE21   2  
ATOM 2047  H HE22   . GLN A 1 3  ? 35.370 26.287 51.102 1.00 0.00 ? 1  GLN A HE22   2  
ATOM 2048  N N      . ARG A 1 4  ? 37.974 24.855 44.376 1.00 0.00 ? 2  ARG A N      2  
ATOM 2049  C CA     . ARG A 1 4  ? 37.512 25.602 43.192 1.00 0.00 ? 2  ARG A CA     2  
ATOM 2050  C C      . ARG A 1 4  ? 36.491 24.806 42.361 1.00 0.00 ? 2  ARG A C      2  
ATOM 2051  O O      . ARG A 1 4  ? 36.402 23.578 42.442 1.00 0.00 ? 2  ARG A O      2  
ATOM 2052  C CB     . ARG A 1 4  ? 38.727 25.938 42.299 1.00 0.00 ? 2  ARG A CB     2  
ATOM 2053  C CG     . ARG A 1 4  ? 39.753 26.897 42.923 1.00 0.00 ? 2  ARG A CG     2  
ATOM 2054  C CD     . ARG A 1 4  ? 40.919 27.147 41.957 1.00 0.00 ? 2  ARG A CD     2  
ATOM 2055  N NE     . ARG A 1 4  ? 41.808 28.199 42.475 1.00 0.00 ? 2  ARG A NE     2  
ATOM 2056  C CZ     . ARG A 1 4  ? 43.089 28.114 42.778 1.00 0.00 ? 2  ARG A CZ     2  
ATOM 2057  N NH1    . ARG A 1 4  ? 43.801 27.032 42.654 1.00 0.00 1 2  ARG A NH1    2  
ATOM 2058  N NH2    . ARG A 1 4  ? 43.699 29.168 43.227 1.00 0.00 ? 2  ARG A NH2    2  
ATOM 2059  H H      . ARG A 1 4  ? 38.149 23.858 44.250 1.00 0.00 ? 2  ARG A H      2  
ATOM 2060  H HA     . ARG A 1 4  ? 37.030 26.528 43.512 1.00 0.00 ? 2  ARG A HA     2  
ATOM 2061  H HB2    . ARG A 1 4  ? 39.228 25.006 42.046 1.00 0.00 ? 2  ARG A HB2    2  
ATOM 2062  H HB3    . ARG A 1 4  ? 38.375 26.392 41.372 1.00 0.00 ? 2  ARG A HB3    2  
ATOM 2063  H HG2    . ARG A 1 4  ? 39.263 27.842 43.156 1.00 0.00 ? 2  ARG A HG2    2  
ATOM 2064  H HG3    . ARG A 1 4  ? 40.158 26.468 43.838 1.00 0.00 ? 2  ARG A HG3    2  
ATOM 2065  H HD2    . ARG A 1 4  ? 41.464 26.215 41.809 1.00 0.00 ? 2  ARG A HD2    2  
ATOM 2066  H HD3    . ARG A 1 4  ? 40.526 27.469 40.993 1.00 0.00 ? 2  ARG A HD3    2  
ATOM 2067  H HE     . ARG A 1 4  ? 41.393 29.110 42.645 1.00 0.00 ? 2  ARG A HE     2  
ATOM 2068  H HH11   . ARG A 1 4  ? 43.381 26.163 42.339 1.00 0.00 ? 2  ARG A HH11   2  
ATOM 2069  H HH12   . ARG A 1 4  ? 44.771 27.071 42.931 1.00 0.00 ? 2  ARG A HH12   2  
ATOM 2070  H HH21   . ARG A 1 4  ? 43.143 30.003 43.402 1.00 0.00 ? 2  ARG A HH21   2  
ATOM 2071  H HH22   . ARG A 1 4  ? 44.678 29.116 43.462 1.00 0.00 ? 2  ARG A HH22   2  
ATOM 2072  N N      . ARG A 1 5  ? 35.816 25.522 41.458 1.00 0.00 ? 3  ARG A N      2  
ATOM 2073  C CA     . ARG A 1 5  ? 35.089 25.011 40.283 1.00 0.00 ? 3  ARG A CA     2  
ATOM 2074  C C      . ARG A 1 5  ? 33.798 24.227 40.554 1.00 0.00 ? 3  ARG A C      2  
ATOM 2075  O O      . ARG A 1 5  ? 33.458 23.853 41.675 1.00 0.00 ? 3  ARG A O      2  
ATOM 2076  C CB     . ARG A 1 5  ? 36.057 24.308 39.299 1.00 0.00 ? 3  ARG A CB     2  
ATOM 2077  C CG     . ARG A 1 5  ? 37.061 25.286 38.648 1.00 0.00 ? 3  ARG A CG     2  
ATOM 2078  C CD     . ARG A 1 5  ? 37.373 24.971 37.174 1.00 0.00 ? 3  ARG A CD     2  
ATOM 2079  N NE     . ARG A 1 5  ? 36.178 25.156 36.327 1.00 0.00 ? 3  ARG A NE     2  
ATOM 2080  C CZ     . ARG A 1 5  ? 35.351 24.219 35.918 1.00 0.00 ? 3  ARG A CZ     2  
ATOM 2081  N NH1    . ARG A 1 5  ? 35.697 22.964 35.855 1.00 0.00 1 3  ARG A NH1    2  
ATOM 2082  N NH2    . ARG A 1 5  ? 34.120 24.530 35.633 1.00 0.00 ? 3  ARG A NH2    2  
ATOM 2083  H H      . ARG A 1 5  ? 35.792 26.525 41.606 1.00 0.00 ? 3  ARG A H      2  
ATOM 2084  H HA     . ARG A 1 5  ? 34.731 25.892 39.759 1.00 0.00 ? 3  ARG A HA     2  
ATOM 2085  H HB2    . ARG A 1 5  ? 36.599 23.509 39.805 1.00 0.00 ? 3  ARG A HB2    2  
ATOM 2086  H HB3    . ARG A 1 5  ? 35.467 23.827 38.524 1.00 0.00 ? 3  ARG A HB3    2  
ATOM 2087  H HG2    . ARG A 1 5  ? 36.672 26.303 38.693 1.00 0.00 ? 3  ARG A HG2    2  
ATOM 2088  H HG3    . ARG A 1 5  ? 37.990 25.265 39.216 1.00 0.00 ? 3  ARG A HG3    2  
ATOM 2089  H HD2    . ARG A 1 5  ? 38.143 25.665 36.837 1.00 0.00 ? 3  ARG A HD2    2  
ATOM 2090  H HD3    . ARG A 1 5  ? 37.769 23.960 37.088 1.00 0.00 ? 3  ARG A HD3    2  
ATOM 2091  H HE     . ARG A 1 5  ? 35.835 26.102 36.240 1.00 0.00 ? 3  ARG A HE     2  
ATOM 2092  H HH11   . ARG A 1 5  ? 36.682 22.724 35.895 1.00 0.00 ? 3  ARG A HH11   2  
ATOM 2093  H HH12   . ARG A 1 5  ? 35.016 22.243 35.715 1.00 0.00 ? 3  ARG A HH12   2  
ATOM 2094  H HH21   . ARG A 1 5  ? 33.815 25.495 35.689 1.00 0.00 ? 3  ARG A HH21   2  
ATOM 2095  H HH22   . ARG A 1 5  ? 33.412 23.818 35.754 1.00 0.00 ? 3  ARG A HH22   2  
ATOM 2096  N N      . GLN A 1 6  ? 33.056 24.068 39.459 1.00 0.00 ? 4  GLN A N      2  
ATOM 2097  C CA     . GLN A 1 6  ? 31.732 23.462 39.286 1.00 0.00 ? 4  GLN A CA     2  
ATOM 2098  C C      . GLN A 1 6  ? 31.709 22.759 37.904 1.00 0.00 ? 4  GLN A C      2  
ATOM 2099  O O      . GLN A 1 6  ? 32.707 22.787 37.172 1.00 0.00 ? 4  GLN A O      2  
ATOM 2100  C CB     . GLN A 1 6  ? 30.665 24.585 39.334 1.00 0.00 ? 4  GLN A CB     2  
ATOM 2101  C CG     . GLN A 1 6  ? 30.539 25.387 40.644 1.00 0.00 ? 4  GLN A CG     2  
ATOM 2102  C CD     . GLN A 1 6  ? 29.901 24.592 41.776 1.00 0.00 ? 4  GLN A CD     2  
ATOM 2103  O OE1    . GLN A 1 6  ? 28.716 24.715 42.064 1.00 0.00 ? 4  GLN A OE1    2  
ATOM 2104  N NE2    . GLN A 1 6  ? 30.650 23.740 42.441 1.00 0.00 ? 4  GLN A NE2    2  
ATOM 2105  H H      . GLN A 1 6  ? 33.488 24.362 38.599 1.00 0.00 ? 4  GLN A H      2  
ATOM 2106  H HA     . GLN A 1 6  ? 31.535 22.723 40.060 1.00 0.00 ? 4  GLN A HA     2  
ATOM 2107  H HB2    . GLN A 1 6  ? 30.896 25.300 38.544 1.00 0.00 ? 4  GLN A HB2    2  
ATOM 2108  H HB3    . GLN A 1 6  ? 29.684 24.159 39.113 1.00 0.00 ? 4  GLN A HB3    2  
ATOM 2109  H HG2    . GLN A 1 6  ? 31.510 25.766 40.960 1.00 0.00 ? 4  GLN A HG2    2  
ATOM 2110  H HG3    . GLN A 1 6  ? 29.907 26.254 40.450 1.00 0.00 ? 4  GLN A HG3    2  
ATOM 2111  H HE21   . GLN A 1 6  ? 31.645 23.680 42.253 1.00 0.00 ? 4  GLN A HE21   2  
ATOM 2112  H HE22   . GLN A 1 6  ? 30.210 23.175 43.159 1.00 0.00 ? 4  GLN A HE22   2  
ATOM 2113  N N      . ARG A 1 7  ? 30.570 22.200 37.481 1.00 0.00 ? 5  ARG A N      2  
ATOM 2114  C CA     . ARG A 1 7  ? 30.256 22.046 36.047 1.00 0.00 ? 5  ARG A CA     2  
ATOM 2115  C C      . ARG A 1 7  ? 28.753 22.171 35.811 1.00 0.00 ? 5  ARG A C      2  
ATOM 2116  O O      . ARG A 1 7  ? 27.958 21.750 36.655 1.00 0.00 ? 5  ARG A O      2  
ATOM 2117  C CB     . ARG A 1 7  ? 30.784 20.710 35.491 1.00 0.00 ? 5  ARG A CB     2  
ATOM 2118  C CG     . ARG A 1 7  ? 31.103 20.763 33.986 1.00 0.00 ? 5  ARG A CG     2  
ATOM 2119  C CD     . ARG A 1 7  ? 32.455 21.434 33.698 1.00 0.00 ? 5  ARG A CD     2  
ATOM 2120  N NE     . ARG A 1 7  ? 32.855 21.245 32.292 1.00 0.00 ? 5  ARG A NE     2  
ATOM 2121  C CZ     . ARG A 1 7  ? 33.965 21.658 31.712 1.00 0.00 ? 5  ARG A CZ     2  
ATOM 2122  N NH1    . ARG A 1 7  ? 34.842 22.407 32.312 1.00 0.00 ? 5  ARG A NH1    2  
ATOM 2123  N NH2    . ARG A 1 7  ? 34.234 21.348 30.481 1.00 0.00 1 5  ARG A NH2    2  
ATOM 2124  H H      . ARG A 1 7  ? 29.793 22.146 38.125 1.00 0.00 ? 5  ARG A H      2  
ATOM 2125  H HA     . ARG A 1 7  ? 30.730 22.865 35.509 1.00 0.00 ? 5  ARG A HA     2  
ATOM 2126  H HB2    . ARG A 1 7  ? 31.681 20.398 36.031 1.00 0.00 ? 5  ARG A HB2    2  
ATOM 2127  H HB3    . ARG A 1 7  ? 30.027 19.944 35.649 1.00 0.00 ? 5  ARG A HB3    2  
ATOM 2128  H HG2    . ARG A 1 7  ? 31.128 19.743 33.613 1.00 0.00 ? 5  ARG A HG2    2  
ATOM 2129  H HG3    . ARG A 1 7  ? 30.314 21.282 33.445 1.00 0.00 ? 5  ARG A HG3    2  
ATOM 2130  H HD2    . ARG A 1 7  ? 32.380 22.500 33.922 1.00 0.00 ? 5  ARG A HD2    2  
ATOM 2131  H HD3    . ARG A 1 7  ? 33.213 20.986 34.343 1.00 0.00 ? 5  ARG A HD3    2  
ATOM 2132  H HE     . ARG A 1 7  ? 32.179 20.815 31.664 1.00 0.00 ? 5  ARG A HE     2  
ATOM 2133  H HH11   . ARG A 1 7  ? 34.590 22.874 33.156 1.00 0.00 ? 5  ARG A HH11   2  
ATOM 2134  H HH12   . ARG A 1 7  ? 35.608 22.745 31.741 1.00 0.00 ? 5  ARG A HH12   2  
ATOM 2135  H HH21   . ARG A 1 7  ? 33.649 20.692 29.962 1.00 0.00 ? 5  ARG A HH21   2  
ATOM 2136  H HH22   . ARG A 1 7  ? 35.068 21.727 30.058 1.00 0.00 ? 5  ARG A HH22   2  
ATOM 2137  N N      . THR A 1 8  ? 28.365 22.669 34.643 1.00 0.00 ? 6  THR A N      2  
ATOM 2138  C CA     . THR A 1 8  ? 27.022 22.486 34.080 1.00 0.00 ? 6  THR A CA     2  
ATOM 2139  C C      . THR A 1 8  ? 27.111 22.164 32.587 1.00 0.00 ? 6  THR A C      2  
ATOM 2140  O O      . THR A 1 8  ? 28.037 22.604 31.907 1.00 0.00 ? 6  THR A O      2  
ATOM 2141  C CB     . THR A 1 8  ? 26.121 23.696 34.377 1.00 0.00 ? 6  THR A CB     2  
ATOM 2142  O OG1    . THR A 1 8  ? 24.787 23.402 34.034 1.00 0.00 ? 6  THR A OG1    2  
ATOM 2143  C CG2    . THR A 1 8  ? 26.527 24.975 33.652 1.00 0.00 ? 6  THR A CG2    2  
ATOM 2144  H H      . THR A 1 8  ? 29.068 23.058 34.030 1.00 0.00 ? 6  THR A H      2  
ATOM 2145  H HA     . THR A 1 8  ? 26.568 21.624 34.567 1.00 0.00 ? 6  THR A HA     2  
ATOM 2146  H HB     . THR A 1 8  ? 26.147 23.885 35.451 1.00 0.00 ? 6  THR A HB     2  
ATOM 2147  H HG1    . THR A 1 8  ? 24.470 22.774 34.715 1.00 0.00 ? 6  THR A HG1    2  
ATOM 2148  H HG21   . THR A 1 8  ? 25.875 25.790 33.966 1.00 0.00 ? 6  THR A HG21   2  
ATOM 2149  H HG22   . THR A 1 8  ? 27.556 25.236 33.898 1.00 0.00 ? 6  THR A HG22   2  
ATOM 2150  H HG23   . THR A 1 8  ? 26.439 24.839 32.574 1.00 0.00 ? 6  THR A HG23   2  
ATOM 2151  N N      . HIS A 1 9  ? 26.153 21.381 32.079 1.00 0.00 ? 7  HIS A N      2  
ATOM 2152  C CA     . HIS A 1 9  ? 26.017 21.045 30.658 1.00 0.00 ? 7  HIS A CA     2  
ATOM 2153  C C      . HIS A 1 9  ? 24.824 21.816 30.086 1.00 0.00 ? 7  HIS A C      2  
ATOM 2154  O O      . HIS A 1 9  ? 23.678 21.367 30.212 1.00 0.00 ? 7  HIS A O      2  
ATOM 2155  C CB     . HIS A 1 9  ? 25.849 19.523 30.491 1.00 0.00 ? 7  HIS A CB     2  
ATOM 2156  C CG     . HIS A 1 9  ? 27.055 18.686 30.849 1.00 0.00 ? 7  HIS A CG     2  
ATOM 2157  N ND1    . HIS A 1 9  ? 28.387 18.979 30.536 1.00 0.00 ? 7  HIS A ND1    2  
ATOM 2158  C CD2    . HIS A 1 9  ? 27.008 17.448 31.418 1.00 0.00 ? 7  HIS A CD2    2  
ATOM 2159  C CE1    . HIS A 1 9  ? 29.106 17.907 30.917 1.00 0.00 ? 7  HIS A CE1    2  
ATOM 2160  N NE2    . HIS A 1 9  ? 28.304 16.982 31.466 1.00 0.00 ? 7  HIS A NE2    2  
ATOM 2161  H H      . HIS A 1 9  ? 25.420 21.072 32.698 1.00 0.00 ? 7  HIS A H      2  
ATOM 2162  H HA     . HIS A 1 9  ? 26.911 21.348 30.106 1.00 0.00 ? 7  HIS A HA     2  
ATOM 2163  H HB2    . HIS A 1 9  ? 25.003 19.188 31.091 1.00 0.00 ? 7  HIS A HB2    2  
ATOM 2164  H HB3    . HIS A 1 9  ? 25.617 19.320 29.447 1.00 0.00 ? 7  HIS A HB3    2  
ATOM 2165  H HD2    . HIS A 1 9  ? 26.114 16.918 31.725 1.00 0.00 ? 7  HIS A HD2    2  
ATOM 2166  H HE1    . HIS A 1 9  ? 30.175 17.791 30.779 1.00 0.00 ? 7  HIS A HE1    2  
ATOM 2167  H HE2    . HIS A 1 9  ? 28.607 16.064 31.797 1.00 0.00 ? 7  HIS A HE2    2  
ATOM 2168  N N      . PHE A 1 10 ? 25.068 22.988 29.499 1.00 0.00 ? 8  PHE A N      2  
ATOM 2169  C CA     . PHE A 1 10 ? 24.013 23.878 28.992 1.00 0.00 ? 8  PHE A CA     2  
ATOM 2170  C C      . PHE A 1 10 ? 23.152 23.198 27.909 1.00 0.00 ? 8  PHE A C      2  
ATOM 2171  O O      . PHE A 1 10 ? 23.678 22.480 27.055 1.00 0.00 ? 8  PHE A O      2  
ATOM 2172  C CB     . PHE A 1 10 ? 24.639 25.170 28.449 1.00 0.00 ? 8  PHE A CB     2  
ATOM 2173  C CG     . PHE A 1 10 ? 25.528 25.926 29.423 1.00 0.00 ? 8  PHE A CG     2  
ATOM 2174  C CD1    . PHE A 1 10 ? 24.958 26.627 30.502 1.00 0.00 ? 8  PHE A CD1    2  
ATOM 2175  C CD2    . PHE A 1 10 ? 26.926 25.944 29.241 1.00 0.00 ? 8  PHE A CD2    2  
ATOM 2176  C CE1    . PHE A 1 10 ? 25.779 27.343 31.392 1.00 0.00 ? 8  PHE A CE1    2  
ATOM 2177  C CE2    . PHE A 1 10 ? 27.746 26.655 30.135 1.00 0.00 ? 8  PHE A CE2    2  
ATOM 2178  C CZ     . PHE A 1 10 ? 27.175 27.358 31.210 1.00 0.00 ? 8  PHE A CZ     2  
ATOM 2179  H H      . PHE A 1 10 ? 26.023 23.312 29.446 1.00 0.00 ? 8  PHE A H      2  
ATOM 2180  H HA     . PHE A 1 10 ? 23.361 24.140 29.826 1.00 0.00 ? 8  PHE A HA     2  
ATOM 2181  H HB2    . PHE A 1 10 ? 25.222 24.923 27.560 1.00 0.00 ? 8  PHE A HB2    2  
ATOM 2182  H HB3    . PHE A 1 10 ? 23.833 25.837 28.138 1.00 0.00 ? 8  PHE A HB3    2  
ATOM 2183  H HD1    . PHE A 1 10 ? 23.886 26.613 30.653 1.00 0.00 ? 8  PHE A HD1    2  
ATOM 2184  H HD2    . PHE A 1 10 ? 27.377 25.417 28.412 1.00 0.00 ? 8  PHE A HD2    2  
ATOM 2185  H HE1    . PHE A 1 10 ? 25.343 27.868 32.228 1.00 0.00 ? 8  PHE A HE1    2  
ATOM 2186  H HE2    . PHE A 1 10 ? 28.818 26.663 29.993 1.00 0.00 ? 8  PHE A HE2    2  
ATOM 2187  H HZ     . PHE A 1 10 ? 27.807 27.897 31.904 1.00 0.00 ? 8  PHE A HZ     2  
ATOM 2188  N N      . THR A 1 11 ? 21.837 23.419 27.931 1.00 0.00 ? 9  THR A N      2  
ATOM 2189  C CA     . THR A 1 11 ? 20.874 22.808 26.994 1.00 0.00 ? 9  THR A CA     2  
ATOM 2190  C C      . THR A 1 11 ? 20.461 23.764 25.871 1.00 0.00 ? 9  THR A C      2  
ATOM 2191  O O      . THR A 1 11 ? 20.601 24.984 25.974 1.00 0.00 ? 9  THR A O      2  
ATOM 2192  C CB     . THR A 1 11 ? 19.641 22.253 27.726 1.00 0.00 ? 9  THR A CB     2  
ATOM 2193  O OG1    . THR A 1 11 ? 18.987 23.274 28.441 1.00 0.00 ? 9  THR A OG1    2  
ATOM 2194  C CG2    . THR A 1 11 ? 20.006 21.150 28.718 1.00 0.00 ? 9  THR A CG2    2  
ATOM 2195  H H      . THR A 1 11 ? 21.450 24.013 28.660 1.00 0.00 ? 9  THR A H      2  
ATOM 2196  H HA     . THR A 1 11 ? 21.352 21.955 26.511 1.00 0.00 ? 9  THR A HA     2  
ATOM 2197  H HB     . THR A 1 11 ? 18.953 21.832 26.996 1.00 0.00 ? 9  THR A HB     2  
ATOM 2198  H HG1    . THR A 1 11 ? 18.395 22.847 29.085 1.00 0.00 ? 9  THR A HG1    2  
ATOM 2199  H HG21   . THR A 1 11 ? 19.099 20.729 29.149 1.00 0.00 ? 9  THR A HG21   2  
ATOM 2200  H HG22   . THR A 1 11 ? 20.537 20.356 28.194 1.00 0.00 ? 9  THR A HG22   2  
ATOM 2201  H HG23   . THR A 1 11 ? 20.635 21.545 29.515 1.00 0.00 ? 9  THR A HG23   2  
ATOM 2202  N N      . SER A 1 12 ? 19.942 23.219 24.769 1.00 0.00 ? 10 SER A N      2  
ATOM 2203  C CA     . SER A 1 12 ? 19.628 23.961 23.535 1.00 0.00 ? 10 SER A CA     2  
ATOM 2204  C C      . SER A 1 12 ? 18.670 25.140 23.765 1.00 0.00 ? 10 SER A C      2  
ATOM 2205  O O      . SER A 1 12 ? 18.867 26.221 23.207 1.00 0.00 ? 10 SER A O      2  
ATOM 2206  C CB     . SER A 1 12 ? 19.031 23.007 22.493 1.00 0.00 ? 10 SER A CB     2  
ATOM 2207  O OG     . SER A 1 12 ? 19.878 21.883 22.295 1.00 0.00 ? 10 SER A OG     2  
ATOM 2208  H H      . SER A 1 12 ? 19.850 22.210 24.743 1.00 0.00 ? 10 SER A H      2  
ATOM 2209  H HA     . SER A 1 12 ? 20.555 24.364 23.125 1.00 0.00 ? 10 SER A HA     2  
ATOM 2210  H HB2    . SER A 1 12 ? 18.053 22.662 22.838 1.00 0.00 ? 10 SER A HB2    2  
ATOM 2211  H HB3    . SER A 1 12 ? 18.901 23.537 21.548 1.00 0.00 ? 10 SER A HB3    2  
ATOM 2212  H HG     . SER A 1 12 ? 19.382 21.257 21.714 1.00 0.00 ? 10 SER A HG     2  
ATOM 2213  N N      . GLN A 1 13 ? 17.682 24.982 24.653 1.00 0.00 ? 11 GLN A N      2  
ATOM 2214  C CA     . GLN A 1 13 ? 16.743 26.051 25.009 1.00 0.00 ? 11 GLN A CA     2  
ATOM 2215  C C      . GLN A 1 13 ? 17.413 27.201 25.791 1.00 0.00 ? 11 GLN A C      2  
ATOM 2216  O O      . GLN A 1 13 ? 16.974 28.348 25.661 1.00 0.00 ? 11 GLN A O      2  
ATOM 2217  C CB     . GLN A 1 13 ? 15.564 25.438 25.786 1.00 0.00 ? 11 GLN A CB     2  
ATOM 2218  C CG     . GLN A 1 13 ? 14.420 26.409 26.131 1.00 0.00 ? 11 GLN A CG     2  
ATOM 2219  C CD     . GLN A 1 13 ? 13.686 26.945 24.904 1.00 0.00 ? 11 GLN A CD     2  
ATOM 2220  O OE1    . GLN A 1 13 ? 12.597 26.504 24.559 1.00 0.00 ? 11 GLN A OE1    2  
ATOM 2221  N NE2    . GLN A 1 13 ? 14.229 27.922 24.212 1.00 0.00 ? 11 GLN A NE2    2  
ATOM 2222  H H      . GLN A 1 13 ? 17.560 24.066 25.076 1.00 0.00 ? 11 GLN A H      2  
ATOM 2223  H HA     . GLN A 1 13 ? 16.364 26.466 24.076 1.00 0.00 ? 11 GLN A HA     2  
ATOM 2224  H HB2    . GLN A 1 13 ? 15.145 24.617 25.204 1.00 0.00 ? 11 GLN A HB2    2  
ATOM 2225  H HB3    . GLN A 1 13 ? 15.952 25.025 26.718 1.00 0.00 ? 11 GLN A HB3    2  
ATOM 2226  H HG2    . GLN A 1 13 ? 13.699 25.877 26.750 1.00 0.00 ? 11 GLN A HG2    2  
ATOM 2227  H HG3    . GLN A 1 13 ? 14.798 27.243 26.722 1.00 0.00 ? 11 GLN A HG3    2  
ATOM 2228  H HE21   . GLN A 1 13 ? 15.090 28.338 24.528 1.00 0.00 ? 11 GLN A HE21   2  
ATOM 2229  H HE22   . GLN A 1 13 ? 13.762 28.262 23.372 1.00 0.00 ? 11 GLN A HE22   2  
ATOM 2230  N N      . GLN A 1 14 ? 18.483 26.925 26.550 1.00 0.00 ? 12 GLN A N      2  
ATOM 2231  C CA     . GLN A 1 14 ? 19.314 27.948 27.201 1.00 0.00 ? 12 GLN A CA     2  
ATOM 2232  C C      . GLN A 1 14 ? 20.221 28.650 26.172 1.00 0.00 ? 12 GLN A C      2  
ATOM 2233  O O      . GLN A 1 14 ? 20.297 29.882 26.145 1.00 0.00 ? 12 GLN A O      2  
ATOM 2234  C CB     . GLN A 1 14 ? 20.161 27.332 28.338 1.00 0.00 ? 12 GLN A CB     2  
ATOM 2235  C CG     . GLN A 1 14 ? 19.353 26.632 29.448 1.00 0.00 ? 12 GLN A CG     2  
ATOM 2236  C CD     . GLN A 1 14 ? 20.269 25.970 30.482 1.00 0.00 ? 12 GLN A CD     2  
ATOM 2237  O OE1    . GLN A 1 14 ? 20.975 25.006 30.218 1.00 0.00 ? 12 GLN A OE1    2  
ATOM 2238  N NE2    . GLN A 1 14 ? 20.321 26.450 31.703 1.00 0.00 ? 12 GLN A NE2    2  
ATOM 2239  H H      . GLN A 1 14 ? 18.820 25.969 26.575 1.00 0.00 ? 12 GLN A H      2  
ATOM 2240  H HA     . GLN A 1 14 ? 18.657 28.700 27.633 1.00 0.00 ? 12 GLN A HA     2  
ATOM 2241  H HB2    . GLN A 1 14 ? 20.863 26.614 27.914 1.00 0.00 ? 12 GLN A HB2    2  
ATOM 2242  H HB3    . GLN A 1 14 ? 20.747 28.130 28.797 1.00 0.00 ? 12 GLN A HB3    2  
ATOM 2243  H HG2    . GLN A 1 14 ? 18.711 27.362 29.940 1.00 0.00 ? 12 GLN A HG2    2  
ATOM 2244  H HG3    . GLN A 1 14 ? 18.716 25.861 29.018 1.00 0.00 ? 12 GLN A HG3    2  
ATOM 2245  H HE21   . GLN A 1 14 ? 19.711 27.207 32.004 1.00 0.00 ? 12 GLN A HE21   2  
ATOM 2246  H HE22   . GLN A 1 14 ? 20.998 26.059 32.342 1.00 0.00 ? 12 GLN A HE22   2  
ATOM 2247  N N      . LEU A 1 15 ? 20.850 27.879 25.274 1.00 0.00 ? 13 LEU A N      2  
ATOM 2248  C CA     . LEU A 1 15 ? 21.707 28.397 24.196 1.00 0.00 ? 13 LEU A CA     2  
ATOM 2249  C C      . LEU A 1 15 ? 20.973 29.382 23.274 1.00 0.00 ? 13 LEU A C      2  
ATOM 2250  O O      . LEU A 1 15 ? 21.574 30.372 22.863 1.00 0.00 ? 13 LEU A O      2  
ATOM 2251  C CB     . LEU A 1 15 ? 22.302 27.228 23.380 1.00 0.00 ? 13 LEU A CB     2  
ATOM 2252  C CG     . LEU A 1 15 ? 23.716 26.766 23.781 1.00 0.00 ? 13 LEU A CG     2  
ATOM 2253  C CD1    . LEU A 1 15 ? 24.772 27.846 23.526 1.00 0.00 ? 13 LEU A CD1    2  
ATOM 2254  C CD2    . LEU A 1 15 ? 23.810 26.333 25.243 1.00 0.00 ? 13 LEU A CD2    2  
ATOM 2255  H H      . LEU A 1 15 ? 20.750 26.873 25.362 1.00 0.00 ? 13 LEU A H      2  
ATOM 2256  H HA     . LEU A 1 15 ? 22.517 28.962 24.652 1.00 0.00 ? 13 LEU A HA     2  
ATOM 2257  H HB2    . LEU A 1 15 ? 21.629 26.371 23.429 1.00 0.00 ? 13 LEU A HB2    2  
ATOM 2258  H HB3    . LEU A 1 15 ? 22.350 27.521 22.329 1.00 0.00 ? 13 LEU A HB3    2  
ATOM 2259  H HG     . LEU A 1 15 ? 23.967 25.905 23.161 1.00 0.00 ? 13 LEU A HG     2  
ATOM 2260  H HD11   . LEU A 1 15 ? 25.762 27.422 23.695 1.00 0.00 ? 13 LEU A HD11   2  
ATOM 2261  H HD12   . LEU A 1 15 ? 24.709 28.180 22.490 1.00 0.00 ? 13 LEU A HD12   2  
ATOM 2262  H HD13   . LEU A 1 15 ? 24.633 28.693 24.194 1.00 0.00 ? 13 LEU A HD13   2  
ATOM 2263  H HD21   . LEU A 1 15 ? 24.818 25.972 25.443 1.00 0.00 ? 13 LEU A HD21   2  
ATOM 2264  H HD22   . LEU A 1 15 ? 23.592 27.166 25.908 1.00 0.00 ? 13 LEU A HD22   2  
ATOM 2265  H HD23   . LEU A 1 15 ? 23.108 25.521 25.428 1.00 0.00 ? 13 LEU A HD23   2  
ATOM 2266  N N      . GLN A 1 16 ? 19.674 29.180 23.027 1.00 0.00 ? 14 GLN A N      2  
ATOM 2267  C CA     . GLN A 1 16 ? 18.843 30.073 22.208 1.00 0.00 ? 14 GLN A CA     2  
ATOM 2268  C C      . GLN A 1 16 ? 18.705 31.515 22.741 1.00 0.00 ? 14 GLN A C      2  
ATOM 2269  O O      . GLN A 1 16 ? 18.349 32.396 21.959 1.00 0.00 ? 14 GLN A O      2  
ATOM 2270  C CB     . GLN A 1 16 ? 17.459 29.429 21.997 1.00 0.00 ? 14 GLN A CB     2  
ATOM 2271  C CG     . GLN A 1 16 ? 17.453 28.375 20.877 1.00 0.00 ? 14 GLN A CG     2  
ATOM 2272  C CD     . GLN A 1 16 ? 17.415 29.006 19.487 1.00 0.00 ? 14 GLN A CD     2  
ATOM 2273  O OE1    . GLN A 1 16 ? 16.360 29.334 18.949 1.00 0.00 ? 14 GLN A OE1    2  
ATOM 2274  N NE2    . GLN A 1 16 ? 18.538 29.258 18.855 1.00 0.00 ? 14 GLN A NE2    2  
ATOM 2275  H H      . GLN A 1 16 ? 19.272 28.304 23.341 1.00 0.00 ? 14 GLN A H      2  
ATOM 2276  H HA     . GLN A 1 16 ? 19.328 30.173 21.238 1.00 0.00 ? 14 GLN A HA     2  
ATOM 2277  H HB2    . GLN A 1 16 ? 17.134 28.965 22.930 1.00 0.00 ? 14 GLN A HB2    2  
ATOM 2278  H HB3    . GLN A 1 16 ? 16.729 30.198 21.742 1.00 0.00 ? 14 GLN A HB3    2  
ATOM 2279  H HG2    . GLN A 1 16 ? 18.326 27.728 20.967 1.00 0.00 ? 14 GLN A HG2    2  
ATOM 2280  H HG3    . GLN A 1 16 ? 16.564 27.753 20.989 1.00 0.00 ? 14 GLN A HG3    2  
ATOM 2281  H HE21   . GLN A 1 16 ? 19.442 29.004 19.263 1.00 0.00 ? 14 GLN A HE21   2  
ATOM 2282  H HE22   . GLN A 1 16 ? 18.494 29.585 17.902 1.00 0.00 ? 14 GLN A HE22   2  
ATOM 2283  N N      . GLU A 1 17 ? 19.012 31.810 24.012 1.00 0.00 ? 15 GLU A N      2  
ATOM 2284  C CA     . GLU A 1 17 ? 19.206 33.202 24.472 1.00 0.00 ? 15 GLU A CA     2  
ATOM 2285  C C      . GLU A 1 17 ? 20.665 33.664 24.345 1.00 0.00 ? 15 GLU A C      2  
ATOM 2286  O O      . GLU A 1 17 ? 20.923 34.811 23.976 1.00 0.00 ? 15 GLU A O      2  
ATOM 2287  C CB     . GLU A 1 17 ? 18.731 33.388 25.926 1.00 0.00 ? 15 GLU A CB     2  
ATOM 2288  C CG     . GLU A 1 17 ? 17.211 33.286 26.116 1.00 0.00 ? 15 GLU A CG     2  
ATOM 2289  C CD     . GLU A 1 17 ? 16.447 34.280 25.233 1.00 0.00 ? 15 GLU A CD     2  
ATOM 2290  O OE1    . GLU A 1 17 ? 16.575 35.516 25.403 1.00 0.00 ? 15 GLU A OE1    2  
ATOM 2291  O OE2    . GLU A 1 17 ? 15.758 33.833 24.284 1.00 0.00 ? 15 GLU A OE2    2  
ATOM 2292  H H      . GLU A 1 17 ? 19.284 31.055 24.633 1.00 0.00 ? 15 GLU A H      2  
ATOM 2293  H HA     . GLU A 1 17 ? 18.633 33.883 23.843 1.00 0.00 ? 15 GLU A HA     2  
ATOM 2294  H HB2    . GLU A 1 17 ? 19.220 32.646 26.559 1.00 0.00 ? 15 GLU A HB2    2  
ATOM 2295  H HB3    . GLU A 1 17 ? 19.044 34.375 26.269 1.00 0.00 ? 15 GLU A HB3    2  
ATOM 2296  H HG2    . GLU A 1 17 ? 16.896 32.268 25.885 1.00 0.00 ? 15 GLU A HG2    2  
ATOM 2297  H HG3    . GLU A 1 17 ? 16.976 33.480 27.164 1.00 0.00 ? 15 GLU A HG3    2  
ATOM 2298  N N      . LEU A 1 18 ? 21.628 32.783 24.626 1.00 0.00 ? 16 LEU A N      2  
ATOM 2299  C CA     . LEU A 1 18 ? 23.056 33.112 24.656 1.00 0.00 ? 16 LEU A CA     2  
ATOM 2300  C C      . LEU A 1 18 ? 23.609 33.417 23.251 1.00 0.00 ? 16 LEU A C      2  
ATOM 2301  O O      . LEU A 1 18 ? 24.243 34.454 23.049 1.00 0.00 ? 16 LEU A O      2  
ATOM 2302  C CB     . LEU A 1 18 ? 23.807 31.957 25.349 1.00 0.00 ? 16 LEU A CB     2  
ATOM 2303  C CG     . LEU A 1 18 ? 23.423 31.743 26.830 1.00 0.00 ? 16 LEU A CG     2  
ATOM 2304  C CD1    . LEU A 1 18 ? 23.977 30.412 27.339 1.00 0.00 ? 16 LEU A CD1    2  
ATOM 2305  C CD2    . LEU A 1 18 ? 23.963 32.859 27.729 1.00 0.00 ? 16 LEU A CD2    2  
ATOM 2306  H H      . LEU A 1 18 ? 21.352 31.838 24.858 1.00 0.00 ? 16 LEU A H      2  
ATOM 2307  H HA     . LEU A 1 18 ? 23.194 34.020 25.242 1.00 0.00 ? 16 LEU A HA     2  
ATOM 2308  H HB2    . LEU A 1 18 ? 23.615 31.038 24.794 1.00 0.00 ? 16 LEU A HB2    2  
ATOM 2309  H HB3    . LEU A 1 18 ? 24.876 32.154 25.298 1.00 0.00 ? 16 LEU A HB3    2  
ATOM 2310  H HG     . LEU A 1 18 ? 22.340 31.709 26.930 1.00 0.00 ? 16 LEU A HG     2  
ATOM 2311  H HD11   . LEU A 1 18 ? 25.063 30.407 27.270 1.00 0.00 ? 16 LEU A HD11   2  
ATOM 2312  H HD12   . LEU A 1 18 ? 23.684 30.262 28.378 1.00 0.00 ? 16 LEU A HD12   2  
ATOM 2313  H HD13   . LEU A 1 18 ? 23.574 29.594 26.744 1.00 0.00 ? 16 LEU A HD13   2  
ATOM 2314  H HD21   . LEU A 1 18 ? 25.049 32.907 27.648 1.00 0.00 ? 16 LEU A HD21   2  
ATOM 2315  H HD22   . LEU A 1 18 ? 23.534 33.815 27.435 1.00 0.00 ? 16 LEU A HD22   2  
ATOM 2316  H HD23   . LEU A 1 18 ? 23.687 32.658 28.764 1.00 0.00 ? 16 LEU A HD23   2  
ATOM 2317  N N      . GLU A 1 19 ? 23.302 32.578 22.257 1.00 0.00 ? 17 GLU A N      2  
ATOM 2318  C CA     . GLU A 1 19 ? 23.739 32.778 20.866 1.00 0.00 ? 17 GLU A CA     2  
ATOM 2319  C C      . GLU A 1 19 ? 23.037 33.977 20.205 1.00 0.00 ? 17 GLU A C      2  
ATOM 2320  O O      . GLU A 1 19 ? 23.672 34.766 19.504 1.00 0.00 ? 17 GLU A O      2  
ATOM 2321  C CB     . GLU A 1 19 ? 23.582 31.471 20.060 1.00 0.00 ? 17 GLU A CB     2  
ATOM 2322  C CG     . GLU A 1 19 ? 22.145 31.133 19.618 1.00 0.00 ? 17 GLU A CG     2  
ATOM 2323  C CD     . GLU A 1 19 ? 22.033 29.698 19.085 1.00 0.00 ? 17 GLU A CD     2  
ATOM 2324  O OE1    . GLU A 1 19 ? 22.750 29.345 18.117 1.00 0.00 ? 17 GLU A OE1    2  
ATOM 2325  O OE2    . GLU A 1 19 ? 21.202 28.915 19.596 1.00 0.00 ? 17 GLU A OE2    2  
ATOM 2326  H H      . GLU A 1 19 ? 22.744 31.756 22.476 1.00 0.00 ? 17 GLU A H      2  
ATOM 2327  H HA     . GLU A 1 19 ? 24.803 33.016 20.884 1.00 0.00 ? 17 GLU A HA     2  
ATOM 2328  H HB2    . GLU A 1 19 ? 24.202 31.546 19.166 1.00 0.00 ? 17 GLU A HB2    2  
ATOM 2329  H HB3    . GLU A 1 19 ? 23.971 30.647 20.661 1.00 0.00 ? 17 GLU A HB3    2  
ATOM 2330  H HG2    . GLU A 1 19 ? 21.462 31.270 20.456 1.00 0.00 ? 17 GLU A HG2    2  
ATOM 2331  H HG3    . GLU A 1 19 ? 21.841 31.825 18.831 1.00 0.00 ? 17 GLU A HG3    2  
ATOM 2332  N N      . ALA A 1 20 ? 21.745 34.169 20.493 1.00 0.00 ? 18 ALA A N      2  
ATOM 2333  C CA     . ALA A 1 20 ? 20.959 35.299 20.000 1.00 0.00 ? 18 ALA A CA     2  
ATOM 2334  C C      . ALA A 1 20 ? 21.439 36.637 20.589 1.00 0.00 ? 18 ALA A C      2  
ATOM 2335  O O      . ALA A 1 20 ? 21.460 37.648 19.888 1.00 0.00 ? 18 ALA A O      2  
ATOM 2336  C CB     . ALA A 1 20 ? 19.491 35.030 20.337 1.00 0.00 ? 18 ALA A CB     2  
ATOM 2337  H H      . ALA A 1 20 ? 21.285 33.495 21.089 1.00 0.00 ? 18 ALA A H      2  
ATOM 2338  H HA     . ALA A 1 20 ? 21.062 35.358 18.915 1.00 0.00 ? 18 ALA A HA     2  
ATOM 2339  H HB1    . ALA A 1 20 ? 19.175 34.081 19.902 1.00 0.00 ? 18 ALA A HB1    2  
ATOM 2340  H HB2    . ALA A 1 20 ? 19.357 34.995 21.419 1.00 0.00 ? 18 ALA A HB2    2  
ATOM 2341  H HB3    . ALA A 1 20 ? 18.869 35.825 19.928 1.00 0.00 ? 18 ALA A HB3    2  
ATOM 2342  N N      . THR A 1 21 ? 21.891 36.634 21.850 1.00 0.00 ? 19 THR A N      2  
ATOM 2343  C CA     . THR A 1 21 ? 22.532 37.801 22.476 1.00 0.00 ? 19 THR A CA     2  
ATOM 2344  C C      . THR A 1 21 ? 23.889 38.082 21.832 1.00 0.00 ? 19 THR A C      2  
ATOM 2345  O O      . THR A 1 21 ? 24.117 39.202 21.388 1.00 0.00 ? 19 THR A O      2  
ATOM 2346  C CB     . THR A 1 21 ? 22.675 37.638 23.997 1.00 0.00 ? 19 THR A CB     2  
ATOM 2347  O OG1    . THR A 1 21 ? 21.420 37.337 24.566 1.00 0.00 ? 19 THR A OG1    2  
ATOM 2348  C CG2    . THR A 1 21 ? 23.159 38.926 24.667 1.00 0.00 ? 19 THR A CG2    2  
ATOM 2349  H H      . THR A 1 21 ? 21.808 35.778 22.387 1.00 0.00 ? 19 THR A H      2  
ATOM 2350  H HA     . THR A 1 21 ? 21.901 38.672 22.302 1.00 0.00 ? 19 THR A HA     2  
ATOM 2351  H HB     . THR A 1 21 ? 23.371 36.829 24.218 1.00 0.00 ? 19 THR A HB     2  
ATOM 2352  H HG1    . THR A 1 21 ? 21.247 36.390 24.383 1.00 0.00 ? 19 THR A HG1    2  
ATOM 2353  H HG21   . THR A 1 21 ? 24.134 39.219 24.275 1.00 0.00 ? 19 THR A HG21   2  
ATOM 2354  H HG22   . THR A 1 21 ? 22.446 39.730 24.488 1.00 0.00 ? 19 THR A HG22   2  
ATOM 2355  H HG23   . THR A 1 21 ? 23.256 38.762 25.738 1.00 0.00 ? 19 THR A HG23   2  
ATOM 2356  N N      . PHE A 1 22 ? 24.760 37.079 21.676 1.00 0.00 ? 20 PHE A N      2  
ATOM 2357  C CA     . PHE A 1 22 ? 26.071 37.245 21.025 1.00 0.00 ? 20 PHE A CA     2  
ATOM 2358  C C      . PHE A 1 22 ? 25.977 37.812 19.591 1.00 0.00 ? 20 PHE A C      2  
ATOM 2359  O O      . PHE A 1 22 ? 26.830 38.600 19.172 1.00 0.00 ? 20 PHE A O      2  
ATOM 2360  C CB     . PHE A 1 22 ? 26.796 35.890 21.048 1.00 0.00 ? 20 PHE A CB     2  
ATOM 2361  C CG     . PHE A 1 22 ? 28.026 35.840 20.162 1.00 0.00 ? 20 PHE A CG     2  
ATOM 2362  C CD1    . PHE A 1 22 ? 29.181 36.568 20.509 1.00 0.00 ? 20 PHE A CD1    2  
ATOM 2363  C CD2    . PHE A 1 22 ? 27.988 35.124 18.949 1.00 0.00 ? 20 PHE A CD2    2  
ATOM 2364  C CE1    . PHE A 1 22 ? 30.286 36.588 19.639 1.00 0.00 ? 20 PHE A CE1    2  
ATOM 2365  C CE2    . PHE A 1 22 ? 29.096 35.140 18.084 1.00 0.00 ? 20 PHE A CE2    2  
ATOM 2366  C CZ     . PHE A 1 22 ? 30.242 35.876 18.428 1.00 0.00 ? 20 PHE A CZ     2  
ATOM 2367  H H      . PHE A 1 22 ? 24.521 36.160 22.038 1.00 0.00 ? 20 PHE A H      2  
ATOM 2368  H HA     . PHE A 1 22 ? 26.658 37.960 21.606 1.00 0.00 ? 20 PHE A HA     2  
ATOM 2369  H HB2    . PHE A 1 22 ? 27.087 35.662 22.075 1.00 0.00 ? 20 PHE A HB2    2  
ATOM 2370  H HB3    . PHE A 1 22 ? 26.104 35.113 20.723 1.00 0.00 ? 20 PHE A HB3    2  
ATOM 2371  H HD1    . PHE A 1 22 ? 29.208 37.132 21.430 1.00 0.00 ? 20 PHE A HD1    2  
ATOM 2372  H HD2    . PHE A 1 22 ? 27.102 34.572 18.671 1.00 0.00 ? 20 PHE A HD2    2  
ATOM 2373  H HE1    . PHE A 1 22 ? 31.162 37.167 19.890 1.00 0.00 ? 20 PHE A HE1    2  
ATOM 2374  H HE2    . PHE A 1 22 ? 29.062 34.598 17.150 1.00 0.00 ? 20 PHE A HE2    2  
ATOM 2375  H HZ     . PHE A 1 22 ? 31.082 35.907 17.750 1.00 0.00 ? 20 PHE A HZ     2  
ATOM 2376  N N      . GLN A 1 23 ? 24.916 37.478 18.849 1.00 0.00 ? 21 GLN A N      2  
ATOM 2377  C CA     . GLN A 1 23 ? 24.636 38.005 17.505 1.00 0.00 ? 21 GLN A CA     2  
ATOM 2378  C C      . GLN A 1 23 ? 24.180 39.485 17.476 1.00 0.00 ? 21 GLN A C      2  
ATOM 2379  O O      . GLN A 1 23 ? 24.033 40.046 16.387 1.00 0.00 ? 21 GLN A O      2  
ATOM 2380  C CB     . GLN A 1 23 ? 23.609 37.082 16.824 1.00 0.00 ? 21 GLN A CB     2  
ATOM 2381  C CG     . GLN A 1 23 ? 24.186 35.709 16.429 1.00 0.00 ? 21 GLN A CG     2  
ATOM 2382  C CD     . GLN A 1 23 ? 24.693 35.673 14.991 1.00 0.00 ? 21 GLN A CD     2  
ATOM 2383  O OE1    . GLN A 1 23 ? 23.997 35.248 14.076 1.00 0.00 ? 21 GLN A OE1    2  
ATOM 2384  N NE2    . GLN A 1 23 ? 25.887 36.121 14.695 1.00 0.00 ? 21 GLN A NE2    2  
ATOM 2385  H H      . GLN A 1 23 ? 24.283 36.777 19.222 1.00 0.00 ? 21 GLN A H      2  
ATOM 2386  H HA     . GLN A 1 23 ? 25.559 37.969 16.925 1.00 0.00 ? 21 GLN A HA     2  
ATOM 2387  H HB2    . GLN A 1 23 ? 22.772 36.930 17.508 1.00 0.00 ? 21 GLN A HB2    2  
ATOM 2388  H HB3    . GLN A 1 23 ? 23.213 37.562 15.927 1.00 0.00 ? 21 GLN A HB3    2  
ATOM 2389  H HG2    . GLN A 1 23 ? 24.989 35.415 17.106 1.00 0.00 ? 21 GLN A HG2    2  
ATOM 2390  H HG3    . GLN A 1 23 ? 23.394 34.966 16.520 1.00 0.00 ? 21 GLN A HG3    2  
ATOM 2391  H HE21   . GLN A 1 23 ? 26.549 36.459 15.382 1.00 0.00 ? 21 GLN A HE21   2  
ATOM 2392  H HE22   . GLN A 1 23 ? 26.164 36.093 13.716 1.00 0.00 ? 21 GLN A HE22   2  
ATOM 2393  N N      . ARG A 1 24 ? 23.970 40.145 18.628 1.00 0.00 ? 22 ARG A N      2  
ATOM 2394  C CA     . ARG A 1 24 ? 23.560 41.568 18.727 1.00 0.00 ? 22 ARG A CA     2  
ATOM 2395  C C      . ARG A 1 24 ? 24.301 42.406 19.786 1.00 0.00 ? 22 ARG A C      2  
ATOM 2396  O O      . ARG A 1 24 ? 24.191 43.637 19.767 1.00 0.00 ? 22 ARG A O      2  
ATOM 2397  C CB     . ARG A 1 24 ? 22.030 41.632 18.918 1.00 0.00 ? 22 ARG A CB     2  
ATOM 2398  C CG     . ARG A 1 24 ? 21.579 41.168 20.312 1.00 0.00 ? 22 ARG A CG     2  
ATOM 2399  C CD     . ARG A 1 24 ? 20.060 41.152 20.493 1.00 0.00 ? 22 ARG A CD     2  
ATOM 2400  N NE     . ARG A 1 24 ? 19.420 40.001 19.829 1.00 0.00 ? 22 ARG A NE     2  
ATOM 2401  C CZ     . ARG A 1 24 ? 18.325 39.379 20.229 1.00 0.00 ? 22 ARG A CZ     2  
ATOM 2402  N NH1    . ARG A 1 24 ? 17.683 39.708 21.313 1.00 0.00 1 22 ARG A NH1    2  
ATOM 2403  N NH2    . ARG A 1 24 ? 17.851 38.386 19.540 1.00 0.00 ? 22 ARG A NH2    2  
ATOM 2404  H H      . ARG A 1 24 ? 24.054 39.611 19.487 1.00 0.00 ? 22 ARG A H      2  
ATOM 2405  H HA     . ARG A 1 24 ? 23.789 42.061 17.783 1.00 0.00 ? 22 ARG A HA     2  
ATOM 2406  H HB2    . ARG A 1 24 ? 21.701 42.660 18.770 1.00 0.00 ? 22 ARG A HB2    2  
ATOM 2407  H HB3    . ARG A 1 24 ? 21.548 41.014 18.156 1.00 0.00 ? 22 ARG A HB3    2  
ATOM 2408  H HG2    . ARG A 1 24 ? 21.955 40.168 20.504 1.00 0.00 ? 22 ARG A HG2    2  
ATOM 2409  H HG3    . ARG A 1 24 ? 21.995 41.840 21.062 1.00 0.00 ? 22 ARG A HG3    2  
ATOM 2410  H HD2    . ARG A 1 24 ? 19.883 41.088 21.564 1.00 0.00 ? 22 ARG A HD2    2  
ATOM 2411  H HD3    . ARG A 1 24 ? 19.632 42.086 20.121 1.00 0.00 ? 22 ARG A HD3    2  
ATOM 2412  H HE     . ARG A 1 24 ? 19.882 39.606 19.026 1.00 0.00 ? 22 ARG A HE     2  
ATOM 2413  H HH11   . ARG A 1 24 ? 17.958 40.537 21.826 1.00 0.00 ? 22 ARG A HH11   2  
ATOM 2414  H HH12   . ARG A 1 24 ? 16.867 39.196 21.599 1.00 0.00 ? 22 ARG A HH12   2  
ATOM 2415  H HH21   . ARG A 1 24 ? 18.265 38.172 18.640 1.00 0.00 ? 22 ARG A HH21   2  
ATOM 2416  H HH22   . ARG A 1 24 ? 16.974 37.966 19.824 1.00 0.00 ? 22 ARG A HH22   2  
ATOM 2417  N N      . ASN A 1 25 ? 24.995 41.761 20.725 1.00 0.00 ? 23 ASN A N      2  
ATOM 2418  C CA     . ASN A 1 25 ? 25.723 42.368 21.841 1.00 0.00 ? 23 ASN A CA     2  
ATOM 2419  C C      . ASN A 1 25 ? 26.805 41.413 22.394 1.00 0.00 ? 23 ASN A C      2  
ATOM 2420  O O      . ASN A 1 25 ? 26.496 40.334 22.903 1.00 0.00 ? 23 ASN A O      2  
ATOM 2421  C CB     . ASN A 1 25 ? 24.711 42.699 22.952 1.00 0.00 ? 23 ASN A CB     2  
ATOM 2422  C CG     . ASN A 1 25 ? 25.317 43.447 24.127 1.00 0.00 ? 23 ASN A CG     2  
ATOM 2423  O OD1    . ASN A 1 25 ? 26.443 43.921 24.090 1.00 0.00 ? 23 ASN A OD1    2  
ATOM 2424  N ND2    . ASN A 1 25 ? 24.585 43.597 25.200 1.00 0.00 ? 23 ASN A ND2    2  
ATOM 2425  H H      . ASN A 1 25 ? 24.956 40.749 20.723 1.00 0.00 ? 23 ASN A H      2  
ATOM 2426  H HA     . ASN A 1 25 ? 26.201 43.290 21.506 1.00 0.00 ? 23 ASN A HA     2  
ATOM 2427  H HB2    . ASN A 1 25 ? 23.919 43.314 22.540 1.00 0.00 ? 23 ASN A HB2    2  
ATOM 2428  H HB3    . ASN A 1 25 ? 24.261 41.780 23.324 1.00 0.00 ? 23 ASN A HB3    2  
ATOM 2429  H HD21   . ASN A 1 25 ? 23.620 43.280 25.185 1.00 0.00 ? 23 ASN A HD21   2  
ATOM 2430  H HD22   . ASN A 1 25 ? 24.926 44.188 25.941 1.00 0.00 ? 23 ASN A HD22   2  
ATOM 2431  N N      . ARG A 1 26 ? 28.077 41.820 22.353 1.00 0.00 ? 24 ARG A N      2  
ATOM 2432  C CA     . ARG A 1 26 ? 29.203 41.103 22.994 1.00 0.00 ? 24 ARG A CA     2  
ATOM 2433  C C      . ARG A 1 26 ? 29.427 41.473 24.467 1.00 0.00 ? 24 ARG A C      2  
ATOM 2434  O O      . ARG A 1 26 ? 30.161 40.764 25.149 1.00 0.00 ? 24 ARG A O      2  
ATOM 2435  C CB     . ARG A 1 26 ? 30.475 41.313 22.151 1.00 0.00 ? 24 ARG A CB     2  
ATOM 2436  C CG     . ARG A 1 26 ? 30.493 40.375 20.928 1.00 0.00 ? 24 ARG A CG     2  
ATOM 2437  C CD     . ARG A 1 26 ? 31.029 41.045 19.660 1.00 0.00 ? 24 ARG A CD     2  
ATOM 2438  N NE     . ARG A 1 26 ? 32.432 41.491 19.759 1.00 0.00 ? 24 ARG A NE     2  
ATOM 2439  C CZ     . ARG A 1 26 ? 33.056 42.172 18.814 1.00 0.00 ? 24 ARG A CZ     2  
ATOM 2440  N NH1    . ARG A 1 26 ? 32.482 42.495 17.690 1.00 0.00 ? 24 ARG A NH1    2  
ATOM 2441  N NH2    . ARG A 1 26 ? 34.286 42.566 18.950 1.00 0.00 1 24 ARG A NH2    2  
ATOM 2442  H H      . ARG A 1 26 ? 28.281 42.674 21.836 1.00 0.00 ? 24 ARG A H      2  
ATOM 2443  H HA     . ARG A 1 26 ? 28.983 40.036 23.016 1.00 0.00 ? 24 ARG A HA     2  
ATOM 2444  H HB2    . ARG A 1 26 ? 30.529 42.357 21.837 1.00 0.00 ? 24 ARG A HB2    2  
ATOM 2445  H HB3    . ARG A 1 26 ? 31.361 41.099 22.750 1.00 0.00 ? 24 ARG A HB3    2  
ATOM 2446  H HG2    . ARG A 1 26 ? 31.093 39.493 21.158 1.00 0.00 ? 24 ARG A HG2    2  
ATOM 2447  H HG3    . ARG A 1 26 ? 29.479 40.039 20.707 1.00 0.00 ? 24 ARG A HG3    2  
ATOM 2448  H HD2    . ARG A 1 26 ? 30.938 40.335 18.836 1.00 0.00 ? 24 ARG A HD2    2  
ATOM 2449  H HD3    . ARG A 1 26 ? 30.394 41.904 19.434 1.00 0.00 ? 24 ARG A HD3    2  
ATOM 2450  H HE     . ARG A 1 26 ? 32.964 41.260 20.591 1.00 0.00 ? 24 ARG A HE     2  
ATOM 2451  H HH11   . ARG A 1 26 ? 31.523 42.215 17.495 1.00 0.00 ? 24 ARG A HH11   2  
ATOM 2452  H HH12   . ARG A 1 26 ? 33.028 42.978 16.992 1.00 0.00 ? 24 ARG A HH12   2  
ATOM 2453  H HH21   . ARG A 1 26 ? 34.814 42.380 19.794 1.00 0.00 ? 24 ARG A HH21   2  
ATOM 2454  H HH22   . ARG A 1 26 ? 34.716 43.070 18.190 1.00 0.00 ? 24 ARG A HH22   2  
ATOM 2455  N N      . TYR A 1 27 ? 28.797 42.545 24.959 1.00 0.00 ? 25 TYR A N      2  
ATOM 2456  C CA     . TYR A 1 27 ? 29.088 43.172 26.258 1.00 0.00 ? 25 TYR A CA     2  
ATOM 2457  C C      . TYR A 1 27 ? 27.807 43.419 27.091 1.00 0.00 ? 25 TYR A C      2  
ATOM 2458  O O      . TYR A 1 27 ? 27.392 44.569 27.291 1.00 0.00 ? 25 TYR A O      2  
ATOM 2459  C CB     . TYR A 1 27 ? 29.910 44.454 26.009 1.00 0.00 ? 25 TYR A CB     2  
ATOM 2460  C CG     . TYR A 1 27 ? 31.065 44.289 25.031 1.00 0.00 ? 25 TYR A CG     2  
ATOM 2461  C CD1    . TYR A 1 27 ? 32.023 43.275 25.225 1.00 0.00 ? 25 TYR A CD1    2  
ATOM 2462  C CD2    . TYR A 1 27 ? 31.136 45.095 23.878 1.00 0.00 ? 25 TYR A CD2    2  
ATOM 2463  C CE1    . TYR A 1 27 ? 33.025 43.051 24.265 1.00 0.00 ? 25 TYR A CE1    2  
ATOM 2464  C CE2    . TYR A 1 27 ? 32.146 44.879 22.921 1.00 0.00 ? 25 TYR A CE2    2  
ATOM 2465  C CZ     . TYR A 1 27 ? 33.091 43.852 23.107 1.00 0.00 ? 25 TYR A CZ     2  
ATOM 2466  O OH     . TYR A 1 27 ? 34.039 43.616 22.164 1.00 0.00 ? 25 TYR A OH     2  
ATOM 2467  H H      . TYR A 1 27 ? 28.159 43.037 24.349 1.00 0.00 ? 25 TYR A H      2  
ATOM 2468  H HA     . TYR A 1 27 ? 29.716 42.502 26.848 1.00 0.00 ? 25 TYR A HA     2  
ATOM 2469  H HB2    . TYR A 1 27 ? 29.243 45.224 25.619 1.00 0.00 ? 25 TYR A HB2    2  
ATOM 2470  H HB3    . TYR A 1 27 ? 30.309 44.804 26.961 1.00 0.00 ? 25 TYR A HB3    2  
ATOM 2471  H HD1    . TYR A 1 27 ? 31.942 42.613 26.075 1.00 0.00 ? 25 TYR A HD1    2  
ATOM 2472  H HD2    . TYR A 1 27 ? 30.404 45.876 23.715 1.00 0.00 ? 25 TYR A HD2    2  
ATOM 2473  H HE1    . TYR A 1 27 ? 33.714 42.234 24.390 1.00 0.00 ? 25 TYR A HE1    2  
ATOM 2474  H HE2    . TYR A 1 27 ? 32.202 45.490 22.037 1.00 0.00 ? 25 TYR A HE2    2  
ATOM 2475  H HH     . TYR A 1 27 ? 34.672 42.953 22.460 1.00 0.00 ? 25 TYR A HH     2  
ATOM 2476  N N      . PRO A 1 28 ? 27.123 42.355 27.562 1.00 0.00 ? 26 PRO A N      2  
ATOM 2477  C CA     . PRO A 1 28 ? 25.928 42.476 28.397 1.00 0.00 ? 26 PRO A CA     2  
ATOM 2478  C C      . PRO A 1 28 ? 26.269 43.013 29.798 1.00 0.00 ? 26 PRO A C      2  
ATOM 2479  O O      . PRO A 1 28 ? 27.198 42.536 30.454 1.00 0.00 ? 26 PRO A O      2  
ATOM 2480  C CB     . PRO A 1 28 ? 25.314 41.074 28.425 1.00 0.00 ? 26 PRO A CB     2  
ATOM 2481  C CG     . PRO A 1 28 ? 26.532 40.159 28.283 1.00 0.00 ? 26 PRO A CG     2  
ATOM 2482  C CD     . PRO A 1 28 ? 27.444 40.948 27.347 1.00 0.00 ? 26 PRO A CD     2  
ATOM 2483  H HA     . PRO A 1 28 ? 25.212 43.147 27.926 1.00 0.00 ? 26 PRO A HA     2  
ATOM 2484  H HB2    . PRO A 1 28 ? 24.753 40.885 29.340 1.00 0.00 ? 26 PRO A HB2    2  
ATOM 2485  H HB3    . PRO A 1 28 ? 24.667 40.947 27.556 1.00 0.00 ? 26 PRO A HB3    2  
ATOM 2486  H HG2    . PRO A 1 28 ? 27.021 40.038 29.249 1.00 0.00 ? 26 PRO A HG2    2  
ATOM 2487  H HG3    . PRO A 1 28 ? 26.262 39.190 27.866 1.00 0.00 ? 26 PRO A HG3    2  
ATOM 2488  H HD2    . PRO A 1 28 ? 28.489 40.734 27.573 1.00 0.00 ? 26 PRO A HD2    2  
ATOM 2489  H HD3    . PRO A 1 28 ? 27.220 40.681 26.313 1.00 0.00 ? 26 PRO A HD3    2  
ATOM 2490  N N      . ASP A 1 29 ? 25.505 43.999 30.273 1.00 0.00 ? 27 ASP A N      2  
ATOM 2491  C CA     . ASP A 1 29 ? 25.644 44.611 31.608 1.00 0.00 ? 27 ASP A CA     2  
ATOM 2492  C C      . ASP A 1 29 ? 25.136 43.698 32.736 1.00 0.00 ? 27 ASP A C      2  
ATOM 2493  O O      . ASP A 1 29 ? 24.341 42.793 32.487 1.00 0.00 ? 27 ASP A O      2  
ATOM 2494  C CB     . ASP A 1 29 ? 24.846 45.921 31.648 1.00 0.00 ? 27 ASP A CB     2  
ATOM 2495  C CG     . ASP A 1 29 ? 25.459 46.999 30.762 1.00 0.00 ? 27 ASP A CG     2  
ATOM 2496  O OD1    . ASP A 1 29 ? 26.450 47.633 31.199 1.00 0.00 ? 27 ASP A OD1    2  
ATOM 2497  O OD2    . ASP A 1 29 ? 24.928 47.253 29.651 1.00 0.00 ? 27 ASP A OD2    2  
ATOM 2498  H H      . ASP A 1 29 ? 24.766 44.345 29.678 1.00 0.00 ? 27 ASP A H      2  
ATOM 2499  H HA     . ASP A 1 29 ? 26.697 44.828 31.800 1.00 0.00 ? 27 ASP A HA     2  
ATOM 2500  H HB2    . ASP A 1 29 ? 23.819 45.729 31.340 1.00 0.00 ? 27 ASP A HB2    2  
ATOM 2501  H HB3    . ASP A 1 29 ? 24.824 46.299 32.669 1.00 0.00 ? 27 ASP A HB3    2  
ATOM 2502  N N      . MET A 1 30 ? 25.505 43.968 33.995 1.00 0.00 ? 28 MET A N      2  
ATOM 2503  C CA     . MET A 1 30 ? 24.963 43.264 35.175 1.00 0.00 ? 28 MET A CA     2  
ATOM 2504  C C      . MET A 1 30 ? 23.425 43.260 35.244 1.00 0.00 ? 28 MET A C      2  
ATOM 2505  O O      . MET A 1 30 ? 22.828 42.273 35.677 1.00 0.00 ? 28 MET A O      2  
ATOM 2506  C CB     . MET A 1 30 ? 25.572 43.851 36.467 1.00 0.00 ? 28 MET A CB     2  
ATOM 2507  C CG     . MET A 1 30 ? 24.964 45.176 36.960 1.00 0.00 ? 28 MET A CG     2  
ATOM 2508  S SD     . MET A 1 30 ? 25.019 46.576 35.805 1.00 0.00 ? 28 MET A SD     2  
ATOM 2509  C CE     . MET A 1 30 ? 26.746 47.080 36.019 1.00 0.00 ? 28 MET A CE     2  
ATOM 2510  H H      . MET A 1 30 ? 26.213 44.679 34.153 1.00 0.00 ? 28 MET A H      2  
ATOM 2511  H HA     . MET A 1 30 ? 25.274 42.224 35.109 1.00 0.00 ? 28 MET A HA     2  
ATOM 2512  H HB2    . MET A 1 30 ? 25.443 43.116 37.258 1.00 0.00 ? 28 MET A HB2    2  
ATOM 2513  H HB3    . MET A 1 30 ? 26.641 43.989 36.327 1.00 0.00 ? 28 MET A HB3    2  
ATOM 2514  H HG2    . MET A 1 30 ? 23.924 45.001 37.232 1.00 0.00 ? 28 MET A HG2    2  
ATOM 2515  H HG3    . MET A 1 30 ? 25.485 45.470 37.871 1.00 0.00 ? 28 MET A HG3    2  
ATOM 2516  H HE1    . MET A 1 30 ? 26.904 47.418 37.042 1.00 0.00 ? 28 MET A HE1    2  
ATOM 2517  H HE2    . MET A 1 30 ? 27.407 46.241 35.815 1.00 0.00 ? 28 MET A HE2    2  
ATOM 2518  H HE3    . MET A 1 30 ? 26.974 47.894 35.332 1.00 0.00 ? 28 MET A HE3    2  
ATOM 2519  N N      . SER A 1 31 ? 22.783 44.330 34.761 1.00 0.00 ? 29 SER A N      2  
ATOM 2520  C CA     . SER A 1 31 ? 21.325 44.484 34.660 1.00 0.00 ? 29 SER A CA     2  
ATOM 2521  C C      . SER A 1 31 ? 20.698 43.678 33.513 1.00 0.00 ? 29 SER A C      2  
ATOM 2522  O O      . SER A 1 31 ? 19.499 43.410 33.534 1.00 0.00 ? 29 SER A O      2  
ATOM 2523  C CB     . SER A 1 31 ? 20.993 45.975 34.516 1.00 0.00 ? 29 SER A CB     2  
ATOM 2524  O OG     . SER A 1 31 ? 21.634 46.551 33.384 1.00 0.00 ? 29 SER A OG     2  
ATOM 2525  H H      . SER A 1 31 ? 23.342 45.115 34.449 1.00 0.00 ? 29 SER A H      2  
ATOM 2526  H HA     . SER A 1 31 ? 20.875 44.128 35.585 1.00 0.00 ? 29 SER A HA     2  
ATOM 2527  H HB2    . SER A 1 31 ? 19.915 46.095 34.420 1.00 0.00 ? 29 SER A HB2    2  
ATOM 2528  H HB3    . SER A 1 31 ? 21.325 46.497 35.414 1.00 0.00 ? 29 SER A HB3    2  
ATOM 2529  H HG     . SER A 1 31 ? 21.581 47.525 33.459 1.00 0.00 ? 29 SER A HG     2  
ATOM 2530  N N      . THR A 1 32 ? 21.499 43.249 32.531 1.00 0.00 ? 30 THR A N      2  
ATOM 2531  C CA     . THR A 1 32 ? 21.075 42.465 31.357 1.00 0.00 ? 30 THR A CA     2  
ATOM 2532  C C      . THR A 1 32 ? 21.424 40.983 31.508 1.00 0.00 ? 30 THR A C      2  
ATOM 2533  O O      . THR A 1 32 ? 20.607 40.120 31.185 1.00 0.00 ? 30 THR A O      2  
ATOM 2534  C CB     . THR A 1 32 ? 21.703 43.050 30.079 1.00 0.00 ? 30 THR A CB     2  
ATOM 2535  O OG1    . THR A 1 32 ? 21.417 44.428 29.985 1.00 0.00 ? 30 THR A OG1    2  
ATOM 2536  C CG2    . THR A 1 32 ? 21.182 42.401 28.798 1.00 0.00 ? 30 THR A CG2    2  
ATOM 2537  H H      . THR A 1 32 ? 22.474 43.521 32.582 1.00 0.00 ? 30 THR A H      2  
ATOM 2538  H HA     . THR A 1 32 ? 19.992 42.525 31.255 1.00 0.00 ? 30 THR A HA     2  
ATOM 2539  H HB     . THR A 1 32 ? 22.786 42.922 30.121 1.00 0.00 ? 30 THR A HB     2  
ATOM 2540  H HG1    . THR A 1 32 ? 20.442 44.502 30.027 1.00 0.00 ? 30 THR A HG1    2  
ATOM 2541  H HG21   . THR A 1 32 ? 21.484 41.355 28.754 1.00 0.00 ? 30 THR A HG21   2  
ATOM 2542  H HG22   . THR A 1 32 ? 20.093 42.461 28.760 1.00 0.00 ? 30 THR A HG22   2  
ATOM 2543  H HG23   . THR A 1 32 ? 21.597 42.920 27.932 1.00 0.00 ? 30 THR A HG23   2  
ATOM 2544  N N      . ARG A 1 33 ? 22.593 40.655 32.078 1.00 0.00 ? 31 ARG A N      2  
ATOM 2545  C CA     . ARG A 1 33 ? 22.987 39.273 32.402 1.00 0.00 ? 31 ARG A CA     2  
ATOM 2546  C C      . ARG A 1 33 ? 22.040 38.632 33.413 1.00 0.00 ? 31 ARG A C      2  
ATOM 2547  O O      . ARG A 1 33 ? 21.800 37.434 33.311 1.00 0.00 ? 31 ARG A O      2  
ATOM 2548  C CB     . ARG A 1 33 ? 24.436 39.207 32.916 1.00 0.00 ? 31 ARG A CB     2  
ATOM 2549  C CG     . ARG A 1 33 ? 25.480 39.578 31.847 1.00 0.00 ? 31 ARG A CG     2  
ATOM 2550  C CD     . ARG A 1 33 ? 26.918 39.246 32.272 1.00 0.00 ? 31 ARG A CD     2  
ATOM 2551  N NE     . ARG A 1 33 ? 27.242 39.769 33.608 1.00 0.00 ? 31 ARG A NE     2  
ATOM 2552  C CZ     . ARG A 1 33 ? 27.650 40.977 33.939 1.00 0.00 ? 31 ARG A CZ     2  
ATOM 2553  N NH1    . ARG A 1 33 ? 27.907 41.941 33.103 1.00 0.00 ? 31 ARG A NH1    2  
ATOM 2554  N NH2    . ARG A 1 33 ? 27.786 41.213 35.198 1.00 0.00 1 31 ARG A NH2    2  
ATOM 2555  H H      . ARG A 1 33 ? 23.226 41.411 32.330 1.00 0.00 ? 31 ARG A H      2  
ATOM 2556  H HA     . ARG A 1 33 ? 22.909 38.665 31.502 1.00 0.00 ? 31 ARG A HA     2  
ATOM 2557  H HB2    . ARG A 1 33 ? 24.540 39.868 33.780 1.00 0.00 ? 31 ARG A HB2    2  
ATOM 2558  H HB3    . ARG A 1 33 ? 24.634 38.185 33.242 1.00 0.00 ? 31 ARG A HB3    2  
ATOM 2559  H HG2    . ARG A 1 33 ? 25.261 39.032 30.930 1.00 0.00 ? 31 ARG A HG2    2  
ATOM 2560  H HG3    . ARG A 1 33 ? 25.416 40.643 31.636 1.00 0.00 ? 31 ARG A HG3    2  
ATOM 2561  H HD2    . ARG A 1 33 ? 27.034 38.160 32.289 1.00 0.00 ? 31 ARG A HD2    2  
ATOM 2562  H HD3    . ARG A 1 33 ? 27.617 39.645 31.533 1.00 0.00 ? 31 ARG A HD3    2  
ATOM 2563  H HE     . ARG A 1 33 ? 27.102 39.153 34.407 1.00 0.00 ? 31 ARG A HE     2  
ATOM 2564  H HH11   . ARG A 1 33 ? 27.751 41.827 32.110 1.00 0.00 ? 31 ARG A HH11   2  
ATOM 2565  H HH12   . ARG A 1 33 ? 28.175 42.854 33.458 1.00 0.00 ? 31 ARG A HH12   2  
ATOM 2566  H HH21   . ARG A 1 33 ? 27.586 40.452 35.844 1.00 0.00 ? 31 ARG A HH21   2  
ATOM 2567  H HH22   . ARG A 1 33 ? 28.213 42.078 35.523 1.00 0.00 ? 31 ARG A HH22   2  
ATOM 2568  N N      . GLU A 1 34 ? 21.456 39.401 34.338 1.00 0.00 ? 32 GLU A N      2  
ATOM 2569  C CA     . GLU A 1 34 ? 20.452 38.843 35.253 1.00 0.00 ? 32 GLU A CA     2  
ATOM 2570  C C      . GLU A 1 34 ? 19.099 38.551 34.582 1.00 0.00 ? 32 GLU A C      2  
ATOM 2571  O O      . GLU A 1 34 ? 18.472 37.565 34.958 1.00 0.00 ? 32 GLU A O      2  
ATOM 2572  C CB     . GLU A 1 34 ? 20.316 39.653 36.549 1.00 0.00 ? 32 GLU A CB     2  
ATOM 2573  C CG     . GLU A 1 34 ? 19.577 40.993 36.449 1.00 0.00 ? 32 GLU A CG     2  
ATOM 2574  C CD     . GLU A 1 34 ? 19.150 41.452 37.848 1.00 0.00 ? 32 GLU A CD     2  
ATOM 2575  O OE1    . GLU A 1 34 ? 19.973 42.089 38.570 1.00 0.00 ? 32 GLU A OE1    2  
ATOM 2576  O OE2    . GLU A 1 34 ? 18.018 41.140 38.267 1.00 0.00 ? 32 GLU A OE2    2  
ATOM 2577  H H      . GLU A 1 34 ? 21.723 40.372 34.423 1.00 0.00 ? 32 GLU A H      2  
ATOM 2578  H HA     . GLU A 1 34 ? 20.829 37.873 35.574 1.00 0.00 ? 32 GLU A HA     2  
ATOM 2579  H HB2    . GLU A 1 34 ? 19.784 39.022 37.259 1.00 0.00 ? 32 GLU A HB2    2  
ATOM 2580  H HB3    . GLU A 1 34 ? 21.311 39.819 36.961 1.00 0.00 ? 32 GLU A HB3    2  
ATOM 2581  H HG2    . GLU A 1 34 ? 20.221 41.733 35.978 1.00 0.00 ? 32 GLU A HG2    2  
ATOM 2582  H HG3    . GLU A 1 34 ? 18.681 40.878 35.839 1.00 0.00 ? 32 GLU A HG3    2  
ATOM 2583  N N      . GLU A 1 35 ? 18.677 39.313 33.561 1.00 0.00 ? 33 GLU A N      2  
ATOM 2584  C CA     . GLU A 1 35 ? 17.489 38.971 32.751 1.00 0.00 ? 33 GLU A CA     2  
ATOM 2585  C C      . GLU A 1 35 ? 17.730 37.669 31.972 1.00 0.00 ? 33 GLU A C      2  
ATOM 2586  O O      . GLU A 1 35 ? 16.937 36.733 32.073 1.00 0.00 ? 33 GLU A O      2  
ATOM 2587  C CB     . GLU A 1 35 ? 17.111 40.108 31.774 1.00 0.00 ? 33 GLU A CB     2  
ATOM 2588  C CG     . GLU A 1 35 ? 16.480 41.337 32.444 1.00 0.00 ? 33 GLU A CG     2  
ATOM 2589  C CD     . GLU A 1 35 ? 16.093 42.413 31.411 1.00 0.00 ? 33 GLU A CD     2  
ATOM 2590  O OE1    . GLU A 1 35 ? 15.314 42.127 30.466 1.00 0.00 ? 33 GLU A OE1    2  
ATOM 2591  O OE2    . GLU A 1 35 ? 16.569 43.572 31.520 1.00 0.00 ? 33 GLU A OE2    2  
ATOM 2592  H H      . GLU A 1 35 ? 19.239 40.101 33.272 1.00 0.00 ? 33 GLU A H      2  
ATOM 2593  H HA     . GLU A 1 35 ? 16.640 38.790 33.412 1.00 0.00 ? 33 GLU A HA     2  
ATOM 2594  H HB2    . GLU A 1 35 ? 17.993 40.417 31.212 1.00 0.00 ? 33 GLU A HB2    2  
ATOM 2595  H HB3    . GLU A 1 35 ? 16.387 39.709 31.064 1.00 0.00 ? 33 GLU A HB3    2  
ATOM 2596  H HG2    . GLU A 1 35 ? 15.586 41.025 32.987 1.00 0.00 ? 33 GLU A HG2    2  
ATOM 2597  H HG3    . GLU A 1 35 ? 17.187 41.752 33.163 1.00 0.00 ? 33 GLU A HG3    2  
ATOM 2598  N N      . ILE A 1 36 ? 18.874 37.558 31.285 1.00 0.00 ? 34 ILE A N      2  
ATOM 2599  C CA     . ILE A 1 36 ? 19.298 36.326 30.593 1.00 0.00 ? 34 ILE A CA     2  
ATOM 2600  C C      . ILE A 1 36 ? 19.322 35.136 31.567 1.00 0.00 ? 34 ILE A C      2  
ATOM 2601  O O      . ILE A 1 36 ? 18.871 34.040 31.225 1.00 0.00 ? 34 ILE A O      2  
ATOM 2602  C CB     . ILE A 1 36 ? 20.675 36.550 29.915 1.00 0.00 ? 34 ILE A CB     2  
ATOM 2603  C CG1    . ILE A 1 36 ? 20.564 37.613 28.795 1.00 0.00 ? 34 ILE A CG1    2  
ATOM 2604  C CG2    . ILE A 1 36 ? 21.242 35.240 29.332 1.00 0.00 ? 34 ILE A CG2    2  
ATOM 2605  C CD1    . ILE A 1 36 ? 21.914 38.165 28.317 1.00 0.00 ? 34 ILE A CD1    2  
ATOM 2606  H H      . ILE A 1 36 ? 19.480 38.370 31.243 1.00 0.00 ? 34 ILE A H      2  
ATOM 2607  H HA     . ILE A 1 36 ? 18.568 36.092 29.818 1.00 0.00 ? 34 ILE A HA     2  
ATOM 2608  H HB     . ILE A 1 36 ? 21.371 36.913 30.672 1.00 0.00 ? 34 ILE A HB     2  
ATOM 2609  H HG12   . ILE A 1 36 ? 20.037 37.185 27.942 1.00 0.00 ? 34 ILE A HG12   2  
ATOM 2610  H HG13   . ILE A 1 36 ? 19.980 38.465 29.146 1.00 0.00 ? 34 ILE A HG13   2  
ATOM 2611  H HG21   . ILE A 1 36 ? 22.200 35.423 28.846 1.00 0.00 ? 34 ILE A HG21   2  
ATOM 2612  H HG22   . ILE A 1 36 ? 21.416 34.509 30.121 1.00 0.00 ? 34 ILE A HG22   2  
ATOM 2613  H HG23   . ILE A 1 36 ? 20.547 34.821 28.604 1.00 0.00 ? 34 ILE A HG23   2  
ATOM 2614  H HD11   . ILE A 1 36 ? 21.734 38.976 27.612 1.00 0.00 ? 34 ILE A HD11   2  
ATOM 2615  H HD12   . ILE A 1 36 ? 22.479 38.554 29.163 1.00 0.00 ? 34 ILE A HD12   2  
ATOM 2616  H HD13   . ILE A 1 36 ? 22.490 37.389 27.814 1.00 0.00 ? 34 ILE A HD13   2  
ATOM 2617  N N      . ALA A 1 37 ? 19.791 35.351 32.801 1.00 0.00 ? 35 ALA A N      2  
ATOM 2618  C CA     . ALA A 1 37 ? 19.795 34.337 33.849 1.00 0.00 ? 35 ALA A CA     2  
ATOM 2619  C C      . ALA A 1 37 ? 18.381 33.941 34.327 1.00 0.00 ? 35 ALA A C      2  
ATOM 2620  O O      . ALA A 1 37 ? 18.182 32.772 34.658 1.00 0.00 ? 35 ALA A O      2  
ATOM 2621  C CB     . ALA A 1 37 ? 20.691 34.816 34.996 1.00 0.00 ? 35 ALA A CB     2  
ATOM 2622  H H      . ALA A 1 37 ? 20.190 36.257 33.015 1.00 0.00 ? 35 ALA A H      2  
ATOM 2623  H HA     . ALA A 1 37 ? 20.245 33.438 33.433 1.00 0.00 ? 35 ALA A HA     2  
ATOM 2624  H HB1    . ALA A 1 37 ? 21.698 35.015 34.628 1.00 0.00 ? 35 ALA A HB1    2  
ATOM 2625  H HB2    . ALA A 1 37 ? 20.282 35.720 35.438 1.00 0.00 ? 35 ALA A HB2    2  
ATOM 2626  H HB3    . ALA A 1 37 ? 20.743 34.049 35.764 1.00 0.00 ? 35 ALA A HB3    2  
ATOM 2627  N N      . VAL A 1 38 ? 17.383 34.839 34.301 1.00 0.00 ? 36 VAL A N      2  
ATOM 2628  C CA     . VAL A 1 38 ? 15.977 34.462 34.551 1.00 0.00 ? 36 VAL A CA     2  
ATOM 2629  C C      . VAL A 1 38 ? 15.488 33.507 33.464 1.00 0.00 ? 36 VAL A C      2  
ATOM 2630  O O      . VAL A 1 38 ? 15.048 32.401 33.785 1.00 0.00 ? 36 VAL A O      2  
ATOM 2631  C CB     . VAL A 1 38 ? 15.025 35.677 34.682 1.00 0.00 ? 36 VAL A CB     2  
ATOM 2632  C CG1    . VAL A 1 38 ? 13.558 35.242 34.824 1.00 0.00 ? 36 VAL A CG1    2  
ATOM 2633  C CG2    . VAL A 1 38 ? 15.334 36.531 35.916 1.00 0.00 ? 36 VAL A CG2    2  
ATOM 2634  H H      . VAL A 1 38 ? 17.587 35.788 34.004 1.00 0.00 ? 36 VAL A H      2  
ATOM 2635  H HA     . VAL A 1 38 ? 15.935 33.915 35.491 1.00 0.00 ? 36 VAL A HA     2  
ATOM 2636  H HB     . VAL A 1 38 ? 15.105 36.303 33.796 1.00 0.00 ? 36 VAL A HB     2  
ATOM 2637  H HG11   . VAL A 1 38 ? 12.923 36.119 34.950 1.00 0.00 ? 36 VAL A HG11   2  
ATOM 2638  H HG12   . VAL A 1 38 ? 13.231 34.720 33.926 1.00 0.00 ? 36 VAL A HG12   2  
ATOM 2639  H HG13   . VAL A 1 38 ? 13.447 34.588 35.691 1.00 0.00 ? 36 VAL A HG13   2  
ATOM 2640  H HG21   . VAL A 1 38 ? 14.648 37.374 35.973 1.00 0.00 ? 36 VAL A HG21   2  
ATOM 2641  H HG22   . VAL A 1 38 ? 15.247 35.931 36.820 1.00 0.00 ? 36 VAL A HG22   2  
ATOM 2642  H HG23   . VAL A 1 38 ? 16.340 36.924 35.855 1.00 0.00 ? 36 VAL A HG23   2  
ATOM 2643  N N      . TRP A 1 39 ? 15.599 33.879 32.183 1.00 0.00 ? 37 TRP A N      2  
ATOM 2644  C CA     . TRP A 1 39 ? 15.016 33.102 31.073 1.00 0.00 ? 37 TRP A CA     2  
ATOM 2645  C C      . TRP A 1 39 ? 15.638 31.700 30.910 1.00 0.00 ? 37 TRP A C      2  
ATOM 2646  O O      . TRP A 1 39 ? 15.002 30.787 30.373 1.00 0.00 ? 37 TRP A O      2  
ATOM 2647  C CB     . TRP A 1 39 ? 15.132 33.892 29.760 1.00 0.00 ? 37 TRP A CB     2  
ATOM 2648  C CG     . TRP A 1 39 ? 14.835 35.363 29.824 1.00 0.00 ? 37 TRP A CG     2  
ATOM 2649  C CD1    . TRP A 1 39 ? 15.602 36.315 29.250 1.00 0.00 ? 37 TRP A CD1    2  
ATOM 2650  C CD2    . TRP A 1 39 ? 13.767 36.087 30.523 1.00 0.00 ? 37 TRP A CD2    2  
ATOM 2651  N NE1    . TRP A 1 39 ? 15.127 37.565 29.583 1.00 0.00 ? 37 TRP A NE1    2  
ATOM 2652  C CE2    . TRP A 1 39 ? 14.013 37.488 30.389 1.00 0.00 ? 37 TRP A CE2    2  
ATOM 2653  C CE3    . TRP A 1 39 ? 12.623 35.715 31.269 1.00 0.00 ? 37 TRP A CE3    2  
ATOM 2654  C CZ2    . TRP A 1 39 ? 13.208 38.461 30.999 1.00 0.00 ? 37 TRP A CZ2    2  
ATOM 2655  C CZ3    . TRP A 1 39 ? 11.808 36.684 31.888 1.00 0.00 ? 37 TRP A CZ3    2  
ATOM 2656  C CH2    . TRP A 1 39 ? 12.107 38.053 31.771 1.00 0.00 ? 37 TRP A CH2    2  
ATOM 2657  H H      . TRP A 1 39 ? 15.982 34.799 31.977 1.00 0.00 ? 37 TRP A H      2  
ATOM 2658  H HA     . TRP A 1 39 ? 13.957 32.961 31.283 1.00 0.00 ? 37 TRP A HA     2  
ATOM 2659  H HB2    . TRP A 1 39 ? 16.155 33.781 29.399 1.00 0.00 ? 37 TRP A HB2    2  
ATOM 2660  H HB3    . TRP A 1 39 ? 14.471 33.438 29.019 1.00 0.00 ? 37 TRP A HB3    2  
ATOM 2661  H HD1    . TRP A 1 39 ? 16.495 36.127 28.665 1.00 0.00 ? 37 TRP A HD1    2  
ATOM 2662  H HE1    . TRP A 1 39 ? 15.597 38.421 29.297 1.00 0.00 ? 37 TRP A HE1    2  
ATOM 2663  H HE3    . TRP A 1 39 ? 12.378 34.667 31.371 1.00 0.00 ? 37 TRP A HE3    2  
ATOM 2664  H HZ2    . TRP A 1 39 ? 13.443 39.510 30.884 1.00 0.00 ? 37 TRP A HZ2    2  
ATOM 2665  H HZ3    . TRP A 1 39 ? 10.948 36.373 32.469 1.00 0.00 ? 37 TRP A HZ3    2  
ATOM 2666  H HH2    . TRP A 1 39 ? 11.488 38.789 32.268 1.00 0.00 ? 37 TRP A HH2    2  
ATOM 2667  N N      . THR A 1 40 ? 16.871 31.524 31.395 1.00 0.00 ? 38 THR A N      2  
ATOM 2668  C CA     . THR A 1 40 ? 17.677 30.292 31.286 1.00 0.00 ? 38 THR A CA     2  
ATOM 2669  C C      . THR A 1 40 ? 17.841 29.519 32.605 1.00 0.00 ? 38 THR A C      2  
ATOM 2670  O O      . THR A 1 40 ? 18.529 28.500 32.621 1.00 0.00 ? 38 THR A O      2  
ATOM 2671  C CB     . THR A 1 40 ? 19.047 30.599 30.654 1.00 0.00 ? 38 THR A CB     2  
ATOM 2672  O OG1    . THR A 1 40 ? 19.768 31.512 31.446 1.00 0.00 ? 38 THR A OG1    2  
ATOM 2673  C CG2    . THR A 1 40 ? 18.934 31.210 29.257 1.00 0.00 ? 38 THR A CG2    2  
ATOM 2674  H H      . THR A 1 40 ? 17.323 32.339 31.794 1.00 0.00 ? 38 THR A H      2  
ATOM 2675  H HA     . THR A 1 40 ? 17.174 29.603 30.609 1.00 0.00 ? 38 THR A HA     2  
ATOM 2676  H HB     . THR A 1 40 ? 19.615 29.672 30.576 1.00 0.00 ? 38 THR A HB     2  
ATOM 2677  H HG1    . THR A 1 40 ? 19.431 32.406 31.251 1.00 0.00 ? 38 THR A HG1    2  
ATOM 2678  H HG21   . THR A 1 40 ? 19.922 31.247 28.795 1.00 0.00 ? 38 THR A HG21   2  
ATOM 2679  H HG22   . THR A 1 40 ? 18.274 30.604 28.639 1.00 0.00 ? 38 THR A HG22   2  
ATOM 2680  H HG23   . THR A 1 40 ? 18.527 32.220 29.308 1.00 0.00 ? 38 THR A HG23   2  
ATOM 2681  N N      . ASN A 1 41 ? 17.211 29.970 33.702 1.00 0.00 ? 39 ASN A N      2  
ATOM 2682  C CA     . ASN A 1 41 ? 17.365 29.441 35.071 1.00 0.00 ? 39 ASN A CA     2  
ATOM 2683  C C      . ASN A 1 41 ? 18.833 29.367 35.567 1.00 0.00 ? 39 ASN A C      2  
ATOM 2684  O O      . ASN A 1 41 ? 19.255 28.408 36.221 1.00 0.00 ? 39 ASN A O      2  
ATOM 2685  C CB     . ASN A 1 41 ? 16.559 28.135 35.253 1.00 0.00 ? 39 ASN A CB     2  
ATOM 2686  C CG     . ASN A 1 41 ? 16.444 27.736 36.720 1.00 0.00 ? 39 ASN A CG     2  
ATOM 2687  O OD1    . ASN A 1 41 ? 16.353 28.576 37.608 1.00 0.00 ? 39 ASN A OD1    2  
ATOM 2688  N ND2    . ASN A 1 41 ? 16.456 26.464 37.033 1.00 0.00 ? 39 ASN A ND2    2  
ATOM 2689  H H      . ASN A 1 41 ? 16.655 30.810 33.600 1.00 0.00 ? 39 ASN A H      2  
ATOM 2690  H HA     . ASN A 1 41 ? 16.900 30.189 35.716 1.00 0.00 ? 39 ASN A HA     2  
ATOM 2691  H HB2    . ASN A 1 41 ? 15.549 28.265 34.862 1.00 0.00 ? 39 ASN A HB2    2  
ATOM 2692  H HB3    . ASN A 1 41 ? 17.043 27.333 34.697 1.00 0.00 ? 39 ASN A HB3    2  
ATOM 2693  H HD21   . ASN A 1 41 ? 16.530 25.740 36.329 1.00 0.00 ? 39 ASN A HD21   2  
ATOM 2694  H HD22   . ASN A 1 41 ? 16.465 26.215 38.017 1.00 0.00 ? 39 ASN A HD22   2  
ATOM 2695  N N      . LEU A 1 42 ? 19.620 30.391 35.244 1.00 0.00 ? 40 LEU A N      2  
ATOM 2696  C CA     . LEU A 1 42 ? 21.017 30.580 35.652 1.00 0.00 ? 40 LEU A CA     2  
ATOM 2697  C C      . LEU A 1 42 ? 21.126 31.546 36.851 1.00 0.00 ? 40 LEU A C      2  
ATOM 2698  O O      . LEU A 1 42 ? 20.127 32.074 37.355 1.00 0.00 ? 40 LEU A O      2  
ATOM 2699  C CB     . LEU A 1 42 ? 21.817 31.073 34.417 1.00 0.00 ? 40 LEU A CB     2  
ATOM 2700  C CG     . LEU A 1 42 ? 22.682 29.999 33.737 1.00 0.00 ? 40 LEU A CG     2  
ATOM 2701  C CD1    . LEU A 1 42 ? 21.856 28.863 33.145 1.00 0.00 ? 40 LEU A CD1    2  
ATOM 2702  C CD2    . LEU A 1 42 ? 23.481 30.633 32.597 1.00 0.00 ? 40 LEU A CD2    2  
ATOM 2703  H H      . LEU A 1 42 ? 19.175 31.163 34.760 1.00 0.00 ? 40 LEU A H      2  
ATOM 2704  H HA     . LEU A 1 42 ? 21.436 29.626 35.976 1.00 0.00 ? 40 LEU A HA     2  
ATOM 2705  H HB2    . LEU A 1 42 ? 21.135 31.483 33.677 1.00 0.00 ? 40 LEU A HB2    2  
ATOM 2706  H HB3    . LEU A 1 42 ? 22.479 31.889 34.707 1.00 0.00 ? 40 LEU A HB3    2  
ATOM 2707  H HG     . LEU A 1 42 ? 23.376 29.584 34.468 1.00 0.00 ? 40 LEU A HG     2  
ATOM 2708  H HD11   . LEU A 1 42 ? 22.516 28.127 32.686 1.00 0.00 ? 40 LEU A HD11   2  
ATOM 2709  H HD12   . LEU A 1 42 ? 21.279 28.372 33.925 1.00 0.00 ? 40 LEU A HD12   2  
ATOM 2710  H HD13   . LEU A 1 42 ? 21.174 29.256 32.394 1.00 0.00 ? 40 LEU A HD13   2  
ATOM 2711  H HD21   . LEU A 1 42 ? 24.115 29.884 32.124 1.00 0.00 ? 40 LEU A HD21   2  
ATOM 2712  H HD22   . LEU A 1 42 ? 22.799 31.043 31.852 1.00 0.00 ? 40 LEU A HD22   2  
ATOM 2713  H HD23   . LEU A 1 42 ? 24.110 31.430 32.985 1.00 0.00 ? 40 LEU A HD23   2  
ATOM 2714  N N      . THR A 1 43 ? 22.360 31.817 37.273 1.00 0.00 ? 41 THR A N      2  
ATOM 2715  C CA     . THR A 1 43 ? 22.758 33.052 37.972 1.00 0.00 ? 41 THR A CA     2  
ATOM 2716  C C      . THR A 1 43 ? 23.738 33.848 37.091 1.00 0.00 ? 41 THR A C      2  
ATOM 2717  O O      . THR A 1 43 ? 24.341 33.281 36.172 1.00 0.00 ? 41 THR A O      2  
ATOM 2718  C CB     . THR A 1 43 ? 23.339 32.758 39.363 1.00 0.00 ? 41 THR A CB     2  
ATOM 2719  O OG1    . THR A 1 43 ? 24.505 31.967 39.295 1.00 0.00 ? 41 THR A OG1    2  
ATOM 2720  C CG2    . THR A 1 43 ? 22.348 32.036 40.275 1.00 0.00 ? 41 THR A CG2    2  
ATOM 2721  H H      . THR A 1 43 ? 23.117 31.281 36.873 1.00 0.00 ? 41 THR A H      2  
ATOM 2722  H HA     . THR A 1 43 ? 21.882 33.684 38.122 1.00 0.00 ? 41 THR A HA     2  
ATOM 2723  H HB     . THR A 1 43 ? 23.597 33.704 39.832 1.00 0.00 ? 41 THR A HB     2  
ATOM 2724  H HG1    . THR A 1 43 ? 25.032 32.248 40.076 1.00 0.00 ? 41 THR A HG1    2  
ATOM 2725  H HG21   . THR A 1 43 ? 21.430 32.618 40.353 1.00 0.00 ? 41 THR A HG21   2  
ATOM 2726  H HG22   . THR A 1 43 ? 22.115 31.046 39.882 1.00 0.00 ? 41 THR A HG22   2  
ATOM 2727  H HG23   . THR A 1 43 ? 22.780 31.929 41.271 1.00 0.00 ? 41 THR A HG23   2  
ATOM 2728  N N      . GLU A 1 44 ? 23.895 35.162 37.300 1.00 0.00 ? 42 GLU A N      2  
ATOM 2729  C CA     . GLU A 1 44 ? 24.633 36.023 36.352 1.00 0.00 ? 42 GLU A CA     2  
ATOM 2730  C C      . GLU A 1 44 ? 26.110 35.638 36.207 1.00 0.00 ? 42 GLU A C      2  
ATOM 2731  O O      . GLU A 1 44 ? 26.657 35.760 35.111 1.00 0.00 ? 42 GLU A O      2  
ATOM 2732  C CB     . GLU A 1 44 ? 24.440 37.525 36.657 1.00 0.00 ? 42 GLU A CB     2  
ATOM 2733  C CG     . GLU A 1 44 ? 25.299 38.142 37.778 1.00 0.00 ? 42 GLU A CG     2  
ATOM 2734  C CD     . GLU A 1 44 ? 26.783 38.351 37.417 1.00 0.00 ? 42 GLU A CD     2  
ATOM 2735  O OE1    . GLU A 1 44 ? 27.107 38.820 36.300 1.00 0.00 ? 42 GLU A OE1    2  
ATOM 2736  O OE2    . GLU A 1 44 ? 27.671 38.107 38.270 1.00 0.00 ? 42 GLU A OE2    2  
ATOM 2737  H H      . GLU A 1 44 ? 23.453 35.595 38.108 1.00 0.00 ? 42 GLU A H      2  
ATOM 2738  H HA     . GLU A 1 44 ? 24.187 35.857 35.370 1.00 0.00 ? 42 GLU A HA     2  
ATOM 2739  H HB2    . GLU A 1 44 ? 24.626 38.084 35.737 1.00 0.00 ? 42 GLU A HB2    2  
ATOM 2740  H HB3    . GLU A 1 44 ? 23.390 37.686 36.906 1.00 0.00 ? 42 GLU A HB3    2  
ATOM 2741  H HG2    . GLU A 1 44 ? 24.876 39.115 38.023 1.00 0.00 ? 42 GLU A HG2    2  
ATOM 2742  H HG3    . GLU A 1 44 ? 25.220 37.521 38.667 1.00 0.00 ? 42 GLU A HG3    2  
ATOM 2743  N N      . ALA A 1 45 ? 26.730 35.093 37.260 1.00 0.00 ? 43 ALA A N      2  
ATOM 2744  C CA     . ALA A 1 45 ? 28.087 34.556 37.219 1.00 0.00 ? 43 ALA A CA     2  
ATOM 2745  C C      . ALA A 1 45 ? 28.266 33.507 36.112 1.00 0.00 ? 43 ALA A C      2  
ATOM 2746  O O      . ALA A 1 45 ? 29.251 33.555 35.379 1.00 0.00 ? 43 ALA A O      2  
ATOM 2747  C CB     . ALA A 1 45 ? 28.412 33.956 38.591 1.00 0.00 ? 43 ALA A CB     2  
ATOM 2748  H H      . ALA A 1 45 ? 26.243 35.071 38.151 1.00 0.00 ? 43 ALA A H      2  
ATOM 2749  H HA     . ALA A 1 45 ? 28.784 35.372 37.019 1.00 0.00 ? 43 ALA A HA     2  
ATOM 2750  H HB1    . ALA A 1 45 ? 27.696 33.175 38.845 1.00 0.00 ? 43 ALA A HB1    2  
ATOM 2751  H HB2    . ALA A 1 45 ? 29.413 33.526 38.567 1.00 0.00 ? 43 ALA A HB2    2  
ATOM 2752  H HB3    . ALA A 1 45 ? 28.381 34.737 39.350 1.00 0.00 ? 43 ALA A HB3    2  
ATOM 2753  N N      . ARG A 1 46 ? 27.283 32.618 35.912 1.00 0.00 ? 44 ARG A N      2  
ATOM 2754  C CA     . ARG A 1 46 ? 27.327 31.585 34.861 1.00 0.00 ? 44 ARG A CA     2  
ATOM 2755  C C      . ARG A 1 46 ? 27.163 32.186 33.462 1.00 0.00 ? 44 ARG A C      2  
ATOM 2756  O O      . ARG A 1 46 ? 27.796 31.719 32.519 1.00 0.00 ? 44 ARG A O      2  
ATOM 2757  C CB     . ARG A 1 46 ? 26.291 30.481 35.136 1.00 0.00 ? 44 ARG A CB     2  
ATOM 2758  C CG     . ARG A 1 46 ? 26.335 29.894 36.557 1.00 0.00 ? 44 ARG A CG     2  
ATOM 2759  C CD     . ARG A 1 46 ? 27.662 29.234 36.981 1.00 0.00 ? 44 ARG A CD     2  
ATOM 2760  N NE     . ARG A 1 46 ? 27.754 27.803 36.627 1.00 0.00 ? 44 ARG A NE     2  
ATOM 2761  C CZ     . ARG A 1 46 ? 27.136 26.803 37.239 1.00 0.00 ? 44 ARG A CZ     2  
ATOM 2762  N NH1    . ARG A 1 46 ? 26.198 26.974 38.120 1.00 0.00 ? 44 ARG A NH1    2  
ATOM 2763  N NH2    . ARG A 1 46 ? 27.449 25.568 37.012 1.00 0.00 1 44 ARG A NH2    2  
ATOM 2764  H H      . ARG A 1 46 ? 26.455 32.691 36.490 1.00 0.00 ? 44 ARG A H      2  
ATOM 2765  H HA     . ARG A 1 46 ? 28.317 31.121 34.873 1.00 0.00 ? 44 ARG A HA     2  
ATOM 2766  H HB2    . ARG A 1 46 ? 25.299 30.900 34.985 1.00 0.00 ? 44 ARG A HB2    2  
ATOM 2767  H HB3    . ARG A 1 46 ? 26.433 29.673 34.417 1.00 0.00 ? 44 ARG A HB3    2  
ATOM 2768  H HG2    . ARG A 1 46 ? 26.118 30.694 37.265 1.00 0.00 ? 44 ARG A HG2    2  
ATOM 2769  H HG3    . ARG A 1 46 ? 25.525 29.170 36.646 1.00 0.00 ? 44 ARG A HG3    2  
ATOM 2770  H HD2    . ARG A 1 46 ? 28.504 29.771 36.546 1.00 0.00 ? 44 ARG A HD2    2  
ATOM 2771  H HD3    . ARG A 1 46 ? 27.759 29.323 38.061 1.00 0.00 ? 44 ARG A HD3    2  
ATOM 2772  H HE     . ARG A 1 46 ? 28.441 27.549 35.914 1.00 0.00 ? 44 ARG A HE     2  
ATOM 2773  H HH11   . ARG A 1 46 ? 25.932 27.906 38.408 1.00 0.00 ? 44 ARG A HH11   2  
ATOM 2774  H HH12   . ARG A 1 46 ? 25.799 26.174 38.586 1.00 0.00 ? 44 ARG A HH12   2  
ATOM 2775  H HH21   . ARG A 1 46 ? 28.326 25.365 36.530 1.00 0.00 ? 44 ARG A HH21   2  
ATOM 2776  H HH22   . ARG A 1 46 ? 26.934 24.843 37.492 1.00 0.00 ? 44 ARG A HH22   2  
ATOM 2777  N N      . VAL A 1 47 ? 26.396 33.273 33.330 1.00 0.00 ? 45 VAL A N      2  
ATOM 2778  C CA     . VAL A 1 47 ? 26.302 34.054 32.079 1.00 0.00 ? 45 VAL A CA     2  
ATOM 2779  C C      . VAL A 1 47 ? 27.628 34.770 31.786 1.00 0.00 ? 45 VAL A C      2  
ATOM 2780  O O      . VAL A 1 47 ? 28.108 34.734 30.653 1.00 0.00 ? 45 VAL A O      2  
ATOM 2781  C CB     . VAL A 1 47 ? 25.125 35.058 32.114 1.00 0.00 ? 45 VAL A CB     2  
ATOM 2782  C CG1    . VAL A 1 47 ? 24.951 35.776 30.767 1.00 0.00 ? 45 VAL A CG1    2  
ATOM 2783  C CG2    . VAL A 1 47 ? 23.792 34.375 32.441 1.00 0.00 ? 45 VAL A CG2    2  
ATOM 2784  H H      . VAL A 1 47 ? 25.935 33.621 34.158 1.00 0.00 ? 45 VAL A H      2  
ATOM 2785  H HA     . VAL A 1 47 ? 26.122 33.358 31.253 1.00 0.00 ? 45 VAL A HA     2  
ATOM 2786  H HB     . VAL A 1 47 ? 25.318 35.810 32.875 1.00 0.00 ? 45 VAL A HB     2  
ATOM 2787  H HG11   . VAL A 1 47 ? 24.781 35.045 29.975 1.00 0.00 ? 45 VAL A HG11   2  
ATOM 2788  H HG12   . VAL A 1 47 ? 24.098 36.451 30.817 1.00 0.00 ? 45 VAL A HG12   2  
ATOM 2789  H HG13   . VAL A 1 47 ? 25.839 36.360 30.528 1.00 0.00 ? 45 VAL A HG13   2  
ATOM 2790  H HG21   . VAL A 1 47 ? 23.824 33.933 33.438 1.00 0.00 ? 45 VAL A HG21   2  
ATOM 2791  H HG22   . VAL A 1 47 ? 22.986 35.108 32.425 1.00 0.00 ? 45 VAL A HG22   2  
ATOM 2792  H HG23   . VAL A 1 47 ? 23.578 33.595 31.708 1.00 0.00 ? 45 VAL A HG23   2  
ATOM 2793  N N      . ARG A 1 48 ? 28.264 35.363 32.804 1.00 0.00 ? 46 ARG A N      2  
ATOM 2794  C CA     . ARG A 1 48 ? 29.579 36.021 32.707 1.00 0.00 ? 46 ARG A CA     2  
ATOM 2795  C C      . ARG A 1 48 ? 30.690 35.022 32.336 1.00 0.00 ? 46 ARG A C      2  
ATOM 2796  O O      . ARG A 1 48 ? 31.476 35.285 31.427 1.00 0.00 ? 46 ARG A O      2  
ATOM 2797  C CB     . ARG A 1 48 ? 29.860 36.747 34.040 1.00 0.00 ? 46 ARG A CB     2  
ATOM 2798  C CG     . ARG A 1 48 ? 30.899 37.868 33.891 1.00 0.00 ? 46 ARG A CG     2  
ATOM 2799  C CD     . ARG A 1 48 ? 31.395 38.407 35.242 1.00 0.00 ? 46 ARG A CD     2  
ATOM 2800  N NE     . ARG A 1 48 ? 30.314 38.920 36.115 1.00 0.00 ? 46 ARG A NE     2  
ATOM 2801  C CZ     . ARG A 1 48 ? 30.351 40.001 36.874 1.00 0.00 ? 46 ARG A CZ     2  
ATOM 2802  N NH1    . ARG A 1 48 ? 31.349 40.831 36.877 1.00 0.00 ? 46 ARG A NH1    2  
ATOM 2803  N NH2    . ARG A 1 48 ? 29.372 40.257 37.682 1.00 0.00 1 46 ARG A NH2    2  
ATOM 2804  H H      . ARG A 1 48 ? 27.802 35.361 33.709 1.00 0.00 ? 46 ARG A H      2  
ATOM 2805  H HA     . ARG A 1 48 ? 29.545 36.760 31.900 1.00 0.00 ? 46 ARG A HA     2  
ATOM 2806  H HB2    . ARG A 1 48 ? 28.935 37.194 34.406 1.00 0.00 ? 46 ARG A HB2    2  
ATOM 2807  H HB3    . ARG A 1 48 ? 30.205 36.025 34.780 1.00 0.00 ? 46 ARG A HB3    2  
ATOM 2808  H HG2    . ARG A 1 48 ? 31.763 37.486 33.346 1.00 0.00 ? 46 ARG A HG2    2  
ATOM 2809  H HG3    . ARG A 1 48 ? 30.467 38.686 33.314 1.00 0.00 ? 46 ARG A HG3    2  
ATOM 2810  H HD2    . ARG A 1 48 ? 31.919 37.604 35.768 1.00 0.00 ? 46 ARG A HD2    2  
ATOM 2811  H HD3    . ARG A 1 48 ? 32.119 39.193 35.028 1.00 0.00 ? 46 ARG A HD3    2  
ATOM 2812  H HE     . ARG A 1 48 ? 29.474 38.363 36.211 1.00 0.00 ? 46 ARG A HE     2  
ATOM 2813  H HH11   . ARG A 1 48 ? 32.214 40.560 36.423 1.00 0.00 ? 46 ARG A HH11   2  
ATOM 2814  H HH12   . ARG A 1 48 ? 31.361 41.630 37.501 1.00 0.00 ? 46 ARG A HH12   2  
ATOM 2815  H HH21   . ARG A 1 48 ? 28.643 39.556 37.814 1.00 0.00 ? 46 ARG A HH21   2  
ATOM 2816  H HH22   . ARG A 1 48 ? 29.350 41.132 38.192 1.00 0.00 ? 46 ARG A HH22   2  
ATOM 2817  N N      . VAL A 1 49 ? 30.683 33.846 32.968 1.00 0.00 ? 47 VAL A N      2  
ATOM 2818  C CA     . VAL A 1 49 ? 31.513 32.678 32.628 1.00 0.00 ? 47 VAL A CA     2  
ATOM 2819  C C      . VAL A 1 49 ? 31.304 32.251 31.175 1.00 0.00 ? 47 VAL A C      2  
ATOM 2820  O O      . VAL A 1 49 ? 32.292 32.059 30.465 1.00 0.00 ? 47 VAL A O      2  
ATOM 2821  C CB     . VAL A 1 49 ? 31.212 31.510 33.599 1.00 0.00 ? 47 VAL A CB     2  
ATOM 2822  C CG1    . VAL A 1 49 ? 31.607 30.118 33.086 1.00 0.00 ? 47 VAL A CG1    2  
ATOM 2823  C CG2    . VAL A 1 49 ? 31.944 31.730 34.925 1.00 0.00 ? 47 VAL A CG2    2  
ATOM 2824  H H      . VAL A 1 49 ? 30.035 33.745 33.740 1.00 0.00 ? 47 VAL A H      2  
ATOM 2825  H HA     . VAL A 1 49 ? 32.567 32.946 32.731 1.00 0.00 ? 47 VAL A HA     2  
ATOM 2826  H HB     . VAL A 1 49 ? 30.145 31.489 33.789 1.00 0.00 ? 47 VAL A HB     2  
ATOM 2827  H HG11   . VAL A 1 49 ? 30.995 29.843 32.227 1.00 0.00 ? 47 VAL A HG11   2  
ATOM 2828  H HG12   . VAL A 1 49 ? 32.658 30.098 32.807 1.00 0.00 ? 47 VAL A HG12   2  
ATOM 2829  H HG13   . VAL A 1 49 ? 31.415 29.379 33.864 1.00 0.00 ? 47 VAL A HG13   2  
ATOM 2830  H HG21   . VAL A 1 49 ? 31.619 30.983 35.649 1.00 0.00 ? 47 VAL A HG21   2  
ATOM 2831  H HG22   . VAL A 1 49 ? 33.018 31.650 34.779 1.00 0.00 ? 47 VAL A HG22   2  
ATOM 2832  H HG23   . VAL A 1 49 ? 31.713 32.715 35.330 1.00 0.00 ? 47 VAL A HG23   2  
ATOM 2833  N N      . TRP A 1 50 ? 30.055 32.139 30.710 1.00 0.00 ? 48 TRP A N      2  
ATOM 2834  C CA     . TRP A 1 50 ? 29.776 31.767 29.323 1.00 0.00 ? 48 TRP A CA     2  
ATOM 2835  C C      . TRP A 1 50 ? 30.329 32.804 28.339 1.00 0.00 ? 48 TRP A C      2  
ATOM 2836  O O      . TRP A 1 50 ? 31.021 32.428 27.396 1.00 0.00 ? 48 TRP A O      2  
ATOM 2837  C CB     . TRP A 1 50 ? 28.275 31.536 29.104 1.00 0.00 ? 48 TRP A CB     2  
ATOM 2838  C CG     . TRP A 1 50 ? 27.953 30.860 27.802 1.00 0.00 ? 48 TRP A CG     2  
ATOM 2839  C CD1    . TRP A 1 50 ? 27.831 29.525 27.641 1.00 0.00 ? 48 TRP A CD1    2  
ATOM 2840  C CD2    . TRP A 1 50 ? 27.735 31.438 26.474 1.00 0.00 ? 48 TRP A CD2    2  
ATOM 2841  N NE1    . TRP A 1 50 ? 27.562 29.232 26.321 1.00 0.00 ? 48 TRP A NE1    2  
ATOM 2842  C CE2    . TRP A 1 50 ? 27.467 30.377 25.557 1.00 0.00 ? 48 TRP A CE2    2  
ATOM 2843  C CE3    . TRP A 1 50 ? 27.751 32.747 25.944 1.00 0.00 ? 48 TRP A CE3    2  
ATOM 2844  C CZ2    . TRP A 1 50 ? 27.213 30.602 24.195 1.00 0.00 ? 48 TRP A CZ2    2  
ATOM 2845  C CZ3    . TRP A 1 50 ? 27.495 32.985 24.579 1.00 0.00 ? 48 TRP A CZ3    2  
ATOM 2846  C CH2    . TRP A 1 50 ? 27.220 31.918 23.706 1.00 0.00 ? 48 TRP A CH2    2  
ATOM 2847  H H      . TRP A 1 50 ? 29.275 32.244 31.347 1.00 0.00 ? 48 TRP A H      2  
ATOM 2848  H HA     . TRP A 1 50 ? 30.287 30.825 29.111 1.00 0.00 ? 48 TRP A HA     2  
ATOM 2849  H HB2    . TRP A 1 50 ? 27.897 30.905 29.912 1.00 0.00 ? 48 TRP A HB2    2  
ATOM 2850  H HB3    . TRP A 1 50 ? 27.745 32.490 29.150 1.00 0.00 ? 48 TRP A HB3    2  
ATOM 2851  H HD1    . TRP A 1 50 ? 27.949 28.790 28.430 1.00 0.00 ? 48 TRP A HD1    2  
ATOM 2852  H HE1    . TRP A 1 50 ? 27.497 28.265 25.991 1.00 0.00 ? 48 TRP A HE1    2  
ATOM 2853  H HE3    . TRP A 1 50 ? 27.946 33.578 26.601 1.00 0.00 ? 48 TRP A HE3    2  
ATOM 2854  H HZ2    . TRP A 1 50 ? 27.001 29.771 23.539 1.00 0.00 ? 48 TRP A HZ2    2  
ATOM 2855  H HZ3    . TRP A 1 50 ? 27.487 34.001 24.204 1.00 0.00 ? 48 TRP A HZ3    2  
ATOM 2856  H HH2    . TRP A 1 50 ? 27.012 32.111 22.663 1.00 0.00 ? 48 TRP A HH2    2  
ATOM 2857  N N      . PHE A 1 51 ? 30.110 34.101 28.582 1.00 0.00 ? 49 PHE A N      2  
ATOM 2858  C CA     . PHE A 1 51 ? 30.603 35.167 27.703 1.00 0.00 ? 49 PHE A CA     2  
ATOM 2859  C C      . PHE A 1 51 ? 32.139 35.221 27.640 1.00 0.00 ? 49 PHE A C      2  
ATOM 2860  O O      . PHE A 1 51 ? 32.692 35.157 26.537 1.00 0.00 ? 49 PHE A O      2  
ATOM 2861  C CB     . PHE A 1 51 ? 29.968 36.517 28.078 1.00 0.00 ? 49 PHE A CB     2  
ATOM 2862  C CG     . PHE A 1 51 ? 28.713 36.814 27.273 1.00 0.00 ? 49 PHE A CG     2  
ATOM 2863  C CD1    . PHE A 1 51 ? 27.511 36.132 27.544 1.00 0.00 ? 49 PHE A CD1    2  
ATOM 2864  C CD2    . PHE A 1 51 ? 28.767 37.722 26.197 1.00 0.00 ? 49 PHE A CD2    2  
ATOM 2865  C CE1    . PHE A 1 51 ? 26.379 36.335 26.733 1.00 0.00 ? 49 PHE A CE1    2  
ATOM 2866  C CE2    . PHE A 1 51 ? 27.635 37.931 25.388 1.00 0.00 ? 49 PHE A CE2    2  
ATOM 2867  C CZ     . PHE A 1 51 ? 26.446 37.229 25.651 1.00 0.00 ? 49 PHE A CZ     2  
ATOM 2868  H H      . PHE A 1 51 ? 29.545 34.355 29.384 1.00 0.00 ? 49 PHE A H      2  
ATOM 2869  H HA     . PHE A 1 51 ? 30.284 34.937 26.685 1.00 0.00 ? 49 PHE A HA     2  
ATOM 2870  H HB2    . PHE A 1 51 ? 29.740 36.544 29.145 1.00 0.00 ? 49 PHE A HB2    2  
ATOM 2871  H HB3    . PHE A 1 51 ? 30.691 37.312 27.889 1.00 0.00 ? 49 PHE A HB3    2  
ATOM 2872  H HD1    . PHE A 1 51 ? 27.461 35.427 28.360 1.00 0.00 ? 49 PHE A HD1    2  
ATOM 2873  H HD2    . PHE A 1 51 ? 29.684 38.255 25.982 1.00 0.00 ? 49 PHE A HD2    2  
ATOM 2874  H HE1    . PHE A 1 51 ? 25.466 35.793 26.932 1.00 0.00 ? 49 PHE A HE1    2  
ATOM 2875  H HE2    . PHE A 1 51 ? 27.679 38.627 24.562 1.00 0.00 ? 49 PHE A HE2    2  
ATOM 2876  H HZ     . PHE A 1 51 ? 25.586 37.377 25.017 1.00 0.00 ? 49 PHE A HZ     2  
ATOM 2877  N N      . LYS A 1 52 ? 32.854 35.215 28.776 1.00 0.00 ? 50 LYS A N      2  
ATOM 2878  C CA     . LYS A 1 52 ? 34.328 35.273 28.745 1.00 0.00 ? 50 LYS A CA     2  
ATOM 2879  C C      . LYS A 1 52 ? 34.964 33.995 28.184 1.00 0.00 ? 50 LYS A C      2  
ATOM 2880  O O      . LYS A 1 52 ? 35.918 34.085 27.413 1.00 0.00 ? 50 LYS A O      2  
ATOM 2881  C CB     . LYS A 1 52 ? 34.898 35.740 30.094 1.00 0.00 ? 50 LYS A CB     2  
ATOM 2882  C CG     . LYS A 1 52 ? 34.868 34.681 31.206 1.00 0.00 ? 50 LYS A CG     2  
ATOM 2883  C CD     . LYS A 1 52 ? 34.974 35.275 32.620 1.00 0.00 ? 50 LYS A CD     2  
ATOM 2884  C CE     . LYS A 1 52 ? 36.324 35.903 33.010 1.00 0.00 ? 50 LYS A CE     2  
ATOM 2885  N NZ     . LYS A 1 52 ? 36.515 37.277 32.481 1.00 0.00 1 50 LYS A NZ     2  
ATOM 2886  H H      . LYS A 1 52 ? 32.365 35.274 29.666 1.00 0.00 ? 50 LYS A H      2  
ATOM 2887  H HA     . LYS A 1 52 ? 34.593 36.058 28.031 1.00 0.00 ? 50 LYS A HA     2  
ATOM 2888  H HB2    . LYS A 1 52 ? 35.932 36.053 29.946 1.00 0.00 ? 50 LYS A HB2    2  
ATOM 2889  H HB3    . LYS A 1 52 ? 34.331 36.616 30.411 1.00 0.00 ? 50 LYS A HB3    2  
ATOM 2890  H HG2    . LYS A 1 52 ? 33.922 34.147 31.147 1.00 0.00 ? 50 LYS A HG2    2  
ATOM 2891  H HG3    . LYS A 1 52 ? 35.677 33.963 31.052 1.00 0.00 ? 50 LYS A HG3    2  
ATOM 2892  H HD2    . LYS A 1 52 ? 34.173 35.999 32.777 1.00 0.00 ? 50 LYS A HD2    2  
ATOM 2893  H HD3    . LYS A 1 52 ? 34.789 34.455 33.309 1.00 0.00 ? 50 LYS A HD3    2  
ATOM 2894  H HE2    . LYS A 1 52 ? 36.351 35.957 34.101 1.00 0.00 ? 50 LYS A HE2    2  
ATOM 2895  H HE3    . LYS A 1 52 ? 37.145 35.246 32.700 1.00 0.00 ? 50 LYS A HE3    2  
ATOM 2896  H HZ1    . LYS A 1 52 ? 37.240 37.759 33.009 1.00 0.00 ? 50 LYS A HZ1    2  
ATOM 2897  H HZ2    . LYS A 1 52 ? 36.851 37.274 31.527 1.00 0.00 ? 50 LYS A HZ2    2  
ATOM 2898  H HZ3    . LYS A 1 52 ? 35.659 37.828 32.527 1.00 0.00 ? 50 LYS A HZ3    2  
ATOM 2899  N N      . ASN A 1 53 ? 34.381 32.813 28.417 1.00 0.00 ? 51 ASN A N      2  
ATOM 2900  C CA     . ASN A 1 53 ? 34.824 31.590 27.731 1.00 0.00 ? 51 ASN A CA     2  
ATOM 2901  C C      . ASN A 1 53 ? 34.395 31.545 26.249 1.00 0.00 ? 51 ASN A C      2  
ATOM 2902  O O      . ASN A 1 53 ? 35.085 30.927 25.444 1.00 0.00 ? 51 ASN A O      2  
ATOM 2903  C CB     . ASN A 1 53 ? 34.423 30.332 28.513 1.00 0.00 ? 51 ASN A CB     2  
ATOM 2904  C CG     . ASN A 1 53 ? 35.221 30.188 29.797 1.00 0.00 ? 51 ASN A CG     2  
ATOM 2905  O OD1    . ASN A 1 53 ? 36.381 29.805 29.804 1.00 0.00 ? 51 ASN A OD1    2  
ATOM 2906  N ND2    . ASN A 1 53 ? 34.636 30.534 30.915 1.00 0.00 ? 51 ASN A ND2    2  
ATOM 2907  H H      . ASN A 1 53 ? 33.586 32.770 29.047 1.00 0.00 ? 51 ASN A H      2  
ATOM 2908  H HA     . ASN A 1 53 ? 35.913 31.601 27.717 1.00 0.00 ? 51 ASN A HA     2  
ATOM 2909  H HB2    . ASN A 1 53 ? 33.354 30.340 28.726 1.00 0.00 ? 51 ASN A HB2    2  
ATOM 2910  H HB3    . ASN A 1 53 ? 34.642 29.450 27.907 1.00 0.00 ? 51 ASN A HB3    2  
ATOM 2911  H HD21   . ASN A 1 53 ? 33.708 30.933 30.884 1.00 0.00 ? 51 ASN A HD21   2  
ATOM 2912  H HD22   . ASN A 1 53 ? 35.109 30.322 31.787 1.00 0.00 ? 51 ASN A HD22   2  
ATOM 2913  N N      . ARG A 1 54 ? 33.349 32.272 25.826 1.00 0.00 ? 52 ARG A N      2  
ATOM 2914  C CA     . ARG A 1 54 ? 33.041 32.516 24.402 1.00 0.00 ? 52 ARG A CA     2  
ATOM 2915  C C      . ARG A 1 54 ? 34.051 33.471 23.753 1.00 0.00 ? 52 ARG A C      2  
ATOM 2916  O O      . ARG A 1 54 ? 34.185 33.467 22.532 1.00 0.00 ? 52 ARG A O      2  
ATOM 2917  C CB     . ARG A 1 54 ? 31.585 33.010 24.253 1.00 0.00 ? 52 ARG A CB     2  
ATOM 2918  C CG     . ARG A 1 54 ? 30.993 32.940 22.831 1.00 0.00 ? 52 ARG A CG     2  
ATOM 2919  C CD     . ARG A 1 54 ? 30.953 31.526 22.228 1.00 0.00 ? 52 ARG A CD     2  
ATOM 2920  N NE     . ARG A 1 54 ? 30.284 30.560 23.118 1.00 0.00 ? 52 ARG A NE     2  
ATOM 2921  C CZ     . ARG A 1 54 ? 30.241 29.249 22.973 1.00 0.00 ? 52 ARG A CZ     2  
ATOM 2922  N NH1    . ARG A 1 54 ? 30.720 28.624 21.936 1.00 0.00 1 52 ARG A NH1    2  
ATOM 2923  N NH2    . ARG A 1 54 ? 29.697 28.511 23.890 1.00 0.00 ? 52 ARG A NH2    2  
ATOM 2924  H H      . ARG A 1 54 ? 32.732 32.683 26.525 1.00 0.00 ? 52 ARG A H      2  
ATOM 2925  H HA     . ARG A 1 54 ? 33.136 31.569 23.879 1.00 0.00 ? 52 ARG A HA     2  
ATOM 2926  H HB2    . ARG A 1 54 ? 30.942 32.418 24.902 1.00 0.00 ? 52 ARG A HB2    2  
ATOM 2927  H HB3    . ARG A 1 54 ? 31.518 34.045 24.592 1.00 0.00 ? 52 ARG A HB3    2  
ATOM 2928  H HG2    . ARG A 1 54 ? 29.973 33.322 22.869 1.00 0.00 ? 52 ARG A HG2    2  
ATOM 2929  H HG3    . ARG A 1 54 ? 31.559 33.589 22.164 1.00 0.00 ? 52 ARG A HG3    2  
ATOM 2930  H HD2    . ARG A 1 54 ? 30.420 31.576 21.275 1.00 0.00 ? 52 ARG A HD2    2  
ATOM 2931  H HD3    . ARG A 1 54 ? 31.973 31.195 22.027 1.00 0.00 ? 52 ARG A HD3    2  
ATOM 2932  H HE     . ARG A 1 54 ? 29.790 30.931 23.914 1.00 0.00 ? 52 ARG A HE     2  
ATOM 2933  H HH11   . ARG A 1 54 ? 31.084 29.138 21.140 1.00 0.00 ? 52 ARG A HH11   2  
ATOM 2934  H HH12   . ARG A 1 54 ? 30.606 27.617 21.889 1.00 0.00 ? 52 ARG A HH12   2  
ATOM 2935  H HH21   . ARG A 1 54 ? 29.352 28.893 24.752 1.00 0.00 ? 52 ARG A HH21   2  
ATOM 2936  H HH22   . ARG A 1 54 ? 29.695 27.500 23.768 1.00 0.00 ? 52 ARG A HH22   2  
ATOM 2937  N N      . ARG A 1 55 ? 34.793 34.283 24.524 1.00 0.00 ? 53 ARG A N      2  
ATOM 2938  C CA     . ARG A 1 55 ? 35.993 35.010 24.043 1.00 0.00 ? 53 ARG A CA     2  
ATOM 2939  C C      . ARG A 1 55 ? 37.222 34.103 24.010 1.00 0.00 ? 53 ARG A C      2  
ATOM 2940  O O      . ARG A 1 55 ? 37.933 34.112 23.009 1.00 0.00 ? 53 ARG A O      2  
ATOM 2941  C CB     . ARG A 1 55 ? 36.238 36.305 24.849 1.00 0.00 ? 53 ARG A CB     2  
ATOM 2942  C CG     . ARG A 1 55 ? 35.065 37.307 24.938 1.00 0.00 ? 53 ARG A CG     2  
ATOM 2943  C CD     . ARG A 1 55 ? 34.557 37.850 23.594 1.00 0.00 ? 53 ARG A CD     2  
ATOM 2944  N NE     . ARG A 1 55 ? 33.911 36.803 22.782 1.00 0.00 ? 53 ARG A NE     2  
ATOM 2945  C CZ     . ARG A 1 55 ? 33.769 36.783 21.472 1.00 0.00 ? 53 ARG A CZ     2  
ATOM 2946  N NH1    . ARG A 1 55 ? 33.912 37.842 20.734 1.00 0.00 1 53 ARG A NH1    2  
ATOM 2947  N NH2    . ARG A 1 55 ? 33.494 35.658 20.879 1.00 0.00 ? 53 ARG A NH2    2  
ATOM 2948  H H      . ARG A 1 55 ? 34.560 34.324 25.513 1.00 0.00 ? 53 ARG A H      2  
ATOM 2949  H HA     . ARG A 1 55 ? 35.858 35.291 23.003 1.00 0.00 ? 53 ARG A HA     2  
ATOM 2950  H HB2    . ARG A 1 55 ? 36.530 36.043 25.868 1.00 0.00 ? 53 ARG A HB2    2  
ATOM 2951  H HB3    . ARG A 1 55 ? 37.089 36.824 24.404 1.00 0.00 ? 53 ARG A HB3    2  
ATOM 2952  H HG2    . ARG A 1 55 ? 34.237 36.854 25.474 1.00 0.00 ? 53 ARG A HG2    2  
ATOM 2953  H HG3    . ARG A 1 55 ? 35.403 38.160 25.531 1.00 0.00 ? 53 ARG A HG3    2  
ATOM 2954  H HD2    . ARG A 1 55 ? 33.837 38.647 23.793 1.00 0.00 ? 53 ARG A HD2    2  
ATOM 2955  H HD3    . ARG A 1 55 ? 35.403 38.276 23.051 1.00 0.00 ? 53 ARG A HD3    2  
ATOM 2956  H HE     . ARG A 1 55 ? 33.689 35.951 23.263 1.00 0.00 ? 53 ARG A HE     2  
ATOM 2957  H HH11   . ARG A 1 55 ? 34.132 38.735 21.168 1.00 0.00 ? 53 ARG A HH11   2  
ATOM 2958  H HH12   . ARG A 1 55 ? 33.826 37.774 19.727 1.00 0.00 ? 53 ARG A HH12   2  
ATOM 2959  H HH21   . ARG A 1 55 ? 33.547 34.782 21.385 1.00 0.00 ? 53 ARG A HH21   2  
ATOM 2960  H HH22   . ARG A 1 55 ? 33.431 35.612 19.868 1.00 0.00 ? 53 ARG A HH22   2  
ATOM 2961  N N      . ALA A 1 56 ? 37.406 33.241 25.012 1.00 0.00 ? 54 ALA A N      2  
ATOM 2962  C CA     . ALA A 1 56 ? 38.440 32.199 24.991 1.00 0.00 ? 54 ALA A CA     2  
ATOM 2963  C C      . ALA A 1 56 ? 38.313 31.277 23.765 1.00 0.00 ? 54 ALA A C      2  
ATOM 2964  O O      . ALA A 1 56 ? 39.297 31.063 23.063 1.00 0.00 ? 54 ALA A O      2  
ATOM 2965  C CB     . ALA A 1 56 ? 38.382 31.398 26.292 1.00 0.00 ? 54 ALA A CB     2  
ATOM 2966  H H      . ALA A 1 56 ? 36.835 33.340 25.845 1.00 0.00 ? 54 ALA A H      2  
ATOM 2967  H HA     . ALA A 1 56 ? 39.413 32.683 24.936 1.00 0.00 ? 54 ALA A HA     2  
ATOM 2968  H HB1    . ALA A 1 56 ? 37.477 30.795 26.339 1.00 0.00 ? 54 ALA A HB1    2  
ATOM 2969  H HB2    . ALA A 1 56 ? 39.235 30.720 26.324 1.00 0.00 ? 54 ALA A HB2    2  
ATOM 2970  H HB3    . ALA A 1 56 ? 38.425 32.066 27.153 1.00 0.00 ? 54 ALA A HB3    2  
ATOM 2971  N N      . LYS A 1 57 ? 37.097 30.810 23.433 1.00 0.00 ? 55 LYS A N      2  
ATOM 2972  C CA     . LYS A 1 57 ? 36.802 29.989 22.239 1.00 0.00 ? 55 LYS A CA     2  
ATOM 2973  C C      . LYS A 1 57 ? 37.362 30.618 20.959 1.00 0.00 ? 55 LYS A C      2  
ATOM 2974  O O      . LYS A 1 57 ? 38.074 29.955 20.213 1.00 0.00 ? 55 LYS A O      2  
ATOM 2975  C CB     . LYS A 1 57 ? 35.276 29.751 22.126 1.00 0.00 ? 55 LYS A CB     2  
ATOM 2976  C CG     . LYS A 1 57 ? 34.876 28.290 21.851 1.00 0.00 ? 55 LYS A CG     2  
ATOM 2977  C CD     . LYS A 1 57 ? 35.133 27.379 23.065 1.00 0.00 ? 55 LYS A CD     2  
ATOM 2978  C CE     . LYS A 1 57 ? 34.556 25.966 22.896 1.00 0.00 ? 55 LYS A CE     2  
ATOM 2979  N NZ     . LYS A 1 57 ? 33.076 25.928 22.912 1.00 0.00 1 55 LYS A NZ     2  
ATOM 2980  H H      . LYS A 1 57 ? 36.347 30.966 24.103 1.00 0.00 ? 55 LYS A H      2  
ATOM 2981  H HA     . LYS A 1 57 ? 37.313 29.036 22.355 1.00 0.00 ? 55 LYS A HA     2  
ATOM 2982  H HB2    . LYS A 1 57 ? 34.775 30.060 23.044 1.00 0.00 ? 55 LYS A HB2    2  
ATOM 2983  H HB3    . LYS A 1 57 ? 34.868 30.372 21.326 1.00 0.00 ? 55 LYS A HB3    2  
ATOM 2984  H HG2    . LYS A 1 57 ? 33.812 28.273 21.613 1.00 0.00 ? 55 LYS A HG2    2  
ATOM 2985  H HG3    . LYS A 1 57 ? 35.424 27.914 20.985 1.00 0.00 ? 55 LYS A HG3    2  
ATOM 2986  H HD2    . LYS A 1 57 ? 36.209 27.284 23.214 1.00 0.00 ? 55 LYS A HD2    2  
ATOM 2987  H HD3    . LYS A 1 57 ? 34.713 27.834 23.962 1.00 0.00 ? 55 LYS A HD3    2  
ATOM 2988  H HE2    . LYS A 1 57 ? 34.915 25.543 21.957 1.00 0.00 ? 55 LYS A HE2    2  
ATOM 2989  H HE3    . LYS A 1 57 ? 34.943 25.336 23.704 1.00 0.00 ? 55 LYS A HE3    2  
ATOM 2990  H HZ1    . LYS A 1 57 ? 32.701 26.461 23.693 1.00 0.00 ? 55 LYS A HZ1    2  
ATOM 2991  H HZ2    . LYS A 1 57 ? 32.687 26.280 22.040 1.00 0.00 ? 55 LYS A HZ2    2  
ATOM 2992  H HZ3    . LYS A 1 57 ? 32.733 24.973 22.991 1.00 0.00 ? 55 LYS A HZ3    2  
ATOM 2993  N N      . TRP A 1 58 ? 37.134 31.917 20.753 1.00 0.00 ? 56 TRP A N      2  
ATOM 2994  C CA     . TRP A 1 58 ? 37.641 32.671 19.599 1.00 0.00 ? 56 TRP A CA     2  
ATOM 2995  C C      . TRP A 1 58 ? 39.178 32.703 19.556 1.00 0.00 ? 56 TRP A C      2  
ATOM 2996  O O      . TRP A 1 58 ? 39.769 32.346 18.533 1.00 0.00 ? 56 TRP A O      2  
ATOM 2997  C CB     . TRP A 1 58 ? 37.002 34.067 19.632 1.00 0.00 ? 56 TRP A CB     2  
ATOM 2998  C CG     . TRP A 1 58 ? 37.505 35.095 18.665 1.00 0.00 ? 56 TRP A CG     2  
ATOM 2999  C CD1    . TRP A 1 58 ? 37.692 34.928 17.334 1.00 0.00 ? 56 TRP A CD1    2  
ATOM 3000  C CD2    . TRP A 1 58 ? 37.865 36.486 18.941 1.00 0.00 ? 56 TRP A CD2    2  
ATOM 3001  N NE1    . TRP A 1 58 ? 38.142 36.109 16.775 1.00 0.00 ? 56 TRP A NE1    2  
ATOM 3002  C CE2    . TRP A 1 58 ? 38.283 37.098 17.721 1.00 0.00 ? 56 TRP A CE2    2  
ATOM 3003  C CE3    . TRP A 1 58 ? 37.885 37.292 20.102 1.00 0.00 ? 56 TRP A CE3    2  
ATOM 3004  C CZ2    . TRP A 1 58 ? 38.712 38.431 17.658 1.00 0.00 ? 56 TRP A CZ2    2  
ATOM 3005  C CZ3    . TRP A 1 58 ? 38.313 38.634 20.051 1.00 0.00 ? 56 TRP A CZ3    2  
ATOM 3006  C CH2    . TRP A 1 58 ? 38.733 39.201 18.834 1.00 0.00 ? 56 TRP A CH2    2  
ATOM 3007  H H      . TRP A 1 58 ? 36.547 32.400 21.415 1.00 0.00 ? 56 TRP A H      2  
ATOM 3008  H HA     . TRP A 1 58 ? 37.315 32.173 18.686 1.00 0.00 ? 56 TRP A HA     2  
ATOM 3009  H HB2    . TRP A 1 58 ? 35.928 33.955 19.474 1.00 0.00 ? 56 TRP A HB2    2  
ATOM 3010  H HB3    . TRP A 1 58 ? 37.132 34.482 20.629 1.00 0.00 ? 56 TRP A HB3    2  
ATOM 3011  H HD1    . TRP A 1 58 ? 37.510 34.008 16.786 1.00 0.00 ? 56 TRP A HD1    2  
ATOM 3012  H HE1    . TRP A 1 58 ? 38.328 36.227 15.785 1.00 0.00 ? 56 TRP A HE1    2  
ATOM 3013  H HE3    . TRP A 1 58 ? 37.579 36.866 21.046 1.00 0.00 ? 56 TRP A HE3    2  
ATOM 3014  H HZ2    . TRP A 1 58 ? 39.036 38.855 16.717 1.00 0.00 ? 56 TRP A HZ2    2  
ATOM 3015  H HZ3    . TRP A 1 58 ? 38.336 39.230 20.953 1.00 0.00 ? 56 TRP A HZ3    2  
ATOM 3016  H HH2    . TRP A 1 58 ? 39.081 40.227 18.808 1.00 0.00 ? 56 TRP A HH2    2  
ATOM 3017  N N      . ARG A 1 59 ? 39.847 33.032 20.673 1.00 0.00 ? 57 ARG A N      2  
ATOM 3018  C CA     . ARG A 1 59 ? 41.324 33.067 20.732 1.00 0.00 ? 57 ARG A CA     2  
ATOM 3019  C C      . ARG A 1 59 ? 41.952 31.669 20.592 1.00 0.00 ? 57 ARG A C      2  
ATOM 3020  O O      . ARG A 1 59 ? 42.937 31.513 19.867 1.00 0.00 ? 57 ARG A O      2  
ATOM 3021  C CB     . ARG A 1 59 ? 41.826 33.761 22.014 1.00 0.00 ? 57 ARG A CB     2  
ATOM 3022  C CG     . ARG A 1 59 ? 41.280 35.171 22.323 1.00 0.00 ? 57 ARG A CG     2  
ATOM 3023  C CD     . ARG A 1 59 ? 41.175 36.165 21.152 1.00 0.00 ? 57 ARG A CD     2  
ATOM 3024  N NE     . ARG A 1 59 ? 42.404 36.284 20.342 1.00 0.00 ? 57 ARG A NE     2  
ATOM 3025  C CZ     . ARG A 1 59 ? 43.598 36.730 20.687 1.00 0.00 ? 57 ARG A CZ     2  
ATOM 3026  N NH1    . ARG A 1 59 ? 43.877 37.177 21.871 1.00 0.00 ? 57 ARG A NH1    2  
ATOM 3027  N NH2    . ARG A 1 59 ? 44.542 36.730 19.795 1.00 0.00 1 57 ARG A NH2    2  
ATOM 3028  H H      . ARG A 1 59 ? 39.309 33.269 21.504 1.00 0.00 ? 57 ARG A H      2  
ATOM 3029  H HA     . ARG A 1 59 ? 41.685 33.641 19.879 1.00 0.00 ? 57 ARG A HA     2  
ATOM 3030  H HB2    . ARG A 1 59 ? 41.616 33.123 22.871 1.00 0.00 ? 57 ARG A HB2    2  
ATOM 3031  H HB3    . ARG A 1 59 ? 42.913 33.840 21.937 1.00 0.00 ? 57 ARG A HB3    2  
ATOM 3032  H HG2    . ARG A 1 59 ? 40.283 35.064 22.749 1.00 0.00 ? 57 ARG A HG2    2  
ATOM 3033  H HG3    . ARG A 1 59 ? 41.905 35.610 23.102 1.00 0.00 ? 57 ARG A HG3    2  
ATOM 3034  H HD2    . ARG A 1 59 ? 40.370 35.839 20.496 1.00 0.00 ? 57 ARG A HD2    2  
ATOM 3035  H HD3    . ARG A 1 59 ? 40.897 37.144 21.543 1.00 0.00 ? 57 ARG A HD3    2  
ATOM 3036  H HE     . ARG A 1 59 ? 42.324 36.063 19.355 1.00 0.00 ? 57 ARG A HE     2  
ATOM 3037  H HH11   . ARG A 1 59 ? 43.103 37.412 22.486 1.00 0.00 ? 57 ARG A HH11   2  
ATOM 3038  H HH12   . ARG A 1 59 ? 44.784 37.573 22.066 1.00 0.00 ? 57 ARG A HH12   2  
ATOM 3039  H HH21   . ARG A 1 59 ? 44.295 36.454 18.856 1.00 0.00 ? 57 ARG A HH21   2  
ATOM 3040  H HH22   . ARG A 1 59 ? 45.459 37.097 20.017 1.00 0.00 ? 57 ARG A HH22   2  
ATOM 3041  N N      . LYS A 1 60 ? 41.356 30.633 21.192 1.00 0.00 ? 58 LYS A N      2  
ATOM 3042  C CA     . LYS A 1 60 ? 41.818 29.230 21.147 1.00 0.00 ? 58 LYS A CA     2  
ATOM 3043  C C      . LYS A 1 60 ? 41.577 28.540 19.794 1.00 0.00 ? 58 LYS A C      2  
ATOM 3044  O O      . LYS A 1 60 ? 42.417 27.739 19.369 1.00 0.00 ? 58 LYS A O      2  
ATOM 3045  C CB     . LYS A 1 60 ? 41.141 28.443 22.288 1.00 0.00 ? 58 LYS A CB     2  
ATOM 3046  C CG     . LYS A 1 60 ? 41.675 28.812 23.686 1.00 0.00 ? 58 LYS A CG     2  
ATOM 3047  C CD     . LYS A 1 60 ? 40.861 28.089 24.772 1.00 0.00 ? 58 LYS A CD     2  
ATOM 3048  C CE     . LYS A 1 60 ? 41.376 28.321 26.201 1.00 0.00 ? 58 LYS A CE     2  
ATOM 3049  N NZ     . LYS A 1 60 ? 42.689 27.676 26.445 1.00 0.00 1 58 LYS A NZ     2  
ATOM 3050  H H      . LYS A 1 60 ? 40.569 30.850 21.797 1.00 0.00 ? 58 LYS A H      2  
ATOM 3051  H HA     . LYS A 1 60 ? 42.894 29.206 21.317 1.00 0.00 ? 58 LYS A HA     2  
ATOM 3052  H HB2    . LYS A 1 60 ? 40.063 28.606 22.248 1.00 0.00 ? 58 LYS A HB2    2  
ATOM 3053  H HB3    . LYS A 1 60 ? 41.319 27.378 22.139 1.00 0.00 ? 58 LYS A HB3    2  
ATOM 3054  H HG2    . LYS A 1 60 ? 42.723 28.518 23.752 1.00 0.00 ? 58 LYS A HG2    2  
ATOM 3055  H HG3    . LYS A 1 60 ? 41.604 29.888 23.846 1.00 0.00 ? 58 LYS A HG3    2  
ATOM 3056  H HD2    . LYS A 1 60 ? 39.830 28.444 24.724 1.00 0.00 ? 58 LYS A HD2    2  
ATOM 3057  H HD3    . LYS A 1 60 ? 40.853 27.017 24.567 1.00 0.00 ? 58 LYS A HD3    2  
ATOM 3058  H HE2    . LYS A 1 60 ? 41.433 29.397 26.402 1.00 0.00 ? 58 LYS A HE2    2  
ATOM 3059  H HE3    . LYS A 1 60 ? 40.640 27.900 26.893 1.00 0.00 ? 58 LYS A HE3    2  
ATOM 3060  H HZ1    . LYS A 1 60 ? 43.461 28.308 26.244 1.00 0.00 ? 58 LYS A HZ1    2  
ATOM 3061  H HZ2    . LYS A 1 60 ? 42.765 27.354 27.408 1.00 0.00 ? 58 LYS A HZ2    2  
ATOM 3062  H HZ3    . LYS A 1 60 ? 42.809 26.855 25.856 1.00 0.00 ? 58 LYS A HZ3    2  
ATOM 3063  N N      . ARG A 1 61 ? 40.458 28.833 19.112 1.00 0.00 ? 59 ARG A N      2  
ATOM 3064  C CA     . ARG A 1 61 ? 40.025 28.161 17.868 1.00 0.00 ? 59 ARG A CA     2  
ATOM 3065  C C      . ARG A 1 61 ? 40.488 28.866 16.591 1.00 0.00 ? 59 ARG A C      2  
ATOM 3066  O O      . ARG A 1 61 ? 40.911 28.191 15.657 1.00 0.00 ? 59 ARG A O      2  
ATOM 3067  C CB     . ARG A 1 61 ? 38.491 27.996 17.897 1.00 0.00 ? 59 ARG A CB     2  
ATOM 3068  C CG     . ARG A 1 61 ? 37.898 27.017 16.866 1.00 0.00 ? 59 ARG A CG     2  
ATOM 3069  C CD     . ARG A 1 61 ? 37.898 25.553 17.333 1.00 0.00 ? 59 ARG A CD     2  
ATOM 3070  N NE     . ARG A 1 61 ? 39.245 24.956 17.366 1.00 0.00 ? 59 ARG A NE     2  
ATOM 3071  C CZ     . ARG A 1 61 ? 39.763 24.198 18.318 1.00 0.00 ? 59 ARG A CZ     2  
ATOM 3072  N NH1    . ARG A 1 61 ? 39.161 23.886 19.428 1.00 0.00 ? 59 ARG A NH1    2  
ATOM 3073  N NH2    . ARG A 1 61 ? 40.951 23.699 18.188 1.00 0.00 1 59 ARG A NH2    2  
ATOM 3074  H H      . ARG A 1 61 ? 39.789 29.445 19.570 1.00 0.00 ? 59 ARG A H      2  
ATOM 3075  H HA     . ARG A 1 61 ? 40.475 27.169 17.846 1.00 0.00 ? 59 ARG A HA     2  
ATOM 3076  H HB2    . ARG A 1 61 ? 38.183 27.663 18.891 1.00 0.00 ? 59 ARG A HB2    2  
ATOM 3077  H HB3    . ARG A 1 61 ? 38.042 28.977 17.725 1.00 0.00 ? 59 ARG A HB3    2  
ATOM 3078  H HG2    . ARG A 1 61 ? 36.858 27.301 16.708 1.00 0.00 ? 59 ARG A HG2    2  
ATOM 3079  H HG3    . ARG A 1 61 ? 38.408 27.107 15.907 1.00 0.00 ? 59 ARG A HG3    2  
ATOM 3080  H HD2    . ARG A 1 61 ? 37.429 25.502 18.314 1.00 0.00 ? 59 ARG A HD2    2  
ATOM 3081  H HD3    . ARG A 1 61 ? 37.284 24.976 16.640 1.00 0.00 ? 59 ARG A HD3    2  
ATOM 3082  H HE     . ARG A 1 61 ? 39.780 25.020 16.506 1.00 0.00 ? 59 ARG A HE     2  
ATOM 3083  H HH11   . ARG A 1 61 ? 38.252 24.262 19.677 1.00 0.00 ? 59 ARG A HH11   2  
ATOM 3084  H HH12   . ARG A 1 61 ? 39.635 23.253 20.059 1.00 0.00 ? 59 ARG A HH12   2  
ATOM 3085  H HH21   . ARG A 1 61 ? 41.573 23.996 17.447 1.00 0.00 ? 59 ARG A HH21   2  
ATOM 3086  H HH22   . ARG A 1 61 ? 41.275 23.089 18.934 1.00 0.00 ? 59 ARG A HH22   2  
ATOM 3087  N N      . GLU A 1 62 ? 40.440 30.196 16.536 1.00 0.00 ? 60 GLU A N      2  
ATOM 3088  C CA     . GLU A 1 62 ? 40.735 30.978 15.314 1.00 0.00 ? 60 GLU A CA     2  
ATOM 3089  C C      . GLU A 1 62 ? 41.874 32.004 15.485 1.00 0.00 ? 60 GLU A C      2  
ATOM 3090  O O      . GLU A 1 62 ? 42.382 32.532 14.494 1.00 0.00 ? 60 GLU A O      2  
ATOM 3091  C CB     . GLU A 1 62 ? 39.456 31.700 14.856 1.00 0.00 ? 60 GLU A CB     2  
ATOM 3092  C CG     . GLU A 1 62 ? 38.301 30.794 14.390 1.00 0.00 ? 60 GLU A CG     2  
ATOM 3093  C CD     . GLU A 1 62 ? 38.561 30.019 13.089 1.00 0.00 ? 60 GLU A CD     2  
ATOM 3094  O OE1    . GLU A 1 62 ? 39.563 30.268 12.381 1.00 0.00 ? 60 GLU A OE1    2  
ATOM 3095  O OE2    . GLU A 1 62 ? 37.770 29.098 12.768 1.00 0.00 ? 60 GLU A OE2    2  
ATOM 3096  H H      . GLU A 1 62 ? 40.056 30.691 17.333 1.00 0.00 ? 60 GLU A H      2  
ATOM 3097  H HA     . GLU A 1 62 ? 41.053 30.314 14.508 1.00 0.00 ? 60 GLU A HA     2  
ATOM 3098  H HB2    . GLU A 1 62 ? 39.096 32.316 15.681 1.00 0.00 ? 60 GLU A HB2    2  
ATOM 3099  H HB3    . GLU A 1 62 ? 39.713 32.374 14.042 1.00 0.00 ? 60 GLU A HB3    2  
ATOM 3100  H HG2    . GLU A 1 62 ? 38.055 30.090 15.188 1.00 0.00 ? 60 GLU A HG2    2  
ATOM 3101  H HG3    . GLU A 1 62 ? 37.424 31.422 14.228 1.00 0.00 ? 60 GLU A HG3    2  
ATOM 3102  N N      . GLU A 1 63 ? 42.285 32.288 16.725 1.00 0.00 ? 61 GLU A N      2  
ATOM 3103  C CA     . GLU A 1 63 ? 43.237 33.330 17.161 1.00 0.00 ? 61 GLU A CA     2  
ATOM 3104  C C      . GLU A 1 63 ? 42.836 34.783 16.850 1.00 0.00 ? 61 GLU A C      2  
ATOM 3105  O O      . GLU A 1 63 ? 43.021 35.636 17.713 1.00 0.00 ? 61 GLU A O      2  
ATOM 3106  C CB     . GLU A 1 63 ? 44.675 32.995 16.733 1.00 0.00 ? 61 GLU A CB     2  
ATOM 3107  C CG     . GLU A 1 63 ? 45.708 33.887 17.443 1.00 0.00 ? 61 GLU A CG     2  
ATOM 3108  C CD     . GLU A 1 63 ? 47.141 33.435 17.151 1.00 0.00 ? 61 GLU A CD     2  
ATOM 3109  O OE1    . GLU A 1 63 ? 47.554 33.452 15.971 1.00 0.00 ? 61 GLU A OE1    2  
ATOM 3110  O OE2    . GLU A 1 63 ? 47.862 33.024 18.095 1.00 0.00 ? 61 GLU A OE2    2  
ATOM 3111  H H      . GLU A 1 63 ? 41.779 31.829 17.472 1.00 0.00 ? 61 GLU A H      2  
ATOM 3112  H HA     . GLU A 1 63 ? 43.249 33.287 18.249 1.00 0.00 ? 61 GLU A HA     2  
ATOM 3113  H HB2    . GLU A 1 63 ? 44.884 31.953 16.984 1.00 0.00 ? 61 GLU A HB2    2  
ATOM 3114  H HB3    . GLU A 1 63 ? 44.769 33.120 15.656 1.00 0.00 ? 61 GLU A HB3    2  
ATOM 3115  H HG2    . GLU A 1 63 ? 45.590 34.920 17.110 1.00 0.00 ? 61 GLU A HG2    2  
ATOM 3116  H HG3    . GLU A 1 63 ? 45.529 33.851 18.520 1.00 0.00 ? 61 GLU A HG3    2  
ATOM 3117  N N      . PHE A 1 64 ? 42.253 35.085 15.689 1.00 0.00 ? 62 PHE A N      2  
ATOM 3118  C CA     . PHE A 1 64 ? 41.672 36.405 15.390 1.00 0.00 ? 62 PHE A CA     2  
ATOM 3119  C C      . PHE A 1 64 ? 40.468 36.366 14.430 1.00 0.00 ? 62 PHE A C      2  
ATOM 3120  O O      . PHE A 1 64 ? 39.678 37.312 14.414 1.00 0.00 ? 62 PHE A O      2  
ATOM 3121  C CB     . PHE A 1 64 ? 42.767 37.343 14.848 1.00 0.00 ? 62 PHE A CB     2  
ATOM 3122  C CG     . PHE A 1 64 ? 43.238 37.040 13.437 1.00 0.00 ? 62 PHE A CG     2  
ATOM 3123  C CD1    . PHE A 1 64 ? 44.242 36.077 13.210 1.00 0.00 ? 62 PHE A CD1    2  
ATOM 3124  C CD2    . PHE A 1 64 ? 42.656 37.707 12.342 1.00 0.00 ? 62 PHE A CD2    2  
ATOM 3125  C CE1    . PHE A 1 64 ? 44.650 35.782 11.897 1.00 0.00 ? 62 PHE A CE1    2  
ATOM 3126  C CE2    . PHE A 1 64 ? 43.061 37.407 11.028 1.00 0.00 ? 62 PHE A CE2    2  
ATOM 3127  C CZ     . PHE A 1 64 ? 44.059 36.444 10.806 1.00 0.00 ? 62 PHE A CZ     2  
ATOM 3128  H H      . PHE A 1 64 ? 42.192 34.343 15.004 1.00 0.00 ? 62 PHE A H      2  
ATOM 3129  H HA     . PHE A 1 64 ? 41.307 36.839 16.323 1.00 0.00 ? 62 PHE A HA     2  
ATOM 3130  H HB2    . PHE A 1 64 ? 42.378 38.364 14.867 1.00 0.00 ? 62 PHE A HB2    2  
ATOM 3131  H HB3    . PHE A 1 64 ? 43.626 37.325 15.520 1.00 0.00 ? 62 PHE A HB3    2  
ATOM 3132  H HD1    . PHE A 1 64 ? 44.692 35.555 14.043 1.00 0.00 ? 62 PHE A HD1    2  
ATOM 3133  H HD2    . PHE A 1 64 ? 41.884 38.445 12.505 1.00 0.00 ? 62 PHE A HD2    2  
ATOM 3134  H HE1    . PHE A 1 64 ? 45.410 35.031 11.723 1.00 0.00 ? 62 PHE A HE1    2  
ATOM 3135  H HE2    . PHE A 1 64 ? 42.592 37.907 10.189 1.00 0.00 ? 62 PHE A HE2    2  
ATOM 3136  H HZ     . PHE A 1 64 ? 44.358 36.201 9.795  1.00 0.00 ? 62 PHE A HZ     2  
ATOM 3137  N N      . ILE A 1 65 ? 40.291 35.296 13.647 1.00 0.00 ? 63 ILE A N      2  
ATOM 3138  C CA     . ILE A 1 65 ? 39.268 35.228 12.588 1.00 0.00 ? 63 ILE A CA     2  
ATOM 3139  C C      . ILE A 1 65 ? 37.870 34.967 13.175 1.00 0.00 ? 63 ILE A C      2  
ATOM 3140  O O      . ILE A 1 65 ? 37.704 34.146 14.077 1.00 0.00 ? 63 ILE A O      2  
ATOM 3141  C CB     . ILE A 1 65 ? 39.666 34.200 11.496 1.00 0.00 ? 63 ILE A CB     2  
ATOM 3142  C CG1    . ILE A 1 65 ? 41.049 34.551 10.893 1.00 0.00 ? 63 ILE A CG1    2  
ATOM 3143  C CG2    . ILE A 1 65 ? 38.597 34.138 10.386 1.00 0.00 ? 63 ILE A CG2    2  
ATOM 3144  C CD1    . ILE A 1 65 ? 41.631 33.489 9.951  1.00 0.00 ? 63 ILE A CD1    2  
ATOM 3145  H H      . ILE A 1 65 ? 40.949 34.534 13.713 1.00 0.00 ? 63 ILE A H      2  
ATOM 3146  H HA     . ILE A 1 65 ? 39.241 36.203 12.101 1.00 0.00 ? 63 ILE A HA     2  
ATOM 3147  H HB     . ILE A 1 65 ? 39.733 33.213 11.952 1.00 0.00 ? 63 ILE A HB     2  
ATOM 3148  H HG12   . ILE A 1 65 ? 40.975 35.496 10.352 1.00 0.00 ? 63 ILE A HG12   2  
ATOM 3149  H HG13   . ILE A 1 65 ? 41.778 34.674 11.695 1.00 0.00 ? 63 ILE A HG13   2  
ATOM 3150  H HG21   . ILE A 1 65 ? 38.467 35.122 9.937  1.00 0.00 ? 63 ILE A HG21   2  
ATOM 3151  H HG22   . ILE A 1 65 ? 38.893 33.436 9.610  1.00 0.00 ? 63 ILE A HG22   2  
ATOM 3152  H HG23   . ILE A 1 65 ? 37.647 33.786 10.786 1.00 0.00 ? 63 ILE A HG23   2  
ATOM 3153  H HD11   . ILE A 1 65 ? 41.656 32.521 10.453 1.00 0.00 ? 63 ILE A HD11   2  
ATOM 3154  H HD12   . ILE A 1 65 ? 41.039 33.416 9.038  1.00 0.00 ? 63 ILE A HD12   2  
ATOM 3155  H HD13   . ILE A 1 65 ? 42.648 33.770 9.678  1.00 0.00 ? 63 ILE A HD13   2  
ATOM 3156  N N      . VAL A 1 66 ? 36.851 35.650 12.651 1.00 0.00 ? 64 VAL A N      2  
ATOM 3157  C CA     . VAL A 1 66 ? 35.435 35.377 12.941 1.00 0.00 ? 64 VAL A CA     2  
ATOM 3158  C C      . VAL A 1 66 ? 34.539 35.723 11.748 1.00 0.00 ? 64 VAL A C      2  
ATOM 3159  O O      . VAL A 1 66 ? 34.671 36.792 11.149 1.00 0.00 ? 64 VAL A O      2  
ATOM 3160  C CB     . VAL A 1 66 ? 34.980 36.087 14.239 1.00 0.00 ? 64 VAL A CB     2  
ATOM 3161  C CG1    . VAL A 1 66 ? 35.185 37.608 14.234 1.00 0.00 ? 64 VAL A CG1    2  
ATOM 3162  C CG2    . VAL A 1 66 ? 33.513 35.785 14.573 1.00 0.00 ? 64 VAL A CG2    2  
ATOM 3163  H H      . VAL A 1 66 ? 37.063 36.381 11.979 1.00 0.00 ? 64 VAL A H      2  
ATOM 3164  H HA     . VAL A 1 66 ? 35.338 34.307 13.114 1.00 0.00 ? 64 VAL A HA     2  
ATOM 3165  H HB     . VAL A 1 66 ? 35.577 35.686 15.060 1.00 0.00 ? 64 VAL A HB     2  
ATOM 3166  H HG11   . VAL A 1 66 ? 36.237 37.846 14.074 1.00 0.00 ? 64 VAL A HG11   2  
ATOM 3167  H HG12   . VAL A 1 66 ? 34.589 38.072 13.450 1.00 0.00 ? 64 VAL A HG12   2  
ATOM 3168  H HG13   . VAL A 1 66 ? 34.885 38.022 15.196 1.00 0.00 ? 64 VAL A HG13   2  
ATOM 3169  H HG21   . VAL A 1 66 ? 33.266 36.197 15.549 1.00 0.00 ? 64 VAL A HG21   2  
ATOM 3170  H HG22   . VAL A 1 66 ? 32.850 36.241 13.836 1.00 0.00 ? 64 VAL A HG22   2  
ATOM 3171  H HG23   . VAL A 1 66 ? 33.347 34.707 14.595 1.00 0.00 ? 64 VAL A HG23   2  
ATOM 3172  N N      . THR A 1 67 ? 33.584 34.840 11.440 1.00 0.00 ? 65 THR A N      2  
ATOM 3173  C CA     . THR A 1 67 ? 32.442 35.116 10.555 1.00 0.00 ? 65 THR A CA     2  
ATOM 3174  C C      . THR A 1 67 ? 31.143 34.709 11.258 1.00 0.00 ? 65 THR A C      2  
ATOM 3175  O O      . THR A 1 67 ? 30.866 33.522 11.446 1.00 0.00 ? 65 THR A O      2  
ATOM 3176  C CB     . THR A 1 67 ? 32.590 34.459 9.166  1.00 0.00 ? 65 THR A CB     2  
ATOM 3177  O OG1    . THR A 1 67 ? 32.819 33.061 9.203  1.00 0.00 ? 65 THR A OG1    2  
ATOM 3178  C CG2    . THR A 1 67 ? 33.744 35.068 8.372  1.00 0.00 ? 65 THR A CG2    2  
ATOM 3179  H H      . THR A 1 67 ? 33.581 33.950 11.914 1.00 0.00 ? 65 THR A H      2  
ATOM 3180  H HA     . THR A 1 67 ? 32.380 36.190 10.384 1.00 0.00 ? 65 THR A HA     2  
ATOM 3181  H HB     . THR A 1 67 ? 31.670 34.636 8.610  1.00 0.00 ? 65 THR A HB     2  
ATOM 3182  H HG1    . THR A 1 67 ? 33.642 32.907 9.709  1.00 0.00 ? 65 THR A HG1    2  
ATOM 3183  H HG21   . THR A 1 67 ? 34.695 34.842 8.853  1.00 0.00 ? 65 THR A HG21   2  
ATOM 3184  H HG22   . THR A 1 67 ? 33.751 34.667 7.359  1.00 0.00 ? 65 THR A HG22   2  
ATOM 3185  H HG23   . THR A 1 67 ? 33.620 36.150 8.317  1.00 0.00 ? 65 THR A HG23   2  
ATOM 3186  N N      . ASP A 1 68 ? 30.346 35.697 11.686 1.00 0.00 ? 66 ASP A N      2  
ATOM 3187  C CA     . ASP A 1 68 ? 29.121 35.514 12.494 1.00 0.00 ? 66 ASP A CA     2  
ATOM 3188  C C      . ASP A 1 68 ? 27.968 36.439 12.087 1.00 0.00 ? 66 ASP A C      2  
ATOM 3189  O O      . ASP A 1 68 ? 26.818 35.963 12.029 1.00 0.00 ? 66 ASP A O      2  
ATOM 3190  C CB     . ASP A 1 68 ? 29.445 35.630 14.004 1.00 0.00 ? 66 ASP A CB     2  
ATOM 3191  C CG     . ASP A 1 68 ? 29.416 37.053 14.585 1.00 0.00 ? 66 ASP A CG     2  
ATOM 3192  O OD1    . ASP A 1 68 ? 30.392 37.829 14.417 1.00 0.00 ? 66 ASP A OD1    2  
ATOM 3193  O OD2    . ASP A 1 68 ? 28.408 37.427 15.234 1.00 0.00 ? 66 ASP A OD2    2  
ATOM 3194  O OXT    . ASP A 1 68 ? 28.203 37.633 11.796 1.00 0.00 ? 66 ASP A OXT    2  
ATOM 3195  H H      . ASP A 1 68 ? 30.628 36.650 11.496 1.00 0.00 ? 66 ASP A H      2  
ATOM 3196  H HA     . ASP A 1 68 ? 28.751 34.502 12.333 1.00 0.00 ? 66 ASP A HA     2  
ATOM 3197  H HB2    . ASP A 1 68 ? 28.711 35.034 14.546 1.00 0.00 ? 66 ASP A HB2    2  
ATOM 3198  H HB3    . ASP A 1 68 ? 30.416 35.177 14.205 1.00 0.00 ? 66 ASP A HB3    2  
ATOM 3199  O "O5'"  . DG  B 2 1  ? 50.711 10.342 28.804 1.00 0.00 ? 67 DG  B "O5'"  2  
ATOM 3200  C "C5'"  . DG  B 2 1  ? 51.589 10.144 27.703 1.00 0.00 ? 67 DG  B "C5'"  2  
ATOM 3201  C "C4'"  . DG  B 2 1  ? 51.202 10.909 26.420 1.00 0.00 ? 67 DG  B "C4'"  2  
ATOM 3202  O "O4'"  . DG  B 2 1  ? 49.802 10.790 26.178 1.00 0.00 ? 67 DG  B "O4'"  2  
ATOM 3203  C "C3'"  . DG  B 2 1  ? 51.478 12.424 26.424 1.00 0.00 ? 67 DG  B "C3'"  2  
ATOM 3204  O "O3'"  . DG  B 2 1  ? 51.633 12.859 25.070 1.00 0.00 ? 67 DG  B "O3'"  2  
ATOM 3205  C "C2'"  . DG  B 2 1  ? 50.211 12.957 27.079 1.00 0.00 ? 67 DG  B "C2'"  2  
ATOM 3206  C "C1'"  . DG  B 2 1  ? 49.157 12.020 26.496 1.00 0.00 ? 67 DG  B "C1'"  2  
ATOM 3207  N N9     . DG  B 2 1  ? 47.996 11.771 27.381 1.00 0.00 ? 67 DG  B N9     2  
ATOM 3208  C C8     . DG  B 2 1  ? 47.883 11.876 28.749 1.00 0.00 ? 67 DG  B C8     2  
ATOM 3209  N N7     . DG  B 2 1  ? 46.702 11.568 29.217 1.00 0.00 ? 67 DG  B N7     2  
ATOM 3210  C C5     . DG  B 2 1  ? 45.959 11.286 28.063 1.00 0.00 ? 67 DG  B C5     2  
ATOM 3211  C C6     . DG  B 2 1  ? 44.581 10.917 27.886 1.00 0.00 ? 67 DG  B C6     2  
ATOM 3212  O O6     . DG  B 2 1  ? 43.718 10.686 28.736 1.00 0.00 ? 67 DG  B O6     2  
ATOM 3213  N N1     . DG  B 2 1  ? 44.213 10.802 26.562 1.00 0.00 ? 67 DG  B N1     2  
ATOM 3214  C C2     . DG  B 2 1  ? 45.068 10.941 25.521 1.00 0.00 ? 67 DG  B C2     2  
ATOM 3215  N N2     . DG  B 2 1  ? 44.571 10.752 24.331 1.00 0.00 ? 67 DG  B N2     2  
ATOM 3216  N N3     . DG  B 2 1  ? 46.370 11.204 25.630 1.00 0.00 ? 67 DG  B N3     2  
ATOM 3217  C C4     . DG  B 2 1  ? 46.747 11.401 26.936 1.00 0.00 ? 67 DG  B C4     2  
ATOM 3218  H "H5'"  . DG  B 2 1  ? 51.616 9.080  27.463 1.00 0.00 ? 67 DG  B "H5'"  2  
ATOM 3219  H "H5''" . DG  B 2 1  ? 52.601 10.441 27.986 1.00 0.00 ? 67 DG  B "H5''" 2  
ATOM 3220  H "H4'"  . DG  B 2 1  ? 51.759 10.453 25.604 1.00 0.00 ? 67 DG  B "H4'"  2  
ATOM 3221  H "H3'"  . DG  B 2 1  ? 52.364 12.665 27.015 1.00 0.00 ? 67 DG  B "H3'"  2  
ATOM 3222  H "H2'"  . DG  B 2 1  ? 50.308 12.862 28.159 1.00 0.00 ? 67 DG  B "H2'"  2  
ATOM 3223  H "H2''" . DG  B 2 1  ? 50.001 13.993 26.829 1.00 0.00 ? 67 DG  B "H2''" 2  
ATOM 3224  H "H1'"  . DG  B 2 1  ? 48.791 12.472 25.569 1.00 0.00 ? 67 DG  B "H1'"  2  
ATOM 3225  H H8     . DG  B 2 1  ? 48.710 12.157 29.392 1.00 0.00 ? 67 DG  B H8     2  
ATOM 3226  H H1     . DG  B 2 1  ? 43.239 10.615 26.376 1.00 0.00 ? 67 DG  B H1     2  
ATOM 3227  H H21    . DG  B 2 1  ? 45.164 10.868 23.520 1.00 0.00 ? 67 DG  B H21    2  
ATOM 3228  H H22    . DG  B 2 1  ? 43.579 10.560 24.242 1.00 0.00 ? 67 DG  B H22    2  
ATOM 3229  H "HO5'" . DG  B 2 1  ? 49.876 9.860  28.630 1.00 0.00 ? 67 DG  B "HO5'" 2  
ATOM 3230  P P      . DC  B 2 2  ? 51.793 14.398 24.654 1.00 0.00 ? 68 DC  B P      2  
ATOM 3231  O OP1    . DC  B 2 2  ? 52.576 14.471 23.401 1.00 0.00 ? 68 DC  B OP1    2  
ATOM 3232  O OP2    . DC  B 2 2  ? 52.242 15.192 25.816 1.00 0.00 ? 68 DC  B OP2    2  
ATOM 3233  O "O5'"  . DC  B 2 2  ? 50.312 14.854 24.294 1.00 0.00 ? 68 DC  B "O5'"  2  
ATOM 3234  C "C5'"  . DC  B 2 2  ? 49.697 14.465 23.066 1.00 0.00 ? 68 DC  B "C5'"  2  
ATOM 3235  C "C4'"  . DC  B 2 2  ? 48.273 15.006 22.941 1.00 0.00 ? 68 DC  B "C4'"  2  
ATOM 3236  O "O4'"  . DC  B 2 2  ? 47.489 14.452 23.981 1.00 0.00 ? 68 DC  B "O4'"  2  
ATOM 3237  C "C3'"  . DC  B 2 2  ? 48.173 16.543 23.013 1.00 0.00 ? 68 DC  B "C3'"  2  
ATOM 3238  O "O3'"  . DC  B 2 2  ? 47.678 17.052 21.771 1.00 0.00 ? 68 DC  B "O3'"  2  
ATOM 3239  C "C2'"  . DC  B 2 2  ? 47.243 16.756 24.210 1.00 0.00 ? 68 DC  B "C2'"  2  
ATOM 3240  C "C1'"  . DC  B 2 2  ? 46.525 15.408 24.351 1.00 0.00 ? 68 DC  B "C1'"  2  
ATOM 3241  N N1     . DC  B 2 2  ? 46.056 15.077 25.723 1.00 0.00 ? 68 DC  B N1     2  
ATOM 3242  C C2     . DC  B 2 2  ? 44.747 14.606 25.904 1.00 0.00 ? 68 DC  B C2     2  
ATOM 3243  O O2     . DC  B 2 2  ? 43.963 14.459 24.963 1.00 0.00 ? 68 DC  B O2     2  
ATOM 3244  N N3     . DC  B 2 2  ? 44.278 14.323 27.146 1.00 0.00 ? 68 DC  B N3     2  
ATOM 3245  C C4     . DC  B 2 2  ? 45.102 14.443 28.168 1.00 0.00 ? 68 DC  B C4     2  
ATOM 3246  N N4     . DC  B 2 2  ? 44.626 14.117 29.332 1.00 0.00 ? 68 DC  B N4     2  
ATOM 3247  C C5     . DC  B 2 2  ? 46.461 14.828 28.038 1.00 0.00 ? 68 DC  B C5     2  
ATOM 3248  C C6     . DC  B 2 2  ? 46.907 15.151 26.799 1.00 0.00 ? 68 DC  B C6     2  
ATOM 3249  H "H5'"  . DC  B 2 2  ? 49.657 13.377 23.002 1.00 0.00 ? 68 DC  B "H5'"  2  
ATOM 3250  H "H5''" . DC  B 2 2  ? 50.280 14.839 22.226 1.00 0.00 ? 68 DC  B "H5''" 2  
ATOM 3251  H "H4'"  . DC  B 2 2  ? 47.853 14.674 21.988 1.00 0.00 ? 68 DC  B "H4'"  2  
ATOM 3252  H "H3'"  . DC  B 2 2  ? 49.153 16.976 23.229 1.00 0.00 ? 68 DC  B "H3'"  2  
ATOM 3253  H "H2'"  . DC  B 2 2  ? 47.847 16.983 25.084 1.00 0.00 ? 68 DC  B "H2'"  2  
ATOM 3254  H "H2''" . DC  B 2 2  ? 46.529 17.557 24.047 1.00 0.00 ? 68 DC  B "H2''" 2  
ATOM 3255  H "H1'"  . DC  B 2 2  ? 45.699 15.391 23.635 1.00 0.00 ? 68 DC  B "H1'"  2  
ATOM 3256  H H41    . DC  B 2 2  ? 43.675 13.772 29.390 1.00 0.00 ? 68 DC  B H41    2  
ATOM 3257  H H42    . DC  B 2 2  ? 45.248 14.079 30.115 1.00 0.00 ? 68 DC  B H42    2  
ATOM 3258  H H5     . DC  B 2 2  ? 47.128 14.891 28.884 1.00 0.00 ? 68 DC  B H5     2  
ATOM 3259  H H6     . DC  B 2 2  ? 47.945 15.439 26.649 1.00 0.00 ? 68 DC  B H6     2  
ATOM 3260  P P      . DT  B 2 3  ? 47.367 18.605 21.495 1.00 0.00 ? 69 DT  B P      2  
ATOM 3261  O OP1    . DT  B 2 3  ? 47.459 18.849 20.038 1.00 0.00 ? 69 DT  B OP1    2  
ATOM 3262  O OP2    . DT  B 2 3  ? 48.200 19.419 22.407 1.00 0.00 ? 69 DT  B OP2    2  
ATOM 3263  O "O5'"  . DT  B 2 3  ? 45.838 18.763 21.939 1.00 0.00 ? 69 DT  B "O5'"  2  
ATOM 3264  C "C5'"  . DT  B 2 3  ? 44.810 18.070 21.227 1.00 0.00 ? 69 DT  B "C5'"  2  
ATOM 3265  C "C4'"  . DT  B 2 3  ? 43.493 17.958 22.005 1.00 0.00 ? 69 DT  B "C4'"  2  
ATOM 3266  O "O4'"  . DT  B 2 3  ? 43.708 17.334 23.263 1.00 0.00 ? 69 DT  B "O4'"  2  
ATOM 3267  C "C3'"  . DT  B 2 3  ? 42.839 19.298 22.351 1.00 0.00 ? 69 DT  B "C3'"  2  
ATOM 3268  O "O3'"  . DT  B 2 3  ? 42.000 19.815 21.329 1.00 0.00 ? 69 DT  B "O3'"  2  
ATOM 3269  C "C2'"  . DT  B 2 3  ? 42.065 18.972 23.624 1.00 0.00 ? 69 DT  B "C2'"  2  
ATOM 3270  C "C1'"  . DT  B 2 3  ? 42.551 17.586 24.039 1.00 0.00 ? 69 DT  B "C1'"  2  
ATOM 3271  N N1     . DT  B 2 3  ? 42.799 17.541 25.502 1.00 0.00 ? 69 DT  B N1     2  
ATOM 3272  C C2     . DT  B 2 3  ? 41.716 17.221 26.324 1.00 0.00 ? 69 DT  B C2     2  
ATOM 3273  O O2     . DT  B 2 3  ? 40.571 17.027 25.905 1.00 0.00 ? 69 DT  B O2     2  
ATOM 3274  N N3     . DT  B 2 3  ? 41.967 17.154 27.669 1.00 0.00 ? 69 DT  B N3     2  
ATOM 3275  C C4     . DT  B 2 3  ? 43.160 17.433 28.292 1.00 0.00 ? 69 DT  B C4     2  
ATOM 3276  O O4     . DT  B 2 3  ? 43.217 17.317 29.516 1.00 0.00 ? 69 DT  B O4     2  
ATOM 3277  C C5     . DT  B 2 3  ? 44.232 17.854 27.385 1.00 0.00 ? 69 DT  B C5     2  
ATOM 3278  C C7     . DT  B 2 3  ? 45.597 18.234 27.935 1.00 0.00 ? 69 DT  B C7     2  
ATOM 3279  C C6     . DT  B 2 3  ? 44.020 17.899 26.043 1.00 0.00 ? 69 DT  B C6     2  
ATOM 3280  H "H5'"  . DT  B 2 3  ? 45.144 17.055 21.008 1.00 0.00 ? 69 DT  B "H5'"  2  
ATOM 3281  H "H5''" . DT  B 2 3  ? 44.620 18.569 20.277 1.00 0.00 ? 69 DT  B "H5''" 2  
ATOM 3282  H "H4'"  . DT  B 2 3  ? 42.785 17.366 21.420 1.00 0.00 ? 69 DT  B "H4'"  2  
ATOM 3283  H "H3'"  . DT  B 2 3  ? 43.619 20.012 22.581 1.00 0.00 ? 69 DT  B "H3'"  2  
ATOM 3284  H "H2'"  . DT  B 2 3  ? 42.304 19.718 24.382 1.00 0.00 ? 69 DT  B "H2'"  2  
ATOM 3285  H "H2''" . DT  B 2 3  ? 40.990 18.933 23.452 1.00 0.00 ? 69 DT  B "H2''" 2  
ATOM 3286  H "H1'"  . DT  B 2 3  ? 41.786 16.849 23.775 1.00 0.00 ? 69 DT  B "H1'"  2  
ATOM 3287  H H3     . DT  B 2 3  ? 41.184 16.921 28.259 1.00 0.00 ? 69 DT  B H3     2  
ATOM 3288  H H71    . DT  B 2 3  ? 45.509 19.125 28.551 1.00 0.00 ? 69 DT  B H71    2  
ATOM 3289  H H72    . DT  B 2 3  ? 45.972 17.436 28.572 1.00 0.00 ? 69 DT  B H72    2  
ATOM 3290  H H73    . DT  B 2 3  ? 46.313 18.422 27.133 1.00 0.00 ? 69 DT  B H73    2  
ATOM 3291  H H6     . DT  B 2 3  ? 44.809 18.224 25.377 1.00 0.00 ? 69 DT  B H6     2  
ATOM 3292  P P      . DC  B 2 4  ? 41.288 21.242 21.484 1.00 0.00 ? 70 DC  B P      2  
ATOM 3293  O OP1    . DC  B 2 4  ? 40.937 21.738 20.141 1.00 0.00 ? 70 DC  B OP1    2  
ATOM 3294  O OP2    . DC  B 2 4  ? 42.134 22.096 22.344 1.00 0.00 ? 70 DC  B OP2    2  
ATOM 3295  O "O5'"  . DC  B 2 4  ? 39.936 20.960 22.274 1.00 0.00 ? 70 DC  B "O5'"  2  
ATOM 3296  C "C5'"  . DC  B 2 4  ? 38.917 20.127 21.729 1.00 0.00 ? 70 DC  B "C5'"  2  
ATOM 3297  C "C4'"  . DC  B 2 4  ? 37.714 19.978 22.677 1.00 0.00 ? 70 DC  B "C4'"  2  
ATOM 3298  O "O4'"  . DC  B 2 4  ? 38.153 19.481 23.941 1.00 0.00 ? 70 DC  B "O4'"  2  
ATOM 3299  C "C3'"  . DC  B 2 4  ? 36.996 21.308 22.933 1.00 0.00 ? 70 DC  B "C3'"  2  
ATOM 3300  O "O3'"  . DC  B 2 4  ? 35.591 21.079 22.990 1.00 0.00 ? 70 DC  B "O3'"  2  
ATOM 3301  C "C2'"  . DC  B 2 4  ? 37.553 21.760 24.276 1.00 0.00 ? 70 DC  B "C2'"  2  
ATOM 3302  C "C1'"  . DC  B 2 4  ? 37.808 20.411 24.960 1.00 0.00 ? 70 DC  B "C1'"  2  
ATOM 3303  N N1     . DC  B 2 4  ? 38.891 20.453 25.984 1.00 0.00 ? 70 DC  B N1     2  
ATOM 3304  C C2     . DC  B 2 4  ? 38.628 19.974 27.274 1.00 0.00 ? 70 DC  B C2     2  
ATOM 3305  O O2     . DC  B 2 4  ? 37.522 19.536 27.593 1.00 0.00 ? 70 DC  B O2     2  
ATOM 3306  N N3     . DC  B 2 4  ? 39.591 19.965 28.228 1.00 0.00 ? 70 DC  B N3     2  
ATOM 3307  C C4     . DC  B 2 4  ? 40.780 20.435 27.915 1.00 0.00 ? 70 DC  B C4     2  
ATOM 3308  N N4     . DC  B 2 4  ? 41.675 20.400 28.855 1.00 0.00 ? 70 DC  B N4     2  
ATOM 3309  C C5     . DC  B 2 4  ? 41.115 20.940 26.633 1.00 0.00 ? 70 DC  B C5     2  
ATOM 3310  C C6     . DC  B 2 4  ? 40.141 20.933 25.684 1.00 0.00 ? 70 DC  B C6     2  
ATOM 3311  H "H5'"  . DC  B 2 4  ? 39.324 19.136 21.532 1.00 0.00 ? 70 DC  B "H5'"  2  
ATOM 3312  H "H5''" . DC  B 2 4  ? 38.567 20.546 20.785 1.00 0.00 ? 70 DC  B "H5''" 2  
ATOM 3313  H "H4'"  . DC  B 2 4  ? 37.002 19.283 22.227 1.00 0.00 ? 70 DC  B "H4'"  2  
ATOM 3314  H "H3'"  . DC  B 2 4  ? 37.257 22.034 22.158 1.00 0.00 ? 70 DC  B "H3'"  2  
ATOM 3315  H "H2'"  . DC  B 2 4  ? 38.472 22.324 24.119 1.00 0.00 ? 70 DC  B "H2'"  2  
ATOM 3316  H "H2''" . DC  B 2 4  ? 36.838 22.356 24.844 1.00 0.00 ? 70 DC  B "H2''" 2  
ATOM 3317  H "H1'"  . DC  B 2 4  ? 36.859 20.100 25.413 1.00 0.00 ? 70 DC  B "H1'"  2  
ATOM 3318  H H41    . DC  B 2 4  ? 42.586 20.805 28.679 1.00 0.00 ? 70 DC  B H41    2  
ATOM 3319  H H42    . DC  B 2 4  ? 41.418 20.043 29.764 1.00 0.00 ? 70 DC  B H42    2  
ATOM 3320  H H5     . DC  B 2 4  ? 42.100 21.319 26.400 1.00 0.00 ? 70 DC  B H5     2  
ATOM 3321  H H6     . DC  B 2 4  ? 40.349 21.304 24.685 1.00 0.00 ? 70 DC  B H6     2  
ATOM 3322  P P      . DT  B 2 5  ? 34.549 22.264 22.800 1.00 0.00 ? 71 DT  B P      2  
ATOM 3323  O OP1    . DT  B 2 5  ? 33.234 21.677 22.463 1.00 0.00 ? 71 DT  B OP1    2  
ATOM 3324  O OP2    . DT  B 2 5  ? 35.136 23.229 21.847 1.00 0.00 ? 71 DT  B OP2    2  
ATOM 3325  O "O5'"  . DT  B 2 5  ? 34.403 22.950 24.244 1.00 0.00 ? 71 DT  B "O5'"  2  
ATOM 3326  C "C5'"  . DT  B 2 5  ? 33.637 22.310 25.270 1.00 0.00 ? 71 DT  B "C5'"  2  
ATOM 3327  C "C4'"  . DT  B 2 5  ? 33.751 22.955 26.662 1.00 0.00 ? 71 DT  B "C4'"  2  
ATOM 3328  O "O4'"  . DT  B 2 5  ? 35.027 22.668 27.238 1.00 0.00 ? 71 DT  B "O4'"  2  
ATOM 3329  C "C3'"  . DT  B 2 5  ? 33.596 24.488 26.633 1.00 0.00 ? 71 DT  B "C3'"  2  
ATOM 3330  O "O3'"  . DT  B 2 5  ? 32.881 24.983 27.760 1.00 0.00 ? 71 DT  B "O3'"  2  
ATOM 3331  C "C2'"  . DT  B 2 5  ? 35.050 24.932 26.776 1.00 0.00 ? 71 DT  B "C2'"  2  
ATOM 3332  C "C1'"  . DT  B 2 5  ? 35.526 23.877 27.777 1.00 0.00 ? 71 DT  B "C1'"  2  
ATOM 3333  N N1     . DT  B 2 5  ? 36.987 23.791 28.064 1.00 0.00 ? 71 DT  B N1     2  
ATOM 3334  C C2     . DT  B 2 5  ? 37.358 23.396 29.360 1.00 0.00 ? 71 DT  B C2     2  
ATOM 3335  O O2     . DT  B 2 5  ? 36.552 23.067 30.233 1.00 0.00 ? 71 DT  B O2     2  
ATOM 3336  N N3     . DT  B 2 5  ? 38.696 23.381 29.661 1.00 0.00 ? 71 DT  B N3     2  
ATOM 3337  C C4     . DT  B 2 5  ? 39.711 23.734 28.803 1.00 0.00 ? 71 DT  B C4     2  
ATOM 3338  O O4     . DT  B 2 5  ? 40.865 23.699 29.221 1.00 0.00 ? 71 DT  B O4     2  
ATOM 3339  C C5     . DT  B 2 5  ? 39.271 24.117 27.457 1.00 0.00 ? 71 DT  B C5     2  
ATOM 3340  C C7     . DT  B 2 5  ? 40.290 24.508 26.400 1.00 0.00 ? 71 DT  B C7     2  
ATOM 3341  C C6     . DT  B 2 5  ? 37.952 24.135 27.134 1.00 0.00 ? 71 DT  B C6     2  
ATOM 3342  H "H5'"  . DT  B 2 5  ? 33.950 21.267 25.357 1.00 0.00 ? 71 DT  B "H5'"  2  
ATOM 3343  H "H5''" . DT  B 2 5  ? 32.584 22.314 24.984 1.00 0.00 ? 71 DT  B "H5''" 2  
ATOM 3344  H "H4'"  . DT  B 2 5  ? 32.973 22.535 27.300 1.00 0.00 ? 71 DT  B "H4'"  2  
ATOM 3345  H "H3'"  . DT  B 2 5  ? 33.162 24.839 25.696 1.00 0.00 ? 71 DT  B "H3'"  2  
ATOM 3346  H "H2'"  . DT  B 2 5  ? 35.562 24.838 25.819 1.00 0.00 ? 71 DT  B "H2'"  2  
ATOM 3347  H "H2''" . DT  B 2 5  ? 35.132 25.944 27.172 1.00 0.00 ? 71 DT  B "H2''" 2  
ATOM 3348  H "H1'"  . DT  B 2 5  ? 35.003 24.084 28.717 1.00 0.00 ? 71 DT  B "H1'"  2  
ATOM 3349  H H3     . DT  B 2 5  ? 38.952 23.160 30.612 1.00 0.00 ? 71 DT  B H3     2  
ATOM 3350  H H71    . DT  B 2 5  ? 39.815 24.676 25.433 1.00 0.00 ? 71 DT  B H71    2  
ATOM 3351  H H72    . DT  B 2 5  ? 40.799 25.415 26.713 1.00 0.00 ? 71 DT  B H72    2  
ATOM 3352  H H73    . DT  B 2 5  ? 41.033 23.719 26.298 1.00 0.00 ? 71 DT  B H73    2  
ATOM 3353  H H6     . DT  B 2 5  ? 37.658 24.429 26.133 1.00 0.00 ? 71 DT  B H6     2  
ATOM 3354  P P      . DA  B 2 6  ? 31.290 25.131 27.791 1.00 0.00 ? 72 DA  B P      2  
ATOM 3355  O OP1    . DA  B 2 6  ? 30.673 23.867 27.332 1.00 0.00 ? 72 DA  B OP1    2  
ATOM 3356  O OP2    . DA  B 2 6  ? 30.945 26.376 27.074 1.00 0.00 ? 72 DA  B OP2    2  
ATOM 3357  O "O5'"  . DA  B 2 6  ? 31.006 25.337 29.360 1.00 0.00 ? 72 DA  B "O5'"  2  
ATOM 3358  C "C5'"  . DA  B 2 6  ? 30.681 24.239 30.212 1.00 0.00 ? 72 DA  B "C5'"  2  
ATOM 3359  C "C4'"  . DA  B 2 6  ? 31.248 24.317 31.640 1.00 0.00 ? 72 DA  B "C4'"  2  
ATOM 3360  O "O4'"  . DA  B 2 6  ? 32.670 24.334 31.572 1.00 0.00 ? 72 DA  B "O4'"  2  
ATOM 3361  C "C3'"  . DA  B 2 6  ? 30.867 25.518 32.520 1.00 0.00 ? 72 DA  B "C3'"  2  
ATOM 3362  O "O3'"  . DA  B 2 6  ? 30.908 25.066 33.877 1.00 0.00 ? 72 DA  B "O3'"  2  
ATOM 3363  C "C2'"  . DA  B 2 6  ? 31.997 26.495 32.212 1.00 0.00 ? 72 DA  B "C2'"  2  
ATOM 3364  C "C1'"  . DA  B 2 6  ? 33.164 25.517 32.174 1.00 0.00 ? 72 DA  B "C1'"  2  
ATOM 3365  N N9     . DA  B 2 6  ? 34.352 25.991 31.439 1.00 0.00 ? 72 DA  B N9     2  
ATOM 3366  C C8     . DA  B 2 6  ? 34.439 26.442 30.146 1.00 0.00 ? 72 DA  B C8     2  
ATOM 3367  N N7     . DA  B 2 6  ? 35.660 26.688 29.749 1.00 0.00 ? 72 DA  B N7     2  
ATOM 3368  C C5     . DA  B 2 6  ? 36.434 26.402 30.885 1.00 0.00 ? 72 DA  B C5     2  
ATOM 3369  C C6     . DA  B 2 6  ? 37.818 26.405 31.195 1.00 0.00 ? 72 DA  B C6     2  
ATOM 3370  N N6     . DA  B 2 6  ? 38.795 26.705 30.365 1.00 0.00 ? 72 DA  B N6     2  
ATOM 3371  N N1     . DA  B 2 6  ? 38.252 26.058 32.406 1.00 0.00 ? 72 DA  B N1     2  
ATOM 3372  C C2     . DA  B 2 6  ? 37.357 25.699 33.307 1.00 0.00 ? 72 DA  B C2     2  
ATOM 3373  N N3     . DA  B 2 6  ? 36.040 25.605 33.171 1.00 0.00 ? 72 DA  B N3     2  
ATOM 3374  C C4     . DA  B 2 6  ? 35.640 25.986 31.920 1.00 0.00 ? 72 DA  B C4     2  
ATOM 3375  H "H5'"  . DA  B 2 6  ? 31.077 23.320 29.776 1.00 0.00 ? 72 DA  B "H5'"  2  
ATOM 3376  H "H5''" . DA  B 2 6  ? 29.597 24.136 30.263 1.00 0.00 ? 72 DA  B "H5''" 2  
ATOM 3377  H "H4'"  . DA  B 2 6  ? 30.923 23.411 32.149 1.00 0.00 ? 72 DA  B "H4'"  2  
ATOM 3378  H "H3'"  . DA  B 2 6  ? 29.886 25.922 32.258 1.00 0.00 ? 72 DA  B "H3'"  2  
ATOM 3379  H "H2'"  . DA  B 2 6  ? 31.839 26.966 31.241 1.00 0.00 ? 72 DA  B "H2'"  2  
ATOM 3380  H "H2''" . DA  B 2 6  ? 32.124 27.246 32.990 1.00 0.00 ? 72 DA  B "H2''" 2  
ATOM 3381  H "H1'"  . DA  B 2 6  ? 33.448 25.298 33.205 1.00 0.00 ? 72 DA  B "H1'"  2  
ATOM 3382  H H8     . DA  B 2 6  ? 33.570 26.540 29.507 1.00 0.00 ? 72 DA  B H8     2  
ATOM 3383  H H61    . DA  B 2 6  ? 38.565 27.055 29.439 1.00 0.00 ? 72 DA  B H61    2  
ATOM 3384  H H62    . DA  B 2 6  ? 39.745 26.649 30.710 1.00 0.00 ? 72 DA  B H62    2  
ATOM 3385  H H2     . DA  B 2 6  ? 37.759 25.425 34.271 1.00 0.00 ? 72 DA  B H2     2  
ATOM 3386  P P      . DA  B 2 7  ? 30.554 25.998 35.132 1.00 0.00 ? 73 DA  B P      2  
ATOM 3387  O OP1    . DA  B 2 7  ? 29.993 25.103 36.154 1.00 0.00 ? 73 DA  B OP1    2  
ATOM 3388  O OP2    . DA  B 2 7  ? 29.737 27.141 34.694 1.00 0.00 ? 73 DA  B OP2    2  
ATOM 3389  O "O5'"  . DA  B 2 7  ? 31.960 26.542 35.705 1.00 0.00 ? 73 DA  B "O5'"  2  
ATOM 3390  C "C5'"  . DA  B 2 7  ? 31.994 27.607 36.655 1.00 0.00 ? 73 DA  B "C5'"  2  
ATOM 3391  C "C4'"  . DA  B 2 7  ? 33.154 27.428 37.650 1.00 0.00 ? 73 DA  B "C4'"  2  
ATOM 3392  O "O4'"  . DA  B 2 7  ? 34.389 27.252 36.959 1.00 0.00 ? 73 DA  B "O4'"  2  
ATOM 3393  C "C3'"  . DA  B 2 7  ? 33.366 28.613 38.600 1.00 0.00 ? 73 DA  B "C3'"  2  
ATOM 3394  O "O3'"  . DA  B 2 7  ? 33.965 28.114 39.794 1.00 0.00 ? 73 DA  B "O3'"  2  
ATOM 3395  C "C2'"  . DA  B 2 7  ? 34.301 29.484 37.763 1.00 0.00 ? 73 DA  B "C2'"  2  
ATOM 3396  C "C1'"  . DA  B 2 7  ? 35.161 28.446 37.038 1.00 0.00 ? 73 DA  B "C1'"  2  
ATOM 3397  N N9     . DA  B 2 7  ? 35.586 28.839 35.673 1.00 0.00 ? 73 DA  B N9     2  
ATOM 3398  C C8     . DA  B 2 7  ? 34.812 29.182 34.592 1.00 0.00 ? 73 DA  B C8     2  
ATOM 3399  N N7     . DA  B 2 7  ? 35.489 29.449 33.505 1.00 0.00 ? 73 DA  B N7     2  
ATOM 3400  C C5     . DA  B 2 7  ? 36.825 29.256 33.901 1.00 0.00 ? 73 DA  B C5     2  
ATOM 3401  C C6     . DA  B 2 7  ? 38.098 29.333 33.273 1.00 0.00 ? 73 DA  B C6     2  
ATOM 3402  N N6     . DA  B 2 7  ? 38.334 29.618 32.007 1.00 0.00 ? 73 DA  B N6     2  
ATOM 3403  N N1     . DA  B 2 7  ? 39.216 29.085 33.960 1.00 0.00 ? 73 DA  B N1     2  
ATOM 3404  C C2     . DA  B 2 7  ? 39.102 28.738 35.232 1.00 0.00 ? 73 DA  B C2     2  
ATOM 3405  N N3     . DA  B 2 7  ? 37.994 28.600 35.948 1.00 0.00 ? 73 DA  B N3     2  
ATOM 3406  C C4     . DA  B 2 7  ? 36.884 28.885 35.219 1.00 0.00 ? 73 DA  B C4     2  
ATOM 3407  H "H5'"  . DA  B 2 7  ? 31.061 27.622 37.225 1.00 0.00 ? 73 DA  B "H5'"  2  
ATOM 3408  H "H5''" . DA  B 2 7  ? 32.077 28.560 36.132 1.00 0.00 ? 73 DA  B "H5''" 2  
ATOM 3409  H "H4'"  . DA  B 2 7  ? 32.934 26.545 38.246 1.00 0.00 ? 73 DA  B "H4'"  2  
ATOM 3410  H "H3'"  . DA  B 2 7  ? 32.427 29.121 38.822 1.00 0.00 ? 73 DA  B "H3'"  2  
ATOM 3411  H "H2'"  . DA  B 2 7  ? 33.719 30.080 37.060 1.00 0.00 ? 73 DA  B "H2'"  2  
ATOM 3412  H "H2''" . DA  B 2 7  ? 34.909 30.142 38.379 1.00 0.00 ? 73 DA  B "H2''" 2  
ATOM 3413  H "H1'"  . DA  B 2 7  ? 36.055 28.274 37.651 1.00 0.00 ? 73 DA  B "H1'"  2  
ATOM 3414  H H8     . DA  B 2 7  ? 33.733 29.214 34.643 1.00 0.00 ? 73 DA  B H8     2  
ATOM 3415  H H61    . DA  B 2 7  ? 37.568 29.749 31.353 1.00 0.00 ? 73 DA  B H61    2  
ATOM 3416  H H62    . DA  B 2 7  ? 39.290 29.568 31.688 1.00 0.00 ? 73 DA  B H62    2  
ATOM 3417  H H2     . DA  B 2 7  ? 40.029 28.551 35.752 1.00 0.00 ? 73 DA  B H2     2  
ATOM 3418  P P      . DT  B 2 8  ? 34.178 28.992 41.122 1.00 0.00 ? 74 DT  B P      2  
ATOM 3419  O OP1    . DT  B 2 8  ? 34.377 28.051 42.248 1.00 0.00 ? 74 DT  B OP1    2  
ATOM 3420  O OP2    . DT  B 2 8  ? 33.112 30.008 41.210 1.00 0.00 ? 74 DT  B OP2    2  
ATOM 3421  O "O5'"  . DT  B 2 8  ? 35.578 29.723 40.861 1.00 0.00 ? 74 DT  B "O5'"  2  
ATOM 3422  C "C5'"  . DT  B 2 8  ? 36.783 28.977 40.996 1.00 0.00 ? 74 DT  B "C5'"  2  
ATOM 3423  C "C4'"  . DT  B 2 8  ? 38.039 29.661 40.456 1.00 0.00 ? 74 DT  B "C4'"  2  
ATOM 3424  O "O4'"  . DT  B 2 8  ? 37.877 29.988 39.091 1.00 0.00 ? 74 DT  B "O4'"  2  
ATOM 3425  C "C3'"  . DT  B 2 8  ? 38.495 30.942 41.183 1.00 0.00 ? 74 DT  B "C3'"  2  
ATOM 3426  O "O3'"  . DT  B 2 8  ? 39.767 30.658 41.760 1.00 0.00 ? 74 DT  B "O3'"  2  
ATOM 3427  C "C2'"  . DT  B 2 8  ? 38.592 31.960 40.041 1.00 0.00 ? 74 DT  B "C2'"  2  
ATOM 3428  C "C1'"  . DT  B 2 8  ? 38.783 31.038 38.843 1.00 0.00 ? 74 DT  B "C1'"  2  
ATOM 3429  N N1     . DT  B 2 8  ? 38.515 31.658 37.523 1.00 0.00 ? 74 DT  B N1     2  
ATOM 3430  C C2     . DT  B 2 8  ? 39.580 31.782 36.625 1.00 0.00 ? 74 DT  B C2     2  
ATOM 3431  O O2     . DT  B 2 8  ? 40.748 31.530 36.918 1.00 0.00 ? 74 DT  B O2     2  
ATOM 3432  N N3     . DT  B 2 8  ? 39.271 32.188 35.351 1.00 0.00 ? 74 DT  B N3     2  
ATOM 3433  C C4     . DT  B 2 8  ? 38.016 32.503 34.885 1.00 0.00 ? 74 DT  B C4     2  
ATOM 3434  O O4     . DT  B 2 8  ? 37.886 32.800 33.702 1.00 0.00 ? 74 DT  B O4     2  
ATOM 3435  C C5     . DT  B 2 8  ? 36.958 32.428 35.896 1.00 0.00 ? 74 DT  B C5     2  
ATOM 3436  C C7     . DT  B 2 8  ? 35.530 32.782 35.538 1.00 0.00 ? 74 DT  B C7     2  
ATOM 3437  C C6     . DT  B 2 8  ? 37.234 32.012 37.158 1.00 0.00 ? 74 DT  B C6     2  
ATOM 3438  H "H5'"  . DT  B 2 8  ? 36.675 28.040 40.450 1.00 0.00 ? 74 DT  B "H5'"  2  
ATOM 3439  H "H5''" . DT  B 2 8  ? 36.941 28.745 42.051 1.00 0.00 ? 74 DT  B "H5''" 2  
ATOM 3440  H "H4'"  . DT  B 2 8  ? 38.853 28.939 40.519 1.00 0.00 ? 74 DT  B "H4'"  2  
ATOM 3441  H "H3'"  . DT  B 2 8  ? 37.769 31.256 41.936 1.00 0.00 ? 74 DT  B "H3'"  2  
ATOM 3442  H "H2'"  . DT  B 2 8  ? 37.661 32.515 39.956 1.00 0.00 ? 74 DT  B "H2'"  2  
ATOM 3443  H "H2''" . DT  B 2 8  ? 39.428 32.646 40.152 1.00 0.00 ? 74 DT  B "H2''" 2  
ATOM 3444  H "H1'"  . DT  B 2 8  ? 39.802 30.644 38.880 1.00 0.00 ? 74 DT  B "H1'"  2  
ATOM 3445  H H3     . DT  B 2 8  ? 40.039 32.284 34.702 1.00 0.00 ? 74 DT  B H3     2  
ATOM 3446  H H71    . DT  B 2 8  ? 34.839 32.473 36.323 1.00 0.00 ? 74 DT  B H71    2  
ATOM 3447  H H72    . DT  B 2 8  ? 35.457 33.860 35.406 1.00 0.00 ? 74 DT  B H72    2  
ATOM 3448  H H73    . DT  B 2 8  ? 35.265 32.291 34.601 1.00 0.00 ? 74 DT  B H73    2  
ATOM 3449  H H6     . DT  B 2 8  ? 36.444 31.939 37.892 1.00 0.00 ? 74 DT  B H6     2  
ATOM 3450  P P      . DC  B 2 9  ? 40.596 31.689 42.655 1.00 0.00 ? 75 DC  B P      2  
ATOM 3451  O OP1    . DC  B 2 9  ? 41.484 30.872 43.509 1.00 0.00 ? 75 DC  B OP1    2  
ATOM 3452  O OP2    . DC  B 2 9  ? 39.694 32.669 43.294 1.00 0.00 ? 75 DC  B OP2    2  
ATOM 3453  O "O5'"  . DC  B 2 9  ? 41.497 32.513 41.642 1.00 0.00 ? 75 DC  B "O5'"  2  
ATOM 3454  C "C5'"  . DC  B 2 9  ? 42.885 32.259 41.489 1.00 0.00 ? 75 DC  B "C5'"  2  
ATOM 3455  C "C4'"  . DC  B 2 9  ? 43.542 33.335 40.621 1.00 0.00 ? 75 DC  B "C4'"  2  
ATOM 3456  O "O4'"  . DC  B 2 9  ? 42.955 33.320 39.328 1.00 0.00 ? 75 DC  B "O4'"  2  
ATOM 3457  C "C3'"  . DC  B 2 9  ? 43.364 34.746 41.196 1.00 0.00 ? 75 DC  B "C3'"  2  
ATOM 3458  O "O3'"  . DC  B 2 9  ? 44.521 35.175 41.910 1.00 0.00 ? 75 DC  B "O3'"  2  
ATOM 3459  C "C2'"  . DC  B 2 9  ? 43.105 35.600 39.959 1.00 0.00 ? 75 DC  B "C2'"  2  
ATOM 3460  C "C1'"  . DC  B 2 9  ? 43.046 34.621 38.787 1.00 0.00 ? 75 DC  B "C1'"  2  
ATOM 3461  N N1     . DC  B 2 9  ? 41.890 34.878 37.885 1.00 0.00 ? 75 DC  B N1     2  
ATOM 3462  C C2     . DC  B 2 9  ? 42.135 35.207 36.549 1.00 0.00 ? 75 DC  B C2     2  
ATOM 3463  O O2     . DC  B 2 9  ? 43.283 35.321 36.118 1.00 0.00 ? 75 DC  B O2     2  
ATOM 3464  N N3     . DC  B 2 9  ? 41.121 35.412 35.680 1.00 0.00 ? 75 DC  B N3     2  
ATOM 3465  C C4     . DC  B 2 9  ? 39.889 35.347 36.136 1.00 0.00 ? 75 DC  B C4     2  
ATOM 3466  N N4     . DC  B 2 9  ? 38.945 35.555 35.268 1.00 0.00 ? 75 DC  B N4     2  
ATOM 3467  C C5     . DC  B 2 9  ? 39.570 35.072 37.495 1.00 0.00 ? 75 DC  B C5     2  
ATOM 3468  C C6     . DC  B 2 9  ? 40.599 34.830 38.346 1.00 0.00 ? 75 DC  B C6     2  
ATOM 3469  H "H5'"  . DC  B 2 9  ? 43.039 31.278 41.040 1.00 0.00 ? 75 DC  B "H5'"  2  
ATOM 3470  H "H5''" . DC  B 2 9  ? 43.359 32.277 42.468 1.00 0.00 ? 75 DC  B "H5''" 2  
ATOM 3471  H "H4'"  . DC  B 2 9  ? 44.610 33.131 40.535 1.00 0.00 ? 75 DC  B "H4'"  2  
ATOM 3472  H "H3'"  . DC  B 2 9  ? 42.483 34.773 41.843 1.00 0.00 ? 75 DC  B "H3'"  2  
ATOM 3473  H "H2'"  . DC  B 2 9  ? 42.172 36.147 40.086 1.00 0.00 ? 75 DC  B "H2'"  2  
ATOM 3474  H "H2''" . DC  B 2 9  ? 43.921 36.297 39.777 1.00 0.00 ? 75 DC  B "H2''" 2  
ATOM 3475  H "H1'"  . DC  B 2 9  ? 43.987 34.706 38.237 1.00 0.00 ? 75 DC  B "H1'"  2  
ATOM 3476  H H41    . DC  B 2 9  ? 37.995 35.655 35.605 1.00 0.00 ? 75 DC  B H41    2  
ATOM 3477  H H42    . DC  B 2 9  ? 39.191 35.667 34.293 1.00 0.00 ? 75 DC  B H42    2  
ATOM 3478  H H5     . DC  B 2 9  ? 38.553 35.029 37.852 1.00 0.00 ? 75 DC  B H5     2  
ATOM 3479  H H6     . DC  B 2 9  ? 40.418 34.596 39.392 1.00 0.00 ? 75 DC  B H6     2  
ATOM 3480  P P      . DC  B 2 10 ? 44.568 36.587 42.660 1.00 0.00 ? 76 DC  B P      2  
ATOM 3481  O OP1    . DC  B 2 10 ? 45.594 36.518 43.727 1.00 0.00 ? 76 DC  B OP1    2  
ATOM 3482  O OP2    . DC  B 2 10 ? 43.192 36.948 43.046 1.00 0.00 ? 76 DC  B OP2    2  
ATOM 3483  O "O5'"  . DC  B 2 10 ? 45.043 37.654 41.571 1.00 0.00 ? 76 DC  B "O5'"  2  
ATOM 3484  C "C5'"  . DC  B 2 10 ? 46.320 37.565 40.948 1.00 0.00 ? 76 DC  B "C5'"  2  
ATOM 3485  C "C4'"  . DC  B 2 10 ? 46.444 38.479 39.716 1.00 0.00 ? 76 DC  B "C4'"  2  
ATOM 3486  O "O4'"  . DC  B 2 10 ? 45.473 38.102 38.741 1.00 0.00 ? 76 DC  B "O4'"  2  
ATOM 3487  C "C3'"  . DC  B 2 10 ? 46.251 39.977 40.024 1.00 0.00 ? 76 DC  B "C3'"  2  
ATOM 3488  O "O3'"  . DC  B 2 10 ? 47.393 40.705 39.576 1.00 0.00 ? 76 DC  B "O3'"  2  
ATOM 3489  C "C2'"  . DC  B 2 10 ? 44.981 40.312 39.246 1.00 0.00 ? 76 DC  B "C2'"  2  
ATOM 3490  C "C1'"  . DC  B 2 10 ? 44.961 39.269 38.129 1.00 0.00 ? 76 DC  B "C1'"  2  
ATOM 3491  N N1     . DC  B 2 10 ? 43.589 39.014 37.602 1.00 0.00 ? 76 DC  B N1     2  
ATOM 3492  C C2     . DC  B 2 10 ? 43.289 39.236 36.248 1.00 0.00 ? 76 DC  B C2     2  
ATOM 3493  O O2     . DC  B 2 10 ? 44.141 39.628 35.444 1.00 0.00 ? 76 DC  B O2     2  
ATOM 3494  N N3     . DC  B 2 10 ? 42.027 39.049 35.777 1.00 0.00 ? 76 DC  B N3     2  
ATOM 3495  C C4     . DC  B 2 10 ? 41.090 38.686 36.634 1.00 0.00 ? 76 DC  B C4     2  
ATOM 3496  N N4     . DC  B 2 10 ? 39.873 38.569 36.190 1.00 0.00 ? 76 DC  B N4     2  
ATOM 3497  C C5     . DC  B 2 10 ? 41.337 38.423 38.005 1.00 0.00 ? 76 DC  B C5     2  
ATOM 3498  C C6     . DC  B 2 10 ? 42.600 38.602 38.459 1.00 0.00 ? 76 DC  B C6     2  
ATOM 3499  H "H5'"  . DC  B 2 10 ? 46.495 36.539 40.619 1.00 0.00 ? 76 DC  B "H5'"  2  
ATOM 3500  H "H5''" . DC  B 2 10 ? 47.098 37.827 41.666 1.00 0.00 ? 76 DC  B "H5''" 2  
ATOM 3501  H "H4'"  . DC  B 2 10 ? 47.436 38.341 39.286 1.00 0.00 ? 76 DC  B "H4'"  2  
ATOM 3502  H "H3'"  . DC  B 2 10 ? 46.094 40.133 41.092 1.00 0.00 ? 76 DC  B "H3'"  2  
ATOM 3503  H "H2'"  . DC  B 2 10 ? 44.132 40.190 39.915 1.00 0.00 ? 76 DC  B "H2'"  2  
ATOM 3504  H "H2''" . DC  B 2 10 ? 44.982 41.320 38.848 1.00 0.00 ? 76 DC  B "H2''" 2  
ATOM 3505  H "H1'"  . DC  B 2 10 ? 45.643 39.585 37.333 1.00 0.00 ? 76 DC  B "H1'"  2  
ATOM 3506  H H41    . DC  B 2 10 ? 39.135 38.359 36.845 1.00 0.00 ? 76 DC  B H41    2  
ATOM 3507  H H42    . DC  B 2 10 ? 39.672 38.639 35.203 1.00 0.00 ? 76 DC  B H42    2  
ATOM 3508  H H5     . DC  B 2 10 ? 40.557 38.115 38.683 1.00 0.00 ? 76 DC  B H5     2  
ATOM 3509  H H6     . DC  B 2 10 ? 42.846 38.430 39.502 1.00 0.00 ? 76 DC  B H6     2  
ATOM 3510  P P      . DC  B 2 11 ? 47.513 42.300 39.631 1.00 0.00 ? 77 DC  B P      2  
ATOM 3511  O OP1    . DC  B 2 11 ? 48.930 42.609 39.920 1.00 0.00 ? 77 DC  B OP1    2  
ATOM 3512  O OP2    . DC  B 2 11 ? 46.482 42.847 40.544 1.00 0.00 ? 77 DC  B OP2    2  
ATOM 3513  O "O5'"  . DC  B 2 11 ? 47.194 42.747 38.134 1.00 0.00 ? 77 DC  B "O5'"  2  
ATOM 3514  C "C5'"  . DC  B 2 11 ? 48.058 42.349 37.075 1.00 0.00 ? 77 DC  B "C5'"  2  
ATOM 3515  C "C4'"  . DC  B 2 11 ? 47.648 42.881 35.697 1.00 0.00 ? 77 DC  B "C4'"  2  
ATOM 3516  O "O4'"  . DC  B 2 11 ? 46.378 42.349 35.326 1.00 0.00 ? 77 DC  B "O4'"  2  
ATOM 3517  C "C3'"  . DC  B 2 11 ? 47.592 44.413 35.622 1.00 0.00 ? 77 DC  B "C3'"  2  
ATOM 3518  O "O3'"  . DC  B 2 11 ? 48.361 44.892 34.516 1.00 0.00 ? 77 DC  B "O3'"  2  
ATOM 3519  C "C2'"  . DC  B 2 11 ? 46.105 44.694 35.443 1.00 0.00 ? 77 DC  B "C2'"  2  
ATOM 3520  C "C1'"  . DC  B 2 11 ? 45.528 43.395 34.878 1.00 0.00 ? 77 DC  B "C1'"  2  
ATOM 3521  N N1     . DC  B 2 11 ? 44.138 43.144 35.353 1.00 0.00 ? 77 DC  B N1     2  
ATOM 3522  C C2     . DC  B 2 11 ? 43.072 43.136 34.442 1.00 0.00 ? 77 DC  B C2     2  
ATOM 3523  O O2     . DC  B 2 11 ? 43.226 43.489 33.269 1.00 0.00 ? 77 DC  B O2     2  
ATOM 3524  N N3     . DC  B 2 11 ? 41.831 42.751 34.834 1.00 0.00 ? 77 DC  B N3     2  
ATOM 3525  C C4     . DC  B 2 11 ? 41.644 42.434 36.102 1.00 0.00 ? 77 DC  B C4     2  
ATOM 3526  N N4     . DC  B 2 11 ? 40.469 41.981 36.425 1.00 0.00 ? 77 DC  B N4     2  
ATOM 3527  C C5     . DC  B 2 11 ? 42.665 42.503 37.088 1.00 0.00 ? 77 DC  B C5     2  
ATOM 3528  C C6     . DC  B 2 11 ? 43.903 42.873 36.677 1.00 0.00 ? 77 DC  B C6     2  
ATOM 3529  H "H5'"  . DC  B 2 11 ? 48.089 41.258 37.024 1.00 0.00 ? 77 DC  B "H5'"  2  
ATOM 3530  H "H5''" . DC  B 2 11 ? 49.069 42.706 37.286 1.00 0.00 ? 77 DC  B "H5''" 2  
ATOM 3531  H "H4'"  . DC  B 2 11 ? 48.401 42.544 34.987 1.00 0.00 ? 77 DC  B "H4'"  2  
ATOM 3532  H "H3'"  . DC  B 2 11 ? 47.951 44.842 36.561 1.00 0.00 ? 77 DC  B "H3'"  2  
ATOM 3533  H "H2'"  . DC  B 2 11 ? 45.667 44.935 36.410 1.00 0.00 ? 77 DC  B "H2'"  2  
ATOM 3534  H "H2''" . DC  B 2 11 ? 45.943 45.511 34.748 1.00 0.00 ? 77 DC  B "H2''" 2  
ATOM 3535  H "H1'"  . DC  B 2 11 ? 45.562 43.442 33.785 1.00 0.00 ? 77 DC  B "H1'"  2  
ATOM 3536  H H41    . DC  B 2 11 ? 40.322 41.638 37.362 1.00 0.00 ? 77 DC  B H41    2  
ATOM 3537  H H42    . DC  B 2 11 ? 39.776 41.860 35.700 1.00 0.00 ? 77 DC  B H42    2  
ATOM 3538  H H5     . DC  B 2 11 ? 42.485 42.270 38.126 1.00 0.00 ? 77 DC  B H5     2  
ATOM 3539  H H6     . DC  B 2 11 ? 44.730 42.935 37.375 1.00 0.00 ? 77 DC  B H6     2  
ATOM 3540  P P      . DC  B 2 12 ? 48.801 46.434 34.384 1.00 0.00 ? 78 DC  B P      2  
ATOM 3541  O OP1    . DC  B 2 12 ? 50.070 46.464 33.619 1.00 0.00 ? 78 DC  B OP1    2  
ATOM 3542  O OP2    . DC  B 2 12 ? 48.775 47.056 35.728 1.00 0.00 ? 78 DC  B OP2    2  
ATOM 3543  O "O5'"  . DC  B 2 12 ? 47.643 47.114 33.514 1.00 0.00 ? 78 DC  B "O5'"  2  
ATOM 3544  C "C5'"  . DC  B 2 12 ? 47.626 47.032 32.094 1.00 0.00 ? 78 DC  B "C5'"  2  
ATOM 3545  C "C4'"  . DC  B 2 12 ? 46.271 47.419 31.478 1.00 0.00 ? 78 DC  B "C4'"  2  
ATOM 3546  O "O4'"  . DC  B 2 12 ? 45.253 46.581 32.013 1.00 0.00 ? 78 DC  B "O4'"  2  
ATOM 3547  C "C3'"  . DC  B 2 12 ? 45.831 48.867 31.738 1.00 0.00 ? 78 DC  B "C3'"  2  
ATOM 3548  O "O3'"  . DC  B 2 12 ? 46.217 49.769 30.701 1.00 0.00 ? 78 DC  B "O3'"  2  
ATOM 3549  C "C2'"  . DC  B 2 12 ? 44.307 48.745 31.785 1.00 0.00 ? 78 DC  B "C2'"  2  
ATOM 3550  C "C1'"  . DC  B 2 12 ? 44.013 47.266 32.014 1.00 0.00 ? 78 DC  B "C1'"  2  
ATOM 3551  N N1     . DC  B 2 12 ? 43.343 47.062 33.323 1.00 0.00 ? 78 DC  B N1     2  
ATOM 3552  C C2     . DC  B 2 12 ? 41.988 46.711 33.348 1.00 0.00 ? 78 DC  B C2     2  
ATOM 3553  O O2     . DC  B 2 12 ? 41.309 46.668 32.315 1.00 0.00 ? 78 DC  B O2     2  
ATOM 3554  N N3     . DC  B 2 12 ? 41.374 46.424 34.520 1.00 0.00 ? 78 DC  B N3     2  
ATOM 3555  C C4     . DC  B 2 12 ? 42.064 46.566 35.634 1.00 0.00 ? 78 DC  B C4     2  
ATOM 3556  N N4     . DC  B 2 12 ? 41.449 46.249 36.730 1.00 0.00 ? 78 DC  B N4     2  
ATOM 3557  C C5     . DC  B 2 12 ? 43.402 47.038 35.680 1.00 0.00 ? 78 DC  B C5     2  
ATOM 3558  C C6     . DC  B 2 12 ? 44.017 47.284 34.499 1.00 0.00 ? 78 DC  B C6     2  
ATOM 3559  H "H5'"  . DC  B 2 12 ? 47.853 46.010 31.791 1.00 0.00 ? 78 DC  B "H5'"  2  
ATOM 3560  H "H5''" . DC  B 2 12 ? 48.400 47.683 31.690 1.00 0.00 ? 78 DC  B "H5''" 2  
ATOM 3561  H "H4'"  . DC  B 2 12 ? 46.327 47.267 30.401 1.00 0.00 ? 78 DC  B "H4'"  2  
ATOM 3562  H "H3'"  . DC  B 2 12 ? 46.213 49.182 32.706 1.00 0.00 ? 78 DC  B "H3'"  2  
ATOM 3563  H "H2'"  . DC  B 2 12 ? 43.899 49.383 32.571 1.00 0.00 ? 78 DC  B "H2'"  2  
ATOM 3564  H "H2''" . DC  B 2 12 ? 43.876 49.011 30.824 1.00 0.00 ? 78 DC  B "H2''" 2  
ATOM 3565  H "H1'"  . DC  B 2 12 ? 43.384 46.892 31.196 1.00 0.00 ? 78 DC  B "H1'"  2  
ATOM 3566  H H41    . DC  B 2 12 ? 41.863 46.475 37.621 1.00 0.00 ? 78 DC  B H41    2  
ATOM 3567  H H42    . DC  B 2 12 ? 40.501 45.903 36.668 1.00 0.00 ? 78 DC  B H42    2  
ATOM 3568  H H5     . DC  B 2 12 ? 43.935 47.180 36.606 1.00 0.00 ? 78 DC  B H5     2  
ATOM 3569  H H6     . DC  B 2 12 ? 45.046 47.636 34.469 1.00 0.00 ? 78 DC  B H6     2  
ATOM 3570  P P      . DG  B 2 13 ? 46.051 51.360 30.877 1.00 0.00 ? 79 DG  B P      2  
ATOM 3571  O OP1    . DG  B 2 13 ? 46.546 52.046 29.662 1.00 0.00 ? 79 DG  B OP1    2  
ATOM 3572  O OP2    . DG  B 2 13 ? 46.598 51.763 32.191 1.00 0.00 ? 79 DG  B OP2    2  
ATOM 3573  O "O5'"  . DG  B 2 13 ? 44.487 51.617 30.937 1.00 0.00 ? 79 DG  B "O5'"  2  
ATOM 3574  C "C5'"  . DG  B 2 13 ? 43.677 51.569 29.772 1.00 0.00 ? 79 DG  B "C5'"  2  
ATOM 3575  C "C4'"  . DG  B 2 13 ? 42.211 51.826 30.126 1.00 0.00 ? 79 DG  B "C4'"  2  
ATOM 3576  O "O4'"  . DG  B 2 13 ? 41.749 50.853 31.064 1.00 0.00 ? 79 DG  B "O4'"  2  
ATOM 3577  C "C3'"  . DG  B 2 13 ? 42.046 53.218 30.763 1.00 0.00 ? 79 DG  B "C3'"  2  
ATOM 3578  O "O3'"  . DG  B 2 13 ? 41.118 54.034 30.063 1.00 0.00 ? 79 DG  B "O3'"  2  
ATOM 3579  C "C2'"  . DG  B 2 13 ? 41.553 52.909 32.171 1.00 0.00 ? 79 DG  B "C2'"  2  
ATOM 3580  C "C1'"  . DG  B 2 13 ? 40.978 51.497 32.060 1.00 0.00 ? 79 DG  B "C1'"  2  
ATOM 3581  N N9     . DG  B 2 13 ? 41.007 50.746 33.347 1.00 0.00 ? 79 DG  B N9     2  
ATOM 3582  C C8     . DG  B 2 13 ? 42.010 50.686 34.288 1.00 0.00 ? 79 DG  B C8     2  
ATOM 3583  N N7     . DG  B 2 13 ? 41.686 50.061 35.391 1.00 0.00 ? 79 DG  B N7     2  
ATOM 3584  C C5     . DG  B 2 13 ? 40.360 49.666 35.163 1.00 0.00 ? 79 DG  B C5     2  
ATOM 3585  C C6     . DG  B 2 13 ? 39.405 48.986 36.003 1.00 0.00 ? 79 DG  B C6     2  
ATOM 3586  O O6     . DG  B 2 13 ? 39.511 48.599 37.169 1.00 0.00 ? 79 DG  B O6     2  
ATOM 3587  N N1     . DG  B 2 13 ? 38.188 48.780 35.401 1.00 0.00 ? 79 DG  B N1     2  
ATOM 3588  C C2     . DG  B 2 13 ? 37.885 49.195 34.151 1.00 0.00 ? 79 DG  B C2     2  
ATOM 3589  N N2     . DG  B 2 13 ? 36.664 48.979 33.748 1.00 0.00 ? 79 DG  B N2     2  
ATOM 3590  N N3     . DG  B 2 13 ? 38.715 49.851 33.340 1.00 0.00 ? 79 DG  B N3     2  
ATOM 3591  C C4     . DG  B 2 13 ? 39.950 50.056 33.903 1.00 0.00 ? 79 DG  B C4     2  
ATOM 3592  H "H5'"  . DG  B 2 13 ? 43.759 50.598 29.287 1.00 0.00 ? 79 DG  B "H5'"  2  
ATOM 3593  H "H5''" . DG  B 2 13 ? 44.008 52.333 29.068 1.00 0.00 ? 79 DG  B "H5''" 2  
ATOM 3594  H "H4'"  . DG  B 2 13 ? 41.614 51.766 29.217 1.00 0.00 ? 79 DG  B "H4'"  2  
ATOM 3595  H "H3'"  . DG  B 2 13 ? 43.008 53.731 30.824 1.00 0.00 ? 79 DG  B "H3'"  2  
ATOM 3596  H "HO3'" . DG  B 2 13 ? 40.303 53.501 29.880 1.00 0.00 ? 79 DG  B "HO3'" 2  
ATOM 3597  H "H2'"  . DG  B 2 13 ? 42.412 52.922 32.832 1.00 0.00 ? 79 DG  B "H2'"  2  
ATOM 3598  H "H2''" . DG  B 2 13 ? 40.803 53.623 32.513 1.00 0.00 ? 79 DG  B "H2''" 2  
ATOM 3599  H "H1'"  . DG  B 2 13 ? 39.948 51.575 31.714 1.00 0.00 ? 79 DG  B "H1'"  2  
ATOM 3600  H H8     . DG  B 2 13 ? 42.982 51.136 34.124 1.00 0.00 ? 79 DG  B H8     2  
ATOM 3601  H H1     . DG  B 2 13 ? 37.482 48.330 35.962 1.00 0.00 ? 79 DG  B H1     2  
ATOM 3602  H H21    . DG  B 2 13 ? 36.372 49.306 32.843 1.00 0.00 ? 79 DG  B H21    2  
ATOM 3603  H H22    . DG  B 2 13 ? 35.990 48.558 34.380 1.00 0.00 ? 79 DG  B H22    2  
ATOM 3604  O "O5'"  . DC  C 3 1  ? 28.958 45.650 39.200 1.00 0.00 ? 80 DC  C "O5'"  2  
ATOM 3605  C "C5'"  . DC  C 3 1  ? 30.300 46.118 39.193 1.00 0.00 ? 80 DC  C "C5'"  2  
ATOM 3606  C "C4'"  . DC  C 3 1  ? 30.702 46.679 37.819 1.00 0.00 ? 80 DC  C "C4'"  2  
ATOM 3607  O "O4'"  . DC  C 3 1  ? 31.911 47.410 37.968 1.00 0.00 ? 80 DC  C "O4'"  2  
ATOM 3608  C "C3'"  . DC  C 3 1  ? 30.926 45.564 36.790 1.00 0.00 ? 80 DC  C "C3'"  2  
ATOM 3609  O "O3'"  . DC  C 3 1  ? 30.058 45.690 35.667 1.00 0.00 ? 80 DC  C "O3'"  2  
ATOM 3610  C "C2'"  . DC  C 3 1  ? 32.387 45.695 36.383 1.00 0.00 ? 80 DC  C "C2'"  2  
ATOM 3611  C "C1'"  . DC  C 3 1  ? 32.847 47.039 36.968 1.00 0.00 ? 80 DC  C "C1'"  2  
ATOM 3612  N N1     . DC  C 3 1  ? 34.195 46.935 37.594 1.00 0.00 ? 80 DC  C N1     2  
ATOM 3613  C C2     . DC  C 3 1  ? 35.275 47.620 37.024 1.00 0.00 ? 80 DC  C C2     2  
ATOM 3614  O O2     . DC  C 3 1  ? 35.154 48.344 36.037 1.00 0.00 ? 80 DC  C O2     2  
ATOM 3615  N N3     . DC  C 3 1  ? 36.518 47.525 37.550 1.00 0.00 ? 80 DC  C N3     2  
ATOM 3616  C C4     . DC  C 3 1  ? 36.692 46.767 38.615 1.00 0.00 ? 80 DC  C C4     2  
ATOM 3617  N N4     . DC  C 3 1  ? 37.895 46.783 39.107 1.00 0.00 ? 80 DC  C N4     2  
ATOM 3618  C C5     . DC  C 3 1  ? 35.634 46.097 39.279 1.00 0.00 ? 80 DC  C C5     2  
ATOM 3619  C C6     . DC  C 3 1  ? 34.393 46.194 38.736 1.00 0.00 ? 80 DC  C C6     2  
ATOM 3620  H "H5'"  . DC  C 3 1  ? 30.978 45.309 39.467 1.00 0.00 ? 80 DC  C "H5'"  2  
ATOM 3621  H "H5''" . DC  C 3 1  ? 30.400 46.909 39.938 1.00 0.00 ? 80 DC  C "H5''" 2  
ATOM 3622  H "H4'"  . DC  C 3 1  ? 29.920 47.348 37.456 1.00 0.00 ? 80 DC  C "H4'"  2  
ATOM 3623  H "H3'"  . DC  C 3 1  ? 30.787 44.599 37.282 1.00 0.00 ? 80 DC  C "H3'"  2  
ATOM 3624  H "H2'"  . DC  C 3 1  ? 32.950 44.867 36.812 1.00 0.00 ? 80 DC  C "H2'"  2  
ATOM 3625  H "H2''" . DC  C 3 1  ? 32.506 45.688 35.299 1.00 0.00 ? 80 DC  C "H2''" 2  
ATOM 3626  H "H1'"  . DC  C 3 1  ? 32.842 47.789 36.168 1.00 0.00 ? 80 DC  C "H1'"  2  
ATOM 3627  H H41    . DC  C 3 1  ? 38.093 46.252 39.948 1.00 0.00 ? 80 DC  C H41    2  
ATOM 3628  H H42    . DC  C 3 1  ? 38.605 47.227 38.544 1.00 0.00 ? 80 DC  C H42    2  
ATOM 3629  H H5     . DC  C 3 1  ? 35.793 45.520 40.178 1.00 0.00 ? 80 DC  C H5     2  
ATOM 3630  H H6     . DC  C 3 1  ? 33.544 45.712 39.212 1.00 0.00 ? 80 DC  C H6     2  
ATOM 3631  H "HO5'" . DC  C 3 1  ? 28.399 46.459 39.309 1.00 0.00 ? 80 DC  C "HO5'" 2  
ATOM 3632  P P      . DG  C 3 2  ? 29.462 44.377 34.979 1.00 0.00 ? 81 DG  C P      2  
ATOM 3633  O OP1    . DG  C 3 2  ? 28.425 44.746 33.985 1.00 0.00 ? 81 DG  C OP1    2  
ATOM 3634  O OP2    . DG  C 3 2  ? 29.099 43.428 36.048 1.00 0.00 ? 81 DG  C OP2    2  
ATOM 3635  O "O5'"  . DG  C 3 2  ? 30.688 43.759 34.178 1.00 0.00 ? 81 DG  C "O5'"  2  
ATOM 3636  C "C5'"  . DG  C 3 2  ? 30.979 44.162 32.846 1.00 0.00 ? 81 DG  C "C5'"  2  
ATOM 3637  C "C4'"  . DG  C 3 2  ? 32.293 43.574 32.317 1.00 0.00 ? 81 DG  C "C4'"  2  
ATOM 3638  O "O4'"  . DG  C 3 2  ? 33.389 44.187 32.993 1.00 0.00 ? 81 DG  C "O4'"  2  
ATOM 3639  C "C3'"  . DG  C 3 2  ? 32.403 42.053 32.547 1.00 0.00 ? 81 DG  C "C3'"  2  
ATOM 3640  O "O3'"  . DG  C 3 2  ? 33.097 41.390 31.502 1.00 0.00 ? 81 DG  C "O3'"  2  
ATOM 3641  C "C2'"  . DG  C 3 2  ? 33.303 41.995 33.772 1.00 0.00 ? 81 DG  C "C2'"  2  
ATOM 3642  C "C1'"  . DG  C 3 2  ? 34.244 43.148 33.440 1.00 0.00 ? 81 DG  C "C1'"  2  
ATOM 3643  N N9     . DG  C 3 2  ? 35.118 43.568 34.557 1.00 0.00 ? 81 DG  C N9     2  
ATOM 3644  C C8     . DG  C 3 2  ? 35.072 43.215 35.884 1.00 0.00 ? 81 DG  C C8     2  
ATOM 3645  N N7     . DG  C 3 2  ? 36.105 43.601 36.582 1.00 0.00 ? 81 DG  C N7     2  
ATOM 3646  C C5     . DG  C 3 2  ? 36.905 44.261 35.641 1.00 0.00 ? 81 DG  C C5     2  
ATOM 3647  C C6     . DG  C 3 2  ? 38.198 44.878 35.751 1.00 0.00 ? 81 DG  C C6     2  
ATOM 3648  O O6     . DG  C 3 2  ? 38.923 44.992 36.738 1.00 0.00 ? 81 DG  C O6     2  
ATOM 3649  N N1     . DG  C 3 2  ? 38.667 45.395 34.563 1.00 0.00 ? 81 DG  C N1     2  
ATOM 3650  C C2     . DG  C 3 2  ? 37.981 45.351 33.400 1.00 0.00 ? 81 DG  C C2     2  
ATOM 3651  N N2     . DG  C 3 2  ? 38.565 45.833 32.342 1.00 0.00 ? 81 DG  C N2     2  
ATOM 3652  N N3     . DG  C 3 2  ? 36.776 44.811 33.245 1.00 0.00 ? 81 DG  C N3     2  
ATOM 3653  C C4     . DG  C 3 2  ? 36.293 44.266 34.405 1.00 0.00 ? 81 DG  C C4     2  
ATOM 3654  H "H5'"  . DG  C 3 2  ? 31.046 45.249 32.793 1.00 0.00 ? 81 DG  C "H5'"  2  
ATOM 3655  H "H5''" . DG  C 3 2  ? 30.167 43.834 32.199 1.00 0.00 ? 81 DG  C "H5''" 2  
ATOM 3656  H "H4'"  . DG  C 3 2  ? 32.356 43.781 31.249 1.00 0.00 ? 81 DG  C "H4'"  2  
ATOM 3657  H "H3'"  . DG  C 3 2  ? 31.432 41.592 32.739 1.00 0.00 ? 81 DG  C "H3'"  2  
ATOM 3658  H "H2'"  . DG  C 3 2  ? 32.725 42.200 34.673 1.00 0.00 ? 81 DG  C "H2'"  2  
ATOM 3659  H "H2''" . DG  C 3 2  ? 33.836 41.046 33.847 1.00 0.00 ? 81 DG  C "H2''" 2  
ATOM 3660  H "H1'"  . DG  C 3 2  ? 34.882 42.835 32.607 1.00 0.00 ? 81 DG  C "H1'"  2  
ATOM 3661  H H8     . DG  C 3 2  ? 34.247 42.659 36.311 1.00 0.00 ? 81 DG  C H8     2  
ATOM 3662  H H1     . DG  C 3 2  ? 39.599 45.781 34.561 1.00 0.00 ? 81 DG  C H1     2  
ATOM 3663  H H21    . DG  C 3 2  ? 38.074 45.738 31.465 1.00 0.00 ? 81 DG  C H21    2  
ATOM 3664  H H22    . DG  C 3 2  ? 39.526 46.164 32.384 1.00 0.00 ? 81 DG  C H22    2  
ATOM 3665  P P      . DG  C 3 3  ? 32.384 40.957 30.141 1.00 0.00 ? 82 DG  C P      2  
ATOM 3666  O OP1    . DG  C 3 3  ? 31.163 41.761 29.948 1.00 0.00 ? 82 DG  C OP1    2  
ATOM 3667  O OP2    . DG  C 3 3  ? 32.335 39.481 30.171 1.00 0.00 ? 82 DG  C OP2    2  
ATOM 3668  O "O5'"  . DG  C 3 3  ? 33.477 41.384 29.049 1.00 0.00 ? 82 DG  C "O5'"  2  
ATOM 3669  C "C5'"  . DG  C 3 3  ? 33.634 42.730 28.626 1.00 0.00 ? 82 DG  C "C5'"  2  
ATOM 3670  C "C4'"  . DG  C 3 3  ? 34.908 42.991 27.792 1.00 0.00 ? 82 DG  C "C4'"  2  
ATOM 3671  O "O4'"  . DG  C 3 3  ? 36.033 43.182 28.639 1.00 0.00 ? 82 DG  C "O4'"  2  
ATOM 3672  C "C3'"  . DG  C 3 3  ? 35.343 41.912 26.792 1.00 0.00 ? 82 DG  C "C3'"  2  
ATOM 3673  O "O3'"  . DG  C 3 3  ? 36.081 42.564 25.752 1.00 0.00 ? 82 DG  C "O3'"  2  
ATOM 3674  C "C2'"  . DG  C 3 3  ? 36.197 41.005 27.684 1.00 0.00 ? 82 DG  C "C2'"  2  
ATOM 3675  C "C1'"  . DG  C 3 3  ? 36.826 42.006 28.657 1.00 0.00 ? 82 DG  C "C1'"  2  
ATOM 3676  N N9     . DG  C 3 3  ? 36.967 41.572 30.066 1.00 0.00 ? 82 DG  C N9     2  
ATOM 3677  C C8     . DG  C 3 3  ? 36.117 40.826 30.841 1.00 0.00 ? 82 DG  C C8     2  
ATOM 3678  N N7     . DG  C 3 3  ? 36.453 40.753 32.103 1.00 0.00 ? 82 DG  C N7     2  
ATOM 3679  C C5     . DG  C 3 3  ? 37.650 41.480 32.161 1.00 0.00 ? 82 DG  C C5     2  
ATOM 3680  C C6     . DG  C 3 3  ? 38.546 41.763 33.252 1.00 0.00 ? 82 DG  C C6     2  
ATOM 3681  O O6     . DG  C 3 3  ? 38.444 41.467 34.443 1.00 0.00 ? 82 DG  C O6     2  
ATOM 3682  N N1     . DG  C 3 3  ? 39.686 42.440 32.866 1.00 0.00 ? 82 DG  C N1     2  
ATOM 3683  C C2     . DG  C 3 3  ? 39.932 42.842 31.597 1.00 0.00 ? 82 DG  C C2     2  
ATOM 3684  N N2     . DG  C 3 3  ? 41.077 43.424 31.375 1.00 0.00 ? 82 DG  C N2     2  
ATOM 3685  N N3     . DG  C 3 3  ? 39.108 42.656 30.564 1.00 0.00 ? 82 DG  C N3     2  
ATOM 3686  C C4     . DG  C 3 3  ? 37.985 41.951 30.910 1.00 0.00 ? 82 DG  C C4     2  
ATOM 3687  H "H5'"  . DG  C 3 3  ? 33.679 43.381 29.501 1.00 0.00 ? 82 DG  C "H5'"  2  
ATOM 3688  H "H5''" . DG  C 3 3  ? 32.758 43.014 28.046 1.00 0.00 ? 82 DG  C "H5''" 2  
ATOM 3689  H "H4'"  . DG  C 3 3  ? 34.734 43.913 27.239 1.00 0.00 ? 82 DG  C "H4'"  2  
ATOM 3690  H "H3'"  . DG  C 3 3  ? 34.486 41.375 26.386 1.00 0.00 ? 82 DG  C "H3'"  2  
ATOM 3691  H "H2'"  . DG  C 3 3  ? 35.562 40.290 28.200 1.00 0.00 ? 82 DG  C "H2'"  2  
ATOM 3692  H "H2''" . DG  C 3 3  ? 36.954 40.465 27.123 1.00 0.00 ? 82 DG  C "H2''" 2  
ATOM 3693  H "H1'"  . DG  C 3 3  ? 37.816 42.250 28.272 1.00 0.00 ? 82 DG  C "H1'"  2  
ATOM 3694  H H8     . DG  C 3 3  ? 35.223 40.372 30.440 1.00 0.00 ? 82 DG  C H8     2  
ATOM 3695  H H1     . DG  C 3 3  ? 40.389 42.614 33.569 1.00 0.00 ? 82 DG  C H1     2  
ATOM 3696  H H21    . DG  C 3 3  ? 41.313 43.677 30.423 1.00 0.00 ? 82 DG  C H21    2  
ATOM 3697  H H22    . DG  C 3 3  ? 41.759 43.516 32.123 1.00 0.00 ? 82 DG  C H22    2  
ATOM 3698  P P      . DG  C 3 4  ? 36.647 41.801 24.453 1.00 0.00 ? 83 DG  C P      2  
ATOM 3699  O OP1    . DG  C 3 4  ? 36.958 42.842 23.442 1.00 0.00 ? 83 DG  C OP1    2  
ATOM 3700  O OP2    . DG  C 3 4  ? 35.696 40.734 24.085 1.00 0.00 ? 83 DG  C OP2    2  
ATOM 3701  O "O5'"  . DG  C 3 4  ? 38.017 41.173 24.993 1.00 0.00 ? 83 DG  C "O5'"  2  
ATOM 3702  C "C5'"  . DG  C 3 4  ? 39.133 42.004 25.291 1.00 0.00 ? 83 DG  C "C5'"  2  
ATOM 3703  C "C4'"  . DG  C 3 4  ? 40.196 41.350 26.183 1.00 0.00 ? 83 DG  C "C4'"  2  
ATOM 3704  O "O4'"  . DG  C 3 4  ? 39.702 41.016 27.468 1.00 0.00 ? 83 DG  C "O4'"  2  
ATOM 3705  C "C3'"  . DG  C 3 4  ? 40.808 40.071 25.602 1.00 0.00 ? 83 DG  C "C3'"  2  
ATOM 3706  O "O3'"  . DG  C 3 4  ? 42.087 40.412 25.087 1.00 0.00 ? 83 DG  C "O3'"  2  
ATOM 3707  C "C2'"  . DG  C 3 4  ? 40.863 39.133 26.815 1.00 0.00 ? 83 DG  C "C2'"  2  
ATOM 3708  C "C1'"  . DG  C 3 4  ? 40.592 40.058 27.999 1.00 0.00 ? 83 DG  C "C1'"  2  
ATOM 3709  N N9     . DG  C 3 4  ? 39.973 39.390 29.166 1.00 0.00 ? 83 DG  C N9     2  
ATOM 3710  C C8     . DG  C 3 4  ? 38.762 38.748 29.226 1.00 0.00 ? 83 DG  C C8     2  
ATOM 3711  N N7     . DG  C 3 4  ? 38.393 38.394 30.429 1.00 0.00 ? 83 DG  C N7     2  
ATOM 3712  C C5     . DG  C 3 4  ? 39.471 38.804 31.226 1.00 0.00 ? 83 DG  C C5     2  
ATOM 3713  C C6     . DG  C 3 4  ? 39.678 38.737 32.649 1.00 0.00 ? 83 DG  C C6     2  
ATOM 3714  O O6     . DG  C 3 4  ? 38.916 38.331 33.525 1.00 0.00 ? 83 DG  C O6     2  
ATOM 3715  N N1     . DG  C 3 4  ? 40.905 39.213 33.056 1.00 0.00 ? 83 DG  C N1     2  
ATOM 3716  C C2     . DG  C 3 4  ? 41.823 39.736 32.218 1.00 0.00 ? 83 DG  C C2     2  
ATOM 3717  N N2     . DG  C 3 4  ? 42.936 40.107 32.790 1.00 0.00 ? 83 DG  C N2     2  
ATOM 3718  N N3     . DG  C 3 4  ? 41.667 39.867 30.896 1.00 0.00 ? 83 DG  C N3     2  
ATOM 3719  C C4     . DG  C 3 4  ? 40.462 39.377 30.455 1.00 0.00 ? 83 DG  C C4     2  
ATOM 3720  H "H5'"  . DG  C 3 4  ? 38.792 42.905 25.796 1.00 0.00 ? 83 DG  C "H5'"  2  
ATOM 3721  H "H5''" . DG  C 3 4  ? 39.604 42.301 24.357 1.00 0.00 ? 83 DG  C "H5''" 2  
ATOM 3722  H "H4'"  . DG  C 3 4  ? 40.995 42.081 26.322 1.00 0.00 ? 83 DG  C "H4'"  2  
ATOM 3723  H "H3'"  . DG  C 3 4  ? 40.167 39.659 24.818 1.00 0.00 ? 83 DG  C "H3'"  2  
ATOM 3724  H "H2'"  . DG  C 3 4  ? 40.079 38.385 26.721 1.00 0.00 ? 83 DG  C "H2'"  2  
ATOM 3725  H "H2''" . DG  C 3 4  ? 41.827 38.647 26.923 1.00 0.00 ? 83 DG  C "H2''" 2  
ATOM 3726  H "H1'"  . DG  C 3 4  ? 41.521 40.545 28.302 1.00 0.00 ? 83 DG  C "H1'"  2  
ATOM 3727  H H8     . DG  C 3 4  ? 38.150 38.588 28.351 1.00 0.00 ? 83 DG  C H8     2  
ATOM 3728  H H1     . DG  C 3 4  ? 41.144 39.159 34.035 1.00 0.00 ? 83 DG  C H1     2  
ATOM 3729  H H21    . DG  C 3 4  ? 43.663 40.540 32.237 1.00 0.00 ? 83 DG  C H21    2  
ATOM 3730  H H22    . DG  C 3 4  ? 43.074 39.949 33.784 1.00 0.00 ? 83 DG  C H22    2  
ATOM 3731  P P      . DG  C 3 5  ? 42.960 39.423 24.195 1.00 0.00 ? 84 DG  C P      2  
ATOM 3732  O OP1    . DG  C 3 5  ? 44.023 40.251 23.583 1.00 0.00 ? 84 DG  C OP1    2  
ATOM 3733  O OP2    . DG  C 3 5  ? 42.063 38.660 23.308 1.00 0.00 ? 84 DG  C OP2    2  
ATOM 3734  O "O5'"  . DG  C 3 5  ? 43.669 38.434 25.207 1.00 0.00 ? 84 DG  C "O5'"  2  
ATOM 3735  C "C5'"  . DG  C 3 5  ? 44.716 38.904 26.046 1.00 0.00 ? 84 DG  C "C5'"  2  
ATOM 3736  C "C4'"  . DG  C 3 5  ? 45.140 37.864 27.077 1.00 0.00 ? 84 DG  C "C4'"  2  
ATOM 3737  O "O4'"  . DG  C 3 5  ? 44.096 37.717 28.021 1.00 0.00 ? 84 DG  C "O4'"  2  
ATOM 3738  C "C3'"  . DG  C 3 5  ? 45.470 36.477 26.488 1.00 0.00 ? 84 DG  C "C3'"  2  
ATOM 3739  O "O3'"  . DG  C 3 5  ? 46.858 36.242 26.726 1.00 0.00 ? 84 DG  C "O3'"  2  
ATOM 3740  C "C2'"  . DG  C 3 5  ? 44.477 35.572 27.230 1.00 0.00 ? 84 DG  C "C2'"  2  
ATOM 3741  C "C1'"  . DG  C 3 5  ? 44.114 36.386 28.467 1.00 0.00 ? 84 DG  C "C1'"  2  
ATOM 3742  N N9     . DG  C 3 5  ? 42.797 36.086 29.077 1.00 0.00 ? 84 DG  C N9     2  
ATOM 3743  C C8     . DG  C 3 5  ? 41.616 35.719 28.479 1.00 0.00 ? 84 DG  C C8     2  
ATOM 3744  N N7     . DG  C 3 5  ? 40.634 35.503 29.315 1.00 0.00 ? 84 DG  C N7     2  
ATOM 3745  C C5     . DG  C 3 5  ? 41.204 35.770 30.571 1.00 0.00 ? 84 DG  C C5     2  
ATOM 3746  C C6     . DG  C 3 5  ? 40.670 35.731 31.911 1.00 0.00 ? 84 DG  C C6     2  
ATOM 3747  O O6     . DG  C 3 5  ? 39.525 35.511 32.306 1.00 0.00 ? 84 DG  C O6     2  
ATOM 3748  N N1     . DG  C 3 5  ? 41.612 35.992 32.881 1.00 0.00 ? 84 DG  C N1     2  
ATOM 3749  C C2     . DG  C 3 5  ? 42.884 36.368 32.622 1.00 0.00 ? 84 DG  C C2     2  
ATOM 3750  N N2     . DG  C 3 5  ? 43.637 36.631 33.648 1.00 0.00 ? 84 DG  C N2     2  
ATOM 3751  N N3     . DG  C 3 5  ? 43.409 36.485 31.408 1.00 0.00 ? 84 DG  C N3     2  
ATOM 3752  C C4     . DG  C 3 5  ? 42.525 36.142 30.422 1.00 0.00 ? 84 DG  C C4     2  
ATOM 3753  H "H5'"  . DG  C 3 5  ? 44.386 39.794 26.579 1.00 0.00 ? 84 DG  C "H5'"  2  
ATOM 3754  H "H5''" . DG  C 3 5  ? 45.575 39.179 25.441 1.00 0.00 ? 84 DG  C "H5''" 2  
ATOM 3755  H "H4'"  . DG  C 3 5  ? 46.019 38.241 27.604 1.00 0.00 ? 84 DG  C "H4'"  2  
ATOM 3756  H "H3'"  . DG  C 3 5  ? 45.263 36.443 25.416 1.00 0.00 ? 84 DG  C "H3'"  2  
ATOM 3757  H "H2'"  . DG  C 3 5  ? 43.604 35.426 26.596 1.00 0.00 ? 84 DG  C "H2'"  2  
ATOM 3758  H "H2''" . DG  C 3 5  ? 44.902 34.610 27.512 1.00 0.00 ? 84 DG  C "H2''" 2  
ATOM 3759  H "H1'"  . DG  C 3 5  ? 44.905 36.259 29.212 1.00 0.00 ? 84 DG  C "H1'"  2  
ATOM 3760  H H8     . DG  C 3 5  ? 41.514 35.620 27.406 1.00 0.00 ? 84 DG  C H8     2  
ATOM 3761  H H1     . DG  C 3 5  ? 41.333 35.878 33.843 1.00 0.00 ? 84 DG  C H1     2  
ATOM 3762  H H21    . DG  C 3 5  ? 44.579 36.964 33.484 1.00 0.00 ? 84 DG  C H21    2  
ATOM 3763  H H22    . DG  C 3 5  ? 43.319 36.414 34.585 1.00 0.00 ? 84 DG  C H22    2  
ATOM 3764  P P      . DA  C 3 6  ? 47.579 34.814 26.678 1.00 0.00 ? 85 DA  C P      2  
ATOM 3765  O OP1    . DA  C 3 6  ? 48.999 35.058 26.344 1.00 0.00 ? 85 DA  C OP1    2  
ATOM 3766  O OP2    . DA  C 3 6  ? 46.799 33.892 25.821 1.00 0.00 ? 85 DA  C OP2    2  
ATOM 3767  O "O5'"  . DA  C 3 6  ? 47.494 34.340 28.198 1.00 0.00 ? 85 DA  C "O5'"  2  
ATOM 3768  C "C5'"  . DA  C 3 6  ? 48.128 35.116 29.216 1.00 0.00 ? 85 DA  C "C5'"  2  
ATOM 3769  C "C4'"  . DA  C 3 6  ? 47.942 34.552 30.630 1.00 0.00 ? 85 DA  C "C4'"  2  
ATOM 3770  O "O4'"  . DA  C 3 6  ? 46.571 34.582 30.997 1.00 0.00 ? 85 DA  C "O4'"  2  
ATOM 3771  C "C3'"  . DA  C 3 6  ? 48.456 33.113 30.781 1.00 0.00 ? 85 DA  C "C3'"  2  
ATOM 3772  O "O3'"  . DA  C 3 6  ? 49.297 33.029 31.928 1.00 0.00 ? 85 DA  C "O3'"  2  
ATOM 3773  C "C2'"  . DA  C 3 6  ? 47.153 32.326 30.912 1.00 0.00 ? 85 DA  C "C2'"  2  
ATOM 3774  C "C1'"  . DA  C 3 6  ? 46.227 33.341 31.582 1.00 0.00 ? 85 DA  C "C1'"  2  
ATOM 3775  N N9     . DA  C 3 6  ? 44.803 33.076 31.303 1.00 0.00 ? 85 DA  C N9     2  
ATOM 3776  C C8     . DA  C 3 6  ? 44.199 32.972 30.075 1.00 0.00 ? 85 DA  C C8     2  
ATOM 3777  N N7     . DA  C 3 6  ? 42.908 32.780 30.127 1.00 0.00 ? 85 DA  C N7     2  
ATOM 3778  C C5     . DA  C 3 6  ? 42.647 32.736 31.507 1.00 0.00 ? 85 DA  C C5     2  
ATOM 3779  C C6     . DA  C 3 6  ? 41.486 32.568 32.304 1.00 0.00 ? 85 DA  C C6     2  
ATOM 3780  N N6     . DA  C 3 6  ? 40.257 32.415 31.848 1.00 0.00 ? 85 DA  C N6     2  
ATOM 3781  N N1     . DA  C 3 6  ? 41.567 32.565 33.631 1.00 0.00 ? 85 DA  C N1     2  
ATOM 3782  C C2     . DA  C 3 6  ? 42.751 32.739 34.192 1.00 0.00 ? 85 DA  C C2     2  
ATOM 3783  N N3     . DA  C 3 6  ? 43.923 32.921 33.590 1.00 0.00 ? 85 DA  C N3     2  
ATOM 3784  C C4     . DA  C 3 6  ? 43.798 32.912 32.230 1.00 0.00 ? 85 DA  C C4     2  
ATOM 3785  H "H5'"  . DA  C 3 6  ? 47.725 36.130 29.202 1.00 0.00 ? 85 DA  C "H5'"  2  
ATOM 3786  H "H5''" . DA  C 3 6  ? 49.196 35.177 29.009 1.00 0.00 ? 85 DA  C "H5''" 2  
ATOM 3787  H "H4'"  . DA  C 3 6  ? 48.492 35.193 31.321 1.00 0.00 ? 85 DA  C "H4'"  2  
ATOM 3788  H "H3'"  . DA  C 3 6  ? 48.999 32.802 29.882 1.00 0.00 ? 85 DA  C "H3'"  2  
ATOM 3789  H "H2'"  . DA  C 3 6  ? 46.795 32.064 29.919 1.00 0.00 ? 85 DA  C "H2'"  2  
ATOM 3790  H "H2''" . DA  C 3 6  ? 47.255 31.429 31.519 1.00 0.00 ? 85 DA  C "H2''" 2  
ATOM 3791  H "H1'"  . DA  C 3 6  ? 46.415 33.362 32.657 1.00 0.00 ? 85 DA  C "H1'"  2  
ATOM 3792  H H8     . DA  C 3 6  ? 44.757 33.058 29.150 1.00 0.00 ? 85 DA  C H8     2  
ATOM 3793  H H61    . DA  C 3 6  ? 40.081 32.402 30.856 1.00 0.00 ? 85 DA  C H61    2  
ATOM 3794  H H62    . DA  C 3 6  ? 39.484 32.441 32.507 1.00 0.00 ? 85 DA  C H62    2  
ATOM 3795  H H2     . DA  C 3 6  ? 42.769 32.720 35.272 1.00 0.00 ? 85 DA  C H2     2  
ATOM 3796  P P      . DT  C 3 7  ? 50.066 31.693 32.350 1.00 0.00 ? 86 DT  C P      2  
ATOM 3797  O OP1    . DT  C 3 7  ? 51.192 32.074 33.222 1.00 0.00 ? 86 DT  C OP1    2  
ATOM 3798  O OP2    . DT  C 3 7  ? 50.342 30.899 31.136 1.00 0.00 ? 86 DT  C OP2    2  
ATOM 3799  O "O5'"  . DT  C 3 7  ? 49.021 30.887 33.262 1.00 0.00 ? 86 DT  C "O5'"  2  
ATOM 3800  C "C5'"  . DT  C 3 7  ? 48.578 31.464 34.494 1.00 0.00 ? 86 DT  C "C5'"  2  
ATOM 3801  C "C4'"  . DT  C 3 7  ? 47.368 30.781 35.148 1.00 0.00 ? 86 DT  C "C4'"  2  
ATOM 3802  O "O4'"  . DT  C 3 7  ? 46.243 30.808 34.289 1.00 0.00 ? 86 DT  C "O4'"  2  
ATOM 3803  C "C3'"  . DT  C 3 7  ? 47.573 29.321 35.586 1.00 0.00 ? 86 DT  C "C3'"  2  
ATOM 3804  O "O3'"  . DT  C 3 7  ? 47.606 29.248 37.023 1.00 0.00 ? 86 DT  C "O3'"  2  
ATOM 3805  C "C2'"  . DT  C 3 7  ? 46.360 28.613 34.965 1.00 0.00 ? 86 DT  C "C2'"  2  
ATOM 3806  C "C1'"  . DT  C 3 7  ? 45.386 29.762 34.703 1.00 0.00 ? 86 DT  C "C1'"  2  
ATOM 3807  N N1     . DT  C 3 7  ? 44.340 29.484 33.676 1.00 0.00 ? 86 DT  C N1     2  
ATOM 3808  C C2     . DT  C 3 7  ? 43.014 29.339 34.107 1.00 0.00 ? 86 DT  C C2     2  
ATOM 3809  O O2     . DT  C 3 7  ? 42.687 29.246 35.286 1.00 0.00 ? 86 DT  C O2     2  
ATOM 3810  N N3     . DT  C 3 7  ? 42.041 29.295 33.139 1.00 0.00 ? 86 DT  C N3     2  
ATOM 3811  C C4     . DT  C 3 7  ? 42.259 29.342 31.784 1.00 0.00 ? 86 DT  C C4     2  
ATOM 3812  O O4     . DT  C 3 7  ? 41.282 29.369 31.040 1.00 0.00 ? 86 DT  C O4     2  
ATOM 3813  C C5     . DT  C 3 7  ? 43.668 29.382 31.392 1.00 0.00 ? 86 DT  C C5     2  
ATOM 3814  C C7     . DT  C 3 7  ? 44.052 29.358 29.921 1.00 0.00 ? 86 DT  C C7     2  
ATOM 3815  C C6     . DT  C 3 7  ? 44.651 29.455 32.333 1.00 0.00 ? 86 DT  C C6     2  
ATOM 3816  H "H5'"  . DT  C 3 7  ? 48.302 32.504 34.316 1.00 0.00 ? 86 DT  C "H5'"  2  
ATOM 3817  H "H5''" . DT  C 3 7  ? 49.403 31.466 35.204 1.00 0.00 ? 86 DT  C "H5''" 2  
ATOM 3818  H "H4'"  . DT  C 3 7  ? 47.116 31.358 36.039 1.00 0.00 ? 86 DT  C "H4'"  2  
ATOM 3819  H "H3'"  . DT  C 3 7  ? 48.494 28.931 35.155 1.00 0.00 ? 86 DT  C "H3'"  2  
ATOM 3820  H "H2'"  . DT  C 3 7  ? 46.650 28.149 34.020 1.00 0.00 ? 86 DT  C "H2'"  2  
ATOM 3821  H "H2''" . DT  C 3 7  ? 45.920 27.871 35.621 1.00 0.00 ? 86 DT  C "H2''" 2  
ATOM 3822  H "H1'"  . DT  C 3 7  ? 44.911 30.038 35.650 1.00 0.00 ? 86 DT  C "H1'"  2  
ATOM 3823  H H3     . DT  C 3 7  ? 41.074 29.269 33.443 1.00 0.00 ? 86 DT  C H3     2  
ATOM 3824  H H71    . DT  C 3 7  ? 43.753 28.403 29.488 1.00 0.00 ? 86 DT  C H71    2  
ATOM 3825  H H72    . DT  C 3 7  ? 43.525 30.152 29.391 1.00 0.00 ? 86 DT  C H72    2  
ATOM 3826  H H73    . DT  C 3 7  ? 45.125 29.488 29.795 1.00 0.00 ? 86 DT  C H73    2  
ATOM 3827  H H6     . DT  C 3 7  ? 45.691 29.507 32.032 1.00 0.00 ? 86 DT  C H6     2  
ATOM 3828  P P      . DT  C 3 8  ? 48.075 27.924 37.809 1.00 0.00 ? 87 DT  C P      2  
ATOM 3829  O OP1    . DT  C 3 8  ? 48.407 28.272 39.209 1.00 0.00 ? 87 DT  C OP1    2  
ATOM 3830  O OP2    . DT  C 3 8  ? 49.108 27.262 36.986 1.00 0.00 ? 87 DT  C OP2    2  
ATOM 3831  O "O5'"  . DT  C 3 8  ? 46.745 27.037 37.848 1.00 0.00 ? 87 DT  C "O5'"  2  
ATOM 3832  C "C5'"  . DT  C 3 8  ? 45.622 27.530 38.579 1.00 0.00 ? 87 DT  C "C5'"  2  
ATOM 3833  C "C4'"  . DT  C 3 8  ? 44.289 26.835 38.304 1.00 0.00 ? 87 DT  C "C4'"  2  
ATOM 3834  O "O4'"  . DT  C 3 8  ? 43.897 26.946 36.951 1.00 0.00 ? 87 DT  C "O4'"  2  
ATOM 3835  C "C3'"  . DT  C 3 8  ? 44.244 25.342 38.644 1.00 0.00 ? 87 DT  C "C3'"  2  
ATOM 3836  O "O3'"  . DT  C 3 8  ? 43.605 25.227 39.908 1.00 0.00 ? 87 DT  C "O3'"  2  
ATOM 3837  C "C2'"  . DT  C 3 8  ? 43.432 24.751 37.480 1.00 0.00 ? 87 DT  C "C2'"  2  
ATOM 3838  C "C1'"  . DT  C 3 8  ? 42.879 25.986 36.778 1.00 0.00 ? 87 DT  C "C1'"  2  
ATOM 3839  N N1     . DT  C 3 8  ? 42.545 25.833 35.333 1.00 0.00 ? 87 DT  C N1     2  
ATOM 3840  C C2     . DT  C 3 8  ? 41.203 25.955 34.957 1.00 0.00 ? 87 DT  C C2     2  
ATOM 3841  O O2     . DT  C 3 8  ? 40.280 26.008 35.765 1.00 0.00 ? 87 DT  C O2     2  
ATOM 3842  N N3     . DT  C 3 8  ? 40.941 26.037 33.607 1.00 0.00 ? 87 DT  C N3     2  
ATOM 3843  C C4     . DT  C 3 8  ? 41.876 26.019 32.601 1.00 0.00 ? 87 DT  C C4     2  
ATOM 3844  O O4     . DT  C 3 8  ? 41.505 26.183 31.439 1.00 0.00 ? 87 DT  C O4     2  
ATOM 3845  C C5     . DT  C 3 8  ? 43.251 25.830 33.055 1.00 0.00 ? 87 DT  C C5     2  
ATOM 3846  C C7     . DT  C 3 8  ? 44.374 25.764 32.043 1.00 0.00 ? 87 DT  C C7     2  
ATOM 3847  C C6     . DT  C 3 8  ? 43.538 25.732 34.382 1.00 0.00 ? 87 DT  C C6     2  
ATOM 3848  H "H5'"  . DT  C 3 8  ? 45.476 28.583 38.338 1.00 0.00 ? 87 DT  C "H5'"  2  
ATOM 3849  H "H5''" . DT  C 3 8  ? 45.824 27.465 39.650 1.00 0.00 ? 87 DT  C "H5''" 2  
ATOM 3850  H "H4'"  . DT  C 3 8  ? 43.530 27.336 38.910 1.00 0.00 ? 87 DT  C "H4'"  2  
ATOM 3851  H "H3'"  . DT  C 3 8  ? 45.252 24.924 38.664 1.00 0.00 ? 87 DT  C "H3'"  2  
ATOM 3852  H "H2'"  . DT  C 3 8  ? 44.099 24.198 36.821 1.00 0.00 ? 87 DT  C "H2'"  2  
ATOM 3853  H "H2''" . DT  C 3 8  ? 42.617 24.116 37.826 1.00 0.00 ? 87 DT  C "H2''" 2  
ATOM 3854  H "H1'"  . DT  C 3 8  ? 41.991 26.313 37.328 1.00 0.00 ? 87 DT  C "H1'"  2  
ATOM 3855  H H3     . DT  C 3 8  ? 39.982 26.152 33.315 1.00 0.00 ? 87 DT  C H3     2  
ATOM 3856  H H71    . DT  C 3 8  ? 45.328 25.565 32.531 1.00 0.00 ? 87 DT  C H71    2  
ATOM 3857  H H72    . DT  C 3 8  ? 44.162 24.976 31.321 1.00 0.00 ? 87 DT  C H72    2  
ATOM 3858  H H73    . DT  C 3 8  ? 44.434 26.703 31.495 1.00 0.00 ? 87 DT  C H73    2  
ATOM 3859  H H6     . DT  C 3 8  ? 44.562 25.602 34.704 1.00 0.00 ? 87 DT  C H6     2  
ATOM 3860  P P      . DA  C 3 9  ? 43.517 23.868 40.727 1.00 0.00 ? 88 DA  C P      2  
ATOM 3861  O OP1    . DA  C 3 9  ? 43.230 24.237 42.129 1.00 0.00 ? 88 DA  C OP1    2  
ATOM 3862  O OP2    . DA  C 3 9  ? 44.732 23.062 40.461 1.00 0.00 ? 88 DA  C OP2    2  
ATOM 3863  O "O5'"  . DA  C 3 9  ? 42.250 23.097 40.143 1.00 0.00 ? 88 DA  C "O5'"  2  
ATOM 3864  C "C5'"  . DA  C 3 9  ? 40.943 23.562 40.453 1.00 0.00 ? 88 DA  C "C5'"  2  
ATOM 3865  C "C4'"  . DA  C 3 9  ? 39.801 22.816 39.757 1.00 0.00 ? 88 DA  C "C4'"  2  
ATOM 3866  O "O4'"  . DA  C 3 9  ? 39.824 23.083 38.359 1.00 0.00 ? 88 DA  C "O4'"  2  
ATOM 3867  C "C3'"  . DA  C 3 9  ? 39.803 21.296 39.963 1.00 0.00 ? 88 DA  C "C3'"  2  
ATOM 3868  O "O3'"  . DA  C 3 9  ? 38.479 20.921 40.324 1.00 0.00 ? 88 DA  C "O3'"  2  
ATOM 3869  C "C2'"  . DA  C 3 9  ? 40.251 20.793 38.589 1.00 0.00 ? 88 DA  C "C2'"  2  
ATOM 3870  C "C1'"  . DA  C 3 9  ? 39.713 21.868 37.642 1.00 0.00 ? 88 DA  C "C1'"  2  
ATOM 3871  N N9     . DA  C 3 9  ? 40.470 21.994 36.370 1.00 0.00 ? 88 DA  C N9     2  
ATOM 3872  C C8     . DA  C 3 9  ? 41.827 21.875 36.174 1.00 0.00 ? 88 DA  C C8     2  
ATOM 3873  N N7     . DA  C 3 9  ? 42.218 22.058 34.939 1.00 0.00 ? 88 DA  C N7     2  
ATOM 3874  C C5     . DA  C 3 9  ? 41.010 22.308 34.263 1.00 0.00 ? 88 DA  C C5     2  
ATOM 3875  C C6     . DA  C 3 9  ? 40.663 22.583 32.915 1.00 0.00 ? 88 DA  C C6     2  
ATOM 3876  N N6     . DA  C 3 9  ? 41.521 22.705 31.918 1.00 0.00 ? 88 DA  C N6     2  
ATOM 3877  N N1     . DA  C 3 9  ? 39.388 22.734 32.558 1.00 0.00 ? 88 DA  C N1     2  
ATOM 3878  C C2     . DA  C 3 9  ? 38.461 22.658 33.503 1.00 0.00 ? 88 DA  C C2     2  
ATOM 3879  N N3     . DA  C 3 9  ? 38.619 22.454 34.809 1.00 0.00 ? 88 DA  C N3     2  
ATOM 3880  C C4     . DA  C 3 9  ? 39.939 22.271 35.124 1.00 0.00 ? 88 DA  C C4     2  
ATOM 3881  H "H5'"  . DA  C 3 9  ? 40.866 24.614 40.172 1.00 0.00 ? 88 DA  C "H5'"  2  
ATOM 3882  H "H5''" . DA  C 3 9  ? 40.786 23.484 41.529 1.00 0.00 ? 88 DA  C "H5''" 2  
ATOM 3883  H "H4'"  . DA  C 3 9  ? 38.870 23.202 40.169 1.00 0.00 ? 88 DA  C "H4'"  2  
ATOM 3884  H "H3'"  . DA  C 3 9  ? 40.513 21.002 40.739 1.00 0.00 ? 88 DA  C "H3'"  2  
ATOM 3885  H "H2'"  . DA  C 3 9  ? 41.340 20.759 38.577 1.00 0.00 ? 88 DA  C "H2'"  2  
ATOM 3886  H "H2''" . DA  C 3 9  ? 39.846 19.811 38.346 1.00 0.00 ? 88 DA  C "H2''" 2  
ATOM 3887  H "H1'"  . DA  C 3 9  ? 38.661 21.652 37.433 1.00 0.00 ? 88 DA  C "H1'"  2  
ATOM 3888  H H8     . DA  C 3 9  ? 42.513 21.668 36.987 1.00 0.00 ? 88 DA  C H8     2  
ATOM 3889  H H61    . DA  C 3 9  ? 42.518 22.610 32.080 1.00 0.00 ? 88 DA  C H61    2  
ATOM 3890  H H62    . DA  C 3 9  ? 41.187 22.978 31.001 1.00 0.00 ? 88 DA  C H62    2  
ATOM 3891  H H2     . DA  C 3 9  ? 37.442 22.789 33.169 1.00 0.00 ? 88 DA  C H2     2  
ATOM 3892  P P      . DG  C 3 10 ? 37.991 19.416 40.504 1.00 0.00 ? 89 DG  C P      2  
ATOM 3893  O OP1    . DG  C 3 10 ? 36.966 19.392 41.566 1.00 0.00 ? 89 DG  C OP1    2  
ATOM 3894  O OP2    . DG  C 3 10 ? 39.159 18.513 40.630 1.00 0.00 ? 89 DG  C OP2    2  
ATOM 3895  O "O5'"  . DG  C 3 10 ? 37.252 19.159 39.118 1.00 0.00 ? 89 DG  C "O5'"  2  
ATOM 3896  C "C5'"  . DG  C 3 10 ? 36.036 19.850 38.835 1.00 0.00 ? 89 DG  C "C5'"  2  
ATOM 3897  C "C4'"  . DG  C 3 10 ? 35.499 19.650 37.412 1.00 0.00 ? 89 DG  C "C4'"  2  
ATOM 3898  O "O4'"  . DG  C 3 10 ? 36.461 20.087 36.453 1.00 0.00 ? 89 DG  C "O4'"  2  
ATOM 3899  C "C3'"  . DG  C 3 10 ? 35.142 18.200 37.074 1.00 0.00 ? 89 DG  C "C3'"  2  
ATOM 3900  O "O3'"  . DG  C 3 10 ? 33.929 18.227 36.343 1.00 0.00 ? 89 DG  C "O3'"  2  
ATOM 3901  C "C2'"  . DG  C 3 10 ? 36.323 17.768 36.221 1.00 0.00 ? 89 DG  C "C2'"  2  
ATOM 3902  C "C1'"  . DG  C 3 10 ? 36.604 19.064 35.484 1.00 0.00 ? 89 DG  C "C1'"  2  
ATOM 3903  N N9     . DG  C 3 10 ? 37.926 19.087 34.831 1.00 0.00 ? 89 DG  C N9     2  
ATOM 3904  C C8     . DG  C 3 10 ? 39.175 18.866 35.348 1.00 0.00 ? 89 DG  C C8     2  
ATOM 3905  N N7     . DG  C 3 10 ? 40.146 18.940 34.472 1.00 0.00 ? 89 DG  C N7     2  
ATOM 3906  C C5     . DG  C 3 10 ? 39.476 19.173 33.263 1.00 0.00 ? 89 DG  C C5     2  
ATOM 3907  C C6     . DG  C 3 10 ? 39.941 19.295 31.900 1.00 0.00 ? 89 DG  C C6     2  
ATOM 3908  O O6     . DG  C 3 10 ? 41.090 19.228 31.457 1.00 0.00 ? 89 DG  C O6     2  
ATOM 3909  N N1     . DG  C 3 10 ? 38.925 19.486 30.986 1.00 0.00 ? 89 DG  C N1     2  
ATOM 3910  C C2     . DG  C 3 10 ? 37.613 19.558 31.319 1.00 0.00 ? 89 DG  C C2     2  
ATOM 3911  N N2     . DG  C 3 10 ? 36.757 19.621 30.337 1.00 0.00 ? 89 DG  C N2     2  
ATOM 3912  N N3     . DG  C 3 10 ? 37.139 19.461 32.558 1.00 0.00 ? 89 DG  C N3     2  
ATOM 3913  C C4     . DG  C 3 10 ? 38.119 19.264 33.486 1.00 0.00 ? 89 DG  C C4     2  
ATOM 3914  H "H5'"  . DG  C 3 10 ? 36.194 20.919 38.983 1.00 0.00 ? 89 DG  C "H5'"  2  
ATOM 3915  H "H5''" . DG  C 3 10 ? 35.267 19.523 39.538 1.00 0.00 ? 89 DG  C "H5''" 2  
ATOM 3916  H "H4'"  . DG  C 3 10 ? 34.592 20.256 37.320 1.00 0.00 ? 89 DG  C "H4'"  2  
ATOM 3917  H "H3'"  . DG  C 3 10 ? 35.030 17.590 37.970 1.00 0.00 ? 89 DG  C "H3'"  2  
ATOM 3918  H "H2'"  . DG  C 3 10 ? 37.148 17.491 36.857 1.00 0.00 ? 89 DG  C "H2'"  2  
ATOM 3919  H "H2''" . DG  C 3 10 ? 36.064 16.964 35.545 1.00 0.00 ? 89 DG  C "H2''" 2  
ATOM 3920  H "H1'"  . DG  C 3 10 ? 35.833 19.186 34.725 1.00 0.00 ? 89 DG  C "H1'"  2  
ATOM 3921  H H8     . DG  C 3 10 ? 39.341 18.659 36.391 1.00 0.00 ? 89 DG  C H8     2  
ATOM 3922  H H1     . DG  C 3 10 ? 39.186 19.567 30.010 1.00 0.00 ? 89 DG  C H1     2  
ATOM 3923  H H21    . DG  C 3 10 ? 35.785 19.504 30.591 1.00 0.00 ? 89 DG  C H21    2  
ATOM 3924  H H22    . DG  C 3 10 ? 37.079 19.613 29.369 1.00 0.00 ? 89 DG  C H22    2  
ATOM 3925  P P      . DA  C 3 11 ? 33.099 16.928 35.910 1.00 0.00 ? 90 DA  C P      2  
ATOM 3926  O OP1    . DA  C 3 11 ? 31.662 17.226 36.075 1.00 0.00 ? 90 DA  C OP1    2  
ATOM 3927  O OP2    . DA  C 3 11 ? 33.680 15.753 36.600 1.00 0.00 ? 90 DA  C OP2    2  
ATOM 3928  O "O5'"  . DA  C 3 11 ? 33.410 16.775 34.347 1.00 0.00 ? 90 DA  C "O5'"  2  
ATOM 3929  C "C5'"  . DA  C 3 11 ? 32.814 17.649 33.402 1.00 0.00 ? 90 DA  C "C5'"  2  
ATOM 3930  C "C4'"  . DA  C 3 11 ? 33.122 17.315 31.940 1.00 0.00 ? 90 DA  C "C4'"  2  
ATOM 3931  O "O4'"  . DA  C 3 11 ? 34.509 17.490 31.699 1.00 0.00 ? 90 DA  C "O4'"  2  
ATOM 3932  C "C3'"  . DA  C 3 11 ? 32.742 15.874 31.562 1.00 0.00 ? 90 DA  C "C3'"  2  
ATOM 3933  O "O3'"  . DA  C 3 11 ? 32.133 15.880 30.274 1.00 0.00 ? 90 DA  C "O3'"  2  
ATOM 3934  C "C2'"  . DA  C 3 11 ? 34.100 15.187 31.583 1.00 0.00 ? 90 DA  C "C2'"  2  
ATOM 3935  C "C1'"  . DA  C 3 11 ? 34.994 16.313 31.092 1.00 0.00 ? 90 DA  C "C1'"  2  
ATOM 3936  N N9     . DA  C 3 11 ? 36.414 16.121 31.441 1.00 0.00 ? 90 DA  C N9     2  
ATOM 3937  C C8     . DA  C 3 11 ? 36.983 15.863 32.663 1.00 0.00 ? 90 DA  C C8     2  
ATOM 3938  N N7     . DA  C 3 11 ? 38.291 15.759 32.645 1.00 0.00 ? 90 DA  C N7     2  
ATOM 3939  C C5     . DA  C 3 11 ? 38.596 15.989 31.290 1.00 0.00 ? 90 DA  C C5     2  
ATOM 3940  C C6     . DA  C 3 11 ? 39.778 16.070 30.510 1.00 0.00 ? 90 DA  C C6     2  
ATOM 3941  N N6     . DA  C 3 11 ? 41.013 15.967 30.952 1.00 0.00 ? 90 DA  C N6     2  
ATOM 3942  N N1     . DA  C 3 11 ? 39.729 16.291 29.199 1.00 0.00 ? 90 DA  C N1     2  
ATOM 3943  C C2     . DA  C 3 11 ? 38.547 16.450 28.632 1.00 0.00 ? 90 DA  C C2     2  
ATOM 3944  N N3     . DA  C 3 11 ? 37.359 16.427 29.220 1.00 0.00 ? 90 DA  C N3     2  
ATOM 3945  C C4     . DA  C 3 11 ? 37.457 16.189 30.558 1.00 0.00 ? 90 DA  C C4     2  
ATOM 3946  H "H5'"  . DA  C 3 11 ? 33.163 18.657 33.613 1.00 0.00 ? 90 DA  C "H5'"  2  
ATOM 3947  H "H5''" . DA  C 3 11 ? 31.735 17.611 33.541 1.00 0.00 ? 90 DA  C "H5''" 2  
ATOM 3948  H "H4'"  . DA  C 3 11 ? 32.567 18.008 31.308 1.00 0.00 ? 90 DA  C "H4'"  2  
ATOM 3949  H "H3'"  . DA  C 3 11 ? 32.068 15.445 32.307 1.00 0.00 ? 90 DA  C "H3'"  2  
ATOM 3950  H "H2'"  . DA  C 3 11 ? 34.348 14.904 32.606 1.00 0.00 ? 90 DA  C "H2'"  2  
ATOM 3951  H "H2''" . DA  C 3 11 ? 34.149 14.320 30.930 1.00 0.00 ? 90 DA  C "H2''" 2  
ATOM 3952  H "H1'"  . DA  C 3 11 ? 34.879 16.390 30.008 1.00 0.00 ? 90 DA  C "H1'"  2  
ATOM 3953  H H8     . DA  C 3 11 ? 36.387 15.767 33.560 1.00 0.00 ? 90 DA  C H8     2  
ATOM 3954  H H61    . DA  C 3 11 ? 41.202 15.879 31.944 1.00 0.00 ? 90 DA  C H61    2  
ATOM 3955  H H62    . DA  C 3 11 ? 41.762 16.039 30.280 1.00 0.00 ? 90 DA  C H62    2  
ATOM 3956  H H2     . DA  C 3 11 ? 38.553 16.630 27.564 1.00 0.00 ? 90 DA  C H2     2  
ATOM 3957  P P      . DG  C 3 12 ? 31.532 14.566 29.598 1.00 0.00 ? 91 DG  C P      2  
ATOM 3958  O OP1    . DG  C 3 12 ? 30.557 14.992 28.569 1.00 0.00 ? 91 DG  C OP1    2  
ATOM 3959  O OP2    . DG  C 3 12 ? 31.088 13.642 30.668 1.00 0.00 ? 91 DG  C OP2    2  
ATOM 3960  O "O5'"  . DG  C 3 12 ? 32.747 13.879 28.835 1.00 0.00 ? 91 DG  C "O5'"  2  
ATOM 3961  C "C5'"  . DG  C 3 12 ? 33.147 14.361 27.561 1.00 0.00 ? 91 DG  C "C5'"  2  
ATOM 3962  C "C4'"  . DG  C 3 12 ? 34.333 13.618 26.947 1.00 0.00 ? 91 DG  C "C4'"  2  
ATOM 3963  O "O4'"  . DG  C 3 12 ? 35.545 13.926 27.609 1.00 0.00 ? 91 DG  C "O4'"  2  
ATOM 3964  C "C3'"  . DG  C 3 12 ? 34.192 12.085 26.886 1.00 0.00 ? 91 DG  C "C3'"  2  
ATOM 3965  O "O3'"  . DG  C 3 12 ? 33.977 11.722 25.518 1.00 0.00 ? 91 DG  C "O3'"  2  
ATOM 3966  C "C2'"  . DG  C 3 12 ? 35.530 11.635 27.485 1.00 0.00 ? 91 DG  C "C2'"  2  
ATOM 3967  C "C1'"  . DG  C 3 12 ? 36.421 12.862 27.318 1.00 0.00 ? 91 DG  C "C1'"  2  
ATOM 3968  N N9     . DG  C 3 12 ? 37.599 12.905 28.214 1.00 0.00 ? 91 DG  C N9     2  
ATOM 3969  C C8     . DG  C 3 12 ? 37.655 12.681 29.568 1.00 0.00 ? 91 DG  C C8     2  
ATOM 3970  N N7     . DG  C 3 12 ? 38.854 12.773 30.081 1.00 0.00 ? 91 DG  C N7     2  
ATOM 3971  C C5     . DG  C 3 12 ? 39.663 13.070 28.972 1.00 0.00 ? 91 DG  C C5     2  
ATOM 3972  C C6     . DG  C 3 12 ? 41.085 13.270 28.858 1.00 0.00 ? 91 DG  C C6     2  
ATOM 3973  O O6     . DG  C 3 12 ? 41.952 13.216 29.734 1.00 0.00 ? 91 DG  C O6     2  
ATOM 3974  N N1     . DG  C 3 12 ? 41.494 13.556 27.571 1.00 0.00 ? 91 DG  C N1     2  
ATOM 3975  C C2     . DG  C 3 12 ? 40.656 13.629 26.509 1.00 0.00 ? 91 DG  C C2     2  
ATOM 3976  N N2     . DG  C 3 12 ? 41.191 13.866 25.340 1.00 0.00 ? 91 DG  C N2     2  
ATOM 3977  N N3     . DG  C 3 12 ? 39.337 13.443 26.557 1.00 0.00 ? 91 DG  C N3     2  
ATOM 3978  C C4     . DG  C 3 12 ? 38.896 13.167 27.827 1.00 0.00 ? 91 DG  C C4     2  
ATOM 3979  H "H5'"  . DG  C 3 12 ? 33.413 15.415 27.643 1.00 0.00 ? 91 DG  C "H5'"  2  
ATOM 3980  H "H5''" . DG  C 3 12 ? 32.314 14.262 26.868 1.00 0.00 ? 91 DG  C "H5''" 2  
ATOM 3981  H "H4'"  . DG  C 3 12 ? 34.427 13.975 25.922 1.00 0.00 ? 91 DG  C "H4'"  2  
ATOM 3982  H "H3'"  . DG  C 3 12 ? 33.369 11.739 27.515 1.00 0.00 ? 91 DG  C "H3'"  2  
ATOM 3983  H "H2'"  . DG  C 3 12 ? 35.384 11.412 28.544 1.00 0.00 ? 91 DG  C "H2'"  2  
ATOM 3984  H "H2''" . DG  C 3 12 ? 35.945 10.770 26.981 1.00 0.00 ? 91 DG  C "H2''" 2  
ATOM 3985  H "H1'"  . DG  C 3 12 ? 36.748 12.922 26.277 1.00 0.00 ? 91 DG  C "H1'"  2  
ATOM 3986  H H8     . DG  C 3 12 ? 36.772 12.455 30.156 1.00 0.00 ? 91 DG  C H8     2  
ATOM 3987  H H1     . DG  C 3 12 ? 42.478 13.710 27.422 1.00 0.00 ? 91 DG  C H1     2  
ATOM 3988  H H21    . DG  C 3 12 ? 40.583 13.922 24.545 1.00 0.00 ? 91 DG  C H21    2  
ATOM 3989  H H22    . DG  C 3 12 ? 42.192 14.023 25.258 1.00 0.00 ? 91 DG  C H22    2  
ATOM 3990  P P      . DC  C 3 13 ? 34.009 10.223 24.948 1.00 0.00 ? 92 DC  C P      2  
ATOM 3991  O OP1    . DC  C 3 13 ? 33.034 10.137 23.842 1.00 0.00 ? 92 DC  C OP1    2  
ATOM 3992  O OP2    . DC  C 3 13 ? 33.920 9.266  26.071 1.00 0.00 ? 92 DC  C OP2    2  
ATOM 3993  O "O5'"  . DC  C 3 13 ? 35.472 10.088 24.316 1.00 0.00 ? 92 DC  C "O5'"  2  
ATOM 3994  C "C5'"  . DC  C 3 13 ? 35.784 10.761 23.102 1.00 0.00 ? 92 DC  C "C5'"  2  
ATOM 3995  C "C4'"  . DC  C 3 13 ? 37.209 10.557 22.580 1.00 0.00 ? 92 DC  C "C4'"  2  
ATOM 3996  O "O4'"  . DC  C 3 13 ? 38.137 11.046 23.539 1.00 0.00 ? 92 DC  C "O4'"  2  
ATOM 3997  C "C3'"  . DC  C 3 13 ? 37.538 9.082  22.287 1.00 0.00 ? 92 DC  C "C3'"  2  
ATOM 3998  O "O3'"  . DC  C 3 13 ? 38.215 8.949  21.044 1.00 0.00 ? 92 DC  C "O3'"  2  
ATOM 3999  C "C2'"  . DC  C 3 13 ? 38.459 8.717  23.441 1.00 0.00 ? 92 DC  C "C2'"  2  
ATOM 4000  C "C1'"  . DC  C 3 13 ? 39.118 10.057 23.772 1.00 0.00 ? 92 DC  C "C1'"  2  
ATOM 4001  N N1     . DC  C 3 13 ? 39.565 10.127 25.182 1.00 0.00 ? 92 DC  C N1     2  
ATOM 4002  C C2     . DC  C 3 13 ? 40.921 10.288 25.474 1.00 0.00 ? 92 DC  C C2     2  
ATOM 4003  O O2     . DC  C 3 13 ? 41.756 10.528 24.597 1.00 0.00 ? 92 DC  C O2     2  
ATOM 4004  N N3     . DC  C 3 13 ? 41.362 10.209 26.750 1.00 0.00 ? 92 DC  C N3     2  
ATOM 4005  C C4     . DC  C 3 13 ? 40.479 10.021 27.708 1.00 0.00 ? 92 DC  C C4     2  
ATOM 4006  N N4     . DC  C 3 13 ? 40.965 10.010 28.908 1.00 0.00 ? 92 DC  C N4     2  
ATOM 4007  C C5     . DC  C 3 13 ? 39.085 9.897  27.485 1.00 0.00 ? 92 DC  C C5     2  
ATOM 4008  C C6     . DC  C 3 13 ? 38.661 9.970  26.200 1.00 0.00 ? 92 DC  C C6     2  
ATOM 4009  H "H5'"  . DC  C 3 13 ? 35.622 11.831 23.241 1.00 0.00 ? 92 DC  C "H5'"  2  
ATOM 4010  H "H5''" . DC  C 3 13 ? 35.106 10.409 22.324 1.00 0.00 ? 92 DC  C "H5''" 2  
ATOM 4011  H "H4'"  . DC  C 3 13 ? 37.319 11.127 21.658 1.00 0.00 ? 92 DC  C "H4'"  2  
ATOM 4012  H "H3'"  . DC  C 3 13 ? 36.639 8.460  22.307 1.00 0.00 ? 92 DC  C "H3'"  2  
ATOM 4013  H "HO3'" . DC  C 3 13 ? 38.631 8.047  21.013 1.00 0.00 ? 92 DC  C "HO3'" 2  
ATOM 4014  H "H2'"  . DC  C 3 13 ? 37.855 8.350  24.269 1.00 0.00 ? 92 DC  C "H2'"  2  
ATOM 4015  H "H2''" . DC  C 3 13 ? 39.199 7.968  23.168 1.00 0.00 ? 92 DC  C "H2''" 2  
ATOM 4016  H "H1'"  . DC  C 3 13 ? 39.956 10.212 23.087 1.00 0.00 ? 92 DC  C "H1'"  2  
ATOM 4017  H H41    . DC  C 3 13 ? 40.330 9.903  29.693 1.00 0.00 ? 92 DC  C H41    2  
ATOM 4018  H H42    . DC  C 3 13 ? 41.920 10.332 29.009 1.00 0.00 ? 92 DC  C H42    2  
ATOM 4019  H H5     . DC  C 3 13 ? 38.380 9.771  28.292 1.00 0.00 ? 92 DC  C H5     2  
ATOM 4020  H H6     . DC  C 3 13 ? 37.611 9.882  25.946 1.00 0.00 ? 92 DC  C H6     2  
ATOM 4021  N N      . GLY A 1 1  ? 33.255 23.500 47.452 1.00 0.00 ? -2 GLY A N      3  
ATOM 4022  C CA     . GLY A 1 1  ? 33.775 24.010 48.730 1.00 0.00 ? -2 GLY A CA     3  
ATOM 4023  C C      . GLY A 1 1  ? 34.919 24.974 48.487 1.00 0.00 ? -2 GLY A C      3  
ATOM 4024  O O      . GLY A 1 1  ? 34.703 26.186 48.495 1.00 0.00 ? -2 GLY A O      3  
ATOM 4025  H H1     . GLY A 1 1  ? 33.978 22.977 46.972 1.00 0.00 ? -2 GLY A H1     3  
ATOM 4026  H H2     . GLY A 1 1  ? 32.985 24.276 46.860 1.00 0.00 ? -2 GLY A H2     3  
ATOM 4027  H H3     . GLY A 1 1  ? 32.450 22.906 47.597 1.00 0.00 ? -2 GLY A H3     3  
ATOM 4028  H HA2    . GLY A 1 1  ? 32.984 24.540 49.257 1.00 0.00 ? -2 GLY A HA2    3  
ATOM 4029  H HA3    . GLY A 1 1  ? 34.124 23.182 49.341 1.00 0.00 ? -2 GLY A HA3    3  
ATOM 4030  N N      . SER A 1 2  ? 36.123 24.442 48.267 1.00 0.00 ? -1 SER A N      3  
ATOM 4031  C CA     . SER A 1 2  ? 37.338 25.176 47.884 1.00 0.00 ? -1 SER A CA     3  
ATOM 4032  C C      . SER A 1 2  ? 38.332 24.266 47.137 1.00 0.00 ? -1 SER A C      3  
ATOM 4033  O O      . SER A 1 2  ? 38.142 23.047 47.092 1.00 0.00 ? -1 SER A O      3  
ATOM 4034  C CB     . SER A 1 2  ? 37.985 25.769 49.136 1.00 0.00 ? -1 SER A CB     3  
ATOM 4035  O OG     . SER A 1 2  ? 38.880 26.812 48.793 1.00 0.00 ? -1 SER A OG     3  
ATOM 4036  H H      . SER A 1 2  ? 36.199 23.430 48.279 1.00 0.00 ? -1 SER A H      3  
ATOM 4037  H HA     . SER A 1 2  ? 37.060 25.998 47.224 1.00 0.00 ? -1 SER A HA     3  
ATOM 4038  H HB2    . SER A 1 2  ? 37.202 26.192 49.767 1.00 0.00 ? -1 SER A HB2    3  
ATOM 4039  H HB3    . SER A 1 2  ? 38.504 24.991 49.698 1.00 0.00 ? -1 SER A HB3    3  
ATOM 4040  H HG     . SER A 1 2  ? 38.861 27.421 49.564 1.00 0.00 ? -1 SER A HG     3  
ATOM 4041  N N      . GLN A 1 3  ? 39.377 24.849 46.533 1.00 0.00 ? 1  GLN A N      3  
ATOM 4042  C CA     . GLN A 1 3  ? 40.420 24.171 45.734 1.00 0.00 ? 1  GLN A CA     3  
ATOM 4043  C C      . GLN A 1 3  ? 39.868 23.200 44.664 1.00 0.00 ? 1  GLN A C      3  
ATOM 4044  O O      . GLN A 1 3  ? 40.448 22.149 44.394 1.00 0.00 ? 1  GLN A O      3  
ATOM 4045  C CB     . GLN A 1 3  ? 41.521 23.571 46.641 1.00 0.00 ? 1  GLN A CB     3  
ATOM 4046  C CG     . GLN A 1 3  ? 42.321 24.677 47.351 1.00 0.00 ? 1  GLN A CG     3  
ATOM 4047  C CD     . GLN A 1 3  ? 43.499 24.155 48.170 1.00 0.00 ? 1  GLN A CD     3  
ATOM 4048  O OE1    . GLN A 1 3  ? 44.651 24.147 47.744 1.00 0.00 ? 1  GLN A OE1    3  
ATOM 4049  N NE2    . GLN A 1 3  ? 43.266 23.714 49.386 1.00 0.00 ? 1  GLN A NE2    3  
ATOM 4050  H H      . GLN A 1 3  ? 39.480 25.846 46.665 1.00 0.00 ? 1  GLN A H      3  
ATOM 4051  H HA     . GLN A 1 3  ? 40.907 24.950 45.149 1.00 0.00 ? 1  GLN A HA     3  
ATOM 4052  H HB2    . GLN A 1 3  ? 41.074 22.901 47.377 1.00 0.00 ? 1  GLN A HB2    3  
ATOM 4053  H HB3    . GLN A 1 3  ? 42.219 22.999 46.029 1.00 0.00 ? 1  GLN A HB3    3  
ATOM 4054  H HG2    . GLN A 1 3  ? 42.706 25.368 46.601 1.00 0.00 ? 1  GLN A HG2    3  
ATOM 4055  H HG3    . GLN A 1 3  ? 41.658 25.227 48.018 1.00 0.00 ? 1  GLN A HG3    3  
ATOM 4056  H HE21   . GLN A 1 3  ? 42.331 23.822 49.787 1.00 0.00 ? 1  GLN A HE21   3  
ATOM 4057  H HE22   . GLN A 1 3  ? 44.067 23.561 49.991 1.00 0.00 ? 1  GLN A HE22   3  
ATOM 4058  N N      . ARG A 1 4  ? 38.726 23.548 44.056 1.00 0.00 ? 2  ARG A N      3  
ATOM 4059  C CA     . ARG A 1 4  ? 38.050 22.808 42.973 1.00 0.00 ? 2  ARG A CA     3  
ATOM 4060  C C      . ARG A 1 4  ? 37.397 23.764 41.973 1.00 0.00 ? 2  ARG A C      3  
ATOM 4061  O O      . ARG A 1 4  ? 37.093 24.912 42.315 1.00 0.00 ? 2  ARG A O      3  
ATOM 4062  C CB     . ARG A 1 4  ? 36.987 21.850 43.560 1.00 0.00 ? 2  ARG A CB     3  
ATOM 4063  C CG     . ARG A 1 4  ? 37.539 20.647 44.346 1.00 0.00 ? 2  ARG A CG     3  
ATOM 4064  C CD     . ARG A 1 4  ? 38.366 19.711 43.452 1.00 0.00 ? 2  ARG A CD     3  
ATOM 4065  N NE     . ARG A 1 4  ? 38.862 18.524 44.171 1.00 0.00 ? 2  ARG A NE     3  
ATOM 4066  C CZ     . ARG A 1 4  ? 39.956 18.443 44.908 1.00 0.00 ? 2  ARG A CZ     3  
ATOM 4067  N NH1    . ARG A 1 4  ? 40.714 19.469 45.163 1.00 0.00 1 2  ARG A NH1    3  
ATOM 4068  N NH2    . ARG A 1 4  ? 40.312 17.301 45.413 1.00 0.00 ? 2  ARG A NH2    3  
ATOM 4069  H H      . ARG A 1 4  ? 38.316 24.428 44.341 1.00 0.00 ? 2  ARG A H      3  
ATOM 4070  H HA     . ARG A 1 4  ? 38.786 22.237 42.404 1.00 0.00 ? 2  ARG A HA     3  
ATOM 4071  H HB2    . ARG A 1 4  ? 36.326 22.418 44.217 1.00 0.00 ? 2  ARG A HB2    3  
ATOM 4072  H HB3    . ARG A 1 4  ? 36.373 21.457 42.746 1.00 0.00 ? 2  ARG A HB3    3  
ATOM 4073  H HG2    . ARG A 1 4  ? 38.146 20.994 45.180 1.00 0.00 ? 2  ARG A HG2    3  
ATOM 4074  H HG3    . ARG A 1 4  ? 36.699 20.084 44.752 1.00 0.00 ? 2  ARG A HG3    3  
ATOM 4075  H HD2    . ARG A 1 4  ? 37.737 19.374 42.630 1.00 0.00 ? 2  ARG A HD2    3  
ATOM 4076  H HD3    . ARG A 1 4  ? 39.202 20.260 43.026 1.00 0.00 ? 2  ARG A HD3    3  
ATOM 4077  H HE     . ARG A 1 4  ? 38.341 17.672 44.035 1.00 0.00 ? 2  ARG A HE     3  
ATOM 4078  H HH11   . ARG A 1 4  ? 40.502 20.368 44.738 1.00 0.00 ? 2  ARG A HH11   3  
ATOM 4079  H HH12   . ARG A 1 4  ? 41.536 19.386 45.744 1.00 0.00 ? 2  ARG A HH12   3  
ATOM 4080  H HH21   . ARG A 1 4  ? 39.785 16.467 45.187 1.00 0.00 ? 2  ARG A HH21   3  
ATOM 4081  H HH22   . ARG A 1 4  ? 41.159 17.232 45.964 1.00 0.00 ? 2  ARG A HH22   3  
ATOM 4082  N N      . ARG A 1 5  ? 37.126 23.279 40.761 1.00 0.00 ? 3  ARG A N      3  
ATOM 4083  C CA     . ARG A 1 5  ? 36.321 23.937 39.713 1.00 0.00 ? 3  ARG A CA     3  
ATOM 4084  C C      . ARG A 1 5  ? 35.166 23.021 39.282 1.00 0.00 ? 3  ARG A C      3  
ATOM 4085  O O      . ARG A 1 5  ? 34.898 21.999 39.911 1.00 0.00 ? 3  ARG A O      3  
ATOM 4086  C CB     . ARG A 1 5  ? 37.247 24.364 38.550 1.00 0.00 ? 3  ARG A CB     3  
ATOM 4087  C CG     . ARG A 1 5  ? 37.988 25.678 38.840 1.00 0.00 ? 3  ARG A CG     3  
ATOM 4088  C CD     . ARG A 1 5  ? 38.908 26.036 37.664 1.00 0.00 ? 3  ARG A CD     3  
ATOM 4089  N NE     . ARG A 1 5  ? 39.489 27.388 37.775 1.00 0.00 ? 3  ARG A NE     3  
ATOM 4090  C CZ     . ARG A 1 5  ? 40.553 27.737 38.478 1.00 0.00 ? 3  ARG A CZ     3  
ATOM 4091  N NH1    . ARG A 1 5  ? 41.100 26.990 39.390 1.00 0.00 ? 3  ARG A NH1    3  
ATOM 4092  N NH2    . ARG A 1 5  ? 41.123 28.891 38.304 1.00 0.00 1 3  ARG A NH2    3  
ATOM 4093  H H      . ARG A 1 5  ? 37.380 22.303 40.602 1.00 0.00 ? 3  ARG A H      3  
ATOM 4094  H HA     . ARG A 1 5  ? 35.843 24.829 40.116 1.00 0.00 ? 3  ARG A HA     3  
ATOM 4095  H HB2    . ARG A 1 5  ? 37.969 23.572 38.346 1.00 0.00 ? 3  ARG A HB2    3  
ATOM 4096  H HB3    . ARG A 1 5  ? 36.660 24.522 37.645 1.00 0.00 ? 3  ARG A HB3    3  
ATOM 4097  H HG2    . ARG A 1 5  ? 37.257 26.477 38.977 1.00 0.00 ? 3  ARG A HG2    3  
ATOM 4098  H HG3    . ARG A 1 5  ? 38.577 25.578 39.749 1.00 0.00 ? 3  ARG A HG3    3  
ATOM 4099  H HD2    . ARG A 1 5  ? 39.707 25.297 37.581 1.00 0.00 ? 3  ARG A HD2    3  
ATOM 4100  H HD3    . ARG A 1 5  ? 38.327 25.995 36.741 1.00 0.00 ? 3  ARG A HD3    3  
ATOM 4101  H HE     . ARG A 1 5  ? 39.180 28.058 37.082 1.00 0.00 ? 3  ARG A HE     3  
ATOM 4102  H HH11   . ARG A 1 5  ? 40.649 26.155 39.736 1.00 0.00 ? 3  ARG A HH11   3  
ATOM 4103  H HH12   . ARG A 1 5  ? 41.891 27.376 39.892 1.00 0.00 ? 3  ARG A HH12   3  
ATOM 4104  H HH21   . ARG A 1 5  ? 40.762 29.556 37.647 1.00 0.00 ? 3  ARG A HH21   3  
ATOM 4105  H HH22   . ARG A 1 5  ? 41.966 29.099 38.829 1.00 0.00 ? 3  ARG A HH22   3  
ATOM 4106  N N      . GLN A 1 6  ? 34.442 23.392 38.231 1.00 0.00 ? 4  GLN A N      3  
ATOM 4107  C CA     . GLN A 1 6  ? 33.381 22.591 37.614 1.00 0.00 ? 4  GLN A CA     3  
ATOM 4108  C C      . GLN A 1 6  ? 33.468 22.690 36.081 1.00 0.00 ? 4  GLN A C      3  
ATOM 4109  O O      . GLN A 1 6  ? 34.197 23.531 35.553 1.00 0.00 ? 4  GLN A O      3  
ATOM 4110  C CB     . GLN A 1 6  ? 31.998 23.050 38.130 1.00 0.00 ? 4  GLN A CB     3  
ATOM 4111  C CG     . GLN A 1 6  ? 31.708 22.789 39.622 1.00 0.00 ? 4  GLN A CG     3  
ATOM 4112  C CD     . GLN A 1 6  ? 31.459 21.319 39.958 1.00 0.00 ? 4  GLN A CD     3  
ATOM 4113  O OE1    . GLN A 1 6  ? 30.324 20.862 40.042 1.00 0.00 ? 4  GLN A OE1    3  
ATOM 4114  N NE2    . GLN A 1 6  ? 32.486 20.510 40.119 1.00 0.00 ? 4  GLN A NE2    3  
ATOM 4115  H H      . GLN A 1 6  ? 34.746 24.203 37.711 1.00 0.00 ? 4  GLN A H      3  
ATOM 4116  H HA     . GLN A 1 6  ? 33.528 21.542 37.869 1.00 0.00 ? 4  GLN A HA     3  
ATOM 4117  H HB2    . GLN A 1 6  ? 31.906 24.121 37.947 1.00 0.00 ? 4  GLN A HB2    3  
ATOM 4118  H HB3    . GLN A 1 6  ? 31.219 22.556 37.550 1.00 0.00 ? 4  GLN A HB3    3  
ATOM 4119  H HG2    . GLN A 1 6  ? 32.516 23.177 40.241 1.00 0.00 ? 4  GLN A HG2    3  
ATOM 4120  H HG3    . GLN A 1 6  ? 30.806 23.341 39.887 1.00 0.00 ? 4  GLN A HG3    3  
ATOM 4121  H HE21   . GLN A 1 6  ? 33.430 20.900 40.141 1.00 0.00 ? 4  GLN A HE21   3  
ATOM 4122  H HE22   . GLN A 1 6  ? 32.326 19.568 40.449 1.00 0.00 ? 4  GLN A HE22   3  
ATOM 4123  N N      . ARG A 1 7  ? 32.731 21.825 35.379 1.00 0.00 ? 5  ARG A N      3  
ATOM 4124  C CA     . ARG A 1 7  ? 32.490 21.903 33.928 1.00 0.00 ? 5  ARG A CA     3  
ATOM 4125  C C      . ARG A 1 7  ? 30.988 21.802 33.603 1.00 0.00 ? 5  ARG A C      3  
ATOM 4126  O O      . ARG A 1 7  ? 30.140 22.033 34.465 1.00 0.00 ? 5  ARG A O      3  
ATOM 4127  C CB     . ARG A 1 7  ? 33.412 20.906 33.183 1.00 0.00 ? 5  ARG A CB     3  
ATOM 4128  C CG     . ARG A 1 7  ? 34.764 21.554 32.821 1.00 0.00 ? 5  ARG A CG     3  
ATOM 4129  C CD     . ARG A 1 7  ? 35.627 20.675 31.904 1.00 0.00 ? 5  ARG A CD     3  
ATOM 4130  N NE     . ARG A 1 7  ? 34.983 20.388 30.603 1.00 0.00 ? 5  ARG A NE     3  
ATOM 4131  C CZ     . ARG A 1 7  ? 35.238 20.900 29.412 1.00 0.00 ? 5  ARG A CZ     3  
ATOM 4132  N NH1    . ARG A 1 7  ? 36.093 21.855 29.191 1.00 0.00 ? 5  ARG A NH1    3  
ATOM 4133  N NH2    . ARG A 1 7  ? 34.607 20.416 28.387 1.00 0.00 1 5  ARG A NH2    3  
ATOM 4134  H H      . ARG A 1 7  ? 32.206 21.135 35.909 1.00 0.00 ? 5  ARG A H      3  
ATOM 4135  H HA     . ARG A 1 7  ? 32.754 22.910 33.598 1.00 0.00 ? 5  ARG A HA     3  
ATOM 4136  H HB2    . ARG A 1 7  ? 33.581 20.018 33.794 1.00 0.00 ? 5  ARG A HB2    3  
ATOM 4137  H HB3    . ARG A 1 7  ? 32.947 20.587 32.255 1.00 0.00 ? 5  ARG A HB3    3  
ATOM 4138  H HG2    . ARG A 1 7  ? 34.587 22.501 32.314 1.00 0.00 ? 5  ARG A HG2    3  
ATOM 4139  H HG3    . ARG A 1 7  ? 35.319 21.756 33.737 1.00 0.00 ? 5  ARG A HG3    3  
ATOM 4140  H HD2    . ARG A 1 7  ? 36.591 21.165 31.750 1.00 0.00 ? 5  ARG A HD2    3  
ATOM 4141  H HD3    . ARG A 1 7  ? 35.817 19.732 32.417 1.00 0.00 ? 5  ARG A HD3    3  
ATOM 4142  H HE     . ARG A 1 7  ? 34.269 19.671 30.594 1.00 0.00 ? 5  ARG A HE     3  
ATOM 4143  H HH11   . ARG A 1 7  ? 36.599 22.293 29.945 1.00 0.00 ? 5  ARG A HH11   3  
ATOM 4144  H HH12   . ARG A 1 7  ? 36.146 22.271 28.275 1.00 0.00 ? 5  ARG A HH12   3  
ATOM 4145  H HH21   . ARG A 1 7  ? 33.904 19.704 28.553 1.00 0.00 ? 5  ARG A HH21   3  
ATOM 4146  H HH22   . ARG A 1 7  ? 34.884 20.652 27.440 1.00 0.00 ? 5  ARG A HH22   3  
ATOM 4147  N N      . THR A 1 8  ? 30.651 21.568 32.340 1.00 0.00 ? 6  THR A N      3  
ATOM 4148  C CA     . THR A 1 8  ? 29.471 22.122 31.666 1.00 0.00 ? 6  THR A CA     3  
ATOM 4149  C C      . THR A 1 8  ? 28.101 21.588 32.131 1.00 0.00 ? 6  THR A C      3  
ATOM 4150  O O      . THR A 1 8  ? 27.925 20.396 32.407 1.00 0.00 ? 6  THR A O      3  
ATOM 4151  C CB     . THR A 1 8  ? 29.650 21.949 30.143 1.00 0.00 ? 6  THR A CB     3  
ATOM 4152  O OG1    . THR A 1 8  ? 30.999 22.191 29.788 1.00 0.00 ? 6  THR A OG1    3  
ATOM 4153  C CG2    . THR A 1 8  ? 28.818 22.947 29.350 1.00 0.00 ? 6  THR A CG2    3  
ATOM 4154  H H      . THR A 1 8  ? 31.398 21.320 31.707 1.00 0.00 ? 6  THR A H      3  
ATOM 4155  H HA     . THR A 1 8  ? 29.485 23.190 31.867 1.00 0.00 ? 6  THR A HA     3  
ATOM 4156  H HB     . THR A 1 8  ? 29.382 20.935 29.852 1.00 0.00 ? 6  THR A HB     3  
ATOM 4157  H HG1    . THR A 1 8  ? 31.046 22.311 28.819 1.00 0.00 ? 6  THR A HG1    3  
ATOM 4158  H HG21   . THR A 1 8  ? 29.008 23.954 29.712 1.00 0.00 ? 6  THR A HG21   3  
ATOM 4159  H HG22   . THR A 1 8  ? 29.072 22.882 28.294 1.00 0.00 ? 6  THR A HG22   3  
ATOM 4160  H HG23   . THR A 1 8  ? 27.766 22.710 29.450 1.00 0.00 ? 6  THR A HG23   3  
ATOM 4161  N N      . HIS A 1 9  ? 27.105 22.486 32.166 1.00 0.00 ? 7  HIS A N      3  
ATOM 4162  C CA     . HIS A 1 9  ? 25.656 22.186 32.187 1.00 0.00 ? 7  HIS A CA     3  
ATOM 4163  C C      . HIS A 1 9  ? 24.836 23.227 31.387 1.00 0.00 ? 7  HIS A C      3  
ATOM 4164  O O      . HIS A 1 9  ? 23.738 23.648 31.763 1.00 0.00 ? 7  HIS A O      3  
ATOM 4165  C CB     . HIS A 1 9  ? 25.145 21.993 33.627 1.00 0.00 ? 7  HIS A CB     3  
ATOM 4166  C CG     . HIS A 1 9  ? 23.730 21.463 33.709 1.00 0.00 ? 7  HIS A CG     3  
ATOM 4167  N ND1    . HIS A 1 9  ? 23.105 20.621 32.775 1.00 0.00 ? 7  HIS A ND1    3  
ATOM 4168  C CD2    . HIS A 1 9  ? 22.841 21.747 34.703 1.00 0.00 ? 7  HIS A CD2    3  
ATOM 4169  C CE1    . HIS A 1 9  ? 21.849 20.444 33.227 1.00 0.00 ? 7  HIS A CE1    3  
ATOM 4170  N NE2    . HIS A 1 9  ? 21.669 21.099 34.387 1.00 0.00 ? 7  HIS A NE2    3  
ATOM 4171  H H      . HIS A 1 9  ? 27.372 23.462 32.087 1.00 0.00 ? 7  HIS A H      3  
ATOM 4172  H HA     . HIS A 1 9  ? 25.515 21.238 31.669 1.00 0.00 ? 7  HIS A HA     3  
ATOM 4173  H HB2    . HIS A 1 9  ? 25.796 21.291 34.147 1.00 0.00 ? 7  HIS A HB2    3  
ATOM 4174  H HB3    . HIS A 1 9  ? 25.188 22.949 34.149 1.00 0.00 ? 7  HIS A HB3    3  
ATOM 4175  H HD2    . HIS A 1 9  ? 23.026 22.377 35.562 1.00 0.00 ? 7  HIS A HD2    3  
ATOM 4176  H HE1    . HIS A 1 9  ? 21.090 19.850 32.731 1.00 0.00 ? 7  HIS A HE1    3  
ATOM 4177  H HE2    . HIS A 1 9  ? 20.801 21.144 34.913 1.00 0.00 ? 7  HIS A HE2    3  
ATOM 4178  N N      . PHE A 1 10 ? 25.393 23.691 30.265 1.00 0.00 ? 8  PHE A N      3  
ATOM 4179  C CA     . PHE A 1 10 ? 24.704 24.563 29.313 1.00 0.00 ? 8  PHE A CA     3  
ATOM 4180  C C      . PHE A 1 10 ? 23.891 23.701 28.330 1.00 0.00 ? 8  PHE A C      3  
ATOM 4181  O O      . PHE A 1 10 ? 24.444 23.127 27.389 1.00 0.00 ? 8  PHE A O      3  
ATOM 4182  C CB     . PHE A 1 10 ? 25.716 25.481 28.602 1.00 0.00 ? 8  PHE A CB     3  
ATOM 4183  C CG     . PHE A 1 10 ? 26.618 26.327 29.494 1.00 0.00 ? 8  PHE A CG     3  
ATOM 4184  C CD1    . PHE A 1 10 ? 26.087 27.082 30.560 1.00 0.00 ? 8  PHE A CD1    3  
ATOM 4185  C CD2    . PHE A 1 10 ? 28.001 26.392 29.230 1.00 0.00 ? 8  PHE A CD2    3  
ATOM 4186  C CE1    . PHE A 1 10 ? 26.931 27.880 31.356 1.00 0.00 ? 8  PHE A CE1    3  
ATOM 4187  C CE2    . PHE A 1 10 ? 28.847 27.180 30.033 1.00 0.00 ? 8  PHE A CE2    3  
ATOM 4188  C CZ     . PHE A 1 10 ? 28.312 27.929 31.095 1.00 0.00 ? 8  PHE A CZ     3  
ATOM 4189  H H      . PHE A 1 10 ? 26.283 23.310 29.989 1.00 0.00 ? 8  PHE A H      3  
ATOM 4190  H HA     . PHE A 1 10 ? 24.003 25.201 29.851 1.00 0.00 ? 8  PHE A HA     3  
ATOM 4191  H HB2    . PHE A 1 10 ? 26.345 24.866 27.957 1.00 0.00 ? 8  PHE A HB2    3  
ATOM 4192  H HB3    . PHE A 1 10 ? 25.156 26.160 27.959 1.00 0.00 ? 8  PHE A HB3    3  
ATOM 4193  H HD1    . PHE A 1 10 ? 25.028 27.057 30.773 1.00 0.00 ? 8  PHE A HD1    3  
ATOM 4194  H HD2    . PHE A 1 10 ? 28.422 25.840 28.399 1.00 0.00 ? 8  PHE A HD2    3  
ATOM 4195  H HE1    . PHE A 1 10 ? 26.520 28.455 32.176 1.00 0.00 ? 8  PHE A HE1    3  
ATOM 4196  H HE2    . PHE A 1 10 ? 29.909 27.222 29.822 1.00 0.00 ? 8  PHE A HE2    3  
ATOM 4197  H HZ     . PHE A 1 10 ? 28.960 28.536 31.716 1.00 0.00 ? 8  PHE A HZ     3  
ATOM 4198  N N      . THR A 1 11 ? 22.584 23.579 28.573 1.00 0.00 ? 9  THR A N      3  
ATOM 4199  C CA     . THR A 1 11 ? 21.654 22.797 27.736 1.00 0.00 ? 9  THR A CA     3  
ATOM 4200  C C      . THR A 1 11 ? 21.188 23.601 26.516 1.00 0.00 ? 9  THR A C      3  
ATOM 4201  O O      . THR A 1 11 ? 21.287 24.831 26.498 1.00 0.00 ? 9  THR A O      3  
ATOM 4202  C CB     . THR A 1 11 ? 20.440 22.283 28.540 1.00 0.00 ? 9  THR A CB     3  
ATOM 4203  O OG1    . THR A 1 11 ? 19.472 23.293 28.697 1.00 0.00 ? 9  THR A OG1    3  
ATOM 4204  C CG2    . THR A 1 11 ? 20.786 21.774 29.940 1.00 0.00 ? 9  THR A CG2    3  
ATOM 4205  H H      . THR A 1 11 ? 22.201 24.026 29.392 1.00 0.00 ? 9  THR A H      3  
ATOM 4206  H HA     . THR A 1 11 ? 22.184 21.919 27.363 1.00 0.00 ? 9  THR A HA     3  
ATOM 4207  H HB     . THR A 1 11 ? 19.989 21.460 27.988 1.00 0.00 ? 9  THR A HB     3  
ATOM 4208  H HG1    . THR A 1 11 ? 18.722 22.902 29.188 1.00 0.00 ? 9  THR A HG1    3  
ATOM 4209  H HG21   . THR A 1 11 ? 21.521 20.977 29.863 1.00 0.00 ? 9  THR A HG21   3  
ATOM 4210  H HG22   . THR A 1 11 ? 21.180 22.576 30.565 1.00 0.00 ? 9  THR A HG22   3  
ATOM 4211  H HG23   . THR A 1 11 ? 19.895 21.375 30.414 1.00 0.00 ? 9  THR A HG23   3  
ATOM 4212  N N      . SER A 1 12 ? 20.617 22.944 25.504 1.00 0.00 ? 10 SER A N      3  
ATOM 4213  C CA     . SER A 1 12 ? 20.082 23.606 24.303 1.00 0.00 ? 10 SER A CA     3  
ATOM 4214  C C      . SER A 1 12 ? 18.867 24.501 24.593 1.00 0.00 ? 10 SER A C      3  
ATOM 4215  O O      . SER A 1 12 ? 18.540 25.365 23.779 1.00 0.00 ? 10 SER A O      3  
ATOM 4216  C CB     . SER A 1 12 ? 19.710 22.579 23.226 1.00 0.00 ? 10 SER A CB     3  
ATOM 4217  O OG     . SER A 1 12 ? 20.763 21.655 23.013 1.00 0.00 ? 10 SER A OG     3  
ATOM 4218  H H      . SER A 1 12 ? 20.489 21.943 25.579 1.00 0.00 ? 10 SER A H      3  
ATOM 4219  H HA     . SER A 1 12 ? 20.863 24.241 23.886 1.00 0.00 ? 10 SER A HA     3  
ATOM 4220  H HB2    . SER A 1 12 ? 18.819 22.042 23.538 1.00 0.00 ? 10 SER A HB2    3  
ATOM 4221  H HB3    . SER A 1 12 ? 19.493 23.102 22.293 1.00 0.00 ? 10 SER A HB3    3  
ATOM 4222  H HG     . SER A 1 12 ? 20.535 21.094 22.237 1.00 0.00 ? 10 SER A HG     3  
ATOM 4223  N N      . GLN A 1 13 ? 18.193 24.346 25.742 1.00 0.00 ? 11 GLN A N      3  
ATOM 4224  C CA     . GLN A 1 13 ? 17.187 25.307 26.228 1.00 0.00 ? 11 GLN A CA     3  
ATOM 4225  C C      . GLN A 1 13 ? 17.851 26.627 26.673 1.00 0.00 ? 11 GLN A C      3  
ATOM 4226  O O      . GLN A 1 13 ? 17.289 27.698 26.441 1.00 0.00 ? 11 GLN A O      3  
ATOM 4227  C CB     . GLN A 1 13 ? 16.376 24.653 27.365 1.00 0.00 ? 11 GLN A CB     3  
ATOM 4228  C CG     . GLN A 1 13 ? 15.262 25.519 27.986 1.00 0.00 ? 11 GLN A CG     3  
ATOM 4229  C CD     . GLN A 1 13 ? 13.978 25.627 27.164 1.00 0.00 ? 11 GLN A CD     3  
ATOM 4230  O OE1    . GLN A 1 13 ? 13.102 24.769 27.203 1.00 0.00 ? 11 GLN A OE1    3  
ATOM 4231  N NE2    . GLN A 1 13 ? 13.769 26.697 26.430 1.00 0.00 ? 11 GLN A NE2    3  
ATOM 4232  H H      . GLN A 1 13 ? 18.441 23.562 26.339 1.00 0.00 ? 11 GLN A H      3  
ATOM 4233  H HA     . GLN A 1 13 ? 16.500 25.546 25.416 1.00 0.00 ? 11 GLN A HA     3  
ATOM 4234  H HB2    . GLN A 1 13 ? 15.934 23.723 27.003 1.00 0.00 ? 11 GLN A HB2    3  
ATOM 4235  H HB3    . GLN A 1 13 ? 17.070 24.398 28.164 1.00 0.00 ? 11 GLN A HB3    3  
ATOM 4236  H HG2    . GLN A 1 13 ? 14.994 25.075 28.943 1.00 0.00 ? 11 GLN A HG2    3  
ATOM 4237  H HG3    . GLN A 1 13 ? 15.640 26.516 28.198 1.00 0.00 ? 11 GLN A HG3    3  
ATOM 4238  H HE21   . GLN A 1 13 ? 14.435 27.452 26.398 1.00 0.00 ? 11 GLN A HE21   3  
ATOM 4239  H HE22   . GLN A 1 13 ? 12.876 26.763 25.953 1.00 0.00 ? 11 GLN A HE22   3  
ATOM 4240  N N      . GLN A 1 14 ? 19.058 26.574 27.252 1.00 0.00 ? 12 GLN A N      3  
ATOM 4241  C CA     . GLN A 1 14 ? 19.818 27.765 27.662 1.00 0.00 ? 12 GLN A CA     3  
ATOM 4242  C C      . GLN A 1 14 ? 20.549 28.408 26.471 1.00 0.00 ? 12 GLN A C      3  
ATOM 4243  O O      . GLN A 1 14 ? 20.464 29.618 26.255 1.00 0.00 ? 12 GLN A O      3  
ATOM 4244  C CB     . GLN A 1 14 ? 20.842 27.429 28.770 1.00 0.00 ? 12 GLN A CB     3  
ATOM 4245  C CG     . GLN A 1 14 ? 20.397 26.491 29.907 1.00 0.00 ? 12 GLN A CG     3  
ATOM 4246  C CD     . GLN A 1 14 ? 19.251 26.998 30.774 1.00 0.00 ? 12 GLN A CD     3  
ATOM 4247  O OE1    . GLN A 1 14 ? 18.306 27.637 30.331 1.00 0.00 ? 12 GLN A OE1    3  
ATOM 4248  N NE2    . GLN A 1 14 ? 19.271 26.706 32.056 1.00 0.00 ? 12 GLN A NE2    3  
ATOM 4249  H H      . GLN A 1 14 ? 19.489 25.666 27.379 1.00 0.00 ? 12 GLN A H      3  
ATOM 4250  H HA     . GLN A 1 14 ? 19.120 28.502 28.057 1.00 0.00 ? 12 GLN A HA     3  
ATOM 4251  H HB2    . GLN A 1 14 ? 21.710 26.958 28.305 1.00 0.00 ? 12 GLN A HB2    3  
ATOM 4252  H HB3    . GLN A 1 14 ? 21.184 28.366 29.211 1.00 0.00 ? 12 GLN A HB3    3  
ATOM 4253  H HG2    . GLN A 1 14 ? 20.117 25.529 29.499 1.00 0.00 ? 12 GLN A HG2    3  
ATOM 4254  H HG3    . GLN A 1 14 ? 21.263 26.322 30.549 1.00 0.00 ? 12 GLN A HG3    3  
ATOM 4255  H HE21   . GLN A 1 14 ? 20.048 26.176 32.445 1.00 0.00 ? 12 GLN A HE21   3  
ATOM 4256  H HE22   . GLN A 1 14 ? 18.655 27.269 32.641 1.00 0.00 ? 12 GLN A HE22   3  
ATOM 4257  N N      . LEU A 1 15 ? 21.262 27.595 25.682 1.00 0.00 ? 13 LEU A N      3  
ATOM 4258  C CA     . LEU A 1 15 ? 22.164 28.053 24.618 1.00 0.00 ? 13 LEU A CA     3  
ATOM 4259  C C      . LEU A 1 15 ? 21.440 28.863 23.537 1.00 0.00 ? 13 LEU A C      3  
ATOM 4260  O O      . LEU A 1 15 ? 21.975 29.870 23.084 1.00 0.00 ? 13 LEU A O      3  
ATOM 4261  C CB     . LEU A 1 15 ? 22.896 26.841 24.012 1.00 0.00 ? 13 LEU A CB     3  
ATOM 4262  C CG     . LEU A 1 15 ? 23.950 26.198 24.938 1.00 0.00 ? 13 LEU A CG     3  
ATOM 4263  C CD1    . LEU A 1 15 ? 24.440 24.885 24.337 1.00 0.00 ? 13 LEU A CD1    3  
ATOM 4264  C CD2    . LEU A 1 15 ? 25.158 27.114 25.149 1.00 0.00 ? 13 LEU A CD2    3  
ATOM 4265  H H      . LEU A 1 15 ? 21.274 26.606 25.917 1.00 0.00 ? 13 LEU A H      3  
ATOM 4266  H HA     . LEU A 1 15 ? 22.902 28.726 25.051 1.00 0.00 ? 13 LEU A HA     3  
ATOM 4267  H HB2    . LEU A 1 15 ? 22.155 26.092 23.738 1.00 0.00 ? 13 LEU A HB2    3  
ATOM 4268  H HB3    . LEU A 1 15 ? 23.394 27.154 23.093 1.00 0.00 ? 13 LEU A HB3    3  
ATOM 4269  H HG     . LEU A 1 15 ? 23.510 25.987 25.911 1.00 0.00 ? 13 LEU A HG     3  
ATOM 4270  H HD11   . LEU A 1 15 ? 25.177 24.427 24.996 1.00 0.00 ? 13 LEU A HD11   3  
ATOM 4271  H HD12   . LEU A 1 15 ? 23.604 24.195 24.224 1.00 0.00 ? 13 LEU A HD12   3  
ATOM 4272  H HD13   . LEU A 1 15 ? 24.897 25.065 23.364 1.00 0.00 ? 13 LEU A HD13   3  
ATOM 4273  H HD21   . LEU A 1 15 ? 25.568 27.412 24.184 1.00 0.00 ? 13 LEU A HD21   3  
ATOM 4274  H HD22   . LEU A 1 15 ? 24.859 27.996 25.712 1.00 0.00 ? 13 LEU A HD22   3  
ATOM 4275  H HD23   . LEU A 1 15 ? 25.929 26.577 25.703 1.00 0.00 ? 13 LEU A HD23   3  
ATOM 4276  N N      . GLN A 1 16 ? 20.202 28.499 23.190 1.00 0.00 ? 14 GLN A N      3  
ATOM 4277  C CA     . GLN A 1 16 ? 19.396 29.219 22.196 1.00 0.00 ? 14 GLN A CA     3  
ATOM 4278  C C      . GLN A 1 16 ? 18.988 30.644 22.623 1.00 0.00 ? 14 GLN A C      3  
ATOM 4279  O O      . GLN A 1 16 ? 18.755 31.490 21.761 1.00 0.00 ? 14 GLN A O      3  
ATOM 4280  C CB     . GLN A 1 16 ? 18.158 28.375 21.864 1.00 0.00 ? 14 GLN A CB     3  
ATOM 4281  C CG     . GLN A 1 16 ? 18.482 27.158 20.983 1.00 0.00 ? 14 GLN A CG     3  
ATOM 4282  C CD     . GLN A 1 16 ? 18.727 27.552 19.530 1.00 0.00 ? 14 GLN A CD     3  
ATOM 4283  O OE1    . GLN A 1 16 ? 17.801 27.869 18.787 1.00 0.00 ? 14 GLN A OE1    3  
ATOM 4284  N NE2    . GLN A 1 16 ? 19.954 27.586 19.064 1.00 0.00 ? 14 GLN A NE2    3  
ATOM 4285  H H      . GLN A 1 16 ? 19.820 27.656 23.598 1.00 0.00 ? 14 GLN A H      3  
ATOM 4286  H HA     . GLN A 1 16 ? 19.988 29.334 21.287 1.00 0.00 ? 14 GLN A HA     3  
ATOM 4287  H HB2    . GLN A 1 16 ? 17.690 28.038 22.791 1.00 0.00 ? 14 GLN A HB2    3  
ATOM 4288  H HB3    . GLN A 1 16 ? 17.438 28.994 21.333 1.00 0.00 ? 14 GLN A HB3    3  
ATOM 4289  H HG2    . GLN A 1 16 ? 19.347 26.624 21.378 1.00 0.00 ? 14 GLN A HG2    3  
ATOM 4290  H HG3    . GLN A 1 16 ? 17.631 26.475 21.006 1.00 0.00 ? 14 GLN A HG3    3  
ATOM 4291  H HE21   . GLN A 1 16 ? 20.760 27.470 19.668 1.00 0.00 ? 14 GLN A HE21   3  
ATOM 4292  H HE22   . GLN A 1 16 ? 20.097 27.703 18.069 1.00 0.00 ? 14 GLN A HE22   3  
ATOM 4293  N N      . GLU A 1 17 ? 18.923 30.949 23.923 1.00 0.00 ? 15 GLU A N      3  
ATOM 4294  C CA     . GLU A 1 17 ? 18.737 32.326 24.416 1.00 0.00 ? 15 GLU A CA     3  
ATOM 4295  C C      . GLU A 1 17 ? 20.057 33.114 24.337 1.00 0.00 ? 15 GLU A C      3  
ATOM 4296  O O      . GLU A 1 17 ? 20.076 34.283 23.934 1.00 0.00 ? 15 GLU A O      3  
ATOM 4297  C CB     . GLU A 1 17 ? 18.191 32.265 25.857 1.00 0.00 ? 15 GLU A CB     3  
ATOM 4298  C CG     . GLU A 1 17 ? 17.897 33.624 26.515 1.00 0.00 ? 15 GLU A CG     3  
ATOM 4299  C CD     . GLU A 1 17 ? 16.818 34.426 25.780 1.00 0.00 ? 15 GLU A CD     3  
ATOM 4300  O OE1    . GLU A 1 17 ? 15.717 33.885 25.518 1.00 0.00 ? 15 GLU A OE1    3  
ATOM 4301  O OE2    . GLU A 1 17 ? 17.070 35.600 25.419 1.00 0.00 ? 15 GLU A OE2    3  
ATOM 4302  H H      . GLU A 1 17 ? 19.150 30.231 24.601 1.00 0.00 ? 15 GLU A H      3  
ATOM 4303  H HA     . GLU A 1 17 ? 18.006 32.838 23.789 1.00 0.00 ? 15 GLU A HA     3  
ATOM 4304  H HB2    . GLU A 1 17 ? 17.275 31.673 25.858 1.00 0.00 ? 15 GLU A HB2    3  
ATOM 4305  H HB3    . GLU A 1 17 ? 18.914 31.744 26.483 1.00 0.00 ? 15 GLU A HB3    3  
ATOM 4306  H HG2    . GLU A 1 17 ? 17.561 33.443 27.539 1.00 0.00 ? 15 GLU A HG2    3  
ATOM 4307  H HG3    . GLU A 1 17 ? 18.823 34.202 26.568 1.00 0.00 ? 15 GLU A HG3    3  
ATOM 4308  N N      . LEU A 1 18 ? 21.164 32.449 24.682 1.00 0.00 ? 16 LEU A N      3  
ATOM 4309  C CA     . LEU A 1 18 ? 22.511 33.015 24.779 1.00 0.00 ? 16 LEU A CA     3  
ATOM 4310  C C      . LEU A 1 18 ? 23.121 33.346 23.405 1.00 0.00 ? 16 LEU A C      3  
ATOM 4311  O O      . LEU A 1 18 ? 23.579 34.470 23.200 1.00 0.00 ? 16 LEU A O      3  
ATOM 4312  C CB     . LEU A 1 18 ? 23.389 32.024 25.571 1.00 0.00 ? 16 LEU A CB     3  
ATOM 4313  C CG     . LEU A 1 18 ? 23.025 31.896 27.063 1.00 0.00 ? 16 LEU A CG     3  
ATOM 4314  C CD1    . LEU A 1 18 ? 23.592 30.612 27.669 1.00 0.00 ? 16 LEU A CD1    3  
ATOM 4315  C CD2    . LEU A 1 18 ? 23.595 33.070 27.859 1.00 0.00 ? 16 LEU A CD2    3  
ATOM 4316  H H      . LEU A 1 18 ? 21.050 31.479 24.951 1.00 0.00 ? 16 LEU A H      3  
ATOM 4317  H HA     . LEU A 1 18 ? 22.458 33.955 25.329 1.00 0.00 ? 16 LEU A HA     3  
ATOM 4318  H HB2    . LEU A 1 18 ? 23.322 31.045 25.098 1.00 0.00 ? 16 LEU A HB2    3  
ATOM 4319  H HB3    . LEU A 1 18 ? 24.425 32.345 25.503 1.00 0.00 ? 16 LEU A HB3    3  
ATOM 4320  H HG     . LEU A 1 18 ? 21.942 31.879 27.183 1.00 0.00 ? 16 LEU A HG     3  
ATOM 4321  H HD11   . LEU A 1 18 ? 24.677 30.607 27.586 1.00 0.00 ? 16 LEU A HD11   3  
ATOM 4322  H HD12   . LEU A 1 18 ? 23.309 30.544 28.718 1.00 0.00 ? 16 LEU A HD12   3  
ATOM 4323  H HD13   . LEU A 1 18 ? 23.186 29.749 27.143 1.00 0.00 ? 16 LEU A HD13   3  
ATOM 4324  H HD21   . LEU A 1 18 ? 24.683 33.076 27.792 1.00 0.00 ? 16 LEU A HD21   3  
ATOM 4325  H HD22   . LEU A 1 18 ? 23.207 34.004 27.457 1.00 0.00 ? 16 LEU A HD22   3  
ATOM 4326  H HD23   . LEU A 1 18 ? 23.298 32.980 28.904 1.00 0.00 ? 16 LEU A HD23   3  
ATOM 4327  N N      . GLU A 1 19 ? 23.084 32.424 22.438 1.00 0.00 ? 17 GLU A N      3  
ATOM 4328  C CA     . GLU A 1 19 ? 23.659 32.636 21.100 1.00 0.00 ? 17 GLU A CA     3  
ATOM 4329  C C      . GLU A 1 19 ? 22.896 33.694 20.290 1.00 0.00 ? 17 GLU A C      3  
ATOM 4330  O O      . GLU A 1 19 ? 23.508 34.544 19.643 1.00 0.00 ? 17 GLU A O      3  
ATOM 4331  C CB     . GLU A 1 19 ? 23.781 31.301 20.339 1.00 0.00 ? 17 GLU A CB     3  
ATOM 4332  C CG     . GLU A 1 19 ? 22.448 30.723 19.838 1.00 0.00 ? 17 GLU A CG     3  
ATOM 4333  C CD     . GLU A 1 19 ? 22.661 29.384 19.134 1.00 0.00 ? 17 GLU A CD     3  
ATOM 4334  O OE1    . GLU A 1 19 ? 22.681 28.324 19.804 1.00 0.00 ? 17 GLU A OE1    3  
ATOM 4335  O OE2    . GLU A 1 19 ? 22.812 29.386 17.887 1.00 0.00 ? 17 GLU A OE2    3  
ATOM 4336  H H      . GLU A 1 19 ? 22.688 31.511 22.654 1.00 0.00 ? 17 GLU A H      3  
ATOM 4337  H HA     . GLU A 1 19 ? 24.672 33.019 21.229 1.00 0.00 ? 17 GLU A HA     3  
ATOM 4338  H HB2    . GLU A 1 19 ? 24.431 31.458 19.477 1.00 0.00 ? 17 GLU A HB2    3  
ATOM 4339  H HB3    . GLU A 1 19 ? 24.267 30.571 20.988 1.00 0.00 ? 17 GLU A HB3    3  
ATOM 4340  H HG2    . GLU A 1 19 ? 21.756 30.605 20.669 1.00 0.00 ? 17 GLU A HG2    3  
ATOM 4341  H HG3    . GLU A 1 19 ? 21.996 31.414 19.125 1.00 0.00 ? 17 GLU A HG3    3  
ATOM 4342  N N      . ALA A 1 20 ? 21.563 33.709 20.393 1.00 0.00 ? 18 ALA A N      3  
ATOM 4343  C CA     . ALA A 1 20 ? 20.731 34.718 19.748 1.00 0.00 ? 18 ALA A CA     3  
ATOM 4344  C C      . ALA A 1 20 ? 20.990 36.113 20.346 1.00 0.00 ? 18 ALA A C      3  
ATOM 4345  O O      . ALA A 1 20 ? 21.030 37.100 19.608 1.00 0.00 ? 18 ALA A O      3  
ATOM 4346  C CB     . ALA A 1 20 ? 19.268 34.282 19.866 1.00 0.00 ? 18 ALA A CB     3  
ATOM 4347  H H      . ALA A 1 20 ? 21.111 32.981 20.928 1.00 0.00 ? 18 ALA A H      3  
ATOM 4348  H HA     . ALA A 1 20 ? 20.992 34.764 18.688 1.00 0.00 ? 18 ALA A HA     3  
ATOM 4349  H HB1    . ALA A 1 20 ? 19.136 33.307 19.394 1.00 0.00 ? 18 ALA A HB1    3  
ATOM 4350  H HB2    . ALA A 1 20 ? 18.974 34.218 20.913 1.00 0.00 ? 18 ALA A HB2    3  
ATOM 4351  H HB3    . ALA A 1 20 ? 18.632 35.004 19.357 1.00 0.00 ? 18 ALA A HB3    3  
ATOM 4352  N N      . THR A 1 21 ? 21.282 36.188 21.655 1.00 0.00 ? 19 THR A N      3  
ATOM 4353  C CA     . THR A 1 21 ? 21.760 37.424 22.294 1.00 0.00 ? 19 THR A CA     3  
ATOM 4354  C C      . THR A 1 21 ? 23.147 37.818 21.768 1.00 0.00 ? 19 THR A C      3  
ATOM 4355  O O      . THR A 1 21 ? 23.341 38.969 21.387 1.00 0.00 ? 19 THR A O      3  
ATOM 4356  C CB     . THR A 1 21 ? 21.781 37.326 23.828 1.00 0.00 ? 19 THR A CB     3  
ATOM 4357  O OG1    . THR A 1 21 ? 20.525 36.932 24.339 1.00 0.00 ? 19 THR A OG1    3  
ATOM 4358  C CG2    . THR A 1 21 ? 22.091 38.684 24.457 1.00 0.00 ? 19 THR A CG2    3  
ATOM 4359  H H      . THR A 1 21 ? 21.258 35.336 22.199 1.00 0.00 ? 19 THR A H      3  
ATOM 4360  H HA     . THR A 1 21 ? 21.069 38.223 22.038 1.00 0.00 ? 19 THR A HA     3  
ATOM 4361  H HB     . THR A 1 21 ? 22.531 36.604 24.149 1.00 0.00 ? 19 THR A HB     3  
ATOM 4362  H HG1    . THR A 1 21 ? 20.439 35.972 24.198 1.00 0.00 ? 19 THR A HG1    3  
ATOM 4363  H HG21   . THR A 1 21 ? 22.001 38.610 25.536 1.00 0.00 ? 19 THR A HG21   3  
ATOM 4364  H HG22   . THR A 1 21 ? 23.107 38.995 24.215 1.00 0.00 ? 19 THR A HG22   3  
ATOM 4365  H HG23   . THR A 1 21 ? 21.388 39.434 24.094 1.00 0.00 ? 19 THR A HG23   3  
ATOM 4366  N N      . PHE A 1 22 ? 24.097 36.880 21.664 1.00 0.00 ? 20 PHE A N      3  
ATOM 4367  C CA     . PHE A 1 22 ? 25.450 37.147 21.148 1.00 0.00 ? 20 PHE A CA     3  
ATOM 4368  C C      . PHE A 1 22 ? 25.436 37.705 19.712 1.00 0.00 ? 20 PHE A C      3  
ATOM 4369  O O      . PHE A 1 22 ? 26.202 38.615 19.394 1.00 0.00 ? 20 PHE A O      3  
ATOM 4370  C CB     . PHE A 1 22 ? 26.288 35.860 21.243 1.00 0.00 ? 20 PHE A CB     3  
ATOM 4371  C CG     . PHE A 1 22 ? 27.776 36.046 20.993 1.00 0.00 ? 20 PHE A CG     3  
ATOM 4372  C CD1    . PHE A 1 22 ? 28.282 36.081 19.679 1.00 0.00 ? 20 PHE A CD1    3  
ATOM 4373  C CD2    . PHE A 1 22 ? 28.664 36.165 22.079 1.00 0.00 ? 20 PHE A CD2    3  
ATOM 4374  C CE1    . PHE A 1 22 ? 29.663 36.241 19.455 1.00 0.00 ? 20 PHE A CE1    3  
ATOM 4375  C CE2    . PHE A 1 22 ? 30.042 36.323 21.854 1.00 0.00 ? 20 PHE A CE2    3  
ATOM 4376  C CZ     . PHE A 1 22 ? 30.544 36.357 20.542 1.00 0.00 ? 20 PHE A CZ     3  
ATOM 4377  H H      . PHE A 1 22 ? 23.887 35.940 21.984 1.00 0.00 ? 20 PHE A H      3  
ATOM 4378  H HA     . PHE A 1 22 ? 25.915 37.903 21.781 1.00 0.00 ? 20 PHE A HA     3  
ATOM 4379  H HB2    . PHE A 1 22 ? 26.160 35.435 22.240 1.00 0.00 ? 20 PHE A HB2    3  
ATOM 4380  H HB3    . PHE A 1 22 ? 25.907 35.129 20.531 1.00 0.00 ? 20 PHE A HB3    3  
ATOM 4381  H HD1    . PHE A 1 22 ? 27.614 35.981 18.834 1.00 0.00 ? 20 PHE A HD1    3  
ATOM 4382  H HD2    . PHE A 1 22 ? 28.288 36.124 23.091 1.00 0.00 ? 20 PHE A HD2    3  
ATOM 4383  H HE1    . PHE A 1 22 ? 30.047 36.269 18.444 1.00 0.00 ? 20 PHE A HE1    3  
ATOM 4384  H HE2    . PHE A 1 22 ? 30.716 36.409 22.692 1.00 0.00 ? 20 PHE A HE2    3  
ATOM 4385  H HZ     . PHE A 1 22 ? 31.607 36.466 20.367 1.00 0.00 ? 20 PHE A HZ     3  
ATOM 4386  N N      . GLN A 1 23 ? 24.520 37.234 18.856 1.00 0.00 ? 21 GLN A N      3  
ATOM 4387  C CA     . GLN A 1 23 ? 24.326 37.739 17.487 1.00 0.00 ? 21 GLN A CA     3  
ATOM 4388  C C      . GLN A 1 23 ? 23.709 39.155 17.400 1.00 0.00 ? 21 GLN A C      3  
ATOM 4389  O O      . GLN A 1 23 ? 23.714 39.747 16.312 1.00 0.00 ? 21 GLN A O      3  
ATOM 4390  C CB     . GLN A 1 23 ? 23.504 36.716 16.681 1.00 0.00 ? 21 GLN A CB     3  
ATOM 4391  C CG     . GLN A 1 23 ? 24.301 35.462 16.290 1.00 0.00 ? 21 GLN A CG     3  
ATOM 4392  C CD     . GLN A 1 23 ? 25.457 35.768 15.341 1.00 0.00 ? 21 GLN A CD     3  
ATOM 4393  O OE1    . GLN A 1 23 ? 26.615 35.811 15.737 1.00 0.00 ? 21 GLN A OE1    3  
ATOM 4394  N NE2    . GLN A 1 23 ? 25.201 36.030 14.079 1.00 0.00 ? 21 GLN A NE2    3  
ATOM 4395  H H      . GLN A 1 23 ? 23.956 36.442 19.157 1.00 0.00 ? 21 GLN A H      3  
ATOM 4396  H HA     . GLN A 1 23 ? 25.307 37.827 17.022 1.00 0.00 ? 21 GLN A HA     3  
ATOM 4397  H HB2    . GLN A 1 23 ? 22.637 36.410 17.266 1.00 0.00 ? 21 GLN A HB2    3  
ATOM 4398  H HB3    . GLN A 1 23 ? 23.140 37.186 15.767 1.00 0.00 ? 21 GLN A HB3    3  
ATOM 4399  H HG2    . GLN A 1 23 ? 24.694 34.980 17.185 1.00 0.00 ? 21 GLN A HG2    3  
ATOM 4400  H HG3    . GLN A 1 23 ? 23.630 34.757 15.803 1.00 0.00 ? 21 GLN A HG3    3  
ATOM 4401  H HE21   . GLN A 1 23 ? 24.239 36.078 13.749 1.00 0.00 ? 21 GLN A HE21   3  
ATOM 4402  H HE22   . GLN A 1 23 ? 25.976 36.202 13.457 1.00 0.00 ? 21 GLN A HE22   3  
ATOM 4403  N N      . ARG A 1 24 ? 23.237 39.732 18.518 1.00 0.00 ? 22 ARG A N      3  
ATOM 4404  C CA     . ARG A 1 24 ? 22.777 41.135 18.610 1.00 0.00 ? 22 ARG A CA     3  
ATOM 4405  C C      . ARG A 1 24 ? 23.618 42.032 19.533 1.00 0.00 ? 22 ARG A C      3  
ATOM 4406  O O      . ARG A 1 24 ? 23.609 43.248 19.332 1.00 0.00 ? 22 ARG A O      3  
ATOM 4407  C CB     . ARG A 1 24 ? 21.265 41.183 18.918 1.00 0.00 ? 22 ARG A CB     3  
ATOM 4408  C CG     . ARG A 1 24 ? 20.859 40.642 20.300 1.00 0.00 ? 22 ARG A CG     3  
ATOM 4409  C CD     . ARG A 1 24 ? 19.363 40.868 20.576 1.00 0.00 ? 22 ARG A CD     3  
ATOM 4410  N NE     . ARG A 1 24 ? 18.963 40.503 21.953 1.00 0.00 ? 22 ARG A NE     3  
ATOM 4411  C CZ     . ARG A 1 24 ? 19.182 41.197 23.058 1.00 0.00 ? 22 ARG A CZ     3  
ATOM 4412  N NH1    . ARG A 1 24 ? 19.910 42.269 23.082 1.00 0.00 ? 22 ARG A NH1    3  
ATOM 4413  N NH2    . ARG A 1 24 ? 18.652 40.834 24.184 1.00 0.00 1 22 ARG A NH2    3  
ATOM 4414  H H      . ARG A 1 24 ? 23.232 39.173 19.364 1.00 0.00 ? 22 ARG A H      3  
ATOM 4415  H HA     . ARG A 1 24 ? 22.899 41.596 17.632 1.00 0.00 ? 22 ARG A HA     3  
ATOM 4416  H HB2    . ARG A 1 24 ? 20.937 42.217 18.840 1.00 0.00 ? 22 ARG A HB2    3  
ATOM 4417  H HB3    . ARG A 1 24 ? 20.733 40.616 18.152 1.00 0.00 ? 22 ARG A HB3    3  
ATOM 4418  H HG2    . ARG A 1 24 ? 21.057 39.575 20.328 1.00 0.00 ? 22 ARG A HG2    3  
ATOM 4419  H HG3    . ARG A 1 24 ? 21.448 41.139 21.069 1.00 0.00 ? 22 ARG A HG3    3  
ATOM 4420  H HD2    . ARG A 1 24 ? 19.119 41.917 20.401 1.00 0.00 ? 22 ARG A HD2    3  
ATOM 4421  H HD3    . ARG A 1 24 ? 18.785 40.271 19.868 1.00 0.00 ? 22 ARG A HD3    3  
ATOM 4422  H HE     . ARG A 1 24 ? 18.341 39.708 22.068 1.00 0.00 ? 22 ARG A HE     3  
ATOM 4423  H HH11   . ARG A 1 24 ? 20.285 42.660 22.224 1.00 0.00 ? 22 ARG A HH11   3  
ATOM 4424  H HH12   . ARG A 1 24 ? 20.103 42.756 23.943 1.00 0.00 ? 22 ARG A HH12   3  
ATOM 4425  H HH21   . ARG A 1 24 ? 18.002 40.052 24.170 1.00 0.00 ? 22 ARG A HH21   3  
ATOM 4426  H HH22   . ARG A 1 24 ? 18.688 41.467 24.974 1.00 0.00 ? 22 ARG A HH22   3  
ATOM 4427  N N      . ASN A 1 25 ? 24.335 41.468 20.508 1.00 0.00 ? 23 ASN A N      3  
ATOM 4428  C CA     . ASN A 1 25 ? 25.197 42.173 21.463 1.00 0.00 ? 23 ASN A CA     3  
ATOM 4429  C C      . ASN A 1 25 ? 26.274 41.215 22.026 1.00 0.00 ? 23 ASN A C      3  
ATOM 4430  O O      . ASN A 1 25 ? 25.947 40.293 22.775 1.00 0.00 ? 23 ASN A O      3  
ATOM 4431  C CB     . ASN A 1 25 ? 24.283 42.727 22.579 1.00 0.00 ? 23 ASN A CB     3  
ATOM 4432  C CG     . ASN A 1 25 ? 24.991 43.520 23.665 1.00 0.00 ? 23 ASN A CG     3  
ATOM 4433  O OD1    . ASN A 1 25 ? 26.200 43.720 23.663 1.00 0.00 ? 23 ASN A OD1    3  
ATOM 4434  N ND2    . ASN A 1 25 ? 24.239 44.032 24.609 1.00 0.00 ? 23 ASN A ND2    3  
ATOM 4435  H H      . ASN A 1 25 ? 24.226 40.470 20.647 1.00 0.00 ? 23 ASN A H      3  
ATOM 4436  H HA     . ASN A 1 25 ? 25.696 43.005 20.963 1.00 0.00 ? 23 ASN A HA     3  
ATOM 4437  H HB2    . ASN A 1 25 ? 23.531 43.380 22.137 1.00 0.00 ? 23 ASN A HB2    3  
ATOM 4438  H HB3    . ASN A 1 25 ? 23.760 41.898 23.057 1.00 0.00 ? 23 ASN A HB3    3  
ATOM 4439  H HD21   . ASN A 1 25 ? 23.227 43.960 24.539 1.00 0.00 ? 23 ASN A HD21   3  
ATOM 4440  H HD22   . ASN A 1 25 ? 24.650 44.537 25.389 1.00 0.00 ? 23 ASN A HD22   3  
ATOM 4441  N N      . ARG A 1 26 ? 27.564 41.437 21.722 1.00 0.00 ? 24 ARG A N      3  
ATOM 4442  C CA     . ARG A 1 26 ? 28.676 40.608 22.255 1.00 0.00 ? 24 ARG A CA     3  
ATOM 4443  C C      . ARG A 1 26 ? 29.069 40.943 23.705 1.00 0.00 ? 24 ARG A C      3  
ATOM 4444  O O      . ARG A 1 26 ? 29.873 40.221 24.301 1.00 0.00 ? 24 ARG A O      3  
ATOM 4445  C CB     . ARG A 1 26 ? 29.926 40.687 21.353 1.00 0.00 ? 24 ARG A CB     3  
ATOM 4446  C CG     . ARG A 1 26 ? 29.693 40.372 19.866 1.00 0.00 ? 24 ARG A CG     3  
ATOM 4447  C CD     . ARG A 1 26 ? 30.980 39.926 19.146 1.00 0.00 ? 24 ARG A CD     3  
ATOM 4448  N NE     . ARG A 1 26 ? 32.136 40.824 19.350 1.00 0.00 ? 24 ARG A NE     3  
ATOM 4449  C CZ     . ARG A 1 26 ? 32.631 41.742 18.537 1.00 0.00 ? 24 ARG A CZ     3  
ATOM 4450  N NH1    . ARG A 1 26 ? 32.045 42.148 17.446 1.00 0.00 ? 24 ARG A NH1    3  
ATOM 4451  N NH2    . ARG A 1 26 ? 33.775 42.281 18.834 1.00 0.00 1 24 ARG A NH2    3  
ATOM 4452  H H      . ARG A 1 26 ? 27.785 42.211 21.098 1.00 0.00 ? 24 ARG A H      3  
ATOM 4453  H HA     . ARG A 1 26 ? 28.347 39.567 22.269 1.00 0.00 ? 24 ARG A HA     3  
ATOM 4454  H HB2    . ARG A 1 26 ? 30.357 41.684 21.427 1.00 0.00 ? 24 ARG A HB2    3  
ATOM 4455  H HB3    . ARG A 1 26 ? 30.659 39.977 21.742 1.00 0.00 ? 24 ARG A HB3    3  
ATOM 4456  H HG2    . ARG A 1 26 ? 28.966 39.563 19.782 1.00 0.00 ? 24 ARG A HG2    3  
ATOM 4457  H HG3    . ARG A 1 26 ? 29.288 41.254 19.370 1.00 0.00 ? 24 ARG A HG3    3  
ATOM 4458  H HD2    . ARG A 1 26 ? 31.253 38.941 19.528 1.00 0.00 ? 24 ARG A HD2    3  
ATOM 4459  H HD3    . ARG A 1 26 ? 30.776 39.804 18.084 1.00 0.00 ? 24 ARG A HD3    3  
ATOM 4460  H HE     . ARG A 1 26 ? 32.769 40.562 20.101 1.00 0.00 ? 24 ARG A HE     3  
ATOM 4461  H HH11   . ARG A 1 26 ? 31.147 41.766 17.176 1.00 0.00 ? 24 ARG A HH11   3  
ATOM 4462  H HH12   . ARG A 1 26 ? 32.467 42.892 16.900 1.00 0.00 ? 24 ARG A HH12   3  
ATOM 4463  H HH21   . ARG A 1 26 ? 34.207 42.067 19.721 1.00 0.00 ? 24 ARG A HH21   3  
ATOM 4464  H HH22   . ARG A 1 26 ? 34.251 42.893 18.180 1.00 0.00 ? 24 ARG A HH22   3  
ATOM 4465  N N      . TYR A 1 27 ? 28.541 42.032 24.269 1.00 0.00 ? 25 TYR A N      3  
ATOM 4466  C CA     . TYR A 1 27 ? 29.032 42.669 25.498 1.00 0.00 ? 25 TYR A CA     3  
ATOM 4467  C C      . TYR A 1 27 ? 27.909 43.042 26.494 1.00 0.00 ? 25 TYR A C      3  
ATOM 4468  O O      . TYR A 1 27 ? 27.834 44.201 26.916 1.00 0.00 ? 25 TYR A O      3  
ATOM 4469  C CB     . TYR A 1 27 ? 29.885 43.889 25.094 1.00 0.00 ? 25 TYR A CB     3  
ATOM 4470  C CG     . TYR A 1 27 ? 31.053 43.571 24.178 1.00 0.00 ? 25 TYR A CG     3  
ATOM 4471  C CD1    . TYR A 1 27 ? 32.138 42.830 24.678 1.00 0.00 ? 25 TYR A CD1    3  
ATOM 4472  C CD2    . TYR A 1 27 ? 31.057 43.998 22.833 1.00 0.00 ? 25 TYR A CD2    3  
ATOM 4473  C CE1    . TYR A 1 27 ? 33.230 42.534 23.847 1.00 0.00 ? 25 TYR A CE1    3  
ATOM 4474  C CE2    . TYR A 1 27 ? 32.150 43.689 21.996 1.00 0.00 ? 25 TYR A CE2    3  
ATOM 4475  C CZ     . TYR A 1 27 ? 33.251 42.970 22.508 1.00 0.00 ? 25 TYR A CZ     3  
ATOM 4476  O OH     . TYR A 1 27 ? 34.343 42.735 21.733 1.00 0.00 ? 25 TYR A OH     3  
ATOM 4477  H H      . TYR A 1 27 ? 27.840 42.540 23.741 1.00 0.00 ? 25 TYR A H      3  
ATOM 4478  H HA     . TYR A 1 27 ? 29.684 41.972 26.025 1.00 0.00 ? 25 TYR A HA     3  
ATOM 4479  H HB2    . TYR A 1 27 ? 29.243 44.626 24.609 1.00 0.00 ? 25 TYR A HB2    3  
ATOM 4480  H HB3    . TYR A 1 27 ? 30.289 44.351 25.995 1.00 0.00 ? 25 TYR A HB3    3  
ATOM 4481  H HD1    . TYR A 1 27 ? 32.130 42.486 25.704 1.00 0.00 ? 25 TYR A HD1    3  
ATOM 4482  H HD2    . TYR A 1 27 ? 30.220 44.561 22.441 1.00 0.00 ? 25 TYR A HD2    3  
ATOM 4483  H HE1    . TYR A 1 27 ? 34.055 41.968 24.234 1.00 0.00 ? 25 TYR A HE1    3  
ATOM 4484  H HE2    . TYR A 1 27 ? 32.156 44.011 20.965 1.00 0.00 ? 25 TYR A HE2    3  
ATOM 4485  H HH     . TYR A 1 27 ? 35.077 42.399 22.264 1.00 0.00 ? 25 TYR A HH     3  
ATOM 4486  N N      . PRO A 1 28 ? 27.028 42.107 26.907 1.00 0.00 ? 26 PRO A N      3  
ATOM 4487  C CA     . PRO A 1 28 ? 25.912 42.406 27.809 1.00 0.00 ? 26 PRO A CA     3  
ATOM 4488  C C      . PRO A 1 28 ? 26.370 42.913 29.189 1.00 0.00 ? 26 PRO A C      3  
ATOM 4489  O O      . PRO A 1 28 ? 27.264 42.338 29.821 1.00 0.00 ? 26 PRO A O      3  
ATOM 4490  C CB     . PRO A 1 28 ? 25.102 41.110 27.907 1.00 0.00 ? 26 PRO A CB     3  
ATOM 4491  C CG     . PRO A 1 28 ? 26.145 40.027 27.641 1.00 0.00 ? 26 PRO A CG     3  
ATOM 4492  C CD     . PRO A 1 28 ? 27.043 40.684 26.595 1.00 0.00 ? 26 PRO A CD     3  
ATOM 4493  H HA     . PRO A 1 28 ? 25.283 43.165 27.348 1.00 0.00 ? 26 PRO A HA     3  
ATOM 4494  H HB2    . PRO A 1 28 ? 24.622 40.989 28.878 1.00 0.00 ? 26 PRO A HB2    3  
ATOM 4495  H HB3    . PRO A 1 28 ? 24.353 41.092 27.112 1.00 0.00 ? 26 PRO A HB3    3  
ATOM 4496  H HG2    . PRO A 1 28 ? 26.720 39.829 28.546 1.00 0.00 ? 26 PRO A HG2    3  
ATOM 4497  H HG3    . PRO A 1 28 ? 25.686 39.112 27.269 1.00 0.00 ? 26 PRO A HG3    3  
ATOM 4498  H HD2    . PRO A 1 28 ? 28.050 40.268 26.647 1.00 0.00 ? 26 PRO A HD2    3  
ATOM 4499  H HD3    . PRO A 1 28 ? 26.620 40.526 25.602 1.00 0.00 ? 26 PRO A HD3    3  
ATOM 4500  N N      . ASP A 1 29 ? 25.719 43.974 29.669 1.00 0.00 ? 27 ASP A N      3  
ATOM 4501  C CA     . ASP A 1 29 ? 25.931 44.585 30.993 1.00 0.00 ? 27 ASP A CA     3  
ATOM 4502  C C      . ASP A 1 29 ? 25.306 43.763 32.140 1.00 0.00 ? 27 ASP A C      3  
ATOM 4503  O O      . ASP A 1 29 ? 24.437 42.930 31.888 1.00 0.00 ? 27 ASP A O      3  
ATOM 4504  C CB     . ASP A 1 29 ? 25.365 46.015 30.979 1.00 0.00 ? 27 ASP A CB     3  
ATOM 4505  C CG     . ASP A 1 29 ? 23.896 46.087 31.405 1.00 0.00 ? 27 ASP A CG     3  
ATOM 4506  O OD1    . ASP A 1 29 ? 23.010 45.678 30.619 1.00 0.00 ? 27 ASP A OD1    3  
ATOM 4507  O OD2    . ASP A 1 29 ? 23.625 46.537 32.539 1.00 0.00 ? 27 ASP A OD2    3  
ATOM 4508  H H      . ASP A 1 29 ? 25.032 44.406 29.065 1.00 0.00 ? 27 ASP A H      3  
ATOM 4509  H HA     . ASP A 1 29 ? 27.005 44.654 31.168 1.00 0.00 ? 27 ASP A HA     3  
ATOM 4510  H HB2    . ASP A 1 29 ? 25.951 46.622 31.663 1.00 0.00 ? 27 ASP A HB2    3  
ATOM 4511  H HB3    . ASP A 1 29 ? 25.471 46.444 29.982 1.00 0.00 ? 27 ASP A HB3    3  
ATOM 4512  N N      . MET A 1 30 ? 25.661 44.027 33.404 1.00 0.00 ? 28 MET A N      3  
ATOM 4513  C CA     . MET A 1 30 ? 25.094 43.309 34.568 1.00 0.00 ? 28 MET A CA     3  
ATOM 4514  C C      . MET A 1 30 ? 23.557 43.244 34.620 1.00 0.00 ? 28 MET A C      3  
ATOM 4515  O O      . MET A 1 30 ? 23.010 42.242 35.090 1.00 0.00 ? 28 MET A O      3  
ATOM 4516  C CB     . MET A 1 30 ? 25.597 43.899 35.895 1.00 0.00 ? 28 MET A CB     3  
ATOM 4517  C CG     . MET A 1 30 ? 25.538 45.426 36.006 1.00 0.00 ? 28 MET A CG     3  
ATOM 4518  S SD     . MET A 1 30 ? 25.856 46.021 37.687 1.00 0.00 ? 28 MET A SD     3  
ATOM 4519  C CE     . MET A 1 30 ? 26.121 47.775 37.333 1.00 0.00 ? 28 MET A CE     3  
ATOM 4520  H H      . MET A 1 30 ? 26.401 44.705 33.568 1.00 0.00 ? 28 MET A H      3  
ATOM 4521  H HA     . MET A 1 30 ? 25.436 42.276 34.523 1.00 0.00 ? 28 MET A HA     3  
ATOM 4522  H HB2    . MET A 1 30 ? 24.994 43.482 36.698 1.00 0.00 ? 28 MET A HB2    3  
ATOM 4523  H HB3    . MET A 1 30 ? 26.616 43.572 36.071 1.00 0.00 ? 28 MET A HB3    3  
ATOM 4524  H HG2    . MET A 1 30 ? 26.286 45.854 35.338 1.00 0.00 ? 28 MET A HG2    3  
ATOM 4525  H HG3    . MET A 1 30 ? 24.554 45.780 35.698 1.00 0.00 ? 28 MET A HG3    3  
ATOM 4526  H HE1    . MET A 1 30 ? 26.996 47.887 36.691 1.00 0.00 ? 28 MET A HE1    3  
ATOM 4527  H HE2    . MET A 1 30 ? 25.245 48.188 36.834 1.00 0.00 ? 28 MET A HE2    3  
ATOM 4528  H HE3    . MET A 1 30 ? 26.292 48.310 38.268 1.00 0.00 ? 28 MET A HE3    3  
ATOM 4529  N N      . SER A 1 31 ? 22.853 44.270 34.136 1.00 0.00 ? 29 SER A N      3  
ATOM 4530  C CA     . SER A 1 31 ? 21.387 44.307 34.109 1.00 0.00 ? 29 SER A CA     3  
ATOM 4531  C C      . SER A 1 31 ? 20.802 43.453 32.976 1.00 0.00 ? 29 SER A C      3  
ATOM 4532  O O      . SER A 1 31 ? 19.747 42.846 33.137 1.00 0.00 ? 29 SER A O      3  
ATOM 4533  C CB     . SER A 1 31 ? 20.936 45.759 33.983 1.00 0.00 ? 29 SER A CB     3  
ATOM 4534  O OG     . SER A 1 31 ? 19.584 45.894 34.361 1.00 0.00 ? 29 SER A OG     3  
ATOM 4535  H H      . SER A 1 31 ? 23.352 45.060 33.731 1.00 0.00 ? 29 SER A H      3  
ATOM 4536  H HA     . SER A 1 31 ? 21.012 43.918 35.055 1.00 0.00 ? 29 SER A HA     3  
ATOM 4537  H HB2    . SER A 1 31 ? 21.547 46.388 34.632 1.00 0.00 ? 29 SER A HB2    3  
ATOM 4538  H HB3    . SER A 1 31 ? 21.061 46.080 32.951 1.00 0.00 ? 29 SER A HB3    3  
ATOM 4539  H HG     . SER A 1 31 ? 19.508 46.744 34.861 1.00 0.00 ? 29 SER A HG     3  
ATOM 4540  N N      . THR A 1 32 ? 21.503 43.338 31.846 1.00 0.00 ? 30 THR A N      3  
ATOM 4541  C CA     . THR A 1 32 ? 21.148 42.418 30.750 1.00 0.00 ? 30 THR A CA     3  
ATOM 4542  C C      . THR A 1 32 ? 21.526 40.972 31.090 1.00 0.00 ? 30 THR A C      3  
ATOM 4543  O O      . THR A 1 32 ? 20.744 40.053 30.854 1.00 0.00 ? 30 THR A O      3  
ATOM 4544  C CB     . THR A 1 32 ? 21.821 42.873 29.446 1.00 0.00 ? 30 THR A CB     3  
ATOM 4545  O OG1    . THR A 1 32 ? 21.439 44.205 29.167 1.00 0.00 ? 30 THR A OG1    3  
ATOM 4546  C CG2    . THR A 1 32 ? 21.427 42.042 28.228 1.00 0.00 ? 30 THR A CG2    3  
ATOM 4547  H H      . THR A 1 32 ? 22.355 43.883 31.756 1.00 0.00 ? 30 THR A H      3  
ATOM 4548  H HA     . THR A 1 32 ? 20.069 42.441 30.598 1.00 0.00 ? 30 THR A HA     3  
ATOM 4549  H HB     . THR A 1 32 ? 22.905 42.837 29.561 1.00 0.00 ? 30 THR A HB     3  
ATOM 4550  H HG1    . THR A 1 32 ? 22.008 44.769 29.746 1.00 0.00 ? 30 THR A HG1    3  
ATOM 4551  H HG21   . THR A 1 32 ? 21.772 41.017 28.348 1.00 0.00 ? 30 THR A HG21   3  
ATOM 4552  H HG22   . THR A 1 32 ? 20.344 42.043 28.111 1.00 0.00 ? 30 THR A HG22   3  
ATOM 4553  H HG23   . THR A 1 32 ? 21.886 42.463 27.333 1.00 0.00 ? 30 THR A HG23   3  
ATOM 4554  N N      . ARG A 1 33 ? 22.691 40.746 31.715 1.00 0.00 ? 31 ARG A N      3  
ATOM 4555  C CA     . ARG A 1 33 ? 23.145 39.414 32.151 1.00 0.00 ? 31 ARG A CA     3  
ATOM 4556  C C      . ARG A 1 33 ? 22.224 38.805 33.215 1.00 0.00 ? 31 ARG A C      3  
ATOM 4557  O O      . ARG A 1 33 ? 22.013 37.594 33.192 1.00 0.00 ? 31 ARG A O      3  
ATOM 4558  C CB     . ARG A 1 33 ? 24.612 39.467 32.619 1.00 0.00 ? 31 ARG A CB     3  
ATOM 4559  C CG     . ARG A 1 33 ? 25.614 39.799 31.496 1.00 0.00 ? 31 ARG A CG     3  
ATOM 4560  C CD     . ARG A 1 33 ? 27.091 39.643 31.899 1.00 0.00 ? 31 ARG A CD     3  
ATOM 4561  N NE     . ARG A 1 33 ? 27.433 40.310 33.172 1.00 0.00 ? 31 ARG A NE     3  
ATOM 4562  C CZ     . ARG A 1 33 ? 28.007 41.480 33.387 1.00 0.00 ? 31 ARG A CZ     3  
ATOM 4563  N NH1    . ARG A 1 33 ? 28.331 42.330 32.454 1.00 0.00 ? 31 ARG A NH1    3  
ATOM 4564  N NH2    . ARG A 1 33 ? 28.262 41.815 34.613 1.00 0.00 1 31 ARG A NH2    3  
ATOM 4565  H H      . ARG A 1 33 ? 23.295 41.546 31.889 1.00 0.00 ? 31 ARG A H      3  
ATOM 4566  H HA     . ARG A 1 33 ? 23.085 38.732 31.305 1.00 0.00 ? 31 ARG A HA     3  
ATOM 4567  H HB2    . ARG A 1 33 ? 24.702 40.217 33.407 1.00 0.00 ? 31 ARG A HB2    3  
ATOM 4568  H HB3    . ARG A 1 33 ? 24.878 38.490 33.028 1.00 0.00 ? 31 ARG A HB3    3  
ATOM 4569  H HG2    . ARG A 1 33 ? 25.425 39.137 30.651 1.00 0.00 ? 31 ARG A HG2    3  
ATOM 4570  H HG3    . ARG A 1 33 ? 25.455 40.818 31.159 1.00 0.00 ? 31 ARG A HG3    3  
ATOM 4571  H HD2    . ARG A 1 33 ? 27.298 38.577 32.011 1.00 0.00 ? 31 ARG A HD2    3  
ATOM 4572  H HD3    . ARG A 1 33 ? 27.723 40.019 31.092 1.00 0.00 ? 31 ARG A HD3    3  
ATOM 4573  H HE     . ARG A 1 33 ? 27.269 39.780 34.028 1.00 0.00 ? 31 ARG A HE     3  
ATOM 4574  H HH11   . ARG A 1 33 ? 28.072 42.156 31.486 1.00 0.00 ? 31 ARG A HH11   3  
ATOM 4575  H HH12   . ARG A 1 33 ? 28.817 43.176 32.707 1.00 0.00 ? 31 ARG A HH12   3  
ATOM 4576  H HH21   . ARG A 1 33 ? 28.020 41.166 35.357 1.00 0.00 ? 31 ARG A HH21   3  
ATOM 4577  H HH22   . ARG A 1 33 ? 28.551 42.766 34.841 1.00 0.00 ? 31 ARG A HH22   3  
ATOM 4578  N N      . GLU A 1 34 ? 21.612 39.611 34.089 1.00 0.00 ? 32 GLU A N      3  
ATOM 4579  C CA     . GLU A 1 34 ? 20.608 39.104 35.038 1.00 0.00 ? 32 GLU A CA     3  
ATOM 4580  C C      . GLU A 1 34 ? 19.220 38.861 34.406 1.00 0.00 ? 32 GLU A C      3  
ATOM 4581  O O      . GLU A 1 34 ? 18.534 37.938 34.834 1.00 0.00 ? 32 GLU A O      3  
ATOM 4582  C CB     . GLU A 1 34 ? 20.557 39.946 36.325 1.00 0.00 ? 32 GLU A CB     3  
ATOM 4583  C CG     . GLU A 1 34 ? 19.747 41.240 36.217 1.00 0.00 ? 32 GLU A CG     3  
ATOM 4584  C CD     . GLU A 1 34 ? 19.781 42.047 37.519 1.00 0.00 ? 32 GLU A CD     3  
ATOM 4585  O OE1    . GLU A 1 34 ? 19.194 41.613 38.539 1.00 0.00 ? 32 GLU A OE1    3  
ATOM 4586  O OE2    . GLU A 1 34 ? 20.365 43.158 37.520 1.00 0.00 ? 32 GLU A OE2    3  
ATOM 4587  H H      . GLU A 1 34 ? 21.866 40.591 34.116 1.00 0.00 ? 32 GLU A H      3  
ATOM 4588  H HA     . GLU A 1 34 ? 20.953 38.123 35.366 1.00 0.00 ? 32 GLU A HA     3  
ATOM 4589  H HB2    . GLU A 1 34 ? 20.119 39.339 37.115 1.00 0.00 ? 32 GLU A HB2    3  
ATOM 4590  H HB3    . GLU A 1 34 ? 21.577 40.178 36.626 1.00 0.00 ? 32 GLU A HB3    3  
ATOM 4591  H HG2    . GLU A 1 34 ? 20.165 41.836 35.411 1.00 0.00 ? 32 GLU A HG2    3  
ATOM 4592  H HG3    . GLU A 1 34 ? 18.709 41.007 35.973 1.00 0.00 ? 32 GLU A HG3    3  
ATOM 4593  N N      . GLU A 1 35 ? 18.812 39.591 33.356 1.00 0.00 ? 33 GLU A N      3  
ATOM 4594  C CA     . GLU A 1 35 ? 17.588 39.259 32.591 1.00 0.00 ? 33 GLU A CA     3  
ATOM 4595  C C      . GLU A 1 35 ? 17.722 37.911 31.873 1.00 0.00 ? 33 GLU A C      3  
ATOM 4596  O O      . GLU A 1 35 ? 16.838 37.060 31.972 1.00 0.00 ? 33 GLU A O      3  
ATOM 4597  C CB     . GLU A 1 35 ? 17.270 40.336 31.545 1.00 0.00 ? 33 GLU A CB     3  
ATOM 4598  C CG     . GLU A 1 35 ? 16.662 41.602 32.147 1.00 0.00 ? 33 GLU A CG     3  
ATOM 4599  C CD     . GLU A 1 35 ? 16.337 42.601 31.035 1.00 0.00 ? 33 GLU A CD     3  
ATOM 4600  O OE1    . GLU A 1 35 ? 17.286 43.179 30.441 1.00 0.00 ? 33 GLU A OE1    3  
ATOM 4601  O OE2    . GLU A 1 35 ? 15.135 42.810 30.748 1.00 0.00 ? 33 GLU A OE2    3  
ATOM 4602  H H      . GLU A 1 35 ? 19.384 40.361 33.035 1.00 0.00 ? 33 GLU A H      3  
ATOM 4603  H HA     . GLU A 1 35 ? 16.740 39.173 33.273 1.00 0.00 ? 33 GLU A HA     3  
ATOM 4604  H HB2    . GLU A 1 35 ? 18.175 40.591 30.995 1.00 0.00 ? 33 GLU A HB2    3  
ATOM 4605  H HB3    . GLU A 1 35 ? 16.549 39.930 30.835 1.00 0.00 ? 33 GLU A HB3    3  
ATOM 4606  H HG2    . GLU A 1 35 ? 15.750 41.336 32.685 1.00 0.00 ? 33 GLU A HG2    3  
ATOM 4607  H HG3    . GLU A 1 35 ? 17.352 42.045 32.863 1.00 0.00 ? 33 GLU A HG3    3  
ATOM 4608  N N      . ILE A 1 36 ? 18.869 37.668 31.227 1.00 0.00 ? 34 ILE A N      3  
ATOM 4609  C CA     . ILE A 1 36 ? 19.202 36.365 30.629 1.00 0.00 ? 34 ILE A CA     3  
ATOM 4610  C C      . ILE A 1 36 ? 19.114 35.256 31.688 1.00 0.00 ? 34 ILE A C      3  
ATOM 4611  O O      . ILE A 1 36 ? 18.592 34.174 31.410 1.00 0.00 ? 34 ILE A O      3  
ATOM 4612  C CB     . ILE A 1 36 ? 20.606 36.433 29.984 1.00 0.00 ? 34 ILE A CB     3  
ATOM 4613  C CG1    . ILE A 1 36 ? 20.628 37.421 28.794 1.00 0.00 ? 34 ILE A CG1    3  
ATOM 4614  C CG2    . ILE A 1 36 ? 21.081 35.049 29.506 1.00 0.00 ? 34 ILE A CG2    3  
ATOM 4615  C CD1    . ILE A 1 36 ? 22.047 37.811 28.360 1.00 0.00 ? 34 ILE A CD1    3  
ATOM 4616  H H      . ILE A 1 36 ? 19.543 38.425 31.157 1.00 0.00 ? 34 ILE A H      3  
ATOM 4617  H HA     . ILE A 1 36 ? 18.470 36.137 29.852 1.00 0.00 ? 34 ILE A HA     3  
ATOM 4618  H HB     . ILE A 1 36 ? 21.305 36.786 30.742 1.00 0.00 ? 34 ILE A HB     3  
ATOM 4619  H HG12   . ILE A 1 36 ? 20.097 36.990 27.945 1.00 0.00 ? 34 ILE A HG12   3  
ATOM 4620  H HG13   . ILE A 1 36 ? 20.108 38.339 29.064 1.00 0.00 ? 34 ILE A HG13   3  
ATOM 4621  H HG21   . ILE A 1 36 ? 22.072 35.139 29.071 1.00 0.00 ? 34 ILE A HG21   3  
ATOM 4622  H HG22   . ILE A 1 36 ? 21.157 34.352 30.339 1.00 0.00 ? 34 ILE A HG22   3  
ATOM 4623  H HG23   . ILE A 1 36 ? 20.392 34.649 28.760 1.00 0.00 ? 34 ILE A HG23   3  
ATOM 4624  H HD11   . ILE A 1 36 ? 22.649 38.073 29.227 1.00 0.00 ? 34 ILE A HD11   3  
ATOM 4625  H HD12   . ILE A 1 36 ? 22.519 36.995 27.816 1.00 0.00 ? 34 ILE A HD12   3  
ATOM 4626  H HD13   . ILE A 1 36 ? 21.992 38.684 27.714 1.00 0.00 ? 34 ILE A HD13   3  
ATOM 4627  N N      . ALA A 1 37 ? 19.560 35.525 32.919 1.00 0.00 ? 35 ALA A N      3  
ATOM 4628  C CA     . ALA A 1 37 ? 19.445 34.604 34.047 1.00 0.00 ? 35 ALA A CA     3  
ATOM 4629  C C      . ALA A 1 37 ? 18.000 34.413 34.568 1.00 0.00 ? 35 ALA A C      3  
ATOM 4630  O O      . ALA A 1 37 ? 17.717 33.363 35.146 1.00 0.00 ? 35 ALA A O      3  
ATOM 4631  C CB     . ALA A 1 37 ? 20.411 35.070 35.140 1.00 0.00 ? 35 ALA A CB     3  
ATOM 4632  H H      . ALA A 1 37 ? 19.997 36.423 33.084 1.00 0.00 ? 35 ALA A H      3  
ATOM 4633  H HA     . ALA A 1 37 ? 19.786 33.623 33.718 1.00 0.00 ? 35 ALA A HA     3  
ATOM 4634  H HB1    . ALA A 1 37 ? 21.436 35.056 34.765 1.00 0.00 ? 35 ALA A HB1    3  
ATOM 4635  H HB2    . ALA A 1 37 ? 20.163 36.076 35.461 1.00 0.00 ? 35 ALA A HB2    3  
ATOM 4636  H HB3    . ALA A 1 37 ? 20.334 34.413 36.001 1.00 0.00 ? 35 ALA A HB3    3  
ATOM 4637  N N      . VAL A 1 38 ? 17.063 35.343 34.331 1.00 0.00 ? 36 VAL A N      3  
ATOM 4638  C CA     . VAL A 1 38 ? 15.616 35.143 34.587 1.00 0.00 ? 36 VAL A CA     3  
ATOM 4639  C C      . VAL A 1 38 ? 14.976 34.276 33.496 1.00 0.00 ? 36 VAL A C      3  
ATOM 4640  O O      . VAL A 1 38 ? 14.164 33.404 33.813 1.00 0.00 ? 36 VAL A O      3  
ATOM 4641  C CB     . VAL A 1 38 ? 14.862 36.486 34.745 1.00 0.00 ? 36 VAL A CB     3  
ATOM 4642  C CG1    . VAL A 1 38 ? 13.343 36.305 34.875 1.00 0.00 ? 36 VAL A CG1    3  
ATOM 4643  C CG2    . VAL A 1 38 ? 15.314 37.225 36.010 1.00 0.00 ? 36 VAL A CG2    3  
ATOM 4644  H H      . VAL A 1 38 ? 17.347 36.207 33.879 1.00 0.00 ? 36 VAL A H      3  
ATOM 4645  H HA     . VAL A 1 38 ? 15.499 34.598 35.524 1.00 0.00 ? 36 VAL A HA     3  
ATOM 4646  H HB     . VAL A 1 38 ? 15.056 37.118 33.880 1.00 0.00 ? 36 VAL A HB     3  
ATOM 4647  H HG11   . VAL A 1 38 ? 13.114 35.633 35.703 1.00 0.00 ? 36 VAL A HG11   3  
ATOM 4648  H HG12   . VAL A 1 38 ? 12.867 37.266 35.063 1.00 0.00 ? 36 VAL A HG12   3  
ATOM 4649  H HG13   . VAL A 1 38 ? 12.925 35.906 33.952 1.00 0.00 ? 36 VAL A HG13   3  
ATOM 4650  H HG21   . VAL A 1 38 ? 14.794 38.180 36.088 1.00 0.00 ? 36 VAL A HG21   3  
ATOM 4651  H HG22   . VAL A 1 38 ? 15.101 36.626 36.896 1.00 0.00 ? 36 VAL A HG22   3  
ATOM 4652  H HG23   . VAL A 1 38 ? 16.379 37.426 35.966 1.00 0.00 ? 36 VAL A HG23   3  
ATOM 4653  N N      . TRP A 1 39 ? 15.363 34.438 32.226 1.00 0.00 ? 37 TRP A N      3  
ATOM 4654  C CA     . TRP A 1 39 ? 14.857 33.595 31.129 1.00 0.00 ? 37 TRP A CA     3  
ATOM 4655  C C      . TRP A 1 39 ? 15.377 32.150 31.222 1.00 0.00 ? 37 TRP A C      3  
ATOM 4656  O O      . TRP A 1 39 ? 14.611 31.196 31.078 1.00 0.00 ? 37 TRP A O      3  
ATOM 4657  C CB     . TRP A 1 39 ? 15.214 34.213 29.767 1.00 0.00 ? 37 TRP A CB     3  
ATOM 4658  C CG     . TRP A 1 39 ? 14.911 35.672 29.559 1.00 0.00 ? 37 TRP A CG     3  
ATOM 4659  C CD1    . TRP A 1 39 ? 15.645 36.492 28.773 1.00 0.00 ? 37 TRP A CD1    3  
ATOM 4660  C CD2    . TRP A 1 39 ? 13.850 36.515 30.124 1.00 0.00 ? 37 TRP A CD2    3  
ATOM 4661  N NE1    . TRP A 1 39 ? 15.141 37.773 28.830 1.00 0.00 ? 37 TRP A NE1    3  
ATOM 4662  C CE2    . TRP A 1 39 ? 14.053 37.855 29.669 1.00 0.00 ? 37 TRP A CE2    3  
ATOM 4663  C CE3    . TRP A 1 39 ? 12.733 36.299 30.966 1.00 0.00 ? 37 TRP A CE3    3  
ATOM 4664  C CZ2    . TRP A 1 39 ? 13.229 38.920 30.061 1.00 0.00 ? 37 TRP A CZ2    3  
ATOM 4665  C CZ3    . TRP A 1 39 ? 11.895 37.361 31.358 1.00 0.00 ? 37 TRP A CZ3    3  
ATOM 4666  C CH2    . TRP A 1 39 ? 12.146 38.672 30.918 1.00 0.00 ? 37 TRP A CH2    3  
ATOM 4667  H H      . TRP A 1 39 ? 15.971 35.222 31.999 1.00 0.00 ? 37 TRP A H      3  
ATOM 4668  H HA     . TRP A 1 39 ? 13.771 33.536 31.198 1.00 0.00 ? 37 TRP A HA     3  
ATOM 4669  H HB2    . TRP A 1 39 ? 16.285 34.075 29.605 1.00 0.00 ? 37 TRP A HB2    3  
ATOM 4670  H HB3    . TRP A 1 39 ? 14.695 33.649 28.990 1.00 0.00 ? 37 TRP A HB3    3  
ATOM 4671  H HD1    . TRP A 1 39 ? 16.516 36.194 28.203 1.00 0.00 ? 37 TRP A HD1    3  
ATOM 4672  H HE1    . TRP A 1 39 ? 15.549 38.548 28.308 1.00 0.00 ? 37 TRP A HE1    3  
ATOM 4673  H HE3    . TRP A 1 39 ? 12.518 35.305 31.324 1.00 0.00 ? 37 TRP A HE3    3  
ATOM 4674  H HZ2    . TRP A 1 39 ? 13.441 39.920 29.718 1.00 0.00 ? 37 TRP A HZ2    3  
ATOM 4675  H HZ3    . TRP A 1 39 ? 11.054 37.173 32.014 1.00 0.00 ? 37 TRP A HZ3    3  
ATOM 4676  H HH2    . TRP A 1 39 ? 11.509 39.485 31.244 1.00 0.00 ? 37 TRP A HH2    3  
ATOM 4677  N N      . THR A 1 40 ? 16.670 31.980 31.509 1.00 0.00 ? 38 THR A N      3  
ATOM 4678  C CA     . THR A 1 40 ? 17.358 30.671 31.583 1.00 0.00 ? 38 THR A CA     3  
ATOM 4679  C C      . THR A 1 40 ? 17.305 29.998 32.961 1.00 0.00 ? 38 THR A C      3  
ATOM 4680  O O      . THR A 1 40 ? 17.741 28.856 33.110 1.00 0.00 ? 38 THR A O      3  
ATOM 4681  C CB     . THR A 1 40 ? 18.823 30.789 31.132 1.00 0.00 ? 38 THR A CB     3  
ATOM 4682  O OG1    . THR A 1 40 ? 19.507 31.731 31.925 1.00 0.00 ? 38 THR A OG1    3  
ATOM 4683  C CG2    . THR A 1 40 ? 18.961 31.222 29.672 1.00 0.00 ? 38 THR A CG2    3  
ATOM 4684  H H      . THR A 1 40 ? 17.235 32.816 31.602 1.00 0.00 ? 38 THR A H      3  
ATOM 4685  H HA     . THR A 1 40 ? 16.869 29.986 30.894 1.00 0.00 ? 38 THR A HA     3  
ATOM 4686  H HB     . THR A 1 40 ? 19.311 29.823 31.244 1.00 0.00 ? 38 THR A HB     3  
ATOM 4687  H HG1    . THR A 1 40 ? 19.231 32.616 31.625 1.00 0.00 ? 38 THR A HG1    3  
ATOM 4688  H HG21   . THR A 1 40 ? 18.558 32.224 29.524 1.00 0.00 ? 38 THR A HG21   3  
ATOM 4689  H HG22   . THR A 1 40 ? 20.013 31.213 29.388 1.00 0.00 ? 38 THR A HG22   3  
ATOM 4690  H HG23   . THR A 1 40 ? 18.420 30.525 29.033 1.00 0.00 ? 38 THR A HG23   3  
ATOM 4691  N N      . ASN A 1 41 ? 16.787 30.686 33.985 1.00 0.00 ? 39 ASN A N      3  
ATOM 4692  C CA     . ASN A 1 41 ? 16.837 30.262 35.391 1.00 0.00 ? 39 ASN A CA     3  
ATOM 4693  C C      . ASN A 1 41 ? 18.268 29.941 35.893 1.00 0.00 ? 39 ASN A C      3  
ATOM 4694  O O      . ASN A 1 41 ? 18.487 28.994 36.656 1.00 0.00 ? 39 ASN A O      3  
ATOM 4695  C CB     . ASN A 1 41 ? 15.802 29.147 35.631 1.00 0.00 ? 39 ASN A CB     3  
ATOM 4696  C CG     . ASN A 1 41 ? 15.562 28.899 37.108 1.00 0.00 ? 39 ASN A CG     3  
ATOM 4697  O OD1    . ASN A 1 41 ? 15.472 29.823 37.908 1.00 0.00 ? 39 ASN A OD1    3  
ATOM 4698  N ND2    . ASN A 1 41 ? 15.443 27.661 37.520 1.00 0.00 ? 39 ASN A ND2    3  
ATOM 4699  H H      . ASN A 1 41 ? 16.427 31.610 33.796 1.00 0.00 ? 39 ASN A H      3  
ATOM 4700  H HA     . ASN A 1 41 ? 16.518 31.126 35.974 1.00 0.00 ? 39 ASN A HA     3  
ATOM 4701  H HB2    . ASN A 1 41 ? 14.852 29.417 35.178 1.00 0.00 ? 39 ASN A HB2    3  
ATOM 4702  H HB3    . ASN A 1 41 ? 16.150 28.231 35.158 1.00 0.00 ? 39 ASN A HB3    3  
ATOM 4703  H HD21   . ASN A 1 41 ? 15.504 26.898 36.854 1.00 0.00 ? 39 ASN A HD21   3  
ATOM 4704  H HD22   . ASN A 1 41 ? 15.293 27.495 38.504 1.00 0.00 ? 39 ASN A HD22   3  
ATOM 4705  N N      . LEU A 1 42 ? 19.250 30.723 35.439 1.00 0.00 ? 40 LEU A N      3  
ATOM 4706  C CA     . LEU A 1 42 ? 20.657 30.684 35.862 1.00 0.00 ? 40 LEU A CA     3  
ATOM 4707  C C      . LEU A 1 42 ? 20.951 31.840 36.843 1.00 0.00 ? 40 LEU A C      3  
ATOM 4708  O O      . LEU A 1 42 ? 20.047 32.337 37.513 1.00 0.00 ? 40 LEU A O      3  
ATOM 4709  C CB     . LEU A 1 42 ? 21.554 30.693 34.599 1.00 0.00 ? 40 LEU A CB     3  
ATOM 4710  C CG     . LEU A 1 42 ? 21.379 29.483 33.662 1.00 0.00 ? 40 LEU A CG     3  
ATOM 4711  C CD1    . LEU A 1 42 ? 22.299 29.628 32.448 1.00 0.00 ? 40 LEU A CD1    3  
ATOM 4712  C CD2    . LEU A 1 42 ? 21.727 28.167 34.360 1.00 0.00 ? 40 LEU A CD2    3  
ATOM 4713  H H      . LEU A 1 42 ? 18.971 31.486 34.836 1.00 0.00 ? 40 LEU A H      3  
ATOM 4714  H HA     . LEU A 1 42 ? 20.854 29.767 36.418 1.00 0.00 ? 40 LEU A HA     3  
ATOM 4715  H HB2    . LEU A 1 42 ? 21.352 31.605 34.035 1.00 0.00 ? 40 LEU A HB2    3  
ATOM 4716  H HB3    . LEU A 1 42 ? 22.600 30.716 34.901 1.00 0.00 ? 40 LEU A HB3    3  
ATOM 4717  H HG     . LEU A 1 42 ? 20.351 29.429 33.312 1.00 0.00 ? 40 LEU A HG     3  
ATOM 4718  H HD11   . LEU A 1 42 ? 23.342 29.647 32.762 1.00 0.00 ? 40 LEU A HD11   3  
ATOM 4719  H HD12   . LEU A 1 42 ? 22.140 28.794 31.766 1.00 0.00 ? 40 LEU A HD12   3  
ATOM 4720  H HD13   . LEU A 1 42 ? 22.062 30.554 31.923 1.00 0.00 ? 40 LEU A HD13   3  
ATOM 4721  H HD21   . LEU A 1 42 ? 22.721 28.225 34.803 1.00 0.00 ? 40 LEU A HD21   3  
ATOM 4722  H HD22   . LEU A 1 42 ? 20.987 27.950 35.130 1.00 0.00 ? 40 LEU A HD22   3  
ATOM 4723  H HD23   . LEU A 1 42 ? 21.709 27.356 33.634 1.00 0.00 ? 40 LEU A HD23   3  
ATOM 4724  N N      . THR A 1 43 ? 22.205 32.286 36.921 1.00 0.00 ? 41 THR A N      3  
ATOM 4725  C CA     . THR A 1 43 ? 22.655 33.447 37.707 1.00 0.00 ? 41 THR A CA     3  
ATOM 4726  C C      . THR A 1 43 ? 23.676 34.283 36.919 1.00 0.00 ? 41 THR A C      3  
ATOM 4727  O O      . THR A 1 43 ? 24.411 33.756 36.082 1.00 0.00 ? 41 THR A O      3  
ATOM 4728  C CB     . THR A 1 43 ? 23.223 33.036 39.082 1.00 0.00 ? 41 THR A CB     3  
ATOM 4729  O OG1    . THR A 1 43 ? 23.606 31.677 39.139 1.00 0.00 ? 41 THR A OG1    3  
ATOM 4730  C CG2    . THR A 1 43 ? 22.201 33.255 40.196 1.00 0.00 ? 41 THR A CG2    3  
ATOM 4731  H H      . THR A 1 43 ? 22.918 31.819 36.381 1.00 0.00 ? 41 THR A H      3  
ATOM 4732  H HA     . THR A 1 43 ? 21.798 34.099 37.883 1.00 0.00 ? 41 THR A HA     3  
ATOM 4733  H HB     . THR A 1 43 ? 24.098 33.646 39.303 1.00 0.00 ? 41 THR A HB     3  
ATOM 4734  H HG1    . THR A 1 43 ? 22.843 31.169 39.465 1.00 0.00 ? 41 THR A HG1    3  
ATOM 4735  H HG21   . THR A 1 43 ? 22.620 32.926 41.148 1.00 0.00 ? 41 THR A HG21   3  
ATOM 4736  H HG22   . THR A 1 43 ? 21.960 34.317 40.264 1.00 0.00 ? 41 THR A HG22   3  
ATOM 4737  H HG23   . THR A 1 43 ? 21.289 32.696 39.983 1.00 0.00 ? 41 THR A HG23   3  
ATOM 4738  N N      . GLU A 1 44 ? 23.705 35.597 37.160 1.00 0.00 ? 42 GLU A N      3  
ATOM 4739  C CA     . GLU A 1 44 ? 24.433 36.600 36.362 1.00 0.00 ? 42 GLU A CA     3  
ATOM 4740  C C      . GLU A 1 44 ? 25.909 36.262 36.089 1.00 0.00 ? 42 GLU A C      3  
ATOM 4741  O O      . GLU A 1 44 ? 26.336 36.338 34.936 1.00 0.00 ? 42 GLU A O      3  
ATOM 4742  C CB     . GLU A 1 44 ? 24.294 37.963 37.068 1.00 0.00 ? 42 GLU A CB     3  
ATOM 4743  C CG     . GLU A 1 44 ? 25.000 39.134 36.364 1.00 0.00 ? 42 GLU A CG     3  
ATOM 4744  C CD     . GLU A 1 44 ? 26.490 39.267 36.711 1.00 0.00 ? 42 GLU A CD     3  
ATOM 4745  O OE1    . GLU A 1 44 ? 26.839 39.301 37.912 1.00 0.00 ? 42 GLU A OE1    3  
ATOM 4746  O OE2    . GLU A 1 44 ? 27.339 39.414 35.801 1.00 0.00 ? 42 GLU A OE2    3  
ATOM 4747  H H      . GLU A 1 44 ? 22.987 35.959 37.785 1.00 0.00 ? 42 GLU A H      3  
ATOM 4748  H HA     . GLU A 1 44 ? 23.947 36.678 35.387 1.00 0.00 ? 42 GLU A HA     3  
ATOM 4749  H HB2    . GLU A 1 44 ? 23.231 38.199 37.109 1.00 0.00 ? 42 GLU A HB2    3  
ATOM 4750  H HB3    . GLU A 1 44 ? 24.651 37.880 38.094 1.00 0.00 ? 42 GLU A HB3    3  
ATOM 4751  H HG2    . GLU A 1 44 ? 24.874 39.017 35.292 1.00 0.00 ? 42 GLU A HG2    3  
ATOM 4752  H HG3    . GLU A 1 44 ? 24.501 40.060 36.654 1.00 0.00 ? 42 GLU A HG3    3  
ATOM 4753  N N      . ALA A 1 45 ? 26.690 35.853 37.095 1.00 0.00 ? 43 ALA A N      3  
ATOM 4754  C CA     . ALA A 1 45 ? 28.107 35.548 36.883 1.00 0.00 ? 43 ALA A CA     3  
ATOM 4755  C C      . ALA A 1 45 ? 28.314 34.281 36.023 1.00 0.00 ? 43 ALA A C      3  
ATOM 4756  O O      . ALA A 1 45 ? 29.269 34.209 35.251 1.00 0.00 ? 43 ALA A O      3  
ATOM 4757  C CB     . ALA A 1 45 ? 28.827 35.484 38.232 1.00 0.00 ? 43 ALA A CB     3  
ATOM 4758  H H      . ALA A 1 45 ? 26.308 35.785 38.034 1.00 0.00 ? 43 ALA A H      3  
ATOM 4759  H HA     . ALA A 1 45 ? 28.548 36.379 36.333 1.00 0.00 ? 43 ALA A HA     3  
ATOM 4760  H HB1    . ALA A 1 45 ? 28.526 34.598 38.781 1.00 0.00 ? 43 ALA A HB1    3  
ATOM 4761  H HB2    . ALA A 1 45 ? 29.901 35.438 38.067 1.00 0.00 ? 43 ALA A HB2    3  
ATOM 4762  H HB3    . ALA A 1 45 ? 28.602 36.374 38.820 1.00 0.00 ? 43 ALA A HB3    3  
ATOM 4763  N N      . ARG A 1 46 ? 27.364 33.331 36.038 1.00 0.00 ? 44 ARG A N      3  
ATOM 4764  C CA     . ARG A 1 46 ? 27.366 32.165 35.131 1.00 0.00 ? 44 ARG A CA     3  
ATOM 4765  C C      . ARG A 1 46 ? 27.185 32.603 33.670 1.00 0.00 ? 44 ARG A C      3  
ATOM 4766  O O      . ARG A 1 46 ? 27.860 32.095 32.777 1.00 0.00 ? 44 ARG A O      3  
ATOM 4767  C CB     . ARG A 1 46 ? 26.298 31.128 35.537 1.00 0.00 ? 44 ARG A CB     3  
ATOM 4768  C CG     . ARG A 1 46 ? 26.186 30.829 37.044 1.00 0.00 ? 44 ARG A CG     3  
ATOM 4769  C CD     . ARG A 1 46 ? 27.496 30.484 37.767 1.00 0.00 ? 44 ARG A CD     3  
ATOM 4770  N NE     . ARG A 1 46 ? 28.091 29.206 37.335 1.00 0.00 ? 44 ARG A NE     3  
ATOM 4771  C CZ     . ARG A 1 46 ? 29.030 28.528 37.970 1.00 0.00 ? 44 ARG A CZ     3  
ATOM 4772  N NH1    . ARG A 1 46 ? 29.603 28.999 39.035 1.00 0.00 ? 44 ARG A NH1    3  
ATOM 4773  N NH2    . ARG A 1 46 ? 29.421 27.363 37.552 1.00 0.00 1 44 ARG A NH2    3  
ATOM 4774  H H      . ARG A 1 46 ? 26.558 33.480 36.635 1.00 0.00 ? 44 ARG A H      3  
ATOM 4775  H HA     . ARG A 1 46 ? 28.339 31.678 35.196 1.00 0.00 ? 44 ARG A HA     3  
ATOM 4776  H HB2    . ARG A 1 46 ? 25.320 31.468 35.194 1.00 0.00 ? 44 ARG A HB2    3  
ATOM 4777  H HB3    . ARG A 1 46 ? 26.513 30.197 35.011 1.00 0.00 ? 44 ARG A HB3    3  
ATOM 4778  H HG2    . ARG A 1 46 ? 25.765 31.706 37.533 1.00 0.00 ? 44 ARG A HG2    3  
ATOM 4779  H HG3    . ARG A 1 46 ? 25.478 30.012 37.187 1.00 0.00 ? 44 ARG A HG3    3  
ATOM 4780  H HD2    . ARG A 1 46 ? 28.216 31.291 37.628 1.00 0.00 ? 44 ARG A HD2    3  
ATOM 4781  H HD3    . ARG A 1 46 ? 27.265 30.419 38.832 1.00 0.00 ? 44 ARG A HD3    3  
ATOM 4782  H HE     . ARG A 1 46 ? 27.732 28.774 36.488 1.00 0.00 ? 44 ARG A HE     3  
ATOM 4783  H HH11   . ARG A 1 46 ? 29.360 29.932 39.349 1.00 0.00 ? 44 ARG A HH11   3  
ATOM 4784  H HH12   . ARG A 1 46 ? 30.309 28.480 39.530 1.00 0.00 ? 44 ARG A HH12   3  
ATOM 4785  H HH21   . ARG A 1 46 ? 29.066 27.008 36.677 1.00 0.00 ? 44 ARG A HH21   3  
ATOM 4786  H HH22   . ARG A 1 46 ? 30.102 26.834 38.073 1.00 0.00 ? 44 ARG A HH22   3  
ATOM 4787  N N      . VAL A 1 47 ? 26.339 33.611 33.432 1.00 0.00 ? 45 VAL A N      3  
ATOM 4788  C CA     . VAL A 1 47 ? 26.189 34.262 32.114 1.00 0.00 ? 45 VAL A CA     3  
ATOM 4789  C C      . VAL A 1 47 ? 27.460 35.042 31.743 1.00 0.00 ? 45 VAL A C      3  
ATOM 4790  O O      . VAL A 1 47 ? 27.904 34.971 30.596 1.00 0.00 ? 45 VAL A O      3  
ATOM 4791  C CB     . VAL A 1 47 ? 24.935 35.166 32.071 1.00 0.00 ? 45 VAL A CB     3  
ATOM 4792  C CG1    . VAL A 1 47 ? 24.735 35.808 30.692 1.00 0.00 ? 45 VAL A CG1    3  
ATOM 4793  C CG2    . VAL A 1 47 ? 23.659 34.375 32.400 1.00 0.00 ? 45 VAL A CG2    3  
ATOM 4794  H H      . VAL A 1 47 ? 25.828 33.986 34.222 1.00 0.00 ? 45 VAL A H      3  
ATOM 4795  H HA     . VAL A 1 47 ? 26.063 33.484 31.361 1.00 0.00 ? 45 VAL A HA     3  
ATOM 4796  H HB     . VAL A 1 47 ? 25.037 35.967 32.800 1.00 0.00 ? 45 VAL A HB     3  
ATOM 4797  H HG11   . VAL A 1 47 ? 23.818 36.396 30.691 1.00 0.00 ? 45 VAL A HG11   3  
ATOM 4798  H HG12   . VAL A 1 47 ? 25.565 36.475 30.461 1.00 0.00 ? 45 VAL A HG12   3  
ATOM 4799  H HG13   . VAL A 1 47 ? 24.668 35.037 29.925 1.00 0.00 ? 45 VAL A HG13   3  
ATOM 4800  H HG21   . VAL A 1 47 ? 23.531 33.555 31.695 1.00 0.00 ? 45 VAL A HG21   3  
ATOM 4801  H HG22   . VAL A 1 47 ? 23.711 33.977 33.413 1.00 0.00 ? 45 VAL A HG22   3  
ATOM 4802  H HG23   . VAL A 1 47 ? 22.793 35.036 32.347 1.00 0.00 ? 45 VAL A HG23   3  
ATOM 4803  N N      . ARG A 1 48 ? 28.100 35.721 32.707 1.00 0.00 ? 46 ARG A N      3  
ATOM 4804  C CA     . ARG A 1 48 ? 29.376 36.442 32.530 1.00 0.00 ? 46 ARG A CA     3  
ATOM 4805  C C      . ARG A 1 48 ? 30.496 35.510 32.040 1.00 0.00 ? 46 ARG A C      3  
ATOM 4806  O O      . ARG A 1 48 ? 31.140 35.811 31.032 1.00 0.00 ? 46 ARG A O      3  
ATOM 4807  C CB     . ARG A 1 48 ? 29.737 37.155 33.854 1.00 0.00 ? 46 ARG A CB     3  
ATOM 4808  C CG     . ARG A 1 48 ? 30.626 38.399 33.679 1.00 0.00 ? 46 ARG A CG     3  
ATOM 4809  C CD     . ARG A 1 48 ? 31.209 38.917 35.009 1.00 0.00 ? 46 ARG A CD     3  
ATOM 4810  N NE     . ARG A 1 48 ? 30.208 39.096 36.084 1.00 0.00 ? 46 ARG A NE     3  
ATOM 4811  C CZ     . ARG A 1 48 ? 30.487 39.210 37.373 1.00 0.00 ? 46 ARG A CZ     3  
ATOM 4812  N NH1    . ARG A 1 48 ? 31.685 39.447 37.826 1.00 0.00 1 46 ARG A NH1    3  
ATOM 4813  N NH2    . ARG A 1 48 ? 29.548 39.091 38.257 1.00 0.00 ? 46 ARG A NH2    3  
ATOM 4814  H H      . ARG A 1 48 ? 27.654 35.759 33.621 1.00 0.00 ? 46 ARG A H      3  
ATOM 4815  H HA     . ARG A 1 48 ? 29.242 37.193 31.751 1.00 0.00 ? 46 ARG A HA     3  
ATOM 4816  H HB2    . ARG A 1 48 ? 28.816 37.481 34.340 1.00 0.00 ? 46 ARG A HB2    3  
ATOM 4817  H HB3    . ARG A 1 48 ? 30.245 36.454 34.516 1.00 0.00 ? 46 ARG A HB3    3  
ATOM 4818  H HG2    . ARG A 1 48 ? 31.458 38.154 33.019 1.00 0.00 ? 46 ARG A HG2    3  
ATOM 4819  H HG3    . ARG A 1 48 ? 30.044 39.190 33.210 1.00 0.00 ? 46 ARG A HG3    3  
ATOM 4820  H HD2    . ARG A 1 48 ? 31.962 38.199 35.347 1.00 0.00 ? 46 ARG A HD2    3  
ATOM 4821  H HD3    . ARG A 1 48 ? 31.709 39.870 34.821 1.00 0.00 ? 46 ARG A HD3    3  
ATOM 4822  H HE     . ARG A 1 48 ? 29.220 39.021 35.858 1.00 0.00 ? 46 ARG A HE     3  
ATOM 4823  H HH11   . ARG A 1 48 ? 32.425 39.670 37.168 1.00 0.00 ? 46 ARG A HH11   3  
ATOM 4824  H HH12   . ARG A 1 48 ? 31.810 39.657 38.805 1.00 0.00 ? 46 ARG A HH12   3  
ATOM 4825  H HH21   . ARG A 1 48 ? 28.575 39.006 37.972 1.00 0.00 ? 46 ARG A HH21   3  
ATOM 4826  H HH22   . ARG A 1 48 ? 29.781 38.993 39.238 1.00 0.00 ? 46 ARG A HH22   3  
ATOM 4827  N N      . VAL A 1 49 ? 30.679 34.341 32.668 1.00 0.00 ? 47 VAL A N      3  
ATOM 4828  C CA     . VAL A 1 49 ? 31.702 33.361 32.241 1.00 0.00 ? 47 VAL A CA     3  
ATOM 4829  C C      . VAL A 1 49 ? 31.331 32.592 30.970 1.00 0.00 ? 47 VAL A C      3  
ATOM 4830  O O      . VAL A 1 49 ? 32.236 32.160 30.253 1.00 0.00 ? 47 VAL A O      3  
ATOM 4831  C CB     . VAL A 1 49 ? 32.145 32.391 33.354 1.00 0.00 ? 47 VAL A CB     3  
ATOM 4832  C CG1    . VAL A 1 49 ? 32.692 33.168 34.552 1.00 0.00 ? 47 VAL A CG1    3  
ATOM 4833  C CG2    . VAL A 1 49 ? 31.046 31.438 33.827 1.00 0.00 ? 47 VAL A CG2    3  
ATOM 4834  H H      . VAL A 1 49 ? 30.152 34.168 33.520 1.00 0.00 ? 47 VAL A H      3  
ATOM 4835  H HA     . VAL A 1 49 ? 32.590 33.935 31.986 1.00 0.00 ? 47 VAL A HA     3  
ATOM 4836  H HB     . VAL A 1 49 ? 32.962 31.784 32.963 1.00 0.00 ? 47 VAL A HB     3  
ATOM 4837  H HG11   . VAL A 1 49 ? 31.895 33.749 35.012 1.00 0.00 ? 47 VAL A HG11   3  
ATOM 4838  H HG12   . VAL A 1 49 ? 33.083 32.475 35.296 1.00 0.00 ? 47 VAL A HG12   3  
ATOM 4839  H HG13   . VAL A 1 49 ? 33.482 33.846 34.234 1.00 0.00 ? 47 VAL A HG13   3  
ATOM 4840  H HG21   . VAL A 1 49 ? 31.438 30.770 34.594 1.00 0.00 ? 47 VAL A HG21   3  
ATOM 4841  H HG22   . VAL A 1 49 ? 30.229 32.014 34.249 1.00 0.00 ? 47 VAL A HG22   3  
ATOM 4842  H HG23   . VAL A 1 49 ? 30.673 30.835 32.998 1.00 0.00 ? 47 VAL A HG23   3  
ATOM 4843  N N      . TRP A 1 50 ? 30.040 32.472 30.629 1.00 0.00 ? 48 TRP A N      3  
ATOM 4844  C CA     . TRP A 1 50 ? 29.630 31.998 29.302 1.00 0.00 ? 48 TRP A CA     3  
ATOM 4845  C C      . TRP A 1 50 ? 30.061 32.995 28.220 1.00 0.00 ? 48 TRP A C      3  
ATOM 4846  O O      . TRP A 1 50 ? 30.740 32.610 27.271 1.00 0.00 ? 48 TRP A O      3  
ATOM 4847  C CB     . TRP A 1 50 ? 28.116 31.730 29.245 1.00 0.00 ? 48 TRP A CB     3  
ATOM 4848  C CG     . TRP A 1 50 ? 27.655 31.027 27.997 1.00 0.00 ? 48 TRP A CG     3  
ATOM 4849  C CD1    . TRP A 1 50 ? 27.471 29.693 27.889 1.00 0.00 ? 48 TRP A CD1    3  
ATOM 4850  C CD2    . TRP A 1 50 ? 27.330 31.571 26.674 1.00 0.00 ? 48 TRP A CD2    3  
ATOM 4851  N NE1    . TRP A 1 50 ? 27.111 29.365 26.600 1.00 0.00 ? 48 TRP A NE1    3  
ATOM 4852  C CE2    . TRP A 1 50 ? 26.969 30.486 25.815 1.00 0.00 ? 48 TRP A CE2    3  
ATOM 4853  C CE3    . TRP A 1 50 ? 27.315 32.860 26.102 1.00 0.00 ? 48 TRP A CE3    3  
ATOM 4854  C CZ2    . TRP A 1 50 ? 26.623 30.669 24.469 1.00 0.00 ? 48 TRP A CZ2    3  
ATOM 4855  C CZ3    . TRP A 1 50 ? 26.967 33.059 24.751 1.00 0.00 ? 48 TRP A CZ3    3  
ATOM 4856  C CH2    . TRP A 1 50 ? 26.622 31.967 23.934 1.00 0.00 ? 48 TRP A CH2    3  
ATOM 4857  H H      . TRP A 1 50 ? 29.327 32.755 31.291 1.00 0.00 ? 48 TRP A H      3  
ATOM 4858  H HA     . TRP A 1 50 ? 30.145 31.058 29.099 1.00 0.00 ? 48 TRP A HA     3  
ATOM 4859  H HB2    . TRP A 1 50 ? 27.842 31.112 30.102 1.00 0.00 ? 48 TRP A HB2    3  
ATOM 4860  H HB3    . TRP A 1 50 ? 27.573 32.669 29.333 1.00 0.00 ? 48 TRP A HB3    3  
ATOM 4861  H HD1    . TRP A 1 50 ? 27.616 28.988 28.696 1.00 0.00 ? 48 TRP A HD1    3  
ATOM 4862  H HE1    . TRP A 1 50 ? 26.997 28.408 26.277 1.00 0.00 ? 48 TRP A HE1    3  
ATOM 4863  H HE3    . TRP A 1 50 ? 27.568 33.711 26.714 1.00 0.00 ? 48 TRP A HE3    3  
ATOM 4864  H HZ2    . TRP A 1 50 ? 26.370 29.820 23.847 1.00 0.00 ? 48 TRP A HZ2    3  
ATOM 4865  H HZ3    . TRP A 1 50 ? 26.952 34.061 24.342 1.00 0.00 ? 48 TRP A HZ3    3  
ATOM 4866  H HH2    . TRP A 1 50 ? 26.356 32.127 22.896 1.00 0.00 ? 48 TRP A HH2    3  
ATOM 4867  N N      . PHE A 1 51 ? 29.739 34.284 28.378 1.00 0.00 ? 49 PHE A N      3  
ATOM 4868  C CA     . PHE A 1 51 ? 30.083 35.311 27.389 1.00 0.00 ? 49 PHE A CA     3  
ATOM 4869  C C      . PHE A 1 51 ? 31.598 35.493 27.225 1.00 0.00 ? 49 PHE A C      3  
ATOM 4870  O O      . PHE A 1 51 ? 32.064 35.560 26.083 1.00 0.00 ? 49 PHE A O      3  
ATOM 4871  C CB     . PHE A 1 51 ? 29.361 36.632 27.706 1.00 0.00 ? 49 PHE A CB     3  
ATOM 4872  C CG     . PHE A 1 51 ? 28.056 36.784 26.944 1.00 0.00 ? 49 PHE A CG     3  
ATOM 4873  C CD1    . PHE A 1 51 ? 26.870 36.204 27.433 1.00 0.00 ? 49 PHE A CD1    3  
ATOM 4874  C CD2    . PHE A 1 51 ? 28.039 37.461 25.708 1.00 0.00 ? 49 PHE A CD2    3  
ATOM 4875  C CE1    . PHE A 1 51 ? 25.682 36.281 26.682 1.00 0.00 ? 49 PHE A CE1    3  
ATOM 4876  C CE2    . PHE A 1 51 ? 26.847 37.553 24.966 1.00 0.00 ? 49 PHE A CE2    3  
ATOM 4877  C CZ     . PHE A 1 51 ? 25.672 36.950 25.445 1.00 0.00 ? 49 PHE A CZ     3  
ATOM 4878  H H      . PHE A 1 51 ? 29.198 34.556 29.195 1.00 0.00 ? 49 PHE A H      3  
ATOM 4879  H HA     . PHE A 1 51 ? 29.726 34.971 26.414 1.00 0.00 ? 49 PHE A HA     3  
ATOM 4880  H HB2    . PHE A 1 51 ? 29.178 36.718 28.778 1.00 0.00 ? 49 PHE A HB2    3  
ATOM 4881  H HB3    . PHE A 1 51 ? 30.008 37.463 27.428 1.00 0.00 ? 49 PHE A HB3    3  
ATOM 4882  H HD1    . PHE A 1 51 ? 26.874 35.679 28.376 1.00 0.00 ? 49 PHE A HD1    3  
ATOM 4883  H HD2    . PHE A 1 51 ? 28.943 37.911 25.324 1.00 0.00 ? 49 PHE A HD2    3  
ATOM 4884  H HE1    . PHE A 1 51 ? 24.778 35.822 27.052 1.00 0.00 ? 49 PHE A HE1    3  
ATOM 4885  H HE2    . PHE A 1 51 ? 26.833 38.086 24.026 1.00 0.00 ? 49 PHE A HE2    3  
ATOM 4886  H HZ     . PHE A 1 51 ? 24.763 37.006 24.866 1.00 0.00 ? 49 PHE A HZ     3  
ATOM 4887  N N      . LYS A 1 52 ? 32.389 35.480 28.312 1.00 0.00 ? 50 LYS A N      3  
ATOM 4888  C CA     . LYS A 1 52 ? 33.856 35.568 28.187 1.00 0.00 ? 50 LYS A CA     3  
ATOM 4889  C C      . LYS A 1 52 ? 34.451 34.394 27.413 1.00 0.00 ? 50 LYS A C      3  
ATOM 4890  O O      . LYS A 1 52 ? 35.307 34.605 26.560 1.00 0.00 ? 50 LYS A O      3  
ATOM 4891  C CB     . LYS A 1 52 ? 34.557 35.791 29.541 1.00 0.00 ? 50 LYS A CB     3  
ATOM 4892  C CG     . LYS A 1 52 ? 35.000 34.516 30.285 1.00 0.00 ? 50 LYS A CG     3  
ATOM 4893  C CD     . LYS A 1 52 ? 35.672 34.789 31.633 1.00 0.00 ? 50 LYS A CD     3  
ATOM 4894  C CE     . LYS A 1 52 ? 36.902 35.693 31.469 1.00 0.00 ? 50 LYS A CE     3  
ATOM 4895  N NZ     . LYS A 1 52 ? 37.635 35.851 32.738 1.00 0.00 1 50 LYS A NZ     3  
ATOM 4896  H H      . LYS A 1 52 ? 31.959 35.473 29.234 1.00 0.00 ? 50 LYS A H      3  
ATOM 4897  H HA     . LYS A 1 52 ? 34.070 36.450 27.580 1.00 0.00 ? 50 LYS A HA     3  
ATOM 4898  H HB2    . LYS A 1 52 ? 35.459 36.360 29.319 1.00 0.00 ? 50 LYS A HB2    3  
ATOM 4899  H HB3    . LYS A 1 52 ? 33.921 36.398 30.190 1.00 0.00 ? 50 LYS A HB3    3  
ATOM 4900  H HG2    . LYS A 1 52 ? 34.137 33.878 30.448 1.00 0.00 ? 50 LYS A HG2    3  
ATOM 4901  H HG3    . LYS A 1 52 ? 35.718 33.969 29.673 1.00 0.00 ? 50 LYS A HG3    3  
ATOM 4902  H HD2    . LYS A 1 52 ? 34.952 35.252 32.308 1.00 0.00 ? 50 LYS A HD2    3  
ATOM 4903  H HD3    . LYS A 1 52 ? 35.986 33.833 32.056 1.00 0.00 ? 50 LYS A HD3    3  
ATOM 4904  H HE2    . LYS A 1 52 ? 37.566 35.252 30.723 1.00 0.00 ? 50 LYS A HE2    3  
ATOM 4905  H HE3    . LYS A 1 52 ? 36.582 36.674 31.108 1.00 0.00 ? 50 LYS A HE3    3  
ATOM 4906  H HZ1    . LYS A 1 52 ? 38.478 36.401 32.591 1.00 0.00 ? 50 LYS A HZ1    3  
ATOM 4907  H HZ2    . LYS A 1 52 ? 37.061 36.287 33.456 1.00 0.00 ? 50 LYS A HZ2    3  
ATOM 4908  H HZ3    . LYS A 1 52 ? 37.965 34.953 33.079 1.00 0.00 ? 50 LYS A HZ3    3  
ATOM 4909  N N      . ASN A 1 53 ? 33.986 33.166 27.662 1.00 0.00 ? 51 ASN A N      3  
ATOM 4910  C CA     . ASN A 1 53 ? 34.512 31.990 26.970 1.00 0.00 ? 51 ASN A CA     3  
ATOM 4911  C C      . ASN A 1 53 ? 33.999 31.882 25.529 1.00 0.00 ? 51 ASN A C      3  
ATOM 4912  O O      . ASN A 1 53 ? 34.735 31.402 24.668 1.00 0.00 ? 51 ASN A O      3  
ATOM 4913  C CB     . ASN A 1 53 ? 34.280 30.733 27.816 1.00 0.00 ? 51 ASN A CB     3  
ATOM 4914  C CG     . ASN A 1 53 ? 35.268 30.678 28.967 1.00 0.00 ? 51 ASN A CG     3  
ATOM 4915  O OD1    . ASN A 1 53 ? 36.478 30.686 28.771 1.00 0.00 ? 51 ASN A OD1    3  
ATOM 4916  N ND2    . ASN A 1 53 ? 34.808 30.697 30.192 1.00 0.00 ? 51 ASN A ND2    3  
ATOM 4917  H H      . ASN A 1 53 ? 33.268 33.045 28.364 1.00 0.00 ? 51 ASN A H      3  
ATOM 4918  H HA     . ASN A 1 53 ? 35.590 32.108 26.871 1.00 0.00 ? 51 ASN A HA     3  
ATOM 4919  H HB2    . ASN A 1 53 ? 33.254 30.695 28.180 1.00 0.00 ? 51 ASN A HB2    3  
ATOM 4920  H HB3    . ASN A 1 53 ? 34.451 29.845 27.205 1.00 0.00 ? 51 ASN A HB3    3  
ATOM 4921  H HD21   . ASN A 1 53 ? 33.817 30.824 30.346 1.00 0.00 ? 51 ASN A HD21   3  
ATOM 4922  H HD22   . ASN A 1 53 ? 35.481 30.574 30.942 1.00 0.00 ? 51 ASN A HD22   3  
ATOM 4923  N N      . ARG A 1 54 ? 32.818 32.438 25.224 1.00 0.00 ? 52 ARG A N      3  
ATOM 4924  C CA     . ARG A 1 54 ? 32.350 32.594 23.840 1.00 0.00 ? 52 ARG A CA     3  
ATOM 4925  C C      . ARG A 1 54 ? 33.246 33.529 23.033 1.00 0.00 ? 52 ARG A C      3  
ATOM 4926  O O      . ARG A 1 54 ? 33.650 33.166 21.932 1.00 0.00 ? 52 ARG A O      3  
ATOM 4927  C CB     . ARG A 1 54 ? 30.876 33.046 23.813 1.00 0.00 ? 52 ARG A CB     3  
ATOM 4928  C CG     . ARG A 1 54 ? 30.056 32.305 22.747 1.00 0.00 ? 52 ARG A CG     3  
ATOM 4929  C CD     . ARG A 1 54 ? 30.012 30.777 22.934 1.00 0.00 ? 52 ARG A CD     3  
ATOM 4930  N NE     . ARG A 1 54 ? 29.750 30.395 24.335 1.00 0.00 ? 52 ARG A NE     3  
ATOM 4931  C CZ     . ARG A 1 54 ? 30.546 29.736 25.162 1.00 0.00 ? 52 ARG A CZ     3  
ATOM 4932  N NH1    . ARG A 1 54 ? 31.647 29.142 24.815 1.00 0.00 ? 52 ARG A NH1    3  
ATOM 4933  N NH2    . ARG A 1 54 ? 30.257 29.649 26.421 1.00 0.00 1 52 ARG A NH2    3  
ATOM 4934  H H      . ARG A 1 54 ? 32.217 32.747 25.983 1.00 0.00 ? 52 ARG A H      3  
ATOM 4935  H HA     . ARG A 1 54 ? 32.447 31.621 23.361 1.00 0.00 ? 52 ARG A HA     3  
ATOM 4936  H HB2    . ARG A 1 54 ? 30.408 32.882 24.783 1.00 0.00 ? 52 ARG A HB2    3  
ATOM 4937  H HB3    . ARG A 1 54 ? 30.822 34.118 23.622 1.00 0.00 ? 52 ARG A HB3    3  
ATOM 4938  H HG2    . ARG A 1 54 ? 29.040 32.694 22.757 1.00 0.00 ? 52 ARG A HG2    3  
ATOM 4939  H HG3    . ARG A 1 54 ? 30.488 32.519 21.771 1.00 0.00 ? 52 ARG A HG3    3  
ATOM 4940  H HD2    . ARG A 1 54 ? 29.231 30.364 22.291 1.00 0.00 ? 52 ARG A HD2    3  
ATOM 4941  H HD3    . ARG A 1 54 ? 30.960 30.368 22.597 1.00 0.00 ? 52 ARG A HD3    3  
ATOM 4942  H HE     . ARG A 1 54 ? 28.891 30.742 24.727 1.00 0.00 ? 52 ARG A HE     3  
ATOM 4943  H HH11   . ARG A 1 54 ? 31.792 28.913 23.838 1.00 0.00 ? 52 ARG A HH11   3  
ATOM 4944  H HH12   . ARG A 1 54 ? 32.129 28.634 25.548 1.00 0.00 ? 52 ARG A HH12   3  
ATOM 4945  H HH21   . ARG A 1 54 ? 29.382 29.989 26.773 1.00 0.00 ? 52 ARG A HH21   3  
ATOM 4946  H HH22   . ARG A 1 54 ? 30.903 29.120 27.006 1.00 0.00 ? 52 ARG A HH22   3  
ATOM 4947  N N      . ARG A 1 55 ? 33.628 34.682 23.594 1.00 0.00 ? 53 ARG A N      3  
ATOM 4948  C CA     . ARG A 1 55 ? 34.592 35.609 22.969 1.00 0.00 ? 53 ARG A CA     3  
ATOM 4949  C C      . ARG A 1 55 ? 36.002 35.007 22.900 1.00 0.00 ? 53 ARG A C      3  
ATOM 4950  O O      . ARG A 1 55 ? 36.641 35.057 21.853 1.00 0.00 ? 53 ARG A O      3  
ATOM 4951  C CB     . ARG A 1 55 ? 34.586 36.955 23.713 1.00 0.00 ? 53 ARG A CB     3  
ATOM 4952  C CG     . ARG A 1 55 ? 33.236 37.687 23.588 1.00 0.00 ? 53 ARG A CG     3  
ATOM 4953  C CD     . ARG A 1 55 ? 33.258 39.086 24.216 1.00 0.00 ? 53 ARG A CD     3  
ATOM 4954  N NE     . ARG A 1 55 ? 33.575 39.042 25.658 1.00 0.00 ? 53 ARG A NE     3  
ATOM 4955  C CZ     . ARG A 1 55 ? 32.786 39.284 26.686 1.00 0.00 ? 53 ARG A CZ     3  
ATOM 4956  N NH1    . ARG A 1 55 ? 31.537 39.635 26.555 1.00 0.00 ? 53 ARG A NH1    3  
ATOM 4957  N NH2    . ARG A 1 55 ? 33.260 39.177 27.892 1.00 0.00 1 53 ARG A NH2    3  
ATOM 4958  H H      . ARG A 1 55 ? 33.239 34.915 24.503 1.00 0.00 ? 53 ARG A H      3  
ATOM 4959  H HA     . ARG A 1 55 ? 34.301 35.786 21.931 1.00 0.00 ? 53 ARG A HA     3  
ATOM 4960  H HB2    . ARG A 1 55 ? 34.816 36.783 24.765 1.00 0.00 ? 53 ARG A HB2    3  
ATOM 4961  H HB3    . ARG A 1 55 ? 35.367 37.590 23.289 1.00 0.00 ? 53 ARG A HB3    3  
ATOM 4962  H HG2    . ARG A 1 55 ? 32.985 37.791 22.532 1.00 0.00 ? 53 ARG A HG2    3  
ATOM 4963  H HG3    . ARG A 1 55 ? 32.453 37.106 24.070 1.00 0.00 ? 53 ARG A HG3    3  
ATOM 4964  H HD2    . ARG A 1 55 ? 34.013 39.678 23.699 1.00 0.00 ? 53 ARG A HD2    3  
ATOM 4965  H HD3    . ARG A 1 55 ? 32.296 39.566 24.042 1.00 0.00 ? 53 ARG A HD3    3  
ATOM 4966  H HE     . ARG A 1 55 ? 34.539 38.825 25.893 1.00 0.00 ? 53 ARG A HE     3  
ATOM 4967  H HH11   . ARG A 1 55 ? 31.133 39.748 25.632 1.00 0.00 ? 53 ARG A HH11   3  
ATOM 4968  H HH12   . ARG A 1 55 ? 30.955 39.775 27.374 1.00 0.00 ? 53 ARG A HH12   3  
ATOM 4969  H HH21   . ARG A 1 55 ? 34.236 38.964 28.065 1.00 0.00 ? 53 ARG A HH21   3  
ATOM 4970  H HH22   . ARG A 1 55 ? 32.712 39.508 28.680 1.00 0.00 ? 53 ARG A HH22   3  
ATOM 4971  N N      . ALA A 1 56 ? 36.456 34.344 23.965 1.00 0.00 ? 54 ALA A N      3  
ATOM 4972  C CA     . ALA A 1 56 ? 37.766 33.690 24.007 1.00 0.00 ? 54 ALA A CA     3  
ATOM 4973  C C      . ALA A 1 56 ? 37.879 32.454 23.092 1.00 0.00 ? 54 ALA A C      3  
ATOM 4974  O O      . ALA A 1 56 ? 38.999 32.059 22.767 1.00 0.00 ? 54 ALA A O      3  
ATOM 4975  C CB     . ALA A 1 56 ? 38.116 33.352 25.459 1.00 0.00 ? 54 ALA A CB     3  
ATOM 4976  H H      . ALA A 1 56 ? 35.920 34.394 24.822 1.00 0.00 ? 54 ALA A H      3  
ATOM 4977  H HA     . ALA A 1 56 ? 38.505 34.412 23.654 1.00 0.00 ? 54 ALA A HA     3  
ATOM 4978  H HB1    . ALA A 1 56 ? 39.146 32.995 25.511 1.00 0.00 ? 54 ALA A HB1    3  
ATOM 4979  H HB2    . ALA A 1 56 ? 38.023 34.244 26.080 1.00 0.00 ? 54 ALA A HB2    3  
ATOM 4980  H HB3    . ALA A 1 56 ? 37.454 32.573 25.833 1.00 0.00 ? 54 ALA A HB3    3  
ATOM 4981  N N      . LYS A 1 57 ? 36.771 31.862 22.614 1.00 0.00 ? 55 LYS A N      3  
ATOM 4982  C CA     . LYS A 1 57 ? 36.782 30.730 21.662 1.00 0.00 ? 55 LYS A CA     3  
ATOM 4983  C C      . LYS A 1 57 ? 37.557 31.063 20.380 1.00 0.00 ? 55 LYS A C      3  
ATOM 4984  O O      . LYS A 1 57 ? 38.358 30.252 19.919 1.00 0.00 ? 55 LYS A O      3  
ATOM 4985  C CB     . LYS A 1 57 ? 35.335 30.296 21.337 1.00 0.00 ? 55 LYS A CB     3  
ATOM 4986  C CG     . LYS A 1 57 ? 35.186 28.768 21.231 1.00 0.00 ? 55 LYS A CG     3  
ATOM 4987  C CD     . LYS A 1 57 ? 35.110 28.122 22.625 1.00 0.00 ? 55 LYS A CD     3  
ATOM 4988  C CE     . LYS A 1 57 ? 35.047 26.594 22.555 1.00 0.00 ? 55 LYS A CE     3  
ATOM 4989  N NZ     . LYS A 1 57 ? 33.764 26.051 22.049 1.00 0.00 1 55 LYS A NZ     3  
ATOM 4990  H H      . LYS A 1 57 ? 35.875 32.159 22.987 1.00 0.00 ? 55 LYS A H      3  
ATOM 4991  H HA     . LYS A 1 57 ? 37.309 29.902 22.135 1.00 0.00 ? 55 LYS A HA     3  
ATOM 4992  H HB2    . LYS A 1 57 ? 34.647 30.651 22.104 1.00 0.00 ? 55 LYS A HB2    3  
ATOM 4993  H HB3    . LYS A 1 57 ? 35.024 30.748 20.394 1.00 0.00 ? 55 LYS A HB3    3  
ATOM 4994  H HG2    . LYS A 1 57 ? 34.271 28.539 20.687 1.00 0.00 ? 55 LYS A HG2    3  
ATOM 4995  H HG3    . LYS A 1 57 ? 36.027 28.355 20.673 1.00 0.00 ? 55 LYS A HG3    3  
ATOM 4996  H HD2    . LYS A 1 57 ? 36.003 28.389 23.191 1.00 0.00 ? 55 LYS A HD2    3  
ATOM 4997  H HD3    . LYS A 1 57 ? 34.245 28.503 23.168 1.00 0.00 ? 55 LYS A HD3    3  
ATOM 4998  H HE2    . LYS A 1 57 ? 35.867 26.245 21.927 1.00 0.00 ? 55 LYS A HE2    3  
ATOM 4999  H HE3    . LYS A 1 57 ? 35.224 26.203 23.561 1.00 0.00 ? 55 LYS A HE3    3  
ATOM 5000  H HZ1    . LYS A 1 57 ? 32.973 26.414 22.582 1.00 0.00 ? 55 LYS A HZ1    3  
ATOM 5001  H HZ2    . LYS A 1 57 ? 33.609 26.283 21.070 1.00 0.00 ? 55 LYS A HZ2    3  
ATOM 5002  H HZ3    . LYS A 1 57 ? 33.749 25.041 22.138 1.00 0.00 ? 55 LYS A HZ3    3  
ATOM 5003  N N      . TRP A 1 58 ? 37.429 32.302 19.898 1.00 0.00 ? 56 TRP A N      3  
ATOM 5004  C CA     . TRP A 1 58 ? 38.223 32.885 18.806 1.00 0.00 ? 56 TRP A CA     3  
ATOM 5005  C C      . TRP A 1 58 ? 39.737 32.731 19.030 1.00 0.00 ? 56 TRP A C      3  
ATOM 5006  O O      . TRP A 1 58 ? 40.480 32.406 18.106 1.00 0.00 ? 56 TRP A O      3  
ATOM 5007  C CB     . TRP A 1 58 ? 37.834 34.369 18.728 1.00 0.00 ? 56 TRP A CB     3  
ATOM 5008  C CG     . TRP A 1 58 ? 38.554 35.254 17.756 1.00 0.00 ? 56 TRP A CG     3  
ATOM 5009  C CD1    . TRP A 1 58 ? 38.992 34.910 16.523 1.00 0.00 ? 56 TRP A CD1    3  
ATOM 5010  C CD2    . TRP A 1 58 ? 38.898 36.666 17.919 1.00 0.00 ? 56 TRP A CD2    3  
ATOM 5011  N NE1    . TRP A 1 58 ? 39.552 36.012 15.910 1.00 0.00 ? 56 TRP A NE1    3  
ATOM 5012  C CE2    . TRP A 1 58 ? 39.535 37.118 16.725 1.00 0.00 ? 56 TRP A CE2    3  
ATOM 5013  C CE3    . TRP A 1 58 ? 38.733 37.614 18.954 1.00 0.00 ? 56 TRP A CE3    3  
ATOM 5014  C CZ2    . TRP A 1 58 ? 39.985 38.437 16.559 1.00 0.00 ? 56 TRP A CZ2    3  
ATOM 5015  C CZ3    . TRP A 1 58 ? 39.173 38.944 18.796 1.00 0.00 ? 56 TRP A CZ3    3  
ATOM 5016  C CH2    . TRP A 1 58 ? 39.792 39.358 17.603 1.00 0.00 ? 56 TRP A CH2    3  
ATOM 5017  H H      . TRP A 1 58 ? 36.749 32.902 20.345 1.00 0.00 ? 56 TRP A H      3  
ATOM 5018  H HA     . TRP A 1 58 ? 37.971 32.396 17.864 1.00 0.00 ? 56 TRP A HA     3  
ATOM 5019  H HB2    . TRP A 1 58 ? 36.769 34.435 18.507 1.00 0.00 ? 56 TRP A HB2    3  
ATOM 5020  H HB3    . TRP A 1 58 ? 37.987 34.807 19.713 1.00 0.00 ? 56 TRP A HB3    3  
ATOM 5021  H HD1    . TRP A 1 58 ? 38.900 33.924 16.081 1.00 0.00 ? 56 TRP A HD1    3  
ATOM 5022  H HE1    . TRP A 1 58 ? 39.947 35.992 14.974 1.00 0.00 ? 56 TRP A HE1    3  
ATOM 5023  H HE3    . TRP A 1 58 ? 38.248 37.316 19.874 1.00 0.00 ? 56 TRP A HE3    3  
ATOM 5024  H HZ2    . TRP A 1 58 ? 40.444 38.744 15.630 1.00 0.00 ? 56 TRP A HZ2    3  
ATOM 5025  H HZ3    . TRP A 1 58 ? 39.013 39.661 19.589 1.00 0.00 ? 56 TRP A HZ3    3  
ATOM 5026  H HH2    . TRP A 1 58 ? 40.098 40.390 17.482 1.00 0.00 ? 56 TRP A HH2    3  
ATOM 5027  N N      . ARG A 1 59 ? 40.195 32.891 20.278 1.00 0.00 ? 57 ARG A N      3  
ATOM 5028  C CA     . ARG A 1 59 ? 41.607 32.801 20.674 1.00 0.00 ? 57 ARG A CA     3  
ATOM 5029  C C      . ARG A 1 59 ? 42.040 31.368 21.008 1.00 0.00 ? 57 ARG A C      3  
ATOM 5030  O O      . ARG A 1 59 ? 43.147 30.960 20.663 1.00 0.00 ? 57 ARG A O      3  
ATOM 5031  C CB     . ARG A 1 59 ? 41.876 33.741 21.866 1.00 0.00 ? 57 ARG A CB     3  
ATOM 5032  C CG     . ARG A 1 59 ? 41.279 35.163 21.780 1.00 0.00 ? 57 ARG A CG     3  
ATOM 5033  C CD     . ARG A 1 59 ? 41.536 35.929 20.475 1.00 0.00 ? 57 ARG A CD     3  
ATOM 5034  N NE     . ARG A 1 59 ? 42.947 35.897 20.067 1.00 0.00 ? 57 ARG A NE     3  
ATOM 5035  C CZ     . ARG A 1 59 ? 43.971 36.538 20.589 1.00 0.00 ? 57 ARG A CZ     3  
ATOM 5036  N NH1    . ARG A 1 59 ? 43.872 37.326 21.616 1.00 0.00 ? 57 ARG A NH1    3  
ATOM 5037  N NH2    . ARG A 1 59 ? 45.158 36.389 20.086 1.00 0.00 1 57 ARG A NH2    3  
ATOM 5038  H H      . ARG A 1 59 ? 39.512 33.079 21.003 1.00 0.00 ? 57 ARG A H      3  
ATOM 5039  H HA     . ARG A 1 59 ? 42.230 33.124 19.838 1.00 0.00 ? 57 ARG A HA     3  
ATOM 5040  H HB2    . ARG A 1 59 ? 41.486 33.279 22.773 1.00 0.00 ? 57 ARG A HB2    3  
ATOM 5041  H HB3    . ARG A 1 59 ? 42.958 33.824 21.991 1.00 0.00 ? 57 ARG A HB3    3  
ATOM 5042  H HG2    . ARG A 1 59 ? 40.200 35.107 21.934 1.00 0.00 ? 57 ARG A HG2    3  
ATOM 5043  H HG3    . ARG A 1 59 ? 41.692 35.746 22.598 1.00 0.00 ? 57 ARG A HG3    3  
ATOM 5044  H HD2    . ARG A 1 59 ? 40.937 35.485 19.679 1.00 0.00 ? 57 ARG A HD2    3  
ATOM 5045  H HD3    . ARG A 1 59 ? 41.208 36.964 20.598 1.00 0.00 ? 57 ARG A HD3    3  
ATOM 5046  H HE     . ARG A 1 59 ? 43.179 35.325 19.262 1.00 0.00 ? 57 ARG A HE     3  
ATOM 5047  H HH11   . ARG A 1 59 ? 42.988 37.490 22.075 1.00 0.00 ? 57 ARG A HH11   3  
ATOM 5048  H HH12   . ARG A 1 59 ? 44.709 37.810 21.921 1.00 0.00 ? 57 ARG A HH12   3  
ATOM 5049  H HH21   . ARG A 1 59 ? 45.310 35.754 19.315 1.00 0.00 ? 57 ARG A HH21   3  
ATOM 5050  H HH22   . ARG A 1 59 ? 45.918 36.924 20.490 1.00 0.00 ? 57 ARG A HH22   3  
ATOM 5051  N N      . LYS A 1 60 ? 41.178 30.581 21.656 1.00 0.00 ? 58 LYS A N      3  
ATOM 5052  C CA     . LYS A 1 60 ? 41.494 29.231 22.168 1.00 0.00 ? 58 LYS A CA     3  
ATOM 5053  C C      . LYS A 1 60 ? 41.240 28.088 21.177 1.00 0.00 ? 58 LYS A C      3  
ATOM 5054  O O      . LYS A 1 60 ? 41.816 27.012 21.344 1.00 0.00 ? 58 LYS A O      3  
ATOM 5055  C CB     . LYS A 1 60 ? 40.782 29.025 23.518 1.00 0.00 ? 58 LYS A CB     3  
ATOM 5056  C CG     . LYS A 1 60 ? 41.502 29.821 24.622 1.00 0.00 ? 58 LYS A CG     3  
ATOM 5057  C CD     . LYS A 1 60 ? 40.803 29.726 25.984 1.00 0.00 ? 58 LYS A CD     3  
ATOM 5058  C CE     . LYS A 1 60 ? 41.767 30.182 27.088 1.00 0.00 ? 58 LYS A CE     3  
ATOM 5059  N NZ     . LYS A 1 60 ? 41.058 30.434 28.362 1.00 0.00 1 58 LYS A NZ     3  
ATOM 5060  H H      . LYS A 1 60 ? 40.305 31.010 21.946 1.00 0.00 ? 58 LYS A H      3  
ATOM 5061  H HA     . LYS A 1 60 ? 42.568 29.172 22.365 1.00 0.00 ? 58 LYS A HA     3  
ATOM 5062  H HB2    . LYS A 1 60 ? 39.738 29.336 23.444 1.00 0.00 ? 58 LYS A HB2    3  
ATOM 5063  H HB3    . LYS A 1 60 ? 40.811 27.967 23.783 1.00 0.00 ? 58 LYS A HB3    3  
ATOM 5064  H HG2    . LYS A 1 60 ? 42.517 29.433 24.714 1.00 0.00 ? 58 LYS A HG2    3  
ATOM 5065  H HG3    . LYS A 1 60 ? 41.562 30.872 24.340 1.00 0.00 ? 58 LYS A HG3    3  
ATOM 5066  H HD2    . LYS A 1 60 ? 39.914 30.359 25.970 1.00 0.00 ? 58 LYS A HD2    3  
ATOM 5067  H HD3    . LYS A 1 60 ? 40.506 28.695 26.180 1.00 0.00 ? 58 LYS A HD3    3  
ATOM 5068  H HE2    . LYS A 1 60 ? 42.521 29.401 27.227 1.00 0.00 ? 58 LYS A HE2    3  
ATOM 5069  H HE3    . LYS A 1 60 ? 42.289 31.091 26.773 1.00 0.00 ? 58 LYS A HE3    3  
ATOM 5070  H HZ1    . LYS A 1 60 ? 40.259 29.816 28.480 1.00 0.00 ? 58 LYS A HZ1    3  
ATOM 5071  H HZ2    . LYS A 1 60 ? 41.681 30.307 29.154 1.00 0.00 ? 58 LYS A HZ2    3  
ATOM 5072  H HZ3    . LYS A 1 60 ? 40.720 31.394 28.416 1.00 0.00 ? 58 LYS A HZ3    3  
ATOM 5073  N N      . ARG A 1 61 ? 40.437 28.311 20.128 1.00 0.00 ? 59 ARG A N      3  
ATOM 5074  C CA     . ARG A 1 61 ? 40.127 27.333 19.061 1.00 0.00 ? 59 ARG A CA     3  
ATOM 5075  C C      . ARG A 1 61 ? 40.622 27.767 17.669 1.00 0.00 ? 59 ARG A C      3  
ATOM 5076  O O      . ARG A 1 61 ? 40.808 26.908 16.805 1.00 0.00 ? 59 ARG A O      3  
ATOM 5077  C CB     . ARG A 1 61 ? 38.610 27.037 19.118 1.00 0.00 ? 59 ARG A CB     3  
ATOM 5078  C CG     . ARG A 1 61 ? 38.165 25.744 18.410 1.00 0.00 ? 59 ARG A CG     3  
ATOM 5079  C CD     . ARG A 1 61 ? 36.696 25.437 18.748 1.00 0.00 ? 59 ARG A CD     3  
ATOM 5080  N NE     . ARG A 1 61 ? 36.184 24.231 18.060 1.00 0.00 ? 59 ARG A NE     3  
ATOM 5081  C CZ     . ARG A 1 61 ? 36.053 23.010 18.552 1.00 0.00 ? 59 ARG A CZ     3  
ATOM 5082  N NH1    . ARG A 1 61 ? 36.466 22.659 19.730 1.00 0.00 1 59 ARG A NH1    3  
ATOM 5083  N NH2    . ARG A 1 61 ? 35.473 22.068 17.873 1.00 0.00 ? 59 ARG A NH2    3  
ATOM 5084  H H      . ARG A 1 61 ? 39.918 29.183 20.129 1.00 0.00 ? 59 ARG A H      3  
ATOM 5085  H HA     . ARG A 1 61 ? 40.651 26.400 19.275 1.00 0.00 ? 59 ARG A HA     3  
ATOM 5086  H HB2    . ARG A 1 61 ? 38.326 26.946 20.169 1.00 0.00 ? 59 ARG A HB2    3  
ATOM 5087  H HB3    . ARG A 1 61 ? 38.060 27.880 18.696 1.00 0.00 ? 59 ARG A HB3    3  
ATOM 5088  H HG2    . ARG A 1 61 ? 38.272 25.863 17.331 1.00 0.00 ? 59 ARG A HG2    3  
ATOM 5089  H HG3    . ARG A 1 61 ? 38.787 24.914 18.742 1.00 0.00 ? 59 ARG A HG3    3  
ATOM 5090  H HD2    . ARG A 1 61 ? 36.592 25.324 19.828 1.00 0.00 ? 59 ARG A HD2    3  
ATOM 5091  H HD3    . ARG A 1 61 ? 36.086 26.290 18.448 1.00 0.00 ? 59 ARG A HD3    3  
ATOM 5092  H HE     . ARG A 1 61 ? 35.872 24.348 17.102 1.00 0.00 ? 59 ARG A HE     3  
ATOM 5093  H HH11   . ARG A 1 61 ? 36.743 23.366 20.407 1.00 0.00 ? 59 ARG A HH11   3  
ATOM 5094  H HH12   . ARG A 1 61 ? 36.230 21.729 20.052 1.00 0.00 ? 59 ARG A HH12   3  
ATOM 5095  H HH21   . ARG A 1 61 ? 34.900 22.295 17.066 1.00 0.00 ? 59 ARG A HH21   3  
ATOM 5096  H HH22   . ARG A 1 61 ? 35.386 21.166 18.316 1.00 0.00 ? 59 ARG A HH22   3  
ATOM 5097  N N      . GLU A 1 62 ? 40.879 29.062 17.441 1.00 0.00 ? 60 GLU A N      3  
ATOM 5098  C CA     . GLU A 1 62 ? 41.290 29.618 16.129 1.00 0.00 ? 60 GLU A CA     3  
ATOM 5099  C C      . GLU A 1 62 ? 42.494 30.589 16.158 1.00 0.00 ? 60 GLU A C      3  
ATOM 5100  O O      . GLU A 1 62 ? 42.922 31.064 15.104 1.00 0.00 ? 60 GLU A O      3  
ATOM 5101  C CB     . GLU A 1 62 ? 40.068 30.244 15.430 1.00 0.00 ? 60 GLU A CB     3  
ATOM 5102  C CG     . GLU A 1 62 ? 39.044 29.162 15.075 1.00 0.00 ? 60 GLU A CG     3  
ATOM 5103  C CD     . GLU A 1 62 ? 37.984 29.642 14.085 1.00 0.00 ? 60 GLU A CD     3  
ATOM 5104  O OE1    . GLU A 1 62 ? 36.930 30.166 14.527 1.00 0.00 ? 60 GLU A OE1    3  
ATOM 5105  O OE2    . GLU A 1 62 ? 38.141 29.376 12.872 1.00 0.00 ? 60 GLU A OE2    3  
ATOM 5106  H H      . GLU A 1 62 ? 40.629 29.722 18.162 1.00 0.00 ? 60 GLU A H      3  
ATOM 5107  H HA     . GLU A 1 62 ? 41.626 28.809 15.486 1.00 0.00 ? 60 GLU A HA     3  
ATOM 5108  H HB2    . GLU A 1 62 ? 39.602 30.996 16.067 1.00 0.00 ? 60 GLU A HB2    3  
ATOM 5109  H HB3    . GLU A 1 62 ? 40.391 30.724 14.512 1.00 0.00 ? 60 GLU A HB3    3  
ATOM 5110  H HG2    . GLU A 1 62 ? 39.570 28.312 14.634 1.00 0.00 ? 60 GLU A HG2    3  
ATOM 5111  H HG3    . GLU A 1 62 ? 38.554 28.815 15.987 1.00 0.00 ? 60 GLU A HG3    3  
ATOM 5112  N N      . GLU A 1 63 ? 43.066 30.856 17.337 1.00 0.00 ? 61 GLU A N      3  
ATOM 5113  C CA     . GLU A 1 63 ? 44.122 31.843 17.652 1.00 0.00 ? 61 GLU A CA     3  
ATOM 5114  C C      . GLU A 1 63 ? 43.804 33.315 17.311 1.00 0.00 ? 61 GLU A C      3  
ATOM 5115  O O      . GLU A 1 63 ? 43.972 34.191 18.159 1.00 0.00 ? 61 GLU A O      3  
ATOM 5116  C CB     . GLU A 1 63 ? 45.493 31.400 17.104 1.00 0.00 ? 61 GLU A CB     3  
ATOM 5117  C CG     . GLU A 1 63 ? 46.598 31.812 18.087 1.00 0.00 ? 61 GLU A CG     3  
ATOM 5118  C CD     . GLU A 1 63 ? 48.008 31.770 17.488 1.00 0.00 ? 61 GLU A CD     3  
ATOM 5119  O OE1    . GLU A 1 63 ? 48.372 30.753 16.849 1.00 0.00 ? 61 GLU A OE1    3  
ATOM 5120  O OE2    . GLU A 1 63 ? 48.778 32.744 17.689 1.00 0.00 ? 61 GLU A OE2    3  
ATOM 5121  H H      . GLU A 1 63 ? 42.683 30.374 18.134 1.00 0.00 ? 61 GLU A H      3  
ATOM 5122  H HA     . GLU A 1 63 ? 44.219 31.832 18.733 1.00 0.00 ? 61 GLU A HA     3  
ATOM 5123  H HB2    . GLU A 1 63 ? 45.519 30.315 16.989 1.00 0.00 ? 61 GLU A HB2    3  
ATOM 5124  H HB3    . GLU A 1 63 ? 45.664 31.857 16.129 1.00 0.00 ? 61 GLU A HB3    3  
ATOM 5125  H HG2    . GLU A 1 63 ? 46.390 32.818 18.444 1.00 0.00 ? 61 GLU A HG2    3  
ATOM 5126  H HG3    . GLU A 1 63 ? 46.556 31.149 18.952 1.00 0.00 ? 61 GLU A HG3    3  
ATOM 5127  N N      . PHE A 1 64 ? 43.346 33.593 16.092 1.00 0.00 ? 62 PHE A N      3  
ATOM 5128  C CA     . PHE A 1 64 ? 42.893 34.897 15.586 1.00 0.00 ? 62 PHE A CA     3  
ATOM 5129  C C      . PHE A 1 64 ? 41.998 34.782 14.330 1.00 0.00 ? 62 PHE A C      3  
ATOM 5130  O O      . PHE A 1 64 ? 41.500 35.802 13.841 1.00 0.00 ? 62 PHE A O      3  
ATOM 5131  C CB     . PHE A 1 64 ? 44.120 35.777 15.277 1.00 0.00 ? 62 PHE A CB     3  
ATOM 5132  C CG     . PHE A 1 64 ? 45.160 35.105 14.400 1.00 0.00 ? 62 PHE A CG     3  
ATOM 5133  C CD1    . PHE A 1 64 ? 44.962 34.991 13.010 1.00 0.00 ? 62 PHE A CD1    3  
ATOM 5134  C CD2    . PHE A 1 64 ? 46.300 34.531 14.991 1.00 0.00 ? 62 PHE A CD2    3  
ATOM 5135  C CE1    . PHE A 1 64 ? 45.883 34.276 12.224 1.00 0.00 ? 62 PHE A CE1    3  
ATOM 5136  C CE2    . PHE A 1 64 ? 47.223 33.825 14.205 1.00 0.00 ? 62 PHE A CE2    3  
ATOM 5137  C CZ     . PHE A 1 64 ? 47.008 33.686 12.824 1.00 0.00 ? 62 PHE A CZ     3  
ATOM 5138  H H      . PHE A 1 64 ? 43.290 32.798 15.468 1.00 0.00 ? 62 PHE A H      3  
ATOM 5139  H HA     . PHE A 1 64 ? 42.301 35.389 16.358 1.00 0.00 ? 62 PHE A HA     3  
ATOM 5140  H HB2    . PHE A 1 64 ? 43.796 36.703 14.801 1.00 0.00 ? 62 PHE A HB2    3  
ATOM 5141  H HB3    . PHE A 1 64 ? 44.587 36.055 16.222 1.00 0.00 ? 62 PHE A HB3    3  
ATOM 5142  H HD1    . PHE A 1 64 ? 44.091 35.429 12.543 1.00 0.00 ? 62 PHE A HD1    3  
ATOM 5143  H HD2    . PHE A 1 64 ? 46.453 34.609 16.058 1.00 0.00 ? 62 PHE A HD2    3  
ATOM 5144  H HE1    . PHE A 1 64 ? 45.713 34.167 11.162 1.00 0.00 ? 62 PHE A HE1    3  
ATOM 5145  H HE2    . PHE A 1 64 ? 48.088 33.375 14.670 1.00 0.00 ? 62 PHE A HE2    3  
ATOM 5146  H HZ     . PHE A 1 64 ? 47.708 33.124 12.224 1.00 0.00 ? 62 PHE A HZ     3  
ATOM 5147  N N      . ILE A 1 65 ? 41.781 33.576 13.787 1.00 0.00 ? 63 ILE A N      3  
ATOM 5148  C CA     . ILE A 1 65 ? 41.073 33.377 12.513 1.00 0.00 ? 63 ILE A CA     3  
ATOM 5149  C C      . ILE A 1 65 ? 39.558 33.571 12.701 1.00 0.00 ? 63 ILE A C      3  
ATOM 5150  O O      . ILE A 1 65 ? 38.941 33.007 13.607 1.00 0.00 ? 63 ILE A O      3  
ATOM 5151  C CB     . ILE A 1 65 ? 41.437 32.016 11.865 1.00 0.00 ? 63 ILE A CB     3  
ATOM 5152  C CG1    . ILE A 1 65 ? 42.970 31.873 11.685 1.00 0.00 ? 63 ILE A CG1    3  
ATOM 5153  C CG2    . ILE A 1 65 ? 40.738 31.850 10.501 1.00 0.00 ? 63 ILE A CG2    3  
ATOM 5154  C CD1    . ILE A 1 65 ? 43.423 30.515 11.129 1.00 0.00 ? 63 ILE A CD1    3  
ATOM 5155  H H      . ILE A 1 65 ? 42.159 32.753 14.240 1.00 0.00 ? 63 ILE A H      3  
ATOM 5156  H HA     . ILE A 1 65 ? 41.416 34.152 11.828 1.00 0.00 ? 63 ILE A HA     3  
ATOM 5157  H HB     . ILE A 1 65 ? 41.092 31.215 12.515 1.00 0.00 ? 63 ILE A HB     3  
ATOM 5158  H HG12   . ILE A 1 65 ? 43.329 32.659 11.021 1.00 0.00 ? 63 ILE A HG12   3  
ATOM 5159  H HG13   . ILE A 1 65 ? 43.465 32.003 12.645 1.00 0.00 ? 63 ILE A HG13   3  
ATOM 5160  H HG21   . ILE A 1 65 ? 41.146 32.554 9.777  1.00 0.00 ? 63 ILE A HG21   3  
ATOM 5161  H HG22   . ILE A 1 65 ? 40.877 30.837 10.131 1.00 0.00 ? 63 ILE A HG22   3  
ATOM 5162  H HG23   . ILE A 1 65 ? 39.665 32.008 10.589 1.00 0.00 ? 63 ILE A HG23   3  
ATOM 5163  H HD11   . ILE A 1 65 ? 44.511 30.472 11.126 1.00 0.00 ? 63 ILE A HD11   3  
ATOM 5164  H HD12   . ILE A 1 65 ? 43.037 29.709 11.756 1.00 0.00 ? 63 ILE A HD12   3  
ATOM 5165  H HD13   . ILE A 1 65 ? 43.077 30.382 10.105 1.00 0.00 ? 63 ILE A HD13   3  
ATOM 5166  N N      . VAL A 1 66 ? 38.965 34.403 11.841 1.00 0.00 ? 64 VAL A N      3  
ATOM 5167  C CA     . VAL A 1 66 ? 37.518 34.670 11.741 1.00 0.00 ? 64 VAL A CA     3  
ATOM 5168  C C      . VAL A 1 66 ? 37.198 35.255 10.356 1.00 0.00 ? 64 VAL A C      3  
ATOM 5169  O O      . VAL A 1 66 ? 38.070 35.891 9.748  1.00 0.00 ? 64 VAL A O      3  
ATOM 5170  C CB     . VAL A 1 66 ? 37.061 35.599 12.892 1.00 0.00 ? 64 VAL A CB     3  
ATOM 5171  C CG1    . VAL A 1 66 ? 37.687 36.999 12.862 1.00 0.00 ? 64 VAL A CG1    3  
ATOM 5172  C CG2    . VAL A 1 66 ? 35.541 35.744 12.954 1.00 0.00 ? 64 VAL A CG2    3  
ATOM 5173  H H      . VAL A 1 66 ? 39.557 34.859 11.160 1.00 0.00 ? 64 VAL A H      3  
ATOM 5174  H HA     . VAL A 1 66 ? 36.987 33.721 11.837 1.00 0.00 ? 64 VAL A HA     3  
ATOM 5175  H HB     . VAL A 1 66 ? 37.363 35.135 13.830 1.00 0.00 ? 64 VAL A HB     3  
ATOM 5176  H HG11   . VAL A 1 66 ? 38.772 36.922 12.884 1.00 0.00 ? 64 VAL A HG11   3  
ATOM 5177  H HG12   . VAL A 1 66 ? 37.378 37.538 11.966 1.00 0.00 ? 64 VAL A HG12   3  
ATOM 5178  H HG13   . VAL A 1 66 ? 37.366 37.562 13.739 1.00 0.00 ? 64 VAL A HG13   3  
ATOM 5179  H HG21   . VAL A 1 66 ? 35.173 36.323 12.110 1.00 0.00 ? 64 VAL A HG21   3  
ATOM 5180  H HG22   . VAL A 1 66 ? 35.076 34.759 12.958 1.00 0.00 ? 64 VAL A HG22   3  
ATOM 5181  H HG23   . VAL A 1 66 ? 35.269 36.262 13.874 1.00 0.00 ? 64 VAL A HG23   3  
ATOM 5182  N N      . THR A 1 67 ? 35.982 35.061 9.830  1.00 0.00 ? 65 THR A N      3  
ATOM 5183  C CA     . THR A 1 67 ? 35.570 35.701 8.562  1.00 0.00 ? 65 THR A CA     3  
ATOM 5184  C C      . THR A 1 67 ? 35.401 37.218 8.741  1.00 0.00 ? 65 THR A C      3  
ATOM 5185  O O      . THR A 1 67 ? 34.842 37.681 9.742  1.00 0.00 ? 65 THR A O      3  
ATOM 5186  C CB     . THR A 1 67 ? 34.314 35.076 7.920  1.00 0.00 ? 65 THR A CB     3  
ATOM 5187  O OG1    . THR A 1 67 ? 33.159 35.227 8.710  1.00 0.00 ? 65 THR A OG1    3  
ATOM 5188  C CG2    . THR A 1 67 ? 34.432 33.578 7.641  1.00 0.00 ? 65 THR A CG2    3  
ATOM 5189  H H      . THR A 1 67 ? 35.291 34.534 10.351 1.00 0.00 ? 65 THR A H      3  
ATOM 5190  H HA     . THR A 1 67 ? 36.378 35.555 7.846  1.00 0.00 ? 65 THR A HA     3  
ATOM 5191  H HB     . THR A 1 67 ? 34.137 35.581 6.970  1.00 0.00 ? 65 THR A HB     3  
ATOM 5192  H HG1    . THR A 1 67 ? 33.276 34.661 9.494  1.00 0.00 ? 65 THR A HG1    3  
ATOM 5193  H HG21   . THR A 1 67 ? 34.698 33.037 8.547  1.00 0.00 ? 65 THR A HG21   3  
ATOM 5194  H HG22   . THR A 1 67 ? 33.485 33.198 7.259  1.00 0.00 ? 65 THR A HG22   3  
ATOM 5195  H HG23   . THR A 1 67 ? 35.195 33.399 6.891  1.00 0.00 ? 65 THR A HG23   3  
ATOM 5196  N N      . ASP A 1 68 ? 35.920 38.003 7.789  1.00 0.00 ? 66 ASP A N      3  
ATOM 5197  C CA     . ASP A 1 68 ? 35.892 39.480 7.796  1.00 0.00 ? 66 ASP A CA     3  
ATOM 5198  C C      . ASP A 1 68 ? 35.835 40.130 6.397  1.00 0.00 ? 66 ASP A C      3  
ATOM 5199  O O      . ASP A 1 68 ? 35.614 39.406 5.397  1.00 0.00 ? 66 ASP A O      3  
ATOM 5200  C CB     . ASP A 1 68 ? 37.033 40.012 8.694  1.00 0.00 ? 66 ASP A CB     3  
ATOM 5201  C CG     . ASP A 1 68 ? 38.491 39.828 8.239  1.00 0.00 ? 66 ASP A CG     3  
ATOM 5202  O OD1    . ASP A 1 68 ? 38.802 39.559 7.054  1.00 0.00 ? 66 ASP A OD1    3  
ATOM 5203  O OD2    . ASP A 1 68 ? 39.380 39.981 9.116  1.00 0.00 ? 66 ASP A OD2    3  
ATOM 5204  O OXT    . ASP A 1 68 ? 35.883 41.376 6.289  1.00 0.00 ? 66 ASP A OXT    3  
ATOM 5205  H H      . ASP A 1 68 ? 36.373 37.558 7.000  1.00 0.00 ? 66 ASP A H      3  
ATOM 5206  H HA     . ASP A 1 68 ? 34.965 39.783 8.276  1.00 0.00 ? 66 ASP A HA     3  
ATOM 5207  H HB2    . ASP A 1 68 ? 36.867 41.072 8.857  1.00 0.00 ? 66 ASP A HB2    3  
ATOM 5208  H HB3    . ASP A 1 68 ? 36.930 39.544 9.674  1.00 0.00 ? 66 ASP A HB3    3  
ATOM 5209  O "O5'"  . DG  B 2 1  ? 53.146 12.149 29.850 1.00 0.00 ? 67 DG  B "O5'"  3  
ATOM 5210  C "C5'"  . DG  B 2 1  ? 53.339 11.967 28.448 1.00 0.00 ? 67 DG  B "C5'"  3  
ATOM 5211  C "C4'"  . DG  B 2 1  ? 52.255 12.663 27.609 1.00 0.00 ? 67 DG  B "C4'"  3  
ATOM 5212  O "O4'"  . DG  B 2 1  ? 50.987 12.145 27.977 1.00 0.00 ? 67 DG  B "O4'"  3  
ATOM 5213  C "C3'"  . DG  B 2 1  ? 52.223 14.192 27.790 1.00 0.00 ? 67 DG  B "C3'"  3  
ATOM 5214  O "O3'"  . DG  B 2 1  ? 52.636 14.820 26.578 1.00 0.00 ? 67 DG  B "O3'"  3  
ATOM 5215  C "C2'"  . DG  B 2 1  ? 50.773 14.474 28.206 1.00 0.00 ? 67 DG  B "C2'"  3  
ATOM 5216  C "C1'"  . DG  B 2 1  ? 50.025 13.178 27.913 1.00 0.00 ? 67 DG  B "C1'"  3  
ATOM 5217  N N9     . DG  B 2 1  ? 48.963 12.858 28.896 1.00 0.00 ? 67 DG  B N9     3  
ATOM 5218  C C8     . DG  B 2 1  ? 49.002 12.935 30.269 1.00 0.00 ? 67 DG  B C8     3  
ATOM 5219  N N7     . DG  B 2 1  ? 47.996 12.362 30.871 1.00 0.00 ? 67 DG  B N7     3  
ATOM 5220  C C5     . DG  B 2 1  ? 47.190 11.930 29.811 1.00 0.00 ? 67 DG  B C5     3  
ATOM 5221  C C6     . DG  B 2 1  ? 45.952 11.203 29.795 1.00 0.00 ? 67 DG  B C6     3  
ATOM 5222  O O6     . DG  B 2 1  ? 45.334 10.700 30.733 1.00 0.00 ? 67 DG  B O6     3  
ATOM 5223  N N1     . DG  B 2 1  ? 45.438 11.020 28.530 1.00 0.00 ? 67 DG  B N1     3  
ATOM 5224  C C2     . DG  B 2 1  ? 46.072 11.403 27.400 1.00 0.00 ? 67 DG  B C2     3  
ATOM 5225  N N2     . DG  B 2 1  ? 45.481 11.128 26.271 1.00 0.00 ? 67 DG  B N2     3  
ATOM 5226  N N3     . DG  B 2 1  ? 47.262 11.999 27.351 1.00 0.00 ? 67 DG  B N3     3  
ATOM 5227  C C4     . DG  B 2 1  ? 47.761 12.261 28.599 1.00 0.00 ? 67 DG  B C4     3  
ATOM 5228  H "H5'"  . DG  B 2 1  ? 53.325 10.900 28.215 1.00 0.00 ? 67 DG  B "H5'"  3  
ATOM 5229  H "H5''" . DG  B 2 1  ? 54.313 12.366 28.160 1.00 0.00 ? 67 DG  B "H5''" 3  
ATOM 5230  H "H4'"  . DG  B 2 1  ? 52.429 12.440 26.554 1.00 0.00 ? 67 DG  B "H4'"  3  
ATOM 5231  H "H3'"  . DG  B 2 1  ? 52.895 14.479 28.597 1.00 0.00 ? 67 DG  B "H3'"  3  
ATOM 5232  H "H2'"  . DG  B 2 1  ? 50.744 14.717 29.263 1.00 0.00 ? 67 DG  B "H2'"  3  
ATOM 5233  H "H2''" . DG  B 2 1  ? 50.324 15.288 27.651 1.00 0.00 ? 67 DG  B "H2''" 3  
ATOM 5234  H "H1'"  . DG  B 2 1  ? 49.603 13.231 26.905 1.00 0.00 ? 67 DG  B "H1'"  3  
ATOM 5235  H H8     . DG  B 2 1  ? 49.837 13.368 30.806 1.00 0.00 ? 67 DG  B H8     3  
ATOM 5236  H H1     . DG  B 2 1  ? 44.544 10.560 28.461 1.00 0.00 ? 67 DG  B H1     3  
ATOM 5237  H H21    . DG  B 2 1  ? 45.958 11.379 25.419 1.00 0.00 ? 67 DG  B H21    3  
ATOM 5238  H H22    . DG  B 2 1  ? 44.566 10.697 26.273 1.00 0.00 ? 67 DG  B H22    3  
ATOM 5239  H "HO5'" . DG  B 2 1  ? 52.300 11.718 30.110 1.00 0.00 ? 67 DG  B "HO5'" 3  
ATOM 5240  P P      . DC  B 2 2  ? 52.529 16.398 26.296 1.00 0.00 ? 68 DC  B P      3  
ATOM 5241  O OP1    . DC  B 2 2  ? 53.491 16.712 25.219 1.00 0.00 ? 68 DC  B OP1    3  
ATOM 5242  O OP2    . DC  B 2 2  ? 52.640 17.135 27.576 1.00 0.00 ? 68 DC  B OP2    3  
ATOM 5243  O "O5'"  . DC  B 2 2  ? 51.057 16.553 25.699 1.00 0.00 ? 68 DC  B "O5'"  3  
ATOM 5244  C "C5'"  . DC  B 2 2  ? 50.700 15.866 24.500 1.00 0.00 ? 68 DC  B "C5'"  3  
ATOM 5245  C "C4'"  . DC  B 2 2  ? 49.190 15.779 24.247 1.00 0.00 ? 68 DC  B "C4'"  3  
ATOM 5246  O "O4'"  . DC  B 2 2  ? 48.533 15.127 25.332 1.00 0.00 ? 68 DC  B "O4'"  3  
ATOM 5247  C "C3'"  . DC  B 2 2  ? 48.515 17.144 24.036 1.00 0.00 ? 68 DC  B "C3'"  3  
ATOM 5248  O "O3'"  . DC  B 2 2  ? 47.918 17.198 22.740 1.00 0.00 ? 68 DC  B "O3'"  3  
ATOM 5249  C "C2'"  . DC  B 2 2  ? 47.483 17.182 25.164 1.00 0.00 ? 68 DC  B "C2'"  3  
ATOM 5250  C "C1'"  . DC  B 2 2  ? 47.251 15.705 25.481 1.00 0.00 ? 68 DC  B "C1'"  3  
ATOM 5251  N N1     . DC  B 2 2  ? 46.726 15.464 26.857 1.00 0.00 ? 68 DC  B N1     3  
ATOM 5252  C C2     . DC  B 2 2  ? 45.496 14.812 27.038 1.00 0.00 ? 68 DC  B C2     3  
ATOM 5253  O O2     . DC  B 2 2  ? 44.798 14.472 26.081 1.00 0.00 ? 68 DC  B O2     3  
ATOM 5254  N N3     . DC  B 2 2  ? 45.026 14.536 28.281 1.00 0.00 ? 68 DC  B N3     3  
ATOM 5255  C C4     . DC  B 2 2  ? 45.740 14.926 29.321 1.00 0.00 ? 68 DC  B C4     3  
ATOM 5256  N N4     . DC  B 2 2  ? 45.286 14.616 30.501 1.00 0.00 ? 68 DC  B N4     3  
ATOM 5257  C C5     . DC  B 2 2  ? 46.982 15.608 29.201 1.00 0.00 ? 68 DC  B C5     3  
ATOM 5258  C C6     . DC  B 2 2  ? 47.445 15.864 27.955 1.00 0.00 ? 68 DC  B C6     3  
ATOM 5259  H "H5'"  . DC  B 2 2  ? 51.075 14.842 24.547 1.00 0.00 ? 68 DC  B "H5'"  3  
ATOM 5260  H "H5''" . DC  B 2 2  ? 51.173 16.356 23.647 1.00 0.00 ? 68 DC  B "H5''" 3  
ATOM 5261  H "H4'"  . DC  B 2 2  ? 49.042 15.181 23.346 1.00 0.00 ? 68 DC  B "H4'"  3  
ATOM 5262  H "H3'"  . DC  B 2 2  ? 49.239 17.954 24.156 1.00 0.00 ? 68 DC  B "H3'"  3  
ATOM 5263  H "H2'"  . DC  B 2 2  ? 47.920 17.707 26.012 1.00 0.00 ? 68 DC  B "H2'"  3  
ATOM 5264  H "H2''" . DC  B 2 2  ? 46.558 17.666 24.864 1.00 0.00 ? 68 DC  B "H2''" 3  
ATOM 5265  H "H1'"  . DC  B 2 2  ? 46.574 15.286 24.728 1.00 0.00 ? 68 DC  B "H1'"  3  
ATOM 5266  H H41    . DC  B 2 2  ? 44.406 14.125 30.591 1.00 0.00 ? 68 DC  B H41    3  
ATOM 5267  H H42    . DC  B 2 2  ? 45.807 14.895 31.317 1.00 0.00 ? 68 DC  B H42    3  
ATOM 5268  H H5     . DC  B 2 2  ? 47.551 15.919 30.060 1.00 0.00 ? 68 DC  B H5     3  
ATOM 5269  H H6     . DC  B 2 2  ? 48.384 16.387 27.810 1.00 0.00 ? 68 DC  B H6     3  
ATOM 5270  P P      . DT  B 2 3  ? 47.191 18.518 22.181 1.00 0.00 ? 69 DT  B P      3  
ATOM 5271  O OP1    . DT  B 2 3  ? 47.356 18.568 20.709 1.00 0.00 ? 69 DT  B OP1    3  
ATOM 5272  O OP2    . DT  B 2 3  ? 47.588 19.696 22.980 1.00 0.00 ? 69 DT  B OP2    3  
ATOM 5273  O "O5'"  . DT  B 2 3  ? 45.658 18.223 22.484 1.00 0.00 ? 69 DT  B "O5'"  3  
ATOM 5274  C "C5'"  . DT  B 2 3  ? 44.979 17.155 21.836 1.00 0.00 ? 69 DT  B "C5'"  3  
ATOM 5275  C "C4'"  . DT  B 2 3  ? 43.470 17.183 22.100 1.00 0.00 ? 69 DT  B "C4'"  3  
ATOM 5276  O "O4'"  . DT  B 2 3  ? 43.201 16.842 23.450 1.00 0.00 ? 69 DT  B "O4'"  3  
ATOM 5277  C "C3'"  . DT  B 2 3  ? 42.868 18.567 21.833 1.00 0.00 ? 69 DT  B "C3'"  3  
ATOM 5278  O "O3'"  . DT  B 2 3  ? 41.641 18.436 21.133 1.00 0.00 ? 69 DT  B "O3'"  3  
ATOM 5279  C "C2'"  . DT  B 2 3  ? 42.654 19.143 23.228 1.00 0.00 ? 69 DT  B "C2'"  3  
ATOM 5280  C "C1'"  . DT  B 2 3  ? 42.452 17.875 24.066 1.00 0.00 ? 69 DT  B "C1'"  3  
ATOM 5281  N N1     . DT  B 2 3  ? 42.866 17.949 25.495 1.00 0.00 ? 69 DT  B N1     3  
ATOM 5282  C C2     . DT  B 2 3  ? 42.047 17.304 26.431 1.00 0.00 ? 69 DT  B C2     3  
ATOM 5283  O O2     . DT  B 2 3  ? 40.957 16.802 26.156 1.00 0.00 ? 69 DT  B O2     3  
ATOM 5284  N N3     . DT  B 2 3  ? 42.513 17.243 27.721 1.00 0.00 ? 69 DT  B N3     3  
ATOM 5285  C C4     . DT  B 2 3  ? 43.692 17.769 28.187 1.00 0.00 ? 69 DT  B C4     3  
ATOM 5286  O O4     . DT  B 2 3  ? 43.990 17.610 29.370 1.00 0.00 ? 69 DT  B O4     3  
ATOM 5287  C C5     . DT  B 2 3  ? 44.484 18.463 27.174 1.00 0.00 ? 69 DT  B C5     3  
ATOM 5288  C C7     . DT  B 2 3  ? 45.790 19.125 27.565 1.00 0.00 ? 69 DT  B C7     3  
ATOM 5289  C C6     . DT  B 2 3  ? 44.062 18.527 25.883 1.00 0.00 ? 69 DT  B C6     3  
ATOM 5290  H "H5'"  . DT  B 2 3  ? 45.377 16.201 22.184 1.00 0.00 ? 69 DT  B "H5'"  3  
ATOM 5291  H "H5''" . DT  B 2 3  ? 45.136 17.222 20.760 1.00 0.00 ? 69 DT  B "H5''" 3  
ATOM 5292  H "H4'"  . DT  B 2 3  ? 43.000 16.451 21.441 1.00 0.00 ? 69 DT  B "H4'"  3  
ATOM 5293  H "H3'"  . DT  B 2 3  ? 43.578 19.173 21.265 1.00 0.00 ? 69 DT  B "H3'"  3  
ATOM 5294  H "H2'"  . DT  B 2 3  ? 43.541 19.701 23.522 1.00 0.00 ? 69 DT  B "H2'"  3  
ATOM 5295  H "H2''" . DT  B 2 3  ? 41.776 19.784 23.271 1.00 0.00 ? 69 DT  B "H2''" 3  
ATOM 5296  H "H1'"  . DT  B 2 3  ? 41.391 17.615 24.007 1.00 0.00 ? 69 DT  B "H1'"  3  
ATOM 5297  H H3     . DT  B 2 3  ? 41.913 16.789 28.393 1.00 0.00 ? 69 DT  B H3     3  
ATOM 5298  H H71    . DT  B 2 3  ? 45.603 19.835 28.369 1.00 0.00 ? 69 DT  B H71    3  
ATOM 5299  H H72    . DT  B 2 3  ? 46.476 18.374 27.949 1.00 0.00 ? 69 DT  B H72    3  
ATOM 5300  H H73    . DT  B 2 3  ? 46.243 19.644 26.720 1.00 0.00 ? 69 DT  B H73    3  
ATOM 5301  H H6     . DT  B 2 3  ? 44.687 19.016 25.146 1.00 0.00 ? 69 DT  B H6     3  
ATOM 5302  P P      . DC  B 2 4  ? 41.044 19.637 20.272 1.00 0.00 ? 70 DC  B P      3  
ATOM 5303  O OP1    . DC  B 2 4  ? 40.301 19.014 19.157 1.00 0.00 ? 70 DC  B OP1    3  
ATOM 5304  O OP2    . DC  B 2 4  ? 42.110 20.606 19.966 1.00 0.00 ? 70 DC  B OP2    3  
ATOM 5305  O "O5'"  . DC  B 2 4  ? 40.012 20.356 21.240 1.00 0.00 ? 70 DC  B "O5'"  3  
ATOM 5306  C "C5'"  . DC  B 2 4  ? 38.770 19.742 21.547 1.00 0.00 ? 70 DC  B "C5'"  3  
ATOM 5307  C "C4'"  . DC  B 2 4  ? 38.178 20.239 22.867 1.00 0.00 ? 70 DC  B "C4'"  3  
ATOM 5308  O "O4'"  . DC  B 2 4  ? 39.099 20.013 23.923 1.00 0.00 ? 70 DC  B "O4'"  3  
ATOM 5309  C "C3'"  . DC  B 2 4  ? 37.840 21.733 22.871 1.00 0.00 ? 70 DC  B "C3'"  3  
ATOM 5310  O "O3'"  . DC  B 2 4  ? 36.466 21.894 23.218 1.00 0.00 ? 70 DC  B "O3'"  3  
ATOM 5311  C "C2'"  . DC  B 2 4  ? 38.784 22.313 23.925 1.00 0.00 ? 70 DC  B "C2'"  3  
ATOM 5312  C "C1'"  . DC  B 2 4  ? 38.987 21.093 24.818 1.00 0.00 ? 70 DC  B "C1'"  3  
ATOM 5313  N N1     . DC  B 2 4  ? 40.148 21.078 25.753 1.00 0.00 ? 70 DC  B N1     3  
ATOM 5314  C C2     . DC  B 2 4  ? 39.991 20.364 26.944 1.00 0.00 ? 70 DC  B C2     3  
ATOM 5315  O O2     . DC  B 2 4  ? 38.968 19.718 27.164 1.00 0.00 ? 70 DC  B O2     3  
ATOM 5316  N N3     . DC  B 2 4  ? 40.949 20.363 27.896 1.00 0.00 ? 70 DC  B N3     3  
ATOM 5317  C C4     . DC  B 2 4  ? 42.073 20.994 27.644 1.00 0.00 ? 70 DC  B C4     3  
ATOM 5318  N N4     . DC  B 2 4  ? 42.951 20.987 28.601 1.00 0.00 ? 70 DC  B N4     3  
ATOM 5319  C C5     . DC  B 2 4  ? 42.344 21.636 26.405 1.00 0.00 ? 70 DC  B C5     3  
ATOM 5320  C C6     . DC  B 2 4  ? 41.353 21.676 25.480 1.00 0.00 ? 70 DC  B C6     3  
ATOM 5321  H "H5'"  . DC  B 2 4  ? 38.907 18.665 21.633 1.00 0.00 ? 70 DC  B "H5'"  3  
ATOM 5322  H "H5''" . DC  B 2 4  ? 38.064 19.933 20.740 1.00 0.00 ? 70 DC  B "H5''" 3  
ATOM 5323  H "H4'"  . DC  B 2 4  ? 37.263 19.681 23.067 1.00 0.00 ? 70 DC  B "H4'"  3  
ATOM 5324  H "H3'"  . DC  B 2 4  ? 38.054 22.167 21.894 1.00 0.00 ? 70 DC  B "H3'"  3  
ATOM 5325  H "H2'"  . DC  B 2 4  ? 39.709 22.617 23.440 1.00 0.00 ? 70 DC  B "H2'"  3  
ATOM 5326  H "H2''" . DC  B 2 4  ? 38.333 23.145 24.466 1.00 0.00 ? 70 DC  B "H2''" 3  
ATOM 5327  H "H1'"  . DC  B 2 4  ? 38.069 20.975 25.402 1.00 0.00 ? 70 DC  B "H1'"  3  
ATOM 5328  H H41    . DC  B 2 4  ? 43.824 21.485 28.476 1.00 0.00 ? 70 DC  B H41    3  
ATOM 5329  H H42    . DC  B 2 4  ? 42.701 20.557 29.482 1.00 0.00 ? 70 DC  B H42    3  
ATOM 5330  H H5     . DC  B 2 4  ? 43.298 22.088 26.195 1.00 0.00 ? 70 DC  B H5     3  
ATOM 5331  H H6     . DC  B 2 4  ? 41.517 22.161 24.523 1.00 0.00 ? 70 DC  B H6     3  
ATOM 5332  P P      . DT  B 2 5  ? 35.701 23.270 22.937 1.00 0.00 ? 71 DT  B P      3  
ATOM 5333  O OP1    . DT  B 2 5  ? 34.331 22.972 22.472 1.00 0.00 ? 71 DT  B OP1    3  
ATOM 5334  O OP2    . DT  B 2 5  ? 36.560 24.115 22.085 1.00 0.00 ? 71 DT  B OP2    3  
ATOM 5335  O "O5'"  . DT  B 2 5  ? 35.589 23.974 24.354 1.00 0.00 ? 71 DT  B "O5'"  3  
ATOM 5336  C "C5'"  . DT  B 2 5  ? 34.556 23.639 25.274 1.00 0.00 ? 71 DT  B "C5'"  3  
ATOM 5337  C "C4'"  . DT  B 2 5  ? 34.751 24.315 26.632 1.00 0.00 ? 71 DT  B "C4'"  3  
ATOM 5338  O "O4'"  . DT  B 2 5  ? 36.015 23.898 27.146 1.00 0.00 ? 71 DT  B "O4'"  3  
ATOM 5339  C "C3'"  . DT  B 2 5  ? 34.764 25.850 26.512 1.00 0.00 ? 71 DT  B "C3'"  3  
ATOM 5340  O "O3'"  . DT  B 2 5  ? 34.144 26.502 27.605 1.00 0.00 ? 71 DT  B "O3'"  3  
ATOM 5341  C "C2'"  . DT  B 2 5  ? 36.251 26.159 26.586 1.00 0.00 ? 71 DT  B "C2'"  3  
ATOM 5342  C "C1'"  . DT  B 2 5  ? 36.728 25.054 27.537 1.00 0.00 ? 71 DT  B "C1'"  3  
ATOM 5343  N N1     . DT  B 2 5  ? 38.198 24.800 27.592 1.00 0.00 ? 71 DT  B N1     3  
ATOM 5344  C C2     . DT  B 2 5  ? 38.712 24.296 28.797 1.00 0.00 ? 71 DT  B C2     3  
ATOM 5345  O O2     . DT  B 2 5  ? 38.013 23.928 29.740 1.00 0.00 ? 71 DT  B O2     3  
ATOM 5346  N N3     . DT  B 2 5  ? 40.081 24.213 28.905 1.00 0.00 ? 71 DT  B N3     3  
ATOM 5347  C C4     . DT  B 2 5  ? 40.994 24.573 27.941 1.00 0.00 ? 71 DT  B C4     3  
ATOM 5348  O O4     . DT  B 2 5  ? 42.197 24.504 28.197 1.00 0.00 ? 71 DT  B O4     3  
ATOM 5349  C C5     . DT  B 2 5  ? 40.399 25.023 26.685 1.00 0.00 ? 71 DT  B C5     3  
ATOM 5350  C C7     . DT  B 2 5  ? 41.287 25.408 25.514 1.00 0.00 ? 71 DT  B C7     3  
ATOM 5351  C C6     . DT  B 2 5  ? 39.050 25.120 26.548 1.00 0.00 ? 71 DT  B C6     3  
ATOM 5352  H "H5'"  . DT  B 2 5  ? 34.527 22.566 25.431 1.00 0.00 ? 71 DT  B "H5'"  3  
ATOM 5353  H "H5''" . DT  B 2 5  ? 33.593 23.933 24.868 1.00 0.00 ? 71 DT  B "H5''" 3  
ATOM 5354  H "H4'"  . DT  B 2 5  ? 33.950 24.008 27.305 1.00 0.00 ? 71 DT  B "H4'"  3  
ATOM 5355  H "H3'"  . DT  B 2 5  ? 34.342 26.191 25.565 1.00 0.00 ? 71 DT  B "H3'"  3  
ATOM 5356  H "H2'"  . DT  B 2 5  ? 36.673 26.062 25.588 1.00 0.00 ? 71 DT  B "H2'"  3  
ATOM 5357  H "H2''" . DT  B 2 5  ? 36.441 27.152 26.994 1.00 0.00 ? 71 DT  B "H2''" 3  
ATOM 5358  H "H1'"  . DT  B 2 5  ? 36.389 25.327 28.541 1.00 0.00 ? 71 DT  B "H1'"  3  
ATOM 5359  H H3     . DT  B 2 5  ? 40.443 23.895 29.794 1.00 0.00 ? 71 DT  B H3     3  
ATOM 5360  H H71    . DT  B 2 5  ? 41.921 26.246 25.801 1.00 0.00 ? 71 DT  B H71    3  
ATOM 5361  H H72    . DT  B 2 5  ? 41.928 24.570 25.244 1.00 0.00 ? 71 DT  B H72    3  
ATOM 5362  H H73    . DT  B 2 5  ? 40.692 25.694 24.647 1.00 0.00 ? 71 DT  B H73    3  
ATOM 5363  H H6     . DT  B 2 5  ? 38.648 25.457 25.602 1.00 0.00 ? 71 DT  B H6     3  
ATOM 5364  P P      . DA  B 2 6  ? 32.566 26.725 27.719 1.00 0.00 ? 72 DA  B P      3  
ATOM 5365  O OP1    . DA  B 2 6  ? 31.854 25.704 26.915 1.00 0.00 ? 72 DA  B OP1    3  
ATOM 5366  O OP2    . DA  B 2 6  ? 32.296 28.144 27.431 1.00 0.00 ? 72 DA  B OP2    3  
ATOM 5367  O "O5'"  . DA  B 2 6  ? 32.356 26.444 29.286 1.00 0.00 ? 72 DA  B "O5'"  3  
ATOM 5368  C "C5'"  . DA  B 2 6  ? 32.153 25.123 29.781 1.00 0.00 ? 72 DA  B "C5'"  3  
ATOM 5369  C "C4'"  . DA  B 2 6  ? 32.553 24.888 31.251 1.00 0.00 ? 72 DA  B "C4'"  3  
ATOM 5370  O "O4'"  . DA  B 2 6  ? 33.969 24.823 31.360 1.00 0.00 ? 72 DA  B "O4'"  3  
ATOM 5371  C "C3'"  . DA  B 2 6  ? 32.065 25.943 32.250 1.00 0.00 ? 72 DA  B "C3'"  3  
ATOM 5372  O "O3'"  . DA  B 2 6  ? 31.745 25.317 33.491 1.00 0.00 ? 72 DA  B "O3'"  3  
ATOM 5373  C "C2'"  . DA  B 2 6  ? 33.290 26.847 32.362 1.00 0.00 ? 72 DA  B "C2'"  3  
ATOM 5374  C "C1'"  . DA  B 2 6  ? 34.438 25.846 32.226 1.00 0.00 ? 72 DA  B "C1'"  3  
ATOM 5375  N N9     . DA  B 2 6  ? 35.647 26.431 31.607 1.00 0.00 ? 72 DA  B N9     3  
ATOM 5376  C C8     . DA  B 2 6  ? 35.744 27.033 30.376 1.00 0.00 ? 72 DA  B C8     3  
ATOM 5377  N N7     . DA  B 2 6  ? 36.965 27.314 30.002 1.00 0.00 ? 72 DA  B N7     3  
ATOM 5378  C C5     . DA  B 2 6  ? 37.725 26.904 31.110 1.00 0.00 ? 72 DA  B C5     3  
ATOM 5379  C C6     . DA  B 2 6  ? 39.105 26.900 31.420 1.00 0.00 ? 72 DA  B C6     3  
ATOM 5380  N N6     . DA  B 2 6  ? 40.064 27.309 30.613 1.00 0.00 ? 72 DA  B N6     3  
ATOM 5381  N N1     . DA  B 2 6  ? 39.542 26.497 32.609 1.00 0.00 ? 72 DA  B N1     3  
ATOM 5382  C C2     . DA  B 2 6  ? 38.652 26.058 33.486 1.00 0.00 ? 72 DA  B C2     3  
ATOM 5383  N N3     . DA  B 2 6  ? 37.339 25.936 33.325 1.00 0.00 ? 72 DA  B N3     3  
ATOM 5384  C C4     . DA  B 2 6  ? 36.931 26.390 32.103 1.00 0.00 ? 72 DA  B C4     3  
ATOM 5385  H "H5'"  . DA  B 2 6  ? 32.730 24.418 29.181 1.00 0.00 ? 72 DA  B "H5'"  3  
ATOM 5386  H "H5''" . DA  B 2 6  ? 31.102 24.871 29.659 1.00 0.00 ? 72 DA  B "H5''" 3  
ATOM 5387  H "H4'"  . DA  B 2 6  ? 32.140 23.923 31.543 1.00 0.00 ? 72 DA  B "H4'"  3  
ATOM 5388  H "H3'"  . DA  B 2 6  ? 31.207 26.485 31.849 1.00 0.00 ? 72 DA  B "H3'"  3  
ATOM 5389  H "H2'"  . DA  B 2 6  ? 33.289 27.562 31.539 1.00 0.00 ? 72 DA  B "H2'"  3  
ATOM 5390  H "H2''" . DA  B 2 6  ? 33.337 27.372 33.312 1.00 0.00 ? 72 DA  B "H2''" 3  
ATOM 5391  H "H1'"  . DA  B 2 6  ? 34.670 25.425 33.212 1.00 0.00 ? 72 DA  B "H1'"  3  
ATOM 5392  H H8     . DA  B 2 6  ? 34.874 27.213 29.757 1.00 0.00 ? 72 DA  B H8     3  
ATOM 5393  H H61    . DA  B 2 6  ? 39.818 27.737 29.736 1.00 0.00 ? 72 DA  B H61    3  
ATOM 5394  H H62    . DA  B 2 6  ? 41.021 27.240 30.938 1.00 0.00 ? 72 DA  B H62    3  
ATOM 5395  H H2     . DA  B 2 6  ? 39.052 25.746 34.441 1.00 0.00 ? 72 DA  B H2     3  
ATOM 5396  P P      . DA  B 2 7  ? 30.900 26.064 34.627 1.00 0.00 ? 73 DA  B P      3  
ATOM 5397  O OP1    . DA  B 2 7  ? 30.498 25.060 35.633 1.00 0.00 ? 73 DA  B OP1    3  
ATOM 5398  O OP2    . DA  B 2 7  ? 29.816 26.796 33.935 1.00 0.00 ? 73 DA  B OP2    3  
ATOM 5399  O "O5'"  . DA  B 2 7  ? 31.905 27.106 35.344 1.00 0.00 ? 73 DA  B "O5'"  3  
ATOM 5400  C "C5'"  . DA  B 2 7  ? 32.795 26.635 36.354 1.00 0.00 ? 73 DA  B "C5'"  3  
ATOM 5401  C "C4'"  . DA  B 2 7  ? 34.007 27.518 36.697 1.00 0.00 ? 73 DA  B "C4'"  3  
ATOM 5402  O "O4'"  . DA  B 2 7  ? 34.902 27.629 35.602 1.00 0.00 ? 73 DA  B "O4'"  3  
ATOM 5403  C "C3'"  . DA  B 2 7  ? 33.737 28.947 37.215 1.00 0.00 ? 73 DA  B "C3'"  3  
ATOM 5404  O "O3'"  . DA  B 2 7  ? 34.137 29.015 38.585 1.00 0.00 ? 73 DA  B "O3'"  3  
ATOM 5405  C "C2'"  . DA  B 2 7  ? 34.635 29.793 36.309 1.00 0.00 ? 73 DA  B "C2'"  3  
ATOM 5406  C "C1'"  . DA  B 2 7  ? 35.675 28.785 35.828 1.00 0.00 ? 73 DA  B "C1'"  3  
ATOM 5407  N N9     . DA  B 2 7  ? 36.360 29.207 34.588 1.00 0.00 ? 73 DA  B N9     3  
ATOM 5408  C C8     . DA  B 2 7  ? 35.785 29.594 33.403 1.00 0.00 ? 73 DA  B C8     3  
ATOM 5409  N N7     . DA  B 2 7  ? 36.633 30.005 32.497 1.00 0.00 ? 73 DA  B N7     3  
ATOM 5410  C C5     . DA  B 2 7  ? 37.877 29.825 33.134 1.00 0.00 ? 73 DA  B C5     3  
ATOM 5411  C C6     . DA  B 2 7  ? 39.230 30.013 32.764 1.00 0.00 ? 73 DA  B C6     3  
ATOM 5412  N N6     . DA  B 2 7  ? 39.658 30.481 31.611 1.00 0.00 ? 73 DA  B N6     3  
ATOM 5413  N N1     . DA  B 2 7  ? 40.226 29.723 33.601 1.00 0.00 ? 73 DA  B N1     3  
ATOM 5414  C C2     . DA  B 2 7  ? 39.916 29.252 34.798 1.00 0.00 ? 73 DA  B C2     3  
ATOM 5415  N N3     . DA  B 2 7  ? 38.707 29.048 35.313 1.00 0.00 ? 73 DA  B N3     3  
ATOM 5416  C C4     . DA  B 2 7  ? 37.720 29.336 34.407 1.00 0.00 ? 73 DA  B C4     3  
ATOM 5417  H "H5'"  . DA  B 2 7  ? 33.192 25.677 36.026 1.00 0.00 ? 73 DA  B "H5'"  3  
ATOM 5418  H "H5''" . DA  B 2 7  ? 32.225 26.457 37.265 1.00 0.00 ? 73 DA  B "H5''" 3  
ATOM 5419  H "H4'"  . DA  B 2 7  ? 34.548 26.994 37.485 1.00 0.00 ? 73 DA  B "H4'"  3  
ATOM 5420  H "H3'"  . DA  B 2 7  ? 32.687 29.224 37.093 1.00 0.00 ? 73 DA  B "H3'"  3  
ATOM 5421  H "H2'"  . DA  B 2 7  ? 34.041 30.166 35.475 1.00 0.00 ? 73 DA  B "H2'"  3  
ATOM 5422  H "H2''" . DA  B 2 7  ? 35.108 30.621 36.832 1.00 0.00 ? 73 DA  B "H2''" 3  
ATOM 5423  H "H1'"  . DA  B 2 7  ? 36.410 28.604 36.618 1.00 0.00 ? 73 DA  B "H1'"  3  
ATOM 5424  H H8     . DA  B 2 7  ? 34.713 29.572 33.249 1.00 0.00 ? 73 DA  B H8     3  
ATOM 5425  H H61    . DA  B 2 7  ? 39.007 30.830 30.919 1.00 0.00 ? 73 DA  B H61    3  
ATOM 5426  H H62    . DA  B 2 7  ? 40.656 30.527 31.469 1.00 0.00 ? 73 DA  B H62    3  
ATOM 5427  H H2     . DA  B 2 7  ? 40.756 29.033 35.445 1.00 0.00 ? 73 DA  B H2     3  
ATOM 5428  P P      . DT  B 2 8  ? 34.126 30.359 39.473 1.00 0.00 ? 74 DT  B P      3  
ATOM 5429  O OP1    . DT  B 2 8  ? 33.670 29.958 40.818 1.00 0.00 ? 74 DT  B OP1    3  
ATOM 5430  O OP2    . DT  B 2 8  ? 33.394 31.436 38.773 1.00 0.00 ? 74 DT  B OP2    3  
ATOM 5431  O "O5'"  . DT  B 2 8  ? 35.665 30.801 39.548 1.00 0.00 ? 74 DT  B "O5'"  3  
ATOM 5432  C "C5'"  . DT  B 2 8  ? 36.595 30.041 40.307 1.00 0.00 ? 74 DT  B "C5'"  3  
ATOM 5433  C "C4'"  . DT  B 2 8  ? 38.032 30.578 40.325 1.00 0.00 ? 74 DT  B "C4'"  3  
ATOM 5434  O "O4'"  . DT  B 2 8  ? 38.544 30.569 38.996 1.00 0.00 ? 74 DT  B "O4'"  3  
ATOM 5435  C "C3'"  . DT  B 2 8  ? 38.183 32.000 40.902 1.00 0.00 ? 74 DT  B "C3'"  3  
ATOM 5436  O "O3'"  . DT  B 2 8  ? 39.293 32.015 41.798 1.00 0.00 ? 74 DT  B "O3'"  3  
ATOM 5437  C "C2'"  . DT  B 2 8  ? 38.419 32.818 39.641 1.00 0.00 ? 74 DT  B "C2'"  3  
ATOM 5438  C "C1'"  . DT  B 2 8  ? 39.136 31.824 38.730 1.00 0.00 ? 74 DT  B "C1'"  3  
ATOM 5439  N N1     . DT  B 2 8  ? 38.990 32.147 37.285 1.00 0.00 ? 74 DT  B N1     3  
ATOM 5440  C C2     . DT  B 2 8  ? 40.145 32.242 36.498 1.00 0.00 ? 74 DT  B C2     3  
ATOM 5441  O O2     . DT  B 2 8  ? 41.260 31.913 36.896 1.00 0.00 ? 74 DT  B O2     3  
ATOM 5442  N N3     . DT  B 2 8  ? 39.984 32.692 35.208 1.00 0.00 ? 74 DT  B N3     3  
ATOM 5443  C C4     . DT  B 2 8  ? 38.778 32.974 34.606 1.00 0.00 ? 74 DT  B C4     3  
ATOM 5444  O O4     . DT  B 2 8  ? 38.771 33.365 33.441 1.00 0.00 ? 74 DT  B O4     3  
ATOM 5445  C C5     . DT  B 2 8  ? 37.603 32.757 35.450 1.00 0.00 ? 74 DT  B C5     3  
ATOM 5446  C C7     . DT  B 2 8  ? 36.207 32.981 34.898 1.00 0.00 ? 74 DT  B C7     3  
ATOM 5447  C C6     . DT  B 2 8  ? 37.741 32.356 36.739 1.00 0.00 ? 74 DT  B C6     3  
ATOM 5448  H "H5'"  . DT  B 2 8  ? 36.627 29.028 39.904 1.00 0.00 ? 74 DT  B "H5'"  3  
ATOM 5449  H "H5''" . DT  B 2 8  ? 36.246 29.989 41.337 1.00 0.00 ? 74 DT  B "H5''" 3  
ATOM 5450  H "H4'"  . DT  B 2 8  ? 38.633 29.903 40.937 1.00 0.00 ? 74 DT  B "H4'"  3  
ATOM 5451  H "H3'"  . DT  B 2 8  ? 37.272 32.321 41.413 1.00 0.00 ? 74 DT  B "H3'"  3  
ATOM 5452  H "H2'"  . DT  B 2 8  ? 37.454 33.124 39.240 1.00 0.00 ? 74 DT  B "H2'"  3  
ATOM 5453  H "H2''" . DT  B 2 8  ? 39.035 33.692 39.820 1.00 0.00 ? 74 DT  B "H2''" 3  
ATOM 5454  H "H1'"  . DT  B 2 8  ? 40.191 31.798 39.024 1.00 0.00 ? 74 DT  B "H1'"  3  
ATOM 5455  H H3     . DT  B 2 8  ? 40.818 32.796 34.645 1.00 0.00 ? 74 DT  B H3     3  
ATOM 5456  H H71    . DT  B 2 8  ? 35.452 32.781 35.658 1.00 0.00 ? 74 DT  B H71    3  
ATOM 5457  H H72    . DT  B 2 8  ? 36.107 34.013 34.571 1.00 0.00 ? 74 DT  B H72    3  
ATOM 5458  H H73    . DT  B 2 8  ? 36.045 32.330 34.041 1.00 0.00 ? 74 DT  B H73    3  
ATOM 5459  H H6     . DT  B 2 8  ? 36.865 32.193 37.357 1.00 0.00 ? 74 DT  B H6     3  
ATOM 5460  P P      . DC  B 2 9  ? 39.864 33.328 42.520 1.00 0.00 ? 75 DC  B P      3  
ATOM 5461  O OP1    . DC  B 2 9  ? 40.452 32.903 43.812 1.00 0.00 ? 75 DC  B OP1    3  
ATOM 5462  O OP2    . DC  B 2 9  ? 38.835 34.394 42.524 1.00 0.00 ? 75 DC  B OP2    3  
ATOM 5463  O "O5'"  . DC  B 2 9  ? 41.043 33.783 41.556 1.00 0.00 ? 75 DC  B "O5'"  3  
ATOM 5464  C "C5'"  . DC  B 2 9  ? 42.207 32.980 41.418 1.00 0.00 ? 75 DC  B "C5'"  3  
ATOM 5465  C "C4'"  . DC  B 2 9  ? 43.282 33.640 40.550 1.00 0.00 ? 75 DC  B "C4'"  3  
ATOM 5466  O "O4'"  . DC  B 2 9  ? 42.837 33.746 39.202 1.00 0.00 ? 75 DC  B "O4'"  3  
ATOM 5467  C "C3'"  . DC  B 2 9  ? 43.671 35.043 41.044 1.00 0.00 ? 75 DC  B "C3'"  3  
ATOM 5468  O "O3'"  . DC  B 2 9  ? 45.082 35.181 41.189 1.00 0.00 ? 75 DC  B "O3'"  3  
ATOM 5469  C "C2'"  . DC  B 2 9  ? 43.120 35.942 39.940 1.00 0.00 ? 75 DC  B "C2'"  3  
ATOM 5470  C "C1'"  . DC  B 2 9  ? 43.160 35.035 38.710 1.00 0.00 ? 75 DC  B "C1'"  3  
ATOM 5471  N N1     . DC  B 2 9  ? 42.162 35.442 37.687 1.00 0.00 ? 75 DC  B N1     3  
ATOM 5472  C C2     . DC  B 2 9  ? 42.574 35.883 36.420 1.00 0.00 ? 75 DC  B C2     3  
ATOM 5473  O O2     . DC  B 2 9  ? 43.759 35.913 36.085 1.00 0.00 ? 75 DC  B O2     3  
ATOM 5474  N N3     . DC  B 2 9  ? 41.666 36.289 35.498 1.00 0.00 ? 75 DC  B N3     3  
ATOM 5475  C C4     . DC  B 2 9  ? 40.391 36.251 35.830 1.00 0.00 ? 75 DC  B C4     3  
ATOM 5476  N N4     . DC  B 2 9  ? 39.552 36.676 34.939 1.00 0.00 ? 75 DC  B N4     3  
ATOM 5477  C C5     . DC  B 2 9  ? 39.907 35.803 37.084 1.00 0.00 ? 75 DC  B C5     3  
ATOM 5478  C C6     . DC  B 2 9  ? 40.826 35.411 37.996 1.00 0.00 ? 75 DC  B C6     3  
ATOM 5479  H "H5'"  . DC  B 2 9  ? 41.938 32.020 40.975 1.00 0.00 ? 75 DC  B "H5'"  3  
ATOM 5480  H "H5''" . DC  B 2 9  ? 42.638 32.794 42.403 1.00 0.00 ? 75 DC  B "H5''" 3  
ATOM 5481  H "H4'"  . DC  B 2 9  ? 44.156 32.996 40.593 1.00 0.00 ? 75 DC  B "H4'"  3  
ATOM 5482  H "H3'"  . DC  B 2 9  ? 43.173 35.252 41.993 1.00 0.00 ? 75 DC  B "H3'"  3  
ATOM 5483  H "H2'"  . DC  B 2 9  ? 42.099 36.225 40.198 1.00 0.00 ? 75 DC  B "H2'"  3  
ATOM 5484  H "H2''" . DC  B 2 9  ? 43.721 36.833 39.787 1.00 0.00 ? 75 DC  B "H2''" 3  
ATOM 5485  H "H1'"  . DC  B 2 9  ? 44.175 35.032 38.298 1.00 0.00 ? 75 DC  B "H1'"  3  
ATOM 5486  H H41    . DC  B 2 9  ? 38.581 36.763 35.220 1.00 0.00 ? 75 DC  B H41    3  
ATOM 5487  H H42    . DC  B 2 9  ? 39.927 37.117 34.116 1.00 0.00 ? 75 DC  B H42    3  
ATOM 5488  H H5     . DC  B 2 9  ? 38.859 35.792 37.331 1.00 0.00 ? 75 DC  B H5     3  
ATOM 5489  H H6     . DC  B 2 9  ? 40.528 35.076 38.985 1.00 0.00 ? 75 DC  B H6     3  
ATOM 5490  P P      . DC  B 2 10 ? 45.728 36.478 41.883 1.00 0.00 ? 76 DC  B P      3  
ATOM 5491  O OP1    . DC  B 2 10 ? 47.046 36.092 42.439 1.00 0.00 ? 76 DC  B OP1    3  
ATOM 5492  O OP2    . DC  B 2 10 ? 44.725 37.092 42.786 1.00 0.00 ? 76 DC  B OP2    3  
ATOM 5493  O "O5'"  . DC  B 2 10 ? 45.966 37.495 40.681 1.00 0.00 ? 76 DC  B "O5'"  3  
ATOM 5494  C "C5'"  . DC  B 2 10 ? 46.863 37.209 39.615 1.00 0.00 ? 76 DC  B "C5'"  3  
ATOM 5495  C "C4'"  . DC  B 2 10 ? 46.655 38.175 38.438 1.00 0.00 ? 76 DC  B "C4'"  3  
ATOM 5496  O "O4'"  . DC  B 2 10 ? 45.341 38.038 37.915 1.00 0.00 ? 76 DC  B "O4'"  3  
ATOM 5497  C "C3'"  . DC  B 2 10 ? 46.824 39.660 38.804 1.00 0.00 ? 76 DC  B "C3'"  3  
ATOM 5498  O "O3'"  . DC  B 2 10 ? 48.043 40.169 38.273 1.00 0.00 ? 76 DC  B "O3'"  3  
ATOM 5499  C "C2'"  . DC  B 2 10 ? 45.599 40.333 38.177 1.00 0.00 ? 76 DC  B "C2'"  3  
ATOM 5500  C "C1'"  . DC  B 2 10 ? 45.028 39.250 37.265 1.00 0.00 ? 76 DC  B "C1'"  3  
ATOM 5501  N N1     . DC  B 2 10 ? 43.560 39.384 37.057 1.00 0.00 ? 76 DC  B N1     3  
ATOM 5502  C C2     . DC  B 2 10 ? 43.082 39.761 35.797 1.00 0.00 ? 76 DC  B C2     3  
ATOM 5503  O O2     . DC  B 2 10 ? 43.848 40.059 34.883 1.00 0.00 ? 76 DC  B O2     3  
ATOM 5504  N N3     . DC  B 2 10 ? 41.755 39.832 35.542 1.00 0.00 ? 76 DC  B N3     3  
ATOM 5505  C C4     . DC  B 2 10 ? 40.923 39.591 36.534 1.00 0.00 ? 76 DC  B C4     3  
ATOM 5506  N N4     . DC  B 2 10 ? 39.660 39.655 36.240 1.00 0.00 ? 76 DC  B N4     3  
ATOM 5507  C C5     . DC  B 2 10 ? 41.341 39.263 37.852 1.00 0.00 ? 76 DC  B C5     3  
ATOM 5508  C C6     . DC  B 2 10 ? 42.675 39.168 38.082 1.00 0.00 ? 76 DC  B C6     3  
ATOM 5509  H "H5'"  . DC  B 2 10 ? 46.693 36.194 39.252 1.00 0.00 ? 76 DC  B "H5'"  3  
ATOM 5510  H "H5''" . DC  B 2 10 ? 47.893 37.287 39.965 1.00 0.00 ? 76 DC  B "H5''" 3  
ATOM 5511  H "H4'"  . DC  B 2 10 ? 47.371 37.929 37.653 1.00 0.00 ? 76 DC  B "H4'"  3  
ATOM 5512  H "H3'"  . DC  B 2 10 ? 46.790 39.773 39.888 1.00 0.00 ? 76 DC  B "H3'"  3  
ATOM 5513  H "H2'"  . DC  B 2 10 ? 44.893 40.597 38.965 1.00 0.00 ? 76 DC  B "H2'"  3  
ATOM 5514  H "H2''" . DC  B 2 10 ? 45.862 41.218 37.598 1.00 0.00 ? 76 DC  B "H2''" 3  
ATOM 5515  H "H1'"  . DC  B 2 10 ? 45.560 39.276 36.308 1.00 0.00 ? 76 DC  B "H1'"  3  
ATOM 5516  H H41    . DC  B 2 10 ? 38.978 39.466 36.966 1.00 0.00 ? 76 DC  B H41    3  
ATOM 5517  H H42    . DC  B 2 10 ? 39.410 39.825 35.282 1.00 0.00 ? 76 DC  B H42    3  
ATOM 5518  H H5     . DC  B 2 10 ? 40.639 39.083 38.650 1.00 0.00 ? 76 DC  B H5     3  
ATOM 5519  H H6     . DC  B 2 10 ? 43.054 38.914 39.066 1.00 0.00 ? 76 DC  B H6     3  
ATOM 5520  P P      . DC  B 2 11 ? 48.604 41.617 38.650 1.00 0.00 ? 77 DC  B P      3  
ATOM 5521  O OP1    . DC  B 2 11 ? 50.080 41.514 38.616 1.00 0.00 ? 77 DC  B OP1    3  
ATOM 5522  O OP2    . DC  B 2 11 ? 47.964 42.068 39.903 1.00 0.00 ? 77 DC  B OP2    3  
ATOM 5523  O "O5'"  . DC  B 2 11 ? 48.106 42.583 37.486 1.00 0.00 ? 77 DC  B "O5'"  3  
ATOM 5524  C "C5'"  . DC  B 2 11 ? 48.590 42.462 36.155 1.00 0.00 ? 77 DC  B "C5'"  3  
ATOM 5525  C "C4'"  . DC  B 2 11 ? 47.824 43.367 35.178 1.00 0.00 ? 77 DC  B "C4'"  3  
ATOM 5526  O "O4'"  . DC  B 2 11 ? 46.475 42.932 35.139 1.00 0.00 ? 77 DC  B "O4'"  3  
ATOM 5527  C "C3'"  . DC  B 2 11 ? 47.816 44.872 35.508 1.00 0.00 ? 77 DC  B "C3'"  3  
ATOM 5528  O "O3'"  . DC  B 2 11 ? 48.758 45.538 34.659 1.00 0.00 ? 77 DC  B "O3'"  3  
ATOM 5529  C "C2'"  . DC  B 2 11 ? 46.352 45.262 35.256 1.00 0.00 ? 77 DC  B "C2'"  3  
ATOM 5530  C "C1'"  . DC  B 2 11 ? 45.663 44.005 34.724 1.00 0.00 ? 77 DC  B "C1'"  3  
ATOM 5531  N N1     . DC  B 2 11 ? 44.284 43.804 35.260 1.00 0.00 ? 77 DC  B N1     3  
ATOM 5532  C C2     . DC  B 2 11 ? 43.193 43.816 34.382 1.00 0.00 ? 77 DC  B C2     3  
ATOM 5533  O O2     . DC  B 2 11 ? 43.339 44.056 33.180 1.00 0.00 ? 77 DC  B O2     3  
ATOM 5534  N N3     . DC  B 2 11 ? 41.938 43.558 34.828 1.00 0.00 ? 77 DC  B N3     3  
ATOM 5535  C C4     . DC  B 2 11 ? 41.765 43.322 36.115 1.00 0.00 ? 77 DC  B C4     3  
ATOM 5536  N N4     . DC  B 2 11 ? 40.551 43.053 36.501 1.00 0.00 ? 77 DC  B N4     3  
ATOM 5537  C C5     . DC  B 2 11 ? 42.829 43.315 37.059 1.00 0.00 ? 77 DC  B C5     3  
ATOM 5538  C C6     . DC  B 2 11 ? 44.081 43.559 36.596 1.00 0.00 ? 77 DC  B C6     3  
ATOM 5539  H "H5'"  . DC  B 2 11 ? 48.464 41.431 35.821 1.00 0.00 ? 77 DC  B "H5'"  3  
ATOM 5540  H "H5''" . DC  B 2 11 ? 49.652 42.700 36.121 1.00 0.00 ? 77 DC  B "H5''" 3  
ATOM 5541  H "H4'"  . DC  B 2 11 ? 48.256 43.242 34.183 1.00 0.00 ? 77 DC  B "H4'"  3  
ATOM 5542  H "H3'"  . DC  B 2 11 ? 48.062 45.028 36.561 1.00 0.00 ? 77 DC  B "H3'"  3  
ATOM 5543  H "H2'"  . DC  B 2 11 ? 45.898 45.588 36.189 1.00 0.00 ? 77 DC  B "H2'"  3  
ATOM 5544  H "H2''" . DC  B 2 11 ? 46.269 46.046 34.514 1.00 0.00 ? 77 DC  B "H2''" 3  
ATOM 5545  H "H1'"  . DC  B 2 11 ? 45.656 44.056 33.630 1.00 0.00 ? 77 DC  B "H1'"  3  
ATOM 5546  H H41    . DC  B 2 11 ? 40.368 42.851 37.472 1.00 0.00 ? 77 DC  B H41    3  
ATOM 5547  H H42    . DC  B 2 11 ? 39.836 42.958 35.794 1.00 0.00 ? 77 DC  B H42    3  
ATOM 5548  H H5     . DC  B 2 11 ? 42.666 43.116 38.107 1.00 0.00 ? 77 DC  B H5     3  
ATOM 5549  H H6     . DC  B 2 11 ? 44.934 43.545 37.266 1.00 0.00 ? 77 DC  B H6     3  
ATOM 5550  P P      . DC  B 2 12 ? 48.955 47.136 34.569 1.00 0.00 ? 78 DC  B P      3  
ATOM 5551  O OP1    . DC  B 2 12 ? 50.306 47.376 34.013 1.00 0.00 ? 78 DC  B OP1    3  
ATOM 5552  O OP2    . DC  B 2 12 ? 48.603 47.727 35.885 1.00 0.00 ? 78 DC  B OP2    3  
ATOM 5553  O "O5'"  . DC  B 2 12 ? 47.883 47.649 33.485 1.00 0.00 ? 78 DC  B "O5'"  3  
ATOM 5554  C "C5'"  . DC  B 2 12 ? 47.946 47.195 32.134 1.00 0.00 ? 78 DC  B "C5'"  3  
ATOM 5555  C "C4'"  . DC  B 2 12 ? 46.678 47.456 31.300 1.00 0.00 ? 78 DC  B "C4'"  3  
ATOM 5556  O "O4'"  . DC  B 2 12 ? 45.550 46.918 31.985 1.00 0.00 ? 78 DC  B "O4'"  3  
ATOM 5557  C "C3'"  . DC  B 2 12 ? 46.390 48.930 30.954 1.00 0.00 ? 78 DC  B "C3'"  3  
ATOM 5558  O "O3'"  . DC  B 2 12 ? 46.270 49.047 29.530 1.00 0.00 ? 78 DC  B "O3'"  3  
ATOM 5559  C "C2'"  . DC  B 2 12 ? 45.096 49.202 31.728 1.00 0.00 ? 78 DC  B "C2'"  3  
ATOM 5560  C "C1'"  . DC  B 2 12 ? 44.461 47.818 31.906 1.00 0.00 ? 78 DC  B "C1'"  3  
ATOM 5561  N N1     . DC  B 2 12 ? 43.650 47.690 33.155 1.00 0.00 ? 78 DC  B N1     3  
ATOM 5562  C C2     . DC  B 2 12 ? 42.291 47.335 33.091 1.00 0.00 ? 78 DC  B C2     3  
ATOM 5563  O O2     . DC  B 2 12 ? 41.705 47.174 32.021 1.00 0.00 ? 78 DC  B O2     3  
ATOM 5564  N N3     . DC  B 2 12 ? 41.561 47.163 34.220 1.00 0.00 ? 78 DC  B N3     3  
ATOM 5565  C C4     . DC  B 2 12 ? 42.162 47.337 35.377 1.00 0.00 ? 78 DC  B C4     3  
ATOM 5566  N N4     . DC  B 2 12 ? 41.432 47.168 36.433 1.00 0.00 ? 78 DC  B N4     3  
ATOM 5567  C C5     . DC  B 2 12 ? 43.531 47.684 35.517 1.00 0.00 ? 78 DC  B C5     3  
ATOM 5568  C C6     . DC  B 2 12 ? 44.246 47.864 34.380 1.00 0.00 ? 78 DC  B C6     3  
ATOM 5569  H "H5'"  . DC  B 2 12 ? 48.108 46.116 32.142 1.00 0.00 ? 78 DC  B "H5'"  3  
ATOM 5570  H "H5''" . DC  B 2 12 ? 48.799 47.654 31.635 1.00 0.00 ? 78 DC  B "H5''" 3  
ATOM 5571  H "H4'"  . DC  B 2 12 ? 46.787 46.915 30.361 1.00 0.00 ? 78 DC  B "H4'"  3  
ATOM 5572  H "H3'"  . DC  B 2 12 ? 47.192 49.574 31.317 1.00 0.00 ? 78 DC  B "H3'"  3  
ATOM 5573  H "H2'"  . DC  B 2 12 ? 45.352 49.645 32.690 1.00 0.00 ? 78 DC  B "H2'"  3  
ATOM 5574  H "H2''" . DC  B 2 12 ? 44.421 49.867 31.198 1.00 0.00 ? 78 DC  B "H2''" 3  
ATOM 5575  H "H1'"  . DC  B 2 12 ? 43.862 47.584 31.018 1.00 0.00 ? 78 DC  B "H1'"  3  
ATOM 5576  H H41    . DC  B 2 12 ? 41.822 47.328 37.349 1.00 0.00 ? 78 DC  B H41    3  
ATOM 5577  H H42    . DC  B 2 12 ? 40.463 46.903 36.328 1.00 0.00 ? 78 DC  B H42    3  
ATOM 5578  H H5     . DC  B 2 12 ? 43.999 47.805 36.480 1.00 0.00 ? 78 DC  B H5     3  
ATOM 5579  H H6     . DC  B 2 12 ? 45.300 48.121 34.423 1.00 0.00 ? 78 DC  B H6     3  
ATOM 5580  P P      . DG  B 2 13 ? 46.054 50.444 28.755 1.00 0.00 ? 79 DG  B P      3  
ATOM 5581  O OP1    . DG  B 2 13 ? 46.301 50.206 27.310 1.00 0.00 ? 79 DG  B OP1    3  
ATOM 5582  O OP2    . DG  B 2 13 ? 46.792 51.524 29.442 1.00 0.00 ? 79 DG  B OP2    3  
ATOM 5583  O "O5'"  . DG  B 2 13 ? 44.512 50.777 28.921 1.00 0.00 ? 79 DG  B "O5'"  3  
ATOM 5584  C "C5'"  . DG  B 2 13 ? 43.527 50.189 28.088 1.00 0.00 ? 79 DG  B "C5'"  3  
ATOM 5585  C "C4'"  . DG  B 2 13 ? 42.117 50.636 28.478 1.00 0.00 ? 79 DG  B "C4'"  3  
ATOM 5586  O "O4'"  . DG  B 2 13 ? 41.777 50.100 29.751 1.00 0.00 ? 79 DG  B "O4'"  3  
ATOM 5587  C "C3'"  . DG  B 2 13 ? 42.003 52.170 28.562 1.00 0.00 ? 79 DG  B "C3'"  3  
ATOM 5588  O "O3'"  . DG  B 2 13 ? 40.893 52.652 27.816 1.00 0.00 ? 79 DG  B "O3'"  3  
ATOM 5589  C "C2'"  . DG  B 2 13 ? 41.806 52.413 30.056 1.00 0.00 ? 79 DG  B "C2'"  3  
ATOM 5590  C "C1'"  . DG  B 2 13 ? 41.114 51.117 30.475 1.00 0.00 ? 79 DG  B "C1'"  3  
ATOM 5591  N N9     . DG  B 2 13 ? 41.119 50.827 31.930 1.00 0.00 ? 79 DG  B N9     3  
ATOM 5592  C C8     . DG  B 2 13 ? 42.099 51.033 32.873 1.00 0.00 ? 79 DG  B C8     3  
ATOM 5593  N N7     . DG  B 2 13 ? 41.738 50.761 34.103 1.00 0.00 ? 79 DG  B N7     3  
ATOM 5594  C C5     . DG  B 2 13 ? 40.403 50.349 33.962 1.00 0.00 ? 79 DG  B C5     3  
ATOM 5595  C C6     . DG  B 2 13 ? 39.402 49.977 34.928 1.00 0.00 ? 79 DG  B C6     3  
ATOM 5596  O O6     . DG  B 2 13 ? 39.460 49.981 36.157 1.00 0.00 ? 79 DG  B O6     3  
ATOM 5597  N N1     . DG  B 2 13 ? 38.203 49.592 34.364 1.00 0.00 ? 79 DG  B N1     3  
ATOM 5598  C C2     . DG  B 2 13 ? 37.958 49.604 33.035 1.00 0.00 ? 79 DG  B C2     3  
ATOM 5599  N N2     . DG  B 2 13 ? 36.775 49.220 32.639 1.00 0.00 ? 79 DG  B N2     3  
ATOM 5600  N N3     . DG  B 2 13 ? 38.829 49.983 32.107 1.00 0.00 ? 79 DG  B N3     3  
ATOM 5601  C C4     . DG  B 2 13 ? 40.040 50.345 32.632 1.00 0.00 ? 79 DG  B C4     3  
ATOM 5602  H "H5'"  . DG  B 2 13 ? 43.588 49.100 28.149 1.00 0.00 ? 79 DG  B "H5'"  3  
ATOM 5603  H "H5''" . DG  B 2 13 ? 43.707 50.497 27.058 1.00 0.00 ? 79 DG  B "H5''" 3  
ATOM 5604  H "H4'"  . DG  B 2 13 ? 41.411 50.260 27.735 1.00 0.00 ? 79 DG  B "H4'"  3  
ATOM 5605  H "H3'"  . DG  B 2 13 ? 42.918 52.653 28.214 1.00 0.00 ? 79 DG  B "H3'"  3  
ATOM 5606  H "HO3'" . DG  B 2 13 ? 40.989 52.295 26.898 1.00 0.00 ? 79 DG  B "HO3'" 3  
ATOM 5607  H "H2'"  . DG  B 2 13 ? 42.776 52.511 30.544 1.00 0.00 ? 79 DG  B "H2'"  3  
ATOM 5608  H "H2''" . DG  B 2 13 ? 41.182 53.287 30.246 1.00 0.00 ? 79 DG  B "H2''" 3  
ATOM 5609  H "H1'"  . DG  B 2 13 ? 40.077 51.176 30.134 1.00 0.00 ? 79 DG  B "H1'"  3  
ATOM 5610  H H8     . DG  B 2 13 ? 43.084 51.395 32.611 1.00 0.00 ? 79 DG  B H8     3  
ATOM 5611  H H1     . DG  B 2 13 ? 37.459 49.317 34.986 1.00 0.00 ? 79 DG  B H1     3  
ATOM 5612  H H21    . DG  B 2 13 ? 36.569 49.228 31.655 1.00 0.00 ? 79 DG  B H21    3  
ATOM 5613  H H22    . DG  B 2 13 ? 36.084 48.913 33.318 1.00 0.00 ? 79 DG  B H22    3  
ATOM 5614  O "O5'"  . DC  C 3 1  ? 29.106 47.467 38.903 1.00 0.00 ? 80 DC  C "O5'"  3  
ATOM 5615  C "C5'"  . DC  C 3 1  ? 30.291 48.060 38.395 1.00 0.00 ? 80 DC  C "C5'"  3  
ATOM 5616  C "C4'"  . DC  C 3 1  ? 30.319 48.105 36.857 1.00 0.00 ? 80 DC  C "C4'"  3  
ATOM 5617  O "O4'"  . DC  C 3 1  ? 31.519 48.750 36.446 1.00 0.00 ? 80 DC  C "O4'"  3  
ATOM 5618  C "C3'"  . DC  C 3 1  ? 30.314 46.720 36.202 1.00 0.00 ? 80 DC  C "C3'"  3  
ATOM 5619  O "O3'"  . DC  C 3 1  ? 29.695 46.802 34.922 1.00 0.00 ? 80 DC  C "O3'"  3  
ATOM 5620  C "C2'"  . DC  C 3 1  ? 31.809 46.417 36.106 1.00 0.00 ? 80 DC  C "C2'"  3  
ATOM 5621  C "C1'"  . DC  C 3 1  ? 32.415 47.805 35.874 1.00 0.00 ? 80 DC  C "C1'"  3  
ATOM 5622  N N1     . DC  C 3 1  ? 33.784 48.003 36.446 1.00 0.00 ? 80 DC  C N1     3  
ATOM 5623  C C2     . DC  C 3 1  ? 34.835 48.383 35.600 1.00 0.00 ? 80 DC  C C2     3  
ATOM 5624  O O2     . DC  C 3 1  ? 34.673 48.521 34.388 1.00 0.00 ? 80 DC  C O2     3  
ATOM 5625  N N3     . DC  C 3 1  ? 36.076 48.632 36.086 1.00 0.00 ? 80 DC  C N3     3  
ATOM 5626  C C4     . DC  C 3 1  ? 36.268 48.541 37.387 1.00 0.00 ? 80 DC  C C4     3  
ATOM 5627  N N4     . DC  C 3 1  ? 37.464 48.808 37.824 1.00 0.00 ? 80 DC  C N4     3  
ATOM 5628  C C5     . DC  C 3 1  ? 35.242 48.197 38.301 1.00 0.00 ? 80 DC  C C5     3  
ATOM 5629  C C6     . DC  C 3 1  ? 34.013 47.918 37.798 1.00 0.00 ? 80 DC  C C6     3  
ATOM 5630  H "H5'"  . DC  C 3 1  ? 31.147 47.494 38.755 1.00 0.00 ? 80 DC  C "H5'"  3  
ATOM 5631  H "H5''" . DC  C 3 1  ? 30.376 49.081 38.771 1.00 0.00 ? 80 DC  C "H5''" 3  
ATOM 5632  H "H4'"  . DC  C 3 1  ? 29.454 48.673 36.513 1.00 0.00 ? 80 DC  C "H4'"  3  
ATOM 5633  H "H3'"  . DC  C 3 1  ? 29.796 46.000 36.840 1.00 0.00 ? 80 DC  C "H3'"  3  
ATOM 5634  H "H2'"  . DC  C 3 1  ? 32.158 45.983 37.041 1.00 0.00 ? 80 DC  C "H2'"  3  
ATOM 5635  H "H2''" . DC  C 3 1  ? 32.029 45.748 35.275 1.00 0.00 ? 80 DC  C "H2''" 3  
ATOM 5636  H "H1'"  . DC  C 3 1  ? 32.429 47.970 34.792 1.00 0.00 ? 80 DC  C "H1'"  3  
ATOM 5637  H H41    . DC  C 3 1  ? 37.658 48.773 38.807 1.00 0.00 ? 80 DC  C H41    3  
ATOM 5638  H H42    . DC  C 3 1  ? 38.180 49.065 37.159 1.00 0.00 ? 80 DC  C H42    3  
ATOM 5639  H H5     . DC  C 3 1  ? 35.415 48.152 39.363 1.00 0.00 ? 80 DC  C H5     3  
ATOM 5640  H H6     . DC  C 3 1  ? 33.204 47.654 38.463 1.00 0.00 ? 80 DC  C H6     3  
ATOM 5641  H "HO5'" . DC  C 3 1  ? 29.342 46.656 39.408 1.00 0.00 ? 80 DC  C "HO5'" 3  
ATOM 5642  P P      . DG  C 3 2  ? 29.124 45.515 34.170 1.00 0.00 ? 81 DG  C P      3  
ATOM 5643  O OP1    . DG  C 3 2  ? 28.159 45.979 33.144 1.00 0.00 ? 81 DG  C OP1    3  
ATOM 5644  O OP2    . DG  C 3 2  ? 28.681 44.515 35.154 1.00 0.00 ? 81 DG  C OP2    3  
ATOM 5645  O "O5'"  . DG  C 3 2  ? 30.352 44.815 33.453 1.00 0.00 ? 81 DG  C "O5'"  3  
ATOM 5646  C "C5'"  . DG  C 3 2  ? 30.905 45.259 32.228 1.00 0.00 ? 81 DG  C "C5'"  3  
ATOM 5647  C "C4'"  . DG  C 3 2  ? 32.273 44.602 31.996 1.00 0.00 ? 81 DG  C "C4'"  3  
ATOM 5648  O "O4'"  . DG  C 3 2  ? 33.256 45.254 32.797 1.00 0.00 ? 81 DG  C "O4'"  3  
ATOM 5649  C "C3'"  . DG  C 3 2  ? 32.309 43.100 32.370 1.00 0.00 ? 81 DG  C "C3'"  3  
ATOM 5650  O "O3'"  . DG  C 3 2  ? 32.926 42.265 31.403 1.00 0.00 ? 81 DG  C "O3'"  3  
ATOM 5651  C "C2'"  . DG  C 3 2  ? 33.218 43.106 33.597 1.00 0.00 ? 81 DG  C "C2'"  3  
ATOM 5652  C "C1'"  . DG  C 3 2  ? 34.153 44.259 33.240 1.00 0.00 ? 81 DG  C "C1'"  3  
ATOM 5653  N N9     . DG  C 3 2  ? 35.037 44.730 34.336 1.00 0.00 ? 81 DG  C N9     3  
ATOM 5654  C C8     . DG  C 3 2  ? 34.866 44.617 35.697 1.00 0.00 ? 81 DG  C C8     3  
ATOM 5655  N N7     . DG  C 3 2  ? 35.886 45.016 36.408 1.00 0.00 ? 81 DG  C N7     3  
ATOM 5656  C C5     . DG  C 3 2  ? 36.821 45.412 35.441 1.00 0.00 ? 81 DG  C C5     3  
ATOM 5657  C C6     . DG  C 3 2  ? 38.172 45.892 35.566 1.00 0.00 ? 81 DG  C C6     3  
ATOM 5658  O O6     . DG  C 3 2  ? 38.852 46.048 36.581 1.00 0.00 ? 81 DG  C O6     3  
ATOM 5659  N N1     . DG  C 3 2  ? 38.767 46.199 34.359 1.00 0.00 ? 81 DG  C N1     3  
ATOM 5660  C C2     . DG  C 3 2  ? 38.157 46.053 33.162 1.00 0.00 ? 81 DG  C C2     3  
ATOM 5661  N N2     . DG  C 3 2  ? 38.862 46.375 32.111 1.00 0.00 ? 81 DG  C N2     3  
ATOM 5662  N N3     . DG  C 3 2  ? 36.932 45.553 32.986 1.00 0.00 ? 81 DG  C N3     3  
ATOM 5663  C C4     . DG  C 3 2  ? 36.301 45.264 34.171 1.00 0.00 ? 81 DG  C C4     3  
ATOM 5664  H "H5'"  . DG  C 3 2  ? 31.034 46.343 32.243 1.00 0.00 ? 81 DG  C "H5'"  3  
ATOM 5665  H "H5''" . DG  C 3 2  ? 30.232 44.999 31.412 1.00 0.00 ? 81 DG  C "H5''" 3  
ATOM 5666  H "H4'"  . DG  C 3 2  ? 32.538 44.723 30.947 1.00 0.00 ? 81 DG  C "H4'"  3  
ATOM 5667  H "H3'"  . DG  C 3 2  ? 31.319 42.717 32.625 1.00 0.00 ? 81 DG  C "H3'"  3  
ATOM 5668  H "H2'"  . DG  C 3 2  ? 32.630 43.336 34.486 1.00 0.00 ? 81 DG  C "H2'"  3  
ATOM 5669  H "H2''" . DG  C 3 2  ? 33.760 42.166 33.712 1.00 0.00 ? 81 DG  C "H2''" 3  
ATOM 5670  H "H1'"  . DG  C 3 2  ? 34.782 43.950 32.401 1.00 0.00 ? 81 DG  C "H1'"  3  
ATOM 5671  H H8     . DG  C 3 2  ? 33.959 44.223 36.139 1.00 0.00 ? 81 DG  C H8     3  
ATOM 5672  H H1     . DG  C 3 2  ? 39.723 46.523 34.370 1.00 0.00 ? 81 DG  C H1     3  
ATOM 5673  H H21    . DG  C 3 2  ? 38.453 46.252 31.194 1.00 0.00 ? 81 DG  C H21    3  
ATOM 5674  H H22    . DG  C 3 2  ? 39.815 46.714 32.204 1.00 0.00 ? 81 DG  C H22    3  
ATOM 5675  P P      . DG  C 3 3  ? 32.200 41.808 30.056 1.00 0.00 ? 82 DG  C P      3  
ATOM 5676  O OP1    . DG  C 3 3  ? 31.006 42.629 29.791 1.00 0.00 ? 82 DG  C OP1    3  
ATOM 5677  O OP2    . DG  C 3 3  ? 32.043 40.338 30.123 1.00 0.00 ? 82 DG  C OP2    3  
ATOM 5678  O "O5'"  . DG  C 3 3  ? 33.318 42.100 28.955 1.00 0.00 ? 82 DG  C "O5'"  3  
ATOM 5679  C "C5'"  . DG  C 3 3  ? 33.480 43.379 28.358 1.00 0.00 ? 82 DG  C "C5'"  3  
ATOM 5680  C "C4'"  . DG  C 3 3  ? 34.853 43.577 27.689 1.00 0.00 ? 82 DG  C "C4'"  3  
ATOM 5681  O "O4'"  . DG  C 3 3  ? 35.846 43.847 28.676 1.00 0.00 ? 82 DG  C "O4'"  3  
ATOM 5682  C "C3'"  . DG  C 3 3  ? 35.384 42.413 26.841 1.00 0.00 ? 82 DG  C "C3'"  3  
ATOM 5683  O "O3'"  . DG  C 3 3  ? 36.163 42.941 25.768 1.00 0.00 ? 82 DG  C "O3'"  3  
ATOM 5684  C "C2'"  . DG  C 3 3  ? 36.230 41.656 27.859 1.00 0.00 ? 82 DG  C "C2'"  3  
ATOM 5685  C "C1'"  . DG  C 3 3  ? 36.779 42.777 28.738 1.00 0.00 ? 82 DG  C "C1'"  3  
ATOM 5686  N N9     . DG  C 3 3  ? 36.952 42.414 30.161 1.00 0.00 ? 82 DG  C N9     3  
ATOM 5687  C C8     . DG  C 3 3  ? 36.040 41.834 31.002 1.00 0.00 ? 82 DG  C C8     3  
ATOM 5688  N N7     . DG  C 3 3  ? 36.409 41.787 32.255 1.00 0.00 ? 82 DG  C N7     3  
ATOM 5689  C C5     . DG  C 3 3  ? 37.683 42.370 32.238 1.00 0.00 ? 82 DG  C C5     3  
ATOM 5690  C C6     . DG  C 3 3  ? 38.620 42.640 33.297 1.00 0.00 ? 82 DG  C C6     3  
ATOM 5691  O O6     . DG  C 3 3  ? 38.494 42.458 34.509 1.00 0.00 ? 82 DG  C O6     3  
ATOM 5692  N N1     . DG  C 3 3  ? 39.811 43.170 32.852 1.00 0.00 ? 82 DG  C N1     3  
ATOM 5693  C C2     . DG  C 3 3  ? 40.062 43.475 31.556 1.00 0.00 ? 82 DG  C C2     3  
ATOM 5694  N N2     . DG  C 3 3  ? 41.230 43.978 31.288 1.00 0.00 ? 82 DG  C N2     3  
ATOM 5695  N N3     . DG  C 3 3  ? 39.212 43.292 30.547 1.00 0.00 ? 82 DG  C N3     3  
ATOM 5696  C C4     . DG  C 3 3  ? 38.035 42.722 30.952 1.00 0.00 ? 82 DG  C C4     3  
ATOM 5697  H "H5'"  . DG  C 3 3  ? 33.374 44.155 29.113 1.00 0.00 ? 82 DG  C "H5'"  3  
ATOM 5698  H "H5''" . DG  C 3 3  ? 32.692 43.532 27.620 1.00 0.00 ? 82 DG  C "H5''" 3  
ATOM 5699  H "H4'"  . DG  C 3 3  ? 34.753 44.447 27.045 1.00 0.00 ? 82 DG  C "H4'"  3  
ATOM 5700  H "H3'"  . DG  C 3 3  ? 34.569 41.792 26.469 1.00 0.00 ? 82 DG  C "H3'"  3  
ATOM 5701  H "H2'"  . DG  C 3 3  ? 35.588 40.989 28.426 1.00 0.00 ? 82 DG  C "H2'"  3  
ATOM 5702  H "H2''" . DG  C 3 3  ? 37.034 41.091 27.395 1.00 0.00 ? 82 DG  C "H2''" 3  
ATOM 5703  H "H1'"  . DG  C 3 3  ? 37.738 43.094 28.321 1.00 0.00 ? 82 DG  C "H1'"  3  
ATOM 5704  H H8     . DG  C 3 3  ? 35.084 41.482 30.645 1.00 0.00 ? 82 DG  C H8     3  
ATOM 5705  H H1     . DG  C 3 3  ? 40.526 43.357 33.539 1.00 0.00 ? 82 DG  C H1     3  
ATOM 5706  H H21    . DG  C 3 3  ? 41.457 44.164 30.327 1.00 0.00 ? 82 DG  C H21    3  
ATOM 5707  H H22    . DG  C 3 3  ? 41.909 44.126 32.029 1.00 0.00 ? 82 DG  C H22    3  
ATOM 5708  P P      . DG  C 3 4  ? 36.848 42.023 24.644 1.00 0.00 ? 83 DG  C P      3  
ATOM 5709  O OP1    . DG  C 3 4  ? 36.997 42.844 23.427 1.00 0.00 ? 83 DG  C OP1    3  
ATOM 5710  O OP2    . DG  C 3 4  ? 36.131 40.738 24.534 1.00 0.00 ? 83 DG  C OP2    3  
ATOM 5711  O "O5'"  . DG  C 3 4  ? 38.274 41.665 25.224 1.00 0.00 ? 83 DG  C "O5'"  3  
ATOM 5712  C "C5'"  . DG  C 3 4  ? 39.352 42.583 25.250 1.00 0.00 ? 83 DG  C "C5'"  3  
ATOM 5713  C "C4'"  . DG  C 3 4  ? 40.556 41.914 25.923 1.00 0.00 ? 83 DG  C "C4'"  3  
ATOM 5714  O "O4'"  . DG  C 3 4  ? 40.270 41.701 27.301 1.00 0.00 ? 83 DG  C "O4'"  3  
ATOM 5715  C "C3'"  . DG  C 3 4  ? 40.889 40.547 25.293 1.00 0.00 ? 83 DG  C "C3'"  3  
ATOM 5716  O "O3'"  . DG  C 3 4  ? 42.277 40.443 25.006 1.00 0.00 ? 83 DG  C "O3'"  3  
ATOM 5717  C "C2'"  . DG  C 3 4  ? 40.464 39.565 26.383 1.00 0.00 ? 83 DG  C "C2'"  3  
ATOM 5718  C "C1'"  . DG  C 3 4  ? 40.694 40.396 27.640 1.00 0.00 ? 83 DG  C "C1'"  3  
ATOM 5719  N N9     . DG  C 3 4  ? 39.983 39.926 28.851 1.00 0.00 ? 83 DG  C N9     3  
ATOM 5720  C C8     . DG  C 3 4  ? 38.723 39.386 28.987 1.00 0.00 ? 83 DG  C C8     3  
ATOM 5721  N N7     . DG  C 3 4  ? 38.363 39.157 30.225 1.00 0.00 ? 83 DG  C N7     3  
ATOM 5722  C C5     . DG  C 3 4  ? 39.496 39.537 30.963 1.00 0.00 ? 83 DG  C C5     3  
ATOM 5723  C C6     . DG  C 3 4  ? 39.766 39.524 32.378 1.00 0.00 ? 83 DG  C C6     3  
ATOM 5724  O O6     . DG  C 3 4  ? 39.038 39.181 33.310 1.00 0.00 ? 83 DG  C O6     3  
ATOM 5725  N N1     . DG  C 3 4  ? 41.029 39.967 32.706 1.00 0.00 ? 83 DG  C N1     3  
ATOM 5726  C C2     . DG  C 3 4  ? 41.949 40.355 31.794 1.00 0.00 ? 83 DG  C C2     3  
ATOM 5727  N N2     . DG  C 3 4  ? 43.140 40.621 32.242 1.00 0.00 ? 83 DG  C N2     3  
ATOM 5728  N N3     . DG  C 3 4  ? 41.752 40.398 30.480 1.00 0.00 ? 83 DG  C N3     3  
ATOM 5729  C C4     . DG  C 3 4  ? 40.495 39.982 30.126 1.00 0.00 ? 83 DG  C C4     3  
ATOM 5730  H "H5'"  . DG  C 3 4  ? 39.077 43.476 25.811 1.00 0.00 ? 83 DG  C "H5'"  3  
ATOM 5731  H "H5''" . DG  C 3 4  ? 39.618 42.872 24.232 1.00 0.00 ? 83 DG  C "H5''" 3  
ATOM 5732  H "H4'"  . DG  C 3 4  ? 41.415 42.575 25.837 1.00 0.00 ? 83 DG  C "H4'"  3  
ATOM 5733  H "H3'"  . DG  C 3 4  ? 40.302 40.397 24.387 1.00 0.00 ? 83 DG  C "H3'"  3  
ATOM 5734  H "H2'"  . DG  C 3 4  ? 39.409 39.325 26.262 1.00 0.00 ? 83 DG  C "H2'"  3  
ATOM 5735  H "H2''" . DG  C 3 4  ? 41.076 38.666 26.385 1.00 0.00 ? 83 DG  C "H2''" 3  
ATOM 5736  H "H1'"  . DG  C 3 4  ? 41.766 40.415 27.846 1.00 0.00 ? 83 DG  C "H1'"  3  
ATOM 5737  H H8     . DG  C 3 4  ? 38.076 39.199 28.137 1.00 0.00 ? 83 DG  C H8     3  
ATOM 5738  H H1     . DG  C 3 4  ? 41.287 39.964 33.683 1.00 0.00 ? 83 DG  C H1     3  
ATOM 5739  H H21    . DG  C 3 4  ? 43.898 40.684 31.576 1.00 0.00 ? 83 DG  C H21    3  
ATOM 5740  H H22    . DG  C 3 4  ? 43.342 40.503 33.230 1.00 0.00 ? 83 DG  C H22    3  
ATOM 5741  P P      . DG  C 3 5  ? 42.871 39.361 23.984 1.00 0.00 ? 84 DG  C P      3  
ATOM 5742  O OP1    . DG  C 3 5  ? 43.555 40.120 22.911 1.00 0.00 ? 84 DG  C OP1    3  
ATOM 5743  O OP2    . DG  C 3 5  ? 41.824 38.388 23.594 1.00 0.00 ? 84 DG  C OP2    3  
ATOM 5744  O "O5'"  . DG  C 3 5  ? 43.940 38.565 24.870 1.00 0.00 ? 84 DG  C "O5'"  3  
ATOM 5745  C "C5'"  . DG  C 3 5  ? 45.207 39.119 25.200 1.00 0.00 ? 84 DG  C "C5'"  3  
ATOM 5746  C "C4'"  . DG  C 3 5  ? 45.820 38.494 26.470 1.00 0.00 ? 84 DG  C "C4'"  3  
ATOM 5747  O "O4'"  . DG  C 3 5  ? 44.883 38.523 27.553 1.00 0.00 ? 84 DG  C "O4'"  3  
ATOM 5748  C "C3'"  . DG  C 3 5  ? 46.286 37.042 26.295 1.00 0.00 ? 84 DG  C "C3'"  3  
ATOM 5749  O "O3'"  . DG  C 3 5  ? 47.608 36.936 26.820 1.00 0.00 ? 84 DG  C "O3'"  3  
ATOM 5750  C "C2'"  . DG  C 3 5  ? 45.251 36.267 27.106 1.00 0.00 ? 84 DG  C "C2'"  3  
ATOM 5751  C "C1'"  . DG  C 3 5  ? 44.887 37.261 28.204 1.00 0.00 ? 84 DG  C "C1'"  3  
ATOM 5752  N N9     . DG  C 3 5  ? 43.569 36.986 28.841 1.00 0.00 ? 84 DG  C N9     3  
ATOM 5753  C C8     . DG  C 3 5  ? 42.363 36.704 28.238 1.00 0.00 ? 84 DG  C C8     3  
ATOM 5754  N N7     . DG  C 3 5  ? 41.373 36.492 29.068 1.00 0.00 ? 84 DG  C N7     3  
ATOM 5755  C C5     . DG  C 3 5  ? 41.970 36.653 30.331 1.00 0.00 ? 84 DG  C C5     3  
ATOM 5756  C C6     . DG  C 3 5  ? 41.426 36.586 31.665 1.00 0.00 ? 84 DG  C C6     3  
ATOM 5757  O O6     . DG  C 3 5  ? 40.258 36.450 32.028 1.00 0.00 ? 84 DG  C O6     3  
ATOM 5758  N N1     . DG  C 3 5  ? 42.376 36.712 32.657 1.00 0.00 ? 84 DG  C N1     3  
ATOM 5759  C C2     . DG  C 3 5  ? 43.681 36.972 32.422 1.00 0.00 ? 84 DG  C C2     3  
ATOM 5760  N N2     . DG  C 3 5  ? 44.457 37.058 33.465 1.00 0.00 ? 84 DG  C N2     3  
ATOM 5761  N N3     . DG  C 3 5  ? 44.218 37.125 31.209 1.00 0.00 ? 84 DG  C N3     3  
ATOM 5762  C C4     . DG  C 3 5  ? 43.315 36.932 30.197 1.00 0.00 ? 84 DG  C C4     3  
ATOM 5763  H "H5'"  . DG  C 3 5  ? 45.107 40.192 25.359 1.00 0.00 ? 84 DG  C "H5'"  3  
ATOM 5764  H "H5''" . DG  C 3 5  ? 45.892 38.977 24.364 1.00 0.00 ? 84 DG  C "H5''" 3  
ATOM 5765  H "H4'"  . DG  C 3 5  ? 46.690 39.089 26.742 1.00 0.00 ? 84 DG  C "H4'"  3  
ATOM 5766  H "H3'"  . DG  C 3 5  ? 46.267 36.754 25.243 1.00 0.00 ? 84 DG  C "H3'"  3  
ATOM 5767  H "H2'"  . DG  C 3 5  ? 44.389 36.065 26.476 1.00 0.00 ? 84 DG  C "H2'"  3  
ATOM 5768  H "H2''" . DG  C 3 5  ? 45.651 35.341 27.513 1.00 0.00 ? 84 DG  C "H2''" 3  
ATOM 5769  H "H1'"  . DG  C 3 5  ? 45.678 37.236 28.960 1.00 0.00 ? 84 DG  C "H1'"  3  
ATOM 5770  H H8     . DG  C 3 5  ? 42.253 36.674 27.160 1.00 0.00 ? 84 DG  C H8     3  
ATOM 5771  H H1     . DG  C 3 5  ? 42.081 36.574 33.613 1.00 0.00 ? 84 DG  C H1     3  
ATOM 5772  H H21    . DG  C 3 5  ? 45.437 37.261 33.313 1.00 0.00 ? 84 DG  C H21    3  
ATOM 5773  H H22    . DG  C 3 5  ? 44.111 36.825 34.391 1.00 0.00 ? 84 DG  C H22    3  
ATOM 5774  P P      . DA  C 3 6  ? 48.484 35.599 26.779 1.00 0.00 ? 85 DA  C P      3  
ATOM 5775  O OP1    . DA  C 3 6  ? 49.887 35.975 26.454 1.00 0.00 ? 85 DA  C OP1    3  
ATOM 5776  O OP2    . DA  C 3 6  ? 47.793 34.589 25.949 1.00 0.00 ? 85 DA  C OP2    3  
ATOM 5777  O "O5'"  . DA  C 3 6  ? 48.440 35.105 28.300 1.00 0.00 ? 85 DA  C "O5'"  3  
ATOM 5778  C "C5'"  . DA  C 3 6  ? 49.041 35.881 29.330 1.00 0.00 ? 85 DA  C "C5'"  3  
ATOM 5779  C "C4'"  . DA  C 3 6  ? 48.836 35.333 30.752 1.00 0.00 ? 85 DA  C "C4'"  3  
ATOM 5780  O "O4'"  . DA  C 3 6  ? 47.451 35.347 31.083 1.00 0.00 ? 85 DA  C "O4'"  3  
ATOM 5781  C "C3'"  . DA  C 3 6  ? 49.359 33.907 30.978 1.00 0.00 ? 85 DA  C "C3'"  3  
ATOM 5782  O "O3'"  . DA  C 3 6  ? 50.125 33.867 32.186 1.00 0.00 ? 85 DA  C "O3'"  3  
ATOM 5783  C "C2'"  . DA  C 3 6  ? 48.070 33.095 31.073 1.00 0.00 ? 85 DA  C "C2'"  3  
ATOM 5784  C "C1'"  . DA  C 3 6  ? 47.092 34.105 31.663 1.00 0.00 ? 85 DA  C "C1'"  3  
ATOM 5785  N N9     . DA  C 3 6  ? 45.686 33.813 31.311 1.00 0.00 ? 85 DA  C N9     3  
ATOM 5786  C C8     . DA  C 3 6  ? 45.141 33.736 30.054 1.00 0.00 ? 85 DA  C C8     3  
ATOM 5787  N N7     . DA  C 3 6  ? 43.842 33.574 30.040 1.00 0.00 ? 85 DA  C N7     3  
ATOM 5788  C C5     . DA  C 3 6  ? 43.520 33.497 31.406 1.00 0.00 ? 85 DA  C C5     3  
ATOM 5789  C C6     . DA  C 3 6  ? 42.322 33.321 32.143 1.00 0.00 ? 85 DA  C C6     3  
ATOM 5790  N N6     . DA  C 3 6  ? 41.120 33.202 31.617 1.00 0.00 ? 85 DA  C N6     3  
ATOM 5791  N N1     . DA  C 3 6  ? 42.332 33.263 33.475 1.00 0.00 ? 85 DA  C N1     3  
ATOM 5792  C C2     . DA  C 3 6  ? 43.497 33.389 34.093 1.00 0.00 ? 85 DA  C C2     3  
ATOM 5793  N N3     . DA  C 3 6  ? 44.697 33.576 33.550 1.00 0.00 ? 85 DA  C N3     3  
ATOM 5794  C C4     . DA  C 3 6  ? 44.639 33.621 32.187 1.00 0.00 ? 85 DA  C C4     3  
ATOM 5795  H "H5'"  . DA  C 3 6  ? 48.624 36.888 29.298 1.00 0.00 ? 85 DA  C "H5'"  3  
ATOM 5796  H "H5''" . DA  C 3 6  ? 50.112 35.956 29.144 1.00 0.00 ? 85 DA  C "H5''" 3  
ATOM 5797  H "H4'"  . DA  C 3 6  ? 49.368 35.998 31.433 1.00 0.00 ? 85 DA  C "H4'"  3  
ATOM 5798  H "H3'"  . DA  C 3 6  ? 49.954 33.584 30.122 1.00 0.00 ? 85 DA  C "H3'"  3  
ATOM 5799  H "H2'"  . DA  C 3 6  ? 47.762 32.795 30.071 1.00 0.00 ? 85 DA  C "H2'"  3  
ATOM 5800  H "H2''" . DA  C 3 6  ? 48.167 32.219 31.710 1.00 0.00 ? 85 DA  C "H2''" 3  
ATOM 5801  H "H1'"  . DA  C 3 6  ? 47.215 34.136 32.751 1.00 0.00 ? 85 DA  C "H1'"  3  
ATOM 5802  H H8     . DA  C 3 6  ? 45.746 33.823 29.159 1.00 0.00 ? 85 DA  C H8     3  
ATOM 5803  H H61    . DA  C 3 6  ? 41.003 33.192 30.612 1.00 0.00 ? 85 DA  C H61    3  
ATOM 5804  H H62    . DA  C 3 6  ? 40.328 33.126 32.242 1.00 0.00 ? 85 DA  C H62    3  
ATOM 5805  H H2     . DA  C 3 6  ? 43.468 33.330 35.174 1.00 0.00 ? 85 DA  C H2     3  
ATOM 5806  P P      . DT  C 3 7  ? 51.036 32.610 32.578 1.00 0.00 ? 86 DT  C P      3  
ATOM 5807  O OP1    . DT  C 3 7  ? 52.067 33.069 33.537 1.00 0.00 ? 86 DT  C OP1    3  
ATOM 5808  O OP2    . DT  C 3 7  ? 51.468 31.963 31.318 1.00 0.00 ? 86 DT  C OP2    3  
ATOM 5809  O "O5'"  . DT  C 3 7  ? 50.032 31.645 33.361 1.00 0.00 ? 86 DT  C "O5'"  3  
ATOM 5810  C "C5'"  . DT  C 3 7  ? 49.535 32.047 34.636 1.00 0.00 ? 86 DT  C "C5'"  3  
ATOM 5811  C "C4'"  . DT  C 3 7  ? 48.358 31.215 35.148 1.00 0.00 ? 86 DT  C "C4'"  3  
ATOM 5812  O "O4'"  . DT  C 3 7  ? 47.223 31.361 34.317 1.00 0.00 ? 86 DT  C "O4'"  3  
ATOM 5813  C "C3'"  . DT  C 3 7  ? 48.645 29.713 35.239 1.00 0.00 ? 86 DT  C "C3'"  3  
ATOM 5814  O "O3'"  . DT  C 3 7  ? 48.942 29.389 36.588 1.00 0.00 ? 86 DT  C "O3'"  3  
ATOM 5815  C "C2'"  . DT  C 3 7  ? 47.355 29.077 34.706 1.00 0.00 ? 86 DT  C "C2'"  3  
ATOM 5816  C "C1'"  . DT  C 3 7  ? 46.389 30.258 34.601 1.00 0.00 ? 86 DT  C "C1'"  3  
ATOM 5817  N N1     . DT  C 3 7  ? 45.359 30.109 33.539 1.00 0.00 ? 86 DT  C N1     3  
ATOM 5818  C C2     . DT  C 3 7  ? 44.015 30.004 33.924 1.00 0.00 ? 86 DT  C C2     3  
ATOM 5819  O O2     . DT  C 3 7  ? 43.641 29.932 35.091 1.00 0.00 ? 86 DT  C O2     3  
ATOM 5820  N N3     . DT  C 3 7  ? 43.080 29.986 32.919 1.00 0.00 ? 86 DT  C N3     3  
ATOM 5821  C C4     . DT  C 3 7  ? 43.350 30.055 31.572 1.00 0.00 ? 86 DT  C C4     3  
ATOM 5822  O O4     . DT  C 3 7  ? 42.405 30.094 30.787 1.00 0.00 ? 86 DT  C O4     3  
ATOM 5823  C C5     . DT  C 3 7  ? 44.772 30.098 31.230 1.00 0.00 ? 86 DT  C C5     3  
ATOM 5824  C C7     . DT  C 3 7  ? 45.207 30.131 29.776 1.00 0.00 ? 86 DT  C C7     3  
ATOM 5825  C C6     . DT  C 3 7  ? 45.720 30.128 32.206 1.00 0.00 ? 86 DT  C C6     3  
ATOM 5826  H "H5'"  . DT  C 3 7  ? 49.200 33.082 34.587 1.00 0.00 ? 86 DT  C "H5'"  3  
ATOM 5827  H "H5''" . DT  C 3 7  ? 50.338 31.994 35.369 1.00 0.00 ? 86 DT  C "H5''" 3  
ATOM 5828  H "H4'"  . DT  C 3 7  ? 48.096 31.574 36.146 1.00 0.00 ? 86 DT  C "H4'"  3  
ATOM 5829  H "H3'"  . DT  C 3 7  ? 49.483 29.450 34.598 1.00 0.00 ? 86 DT  C "H3'"  3  
ATOM 5830  H "H2'"  . DT  C 3 7  ? 47.545 28.643 33.725 1.00 0.00 ? 86 DT  C "H2'"  3  
ATOM 5831  H "H2''" . DT  C 3 7  ? 46.957 28.321 35.375 1.00 0.00 ? 86 DT  C "H2''" 3  
ATOM 5832  H "H1'"  . DT  C 3 7  ? 45.913 30.409 35.577 1.00 0.00 ? 86 DT  C "H1'"  3  
ATOM 5833  H H3     . DT  C 3 7  ? 42.109 29.932 33.198 1.00 0.00 ? 86 DT  C H3     3  
ATOM 5834  H H71    . DT  C 3 7  ? 44.891 29.212 29.282 1.00 0.00 ? 86 DT  C H71    3  
ATOM 5835  H H72    . DT  C 3 7  ? 44.727 30.969 29.272 1.00 0.00 ? 86 DT  C H72    3  
ATOM 5836  H H73    . DT  C 3 7  ? 46.289 30.232 29.685 1.00 0.00 ? 86 DT  C H73    3  
ATOM 5837  H H6     . DT  C 3 7  ? 46.770 30.187 31.943 1.00 0.00 ? 86 DT  C H6     3  
ATOM 5838  P P      . DT  C 3 8  ? 49.427 27.943 37.045 1.00 0.00 ? 87 DT  C P      3  
ATOM 5839  O OP1    . DT  C 3 8  ? 50.167 28.138 38.311 1.00 0.00 ? 87 DT  C OP1    3  
ATOM 5840  O OP2    . DT  C 3 8  ? 50.110 27.308 35.901 1.00 0.00 ? 87 DT  C OP2    3  
ATOM 5841  O "O5'"  . DT  C 3 8  ? 48.084 27.130 37.324 1.00 0.00 ? 87 DT  C "O5'"  3  
ATOM 5842  C "C5'"  . DT  C 3 8  ? 47.171 27.566 38.326 1.00 0.00 ? 87 DT  C "C5'"  3  
ATOM 5843  C "C4'"  . DT  C 3 8  ? 45.778 26.942 38.196 1.00 0.00 ? 87 DT  C "C4'"  3  
ATOM 5844  O "O4'"  . DT  C 3 8  ? 45.171 27.296 36.962 1.00 0.00 ? 87 DT  C "O4'"  3  
ATOM 5845  C "C3'"  . DT  C 3 8  ? 45.781 25.410 38.284 1.00 0.00 ? 87 DT  C "C3'"  3  
ATOM 5846  O "O3'"  . DT  C 3 8  ? 45.148 25.032 39.498 1.00 0.00 ? 87 DT  C "O3'"  3  
ATOM 5847  C "C2'"  . DT  C 3 8  ? 45.005 24.983 37.034 1.00 0.00 ? 87 DT  C "C2'"  3  
ATOM 5848  C "C1'"  . DT  C 3 8  ? 44.272 26.261 36.623 1.00 0.00 ? 87 DT  C "C1'"  3  
ATOM 5849  N N1     . DT  C 3 8  ? 43.932 26.343 35.174 1.00 0.00 ? 87 DT  C N1     3  
ATOM 5850  C C2     . DT  C 3 8  ? 42.586 26.504 34.817 1.00 0.00 ? 87 DT  C C2     3  
ATOM 5851  O O2     . DT  C 3 8  ? 41.660 26.548 35.621 1.00 0.00 ? 87 DT  C O2     3  
ATOM 5852  N N3     . DT  C 3 8  ? 42.311 26.634 33.476 1.00 0.00 ? 87 DT  C N3     3  
ATOM 5853  C C4     . DT  C 3 8  ? 43.235 26.656 32.459 1.00 0.00 ? 87 DT  C C4     3  
ATOM 5854  O O4     . DT  C 3 8  ? 42.846 26.855 31.307 1.00 0.00 ? 87 DT  C O4     3  
ATOM 5855  C C5     . DT  C 3 8  ? 44.619 26.468 32.889 1.00 0.00 ? 87 DT  C C5     3  
ATOM 5856  C C7     . DT  C 3 8  ? 45.734 26.450 31.859 1.00 0.00 ? 87 DT  C C7     3  
ATOM 5857  C C6     . DT  C 3 8  ? 44.923 26.316 34.208 1.00 0.00 ? 87 DT  C C6     3  
ATOM 5858  H "H5'"  . DT  C 3 8  ? 47.050 28.649 38.263 1.00 0.00 ? 87 DT  C "H5'"  3  
ATOM 5859  H "H5''" . DT  C 3 8  ? 47.572 27.322 39.309 1.00 0.00 ? 87 DT  C "H5''" 3  
ATOM 5860  H "H4'"  . DT  C 3 8  ? 45.155 27.330 39.004 1.00 0.00 ? 87 DT  C "H4'"  3  
ATOM 5861  H "H3'"  . DT  C 3 8  ? 46.803 25.032 38.251 1.00 0.00 ? 87 DT  C "H3'"  3  
ATOM 5862  H "H2'"  . DT  C 3 8  ? 45.708 24.673 36.262 1.00 0.00 ? 87 DT  C "H2'"  3  
ATOM 5863  H "H2''" . DT  C 3 8  ? 44.303 24.179 37.239 1.00 0.00 ? 87 DT  C "H2''" 3  
ATOM 5864  H "H1'"  . DT  C 3 8  ? 43.366 26.353 37.232 1.00 0.00 ? 87 DT  C "H1'"  3  
ATOM 5865  H H3     . DT  C 3 8  ? 41.336 26.703 33.220 1.00 0.00 ? 87 DT  C H3     3  
ATOM 5866  H H71    . DT  C 3 8  ? 45.758 27.397 31.323 1.00 0.00 ? 87 DT  C H71    3  
ATOM 5867  H H72    . DT  C 3 8  ? 46.702 26.273 32.328 1.00 0.00 ? 87 DT  C H72    3  
ATOM 5868  H H73    . DT  C 3 8  ? 45.535 25.661 31.134 1.00 0.00 ? 87 DT  C H73    3  
ATOM 5869  H H6     . DT  C 3 8  ? 45.956 26.196 34.513 1.00 0.00 ? 87 DT  C H6     3  
ATOM 5870  P P      . DA  C 3 9  ? 45.150 23.545 40.066 1.00 0.00 ? 88 DA  C P      3  
ATOM 5871  O OP1    . DA  C 3 9  ? 44.998 23.651 41.534 1.00 0.00 ? 88 DA  C OP1    3  
ATOM 5872  O OP2    . DA  C 3 9  ? 46.347 22.848 39.544 1.00 0.00 ? 88 DA  C OP2    3  
ATOM 5873  O "O5'"  . DA  C 3 9  ? 43.833 22.881 39.445 1.00 0.00 ? 88 DA  C "O5'"  3  
ATOM 5874  C "C5'"  . DA  C 3 9  ? 42.560 23.419 39.791 1.00 0.00 ? 88 DA  C "C5'"  3  
ATOM 5875  C "C4'"  . DA  C 3 9  ? 41.431 23.116 38.804 1.00 0.00 ? 88 DA  C "C4'"  3  
ATOM 5876  O "O4'"  . DA  C 3 9  ? 41.809 23.482 37.484 1.00 0.00 ? 88 DA  C "O4'"  3  
ATOM 5877  C "C3'"  . DA  C 3 9  ? 41.004 21.646 38.788 1.00 0.00 ? 88 DA  C "C3'"  3  
ATOM 5878  O "O3'"  . DA  C 3 9  ? 39.656 21.581 39.228 1.00 0.00 ? 88 DA  C "O3'"  3  
ATOM 5879  C "C2'"  . DA  C 3 9  ? 41.191 21.244 37.324 1.00 0.00 ? 88 DA  C "C2'"  3  
ATOM 5880  C "C1'"  . DA  C 3 9  ? 41.205 22.577 36.585 1.00 0.00 ? 88 DA  C "C1'"  3  
ATOM 5881  N N9     . DA  C 3 9  ? 41.984 22.532 35.324 1.00 0.00 ? 88 DA  C N9     3  
ATOM 5882  C C8     . DA  C 3 9  ? 43.328 22.282 35.159 1.00 0.00 ? 88 DA  C C8     3  
ATOM 5883  N N7     . DA  C 3 9  ? 43.757 22.413 33.929 1.00 0.00 ? 88 DA  C N7     3  
ATOM 5884  C C5     . DA  C 3 9  ? 42.587 22.757 33.227 1.00 0.00 ? 88 DA  C C5     3  
ATOM 5885  C C6     . DA  C 3 9  ? 42.283 23.083 31.881 1.00 0.00 ? 88 DA  C C6     3  
ATOM 5886  N N6     . DA  C 3 9  ? 43.155 23.208 30.899 1.00 0.00 ? 88 DA  C N6     3  
ATOM 5887  N N1     . DA  C 3 9  ? 41.031 23.328 31.498 1.00 0.00 ? 88 DA  C N1     3  
ATOM 5888  C C2     . DA  C 3 9  ? 40.078 23.287 32.417 1.00 0.00 ? 88 DA  C C2     3  
ATOM 5889  N N3     . DA  C 3 9  ? 40.201 23.047 33.718 1.00 0.00 ? 88 DA  C N3     3  
ATOM 5890  C C4     . DA  C 3 9  ? 41.498 22.785 34.061 1.00 0.00 ? 88 DA  C C4     3  
ATOM 5891  H "H5'"  . DA  C 3 9  ? 42.639 24.506 39.859 1.00 0.00 ? 88 DA  C "H5'"  3  
ATOM 5892  H "H5''" . DA  C 3 9  ? 42.267 23.033 40.768 1.00 0.00 ? 88 DA  C "H5''" 3  
ATOM 5893  H "H4'"  . DA  C 3 9  ? 40.564 23.709 39.095 1.00 0.00 ? 88 DA  C "H4'"  3  
ATOM 5894  H "H3'"  . DA  C 3 9  ? 41.643 21.054 39.442 1.00 0.00 ? 88 DA  C "H3'"  3  
ATOM 5895  H "H2'"  . DA  C 3 9  ? 42.141 20.725 37.205 1.00 0.00 ? 88 DA  C "H2'"  3  
ATOM 5896  H "H2''" . DA  C 3 9  ? 40.378 20.625 36.962 1.00 0.00 ? 88 DA  C "H2''" 3  
ATOM 5897  H "H1'"  . DA  C 3 9  ? 40.175 22.886 36.382 1.00 0.00 ? 88 DA  C "H1'"  3  
ATOM 5898  H H8     . DA  C 3 9  ? 43.977 22.022 35.990 1.00 0.00 ? 88 DA  C H8     3  
ATOM 5899  H H61    . DA  C 3 9  ? 44.147 23.080 31.076 1.00 0.00 ? 88 DA  C H61    3  
ATOM 5900  H H62    . DA  C 3 9  ? 42.813 23.475 29.990 1.00 0.00 ? 88 DA  C H62    3  
ATOM 5901  H H2     . DA  C 3 9  ? 39.075 23.493 32.069 1.00 0.00 ? 88 DA  C H2     3  
ATOM 5902  P P      . DG  C 3 10 ? 38.893 20.207 39.496 1.00 0.00 ? 89 DG  C P      3  
ATOM 5903  O OP1    . DG  C 3 10 ? 37.776 20.487 40.416 1.00 0.00 ? 89 DG  C OP1    3  
ATOM 5904  O OP2    . DG  C 3 10 ? 39.883 19.176 39.889 1.00 0.00 ? 89 DG  C OP2    3  
ATOM 5905  O "O5'"  . DG  C 3 10 ? 38.267 19.832 38.078 1.00 0.00 ? 89 DG  C "O5'"  3  
ATOM 5906  C "C5'"  . DG  C 3 10 ? 37.262 20.664 37.503 1.00 0.00 ? 89 DG  C "C5'"  3  
ATOM 5907  C "C4'"  . DG  C 3 10 ? 36.433 20.006 36.394 1.00 0.00 ? 89 DG  C "C4'"  3  
ATOM 5908  O "O4'"  . DG  C 3 10 ? 37.103 20.010 35.146 1.00 0.00 ? 89 DG  C "O4'"  3  
ATOM 5909  C "C3'"  . DG  C 3 10 ? 36.068 18.562 36.730 1.00 0.00 ? 89 DG  C "C3'"  3  
ATOM 5910  O "O3'"  . DG  C 3 10 ? 34.726 18.333 36.323 1.00 0.00 ? 89 DG  C "O3'"  3  
ATOM 5911  C "C2'"  . DG  C 3 10 ? 37.126 17.773 35.951 1.00 0.00 ? 89 DG  C "C2'"  3  
ATOM 5912  C "C1'"  . DG  C 3 10 ? 37.402 18.682 34.752 1.00 0.00 ? 89 DG  C "C1'"  3  
ATOM 5913  N N9     . DG  C 3 10 ? 38.791 18.700 34.236 1.00 0.00 ? 89 DG  C N9     3  
ATOM 5914  C C8     . DG  C 3 10 ? 39.977 18.815 34.915 1.00 0.00 ? 89 DG  C C8     3  
ATOM 5915  N N7     . DG  C 3 10 ? 41.010 19.112 34.162 1.00 0.00 ? 89 DG  C N7     3  
ATOM 5916  C C5     . DG  C 3 10 ? 40.464 19.161 32.869 1.00 0.00 ? 89 DG  C C5     3  
ATOM 5917  C C6     . DG  C 3 10 ? 41.037 19.477 31.581 1.00 0.00 ? 89 DG  C C6     3  
ATOM 5918  O O6     . DG  C 3 10 ? 42.188 19.812 31.289 1.00 0.00 ? 89 DG  C O6     3  
ATOM 5919  N N1     . DG  C 3 10 ? 40.128 19.401 30.544 1.00 0.00 ? 89 DG  C N1     3  
ATOM 5920  C C2     . DG  C 3 10 ? 38.830 19.053 30.709 1.00 0.00 ? 89 DG  C C2     3  
ATOM 5921  N N2     . DG  C 3 10 ? 38.072 18.977 29.657 1.00 0.00 ? 89 DG  C N2     3  
ATOM 5922  N N3     . DG  C 3 10 ? 38.252 18.776 31.864 1.00 0.00 ? 89 DG  C N3     3  
ATOM 5923  C C4     . DG  C 3 10 ? 39.120 18.854 32.913 1.00 0.00 ? 89 DG  C C4     3  
ATOM 5924  H "H5'"  . DG  C 3 10 ? 37.721 21.574 37.113 1.00 0.00 ? 89 DG  C "H5'"  3  
ATOM 5925  H "H5''" . DG  C 3 10 ? 36.562 20.947 38.286 1.00 0.00 ? 89 DG  C "H5''" 3  
ATOM 5926  H "H4'"  . DG  C 3 10 ? 35.516 20.585 36.283 1.00 0.00 ? 89 DG  C "H4'"  3  
ATOM 5927  H "H3'"  . DG  C 3 10 ? 36.167 18.389 37.801 1.00 0.00 ? 89 DG  C "H3'"  3  
ATOM 5928  H "H2'"  . DG  C 3 10 ? 38.018 17.656 36.565 1.00 0.00 ? 89 DG  C "H2'"  3  
ATOM 5929  H "H2''" . DG  C 3 10 ? 36.763 16.798 35.631 1.00 0.00 ? 89 DG  C "H2''" 3  
ATOM 5930  H "H1'"  . DG  C 3 10 ? 36.727 18.391 33.943 1.00 0.00 ? 89 DG  C "H1'"  3  
ATOM 5931  H H8     . DG  C 3 10 ? 40.026 18.715 35.992 1.00 0.00 ? 89 DG  C H8     3  
ATOM 5932  H H1     . DG  C 3 10 ? 40.459 19.625 29.620 1.00 0.00 ? 89 DG  C H1     3  
ATOM 5933  H H21    . DG  C 3 10 ? 37.145 18.616 29.782 1.00 0.00 ? 89 DG  C H21    3  
ATOM 5934  H H22    . DG  C 3 10 ? 38.445 19.191 28.740 1.00 0.00 ? 89 DG  C H22    3  
ATOM 5935  P P      . DA  C 3 11 ? 33.962 16.976 36.622 1.00 0.00 ? 90 DA  C P      3  
ATOM 5936  O OP1    . DA  C 3 11 ? 32.516 17.274 36.688 1.00 0.00 ? 90 DA  C OP1    3  
ATOM 5937  O OP2    . DA  C 3 11 ? 34.611 16.295 37.764 1.00 0.00 ? 90 DA  C OP2    3  
ATOM 5938  O "O5'"  . DA  C 3 11 ? 34.193 16.107 35.309 1.00 0.00 ? 90 DA  C "O5'"  3  
ATOM 5939  C "C5'"  . DA  C 3 11 ? 33.668 16.565 34.069 1.00 0.00 ? 90 DA  C "C5'"  3  
ATOM 5940  C "C4'"  . DA  C 3 11 ? 34.297 15.903 32.845 1.00 0.00 ? 90 DA  C "C4'"  3  
ATOM 5941  O "O4'"  . DA  C 3 11 ? 35.671 16.218 32.749 1.00 0.00 ? 90 DA  C "O4'"  3  
ATOM 5942  C "C3'"  . DA  C 3 11 ? 34.166 14.373 32.804 1.00 0.00 ? 90 DA  C "C3'"  3  
ATOM 5943  O "O3'"  . DA  C 3 11 ? 33.208 14.073 31.795 1.00 0.00 ? 90 DA  C "O3'"  3  
ATOM 5944  C "C2'"  . DA  C 3 11 ? 35.598 13.918 32.494 1.00 0.00 ? 90 DA  C "C2'"  3  
ATOM 5945  C "C1'"  . DA  C 3 11 ? 36.257 15.194 31.978 1.00 0.00 ? 90 DA  C "C1'"  3  
ATOM 5946  N N9     . DA  C 3 11 ? 37.724 15.248 32.147 1.00 0.00 ? 90 DA  C N9     3  
ATOM 5947  C C8     . DA  C 3 11 ? 38.463 15.194 33.304 1.00 0.00 ? 90 DA  C C8     3  
ATOM 5948  N N7     . DA  C 3 11 ? 39.745 15.401 33.136 1.00 0.00 ? 90 DA  C N7     3  
ATOM 5949  C C5     . DA  C 3 11 ? 39.850 15.604 31.749 1.00 0.00 ? 90 DA  C C5     3  
ATOM 5950  C C6     . DA  C 3 11 ? 40.897 15.923 30.851 1.00 0.00 ? 90 DA  C C6     3  
ATOM 5951  N N6     . DA  C 3 11 ? 42.161 16.136 31.157 1.00 0.00 ? 90 DA  C N6     3  
ATOM 5952  N N1     . DA  C 3 11 ? 40.666 16.045 29.546 1.00 0.00 ? 90 DA  C N1     3  
ATOM 5953  C C2     . DA  C 3 11 ? 39.433 15.872 29.102 1.00 0.00 ? 90 DA  C C2     3  
ATOM 5954  N N3     . DA  C 3 11 ? 38.341 15.599 29.807 1.00 0.00 ? 90 DA  C N3     3  
ATOM 5955  C C4     . DA  C 3 11 ? 38.626 15.484 31.139 1.00 0.00 ? 90 DA  C C4     3  
ATOM 5956  H "H5'"  . DA  C 3 11 ? 33.842 17.638 33.977 1.00 0.00 ? 90 DA  C "H5'"  3  
ATOM 5957  H "H5''" . DA  C 3 11 ? 32.593 16.389 34.048 1.00 0.00 ? 90 DA  C "H5''" 3  
ATOM 5958  H "H4'"  . DA  C 3 11 ? 33.804 16.310 31.959 1.00 0.00 ? 90 DA  C "H4'"  3  
ATOM 5959  H "H3'"  . DA  C 3 11 ? 33.852 13.981 33.772 1.00 0.00 ? 90 DA  C "H3'"  3  
ATOM 5960  H "H2'"  . DA  C 3 11 ? 36.078 13.584 33.415 1.00 0.00 ? 90 DA  C "H2'"  3  
ATOM 5961  H "H2''" . DA  C 3 11 ? 35.639 13.134 31.742 1.00 0.00 ? 90 DA  C "H2''" 3  
ATOM 5962  H "H1'"  . DA  C 3 11 ? 36.004 15.329 30.923 1.00 0.00 ? 90 DA  C "H1'"  3  
ATOM 5963  H H8     . DA  C 3 11 ? 38.010 15.017 34.273 1.00 0.00 ? 90 DA  C H8     3  
ATOM 5964  H H61    . DA  C 3 11 ? 42.503 16.005 32.105 1.00 0.00 ? 90 DA  C H61    3  
ATOM 5965  H H62    . DA  C 3 11 ? 42.795 16.457 30.440 1.00 0.00 ? 90 DA  C H62    3  
ATOM 5966  H H2     . DA  C 3 11 ? 39.294 15.978 28.035 1.00 0.00 ? 90 DA  C H2     3  
ATOM 5967  P P      . DG  C 3 12 ? 32.677 12.602 31.475 1.00 0.00 ? 91 DG  C P      3  
ATOM 5968  O OP1    . DG  C 3 12 ? 31.415 12.771 30.731 1.00 0.00 ? 91 DG  C OP1    3  
ATOM 5969  O OP2    . DG  C 3 12 ? 32.675 11.809 32.717 1.00 0.00 ? 91 DG  C OP2    3  
ATOM 5970  O "O5'"  . DG  C 3 12 ? 33.762 11.971 30.483 1.00 0.00 ? 91 DG  C "O5'"  3  
ATOM 5971  C "C5'"  . DG  C 3 12 ? 33.885 12.483 29.158 1.00 0.00 ? 91 DG  C "C5'"  3  
ATOM 5972  C "C4'"  . DG  C 3 12 ? 35.196 12.121 28.454 1.00 0.00 ? 91 DG  C "C4'"  3  
ATOM 5973  O "O4'"  . DG  C 3 12 ? 36.326 12.664 29.115 1.00 0.00 ? 91 DG  C "O4'"  3  
ATOM 5974  C "C3'"  . DG  C 3 12 ? 35.480 10.619 28.275 1.00 0.00 ? 91 DG  C "C3'"  3  
ATOM 5975  O "O3'"  . DG  C 3 12 ? 35.028 10.151 27.003 1.00 0.00 ? 91 DG  C "O3'"  3  
ATOM 5976  C "C2'"  . DG  C 3 12 ? 37.006 10.558 28.419 1.00 0.00 ? 91 DG  C "C2'"  3  
ATOM 5977  C "C1'"  . DG  C 3 12 ? 37.456 12.009 28.569 1.00 0.00 ? 91 DG  C "C1'"  3  
ATOM 5978  N N9     . DG  C 3 12 ? 38.640 12.143 29.446 1.00 0.00 ? 91 DG  C N9     3  
ATOM 5979  C C8     . DG  C 3 12 ? 38.716 11.923 30.797 1.00 0.00 ? 91 DG  C C8     3  
ATOM 5980  N N7     . DG  C 3 12 ? 39.900 12.133 31.311 1.00 0.00 ? 91 DG  C N7     3  
ATOM 5981  C C5     . DG  C 3 12 ? 40.678 12.507 30.202 1.00 0.00 ? 91 DG  C C5     3  
ATOM 5982  C C6     . DG  C 3 12 ? 42.066 12.881 30.078 1.00 0.00 ? 91 DG  C C6     3  
ATOM 5983  O O6     . DG  C 3 12 ? 42.939 12.968 30.943 1.00 0.00 ? 91 DG  C O6     3  
ATOM 5984  N N1     . DG  C 3 12 ? 42.446 13.191 28.789 1.00 0.00 ? 91 DG  C N1     3  
ATOM 5985  C C2     . DG  C 3 12 ? 41.609 13.146 27.729 1.00 0.00 ? 91 DG  C C2     3  
ATOM 5986  N N2     . DG  C 3 12 ? 42.120 13.472 26.573 1.00 0.00 ? 91 DG  C N2     3  
ATOM 5987  N N3     . DG  C 3 12 ? 40.328 12.786 27.781 1.00 0.00 ? 91 DG  C N3     3  
ATOM 5988  C C4     . DG  C 3 12 ? 39.914 12.493 29.054 1.00 0.00 ? 91 DG  C C4     3  
ATOM 5989  H "H5'"  . DG  C 3 12 ? 33.829 13.573 29.191 1.00 0.00 ? 91 DG  C "H5'"  3  
ATOM 5990  H "H5''" . DG  C 3 12 ? 33.048 12.128 28.554 1.00 0.00 ? 91 DG  C "H5''" 3  
ATOM 5991  H "H4'"  . DG  C 3 12 ? 35.152 12.576 27.468 1.00 0.00 ? 91 DG  C "H4'"  3  
ATOM 5992  H "H3'"  . DG  C 3 12 ? 35.012 10.053 29.084 1.00 0.00 ? 91 DG  C "H3'"  3  
ATOM 5993  H "H2'"  . DG  C 3 12 ? 37.261 9.988  29.310 1.00 0.00 ? 91 DG  C "H2'"  3  
ATOM 5994  H "H2''" . DG  C 3 12 ? 37.485 10.120 27.546 1.00 0.00 ? 91 DG  C "H2''" 3  
ATOM 5995  H "H1'"  . DG  C 3 12 ? 37.692 12.424 27.586 1.00 0.00 ? 91 DG  C "H1'"  3  
ATOM 5996  H H8     . DG  C 3 12 ? 37.854 11.617 31.378 1.00 0.00 ? 91 DG  C H8     3  
ATOM 5997  H H1     . DG  C 3 12 ? 43.380 13.543 28.654 1.00 0.00 ? 91 DG  C H1     3  
ATOM 5998  H H21    . DG  C 3 12 ? 41.503 13.493 25.778 1.00 0.00 ? 91 DG  C H21    3  
ATOM 5999  H H22    . DG  C 3 12 ? 43.073 13.815 26.513 1.00 0.00 ? 91 DG  C H22    3  
ATOM 6000  P P      . DC  C 3 13 ? 35.091 8.600  26.579 1.00 0.00 ? 92 DC  C P      3  
ATOM 6001  O OP1    . DC  C 3 13 ? 34.129 8.388  25.475 1.00 0.00 ? 92 DC  C OP1    3  
ATOM 6002  O OP2    . DC  C 3 13 ? 34.999 7.741  27.782 1.00 0.00 ? 92 DC  C OP2    3  
ATOM 6003  O "O5'"  . DC  C 3 13 ? 36.546 8.401  25.962 1.00 0.00 ? 92 DC  C "O5'"  3  
ATOM 6004  C "C5'"  . DC  C 3 13 ? 36.910 9.011  24.727 1.00 0.00 ? 92 DC  C "C5'"  3  
ATOM 6005  C "C4'"  . DC  C 3 13 ? 38.416 8.929  24.461 1.00 0.00 ? 92 DC  C "C4'"  3  
ATOM 6006  O "O4'"  . DC  C 3 13 ? 39.137 9.553  25.516 1.00 0.00 ? 92 DC  C "O4'"  3  
ATOM 6007  C "C3'"  . DC  C 3 13 ? 38.930 7.489  24.348 1.00 0.00 ? 92 DC  C "C3'"  3  
ATOM 6008  O "O3'"  . DC  C 3 13 ? 39.472 7.253  23.061 1.00 0.00 ? 92 DC  C "O3'"  3  
ATOM 6009  C "C2'"  . DC  C 3 13 ? 40.015 7.412  25.417 1.00 0.00 ? 92 DC  C "C2'"  3  
ATOM 6010  C "C1'"  . DC  C 3 13 ? 40.368 8.879  25.654 1.00 0.00 ? 92 DC  C "C1'"  3  
ATOM 6011  N N1     . DC  C 3 13 ? 40.939 9.125  27.008 1.00 0.00 ? 92 DC  C N1     3  
ATOM 6012  C C2     . DC  C 3 13 ? 42.265 9.559  27.130 1.00 0.00 ? 92 DC  C C2     3  
ATOM 6013  O O2     . DC  C 3 13 ? 42.984 9.776  26.148 1.00 0.00 ? 92 DC  C O2     3  
ATOM 6014  N N3     . DC  C 3 13 ? 42.833 9.725  28.347 1.00 0.00 ? 92 DC  C N3     3  
ATOM 6015  C C4     . DC  C 3 13 ? 42.104 9.475  29.415 1.00 0.00 ? 92 DC  C C4     3  
ATOM 6016  N N4     . DC  C 3 13 ? 42.719 9.579  30.555 1.00 0.00 ? 92 DC  C N4     3  
ATOM 6017  C C5     . DC  C 3 13 ? 40.760 9.025  29.361 1.00 0.00 ? 92 DC  C C5     3  
ATOM 6018  C C6     . DC  C 3 13 ? 40.203 8.861  28.137 1.00 0.00 ? 92 DC  C C6     3  
ATOM 6019  H "H5'"  . DC  C 3 13 ? 36.632 10.061 24.740 1.00 0.00 ? 92 DC  C "H5'"  3  
ATOM 6020  H "H5''" . DC  C 3 13 ? 36.376 8.530  23.908 1.00 0.00 ? 92 DC  C "H5''" 3  
ATOM 6021  H "H4'"  . DC  C 3 13 ? 38.633 9.452  23.526 1.00 0.00 ? 92 DC  C "H4'"  3  
ATOM 6022  H "H3'"  . DC  C 3 13 ? 38.135 6.772  24.560 1.00 0.00 ? 92 DC  C "H3'"  3  
ATOM 6023  H "HO3'" . DC  C 3 13 ? 40.432 7.460  23.064 1.00 0.00 ? 92 DC  C "HO3'" 3  
ATOM 6024  H "H2'"  . DC  C 3 13 ? 39.592 6.961  26.314 1.00 0.00 ? 92 DC  C "H2'"  3  
ATOM 6025  H "H2''" . DC  C 3 13 ? 40.884 6.841  25.092 1.00 0.00 ? 92 DC  C "H2''" 3  
ATOM 6026  H "H1'"  . DC  C 3 13 ? 41.057 9.210  24.870 1.00 0.00 ? 92 DC  C "H1'"  3  
ATOM 6027  H H41    . DC  C 3 13 ? 42.194 9.387  31.405 1.00 0.00 ? 92 DC  C H41    3  
ATOM 6028  H H42    . DC  C 3 13 ? 43.615 10.053 30.602 1.00 0.00 ? 92 DC  C H42    3  
ATOM 6029  H H5     . DC  C 3 13 ? 40.184 8.814  30.249 1.00 0.00 ? 92 DC  C H5     3  
ATOM 6030  H H6     . DC  C 3 13 ? 39.178 8.513  28.037 1.00 0.00 ? 92 DC  C H6     3  
ATOM 6031  N N      . GLY A 1 1  ? 39.140 28.895 50.110 1.00 0.00 ? -2 GLY A N      4  
ATOM 6032  C CA     . GLY A 1 1  ? 39.459 28.218 48.837 1.00 0.00 ? -2 GLY A CA     4  
ATOM 6033  C C      . GLY A 1 1  ? 39.362 26.708 48.967 1.00 0.00 ? -2 GLY A C      4  
ATOM 6034  O O      . GLY A 1 1  ? 39.749 26.150 49.998 1.00 0.00 ? -2 GLY A O      4  
ATOM 6035  H H1     . GLY A 1 1  ? 38.244 28.582 50.461 1.00 0.00 ? -2 GLY A H1     4  
ATOM 6036  H H2     . GLY A 1 1  ? 39.087 29.897 49.967 1.00 0.00 ? -2 GLY A H2     4  
ATOM 6037  H H3     . GLY A 1 1  ? 39.856 28.706 50.801 1.00 0.00 ? -2 GLY A H3     4  
ATOM 6038  H HA2    . GLY A 1 1  ? 38.754 28.547 48.074 1.00 0.00 ? -2 GLY A HA2    4  
ATOM 6039  H HA3    . GLY A 1 1  ? 40.468 28.484 48.527 1.00 0.00 ? -2 GLY A HA3    4  
ATOM 6040  N N      . SER A 1 2  ? 38.834 26.044 47.934 1.00 0.00 ? -1 SER A N      4  
ATOM 6041  C CA     . SER A 1 2  ? 38.531 24.597 47.892 1.00 0.00 ? -1 SER A CA     4  
ATOM 6042  C C      . SER A 1 2  ? 39.060 23.864 46.636 1.00 0.00 ? -1 SER A C      4  
ATOM 6043  O O      . SER A 1 2  ? 38.954 22.639 46.549 1.00 0.00 ? -1 SER A O      4  
ATOM 6044  C CB     . SER A 1 2  ? 37.012 24.406 48.008 1.00 0.00 ? -1 SER A CB     4  
ATOM 6045  O OG     . SER A 1 2  ? 36.531 24.851 49.270 1.00 0.00 ? -1 SER A OG     4  
ATOM 6046  H H      . SER A 1 2  ? 38.565 26.583 47.114 1.00 0.00 ? -1 SER A H      4  
ATOM 6047  H HA     . SER A 1 2  ? 38.998 24.104 48.746 1.00 0.00 ? -1 SER A HA     4  
ATOM 6048  H HB2    . SER A 1 2  ? 36.510 24.969 47.224 1.00 0.00 ? -1 SER A HB2    4  
ATOM 6049  H HB3    . SER A 1 2  ? 36.769 23.350 47.891 1.00 0.00 ? -1 SER A HB3    4  
ATOM 6050  H HG     . SER A 1 2  ? 36.642 25.823 49.326 1.00 0.00 ? -1 SER A HG     4  
ATOM 6051  N N      . GLN A 1 3  ? 39.643 24.599 45.681 1.00 0.00 ? 1  GLN A N      4  
ATOM 6052  C CA     . GLN A 1 3  ? 40.339 24.122 44.472 1.00 0.00 ? 1  GLN A CA     4  
ATOM 6053  C C      . GLN A 1 3  ? 39.565 23.121 43.581 1.00 0.00 ? 1  GLN A C      4  
ATOM 6054  O O      . GLN A 1 3  ? 40.141 22.172 43.040 1.00 0.00 ? 1  GLN A O      4  
ATOM 6055  C CB     . GLN A 1 3  ? 41.788 23.713 44.823 1.00 0.00 ? 1  GLN A CB     4  
ATOM 6056  C CG     . GLN A 1 3  ? 42.780 23.875 43.654 1.00 0.00 ? 1  GLN A CG     4  
ATOM 6057  C CD     . GLN A 1 3  ? 42.950 25.312 43.154 1.00 0.00 ? 1  GLN A CD     4  
ATOM 6058  O OE1    . GLN A 1 3  ? 42.584 26.289 43.801 1.00 0.00 ? 1  GLN A OE1    4  
ATOM 6059  N NE2    . GLN A 1 3  ? 43.516 25.497 41.982 1.00 0.00 ? 1  GLN A NE2    4  
ATOM 6060  H H      . GLN A 1 3  ? 39.735 25.591 45.865 1.00 0.00 ? 1  GLN A H      4  
ATOM 6061  H HA     . GLN A 1 3  ? 40.415 25.011 43.849 1.00 0.00 ? 1  GLN A HA     4  
ATOM 6062  H HB2    . GLN A 1 3  ? 42.148 24.328 45.649 1.00 0.00 ? 1  GLN A HB2    4  
ATOM 6063  H HB3    . GLN A 1 3  ? 41.795 22.675 45.162 1.00 0.00 ? 1  GLN A HB3    4  
ATOM 6064  H HG2    . GLN A 1 3  ? 43.757 23.518 43.980 1.00 0.00 ? 1  GLN A HG2    4  
ATOM 6065  H HG3    . GLN A 1 3  ? 42.468 23.246 42.823 1.00 0.00 ? 1  GLN A HG3    4  
ATOM 6066  H HE21   . GLN A 1 3  ? 43.903 24.706 41.481 1.00 0.00 ? 1  GLN A HE21   4  
ATOM 6067  H HE22   . GLN A 1 3  ? 43.732 26.444 41.698 1.00 0.00 ? 1  GLN A HE22   4  
ATOM 6068  N N      . ARG A 1 4  ? 38.257 23.349 43.411 1.00 0.00 ? 2  ARG A N      4  
ATOM 6069  C CA     . ARG A 1 4  ? 37.358 22.647 42.475 1.00 0.00 ? 2  ARG A CA     4  
ATOM 6070  C C      . ARG A 1 4  ? 36.501 23.636 41.663 1.00 0.00 ? 2  ARG A C      4  
ATOM 6071  O O      . ARG A 1 4  ? 36.283 24.766 42.110 1.00 0.00 ? 2  ARG A O      4  
ATOM 6072  C CB     . ARG A 1 4  ? 36.464 21.660 43.254 1.00 0.00 ? 2  ARG A CB     4  
ATOM 6073  C CG     . ARG A 1 4  ? 37.192 20.525 43.996 1.00 0.00 ? 2  ARG A CG     4  
ATOM 6074  C CD     . ARG A 1 4  ? 37.893 19.545 43.052 1.00 0.00 ? 2  ARG A CD     4  
ATOM 6075  N NE     . ARG A 1 4  ? 38.414 18.367 43.763 1.00 0.00 ? 2  ARG A NE     4  
ATOM 6076  C CZ     . ARG A 1 4  ? 38.899 17.271 43.210 1.00 0.00 ? 2  ARG A CZ     4  
ATOM 6077  N NH1    . ARG A 1 4  ? 39.091 17.154 41.930 1.00 0.00 1 2  ARG A NH1    4  
ATOM 6078  N NH2    . ARG A 1 4  ? 39.194 16.257 43.964 1.00 0.00 ? 2  ARG A NH2    4  
ATOM 6079  H H      . ARG A 1 4  ? 37.870 24.144 43.905 1.00 0.00 ? 2  ARG A H      4  
ATOM 6080  H HA     . ARG A 1 4  ? 37.961 22.091 41.757 1.00 0.00 ? 2  ARG A HA     4  
ATOM 6081  H HB2    . ARG A 1 4  ? 35.893 22.226 43.987 1.00 0.00 ? 2  ARG A HB2    4  
ATOM 6082  H HB3    . ARG A 1 4  ? 35.747 21.211 42.565 1.00 0.00 ? 2  ARG A HB3    4  
ATOM 6083  H HG2    . ARG A 1 4  ? 37.918 20.939 44.696 1.00 0.00 ? 2  ARG A HG2    4  
ATOM 6084  H HG3    . ARG A 1 4  ? 36.447 19.975 44.571 1.00 0.00 ? 2  ARG A HG3    4  
ATOM 6085  H HD2    . ARG A 1 4  ? 37.165 19.201 42.316 1.00 0.00 ? 2  ARG A HD2    4  
ATOM 6086  H HD3    . ARG A 1 4  ? 38.706 20.054 42.535 1.00 0.00 ? 2  ARG A HD3    4  
ATOM 6087  H HE     . ARG A 1 4  ? 38.288 18.329 44.767 1.00 0.00 ? 2  ARG A HE     4  
ATOM 6088  H HH11   . ARG A 1 4  ? 38.945 17.957 41.317 1.00 0.00 ? 2  ARG A HH11   4  
ATOM 6089  H HH12   . ARG A 1 4  ? 39.434 16.291 41.544 1.00 0.00 ? 2  ARG A HH12   4  
ATOM 6090  H HH21   . ARG A 1 4  ? 39.059 16.362 44.962 1.00 0.00 ? 2  ARG A HH21   4  
ATOM 6091  H HH22   . ARG A 1 4  ? 39.516 15.379 43.572 1.00 0.00 ? 2  ARG A HH22   4  
ATOM 6092  N N      . ARG A 1 5  ? 35.996 23.232 40.489 1.00 0.00 ? 3  ARG A N      4  
ATOM 6093  C CA     . ARG A 1 5  ? 35.055 24.030 39.657 1.00 0.00 ? 3  ARG A CA     4  
ATOM 6094  C C      . ARG A 1 5  ? 33.665 23.376 39.560 1.00 0.00 ? 3  ARG A C      4  
ATOM 6095  O O      . ARG A 1 5  ? 33.584 22.156 39.410 1.00 0.00 ? 3  ARG A O      4  
ATOM 6096  C CB     . ARG A 1 5  ? 35.609 24.280 38.236 1.00 0.00 ? 3  ARG A CB     4  
ATOM 6097  C CG     . ARG A 1 5  ? 36.645 25.404 38.046 1.00 0.00 ? 3  ARG A CG     4  
ATOM 6098  C CD     . ARG A 1 5  ? 38.018 25.089 38.644 1.00 0.00 ? 3  ARG A CD     4  
ATOM 6099  N NE     . ARG A 1 5  ? 39.103 25.885 38.022 1.00 0.00 ? 3  ARG A NE     4  
ATOM 6100  C CZ     . ARG A 1 5  ? 39.781 26.889 38.554 1.00 0.00 ? 3  ARG A CZ     4  
ATOM 6101  N NH1    . ARG A 1 5  ? 39.509 27.428 39.699 1.00 0.00 ? 3  ARG A NH1    4  
ATOM 6102  N NH2    . ARG A 1 5  ? 40.803 27.389 37.931 1.00 0.00 1 3  ARG A NH2    4  
ATOM 6103  H H      . ARG A 1 5  ? 36.201 22.272 40.215 1.00 0.00 ? 3  ARG A H      4  
ATOM 6104  H HA     . ARG A 1 5  ? 34.913 25.000 40.129 1.00 0.00 ? 3  ARG A HA     4  
ATOM 6105  H HB2    . ARG A 1 5  ? 36.006 23.346 37.834 1.00 0.00 ? 3  ARG A HB2    4  
ATOM 6106  H HB3    . ARG A 1 5  ? 34.763 24.562 37.614 1.00 0.00 ? 3  ARG A HB3    4  
ATOM 6107  H HG2    . ARG A 1 5  ? 36.768 25.551 36.970 1.00 0.00 ? 3  ARG A HG2    4  
ATOM 6108  H HG3    . ARG A 1 5  ? 36.266 26.336 38.465 1.00 0.00 ? 3  ARG A HG3    4  
ATOM 6109  H HD2    . ARG A 1 5  ? 37.988 25.241 39.724 1.00 0.00 ? 3  ARG A HD2    4  
ATOM 6110  H HD3    . ARG A 1 5  ? 38.219 24.035 38.456 1.00 0.00 ? 3  ARG A HD3    4  
ATOM 6111  H HE     . ARG A 1 5  ? 39.455 25.569 37.129 1.00 0.00 ? 3  ARG A HE     4  
ATOM 6112  H HH11   . ARG A 1 5  ? 38.678 27.160 40.218 1.00 0.00 ? 3  ARG A HH11   4  
ATOM 6113  H HH12   . ARG A 1 5  ? 40.156 28.107 40.081 1.00 0.00 ? 3  ARG A HH12   4  
ATOM 6114  H HH21   . ARG A 1 5  ? 41.034 27.035 37.013 1.00 0.00 ? 3  ARG A HH21   4  
ATOM 6115  H HH22   . ARG A 1 5  ? 41.327 28.142 38.360 1.00 0.00 ? 3  ARG A HH22   4  
ATOM 6116  N N      . GLN A 1 6  ? 32.585 24.178 39.517 1.00 0.00 ? 4  GLN A N      4  
ATOM 6117  C CA     . GLN A 1 6  ? 31.203 23.677 39.300 1.00 0.00 ? 4  GLN A CA     4  
ATOM 6118  C C      . GLN A 1 6  ? 31.127 22.785 38.037 1.00 0.00 ? 4  GLN A C      4  
ATOM 6119  O O      . GLN A 1 6  ? 30.813 21.597 38.123 1.00 0.00 ? 4  GLN A O      4  
ATOM 6120  C CB     . GLN A 1 6  ? 30.128 24.797 39.171 1.00 0.00 ? 4  GLN A CB     4  
ATOM 6121  C CG     . GLN A 1 6  ? 30.315 26.163 39.849 1.00 0.00 ? 4  GLN A CG     4  
ATOM 6122  C CD     . GLN A 1 6  ? 30.000 26.168 41.337 1.00 0.00 ? 4  GLN A CD     4  
ATOM 6123  O OE1    . GLN A 1 6  ? 28.842 26.130 41.738 1.00 0.00 ? 4  GLN A OE1    4  
ATOM 6124  N NE2    . GLN A 1 6  ? 30.991 26.213 42.192 1.00 0.00 ? 4  GLN A NE2    4  
ATOM 6125  H H      . GLN A 1 6  ? 32.725 25.155 39.750 1.00 0.00 ? 4  GLN A H      4  
ATOM 6126  H HA     . GLN A 1 6  ? 30.939 23.058 40.159 1.00 0.00 ? 4  GLN A HA     4  
ATOM 6127  H HB2    . GLN A 1 6  ? 29.996 25.032 38.120 1.00 0.00 ? 4  GLN A HB2    4  
ATOM 6128  H HB3    . GLN A 1 6  ? 29.172 24.380 39.493 1.00 0.00 ? 4  GLN A HB3    4  
ATOM 6129  H HG2    . GLN A 1 6  ? 31.309 26.547 39.656 1.00 0.00 ? 4  GLN A HG2    4  
ATOM 6130  H HG3    . GLN A 1 6  ? 29.630 26.868 39.381 1.00 0.00 ? 4  GLN A HG3    4  
ATOM 6131  H HE21   . GLN A 1 6  ? 31.943 26.322 41.860 1.00 0.00 ? 4  GLN A HE21   4  
ATOM 6132  H HE22   . GLN A 1 6  ? 30.759 26.285 43.180 1.00 0.00 ? 4  GLN A HE22   4  
ATOM 6133  N N      . ARG A 1 7  ? 31.479 23.388 36.889 1.00 0.00 ? 5  ARG A N      4  
ATOM 6134  C CA     . ARG A 1 7  ? 31.536 22.864 35.515 1.00 0.00 ? 5  ARG A CA     4  
ATOM 6135  C C      . ARG A 1 7  ? 30.242 22.276 34.941 1.00 0.00 ? 5  ARG A C      4  
ATOM 6136  O O      . ARG A 1 7  ? 29.205 22.210 35.610 1.00 0.00 ? 5  ARG A O      4  
ATOM 6137  C CB     . ARG A 1 7  ? 32.828 22.054 35.279 1.00 0.00 ? 5  ARG A CB     4  
ATOM 6138  C CG     . ARG A 1 7  ? 33.957 23.031 34.892 1.00 0.00 ? 5  ARG A CG     4  
ATOM 6139  C CD     . ARG A 1 7  ? 35.289 22.351 34.579 1.00 0.00 ? 5  ARG A CD     4  
ATOM 6140  N NE     . ARG A 1 7  ? 35.183 21.493 33.389 1.00 0.00 ? 5  ARG A NE     4  
ATOM 6141  C CZ     . ARG A 1 7  ? 35.387 21.848 32.137 1.00 0.00 ? 5  ARG A CZ     4  
ATOM 6142  N NH1    . ARG A 1 7  ? 35.821 23.029 31.805 1.00 0.00 ? 5  ARG A NH1    4  
ATOM 6143  N NH2    . ARG A 1 7  ? 35.140 21.009 31.181 1.00 0.00 1 5  ARG A NH2    4  
ATOM 6144  H H      . ARG A 1 7  ? 31.587 24.389 36.961 1.00 0.00 ? 5  ARG A H      4  
ATOM 6145  H HA     . ARG A 1 7  ? 31.631 23.751 34.891 1.00 0.00 ? 5  ARG A HA     4  
ATOM 6146  H HB2    . ARG A 1 7  ? 33.099 21.496 36.178 1.00 0.00 ? 5  ARG A HB2    4  
ATOM 6147  H HB3    . ARG A 1 7  ? 32.685 21.342 34.468 1.00 0.00 ? 5  ARG A HB3    4  
ATOM 6148  H HG2    . ARG A 1 7  ? 33.653 23.601 34.014 1.00 0.00 ? 5  ARG A HG2    4  
ATOM 6149  H HG3    . ARG A 1 7  ? 34.112 23.734 35.704 1.00 0.00 ? 5  ARG A HG3    4  
ATOM 6150  H HD2    . ARG A 1 7  ? 36.056 23.113 34.429 1.00 0.00 ? 5  ARG A HD2    4  
ATOM 6151  H HD3    . ARG A 1 7  ? 35.586 21.758 35.439 1.00 0.00 ? 5  ARG A HD3    4  
ATOM 6152  H HE     . ARG A 1 7  ? 34.917 20.524 33.540 1.00 0.00 ? 5  ARG A HE     4  
ATOM 6153  H HH11   . ARG A 1 7  ? 35.954 23.740 32.504 1.00 0.00 ? 5  ARG A HH11   4  
ATOM 6154  H HH12   . ARG A 1 7  ? 36.094 23.219 30.847 1.00 0.00 ? 5  ARG A HH12   4  
ATOM 6155  H HH21   . ARG A 1 7  ? 34.855 20.065 31.386 1.00 0.00 ? 5  ARG A HH21   4  
ATOM 6156  H HH22   . ARG A 1 7  ? 35.240 21.309 30.214 1.00 0.00 ? 5  ARG A HH22   4  
ATOM 6157  N N      . THR A 1 8  ? 30.294 22.021 33.633 1.00 0.00 ? 6  THR A N      4  
ATOM 6158  C CA     . THR A 1 8  ? 29.190 22.114 32.664 1.00 0.00 ? 6  THR A CA     4  
ATOM 6159  C C      . THR A 1 8  ? 27.893 21.451 33.118 1.00 0.00 ? 6  THR A C      4  
ATOM 6160  O O      . THR A 1 8  ? 27.891 20.291 33.524 1.00 0.00 ? 6  THR A O      4  
ATOM 6161  C CB     . THR A 1 8  ? 29.616 21.491 31.322 1.00 0.00 ? 6  THR A CB     4  
ATOM 6162  O OG1    . THR A 1 8  ? 30.959 21.820 31.040 1.00 0.00 ? 6  THR A OG1    4  
ATOM 6163  C CG2    . THR A 1 8  ? 28.775 22.017 30.161 1.00 0.00 ? 6  THR A CG2    4  
ATOM 6164  H H      . THR A 1 8  ? 31.208 22.011 33.204 1.00 0.00 ? 6  THR A H      4  
ATOM 6165  H HA     . THR A 1 8  ? 28.994 23.174 32.494 1.00 0.00 ? 6  THR A HA     4  
ATOM 6166  H HB     . THR A 1 8  ? 29.531 20.405 31.376 1.00 0.00 ? 6  THR A HB     4  
ATOM 6167  H HG1    . THR A 1 8  ? 31.217 21.336 30.231 1.00 0.00 ? 6  THR A HG1    4  
ATOM 6168  H HG21   . THR A 1 8  ? 29.109 21.569 29.225 1.00 0.00 ? 6  THR A HG21   4  
ATOM 6169  H HG22   . THR A 1 8  ? 27.726 21.763 30.306 1.00 0.00 ? 6  THR A HG22   4  
ATOM 6170  H HG23   . THR A 1 8  ? 28.886 23.098 30.088 1.00 0.00 ? 6  THR A HG23   4  
ATOM 6171  N N      . HIS A 1 9  ? 26.773 22.168 33.001 1.00 0.00 ? 7  HIS A N      4  
ATOM 6172  C CA     . HIS A 1 9  ? 25.438 21.654 33.326 1.00 0.00 ? 7  HIS A CA     4  
ATOM 6173  C C      . HIS A 1 9  ? 24.380 22.286 32.404 1.00 0.00 ? 7  HIS A C      4  
ATOM 6174  O O      . HIS A 1 9  ? 23.502 23.014 32.866 1.00 0.00 ? 7  HIS A O      4  
ATOM 6175  C CB     . HIS A 1 9  ? 25.173 21.867 34.829 1.00 0.00 ? 7  HIS A CB     4  
ATOM 6176  C CG     . HIS A 1 9  ? 23.915 21.193 35.318 1.00 0.00 ? 7  HIS A CG     4  
ATOM 6177  N ND1    . HIS A 1 9  ? 23.672 19.815 35.304 1.00 0.00 ? 7  HIS A ND1    4  
ATOM 6178  C CD2    . HIS A 1 9  ? 22.810 21.834 35.795 1.00 0.00 ? 7  HIS A CD2    4  
ATOM 6179  C CE1    . HIS A 1 9  ? 22.415 19.667 35.765 1.00 0.00 ? 7  HIS A CE1    4  
ATOM 6180  N NE2    . HIS A 1 9  ? 21.877 20.861 36.061 1.00 0.00 ? 7  HIS A NE2    4  
ATOM 6181  H H      . HIS A 1 9  ? 26.840 23.121 32.672 1.00 0.00 ? 7  HIS A H      4  
ATOM 6182  H HA     . HIS A 1 9  ? 25.421 20.581 33.141 1.00 0.00 ? 7  HIS A HA     4  
ATOM 6183  H HB2    . HIS A 1 9  ? 26.007 21.456 35.400 1.00 0.00 ? 7  HIS A HB2    4  
ATOM 6184  H HB3    . HIS A 1 9  ? 25.118 22.935 35.041 1.00 0.00 ? 7  HIS A HB3    4  
ATOM 6185  H HD2    . HIS A 1 9  ? 22.685 22.903 35.896 1.00 0.00 ? 7  HIS A HD2    4  
ATOM 6186  H HE1    . HIS A 1 9  ? 21.895 18.721 35.867 1.00 0.00 ? 7  HIS A HE1    4  
ATOM 6187  H HE2    . HIS A 1 9  ? 20.910 21.021 36.342 1.00 0.00 ? 7  HIS A HE2    4  
ATOM 6188  N N      . PHE A 1 10 ? 24.530 22.111 31.084 1.00 0.00 ? 8  PHE A N      4  
ATOM 6189  C CA     . PHE A 1 10 ? 23.846 22.925 30.063 1.00 0.00 ? 8  PHE A CA     4  
ATOM 6190  C C      . PHE A 1 10 ? 23.120 22.111 28.981 1.00 0.00 ? 8  PHE A C      4  
ATOM 6191  O O      . PHE A 1 10 ? 23.448 20.950 28.707 1.00 0.00 ? 8  PHE A O      4  
ATOM 6192  C CB     . PHE A 1 10 ? 24.835 23.903 29.403 1.00 0.00 ? 8  PHE A CB     4  
ATOM 6193  C CG     . PHE A 1 10 ? 25.602 24.830 30.333 1.00 0.00 ? 8  PHE A CG     4  
ATOM 6194  C CD1    . PHE A 1 10 ? 24.980 25.424 31.451 1.00 0.00 ? 8  PHE A CD1    4  
ATOM 6195  C CD2    . PHE A 1 10 ? 26.950 25.123 30.056 1.00 0.00 ? 8  PHE A CD2    4  
ATOM 6196  C CE1    . PHE A 1 10 ? 25.719 26.245 32.320 1.00 0.00 ? 8  PHE A CE1    4  
ATOM 6197  C CE2    . PHE A 1 10 ? 27.685 25.959 30.913 1.00 0.00 ? 8  PHE A CE2    4  
ATOM 6198  C CZ     . PHE A 1 10 ? 27.073 26.506 32.054 1.00 0.00 ? 8  PHE A CZ     4  
ATOM 6199  H H      . PHE A 1 10 ? 25.195 21.414 30.768 1.00 0.00 ? 8  PHE A H      4  
ATOM 6200  H HA     . PHE A 1 10 ? 23.079 23.520 30.552 1.00 0.00 ? 8  PHE A HA     4  
ATOM 6201  H HB2    . PHE A 1 10 ? 25.551 23.316 28.825 1.00 0.00 ? 8  PHE A HB2    4  
ATOM 6202  H HB3    . PHE A 1 10 ? 24.289 24.531 28.698 1.00 0.00 ? 8  PHE A HB3    4  
ATOM 6203  H HD1    . PHE A 1 10 ? 23.932 25.253 31.653 1.00 0.00 ? 8  PHE A HD1    4  
ATOM 6204  H HD2    . PHE A 1 10 ? 27.423 24.718 29.169 1.00 0.00 ? 8  PHE A HD2    4  
ATOM 6205  H HE1    . PHE A 1 10 ? 25.240 26.682 33.187 1.00 0.00 ? 8  PHE A HE1    4  
ATOM 6206  H HE2    . PHE A 1 10 ? 28.714 26.198 30.684 1.00 0.00 ? 8  PHE A HE2    4  
ATOM 6207  H HZ     . PHE A 1 10 ? 27.637 27.148 32.714 1.00 0.00 ? 8  PHE A HZ     4  
ATOM 6208  N N      . THR A 1 11 ? 22.149 22.757 28.329 1.00 0.00 ? 9  THR A N      4  
ATOM 6209  C CA     . THR A 1 11 ? 21.304 22.194 27.263 1.00 0.00 ? 9  THR A CA     4  
ATOM 6210  C C      . THR A 1 11 ? 21.048 23.201 26.140 1.00 0.00 ? 9  THR A C      4  
ATOM 6211  O O      . THR A 1 11 ? 21.155 24.415 26.349 1.00 0.00 ? 9  THR A O      4  
ATOM 6212  C CB     . THR A 1 11 ? 19.951 21.724 27.828 1.00 0.00 ? 9  THR A CB     4  
ATOM 6213  O OG1    . THR A 1 11 ? 19.166 22.802 28.282 1.00 0.00 ? 9  THR A OG1    4  
ATOM 6214  C CG2    . THR A 1 11 ? 20.127 20.747 28.985 1.00 0.00 ? 9  THR A CG2    4  
ATOM 6215  H H      . THR A 1 11 ? 21.911 23.692 28.635 1.00 0.00 ? 9  THR A H      4  
ATOM 6216  H HA     . THR A 1 11 ? 21.804 21.332 26.822 1.00 0.00 ? 9  THR A HA     4  
ATOM 6217  H HB     . THR A 1 11 ? 19.414 21.216 27.036 1.00 0.00 ? 9  THR A HB     4  
ATOM 6218  H HG1    . THR A 1 11 ? 18.410 22.428 28.766 1.00 0.00 ? 9  THR A HG1    4  
ATOM 6219  H HG21   . THR A 1 11 ? 20.816 19.965 28.676 1.00 0.00 ? 9  THR A HG21   4  
ATOM 6220  H HG22   . THR A 1 11 ? 20.536 21.262 29.849 1.00 0.00 ? 9  THR A HG22   4  
ATOM 6221  H HG23   . THR A 1 11 ? 19.172 20.301 29.252 1.00 0.00 ? 9  THR A HG23   4  
ATOM 6222  N N      . SER A 1 12 ? 20.653 22.725 24.953 1.00 0.00 ? 10 SER A N      4  
ATOM 6223  C CA     . SER A 1 12 ? 20.262 23.593 23.826 1.00 0.00 ? 10 SER A CA     4  
ATOM 6224  C C      . SER A 1 12 ? 19.147 24.576 24.204 1.00 0.00 ? 10 SER A C      4  
ATOM 6225  O O      . SER A 1 12 ? 19.183 25.730 23.783 1.00 0.00 ? 10 SER A O      4  
ATOM 6226  C CB     . SER A 1 12 ? 19.786 22.765 22.628 1.00 0.00 ? 10 SER A CB     4  
ATOM 6227  O OG     . SER A 1 12 ? 20.759 21.809 22.260 1.00 0.00 ? 10 SER A OG     4  
ATOM 6228  H H      . SER A 1 12 ? 20.616 21.722 24.806 1.00 0.00 ? 10 SER A H      4  
ATOM 6229  H HA     . SER A 1 12 ? 21.128 24.175 23.511 1.00 0.00 ? 10 SER A HA     4  
ATOM 6230  H HB2    . SER A 1 12 ? 18.860 22.249 22.877 1.00 0.00 ? 10 SER A HB2    4  
ATOM 6231  H HB3    . SER A 1 12 ? 19.595 23.432 21.785 1.00 0.00 ? 10 SER A HB3    4  
ATOM 6232  H HG     . SER A 1 12 ? 20.477 21.419 21.410 1.00 0.00 ? 10 SER A HG     4  
ATOM 6233  N N      . GLN A 1 13 ? 18.200 24.164 25.056 1.00 0.00 ? 11 GLN A N      4  
ATOM 6234  C CA     . GLN A 1 13 ? 17.110 25.022 25.528 1.00 0.00 ? 11 GLN A CA     4  
ATOM 6235  C C      . GLN A 1 13 ? 17.612 26.244 26.326 1.00 0.00 ? 11 GLN A C      4  
ATOM 6236  O O      . GLN A 1 13 ? 16.989 27.307 26.257 1.00 0.00 ? 11 GLN A O      4  
ATOM 6237  C CB     . GLN A 1 13 ? 16.113 24.165 26.337 1.00 0.00 ? 11 GLN A CB     4  
ATOM 6238  C CG     . GLN A 1 13 ? 14.842 24.899 26.808 1.00 0.00 ? 11 GLN A CG     4  
ATOM 6239  C CD     . GLN A 1 13 ? 14.017 25.478 25.662 1.00 0.00 ? 11 GLN A CD     4  
ATOM 6240  O OE1    . GLN A 1 13 ? 13.043 24.900 25.195 1.00 0.00 ? 11 GLN A OE1    4  
ATOM 6241  N NE2    . GLN A 1 13 ? 14.383 26.628 25.143 1.00 0.00 ? 11 GLN A NE2    4  
ATOM 6242  H H      . GLN A 1 13 ? 18.199 23.189 25.335 1.00 0.00 ? 11 GLN A H      4  
ATOM 6243  H HA     . GLN A 1 13 ? 16.602 25.401 24.642 1.00 0.00 ? 11 GLN A HA     4  
ATOM 6244  H HB2    . GLN A 1 13 ? 15.804 23.317 25.725 1.00 0.00 ? 11 GLN A HB2    4  
ATOM 6245  H HB3    . GLN A 1 13 ? 16.624 23.770 27.217 1.00 0.00 ? 11 GLN A HB3    4  
ATOM 6246  H HG2    . GLN A 1 13 ? 14.219 24.198 27.364 1.00 0.00 ? 11 GLN A HG2    4  
ATOM 6247  H HG3    . GLN A 1 13 ? 15.118 25.702 27.486 1.00 0.00 ? 11 GLN A HG3    4  
ATOM 6248  H HE21   . GLN A 1 13 ? 15.173 27.122 25.539 1.00 0.00 ? 11 GLN A HE21   4  
ATOM 6249  H HE22   . GLN A 1 13 ? 13.945 26.939 24.285 1.00 0.00 ? 11 GLN A HE22   4  
ATOM 6250  N N      . GLN A 1 14 ? 18.745 26.131 27.030 1.00 0.00 ? 12 GLN A N      4  
ATOM 6251  C CA     . GLN A 1 14 ? 19.409 27.259 27.698 1.00 0.00 ? 12 GLN A CA     4  
ATOM 6252  C C      . GLN A 1 14 ? 20.280 28.061 26.713 1.00 0.00 ? 12 GLN A C      4  
ATOM 6253  O O      . GLN A 1 14 ? 20.188 29.288 26.647 1.00 0.00 ? 12 GLN A O      4  
ATOM 6254  C CB     . GLN A 1 14 ? 20.254 26.746 28.881 1.00 0.00 ? 12 GLN A CB     4  
ATOM 6255  C CG     . GLN A 1 14 ? 19.427 26.008 29.946 1.00 0.00 ? 12 GLN A CG     4  
ATOM 6256  C CD     . GLN A 1 14 ? 20.302 25.470 31.073 1.00 0.00 ? 12 GLN A CD     4  
ATOM 6257  O OE1    . GLN A 1 14 ? 20.862 24.383 30.995 1.00 0.00 ? 12 GLN A OE1    4  
ATOM 6258  N NE2    . GLN A 1 14 ? 20.469 26.209 32.146 1.00 0.00 ? 12 GLN A NE2    4  
ATOM 6259  H H      . GLN A 1 14 ? 19.210 25.231 27.045 1.00 0.00 ? 12 GLN A H      4  
ATOM 6260  H HA     . GLN A 1 14 ? 18.653 27.938 28.094 1.00 0.00 ? 12 GLN A HA     4  
ATOM 6261  H HB2    . GLN A 1 14 ? 21.027 26.073 28.509 1.00 0.00 ? 12 GLN A HB2    4  
ATOM 6262  H HB3    . GLN A 1 14 ? 20.746 27.597 29.354 1.00 0.00 ? 12 GLN A HB3    4  
ATOM 6263  H HG2    . GLN A 1 14 ? 18.681 26.687 30.358 1.00 0.00 ? 12 GLN A HG2    4  
ATOM 6264  H HG3    . GLN A 1 14 ? 18.910 25.164 29.494 1.00 0.00 ? 12 GLN A HG3    4  
ATOM 6265  H HE21   . GLN A 1 14 ? 19.965 27.086 32.253 1.00 0.00 ? 12 GLN A HE21   4  
ATOM 6266  H HE22   . GLN A 1 14 ? 21.104 25.880 32.862 1.00 0.00 ? 12 GLN A HE22   4  
ATOM 6267  N N      . LEU A 1 15 ? 21.099 27.368 25.912 1.00 0.00 ? 13 LEU A N      4  
ATOM 6268  C CA     . LEU A 1 15 ? 22.066 27.979 24.987 1.00 0.00 ? 13 LEU A CA     4  
ATOM 6269  C C      . LEU A 1 15 ? 21.403 28.780 23.848 1.00 0.00 ? 13 LEU A C      4  
ATOM 6270  O O      . LEU A 1 15 ? 21.970 29.779 23.401 1.00 0.00 ? 13 LEU A O      4  
ATOM 6271  C CB     . LEU A 1 15 ? 22.984 26.874 24.430 1.00 0.00 ? 13 LEU A CB     4  
ATOM 6272  C CG     . LEU A 1 15 ? 23.919 26.208 25.461 1.00 0.00 ? 13 LEU A CG     4  
ATOM 6273  C CD1    . LEU A 1 15 ? 24.557 24.960 24.850 1.00 0.00 ? 13 LEU A CD1    4  
ATOM 6274  C CD2    . LEU A 1 15 ? 25.045 27.145 25.903 1.00 0.00 ? 13 LEU A CD2    4  
ATOM 6275  H H      . LEU A 1 15 ? 21.101 26.357 25.998 1.00 0.00 ? 13 LEU A H      4  
ATOM 6276  H HA     . LEU A 1 15 ? 22.676 28.690 25.541 1.00 0.00 ? 13 LEU A HA     4  
ATOM 6277  H HB2    . LEU A 1 15 ? 22.354 26.108 23.976 1.00 0.00 ? 13 LEU A HB2    4  
ATOM 6278  H HB3    . LEU A 1 15 ? 23.602 27.303 23.640 1.00 0.00 ? 13 LEU A HB3    4  
ATOM 6279  H HG     . LEU A 1 15 ? 23.352 25.907 26.341 1.00 0.00 ? 13 LEU A HG     4  
ATOM 6280  H HD11   . LEU A 1 15 ? 25.216 24.487 25.578 1.00 0.00 ? 13 LEU A HD11   4  
ATOM 6281  H HD12   . LEU A 1 15 ? 23.779 24.248 24.571 1.00 0.00 ? 13 LEU A HD12   4  
ATOM 6282  H HD13   . LEU A 1 15 ? 25.133 25.228 23.963 1.00 0.00 ? 13 LEU A HD13   4  
ATOM 6283  H HD21   . LEU A 1 15 ? 25.613 27.481 25.036 1.00 0.00 ? 13 LEU A HD21   4  
ATOM 6284  H HD22   . LEU A 1 15 ? 24.635 28.008 26.423 1.00 0.00 ? 13 LEU A HD22   4  
ATOM 6285  H HD23   . LEU A 1 15 ? 25.713 26.620 26.586 1.00 0.00 ? 13 LEU A HD23   4  
ATOM 6286  N N      . GLN A 1 16 ? 20.183 28.412 23.439 1.00 0.00 ? 14 GLN A N      4  
ATOM 6287  C CA     . GLN A 1 16 ? 19.359 29.108 22.437 1.00 0.00 ? 14 GLN A CA     4  
ATOM 6288  C C      . GLN A 1 16 ? 19.240 30.620 22.691 1.00 0.00 ? 14 GLN A C      4  
ATOM 6289  O O      . GLN A 1 16 ? 19.266 31.400 21.739 1.00 0.00 ? 14 GLN A O      4  
ATOM 6290  C CB     . GLN A 1 16 ? 17.963 28.444 22.429 1.00 0.00 ? 14 GLN A CB     4  
ATOM 6291  C CG     . GLN A 1 16 ? 16.865 29.145 21.604 1.00 0.00 ? 14 GLN A CG     4  
ATOM 6292  C CD     . GLN A 1 16 ? 17.117 29.140 20.101 1.00 0.00 ? 14 GLN A CD     4  
ATOM 6293  O OE1    . GLN A 1 16 ? 16.584 28.321 19.356 1.00 0.00 ? 14 GLN A OE1    4  
ATOM 6294  N NE2    . GLN A 1 16 ? 17.940 30.035 19.604 1.00 0.00 ? 14 GLN A NE2    4  
ATOM 6295  H H      . GLN A 1 16 ? 19.817 27.539 23.807 1.00 0.00 ? 14 GLN A H      4  
ATOM 6296  H HA     . GLN A 1 16 ? 19.818 28.971 21.457 1.00 0.00 ? 14 GLN A HA     4  
ATOM 6297  H HB2    . GLN A 1 16 ? 18.066 27.424 22.058 1.00 0.00 ? 14 GLN A HB2    4  
ATOM 6298  H HB3    . GLN A 1 16 ? 17.605 28.387 23.459 1.00 0.00 ? 14 GLN A HB3    4  
ATOM 6299  H HG2    . GLN A 1 16 ? 15.927 28.624 21.784 1.00 0.00 ? 14 GLN A HG2    4  
ATOM 6300  H HG3    . GLN A 1 16 ? 16.731 30.170 21.947 1.00 0.00 ? 14 GLN A HG3    4  
ATOM 6301  H HE21   . GLN A 1 16 ? 18.400 30.699 20.217 1.00 0.00 ? 14 GLN A HE21   4  
ATOM 6302  H HE22   . GLN A 1 16 ? 18.182 29.995 18.619 1.00 0.00 ? 14 GLN A HE22   4  
ATOM 6303  N N      . GLU A 1 17 ? 19.105 31.056 23.946 1.00 0.00 ? 15 GLU A N      4  
ATOM 6304  C CA     . GLU A 1 17 ? 18.959 32.484 24.273 1.00 0.00 ? 15 GLU A CA     4  
ATOM 6305  C C      . GLU A 1 17 ? 20.308 33.220 24.329 1.00 0.00 ? 15 GLU A C      4  
ATOM 6306  O O      . GLU A 1 17 ? 20.375 34.426 24.077 1.00 0.00 ? 15 GLU A O      4  
ATOM 6307  C CB     . GLU A 1 17 ? 18.201 32.642 25.602 1.00 0.00 ? 15 GLU A CB     4  
ATOM 6308  C CG     . GLU A 1 17 ? 16.802 31.998 25.623 1.00 0.00 ? 15 GLU A CG     4  
ATOM 6309  C CD     . GLU A 1 17 ? 15.838 32.557 24.567 1.00 0.00 ? 15 GLU A CD     4  
ATOM 6310  O OE1    . GLU A 1 17 ? 16.073 33.649 24.004 1.00 0.00 ? 15 GLU A OE1    4  
ATOM 6311  O OE2    . GLU A 1 17 ? 14.793 31.924 24.286 1.00 0.00 ? 15 GLU A OE2    4  
ATOM 6312  H H      . GLU A 1 17 ? 19.124 30.382 24.702 1.00 0.00 ? 15 GLU A H      4  
ATOM 6313  H HA     . GLU A 1 17 ? 18.382 32.973 23.488 1.00 0.00 ? 15 GLU A HA     4  
ATOM 6314  H HB2    . GLU A 1 17 ? 18.799 32.193 26.394 1.00 0.00 ? 15 GLU A HB2    4  
ATOM 6315  H HB3    . GLU A 1 17 ? 18.100 33.705 25.827 1.00 0.00 ? 15 GLU A HB3    4  
ATOM 6316  H HG2    . GLU A 1 17 ? 16.902 30.919 25.487 1.00 0.00 ? 15 GLU A HG2    4  
ATOM 6317  H HG3    . GLU A 1 17 ? 16.367 32.167 26.611 1.00 0.00 ? 15 GLU A HG3    4  
ATOM 6318  N N      . LEU A 1 18 ? 21.393 32.496 24.616 1.00 0.00 ? 16 LEU A N      4  
ATOM 6319  C CA     . LEU A 1 18 ? 22.748 33.041 24.681 1.00 0.00 ? 16 LEU A CA     4  
ATOM 6320  C C      . LEU A 1 18 ? 23.304 33.302 23.274 1.00 0.00 ? 16 LEU A C      4  
ATOM 6321  O O      . LEU A 1 18 ? 23.768 34.411 23.006 1.00 0.00 ? 16 LEU A O      4  
ATOM 6322  C CB     . LEU A 1 18 ? 23.631 32.096 25.519 1.00 0.00 ? 16 LEU A CB     4  
ATOM 6323  C CG     . LEU A 1 18 ? 23.264 32.057 27.016 1.00 0.00 ? 16 LEU A CG     4  
ATOM 6324  C CD1    . LEU A 1 18 ? 23.982 30.904 27.714 1.00 0.00 ? 16 LEU A CD1    4  
ATOM 6325  C CD2    . LEU A 1 18 ? 23.658 33.352 27.734 1.00 0.00 ? 16 LEU A CD2    4  
ATOM 6326  H H      . LEU A 1 18 ? 21.280 31.497 24.727 1.00 0.00 ? 16 LEU A H      4  
ATOM 6327  H HA     . LEU A 1 18 ? 22.714 34.011 25.174 1.00 0.00 ? 16 LEU A HA     4  
ATOM 6328  H HB2    . LEU A 1 18 ? 23.565 31.090 25.105 1.00 0.00 ? 16 LEU A HB2    4  
ATOM 6329  H HB3    . LEU A 1 18 ? 24.667 32.416 25.431 1.00 0.00 ? 16 LEU A HB3    4  
ATOM 6330  H HG     . LEU A 1 18 ? 22.190 31.905 27.130 1.00 0.00 ? 16 LEU A HG     4  
ATOM 6331  H HD11   . LEU A 1 18 ? 23.734 30.898 28.776 1.00 0.00 ? 16 LEU A HD11   4  
ATOM 6332  H HD12   . LEU A 1 18 ? 23.654 29.961 27.281 1.00 0.00 ? 16 LEU A HD12   4  
ATOM 6333  H HD13   . LEU A 1 18 ? 25.061 31.002 27.593 1.00 0.00 ? 16 LEU A HD13   4  
ATOM 6334  H HD21   . LEU A 1 18 ? 23.124 34.197 27.307 1.00 0.00 ? 16 LEU A HD21   4  
ATOM 6335  H HD22   . LEU A 1 18 ? 23.398 33.275 28.789 1.00 0.00 ? 16 LEU A HD22   4  
ATOM 6336  H HD23   . LEU A 1 18 ? 24.732 33.516 27.639 1.00 0.00 ? 16 LEU A HD23   4  
ATOM 6337  N N      . GLU A 1 19 ? 23.156 32.357 22.337 1.00 0.00 ? 17 GLU A N      4  
ATOM 6338  C CA     . GLU A 1 19 ? 23.552 32.560 20.931 1.00 0.00 ? 17 GLU A CA     4  
ATOM 6339  C C      . GLU A 1 19 ? 22.702 33.644 20.235 1.00 0.00 ? 17 GLU A C      4  
ATOM 6340  O O      . GLU A 1 19 ? 23.245 34.506 19.540 1.00 0.00 ? 17 GLU A O      4  
ATOM 6341  C CB     . GLU A 1 19 ? 23.574 31.218 20.170 1.00 0.00 ? 17 GLU A CB     4  
ATOM 6342  C CG     . GLU A 1 19 ? 22.196 30.563 19.961 1.00 0.00 ? 17 GLU A CG     4  
ATOM 6343  C CD     . GLU A 1 19 ? 22.262 29.147 19.368 1.00 0.00 ? 17 GLU A CD     4  
ATOM 6344  O OE1    . GLU A 1 19 ? 23.252 28.402 19.578 1.00 0.00 ? 17 GLU A OE1    4  
ATOM 6345  O OE2    . GLU A 1 19 ? 21.273 28.714 18.726 1.00 0.00 ? 17 GLU A OE2    4  
ATOM 6346  H H      . GLU A 1 19 ? 22.760 31.462 22.613 1.00 0.00 ? 17 GLU A H      4  
ATOM 6347  H HA     . GLU A 1 19 ? 24.576 32.933 20.927 1.00 0.00 ? 17 GLU A HA     4  
ATOM 6348  H HB2    . GLU A 1 19 ? 24.032 31.379 19.192 1.00 0.00 ? 17 GLU A HB2    4  
ATOM 6349  H HB3    . GLU A 1 19 ? 24.215 30.533 20.728 1.00 0.00 ? 17 GLU A HB3    4  
ATOM 6350  H HG2    . GLU A 1 19 ? 21.681 30.511 20.917 1.00 0.00 ? 17 GLU A HG2    4  
ATOM 6351  H HG3    . GLU A 1 19 ? 21.604 31.195 19.297 1.00 0.00 ? 17 GLU A HG3    4  
ATOM 6352  N N      . ALA A 1 20 ? 21.392 33.687 20.509 1.00 0.00 ? 18 ALA A N      4  
ATOM 6353  C CA     . ALA A 1 20 ? 20.492 34.723 19.994 1.00 0.00 ? 18 ALA A CA     4  
ATOM 6354  C C      . ALA A 1 20 ? 20.839 36.135 20.508 1.00 0.00 ? 18 ALA A C      4  
ATOM 6355  O O      . ALA A 1 20 ? 20.667 37.117 19.781 1.00 0.00 ? 18 ALA A O      4  
ATOM 6356  C CB     . ALA A 1 20 ? 19.061 34.347 20.381 1.00 0.00 ? 18 ALA A CB     4  
ATOM 6357  H H      . ALA A 1 20 ? 20.990 32.947 21.072 1.00 0.00 ? 18 ALA A H      4  
ATOM 6358  H HA     . ALA A 1 20 ? 20.565 34.741 18.905 1.00 0.00 ? 18 ALA A HA     4  
ATOM 6359  H HB1    . ALA A 1 20 ? 18.970 34.272 21.466 1.00 0.00 ? 18 ALA A HB1    4  
ATOM 6360  H HB2    . ALA A 1 20 ? 18.375 35.112 20.020 1.00 0.00 ? 18 ALA A HB2    4  
ATOM 6361  H HB3    . ALA A 1 20 ? 18.798 33.390 19.928 1.00 0.00 ? 18 ALA A HB3    4  
ATOM 6362  N N      . THR A 1 21 ? 21.352 36.240 21.741 1.00 0.00 ? 19 THR A N      4  
ATOM 6363  C CA     . THR A 1 21 ? 21.834 37.506 22.314 1.00 0.00 ? 19 THR A CA     4  
ATOM 6364  C C      . THR A 1 21 ? 23.204 37.885 21.742 1.00 0.00 ? 19 THR A C      4  
ATOM 6365  O O      . THR A 1 21 ? 23.397 39.025 21.322 1.00 0.00 ? 19 THR A O      4  
ATOM 6366  C CB     . THR A 1 21 ? 21.890 37.444 23.849 1.00 0.00 ? 19 THR A CB     4  
ATOM 6367  O OG1    . THR A 1 21 ? 20.632 37.068 24.370 1.00 0.00 ? 19 THR A OG1    4  
ATOM 6368  C CG2    . THR A 1 21 ? 22.225 38.804 24.463 1.00 0.00 ? 19 THR A CG2    4  
ATOM 6369  H H      . THR A 1 21 ? 21.444 35.393 22.288 1.00 0.00 ? 19 THR A H      4  
ATOM 6370  H HA     . THR A 1 21 ? 21.138 38.300 22.042 1.00 0.00 ? 19 THR A HA     4  
ATOM 6371  H HB     . THR A 1 21 ? 22.636 36.713 24.161 1.00 0.00 ? 19 THR A HB     4  
ATOM 6372  H HG1    . THR A 1 21 ? 20.562 36.094 24.276 1.00 0.00 ? 19 THR A HG1    4  
ATOM 6373  H HG21   . THR A 1 21 ? 22.242 38.717 25.548 1.00 0.00 ? 19 THR A HG21   4  
ATOM 6374  H HG22   . THR A 1 21 ? 23.208 39.140 24.134 1.00 0.00 ? 19 THR A HG22   4  
ATOM 6375  H HG23   . THR A 1 21 ? 21.477 39.541 24.171 1.00 0.00 ? 19 THR A HG23   4  
ATOM 6376  N N      . PHE A 1 22 ? 24.136 36.932 21.647 1.00 0.00 ? 20 PHE A N      4  
ATOM 6377  C CA     . PHE A 1 22 ? 25.476 37.140 21.085 1.00 0.00 ? 20 PHE A CA     4  
ATOM 6378  C C      . PHE A 1 22 ? 25.443 37.681 19.644 1.00 0.00 ? 20 PHE A C      4  
ATOM 6379  O O      . PHE A 1 22 ? 26.234 38.555 19.284 1.00 0.00 ? 20 PHE A O      4  
ATOM 6380  C CB     . PHE A 1 22 ? 26.231 35.805 21.162 1.00 0.00 ? 20 PHE A CB     4  
ATOM 6381  C CG     . PHE A 1 22 ? 27.618 35.854 20.560 1.00 0.00 ? 20 PHE A CG     4  
ATOM 6382  C CD1    . PHE A 1 22 ? 28.697 36.339 21.322 1.00 0.00 ? 20 PHE A CD1    4  
ATOM 6383  C CD2    . PHE A 1 22 ? 27.820 35.460 19.223 1.00 0.00 ? 20 PHE A CD2    4  
ATOM 6384  C CE1    . PHE A 1 22 ? 29.971 36.450 20.740 1.00 0.00 ? 20 PHE A CE1    4  
ATOM 6385  C CE2    . PHE A 1 22 ? 29.092 35.577 18.640 1.00 0.00 ? 20 PHE A CE2    4  
ATOM 6386  C CZ     . PHE A 1 22 ? 30.163 36.081 19.397 1.00 0.00 ? 20 PHE A CZ     4  
ATOM 6387  H H      . PHE A 1 22 ? 23.919 36.003 21.996 1.00 0.00 ? 20 PHE A H      4  
ATOM 6388  H HA     . PHE A 1 22 ? 26.004 37.878 21.690 1.00 0.00 ? 20 PHE A HA     4  
ATOM 6389  H HB2    . PHE A 1 22 ? 26.311 35.506 22.207 1.00 0.00 ? 20 PHE A HB2    4  
ATOM 6390  H HB3    . PHE A 1 22 ? 25.655 35.038 20.646 1.00 0.00 ? 20 PHE A HB3    4  
ATOM 6391  H HD1    . PHE A 1 22 ? 28.547 36.639 22.349 1.00 0.00 ? 20 PHE A HD1    4  
ATOM 6392  H HD2    . PHE A 1 22 ? 26.995 35.084 18.633 1.00 0.00 ? 20 PHE A HD2    4  
ATOM 6393  H HE1    . PHE A 1 22 ? 30.798 36.833 21.320 1.00 0.00 ? 20 PHE A HE1    4  
ATOM 6394  H HE2    . PHE A 1 22 ? 29.246 35.289 17.608 1.00 0.00 ? 20 PHE A HE2    4  
ATOM 6395  H HZ     . PHE A 1 22 ? 31.136 36.187 18.940 1.00 0.00 ? 20 PHE A HZ     4  
ATOM 6396  N N      . GLN A 1 23 ? 24.469 37.243 18.841 1.00 0.00 ? 21 GLN A N      4  
ATOM 6397  C CA     . GLN A 1 23 ? 24.233 37.737 17.479 1.00 0.00 ? 21 GLN A CA     4  
ATOM 6398  C C      . GLN A 1 23 ? 23.879 39.238 17.375 1.00 0.00 ? 21 GLN A C      4  
ATOM 6399  O O      . GLN A 1 23 ? 23.990 39.804 16.282 1.00 0.00 ? 21 GLN A O      4  
ATOM 6400  C CB     . GLN A 1 23 ? 23.127 36.877 16.839 1.00 0.00 ? 21 GLN A CB     4  
ATOM 6401  C CG     . GLN A 1 23 ? 23.675 35.614 16.154 1.00 0.00 ? 21 GLN A CG     4  
ATOM 6402  C CD     . GLN A 1 23 ? 24.585 35.948 14.974 1.00 0.00 ? 21 GLN A CD     4  
ATOM 6403  O OE1    . GLN A 1 23 ? 25.769 35.626 14.945 1.00 0.00 ? 21 GLN A OE1    4  
ATOM 6404  N NE2    . GLN A 1 23 ? 24.093 36.628 13.966 1.00 0.00 ? 21 GLN A NE2    4  
ATOM 6405  H H      . GLN A 1 23 ? 23.893 36.475 19.172 1.00 0.00 ? 21 GLN A H      4  
ATOM 6406  H HA     . GLN A 1 23 ? 25.155 37.613 16.911 1.00 0.00 ? 21 GLN A HA     4  
ATOM 6407  H HB2    . GLN A 1 23 ? 22.397 36.587 17.597 1.00 0.00 ? 21 GLN A HB2    4  
ATOM 6408  H HB3    . GLN A 1 23 ? 22.594 37.468 16.097 1.00 0.00 ? 21 GLN A HB3    4  
ATOM 6409  H HG2    . GLN A 1 23 ? 24.226 35.013 16.878 1.00 0.00 ? 21 GLN A HG2    4  
ATOM 6410  H HG3    . GLN A 1 23 ? 22.835 35.024 15.786 1.00 0.00 ? 21 GLN A HG3    4  
ATOM 6411  H HE21   . GLN A 1 23 ? 23.126 36.942 13.974 1.00 0.00 ? 21 GLN A HE21   4  
ATOM 6412  H HE22   . GLN A 1 23 ? 24.735 36.903 13.230 1.00 0.00 ? 21 GLN A HE22   4  
ATOM 6413  N N      . ARG A 1 24 ? 23.488 39.905 18.472 1.00 0.00 ? 22 ARG A N      4  
ATOM 6414  C CA     . ARG A 1 24 ? 23.104 41.335 18.494 1.00 0.00 ? 22 ARG A CA     4  
ATOM 6415  C C      . ARG A 1 24 ? 23.897 42.203 19.477 1.00 0.00 ? 22 ARG A C      4  
ATOM 6416  O O      . ARG A 1 24 ? 24.113 43.384 19.200 1.00 0.00 ? 22 ARG A O      4  
ATOM 6417  C CB     . ARG A 1 24 ? 21.582 41.451 18.704 1.00 0.00 ? 22 ARG A CB     4  
ATOM 6418  C CG     . ARG A 1 24 ? 21.105 40.945 20.073 1.00 0.00 ? 22 ARG A CG     4  
ATOM 6419  C CD     . ARG A 1 24 ? 19.586 41.044 20.205 1.00 0.00 ? 22 ARG A CD     4  
ATOM 6420  N NE     . ARG A 1 24 ? 19.133 40.727 21.571 1.00 0.00 ? 22 ARG A NE     4  
ATOM 6421  C CZ     . ARG A 1 24 ? 19.206 41.515 22.631 1.00 0.00 ? 22 ARG A CZ     4  
ATOM 6422  N NH1    . ARG A 1 24 ? 19.711 42.713 22.575 1.00 0.00 1 22 ARG A NH1    4  
ATOM 6423  N NH2    . ARG A 1 24 ? 18.774 41.117 23.791 1.00 0.00 ? 22 ARG A NH2    4  
ATOM 6424  H H      . ARG A 1 24 ? 23.430 39.378 19.337 1.00 0.00 ? 22 ARG A H      4  
ATOM 6425  H HA     . ARG A 1 24 ? 23.310 41.774 17.519 1.00 0.00 ? 22 ARG A HA     4  
ATOM 6426  H HB2    . ARG A 1 24 ? 21.293 42.497 18.590 1.00 0.00 ? 22 ARG A HB2    4  
ATOM 6427  H HB3    . ARG A 1 24 ? 21.077 40.876 17.926 1.00 0.00 ? 22 ARG A HB3    4  
ATOM 6428  H HG2    . ARG A 1 24 ? 21.373 39.898 20.183 1.00 0.00 ? 22 ARG A HG2    4  
ATOM 6429  H HG3    . ARG A 1 24 ? 21.578 41.528 20.862 1.00 0.00 ? 22 ARG A HG3    4  
ATOM 6430  H HD2    . ARG A 1 24 ? 19.246 42.039 19.918 1.00 0.00 ? 22 ARG A HD2    4  
ATOM 6431  H HD3    . ARG A 1 24 ? 19.148 40.336 19.503 1.00 0.00 ? 22 ARG A HD3    4  
ATOM 6432  H HE     . ARG A 1 24 ? 18.669 39.836 21.692 1.00 0.00 ? 22 ARG A HE     4  
ATOM 6433  H HH11   . ARG A 1 24 ? 19.963 43.124 21.680 1.00 0.00 ? 22 ARG A HH11   4  
ATOM 6434  H HH12   . ARG A 1 24 ? 19.927 43.228 23.419 1.00 0.00 ? 22 ARG A HH12   4  
ATOM 6435  H HH21   . ARG A 1 24 ? 18.357 40.197 23.885 1.00 0.00 ? 22 ARG A HH21   4  
ATOM 6436  H HH22   . ARG A 1 24 ? 18.654 41.809 24.525 1.00 0.00 ? 22 ARG A HH22   4  
ATOM 6437  N N      . ASN A 1 25 ? 24.357 41.640 20.594 1.00 0.00 ? 23 ASN A N      4  
ATOM 6438  C CA     . ASN A 1 25 ? 25.124 42.337 21.626 1.00 0.00 ? 23 ASN A CA     4  
ATOM 6439  C C      . ASN A 1 25 ? 26.135 41.378 22.278 1.00 0.00 ? 23 ASN A C      4  
ATOM 6440  O O      . ASN A 1 25 ? 25.747 40.392 22.906 1.00 0.00 ? 23 ASN A O      4  
ATOM 6441  C CB     . ASN A 1 25 ? 24.136 42.908 22.664 1.00 0.00 ? 23 ASN A CB     4  
ATOM 6442  C CG     . ASN A 1 25 ? 24.789 43.793 23.712 1.00 0.00 ? 23 ASN A CG     4  
ATOM 6443  O OD1    . ASN A 1 25 ? 25.972 44.111 23.669 1.00 0.00 ? 23 ASN A OD1    4  
ATOM 6444  N ND2    . ASN A 1 25 ? 24.029 44.246 24.676 1.00 0.00 ? 23 ASN A ND2    4  
ATOM 6445  H H      . ASN A 1 25 ? 24.134 40.666 20.768 1.00 0.00 ? 23 ASN A H      4  
ATOM 6446  H HA     . ASN A 1 25 ? 25.678 43.165 21.174 1.00 0.00 ? 23 ASN A HA     4  
ATOM 6447  H HB2    . ASN A 1 25 ? 23.379 43.506 22.155 1.00 0.00 ? 23 ASN A HB2    4  
ATOM 6448  H HB3    . ASN A 1 25 ? 23.627 42.088 23.171 1.00 0.00 ? 23 ASN A HB3    4  
ATOM 6449  H HD21   . ASN A 1 25 ? 23.028 44.074 24.654 1.00 0.00 ? 23 ASN A HD21   4  
ATOM 6450  H HD22   . ASN A 1 25 ? 24.410 44.933 25.303 1.00 0.00 ? 23 ASN A HD22   4  
ATOM 6451  N N      . ARG A 1 26 ? 27.433 41.685 22.167 1.00 0.00 ? 24 ARG A N      4  
ATOM 6452  C CA     . ARG A 1 26 ? 28.529 40.916 22.797 1.00 0.00 ? 24 ARG A CA     4  
ATOM 6453  C C      . ARG A 1 26 ? 28.950 41.472 24.167 1.00 0.00 ? 24 ARG A C      4  
ATOM 6454  O O      . ARG A 1 26 ? 29.694 40.807 24.892 1.00 0.00 ? 24 ARG A O      4  
ATOM 6455  C CB     . ARG A 1 26 ? 29.684 40.671 21.797 1.00 0.00 ? 24 ARG A CB     4  
ATOM 6456  C CG     . ARG A 1 26 ? 30.098 41.895 20.959 1.00 0.00 ? 24 ARG A CG     4  
ATOM 6457  C CD     . ARG A 1 26 ? 31.175 41.609 19.905 1.00 0.00 ? 24 ARG A CD     4  
ATOM 6458  N NE     . ARG A 1 26 ? 32.490 41.312 20.493 1.00 0.00 ? 24 ARG A NE     4  
ATOM 6459  C CZ     . ARG A 1 26 ? 33.648 41.343 19.863 1.00 0.00 ? 24 ARG A CZ     4  
ATOM 6460  N NH1    . ARG A 1 26 ? 33.796 41.762 18.645 1.00 0.00 1 24 ARG A NH1    4  
ATOM 6461  N NH2    . ARG A 1 26 ? 34.720 40.928 20.455 1.00 0.00 ? 24 ARG A NH2    4  
ATOM 6462  H H      . ARG A 1 26 ? 27.676 42.545 21.678 1.00 0.00 ? 24 ARG A H      4  
ATOM 6463  H HA     . ARG A 1 26 ? 28.144 39.926 23.038 1.00 0.00 ? 24 ARG A HA     4  
ATOM 6464  H HB2    . ARG A 1 26 ? 30.553 40.291 22.337 1.00 0.00 ? 24 ARG A HB2    4  
ATOM 6465  H HB3    . ARG A 1 26 ? 29.364 39.890 21.103 1.00 0.00 ? 24 ARG A HB3    4  
ATOM 6466  H HG2    . ARG A 1 26 ? 29.229 42.247 20.404 1.00 0.00 ? 24 ARG A HG2    4  
ATOM 6467  H HG3    . ARG A 1 26 ? 30.436 42.690 21.618 1.00 0.00 ? 24 ARG A HG3    4  
ATOM 6468  H HD2    . ARG A 1 26 ? 30.856 40.768 19.284 1.00 0.00 ? 24 ARG A HD2    4  
ATOM 6469  H HD3    . ARG A 1 26 ? 31.258 42.491 19.269 1.00 0.00 ? 24 ARG A HD3    4  
ATOM 6470  H HE     . ARG A 1 26 ? 32.533 40.942 21.436 1.00 0.00 ? 24 ARG A HE     4  
ATOM 6471  H HH11   . ARG A 1 26 ? 33.001 42.043 18.087 1.00 0.00 ? 24 ARG A HH11   4  
ATOM 6472  H HH12   . ARG A 1 26 ? 34.705 41.645 18.213 1.00 0.00 ? 24 ARG A HH12   4  
ATOM 6473  H HH21   . ARG A 1 26 ? 34.617 40.507 21.373 1.00 0.00 ? 24 ARG A HH21   4  
ATOM 6474  H HH22   . ARG A 1 26 ? 35.568 40.877 19.907 1.00 0.00 ? 24 ARG A HH22   4  
ATOM 6475  N N      . TYR A 1 27 ? 28.403 42.625 24.571 1.00 0.00 ? 25 TYR A N      4  
ATOM 6476  C CA     . TYR A 1 27 ? 28.657 43.272 25.867 1.00 0.00 ? 25 TYR A CA     4  
ATOM 6477  C C      . TYR A 1 27 ? 27.362 43.699 26.610 1.00 0.00 ? 25 TYR A C      4  
ATOM 6478  O O      . TYR A 1 27 ? 27.137 44.901 26.808 1.00 0.00 ? 25 TYR A O      4  
ATOM 6479  C CB     . TYR A 1 27 ? 29.657 44.426 25.669 1.00 0.00 ? 25 TYR A CB     4  
ATOM 6480  C CG     . TYR A 1 27 ? 30.952 44.011 24.994 1.00 0.00 ? 25 TYR A CG     4  
ATOM 6481  C CD1    . TYR A 1 27 ? 31.861 43.175 25.668 1.00 0.00 ? 25 TYR A CD1    4  
ATOM 6482  C CD2    . TYR A 1 27 ? 31.223 44.419 23.674 1.00 0.00 ? 25 TYR A CD2    4  
ATOM 6483  C CE1    . TYR A 1 27 ? 33.023 42.725 25.014 1.00 0.00 ? 25 TYR A CE1    4  
ATOM 6484  C CE2    . TYR A 1 27 ? 32.393 43.983 23.022 1.00 0.00 ? 25 TYR A CE2    4  
ATOM 6485  C CZ     . TYR A 1 27 ? 33.293 43.132 23.692 1.00 0.00 ? 25 TYR A CZ     4  
ATOM 6486  O OH     . TYR A 1 27 ? 34.441 42.750 23.082 1.00 0.00 ? 25 TYR A OH     4  
ATOM 6487  H H      . TYR A 1 27 ? 27.768 43.092 23.936 1.00 0.00 ? 25 TYR A H      4  
ATOM 6488  H HA     . TYR A 1 27 ? 29.149 42.552 26.513 1.00 0.00 ? 25 TYR A HA     4  
ATOM 6489  H HB2    . TYR A 1 27 ? 29.186 45.201 25.067 1.00 0.00 ? 25 TYR A HB2    4  
ATOM 6490  H HB3    . TYR A 1 27 ? 29.899 44.858 26.643 1.00 0.00 ? 25 TYR A HB3    4  
ATOM 6491  H HD1    . TYR A 1 27 ? 31.658 42.862 26.684 1.00 0.00 ? 25 TYR A HD1    4  
ATOM 6492  H HD2    . TYR A 1 27 ? 30.525 45.063 23.156 1.00 0.00 ? 25 TYR A HD2    4  
ATOM 6493  H HE1    . TYR A 1 27 ? 33.703 42.052 25.516 1.00 0.00 ? 25 TYR A HE1    4  
ATOM 6494  H HE2    . TYR A 1 27 ? 32.610 44.294 22.010 1.00 0.00 ? 25 TYR A HE2    4  
ATOM 6495  H HH     . TYR A 1 27 ? 35.038 42.332 23.742 1.00 0.00 ? 25 TYR A HH     4  
ATOM 6496  N N      . PRO A 1 28 ? 26.475 42.758 27.004 1.00 0.00 ? 26 PRO A N      4  
ATOM 6497  C CA     . PRO A 1 28 ? 25.287 43.052 27.815 1.00 0.00 ? 26 PRO A CA     4  
ATOM 6498  C C      . PRO A 1 28 ? 25.629 43.400 29.279 1.00 0.00 ? 26 PRO A C      4  
ATOM 6499  O O      . PRO A 1 28 ? 26.386 42.686 29.938 1.00 0.00 ? 26 PRO A O      4  
ATOM 6500  C CB     . PRO A 1 28 ? 24.414 41.794 27.724 1.00 0.00 ? 26 PRO A CB     4  
ATOM 6501  C CG     . PRO A 1 28 ? 25.435 40.672 27.537 1.00 0.00 ? 26 PRO A CG     4  
ATOM 6502  C CD     . PRO A 1 28 ? 26.520 41.335 26.691 1.00 0.00 ? 26 PRO A CD     4  
ATOM 6503  H HA     . PRO A 1 28 ? 24.741 43.884 27.377 1.00 0.00 ? 26 PRO A HA     4  
ATOM 6504  H HB2    . PRO A 1 28 ? 23.806 41.646 28.618 1.00 0.00 ? 26 PRO A HB2    4  
ATOM 6505  H HB3    . PRO A 1 28 ? 23.779 41.858 26.840 1.00 0.00 ? 26 PRO A HB3    4  
ATOM 6506  H HG2    . PRO A 1 28 ? 25.850 40.382 28.503 1.00 0.00 ? 26 PRO A HG2    4  
ATOM 6507  H HG3    . PRO A 1 28 ? 25.000 39.809 27.032 1.00 0.00 ? 26 PRO A HG3    4  
ATOM 6508  H HD2    . PRO A 1 28 ? 27.490 40.901 26.926 1.00 0.00 ? 26 PRO A HD2    4  
ATOM 6509  H HD3    . PRO A 1 28 ? 26.290 41.189 25.635 1.00 0.00 ? 26 PRO A HD3    4  
ATOM 6510  N N      . ASP A 1 29 ? 25.028 44.470 29.806 1.00 0.00 ? 27 ASP A N      4  
ATOM 6511  C CA     . ASP A 1 29 ? 25.185 44.929 31.200 1.00 0.00 ? 27 ASP A CA     4  
ATOM 6512  C C      . ASP A 1 29 ? 24.706 43.884 32.233 1.00 0.00 ? 27 ASP A C      4  
ATOM 6513  O O      . ASP A 1 29 ? 23.798 43.099 31.945 1.00 0.00 ? 27 ASP A O      4  
ATOM 6514  C CB     . ASP A 1 29 ? 24.413 46.252 31.363 1.00 0.00 ? 27 ASP A CB     4  
ATOM 6515  C CG     . ASP A 1 29 ? 24.583 46.878 32.750 1.00 0.00 ? 27 ASP A CG     4  
ATOM 6516  O OD1    . ASP A 1 29 ? 23.808 46.511 33.664 1.00 0.00 ? 27 ASP A OD1    4  
ATOM 6517  O OD2    . ASP A 1 29 ? 25.505 47.717 32.911 1.00 0.00 ? 27 ASP A OD2    4  
ATOM 6518  H H      . ASP A 1 29 ? 24.413 45.008 29.207 1.00 0.00 ? 27 ASP A H      4  
ATOM 6519  H HA     . ASP A 1 29 ? 26.243 45.124 31.384 1.00 0.00 ? 27 ASP A HA     4  
ATOM 6520  H HB2    . ASP A 1 29 ? 24.765 46.962 30.612 1.00 0.00 ? 27 ASP A HB2    4  
ATOM 6521  H HB3    . ASP A 1 29 ? 23.352 46.072 31.180 1.00 0.00 ? 27 ASP A HB3    4  
ATOM 6522  N N      . MET A 1 30 ? 25.267 43.890 33.451 1.00 0.00 ? 28 MET A N      4  
ATOM 6523  C CA     . MET A 1 30 ? 24.906 42.979 34.554 1.00 0.00 ? 28 MET A CA     4  
ATOM 6524  C C      . MET A 1 30 ? 23.390 42.842 34.787 1.00 0.00 ? 28 MET A C      4  
ATOM 6525  O O      . MET A 1 30 ? 22.902 41.735 35.023 1.00 0.00 ? 28 MET A O      4  
ATOM 6526  C CB     . MET A 1 30 ? 25.625 43.412 35.849 1.00 0.00 ? 28 MET A CB     4  
ATOM 6527  C CG     . MET A 1 30 ? 25.031 44.667 36.513 1.00 0.00 ? 28 MET A CG     4  
ATOM 6528  S SD     . MET A 1 30 ? 25.943 45.300 37.946 1.00 0.00 ? 28 MET A SD     4  
ATOM 6529  C CE     . MET A 1 30 ? 27.334 46.062 37.081 1.00 0.00 ? 28 MET A CE     4  
ATOM 6530  H H      . MET A 1 30 ? 26.035 44.533 33.615 1.00 0.00 ? 28 MET A H      4  
ATOM 6531  H HA     . MET A 1 30 ? 25.273 41.989 34.296 1.00 0.00 ? 28 MET A HA     4  
ATOM 6532  H HB2    . MET A 1 30 ? 25.572 42.595 36.568 1.00 0.00 ? 28 MET A HB2    4  
ATOM 6533  H HB3    . MET A 1 30 ? 26.677 43.592 35.626 1.00 0.00 ? 28 MET A HB3    4  
ATOM 6534  H HG2    . MET A 1 30 ? 24.960 45.463 35.774 1.00 0.00 ? 28 MET A HG2    4  
ATOM 6535  H HG3    . MET A 1 30 ? 24.022 44.433 36.854 1.00 0.00 ? 28 MET A HG3    4  
ATOM 6536  H HE1    . MET A 1 30 ? 27.993 45.292 36.679 1.00 0.00 ? 28 MET A HE1    4  
ATOM 6537  H HE2    . MET A 1 30 ? 26.956 46.672 36.262 1.00 0.00 ? 28 MET A HE2    4  
ATOM 6538  H HE3    . MET A 1 30 ? 27.884 46.700 37.768 1.00 0.00 ? 28 MET A HE3    4  
ATOM 6539  N N      . SER A 1 31 ? 22.631 43.933 34.643 1.00 0.00 ? 29 SER A N      4  
ATOM 6540  C CA     . SER A 1 31 ? 21.177 43.931 34.837 1.00 0.00 ? 29 SER A CA     4  
ATOM 6541  C C      . SER A 1 31 ? 20.451 43.157 33.724 1.00 0.00 ? 29 SER A C      4  
ATOM 6542  O O      . SER A 1 31 ? 19.489 42.429 33.982 1.00 0.00 ? 29 SER A O      4  
ATOM 6543  C CB     . SER A 1 31 ? 20.707 45.383 34.930 1.00 0.00 ? 29 SER A CB     4  
ATOM 6544  O OG     . SER A 1 31 ? 19.390 45.485 35.425 1.00 0.00 ? 29 SER A OG     4  
ATOM 6545  H H      . SER A 1 31 ? 23.092 44.810 34.408 1.00 0.00 ? 29 SER A H      4  
ATOM 6546  H HA     . SER A 1 31 ? 20.958 43.444 35.787 1.00 0.00 ? 29 SER A HA     4  
ATOM 6547  H HB2    . SER A 1 31 ? 21.361 45.916 35.620 1.00 0.00 ? 29 SER A HB2    4  
ATOM 6548  H HB3    . SER A 1 31 ? 20.779 45.856 33.948 1.00 0.00 ? 29 SER A HB3    4  
ATOM 6549  H HG     . SER A 1 31 ? 19.090 46.396 35.192 1.00 0.00 ? 29 SER A HG     4  
ATOM 6550  N N      . THR A 1 32 ? 20.961 43.222 32.492 1.00 0.00 ? 30 THR A N      4  
ATOM 6551  C CA     . THR A 1 32 ? 20.492 42.405 31.362 1.00 0.00 ? 30 THR A CA     4  
ATOM 6552  C C      . THR A 1 32 ? 20.968 40.954 31.482 1.00 0.00 ? 30 THR A C      4  
ATOM 6553  O O      . THR A 1 32 ? 20.203 40.038 31.183 1.00 0.00 ? 30 THR A O      4  
ATOM 6554  C CB     . THR A 1 32 ? 20.960 43.023 30.036 1.00 0.00 ? 30 THR A CB     4  
ATOM 6555  O OG1    . THR A 1 32 ? 20.478 44.345 29.938 1.00 0.00 ? 30 THR A OG1    4  
ATOM 6556  C CG2    . THR A 1 32 ? 20.462 42.276 28.800 1.00 0.00 ? 30 THR A CG2    4  
ATOM 6557  H H      . THR A 1 32 ? 21.800 43.772 32.354 1.00 0.00 ? 30 THR A H      4  
ATOM 6558  H HA     . THR A 1 32 ? 19.402 42.386 31.365 1.00 0.00 ? 30 THR A HA     4  
ATOM 6559  H HB     . THR A 1 32 ? 22.050 43.050 30.008 1.00 0.00 ? 30 THR A HB     4  
ATOM 6560  H HG1    . THR A 1 32 ? 19.518 44.316 30.115 1.00 0.00 ? 30 THR A HG1    4  
ATOM 6561  H HG21   . THR A 1 32 ? 20.693 42.852 27.903 1.00 0.00 ? 30 THR A HG21   4  
ATOM 6562  H HG22   . THR A 1 32 ? 20.959 41.310 28.728 1.00 0.00 ? 30 THR A HG22   4  
ATOM 6563  H HG23   . THR A 1 32 ? 19.387 42.119 28.866 1.00 0.00 ? 30 THR A HG23   4  
ATOM 6564  N N      . ARG A 1 33 ? 22.191 40.718 31.982 1.00 0.00 ? 31 ARG A N      4  
ATOM 6565  C CA     . ARG A 1 33 ? 22.698 39.363 32.262 1.00 0.00 ? 31 ARG A CA     4  
ATOM 6566  C C      . ARG A 1 33 ? 21.849 38.636 33.305 1.00 0.00 ? 31 ARG A C      4  
ATOM 6567  O O      . ARG A 1 33 ? 21.598 37.446 33.131 1.00 0.00 ? 31 ARG A O      4  
ATOM 6568  C CB     . ARG A 1 33 ? 24.180 39.392 32.681 1.00 0.00 ? 31 ARG A CB     4  
ATOM 6569  C CG     . ARG A 1 33 ? 25.126 39.839 31.555 1.00 0.00 ? 31 ARG A CG     4  
ATOM 6570  C CD     . ARG A 1 33 ? 26.597 39.480 31.827 1.00 0.00 ? 31 ARG A CD     4  
ATOM 6571  N NE     . ARG A 1 33 ? 27.128 40.062 33.075 1.00 0.00 ? 31 ARG A NE     4  
ATOM 6572  C CZ     . ARG A 1 33 ? 27.705 41.240 33.229 1.00 0.00 ? 31 ARG A CZ     4  
ATOM 6573  N NH1    . ARG A 1 33 ? 27.787 42.136 32.295 1.00 0.00 ? 31 ARG A NH1    4  
ATOM 6574  N NH2    . ARG A 1 33 ? 28.209 41.537 34.384 1.00 0.00 1 31 ARG A NH2    4  
ATOM 6575  H H      . ARG A 1 33 ? 22.778 41.520 32.200 1.00 0.00 ? 31 ARG A H      4  
ATOM 6576  H HA     . ARG A 1 33 ? 22.610 38.765 31.354 1.00 0.00 ? 31 ARG A HA     4  
ATOM 6577  H HB2    . ARG A 1 33 ? 24.298 40.059 33.532 1.00 0.00 ? 31 ARG A HB2    4  
ATOM 6578  H HB3    . ARG A 1 33 ? 24.464 38.387 32.994 1.00 0.00 ? 31 ARG A HB3    4  
ATOM 6579  H HG2    . ARG A 1 33 ? 24.829 39.348 30.627 1.00 0.00 ? 31 ARG A HG2    4  
ATOM 6580  H HG3    . ARG A 1 33 ? 25.038 40.914 31.413 1.00 0.00 ? 31 ARG A HG3    4  
ATOM 6581  H HD2    . ARG A 1 33 ? 26.683 38.395 31.888 1.00 0.00 ? 31 ARG A HD2    4  
ATOM 6582  H HD3    . ARG A 1 33 ? 27.202 39.813 30.980 1.00 0.00 ? 31 ARG A HD3    4  
ATOM 6583  H HE     . ARG A 1 33 ? 27.147 39.476 33.906 1.00 0.00 ? 31 ARG A HE     4  
ATOM 6584  H HH11   . ARG A 1 33 ? 27.331 42.014 31.398 1.00 0.00 ? 31 ARG A HH11   4  
ATOM 6585  H HH12   . ARG A 1 33 ? 28.131 43.055 32.547 1.00 0.00 ? 31 ARG A HH12   4  
ATOM 6586  H HH21   . ARG A 1 33 ? 28.145 40.845 35.128 1.00 0.00 ? 31 ARG A HH21   4  
ATOM 6587  H HH22   . ARG A 1 33 ? 28.702 42.402 34.560 1.00 0.00 ? 31 ARG A HH22   4  
ATOM 6588  N N      . GLU A 1 34 ? 21.343 39.318 34.339 1.00 0.00 ? 32 GLU A N      4  
ATOM 6589  C CA     . GLU A 1 34 ? 20.439 38.665 35.294 1.00 0.00 ? 32 GLU A CA     4  
ATOM 6590  C C      . GLU A 1 34 ? 19.023 38.411 34.745 1.00 0.00 ? 32 GLU A C      4  
ATOM 6591  O O      . GLU A 1 34 ? 18.443 37.387 35.095 1.00 0.00 ? 32 GLU A O      4  
ATOM 6592  C CB     . GLU A 1 34 ? 20.446 39.311 36.688 1.00 0.00 ? 32 GLU A CB     4  
ATOM 6593  C CG     . GLU A 1 34 ? 19.602 40.576 36.869 1.00 0.00 ? 32 GLU A CG     4  
ATOM 6594  C CD     . GLU A 1 34 ? 19.346 40.807 38.360 1.00 0.00 ? 32 GLU A CD     4  
ATOM 6595  O OE1    . GLU A 1 34 ? 18.365 40.233 38.899 1.00 0.00 ? 32 GLU A OE1    4  
ATOM 6596  O OE2    . GLU A 1 34 ? 20.142 41.518 39.020 1.00 0.00 ? 32 GLU A OE2    4  
ATOM 6597  H H      . GLU A 1 34 ? 21.641 40.278 34.497 1.00 0.00 ? 32 GLU A H      4  
ATOM 6598  H HA     . GLU A 1 34 ? 20.857 37.675 35.467 1.00 0.00 ? 32 GLU A HA     4  
ATOM 6599  H HB2    . GLU A 1 34 ? 20.070 38.558 37.381 1.00 0.00 ? 32 GLU A HB2    4  
ATOM 6600  H HB3    . GLU A 1 34 ? 21.473 39.531 36.977 1.00 0.00 ? 32 GLU A HB3    4  
ATOM 6601  H HG2    . GLU A 1 34 ? 20.129 41.425 36.436 1.00 0.00 ? 32 GLU A HG2    4  
ATOM 6602  H HG3    . GLU A 1 34 ? 18.642 40.467 36.363 1.00 0.00 ? 32 GLU A HG3    4  
ATOM 6603  N N      . GLU A 1 35 ? 18.486 39.239 33.837 1.00 0.00 ? 33 GLU A N      4  
ATOM 6604  C CA     . GLU A 1 35 ? 17.229 38.918 33.129 1.00 0.00 ? 33 GLU A CA     4  
ATOM 6605  C C      . GLU A 1 35 ? 17.395 37.661 32.255 1.00 0.00 ? 33 GLU A C      4  
ATOM 6606  O O      . GLU A 1 35 ? 16.591 36.733 32.344 1.00 0.00 ? 33 GLU A O      4  
ATOM 6607  C CB     . GLU A 1 35 ? 16.730 40.109 32.283 1.00 0.00 ? 33 GLU A CB     4  
ATOM 6608  C CG     . GLU A 1 35 ? 16.015 41.179 33.122 1.00 0.00 ? 33 GLU A CG     4  
ATOM 6609  C CD     . GLU A 1 35 ? 15.480 42.333 32.257 1.00 0.00 ? 33 GLU A CD     4  
ATOM 6610  O OE1    . GLU A 1 35 ? 14.426 42.186 31.589 1.00 0.00 ? 33 GLU A OE1    4  
ATOM 6611  O OE2    . GLU A 1 35 ? 16.099 43.421 32.232 1.00 0.00 ? 33 GLU A OE2    4  
ATOM 6612  H H      . GLU A 1 35 ? 18.980 40.089 33.594 1.00 0.00 ? 33 GLU A H      4  
ATOM 6613  H HA     . GLU A 1 35 ? 16.456 38.680 33.862 1.00 0.00 ? 33 GLU A HA     4  
ATOM 6614  H HB2    . GLU A 1 35 ? 17.566 40.561 31.748 1.00 0.00 ? 33 GLU A HB2    4  
ATOM 6615  H HB3    . GLU A 1 35 ? 16.020 39.738 31.543 1.00 0.00 ? 33 GLU A HB3    4  
ATOM 6616  H HG2    . GLU A 1 35 ? 15.181 40.714 33.649 1.00 0.00 ? 33 GLU A HG2    4  
ATOM 6617  H HG3    . GLU A 1 35 ? 16.708 41.571 33.867 1.00 0.00 ? 33 GLU A HG3    4  
ATOM 6618  N N      . ILE A 1 36 ? 18.498 37.560 31.502 1.00 0.00 ? 34 ILE A N      4  
ATOM 6619  C CA     . ILE A 1 36 ? 18.854 36.348 30.738 1.00 0.00 ? 34 ILE A CA     4  
ATOM 6620  C C      . ILE A 1 36 ? 18.957 35.122 31.663 1.00 0.00 ? 34 ILE A C      4  
ATOM 6621  O O      . ILE A 1 36 ? 18.529 34.027 31.290 1.00 0.00 ? 34 ILE A O      4  
ATOM 6622  C CB     . ILE A 1 36 ? 20.153 36.595 29.931 1.00 0.00 ? 34 ILE A CB     4  
ATOM 6623  C CG1    . ILE A 1 36 ? 19.901 37.648 28.825 1.00 0.00 ? 34 ILE A CG1    4  
ATOM 6624  C CG2    . ILE A 1 36 ? 20.697 35.298 29.298 1.00 0.00 ? 34 ILE A CG2    4  
ATOM 6625  C CD1    . ILE A 1 36 ? 21.185 38.231 28.221 1.00 0.00 ? 34 ILE A CD1    4  
ATOM 6626  H H      . ILE A 1 36 ? 19.132 38.354 31.477 1.00 0.00 ? 34 ILE A H      4  
ATOM 6627  H HA     . ILE A 1 36 ? 18.051 36.138 30.033 1.00 0.00 ? 34 ILE A HA     4  
ATOM 6628  H HB     . ILE A 1 36 ? 20.912 36.978 30.614 1.00 0.00 ? 34 ILE A HB     4  
ATOM 6629  H HG12   . ILE A 1 36 ? 19.301 37.205 28.029 1.00 0.00 ? 34 ILE A HG12   4  
ATOM 6630  H HG13   . ILE A 1 36 ? 19.333 38.484 29.232 1.00 0.00 ? 34 ILE A HG13   4  
ATOM 6631  H HG21   . ILE A 1 36 ? 19.949 34.855 28.639 1.00 0.00 ? 34 ILE A HG21   4  
ATOM 6632  H HG22   . ILE A 1 36 ? 21.598 35.505 28.724 1.00 0.00 ? 34 ILE A HG22   4  
ATOM 6633  H HG23   . ILE A 1 36 ? 20.968 34.575 30.067 1.00 0.00 ? 34 ILE A HG23   4  
ATOM 6634  H HD11   . ILE A 1 36 ? 20.920 39.035 27.535 1.00 0.00 ? 34 ILE A HD11   4  
ATOM 6635  H HD12   . ILE A 1 36 ? 21.819 38.637 29.011 1.00 0.00 ? 34 ILE A HD12   4  
ATOM 6636  H HD13   . ILE A 1 36 ? 21.732 37.468 27.669 1.00 0.00 ? 34 ILE A HD13   4  
ATOM 6637  N N      . ALA A 1 37 ? 19.460 35.298 32.888 1.00 0.00 ? 35 ALA A N      4  
ATOM 6638  C CA     . ALA A 1 37 ? 19.533 34.245 33.897 1.00 0.00 ? 35 ALA A CA     4  
ATOM 6639  C C      . ALA A 1 37 ? 18.174 33.862 34.530 1.00 0.00 ? 35 ALA A C      4  
ATOM 6640  O O      . ALA A 1 37 ? 18.060 32.743 35.038 1.00 0.00 ? 35 ALA A O      4  
ATOM 6641  C CB     . ALA A 1 37 ? 20.568 34.660 34.946 1.00 0.00 ? 35 ALA A CB     4  
ATOM 6642  H H      . ALA A 1 37 ? 19.834 36.209 33.124 1.00 0.00 ? 35 ALA A H      4  
ATOM 6643  H HA     . ALA A 1 37 ? 19.909 33.343 33.413 1.00 0.00 ? 35 ALA A HA     4  
ATOM 6644  H HB1    . ALA A 1 37 ? 20.613 33.904 35.722 1.00 0.00 ? 35 ALA A HB1    4  
ATOM 6645  H HB2    . ALA A 1 37 ? 21.548 34.771 34.479 1.00 0.00 ? 35 ALA A HB2    4  
ATOM 6646  H HB3    . ALA A 1 37 ? 20.279 35.598 35.408 1.00 0.00 ? 35 ALA A HB3    4  
ATOM 6647  N N      . VAL A 1 38 ? 17.129 34.701 34.452 1.00 0.00 ? 36 VAL A N      4  
ATOM 6648  C CA     . VAL A 1 38 ? 15.739 34.294 34.773 1.00 0.00 ? 36 VAL A CA     4  
ATOM 6649  C C      . VAL A 1 38 ? 15.180 33.411 33.655 1.00 0.00 ? 36 VAL A C      4  
ATOM 6650  O O      . VAL A 1 38 ? 14.565 32.375 33.928 1.00 0.00 ? 36 VAL A O      4  
ATOM 6651  C CB     . VAL A 1 38 ? 14.798 35.498 35.017 1.00 0.00 ? 36 VAL A CB     4  
ATOM 6652  C CG1    . VAL A 1 38 ? 13.373 35.044 35.370 1.00 0.00 ? 36 VAL A CG1    4  
ATOM 6653  C CG2    . VAL A 1 38 ? 15.272 36.374 36.182 1.00 0.00 ? 36 VAL A CG2    4  
ATOM 6654  H H      . VAL A 1 38 ? 17.276 35.623 34.052 1.00 0.00 ? 36 VAL A H      4  
ATOM 6655  H HA     . VAL A 1 38 ? 15.751 33.697 35.685 1.00 0.00 ? 36 VAL A HA     4  
ATOM 6656  H HB     . VAL A 1 38 ? 14.747 36.112 34.120 1.00 0.00 ? 36 VAL A HB     4  
ATOM 6657  H HG11   . VAL A 1 38 ? 13.389 34.394 36.246 1.00 0.00 ? 36 VAL A HG11   4  
ATOM 6658  H HG12   . VAL A 1 38 ? 12.746 35.911 35.579 1.00 0.00 ? 36 VAL A HG12   4  
ATOM 6659  H HG13   . VAL A 1 38 ? 12.922 34.511 34.533 1.00 0.00 ? 36 VAL A HG13   4  
ATOM 6660  H HG21   . VAL A 1 38 ? 14.545 37.162 36.377 1.00 0.00 ? 36 VAL A HG21   4  
ATOM 6661  H HG22   . VAL A 1 38 ? 15.403 35.769 37.080 1.00 0.00 ? 36 VAL A HG22   4  
ATOM 6662  H HG23   . VAL A 1 38 ? 16.211 36.849 35.928 1.00 0.00 ? 36 VAL A HG23   4  
ATOM 6663  N N      . TRP A 1 39 ? 15.432 33.771 32.391 1.00 0.00 ? 37 TRP A N      4  
ATOM 6664  C CA     . TRP A 1 39 ? 14.968 33.004 31.228 1.00 0.00 ? 37 TRP A CA     4  
ATOM 6665  C C      . TRP A 1 39 ? 15.625 31.613 31.166 1.00 0.00 ? 37 TRP A C      4  
ATOM 6666  O O      . TRP A 1 39 ? 14.936 30.606 30.990 1.00 0.00 ? 37 TRP A O      4  
ATOM 6667  C CB     . TRP A 1 39 ? 15.225 33.799 29.933 1.00 0.00 ? 37 TRP A CB     4  
ATOM 6668  C CG     . TRP A 1 39 ? 14.845 35.258 29.903 1.00 0.00 ? 37 TRP A CG     4  
ATOM 6669  C CD1    . TRP A 1 39 ? 15.461 36.183 29.130 1.00 0.00 ? 37 TRP A CD1    4  
ATOM 6670  C CD2    . TRP A 1 39 ? 13.827 35.998 30.663 1.00 0.00 ? 37 TRP A CD2    4  
ATOM 6671  N NE1    . TRP A 1 39 ? 14.914 37.431 29.355 1.00 0.00 ? 37 TRP A NE1    4  
ATOM 6672  C CE2    . TRP A 1 39 ? 13.925 37.381 30.313 1.00 0.00 ? 37 TRP A CE2    4  
ATOM 6673  C CE3    . TRP A 1 39 ? 12.849 35.662 31.630 1.00 0.00 ? 37 TRP A CE3    4  
ATOM 6674  C CZ2    . TRP A 1 39 ? 13.122 38.371 30.900 1.00 0.00 ? 37 TRP A CZ2    4  
ATOM 6675  C CZ3    . TRP A 1 39 ? 12.055 36.650 32.244 1.00 0.00 ? 37 TRP A CZ3    4  
ATOM 6676  C CH2    . TRP A 1 39 ? 12.187 38.001 31.880 1.00 0.00 ? 37 TRP A CH2    4  
ATOM 6677  H H      . TRP A 1 39 ? 15.892 34.663 32.227 1.00 0.00 ? 37 TRP A H      4  
ATOM 6678  H HA     . TRP A 1 39 ? 13.894 32.851 31.313 1.00 0.00 ? 37 TRP A HA     4  
ATOM 6679  H HB2    . TRP A 1 39 ? 16.290 33.740 29.706 1.00 0.00 ? 37 TRP A HB2    4  
ATOM 6680  H HB3    . TRP A 1 39 ? 14.699 33.299 29.119 1.00 0.00 ? 37 TRP A HB3    4  
ATOM 6681  H HD1    . TRP A 1 39 ? 16.284 35.970 28.457 1.00 0.00 ? 37 TRP A HD1    4  
ATOM 6682  H HE1    . TRP A 1 39 ? 15.244 38.289 28.912 1.00 0.00 ? 37 TRP A HE1    4  
ATOM 6683  H HE3    . TRP A 1 39 ? 12.723 34.632 31.925 1.00 0.00 ? 37 TRP A HE3    4  
ATOM 6684  H HZ2    . TRP A 1 39 ? 13.234 39.407 30.617 1.00 0.00 ? 37 TRP A HZ2    4  
ATOM 6685  H HZ3    . TRP A 1 39 ? 11.339 36.373 33.007 1.00 0.00 ? 37 TRP A HZ3    4  
ATOM 6686  H HH2    . TRP A 1 39 ? 11.573 38.754 32.360 1.00 0.00 ? 37 TRP A HH2    4  
ATOM 6687  N N      . THR A 1 40 ? 16.944 31.555 31.379 1.00 0.00 ? 38 THR A N      4  
ATOM 6688  C CA     . THR A 1 40 ? 17.792 30.353 31.212 1.00 0.00 ? 38 THR A CA     4  
ATOM 6689  C C      . THR A 1 40 ? 18.115 29.594 32.508 1.00 0.00 ? 38 THR A C      4  
ATOM 6690  O O      . THR A 1 40 ? 18.816 28.582 32.454 1.00 0.00 ? 38 THR A O      4  
ATOM 6691  C CB     . THR A 1 40 ? 19.102 30.698 30.478 1.00 0.00 ? 38 THR A CB     4  
ATOM 6692  O OG1    . THR A 1 40 ? 19.832 31.664 31.199 1.00 0.00 ? 38 THR A OG1    4  
ATOM 6693  C CG2    . THR A 1 40 ? 18.868 31.255 29.077 1.00 0.00 ? 38 THR A CG2    4  
ATOM 6694  H H      . THR A 1 40 ? 17.419 32.440 31.522 1.00 0.00 ? 38 THR A H      4  
ATOM 6695  H HA     . THR A 1 40 ? 17.257 29.641 30.582 1.00 0.00 ? 38 THR A HA     4  
ATOM 6696  H HB     . THR A 1 40 ? 19.707 29.795 30.387 1.00 0.00 ? 38 THR A HB     4  
ATOM 6697  H HG1    . THR A 1 40 ? 19.391 32.522 31.077 1.00 0.00 ? 38 THR A HG1    4  
ATOM 6698  H HG21   . THR A 1 40 ? 19.832 31.406 28.588 1.00 0.00 ? 38 THR A HG21   4  
ATOM 6699  H HG22   . THR A 1 40 ? 18.289 30.540 28.493 1.00 0.00 ? 38 THR A HG22   4  
ATOM 6700  H HG23   . THR A 1 40 ? 18.332 32.203 29.120 1.00 0.00 ? 38 THR A HG23   4  
ATOM 6701  N N      . ASN A 1 41 ? 17.608 30.053 33.663 1.00 0.00 ? 39 ASN A N      4  
ATOM 6702  C CA     . ASN A 1 41 ? 17.841 29.461 34.993 1.00 0.00 ? 39 ASN A CA     4  
ATOM 6703  C C      . ASN A 1 41 ? 19.342 29.391 35.378 1.00 0.00 ? 39 ASN A C      4  
ATOM 6704  O O      . ASN A 1 41 ? 19.845 28.382 35.876 1.00 0.00 ? 39 ASN A O      4  
ATOM 6705  C CB     . ASN A 1 41 ? 17.061 28.139 35.074 1.00 0.00 ? 39 ASN A CB     4  
ATOM 6706  C CG     . ASN A 1 41 ? 16.863 27.579 36.468 1.00 0.00 ? 39 ASN A CG     4  
ATOM 6707  O OD1    . ASN A 1 41 ? 17.233 28.152 37.489 1.00 0.00 ? 39 ASN A OD1    4  
ATOM 6708  N ND2    . ASN A 1 41 ? 16.245 26.428 36.538 1.00 0.00 ? 39 ASN A ND2    4  
ATOM 6709  H H      . ASN A 1 41 ? 17.043 30.887 33.624 1.00 0.00 ? 39 ASN A H      4  
ATOM 6710  H HA     . ASN A 1 41 ? 17.388 30.138 35.719 1.00 0.00 ? 39 ASN A HA     4  
ATOM 6711  H HB2    . ASN A 1 41 ? 16.067 28.287 34.653 1.00 0.00 ? 39 ASN A HB2    4  
ATOM 6712  H HB3    . ASN A 1 41 ? 17.574 27.385 34.477 1.00 0.00 ? 39 ASN A HB3    4  
ATOM 6713  H HD21   . ASN A 1 41 ? 15.944 25.973 35.683 1.00 0.00 ? 39 ASN A HD21   4  
ATOM 6714  H HD22   . ASN A 1 41 ? 16.114 25.999 37.446 1.00 0.00 ? 39 ASN A HD22   4  
ATOM 6715  N N      . LEU A 1 42 ? 20.057 30.485 35.107 1.00 0.00 ? 40 LEU A N      4  
ATOM 6716  C CA     . LEU A 1 42 ? 21.488 30.698 35.368 1.00 0.00 ? 40 LEU A CA     4  
ATOM 6717  C C      . LEU A 1 42 ? 21.680 31.649 36.575 1.00 0.00 ? 40 LEU A C      4  
ATOM 6718  O O      . LEU A 1 42 ? 20.770 31.815 37.387 1.00 0.00 ? 40 LEU A O      4  
ATOM 6719  C CB     . LEU A 1 42 ? 22.139 31.182 34.042 1.00 0.00 ? 40 LEU A CB     4  
ATOM 6720  C CG     . LEU A 1 42 ? 22.999 30.112 33.345 1.00 0.00 ? 40 LEU A CG     4  
ATOM 6721  C CD1    . LEU A 1 42 ? 22.183 28.915 32.868 1.00 0.00 ? 40 LEU A CD1    4  
ATOM 6722  C CD2    . LEU A 1 42 ? 23.698 30.722 32.129 1.00 0.00 ? 40 LEU A CD2    4  
ATOM 6723  H H      . LEU A 1 42 ? 19.533 31.275 34.757 1.00 0.00 ? 40 LEU A H      4  
ATOM 6724  H HA     . LEU A 1 42 ? 21.951 29.752 35.652 1.00 0.00 ? 40 LEU A HA     4  
ATOM 6725  H HB2    . LEU A 1 42 ? 21.367 31.513 33.348 1.00 0.00 ? 40 LEU A HB2    4  
ATOM 6726  H HB3    . LEU A 1 42 ? 22.771 32.050 34.216 1.00 0.00 ? 40 LEU A HB3    4  
ATOM 6727  H HG     . LEU A 1 42 ? 23.760 29.760 34.042 1.00 0.00 ? 40 LEU A HG     4  
ATOM 6728  H HD11   . LEU A 1 42 ? 22.833 28.197 32.366 1.00 0.00 ? 40 LEU A HD11   4  
ATOM 6729  H HD12   . LEU A 1 42 ? 21.712 28.418 33.715 1.00 0.00 ? 40 LEU A HD12   4  
ATOM 6730  H HD13   . LEU A 1 42 ? 21.412 29.246 32.174 1.00 0.00 ? 40 LEU A HD13   4  
ATOM 6731  H HD21   . LEU A 1 42 ? 22.953 31.070 31.411 1.00 0.00 ? 40 LEU A HD21   4  
ATOM 6732  H HD22   . LEU A 1 42 ? 24.320 31.561 32.436 1.00 0.00 ? 40 LEU A HD22   4  
ATOM 6733  H HD23   . LEU A 1 42 ? 24.331 29.972 31.653 1.00 0.00 ? 40 LEU A HD23   4  
ATOM 6734  N N      . THR A 1 43 ? 22.842 32.300 36.685 1.00 0.00 ? 41 THR A N      4  
ATOM 6735  C CA     . THR A 1 43 ? 23.041 33.554 37.442 1.00 0.00 ? 41 THR A CA     4  
ATOM 6736  C C      . THR A 1 43 ? 23.754 34.580 36.551 1.00 0.00 ? 41 THR A C      4  
ATOM 6737  O O      . THR A 1 43 ? 24.277 34.214 35.493 1.00 0.00 ? 41 THR A O      4  
ATOM 6738  C CB     . THR A 1 43 ? 23.827 33.355 38.755 1.00 0.00 ? 41 THR A CB     4  
ATOM 6739  O OG1    . THR A 1 43 ? 25.208 33.195 38.516 1.00 0.00 ? 41 THR A OG1    4  
ATOM 6740  C CG2    . THR A 1 43 ? 23.337 32.160 39.568 1.00 0.00 ? 41 THR A CG2    4  
ATOM 6741  H H      . THR A 1 43 ? 23.561 32.088 36.013 1.00 0.00 ? 41 THR A H      4  
ATOM 6742  H HA     . THR A 1 43 ? 22.069 33.968 37.710 1.00 0.00 ? 41 THR A HA     4  
ATOM 6743  H HB     . THR A 1 43 ? 23.701 34.253 39.361 1.00 0.00 ? 41 THR A HB     4  
ATOM 6744  H HG1    . THR A 1 43 ? 25.625 33.105 39.396 1.00 0.00 ? 41 THR A HG1    4  
ATOM 6745  H HG21   . THR A 1 43 ? 23.467 31.231 39.015 1.00 0.00 ? 41 THR A HG21   4  
ATOM 6746  H HG22   . THR A 1 43 ? 23.894 32.082 40.497 1.00 0.00 ? 41 THR A HG22   4  
ATOM 6747  H HG23   . THR A 1 43 ? 22.283 32.298 39.810 1.00 0.00 ? 41 THR A HG23   4  
ATOM 6748  N N      . GLU A 1 44 ? 23.813 35.853 36.959 1.00 0.00 ? 42 GLU A N      4  
ATOM 6749  C CA     . GLU A 1 44 ? 24.568 36.898 36.241 1.00 0.00 ? 42 GLU A CA     4  
ATOM 6750  C C      . GLU A 1 44 ? 26.008 36.463 35.925 1.00 0.00 ? 42 GLU A C      4  
ATOM 6751  O O      . GLU A 1 44 ? 26.452 36.599 34.782 1.00 0.00 ? 42 GLU A O      4  
ATOM 6752  C CB     . GLU A 1 44 ? 24.552 38.184 37.090 1.00 0.00 ? 42 GLU A CB     4  
ATOM 6753  C CG     . GLU A 1 44 ? 25.370 39.360 36.535 1.00 0.00 ? 42 GLU A CG     4  
ATOM 6754  C CD     . GLU A 1 44 ? 26.873 39.260 36.828 1.00 0.00 ? 42 GLU A CD     4  
ATOM 6755  O OE1    . GLU A 1 44 ? 27.271 39.178 38.014 1.00 0.00 ? 42 GLU A OE1    4  
ATOM 6756  O OE2    . GLU A 1 44 ? 27.687 39.320 35.879 1.00 0.00 ? 42 GLU A OE2    4  
ATOM 6757  H H      . GLU A 1 44 ? 23.342 36.122 37.817 1.00 0.00 ? 42 GLU A H      4  
ATOM 6758  H HA     . GLU A 1 44 ? 24.075 37.104 35.290 1.00 0.00 ? 42 GLU A HA     4  
ATOM 6759  H HB2    . GLU A 1 44 ? 23.517 38.511 37.166 1.00 0.00 ? 42 GLU A HB2    4  
ATOM 6760  H HB3    . GLU A 1 44 ? 24.898 37.960 38.099 1.00 0.00 ? 42 GLU A HB3    4  
ATOM 6761  H HG2    . GLU A 1 44 ? 25.205 39.429 35.461 1.00 0.00 ? 42 GLU A HG2    4  
ATOM 6762  H HG3    . GLU A 1 44 ? 24.994 40.278 36.987 1.00 0.00 ? 42 GLU A HG3    4  
ATOM 6763  N N      . ALA A 1 45 ? 26.707 35.884 36.907 1.00 0.00 ? 43 ALA A N      4  
ATOM 6764  C CA     . ALA A 1 45 ? 28.079 35.413 36.749 1.00 0.00 ? 43 ALA A CA     4  
ATOM 6765  C C      . ALA A 1 45 ? 28.187 34.290 35.704 1.00 0.00 ? 43 ALA A C      4  
ATOM 6766  O O      . ALA A 1 45 ? 29.063 34.340 34.842 1.00 0.00 ? 43 ALA A O      4  
ATOM 6767  C CB     . ALA A 1 45 ? 28.606 34.976 38.121 1.00 0.00 ? 43 ALA A CB     4  
ATOM 6768  H H      . ALA A 1 45 ? 26.268 35.769 37.808 1.00 0.00 ? 43 ALA A H      4  
ATOM 6769  H HA     . ALA A 1 45 ? 28.693 36.246 36.399 1.00 0.00 ? 43 ALA A HA     4  
ATOM 6770  H HB1    . ALA A 1 45 ? 28.012 34.148 38.511 1.00 0.00 ? 43 ALA A HB1    4  
ATOM 6771  H HB2    . ALA A 1 45 ? 29.644 34.650 38.026 1.00 0.00 ? 43 ALA A HB2    4  
ATOM 6772  H HB3    . ALA A 1 45 ? 28.564 35.812 38.821 1.00 0.00 ? 43 ALA A HB3    4  
ATOM 6773  N N      . ARG A 1 46 ? 27.250 33.326 35.691 1.00 0.00 ? 44 ARG A N      4  
ATOM 6774  C CA     . ARG A 1 46 ? 27.245 32.239 34.691 1.00 0.00 ? 44 ARG A CA     4  
ATOM 6775  C C      . ARG A 1 46 ? 27.072 32.753 33.259 1.00 0.00 ? 44 ARG A C      4  
ATOM 6776  O O      . ARG A 1 46 ? 27.712 32.237 32.344 1.00 0.00 ? 44 ARG A O      4  
ATOM 6777  C CB     . ARG A 1 46 ? 26.169 31.194 35.007 1.00 0.00 ? 44 ARG A CB     4  
ATOM 6778  C CG     . ARG A 1 46 ? 26.280 30.527 36.384 1.00 0.00 ? 44 ARG A CG     4  
ATOM 6779  C CD     . ARG A 1 46 ? 27.697 30.061 36.755 1.00 0.00 ? 44 ARG A CD     4  
ATOM 6780  N NE     . ARG A 1 46 ? 27.622 29.061 37.831 1.00 0.00 ? 44 ARG A NE     4  
ATOM 6781  C CZ     . ARG A 1 46 ? 27.370 27.779 37.636 1.00 0.00 ? 44 ARG A CZ     4  
ATOM 6782  N NH1    . ARG A 1 46 ? 27.472 27.218 36.465 1.00 0.00 ? 44 ARG A NH1    4  
ATOM 6783  N NH2    . ARG A 1 46 ? 26.987 27.018 38.613 1.00 0.00 1 44 ARG A NH2    4  
ATOM 6784  H H      . ARG A 1 46 ? 26.518 33.366 36.391 1.00 0.00 ? 44 ARG A H      4  
ATOM 6785  H HA     . ARG A 1 46 ? 28.216 31.748 34.712 1.00 0.00 ? 44 ARG A HA     4  
ATOM 6786  H HB2    . ARG A 1 46 ? 25.185 31.654 34.926 1.00 0.00 ? 44 ARG A HB2    4  
ATOM 6787  H HB3    . ARG A 1 46 ? 26.232 30.408 34.251 1.00 0.00 ? 44 ARG A HB3    4  
ATOM 6788  H HG2    . ARG A 1 46 ? 25.934 31.214 37.150 1.00 0.00 ? 44 ARG A HG2    4  
ATOM 6789  H HG3    . ARG A 1 46 ? 25.604 29.670 36.384 1.00 0.00 ? 44 ARG A HG3    4  
ATOM 6790  H HD2    . ARG A 1 46 ? 28.192 29.639 35.878 1.00 0.00 ? 44 ARG A HD2    4  
ATOM 6791  H HD3    . ARG A 1 46 ? 28.283 30.919 37.094 1.00 0.00 ? 44 ARG A HD3    4  
ATOM 6792  H HE     . ARG A 1 46 ? 27.591 29.416 38.783 1.00 0.00 ? 44 ARG A HE     4  
ATOM 6793  H HH11   . ARG A 1 46 ? 27.995 27.682 35.737 1.00 0.00 ? 44 ARG A HH11   4  
ATOM 6794  H HH12   . ARG A 1 46 ? 27.370 26.216 36.396 1.00 0.00 ? 44 ARG A HH12   4  
ATOM 6795  H HH21   . ARG A 1 46 ? 26.813 27.404 39.535 1.00 0.00 ? 44 ARG A HH21   4  
ATOM 6796  H HH22   . ARG A 1 46 ? 26.656 26.082 38.419 1.00 0.00 ? 44 ARG A HH22   4  
ATOM 6797  N N      . VAL A 1 47 ? 26.258 33.795 33.066 1.00 0.00 ? 45 VAL A N      4  
ATOM 6798  C CA     . VAL A 1 47 ? 26.124 34.479 31.768 1.00 0.00 ? 45 VAL A CA     4  
ATOM 6799  C C      . VAL A 1 47 ? 27.416 35.235 31.426 1.00 0.00 ? 45 VAL A C      4  
ATOM 6800  O O      . VAL A 1 47 ? 27.915 35.116 30.307 1.00 0.00 ? 45 VAL A O      4  
ATOM 6801  C CB     . VAL A 1 47 ? 24.889 35.406 31.754 1.00 0.00 ? 45 VAL A CB     4  
ATOM 6802  C CG1    . VAL A 1 47 ? 24.737 36.152 30.421 1.00 0.00 ? 45 VAL A CG1    4  
ATOM 6803  C CG2    . VAL A 1 47 ? 23.594 34.611 31.978 1.00 0.00 ? 45 VAL A CG2    4  
ATOM 6804  H H      . VAL A 1 47 ? 25.756 34.160 33.870 1.00 0.00 ? 45 VAL A H      4  
ATOM 6805  H HA     . VAL A 1 47 ? 25.984 33.725 30.992 1.00 0.00 ? 45 VAL A HA     4  
ATOM 6806  H HB     . VAL A 1 47 ? 24.985 36.141 32.551 1.00 0.00 ? 45 VAL A HB     4  
ATOM 6807  H HG11   . VAL A 1 47 ? 25.581 36.821 30.261 1.00 0.00 ? 45 VAL A HG11   4  
ATOM 6808  H HG12   . VAL A 1 47 ? 24.686 35.438 29.598 1.00 0.00 ? 45 VAL A HG12   4  
ATOM 6809  H HG13   . VAL A 1 47 ? 23.825 36.748 30.433 1.00 0.00 ? 45 VAL A HG13   4  
ATOM 6810  H HG21   . VAL A 1 47 ? 22.737 35.283 31.958 1.00 0.00 ? 45 VAL A HG21   4  
ATOM 6811  H HG22   . VAL A 1 47 ? 23.475 33.853 31.204 1.00 0.00 ? 45 VAL A HG22   4  
ATOM 6812  H HG23   . VAL A 1 47 ? 23.612 34.125 32.951 1.00 0.00 ? 45 VAL A HG23   4  
ATOM 6813  N N      . ARG A 1 48 ? 28.006 35.957 32.390 1.00 0.00 ? 46 ARG A N      4  
ATOM 6814  C CA     . ARG A 1 48 ? 29.267 36.707 32.223 1.00 0.00 ? 46 ARG A CA     4  
ATOM 6815  C C      . ARG A 1 48 ? 30.415 35.812 31.742 1.00 0.00 ? 46 ARG A C      4  
ATOM 6816  O O      . ARG A 1 48 ? 31.097 36.151 30.773 1.00 0.00 ? 46 ARG A O      4  
ATOM 6817  C CB     . ARG A 1 48 ? 29.628 37.377 33.560 1.00 0.00 ? 46 ARG A CB     4  
ATOM 6818  C CG     . ARG A 1 48 ? 30.589 38.564 33.399 1.00 0.00 ? 46 ARG A CG     4  
ATOM 6819  C CD     . ARG A 1 48 ? 31.354 38.890 34.689 1.00 0.00 ? 46 ARG A CD     4  
ATOM 6820  N NE     . ARG A 1 48 ? 30.494 38.914 35.890 1.00 0.00 ? 46 ARG A NE     4  
ATOM 6821  C CZ     . ARG A 1 48 ? 30.882 38.654 37.125 1.00 0.00 ? 46 ARG A CZ     4  
ATOM 6822  N NH1    . ARG A 1 48 ? 32.130 38.441 37.433 1.00 0.00 ? 46 ARG A NH1    4  
ATOM 6823  N NH2    . ARG A 1 48 ? 30.001 38.590 38.076 1.00 0.00 1 46 ARG A NH2    4  
ATOM 6824  H H      . ARG A 1 48 ? 27.547 35.998 33.298 1.00 0.00 ? 46 ARG A H      4  
ATOM 6825  H HA     . ARG A 1 48 ? 29.128 37.477 31.461 1.00 0.00 ? 46 ARG A HA     4  
ATOM 6826  H HB2    . ARG A 1 48 ? 28.720 37.745 34.036 1.00 0.00 ? 46 ARG A HB2    4  
ATOM 6827  H HB3    . ARG A 1 48 ? 30.078 36.636 34.223 1.00 0.00 ? 46 ARG A HB3    4  
ATOM 6828  H HG2    . ARG A 1 48 ? 31.325 38.333 32.629 1.00 0.00 ? 46 ARG A HG2    4  
ATOM 6829  H HG3    . ARG A 1 48 ? 30.023 39.439 33.080 1.00 0.00 ? 46 ARG A HG3    4  
ATOM 6830  H HD2    . ARG A 1 48 ? 32.124 38.126 34.812 1.00 0.00 ? 46 ARG A HD2    4  
ATOM 6831  H HD3    . ARG A 1 48 ? 31.847 39.857 34.572 1.00 0.00 ? 46 ARG A HD3    4  
ATOM 6832  H HE     . ARG A 1 48 ? 29.495 39.071 35.772 1.00 0.00 ? 46 ARG A HE     4  
ATOM 6833  H HH11   . ARG A 1 48 ? 32.857 38.536 36.733 1.00 0.00 ? 46 ARG A HH11   4  
ATOM 6834  H HH12   . ARG A 1 48 ? 32.387 38.159 38.372 1.00 0.00 ? 46 ARG A HH12   4  
ATOM 6835  H HH21   . ARG A 1 48 ? 29.022 38.789 37.873 1.00 0.00 ? 46 ARG A HH21   4  
ATOM 6836  H HH22   . ARG A 1 48 ? 30.272 38.414 39.036 1.00 0.00 ? 46 ARG A HH22   4  
ATOM 6837  N N      . VAL A 1 49 ? 30.605 34.648 32.373 1.00 0.00 ? 47 VAL A N      4  
ATOM 6838  C CA     . VAL A 1 49 ? 31.684 33.720 31.992 1.00 0.00 ? 47 VAL A CA     4  
ATOM 6839  C C      . VAL A 1 49 ? 31.434 33.076 30.629 1.00 0.00 ? 47 VAL A C      4  
ATOM 6840  O O      . VAL A 1 49 ? 32.372 32.973 29.839 1.00 0.00 ? 47 VAL A O      4  
ATOM 6841  C CB     . VAL A 1 49 ? 32.025 32.677 33.071 1.00 0.00 ? 47 VAL A CB     4  
ATOM 6842  C CG1    . VAL A 1 49 ? 32.384 33.368 34.386 1.00 0.00 ? 47 VAL A CG1    4  
ATOM 6843  C CG2    . VAL A 1 49 ? 30.915 31.664 33.339 1.00 0.00 ? 47 VAL A CG2    4  
ATOM 6844  H H      . VAL A 1 49 ? 30.032 34.439 33.186 1.00 0.00 ? 47 VAL A H      4  
ATOM 6845  H HA     . VAL A 1 49 ? 32.582 34.319 31.885 1.00 0.00 ? 47 VAL A HA     4  
ATOM 6846  H HB     . VAL A 1 49 ? 32.904 32.126 32.739 1.00 0.00 ? 47 VAL A HB     4  
ATOM 6847  H HG11   . VAL A 1 49 ? 31.525 33.880 34.813 1.00 0.00 ? 47 VAL A HG11   4  
ATOM 6848  H HG12   . VAL A 1 49 ? 32.714 32.622 35.107 1.00 0.00 ? 47 VAL A HG12   4  
ATOM 6849  H HG13   . VAL A 1 49 ? 33.179 34.095 34.224 1.00 0.00 ? 47 VAL A HG13   4  
ATOM 6850  H HG21   . VAL A 1 49 ? 31.217 30.976 34.130 1.00 0.00 ? 47 VAL A HG21   4  
ATOM 6851  H HG22   . VAL A 1 49 ? 30.017 32.187 33.645 1.00 0.00 ? 47 VAL A HG22   4  
ATOM 6852  H HG23   . VAL A 1 49 ? 30.718 31.089 32.437 1.00 0.00 ? 47 VAL A HG23   4  
ATOM 6853  N N      . TRP A 1 50 ? 30.178 32.756 30.286 1.00 0.00 ? 48 TRP A N      4  
ATOM 6854  C CA     . TRP A 1 50 ? 29.844 32.242 28.953 1.00 0.00 ? 48 TRP A CA     4  
ATOM 6855  C C      . TRP A 1 50 ? 30.197 33.242 27.845 1.00 0.00 ? 48 TRP A C      4  
ATOM 6856  O O      . TRP A 1 50 ? 30.710 32.821 26.805 1.00 0.00 ? 48 TRP A O      4  
ATOM 6857  C CB     . TRP A 1 50 ? 28.371 31.817 28.875 1.00 0.00 ? 48 TRP A CB     4  
ATOM 6858  C CG     . TRP A 1 50 ? 27.991 31.182 27.566 1.00 0.00 ? 48 TRP A CG     4  
ATOM 6859  C CD1    . TRP A 1 50 ? 28.010 29.855 27.297 1.00 0.00 ? 48 TRP A CD1    4  
ATOM 6860  C CD2    . TRP A 1 50 ? 27.592 31.829 26.315 1.00 0.00 ? 48 TRP A CD2    4  
ATOM 6861  N NE1    . TRP A 1 50 ? 27.659 29.637 25.977 1.00 0.00 ? 48 TRP A NE1    4  
ATOM 6862  C CE2    . TRP A 1 50 ? 27.382 30.820 25.326 1.00 0.00 ? 48 TRP A CE2    4  
ATOM 6863  C CE3    . TRP A 1 50 ? 27.415 33.169 25.906 1.00 0.00 ? 48 TRP A CE3    4  
ATOM 6864  C CZ2    . TRP A 1 50 ? 27.012 31.124 24.007 1.00 0.00 ? 48 TRP A CZ2    4  
ATOM 6865  C CZ3    . TRP A 1 50 ? 27.054 33.488 24.582 1.00 0.00 ? 48 TRP A CZ3    4  
ATOM 6866  C CH2    . TRP A 1 50 ? 26.850 32.470 23.634 1.00 0.00 ? 48 TRP A CH2    4  
ATOM 6867  H H      . TRP A 1 50 ? 29.436 32.853 30.971 1.00 0.00 ? 48 TRP A H      4  
ATOM 6868  H HA     . TRP A 1 50 ? 30.449 31.356 28.775 1.00 0.00 ? 48 TRP A HA     4  
ATOM 6869  H HB2    . TRP A 1 50 ? 28.168 31.105 29.677 1.00 0.00 ? 48 TRP A HB2    4  
ATOM 6870  H HB3    . TRP A 1 50 ? 27.736 32.687 29.035 1.00 0.00 ? 48 TRP A HB3    4  
ATOM 6871  H HD1    . TRP A 1 50 ? 28.291 29.082 28.005 1.00 0.00 ? 48 TRP A HD1    4  
ATOM 6872  H HE1    . TRP A 1 50 ? 27.684 28.719 25.533 1.00 0.00 ? 48 TRP A HE1    4  
ATOM 6873  H HE3    . TRP A 1 50 ? 27.557 33.962 26.624 1.00 0.00 ? 48 TRP A HE3    4  
ATOM 6874  H HZ2    . TRP A 1 50 ? 26.862 30.332 23.288 1.00 0.00 ? 48 TRP A HZ2    4  
ATOM 6875  H HZ3    . TRP A 1 50 ? 26.918 34.524 24.300 1.00 0.00 ? 48 TRP A HZ3    4  
ATOM 6876  H HH2    . TRP A 1 50 ? 26.564 32.724 22.620 1.00 0.00 ? 48 TRP A HH2    4  
ATOM 6877  N N      . PHE A 1 51 ? 29.994 34.547 28.072 1.00 0.00 ? 49 PHE A N      4  
ATOM 6878  C CA     . PHE A 1 51 ? 30.375 35.596 27.120 1.00 0.00 ? 49 PHE A CA     4  
ATOM 6879  C C      . PHE A 1 51 ? 31.897 35.798 27.017 1.00 0.00 ? 49 PHE A C      4  
ATOM 6880  O O      . PHE A 1 51 ? 32.413 35.785 25.899 1.00 0.00 ? 49 PHE A O      4  
ATOM 6881  C CB     . PHE A 1 51 ? 29.642 36.910 27.432 1.00 0.00 ? 49 PHE A CB     4  
ATOM 6882  C CG     . PHE A 1 51 ? 28.311 37.057 26.711 1.00 0.00 ? 49 PHE A CG     4  
ATOM 6883  C CD1    . PHE A 1 51 ? 28.273 37.611 25.417 1.00 0.00 ? 49 PHE A CD1    4  
ATOM 6884  C CD2    . PHE A 1 51 ? 27.113 36.627 27.314 1.00 0.00 ? 49 PHE A CD2    4  
ATOM 6885  C CE1    . PHE A 1 51 ? 27.049 37.725 24.733 1.00 0.00 ? 49 PHE A CE1    4  
ATOM 6886  C CE2    . PHE A 1 51 ? 25.891 36.733 26.626 1.00 0.00 ? 49 PHE A CE2    4  
ATOM 6887  C CZ     . PHE A 1 51 ? 25.860 37.282 25.334 1.00 0.00 ? 49 PHE A CZ     4  
ATOM 6888  H H      . PHE A 1 51 ? 29.548 34.819 28.941 1.00 0.00 ? 49 PHE A H      4  
ATOM 6889  H HA     . PHE A 1 51 ? 30.050 35.284 26.126 1.00 0.00 ? 49 PHE A HA     4  
ATOM 6890  H HB2    . PHE A 1 51 ? 29.500 37.017 28.510 1.00 0.00 ? 49 PHE A HB2    4  
ATOM 6891  H HB3    . PHE A 1 51 ? 30.280 37.731 27.109 1.00 0.00 ? 49 PHE A HB3    4  
ATOM 6892  H HD1    . PHE A 1 51 ? 29.187 37.948 24.947 1.00 0.00 ? 49 PHE A HD1    4  
ATOM 6893  H HD2    . PHE A 1 51 ? 27.132 36.199 28.302 1.00 0.00 ? 49 PHE A HD2    4  
ATOM 6894  H HE1    . PHE A 1 51 ? 27.016 38.151 23.741 1.00 0.00 ? 49 PHE A HE1    4  
ATOM 6895  H HE2    . PHE A 1 51 ? 24.977 36.386 27.089 1.00 0.00 ? 49 PHE A HE2    4  
ATOM 6896  H HZ     . PHE A 1 51 ? 24.925 37.362 24.799 1.00 0.00 ? 49 PHE A HZ     4  
ATOM 6897  N N      . LYS A 1 52 ? 32.653 35.899 28.126 1.00 0.00 ? 50 LYS A N      4  
ATOM 6898  C CA     . LYS A 1 52 ? 34.127 36.050 28.026 1.00 0.00 ? 50 LYS A CA     4  
ATOM 6899  C C      . LYS A 1 52 ? 34.795 34.812 27.407 1.00 0.00 ? 50 LYS A C      4  
ATOM 6900  O O      . LYS A 1 52 ? 35.684 34.949 26.565 1.00 0.00 ? 50 LYS A O      4  
ATOM 6901  C CB     . LYS A 1 52 ? 34.760 36.513 29.355 1.00 0.00 ? 50 LYS A CB     4  
ATOM 6902  C CG     . LYS A 1 52 ? 34.928 35.411 30.413 1.00 0.00 ? 50 LYS A CG     4  
ATOM 6903  C CD     . LYS A 1 52 ? 35.263 35.959 31.812 1.00 0.00 ? 50 LYS A CD     4  
ATOM 6904  C CE     . LYS A 1 52 ? 36.699 36.498 31.901 1.00 0.00 ? 50 LYS A CE     4  
ATOM 6905  N NZ     . LYS A 1 52 ? 36.904 37.277 33.144 1.00 0.00 1 50 LYS A NZ     4  
ATOM 6906  H H      . LYS A 1 52 ? 32.196 35.920 29.034 1.00 0.00 ? 50 LYS A H      4  
ATOM 6907  H HA     . LYS A 1 52 ? 34.306 36.855 27.310 1.00 0.00 ? 50 LYS A HA     4  
ATOM 6908  H HB2    . LYS A 1 52 ? 35.744 36.928 29.136 1.00 0.00 ? 50 LYS A HB2    4  
ATOM 6909  H HB3    . LYS A 1 52 ? 34.146 37.319 29.762 1.00 0.00 ? 50 LYS A HB3    4  
ATOM 6910  H HG2    . LYS A 1 52 ? 33.991 34.870 30.476 1.00 0.00 ? 50 LYS A HG2    4  
ATOM 6911  H HG3    . LYS A 1 52 ? 35.702 34.708 30.100 1.00 0.00 ? 50 LYS A HG3    4  
ATOM 6912  H HD2    . LYS A 1 52 ? 34.551 36.752 32.062 1.00 0.00 ? 50 LYS A HD2    4  
ATOM 6913  H HD3    . LYS A 1 52 ? 35.152 35.151 32.539 1.00 0.00 ? 50 LYS A HD3    4  
ATOM 6914  H HE2    . LYS A 1 52 ? 37.406 35.662 31.871 1.00 0.00 ? 50 LYS A HE2    4  
ATOM 6915  H HE3    . LYS A 1 52 ? 36.904 37.148 31.044 1.00 0.00 ? 50 LYS A HE3    4  
ATOM 6916  H HZ1    . LYS A 1 52 ? 36.336 38.119 33.145 1.00 0.00 ? 50 LYS A HZ1    4  
ATOM 6917  H HZ2    . LYS A 1 52 ? 36.695 36.751 33.987 1.00 0.00 ? 50 LYS A HZ2    4  
ATOM 6918  H HZ3    . LYS A 1 52 ? 37.867 37.591 33.221 1.00 0.00 ? 50 LYS A HZ3    4  
ATOM 6919  N N      . ASN A 1 53 ? 34.283 33.610 27.695 1.00 0.00 ? 51 ASN A N      4  
ATOM 6920  C CA     . ASN A 1 53 ? 34.707 32.385 27.013 1.00 0.00 ? 51 ASN A CA     4  
ATOM 6921  C C      . ASN A 1 53 ? 34.327 32.371 25.517 1.00 0.00 ? 51 ASN A C      4  
ATOM 6922  O O      . ASN A 1 53 ? 35.025 31.730 24.736 1.00 0.00 ? 51 ASN A O      4  
ATOM 6923  C CB     . ASN A 1 53 ? 34.169 31.152 27.767 1.00 0.00 ? 51 ASN A CB     4  
ATOM 6924  C CG     . ASN A 1 53 ? 34.934 30.860 29.052 1.00 0.00 ? 51 ASN A CG     4  
ATOM 6925  O OD1    . ASN A 1 53 ? 36.144 31.033 29.142 1.00 0.00 ? 51 ASN A OD1    4  
ATOM 6926  N ND2    . ASN A 1 53 ? 34.276 30.357 30.065 1.00 0.00 ? 51 ASN A ND2    4  
ATOM 6927  H H      . ASN A 1 53 ? 33.562 33.543 28.407 1.00 0.00 ? 51 ASN A H      4  
ATOM 6928  H HA     . ASN A 1 53 ? 35.796 32.343 27.043 1.00 0.00 ? 51 ASN A HA     4  
ATOM 6929  H HB2    . ASN A 1 53 ? 33.111 31.281 27.986 1.00 0.00 ? 51 ASN A HB2    4  
ATOM 6930  H HB3    . ASN A 1 53 ? 34.267 30.269 27.136 1.00 0.00 ? 51 ASN A HB3    4  
ATOM 6931  H HD21   . ASN A 1 53 ? 33.276 30.177 29.982 1.00 0.00 ? 51 ASN A HD21   4  
ATOM 6932  H HD22   . ASN A 1 53 ? 34.784 30.189 30.926 1.00 0.00 ? 51 ASN A HD22   4  
ATOM 6933  N N      . ARG A 1 54 ? 33.299 33.118 25.081 1.00 0.00 ? 52 ARG A N      4  
ATOM 6934  C CA     . ARG A 1 54 ? 32.874 33.209 23.667 1.00 0.00 ? 52 ARG A CA     4  
ATOM 6935  C C      . ARG A 1 54 ? 33.878 33.928 22.771 1.00 0.00 ? 52 ARG A C      4  
ATOM 6936  O O      . ARG A 1 54 ? 34.021 33.540 21.613 1.00 0.00 ? 52 ARG A O      4  
ATOM 6937  C CB     . ARG A 1 54 ? 31.480 33.871 23.563 1.00 0.00 ? 52 ARG A CB     4  
ATOM 6938  C CG     . ARG A 1 54 ? 30.507 33.185 22.586 1.00 0.00 ? 52 ARG A CG     4  
ATOM 6939  C CD     . ARG A 1 54 ? 30.355 31.668 22.794 1.00 0.00 ? 52 ARG A CD     4  
ATOM 6940  N NE     . ARG A 1 54 ? 30.414 31.287 24.221 1.00 0.00 ? 52 ARG A NE     4  
ATOM 6941  C CZ     . ARG A 1 54 ? 30.855 30.152 24.723 1.00 0.00 ? 52 ARG A CZ     4  
ATOM 6942  N NH1    . ARG A 1 54 ? 31.138 29.123 23.981 1.00 0.00 1 52 ARG A NH1    4  
ATOM 6943  N NH2    . ARG A 1 54 ? 31.035 30.059 26.004 1.00 0.00 ? 52 ARG A NH2    4  
ATOM 6944  H H      . ARG A 1 54 ? 32.769 33.647 25.766 1.00 0.00 ? 52 ARG A H      4  
ATOM 6945  H HA     . ARG A 1 54 ? 32.828 32.193 23.279 1.00 0.00 ? 52 ARG A HA     4  
ATOM 6946  H HB2    . ARG A 1 54 ? 31.004 33.878 24.541 1.00 0.00 ? 52 ARG A HB2    4  
ATOM 6947  H HB3    . ARG A 1 54 ? 31.590 34.918 23.273 1.00 0.00 ? 52 ARG A HB3    4  
ATOM 6948  H HG2    . ARG A 1 54 ? 29.528 33.650 22.705 1.00 0.00 ? 52 ARG A HG2    4  
ATOM 6949  H HG3    . ARG A 1 54 ? 30.839 33.364 21.562 1.00 0.00 ? 52 ARG A HG3    4  
ATOM 6950  H HD2    . ARG A 1 54 ? 29.408 31.341 22.360 1.00 0.00 ? 52 ARG A HD2    4  
ATOM 6951  H HD3    . ARG A 1 54 ? 31.161 31.172 22.253 1.00 0.00 ? 52 ARG A HD3    4  
ATOM 6952  H HE     . ARG A 1 54 ? 30.177 31.996 24.900 1.00 0.00 ? 52 ARG A HE     4  
ATOM 6953  H HH11   . ARG A 1 54 ? 30.913 29.154 22.990 1.00 0.00 ? 52 ARG A HH11   4  
ATOM 6954  H HH12   . ARG A 1 54 ? 31.342 28.228 24.413 1.00 0.00 ? 52 ARG A HH12   4  
ATOM 6955  H HH21   . ARG A 1 54 ? 30.829 30.863 26.575 1.00 0.00 ? 52 ARG A HH21   4  
ATOM 6956  H HH22   . ARG A 1 54 ? 31.335 29.182 26.437 1.00 0.00 ? 52 ARG A HH22   4  
ATOM 6957  N N      . ARG A 1 55 ? 34.609 34.917 23.302 1.00 0.00 ? 53 ARG A N      4  
ATOM 6958  C CA     . ARG A 1 55 ? 35.753 35.530 22.602 1.00 0.00 ? 53 ARG A CA     4  
ATOM 6959  C C      . ARG A 1 55 ? 37.048 34.732 22.760 1.00 0.00 ? 53 ARG A C      4  
ATOM 6960  O O      . ARG A 1 55 ? 37.755 34.518 21.778 1.00 0.00 ? 53 ARG A O      4  
ATOM 6961  C CB     . ARG A 1 55 ? 35.911 37.014 22.952 1.00 0.00 ? 53 ARG A CB     4  
ATOM 6962  C CG     . ARG A 1 55 ? 36.164 37.342 24.436 1.00 0.00 ? 53 ARG A CG     4  
ATOM 6963  C CD     . ARG A 1 55 ? 36.700 38.769 24.602 1.00 0.00 ? 53 ARG A CD     4  
ATOM 6964  N NE     . ARG A 1 55 ? 38.033 38.881 23.979 1.00 0.00 ? 53 ARG A NE     4  
ATOM 6965  C CZ     . ARG A 1 55 ? 38.395 39.692 23.007 1.00 0.00 ? 53 ARG A CZ     4  
ATOM 6966  N NH1    . ARG A 1 55 ? 37.673 40.702 22.629 1.00 0.00 ? 53 ARG A NH1    4  
ATOM 6967  N NH2    . ARG A 1 55 ? 39.525 39.520 22.396 1.00 0.00 1 53 ARG A NH2    4  
ATOM 6968  H H      . ARG A 1 55 ? 34.384 35.210 24.244 1.00 0.00 ? 53 ARG A H      4  
ATOM 6969  H HA     . ARG A 1 55 ? 35.547 35.501 21.531 1.00 0.00 ? 53 ARG A HA     4  
ATOM 6970  H HB2    . ARG A 1 55 ? 36.739 37.386 22.348 1.00 0.00 ? 53 ARG A HB2    4  
ATOM 6971  H HB3    . ARG A 1 55 ? 35.016 37.540 22.629 1.00 0.00 ? 53 ARG A HB3    4  
ATOM 6972  H HG2    . ARG A 1 55 ? 35.230 37.242 24.989 1.00 0.00 ? 53 ARG A HG2    4  
ATOM 6973  H HG3    . ARG A 1 55 ? 36.898 36.656 24.857 1.00 0.00 ? 53 ARG A HG3    4  
ATOM 6974  H HD2    . ARG A 1 55 ? 35.989 39.468 24.158 1.00 0.00 ? 53 ARG A HD2    4  
ATOM 6975  H HD3    . ARG A 1 55 ? 36.782 38.998 25.666 1.00 0.00 ? 53 ARG A HD3    4  
ATOM 6976  H HE     . ARG A 1 55 ? 38.707 38.150 24.195 1.00 0.00 ? 53 ARG A HE     4  
ATOM 6977  H HH11   . ARG A 1 55 ? 36.965 41.001 23.296 1.00 0.00 ? 53 ARG A HH11   4  
ATOM 6978  H HH12   . ARG A 1 55 ? 38.151 41.412 22.094 1.00 0.00 ? 53 ARG A HH12   4  
ATOM 6979  H HH21   . ARG A 1 55 ? 40.212 38.870 22.767 1.00 0.00 ? 53 ARG A HH21   4  
ATOM 6980  H HH22   . ARG A 1 55 ? 39.750 40.081 21.591 1.00 0.00 ? 53 ARG A HH22   4  
ATOM 6981  N N      . ALA A 1 56 ? 37.304 34.175 23.947 1.00 0.00 ? 54 ALA A N      4  
ATOM 6982  C CA     . ALA A 1 56 ? 38.440 33.273 24.153 1.00 0.00 ? 54 ALA A CA     4  
ATOM 6983  C C      . ALA A 1 56 ? 38.393 32.061 23.200 1.00 0.00 ? 54 ALA A C      4  
ATOM 6984  O O      . ALA A 1 56 ? 39.439 31.589 22.759 1.00 0.00 ? 54 ALA A O      4  
ATOM 6985  C CB     . ALA A 1 56 ? 38.472 32.836 25.621 1.00 0.00 ? 54 ALA A CB     4  
ATOM 6986  H H      . ALA A 1 56 ? 36.713 34.403 24.735 1.00 0.00 ? 54 ALA A H      4  
ATOM 6987  H HA     . ALA A 1 56 ? 39.358 33.827 23.942 1.00 0.00 ? 54 ALA A HA     4  
ATOM 6988  H HB1    . ALA A 1 56 ? 38.451 33.710 26.273 1.00 0.00 ? 54 ALA A HB1    4  
ATOM 6989  H HB2    . ALA A 1 56 ? 37.622 32.191 25.840 1.00 0.00 ? 54 ALA A HB2    4  
ATOM 6990  H HB3    . ALA A 1 56 ? 39.392 32.285 25.811 1.00 0.00 ? 54 ALA A HB3    4  
ATOM 6991  N N      . LYS A 1 57 ? 37.189 31.604 22.820 1.00 0.00 ? 55 LYS A N      4  
ATOM 6992  C CA     . LYS A 1 57 ? 36.903 30.534 21.850 1.00 0.00 ? 55 LYS A CA     4  
ATOM 6993  C C      . LYS A 1 57 ? 37.765 30.603 20.578 1.00 0.00 ? 55 LYS A C      4  
ATOM 6994  O O      . LYS A 1 57 ? 38.465 29.635 20.271 1.00 0.00 ? 55 LYS A O      4  
ATOM 6995  C CB     . LYS A 1 57 ? 35.402 30.608 21.499 1.00 0.00 ? 55 LYS A CB     4  
ATOM 6996  C CG     . LYS A 1 57 ? 34.783 29.285 21.038 1.00 0.00 ? 55 LYS A CG     4  
ATOM 6997  C CD     . LYS A 1 57 ? 34.534 28.299 22.192 1.00 0.00 ? 55 LYS A CD     4  
ATOM 6998  C CE     . LYS A 1 57 ? 33.523 27.222 21.780 1.00 0.00 ? 55 LYS A CE     4  
ATOM 6999  N NZ     . LYS A 1 57 ? 34.015 26.411 20.647 1.00 0.00 1 55 LYS A NZ     4  
ATOM 7000  H H      . LYS A 1 57 ? 36.389 31.998 23.303 1.00 0.00 ? 55 LYS A H      4  
ATOM 7001  H HA     . LYS A 1 57 ? 37.115 29.578 22.327 1.00 0.00 ? 55 LYS A HA     4  
ATOM 7002  H HB2    . LYS A 1 57 ? 34.830 30.952 22.359 1.00 0.00 ? 55 LYS A HB2    4  
ATOM 7003  H HB3    . LYS A 1 57 ? 35.256 31.348 20.710 1.00 0.00 ? 55 LYS A HB3    4  
ATOM 7004  H HG2    . LYS A 1 57 ? 33.827 29.516 20.565 1.00 0.00 ? 55 LYS A HG2    4  
ATOM 7005  H HG3    . LYS A 1 57 ? 35.434 28.826 20.296 1.00 0.00 ? 55 LYS A HG3    4  
ATOM 7006  H HD2    . LYS A 1 57 ? 35.473 27.834 22.498 1.00 0.00 ? 55 LYS A HD2    4  
ATOM 7007  H HD3    . LYS A 1 57 ? 34.120 28.838 23.046 1.00 0.00 ? 55 LYS A HD3    4  
ATOM 7008  H HE2    . LYS A 1 57 ? 33.320 26.572 22.637 1.00 0.00 ? 55 LYS A HE2    4  
ATOM 7009  H HE3    . LYS A 1 57 ? 32.586 27.711 21.499 1.00 0.00 ? 55 LYS A HE3    4  
ATOM 7010  H HZ1    . LYS A 1 57 ? 34.804 25.834 20.929 1.00 0.00 ? 55 LYS A HZ1    4  
ATOM 7011  H HZ2    . LYS A 1 57 ? 33.281 25.787 20.320 1.00 0.00 ? 55 LYS A HZ2    4  
ATOM 7012  H HZ3    . LYS A 1 57 ? 34.275 26.994 19.852 1.00 0.00 ? 55 LYS A HZ3    4  
ATOM 7013  N N      . TRP A 1 58 ? 37.809 31.752 19.890 1.00 0.00 ? 56 TRP A N      4  
ATOM 7014  C CA     . TRP A 1 58 ? 38.623 31.879 18.672 1.00 0.00 ? 56 TRP A CA     4  
ATOM 7015  C C      . TRP A 1 58 ? 40.119 31.880 19.000 1.00 0.00 ? 56 TRP A C      4  
ATOM 7016  O O      . TRP A 1 58 ? 40.920 31.339 18.240 1.00 0.00 ? 56 TRP A O      4  
ATOM 7017  C CB     . TRP A 1 58 ? 38.203 33.082 17.806 1.00 0.00 ? 56 TRP A CB     4  
ATOM 7018  C CG     . TRP A 1 58 ? 38.807 34.431 18.098 1.00 0.00 ? 56 TRP A CG     4  
ATOM 7019  C CD1    . TRP A 1 58 ? 40.081 34.808 17.827 1.00 0.00 ? 56 TRP A CD1    4  
ATOM 7020  C CD2    . TRP A 1 58 ? 38.154 35.627 18.629 1.00 0.00 ? 56 TRP A CD2    4  
ATOM 7021  N NE1    . TRP A 1 58 ? 40.273 36.126 18.203 1.00 0.00 ? 56 TRP A NE1    4  
ATOM 7022  C CE2    . TRP A 1 58 ? 39.117 36.677 18.705 1.00 0.00 ? 56 TRP A CE2    4  
ATOM 7023  C CE3    . TRP A 1 58 ? 36.838 35.944 19.029 1.00 0.00 ? 56 TRP A CE3    4  
ATOM 7024  C CZ2    . TRP A 1 58 ? 38.809 37.954 19.194 1.00 0.00 ? 56 TRP A CZ2    4  
ATOM 7025  C CZ3    . TRP A 1 58 ? 36.512 37.228 19.507 1.00 0.00 ? 56 TRP A CZ3    4  
ATOM 7026  C CH2    . TRP A 1 58 ? 37.497 38.224 19.612 1.00 0.00 ? 56 TRP A CH2    4  
ATOM 7027  H H      . TRP A 1 58 ? 37.246 32.533 20.196 1.00 0.00 ? 56 TRP A H      4  
ATOM 7028  H HA     . TRP A 1 58 ? 38.436 30.989 18.067 1.00 0.00 ? 56 TRP A HA     4  
ATOM 7029  H HB2    . TRP A 1 58 ? 38.468 32.835 16.780 1.00 0.00 ? 56 TRP A HB2    4  
ATOM 7030  H HB3    . TRP A 1 58 ? 37.116 33.170 17.828 1.00 0.00 ? 56 TRP A HB3    4  
ATOM 7031  H HD1    . TRP A 1 58 ? 40.834 34.168 17.382 1.00 0.00 ? 56 TRP A HD1    4  
ATOM 7032  H HE1    . TRP A 1 58 ? 41.151 36.640 18.127 1.00 0.00 ? 56 TRP A HE1    4  
ATOM 7033  H HE3    . TRP A 1 58 ? 36.075 35.184 18.966 1.00 0.00 ? 56 TRP A HE3    4  
ATOM 7034  H HZ2    . TRP A 1 58 ? 39.574 38.714 19.241 1.00 0.00 ? 56 TRP A HZ2    4  
ATOM 7035  H HZ3    . TRP A 1 58 ? 35.496 37.448 19.804 1.00 0.00 ? 56 TRP A HZ3    4  
ATOM 7036  H HH2    . TRP A 1 58 ? 37.243 39.198 20.004 1.00 0.00 ? 56 TRP A HH2    4  
ATOM 7037  N N      . ARG A 1 59 ? 40.509 32.397 20.172 1.00 0.00 ? 57 ARG A N      4  
ATOM 7038  C CA     . ARG A 1 59 ? 41.902 32.384 20.642 1.00 0.00 ? 57 ARG A CA     4  
ATOM 7039  C C      . ARG A 1 59 ? 42.384 30.977 21.025 1.00 0.00 ? 57 ARG A C      4  
ATOM 7040  O O      . ARG A 1 59 ? 43.561 30.677 20.815 1.00 0.00 ? 57 ARG A O      4  
ATOM 7041  C CB     . ARG A 1 59 ? 42.114 33.408 21.774 1.00 0.00 ? 57 ARG A CB     4  
ATOM 7042  C CG     . ARG A 1 59 ? 41.552 34.808 21.443 1.00 0.00 ? 57 ARG A CG     4  
ATOM 7043  C CD     . ARG A 1 59 ? 42.445 35.955 21.927 1.00 0.00 ? 57 ARG A CD     4  
ATOM 7044  N NE     . ARG A 1 59 ? 43.656 36.049 21.094 1.00 0.00 ? 57 ARG A NE     4  
ATOM 7045  C CZ     . ARG A 1 59 ? 44.828 36.561 21.408 1.00 0.00 ? 57 ARG A CZ     4  
ATOM 7046  N NH1    . ARG A 1 59 ? 45.064 37.183 22.527 1.00 0.00 1 57 ARG A NH1    4  
ATOM 7047  N NH2    . ARG A 1 59 ? 45.798 36.424 20.554 1.00 0.00 ? 57 ARG A NH2    4  
ATOM 7048  H H      . ARG A 1 59 ? 39.798 32.805 20.769 1.00 0.00 ? 57 ARG A H      4  
ATOM 7049  H HA     . ARG A 1 59 ? 42.528 32.701 19.811 1.00 0.00 ? 57 ARG A HA     4  
ATOM 7050  H HB2    . ARG A 1 59 ? 41.645 33.051 22.690 1.00 0.00 ? 57 ARG A HB2    4  
ATOM 7051  H HB3    . ARG A 1 59 ? 43.188 33.478 21.958 1.00 0.00 ? 57 ARG A HB3    4  
ATOM 7052  H HG2    . ARG A 1 59 ? 41.436 34.915 20.365 1.00 0.00 ? 57 ARG A HG2    4  
ATOM 7053  H HG3    . ARG A 1 59 ? 40.566 34.908 21.897 1.00 0.00 ? 57 ARG A HG3    4  
ATOM 7054  H HD2    . ARG A 1 59 ? 41.883 36.886 21.835 1.00 0.00 ? 57 ARG A HD2    4  
ATOM 7055  H HD3    . ARG A 1 59 ? 42.702 35.798 22.977 1.00 0.00 ? 57 ARG A HD3    4  
ATOM 7056  H HE     . ARG A 1 59 ? 43.609 35.637 20.170 1.00 0.00 ? 57 ARG A HE     4  
ATOM 7057  H HH11   . ARG A 1 59 ? 44.310 37.378 23.170 1.00 0.00 ? 57 ARG A HH11   4  
ATOM 7058  H HH12   . ARG A 1 59 ? 46.005 37.465 22.764 1.00 0.00 ? 57 ARG A HH12   4  
ATOM 7059  H HH21   . ARG A 1 59 ? 45.600 35.960 19.682 1.00 0.00 ? 57 ARG A HH21   4  
ATOM 7060  H HH22   . ARG A 1 59 ? 46.703 36.847 20.727 1.00 0.00 ? 57 ARG A HH22   4  
ATOM 7061  N N      . LYS A 1 60 ? 41.492 30.080 21.482 1.00 0.00 ? 58 LYS A N      4  
ATOM 7062  C CA     . LYS A 1 60 ? 41.789 28.653 21.738 1.00 0.00 ? 58 LYS A CA     4  
ATOM 7063  C C      . LYS A 1 60 ? 42.062 27.862 20.455 1.00 0.00 ? 58 LYS A C      4  
ATOM 7064  O O      . LYS A 1 60 ? 42.973 27.028 20.443 1.00 0.00 ? 58 LYS A O      4  
ATOM 7065  C CB     . LYS A 1 60 ? 40.638 27.954 22.496 1.00 0.00 ? 58 LYS A CB     4  
ATOM 7066  C CG     . LYS A 1 60 ? 40.234 28.505 23.871 1.00 0.00 ? 58 LYS A CG     4  
ATOM 7067  C CD     . LYS A 1 60 ? 41.403 28.835 24.806 1.00 0.00 ? 58 LYS A CD     4  
ATOM 7068  C CE     . LYS A 1 60 ? 40.835 29.279 26.159 1.00 0.00 ? 58 LYS A CE     4  
ATOM 7069  N NZ     . LYS A 1 60 ? 41.903 29.508 27.155 1.00 0.00 1 58 LYS A NZ     4  
ATOM 7070  H H      . LYS A 1 60 ? 40.561 30.433 21.689 1.00 0.00 ? 58 LYS A H      4  
ATOM 7071  H HA     . LYS A 1 60 ? 42.698 28.584 22.337 1.00 0.00 ? 58 LYS A HA     4  
ATOM 7072  H HB2    . LYS A 1 60 ? 39.747 27.947 21.867 1.00 0.00 ? 58 LYS A HB2    4  
ATOM 7073  H HB3    . LYS A 1 60 ? 40.924 26.912 22.643 1.00 0.00 ? 58 LYS A HB3    4  
ATOM 7074  H HG2    . LYS A 1 60 ? 39.628 29.394 23.737 1.00 0.00 ? 58 LYS A HG2    4  
ATOM 7075  H HG3    . LYS A 1 60 ? 39.596 27.762 24.354 1.00 0.00 ? 58 LYS A HG3    4  
ATOM 7076  H HD2    . LYS A 1 60 ? 42.038 27.958 24.930 1.00 0.00 ? 58 LYS A HD2    4  
ATOM 7077  H HD3    . LYS A 1 60 ? 41.995 29.648 24.383 1.00 0.00 ? 58 LYS A HD3    4  
ATOM 7078  H HE2    . LYS A 1 60 ? 40.274 30.206 26.009 1.00 0.00 ? 58 LYS A HE2    4  
ATOM 7079  H HE3    . LYS A 1 60 ? 40.140 28.521 26.534 1.00 0.00 ? 58 LYS A HE3    4  
ATOM 7080  H HZ1    . LYS A 1 60 ? 41.528 30.012 27.948 1.00 0.00 ? 58 LYS A HZ1    4  
ATOM 7081  H HZ2    . LYS A 1 60 ? 42.274 28.626 27.511 1.00 0.00 ? 58 LYS A HZ2    4  
ATOM 7082  H HZ3    . LYS A 1 60 ? 42.648 30.077 26.756 1.00 0.00 ? 58 LYS A HZ3    4  
ATOM 7083  N N      . ARG A 1 61 ? 41.279 28.091 19.390 1.00 0.00 ? 59 ARG A N      4  
ATOM 7084  C CA     . ARG A 1 61 ? 41.320 27.295 18.143 1.00 0.00 ? 59 ARG A CA     4  
ATOM 7085  C C      . ARG A 1 61 ? 42.184 27.906 17.035 1.00 0.00 ? 59 ARG A C      4  
ATOM 7086  O O      . ARG A 1 61 ? 42.845 27.174 16.299 1.00 0.00 ? 59 ARG A O      4  
ATOM 7087  C CB     . ARG A 1 61 ? 39.875 27.050 17.667 1.00 0.00 ? 59 ARG A CB     4  
ATOM 7088  C CG     . ARG A 1 61 ? 39.800 25.956 16.587 1.00 0.00 ? 59 ARG A CG     4  
ATOM 7089  C CD     . ARG A 1 61 ? 38.382 25.770 16.040 1.00 0.00 ? 59 ARG A CD     4  
ATOM 7090  N NE     . ARG A 1 61 ? 38.159 26.565 14.820 1.00 0.00 ? 59 ARG A NE     4  
ATOM 7091  C CZ     . ARG A 1 61 ? 37.013 26.754 14.200 1.00 0.00 ? 59 ARG A CZ     4  
ATOM 7092  N NH1    . ARG A 1 61 ? 35.869 26.347 14.656 1.00 0.00 ? 59 ARG A NH1    4  
ATOM 7093  N NH2    . ARG A 1 61 ? 37.005 27.367 13.059 1.00 0.00 1 59 ARG A NH2    4  
ATOM 7094  H H      . ARG A 1 61 ? 40.515 28.746 19.522 1.00 0.00 ? 59 ARG A H      4  
ATOM 7095  H HA     . ARG A 1 61 ? 41.760 26.319 18.365 1.00 0.00 ? 59 ARG A HA     4  
ATOM 7096  H HB2    . ARG A 1 61 ? 39.271 26.727 18.517 1.00 0.00 ? 59 ARG A HB2    4  
ATOM 7097  H HB3    . ARG A 1 61 ? 39.448 27.980 17.289 1.00 0.00 ? 59 ARG A HB3    4  
ATOM 7098  H HG2    . ARG A 1 61 ? 40.476 26.175 15.760 1.00 0.00 ? 59 ARG A HG2    4  
ATOM 7099  H HG3    . ARG A 1 61 ? 40.112 25.017 17.036 1.00 0.00 ? 59 ARG A HG3    4  
ATOM 7100  H HD2    . ARG A 1 61 ? 38.237 24.716 15.800 1.00 0.00 ? 59 ARG A HD2    4  
ATOM 7101  H HD3    . ARG A 1 61 ? 37.664 26.050 16.812 1.00 0.00 ? 59 ARG A HD3    4  
ATOM 7102  H HE     . ARG A 1 61 ? 38.967 26.923 14.324 1.00 0.00 ? 59 ARG A HE     4  
ATOM 7103  H HH11   . ARG A 1 61 ? 35.804 25.868 15.547 1.00 0.00 ? 59 ARG A HH11   4  
ATOM 7104  H HH12   . ARG A 1 61 ? 35.042 26.538 14.101 1.00 0.00 ? 59 ARG A HH12   4  
ATOM 7105  H HH21   . ARG A 1 61 ? 37.882 27.651 12.649 1.00 0.00 ? 59 ARG A HH21   4  
ATOM 7106  H HH22   . ARG A 1 61 ? 36.105 27.543 12.621 1.00 0.00 ? 59 ARG A HH22   4  
ATOM 7107  N N      . GLU A 1 62 ? 42.186 29.231 16.909 1.00 0.00 ? 60 GLU A N      4  
ATOM 7108  C CA     . GLU A 1 62 ? 42.708 29.959 15.740 1.00 0.00 ? 60 GLU A CA     4  
ATOM 7109  C C      . GLU A 1 62 ? 43.661 31.125 16.080 1.00 0.00 ? 60 GLU A C      4  
ATOM 7110  O O      . GLU A 1 62 ? 44.144 31.782 15.158 1.00 0.00 ? 60 GLU A O      4  
ATOM 7111  C CB     . GLU A 1 62 ? 41.533 30.516 14.912 1.00 0.00 ? 60 GLU A CB     4  
ATOM 7112  C CG     . GLU A 1 62 ? 40.435 29.525 14.486 1.00 0.00 ? 60 GLU A CG     4  
ATOM 7113  C CD     . GLU A 1 62 ? 40.830 28.539 13.380 1.00 0.00 ? 60 GLU A CD     4  
ATOM 7114  O OE1    . GLU A 1 62 ? 42.015 28.487 12.965 1.00 0.00 ? 60 GLU A OE1    4  
ATOM 7115  O OE2    . GLU A 1 62 ? 39.911 27.828 12.903 1.00 0.00 ? 60 GLU A OE2    4  
ATOM 7116  H H      . GLU A 1 62 ? 41.604 29.765 17.545 1.00 0.00 ? 60 GLU A H      4  
ATOM 7117  H HA     . GLU A 1 62 ? 43.275 29.269 15.117 1.00 0.00 ? 60 GLU A HA     4  
ATOM 7118  H HB2    . GLU A 1 62 ? 41.054 31.305 15.493 1.00 0.00 ? 60 GLU A HB2    4  
ATOM 7119  H HB3    . GLU A 1 62 ? 41.937 30.974 14.012 1.00 0.00 ? 60 GLU A HB3    4  
ATOM 7120  H HG2    . GLU A 1 62 ? 40.073 28.973 15.350 1.00 0.00 ? 60 GLU A HG2    4  
ATOM 7121  H HG3    . GLU A 1 62 ? 39.595 30.114 14.118 1.00 0.00 ? 60 GLU A HG3    4  
ATOM 7122  N N      . GLU A 1 63 ? 43.909 31.388 17.371 1.00 0.00 ? 61 GLU A N      4  
ATOM 7123  C CA     . GLU A 1 63 ? 44.715 32.469 17.982 1.00 0.00 ? 61 GLU A CA     4  
ATOM 7124  C C      . GLU A 1 63 ? 44.304 33.925 17.667 1.00 0.00 ? 61 GLU A C      4  
ATOM 7125  O O      . GLU A 1 63 ? 44.235 34.738 18.592 1.00 0.00 ? 61 GLU A O      4  
ATOM 7126  C CB     . GLU A 1 63 ? 46.220 32.211 17.784 1.00 0.00 ? 61 GLU A CB     4  
ATOM 7127  C CG     . GLU A 1 63 ? 47.073 33.198 18.598 1.00 0.00 ? 61 GLU A CG     4  
ATOM 7128  C CD     . GLU A 1 63 ? 48.506 32.693 18.791 1.00 0.00 ? 61 GLU A CD     4  
ATOM 7129  O OE1    . GLU A 1 63 ? 49.326 32.781 17.851 1.00 0.00 ? 61 GLU A OE1    4  
ATOM 7130  O OE2    . GLU A 1 63 ? 48.834 32.202 19.897 1.00 0.00 ? 61 GLU A OE2    4  
ATOM 7131  H H      . GLU A 1 63 ? 43.435 30.783 18.025 1.00 0.00 ? 61 GLU A H      4  
ATOM 7132  H HA     . GLU A 1 63 ? 44.560 32.375 19.055 1.00 0.00 ? 61 GLU A HA     4  
ATOM 7133  H HB2    . GLU A 1 63 ? 46.440 31.196 18.124 1.00 0.00 ? 61 GLU A HB2    4  
ATOM 7134  H HB3    . GLU A 1 63 ? 46.481 32.289 16.728 1.00 0.00 ? 61 GLU A HB3    4  
ATOM 7135  H HG2    . GLU A 1 63 ? 47.089 34.166 18.091 1.00 0.00 ? 61 GLU A HG2    4  
ATOM 7136  H HG3    . GLU A 1 63 ? 46.616 33.340 19.579 1.00 0.00 ? 61 GLU A HG3    4  
ATOM 7137  N N      . PHE A 1 64 ? 44.024 34.267 16.405 1.00 0.00 ? 62 PHE A N      4  
ATOM 7138  C CA     . PHE A 1 64 ? 43.701 35.632 15.950 1.00 0.00 ? 62 PHE A CA     4  
ATOM 7139  C C      . PHE A 1 64 ? 42.575 35.715 14.897 1.00 0.00 ? 62 PHE A C      4  
ATOM 7140  O O      . PHE A 1 64 ? 42.112 36.813 14.584 1.00 0.00 ? 62 PHE A O      4  
ATOM 7141  C CB     . PHE A 1 64 ? 44.987 36.297 15.424 1.00 0.00 ? 62 PHE A CB     4  
ATOM 7142  C CG     . PHE A 1 64 ? 45.548 35.683 14.151 1.00 0.00 ? 62 PHE A CG     4  
ATOM 7143  C CD1    . PHE A 1 64 ? 45.128 36.158 12.893 1.00 0.00 ? 62 PHE A CD1    4  
ATOM 7144  C CD2    . PHE A 1 64 ? 46.478 34.627 14.221 1.00 0.00 ? 62 PHE A CD2    4  
ATOM 7145  C CE1    . PHE A 1 64 ? 45.619 35.568 11.714 1.00 0.00 ? 62 PHE A CE1    4  
ATOM 7146  C CE2    . PHE A 1 64 ? 46.967 34.036 13.041 1.00 0.00 ? 62 PHE A CE2    4  
ATOM 7147  C CZ     . PHE A 1 64 ? 46.531 34.500 11.788 1.00 0.00 ? 62 PHE A CZ     4  
ATOM 7148  H H      . PHE A 1 64 ? 44.167 33.550 15.702 1.00 0.00 ? 62 PHE A H      4  
ATOM 7149  H HA     . PHE A 1 64 ? 43.356 36.218 16.804 1.00 0.00 ? 62 PHE A HA     4  
ATOM 7150  H HB2    . PHE A 1 64 ? 44.780 37.353 15.240 1.00 0.00 ? 62 PHE A HB2    4  
ATOM 7151  H HB3    . PHE A 1 64 ? 45.750 36.259 16.204 1.00 0.00 ? 62 PHE A HB3    4  
ATOM 7152  H HD1    . PHE A 1 64 ? 44.419 36.972 12.828 1.00 0.00 ? 62 PHE A HD1    4  
ATOM 7153  H HD2    . PHE A 1 64 ? 46.815 34.264 15.180 1.00 0.00 ? 62 PHE A HD2    4  
ATOM 7154  H HE1    . PHE A 1 64 ? 45.284 35.928 10.751 1.00 0.00 ? 62 PHE A HE1    4  
ATOM 7155  H HE2    . PHE A 1 64 ? 47.671 33.219 13.101 1.00 0.00 ? 62 PHE A HE2    4  
ATOM 7156  H HZ     . PHE A 1 64 ? 46.895 34.038 10.881 1.00 0.00 ? 62 PHE A HZ     4  
ATOM 7157  N N      . ILE A 1 65 ? 42.119 34.589 14.329 1.00 0.00 ? 63 ILE A N      4  
ATOM 7158  C CA     . ILE A 1 65 ? 41.060 34.579 13.301 1.00 0.00 ? 63 ILE A CA     4  
ATOM 7159  C C      . ILE A 1 65 ? 39.680 34.543 13.976 1.00 0.00 ? 63 ILE A C      4  
ATOM 7160  O O      . ILE A 1 65 ? 39.237 33.487 14.431 1.00 0.00 ? 63 ILE A O      4  
ATOM 7161  C CB     . ILE A 1 65 ? 41.239 33.438 12.267 1.00 0.00 ? 63 ILE A CB     4  
ATOM 7162  C CG1    . ILE A 1 65 ? 42.684 33.391 11.715 1.00 0.00 ? 63 ILE A CG1    4  
ATOM 7163  C CG2    . ILE A 1 65 ? 40.218 33.618 11.124 1.00 0.00 ? 63 ILE A CG2    4  
ATOM 7164  C CD1    . ILE A 1 65 ? 42.932 32.280 10.689 1.00 0.00 ? 63 ILE A CD1    4  
ATOM 7165  H H      . ILE A 1 65 ? 42.534 33.709 14.598 1.00 0.00 ? 63 ILE A H      4  
ATOM 7166  H HA     . ILE A 1 65 ? 41.130 35.506 12.734 1.00 0.00 ? 63 ILE A HA     4  
ATOM 7167  H HB     . ILE A 1 65 ? 41.026 32.489 12.752 1.00 0.00 ? 63 ILE A HB     4  
ATOM 7168  H HG12   . ILE A 1 65 ? 42.928 34.351 11.256 1.00 0.00 ? 63 ILE A HG12   4  
ATOM 7169  H HG13   . ILE A 1 65 ? 43.379 33.225 12.540 1.00 0.00 ? 63 ILE A HG13   4  
ATOM 7170  H HG21   . ILE A 1 65 ? 39.203 33.653 11.515 1.00 0.00 ? 63 ILE A HG21   4  
ATOM 7171  H HG22   . ILE A 1 65 ? 40.429 34.537 10.573 1.00 0.00 ? 63 ILE A HG22   4  
ATOM 7172  H HG23   . ILE A 1 65 ? 40.268 32.772 10.441 1.00 0.00 ? 63 ILE A HG23   4  
ATOM 7173  H HD11   . ILE A 1 65 ? 42.577 31.326 11.078 1.00 0.00 ? 63 ILE A HD11   4  
ATOM 7174  H HD12   . ILE A 1 65 ? 42.423 32.506 9.754  1.00 0.00 ? 63 ILE A HD12   4  
ATOM 7175  H HD13   . ILE A 1 65 ? 44.003 32.207 10.492 1.00 0.00 ? 63 ILE A HD13   4  
ATOM 7176  N N      . VAL A 1 66 ? 38.975 35.680 13.997 1.00 0.00 ? 64 VAL A N      4  
ATOM 7177  C CA     . VAL A 1 66 ? 37.687 35.877 14.709 1.00 0.00 ? 64 VAL A CA     4  
ATOM 7178  C C      . VAL A 1 66 ? 36.555 34.938 14.249 1.00 0.00 ? 64 VAL A C      4  
ATOM 7179  O O      . VAL A 1 66 ? 35.619 34.670 15.002 1.00 0.00 ? 64 VAL A O      4  
ATOM 7180  C CB     . VAL A 1 66 ? 37.281 37.363 14.612 1.00 0.00 ? 64 VAL A CB     4  
ATOM 7181  C CG1    . VAL A 1 66 ? 36.872 37.782 13.194 1.00 0.00 ? 64 VAL A CG1    4  
ATOM 7182  C CG2    . VAL A 1 66 ? 36.149 37.730 15.575 1.00 0.00 ? 64 VAL A CG2    4  
ATOM 7183  H H      . VAL A 1 66 ? 39.414 36.505 13.599 1.00 0.00 ? 64 VAL A H      4  
ATOM 7184  H HA     . VAL A 1 66 ? 37.864 35.656 15.763 1.00 0.00 ? 64 VAL A HA     4  
ATOM 7185  H HB     . VAL A 1 66 ? 38.149 37.959 14.902 1.00 0.00 ? 64 VAL A HB     4  
ATOM 7186  H HG11   . VAL A 1 66 ? 35.949 37.286 12.895 1.00 0.00 ? 64 VAL A HG11   4  
ATOM 7187  H HG12   . VAL A 1 66 ? 36.718 38.860 13.170 1.00 0.00 ? 64 VAL A HG12   4  
ATOM 7188  H HG13   . VAL A 1 66 ? 37.664 37.541 12.485 1.00 0.00 ? 64 VAL A HG13   4  
ATOM 7189  H HG21   . VAL A 1 66 ? 35.208 37.285 15.259 1.00 0.00 ? 64 VAL A HG21   4  
ATOM 7190  H HG22   . VAL A 1 66 ? 36.391 37.392 16.581 1.00 0.00 ? 64 VAL A HG22   4  
ATOM 7191  H HG23   . VAL A 1 66 ? 36.028 38.810 15.599 1.00 0.00 ? 64 VAL A HG23   4  
ATOM 7192  N N      . THR A 1 67 ? 36.688 34.377 13.039 1.00 0.00 ? 65 THR A N      4  
ATOM 7193  C CA     . THR A 1 67 ? 35.924 33.254 12.448 1.00 0.00 ? 65 THR A CA     4  
ATOM 7194  C C      . THR A 1 67 ? 34.427 33.488 12.180 1.00 0.00 ? 65 THR A C      4  
ATOM 7195  O O      . THR A 1 67 ? 33.943 33.006 11.157 1.00 0.00 ? 65 THR A O      4  
ATOM 7196  C CB     . THR A 1 67 ? 36.217 31.955 13.227 1.00 0.00 ? 65 THR A CB     4  
ATOM 7197  O OG1    . THR A 1 67 ? 37.599 31.651 13.125 1.00 0.00 ? 65 THR A OG1    4  
ATOM 7198  C CG2    . THR A 1 67 ? 35.485 30.724 12.695 1.00 0.00 ? 65 THR A CG2    4  
ATOM 7199  H H      . THR A 1 67 ? 37.497 34.680 12.519 1.00 0.00 ? 65 THR A H      4  
ATOM 7200  H HA     . THR A 1 67 ? 36.350 33.091 11.458 1.00 0.00 ? 65 THR A HA     4  
ATOM 7201  H HB     . THR A 1 67 ? 35.954 32.087 14.276 1.00 0.00 ? 65 THR A HB     4  
ATOM 7202  H HG1    . THR A 1 67 ? 38.076 32.268 13.709 1.00 0.00 ? 65 THR A HG1    4  
ATOM 7203  H HG21   . THR A 1 67 ? 35.812 29.847 13.254 1.00 0.00 ? 65 THR A HG21   4  
ATOM 7204  H HG22   . THR A 1 67 ? 34.410 30.834 12.844 1.00 0.00 ? 65 THR A HG22   4  
ATOM 7205  H HG23   . THR A 1 67 ? 35.698 30.586 11.636 1.00 0.00 ? 65 THR A HG23   4  
ATOM 7206  N N      . ASP A 1 68 ? 33.696 34.257 12.994 1.00 0.00 ? 66 ASP A N      4  
ATOM 7207  C CA     . ASP A 1 68 ? 32.288 34.658 12.766 1.00 0.00 ? 66 ASP A CA     4  
ATOM 7208  C C      . ASP A 1 68 ? 32.004 36.091 13.226 1.00 0.00 ? 66 ASP A C      4  
ATOM 7209  O O      . ASP A 1 68 ? 31.369 36.833 12.441 1.00 0.00 ? 66 ASP A O      4  
ATOM 7210  C CB     . ASP A 1 68 ? 31.326 33.657 13.450 1.00 0.00 ? 66 ASP A CB     4  
ATOM 7211  C CG     . ASP A 1 68 ? 29.856 33.881 13.058 1.00 0.00 ? 66 ASP A CG     4  
ATOM 7212  O OD1    . ASP A 1 68 ? 29.498 33.626 11.875 1.00 0.00 ? 66 ASP A OD1    4  
ATOM 7213  O OD2    . ASP A 1 68 ? 29.021 34.267 13.910 1.00 0.00 ? 66 ASP A OD2    4  
ATOM 7214  O OXT    . ASP A 1 68 ? 32.467 36.468 14.324 1.00 0.00 ? 66 ASP A OXT    4  
ATOM 7215  H H      . ASP A 1 68 ? 34.152 34.627 13.824 1.00 0.00 ? 66 ASP A H      4  
ATOM 7216  H HA     . ASP A 1 68 ? 32.089 34.627 11.693 1.00 0.00 ? 66 ASP A HA     4  
ATOM 7217  H HB2    . ASP A 1 68 ? 31.605 32.643 13.161 1.00 0.00 ? 66 ASP A HB2    4  
ATOM 7218  H HB3    . ASP A 1 68 ? 31.435 33.737 14.535 1.00 0.00 ? 66 ASP A HB3    4  
ATOM 7219  O "O5'"  . DG  B 2 1  ? 50.287 11.211 30.845 1.00 0.00 ? 67 DG  B "O5'"  4  
ATOM 7220  C "C5'"  . DG  B 2 1  ? 51.201 11.134 29.756 1.00 0.00 ? 67 DG  B "C5'"  4  
ATOM 7221  C "C4'"  . DG  B 2 1  ? 50.735 11.865 28.477 1.00 0.00 ? 67 DG  B "C4'"  4  
ATOM 7222  O "O4'"  . DG  B 2 1  ? 49.377 11.506 28.206 1.00 0.00 ? 67 DG  B "O4'"  4  
ATOM 7223  C "C3'"  . DG  B 2 1  ? 50.788 13.403 28.555 1.00 0.00 ? 67 DG  B "C3'"  4  
ATOM 7224  O "O3'"  . DG  B 2 1  ? 51.092 13.917 27.263 1.00 0.00 ? 67 DG  B "O3'"  4  
ATOM 7225  C "C2'"  . DG  B 2 1  ? 49.386 13.733 29.039 1.00 0.00 ? 67 DG  B "C2'"  4  
ATOM 7226  C "C1'"  . DG  B 2 1  ? 48.533 12.631 28.407 1.00 0.00 ? 67 DG  B "C1'"  4  
ATOM 7227  N N9     . DG  B 2 1  ? 47.367 12.242 29.237 1.00 0.00 ? 67 DG  B N9     4  
ATOM 7228  C C8     . DG  B 2 1  ? 47.224 12.265 30.606 1.00 0.00 ? 67 DG  B C8     4  
ATOM 7229  N N7     . DG  B 2 1  ? 46.068 11.839 31.041 1.00 0.00 ? 67 DG  B N7     4  
ATOM 7230  C C5     . DG  B 2 1  ? 45.377 11.527 29.860 1.00 0.00 ? 67 DG  B C5     4  
ATOM 7231  C C6     . DG  B 2 1  ? 44.044 11.029 29.645 1.00 0.00 ? 67 DG  B C6     4  
ATOM 7232  O O6     . DG  B 2 1  ? 43.190 10.724 30.481 1.00 0.00 ? 67 DG  B O6     4  
ATOM 7233  N N1     . DG  B 2 1  ? 43.718 10.899 28.310 1.00 0.00 ? 67 DG  B N1     4  
ATOM 7234  C C2     . DG  B 2 1  ? 44.567 11.181 27.292 1.00 0.00 ? 67 DG  B C2     4  
ATOM 7235  N N2     . DG  B 2 1  ? 44.106 11.038 26.081 1.00 0.00 ? 67 DG  B N2     4  
ATOM 7236  N N3     . DG  B 2 1  ? 45.821 11.611 27.439 1.00 0.00 ? 67 DG  B N3     4  
ATOM 7237  C C4     . DG  B 2 1  ? 46.164 11.776 28.755 1.00 0.00 ? 67 DG  B C4     4  
ATOM 7238  H "H5'"  . DG  B 2 1  ? 51.369 10.084 29.508 1.00 0.00 ? 67 DG  B "H5'"  4  
ATOM 7239  H "H5''" . DG  B 2 1  ? 52.157 11.548 30.072 1.00 0.00 ? 67 DG  B "H5''" 4  
ATOM 7240  H "H4'"  . DG  B 2 1  ? 51.374 11.541 27.655 1.00 0.00 ? 67 DG  B "H4'"  4  
ATOM 7241  H "H3'"  . DG  B 2 1  ? 51.537 13.736 29.275 1.00 0.00 ? 67 DG  B "H3'"  4  
ATOM 7242  H "H2'"  . DG  B 2 1  ? 49.394 13.670 30.122 1.00 0.00 ? 67 DG  B "H2'"  4  
ATOM 7243  H "H2''" . DG  B 2 1  ? 49.049 14.722 28.735 1.00 0.00 ? 67 DG  B "H2''" 4  
ATOM 7244  H "H1'"  . DG  B 2 1  ? 48.184 12.984 27.431 1.00 0.00 ? 67 DG  B "H1'"  4  
ATOM 7245  H H8     . DG  B 2 1  ? 48.019 12.579 31.270 1.00 0.00 ? 67 DG  B H8     4  
ATOM 7246  H H1     . DG  B 2 1  ? 42.766 10.634 28.094 1.00 0.00 ? 67 DG  B H1     4  
ATOM 7247  H H21    . DG  B 2 1  ? 44.683 11.315 25.298 1.00 0.00 ? 67 DG  B H21    4  
ATOM 7248  H H22    . DG  B 2 1  ? 43.142 10.753 25.942 1.00 0.00 ? 67 DG  B H22    4  
ATOM 7249  H "HO5'" . DG  B 2 1  ? 49.618 10.504 30.709 1.00 0.00 ? 67 DG  B "HO5'" 4  
ATOM 7250  P P      . DC  B 2 2  ? 51.049 15.465 26.859 1.00 0.00 ? 68 DC  B P      4  
ATOM 7251  O OP1    . DC  B 2 2  ? 52.100 15.670 25.835 1.00 0.00 ? 68 DC  B OP1    4  
ATOM 7252  O OP2    . DC  B 2 2  ? 51.035 16.327 28.067 1.00 0.00 ? 68 DC  B OP2    4  
ATOM 7253  O "O5'"  . DC  B 2 2  ? 49.623 15.568 26.140 1.00 0.00 ? 68 DC  B "O5'"  4  
ATOM 7254  C "C5'"  . DC  B 2 2  ? 49.392 14.901 24.899 1.00 0.00 ? 68 DC  B "C5'"  4  
ATOM 7255  C "C4'"  . DC  B 2 2  ? 47.965 15.056 24.357 1.00 0.00 ? 68 DC  B "C4'"  4  
ATOM 7256  O "O4'"  . DC  B 2 2  ? 47.038 14.417 25.235 1.00 0.00 ? 68 DC  B "O4'"  4  
ATOM 7257  C "C3'"  . DC  B 2 2  ? 47.550 16.525 24.192 1.00 0.00 ? 68 DC  B "C3'"  4  
ATOM 7258  O "O3'"  . DC  B 2 2  ? 47.042 16.761 22.882 1.00 0.00 ? 68 DC  B "O3'"  4  
ATOM 7259  C "C2'"  . DC  B 2 2  ? 46.492 16.682 25.280 1.00 0.00 ? 68 DC  B "C2'"  4  
ATOM 7260  C "C1'"  . DC  B 2 2  ? 45.923 15.271 25.415 1.00 0.00 ? 68 DC  B "C1'"  4  
ATOM 7261  N N1     . DC  B 2 2  ? 45.282 15.013 26.739 1.00 0.00 ? 68 DC  B N1     4  
ATOM 7262  C C2     . DC  B 2 2  ? 43.943 14.603 26.791 1.00 0.00 ? 68 DC  B C2     4  
ATOM 7263  O O2     . DC  B 2 2  ? 43.282 14.409 25.774 1.00 0.00 ? 68 DC  B O2     4  
ATOM 7264  N N3     . DC  B 2 2  ? 43.314 14.413 27.975 1.00 0.00 ? 68 DC  B N3     4  
ATOM 7265  C C4     . DC  B 2 2  ? 43.993 14.615 29.083 1.00 0.00 ? 68 DC  B C4     4  
ATOM 7266  N N4     . DC  B 2 2  ? 43.362 14.373 30.193 1.00 0.00 ? 68 DC  B N4     4  
ATOM 7267  C C5     . DC  B 2 2  ? 45.359 15.010 29.104 1.00 0.00 ? 68 DC  B C5     4  
ATOM 7268  C C6     . DC  B 2 2  ? 45.977 15.196 27.909 1.00 0.00 ? 68 DC  B C6     4  
ATOM 7269  H "H5'"  . DC  B 2 2  ? 49.593 13.835 25.023 1.00 0.00 ? 68 DC  B "H5'"  4  
ATOM 7270  H "H5''" . DC  B 2 2  ? 50.085 15.291 24.152 1.00 0.00 ? 68 DC  B "H5''" 4  
ATOM 7271  H "H4'"  . DC  B 2 2  ? 47.917 14.579 23.376 1.00 0.00 ? 68 DC  B "H4'"  4  
ATOM 7272  H "H3'"  . DC  B 2 2  ? 48.404 17.177 24.381 1.00 0.00 ? 68 DC  B "H3'"  4  
ATOM 7273  H "H2'"  . DC  B 2 2  ? 46.981 17.006 26.198 1.00 0.00 ? 68 DC  B "H2'"  4  
ATOM 7274  H "H2''" . DC  B 2 2  ? 45.718 17.389 24.996 1.00 0.00 ? 68 DC  B "H2''" 4  
ATOM 7275  H "H1'"  . DC  B 2 2  ? 45.203 15.118 24.601 1.00 0.00 ? 68 DC  B "H1'"  4  
ATOM 7276  H H41    . DC  B 2 2  ? 42.412 14.021 30.162 1.00 0.00 ? 68 DC  B H41    4  
ATOM 7277  H H42    . DC  B 2 2  ? 43.860 14.452 31.068 1.00 0.00 ? 68 DC  B H42    4  
ATOM 7278  H H5     . DC  B 2 2  ? 45.902 15.155 30.024 1.00 0.00 ? 68 DC  B H5     4  
ATOM 7279  H H6     . DC  B 2 2  ? 47.020 15.490 27.864 1.00 0.00 ? 68 DC  B H6     4  
ATOM 7280  P P      . DT  B 2 3  ? 46.579 18.210 22.377 1.00 0.00 ? 69 DT  B P      4  
ATOM 7281  O OP1    . DT  B 2 3  ? 46.930 18.364 20.945 1.00 0.00 ? 69 DT  B OP1    4  
ATOM 7282  O OP2    . DT  B 2 3  ? 47.033 19.245 23.337 1.00 0.00 ? 69 DT  B OP2    4  
ATOM 7283  O "O5'"  . DT  B 2 3  ? 44.989 18.149 22.481 1.00 0.00 ? 69 DT  B "O5'"  4  
ATOM 7284  C "C5'"  . DT  B 2 3  ? 44.230 17.312 21.615 1.00 0.00 ? 69 DT  B "C5'"  4  
ATOM 7285  C "C4'"  . DT  B 2 3  ? 42.726 17.354 21.910 1.00 0.00 ? 69 DT  B "C4'"  4  
ATOM 7286  O "O4'"  . DT  B 2 3  ? 42.497 16.918 23.242 1.00 0.00 ? 69 DT  B "O4'"  4  
ATOM 7287  C "C3'"  . DT  B 2 3  ? 42.130 18.760 21.744 1.00 0.00 ? 69 DT  B "C3'"  4  
ATOM 7288  O "O3'"  . DT  B 2 3  ? 41.027 18.730 20.840 1.00 0.00 ? 69 DT  B "O3'"  4  
ATOM 7289  C "C2'"  . DT  B 2 3  ? 41.689 19.128 23.154 1.00 0.00 ? 69 DT  B "C2'"  4  
ATOM 7290  C "C1'"  . DT  B 2 3  ? 41.561 17.780 23.859 1.00 0.00 ? 69 DT  B "C1'"  4  
ATOM 7291  N N1     . DT  B 2 3  ? 41.831 17.843 25.321 1.00 0.00 ? 69 DT  B N1     4  
ATOM 7292  C C2     . DT  B 2 3  ? 40.799 17.486 26.196 1.00 0.00 ? 69 DT  B C2     4  
ATOM 7293  O O2     . DT  B 2 3  ? 39.639 17.288 25.839 1.00 0.00 ? 69 DT  B O2     4  
ATOM 7294  N N3     . DT  B 2 3  ? 41.123 17.385 27.526 1.00 0.00 ? 69 DT  B N3     4  
ATOM 7295  C C4     . DT  B 2 3  ? 42.347 17.676 28.081 1.00 0.00 ? 69 DT  B C4     4  
ATOM 7296  O O4     . DT  B 2 3  ? 42.505 17.512 29.291 1.00 0.00 ? 69 DT  B O4     4  
ATOM 7297  C C5     . DT  B 2 3  ? 43.350 18.161 27.133 1.00 0.00 ? 69 DT  B C5     4  
ATOM 7298  C C7     . DT  B 2 3  ? 44.709 18.617 27.636 1.00 0.00 ? 69 DT  B C7     4  
ATOM 7299  C C6     . DT  B 2 3  ? 43.068 18.224 25.802 1.00 0.00 ? 69 DT  B C6     4  
ATOM 7300  H "H5'"  . DT  B 2 3  ? 44.573 16.280 21.716 1.00 0.00 ? 69 DT  B "H5'"  4  
ATOM 7301  H "H5''" . DT  B 2 3  ? 44.379 17.630 20.582 1.00 0.00 ? 69 DT  B "H5''" 4  
ATOM 7302  H "H4'"  . DT  B 2 3  ? 42.221 16.678 21.220 1.00 0.00 ? 69 DT  B "H4'"  4  
ATOM 7303  H "H3'"  . DT  B 2 3  ? 42.900 19.451 21.396 1.00 0.00 ? 69 DT  B "H3'"  4  
ATOM 7304  H "H2'"  . DT  B 2 3  ? 42.455 19.747 23.619 1.00 0.00 ? 69 DT  B "H2'"  4  
ATOM 7305  H "H2''" . DT  B 2 3  ? 40.731 19.643 23.150 1.00 0.00 ? 69 DT  B "H2''" 4  
ATOM 7306  H "H1'"  . DT  B 2 3  ? 40.556 17.389 23.681 1.00 0.00 ? 69 DT  B "H1'"  4  
ATOM 7307  H H3     . DT  B 2 3  ? 40.384 17.091 28.149 1.00 0.00 ? 69 DT  B H3     4  
ATOM 7308  H H71    . DT  B 2 3  ? 45.209 17.796 28.147 1.00 0.00 ? 69 DT  B H71    4  
ATOM 7309  H H72    . DT  B 2 3  ? 45.334 18.979 26.820 1.00 0.00 ? 69 DT  B H72    4  
ATOM 7310  H H73    . DT  B 2 3  ? 44.573 19.423 28.358 1.00 0.00 ? 69 DT  B H73    4  
ATOM 7311  H H6     . DT  B 2 3  ? 43.814 18.572 25.097 1.00 0.00 ? 69 DT  B H6     4  
ATOM 7312  P P      . DC  B 2 4  ? 40.465 20.059 20.139 1.00 0.00 ? 70 DC  B P      4  
ATOM 7313  O OP1    . DC  B 2 4  ? 39.825 19.640 18.873 1.00 0.00 ? 70 DC  B OP1    4  
ATOM 7314  O OP2    . DC  B 2 4  ? 41.550 21.062 20.066 1.00 0.00 ? 70 DC  B OP2    4  
ATOM 7315  O "O5'"  . DC  B 2 4  ? 39.356 20.626 21.119 1.00 0.00 ? 70 DC  B "O5'"  4  
ATOM 7316  C "C5'"  . DC  B 2 4  ? 38.050 20.069 21.149 1.00 0.00 ? 70 DC  B "C5'"  4  
ATOM 7317  C "C4'"  . DC  B 2 4  ? 37.261 20.511 22.383 1.00 0.00 ? 70 DC  B "C4'"  4  
ATOM 7318  O "O4'"  . DC  B 2 4  ? 38.011 20.177 23.545 1.00 0.00 ? 70 DC  B "O4'"  4  
ATOM 7319  C "C3'"  . DC  B 2 4  ? 36.983 22.018 22.405 1.00 0.00 ? 70 DC  B "C3'"  4  
ATOM 7320  O "O3'"  . DC  B 2 4  ? 35.594 22.243 22.618 1.00 0.00 ? 70 DC  B "O3'"  4  
ATOM 7321  C "C2'"  . DC  B 2 4  ? 37.847 22.522 23.556 1.00 0.00 ? 70 DC  B "C2'"  4  
ATOM 7322  C "C1'"  . DC  B 2 4  ? 37.988 21.275 24.429 1.00 0.00 ? 70 DC  B "C1'"  4  
ATOM 7323  N N1     . DC  B 2 4  ? 39.195 21.228 25.306 1.00 0.00 ? 70 DC  B N1     4  
ATOM 7324  C C2     . DC  B 2 4  ? 39.054 20.674 26.582 1.00 0.00 ? 70 DC  B C2     4  
ATOM 7325  O O2     . DC  B 2 4  ? 37.990 20.173 26.948 1.00 0.00 ? 70 DC  B O2     4  
ATOM 7326  N N3     . DC  B 2 4  ? 40.092 20.664 27.452 1.00 0.00 ? 70 DC  B N3     4  
ATOM 7327  C C4     . DC  B 2 4  ? 41.260 21.118 27.049 1.00 0.00 ? 70 DC  B C4     4  
ATOM 7328  N N4     . DC  B 2 4  ? 42.226 21.070 27.916 1.00 0.00 ? 70 DC  B N4     4  
ATOM 7329  C C5     . DC  B 2 4  ? 41.493 21.601 25.737 1.00 0.00 ? 70 DC  B C5     4  
ATOM 7330  C C6     . DC  B 2 4  ? 40.435 21.653 24.889 1.00 0.00 ? 70 DC  B C6     4  
ATOM 7331  H "H5'"  . DC  B 2 4  ? 38.104 18.984 21.154 1.00 0.00 ? 70 DC  B "H5'"  4  
ATOM 7332  H "H5''" . DC  B 2 4  ? 37.512 20.368 20.252 1.00 0.00 ? 70 DC  B "H5''" 4  
ATOM 7333  H "H4'"  . DC  B 2 4  ? 36.309 19.981 22.400 1.00 0.00 ? 70 DC  B "H4'"  4  
ATOM 7334  H "H3'"  . DC  B 2 4  ? 37.305 22.469 21.466 1.00 0.00 ? 70 DC  B "H3'"  4  
ATOM 7335  H "H2'"  . DC  B 2 4  ? 38.800 22.851 23.150 1.00 0.00 ? 70 DC  B "H2'"  4  
ATOM 7336  H "H2''" . DC  B 2 4  ? 37.374 23.332 24.110 1.00 0.00 ? 70 DC  B "H2''" 4  
ATOM 7337  H "H1'"  . DC  B 2 4  ? 37.079 21.205 25.038 1.00 0.00 ? 70 DC  B "H1'"  4  
ATOM 7338  H H41    . DC  B 2 4  ? 43.161 21.332 27.635 1.00 0.00 ? 70 DC  B H41    4  
ATOM 7339  H H42    . DC  B 2 4  ? 42.005 20.719 28.841 1.00 0.00 ? 70 DC  B H42    4  
ATOM 7340  H H5     . DC  B 2 4  ? 42.471 21.922 25.408 1.00 0.00 ? 70 DC  B H5     4  
ATOM 7341  H H6     . DC  B 2 4  ? 40.577 21.999 23.871 1.00 0.00 ? 70 DC  B H6     4  
ATOM 7342  P P      . DT  B 2 5  ? 34.930 23.686 22.493 1.00 0.00 ? 71 DT  B P      4  
ATOM 7343  O OP1    . DT  B 2 5  ? 33.541 23.507 22.024 1.00 0.00 ? 71 DT  B OP1    4  
ATOM 7344  O OP2    . DT  B 2 5  ? 35.821 24.564 21.697 1.00 0.00 ? 71 DT  B OP2    4  
ATOM 7345  O "O5'"  . DT  B 2 5  ? 34.894 24.249 23.982 1.00 0.00 ? 71 DT  B "O5'"  4  
ATOM 7346  C "C5'"  . DT  B 2 5  ? 34.034 23.686 24.967 1.00 0.00 ? 71 DT  B "C5'"  4  
ATOM 7347  C "C4'"  . DT  B 2 5  ? 34.329 24.227 26.370 1.00 0.00 ? 71 DT  B "C4'"  4  
ATOM 7348  O "O4'"  . DT  B 2 5  ? 35.624 23.787 26.771 1.00 0.00 ? 71 DT  B "O4'"  4  
ATOM 7349  C "C3'"  . DT  B 2 5  ? 34.317 25.767 26.445 1.00 0.00 ? 71 DT  B "C3'"  4  
ATOM 7350  O "O3'"  . DT  B 2 5  ? 33.691 26.238 27.630 1.00 0.00 ? 71 DT  B "O3'"  4  
ATOM 7351  C "C2'"  . DT  B 2 5  ? 35.804 26.087 26.554 1.00 0.00 ? 71 DT  B "C2'"  4  
ATOM 7352  C "C1'"  . DT  B 2 5  ? 36.254 24.889 27.392 1.00 0.00 ? 71 DT  B "C1'"  4  
ATOM 7353  N N1     . DT  B 2 5  ? 37.722 24.665 27.527 1.00 0.00 ? 71 DT  B N1     4  
ATOM 7354  C C2     . DT  B 2 5  ? 38.175 24.213 28.775 1.00 0.00 ? 71 DT  B C2     4  
ATOM 7355  O O2     . DT  B 2 5  ? 37.429 23.930 29.710 1.00 0.00 ? 71 DT  B O2     4  
ATOM 7356  N N3     . DT  B 2 5  ? 39.534 24.101 28.943 1.00 0.00 ? 71 DT  B N3     4  
ATOM 7357  C C4     . DT  B 2 5  ? 40.492 24.400 28.005 1.00 0.00 ? 71 DT  B C4     4  
ATOM 7358  O O4     . DT  B 2 5  ? 41.682 24.321 28.318 1.00 0.00 ? 71 DT  B O4     4  
ATOM 7359  C C5     . DT  B 2 5  ? 39.958 24.815 26.705 1.00 0.00 ? 71 DT  B C5     4  
ATOM 7360  C C7     . DT  B 2 5  ? 40.909 25.145 25.568 1.00 0.00 ? 71 DT  B C7     4  
ATOM 7361  C C6     . DT  B 2 5  ? 38.616 24.930 26.505 1.00 0.00 ? 71 DT  B C6     4  
ATOM 7362  H "H5'"  . DT  B 2 5  ? 34.154 22.601 24.985 1.00 0.00 ? 71 DT  B "H5'"  4  
ATOM 7363  H "H5''" . DT  B 2 5  ? 32.998 23.911 24.724 1.00 0.00 ? 71 DT  B "H5''" 4  
ATOM 7364  H "H4'"  . DT  B 2 5  ? 33.588 23.834 27.066 1.00 0.00 ? 71 DT  B "H4'"  4  
ATOM 7365  H "H3'"  . DT  B 2 5  ? 33.879 26.224 25.555 1.00 0.00 ? 71 DT  B "H3'"  4  
ATOM 7366  H "H2'"  . DT  B 2 5  ? 36.251 26.083 25.562 1.00 0.00 ? 71 DT  B "H2'"  4  
ATOM 7367  H "H2''" . DT  B 2 5  ? 35.978 27.033 27.068 1.00 0.00 ? 71 DT  B "H2''" 4  
ATOM 7368  H "H1'"  . DT  B 2 5  ? 35.823 25.024 28.391 1.00 0.00 ? 71 DT  B "H1'"  4  
ATOM 7369  H H3     . DT  B 2 5  ? 39.847 23.800 29.857 1.00 0.00 ? 71 DT  B H3     4  
ATOM 7370  H H71    . DT  B 2 5  ? 41.562 25.960 25.873 1.00 0.00 ? 71 DT  B H71    4  
ATOM 7371  H H72    . DT  B 2 5  ? 41.542 24.286 25.353 1.00 0.00 ? 71 DT  B H72    4  
ATOM 7372  H H73    . DT  B 2 5  ? 40.367 25.421 24.663 1.00 0.00 ? 71 DT  B H73    4  
ATOM 7373  H H6     . DT  B 2 5  ? 38.245 25.232 25.531 1.00 0.00 ? 71 DT  B H6     4  
ATOM 7374  P P      . DA  B 2 6  ? 32.111 26.435 27.765 1.00 0.00 ? 72 DA  B P      4  
ATOM 7375  O OP1    . DA  B 2 6  ? 31.417 25.356 27.020 1.00 0.00 ? 72 DA  B OP1    4  
ATOM 7376  O OP2    . DA  B 2 6  ? 31.799 27.839 27.443 1.00 0.00 ? 72 DA  B OP2    4  
ATOM 7377  O "O5'"  . DA  B 2 6  ? 31.895 26.246 29.336 1.00 0.00 ? 72 DA  B "O5'"  4  
ATOM 7378  C "C5'"  . DA  B 2 6  ? 31.689 24.972 29.932 1.00 0.00 ? 72 DA  B "C5'"  4  
ATOM 7379  C "C4'"  . DA  B 2 6  ? 31.975 24.947 31.447 1.00 0.00 ? 72 DA  B "C4'"  4  
ATOM 7380  O "O4'"  . DA  B 2 6  ? 33.374 24.883 31.677 1.00 0.00 ? 72 DA  B "O4'"  4  
ATOM 7381  C "C3'"  . DA  B 2 6  ? 31.453 26.142 32.252 1.00 0.00 ? 72 DA  B "C3'"  4  
ATOM 7382  O "O3'"  . DA  B 2 6  ? 31.133 25.692 33.563 1.00 0.00 ? 72 DA  B "O3'"  4  
ATOM 7383  C "C2'"  . DA  B 2 6  ? 32.654 27.082 32.236 1.00 0.00 ? 72 DA  B "C2'"  4  
ATOM 7384  C "C1'"  . DA  B 2 6  ? 33.817 26.093 32.264 1.00 0.00 ? 72 DA  B "C1'"  4  
ATOM 7385  N N9     . DA  B 2 6  ? 35.030 26.534 31.544 1.00 0.00 ? 72 DA  B N9     4  
ATOM 7386  C C8     . DA  B 2 6  ? 35.154 27.163 30.325 1.00 0.00 ? 72 DA  B C8     4  
ATOM 7387  N N7     . DA  B 2 6  ? 36.393 27.387 29.959 1.00 0.00 ? 72 DA  B N7     4  
ATOM 7388  C C5     . DA  B 2 6  ? 37.130 26.875 31.040 1.00 0.00 ? 72 DA  B C5     4  
ATOM 7389  C C6     . DA  B 2 6  ? 38.503 26.771 31.356 1.00 0.00 ? 72 DA  B C6     4  
ATOM 7390  N N6     . DA  B 2 6  ? 39.482 27.207 30.588 1.00 0.00 ? 72 DA  B N6     4  
ATOM 7391  N N1     . DA  B 2 6  ? 38.911 26.238 32.508 1.00 0.00 ? 72 DA  B N1     4  
ATOM 7392  C C2     . DA  B 2 6  ? 37.991 25.771 33.339 1.00 0.00 ? 72 DA  B C2     4  
ATOM 7393  N N3     . DA  B 2 6  ? 36.675 25.733 33.163 1.00 0.00 ? 72 DA  B N3     4  
ATOM 7394  C C4     . DA  B 2 6  ? 36.309 26.340 31.995 1.00 0.00 ? 72 DA  B C4     4  
ATOM 7395  H "H5'"  . DA  B 2 6  ? 32.342 24.235 29.459 1.00 0.00 ? 72 DA  B "H5'"  4  
ATOM 7396  H "H5''" . DA  B 2 6  ? 30.658 24.665 29.758 1.00 0.00 ? 72 DA  B "H5''" 4  
ATOM 7397  H "H4'"  . DA  B 2 6  ? 31.521 24.046 31.852 1.00 0.00 ? 72 DA  B "H4'"  4  
ATOM 7398  H "H3'"  . DA  B 2 6  ? 30.587 26.587 31.769 1.00 0.00 ? 72 DA  B "H3'"  4  
ATOM 7399  H "H2'"  . DA  B 2 6  ? 32.655 27.666 31.319 1.00 0.00 ? 72 DA  B "H2'"  4  
ATOM 7400  H "H2''" . DA  B 2 6  ? 32.669 27.745 33.096 1.00 0.00 ? 72 DA  B "H2''" 4  
ATOM 7401  H "H1'"  . DA  B 2 6  ? 34.069 25.907 33.312 1.00 0.00 ? 72 DA  B "H1'"  4  
ATOM 7402  H H8     . DA  B 2 6  ? 34.297 27.433 29.720 1.00 0.00 ? 72 DA  B H8     4  
ATOM 7403  H H61    . DA  B 2 6  ? 39.263 27.756 29.772 1.00 0.00 ? 72 DA  B H61    4  
ATOM 7404  H H62    . DA  B 2 6  ? 40.431 27.068 30.907 1.00 0.00 ? 72 DA  B H62    4  
ATOM 7405  H H2     . DA  B 2 6  ? 38.360 25.337 34.260 1.00 0.00 ? 72 DA  B H2     4  
ATOM 7406  P P      . DA  B 2 7  ? 30.480 26.619 34.693 1.00 0.00 ? 73 DA  B P      4  
ATOM 7407  O OP1    . DA  B 2 7  ? 29.827 25.697 35.643 1.00 0.00 ? 73 DA  B OP1    4  
ATOM 7408  O OP2    . DA  B 2 7  ? 29.674 27.689 34.070 1.00 0.00 ? 73 DA  B OP2    4  
ATOM 7409  O "O5'"  . DA  B 2 7  ? 31.727 27.279 35.456 1.00 0.00 ? 73 DA  B "O5'"  4  
ATOM 7410  C "C5'"  . DA  B 2 7  ? 32.410 26.567 36.476 1.00 0.00 ? 73 DA  B "C5'"  4  
ATOM 7411  C "C4'"  . DA  B 2 7  ? 33.569 27.335 37.116 1.00 0.00 ? 73 DA  B "C4'"  4  
ATOM 7412  O "O4'"  . DA  B 2 7  ? 34.620 27.466 36.170 1.00 0.00 ? 73 DA  B "O4'"  4  
ATOM 7413  C "C3'"  . DA  B 2 7  ? 33.181 28.729 37.626 1.00 0.00 ? 73 DA  B "C3'"  4  
ATOM 7414  O "O3'"  . DA  B 2 7  ? 33.757 28.939 38.910 1.00 0.00 ? 73 DA  B "O3'"  4  
ATOM 7415  C "C2'"  . DA  B 2 7  ? 33.783 29.618 36.544 1.00 0.00 ? 73 DA  B "C2'"  4  
ATOM 7416  C "C1'"  . DA  B 2 7  ? 35.025 28.820 36.149 1.00 0.00 ? 73 DA  B "C1'"  4  
ATOM 7417  N N9     . DA  B 2 7  ? 35.551 29.168 34.812 1.00 0.00 ? 73 DA  B N9     4  
ATOM 7418  C C8     . DA  B 2 7  ? 34.862 29.585 33.698 1.00 0.00 ? 73 DA  B C8     4  
ATOM 7419  N N7     . DA  B 2 7  ? 35.617 29.907 32.684 1.00 0.00 ? 73 DA  B N7     4  
ATOM 7420  C C5     . DA  B 2 7  ? 36.911 29.679 33.179 1.00 0.00 ? 73 DA  B C5     4  
ATOM 7421  C C6     . DA  B 2 7  ? 38.216 29.857 32.669 1.00 0.00 ? 73 DA  B C6     4  
ATOM 7422  N N6     . DA  B 2 7  ? 38.489 30.355 31.484 1.00 0.00 ? 73 DA  B N6     4  
ATOM 7423  N N1     . DA  B 2 7  ? 39.299 29.541 33.383 1.00 0.00 ? 73 DA  B N1     4  
ATOM 7424  C C2     . DA  B 2 7  ? 39.106 29.068 34.607 1.00 0.00 ? 73 DA  B C2     4  
ATOM 7425  N N3     . DA  B 2 7  ? 37.954 28.880 35.240 1.00 0.00 ? 73 DA  B N3     4  
ATOM 7426  C C4     . DA  B 2 7  ? 36.882 29.206 34.462 1.00 0.00 ? 73 DA  B C4     4  
ATOM 7427  H "H5'"  . DA  B 2 7  ? 32.805 25.644 36.056 1.00 0.00 ? 73 DA  B "H5'"  4  
ATOM 7428  H "H5''" . DA  B 2 7  ? 31.697 26.325 37.263 1.00 0.00 ? 73 DA  B "H5''" 4  
ATOM 7429  H "H4'"  . DA  B 2 7  ? 33.935 26.760 37.965 1.00 0.00 ? 73 DA  B "H4'"  4  
ATOM 7430  H "H3'"  . DA  B 2 7  ? 32.094 28.849 37.662 1.00 0.00 ? 73 DA  B "H3'"  4  
ATOM 7431  H "H2'"  . DA  B 2 7  ? 33.074 29.688 35.722 1.00 0.00 ? 73 DA  B "H2'"  4  
ATOM 7432  H "H2''" . DA  B 2 7  ? 34.033 30.616 36.898 1.00 0.00 ? 73 DA  B "H2''" 4  
ATOM 7433  H "H1'"  . DA  B 2 7  ? 35.802 28.976 36.904 1.00 0.00 ? 73 DA  B "H1'"  4  
ATOM 7434  H H8     . DA  B 2 7  ? 33.782 29.650 33.669 1.00 0.00 ? 73 DA  B H8     4  
ATOM 7435  H H61    . DA  B 2 7  ? 37.722 30.673 30.905 1.00 0.00 ? 73 DA  B H61    4  
ATOM 7436  H H62    . DA  B 2 7  ? 39.450 30.576 31.299 1.00 0.00 ? 73 DA  B H62    4  
ATOM 7437  H H2     . DA  B 2 7  ? 39.998 28.822 35.167 1.00 0.00 ? 73 DA  B H2     4  
ATOM 7438  P P      . DT  B 2 8  ? 33.444 30.252 39.770 1.00 0.00 ? 74 DT  B P      4  
ATOM 7439  O OP1    . DT  B 2 8  ? 33.732 29.899 41.176 1.00 0.00 ? 74 DT  B OP1    4  
ATOM 7440  O OP2    . DT  B 2 8  ? 32.093 30.727 39.423 1.00 0.00 ? 74 DT  B OP2    4  
ATOM 7441  O "O5'"  . DT  B 2 8  ? 34.483 31.351 39.262 1.00 0.00 ? 74 DT  B "O5'"  4  
ATOM 7442  C "C5'"  . DT  B 2 8  ? 35.388 32.024 40.121 1.00 0.00 ? 74 DT  B "C5'"  4  
ATOM 7443  C "C4'"  . DT  B 2 8  ? 36.619 31.174 40.502 1.00 0.00 ? 74 DT  B "C4'"  4  
ATOM 7444  O "O4'"  . DT  B 2 8  ? 37.183 30.510 39.371 1.00 0.00 ? 74 DT  B "O4'"  4  
ATOM 7445  C "C3'"  . DT  B 2 8  ? 37.705 32.091 41.069 1.00 0.00 ? 74 DT  B "C3'"  4  
ATOM 7446  O "O3'"  . DT  B 2 8  ? 38.495 31.419 42.035 1.00 0.00 ? 74 DT  B "O3'"  4  
ATOM 7447  C "C2'"  . DT  B 2 8  ? 38.501 32.441 39.818 1.00 0.00 ? 74 DT  B "C2'"  4  
ATOM 7448  C "C1'"  . DT  B 2 8  ? 38.330 31.222 38.909 1.00 0.00 ? 74 DT  B "C1'"  4  
ATOM 7449  N N1     . DT  B 2 8  ? 38.211 31.649 37.482 1.00 0.00 ? 74 DT  B N1     4  
ATOM 7450  C C2     . DT  B 2 8  ? 39.378 31.733 36.707 1.00 0.00 ? 74 DT  B C2     4  
ATOM 7451  O O2     . DT  B 2 8  ? 40.490 31.388 37.101 1.00 0.00 ? 74 DT  B O2     4  
ATOM 7452  N N3     . DT  B 2 8  ? 39.245 32.234 35.432 1.00 0.00 ? 74 DT  B N3     4  
ATOM 7453  C C4     . DT  B 2 8  ? 38.074 32.648 34.844 1.00 0.00 ? 74 DT  B C4     4  
ATOM 7454  O O4     . DT  B 2 8  ? 38.096 33.042 33.680 1.00 0.00 ? 74 DT  B O4     4  
ATOM 7455  C C5     . DT  B 2 8  ? 36.901 32.553 35.705 1.00 0.00 ? 74 DT  B C5     4  
ATOM 7456  C C7     . DT  B 2 8  ? 35.556 33.015 35.199 1.00 0.00 ? 74 DT  B C7     4  
ATOM 7457  C C6     . DT  B 2 8  ? 37.001 32.068 36.970 1.00 0.00 ? 74 DT  B C6     4  
ATOM 7458  H "H5'"  . DT  B 2 8  ? 34.867 32.326 41.030 1.00 0.00 ? 74 DT  B "H5'"  4  
ATOM 7459  H "H5''" . DT  B 2 8  ? 35.723 32.927 39.610 1.00 0.00 ? 74 DT  B "H5''" 4  
ATOM 7460  H "H4'"  . DT  B 2 8  ? 36.322 30.450 41.260 1.00 0.00 ? 74 DT  B "H4'"  4  
ATOM 7461  H "H3'"  . DT  B 2 8  ? 37.255 32.986 41.493 1.00 0.00 ? 74 DT  B "H3'"  4  
ATOM 7462  H "H2'"  . DT  B 2 8  ? 38.074 33.330 39.356 1.00 0.00 ? 74 DT  B "H2'"  4  
ATOM 7463  H "H2''" . DT  B 2 8  ? 39.552 32.603 40.043 1.00 0.00 ? 74 DT  B "H2''" 4  
ATOM 7464  H "H1'"  . DT  B 2 8  ? 39.206 30.579 39.027 1.00 0.00 ? 74 DT  B "H1'"  4  
ATOM 7465  H H3     . DT  B 2 8  ? 40.077 32.308 34.864 1.00 0.00 ? 74 DT  B H3     4  
ATOM 7466  H H71    . DT  B 2 8  ? 35.637 34.049 34.863 1.00 0.00 ? 74 DT  B H71    4  
ATOM 7467  H H72    . DT  B 2 8  ? 35.258 32.400 34.349 1.00 0.00 ? 74 DT  B H72    4  
ATOM 7468  H H73    . DT  B 2 8  ? 34.807 32.956 35.988 1.00 0.00 ? 74 DT  B H73    4  
ATOM 7469  H H6     . DT  B 2 8  ? 36.117 32.010 37.587 1.00 0.00 ? 74 DT  B H6     4  
ATOM 7470  P P      . DC  B 2 9  ? 39.286 32.211 43.168 1.00 0.00 ? 75 DC  B P      4  
ATOM 7471  O OP1    . DC  B 2 9  ? 39.785 31.211 44.135 1.00 0.00 ? 75 DC  B OP1    4  
ATOM 7472  O OP2    . DC  B 2 9  ? 38.398 33.269 43.699 1.00 0.00 ? 75 DC  B OP2    4  
ATOM 7473  O "O5'"  . DC  B 2 9  ? 40.516 32.956 42.454 1.00 0.00 ? 75 DC  B "O5'"  4  
ATOM 7474  C "C5'"  . DC  B 2 9  ? 41.691 32.247 42.065 1.00 0.00 ? 75 DC  B "C5'"  4  
ATOM 7475  C "C4'"  . DC  B 2 9  ? 42.642 33.028 41.136 1.00 0.00 ? 75 DC  B "C4'"  4  
ATOM 7476  O "O4'"  . DC  B 2 9  ? 42.046 33.221 39.859 1.00 0.00 ? 75 DC  B "O4'"  4  
ATOM 7477  C "C3'"  . DC  B 2 9  ? 43.090 34.407 41.652 1.00 0.00 ? 75 DC  B "C3'"  4  
ATOM 7478  O "O3'"  . DC  B 2 9  ? 44.486 34.369 41.955 1.00 0.00 ? 75 DC  B "O3'"  4  
ATOM 7479  C "C2'"  . DC  B 2 9  ? 42.753 35.329 40.474 1.00 0.00 ? 75 DC  B "C2'"  4  
ATOM 7480  C "C1'"  . DC  B 2 9  ? 42.573 34.395 39.276 1.00 0.00 ? 75 DC  B "C1'"  4  
ATOM 7481  N N1     . DC  B 2 9  ? 41.620 34.896 38.240 1.00 0.00 ? 75 DC  B N1     4  
ATOM 7482  C C2     . DC  B 2 9  ? 42.044 35.089 36.915 1.00 0.00 ? 75 DC  B C2     4  
ATOM 7483  O O2     . DC  B 2 9  ? 43.227 34.977 36.584 1.00 0.00 ? 75 DC  B O2     4  
ATOM 7484  N N3     . DC  B 2 9  ? 41.162 35.414 35.936 1.00 0.00 ? 75 DC  B N3     4  
ATOM 7485  C C4     . DC  B 2 9  ? 39.897 35.577 36.271 1.00 0.00 ? 75 DC  B C4     4  
ATOM 7486  N N4     . DC  B 2 9  ? 39.054 35.836 35.316 1.00 0.00 ? 75 DC  B N4     4  
ATOM 7487  C C5     . DC  B 2 9  ? 39.414 35.443 37.599 1.00 0.00 ? 75 DC  B C5     4  
ATOM 7488  C C6     . DC  B 2 9  ? 40.304 35.101 38.561 1.00 0.00 ? 75 DC  B C6     4  
ATOM 7489  H "H5'"  . DC  B 2 9  ? 41.397 31.330 41.553 1.00 0.00 ? 75 DC  B "H5'"  4  
ATOM 7490  H "H5''" . DC  B 2 9  ? 42.245 31.959 42.957 1.00 0.00 ? 75 DC  B "H5''" 4  
ATOM 7491  H "H4'"  . DC  B 2 9  ? 43.537 32.418 41.000 1.00 0.00 ? 75 DC  B "H4'"  4  
ATOM 7492  H "H3'"  . DC  B 2 9  ? 42.512 34.687 42.535 1.00 0.00 ? 75 DC  B "H3'"  4  
ATOM 7493  H "H2'"  . DC  B 2 9  ? 41.836 35.877 40.692 1.00 0.00 ? 75 DC  B "H2'"  4  
ATOM 7494  H "H2''" . DC  B 2 9  ? 43.559 36.023 40.268 1.00 0.00 ? 75 DC  B "H2''" 4  
ATOM 7495  H "H1'"  . DC  B 2 9  ? 43.551 34.171 38.839 1.00 0.00 ? 75 DC  B "H1'"  4  
ATOM 7496  H H41    . DC  B 2 9  ? 38.087 36.001 35.564 1.00 0.00 ? 75 DC  B H41    4  
ATOM 7497  H H42    . DC  B 2 9  ? 39.389 35.863 34.362 1.00 0.00 ? 75 DC  B H42    4  
ATOM 7498  H H5     . DC  B 2 9  ? 38.375 35.591 37.851 1.00 0.00 ? 75 DC  B H5     4  
ATOM 7499  H H6     . DC  B 2 9  ? 39.983 34.969 39.586 1.00 0.00 ? 75 DC  B H6     4  
ATOM 7500  P P      . DC  B 2 10 ? 45.276 35.576 42.650 1.00 0.00 ? 76 DC  B P      4  
ATOM 7501  O OP1    . DC  B 2 10 ? 46.540 35.043 43.202 1.00 0.00 ? 76 DC  B OP1    4  
ATOM 7502  O OP2    . DC  B 2 10 ? 44.367 36.317 43.552 1.00 0.00 ? 76 DC  B OP2    4  
ATOM 7503  O "O5'"  . DC  B 2 10 ? 45.662 36.560 41.452 1.00 0.00 ? 76 DC  B "O5'"  4  
ATOM 7504  C "C5'"  . DC  B 2 10 ? 46.578 36.142 40.443 1.00 0.00 ? 76 DC  B "C5'"  4  
ATOM 7505  C "C4'"  . DC  B 2 10 ? 46.611 37.087 39.236 1.00 0.00 ? 76 DC  B "C4'"  4  
ATOM 7506  O "O4'"  . DC  B 2 10 ? 45.374 37.023 38.547 1.00 0.00 ? 76 DC  B "O4'"  4  
ATOM 7507  C "C3'"  . DC  B 2 10 ? 46.875 38.565 39.577 1.00 0.00 ? 76 DC  B "C3'"  4  
ATOM 7508  O "O3'"  . DC  B 2 10 ? 48.164 38.936 39.100 1.00 0.00 ? 76 DC  B "O3'"  4  
ATOM 7509  C "C2'"  . DC  B 2 10 ? 45.714 39.290 38.886 1.00 0.00 ? 76 DC  B "C2'"  4  
ATOM 7510  C "C1'"  . DC  B 2 10 ? 45.167 38.260 37.901 1.00 0.00 ? 76 DC  B "C1'"  4  
ATOM 7511  N N1     . DC  B 2 10 ? 43.719 38.447 37.624 1.00 0.00 ? 76 DC  B N1     4  
ATOM 7512  C C2     . DC  B 2 10 ? 43.282 38.748 36.327 1.00 0.00 ? 76 DC  B C2     4  
ATOM 7513  O O2     . DC  B 2 10 ? 44.076 38.920 35.397 1.00 0.00 ? 76 DC  B O2     4  
ATOM 7514  N N3     . DC  B 2 10 ? 41.957 38.872 36.056 1.00 0.00 ? 76 DC  B N3     4  
ATOM 7515  C C4     . DC  B 2 10 ? 41.097 38.730 37.047 1.00 0.00 ? 76 DC  B C4     4  
ATOM 7516  N N4     . DC  B 2 10 ? 39.833 38.866 36.777 1.00 0.00 ? 76 DC  B N4     4  
ATOM 7517  C C5     . DC  B 2 10 ? 41.482 38.446 38.380 1.00 0.00 ? 76 DC  B C5     4  
ATOM 7518  C C6     . DC  B 2 10 ? 42.804 38.324 38.637 1.00 0.00 ? 76 DC  B C6     4  
ATOM 7519  H "H5'"  . DC  B 2 10 ? 46.290 35.152 40.085 1.00 0.00 ? 76 DC  B "H5'"  4  
ATOM 7520  H "H5''" . DC  B 2 10 ? 47.580 36.061 40.864 1.00 0.00 ? 76 DC  B "H5''" 4  
ATOM 7521  H "H4'"  . DC  B 2 10 ? 47.394 36.746 38.556 1.00 0.00 ? 76 DC  B "H4'"  4  
ATOM 7522  H "H3'"  . DC  B 2 10 ? 46.822 38.729 40.654 1.00 0.00 ? 76 DC  B "H3'"  4  
ATOM 7523  H "H2'"  . DC  B 2 10 ? 44.970 39.560 39.637 1.00 0.00 ? 76 DC  B "H2'"  4  
ATOM 7524  H "H2''" . DC  B 2 10 ? 46.022 40.180 38.352 1.00 0.00 ? 76 DC  B "H2''" 4  
ATOM 7525  H "H1'"  . DC  B 2 10 ? 45.752 38.300 36.975 1.00 0.00 ? 76 DC  B "H1'"  4  
ATOM 7526  H H41    . DC  B 2 10 ? 39.172 38.818 37.541 1.00 0.00 ? 76 DC  B H41    4  
ATOM 7527  H H42    . DC  B 2 10 ? 39.546 39.000 35.814 1.00 0.00 ? 76 DC  B H42    4  
ATOM 7528  H H5     . DC  B 2 10 ? 40.763 38.337 39.176 1.00 0.00 ? 76 DC  B H5     4  
ATOM 7529  H H6     . DC  B 2 10 ? 43.148 38.116 39.643 1.00 0.00 ? 76 DC  B H6     4  
ATOM 7530  P P      . DC  B 2 11 ? 48.743 40.427 39.200 1.00 0.00 ? 77 DC  B P      4  
ATOM 7531  O OP1    . DC  B 2 11 ? 50.212 40.346 39.048 1.00 0.00 ? 77 DC  B OP1    4  
ATOM 7532  O OP2    . DC  B 2 11 ? 48.173 41.081 40.396 1.00 0.00 ? 77 DC  B OP2    4  
ATOM 7533  O "O5'"  . DC  B 2 11 ? 48.184 41.174 37.927 1.00 0.00 ? 77 DC  B "O5'"  4  
ATOM 7534  C "C5'"  . DC  B 2 11 ? 48.509 40.751 36.610 1.00 0.00 ? 77 DC  B "C5'"  4  
ATOM 7535  C "C4'"  . DC  B 2 11 ? 47.738 41.585 35.587 1.00 0.00 ? 77 DC  B "C4'"  4  
ATOM 7536  O "O4'"  . DC  B 2 11 ? 46.351 41.309 35.702 1.00 0.00 ? 77 DC  B "O4'"  4  
ATOM 7537  C "C3'"  . DC  B 2 11 ? 47.929 43.101 35.792 1.00 0.00 ? 77 DC  B "C3'"  4  
ATOM 7538  O "O3'"  . DC  B 2 11 ? 48.489 43.692 34.625 1.00 0.00 ? 77 DC  B "O3'"  4  
ATOM 7539  C "C2'"  . DC  B 2 11 ? 46.508 43.599 36.049 1.00 0.00 ? 77 DC  B "C2'"  4  
ATOM 7540  C "C1'"  . DC  B 2 11 ? 45.666 42.503 35.404 1.00 0.00 ? 77 DC  B "C1'"  4  
ATOM 7541  N N1     . DC  B 2 11 ? 44.258 42.442 35.886 1.00 0.00 ? 77 DC  B N1     4  
ATOM 7542  C C2     . DC  B 2 11 ? 43.228 42.663 34.970 1.00 0.00 ? 77 DC  B C2     4  
ATOM 7543  O O2     . DC  B 2 11 ? 43.474 42.997 33.811 1.00 0.00 ? 77 DC  B O2     4  
ATOM 7544  N N3     . DC  B 2 11 ? 41.929 42.538 35.332 1.00 0.00 ? 77 DC  B N3     4  
ATOM 7545  C C4     . DC  B 2 11 ? 41.660 42.233 36.586 1.00 0.00 ? 77 DC  B C4     4  
ATOM 7546  N N4     . DC  B 2 11 ? 40.403 42.116 36.896 1.00 0.00 ? 77 DC  B N4     4  
ATOM 7547  C C5     . DC  B 2 11 ? 42.660 42.039 37.579 1.00 0.00 ? 77 DC  B C5     4  
ATOM 7548  C C6     . DC  B 2 11 ? 43.956 42.147 37.190 1.00 0.00 ? 77 DC  B C6     4  
ATOM 7549  H "H5'"  . DC  B 2 11 ? 48.240 39.702 36.480 1.00 0.00 ? 77 DC  B "H5'"  4  
ATOM 7550  H "H5''" . DC  B 2 11 ? 49.579 40.868 36.432 1.00 0.00 ? 77 DC  B "H5''" 4  
ATOM 7551  H "H4'"  . DC  B 2 11 ? 48.073 41.314 34.585 1.00 0.00 ? 77 DC  B "H4'"  4  
ATOM 7552  H "H3'"  . DC  B 2 11 ? 48.561 43.287 36.661 1.00 0.00 ? 77 DC  B "H3'"  4  
ATOM 7553  H "H2'"  . DC  B 2 11 ? 46.330 43.654 37.123 1.00 0.00 ? 77 DC  B "H2'"  4  
ATOM 7554  H "H2''" . DC  B 2 11 ? 46.325 44.562 35.575 1.00 0.00 ? 77 DC  B "H2''" 4  
ATOM 7555  H "H1'"  . DC  B 2 11 ? 45.686 42.651 34.322 1.00 0.00 ? 77 DC  B "H1'"  4  
ATOM 7556  H H41    . DC  B 2 11 ? 40.157 41.952 37.857 1.00 0.00 ? 77 DC  B H41    4  
ATOM 7557  H H42    . DC  B 2 11 ? 39.699 42.151 36.172 1.00 0.00 ? 77 DC  B H42    4  
ATOM 7558  H H5     . DC  B 2 11 ? 42.416 41.799 38.602 1.00 0.00 ? 77 DC  B H5     4  
ATOM 7559  H H6     . DC  B 2 11 ? 44.763 41.993 37.893 1.00 0.00 ? 77 DC  B H6     4  
ATOM 7560  P P      . DC  B 2 12 ? 49.162 45.147 34.643 1.00 0.00 ? 78 DC  B P      4  
ATOM 7561  O OP1    . DC  B 2 12 ? 50.240 45.097 33.629 1.00 0.00 ? 78 DC  B OP1    4  
ATOM 7562  O OP2    . DC  B 2 12 ? 49.512 45.510 36.035 1.00 0.00 ? 78 DC  B OP2    4  
ATOM 7563  O "O5'"  . DC  B 2 12 ? 48.016 46.152 34.156 1.00 0.00 ? 78 DC  B "O5'"  4  
ATOM 7564  C "C5'"  . DC  B 2 12 ? 47.717 46.319 32.776 1.00 0.00 ? 78 DC  B "C5'"  4  
ATOM 7565  C "C4'"  . DC  B 2 12 ? 46.519 47.237 32.505 1.00 0.00 ? 78 DC  B "C4'"  4  
ATOM 7566  O "O4'"  . DC  B 2 12 ? 45.354 46.709 33.123 1.00 0.00 ? 78 DC  B "O4'"  4  
ATOM 7567  C "C3'"  . DC  B 2 12 ? 46.725 48.686 32.980 1.00 0.00 ? 78 DC  B "C3'"  4  
ATOM 7568  O "O3'"  . DC  B 2 12 ? 46.532 49.546 31.857 1.00 0.00 ? 78 DC  B "O3'"  4  
ATOM 7569  C "C2'"  . DC  B 2 12 ? 45.681 48.824 34.094 1.00 0.00 ? 78 DC  B "C2'"  4  
ATOM 7570  C "C1'"  . DC  B 2 12 ? 44.639 47.751 33.756 1.00 0.00 ? 78 DC  B "C1'"  4  
ATOM 7571  N N1     . DC  B 2 12 ? 43.932 47.152 34.927 1.00 0.00 ? 78 DC  B N1     4  
ATOM 7572  C C2     . DC  B 2 12 ? 42.544 46.952 34.863 1.00 0.00 ? 78 DC  B C2     4  
ATOM 7573  O O2     . DC  B 2 12 ? 41.877 47.317 33.891 1.00 0.00 ? 78 DC  B O2     4  
ATOM 7574  N N3     . DC  B 2 12 ? 41.886 46.341 35.878 1.00 0.00 ? 78 DC  B N3     4  
ATOM 7575  C C4     . DC  B 2 12 ? 42.577 45.934 36.924 1.00 0.00 ? 78 DC  B C4     4  
ATOM 7576  N N4     . DC  B 2 12 ? 41.908 45.347 37.870 1.00 0.00 ? 78 DC  B N4     4  
ATOM 7577  C C5     . DC  B 2 12 ? 43.985 46.070 37.034 1.00 0.00 ? 78 DC  B C5     4  
ATOM 7578  C C6     . DC  B 2 12 ? 44.633 46.688 36.015 1.00 0.00 ? 78 DC  B C6     4  
ATOM 7579  H "H5'"  . DC  B 2 12 ? 47.511 45.348 32.326 1.00 0.00 ? 78 DC  B "H5'"  4  
ATOM 7580  H "H5''" . DC  B 2 12 ? 48.585 46.752 32.281 1.00 0.00 ? 78 DC  B "H5''" 4  
ATOM 7581  H "H4'"  . DC  B 2 12 ? 46.350 47.252 31.428 1.00 0.00 ? 78 DC  B "H4'"  4  
ATOM 7582  H "H3'"  . DC  B 2 12 ? 47.729 48.822 33.393 1.00 0.00 ? 78 DC  B "H3'"  4  
ATOM 7583  H "H2'"  . DC  B 2 12 ? 46.171 48.633 35.046 1.00 0.00 ? 78 DC  B "H2'"  4  
ATOM 7584  H "H2''" . DC  B 2 12 ? 45.225 49.812 34.127 1.00 0.00 ? 78 DC  B "H2''" 4  
ATOM 7585  H "H1'"  . DC  B 2 12 ? 43.920 48.191 33.053 1.00 0.00 ? 78 DC  B "H1'"  4  
ATOM 7586  H H41    . DC  B 2 12 ? 42.388 45.001 38.686 1.00 0.00 ? 78 DC  B H41    4  
ATOM 7587  H H42    . DC  B 2 12 ? 40.906 45.280 37.753 1.00 0.00 ? 78 DC  B H42    4  
ATOM 7588  H H5     . DC  B 2 12 ? 44.533 45.705 37.888 1.00 0.00 ? 78 DC  B H5     4  
ATOM 7589  H H6     . DC  B 2 12 ? 45.713 46.792 36.040 1.00 0.00 ? 78 DC  B H6     4  
ATOM 7590  P P      . DG  B 2 13 ? 46.649 51.145 31.936 1.00 0.00 ? 79 DG  B P      4  
ATOM 7591  O OP1    . DG  B 2 13 ? 46.845 51.632 30.553 1.00 0.00 ? 79 DG  B OP1    4  
ATOM 7592  O OP2    . DG  B 2 13 ? 47.658 51.502 32.952 1.00 0.00 ? 79 DG  B OP2    4  
ATOM 7593  O "O5'"  . DG  B 2 13 ? 45.221 51.623 32.429 1.00 0.00 ? 79 DG  B "O5'"  4  
ATOM 7594  C "C5'"  . DG  B 2 13 ? 44.093 51.488 31.578 1.00 0.00 ? 79 DG  B "C5'"  4  
ATOM 7595  C "C4'"  . DG  B 2 13 ? 42.766 51.630 32.323 1.00 0.00 ? 79 DG  B "C4'"  4  
ATOM 7596  O "O4'"  . DG  B 2 13 ? 42.645 50.616 33.314 1.00 0.00 ? 79 DG  B "O4'"  4  
ATOM 7597  C "C3'"  . DG  B 2 13 ? 42.583 52.980 33.045 1.00 0.00 ? 79 DG  B "C3'"  4  
ATOM 7598  O "O3'"  . DG  B 2 13 ? 41.381 53.636 32.651 1.00 0.00 ? 79 DG  B "O3'"  4  
ATOM 7599  C "C2'"  . DG  B 2 13 ? 42.464 52.574 34.509 1.00 0.00 ? 79 DG  B "C2'"  4  
ATOM 7600  C "C1'"  . DG  B 2 13 ? 41.870 51.181 34.347 1.00 0.00 ? 79 DG  B "C1'"  4  
ATOM 7601  N N9     . DG  B 2 13 ? 41.860 50.353 35.571 1.00 0.00 ? 79 DG  B N9     4  
ATOM 7602  C C8     . DG  B 2 13 ? 42.823 50.187 36.536 1.00 0.00 ? 79 DG  B C8     4  
ATOM 7603  N N7     . DG  B 2 13 ? 42.432 49.494 37.577 1.00 0.00 ? 79 DG  B N7     4  
ATOM 7604  C C5     . DG  B 2 13 ? 41.096 49.176 37.269 1.00 0.00 ? 79 DG  B C5     4  
ATOM 7605  C C6     . DG  B 2 13 ? 40.073 48.479 38.007 1.00 0.00 ? 79 DG  B C6     4  
ATOM 7606  O O6     . DG  B 2 13 ? 40.124 47.966 39.128 1.00 0.00 ? 79 DG  B O6     4  
ATOM 7607  N N1     . DG  B 2 13 ? 38.857 48.435 37.356 1.00 0.00 ? 79 DG  B N1     4  
ATOM 7608  C C2     . DG  B 2 13 ? 38.633 48.969 36.133 1.00 0.00 ? 79 DG  B C2     4  
ATOM 7609  N N2     . DG  B 2 13 ? 37.414 48.908 35.677 1.00 0.00 ? 79 DG  B N2     4  
ATOM 7610  N N3     . DG  B 2 13 ? 39.543 49.603 35.400 1.00 0.00 ? 79 DG  B N3     4  
ATOM 7611  C C4     . DG  B 2 13 ? 40.754 49.685 36.033 1.00 0.00 ? 79 DG  B C4     4  
ATOM 7612  H "H5'"  . DG  B 2 13 ? 44.103 50.501 31.112 1.00 0.00 ? 79 DG  B "H5'"  4  
ATOM 7613  H "H5''" . DG  B 2 13 ? 44.141 52.242 30.793 1.00 0.00 ? 79 DG  B "H5''" 4  
ATOM 7614  H "H4'"  . DG  B 2 13 ? 41.964 51.513 31.595 1.00 0.00 ? 79 DG  B "H4'"  4  
ATOM 7615  H "H3'"  . DG  B 2 13 ? 43.447 53.630 32.898 1.00 0.00 ? 79 DG  B "H3'"  4  
ATOM 7616  H "HO3'" . DG  B 2 13 ? 40.739 52.976 32.282 1.00 0.00 ? 79 DG  B "HO3'" 4  
ATOM 7617  H "H2'"  . DG  B 2 13 ? 43.455 52.523 34.960 1.00 0.00 ? 79 DG  B "H2'"  4  
ATOM 7618  H "H2''" . DG  B 2 13 ? 41.809 53.237 35.076 1.00 0.00 ? 79 DG  B "H2''" 4  
ATOM 7619  H "H1'"  . DG  B 2 13 ? 40.838 51.285 34.000 1.00 0.00 ? 79 DG  B "H1'"  4  
ATOM 7620  H H8     . DG  B 2 13 ? 43.812 50.621 36.443 1.00 0.00 ? 79 DG  B H8     4  
ATOM 7621  H H1     . DG  B 2 13 ? 38.089 47.991 37.831 1.00 0.00 ? 79 DG  B H1     4  
ATOM 7622  H H21    . DG  B 2 13 ? 37.223 49.375 34.797 1.00 0.00 ? 79 DG  B H21    4  
ATOM 7623  H H22    . DG  B 2 13 ? 36.671 48.518 36.240 1.00 0.00 ? 79 DG  B H22    4  
ATOM 7624  O "O5'"  . DC  C 3 1  ? 31.370 43.627 38.589 1.00 0.00 ? 80 DC  C "O5'"  4  
ATOM 7625  C "C5'"  . DC  C 3 1  ? 30.407 44.576 39.043 1.00 0.00 ? 80 DC  C "C5'"  4  
ATOM 7626  C "C4'"  . DC  C 3 1  ? 30.661 46.012 38.534 1.00 0.00 ? 80 DC  C "C4'"  4  
ATOM 7627  O "O4'"  . DC  C 3 1  ? 31.790 46.564 39.205 1.00 0.00 ? 80 DC  C "O4'"  4  
ATOM 7628  C "C3'"  . DC  C 3 1  ? 30.936 46.099 37.021 1.00 0.00 ? 80 DC  C "C3'"  4  
ATOM 7629  O "O3'"  . DC  C 3 1  ? 30.419 47.300 36.459 1.00 0.00 ? 80 DC  C "O3'"  4  
ATOM 7630  C "C2'"  . DC  C 3 1  ? 32.462 46.123 37.015 1.00 0.00 ? 80 DC  C "C2'"  4  
ATOM 7631  C "C1'"  . DC  C 3 1  ? 32.770 46.952 38.256 1.00 0.00 ? 80 DC  C "C1'"  4  
ATOM 7632  N N1     . DC  C 3 1  ? 34.159 46.711 38.742 1.00 0.00 ? 80 DC  C N1     4  
ATOM 7633  C C2     . DC  C 3 1  ? 35.223 47.403 38.144 1.00 0.00 ? 80 DC  C C2     4  
ATOM 7634  O O2     . DC  C 3 1  ? 35.047 48.179 37.199 1.00 0.00 ? 80 DC  C O2     4  
ATOM 7635  N N3     . DC  C 3 1  ? 36.493 47.250 38.592 1.00 0.00 ? 80 DC  C N3     4  
ATOM 7636  C C4     . DC  C 3 1  ? 36.699 46.431 39.608 1.00 0.00 ? 80 DC  C C4     4  
ATOM 7637  N N4     . DC  C 3 1  ? 37.919 46.337 40.047 1.00 0.00 ? 80 DC  C N4     4  
ATOM 7638  C C5     . DC  C 3 1  ? 35.675 45.660 40.221 1.00 0.00 ? 80 DC  C C5     4  
ATOM 7639  C C6     . DC  C 3 1  ? 34.412 45.815 39.752 1.00 0.00 ? 80 DC  C C6     4  
ATOM 7640  H "H5'"  . DC  C 3 1  ? 30.403 44.596 40.135 1.00 0.00 ? 80 DC  C "H5'"  4  
ATOM 7641  H "H5''" . DC  C 3 1  ? 29.414 44.263 38.712 1.00 0.00 ? 80 DC  C "H5''" 4  
ATOM 7642  H "H4'"  . DC  C 3 1  ? 29.788 46.614 38.778 1.00 0.00 ? 80 DC  C "H4'"  4  
ATOM 7643  H "H3'"  . DC  C 3 1  ? 30.542 45.227 36.496 1.00 0.00 ? 80 DC  C "H3'"  4  
ATOM 7644  H "H2'"  . DC  C 3 1  ? 32.840 45.113 37.133 1.00 0.00 ? 80 DC  C "H2'"  4  
ATOM 7645  H "H2''" . DC  C 3 1  ? 32.872 46.582 36.117 1.00 0.00 ? 80 DC  C "H2''" 4  
ATOM 7646  H "H1'"  . DC  C 3 1  ? 32.640 48.012 38.010 1.00 0.00 ? 80 DC  C "H1'"  4  
ATOM 7647  H H41    . DC  C 3 1  ? 38.080 45.824 40.896 1.00 0.00 ? 80 DC  C H41    4  
ATOM 7648  H H42    . DC  C 3 1  ? 38.644 46.898 39.618 1.00 0.00 ? 80 DC  C H42    4  
ATOM 7649  H H5     . DC  C 3 1  ? 35.874 44.978 41.033 1.00 0.00 ? 80 DC  C H5     4  
ATOM 7650  H H6     . DC  C 3 1  ? 33.589 45.265 40.194 1.00 0.00 ? 80 DC  C H6     4  
ATOM 7651  H "HO5'" . DC  C 3 1  ? 31.655 43.057 39.341 1.00 0.00 ? 80 DC  C "HO5'" 4  
ATOM 7652  P P      . DG  C 3 2  ? 30.249 47.486 34.872 1.00 0.00 ? 81 DG  C P      4  
ATOM 7653  O OP1    . DG  C 3 2  ? 30.612 48.883 34.586 1.00 0.00 ? 81 DG  C OP1    4  
ATOM 7654  O OP2    . DG  C 3 2  ? 28.900 47.027 34.480 1.00 0.00 ? 81 DG  C OP2    4  
ATOM 7655  O "O5'"  . DG  C 3 2  ? 31.327 46.534 34.171 1.00 0.00 ? 81 DG  C "O5'"  4  
ATOM 7656  C "C5'"  . DG  C 3 2  ? 31.770 46.734 32.835 1.00 0.00 ? 81 DG  C "C5'"  4  
ATOM 7657  C "C4'"  . DG  C 3 2  ? 32.861 45.722 32.447 1.00 0.00 ? 81 DG  C "C4'"  4  
ATOM 7658  O "O4'"  . DG  C 3 2  ? 33.975 45.865 33.326 1.00 0.00 ? 81 DG  C "O4'"  4  
ATOM 7659  C "C3'"  . DG  C 3 2  ? 32.381 44.256 32.557 1.00 0.00 ? 81 DG  C "C3'"  4  
ATOM 7660  O "O3'"  . DG  C 3 2  ? 32.838 43.407 31.503 1.00 0.00 ? 81 DG  C "O3'"  4  
ATOM 7661  C "C2'"  . DG  C 3 2  ? 33.081 43.793 33.830 1.00 0.00 ? 81 DG  C "C2'"  4  
ATOM 7662  C "C1'"  . DG  C 3 2  ? 34.391 44.562 33.693 1.00 0.00 ? 81 DG  C "C1'"  4  
ATOM 7663  N N9     . DG  C 3 2  ? 35.264 44.563 34.892 1.00 0.00 ? 81 DG  C N9     4  
ATOM 7664  C C8     . DG  C 3 2  ? 35.062 44.012 36.136 1.00 0.00 ? 81 DG  C C8     4  
ATOM 7665  N N7     . DG  C 3 2  ? 36.064 44.163 36.961 1.00 0.00 ? 81 DG  C N7     4  
ATOM 7666  C C5     . DG  C 3 2  ? 37.044 44.791 36.180 1.00 0.00 ? 81 DG  C C5     4  
ATOM 7667  C C6     . DG  C 3 2  ? 38.413 45.145 36.456 1.00 0.00 ? 81 DG  C C6     4  
ATOM 7668  O O6     . DG  C 3 2  ? 39.065 45.014 37.492 1.00 0.00 ? 81 DG  C O6     4  
ATOM 7669  N N1     . DG  C 3 2  ? 39.072 45.681 35.373 1.00 0.00 ? 81 DG  C N1     4  
ATOM 7670  C C2     . DG  C 3 2  ? 38.498 45.865 34.163 1.00 0.00 ? 81 DG  C C2     4  
ATOM 7671  N N2     . DG  C 3 2  ? 39.267 46.288 33.206 1.00 0.00 ? 81 DG  C N2     4  
ATOM 7672  N N3     . DG  C 3 2  ? 37.242 45.559 33.857 1.00 0.00 ? 81 DG  C N3     4  
ATOM 7673  C C4     . DG  C 3 2  ? 36.560 45.023 34.912 1.00 0.00 ? 81 DG  C C4     4  
ATOM 7674  H "H5'"  . DG  C 3 2  ? 32.176 47.741 32.731 1.00 0.00 ? 81 DG  C "H5'"  4  
ATOM 7675  H "H5''" . DG  C 3 2  ? 30.927 46.630 32.149 1.00 0.00 ? 81 DG  C "H5''" 4  
ATOM 7676  H "H4'"  . DG  C 3 2  ? 33.183 45.929 31.427 1.00 0.00 ? 81 DG  C "H4'"  4  
ATOM 7677  H "H3'"  . DG  C 3 2  ? 31.296 44.195 32.663 1.00 0.00 ? 81 DG  C "H3'"  4  
ATOM 7678  H "H2'"  . DG  C 3 2  ? 32.519 44.121 34.706 1.00 0.00 ? 81 DG  C "H2'"  4  
ATOM 7679  H "H2''" . DG  C 3 2  ? 33.241 42.714 33.845 1.00 0.00 ? 81 DG  C "H2''" 4  
ATOM 7680  H "H1'"  . DG  C 3 2  ? 34.962 44.134 32.865 1.00 0.00 ? 81 DG  C "H1'"  4  
ATOM 7681  H H8     . DG  C 3 2  ? 34.144 43.510 36.413 1.00 0.00 ? 81 DG  C H8     4  
ATOM 7682  H H1     . DG  C 3 2  ? 40.043 45.928 35.494 1.00 0.00 ? 81 DG  C H1     4  
ATOM 7683  H H21    . DG  C 3 2  ? 38.837 46.397 32.293 1.00 0.00 ? 81 DG  C H21    4  
ATOM 7684  H H22    . DG  C 3 2  ? 40.235 46.529 33.382 1.00 0.00 ? 81 DG  C H22    4  
ATOM 7685  P P      . DG  C 3 3  ? 32.375 43.567 29.978 1.00 0.00 ? 82 DG  C P      4  
ATOM 7686  O OP1    . DG  C 3 3  ? 31.599 44.818 29.838 1.00 0.00 ? 82 DG  C OP1    4  
ATOM 7687  O OP2    . DG  C 3 3  ? 31.746 42.290 29.591 1.00 0.00 ? 82 DG  C OP2    4  
ATOM 7688  O "O5'"  . DG  C 3 3  ? 33.764 43.669 29.201 1.00 0.00 ? 82 DG  C "O5'"  4  
ATOM 7689  C "C5'"  . DG  C 3 3  ? 34.235 44.869 28.604 1.00 0.00 ? 82 DG  C "C5'"  4  
ATOM 7690  C "C4'"  . DG  C 3 3  ? 35.685 44.762 28.086 1.00 0.00 ? 82 DG  C "C4'"  4  
ATOM 7691  O "O4'"  . DG  C 3 3  ? 36.587 44.608 29.175 1.00 0.00 ? 82 DG  C "O4'"  4  
ATOM 7692  C "C3'"  . DG  C 3 3  ? 35.961 43.582 27.149 1.00 0.00 ? 82 DG  C "C3'"  4  
ATOM 7693  O "O3'"  . DG  C 3 3  ? 37.013 43.939 26.255 1.00 0.00 ? 82 DG  C "O3'"  4  
ATOM 7694  C "C2'"  . DG  C 3 3  ? 36.363 42.476 28.123 1.00 0.00 ? 82 DG  C "C2'"  4  
ATOM 7695  C "C1'"  . DG  C 3 3  ? 37.094 43.282 29.194 1.00 0.00 ? 82 DG  C "C1'"  4  
ATOM 7696  N N9     . DG  C 3 3  ? 37.001 42.757 30.576 1.00 0.00 ? 82 DG  C N9     4  
ATOM 7697  C C8     . DG  C 3 3  ? 35.937 42.211 31.250 1.00 0.00 ? 82 DG  C C8     4  
ATOM 7698  N N7     . DG  C 3 3  ? 36.178 41.945 32.510 1.00 0.00 ? 82 DG  C N7     4  
ATOM 7699  C C5     . DG  C 3 3  ? 37.514 42.335 32.680 1.00 0.00 ? 82 DG  C C5     4  
ATOM 7700  C C6     . DG  C 3 3  ? 38.390 42.312 33.825 1.00 0.00 ? 82 DG  C C6     4  
ATOM 7701  O O6     . DG  C 3 3  ? 38.165 41.965 34.988 1.00 0.00 ? 82 DG  C O6     4  
ATOM 7702  N N1     . DG  C 3 3  ? 39.666 42.751 33.539 1.00 0.00 ? 82 DG  C N1     4  
ATOM 7703  C C2     . DG  C 3 3  ? 40.054 43.208 32.327 1.00 0.00 ? 82 DG  C C2     4  
ATOM 7704  N N2     . DG  C 3 3  ? 41.296 43.571 32.198 1.00 0.00 ? 82 DG  C N2     4  
ATOM 7705  N N3     . DG  C 3 3  ? 39.289 43.263 31.245 1.00 0.00 ? 82 DG  C N3     4  
ATOM 7706  C C4     . DG  C 3 3  ? 38.022 42.811 31.489 1.00 0.00 ? 82 DG  C C4     4  
ATOM 7707  H "H5'"  . DG  C 3 3  ? 34.191 45.684 29.327 1.00 0.00 ? 82 DG  C "H5'"  4  
ATOM 7708  H "H5''" . DG  C 3 3  ? 33.583 45.124 27.766 1.00 0.00 ? 82 DG  C "H5''" 4  
ATOM 7709  H "H4'"  . DG  C 3 3  ? 35.916 45.685 27.554 1.00 0.00 ? 82 DG  C "H4'"  4  
ATOM 7710  H "H3'"  . DG  C 3 3  ? 35.060 43.321 26.600 1.00 0.00 ? 82 DG  C "H3'"  4  
ATOM 7711  H "H2'"  . DG  C 3 3  ? 35.476 41.985 28.521 1.00 0.00 ? 82 DG  C "H2'"  4  
ATOM 7712  H "H2''" . DG  C 3 3  ? 37.017 41.736 27.664 1.00 0.00 ? 82 DG  C "H2''" 4  
ATOM 7713  H "H1'"  . DG  C 3 3  ? 38.146 43.316 28.902 1.00 0.00 ? 82 DG  C "H1'"  4  
ATOM 7714  H H8     . DG  C 3 3  ? 34.974 42.049 30.780 1.00 0.00 ? 82 DG  C H8     4  
ATOM 7715  H H1     . DG  C 3 3  ? 40.356 42.722 34.273 1.00 0.00 ? 82 DG  C H1     4  
ATOM 7716  H H21    . DG  C 3 3  ? 41.623 43.870 31.296 1.00 0.00 ? 82 DG  C H21    4  
ATOM 7717  H H22    . DG  C 3 3  ? 41.944 43.465 32.973 1.00 0.00 ? 82 DG  C H22    4  
ATOM 7718  P P      . DG  C 3 4  ? 37.469 42.987 25.057 1.00 0.00 ? 83 DG  C P      4  
ATOM 7719  O OP1    . DG  C 3 4  ? 38.040 43.843 23.993 1.00 0.00 ? 83 DG  C OP1    4  
ATOM 7720  O OP2    . DG  C 3 4  ? 36.364 42.082 24.677 1.00 0.00 ? 83 DG  C OP2    4  
ATOM 7721  O "O5'"  . DG  C 3 4  ? 38.630 42.085 25.668 1.00 0.00 ? 83 DG  C "O5'"  4  
ATOM 7722  C "C5'"  . DG  C 3 4  ? 39.973 42.542 25.787 1.00 0.00 ? 83 DG  C "C5'"  4  
ATOM 7723  C "C4'"  . DG  C 3 4  ? 40.841 41.521 26.540 1.00 0.00 ? 83 DG  C "C4'"  4  
ATOM 7724  O "O4'"  . DG  C 3 4  ? 40.487 41.499 27.920 1.00 0.00 ? 83 DG  C "O4'"  4  
ATOM 7725  C "C3'"  . DG  C 3 4  ? 40.650 40.089 26.002 1.00 0.00 ? 83 DG  C "C3'"  4  
ATOM 7726  O "O3'"  . DG  C 3 4  ? 41.863 39.371 25.862 1.00 0.00 ? 83 DG  C "O3'"  4  
ATOM 7727  C "C2'"  . DG  C 3 4  ? 39.855 39.432 27.120 1.00 0.00 ? 83 DG  C "C2'"  4  
ATOM 7728  C "C1'"  . DG  C 3 4  ? 40.483 40.143 28.316 1.00 0.00 ? 83 DG  C "C1'"  4  
ATOM 7729  N N9     . DG  C 3 4  ? 39.773 39.935 29.596 1.00 0.00 ? 83 DG  C N9     4  
ATOM 7730  C C8     . DG  C 3 4  ? 38.450 39.623 29.809 1.00 0.00 ? 83 DG  C C8     4  
ATOM 7731  N N7     . DG  C 3 4  ? 38.145 39.374 31.052 1.00 0.00 ? 83 DG  C N7     4  
ATOM 7732  C C5     . DG  C 3 4  ? 39.370 39.519 31.716 1.00 0.00 ? 83 DG  C C5     4  
ATOM 7733  C C6     . DG  C 3 4  ? 39.719 39.333 33.096 1.00 0.00 ? 83 DG  C C6     4  
ATOM 7734  O O6     . DG  C 3 4  ? 39.000 38.986 34.031 1.00 0.00 ? 83 DG  C O6     4  
ATOM 7735  N N1     . DG  C 3 4  ? 41.051 39.551 33.366 1.00 0.00 ? 83 DG  C N1     4  
ATOM 7736  C C2     . DG  C 3 4  ? 41.966 39.879 32.424 1.00 0.00 ? 83 DG  C C2     4  
ATOM 7737  N N2     . DG  C 3 4  ? 43.210 39.889 32.814 1.00 0.00 ? 83 DG  C N2     4  
ATOM 7738  N N3     . DG  C 3 4  ? 41.699 40.070 31.131 1.00 0.00 ? 83 DG  C N3     4  
ATOM 7739  C C4     . DG  C 3 4  ? 40.370 39.875 30.837 1.00 0.00 ? 83 DG  C C4     4  
ATOM 7740  H "H5'"  . DG  C 3 4  ? 40.000 43.491 26.325 1.00 0.00 ? 83 DG  C "H5'"  4  
ATOM 7741  H "H5''" . DG  C 3 4  ? 40.396 42.694 24.795 1.00 0.00 ? 83 DG  C "H5''" 4  
ATOM 7742  H "H4'"  . DG  C 3 4  ? 41.890 41.799 26.446 1.00 0.00 ? 83 DG  C "H4'"  4  
ATOM 7743  H "H3'"  . DG  C 3 4  ? 40.090 40.085 25.070 1.00 0.00 ? 83 DG  C "H3'"  4  
ATOM 7744  H "H2'"  . DG  C 3 4  ? 38.800 39.688 27.017 1.00 0.00 ? 83 DG  C "H2'"  4  
ATOM 7745  H "H2''" . DG  C 3 4  ? 40.001 38.354 27.148 1.00 0.00 ? 83 DG  C "H2''" 4  
ATOM 7746  H "H1'"  . DG  C 3 4  ? 41.514 39.791 28.426 1.00 0.00 ? 83 DG  C "H1'"  4  
ATOM 7747  H H8     . DG  C 3 4  ? 37.725 39.590 29.007 1.00 0.00 ? 83 DG  C H8     4  
ATOM 7748  H H1     . DG  C 3 4  ? 41.363 39.384 34.311 1.00 0.00 ? 83 DG  C H1     4  
ATOM 7749  H H21    . DG  C 3 4  ? 43.924 39.978 32.109 1.00 0.00 ? 83 DG  C H21    4  
ATOM 7750  H H22    . DG  C 3 4  ? 43.449 39.633 33.767 1.00 0.00 ? 83 DG  C H22    4  
ATOM 7751  P P      . DG  C 3 5  ? 42.754 39.492 24.553 1.00 0.00 ? 84 DG  C P      4  
ATOM 7752  O OP1    . DG  C 3 5  ? 43.154 40.905 24.366 1.00 0.00 ? 84 DG  C OP1    4  
ATOM 7753  O OP2    . DG  C 3 5  ? 42.046 38.801 23.453 1.00 0.00 ? 84 DG  C OP2    4  
ATOM 7754  O "O5'"  . DG  C 3 5  ? 44.031 38.600 24.904 1.00 0.00 ? 84 DG  C "O5'"  4  
ATOM 7755  C "C5'"  . DG  C 3 5  ? 45.060 39.083 25.759 1.00 0.00 ? 84 DG  C "C5'"  4  
ATOM 7756  C "C4'"  . DG  C 3 5  ? 45.334 38.180 26.971 1.00 0.00 ? 84 DG  C "C4'"  4  
ATOM 7757  O "O4'"  . DG  C 3 5  ? 44.282 38.220 27.927 1.00 0.00 ? 84 DG  C "O4'"  4  
ATOM 7758  C "C3'"  . DG  C 3 5  ? 45.644 36.702 26.663 1.00 0.00 ? 84 DG  C "C3'"  4  
ATOM 7759  O "O3'"  . DG  C 3 5  ? 47.058 36.578 26.857 1.00 0.00 ? 84 DG  C "O3'"  4  
ATOM 7760  C "C2'"  . DG  C 3 5  ? 44.721 35.969 27.650 1.00 0.00 ? 84 DG  C "C2'"  4  
ATOM 7761  C "C1'"  . DG  C 3 5  ? 44.337 37.026 28.687 1.00 0.00 ? 84 DG  C "C1'"  4  
ATOM 7762  N N9     . DG  C 3 5  ? 43.024 36.793 29.349 1.00 0.00 ? 84 DG  C N9     4  
ATOM 7763  C C8     . DG  C 3 5  ? 41.785 36.744 28.757 1.00 0.00 ? 84 DG  C C8     4  
ATOM 7764  N N7     . DG  C 3 5  ? 40.791 36.593 29.593 1.00 0.00 ? 84 DG  C N7     4  
ATOM 7765  C C5     . DG  C 3 5  ? 41.419 36.498 30.841 1.00 0.00 ? 84 DG  C C5     4  
ATOM 7766  C C6     . DG  C 3 5  ? 40.885 36.307 32.168 1.00 0.00 ? 84 DG  C C6     4  
ATOM 7767  O O6     . DG  C 3 5  ? 39.716 36.222 32.545 1.00 0.00 ? 84 DG  C O6     4  
ATOM 7768  N N1     . DG  C 3 5  ? 41.853 36.223 33.145 1.00 0.00 ? 84 DG  C N1     4  
ATOM 7769  C C2     . DG  C 3 5  ? 43.175 36.349 32.905 1.00 0.00 ? 84 DG  C C2     4  
ATOM 7770  N N2     . DG  C 3 5  ? 43.968 36.163 33.924 1.00 0.00 ? 84 DG  C N2     4  
ATOM 7771  N N3     . DG  C 3 5  ? 43.718 36.575 31.708 1.00 0.00 ? 84 DG  C N3     4  
ATOM 7772  C C4     . DG  C 3 5  ? 42.787 36.622 30.701 1.00 0.00 ? 84 DG  C C4     4  
ATOM 7773  H "H5'"  . DG  C 3 5  ? 44.809 40.080 26.132 1.00 0.00 ? 84 DG  C "H5'"  4  
ATOM 7774  H "H5''" . DG  C 3 5  ? 45.975 39.171 25.174 1.00 0.00 ? 84 DG  C "H5''" 4  
ATOM 7775  H "H4'"  . DG  C 3 5  ? 46.218 38.594 27.461 1.00 0.00 ? 84 DG  C "H4'"  4  
ATOM 7776  H "H3'"  . DG  C 3 5  ? 45.363 36.443 25.640 1.00 0.00 ? 84 DG  C "H3'"  4  
ATOM 7777  H "H2'"  . DG  C 3 5  ? 43.833 35.633 27.114 1.00 0.00 ? 84 DG  C "H2'"  4  
ATOM 7778  H "H2''" . DG  C 3 5  ? 45.201 35.116 28.116 1.00 0.00 ? 84 DG  C "H2''" 4  
ATOM 7779  H "H1'"  . DG  C 3 5  ? 45.126 37.087 29.442 1.00 0.00 ? 84 DG  C "H1'"  4  
ATOM 7780  H H8     . DG  C 3 5  ? 41.655 36.847 27.686 1.00 0.00 ? 84 DG  C H8     4  
ATOM 7781  H H1     . DG  C 3 5  ? 41.552 36.020 34.088 1.00 0.00 ? 84 DG  C H1     4  
ATOM 7782  H H21    . DG  C 3 5  ? 44.959 36.157 33.761 1.00 0.00 ? 84 DG  C H21    4  
ATOM 7783  H H22    . DG  C 3 5  ? 43.587 35.897 34.826 1.00 0.00 ? 84 DG  C H22    4  
ATOM 7784  P P      . DA  C 3 6  ? 47.888 35.238 27.116 1.00 0.00 ? 85 DA  C P      4  
ATOM 7785  O OP1    . DA  C 3 6  ? 49.310 35.609 26.967 1.00 0.00 ? 85 DA  C OP1    4  
ATOM 7786  O OP2    . DA  C 3 6  ? 47.369 34.137 26.282 1.00 0.00 ? 85 DA  C OP2    4  
ATOM 7787  O "O5'"  . DA  C 3 6  ? 47.642 34.879 28.640 1.00 0.00 ? 85 DA  C "O5'"  4  
ATOM 7788  C "C5'"  . DA  C 3 6  ? 48.030 35.781 29.664 1.00 0.00 ? 85 DA  C "C5'"  4  
ATOM 7789  C "C4'"  . DA  C 3 6  ? 47.754 35.217 31.058 1.00 0.00 ? 85 DA  C "C4'"  4  
ATOM 7790  O "O4'"  . DA  C 3 6  ? 46.366 35.031 31.263 1.00 0.00 ? 85 DA  C "O4'"  4  
ATOM 7791  C "C3'"  . DA  C 3 6  ? 48.452 33.871 31.319 1.00 0.00 ? 85 DA  C "C3'"  4  
ATOM 7792  O "O3'"  . DA  C 3 6  ? 49.092 33.936 32.594 1.00 0.00 ? 85 DA  C "O3'"  4  
ATOM 7793  C "C2'"  . DA  C 3 6  ? 47.276 32.892 31.261 1.00 0.00 ? 85 DA  C "C2'"  4  
ATOM 7794  C "C1'"  . DA  C 3 6  ? 46.155 33.752 31.831 1.00 0.00 ? 85 DA  C "C1'"  4  
ATOM 7795  N N9     . DA  C 3 6  ? 44.796 33.317 31.455 1.00 0.00 ? 85 DA  C N9     4  
ATOM 7796  C C8     . DA  C 3 6  ? 44.249 33.251 30.196 1.00 0.00 ? 85 DA  C C8     4  
ATOM 7797  N N7     . DA  C 3 6  ? 42.950 33.089 30.178 1.00 0.00 ? 85 DA  C N7     4  
ATOM 7798  C C5     . DA  C 3 6  ? 42.636 33.003 31.545 1.00 0.00 ? 85 DA  C C5     4  
ATOM 7799  C C6     . DA  C 3 6  ? 41.441 32.856 32.284 1.00 0.00 ? 85 DA  C C6     4  
ATOM 7800  N N6     . DA  C 3 6  ? 40.231 32.837 31.765 1.00 0.00 ? 85 DA  C N6     4  
ATOM 7801  N N1     . DA  C 3 6  ? 41.461 32.738 33.609 1.00 0.00 ? 85 DA  C N1     4  
ATOM 7802  C C2     . DA  C 3 6  ? 42.627 32.814 34.229 1.00 0.00 ? 85 DA  C C2     4  
ATOM 7803  N N3     . DA  C 3 6  ? 43.827 32.992 33.689 1.00 0.00 ? 85 DA  C N3     4  
ATOM 7804  C C4     . DA  C 3 6  ? 43.759 33.082 32.326 1.00 0.00 ? 85 DA  C C4     4  
ATOM 7805  H "H5'"  . DA  C 3 6  ? 47.486 36.720 29.551 1.00 0.00 ? 85 DA  C "H5'"  4  
ATOM 7806  H "H5''" . DA  C 3 6  ? 49.099 35.989 29.580 1.00 0.00 ? 85 DA  C "H5''" 4  
ATOM 7807  H "H4'"  . DA  C 3 6  ? 48.090 35.956 31.778 1.00 0.00 ? 85 DA  C "H4'"  4  
ATOM 7808  H "H3'"  . DA  C 3 6  ? 49.173 33.648 30.530 1.00 0.00 ? 85 DA  C "H3'"  4  
ATOM 7809  H "H2'"  . DA  C 3 6  ? 47.070 32.629 30.223 1.00 0.00 ? 85 DA  C "H2'"  4  
ATOM 7810  H "H2''" . DA  C 3 6  ? 47.436 31.994 31.853 1.00 0.00 ? 85 DA  C "H2''" 4  
ATOM 7811  H "H1'"  . DA  C 3 6  ? 46.250 33.800 32.921 1.00 0.00 ? 85 DA  C "H1'"  4  
ATOM 7812  H H8     . DA  C 3 6  ? 44.849 33.358 29.301 1.00 0.00 ? 85 DA  C H8     4  
ATOM 7813  H H61    . DA  C 3 6  ? 40.107 33.052 30.790 1.00 0.00 ? 85 DA  C H61    4  
ATOM 7814  H H62    . DA  C 3 6  ? 39.450 32.854 32.418 1.00 0.00 ? 85 DA  C H62    4  
ATOM 7815  H H2     . DA  C 3 6  ? 42.597 32.714 35.305 1.00 0.00 ? 85 DA  C H2     4  
ATOM 7816  P P      . DT  C 3 7  ? 50.053 32.786 33.156 1.00 0.00 ? 86 DT  C P      4  
ATOM 7817  O OP1    . DT  C 3 7  ? 50.821 33.363 34.284 1.00 0.00 ? 86 DT  C OP1    4  
ATOM 7818  O OP2    . DT  C 3 7  ? 50.791 32.191 32.019 1.00 0.00 ? 86 DT  C OP2    4  
ATOM 7819  O "O5'"  . DT  C 3 7  ? 49.060 31.687 33.723 1.00 0.00 ? 86 DT  C "O5'"  4  
ATOM 7820  C "C5'"  . DT  C 3 7  ? 48.326 31.912 34.917 1.00 0.00 ? 86 DT  C "C5'"  4  
ATOM 7821  C "C4'"  . DT  C 3 7  ? 47.213 30.882 35.134 1.00 0.00 ? 86 DT  C "C4'"  4  
ATOM 7822  O "O4'"  . DT  C 3 7  ? 46.152 31.004 34.208 1.00 0.00 ? 86 DT  C "O4'"  4  
ATOM 7823  C "C3'"  . DT  C 3 7  ? 47.647 29.418 35.048 1.00 0.00 ? 86 DT  C "C3'"  4  
ATOM 7824  O "O3'"  . DT  C 3 7  ? 48.078 29.012 36.337 1.00 0.00 ? 86 DT  C "O3'"  4  
ATOM 7825  C "C2'"  . DT  C 3 7  ? 46.375 28.714 34.553 1.00 0.00 ? 86 DT  C "C2'"  4  
ATOM 7826  C "C1'"  . DT  C 3 7  ? 45.359 29.849 34.399 1.00 0.00 ? 86 DT  C "C1'"  4  
ATOM 7827  N N1     . DT  C 3 7  ? 44.400 29.676 33.275 1.00 0.00 ? 86 DT  C N1     4  
ATOM 7828  C C2     . DT  C 3 7  ? 43.043 29.502 33.581 1.00 0.00 ? 86 DT  C C2     4  
ATOM 7829  O O2     . DT  C 3 7  ? 42.620 29.319 34.720 1.00 0.00 ? 86 DT  C O2     4  
ATOM 7830  N N3     . DT  C 3 7  ? 42.159 29.526 32.529 1.00 0.00 ? 86 DT  C N3     4  
ATOM 7831  C C4     . DT  C 3 7  ? 42.498 29.644 31.201 1.00 0.00 ? 86 DT  C C4     4  
ATOM 7832  O O4     . DT  C 3 7  ? 41.597 29.678 30.363 1.00 0.00 ? 86 DT  C O4     4  
ATOM 7833  C C5     . DT  C 3 7  ? 43.937 29.736 30.937 1.00 0.00 ? 86 DT  C C5     4  
ATOM 7834  C C7     . DT  C 3 7  ? 44.457 29.842 29.515 1.00 0.00 ? 86 DT  C C7     4  
ATOM 7835  C C6     . DT  C 3 7  ? 44.827 29.759 31.966 1.00 0.00 ? 86 DT  C C6     4  
ATOM 7836  H "H5'"  . DT  C 3 7  ? 47.865 32.901 34.883 1.00 0.00 ? 86 DT  C "H5'"  4  
ATOM 7837  H "H5''" . DT  C 3 7  ? 49.006 31.877 35.770 1.00 0.00 ? 86 DT  C "H5''" 4  
ATOM 7838  H "H4'"  . DT  C 3 7  ? 46.806 31.051 36.131 1.00 0.00 ? 86 DT  C "H4'"  4  
ATOM 7839  H "H3'"  . DT  C 3 7  ? 48.436 29.313 34.303 1.00 0.00 ? 86 DT  C "H3'"  4  
ATOM 7840  H "H2'"  . DT  C 3 7  ? 46.573 28.230 33.596 1.00 0.00 ? 86 DT  C "H2'"  4  
ATOM 7841  H "H2''" . DT  C 3 7  ? 46.006 27.985 35.269 1.00 0.00 ? 86 DT  C "H2''" 4  
ATOM 7842  H "H1'"  . DT  C 3 7  ? 44.812 29.952 35.342 1.00 0.00 ? 86 DT  C "H1'"  4  
ATOM 7843  H H3     . DT  C 3 7  ? 41.174 29.476 32.762 1.00 0.00 ? 86 DT  C H3     4  
ATOM 7844  H H71    . DT  C 3 7  ? 45.530 30.037 29.500 1.00 0.00 ? 86 DT  C H71    4  
ATOM 7845  H H72    . DT  C 3 7  ? 44.261 28.909 28.985 1.00 0.00 ? 86 DT  C H72    4  
ATOM 7846  H H73    . DT  C 3 7  ? 43.946 30.654 29.000 1.00 0.00 ? 86 DT  C H73    4  
ATOM 7847  H H6     . DT  C 3 7  ? 45.886 29.867 31.765 1.00 0.00 ? 86 DT  C H6     4  
ATOM 7848  P P      . DT  C 3 8  ? 48.665 27.572 36.654 1.00 0.00 ? 87 DT  C P      4  
ATOM 7849  O OP1    . DT  C 3 8  ? 49.524 27.750 37.840 1.00 0.00 ? 87 DT  C OP1    4  
ATOM 7850  O OP2    . DT  C 3 8  ? 49.287 27.015 35.437 1.00 0.00 ? 87 DT  C OP2    4  
ATOM 7851  O "O5'"  . DT  C 3 8  ? 47.406 26.675 37.028 1.00 0.00 ? 87 DT  C "O5'"  4  
ATOM 7852  C "C5'"  . DT  C 3 8  ? 46.555 27.029 38.114 1.00 0.00 ? 87 DT  C "C5'"  4  
ATOM 7853  C "C4'"  . DT  C 3 8  ? 45.213 26.294 38.080 1.00 0.00 ? 87 DT  C "C4'"  4  
ATOM 7854  O "O4'"  . DT  C 3 8  ? 44.476 26.670 36.923 1.00 0.00 ? 87 DT  C "O4'"  4  
ATOM 7855  C "C3'"  . DT  C 3 8  ? 45.362 24.766 38.073 1.00 0.00 ? 87 DT  C "C3'"  4  
ATOM 7856  O "O3'"  . DT  C 3 8  ? 44.787 24.266 39.268 1.00 0.00 ? 87 DT  C "O3'"  4  
ATOM 7857  C "C2'"  . DT  C 3 8  ? 44.634 24.361 36.787 1.00 0.00 ? 87 DT  C "C2'"  4  
ATOM 7858  C "C1'"  . DT  C 3 8  ? 43.727 25.555 36.491 1.00 0.00 ? 87 DT  C "C1'"  4  
ATOM 7859  N N1     . DT  C 3 8  ? 43.352 25.735 35.055 1.00 0.00 ? 87 DT  C N1     4  
ATOM 7860  C C2     . DT  C 3 8  ? 41.998 25.928 34.741 1.00 0.00 ? 87 DT  C C2     4  
ATOM 7861  O O2     . DT  C 3 8  ? 41.093 25.932 35.576 1.00 0.00 ? 87 DT  C O2     4  
ATOM 7862  N N3     . DT  C 3 8  ? 41.686 26.140 33.417 1.00 0.00 ? 87 DT  C N3     4  
ATOM 7863  C C4     . DT  C 3 8  ? 42.585 26.230 32.382 1.00 0.00 ? 87 DT  C C4     4  
ATOM 7864  O O4     . DT  C 3 8  ? 42.176 26.507 31.255 1.00 0.00 ? 87 DT  C O4     4  
ATOM 7865  C C5     . DT  C 3 8  ? 43.977 26.014 32.764 1.00 0.00 ? 87 DT  C C5     4  
ATOM 7866  C C7     . DT  C 3 8  ? 45.059 26.069 31.701 1.00 0.00 ? 87 DT  C C7     4  
ATOM 7867  C C6     . DT  C 3 8  ? 44.316 25.780 34.062 1.00 0.00 ? 87 DT  C C6     4  
ATOM 7868  H "H5'"  . DT  C 3 8  ? 46.333 28.096 38.077 1.00 0.00 ? 87 DT  C "H5'"  4  
ATOM 7869  H "H5''" . DT  C 3 8  ? 47.050 26.809 39.059 1.00 0.00 ? 87 DT  C "H5''" 4  
ATOM 7870  H "H4'"  . DT  C 3 8  ? 44.643 26.582 38.964 1.00 0.00 ? 87 DT  C "H4'"  4  
ATOM 7871  H "H3'"  . DT  C 3 8  ? 46.408 24.472 38.034 1.00 0.00 ? 87 DT  C "H3'"  4  
ATOM 7872  H "H2'"  . DT  C 3 8  ? 45.367 24.211 35.998 1.00 0.00 ? 87 DT  C "H2'"  4  
ATOM 7873  H "H2''" . DT  C 3 8  ? 44.047 23.461 36.921 1.00 0.00 ? 87 DT  C "H2''" 4  
ATOM 7874  H "H1'"  . DT  C 3 8  ? 42.833 25.454 37.115 1.00 0.00 ? 87 DT  C "H1'"  4  
ATOM 7875  H H3     . DT  C 3 8  ? 40.707 26.244 33.185 1.00 0.00 ? 87 DT  C H3     4  
ATOM 7876  H H71    . DT  C 3 8  ? 46.048 25.966 32.139 1.00 0.00 ? 87 DT  C H71    4  
ATOM 7877  H H72    . DT  C 3 8  ? 44.897 25.266 30.982 1.00 0.00 ? 87 DT  C H72    4  
ATOM 7878  H H73    . DT  C 3 8  ? 45.002 27.015 31.165 1.00 0.00 ? 87 DT  C H73    4  
ATOM 7879  H H6     . DT  C 3 8  ? 45.358 25.655 34.329 1.00 0.00 ? 87 DT  C H6     4  
ATOM 7880  P P      . DA  C 3 9  ? 44.672 22.715 39.623 1.00 0.00 ? 88 DA  C P      4  
ATOM 7881  O OP1    . DA  C 3 9  ? 44.649 22.624 41.096 1.00 0.00 ? 88 DA  C OP1    4  
ATOM 7882  O OP2    . DA  C 3 9  ? 45.678 21.941 38.857 1.00 0.00 ? 88 DA  C OP2    4  
ATOM 7883  O "O5'"  . DA  C 3 9  ? 43.215 22.411 39.070 1.00 0.00 ? 88 DA  C "O5'"  4  
ATOM 7884  C "C5'"  . DA  C 3 9  ? 42.110 23.137 39.592 1.00 0.00 ? 88 DA  C "C5'"  4  
ATOM 7885  C "C4'"  . DA  C 3 9  ? 40.816 22.914 38.816 1.00 0.00 ? 88 DA  C "C4'"  4  
ATOM 7886  O "O4'"  . DA  C 3 9  ? 40.965 23.302 37.450 1.00 0.00 ? 88 DA  C "O4'"  4  
ATOM 7887  C "C3'"  . DA  C 3 9  ? 40.359 21.458 38.844 1.00 0.00 ? 88 DA  C "C3'"  4  
ATOM 7888  O "O3'"  . DA  C 3 9  ? 38.956 21.442 39.057 1.00 0.00 ? 88 DA  C "O3'"  4  
ATOM 7889  C "C2'"  . DA  C 3 9  ? 40.744 20.964 37.457 1.00 0.00 ? 88 DA  C "C2'"  4  
ATOM 7890  C "C1'"  . DA  C 3 9  ? 40.558 22.225 36.619 1.00 0.00 ? 88 DA  C "C1'"  4  
ATOM 7891  N N9     . DA  C 3 9  ? 41.342 22.222 35.360 1.00 0.00 ? 88 DA  C N9     4  
ATOM 7892  C C8     . DA  C 3 9  ? 42.678 21.947 35.170 1.00 0.00 ? 88 DA  C C8     4  
ATOM 7893  N N7     . DA  C 3 9  ? 43.112 22.167 33.951 1.00 0.00 ? 88 DA  C N7     4  
ATOM 7894  C C5     . DA  C 3 9  ? 41.938 22.551 33.274 1.00 0.00 ? 88 DA  C C5     4  
ATOM 7895  C C6     . DA  C 3 9  ? 41.620 22.934 31.946 1.00 0.00 ? 88 DA  C C6     4  
ATOM 7896  N N6     . DA  C 3 9  ? 42.476 23.088 30.955 1.00 0.00 ? 88 DA  C N6     4  
ATOM 7897  N N1     . DA  C 3 9  ? 40.365 23.172 31.577 1.00 0.00 ? 88 DA  C N1     4  
ATOM 7898  C C2     . DA  C 3 9  ? 39.418 23.077 32.497 1.00 0.00 ? 88 DA  C C2     4  
ATOM 7899  N N3     . DA  C 3 9  ? 39.555 22.796 33.787 1.00 0.00 ? 88 DA  C N3     4  
ATOM 7900  C C4     . DA  C 3 9  ? 40.853 22.537 34.113 1.00 0.00 ? 88 DA  C C4     4  
ATOM 7901  H "H5'"  . DA  C 3 9  ? 42.324 24.207 39.572 1.00 0.00 ? 88 DA  C "H5'"  4  
ATOM 7902  H "H5''" . DA  C 3 9  ? 41.949 22.848 40.630 1.00 0.00 ? 88 DA  C "H5''" 4  
ATOM 7903  H "H4'"  . DA  C 3 9  ? 40.058 23.522 39.301 1.00 0.00 ? 88 DA  C "H4'"  4  
ATOM 7904  H "H3'"  . DA  C 3 9  ? 40.881 20.902 39.624 1.00 0.00 ? 88 DA  C "H3'"  4  
ATOM 7905  H "H2'"  . DA  C 3 9  ? 41.789 20.656 37.468 1.00 0.00 ? 88 DA  C "H2'"  4  
ATOM 7906  H "H2''" . DA  C 3 9  ? 40.101 20.155 37.119 1.00 0.00 ? 88 DA  C "H2''" 4  
ATOM 7907  H "H1'"  . DA  C 3 9  ? 39.494 22.329 36.386 1.00 0.00 ? 88 DA  C "H1'"  4  
ATOM 7908  H H8     . DA  C 3 9  ? 43.320 21.620 35.981 1.00 0.00 ? 88 DA  C H8     4  
ATOM 7909  H H61    . DA  C 3 9  ? 43.460 22.931 31.082 1.00 0.00 ? 88 DA  C H61    4  
ATOM 7910  H H62    . DA  C 3 9  ? 42.111 23.387 30.062 1.00 0.00 ? 88 DA  C H62    4  
ATOM 7911  H H2     . DA  C 3 9  ? 38.413 23.276 32.157 1.00 0.00 ? 88 DA  C H2     4  
ATOM 7912  P P      . DG  C 3 10 ? 38.183 20.105 39.440 1.00 0.00 ? 89 DG  C P      4  
ATOM 7913  O OP1    . DG  C 3 10 ? 37.002 20.490 40.236 1.00 0.00 ? 89 DG  C OP1    4  
ATOM 7914  O OP2    . DG  C 3 10 ? 39.146 19.127 39.991 1.00 0.00 ? 89 DG  C OP2    4  
ATOM 7915  O "O5'"  . DG  C 3 10 ? 37.654 19.541 38.057 1.00 0.00 ? 89 DG  C "O5'"  4  
ATOM 7916  C "C5'"  . DG  C 3 10 ? 36.407 19.974 37.539 1.00 0.00 ? 89 DG  C "C5'"  4  
ATOM 7917  C "C4'"  . DG  C 3 10 ? 35.995 19.190 36.293 1.00 0.00 ? 89 DG  C "C4'"  4  
ATOM 7918  O "O4'"  . DG  C 3 10 ? 36.812 19.579 35.200 1.00 0.00 ? 89 DG  C "O4'"  4  
ATOM 7919  C "C3'"  . DG  C 3 10 ? 36.141 17.674 36.469 1.00 0.00 ? 89 DG  C "C3'"  4  
ATOM 7920  O "O3'"  . DG  C 3 10 ? 35.051 17.016 35.837 1.00 0.00 ? 89 DG  C "O3'"  4  
ATOM 7921  C "C2'"  . DG  C 3 10 ? 37.455 17.404 35.739 1.00 0.00 ? 89 DG  C "C2'"  4  
ATOM 7922  C "C1'"  . DG  C 3 10 ? 37.351 18.419 34.603 1.00 0.00 ? 89 DG  C "C1'"  4  
ATOM 7923  N N9     . DG  C 3 10 ? 38.616 18.762 33.916 1.00 0.00 ? 89 DG  C N9     4  
ATOM 7924  C C8     . DG  C 3 10 ? 39.895 18.850 34.404 1.00 0.00 ? 89 DG  C C8     4  
ATOM 7925  N N7     . DG  C 3 10 ? 40.785 19.228 33.520 1.00 0.00 ? 89 DG  C N7     4  
ATOM 7926  C C5     . DG  C 3 10 ? 40.028 19.398 32.350 1.00 0.00 ? 89 DG  C C5     4  
ATOM 7927  C C6     . DG  C 3 10 ? 40.397 19.788 31.011 1.00 0.00 ? 89 DG  C C6     4  
ATOM 7928  O O6     . DG  C 3 10 ? 41.504 20.101 30.569 1.00 0.00 ? 89 DG  C O6     4  
ATOM 7929  N N1     . DG  C 3 10 ? 39.339 19.799 30.129 1.00 0.00 ? 89 DG  C N1     4  
ATOM 7930  C C2     . DG  C 3 10 ? 38.079 19.439 30.465 1.00 0.00 ? 89 DG  C C2     4  
ATOM 7931  N N2     . DG  C 3 10 ? 37.187 19.388 29.519 1.00 0.00 ? 89 DG  C N2     4  
ATOM 7932  N N3     . DG  C 3 10 ? 37.686 19.077 31.679 1.00 0.00 ? 89 DG  C N3     4  
ATOM 7933  C C4     . DG  C 3 10 ? 38.708 19.086 32.586 1.00 0.00 ? 89 DG  C C4     4  
ATOM 7934  H "H5'"  . DG  C 3 10 ? 36.463 21.036 37.303 1.00 0.00 ? 89 DG  C "H5'"  4  
ATOM 7935  H "H5''" . DG  C 3 10 ? 35.631 19.829 38.289 1.00 0.00 ? 89 DG  C "H5''" 4  
ATOM 7936  H "H4'"  . DG  C 3 10 ? 34.953 19.427 36.081 1.00 0.00 ? 89 DG  C "H4'"  4  
ATOM 7937  H "H3'"  . DG  C 3 10 ? 36.204 17.410 37.528 1.00 0.00 ? 89 DG  C "H3'"  4  
ATOM 7938  H "H2'"  . DG  C 3 10 ? 38.295 17.630 36.395 1.00 0.00 ? 89 DG  C "H2'"  4  
ATOM 7939  H "H2''" . DG  C 3 10 ? 37.519 16.383 35.370 1.00 0.00 ? 89 DG  C "H2''" 4  
ATOM 7940  H "H1'"  . DG  C 3 10 ? 36.645 18.038 33.859 1.00 0.00 ? 89 DG  C "H1'"  4  
ATOM 7941  H H8     . DG  C 3 10 ? 40.135 18.632 35.438 1.00 0.00 ? 89 DG  C H8     4  
ATOM 7942  H H1     . DG  C 3 10 ? 39.535 20.049 29.172 1.00 0.00 ? 89 DG  C H1     4  
ATOM 7943  H H21    . DG  C 3 10 ? 36.266 19.093 29.783 1.00 0.00 ? 89 DG  C H21    4  
ATOM 7944  H H22    . DG  C 3 10 ? 37.412 19.700 28.579 1.00 0.00 ? 89 DG  C H22    4  
ATOM 7945  P P      . DA  C 3 11 ? 34.643 15.520 36.218 1.00 0.00 ? 90 DA  C P      4  
ATOM 7946  O OP1    . DA  C 3 11 ? 33.455 15.572 37.097 1.00 0.00 ? 90 DA  C OP1    4  
ATOM 7947  O OP2    . DA  C 3 11 ? 35.836 14.771 36.675 1.00 0.00 ? 90 DA  C OP2    4  
ATOM 7948  O "O5'"  . DA  C 3 11 ? 34.198 14.929 34.809 1.00 0.00 ? 90 DA  C "O5'"  4  
ATOM 7949  C "C5'"  . DA  C 3 11 ? 32.945 15.261 34.225 1.00 0.00 ? 90 DA  C "C5'"  4  
ATOM 7950  C "C4'"  . DA  C 3 11 ? 32.805 14.760 32.777 1.00 0.00 ? 90 DA  C "C4'"  4  
ATOM 7951  O "O4'"  . DA  C 3 11 ? 33.738 15.432 31.928 1.00 0.00 ? 90 DA  C "O4'"  4  
ATOM 7952  C "C3'"  . DA  C 3 11 ? 33.035 13.247 32.640 1.00 0.00 ? 90 DA  C "C3'"  4  
ATOM 7953  O "O3'"  . DA  C 3 11 ? 32.074 12.715 31.727 1.00 0.00 ? 90 DA  C "O3'"  4  
ATOM 7954  C "C2'"  . DA  C 3 11 ? 34.500 13.207 32.213 1.00 0.00 ? 90 DA  C "C2'"  4  
ATOM 7955  C "C1'"  . DA  C 3 11 ? 34.733 14.526 31.472 1.00 0.00 ? 90 DA  C "C1'"  4  
ATOM 7956  N N9     . DA  C 3 11 ? 36.090 15.081 31.718 1.00 0.00 ? 90 DA  C N9     4  
ATOM 7957  C C8     . DA  C 3 11 ? 36.803 15.096 32.895 1.00 0.00 ? 90 DA  C C8     4  
ATOM 7958  N N7     . DA  C 3 11 ? 38.039 15.508 32.788 1.00 0.00 ? 90 DA  C N7     4  
ATOM 7959  C C5     . DA  C 3 11 ? 38.141 15.798 31.420 1.00 0.00 ? 90 DA  C C5     4  
ATOM 7960  C C6     . DA  C 3 11 ? 39.185 16.248 30.582 1.00 0.00 ? 90 DA  C C6     4  
ATOM 7961  N N6     . DA  C 3 11 ? 40.420 16.485 30.979 1.00 0.00 ? 90 DA  C N6     4  
ATOM 7962  N N1     . DA  C 3 11 ? 38.990 16.445 29.280 1.00 0.00 ? 90 DA  C N1     4  
ATOM 7963  C C2     . DA  C 3 11 ? 37.780 16.216 28.793 1.00 0.00 ? 90 DA  C C2     4  
ATOM 7964  N N3     . DA  C 3 11 ? 36.696 15.788 29.438 1.00 0.00 ? 90 DA  C N3     4  
ATOM 7965  C C4     . DA  C 3 11 ? 36.954 15.583 30.767 1.00 0.00 ? 90 DA  C C4     4  
ATOM 7966  H "H5'"  . DA  C 3 11 ? 32.814 16.343 34.226 1.00 0.00 ? 90 DA  C "H5'"  4  
ATOM 7967  H "H5''" . DA  C 3 11 ? 32.144 14.825 34.825 1.00 0.00 ? 90 DA  C "H5''" 4  
ATOM 7968  H "H4'"  . DA  C 3 11 ? 31.793 14.992 32.442 1.00 0.00 ? 90 DA  C "H4'"  4  
ATOM 7969  H "H3'"  . DA  C 3 11 ? 32.930 12.757 33.606 1.00 0.00 ? 90 DA  C "H3'"  4  
ATOM 7970  H "H2'"  . DA  C 3 11 ? 35.112 13.132 33.110 1.00 0.00 ? 90 DA  C "H2'"  4  
ATOM 7971  H "H2''" . DA  C 3 11 ? 34.732 12.356 31.589 1.00 0.00 ? 90 DA  C "H2''" 4  
ATOM 7972  H "H1'"  . DA  C 3 11 ? 34.598 14.347 30.401 1.00 0.00 ? 90 DA  C "H1'"  4  
ATOM 7973  H H8     . DA  C 3 11 ? 36.376 14.769 33.832 1.00 0.00 ? 90 DA  C H8     4  
ATOM 7974  H H61    . DA  C 3 11 ? 40.664 16.304 31.936 1.00 0.00 ? 90 DA  C H61    4  
ATOM 7975  H H62    . DA  C 3 11 ? 41.106 16.783 30.297 1.00 0.00 ? 90 DA  C H62    4  
ATOM 7976  H H2     . DA  C 3 11 ? 37.664 16.386 27.732 1.00 0.00 ? 90 DA  C H2     4  
ATOM 7977  P P      . DG  C 3 12 ? 32.234 11.336 30.915 1.00 0.00 ? 91 DG  C P      4  
ATOM 7978  O OP1    . DG  C 3 12 ? 30.889 10.901 30.494 1.00 0.00 ? 91 DG  C OP1    4  
ATOM 7979  O OP2    . DG  C 3 12 ? 33.075 10.386 31.673 1.00 0.00 ? 91 DG  C OP2    4  
ATOM 7980  O "O5'"  . DG  C 3 12 ? 33.034 11.801 29.615 1.00 0.00 ? 91 DG  C "O5'"  4  
ATOM 7981  C "C5'"  . DG  C 3 12 ? 32.488 12.790 28.746 1.00 0.00 ? 91 DG  C "C5'"  4  
ATOM 7982  C "C4'"  . DG  C 3 12 ? 33.284 12.981 27.445 1.00 0.00 ? 91 DG  C "C4'"  4  
ATOM 7983  O "O4'"  . DG  C 3 12 ? 34.590 13.489 27.715 1.00 0.00 ? 91 DG  C "O4'"  4  
ATOM 7984  C "C3'"  . DG  C 3 12 ? 33.442 11.671 26.663 1.00 0.00 ? 91 DG  C "C3'"  4  
ATOM 7985  O "O3'"  . DG  C 3 12 ? 33.324 11.941 25.267 1.00 0.00 ? 91 DG  C "O3'"  4  
ATOM 7986  C "C2'"  . DG  C 3 12 ? 34.839 11.224 27.092 1.00 0.00 ? 91 DG  C "C2'"  4  
ATOM 7987  C "C1'"  . DG  C 3 12 ? 35.571 12.552 27.286 1.00 0.00 ? 91 DG  C "C1'"  4  
ATOM 7988  N N9     . DG  C 3 12 ? 36.670 12.498 28.281 1.00 0.00 ? 91 DG  C N9     4  
ATOM 7989  C C8     . DG  C 3 12 ? 36.623 12.035 29.571 1.00 0.00 ? 91 DG  C C8     4  
ATOM 7990  N N7     . DG  C 3 12 ? 37.715 12.234 30.261 1.00 0.00 ? 91 DG  C N7     4  
ATOM 7991  C C5     . DG  C 3 12 ? 38.586 12.810 29.330 1.00 0.00 ? 91 DG  C C5     4  
ATOM 7992  C C6     . DG  C 3 12 ? 39.961 13.223 29.442 1.00 0.00 ? 91 DG  C C6     4  
ATOM 7993  O O6     . DG  C 3 12 ? 40.702 13.224 30.428 1.00 0.00 ? 91 DG  C O6     4  
ATOM 7994  N N1     . DG  C 3 12 ? 40.497 13.675 28.257 1.00 0.00 ? 91 DG  C N1     4  
ATOM 7995  C C2     . DG  C 3 12 ? 39.798 13.782 27.107 1.00 0.00 ? 91 DG  C C2     4  
ATOM 7996  N N2     . DG  C 3 12 ? 40.457 14.215 26.069 1.00 0.00 ? 91 DG  C N2     4  
ATOM 7997  N N3     . DG  C 3 12 ? 38.515 13.448 26.958 1.00 0.00 ? 91 DG  C N3     4  
ATOM 7998  C C4     . DG  C 3 12 ? 37.960 12.953 28.108 1.00 0.00 ? 91 DG  C C4     4  
ATOM 7999  H "H5'"  . DG  C 3 12 ? 32.439 13.747 29.270 1.00 0.00 ? 91 DG  C "H5'"  4  
ATOM 8000  H "H5''" . DG  C 3 12 ? 31.467 12.507 28.477 1.00 0.00 ? 91 DG  C "H5''" 4  
ATOM 8001  H "H4'"  . DG  C 3 12 ? 32.739 13.699 26.830 1.00 0.00 ? 91 DG  C "H4'"  4  
ATOM 8002  H "H3'"  . DG  C 3 12 ? 32.688 10.945 26.977 1.00 0.00 ? 91 DG  C "H3'"  4  
ATOM 8003  H "H2'"  . DG  C 3 12 ? 34.768 10.675 28.031 1.00 0.00 ? 91 DG  C "H2'"  4  
ATOM 8004  H "H2''" . DG  C 3 12 ? 35.325 10.603 26.346 1.00 0.00 ? 91 DG  C "H2''" 4  
ATOM 8005  H "H1'"  . DG  C 3 12 ? 35.974 12.861 26.319 1.00 0.00 ? 91 DG  C "H1'"  4  
ATOM 8006  H H8     . DG  C 3 12 ? 35.739 11.561 29.974 1.00 0.00 ? 91 DG  C H8     4  
ATOM 8007  H H1     . DG  C 3 12 ? 41.472 13.923 28.243 1.00 0.00 ? 91 DG  C H1     4  
ATOM 8008  H H21    . DG  C 3 12 ? 39.990 14.311 25.181 1.00 0.00 ? 91 DG  C H21    4  
ATOM 8009  H H22    . DG  C 3 12 ? 41.455 14.393 26.130 1.00 0.00 ? 91 DG  C H22    4  
ATOM 8010  P P      . DC  C 3 13 ? 33.222 10.769 24.177 1.00 0.00 ? 92 DC  C P      4  
ATOM 8011  O OP1    . DC  C 3 13 ? 32.664 11.351 22.936 1.00 0.00 ? 92 DC  C OP1    4  
ATOM 8012  O OP2    . DC  C 3 13 ? 32.529 9.604  24.772 1.00 0.00 ? 92 DC  C OP2    4  
ATOM 8013  O "O5'"  . DC  C 3 13 ? 34.750 10.377 23.931 1.00 0.00 ? 92 DC  C "O5'"  4  
ATOM 8014  C "C5'"  . DC  C 3 13 ? 35.639 11.294 23.306 1.00 0.00 ? 92 DC  C "C5'"  4  
ATOM 8015  C "C4'"  . DC  C 3 13 ? 37.120 10.944 23.499 1.00 0.00 ? 92 DC  C "C4'"  4  
ATOM 8016  O "O4'"  . DC  C 3 13 ? 37.545 11.088 24.850 1.00 0.00 ? 92 DC  C "O4'"  4  
ATOM 8017  C "C3'"  . DC  C 3 13 ? 37.509 9.516  23.066 1.00 0.00 ? 92 DC  C "C3'"  4  
ATOM 8018  O "O3'"  . DC  C 3 13 ? 38.435 9.553  21.985 1.00 0.00 ? 92 DC  C "O3'"  4  
ATOM 8019  C "C2'"  . DC  C 3 13 ? 38.190 8.965  24.321 1.00 0.00 ? 92 DC  C "C2'"  4  
ATOM 8020  C "C1'"  . DC  C 3 13 ? 38.676 10.251 24.982 1.00 0.00 ? 92 DC  C "C1'"  4  
ATOM 8021  N N1     . DC  C 3 13 ? 39.116 10.091 26.395 1.00 0.00 ? 92 DC  C N1     4  
ATOM 8022  C C2     . DC  C 3 13 ? 40.435 10.418 26.744 1.00 0.00 ? 92 DC  C C2     4  
ATOM 8023  O O2     . DC  C 3 13 ? 41.247 10.836 25.917 1.00 0.00 ? 92 DC  C O2     4  
ATOM 8024  N N3     . DC  C 3 13 ? 40.864 10.304 28.023 1.00 0.00 ? 92 DC  C N3     4  
ATOM 8025  C C4     . DC  C 3 13 ? 40.019 9.864  28.931 1.00 0.00 ? 92 DC  C C4     4  
ATOM 8026  N N4     . DC  C 3 13 ? 40.473 9.860  30.149 1.00 0.00 ? 92 DC  C N4     4  
ATOM 8027  C C5     . DC  C 3 13 ? 38.673 9.504  28.646 1.00 0.00 ? 92 DC  C C5     4  
ATOM 8028  C C6     . DC  C 3 13 ? 38.255 9.630  27.360 1.00 0.00 ? 92 DC  C C6     4  
ATOM 8029  H "H5'"  . DC  C 3 13 ? 35.489 12.291 23.717 1.00 0.00 ? 92 DC  C "H5'"  4  
ATOM 8030  H "H5''" . DC  C 3 13 ? 35.419 11.334 22.235 1.00 0.00 ? 92 DC  C "H5''" 4  
ATOM 8031  H "H4'"  . DC  C 3 13 ? 37.694 11.654 22.905 1.00 0.00 ? 92 DC  C "H4'"  4  
ATOM 8032  H "H3'"  . DC  C 3 13 ? 36.630 8.919  22.812 1.00 0.00 ? 92 DC  C "H3'"  4  
ATOM 8033  H "HO3'" . DC  C 3 13 ? 39.001 8.740  22.021 1.00 0.00 ? 92 DC  C "HO3'" 4  
ATOM 8034  H "H2'"  . DC  C 3 13 ? 37.450 8.465  24.945 1.00 0.00 ? 92 DC  C "H2'"  4  
ATOM 8035  H "H2''" . DC  C 3 13 ? 39.014 8.289  24.101 1.00 0.00 ? 92 DC  C "H2''" 4  
ATOM 8036  H "H1'"  . DC  C 3 13 ? 39.500 10.663 24.386 1.00 0.00 ? 92 DC  C "H1'"  4  
ATOM 8037  H H41    . DC  C 3 13 ? 39.833 9.706  30.914 1.00 0.00 ? 92 DC  C H41    4  
ATOM 8038  H H42    . DC  C 3 13 ? 41.380 10.288 30.287 1.00 0.00 ? 92 DC  C H42    4  
ATOM 8039  H H5     . DC  C 3 13 ? 37.994 9.167  29.412 1.00 0.00 ? 92 DC  C H5     4  
ATOM 8040  H H6     . DC  C 3 13 ? 37.234 9.394  27.083 1.00 0.00 ? 92 DC  C H6     4  
ATOM 8041  N N      . GLY A 1 1  ? 45.534 20.234 46.729 1.00 0.00 ? -2 GLY A N      5  
ATOM 8042  C CA     . GLY A 1 1  ? 44.962 21.482 47.265 1.00 0.00 ? -2 GLY A CA     5  
ATOM 8043  C C      . GLY A 1 1  ? 43.555 21.236 47.758 1.00 0.00 ? -2 GLY A C      5  
ATOM 8044  O O      . GLY A 1 1  ? 43.371 20.406 48.645 1.00 0.00 ? -2 GLY A O      5  
ATOM 8045  H H1     . GLY A 1 1  ? 45.533 19.507 47.432 1.00 0.00 ? -2 GLY A H1     5  
ATOM 8046  H H2     . GLY A 1 1  ? 46.479 20.392 46.406 1.00 0.00 ? -2 GLY A H2     5  
ATOM 8047  H H3     . GLY A 1 1  ? 44.980 19.917 45.941 1.00 0.00 ? -2 GLY A H3     5  
ATOM 8048  H HA2    . GLY A 1 1  ? 45.570 21.836 48.096 1.00 0.00 ? -2 GLY A HA2    5  
ATOM 8049  H HA3    . GLY A 1 1  ? 44.943 22.235 46.480 1.00 0.00 ? -2 GLY A HA3    5  
ATOM 8050  N N      . SER A 1 2  ? 42.567 21.912 47.168 1.00 0.00 ? -1 SER A N      5  
ATOM 8051  C CA     . SER A 1 2  ? 41.133 21.641 47.362 1.00 0.00 ? -1 SER A CA     5  
ATOM 8052  C C      . SER A 1 2  ? 40.412 21.606 46.013 1.00 0.00 ? -1 SER A C      5  
ATOM 8053  O O      . SER A 1 2  ? 40.754 22.354 45.094 1.00 0.00 ? -1 SER A O      5  
ATOM 8054  C CB     . SER A 1 2  ? 40.484 22.684 48.279 1.00 0.00 ? -1 SER A CB     5  
ATOM 8055  O OG     . SER A 1 2  ? 41.047 22.614 49.577 1.00 0.00 ? -1 SER A OG     5  
ATOM 8056  H H      . SER A 1 2  ? 42.800 22.552 46.419 1.00 0.00 ? -1 SER A H      5  
ATOM 8057  H HA     . SER A 1 2  ? 41.004 20.662 47.822 1.00 0.00 ? -1 SER A HA     5  
ATOM 8058  H HB2    . SER A 1 2  ? 40.645 23.681 47.865 1.00 0.00 ? -1 SER A HB2    5  
ATOM 8059  H HB3    . SER A 1 2  ? 39.411 22.498 48.343 1.00 0.00 ? -1 SER A HB3    5  
ATOM 8060  H HG     . SER A 1 2  ? 40.588 21.900 50.071 1.00 0.00 ? -1 SER A HG     5  
ATOM 8061  N N      . GLN A 1 3  ? 39.415 20.732 45.887 1.00 0.00 ? 1  GLN A N      5  
ATOM 8062  C CA     . GLN A 1 3  ? 38.698 20.487 44.637 1.00 0.00 ? 1  GLN A CA     5  
ATOM 8063  C C      . GLN A 1 3  ? 37.502 21.443 44.541 1.00 0.00 ? 1  GLN A C      5  
ATOM 8064  O O      . GLN A 1 3  ? 36.575 21.368 45.351 1.00 0.00 ? 1  GLN A O      5  
ATOM 8065  C CB     . GLN A 1 3  ? 38.301 19.002 44.555 1.00 0.00 ? 1  GLN A CB     5  
ATOM 8066  C CG     . GLN A 1 3  ? 39.475 18.082 44.175 1.00 0.00 ? 1  GLN A CG     5  
ATOM 8067  C CD     . GLN A 1 3  ? 40.556 17.966 45.247 1.00 0.00 ? 1  GLN A CD     5  
ATOM 8068  O OE1    . GLN A 1 3  ? 41.638 18.537 45.155 1.00 0.00 ? 1  GLN A OE1    5  
ATOM 8069  N NE2    . GLN A 1 3  ? 40.305 17.245 46.316 1.00 0.00 ? 1  GLN A NE2    5  
ATOM 8070  H H      . GLN A 1 3  ? 39.110 20.217 46.710 1.00 0.00 ? 1  GLN A H      5  
ATOM 8071  H HA     . GLN A 1 3  ? 39.357 20.696 43.793 1.00 0.00 ? 1  GLN A HA     5  
ATOM 8072  H HB2    . GLN A 1 3  ? 37.861 18.677 45.500 1.00 0.00 ? 1  GLN A HB2    5  
ATOM 8073  H HB3    . GLN A 1 3  ? 37.540 18.891 43.786 1.00 0.00 ? 1  GLN A HB3    5  
ATOM 8074  H HG2    . GLN A 1 3  ? 39.080 17.084 43.983 1.00 0.00 ? 1  GLN A HG2    5  
ATOM 8075  H HG3    . GLN A 1 3  ? 39.931 18.443 43.252 1.00 0.00 ? 1  GLN A HG3    5  
ATOM 8076  H HE21   . GLN A 1 3  ? 39.407 16.797 46.434 1.00 0.00 ? 1  GLN A HE21   5  
ATOM 8077  H HE22   . GLN A 1 3  ? 41.024 17.133 47.018 1.00 0.00 ? 1  GLN A HE22   5  
ATOM 8078  N N      . ARG A 1 4  ? 37.558 22.373 43.583 1.00 0.00 ? 2  ARG A N      5  
ATOM 8079  C CA     . ARG A 1 4  ? 36.637 23.510 43.400 1.00 0.00 ? 2  ARG A CA     5  
ATOM 8080  C C      . ARG A 1 4  ? 35.982 23.524 42.017 1.00 0.00 ? 2  ARG A C      5  
ATOM 8081  O O      . ARG A 1 4  ? 34.788 23.807 41.903 1.00 0.00 ? 2  ARG A O      5  
ATOM 8082  C CB     . ARG A 1 4  ? 37.413 24.831 43.588 1.00 0.00 ? 2  ARG A CB     5  
ATOM 8083  C CG     . ARG A 1 4  ? 37.831 25.132 45.038 1.00 0.00 ? 2  ARG A CG     5  
ATOM 8084  C CD     . ARG A 1 4  ? 38.635 26.439 45.159 1.00 0.00 ? 2  ARG A CD     5  
ATOM 8085  N NE     . ARG A 1 4  ? 37.860 27.596 44.677 1.00 0.00 ? 2  ARG A NE     5  
ATOM 8086  C CZ     . ARG A 1 4  ? 38.184 28.872 44.698 1.00 0.00 ? 2  ARG A CZ     5  
ATOM 8087  N NH1    . ARG A 1 4  ? 39.257 29.350 45.242 1.00 0.00 ? 2  ARG A NH1    5  
ATOM 8088  N NH2    . ARG A 1 4  ? 37.378 29.732 44.165 1.00 0.00 1 2  ARG A NH2    5  
ATOM 8089  H H      . ARG A 1 4  ? 38.335 22.294 42.934 1.00 0.00 ? 2  ARG A H      5  
ATOM 8090  H HA     . ARG A 1 4  ? 35.827 23.463 44.132 1.00 0.00 ? 2  ARG A HA     5  
ATOM 8091  H HB2    . ARG A 1 4  ? 38.304 24.817 42.957 1.00 0.00 ? 2  ARG A HB2    5  
ATOM 8092  H HB3    . ARG A 1 4  ? 36.775 25.644 43.240 1.00 0.00 ? 2  ARG A HB3    5  
ATOM 8093  H HG2    . ARG A 1 4  ? 36.934 25.214 45.654 1.00 0.00 ? 2  ARG A HG2    5  
ATOM 8094  H HG3    . ARG A 1 4  ? 38.442 24.313 45.418 1.00 0.00 ? 2  ARG A HG3    5  
ATOM 8095  H HD2    . ARG A 1 4  ? 38.902 26.590 46.207 1.00 0.00 ? 2  ARG A HD2    5  
ATOM 8096  H HD3    . ARG A 1 4  ? 39.555 26.347 44.579 1.00 0.00 ? 2  ARG A HD3    5  
ATOM 8097  H HE     . ARG A 1 4  ? 36.943 27.411 44.285 1.00 0.00 ? 2  ARG A HE     5  
ATOM 8098  H HH11   . ARG A 1 4  ? 39.913 28.761 45.739 1.00 0.00 ? 2  ARG A HH11   5  
ATOM 8099  H HH12   . ARG A 1 4  ? 39.390 30.356 45.243 1.00 0.00 ? 2  ARG A HH12   5  
ATOM 8100  H HH21   . ARG A 1 4  ? 36.498 29.386 43.796 1.00 0.00 ? 2  ARG A HH21   5  
ATOM 8101  H HH22   . ARG A 1 4  ? 37.565 30.718 44.281 1.00 0.00 ? 2  ARG A HH22   5  
ATOM 8102  N N      . ARG A 1 5  ? 36.763 23.278 40.961 1.00 0.00 ? 3  ARG A N      5  
ATOM 8103  C CA     . ARG A 1 5  ? 36.408 23.520 39.551 1.00 0.00 ? 3  ARG A CA     5  
ATOM 8104  C C      . ARG A 1 5  ? 35.554 22.392 38.971 1.00 0.00 ? 3  ARG A C      5  
ATOM 8105  O O      . ARG A 1 5  ? 35.502 21.290 39.517 1.00 0.00 ? 3  ARG A O      5  
ATOM 8106  C CB     . ARG A 1 5  ? 37.699 23.781 38.751 1.00 0.00 ? 3  ARG A CB     5  
ATOM 8107  C CG     . ARG A 1 5  ? 37.542 24.874 37.682 1.00 0.00 ? 3  ARG A CG     5  
ATOM 8108  C CD     . ARG A 1 5  ? 38.879 25.274 37.044 1.00 0.00 ? 3  ARG A CD     5  
ATOM 8109  N NE     . ARG A 1 5  ? 39.841 25.850 38.018 1.00 0.00 ? 3  ARG A NE     5  
ATOM 8110  C CZ     . ARG A 1 5  ? 40.659 26.863 37.810 1.00 0.00 ? 3  ARG A CZ     5  
ATOM 8111  N NH1    . ARG A 1 5  ? 40.561 27.647 36.784 1.00 0.00 1 3  ARG A NH1    5  
ATOM 8112  N NH2    . ARG A 1 5  ? 41.626 27.153 38.628 1.00 0.00 ? 3  ARG A NH2    5  
ATOM 8113  H H      . ARG A 1 5  ? 37.708 22.958 41.158 1.00 0.00 ? 3  ARG A H      5  
ATOM 8114  H HA     . ARG A 1 5  ? 35.795 24.424 39.525 1.00 0.00 ? 3  ARG A HA     5  
ATOM 8115  H HB2    . ARG A 1 5  ? 38.465 24.110 39.449 1.00 0.00 ? 3  ARG A HB2    5  
ATOM 8116  H HB3    . ARG A 1 5  ? 38.043 22.854 38.288 1.00 0.00 ? 3  ARG A HB3    5  
ATOM 8117  H HG2    . ARG A 1 5  ? 36.878 24.513 36.895 1.00 0.00 ? 3  ARG A HG2    5  
ATOM 8118  H HG3    . ARG A 1 5  ? 37.096 25.761 38.132 1.00 0.00 ? 3  ARG A HG3    5  
ATOM 8119  H HD2    . ARG A 1 5  ? 39.325 24.399 36.570 1.00 0.00 ? 3  ARG A HD2    5  
ATOM 8120  H HD3    . ARG A 1 5  ? 38.668 25.989 36.249 1.00 0.00 ? 3  ARG A HD3    5  
ATOM 8121  H HE     . ARG A 1 5  ? 39.992 25.355 38.892 1.00 0.00 ? 3  ARG A HE     5  
ATOM 8122  H HH11   . ARG A 1 5  ? 39.837 27.484 36.097 1.00 0.00 ? 3  ARG A HH11   5  
ATOM 8123  H HH12   . ARG A 1 5  ? 41.266 28.355 36.645 1.00 0.00 ? 3  ARG A HH12   5  
ATOM 8124  H HH21   . ARG A 1 5  ? 41.776 26.631 39.488 1.00 0.00 ? 3  ARG A HH21   5  
ATOM 8125  H HH22   . ARG A 1 5  ? 42.267 27.892 38.367 1.00 0.00 ? 3  ARG A HH22   5  
ATOM 8126  N N      . GLN A 1 6  ? 34.844 22.685 37.887 1.00 0.00 ? 4  GLN A N      5  
ATOM 8127  C CA     . GLN A 1 6  ? 33.799 21.843 37.294 1.00 0.00 ? 4  GLN A CA     5  
ATOM 8128  C C      . GLN A 1 6  ? 33.796 22.007 35.766 1.00 0.00 ? 4  GLN A C      5  
ATOM 8129  O O      . GLN A 1 6  ? 34.472 22.890 35.241 1.00 0.00 ? 4  GLN A O      5  
ATOM 8130  C CB     . GLN A 1 6  ? 32.421 22.282 37.832 1.00 0.00 ? 4  GLN A CB     5  
ATOM 8131  C CG     . GLN A 1 6  ? 32.214 22.282 39.354 1.00 0.00 ? 4  GLN A CG     5  
ATOM 8132  C CD     . GLN A 1 6  ? 31.962 20.890 39.903 1.00 0.00 ? 4  GLN A CD     5  
ATOM 8133  O OE1    . GLN A 1 6  ? 30.822 20.490 40.110 1.00 0.00 ? 4  GLN A OE1    5  
ATOM 8134  N NE2    . GLN A 1 6  ? 32.982 20.108 40.163 1.00 0.00 ? 4  GLN A NE2    5  
ATOM 8135  H H      . GLN A 1 6  ? 35.022 23.560 37.419 1.00 0.00 ? 4  GLN A H      5  
ATOM 8136  H HA     . GLN A 1 6  ? 33.970 20.791 37.531 1.00 0.00 ? 4  GLN A HA     5  
ATOM 8137  H HB2    . GLN A 1 6  ? 32.225 23.291 37.478 1.00 0.00 ? 4  GLN A HB2    5  
ATOM 8138  H HB3    . GLN A 1 6  ? 31.659 21.634 37.398 1.00 0.00 ? 4  GLN A HB3    5  
ATOM 8139  H HG2    . GLN A 1 6  ? 33.053 22.741 39.870 1.00 0.00 ? 4  GLN A HG2    5  
ATOM 8140  H HG3    . GLN A 1 6  ? 31.335 22.889 39.574 1.00 0.00 ? 4  GLN A HG3    5  
ATOM 8141  H HE21   . GLN A 1 6  ? 33.929 20.431 40.003 1.00 0.00 ? 4  GLN A HE21   5  
ATOM 8142  H HE22   . GLN A 1 6  ? 32.804 19.191 40.556 1.00 0.00 ? 4  GLN A HE22   5  
ATOM 8143  N N      . ARG A 1 7  ? 32.975 21.215 35.071 1.00 0.00 ? 5  ARG A N      5  
ATOM 8144  C CA     . ARG A 1 7  ? 32.566 21.445 33.674 1.00 0.00 ? 5  ARG A CA     5  
ATOM 8145  C C      . ARG A 1 7  ? 31.028 21.456 33.554 1.00 0.00 ? 5  ARG A C      5  
ATOM 8146  O O      . ARG A 1 7  ? 30.339 21.619 34.563 1.00 0.00 ? 5  ARG A O      5  
ATOM 8147  C CB     . ARG A 1 7  ? 33.325 20.454 32.764 1.00 0.00 ? 5  ARG A CB     5  
ATOM 8148  C CG     . ARG A 1 7  ? 33.950 21.147 31.541 1.00 0.00 ? 5  ARG A CG     5  
ATOM 8149  C CD     . ARG A 1 7  ? 34.831 20.168 30.757 1.00 0.00 ? 5  ARG A CD     5  
ATOM 8150  N NE     . ARG A 1 7  ? 35.335 20.757 29.501 1.00 0.00 ? 5  ARG A NE     5  
ATOM 8151  C CZ     . ARG A 1 7  ? 35.395 20.162 28.323 1.00 0.00 ? 5  ARG A CZ     5  
ATOM 8152  N NH1    . ARG A 1 7  ? 34.889 18.991 28.084 1.00 0.00 ? 5  ARG A NH1    5  
ATOM 8153  N NH2    . ARG A 1 7  ? 35.999 20.724 27.329 1.00 0.00 1 5  ARG A NH2    5  
ATOM 8154  H H      . ARG A 1 7  ? 32.505 20.475 35.589 1.00 0.00 ? 5  ARG A H      5  
ATOM 8155  H HA     . ARG A 1 7  ? 32.879 22.457 33.404 1.00 0.00 ? 5  ARG A HA     5  
ATOM 8156  H HB2    . ARG A 1 7  ? 34.139 19.998 33.332 1.00 0.00 ? 5  ARG A HB2    5  
ATOM 8157  H HB3    . ARG A 1 7  ? 32.662 19.654 32.433 1.00 0.00 ? 5  ARG A HB3    5  
ATOM 8158  H HG2    . ARG A 1 7  ? 33.158 21.524 30.894 1.00 0.00 ? 5  ARG A HG2    5  
ATOM 8159  H HG3    . ARG A 1 7  ? 34.572 21.979 31.874 1.00 0.00 ? 5  ARG A HG3    5  
ATOM 8160  H HD2    . ARG A 1 7  ? 35.682 19.882 31.380 1.00 0.00 ? 5  ARG A HD2    5  
ATOM 8161  H HD3    . ARG A 1 7  ? 34.250 19.271 30.553 1.00 0.00 ? 5  ARG A HD3    5  
ATOM 8162  H HE     . ARG A 1 7  ? 35.838 21.638 29.571 1.00 0.00 ? 5  ARG A HE     5  
ATOM 8163  H HH11   . ARG A 1 7  ? 34.152 18.643 28.682 1.00 0.00 ? 5  ARG A HH11   5  
ATOM 8164  H HH12   . ARG A 1 7  ? 35.049 18.572 27.177 1.00 0.00 ? 5  ARG A HH12   5  
ATOM 8165  H HH21   . ARG A 1 7  ? 36.249 21.697 27.393 1.00 0.00 ? 5  ARG A HH21   5  
ATOM 8166  H HH22   . ARG A 1 7  ? 35.992 20.246 26.431 1.00 0.00 ? 5  ARG A HH22   5  
ATOM 8167  N N      . THR A 1 8  ? 30.484 21.343 32.339 1.00 0.00 ? 6  THR A N      5  
ATOM 8168  C CA     . THR A 1 8  ? 29.136 21.785 31.906 1.00 0.00 ? 6  THR A CA     5  
ATOM 8169  C C      . THR A 1 8  ? 27.986 21.664 32.921 1.00 0.00 ? 6  THR A C      5  
ATOM 8170  O O      . THR A 1 8  ? 27.654 20.574 33.399 1.00 0.00 ? 6  THR A O      5  
ATOM 8171  C CB     . THR A 1 8  ? 28.707 21.004 30.654 1.00 0.00 ? 6  THR A CB     5  
ATOM 8172  O OG1    . THR A 1 8  ? 29.757 20.931 29.721 1.00 0.00 ? 6  THR A OG1    5  
ATOM 8173  C CG2    . THR A 1 8  ? 27.519 21.629 29.921 1.00 0.00 ? 6  THR A CG2    5  
ATOM 8174  H H      . THR A 1 8  ? 31.104 21.071 31.591 1.00 0.00 ? 6  THR A H      5  
ATOM 8175  H HA     . THR A 1 8  ? 29.218 22.833 31.620 1.00 0.00 ? 6  THR A HA     5  
ATOM 8176  H HB     . THR A 1 8  ? 28.445 19.991 30.949 1.00 0.00 ? 6  THR A HB     5  
ATOM 8177  H HG1    . THR A 1 8  ? 29.478 20.216 29.104 1.00 0.00 ? 6  THR A HG1    5  
ATOM 8178  H HG21   . THR A 1 8  ? 26.612 21.500 30.509 1.00 0.00 ? 6  THR A HG21   5  
ATOM 8179  H HG22   . THR A 1 8  ? 27.701 22.688 29.736 1.00 0.00 ? 6  THR A HG22   5  
ATOM 8180  H HG23   . THR A 1 8  ? 27.368 21.125 28.965 1.00 0.00 ? 6  THR A HG23   5  
ATOM 8181  N N      . HIS A 1 9  ? 27.284 22.782 33.139 1.00 0.00 ? 7  HIS A N      5  
ATOM 8182  C CA     . HIS A 1 9  ? 25.992 22.860 33.844 1.00 0.00 ? 7  HIS A CA     5  
ATOM 8183  C C      . HIS A 1 9  ? 24.953 23.663 33.030 1.00 0.00 ? 7  HIS A C      5  
ATOM 8184  O O      . HIS A 1 9  ? 24.205 24.479 33.572 1.00 0.00 ? 7  HIS A O      5  
ATOM 8185  C CB     . HIS A 1 9  ? 26.224 23.370 35.282 1.00 0.00 ? 7  HIS A CB     5  
ATOM 8186  C CG     . HIS A 1 9  ? 25.026 23.257 36.196 1.00 0.00 ? 7  HIS A CG     5  
ATOM 8187  N ND1    . HIS A 1 9  ? 24.557 24.262 37.051 1.00 0.00 ? 7  HIS A ND1    5  
ATOM 8188  C CD2    . HIS A 1 9  ? 24.216 22.165 36.318 1.00 0.00 ? 7  HIS A CD2    5  
ATOM 8189  C CE1    . HIS A 1 9  ? 23.452 23.761 37.631 1.00 0.00 ? 7  HIS A CE1    5  
ATOM 8190  N NE2    . HIS A 1 9  ? 23.231 22.504 37.216 1.00 0.00 ? 7  HIS A NE2    5  
ATOM 8191  H H      . HIS A 1 9  ? 27.651 23.649 32.769 1.00 0.00 ? 7  HIS A H      5  
ATOM 8192  H HA     . HIS A 1 9  ? 25.583 21.852 33.922 1.00 0.00 ? 7  HIS A HA     5  
ATOM 8193  H HB2    . HIS A 1 9  ? 27.020 22.781 35.730 1.00 0.00 ? 7  HIS A HB2    5  
ATOM 8194  H HB3    . HIS A 1 9  ? 26.551 24.410 35.248 1.00 0.00 ? 7  HIS A HB3    5  
ATOM 8195  H HD2    . HIS A 1 9  ? 24.313 21.227 35.789 1.00 0.00 ? 7  HIS A HD2    5  
ATOM 8196  H HE1    . HIS A 1 9  ? 22.818 24.298 38.327 1.00 0.00 ? 7  HIS A HE1    5  
ATOM 8197  H HE2    . HIS A 1 9  ? 22.421 21.937 37.468 1.00 0.00 ? 7  HIS A HE2    5  
ATOM 8198  N N      . PHE A 1 10 ? 24.937 23.454 31.707 1.00 0.00 ? 8  PHE A N      5  
ATOM 8199  C CA     . PHE A 1 10 ? 24.084 24.159 30.741 1.00 0.00 ? 8  PHE A CA     5  
ATOM 8200  C C      . PHE A 1 10 ? 23.218 23.186 29.924 1.00 0.00 ? 8  PHE A C      5  
ATOM 8201  O O      . PHE A 1 10 ? 23.730 22.198 29.388 1.00 0.00 ? 8  PHE A O      5  
ATOM 8202  C CB     . PHE A 1 10 ? 24.934 25.004 29.775 1.00 0.00 ? 8  PHE A CB     5  
ATOM 8203  C CG     . PHE A 1 10 ? 26.017 25.866 30.401 1.00 0.00 ? 8  PHE A CG     5  
ATOM 8204  C CD1    . PHE A 1 10 ? 25.709 26.765 31.439 1.00 0.00 ? 8  PHE A CD1    5  
ATOM 8205  C CD2    . PHE A 1 10 ? 27.338 25.787 29.919 1.00 0.00 ? 8  PHE A CD2    5  
ATOM 8206  C CE1    . PHE A 1 10 ? 26.719 27.567 32.001 1.00 0.00 ? 8  PHE A CE1    5  
ATOM 8207  C CE2    . PHE A 1 10 ? 28.347 26.583 30.485 1.00 0.00 ? 8  PHE A CE2    5  
ATOM 8208  C CZ     . PHE A 1 10 ? 28.040 27.470 31.532 1.00 0.00 ? 8  PHE A CZ     5  
ATOM 8209  H H      . PHE A 1 10 ? 25.546 22.744 31.332 1.00 0.00 ? 8  PHE A H      5  
ATOM 8210  H HA     . PHE A 1 10 ? 23.423 24.835 31.279 1.00 0.00 ? 8  PHE A HA     5  
ATOM 8211  H HB2    . PHE A 1 10 ? 25.406 24.331 29.058 1.00 0.00 ? 8  PHE A HB2    5  
ATOM 8212  H HB3    . PHE A 1 10 ? 24.267 25.656 29.210 1.00 0.00 ? 8  PHE A HB3    5  
ATOM 8213  H HD1    . PHE A 1 10 ? 24.694 26.846 31.805 1.00 0.00 ? 8  PHE A HD1    5  
ATOM 8214  H HD2    . PHE A 1 10 ? 27.579 25.132 29.092 1.00 0.00 ? 8  PHE A HD2    5  
ATOM 8215  H HE1    . PHE A 1 10 ? 26.476 28.261 32.793 1.00 0.00 ? 8  PHE A HE1    5  
ATOM 8216  H HE2    . PHE A 1 10 ? 29.350 26.534 30.088 1.00 0.00 ? 8  PHE A HE2    5  
ATOM 8217  H HZ     . PHE A 1 10 ? 28.814 28.090 31.967 1.00 0.00 ? 8  PHE A HZ     5  
ATOM 8218  N N      . THR A 1 11 ? 21.929 23.493 29.772 1.00 0.00 ? 9  THR A N      5  
ATOM 8219  C CA     . THR A 1 11 ? 20.992 22.756 28.905 1.00 0.00 ? 9  THR A CA     5  
ATOM 8220  C C      . THR A 1 11 ? 20.833 23.438 27.542 1.00 0.00 ? 9  THR A C      5  
ATOM 8221  O O      . THR A 1 11 ? 21.105 24.632 27.394 1.00 0.00 ? 9  THR A O      5  
ATOM 8222  C CB     . THR A 1 11 ? 19.622 22.546 29.576 1.00 0.00 ? 9  THR A CB     5  
ATOM 8223  O OG1    . THR A 1 11 ? 18.874 23.739 29.592 1.00 0.00 ? 9  THR A OG1    5  
ATOM 8224  C CG2    . THR A 1 11 ? 19.735 22.026 31.010 1.00 0.00 ? 9  THR A CG2    5  
ATOM 8225  H H      . THR A 1 11 ? 21.569 24.310 30.260 1.00 0.00 ? 9  THR A H      5  
ATOM 8226  H HA     . THR A 1 11 ? 21.403 21.765 28.718 1.00 0.00 ? 9  THR A HA     5  
ATOM 8227  H HB     . THR A 1 11 ? 19.066 21.813 28.996 1.00 0.00 ? 9  THR A HB     5  
ATOM 8228  H HG1    . THR A 1 11 ? 18.035 23.540 30.050 1.00 0.00 ? 9  THR A HG1    5  
ATOM 8229  H HG21   . THR A 1 11 ? 18.753 21.737 31.378 1.00 0.00 ? 9  THR A HG21   5  
ATOM 8230  H HG22   . THR A 1 11 ? 20.385 21.152 31.033 1.00 0.00 ? 9  THR A HG22   5  
ATOM 8231  H HG23   . THR A 1 11 ? 20.146 22.797 31.665 1.00 0.00 ? 9  THR A HG23   5  
ATOM 8232  N N      . SER A 1 12 ? 20.360 22.718 26.520 1.00 0.00 ? 10 SER A N      5  
ATOM 8233  C CA     . SER A 1 12 ? 20.187 23.286 25.172 1.00 0.00 ? 10 SER A CA     5  
ATOM 8234  C C      . SER A 1 12 ? 19.190 24.453 25.148 1.00 0.00 ? 10 SER A C      5  
ATOM 8235  O O      . SER A 1 12 ? 19.437 25.451 24.479 1.00 0.00 ? 10 SER A O      5  
ATOM 8236  C CB     . SER A 1 12 ? 19.754 22.206 24.180 1.00 0.00 ? 10 SER A CB     5  
ATOM 8237  O OG     . SER A 1 12 ? 20.672 21.128 24.190 1.00 0.00 ? 10 SER A OG     5  
ATOM 8238  H H      . SER A 1 12 ? 20.136 21.741 26.655 1.00 0.00 ? 10 SER A H      5  
ATOM 8239  H HA     . SER A 1 12 ? 21.148 23.674 24.834 1.00 0.00 ? 10 SER A HA     5  
ATOM 8240  H HB2    . SER A 1 12 ? 18.766 21.843 24.457 1.00 0.00 ? 10 SER A HB2    5  
ATOM 8241  H HB3    . SER A 1 12 ? 19.710 22.633 23.177 1.00 0.00 ? 10 SER A HB3    5  
ATOM 8242  H HG     . SER A 1 12 ? 20.415 20.515 23.469 1.00 0.00 ? 10 SER A HG     5  
ATOM 8243  N N      . GLN A 1 13 ? 18.119 24.397 25.953 1.00 0.00 ? 11 GLN A N      5  
ATOM 8244  C CA     . GLN A 1 13 ? 17.176 25.516 26.133 1.00 0.00 ? 11 GLN A CA     5  
ATOM 8245  C C      . GLN A 1 13 ? 17.860 26.778 26.702 1.00 0.00 ? 11 GLN A C      5  
ATOM 8246  O O      . GLN A 1 13 ? 17.425 27.890 26.402 1.00 0.00 ? 11 GLN A O      5  
ATOM 8247  C CB     . GLN A 1 13 ? 16.015 25.034 27.028 1.00 0.00 ? 11 GLN A CB     5  
ATOM 8248  C CG     . GLN A 1 13 ? 15.010 26.102 27.507 1.00 0.00 ? 11 GLN A CG     5  
ATOM 8249  C CD     . GLN A 1 13 ? 14.183 26.768 26.406 1.00 0.00 ? 11 GLN A CD     5  
ATOM 8250  O OE1    . GLN A 1 13 ? 13.041 26.403 26.144 1.00 0.00 ? 11 GLN A OE1    5  
ATOM 8251  N NE2    . GLN A 1 13 ? 14.700 27.781 25.750 1.00 0.00 ? 11 GLN A NE2    5  
ATOM 8252  H H      . GLN A 1 13 ? 17.984 23.561 26.505 1.00 0.00 ? 11 GLN A H      5  
ATOM 8253  H HA     . GLN A 1 13 ? 16.771 25.786 25.157 1.00 0.00 ? 11 GLN A HA     5  
ATOM 8254  H HB2    . GLN A 1 13 ? 15.466 24.257 26.494 1.00 0.00 ? 11 GLN A HB2    5  
ATOM 8255  H HB3    . GLN A 1 13 ? 16.444 24.577 27.921 1.00 0.00 ? 11 GLN A HB3    5  
ATOM 8256  H HG2    . GLN A 1 13 ? 14.316 25.615 28.189 1.00 0.00 ? 11 GLN A HG2    5  
ATOM 8257  H HG3    . GLN A 1 13 ? 15.529 26.869 28.081 1.00 0.00 ? 11 GLN A HG3    5  
ATOM 8258  H HE21   . GLN A 1 13 ? 15.652 28.077 25.947 1.00 0.00 ? 11 GLN A HE21   5  
ATOM 8259  H HE22   . GLN A 1 13 ? 14.162 28.239 25.027 1.00 0.00 ? 11 GLN A HE22   5  
ATOM 8260  N N      . GLN A 1 14 ? 18.930 26.638 27.488 1.00 0.00 ? 12 GLN A N      5  
ATOM 8261  C CA     . GLN A 1 14 ? 19.718 27.775 27.971 1.00 0.00 ? 12 GLN A CA     5  
ATOM 8262  C C      . GLN A 1 14 ? 20.657 28.297 26.875 1.00 0.00 ? 12 GLN A C      5  
ATOM 8263  O O      . GLN A 1 14 ? 20.667 29.494 26.589 1.00 0.00 ? 12 GLN A O      5  
ATOM 8264  C CB     . GLN A 1 14 ? 20.483 27.380 29.246 1.00 0.00 ? 12 GLN A CB     5  
ATOM 8265  C CG     . GLN A 1 14 ? 19.525 27.008 30.391 1.00 0.00 ? 12 GLN A CG     5  
ATOM 8266  C CD     . GLN A 1 14 ? 20.240 26.434 31.611 1.00 0.00 ? 12 GLN A CD     5  
ATOM 8267  O OE1    . GLN A 1 14 ? 21.215 25.707 31.513 1.00 0.00 ? 12 GLN A OE1    5  
ATOM 8268  N NE2    . GLN A 1 14 ? 19.795 26.746 32.806 1.00 0.00 ? 12 GLN A NE2    5  
ATOM 8269  H H      . GLN A 1 14 ? 19.273 25.706 27.692 1.00 0.00 ? 12 GLN A H      5  
ATOM 8270  H HA     . GLN A 1 14 ? 19.041 28.590 28.226 1.00 0.00 ? 12 GLN A HA     5  
ATOM 8271  H HB2    . GLN A 1 14 ? 21.143 26.541 29.031 1.00 0.00 ? 12 GLN A HB2    5  
ATOM 8272  H HB3    . GLN A 1 14 ? 21.099 28.220 29.568 1.00 0.00 ? 12 GLN A HB3    5  
ATOM 8273  H HG2    . GLN A 1 14 ? 18.976 27.899 30.671 1.00 0.00 ? 12 GLN A HG2    5  
ATOM 8274  H HG3    . GLN A 1 14 ? 18.797 26.271 30.063 1.00 0.00 ? 12 GLN A HG3    5  
ATOM 8275  H HE21   . GLN A 1 14 ? 19.097 27.476 32.894 1.00 0.00 ? 12 GLN A HE21   5  
ATOM 8276  H HE22   . GLN A 1 14 ? 20.368 26.452 33.590 1.00 0.00 ? 12 GLN A HE22   5  
ATOM 8277  N N      . LEU A 1 15 ? 21.390 27.395 26.210 1.00 0.00 ? 13 LEU A N      5  
ATOM 8278  C CA     . LEU A 1 15 ? 22.330 27.730 25.132 1.00 0.00 ? 13 LEU A CA     5  
ATOM 8279  C C      . LEU A 1 15 ? 21.648 28.460 23.962 1.00 0.00 ? 13 LEU A C      5  
ATOM 8280  O O      . LEU A 1 15 ? 22.185 29.456 23.477 1.00 0.00 ? 13 LEU A O      5  
ATOM 8281  C CB     . LEU A 1 15 ? 23.032 26.445 24.646 1.00 0.00 ? 13 LEU A CB     5  
ATOM 8282  C CG     . LEU A 1 15 ? 23.938 25.760 25.690 1.00 0.00 ? 13 LEU A CG     5  
ATOM 8283  C CD1    . LEU A 1 15 ? 24.425 24.411 25.158 1.00 0.00 ? 13 LEU A CD1    5  
ATOM 8284  C CD2    . LEU A 1 15 ? 25.167 26.602 26.036 1.00 0.00 ? 13 LEU A CD2    5  
ATOM 8285  H H      . LEU A 1 15 ? 21.310 26.423 26.491 1.00 0.00 ? 13 LEU A H      5  
ATOM 8286  H HA     . LEU A 1 15 ? 23.083 28.414 25.520 1.00 0.00 ? 13 LEU A HA     5  
ATOM 8287  H HB2    . LEU A 1 15 ? 22.268 25.736 24.323 1.00 0.00 ? 13 LEU A HB2    5  
ATOM 8288  H HB3    . LEU A 1 15 ? 23.638 26.688 23.773 1.00 0.00 ? 13 LEU A HB3    5  
ATOM 8289  H HG     . LEU A 1 15 ? 23.379 25.581 26.605 1.00 0.00 ? 13 LEU A HG     5  
ATOM 8290  H HD11   . LEU A 1 15 ? 25.005 24.557 24.247 1.00 0.00 ? 13 LEU A HD11   5  
ATOM 8291  H HD12   . LEU A 1 15 ? 25.047 23.921 25.907 1.00 0.00 ? 13 LEU A HD12   5  
ATOM 8292  H HD13   . LEU A 1 15 ? 23.571 23.771 24.941 1.00 0.00 ? 13 LEU A HD13   5  
ATOM 8293  H HD21   . LEU A 1 15 ? 25.741 26.810 25.132 1.00 0.00 ? 13 LEU A HD21   5  
ATOM 8294  H HD22   . LEU A 1 15 ? 24.863 27.539 26.501 1.00 0.00 ? 13 LEU A HD22   5  
ATOM 8295  H HD23   . LEU A 1 15 ? 25.797 26.060 26.741 1.00 0.00 ? 13 LEU A HD23   5  
ATOM 8296  N N      . GLN A 1 16 ? 20.447 28.029 23.557 1.00 0.00 ? 14 GLN A N      5  
ATOM 8297  C CA     . GLN A 1 16 ? 19.703 28.591 22.422 1.00 0.00 ? 14 GLN A CA     5  
ATOM 8298  C C      . GLN A 1 16 ? 19.338 30.083 22.567 1.00 0.00 ? 14 GLN A C      5  
ATOM 8299  O O      . GLN A 1 16 ? 19.282 30.782 21.555 1.00 0.00 ? 14 GLN A O      5  
ATOM 8300  C CB     . GLN A 1 16 ? 18.429 27.756 22.180 1.00 0.00 ? 14 GLN A CB     5  
ATOM 8301  C CG     . GLN A 1 16 ? 18.657 26.431 21.426 1.00 0.00 ? 14 GLN A CG     5  
ATOM 8302  C CD     . GLN A 1 16 ? 19.345 26.592 20.075 1.00 0.00 ? 14 GLN A CD     5  
ATOM 8303  O OE1    . GLN A 1 16 ? 20.343 25.947 19.776 1.00 0.00 ? 14 GLN A OE1    5  
ATOM 8304  N NE2    . GLN A 1 16 ? 18.873 27.461 19.212 1.00 0.00 ? 14 GLN A NE2    5  
ATOM 8305  H H      . GLN A 1 16 ? 20.075 27.194 24.000 1.00 0.00 ? 14 GLN A H      5  
ATOM 8306  H HA     . GLN A 1 16 ? 20.337 28.526 21.538 1.00 0.00 ? 14 GLN A HA     5  
ATOM 8307  H HB2    . GLN A 1 16 ? 17.947 27.545 23.137 1.00 0.00 ? 14 GLN A HB2    5  
ATOM 8308  H HB3    . GLN A 1 16 ? 17.723 28.347 21.598 1.00 0.00 ? 14 GLN A HB3    5  
ATOM 8309  H HG2    . GLN A 1 16 ? 19.265 25.764 22.033 1.00 0.00 ? 14 GLN A HG2    5  
ATOM 8310  H HG3    . GLN A 1 16 ? 17.689 25.955 21.267 1.00 0.00 ? 14 GLN A HG3    5  
ATOM 8311  H HE21   . GLN A 1 16 ? 18.106 28.078 19.455 1.00 0.00 ? 14 GLN A HE21   5  
ATOM 8312  H HE22   . GLN A 1 16 ? 19.378 27.593 18.345 1.00 0.00 ? 14 GLN A HE22   5  
ATOM 8313  N N      . GLU A 1 17 ? 19.124 30.595 23.785 1.00 0.00 ? 15 GLU A N      5  
ATOM 8314  C CA     . GLU A 1 17 ? 18.888 32.032 24.029 1.00 0.00 ? 15 GLU A CA     5  
ATOM 8315  C C      . GLU A 1 17 ? 20.201 32.820 24.207 1.00 0.00 ? 15 GLU A C      5  
ATOM 8316  O O      . GLU A 1 17 ? 20.280 34.000 23.848 1.00 0.00 ? 15 GLU A O      5  
ATOM 8317  C CB     . GLU A 1 17 ? 17.979 32.214 25.259 1.00 0.00 ? 15 GLU A CB     5  
ATOM 8318  C CG     . GLU A 1 17 ? 16.504 31.858 25.005 1.00 0.00 ? 15 GLU A CG     5  
ATOM 8319  C CD     . GLU A 1 17 ? 15.812 32.881 24.093 1.00 0.00 ? 15 GLU A CD     5  
ATOM 8320  O OE1    . GLU A 1 17 ? 15.503 34.004 24.552 1.00 0.00 ? 15 GLU A OE1    5  
ATOM 8321  O OE2    . GLU A 1 17 ? 15.603 32.597 22.889 1.00 0.00 ? 15 GLU A OE2    5  
ATOM 8322  H H      . GLU A 1 17 ? 19.188 29.975 24.583 1.00 0.00 ? 15 GLU A H      5  
ATOM 8323  H HA     . GLU A 1 17 ? 18.383 32.469 23.167 1.00 0.00 ? 15 GLU A HA     5  
ATOM 8324  H HB2    . GLU A 1 17 ? 18.359 31.592 26.071 1.00 0.00 ? 15 GLU A HB2    5  
ATOM 8325  H HB3    . GLU A 1 17 ? 18.027 33.253 25.590 1.00 0.00 ? 15 GLU A HB3    5  
ATOM 8326  H HG2    . GLU A 1 17 ? 16.436 30.858 24.572 1.00 0.00 ? 15 GLU A HG2    5  
ATOM 8327  H HG3    . GLU A 1 17 ? 15.985 31.837 25.966 1.00 0.00 ? 15 GLU A HG3    5  
ATOM 8328  N N      . LEU A 1 18 ? 21.256 32.171 24.715 1.00 0.00 ? 16 LEU A N      5  
ATOM 8329  C CA     . LEU A 1 18 ? 22.581 32.777 24.878 1.00 0.00 ? 16 LEU A CA     5  
ATOM 8330  C C      . LEU A 1 18 ? 23.237 33.065 23.515 1.00 0.00 ? 16 LEU A C      5  
ATOM 8331  O O      . LEU A 1 18 ? 23.707 34.182 23.289 1.00 0.00 ? 16 LEU A O      5  
ATOM 8332  C CB     . LEU A 1 18 ? 23.452 31.867 25.768 1.00 0.00 ? 16 LEU A CB     5  
ATOM 8333  C CG     . LEU A 1 18 ? 23.007 31.794 27.244 1.00 0.00 ? 16 LEU A CG     5  
ATOM 8334  C CD1    . LEU A 1 18 ? 23.689 30.626 27.958 1.00 0.00 ? 16 LEU A CD1    5  
ATOM 8335  C CD2    . LEU A 1 18 ? 23.366 33.069 28.012 1.00 0.00 ? 16 LEU A CD2    5  
ATOM 8336  H H      . LEU A 1 18 ? 21.143 31.197 24.970 1.00 0.00 ? 16 LEU A H      5  
ATOM 8337  H HA     . LEU A 1 18 ? 22.465 33.741 25.371 1.00 0.00 ? 16 LEU A HA     5  
ATOM 8338  H HB2    . LEU A 1 18 ? 23.453 30.862 25.346 1.00 0.00 ? 16 LEU A HB2    5  
ATOM 8339  H HB3    . LEU A 1 18 ? 24.475 32.232 25.743 1.00 0.00 ? 16 LEU A HB3    5  
ATOM 8340  H HG     . LEU A 1 18 ? 21.930 31.652 27.302 1.00 0.00 ? 16 LEU A HG     5  
ATOM 8341  H HD11   . LEU A 1 18 ? 24.771 30.741 27.924 1.00 0.00 ? 16 LEU A HD11   5  
ATOM 8342  H HD12   . LEU A 1 18 ? 23.361 30.581 28.995 1.00 0.00 ? 16 LEU A HD12   5  
ATOM 8343  H HD13   . LEU A 1 18 ? 23.416 29.691 27.469 1.00 0.00 ? 16 LEU A HD13   5  
ATOM 8344  H HD21   . LEU A 1 18 ? 24.447 33.211 28.009 1.00 0.00 ? 16 LEU A HD21   5  
ATOM 8345  H HD22   . LEU A 1 18 ? 22.881 33.927 27.551 1.00 0.00 ? 16 LEU A HD22   5  
ATOM 8346  H HD23   . LEU A 1 18 ? 23.016 32.984 29.040 1.00 0.00 ? 16 LEU A HD23   5  
ATOM 8347  N N      . GLU A 1 19 ? 23.191 32.124 22.564 1.00 0.00 ? 17 GLU A N      5  
ATOM 8348  C CA     . GLU A 1 19 ? 23.695 32.362 21.199 1.00 0.00 ? 17 GLU A CA     5  
ATOM 8349  C C      . GLU A 1 19 ? 22.839 33.372 20.412 1.00 0.00 ? 17 GLU A C      5  
ATOM 8350  O O      . GLU A 1 19 ? 23.387 34.237 19.726 1.00 0.00 ? 17 GLU A O      5  
ATOM 8351  C CB     . GLU A 1 19 ? 23.872 31.042 20.429 1.00 0.00 ? 17 GLU A CB     5  
ATOM 8352  C CG     . GLU A 1 19 ? 22.568 30.287 20.137 1.00 0.00 ? 17 GLU A CG     5  
ATOM 8353  C CD     . GLU A 1 19 ? 22.809 29.118 19.190 1.00 0.00 ? 17 GLU A CD     5  
ATOM 8354  O OE1    . GLU A 1 19 ? 23.266 28.037 19.634 1.00 0.00 ? 17 GLU A OE1    5  
ATOM 8355  O OE2    . GLU A 1 19 ? 22.509 29.269 17.982 1.00 0.00 ? 17 GLU A OE2    5  
ATOM 8356  H H      . GLU A 1 19 ? 22.807 31.212 22.801 1.00 0.00 ? 17 GLU A H      5  
ATOM 8357  H HA     . GLU A 1 19 ? 24.686 32.809 21.284 1.00 0.00 ? 17 GLU A HA     5  
ATOM 8358  H HB2    . GLU A 1 19 ? 24.359 31.270 19.481 1.00 0.00 ? 17 GLU A HB2    5  
ATOM 8359  H HB3    . GLU A 1 19 ? 24.537 30.392 20.999 1.00 0.00 ? 17 GLU A HB3    5  
ATOM 8360  H HG2    . GLU A 1 19 ? 22.131 29.927 21.063 1.00 0.00 ? 17 GLU A HG2    5  
ATOM 8361  H HG3    . GLU A 1 19 ? 21.844 30.954 19.670 1.00 0.00 ? 17 GLU A HG3    5  
ATOM 8362  N N      . ALA A 1 20 ? 21.510 33.334 20.583 1.00 0.00 ? 18 ALA A N      5  
ATOM 8363  C CA     . ALA A 1 20 ? 20.580 34.278 19.961 1.00 0.00 ? 18 ALA A CA     5  
ATOM 8364  C C      . ALA A 1 20 ? 20.771 35.720 20.471 1.00 0.00 ? 18 ALA A C      5  
ATOM 8365  O O      . ALA A 1 20 ? 20.383 36.674 19.793 1.00 0.00 ? 18 ALA A O      5  
ATOM 8366  C CB     . ALA A 1 20 ? 19.153 33.784 20.213 1.00 0.00 ? 18 ALA A CB     5  
ATOM 8367  H H      . ALA A 1 20 ? 21.119 32.594 21.149 1.00 0.00 ? 18 ALA A H      5  
ATOM 8368  H HA     . ALA A 1 20 ? 20.756 34.283 18.884 1.00 0.00 ? 18 ALA A HA     5  
ATOM 8369  H HB1    . ALA A 1 20 ? 18.947 33.760 21.282 1.00 0.00 ? 18 ALA A HB1    5  
ATOM 8370  H HB2    . ALA A 1 20 ? 18.445 34.457 19.731 1.00 0.00 ? 18 ALA A HB2    5  
ATOM 8371  H HB3    . ALA A 1 20 ? 19.027 32.785 19.796 1.00 0.00 ? 18 ALA A HB3    5  
ATOM 8372  N N      . THR A 1 21 ? 21.404 35.877 21.639 1.00 0.00 ? 19 THR A N      5  
ATOM 8373  C CA     . THR A 1 21 ? 21.882 37.161 22.160 1.00 0.00 ? 19 THR A CA     5  
ATOM 8374  C C      . THR A 1 21 ? 23.262 37.512 21.589 1.00 0.00 ? 19 THR A C      5  
ATOM 8375  O O      . THR A 1 21 ? 23.445 38.607 21.060 1.00 0.00 ? 19 THR A O      5  
ATOM 8376  C CB     . THR A 1 21 ? 21.927 37.143 23.694 1.00 0.00 ? 19 THR A CB     5  
ATOM 8377  O OG1    . THR A 1 21 ? 20.683 36.742 24.234 1.00 0.00 ? 19 THR A OG1    5  
ATOM 8378  C CG2    . THR A 1 21 ? 22.236 38.530 24.253 1.00 0.00 ? 19 THR A CG2    5  
ATOM 8379  H H      . THR A 1 21 ? 21.632 35.037 22.156 1.00 0.00 ? 19 THR A H      5  
ATOM 8380  H HA     . THR A 1 21 ? 21.190 37.948 21.859 1.00 0.00 ? 19 THR A HA     5  
ATOM 8381  H HB     . THR A 1 21 ? 22.693 36.446 24.031 1.00 0.00 ? 19 THR A HB     5  
ATOM 8382  H HG1    . THR A 1 21 ? 20.562 35.791 24.045 1.00 0.00 ? 19 THR A HG1    5  
ATOM 8383  H HG21   . THR A 1 21 ? 22.268 38.476 25.336 1.00 0.00 ? 19 THR A HG21   5  
ATOM 8384  H HG22   . THR A 1 21 ? 23.206 38.882 23.902 1.00 0.00 ? 19 THR A HG22   5  
ATOM 8385  H HG23   . THR A 1 21 ? 21.466 39.240 23.948 1.00 0.00 ? 19 THR A HG23   5  
ATOM 8386  N N      . PHE A 1 22 ? 24.231 36.589 21.630 1.00 0.00 ? 20 PHE A N      5  
ATOM 8387  C CA     . PHE A 1 22 ? 25.610 36.841 21.177 1.00 0.00 ? 20 PHE A CA     5  
ATOM 8388  C C      . PHE A 1 22 ? 25.685 37.267 19.696 1.00 0.00 ? 20 PHE A C      5  
ATOM 8389  O O      . PHE A 1 22 ? 26.435 38.181 19.343 1.00 0.00 ? 20 PHE A O      5  
ATOM 8390  C CB     . PHE A 1 22 ? 26.465 35.597 21.457 1.00 0.00 ? 20 PHE A CB     5  
ATOM 8391  C CG     . PHE A 1 22 ? 27.964 35.847 21.405 1.00 0.00 ? 20 PHE A CG     5  
ATOM 8392  C CD1    . PHE A 1 22 ? 28.629 36.346 22.541 1.00 0.00 ? 20 PHE A CD1    5  
ATOM 8393  C CD2    . PHE A 1 22 ? 28.698 35.579 20.234 1.00 0.00 ? 20 PHE A CD2    5  
ATOM 8394  C CE1    . PHE A 1 22 ? 30.015 36.575 22.513 1.00 0.00 ? 20 PHE A CE1    5  
ATOM 8395  C CE2    . PHE A 1 22 ? 30.089 35.797 20.208 1.00 0.00 ? 20 PHE A CE2    5  
ATOM 8396  C CZ     . PHE A 1 22 ? 30.749 36.290 21.347 1.00 0.00 ? 20 PHE A CZ     5  
ATOM 8397  H H      . PHE A 1 22 ? 24.029 35.690 22.056 1.00 0.00 ? 20 PHE A H      5  
ATOM 8398  H HA     . PHE A 1 22 ? 26.013 37.663 21.768 1.00 0.00 ? 20 PHE A HA     5  
ATOM 8399  H HB2    . PHE A 1 22 ? 26.227 35.224 22.454 1.00 0.00 ? 20 PHE A HB2    5  
ATOM 8400  H HB3    . PHE A 1 22 ? 26.204 34.811 20.746 1.00 0.00 ? 20 PHE A HB3    5  
ATOM 8401  H HD1    . PHE A 1 22 ? 28.070 36.551 23.441 1.00 0.00 ? 20 PHE A HD1    5  
ATOM 8402  H HD2    . PHE A 1 22 ? 28.200 35.203 19.352 1.00 0.00 ? 20 PHE A HD2    5  
ATOM 8403  H HE1    . PHE A 1 22 ? 30.516 36.961 23.389 1.00 0.00 ? 20 PHE A HE1    5  
ATOM 8404  H HE2    . PHE A 1 22 ? 30.648 35.584 19.307 1.00 0.00 ? 20 PHE A HE2    5  
ATOM 8405  H HZ     . PHE A 1 22 ? 31.817 36.454 21.320 1.00 0.00 ? 20 PHE A HZ     5  
ATOM 8406  N N      . GLN A 1 23 ? 24.824 36.699 18.839 1.00 0.00 ? 21 GLN A N      5  
ATOM 8407  C CA     . GLN A 1 23 ? 24.729 37.072 17.421 1.00 0.00 ? 21 GLN A CA     5  
ATOM 8408  C C      . GLN A 1 23 ? 24.165 38.487 17.163 1.00 0.00 ? 21 GLN A C      5  
ATOM 8409  O O      . GLN A 1 23 ? 24.131 38.916 16.011 1.00 0.00 ? 21 GLN A O      5  
ATOM 8410  C CB     . GLN A 1 23 ? 23.970 35.987 16.635 1.00 0.00 ? 21 GLN A CB     5  
ATOM 8411  C CG     . GLN A 1 23 ? 22.437 36.032 16.793 1.00 0.00 ? 21 GLN A CG     5  
ATOM 8412  C CD     . GLN A 1 23 ? 21.714 36.346 15.481 1.00 0.00 ? 21 GLN A CD     5  
ATOM 8413  O OE1    . GLN A 1 23 ? 21.034 35.503 14.913 1.00 0.00 ? 21 GLN A OE1    5  
ATOM 8414  N NE2    . GLN A 1 23 ? 21.860 37.521 14.912 1.00 0.00 ? 21 GLN A NE2    5  
ATOM 8415  H H      . GLN A 1 23 ? 24.248 35.931 19.175 1.00 0.00 ? 21 GLN A H      5  
ATOM 8416  H HA     . GLN A 1 23 ? 25.748 37.081 17.030 1.00 0.00 ? 21 GLN A HA     5  
ATOM 8417  H HB2    . GLN A 1 23 ? 24.226 36.088 15.579 1.00 0.00 ? 21 GLN A HB2    5  
ATOM 8418  H HB3    . GLN A 1 23 ? 24.330 35.006 16.951 1.00 0.00 ? 21 GLN A HB3    5  
ATOM 8419  H HG2    . GLN A 1 23 ? 22.101 35.053 17.137 1.00 0.00 ? 21 GLN A HG2    5  
ATOM 8420  H HG3    . GLN A 1 23 ? 22.142 36.762 17.546 1.00 0.00 ? 21 GLN A HG3    5  
ATOM 8421  H HE21   . GLN A 1 23 ? 22.514 38.203 15.277 1.00 0.00 ? 21 GLN A HE21   5  
ATOM 8422  H HE22   . GLN A 1 23 ? 21.314 37.729 14.076 1.00 0.00 ? 21 GLN A HE22   5  
ATOM 8423  N N      . ARG A 1 24 ? 23.720 39.219 18.199 1.00 0.00 ? 22 ARG A N      5  
ATOM 8424  C CA     . ARG A 1 24 ? 23.404 40.661 18.123 1.00 0.00 ? 22 ARG A CA     5  
ATOM 8425  C C      . ARG A 1 24 ? 24.258 41.544 19.042 1.00 0.00 ? 22 ARG A C      5  
ATOM 8426  O O      . ARG A 1 24 ? 24.407 42.733 18.758 1.00 0.00 ? 22 ARG A O      5  
ATOM 8427  C CB     . ARG A 1 24 ? 21.897 40.914 18.318 1.00 0.00 ? 22 ARG A CB     5  
ATOM 8428  C CG     . ARG A 1 24 ? 21.340 40.580 19.718 1.00 0.00 ? 22 ARG A CG     5  
ATOM 8429  C CD     . ARG A 1 24 ? 20.006 41.285 20.009 1.00 0.00 ? 22 ARG A CD     5  
ATOM 8430  N NE     . ARG A 1 24 ? 20.185 42.749 20.091 1.00 0.00 ? 22 ARG A NE     5  
ATOM 8431  C CZ     . ARG A 1 24 ? 19.557 43.610 20.868 1.00 0.00 ? 22 ARG A CZ     5  
ATOM 8432  N NH1    . ARG A 1 24 ? 18.573 43.279 21.648 1.00 0.00 ? 22 ARG A NH1    5  
ATOM 8433  N NH2    . ARG A 1 24 ? 19.937 44.849 20.847 1.00 0.00 1 22 ARG A NH2    5  
ATOM 8434  H H      . ARG A 1 24 ? 23.699 38.775 19.110 1.00 0.00 ? 22 ARG A H      5  
ATOM 8435  H HA     . ARG A 1 24 ? 23.641 41.011 17.117 1.00 0.00 ? 22 ARG A HA     5  
ATOM 8436  H HB2    . ARG A 1 24 ? 21.727 41.970 18.113 1.00 0.00 ? 22 ARG A HB2    5  
ATOM 8437  H HB3    . ARG A 1 24 ? 21.335 40.347 17.574 1.00 0.00 ? 22 ARG A HB3    5  
ATOM 8438  H HG2    . ARG A 1 24 ? 21.194 39.502 19.790 1.00 0.00 ? 22 ARG A HG2    5  
ATOM 8439  H HG3    . ARG A 1 24 ? 22.048 40.884 20.489 1.00 0.00 ? 22 ARG A HG3    5  
ATOM 8440  H HD2    . ARG A 1 24 ? 19.286 41.041 19.226 1.00 0.00 ? 22 ARG A HD2    5  
ATOM 8441  H HD3    . ARG A 1 24 ? 19.622 40.906 20.959 1.00 0.00 ? 22 ARG A HD3    5  
ATOM 8442  H HE     . ARG A 1 24 ? 20.902 43.168 19.511 1.00 0.00 ? 22 ARG A HE     5  
ATOM 8443  H HH11   . ARG A 1 24 ? 18.221 42.332 21.638 1.00 0.00 ? 22 ARG A HH11   5  
ATOM 8444  H HH12   . ARG A 1 24 ? 18.098 43.981 22.205 1.00 0.00 ? 22 ARG A HH12   5  
ATOM 8445  H HH21   . ARG A 1 24 ? 20.706 45.102 20.237 1.00 0.00 ? 22 ARG A HH21   5  
ATOM 8446  H HH22   . ARG A 1 24 ? 19.534 45.526 21.486 1.00 0.00 ? 22 ARG A HH22   5  
ATOM 8447  N N      . ASN A 1 25 ? 24.809 40.993 20.127 1.00 0.00 ? 23 ASN A N      5  
ATOM 8448  C CA     . ASN A 1 25 ? 25.537 41.741 21.152 1.00 0.00 ? 23 ASN A CA     5  
ATOM 8449  C C      . ASN A 1 25 ? 26.603 40.879 21.860 1.00 0.00 ? 23 ASN A C      5  
ATOM 8450  O O      . ASN A 1 25 ? 26.275 39.971 22.622 1.00 0.00 ? 23 ASN A O      5  
ATOM 8451  C CB     . ASN A 1 25 ? 24.496 42.263 22.159 1.00 0.00 ? 23 ASN A CB     5  
ATOM 8452  C CG     . ASN A 1 25 ? 25.073 43.190 23.211 1.00 0.00 ? 23 ASN A CG     5  
ATOM 8453  O OD1    . ASN A 1 25 ? 26.243 43.561 23.200 1.00 0.00 ? 23 ASN A OD1    5  
ATOM 8454  N ND2    . ASN A 1 25 ? 24.246 43.609 24.132 1.00 0.00 ? 23 ASN A ND2    5  
ATOM 8455  H H      . ASN A 1 25 ? 24.596 40.024 20.329 1.00 0.00 ? 23 ASN A H      5  
ATOM 8456  H HA     . ASN A 1 25 ? 26.037 42.596 20.693 1.00 0.00 ? 23 ASN A HA     5  
ATOM 8457  H HB2    . ASN A 1 25 ? 23.723 42.818 21.628 1.00 0.00 ? 23 ASN A HB2    5  
ATOM 8458  H HB3    . ASN A 1 25 ? 24.016 41.423 22.664 1.00 0.00 ? 23 ASN A HB3    5  
ATOM 8459  H HD21   . ASN A 1 25 ? 23.293 43.248 24.143 1.00 0.00 ? 23 ASN A HD21   5  
ATOM 8460  H HD22   . ASN A 1 25 ? 24.524 44.389 24.710 1.00 0.00 ? 23 ASN A HD22   5  
ATOM 8461  N N      . ARG A 1 26 ? 27.888 41.208 21.672 1.00 0.00 ? 24 ARG A N      5  
ATOM 8462  C CA     . ARG A 1 26 ? 29.034 40.541 22.331 1.00 0.00 ? 24 ARG A CA     5  
ATOM 8463  C C      . ARG A 1 26 ? 29.300 41.024 23.771 1.00 0.00 ? 24 ARG A C      5  
ATOM 8464  O O      . ARG A 1 26 ? 30.093 40.393 24.476 1.00 0.00 ? 24 ARG A O      5  
ATOM 8465  C CB     . ARG A 1 26 ? 30.289 40.708 21.447 1.00 0.00 ? 24 ARG A CB     5  
ATOM 8466  C CG     . ARG A 1 26 ? 30.177 39.956 20.108 1.00 0.00 ? 24 ARG A CG     5  
ATOM 8467  C CD     . ARG A 1 26 ? 31.275 40.348 19.110 1.00 0.00 ? 24 ARG A CD     5  
ATOM 8468  N NE     . ARG A 1 26 ? 32.607 39.805 19.437 1.00 0.00 ? 24 ARG A NE     5  
ATOM 8469  C CZ     . ARG A 1 26 ? 33.784 40.402 19.347 1.00 0.00 ? 24 ARG A CZ     5  
ATOM 8470  N NH1    . ARG A 1 26 ? 33.975 41.680 19.222 1.00 0.00 ? 24 ARG A NH1    5  
ATOM 8471  N NH2    . ARG A 1 26 ? 34.860 39.683 19.374 1.00 0.00 1 24 ARG A NH2    5  
ATOM 8472  H H      . ARG A 1 26 ? 28.082 41.935 20.987 1.00 0.00 ? 24 ARG A H      5  
ATOM 8473  H HA     . ARG A 1 26 ? 28.817 39.474 22.414 1.00 0.00 ? 24 ARG A HA     5  
ATOM 8474  H HB2    . ARG A 1 26 ? 30.443 41.770 21.250 1.00 0.00 ? 24 ARG A HB2    5  
ATOM 8475  H HB3    . ARG A 1 26 ? 31.165 40.331 21.979 1.00 0.00 ? 24 ARG A HB3    5  
ATOM 8476  H HG2    . ARG A 1 26 ? 30.205 38.880 20.285 1.00 0.00 ? 24 ARG A HG2    5  
ATOM 8477  H HG3    . ARG A 1 26 ? 29.219 40.191 19.642 1.00 0.00 ? 24 ARG A HG3    5  
ATOM 8478  H HD2    . ARG A 1 26 ? 30.985 39.951 18.135 1.00 0.00 ? 24 ARG A HD2    5  
ATOM 8479  H HD3    . ARG A 1 26 ? 31.301 41.431 19.026 1.00 0.00 ? 24 ARG A HD3    5  
ATOM 8480  H HE     . ARG A 1 26 ? 32.672 38.797 19.533 1.00 0.00 ? 24 ARG A HE     5  
ATOM 8481  H HH11   . ARG A 1 26 ? 33.192 42.329 19.227 1.00 0.00 ? 24 ARG A HH11   5  
ATOM 8482  H HH12   . ARG A 1 26 ? 34.925 42.017 19.135 1.00 0.00 ? 24 ARG A HH12   5  
ATOM 8483  H HH21   . ARG A 1 26 ? 34.772 38.674 19.406 1.00 0.00 ? 24 ARG A HH21   5  
ATOM 8484  H HH22   . ARG A 1 26 ? 35.764 40.142 19.286 1.00 0.00 ? 24 ARG A HH22   5  
ATOM 8485  N N      . TYR A 1 27 ? 28.657 42.118 24.202 1.00 0.00 ? 25 TYR A N      5  
ATOM 8486  C CA     . TYR A 1 27 ? 28.950 42.844 25.452 1.00 0.00 ? 25 TYR A CA     5  
ATOM 8487  C C      . TYR A 1 27 ? 27.694 43.411 26.171 1.00 0.00 ? 25 TYR A C      5  
ATOM 8488  O O      . TYR A 1 27 ? 27.630 44.624 26.425 1.00 0.00 ? 25 TYR A O      5  
ATOM 8489  C CB     . TYR A 1 27 ? 29.962 43.964 25.148 1.00 0.00 ? 25 TYR A CB     5  
ATOM 8490  C CG     . TYR A 1 27 ? 31.273 43.493 24.559 1.00 0.00 ? 25 TYR A CG     5  
ATOM 8491  C CD1    . TYR A 1 27 ? 32.228 42.883 25.390 1.00 0.00 ? 25 TYR A CD1    5  
ATOM 8492  C CD2    . TYR A 1 27 ? 31.529 43.650 23.183 1.00 0.00 ? 25 TYR A CD2    5  
ATOM 8493  C CE1    . TYR A 1 27 ? 33.445 42.443 24.845 1.00 0.00 ? 25 TYR A CE1    5  
ATOM 8494  C CE2    . TYR A 1 27 ? 32.745 43.202 22.636 1.00 0.00 ? 25 TYR A CE2    5  
ATOM 8495  C CZ     . TYR A 1 27 ? 33.712 42.607 23.470 1.00 0.00 ? 25 TYR A CZ     5  
ATOM 8496  O OH     . TYR A 1 27 ? 34.919 42.247 22.965 1.00 0.00 ? 25 TYR A OH     5  
ATOM 8497  H H      . TYR A 1 27 ? 27.973 42.529 23.582 1.00 0.00 ? 25 TYR A H      5  
ATOM 8498  H HA     . TYR A 1 27 ? 29.420 42.155 26.153 1.00 0.00 ? 25 TYR A HA     5  
ATOM 8499  H HB2    . TYR A 1 27 ? 29.502 44.678 24.463 1.00 0.00 ? 25 TYR A HB2    5  
ATOM 8500  H HB3    . TYR A 1 27 ? 30.190 44.495 26.074 1.00 0.00 ? 25 TYR A HB3    5  
ATOM 8501  H HD1    . TYR A 1 27 ? 32.024 42.750 26.445 1.00 0.00 ? 25 TYR A HD1    5  
ATOM 8502  H HD2    . TYR A 1 27 ? 30.793 44.118 22.545 1.00 0.00 ? 25 TYR A HD2    5  
ATOM 8503  H HE1    . TYR A 1 27 ? 34.172 41.960 25.478 1.00 0.00 ? 25 TYR A HE1    5  
ATOM 8504  H HE2    . TYR A 1 27 ? 32.950 43.333 21.584 1.00 0.00 ? 25 TYR A HE2    5  
ATOM 8505  H HH     . TYR A 1 27 ? 35.557 42.108 23.700 1.00 0.00 ? 25 TYR A HH     5  
ATOM 8506  N N      . PRO A 1 28 ? 26.686 42.584 26.518 1.00 0.00 ? 26 PRO A N      5  
ATOM 8507  C CA     . PRO A 1 28 ? 25.498 43.031 27.251 1.00 0.00 ? 26 PRO A CA     5  
ATOM 8508  C C      . PRO A 1 28 ? 25.829 43.604 28.639 1.00 0.00 ? 26 PRO A C      5  
ATOM 8509  O O      . PRO A 1 28 ? 26.699 43.095 29.357 1.00 0.00 ? 26 PRO A O      5  
ATOM 8510  C CB     . PRO A 1 28 ? 24.579 41.807 27.342 1.00 0.00 ? 26 PRO A CB     5  
ATOM 8511  C CG     . PRO A 1 28 ? 25.551 40.630 27.253 1.00 0.00 ? 26 PRO A CG     5  
ATOM 8512  C CD     . PRO A 1 28 ? 26.626 41.146 26.300 1.00 0.00 ? 26 PRO A CD     5  
ATOM 8513  H HA     . PRO A 1 28 ? 24.992 43.807 26.679 1.00 0.00 ? 26 PRO A HA     5  
ATOM 8514  H HB2    . PRO A 1 28 ? 24.002 41.786 28.268 1.00 0.00 ? 26 PRO A HB2    5  
ATOM 8515  H HB3    . PRO A 1 28 ? 23.909 41.790 26.480 1.00 0.00 ? 26 PRO A HB3    5  
ATOM 8516  H HG2    . PRO A 1 28 ? 25.999 40.443 28.228 1.00 0.00 ? 26 PRO A HG2    5  
ATOM 8517  H HG3    . PRO A 1 28 ? 25.064 39.732 26.871 1.00 0.00 ? 26 PRO A HG3    5  
ATOM 8518  H HD2    . PRO A 1 28 ? 27.580 40.664 26.518 1.00 0.00 ? 26 PRO A HD2    5  
ATOM 8519  H HD3    . PRO A 1 28 ? 26.327 40.948 25.270 1.00 0.00 ? 26 PRO A HD3    5  
ATOM 8520  N N      . ASP A 1 29 ? 25.109 44.658 29.023 1.00 0.00 ? 27 ASP A N      5  
ATOM 8521  C CA     . ASP A 1 29 ? 25.267 45.362 30.300 1.00 0.00 ? 27 ASP A CA     5  
ATOM 8522  C C      . ASP A 1 29 ? 24.943 44.466 31.506 1.00 0.00 ? 27 ASP A C      5  
ATOM 8523  O O      . ASP A 1 29 ? 24.126 43.551 31.399 1.00 0.00 ? 27 ASP A O      5  
ATOM 8524  C CB     . ASP A 1 29 ? 24.338 46.583 30.293 1.00 0.00 ? 27 ASP A CB     5  
ATOM 8525  C CG     . ASP A 1 29 ? 24.632 47.563 31.425 1.00 0.00 ? 27 ASP A CG     5  
ATOM 8526  O OD1    . ASP A 1 29 ? 25.506 48.440 31.231 1.00 0.00 ? 27 ASP A OD1    5  
ATOM 8527  O OD2    . ASP A 1 29 ? 23.945 47.515 32.475 1.00 0.00 ? 27 ASP A OD2    5  
ATOM 8528  H H      . ASP A 1 29 ? 24.395 45.010 28.391 1.00 0.00 ? 27 ASP A H      5  
ATOM 8529  H HA     . ASP A 1 29 ? 26.299 45.706 30.380 1.00 0.00 ? 27 ASP A HA     5  
ATOM 8530  H HB2    . ASP A 1 29 ? 24.452 47.110 29.346 1.00 0.00 ? 27 ASP A HB2    5  
ATOM 8531  H HB3    . ASP A 1 29 ? 23.301 46.249 30.365 1.00 0.00 ? 27 ASP A HB3    5  
ATOM 8532  N N      . MET A 1 30 ? 25.506 44.759 32.679 1.00 0.00 ? 28 MET A N      5  
ATOM 8533  C CA     . MET A 1 30 ? 25.180 44.081 33.944 1.00 0.00 ? 28 MET A CA     5  
ATOM 8534  C C      . MET A 1 30 ? 23.664 43.997 34.213 1.00 0.00 ? 28 MET A C      5  
ATOM 8535  O O      . MET A 1 30 ? 23.166 42.932 34.580 1.00 0.00 ? 28 MET A O      5  
ATOM 8536  C CB     . MET A 1 30 ? 25.945 44.760 35.097 1.00 0.00 ? 28 MET A CB     5  
ATOM 8537  C CG     . MET A 1 30 ? 25.576 46.239 35.307 1.00 0.00 ? 28 MET A CG     5  
ATOM 8538  S SD     . MET A 1 30 ? 26.628 47.175 36.450 1.00 0.00 ? 28 MET A SD     5  
ATOM 8539  C CE     . MET A 1 30 ? 26.399 46.211 37.965 1.00 0.00 ? 28 MET A CE     5  
ATOM 8540  H H      . MET A 1 30 ? 26.243 45.455 32.688 1.00 0.00 ? 28 MET A H      5  
ATOM 8541  H HA     . MET A 1 30 ? 25.533 43.053 33.878 1.00 0.00 ? 28 MET A HA     5  
ATOM 8542  H HB2    . MET A 1 30 ? 25.748 44.210 36.017 1.00 0.00 ? 28 MET A HB2    5  
ATOM 8543  H HB3    . MET A 1 30 ? 27.014 44.697 34.890 1.00 0.00 ? 28 MET A HB3    5  
ATOM 8544  H HG2    . MET A 1 30 ? 25.629 46.750 34.346 1.00 0.00 ? 28 MET A HG2    5  
ATOM 8545  H HG3    . MET A 1 30 ? 24.549 46.299 35.668 1.00 0.00 ? 28 MET A HG3    5  
ATOM 8546  H HE1    . MET A 1 30 ? 25.334 46.075 38.159 1.00 0.00 ? 28 MET A HE1    5  
ATOM 8547  H HE2    . MET A 1 30 ? 26.877 45.238 37.852 1.00 0.00 ? 28 MET A HE2    5  
ATOM 8548  H HE3    . MET A 1 30 ? 26.851 46.732 38.807 1.00 0.00 ? 28 MET A HE3    5  
ATOM 8549  N N      . SER A 1 31 ? 22.907 45.062 33.913 1.00 0.00 ? 29 SER A N      5  
ATOM 8550  C CA     . SER A 1 31 ? 21.444 45.093 34.076 1.00 0.00 ? 29 SER A CA     5  
ATOM 8551  C C      . SER A 1 31 ? 20.690 44.278 33.007 1.00 0.00 ? 29 SER A C      5  
ATOM 8552  O O      . SER A 1 31 ? 19.526 43.917 33.200 1.00 0.00 ? 29 SER A O      5  
ATOM 8553  C CB     . SER A 1 31 ? 20.979 46.552 34.077 1.00 0.00 ? 29 SER A CB     5  
ATOM 8554  O OG     . SER A 1 31 ? 19.656 46.661 34.564 1.00 0.00 ? 29 SER A OG     5  
ATOM 8555  H H      . SER A 1 31 ? 23.368 45.890 33.544 1.00 0.00 ? 29 SER A H      5  
ATOM 8556  H HA     . SER A 1 31 ? 21.202 44.667 35.050 1.00 0.00 ? 29 SER A HA     5  
ATOM 8557  H HB2    . SER A 1 31 ? 21.631 47.134 34.730 1.00 0.00 ? 29 SER A HB2    5  
ATOM 8558  H HB3    . SER A 1 31 ? 21.041 46.960 33.067 1.00 0.00 ? 29 SER A HB3    5  
ATOM 8559  H HG     . SER A 1 31 ? 19.429 47.618 34.541 1.00 0.00 ? 29 SER A HG     5  
ATOM 8560  N N      . THR A 1 32 ? 21.348 43.950 31.891 1.00 0.00 ? 30 THR A N      5  
ATOM 8561  C CA     . THR A 1 32 ? 20.823 43.131 30.781 1.00 0.00 ? 30 THR A CA     5  
ATOM 8562  C C      . THR A 1 32 ? 21.177 41.649 30.958 1.00 0.00 ? 30 THR A C      5  
ATOM 8563  O O      . THR A 1 32 ? 20.326 40.785 30.744 1.00 0.00 ? 30 THR A O      5  
ATOM 8564  C CB     . THR A 1 32 ? 21.364 43.651 29.436 1.00 0.00 ? 30 THR A CB     5  
ATOM 8565  O OG1    . THR A 1 32 ? 21.124 45.036 29.309 1.00 0.00 ? 30 THR A OG1    5  
ATOM 8566  C CG2    . THR A 1 32 ? 20.716 42.978 28.228 1.00 0.00 ? 30 THR A CG2    5  
ATOM 8567  H H      . THR A 1 32 ? 22.309 44.261 31.810 1.00 0.00 ? 30 THR A H      5  
ATOM 8568  H HA     . THR A 1 32 ? 19.736 43.211 30.757 1.00 0.00 ? 30 THR A HA     5  
ATOM 8569  H HB     . THR A 1 32 ? 22.440 43.484 29.394 1.00 0.00 ? 30 THR A HB     5  
ATOM 8570  H HG1    . THR A 1 32 ? 21.693 45.328 28.570 1.00 0.00 ? 30 THR A HG1    5  
ATOM 8571  H HG21   . THR A 1 32 ? 19.632 43.090 28.273 1.00 0.00 ? 30 THR A HG21   5  
ATOM 8572  H HG22   . THR A 1 32 ? 21.086 43.434 27.309 1.00 0.00 ? 30 THR A HG22   5  
ATOM 8573  H HG23   . THR A 1 32 ? 20.963 41.918 28.209 1.00 0.00 ? 30 THR A HG23   5  
ATOM 8574  N N      . ARG A 1 33 ? 22.396 41.327 31.425 1.00 0.00 ? 31 ARG A N      5  
ATOM 8575  C CA     . ARG A 1 33 ? 22.824 39.947 31.740 1.00 0.00 ? 31 ARG A CA     5  
ATOM 8576  C C      . ARG A 1 33 ? 21.918 39.286 32.776 1.00 0.00 ? 31 ARG A C      5  
ATOM 8577  O O      . ARG A 1 33 ? 21.633 38.097 32.663 1.00 0.00 ? 31 ARG A O      5  
ATOM 8578  C CB     . ARG A 1 33 ? 24.285 39.918 32.222 1.00 0.00 ? 31 ARG A CB     5  
ATOM 8579  C CG     . ARG A 1 33 ? 25.296 40.250 31.113 1.00 0.00 ? 31 ARG A CG     5  
ATOM 8580  C CD     . ARG A 1 33 ? 26.742 39.884 31.490 1.00 0.00 ? 31 ARG A CD     5  
ATOM 8581  N NE     . ARG A 1 33 ? 27.193 40.493 32.757 1.00 0.00 ? 31 ARG A NE     5  
ATOM 8582  C CZ     . ARG A 1 33 ? 27.731 41.683 32.940 1.00 0.00 ? 31 ARG A CZ     5  
ATOM 8583  N NH1    . ARG A 1 33 ? 27.830 42.574 31.995 1.00 0.00 ? 31 ARG A NH1    5  
ATOM 8584  N NH2    . ARG A 1 33 ? 28.163 41.969 34.129 1.00 0.00 1 31 ARG A NH2    5  
ATOM 8585  H H      . ARG A 1 33 ? 23.053 42.087 31.582 1.00 0.00 ? 31 ARG A H      5  
ATOM 8586  H HA     . ARG A 1 33 ? 22.742 39.331 30.848 1.00 0.00 ? 31 ARG A HA     5  
ATOM 8587  H HB2    . ARG A 1 33 ? 24.410 40.617 33.051 1.00 0.00 ? 31 ARG A HB2    5  
ATOM 8588  H HB3    . ARG A 1 33 ? 24.502 38.910 32.581 1.00 0.00 ? 31 ARG A HB3    5  
ATOM 8589  H HG2    . ARG A 1 33 ? 25.031 39.685 30.219 1.00 0.00 ? 31 ARG A HG2    5  
ATOM 8590  H HG3    . ARG A 1 33 ? 25.243 41.310 30.876 1.00 0.00 ? 31 ARG A HG3    5  
ATOM 8591  H HD2    . ARG A 1 33 ? 26.810 38.798 31.585 1.00 0.00 ? 31 ARG A HD2    5  
ATOM 8592  H HD3    . ARG A 1 33 ? 27.407 40.184 30.677 1.00 0.00 ? 31 ARG A HD3    5  
ATOM 8593  H HE     . ARG A 1 33 ? 27.159 39.923 33.600 1.00 0.00 ? 31 ARG A HE     5  
ATOM 8594  H HH11   . ARG A 1 33 ? 27.408 42.410 31.091 1.00 0.00 ? 31 ARG A HH11   5  
ATOM 8595  H HH12   . ARG A 1 33 ? 28.151 43.516 32.197 1.00 0.00 ? 31 ARG A HH12   5  
ATOM 8596  H HH21   . ARG A 1 33 ? 28.025 41.280 34.866 1.00 0.00 ? 31 ARG A HH21   5  
ATOM 8597  H HH22   . ARG A 1 33 ? 28.677 42.815 34.342 1.00 0.00 ? 31 ARG A HH22   5  
ATOM 8598  N N      . GLU A 1 34 ? 21.409 40.051 33.741 1.00 0.00 ? 32 GLU A N      5  
ATOM 8599  C CA     . GLU A 1 34 ? 20.441 39.532 34.709 1.00 0.00 ? 32 GLU A CA     5  
ATOM 8600  C C      . GLU A 1 34 ? 19.015 39.336 34.156 1.00 0.00 ? 32 GLU A C      5  
ATOM 8601  O O      . GLU A 1 34 ? 18.269 38.564 34.751 1.00 0.00 ? 32 GLU A O      5  
ATOM 8602  C CB     . GLU A 1 34 ? 20.455 40.361 35.997 1.00 0.00 ? 32 GLU A CB     5  
ATOM 8603  C CG     . GLU A 1 34 ? 19.912 41.785 35.846 1.00 0.00 ? 32 GLU A CG     5  
ATOM 8604  C CD     . GLU A 1 34 ? 19.583 42.412 37.204 1.00 0.00 ? 32 GLU A CD     5  
ATOM 8605  O OE1    . GLU A 1 34 ? 20.164 42.015 38.244 1.00 0.00 ? 32 GLU A OE1    5  
ATOM 8606  O OE2    . GLU A 1 34 ? 18.667 43.272 37.257 1.00 0.00 ? 32 GLU A OE2    5  
ATOM 8607  H H      . GLU A 1 34 ? 21.728 41.008 33.825 1.00 0.00 ? 32 GLU A H      5  
ATOM 8608  H HA     . GLU A 1 34 ? 20.779 38.537 35.000 1.00 0.00 ? 32 GLU A HA     5  
ATOM 8609  H HB2    . GLU A 1 34 ? 19.851 39.833 36.735 1.00 0.00 ? 32 GLU A HB2    5  
ATOM 8610  H HB3    . GLU A 1 34 ? 21.477 40.415 36.370 1.00 0.00 ? 32 GLU A HB3    5  
ATOM 8611  H HG2    . GLU A 1 34 ? 20.646 42.396 35.323 1.00 0.00 ? 32 GLU A HG2    5  
ATOM 8612  H HG3    . GLU A 1 34 ? 19.002 41.758 35.249 1.00 0.00 ? 32 GLU A HG3    5  
ATOM 8613  N N      . GLU A 1 35 ? 18.632 39.947 33.027 1.00 0.00 ? 33 GLU A N      5  
ATOM 8614  C CA     . GLU A 1 35 ? 17.372 39.614 32.334 1.00 0.00 ? 33 GLU A CA     5  
ATOM 8615  C C      . GLU A 1 35 ? 17.513 38.316 31.533 1.00 0.00 ? 33 GLU A C      5  
ATOM 8616  O O      . GLU A 1 35 ? 16.673 37.426 31.638 1.00 0.00 ? 33 GLU A O      5  
ATOM 8617  C CB     . GLU A 1 35 ? 16.900 40.741 31.402 1.00 0.00 ? 33 GLU A CB     5  
ATOM 8618  C CG     . GLU A 1 35 ? 16.434 41.988 32.157 1.00 0.00 ? 33 GLU A CG     5  
ATOM 8619  C CD     . GLU A 1 35 ? 15.629 42.901 31.229 1.00 0.00 ? 33 GLU A CD     5  
ATOM 8620  O OE1    . GLU A 1 35 ? 14.435 42.612 30.987 1.00 0.00 ? 33 GLU A OE1    5  
ATOM 8621  O OE2    . GLU A 1 35 ? 16.181 43.905 30.714 1.00 0.00 ? 33 GLU A OE2    5  
ATOM 8622  H H      . GLU A 1 35 ? 19.286 40.553 32.548 1.00 0.00 ? 33 GLU A H      5  
ATOM 8623  H HA     . GLU A 1 35 ? 16.585 39.448 33.071 1.00 0.00 ? 33 GLU A HA     5  
ATOM 8624  H HB2    . GLU A 1 35 ? 17.690 41.012 30.704 1.00 0.00 ? 33 GLU A HB2    5  
ATOM 8625  H HB3    . GLU A 1 35 ? 16.058 40.359 30.823 1.00 0.00 ? 33 GLU A HB3    5  
ATOM 8626  H HG2    . GLU A 1 35 ? 15.803 41.690 32.998 1.00 0.00 ? 33 GLU A HG2    5  
ATOM 8627  H HG3    . GLU A 1 35 ? 17.305 42.517 32.546 1.00 0.00 ? 33 GLU A HG3    5  
ATOM 8628  N N      . ILE A 1 36 ? 18.627 38.156 30.810 1.00 0.00 ? 34 ILE A N      5  
ATOM 8629  C CA     . ILE A 1 36 ? 18.979 36.915 30.092 1.00 0.00 ? 34 ILE A CA     5  
ATOM 8630  C C      . ILE A 1 36 ? 19.002 35.713 31.060 1.00 0.00 ? 34 ILE A C      5  
ATOM 8631  O O      . ILE A 1 36 ? 18.596 34.600 30.709 1.00 0.00 ? 34 ILE A O      5  
ATOM 8632  C CB     . ILE A 1 36 ? 20.338 37.126 29.379 1.00 0.00 ? 34 ILE A CB     5  
ATOM 8633  C CG1    . ILE A 1 36 ? 20.228 38.222 28.289 1.00 0.00 ? 34 ILE A CG1    5  
ATOM 8634  C CG2    . ILE A 1 36 ? 20.864 35.824 28.746 1.00 0.00 ? 34 ILE A CG2    5  
ATOM 8635  C CD1    . ILE A 1 36 ? 21.573 38.877 27.955 1.00 0.00 ? 34 ILE A CD1    5  
ATOM 8636  H H      . ILE A 1 36 ? 19.267 38.941 30.756 1.00 0.00 ? 34 ILE A H      5  
ATOM 8637  H HA     . ILE A 1 36 ? 18.216 36.714 29.340 1.00 0.00 ? 34 ILE A HA     5  
ATOM 8638  H HB     . ILE A 1 36 ? 21.063 37.451 30.126 1.00 0.00 ? 34 ILE A HB     5  
ATOM 8639  H HG12   . ILE A 1 36 ? 19.801 37.793 27.381 1.00 0.00 ? 34 ILE A HG12   5  
ATOM 8640  H HG13   . ILE A 1 36 ? 19.562 39.021 28.612 1.00 0.00 ? 34 ILE A HG13   5  
ATOM 8641  H HG21   . ILE A 1 36 ? 21.074 35.080 29.514 1.00 0.00 ? 34 ILE A HG21   5  
ATOM 8642  H HG22   . ILE A 1 36 ? 20.126 35.421 28.048 1.00 0.00 ? 34 ILE A HG22   5  
ATOM 8643  H HG23   . ILE A 1 36 ? 21.790 36.014 28.207 1.00 0.00 ? 34 ILE A HG23   5  
ATOM 8644  H HD11   . ILE A 1 36 ? 21.966 39.387 28.832 1.00 0.00 ? 34 ILE A HD11   5  
ATOM 8645  H HD12   . ILE A 1 36 ? 22.295 38.135 27.620 1.00 0.00 ? 34 ILE A HD12   5  
ATOM 8646  H HD13   . ILE A 1 36 ? 21.424 39.618 27.169 1.00 0.00 ? 34 ILE A HD13   5  
ATOM 8647  N N      . ALA A 1 37 ? 19.409 35.951 32.311 1.00 0.00 ? 35 ALA A N      5  
ATOM 8648  C CA     . ALA A 1 37 ? 19.373 34.982 33.400 1.00 0.00 ? 35 ALA A CA     5  
ATOM 8649  C C      . ALA A 1 37 ? 17.948 34.561 33.844 1.00 0.00 ? 35 ALA A C      5  
ATOM 8650  O O      . ALA A 1 37 ? 17.805 33.490 34.432 1.00 0.00 ? 35 ALA A O      5  
ATOM 8651  C CB     . ALA A 1 37 ? 20.183 35.570 34.562 1.00 0.00 ? 35 ALA A CB     5  
ATOM 8652  H H      . ALA A 1 37 ? 19.777 36.872 32.514 1.00 0.00 ? 35 ALA A H      5  
ATOM 8653  H HA     . ALA A 1 37 ? 19.880 34.078 33.064 1.00 0.00 ? 35 ALA A HA     5  
ATOM 8654  H HB1    . ALA A 1 37 ? 21.189 35.828 34.229 1.00 0.00 ? 35 ALA A HB1    5  
ATOM 8655  H HB2    . ALA A 1 37 ? 19.689 36.457 34.950 1.00 0.00 ? 35 ALA A HB2    5  
ATOM 8656  H HB3    . ALA A 1 37 ? 20.257 34.844 35.364 1.00 0.00 ? 35 ALA A HB3    5  
ATOM 8657  N N      . VAL A 1 38 ? 16.891 35.334 33.558 1.00 0.00 ? 36 VAL A N      5  
ATOM 8658  C CA     . VAL A 1 38 ? 15.498 34.978 33.905 1.00 0.00 ? 36 VAL A CA     5  
ATOM 8659  C C      . VAL A 1 38 ? 14.973 33.886 32.972 1.00 0.00 ? 36 VAL A C      5  
ATOM 8660  O O      . VAL A 1 38 ? 14.549 32.822 33.428 1.00 0.00 ? 36 VAL A O      5  
ATOM 8661  C CB     . VAL A 1 38 ? 14.550 36.201 33.877 1.00 0.00 ? 36 VAL A CB     5  
ATOM 8662  C CG1    . VAL A 1 38 ? 13.143 35.829 34.357 1.00 0.00 ? 36 VAL A CG1    5  
ATOM 8663  C CG2    . VAL A 1 38 ? 15.044 37.339 34.774 1.00 0.00 ? 36 VAL A CG2    5  
ATOM 8664  H H      . VAL A 1 38 ? 17.040 36.193 33.036 1.00 0.00 ? 36 VAL A H      5  
ATOM 8665  H HA     . VAL A 1 38 ? 15.485 34.574 34.917 1.00 0.00 ? 36 VAL A HA     5  
ATOM 8666  H HB     . VAL A 1 38 ? 14.475 36.577 32.858 1.00 0.00 ? 36 VAL A HB     5  
ATOM 8667  H HG11   . VAL A 1 38 ? 13.180 35.429 35.370 1.00 0.00 ? 36 VAL A HG11   5  
ATOM 8668  H HG12   . VAL A 1 38 ? 12.503 36.712 34.344 1.00 0.00 ? 36 VAL A HG12   5  
ATOM 8669  H HG13   . VAL A 1 38 ? 12.699 35.089 33.693 1.00 0.00 ? 36 VAL A HG13   5  
ATOM 8670  H HG21   . VAL A 1 38 ? 14.327 38.162 34.761 1.00 0.00 ? 36 VAL A HG21   5  
ATOM 8671  H HG22   . VAL A 1 38 ? 15.180 36.989 35.794 1.00 0.00 ? 36 VAL A HG22   5  
ATOM 8672  H HG23   . VAL A 1 38 ? 15.988 37.713 34.394 1.00 0.00 ? 36 VAL A HG23   5  
ATOM 8673  N N      . TRP A 1 39 ? 15.057 34.102 31.655 1.00 0.00 ? 37 TRP A N      5  
ATOM 8674  C CA     . TRP A 1 39 ? 14.519 33.182 30.634 1.00 0.00 ? 37 TRP A CA     5  
ATOM 8675  C C      . TRP A 1 39 ? 15.205 31.813 30.707 1.00 0.00 ? 37 TRP A C      5  
ATOM 8676  O O      . TRP A 1 39 ? 14.558 30.766 30.617 1.00 0.00 ? 37 TRP A O      5  
ATOM 8677  C CB     . TRP A 1 39 ? 14.685 33.800 29.231 1.00 0.00 ? 37 TRP A CB     5  
ATOM 8678  C CG     . TRP A 1 39 ? 14.595 35.296 29.168 1.00 0.00 ? 37 TRP A CG     5  
ATOM 8679  C CD1    . TRP A 1 39 ? 15.477 36.102 28.540 1.00 0.00 ? 37 TRP A CD1    5  
ATOM 8680  C CD2    . TRP A 1 39 ? 13.647 36.188 29.833 1.00 0.00 ? 37 TRP A CD2    5  
ATOM 8681  N NE1    . TRP A 1 39 ? 15.172 37.422 28.799 1.00 0.00 ? 37 TRP A NE1    5  
ATOM 8682  C CE2    . TRP A 1 39 ? 14.079 37.535 29.633 1.00 0.00 ? 37 TRP A CE2    5  
ATOM 8683  C CE3    . TRP A 1 39 ? 12.498 35.988 30.630 1.00 0.00 ? 37 TRP A CE3    5  
ATOM 8684  C CZ2    . TRP A 1 39 ? 13.427 38.626 30.223 1.00 0.00 ? 37 TRP A CZ2    5  
ATOM 8685  C CZ3    . TRP A 1 39 ? 11.839 37.075 31.232 1.00 0.00 ? 37 TRP A CZ3    5  
ATOM 8686  C CH2    . TRP A 1 39 ? 12.309 38.386 31.042 1.00 0.00 ? 37 TRP A CH2    5  
ATOM 8687  H H      . TRP A 1 39 ? 15.402 35.002 31.341 1.00 0.00 ? 37 TRP A H      5  
ATOM 8688  H HA     . TRP A 1 39 ? 13.453 33.038 30.819 1.00 0.00 ? 37 TRP A HA     5  
ATOM 8689  H HB2    . TRP A 1 39 ? 15.661 33.515 28.836 1.00 0.00 ? 37 TRP A HB2    5  
ATOM 8690  H HB3    . TRP A 1 39 ? 13.930 33.374 28.569 1.00 0.00 ? 37 TRP A HB3    5  
ATOM 8691  H HD1    . TRP A 1 39 ? 16.327 35.763 27.957 1.00 0.00 ? 37 TRP A HD1    5  
ATOM 8692  H HE1    . TRP A 1 39 ? 15.740 38.192 28.446 1.00 0.00 ? 37 TRP A HE1    5  
ATOM 8693  H HE3    . TRP A 1 39 ? 12.130 34.987 30.795 1.00 0.00 ? 37 TRP A HE3    5  
ATOM 8694  H HZ2    . TRP A 1 39 ? 13.793 39.632 30.074 1.00 0.00 ? 37 TRP A HZ2    5  
ATOM 8695  H HZ3    . TRP A 1 39 ? 10.976 36.898 31.857 1.00 0.00 ? 37 TRP A HZ3    5  
ATOM 8696  H HH2    . TRP A 1 39 ? 11.802 39.204 31.529 1.00 0.00 ? 37 TRP A HH2    5  
ATOM 8697  N N      . THR A 1 40 ? 16.514 31.841 30.964 1.00 0.00 ? 38 THR A N      5  
ATOM 8698  C CA     . THR A 1 40 ? 17.393 30.673 31.088 1.00 0.00 ? 38 THR A CA     5  
ATOM 8699  C C      . THR A 1 40 ? 17.441 30.066 32.502 1.00 0.00 ? 38 THR A C      5  
ATOM 8700  O O      . THR A 1 40 ? 17.986 28.973 32.662 1.00 0.00 ? 38 THR A O      5  
ATOM 8701  C CB     . THR A 1 40 ? 18.815 31.036 30.626 1.00 0.00 ? 38 THR A CB     5  
ATOM 8702  O OG1    . THR A 1 40 ? 19.321 32.080 31.422 1.00 0.00 ? 38 THR A OG1    5  
ATOM 8703  C CG2    . THR A 1 40 ? 18.878 31.497 29.170 1.00 0.00 ? 38 THR A CG2    5  
ATOM 8704  H H      . THR A 1 40 ? 16.945 32.754 31.042 1.00 0.00 ? 38 THR A H      5  
ATOM 8705  H HA     . THR A 1 40 ? 17.024 29.889 30.426 1.00 0.00 ? 38 THR A HA     5  
ATOM 8706  H HB     . THR A 1 40 ? 19.455 30.163 30.736 1.00 0.00 ? 38 THR A HB     5  
ATOM 8707  H HG1    . THR A 1 40 ? 19.096 32.927 30.994 1.00 0.00 ? 38 THR A HG1    5  
ATOM 8708  H HG21   . THR A 1 40 ? 18.348 32.440 29.035 1.00 0.00 ? 38 THR A HG21   5  
ATOM 8709  H HG22   . THR A 1 40 ? 19.920 31.628 28.877 1.00 0.00 ? 38 THR A HG22   5  
ATOM 8710  H HG23   . THR A 1 40 ? 18.426 30.745 28.524 1.00 0.00 ? 38 THR A HG23   5  
ATOM 8711  N N      . ASN A 1 41 ? 16.853 30.707 33.522 1.00 0.00 ? 39 ASN A N      5  
ATOM 8712  C CA     . ASN A 1 41 ? 16.941 30.310 34.941 1.00 0.00 ? 39 ASN A CA     5  
ATOM 8713  C C      . ASN A 1 41 ? 18.389 30.290 35.508 1.00 0.00 ? 39 ASN A C      5  
ATOM 8714  O O      . ASN A 1 41 ? 18.683 29.607 36.494 1.00 0.00 ? 39 ASN A O      5  
ATOM 8715  C CB     . ASN A 1 41 ? 16.104 29.030 35.164 1.00 0.00 ? 39 ASN A CB     5  
ATOM 8716  C CG     . ASN A 1 41 ? 15.991 28.600 36.617 1.00 0.00 ? 39 ASN A CG     5  
ATOM 8717  O OD1    . ASN A 1 41 ? 15.637 29.375 37.499 1.00 0.00 ? 39 ASN A OD1    5  
ATOM 8718  N ND2    . ASN A 1 41 ? 16.294 27.358 36.906 1.00 0.00 ? 39 ASN A ND2    5  
ATOM 8719  H H      . ASN A 1 41 ? 16.381 31.580 33.325 1.00 0.00 ? 39 ASN A H      5  
ATOM 8720  H HA     . ASN A 1 41 ? 16.444 31.105 35.501 1.00 0.00 ? 39 ASN A HA     5  
ATOM 8721  H HB2    . ASN A 1 41 ? 15.094 29.187 34.789 1.00 0.00 ? 39 ASN A HB2    5  
ATOM 8722  H HB3    . ASN A 1 41 ? 16.542 28.210 34.598 1.00 0.00 ? 39 ASN A HB3    5  
ATOM 8723  H HD21   . ASN A 1 41 ? 16.663 26.745 36.186 1.00 0.00 ? 39 ASN A HD21   5  
ATOM 8724  H HD22   . ASN A 1 41 ? 16.253 27.048 37.865 1.00 0.00 ? 39 ASN A HD22   5  
ATOM 8725  N N      . LEU A 1 42 ? 19.297 31.069 34.913 1.00 0.00 ? 40 LEU A N      5  
ATOM 8726  C CA     . LEU A 1 42 ? 20.660 31.334 35.396 1.00 0.00 ? 40 LEU A CA     5  
ATOM 8727  C C      . LEU A 1 42 ? 20.684 32.434 36.483 1.00 0.00 ? 40 LEU A C      5  
ATOM 8728  O O      . LEU A 1 42 ? 19.646 32.929 36.932 1.00 0.00 ? 40 LEU A O      5  
ATOM 8729  C CB     . LEU A 1 42 ? 21.558 31.676 34.175 1.00 0.00 ? 40 LEU A CB     5  
ATOM 8730  C CG     . LEU A 1 42 ? 22.409 30.503 33.657 1.00 0.00 ? 40 LEU A CG     5  
ATOM 8731  C CD1    . LEU A 1 42 ? 21.567 29.319 33.199 1.00 0.00 ? 40 LEU A CD1    5  
ATOM 8732  C CD2    . LEU A 1 42 ? 23.265 30.958 32.475 1.00 0.00 ? 40 LEU A CD2    5  
ATOM 8733  H H      . LEU A 1 42 ? 18.955 31.661 34.166 1.00 0.00 ? 40 LEU A H      5  
ATOM 8734  H HA     . LEU A 1 42 ? 21.052 30.431 35.867 1.00 0.00 ? 40 LEU A HA     5  
ATOM 8735  H HB2    . LEU A 1 42 ? 20.943 32.055 33.363 1.00 0.00 ? 40 LEU A HB2    5  
ATOM 8736  H HB3    . LEU A 1 42 ? 22.247 32.481 34.425 1.00 0.00 ? 40 LEU A HB3    5  
ATOM 8737  H HG     . LEU A 1 42 ? 23.070 30.169 34.457 1.00 0.00 ? 40 LEU A HG     5  
ATOM 8738  H HD11   . LEU A 1 42 ? 21.007 28.917 34.042 1.00 0.00 ? 40 LEU A HD11   5  
ATOM 8739  H HD12   . LEU A 1 42 ? 20.871 29.636 32.424 1.00 0.00 ? 40 LEU A HD12   5  
ATOM 8740  H HD13   . LEU A 1 42 ? 22.214 28.533 32.810 1.00 0.00 ? 40 LEU A HD13   5  
ATOM 8741  H HD21   . LEU A 1 42 ? 23.896 30.135 32.139 1.00 0.00 ? 40 LEU A HD21   5  
ATOM 8742  H HD22   . LEU A 1 42 ? 22.625 31.278 31.652 1.00 0.00 ? 40 LEU A HD22   5  
ATOM 8743  H HD23   . LEU A 1 42 ? 23.905 31.786 32.776 1.00 0.00 ? 40 LEU A HD23   5  
ATOM 8744  N N      . THR A 1 43 ? 21.892 32.831 36.883 1.00 0.00 ? 41 THR A N      5  
ATOM 8745  C CA     . THR A 1 43 ? 22.224 34.032 37.672 1.00 0.00 ? 41 THR A CA     5  
ATOM 8746  C C      . THR A 1 43 ? 23.266 34.840 36.882 1.00 0.00 ? 41 THR A C      5  
ATOM 8747  O O      . THR A 1 43 ? 24.025 34.240 36.120 1.00 0.00 ? 41 THR A O      5  
ATOM 8748  C CB     . THR A 1 43 ? 22.773 33.633 39.058 1.00 0.00 ? 41 THR A CB     5  
ATOM 8749  O OG1    . THR A 1 43 ? 21.974 32.625 39.644 1.00 0.00 ? 41 THR A OG1    5  
ATOM 8750  C CG2    . THR A 1 43 ? 22.834 34.798 40.043 1.00 0.00 ? 41 THR A CG2    5  
ATOM 8751  H H      . THR A 1 43 ? 22.678 32.338 36.490 1.00 0.00 ? 41 THR A H      5  
ATOM 8752  H HA     . THR A 1 43 ? 21.332 34.643 37.810 1.00 0.00 ? 41 THR A HA     5  
ATOM 8753  H HB     . THR A 1 43 ? 23.780 33.233 38.934 1.00 0.00 ? 41 THR A HB     5  
ATOM 8754  H HG1    . THR A 1 43 ? 21.827 32.873 40.575 1.00 0.00 ? 41 THR A HG1    5  
ATOM 8755  H HG21   . THR A 1 43 ? 23.241 34.453 40.992 1.00 0.00 ? 41 THR A HG21   5  
ATOM 8756  H HG22   . THR A 1 43 ? 23.490 35.581 39.668 1.00 0.00 ? 41 THR A HG22   5  
ATOM 8757  H HG23   . THR A 1 43 ? 21.838 35.211 40.205 1.00 0.00 ? 41 THR A HG23   5  
ATOM 8758  N N      . GLU A 1 44 ? 23.344 36.170 37.028 1.00 0.00 ? 42 GLU A N      5  
ATOM 8759  C CA     . GLU A 1 44 ? 24.207 37.042 36.195 1.00 0.00 ? 42 GLU A CA     5  
ATOM 8760  C C      . GLU A 1 44 ? 25.655 36.544 36.030 1.00 0.00 ? 42 GLU A C      5  
ATOM 8761  O O      . GLU A 1 44 ? 26.149 36.485 34.905 1.00 0.00 ? 42 GLU A O      5  
ATOM 8762  C CB     . GLU A 1 44 ? 24.190 38.476 36.754 1.00 0.00 ? 42 GLU A CB     5  
ATOM 8763  C CG     . GLU A 1 44 ? 25.036 39.485 35.948 1.00 0.00 ? 42 GLU A CG     5  
ATOM 8764  C CD     . GLU A 1 44 ? 26.512 39.587 36.374 1.00 0.00 ? 42 GLU A CD     5  
ATOM 8765  O OE1    . GLU A 1 44 ? 26.807 39.660 37.592 1.00 0.00 ? 42 GLU A OE1    5  
ATOM 8766  O OE2    . GLU A 1 44 ? 27.401 39.673 35.493 1.00 0.00 ? 42 GLU A OE2    5  
ATOM 8767  H H      . GLU A 1 44 ? 22.663 36.623 37.633 1.00 0.00 ? 42 GLU A H      5  
ATOM 8768  H HA     . GLU A 1 44 ? 23.780 37.077 35.190 1.00 0.00 ? 42 GLU A HA     5  
ATOM 8769  H HB2    . GLU A 1 44 ? 23.155 38.815 36.727 1.00 0.00 ? 42 GLU A HB2    5  
ATOM 8770  H HB3    . GLU A 1 44 ? 24.505 38.468 37.796 1.00 0.00 ? 42 GLU A HB3    5  
ATOM 8771  H HG2    . GLU A 1 44 ? 24.976 39.222 34.891 1.00 0.00 ? 42 GLU A HG2    5  
ATOM 8772  H HG3    . GLU A 1 44 ? 24.587 40.472 36.056 1.00 0.00 ? 42 GLU A HG3    5  
ATOM 8773  N N      . ALA A 1 45 ? 26.314 36.111 37.109 1.00 0.00 ? 43 ALA A N      5  
ATOM 8774  C CA     . ALA A 1 45 ? 27.681 35.582 37.051 1.00 0.00 ? 43 ALA A CA     5  
ATOM 8775  C C      . ALA A 1 45 ? 27.823 34.349 36.133 1.00 0.00 ? 43 ALA A C      5  
ATOM 8776  O O      . ALA A 1 45 ? 28.823 34.211 35.432 1.00 0.00 ? 43 ALA A O      5  
ATOM 8777  C CB     . ALA A 1 45 ? 28.122 35.262 38.482 1.00 0.00 ? 43 ALA A CB     5  
ATOM 8778  H H      . ALA A 1 45 ? 25.878 36.208 38.014 1.00 0.00 ? 43 ALA A H      5  
ATOM 8779  H HA     . ALA A 1 45 ? 28.338 36.358 36.658 1.00 0.00 ? 43 ALA A HA     5  
ATOM 8780  H HB1    . ALA A 1 45 ? 28.110 36.172 39.086 1.00 0.00 ? 43 ALA A HB1    5  
ATOM 8781  H HB2    . ALA A 1 45 ? 27.458 34.521 38.931 1.00 0.00 ? 43 ALA A HB2    5  
ATOM 8782  H HB3    . ALA A 1 45 ? 29.136 34.863 38.467 1.00 0.00 ? 43 ALA A HB3    5  
ATOM 8783  N N      . ARG A 1 46 ? 26.800 33.483 36.060 1.00 0.00 ? 44 ARG A N      5  
ATOM 8784  C CA     . ARG A 1 46 ? 26.768 32.311 35.164 1.00 0.00 ? 44 ARG A CA     5  
ATOM 8785  C C      . ARG A 1 46 ? 26.740 32.744 33.692 1.00 0.00 ? 44 ARG A C      5  
ATOM 8786  O O      . ARG A 1 46 ? 27.447 32.175 32.864 1.00 0.00 ? 44 ARG A O      5  
ATOM 8787  C CB     . ARG A 1 46 ? 25.554 31.415 35.489 1.00 0.00 ? 44 ARG A CB     5  
ATOM 8788  C CG     . ARG A 1 46 ? 25.386 31.002 36.967 1.00 0.00 ? 44 ARG A CG     5  
ATOM 8789  C CD     . ARG A 1 46 ? 26.540 30.156 37.517 1.00 0.00 ? 44 ARG A CD     5  
ATOM 8790  N NE     . ARG A 1 46 ? 26.620 28.859 36.825 1.00 0.00 ? 44 ARG A NE     5  
ATOM 8791  C CZ     . ARG A 1 46 ? 27.608 28.413 36.073 1.00 0.00 ? 44 ARG A CZ     5  
ATOM 8792  N NH1    . ARG A 1 46 ? 28.793 28.945 36.039 1.00 0.00 ? 44 ARG A NH1    5  
ATOM 8793  N NH2    . ARG A 1 46 ? 27.415 27.400 35.292 1.00 0.00 1 44 ARG A NH2    5  
ATOM 8794  H H      . ARG A 1 46 ? 25.952 33.725 36.561 1.00 0.00 ? 44 ARG A H      5  
ATOM 8795  H HA     . ARG A 1 46 ? 27.686 31.734 35.293 1.00 0.00 ? 44 ARG A HA     5  
ATOM 8796  H HB2    . ARG A 1 46 ? 24.648 31.939 35.191 1.00 0.00 ? 44 ARG A HB2    5  
ATOM 8797  H HB3    . ARG A 1 46 ? 25.615 30.515 34.875 1.00 0.00 ? 44 ARG A HB3    5  
ATOM 8798  H HG2    . ARG A 1 46 ? 25.281 31.893 37.585 1.00 0.00 ? 44 ARG A HG2    5  
ATOM 8799  H HG3    . ARG A 1 46 ? 24.463 30.429 37.061 1.00 0.00 ? 44 ARG A HG3    5  
ATOM 8800  H HD2    . ARG A 1 46 ? 27.465 30.722 37.408 1.00 0.00 ? 44 ARG A HD2    5  
ATOM 8801  H HD3    . ARG A 1 46 ? 26.373 29.979 38.581 1.00 0.00 ? 44 ARG A HD3    5  
ATOM 8802  H HE     . ARG A 1 46 ? 25.817 28.243 36.904 1.00 0.00 ? 44 ARG A HE     5  
ATOM 8803  H HH11   . ARG A 1 46 ? 29.066 29.622 36.742 1.00 0.00 ? 44 ARG A HH11   5  
ATOM 8804  H HH12   . ARG A 1 46 ? 29.471 28.514 35.411 1.00 0.00 ? 44 ARG A HH12   5  
ATOM 8805  H HH21   . ARG A 1 46 ? 26.474 27.050 35.144 1.00 0.00 ? 44 ARG A HH21   5  
ATOM 8806  H HH22   . ARG A 1 46 ? 28.201 27.094 34.723 1.00 0.00 ? 44 ARG A HH22   5  
ATOM 8807  N N      . VAL A 1 47 ? 25.973 33.796 33.382 1.00 0.00 ? 45 VAL A N      5  
ATOM 8808  C CA     . VAL A 1 47 ? 25.939 34.422 32.045 1.00 0.00 ? 45 VAL A CA     5  
ATOM 8809  C C      . VAL A 1 47 ? 27.288 35.082 31.732 1.00 0.00 ? 45 VAL A C      5  
ATOM 8810  O O      . VAL A 1 47 ? 27.806 34.919 30.630 1.00 0.00 ? 45 VAL A O      5  
ATOM 8811  C CB     . VAL A 1 47 ? 24.781 35.442 31.929 1.00 0.00 ? 45 VAL A CB     5  
ATOM 8812  C CG1    . VAL A 1 47 ? 24.674 36.033 30.516 1.00 0.00 ? 45 VAL A CG1    5  
ATOM 8813  C CG2    . VAL A 1 47 ? 23.423 34.808 32.263 1.00 0.00 ? 45 VAL A CG2    5  
ATOM 8814  H H      . VAL A 1 47 ? 25.459 34.234 34.135 1.00 0.00 ? 45 VAL A H      5  
ATOM 8815  H HA     . VAL A 1 47 ? 25.779 33.642 31.301 1.00 0.00 ? 45 VAL A HA     5  
ATOM 8816  H HB     . VAL A 1 47 ? 24.952 36.264 32.622 1.00 0.00 ? 45 VAL A HB     5  
ATOM 8817  H HG11   . VAL A 1 47 ? 24.525 35.236 29.788 1.00 0.00 ? 45 VAL A HG11   5  
ATOM 8818  H HG12   . VAL A 1 47 ? 23.833 36.725 30.466 1.00 0.00 ? 45 VAL A HG12   5  
ATOM 8819  H HG13   . VAL A 1 47 ? 25.581 36.583 30.263 1.00 0.00 ? 45 VAL A HG13   5  
ATOM 8820  H HG21   . VAL A 1 47 ? 23.407 34.473 33.300 1.00 0.00 ? 45 VAL A HG21   5  
ATOM 8821  H HG22   . VAL A 1 47 ? 22.630 35.545 32.136 1.00 0.00 ? 45 VAL A HG22   5  
ATOM 8822  H HG23   . VAL A 1 47 ? 23.231 33.963 31.603 1.00 0.00 ? 45 VAL A HG23   5  
ATOM 8823  N N      . ARG A 1 48 ? 27.895 35.769 32.710 1.00 0.00 ? 46 ARG A N      5  
ATOM 8824  C CA     . ARG A 1 48 ? 29.202 36.436 32.583 1.00 0.00 ? 46 ARG A CA     5  
ATOM 8825  C C      . ARG A 1 48 ? 30.331 35.455 32.232 1.00 0.00 ? 46 ARG A C      5  
ATOM 8826  O O      . ARG A 1 48 ? 31.087 35.727 31.298 1.00 0.00 ? 46 ARG A O      5  
ATOM 8827  C CB     . ARG A 1 48 ? 29.501 37.191 33.890 1.00 0.00 ? 46 ARG A CB     5  
ATOM 8828  C CG     . ARG A 1 48 ? 30.465 38.366 33.673 1.00 0.00 ? 46 ARG A CG     5  
ATOM 8829  C CD     . ARG A 1 48 ? 31.130 38.811 34.980 1.00 0.00 ? 46 ARG A CD     5  
ATOM 8830  N NE     . ARG A 1 48 ? 30.168 39.133 36.052 1.00 0.00 ? 46 ARG A NE     5  
ATOM 8831  C CZ     . ARG A 1 48 ? 30.445 39.158 37.343 1.00 0.00 ? 46 ARG A CZ     5  
ATOM 8832  N NH1    . ARG A 1 48 ? 31.648 38.978 37.815 1.00 0.00 ? 46 ARG A NH1    5  
ATOM 8833  N NH2    . ARG A 1 48 ? 29.489 39.360 38.196 1.00 0.00 1 46 ARG A NH2    5  
ATOM 8834  H H      . ARG A 1 48 ? 27.393 35.872 33.589 1.00 0.00 ? 46 ARG A H      5  
ATOM 8835  H HA     . ARG A 1 48 ? 29.144 37.151 31.762 1.00 0.00 ? 46 ARG A HA     5  
ATOM 8836  H HB2    . ARG A 1 48 ? 28.574 37.589 34.304 1.00 0.00 ? 46 ARG A HB2    5  
ATOM 8837  H HB3    . ARG A 1 48 ? 29.927 36.498 34.617 1.00 0.00 ? 46 ARG A HB3    5  
ATOM 8838  H HG2    . ARG A 1 48 ? 31.255 38.062 32.987 1.00 0.00 ? 46 ARG A HG2    5  
ATOM 8839  H HG3    . ARG A 1 48 ? 29.925 39.203 33.232 1.00 0.00 ? 46 ARG A HG3    5  
ATOM 8840  H HD2    . ARG A 1 48 ? 31.779 38.001 35.314 1.00 0.00 ? 46 ARG A HD2    5  
ATOM 8841  H HD3    . ARG A 1 48 ? 31.755 39.680 34.778 1.00 0.00 ? 46 ARG A HD3    5  
ATOM 8842  H HE     . ARG A 1 48 ? 29.194 39.294 35.800 1.00 0.00 ? 46 ARG A HE     5  
ATOM 8843  H HH11   . ARG A 1 48 ? 32.424 38.876 37.165 1.00 0.00 ? 46 ARG A HH11   5  
ATOM 8844  H HH12   . ARG A 1 48 ? 31.804 38.854 38.807 1.00 0.00 ? 46 ARG A HH12   5  
ATOM 8845  H HH21   . ARG A 1 48 ? 28.534 39.494 37.866 1.00 0.00 ? 46 ARG A HH21   5  
ATOM 8846  H HH22   . ARG A 1 48 ? 29.706 39.504 39.176 1.00 0.00 ? 46 ARG A HH22   5  
ATOM 8847  N N      . VAL A 1 49 ? 30.386 34.299 32.906 1.00 0.00 ? 47 VAL A N      5  
ATOM 8848  C CA     . VAL A 1 49 ? 31.321 33.197 32.592 1.00 0.00 ? 47 VAL A CA     5  
ATOM 8849  C C      . VAL A 1 49 ? 31.098 32.688 31.165 1.00 0.00 ? 47 VAL A C      5  
ATOM 8850  O O      . VAL A 1 49 ? 32.048 32.611 30.384 1.00 0.00 ? 47 VAL A O      5  
ATOM 8851  C CB     . VAL A 1 49 ? 31.207 32.046 33.618 1.00 0.00 ? 47 VAL A CB     5  
ATOM 8852  C CG1    . VAL A 1 49 ? 32.001 30.794 33.212 1.00 0.00 ? 47 VAL A CG1    5  
ATOM 8853  C CG2    . VAL A 1 49 ? 31.749 32.486 34.982 1.00 0.00 ? 47 VAL A CG2    5  
ATOM 8854  H H      . VAL A 1 49 ? 29.767 34.191 33.702 1.00 0.00 ? 47 VAL A H      5  
ATOM 8855  H HA     . VAL A 1 49 ? 32.338 33.578 32.647 1.00 0.00 ? 47 VAL A HA     5  
ATOM 8856  H HB     . VAL A 1 49 ? 30.159 31.766 33.729 1.00 0.00 ? 47 VAL A HB     5  
ATOM 8857  H HG11   . VAL A 1 49 ? 33.045 31.055 33.028 1.00 0.00 ? 47 VAL A HG11   5  
ATOM 8858  H HG12   . VAL A 1 49 ? 31.950 30.049 34.006 1.00 0.00 ? 47 VAL A HG12   5  
ATOM 8859  H HG13   . VAL A 1 49 ? 31.576 30.349 32.313 1.00 0.00 ? 47 VAL A HG13   5  
ATOM 8860  H HG21   . VAL A 1 49 ? 31.211 33.360 35.343 1.00 0.00 ? 47 VAL A HG21   5  
ATOM 8861  H HG22   . VAL A 1 49 ? 31.623 31.682 35.707 1.00 0.00 ? 47 VAL A HG22   5  
ATOM 8862  H HG23   . VAL A 1 49 ? 32.806 32.738 34.905 1.00 0.00 ? 47 VAL A HG23   5  
ATOM 8863  N N      . TRP A 1 50 ? 29.844 32.407 30.785 1.00 0.00 ? 48 TRP A N      5  
ATOM 8864  C CA     . TRP A 1 50 ? 29.536 31.888 29.449 1.00 0.00 ? 48 TRP A CA     5  
ATOM 8865  C C      . TRP A 1 50 ? 29.926 32.862 28.329 1.00 0.00 ? 48 TRP A C      5  
ATOM 8866  O O      . TRP A 1 50 ? 30.452 32.427 27.301 1.00 0.00 ? 48 TRP A O      5  
ATOM 8867  C CB     . TRP A 1 50 ? 28.053 31.512 29.349 1.00 0.00 ? 48 TRP A CB     5  
ATOM 8868  C CG     . TRP A 1 50 ? 27.728 30.668 28.152 1.00 0.00 ? 48 TRP A CG     5  
ATOM 8869  C CD1    . TRP A 1 50 ? 27.739 29.318 28.144 1.00 0.00 ? 48 TRP A CD1    5  
ATOM 8870  C CD2    . TRP A 1 50 ? 27.403 31.067 26.780 1.00 0.00 ? 48 TRP A CD2    5  
ATOM 8871  N NE1    . TRP A 1 50 ? 27.451 28.850 26.879 1.00 0.00 ? 48 TRP A NE1    5  
ATOM 8872  C CE2    . TRP A 1 50 ? 27.187 29.883 26.007 1.00 0.00 ? 48 TRP A CE2    5  
ATOM 8873  C CE3    . TRP A 1 50 ? 27.292 32.302 26.103 1.00 0.00 ? 48 TRP A CE3    5  
ATOM 8874  C CZ2    . TRP A 1 50 ? 26.840 29.928 24.648 1.00 0.00 ? 48 TRP A CZ2    5  
ATOM 8875  C CZ3    . TRP A 1 50 ? 26.956 32.358 24.734 1.00 0.00 ? 48 TRP A CZ3    5  
ATOM 8876  C CH2    . TRP A 1 50 ? 26.713 31.175 24.012 1.00 0.00 ? 48 TRP A CH2    5  
ATOM 8877  H H      . TRP A 1 50 ? 29.094 32.482 31.463 1.00 0.00 ? 48 TRP A H      5  
ATOM 8878  H HA     . TRP A 1 50 ? 30.121 30.980 29.302 1.00 0.00 ? 48 TRP A HA     5  
ATOM 8879  H HB2    . TRP A 1 50 ? 27.773 30.950 30.242 1.00 0.00 ? 48 TRP A HB2    5  
ATOM 8880  H HB3    . TRP A 1 50 ? 27.445 32.418 29.324 1.00 0.00 ? 48 TRP A HB3    5  
ATOM 8881  H HD1    . TRP A 1 50 ? 27.968 28.695 28.999 1.00 0.00 ? 48 TRP A HD1    5  
ATOM 8882  H HE1    . TRP A 1 50 ? 27.528 27.861 26.633 1.00 0.00 ? 48 TRP A HE1    5  
ATOM 8883  H HE3    . TRP A 1 50 ? 27.455 33.219 26.648 1.00 0.00 ? 48 TRP A HE3    5  
ATOM 8884  H HZ2    . TRP A 1 50 ? 26.684 29.012 24.096 1.00 0.00 ? 48 TRP A HZ2    5  
ATOM 8885  H HZ3    . TRP A 1 50 ? 26.855 33.316 24.242 1.00 0.00 ? 48 TRP A HZ3    5  
ATOM 8886  H HH2    . TRP A 1 50 ? 26.439 31.223 22.966 1.00 0.00 ? 48 TRP A HH2    5  
ATOM 8887  N N      . PHE A 1 51 ? 29.718 34.168 28.530 1.00 0.00 ? 49 PHE A N      5  
ATOM 8888  C CA     . PHE A 1 51 ? 30.096 35.215 27.576 1.00 0.00 ? 49 PHE A CA     5  
ATOM 8889  C C      . PHE A 1 51 ? 31.615 35.420 27.488 1.00 0.00 ? 49 PHE A C      5  
ATOM 8890  O O      . PHE A 1 51 ? 32.140 35.472 26.371 1.00 0.00 ? 49 PHE A O      5  
ATOM 8891  C CB     . PHE A 1 51 ? 29.364 36.529 27.899 1.00 0.00 ? 49 PHE A CB     5  
ATOM 8892  C CG     . PHE A 1 51 ? 28.046 36.697 27.162 1.00 0.00 ? 49 PHE A CG     5  
ATOM 8893  C CD1    . PHE A 1 51 ? 26.941 35.881 27.473 1.00 0.00 ? 49 PHE A CD1    5  
ATOM 8894  C CD2    . PHE A 1 51 ? 27.933 37.653 26.133 1.00 0.00 ? 49 PHE A CD2    5  
ATOM 8895  C CE1    . PHE A 1 51 ? 25.739 36.010 26.752 1.00 0.00 ? 49 PHE A CE1    5  
ATOM 8896  C CE2    . PHE A 1 51 ? 26.731 37.783 25.417 1.00 0.00 ? 49 PHE A CE2    5  
ATOM 8897  C CZ     . PHE A 1 51 ? 25.636 36.957 25.721 1.00 0.00 ? 49 PHE A CZ     5  
ATOM 8898  H H      . PHE A 1 51 ? 29.254 34.449 29.389 1.00 0.00 ? 49 PHE A H      5  
ATOM 8899  H HA     . PHE A 1 51 ? 29.779 34.902 26.579 1.00 0.00 ? 49 PHE A HA     5  
ATOM 8900  H HB2    . PHE A 1 51 ? 29.198 36.614 28.974 1.00 0.00 ? 49 PHE A HB2    5  
ATOM 8901  H HB3    . PHE A 1 51 ? 30.013 37.359 27.616 1.00 0.00 ? 49 PHE A HB3    5  
ATOM 8902  H HD1    . PHE A 1 51 ? 27.014 35.146 28.258 1.00 0.00 ? 49 PHE A HD1    5  
ATOM 8903  H HD2    . PHE A 1 51 ? 28.773 38.288 25.884 1.00 0.00 ? 49 PHE A HD2    5  
ATOM 8904  H HE1    . PHE A 1 51 ? 24.897 35.376 26.984 1.00 0.00 ? 49 PHE A HE1    5  
ATOM 8905  H HE2    . PHE A 1 51 ? 26.648 38.512 24.623 1.00 0.00 ? 49 PHE A HE2    5  
ATOM 8906  H HZ     . PHE A 1 51 ? 24.716 37.052 25.160 1.00 0.00 ? 49 PHE A HZ     5  
ATOM 8907  N N      . LYS A 1 52 ? 32.353 35.470 28.613 1.00 0.00 ? 50 LYS A N      5  
ATOM 8908  C CA     . LYS A 1 52 ? 33.822 35.594 28.545 1.00 0.00 ? 50 LYS A CA     5  
ATOM 8909  C C      . LYS A 1 52 ? 34.475 34.360 27.919 1.00 0.00 ? 50 LYS A C      5  
ATOM 8910  O O      . LYS A 1 52 ? 35.411 34.526 27.142 1.00 0.00 ? 50 LYS A O      5  
ATOM 8911  C CB     . LYS A 1 52 ? 34.460 36.032 29.877 1.00 0.00 ? 50 LYS A CB     5  
ATOM 8912  C CG     . LYS A 1 52 ? 34.543 34.962 30.977 1.00 0.00 ? 50 LYS A CG     5  
ATOM 8913  C CD     . LYS A 1 52 ? 35.169 35.500 32.278 1.00 0.00 ? 50 LYS A CD     5  
ATOM 8914  C CE     . LYS A 1 52 ? 36.677 35.780 32.147 1.00 0.00 ? 50 LYS A CE     5  
ATOM 8915  N NZ     . LYS A 1 52 ? 37.223 36.424 33.363 1.00 0.00 1 50 LYS A NZ     5  
ATOM 8916  H H      . LYS A 1 52 ? 31.889 35.427 29.519 1.00 0.00 ? 50 LYS A H      5  
ATOM 8917  H HA     . LYS A 1 52 ? 34.033 36.402 27.843 1.00 0.00 ? 50 LYS A HA     5  
ATOM 8918  H HB2    . LYS A 1 52 ? 35.473 36.370 29.659 1.00 0.00 ? 50 LYS A HB2    5  
ATOM 8919  H HB3    . LYS A 1 52 ? 33.904 36.889 30.258 1.00 0.00 ? 50 LYS A HB3    5  
ATOM 8920  H HG2    . LYS A 1 52 ? 33.535 34.626 31.195 1.00 0.00 ? 50 LYS A HG2    5  
ATOM 8921  H HG3    . LYS A 1 52 ? 35.125 34.108 30.628 1.00 0.00 ? 50 LYS A HG3    5  
ATOM 8922  H HD2    . LYS A 1 52 ? 34.647 36.410 32.573 1.00 0.00 ? 50 LYS A HD2    5  
ATOM 8923  H HD3    . LYS A 1 52 ? 35.017 34.762 33.064 1.00 0.00 ? 50 LYS A HD3    5  
ATOM 8924  H HE2    . LYS A 1 52 ? 37.203 34.837 31.967 1.00 0.00 ? 50 LYS A HE2    5  
ATOM 8925  H HE3    . LYS A 1 52 ? 36.852 36.438 31.293 1.00 0.00 ? 50 LYS A HE3    5  
ATOM 8926  H HZ1    . LYS A 1 52 ? 36.773 37.320 33.544 1.00 0.00 ? 50 LYS A HZ1    5  
ATOM 8927  H HZ2    . LYS A 1 52 ? 37.091 35.840 34.185 1.00 0.00 ? 50 LYS A HZ2    5  
ATOM 8928  H HZ3    . LYS A 1 52 ? 38.221 36.587 33.258 1.00 0.00 ? 50 LYS A HZ3    5  
ATOM 8929  N N      . ASN A 1 53 ? 33.928 33.156 28.122 1.00 0.00 ? 51 ASN A N      5  
ATOM 8930  C CA     . ASN A 1 53 ? 34.369 31.960 27.393 1.00 0.00 ? 51 ASN A CA     5  
ATOM 8931  C C      . ASN A 1 53 ? 34.010 31.993 25.900 1.00 0.00 ? 51 ASN A C      5  
ATOM 8932  O O      . ASN A 1 53 ? 34.839 31.596 25.081 1.00 0.00 ? 51 ASN A O      5  
ATOM 8933  C CB     . ASN A 1 53 ? 33.843 30.690 28.079 1.00 0.00 ? 51 ASN A CB     5  
ATOM 8934  C CG     . ASN A 1 53 ? 34.723 30.266 29.240 1.00 0.00 ? 51 ASN A CG     5  
ATOM 8935  O OD1    . ASN A 1 53 ? 35.945 30.357 29.202 1.00 0.00 ? 51 ASN A OD1    5  
ATOM 8936  N ND2    . ASN A 1 53 ? 34.134 29.757 30.287 1.00 0.00 ? 51 ASN A ND2    5  
ATOM 8937  H H      . ASN A 1 53 ? 33.189 33.066 28.814 1.00 0.00 ? 51 ASN A H      5  
ATOM 8938  H HA     . ASN A 1 53 ? 35.456 31.931 27.429 1.00 0.00 ? 51 ASN A HA     5  
ATOM 8939  H HB2    . ASN A 1 53 ? 32.818 30.845 28.418 1.00 0.00 ? 51 ASN A HB2    5  
ATOM 8940  H HB3    . ASN A 1 53 ? 33.840 29.862 27.370 1.00 0.00 ? 51 ASN A HB3    5  
ATOM 8941  H HD21   . ASN A 1 53 ? 33.125 29.649 30.299 1.00 0.00 ? 51 ASN A HD21   5  
ATOM 8942  H HD22   . ASN A 1 53 ? 34.735 29.520 31.069 1.00 0.00 ? 51 ASN A HD22   5  
ATOM 8943  N N      . ARG A 1 54 ? 32.844 32.535 25.509 1.00 0.00 ? 52 ARG A N      5  
ATOM 8944  C CA     . ARG A 1 54 ? 32.493 32.723 24.086 1.00 0.00 ? 52 ARG A CA     5  
ATOM 8945  C C      . ARG A 1 54 ? 33.490 33.623 23.360 1.00 0.00 ? 52 ARG A C      5  
ATOM 8946  O O      . ARG A 1 54 ? 33.832 33.350 22.212 1.00 0.00 ? 52 ARG A O      5  
ATOM 8947  C CB     . ARG A 1 54 ? 31.057 33.273 23.940 1.00 0.00 ? 52 ARG A CB     5  
ATOM 8948  C CG     . ARG A 1 54 ? 30.253 32.621 22.795 1.00 0.00 ? 52 ARG A CG     5  
ATOM 8949  C CD     . ARG A 1 54 ? 30.146 31.087 22.894 1.00 0.00 ? 52 ARG A CD     5  
ATOM 8950  N NE     . ARG A 1 54 ? 29.940 30.653 24.289 1.00 0.00 ? 52 ARG A NE     5  
ATOM 8951  C CZ     . ARG A 1 54 ? 30.533 29.659 24.921 1.00 0.00 ? 52 ARG A CZ     5  
ATOM 8952  N NH1    . ARG A 1 54 ? 31.168 28.706 24.309 1.00 0.00 1 52 ARG A NH1    5  
ATOM 8953  N NH2    . ARG A 1 54 ? 30.511 29.625 26.215 1.00 0.00 ? 52 ARG A NH2    5  
ATOM 8954  H H      . ARG A 1 54 ? 32.170 32.800 26.222 1.00 0.00 ? 52 ARG A H      5  
ATOM 8955  H HA     . ARG A 1 54 ? 32.570 31.752 23.600 1.00 0.00 ? 52 ARG A HA     5  
ATOM 8956  H HB2    . ARG A 1 54 ? 30.505 33.129 24.868 1.00 0.00 ? 52 ARG A HB2    5  
ATOM 8957  H HB3    . ARG A 1 54 ? 31.094 34.350 23.778 1.00 0.00 ? 52 ARG A HB3    5  
ATOM 8958  H HG2    . ARG A 1 54 ? 29.246 33.041 22.810 1.00 0.00 ? 52 ARG A HG2    5  
ATOM 8959  H HG3    . ARG A 1 54 ? 30.708 32.881 21.839 1.00 0.00 ? 52 ARG A HG3    5  
ATOM 8960  H HD2    . ARG A 1 54 ? 29.317 30.743 22.272 1.00 0.00 ? 52 ARG A HD2    5  
ATOM 8961  H HD3    . ARG A 1 54 ? 31.064 30.652 22.497 1.00 0.00 ? 52 ARG A HD3    5  
ATOM 8962  H HE     . ARG A 1 54 ? 29.323 31.220 24.851 1.00 0.00 ? 52 ARG A HE     5  
ATOM 8963  H HH11   . ARG A 1 54 ? 31.120 28.642 23.298 1.00 0.00 ? 52 ARG A HH11   5  
ATOM 8964  H HH12   . ARG A 1 54 ? 31.451 27.879 24.816 1.00 0.00 ? 52 ARG A HH12   5  
ATOM 8965  H HH21   . ARG A 1 54 ? 30.092 30.377 26.736 1.00 0.00 ? 52 ARG A HH21   5  
ATOM 8966  H HH22   . ARG A 1 54 ? 30.957 28.845 26.695 1.00 0.00 ? 52 ARG A HH22   5  
ATOM 8967  N N      . ARG A 1 55 ? 34.004 34.653 24.043 1.00 0.00 ? 53 ARG A N      5  
ATOM 8968  C CA     . ARG A 1 55 ? 35.082 35.523 23.543 1.00 0.00 ? 53 ARG A CA     5  
ATOM 8969  C C      . ARG A 1 55 ? 36.451 34.819 23.591 1.00 0.00 ? 53 ARG A C      5  
ATOM 8970  O O      . ARG A 1 55 ? 37.152 34.774 22.587 1.00 0.00 ? 53 ARG A O      5  
ATOM 8971  C CB     . ARG A 1 55 ? 35.035 36.878 24.280 1.00 0.00 ? 53 ARG A CB     5  
ATOM 8972  C CG     . ARG A 1 55 ? 33.710 37.624 23.994 1.00 0.00 ? 53 ARG A CG     5  
ATOM 8973  C CD     . ARG A 1 55 ? 33.663 39.071 24.506 1.00 0.00 ? 53 ARG A CD     5  
ATOM 8974  N NE     . ARG A 1 55 ? 33.895 39.168 25.959 1.00 0.00 ? 53 ARG A NE     5  
ATOM 8975  C CZ     . ARG A 1 55 ? 33.027 39.420 26.924 1.00 0.00 ? 53 ARG A CZ     5  
ATOM 8976  N NH1    . ARG A 1 55 ? 31.763 39.655 26.719 1.00 0.00 ? 53 ARG A NH1    5  
ATOM 8977  N NH2    . ARG A 1 55 ? 33.445 39.448 28.156 1.00 0.00 1 53 ARG A NH2    5  
ATOM 8978  H H      . ARG A 1 55 ? 33.618 34.829 24.964 1.00 0.00 ? 53 ARG A H      5  
ATOM 8979  H HA     . ARG A 1 55 ? 34.907 35.717 22.482 1.00 0.00 ? 53 ARG A HA     5  
ATOM 8980  H HB2    . ARG A 1 55 ? 35.141 36.716 25.353 1.00 0.00 ? 53 ARG A HB2    5  
ATOM 8981  H HB3    . ARG A 1 55 ? 35.870 37.492 23.944 1.00 0.00 ? 53 ARG A HB3    5  
ATOM 8982  H HG2    . ARG A 1 55 ? 33.549 37.651 22.915 1.00 0.00 ? 53 ARG A HG2    5  
ATOM 8983  H HG3    . ARG A 1 55 ? 32.880 37.078 24.442 1.00 0.00 ? 53 ARG A HG3    5  
ATOM 8984  H HD2    . ARG A 1 55 ? 34.438 39.643 23.991 1.00 0.00 ? 53 ARG A HD2    5  
ATOM 8985  H HD3    . ARG A 1 55 ? 32.701 39.510 24.241 1.00 0.00 ? 53 ARG A HD3    5  
ATOM 8986  H HE     . ARG A 1 55 ? 34.863 39.106 26.251 1.00 0.00 ? 53 ARG A HE     5  
ATOM 8987  H HH11   . ARG A 1 55 ? 31.392 39.781 25.784 1.00 0.00 ? 53 ARG A HH11   5  
ATOM 8988  H HH12   . ARG A 1 55 ? 31.143 39.713 27.520 1.00 0.00 ? 53 ARG A HH12   5  
ATOM 8989  H HH21   . ARG A 1 55 ? 34.417 39.224 28.353 1.00 0.00 ? 53 ARG A HH21   5  
ATOM 8990  H HH22   . ARG A 1 55 ? 32.853 39.815 28.895 1.00 0.00 ? 53 ARG A HH22   5  
ATOM 8991  N N      . ALA A 1 56 ? 36.799 34.153 24.694 1.00 0.00 ? 54 ALA A N      5  
ATOM 8992  C CA     . ALA A 1 56 ? 38.042 33.377 24.820 1.00 0.00 ? 54 ALA A CA     5  
ATOM 8993  C C      . ALA A 1 56 ? 38.206 32.285 23.737 1.00 0.00 ? 54 ALA A C      5  
ATOM 8994  O O      . ALA A 1 56 ? 39.337 31.999 23.325 1.00 0.00 ? 54 ALA A O      5  
ATOM 8995  C CB     . ALA A 1 56 ? 38.086 32.755 26.220 1.00 0.00 ? 54 ALA A CB     5  
ATOM 8996  H H      . ALA A 1 56 ? 36.201 34.224 25.509 1.00 0.00 ? 54 ALA A H      5  
ATOM 8997  H HA     . ALA A 1 56 ? 38.885 34.063 24.726 1.00 0.00 ? 54 ALA A HA     5  
ATOM 8998  H HB1    . ALA A 1 56 ? 37.295 32.016 26.325 1.00 0.00 ? 54 ALA A HB1    5  
ATOM 8999  H HB2    . ALA A 1 56 ? 39.041 32.255 26.372 1.00 0.00 ? 54 ALA A HB2    5  
ATOM 9000  H HB3    . ALA A 1 56 ? 37.973 33.528 26.981 1.00 0.00 ? 54 ALA A HB3    5  
ATOM 9001  N N      . LYS A 1 57 ? 37.090 31.726 23.239 1.00 0.00 ? 55 LYS A N      5  
ATOM 9002  C CA     . LYS A 1 57 ? 37.025 30.727 22.158 1.00 0.00 ? 55 LYS A CA     5  
ATOM 9003  C C      . LYS A 1 57 ? 37.831 31.135 20.918 1.00 0.00 ? 55 LYS A C      5  
ATOM 9004  O O      . LYS A 1 57 ? 38.578 30.312 20.390 1.00 0.00 ? 55 LYS A O      5  
ATOM 9005  C CB     . LYS A 1 57 ? 35.546 30.469 21.774 1.00 0.00 ? 55 LYS A CB     5  
ATOM 9006  C CG     . LYS A 1 57 ? 35.219 28.981 21.546 1.00 0.00 ? 55 LYS A CG     5  
ATOM 9007  C CD     . LYS A 1 57 ? 34.794 28.292 22.856 1.00 0.00 ? 55 LYS A CD     5  
ATOM 9008  C CE     . LYS A 1 57 ? 34.617 26.774 22.720 1.00 0.00 ? 55 LYS A CE     5  
ATOM 9009  N NZ     . LYS A 1 57 ? 33.558 26.368 21.763 1.00 0.00 1 55 LYS A NZ     5  
ATOM 9010  H H      . LYS A 1 57 ? 36.218 31.960 23.706 1.00 0.00 ? 55 LYS A H      5  
ATOM 9011  H HA     . LYS A 1 57 ? 37.463 29.798 22.528 1.00 0.00 ? 55 LYS A HA     5  
ATOM 9012  H HB2    . LYS A 1 57 ? 34.878 30.852 22.546 1.00 0.00 ? 55 LYS A HB2    5  
ATOM 9013  H HB3    . LYS A 1 57 ? 35.311 31.019 20.860 1.00 0.00 ? 55 LYS A HB3    5  
ATOM 9014  H HG2    . LYS A 1 57 ? 34.394 28.912 20.837 1.00 0.00 ? 55 LYS A HG2    5  
ATOM 9015  H HG3    . LYS A 1 57 ? 36.083 28.473 21.115 1.00 0.00 ? 55 LYS A HG3    5  
ATOM 9016  H HD2    . LYS A 1 57 ? 35.562 28.471 23.611 1.00 0.00 ? 55 LYS A HD2    5  
ATOM 9017  H HD3    . LYS A 1 57 ? 33.861 28.733 23.210 1.00 0.00 ? 55 LYS A HD3    5  
ATOM 9018  H HE2    . LYS A 1 57 ? 35.570 26.342 22.414 1.00 0.00 ? 55 LYS A HE2    5  
ATOM 9019  H HE3    . LYS A 1 57 ? 34.382 26.360 23.702 1.00 0.00 ? 55 LYS A HE3    5  
ATOM 9020  H HZ1    . LYS A 1 57 ? 33.551 25.355 21.684 1.00 0.00 ? 55 LYS A HZ1    5  
ATOM 9021  H HZ2    . LYS A 1 57 ? 32.642 26.702 22.051 1.00 0.00 ? 55 LYS A HZ2    5  
ATOM 9022  H HZ3    . LYS A 1 57 ? 33.718 26.726 20.825 1.00 0.00 ? 55 LYS A HZ3    5  
ATOM 9023  N N      . TRP A 1 58 ? 37.762 32.401 20.479 1.00 0.00 ? 56 TRP A N      5  
ATOM 9024  C CA     . TRP A 1 58 ? 38.480 32.834 19.266 1.00 0.00 ? 56 TRP A CA     5  
ATOM 9025  C C      . TRP A 1 58 ? 40.001 32.762 19.446 1.00 0.00 ? 56 TRP A C      5  
ATOM 9026  O O      . TRP A 1 58 ? 40.717 32.393 18.515 1.00 0.00 ? 56 TRP A O      5  
ATOM 9027  C CB     . TRP A 1 58 ? 38.004 34.217 18.777 1.00 0.00 ? 56 TRP A CB     5  
ATOM 9028  C CG     . TRP A 1 58 ? 38.720 35.447 19.273 1.00 0.00 ? 56 TRP A CG     5  
ATOM 9029  C CD1    . TRP A 1 58 ? 39.987 35.801 18.945 1.00 0.00 ? 56 TRP A CD1    5  
ATOM 9030  C CD2    . TRP A 1 58 ? 38.197 36.573 20.051 1.00 0.00 ? 56 TRP A CD2    5  
ATOM 9031  N NE1    . TRP A 1 58 ? 40.301 37.021 19.513 1.00 0.00 ? 56 TRP A NE1    5  
ATOM 9032  C CE2    . TRP A 1 58 ? 39.236 37.539 20.214 1.00 0.00 ? 56 TRP A CE2    5  
ATOM 9033  C CE3    . TRP A 1 58 ? 36.935 36.903 20.592 1.00 0.00 ? 56 TRP A CE3    5  
ATOM 9034  C CZ2    . TRP A 1 58 ? 39.048 38.742 20.912 1.00 0.00 ? 56 TRP A CZ2    5  
ATOM 9035  C CZ3    . TRP A 1 58 ? 36.735 38.104 21.300 1.00 0.00 ? 56 TRP A CZ3    5  
ATOM 9036  C CH2    . TRP A 1 58 ? 37.786 39.022 21.460 1.00 0.00 ? 56 TRP A CH2    5  
ATOM 9037  H H      . TRP A 1 58 ? 37.187 33.068 20.979 1.00 0.00 ? 56 TRP A H      5  
ATOM 9038  H HA     . TRP A 1 58 ? 38.232 32.124 18.475 1.00 0.00 ? 56 TRP A HA     5  
ATOM 9039  H HB2    . TRP A 1 58 ? 38.107 34.221 17.690 1.00 0.00 ? 56 TRP A HB2    5  
ATOM 9040  H HB3    . TRP A 1 58 ? 36.938 34.323 18.982 1.00 0.00 ? 56 TRP A HB3    5  
ATOM 9041  H HD1    . TRP A 1 58 ? 40.639 35.224 18.300 1.00 0.00 ? 56 TRP A HD1    5  
ATOM 9042  H HE1    . TRP A 1 58 ? 41.166 37.514 19.334 1.00 0.00 ? 56 TRP A HE1    5  
ATOM 9043  H HE3    . TRP A 1 58 ? 36.119 36.208 20.463 1.00 0.00 ? 56 TRP A HE3    5  
ATOM 9044  H HZ2    . TRP A 1 58 ? 39.855 39.458 20.986 1.00 0.00 ? 56 TRP A HZ2    5  
ATOM 9045  H HZ3    . TRP A 1 58 ? 35.760 38.335 21.702 1.00 0.00 ? 56 TRP A HZ3    5  
ATOM 9046  H HH2    . TRP A 1 58 ? 37.613 39.954 21.983 1.00 0.00 ? 56 TRP A HH2    5  
ATOM 9047  N N      . ARG A 1 59 ? 40.504 33.030 20.660 1.00 0.00 ? 57 ARG A N      5  
ATOM 9048  C CA     . ARG A 1 59 ? 41.938 32.929 20.976 1.00 0.00 ? 57 ARG A CA     5  
ATOM 9049  C C      . ARG A 1 59 ? 42.409 31.478 21.010 1.00 0.00 ? 57 ARG A C      5  
ATOM 9050  O O      . ARG A 1 59 ? 43.446 31.148 20.435 1.00 0.00 ? 57 ARG A O      5  
ATOM 9051  C CB     . ARG A 1 59 ? 42.278 33.637 22.295 1.00 0.00 ? 57 ARG A CB     5  
ATOM 9052  C CG     . ARG A 1 59 ? 41.677 35.045 22.439 1.00 0.00 ? 57 ARG A CG     5  
ATOM 9053  C CD     . ARG A 1 59 ? 42.431 35.871 23.493 1.00 0.00 ? 57 ARG A CD     5  
ATOM 9054  N NE     . ARG A 1 59 ? 43.722 36.347 22.956 1.00 0.00 ? 57 ARG A NE     5  
ATOM 9055  C CZ     . ARG A 1 59 ? 43.888 37.414 22.195 1.00 0.00 ? 57 ARG A CZ     5  
ATOM 9056  N NH1    . ARG A 1 59 ? 42.924 38.264 21.988 1.00 0.00 1 57 ARG A NH1    5  
ATOM 9057  N NH2    . ARG A 1 59 ? 45.031 37.649 21.624 1.00 0.00 ? 57 ARG A NH2    5  
ATOM 9058  H H      . ARG A 1 59 ? 39.854 33.301 21.388 1.00 0.00 ? 57 ARG A H      5  
ATOM 9059  H HA     . ARG A 1 59 ? 42.494 33.418 20.178 1.00 0.00 ? 57 ARG A HA     5  
ATOM 9060  H HB2    . ARG A 1 59 ? 41.937 33.028 23.130 1.00 0.00 ? 57 ARG A HB2    5  
ATOM 9061  H HB3    . ARG A 1 59 ? 43.365 33.701 22.350 1.00 0.00 ? 57 ARG A HB3    5  
ATOM 9062  H HG2    . ARG A 1 59 ? 41.723 35.564 21.481 1.00 0.00 ? 57 ARG A HG2    5  
ATOM 9063  H HG3    . ARG A 1 59 ? 40.631 34.958 22.735 1.00 0.00 ? 57 ARG A HG3    5  
ATOM 9064  H HD2    . ARG A 1 59 ? 41.814 36.719 23.791 1.00 0.00 ? 57 ARG A HD2    5  
ATOM 9065  H HD3    . ARG A 1 59 ? 42.602 35.263 24.381 1.00 0.00 ? 57 ARG A HD3    5  
ATOM 9066  H HE     . ARG A 1 59 ? 44.508 35.713 23.007 1.00 0.00 ? 57 ARG A HE     5  
ATOM 9067  H HH11   . ARG A 1 59 ? 42.148 38.282 22.635 1.00 0.00 ? 57 ARG A HH11   5  
ATOM 9068  H HH12   . ARG A 1 59 ? 43.056 39.038 21.353 1.00 0.00 ? 57 ARG A HH12   5  
ATOM 9069  H HH21   . ARG A 1 59 ? 45.817 37.028 21.781 1.00 0.00 ? 57 ARG A HH21   5  
ATOM 9070  H HH22   . ARG A 1 59 ? 45.158 38.494 21.082 1.00 0.00 ? 57 ARG A HH22   5  
ATOM 9071  N N      . LYS A 1 60 ? 41.597 30.599 21.607 1.00 0.00 ? 58 LYS A N      5  
ATOM 9072  C CA     . LYS A 1 60 ? 41.840 29.147 21.678 1.00 0.00 ? 58 LYS A CA     5  
ATOM 9073  C C      . LYS A 1 60 ? 41.787 28.473 20.302 1.00 0.00 ? 58 LYS A C      5  
ATOM 9074  O O      . LYS A 1 60 ? 42.440 27.447 20.104 1.00 0.00 ? 58 LYS A O      5  
ATOM 9075  C CB     . LYS A 1 60 ? 40.853 28.513 22.677 1.00 0.00 ? 58 LYS A CB     5  
ATOM 9076  C CG     . LYS A 1 60 ? 41.137 29.018 24.102 1.00 0.00 ? 58 LYS A CG     5  
ATOM 9077  C CD     . LYS A 1 60 ? 40.147 28.489 25.145 1.00 0.00 ? 58 LYS A CD     5  
ATOM 9078  C CE     . LYS A 1 60 ? 40.291 29.198 26.500 1.00 0.00 ? 58 LYS A CE     5  
ATOM 9079  N NZ     . LYS A 1 60 ? 41.649 29.110 27.082 1.00 0.00 1 58 LYS A NZ     5  
ATOM 9080  H H      . LYS A 1 60 ? 40.759 30.968 22.044 1.00 0.00 ? 58 LYS A H      5  
ATOM 9081  H HA     . LYS A 1 60 ? 42.852 28.977 22.049 1.00 0.00 ? 58 LYS A HA     5  
ATOM 9082  H HB2    . LYS A 1 60 ? 39.828 28.758 22.391 1.00 0.00 ? 58 LYS A HB2    5  
ATOM 9083  H HB3    . LYS A 1 60 ? 40.969 27.427 22.660 1.00 0.00 ? 58 LYS A HB3    5  
ATOM 9084  H HG2    . LYS A 1 60 ? 42.142 28.696 24.378 1.00 0.00 ? 58 LYS A HG2    5  
ATOM 9085  H HG3    . LYS A 1 60 ? 41.099 30.108 24.121 1.00 0.00 ? 58 LYS A HG3    5  
ATOM 9086  H HD2    . LYS A 1 60 ? 39.128 28.645 24.785 1.00 0.00 ? 58 LYS A HD2    5  
ATOM 9087  H HD3    . LYS A 1 60 ? 40.299 27.422 25.279 1.00 0.00 ? 58 LYS A HD3    5  
ATOM 9088  H HE2    . LYS A 1 60 ? 40.018 30.250 26.383 1.00 0.00 ? 58 LYS A HE2    5  
ATOM 9089  H HE3    . LYS A 1 60 ? 39.581 28.752 27.197 1.00 0.00 ? 58 LYS A HE3    5  
ATOM 9090  H HZ1    . LYS A 1 60 ? 42.339 29.582 26.501 1.00 0.00 ? 58 LYS A HZ1    5  
ATOM 9091  H HZ2    . LYS A 1 60 ? 41.661 29.570 27.992 1.00 0.00 ? 58 LYS A HZ2    5  
ATOM 9092  H HZ3    . LYS A 1 60 ? 41.953 28.153 27.236 1.00 0.00 ? 58 LYS A HZ3    5  
ATOM 9093  N N      . ARG A 1 61 ? 41.076 29.068 19.335 1.00 0.00 ? 59 ARG A N      5  
ATOM 9094  C CA     . ARG A 1 61 ? 40.967 28.603 17.942 1.00 0.00 ? 59 ARG A CA     5  
ATOM 9095  C C      . ARG A 1 61 ? 42.036 29.182 17.001 1.00 0.00 ? 59 ARG A C      5  
ATOM 9096  O O      . ARG A 1 61 ? 42.630 28.425 16.234 1.00 0.00 ? 59 ARG A O      5  
ATOM 9097  C CB     . ARG A 1 61 ? 39.528 28.893 17.470 1.00 0.00 ? 59 ARG A CB     5  
ATOM 9098  C CG     . ARG A 1 61 ? 39.131 28.256 16.129 1.00 0.00 ? 59 ARG A CG     5  
ATOM 9099  C CD     . ARG A 1 61 ? 38.612 26.809 16.216 1.00 0.00 ? 59 ARG A CD     5  
ATOM 9100  N NE     . ARG A 1 61 ? 39.623 25.837 16.672 1.00 0.00 ? 59 ARG A NE     5  
ATOM 9101  C CZ     . ARG A 1 61 ? 40.627 25.330 15.983 1.00 0.00 ? 59 ARG A CZ     5  
ATOM 9102  N NH1    . ARG A 1 61 ? 40.918 25.705 14.772 1.00 0.00 ? 59 ARG A NH1    5  
ATOM 9103  N NH2    . ARG A 1 61 ? 41.380 24.435 16.536 1.00 0.00 1 59 ARG A NH2    5  
ATOM 9104  H H      . ARG A 1 61 ? 40.472 29.828 19.627 1.00 0.00 ? 59 ARG A H      5  
ATOM 9105  H HA     . ARG A 1 61 ? 41.117 27.525 17.926 1.00 0.00 ? 59 ARG A HA     5  
ATOM 9106  H HB2    . ARG A 1 61 ? 38.822 28.551 18.231 1.00 0.00 ? 59 ARG A HB2    5  
ATOM 9107  H HB3    . ARG A 1 61 ? 39.409 29.974 17.382 1.00 0.00 ? 59 ARG A HB3    5  
ATOM 9108  H HG2    . ARG A 1 61 ? 38.324 28.859 15.714 1.00 0.00 ? 59 ARG A HG2    5  
ATOM 9109  H HG3    . ARG A 1 61 ? 39.966 28.308 15.434 1.00 0.00 ? 59 ARG A HG3    5  
ATOM 9110  H HD2    . ARG A 1 61 ? 37.763 26.784 16.902 1.00 0.00 ? 59 ARG A HD2    5  
ATOM 9111  H HD3    . ARG A 1 61 ? 38.244 26.507 15.233 1.00 0.00 ? 59 ARG A HD3    5  
ATOM 9112  H HE     . ARG A 1 61 ? 39.599 25.556 17.648 1.00 0.00 ? 59 ARG A HE     5  
ATOM 9113  H HH11   . ARG A 1 61 ? 40.348 26.395 14.302 1.00 0.00 ? 59 ARG A HH11   5  
ATOM 9114  H HH12   . ARG A 1 61 ? 41.690 25.281 14.275 1.00 0.00 ? 59 ARG A HH12   5  
ATOM 9115  H HH21   . ARG A 1 61 ? 41.074 24.006 17.407 1.00 0.00 ? 59 ARG A HH21   5  
ATOM 9116  H HH22   . ARG A 1 61 ? 42.272 24.183 16.130 1.00 0.00 ? 59 ARG A HH22   5  
ATOM 9117  N N      . GLU A 1 62 ? 42.285 30.495 17.042 1.00 0.00 ? 60 GLU A N      5  
ATOM 9118  C CA     . GLU A 1 62 ? 43.041 31.244 16.013 1.00 0.00 ? 60 GLU A CA     5  
ATOM 9119  C C      . GLU A 1 62 ? 44.095 32.233 16.569 1.00 0.00 ? 60 GLU A C      5  
ATOM 9120  O O      . GLU A 1 62 ? 44.621 33.054 15.814 1.00 0.00 ? 60 GLU A O      5  
ATOM 9121  C CB     . GLU A 1 62 ? 42.066 32.051 15.130 1.00 0.00 ? 60 GLU A CB     5  
ATOM 9122  C CG     . GLU A 1 62 ? 40.916 31.301 14.442 1.00 0.00 ? 60 GLU A CG     5  
ATOM 9123  C CD     . GLU A 1 62 ? 41.302 30.508 13.187 1.00 0.00 ? 60 GLU A CD     5  
ATOM 9124  O OE1    . GLU A 1 62 ? 42.494 30.183 12.958 1.00 0.00 ? 60 GLU A OE1    5  
ATOM 9125  O OE2    . GLU A 1 62 ? 40.370 30.166 12.420 1.00 0.00 ? 60 GLU A OE2    5  
ATOM 9126  H H      . GLU A 1 62 ? 41.729 31.049 17.688 1.00 0.00 ? 60 GLU A H      5  
ATOM 9127  H HA     . GLU A 1 62 ? 43.581 30.544 15.374 1.00 0.00 ? 60 GLU A HA     5  
ATOM 9128  H HB2    . GLU A 1 62 ? 41.621 32.825 15.758 1.00 0.00 ? 60 GLU A HB2    5  
ATOM 9129  H HB3    . GLU A 1 62 ? 42.640 32.551 14.354 1.00 0.00 ? 60 GLU A HB3    5  
ATOM 9130  H HG2    . GLU A 1 62 ? 40.414 30.649 15.154 1.00 0.00 ? 60 GLU A HG2    5  
ATOM 9131  H HG3    . GLU A 1 62 ? 40.189 32.054 14.137 1.00 0.00 ? 60 GLU A HG3    5  
ATOM 9132  N N      . GLU A 1 63 ? 44.384 32.217 17.874 1.00 0.00 ? 61 GLU A N      5  
ATOM 9133  C CA     . GLU A 1 63 ? 45.118 33.250 18.642 1.00 0.00 ? 61 GLU A CA     5  
ATOM 9134  C C      . GLU A 1 63 ? 44.436 34.631 18.685 1.00 0.00 ? 61 GLU A C      5  
ATOM 9135  O O      . GLU A 1 63 ? 44.178 35.143 19.772 1.00 0.00 ? 61 GLU A O      5  
ATOM 9136  C CB     . GLU A 1 63 ? 46.600 33.337 18.220 1.00 0.00 ? 61 GLU A CB     5  
ATOM 9137  C CG     . GLU A 1 63 ? 47.370 34.366 19.060 1.00 0.00 ? 61 GLU A CG     5  
ATOM 9138  C CD     . GLU A 1 63 ? 48.883 34.299 18.833 1.00 0.00 ? 61 GLU A CD     5  
ATOM 9139  O OE1    . GLU A 1 63 ? 49.367 34.658 17.731 1.00 0.00 ? 61 GLU A OE1    5  
ATOM 9140  O OE2    . GLU A 1 63 ? 49.604 33.917 19.786 1.00 0.00 ? 61 GLU A OE2    5  
ATOM 9141  H H      . GLU A 1 63 ? 43.920 31.510 18.432 1.00 0.00 ? 61 GLU A H      5  
ATOM 9142  H HA     . GLU A 1 63 ? 45.130 32.916 19.682 1.00 0.00 ? 61 GLU A HA     5  
ATOM 9143  H HB2    . GLU A 1 63 ? 47.056 32.354 18.343 1.00 0.00 ? 61 GLU A HB2    5  
ATOM 9144  H HB3    . GLU A 1 63 ? 46.680 33.621 17.173 1.00 0.00 ? 61 GLU A HB3    5  
ATOM 9145  H HG2    . GLU A 1 63 ? 47.023 35.372 18.811 1.00 0.00 ? 61 GLU A HG2    5  
ATOM 9146  H HG3    . GLU A 1 63 ? 47.158 34.187 20.117 1.00 0.00 ? 61 GLU A HG3    5  
ATOM 9147  N N      . PHE A 1 64 ? 44.130 35.229 17.531 1.00 0.00 ? 62 PHE A N      5  
ATOM 9148  C CA     . PHE A 1 64 ? 43.607 36.597 17.435 1.00 0.00 ? 62 PHE A CA     5  
ATOM 9149  C C      . PHE A 1 64 ? 42.455 36.781 16.433 1.00 0.00 ? 62 PHE A C      5  
ATOM 9150  O O      . PHE A 1 64 ? 41.712 37.752 16.563 1.00 0.00 ? 62 PHE A O      5  
ATOM 9151  C CB     . PHE A 1 64 ? 44.766 37.555 17.101 1.00 0.00 ? 62 PHE A CB     5  
ATOM 9152  C CG     . PHE A 1 64 ? 45.300 37.447 15.681 1.00 0.00 ? 62 PHE A CG     5  
ATOM 9153  C CD1    . PHE A 1 64 ? 46.260 36.471 15.351 1.00 0.00 ? 62 PHE A CD1    5  
ATOM 9154  C CD2    . PHE A 1 64 ? 44.829 38.320 14.680 1.00 0.00 ? 62 PHE A CD2    5  
ATOM 9155  C CE1    . PHE A 1 64 ? 46.733 36.361 14.031 1.00 0.00 ? 62 PHE A CE1    5  
ATOM 9156  C CE2    . PHE A 1 64 ? 45.313 38.220 13.363 1.00 0.00 ? 62 PHE A CE2    5  
ATOM 9157  C CZ     . PHE A 1 64 ? 46.269 37.241 13.038 1.00 0.00 ? 62 PHE A CZ     5  
ATOM 9158  H H      . PHE A 1 64 ? 44.387 34.738 16.682 1.00 0.00 ? 62 PHE A H      5  
ATOM 9159  H HA     . PHE A 1 64 ? 43.214 36.894 18.408 1.00 0.00 ? 62 PHE A HA     5  
ATOM 9160  H HB2    . PHE A 1 64 ? 44.420 38.577 17.264 1.00 0.00 ? 62 PHE A HB2    5  
ATOM 9161  H HB3    . PHE A 1 64 ? 45.583 37.384 17.804 1.00 0.00 ? 62 PHE A HB3    5  
ATOM 9162  H HD1    . PHE A 1 64 ? 46.637 35.802 16.111 1.00 0.00 ? 62 PHE A HD1    5  
ATOM 9163  H HD2    . PHE A 1 64 ? 44.089 39.071 14.920 1.00 0.00 ? 62 PHE A HD2    5  
ATOM 9164  H HE1    . PHE A 1 64 ? 47.459 35.600 13.783 1.00 0.00 ? 62 PHE A HE1    5  
ATOM 9165  H HE2    . PHE A 1 64 ? 44.946 38.893 12.599 1.00 0.00 ? 62 PHE A HE2    5  
ATOM 9166  H HZ     . PHE A 1 64 ? 46.643 37.163 12.026 1.00 0.00 ? 62 PHE A HZ     5  
ATOM 9167  N N      . ILE A 1 65 ? 42.296 35.896 15.441 1.00 0.00 ? 63 ILE A N      5  
ATOM 9168  C CA     . ILE A 1 65 ? 41.391 36.125 14.298 1.00 0.00 ? 63 ILE A CA     5  
ATOM 9169  C C      . ILE A 1 65 ? 39.922 36.013 14.735 1.00 0.00 ? 63 ILE A C      5  
ATOM 9170  O O      . ILE A 1 65 ? 39.468 34.948 15.158 1.00 0.00 ? 63 ILE A O      5  
ATOM 9171  C CB     . ILE A 1 65 ? 41.699 35.174 13.114 1.00 0.00 ? 63 ILE A CB     5  
ATOM 9172  C CG1    . ILE A 1 65 ? 43.200 35.192 12.732 1.00 0.00 ? 63 ILE A CG1    5  
ATOM 9173  C CG2    . ILE A 1 65 ? 40.832 35.545 11.893 1.00 0.00 ? 63 ILE A CG2    5  
ATOM 9174  C CD1    . ILE A 1 65 ? 43.605 34.110 11.723 1.00 0.00 ? 63 ILE A CD1    5  
ATOM 9175  H H      . ILE A 1 65 ? 42.912 35.099 15.403 1.00 0.00 ? 63 ILE A H      5  
ATOM 9176  H HA     . ILE A 1 65 ? 41.558 37.143 13.943 1.00 0.00 ? 63 ILE A HA     5  
ATOM 9177  H HB     . ILE A 1 65 ? 41.429 34.162 13.410 1.00 0.00 ? 63 ILE A HB     5  
ATOM 9178  H HG12   . ILE A 1 65 ? 43.455 36.171 12.325 1.00 0.00 ? 63 ILE A HG12   5  
ATOM 9179  H HG13   . ILE A 1 65 ? 43.812 35.027 13.617 1.00 0.00 ? 63 ILE A HG13   5  
ATOM 9180  H HG21   . ILE A 1 65 ? 41.086 36.546 11.541 1.00 0.00 ? 63 ILE A HG21   5  
ATOM 9181  H HG22   . ILE A 1 65 ? 40.986 34.833 11.084 1.00 0.00 ? 63 ILE A HG22   5  
ATOM 9182  H HG23   . ILE A 1 65 ? 39.773 35.513 12.148 1.00 0.00 ? 63 ILE A HG23   5  
ATOM 9183  H HD11   . ILE A 1 65 ? 44.683 34.153 11.578 1.00 0.00 ? 63 ILE A HD11   5  
ATOM 9184  H HD12   . ILE A 1 65 ? 43.338 33.124 12.103 1.00 0.00 ? 63 ILE A HD12   5  
ATOM 9185  H HD13   . ILE A 1 65 ? 43.118 34.270 10.763 1.00 0.00 ? 63 ILE A HD13   5  
ATOM 9186  N N      . VAL A 1 66 ? 39.173 37.107 14.586 1.00 0.00 ? 64 VAL A N      5  
ATOM 9187  C CA     . VAL A 1 66 ? 37.736 37.207 14.890 1.00 0.00 ? 64 VAL A CA     5  
ATOM 9188  C C      . VAL A 1 66 ? 37.077 38.340 14.096 1.00 0.00 ? 64 VAL A C      5  
ATOM 9189  O O      . VAL A 1 66 ? 37.710 39.364 13.820 1.00 0.00 ? 64 VAL A O      5  
ATOM 9190  C CB     . VAL A 1 66 ? 37.522 37.390 16.409 1.00 0.00 ? 64 VAL A CB     5  
ATOM 9191  C CG1    . VAL A 1 66 ? 37.988 38.748 16.951 1.00 0.00 ? 64 VAL A CG1    5  
ATOM 9192  C CG2    . VAL A 1 66 ? 36.062 37.169 16.815 1.00 0.00 ? 64 VAL A CG2    5  
ATOM 9193  H H      . VAL A 1 66 ? 39.626 37.931 14.208 1.00 0.00 ? 64 VAL A H      5  
ATOM 9194  H HA     . VAL A 1 66 ? 37.261 36.272 14.596 1.00 0.00 ? 64 VAL A HA     5  
ATOM 9195  H HB     . VAL A 1 66 ? 38.104 36.621 16.909 1.00 0.00 ? 64 VAL A HB     5  
ATOM 9196  H HG11   . VAL A 1 66 ? 37.887 38.762 18.036 1.00 0.00 ? 64 VAL A HG11   5  
ATOM 9197  H HG12   . VAL A 1 66 ? 39.037 38.909 16.703 1.00 0.00 ? 64 VAL A HG12   5  
ATOM 9198  H HG13   . VAL A 1 66 ? 37.387 39.559 16.542 1.00 0.00 ? 64 VAL A HG13   5  
ATOM 9199  H HG21   . VAL A 1 66 ? 35.430 37.981 16.456 1.00 0.00 ? 64 VAL A HG21   5  
ATOM 9200  H HG22   . VAL A 1 66 ? 35.703 36.219 16.418 1.00 0.00 ? 64 VAL A HG22   5  
ATOM 9201  H HG23   . VAL A 1 66 ? 35.998 37.131 17.901 1.00 0.00 ? 64 VAL A HG23   5  
ATOM 9202  N N      . THR A 1 67 ? 35.802 38.186 13.745 1.00 0.00 ? 65 THR A N      5  
ATOM 9203  C CA     . THR A 1 67 ? 34.952 39.249 13.176 1.00 0.00 ? 65 THR A CA     5  
ATOM 9204  C C      . THR A 1 67 ? 33.616 39.349 13.916 1.00 0.00 ? 65 THR A C      5  
ATOM 9205  O O      . THR A 1 67 ? 33.109 38.362 14.459 1.00 0.00 ? 65 THR A O      5  
ATOM 9206  C CB     . THR A 1 67 ? 34.735 39.096 11.655 1.00 0.00 ? 65 THR A CB     5  
ATOM 9207  O OG1    . THR A 1 67 ? 34.793 37.748 11.232 1.00 0.00 ? 65 THR A OG1    5  
ATOM 9208  C CG2    . THR A 1 67 ? 35.813 39.833 10.864 1.00 0.00 ? 65 THR A CG2    5  
ATOM 9209  H H      . THR A 1 67 ? 35.355 37.299 13.933 1.00 0.00 ? 65 THR A H      5  
ATOM 9210  H HA     . THR A 1 67 ? 35.444 40.210 13.334 1.00 0.00 ? 65 THR A HA     5  
ATOM 9211  H HB     . THR A 1 67 ? 33.766 39.513 11.383 1.00 0.00 ? 65 THR A HB     5  
ATOM 9212  H HG1    . THR A 1 67 ? 34.263 37.687 10.411 1.00 0.00 ? 65 THR A HG1    5  
ATOM 9213  H HG21   . THR A 1 67 ? 36.801 39.458 11.132 1.00 0.00 ? 65 THR A HG21   5  
ATOM 9214  H HG22   . THR A 1 67 ? 35.650 39.694 9.796  1.00 0.00 ? 65 THR A HG22   5  
ATOM 9215  H HG23   . THR A 1 67 ? 35.766 40.901 11.086 1.00 0.00 ? 65 THR A HG23   5  
ATOM 9216  N N      . ASP A 1 68 ? 33.068 40.565 13.952 1.00 0.00 ? 66 ASP A N      5  
ATOM 9217  C CA     . ASP A 1 68 ? 31.864 40.995 14.689 1.00 0.00 ? 66 ASP A CA     5  
ATOM 9218  C C      . ASP A 1 68 ? 30.969 41.945 13.882 1.00 0.00 ? 66 ASP A C      5  
ATOM 9219  O O      . ASP A 1 68 ? 29.794 42.133 14.272 1.00 0.00 ? 66 ASP A O      5  
ATOM 9220  C CB     . ASP A 1 68 ? 32.286 41.656 16.021 1.00 0.00 ? 66 ASP A CB     5  
ATOM 9221  C CG     . ASP A 1 68 ? 32.765 43.116 15.926 1.00 0.00 ? 66 ASP A CG     5  
ATOM 9222  O OD1    . ASP A 1 68 ? 33.786 43.413 15.265 1.00 0.00 ? 66 ASP A OD1    5  
ATOM 9223  O OD2    . ASP A 1 68 ? 32.178 44.012 16.578 1.00 0.00 ? 66 ASP A OD2    5  
ATOM 9224  O OXT    . ASP A 1 68 ? 31.450 42.505 12.870 1.00 0.00 ? 66 ASP A OXT    5  
ATOM 9225  H H      . ASP A 1 68 ? 33.547 41.296 13.440 1.00 0.00 ? 66 ASP A H      5  
ATOM 9226  H HA     . ASP A 1 68 ? 31.263 40.117 14.924 1.00 0.00 ? 66 ASP A HA     5  
ATOM 9227  H HB2    . ASP A 1 68 ? 31.420 41.637 16.677 1.00 0.00 ? 66 ASP A HB2    5  
ATOM 9228  H HB3    . ASP A 1 68 ? 33.063 41.050 16.491 1.00 0.00 ? 66 ASP A HB3    5  
ATOM 9229  O "O5'"  . DG  B 2 1  ? 52.982 10.672 23.797 1.00 0.00 ? 67 DG  B "O5'"  5  
ATOM 9230  C "C5'"  . DG  B 2 1  ? 52.883 10.581 22.382 1.00 0.00 ? 67 DG  B "C5'"  5  
ATOM 9231  C "C4'"  . DG  B 2 1  ? 51.732 11.412 21.798 1.00 0.00 ? 67 DG  B "C4'"  5  
ATOM 9232  O "O4'"  . DG  B 2 1  ? 50.486 10.928 22.295 1.00 0.00 ? 67 DG  B "O4'"  5  
ATOM 9233  C "C3'"  . DG  B 2 1  ? 51.833 12.907 22.141 1.00 0.00 ? 67 DG  B "C3'"  5  
ATOM 9234  O "O3'"  . DG  B 2 1  ? 51.635 13.656 20.947 1.00 0.00 ? 67 DG  B "O3'"  5  
ATOM 9235  C "C2'"  . DG  B 2 1  ? 50.715 13.079 23.170 1.00 0.00 ? 67 DG  B "C2'"  5  
ATOM 9236  C "C1'"  . DG  B 2 1  ? 49.704 12.035 22.702 1.00 0.00 ? 67 DG  B "C1'"  5  
ATOM 9237  N N9     . DG  B 2 1  ? 48.726 11.608 23.732 1.00 0.00 ? 67 DG  B N9     5  
ATOM 9238  C C8     . DG  B 2 1  ? 48.915 11.338 25.070 1.00 0.00 ? 67 DG  B C8     5  
ATOM 9239  N N7     . DG  B 2 1  ? 47.845 10.906 25.685 1.00 0.00 ? 67 DG  B N7     5  
ATOM 9240  C C5     . DG  B 2 1  ? 46.862 10.919 24.687 1.00 0.00 ? 67 DG  B C5     5  
ATOM 9241  C C6     . DG  B 2 1  ? 45.473 10.546 24.714 1.00 0.00 ? 67 DG  B C6     5  
ATOM 9242  O O6     . DG  B 2 1  ? 44.827 10.033 25.630 1.00 0.00 ? 67 DG  B O6     5  
ATOM 9243  N N1     . DG  B 2 1  ? 44.816 10.798 23.526 1.00 0.00 ? 67 DG  B N1     5  
ATOM 9244  C C2     . DG  B 2 1  ? 45.425 11.279 22.413 1.00 0.00 ? 67 DG  B C2     5  
ATOM 9245  N N2     . DG  B 2 1  ? 44.686 11.499 21.360 1.00 0.00 ? 67 DG  B N2     5  
ATOM 9246  N N3     . DG  B 2 1  ? 46.727 11.532 22.309 1.00 0.00 ? 67 DG  B N3     5  
ATOM 9247  C C4     . DG  B 2 1  ? 47.391 11.365 23.496 1.00 0.00 ? 67 DG  B C4     5  
ATOM 9248  H "H5'"  . DG  B 2 1  ? 52.727 9.538  22.099 1.00 0.00 ? 67 DG  B "H5'"  5  
ATOM 9249  H "H5''" . DG  B 2 1  ? 53.822 10.914 21.934 1.00 0.00 ? 67 DG  B "H5''" 5  
ATOM 9250  H "H4'"  . DG  B 2 1  ? 51.749 11.301 20.713 1.00 0.00 ? 67 DG  B "H4'"  5  
ATOM 9251  H "H3'"  . DG  B 2 1  ? 52.807 13.140 22.576 1.00 0.00 ? 67 DG  B "H3'"  5  
ATOM 9252  H "H2'"  . DG  B 2 1  ? 51.096 12.837 24.162 1.00 0.00 ? 67 DG  B "H2'"  5  
ATOM 9253  H "H2''" . DG  B 2 1  ? 50.289 14.080 23.164 1.00 0.00 ? 67 DG  B "H2''" 5  
ATOM 9254  H "H1'"  . DG  B 2 1  ? 49.167 12.436 21.837 1.00 0.00 ? 67 DG  B "H1'"  5  
ATOM 9255  H H8     . DG  B 2 1  ? 49.874 11.450 25.563 1.00 0.00 ? 67 DG  B H8     5  
ATOM 9256  H H1     . DG  B 2 1  ? 43.826 10.606 23.507 1.00 0.00 ? 67 DG  B H1     5  
ATOM 9257  H H21    . DG  B 2 1  ? 45.143 11.866 20.533 1.00 0.00 ? 67 DG  B H21    5  
ATOM 9258  H H22    . DG  B 2 1  ? 43.683 11.356 21.401 1.00 0.00 ? 67 DG  B H22    5  
ATOM 9259  H "HO5'" . DG  B 2 1  ? 53.335 9.810  24.110 1.00 0.00 ? 67 DG  B "HO5'" 5  
ATOM 9260  P P      . DC  B 2 2  ? 51.729 15.251 20.883 1.00 0.00 ? 68 DC  B P      5  
ATOM 9261  O OP1    . DC  B 2 2  ? 52.525 15.618 19.687 1.00 0.00 ? 68 DC  B OP1    5  
ATOM 9262  O OP2    . DC  B 2 2  ? 52.131 15.795 22.201 1.00 0.00 ? 68 DC  B OP2    5  
ATOM 9263  O "O5'"  . DC  B 2 2  ? 50.207 15.653 20.614 1.00 0.00 ? 68 DC  B "O5'"  5  
ATOM 9264  C "C5'"  . DC  B 2 2  ? 49.584 15.364 19.364 1.00 0.00 ? 68 DC  B "C5'"  5  
ATOM 9265  C "C4'"  . DC  B 2 2  ? 48.181 15.969 19.218 1.00 0.00 ? 68 DC  B "C4'"  5  
ATOM 9266  O "O4'"  . DC  B 2 2  ? 47.249 15.195 19.967 1.00 0.00 ? 68 DC  B "O4'"  5  
ATOM 9267  C "C3'"  . DC  B 2 2  ? 48.114 17.439 19.670 1.00 0.00 ? 68 DC  B "C3'"  5  
ATOM 9268  O "O3'"  . DC  B 2 2  ? 47.454 18.273 18.717 1.00 0.00 ? 68 DC  B "O3'"  5  
ATOM 9269  C "C2'"  . DC  B 2 2  ? 47.362 17.327 20.993 1.00 0.00 ? 68 DC  B "C2'"  5  
ATOM 9270  C "C1'"  . DC  B 2 2  ? 46.534 16.046 20.844 1.00 0.00 ? 68 DC  B "C1'"  5  
ATOM 9271  N N1     . DC  B 2 2  ? 46.311 15.350 22.143 1.00 0.00 ? 68 DC  B N1     5  
ATOM 9272  C C2     . DC  B 2 2  ? 45.006 15.025 22.537 1.00 0.00 ? 68 DC  B C2     5  
ATOM 9273  O O2     . DC  B 2 2  ? 44.035 15.201 21.794 1.00 0.00 ? 68 DC  B O2     5  
ATOM 9274  N N3     . DC  B 2 2  ? 44.761 14.527 23.773 1.00 0.00 ? 68 DC  B N3     5  
ATOM 9275  C C4     . DC  B 2 2  ? 45.780 14.353 24.589 1.00 0.00 ? 68 DC  B C4     5  
ATOM 9276  N N4     . DC  B 2 2  ? 45.504 13.929 25.781 1.00 0.00 ? 68 DC  B N4     5  
ATOM 9277  C C5     . DC  B 2 2  ? 47.126 14.629 24.241 1.00 0.00 ? 68 DC  B C5     5  
ATOM 9278  C C6     . DC  B 2 2  ? 47.358 15.109 22.997 1.00 0.00 ? 68 DC  B C6     5  
ATOM 9279  H "H5'"  . DC  B 2 2  ? 49.517 14.283 19.232 1.00 0.00 ? 68 DC  B "H5'"  5  
ATOM 9280  H "H5''" . DC  B 2 2  ? 50.193 15.762 18.557 1.00 0.00 ? 68 DC  B "H5''" 5  
ATOM 9281  H "H4'"  . DC  B 2 2  ? 47.906 15.915 18.166 1.00 0.00 ? 68 DC  B "H4'"  5  
ATOM 9282  H "H3'"  . DC  B 2 2  ? 49.119 17.826 19.849 1.00 0.00 ? 68 DC  B "H3'"  5  
ATOM 9283  H "H2'"  . DC  B 2 2  ? 48.097 17.262 21.793 1.00 0.00 ? 68 DC  B "H2'"  5  
ATOM 9284  H "H2''" . DC  B 2 2  ? 46.715 18.176 21.186 1.00 0.00 ? 68 DC  B "H2''" 5  
ATOM 9285  H "H1'"  . DC  B 2 2  ? 45.578 16.316 20.381 1.00 0.00 ? 68 DC  B "H1'"  5  
ATOM 9286  H H41    . DC  B 2 2  ? 44.537 13.741 26.012 1.00 0.00 ? 68 DC  B H41    5  
ATOM 9287  H H42    . DC  B 2 2  ? 46.220 13.979 26.486 1.00 0.00 ? 68 DC  B H42    5  
ATOM 9288  H H5     . DC  B 2 2  ? 47.946 14.470 24.925 1.00 0.00 ? 68 DC  B H5     5  
ATOM 9289  H H6     . DC  B 2 2  ? 48.371 15.328 22.673 1.00 0.00 ? 68 DC  B H6     5  
ATOM 9290  P P      . DT  B 2 3  ? 47.215 19.842 18.991 1.00 0.00 ? 69 DT  B P      5  
ATOM 9291  O OP1    . DT  B 2 3  ? 47.203 20.585 17.713 1.00 0.00 ? 69 DT  B OP1    5  
ATOM 9292  O OP2    . DT  B 2 3  ? 48.133 20.289 20.060 1.00 0.00 ? 69 DT  B OP2    5  
ATOM 9293  O "O5'"  . DT  B 2 3  ? 45.733 19.898 19.591 1.00 0.00 ? 69 DT  B "O5'"  5  
ATOM 9294  C "C5'"  . DT  B 2 3  ? 44.629 19.381 18.850 1.00 0.00 ? 69 DT  B "C5'"  5  
ATOM 9295  C "C4'"  . DT  B 2 3  ? 43.399 19.140 19.734 1.00 0.00 ? 69 DT  B "C4'"  5  
ATOM 9296  O "O4'"  . DT  B 2 3  ? 43.739 18.323 20.844 1.00 0.00 ? 69 DT  B "O4'"  5  
ATOM 9297  C "C3'"  . DT  B 2 3  ? 42.794 20.420 20.314 1.00 0.00 ? 69 DT  B "C3'"  5  
ATOM 9298  O "O3'"  . DT  B 2 3  ? 41.680 20.803 19.526 1.00 0.00 ? 69 DT  B "O3'"  5  
ATOM 9299  C "C2'"  . DT  B 2 3  ? 42.391 20.019 21.733 1.00 0.00 ? 69 DT  B "C2'"  5  
ATOM 9300  C "C1'"  . DT  B 2 3  ? 42.769 18.541 21.849 1.00 0.00 ? 69 DT  B "C1'"  5  
ATOM 9301  N N1     . DT  B 2 3  ? 43.313 18.200 23.193 1.00 0.00 ? 69 DT  B N1     5  
ATOM 9302  C C2     . DT  B 2 3  ? 42.443 17.659 24.145 1.00 0.00 ? 69 DT  B C2     5  
ATOM 9303  O O2     . DT  B 2 3  ? 41.235 17.520 23.955 1.00 0.00 ? 69 DT  B O2     5  
ATOM 9304  N N3     . DT  B 2 3  ? 42.990 17.304 25.356 1.00 0.00 ? 69 DT  B N3     5  
ATOM 9305  C C4     . DT  B 2 3  ? 44.302 17.487 25.735 1.00 0.00 ? 69 DT  B C4     5  
ATOM 9306  O O4     . DT  B 2 3  ? 44.652 17.146 26.869 1.00 0.00 ? 69 DT  B O4     5  
ATOM 9307  C C5     . DT  B 2 3  ? 45.151 18.099 24.710 1.00 0.00 ? 69 DT  B C5     5  
ATOM 9308  C C7     . DT  B 2 3  ? 46.619 18.369 24.990 1.00 0.00 ? 69 DT  B C7     5  
ATOM 9309  C C6     . DT  B 2 3  ? 44.637 18.439 23.498 1.00 0.00 ? 69 DT  B C6     5  
ATOM 9310  H "H5'"  . DT  B 2 3  ? 44.901 18.423 18.401 1.00 0.00 ? 69 DT  B "H5'"  5  
ATOM 9311  H "H5''" . DT  B 2 3  ? 44.365 20.068 18.043 1.00 0.00 ? 69 DT  B "H5''" 5  
ATOM 9312  H "H4'"  . DT  B 2 3  ? 42.632 18.637 19.142 1.00 0.00 ? 69 DT  B "H4'"  5  
ATOM 9313  H "H3'"  . DT  B 2 3  ? 43.543 21.211 20.341 1.00 0.00 ? 69 DT  B "H3'"  5  
ATOM 9314  H "H2'"  . DT  B 2 3  ? 42.946 20.623 22.451 1.00 0.00 ? 69 DT  B "H2'"  5  
ATOM 9315  H "H2''" . DT  B 2 3  ? 41.320 20.134 21.887 1.00 0.00 ? 69 DT  B "H2''" 5  
ATOM 9316  H "H1'"  . DT  B 2 3  ? 41.887 17.930 21.631 1.00 0.00 ? 69 DT  B "H1'"  5  
ATOM 9317  H H3     . DT  B 2 3  ? 42.355 16.937 26.050 1.00 0.00 ? 69 DT  B H3     5  
ATOM 9318  H H71    . DT  B 2 3  ? 47.127 17.427 25.197 1.00 0.00 ? 69 DT  B H71    5  
ATOM 9319  H H72    . DT  B 2 3  ? 47.104 18.854 24.142 1.00 0.00 ? 69 DT  B H72    5  
ATOM 9320  H H73    . DT  B 2 3  ? 46.706 19.013 25.866 1.00 0.00 ? 69 DT  B H73    5  
ATOM 9321  H H6     . DT  B 2 3  ? 45.270 18.896 22.749 1.00 0.00 ? 69 DT  B H6     5  
ATOM 9322  P P      . DC  B 2 4  ? 40.975 22.226 19.646 1.00 0.00 ? 70 DC  B P      5  
ATOM 9323  O OP1    . DC  B 2 4  ? 40.370 22.521 18.330 1.00 0.00 ? 70 DC  B OP1    5  
ATOM 9324  O OP2    . DC  B 2 4  ? 41.948 23.202 20.183 1.00 0.00 ? 70 DC  B OP2    5  
ATOM 9325  O "O5'"  . DC  B 2 4  ? 39.808 22.066 20.741 1.00 0.00 ? 70 DC  B "O5'"  5  
ATOM 9326  C "C5'"  . DC  B 2 4  ? 38.640 21.296 20.458 1.00 0.00 ? 70 DC  B "C5'"  5  
ATOM 9327  C "C4'"  . DC  B 2 4  ? 37.824 20.875 21.695 1.00 0.00 ? 70 DC  B "C4'"  5  
ATOM 9328  O "O4'"  . DC  B 2 4  ? 38.700 20.237 22.615 1.00 0.00 ? 70 DC  B "O4'"  5  
ATOM 9329  C "C3'"  . DC  B 2 4  ? 37.087 22.007 22.439 1.00 0.00 ? 70 DC  B "C3'"  5  
ATOM 9330  O "O3'"  . DC  B 2 4  ? 35.703 21.668 22.563 1.00 0.00 ? 70 DC  B "O3'"  5  
ATOM 9331  C "C2'"  . DC  B 2 4  ? 37.754 22.031 23.815 1.00 0.00 ? 70 DC  B "C2'"  5  
ATOM 9332  C "C1'"  . DC  B 2 4  ? 38.363 20.632 23.929 1.00 0.00 ? 70 DC  B "C1'"  5  
ATOM 9333  N N1     . DC  B 2 4  ? 39.584 20.568 24.784 1.00 0.00 ? 70 DC  B N1     5  
ATOM 9334  C C2     . DC  B 2 4  ? 39.562 19.784 25.940 1.00 0.00 ? 70 DC  B C2     5  
ATOM 9335  O O2     . DC  B 2 4  ? 38.550 19.179 26.280 1.00 0.00 ? 70 DC  B O2     5  
ATOM 9336  N N3     . DC  B 2 4  ? 40.650 19.683 26.739 1.00 0.00 ? 70 DC  B N3     5  
ATOM 9337  C C4     . DC  B 2 4  ? 41.747 20.315 26.390 1.00 0.00 ? 70 DC  B C4     5  
ATOM 9338  N N4     . DC  B 2 4  ? 42.763 20.151 27.185 1.00 0.00 ? 70 DC  B N4     5  
ATOM 9339  C C5     . DC  B 2 4  ? 41.847 21.114 25.217 1.00 0.00 ? 70 DC  B C5     5  
ATOM 9340  C C6     . DC  B 2 4  ? 40.737 21.232 24.440 1.00 0.00 ? 70 DC  B C6     5  
ATOM 9341  H "H5'"  . DC  B 2 4  ? 38.942 20.381 19.945 1.00 0.00 ? 70 DC  B "H5'"  5  
ATOM 9342  H "H5''" . DC  B 2 4  ? 37.992 21.857 19.786 1.00 0.00 ? 70 DC  B "H5''" 5  
ATOM 9343  H "H4'"  . DC  B 2 4  ? 37.075 20.151 21.368 1.00 0.00 ? 70 DC  B "H4'"  5  
ATOM 9344  H "H3'"  . DC  B 2 4  ? 37.224 22.960 21.923 1.00 0.00 ? 70 DC  B "H3'"  5  
ATOM 9345  H "H2'"  . DC  B 2 4  ? 38.524 22.796 23.843 1.00 0.00 ? 70 DC  B "H2'"  5  
ATOM 9346  H "H2''" . DC  B 2 4  ? 37.029 22.207 24.610 1.00 0.00 ? 70 DC  B "H2''" 5  
ATOM 9347  H "H1'"  . DC  B 2 4  ? 37.587 19.958 24.308 1.00 0.00 ? 70 DC  B "H1'"  5  
ATOM 9348  H H41    . DC  B 2 4  ? 43.648 20.606 26.977 1.00 0.00 ? 70 DC  B H41    5  
ATOM 9349  H H42    . DC  B 2 4  ? 42.640 19.618 28.033 1.00 0.00 ? 70 DC  B H42    5  
ATOM 9350  H H5     . DC  B 2 4  ? 42.758 21.627 24.952 1.00 0.00 ? 70 DC  B H5     5  
ATOM 9351  H H6     . DC  B 2 4  ? 40.746 21.834 23.537 1.00 0.00 ? 70 DC  B H6     5  
ATOM 9352  P P      . DT  B 2 5  ? 34.543 22.765 22.659 1.00 0.00 ? 71 DT  B P      5  
ATOM 9353  O OP1    . DT  B 2 5  ? 33.242 22.050 22.655 1.00 0.00 ? 71 DT  B OP1    5  
ATOM 9354  O OP2    . DT  B 2 5  ? 34.781 23.748 21.583 1.00 0.00 ? 71 DT  B OP2    5  
ATOM 9355  O "O5'"  . DT  B 2 5  ? 34.673 23.514 24.062 1.00 0.00 ? 71 DT  B "O5'"  5  
ATOM 9356  C "C5'"  . DT  B 2 5  ? 33.877 23.109 25.170 1.00 0.00 ? 71 DT  B "C5'"  5  
ATOM 9357  C "C4'"  . DT  B 2 5  ? 34.226 23.811 26.485 1.00 0.00 ? 71 DT  B "C4'"  5  
ATOM 9358  O "O4'"  . DT  B 2 5  ? 35.522 23.400 26.882 1.00 0.00 ? 71 DT  B "O4'"  5  
ATOM 9359  C "C3'"  . DT  B 2 5  ? 34.253 25.346 26.395 1.00 0.00 ? 71 DT  B "C3'"  5  
ATOM 9360  O "O3'"  . DT  B 2 5  ? 33.680 25.950 27.546 1.00 0.00 ? 71 DT  B "O3'"  5  
ATOM 9361  C "C2'"  . DT  B 2 5  ? 35.751 25.638 26.391 1.00 0.00 ? 71 DT  B "C2'"  5  
ATOM 9362  C "C1'"  . DT  B 2 5  ? 36.218 24.534 27.337 1.00 0.00 ? 71 DT  B "C1'"  5  
ATOM 9363  N N1     . DT  B 2 5  ? 37.667 24.205 27.415 1.00 0.00 ? 71 DT  B N1     5  
ATOM 9364  C C2     . DT  B 2 5  ? 38.054 23.406 28.501 1.00 0.00 ? 71 DT  B C2     5  
ATOM 9365  O O2     . DT  B 2 5  ? 37.260 22.934 29.314 1.00 0.00 ? 71 DT  B O2     5  
ATOM 9366  N N3     . DT  B 2 5  ? 39.390 23.119 28.617 1.00 0.00 ? 71 DT  B N3     5  
ATOM 9367  C C4     . DT  B 2 5  ? 40.373 23.502 27.738 1.00 0.00 ? 71 DT  B C4     5  
ATOM 9368  O O4     . DT  B 2 5  ? 41.532 23.157 27.964 1.00 0.00 ? 71 DT  B O4     5  
ATOM 9369  C C5     . DT  B 2 5  ? 39.903 24.288 26.597 1.00 0.00 ? 71 DT  B C5     5  
ATOM 9370  C C7     . DT  B 2 5  ? 40.882 24.727 25.525 1.00 0.00 ? 71 DT  B C7     5  
ATOM 9371  C C6     . DT  B 2 5  ? 38.590 24.620 26.472 1.00 0.00 ? 71 DT  B C6     5  
ATOM 9372  H "H5'"  . DT  B 2 5  ? 33.982 22.033 25.320 1.00 0.00 ? 71 DT  B "H5'"  5  
ATOM 9373  H "H5''" . DT  B 2 5  ? 32.835 23.324 24.937 1.00 0.00 ? 71 DT  B "H5''" 5  
ATOM 9374  H "H4'"  . DT  B 2 5  ? 33.507 23.509 27.247 1.00 0.00 ? 71 DT  B "H4'"  5  
ATOM 9375  H "H3'"  . DT  B 2 5  ? 33.789 25.714 25.484 1.00 0.00 ? 71 DT  B "H3'"  5  
ATOM 9376  H "H2'"  . DT  B 2 5  ? 36.144 25.500 25.384 1.00 0.00 ? 71 DT  B "H2'"  5  
ATOM 9377  H "H2''" . DT  B 2 5  ? 35.973 26.633 26.778 1.00 0.00 ? 71 DT  B "H2''" 5  
ATOM 9378  H "H1'"  . DT  B 2 5  ? 35.860 24.778 28.342 1.00 0.00 ? 71 DT  B "H1'"  5  
ATOM 9379  H H3     . DT  B 2 5  ? 39.685 22.639 29.456 1.00 0.00 ? 71 DT  B H3     5  
ATOM 9380  H H71    . DT  B 2 5  ? 40.367 25.210 24.696 1.00 0.00 ? 71 DT  B H71    5  
ATOM 9381  H H72    . DT  B 2 5  ? 41.610 25.414 25.948 1.00 0.00 ? 71 DT  B H72    5  
ATOM 9382  H H73    . DT  B 2 5  ? 41.420 23.861 25.145 1.00 0.00 ? 71 DT  B H73    5  
ATOM 9383  H H6     . DT  B 2 5  ? 38.270 25.195 25.612 1.00 0.00 ? 71 DT  B H6     5  
ATOM 9384  P P      . DA  B 2 6  ? 32.110 26.165 27.729 1.00 0.00 ? 72 DA  B P      5  
ATOM 9385  O OP1    . DA  B 2 6  ? 31.367 25.142 26.953 1.00 0.00 ? 72 DA  B OP1    5  
ATOM 9386  O OP2    . DA  B 2 6  ? 31.822 27.588 27.480 1.00 0.00 ? 72 DA  B OP2    5  
ATOM 9387  O "O5'"  . DA  B 2 6  ? 31.891 25.921 29.302 1.00 0.00 ? 72 DA  B "O5'"  5  
ATOM 9388  C "C5'"  . DA  B 2 6  ? 31.611 24.637 29.841 1.00 0.00 ? 72 DA  B "C5'"  5  
ATOM 9389  C "C4'"  . DA  B 2 6  ? 31.961 24.493 31.337 1.00 0.00 ? 72 DA  B "C4'"  5  
ATOM 9390  O "O4'"  . DA  B 2 6  ? 33.361 24.308 31.476 1.00 0.00 ? 72 DA  B "O4'"  5  
ATOM 9391  C "C3'"  . DA  B 2 6  ? 31.552 25.635 32.278 1.00 0.00 ? 72 DA  B "C3'"  5  
ATOM 9392  O "O3'"  . DA  B 2 6  ? 31.169 25.101 33.544 1.00 0.00 ? 72 DA  B "O3'"  5  
ATOM 9393  C "C2'"  . DA  B 2 6  ? 32.840 26.453 32.332 1.00 0.00 ? 72 DA  B "C2'"  5  
ATOM 9394  C "C1'"  . DA  B 2 6  ? 33.935 25.397 32.183 1.00 0.00 ? 72 DA  B "C1'"  5  
ATOM 9395  N N9     . DA  B 2 6  ? 35.106 25.881 31.419 1.00 0.00 ? 72 DA  B N9     5  
ATOM 9396  C C8     . DA  B 2 6  ? 35.126 26.565 30.227 1.00 0.00 ? 72 DA  B C8     5  
ATOM 9397  N N7     . DA  B 2 6  ? 36.320 26.766 29.737 1.00 0.00 ? 72 DA  B N7     5  
ATOM 9398  C C5     . DA  B 2 6  ? 37.153 26.201 30.710 1.00 0.00 ? 72 DA  B C5     5  
ATOM 9399  C C6     . DA  B 2 6  ? 38.551 26.060 30.857 1.00 0.00 ? 72 DA  B C6     5  
ATOM 9400  N N6     . DA  B 2 6  ? 39.444 26.499 29.991 1.00 0.00 ? 72 DA  B N6     5  
ATOM 9401  N N1     . DA  B 2 6  ? 39.072 25.486 31.939 1.00 0.00 ? 72 DA  B N1     5  
ATOM 9402  C C2     . DA  B 2 6  ? 38.241 25.048 32.877 1.00 0.00 ? 72 DA  B C2     5  
ATOM 9403  N N3     . DA  B 2 6  ? 36.916 25.098 32.876 1.00 0.00 ? 72 DA  B N3     5  
ATOM 9404  C C4     . DA  B 2 6  ? 36.426 25.684 31.749 1.00 0.00 ? 72 DA  B C4     5  
ATOM 9405  H "H5'"  . DA  B 2 6  ? 32.186 23.885 29.296 1.00 0.00 ? 72 DA  B "H5'"  5  
ATOM 9406  H "H5''" . DA  B 2 6  ? 30.553 24.415 29.696 1.00 0.00 ? 72 DA  B "H5''" 5  
ATOM 9407  H "H4'"  . DA  B 2 6  ? 31.471 23.593 31.687 1.00 0.00 ? 72 DA  B "H4'"  5  
ATOM 9408  H "H3'"  . DA  B 2 6  ? 30.737 26.223 31.859 1.00 0.00 ? 72 DA  B "H3'"  5  
ATOM 9409  H "H2'"  . DA  B 2 6  ? 32.851 27.157 31.502 1.00 0.00 ? 72 DA  B "H2'"  5  
ATOM 9410  H "H2''" . DA  B 2 6  ? 32.951 27.002 33.261 1.00 0.00 ? 72 DA  B "H2''" 5  
ATOM 9411  H "H1'"  . DA  B 2 6  ? 34.257 25.059 33.178 1.00 0.00 ? 72 DA  B "H1'"  5  
ATOM 9412  H H8     . DA  B 2 6  ? 34.225 26.882 29.722 1.00 0.00 ? 72 DA  B H8     5  
ATOM 9413  H H61    . DA  B 2 6  ? 39.127 27.089 29.236 1.00 0.00 ? 72 DA  B H61    5  
ATOM 9414  H H62    . DA  B 2 6  ? 40.424 26.375 30.208 1.00 0.00 ? 72 DA  B H62    5  
ATOM 9415  H H2     . DA  B 2 6  ? 38.699 24.595 33.746 1.00 0.00 ? 72 DA  B H2     5  
ATOM 9416  P P      . DA  B 2 7  ? 30.658 26.032 34.754 1.00 0.00 ? 73 DA  B P      5  
ATOM 9417  O OP1    . DA  B 2 7  ? 29.945 25.193 35.741 1.00 0.00 ? 73 DA  B OP1    5  
ATOM 9418  O OP2    . DA  B 2 7  ? 29.943 27.194 34.194 1.00 0.00 ? 73 DA  B OP2    5  
ATOM 9419  O "O5'"  . DA  B 2 7  ? 31.975 26.585 35.467 1.00 0.00 ? 73 DA  B "O5'"  5  
ATOM 9420  C "C5'"  . DA  B 2 7  ? 32.778 25.721 36.252 1.00 0.00 ? 73 DA  B "C5'"  5  
ATOM 9421  C "C4'"  . DA  B 2 7  ? 34.134 26.322 36.635 1.00 0.00 ? 73 DA  B "C4'"  5  
ATOM 9422  O "O4'"  . DA  B 2 7  ? 34.955 26.532 35.501 1.00 0.00 ? 73 DA  B "O4'"  5  
ATOM 9423  C "C3'"  . DA  B 2 7  ? 34.033 27.648 37.393 1.00 0.00 ? 73 DA  B "C3'"  5  
ATOM 9424  O "O3'"  . DA  B 2 7  ? 34.400 27.416 38.746 1.00 0.00 ? 73 DA  B "O3'"  5  
ATOM 9425  C "C2'"  . DA  B 2 7  ? 35.010 28.561 36.650 1.00 0.00 ? 73 DA  B "C2'"  5  
ATOM 9426  C "C1'"  . DA  B 2 7  ? 35.822 27.615 35.770 1.00 0.00 ? 73 DA  B "C1'"  5  
ATOM 9427  N N9     . DA  B 2 7  ? 36.205 28.231 34.484 1.00 0.00 ? 73 DA  B N9     5  
ATOM 9428  C C8     . DA  B 2 7  ? 35.360 28.738 33.533 1.00 0.00 ? 73 DA  B C8     5  
ATOM 9429  N N7     . DA  B 2 7  ? 35.960 29.195 32.470 1.00 0.00 ? 73 DA  B N7     5  
ATOM 9430  C C5     . DA  B 2 7  ? 37.317 28.985 32.755 1.00 0.00 ? 73 DA  B C5     5  
ATOM 9431  C C6     . DA  B 2 7  ? 38.532 29.242 32.073 1.00 0.00 ? 73 DA  B C6     5  
ATOM 9432  N N6     . DA  B 2 7  ? 38.636 29.795 30.883 1.00 0.00 ? 73 DA  B N6     5  
ATOM 9433  N N1     . DA  B 2 7  ? 39.706 28.913 32.612 1.00 0.00 ? 73 DA  B N1     5  
ATOM 9434  C C2     . DA  B 2 7  ? 39.699 28.343 33.803 1.00 0.00 ? 73 DA  B C2     5  
ATOM 9435  N N3     . DA  B 2 7  ? 38.658 28.056 34.581 1.00 0.00 ? 73 DA  B N3     5  
ATOM 9436  C C4     . DA  B 2 7  ? 37.478 28.398 33.983 1.00 0.00 ? 73 DA  B C4     5  
ATOM 9437  H "H5'"  . DA  B 2 7  ? 32.958 24.804 35.693 1.00 0.00 ? 73 DA  B "H5'"  5  
ATOM 9438  H "H5''" . DA  B 2 7  ? 32.238 25.476 37.167 1.00 0.00 ? 73 DA  B "H5''" 5  
ATOM 9439  H "H4'"  . DA  B 2 7  ? 34.638 25.609 37.284 1.00 0.00 ? 73 DA  B "H4'"  5  
ATOM 9440  H "H3'"  . DA  B 2 7  ? 33.019 28.049 37.325 1.00 0.00 ? 73 DA  B "H3'"  5  
ATOM 9441  H "H2'"  . DA  B 2 7  ? 34.440 29.269 36.049 1.00 0.00 ? 73 DA  B "H2'"  5  
ATOM 9442  H "H2''" . DA  B 2 7  ? 35.665 29.100 37.329 1.00 0.00 ? 73 DA  B "H2''" 5  
ATOM 9443  H "H1'"  . DA  B 2 7  ? 36.711 27.280 36.307 1.00 0.00 ? 73 DA  B "H1'"  5  
ATOM 9444  H H8     . DA  B 2 7  ? 34.286 28.745 33.662 1.00 0.00 ? 73 DA  B H8     5  
ATOM 9445  H H61    . DA  B 2 7  ? 37.794 30.096 30.409 1.00 0.00 ? 73 DA  B H61    5  
ATOM 9446  H H62    . DA  B 2 7  ? 39.561 29.927 30.506 1.00 0.00 ? 73 DA  B H62    5  
ATOM 9447  H H2     . DA  B 2 7  ? 40.672 28.096 34.201 1.00 0.00 ? 73 DA  B H2     5  
ATOM 9448  P P      . DT  B 2 8  ? 34.328 28.543 39.868 1.00 0.00 ? 74 DT  B P      5  
ATOM 9449  O OP1    . DT  B 2 8  ? 34.089 27.856 41.154 1.00 0.00 ? 74 DT  B OP1    5  
ATOM 9450  O OP2    . DT  B 2 8  ? 33.355 29.571 39.441 1.00 0.00 ? 74 DT  B OP2    5  
ATOM 9451  O "O5'"  . DT  B 2 8  ? 35.787 29.167 39.874 1.00 0.00 ? 74 DT  B "O5'"  5  
ATOM 9452  C "C5'"  . DT  B 2 8  ? 36.910 28.356 40.180 1.00 0.00 ? 74 DT  B "C5'"  5  
ATOM 9453  C "C4'"  . DT  B 2 8  ? 38.221 28.980 39.699 1.00 0.00 ? 74 DT  B "C4'"  5  
ATOM 9454  O "O4'"  . DT  B 2 8  ? 38.190 29.240 38.303 1.00 0.00 ? 74 DT  B "O4'"  5  
ATOM 9455  C "C3'"  . DT  B 2 8  ? 38.591 30.290 40.420 1.00 0.00 ? 74 DT  B "C3'"  5  
ATOM 9456  O "O3'"  . DT  B 2 8  ? 39.836 30.068 41.086 1.00 0.00 ? 74 DT  B "O3'"  5  
ATOM 9457  C "C2'"  . DT  B 2 8  ? 38.662 31.285 39.259 1.00 0.00 ? 74 DT  B "C2'"  5  
ATOM 9458  C "C1'"  . DT  B 2 8  ? 39.006 30.373 38.086 1.00 0.00 ? 74 DT  B "C1'"  5  
ATOM 9459  N N1     . DT  B 2 8  ? 38.757 30.965 36.743 1.00 0.00 ? 74 DT  B N1     5  
ATOM 9460  C C2     . DT  B 2 8  ? 39.859 31.164 35.900 1.00 0.00 ? 74 DT  B C2     5  
ATOM 9461  O O2     . DT  B 2 8  ? 41.019 30.902 36.217 1.00 0.00 ? 74 DT  B O2     5  
ATOM 9462  N N3     . DT  B 2 8  ? 39.599 31.674 34.653 1.00 0.00 ? 74 DT  B N3     5  
ATOM 9463  C C4     . DT  B 2 8  ? 38.365 32.018 34.155 1.00 0.00 ? 74 DT  B C4     5  
ATOM 9464  O O4     . DT  B 2 8  ? 38.301 32.469 33.014 1.00 0.00 ? 74 DT  B O4     5  
ATOM 9465  C C5     . DT  B 2 8  ? 37.253 31.779 35.075 1.00 0.00 ? 74 DT  B C5     5  
ATOM 9466  C C7     . DT  B 2 8  ? 35.827 32.067 34.635 1.00 0.00 ? 74 DT  B C7     5  
ATOM 9467  C C6     . DT  B 2 8  ? 37.479 31.275 36.320 1.00 0.00 ? 74 DT  B C6     5  
ATOM 9468  H "H5'"  . DT  B 2 8  ? 36.806 27.388 39.692 1.00 0.00 ? 74 DT  B "H5'"  5  
ATOM 9469  H "H5''" . DT  B 2 8  ? 36.962 28.188 41.257 1.00 0.00 ? 74 DT  B "H5''" 5  
ATOM 9470  H "H4'"  . DT  B 2 8  ? 39.016 28.257 39.865 1.00 0.00 ? 74 DT  B "H4'"  5  
ATOM 9471  H "H3'"  . DT  B 2 8  ? 37.816 30.589 41.131 1.00 0.00 ? 74 DT  B "H3'"  5  
ATOM 9472  H "H2'"  . DT  B 2 8  ? 37.684 31.746 39.113 1.00 0.00 ? 74 DT  B "H2'"  5  
ATOM 9473  H "H2''" . DT  B 2 8  ? 39.420 32.045 39.413 1.00 0.00 ? 74 DT  B "H2''" 5  
ATOM 9474  H "H1'"  . DT  B 2 8  ? 40.056 30.084 38.184 1.00 0.00 ? 74 DT  B "H1'"  5  
ATOM 9475  H H3     . DT  B 2 8  ? 40.392 31.861 34.058 1.00 0.00 ? 74 DT  B H3     5  
ATOM 9476  H H71    . DT  B 2 8  ? 35.679 33.142 34.578 1.00 0.00 ? 74 DT  B H71    5  
ATOM 9477  H H72    . DT  B 2 8  ? 35.660 31.651 33.643 1.00 0.00 ? 74 DT  B H72    5  
ATOM 9478  H H73    . DT  B 2 8  ? 35.107 31.641 35.332 1.00 0.00 ? 74 DT  B H73    5  
ATOM 9479  H H6     . DT  B 2 8  ? 36.648 31.116 36.996 1.00 0.00 ? 74 DT  B H6     5  
ATOM 9480  P P      . DC  B 2 9  ? 40.646 31.194 41.903 1.00 0.00 ? 75 DC  B P      5  
ATOM 9481  O OP1    . DC  B 2 9  ? 41.275 30.547 43.074 1.00 0.00 ? 75 DC  B OP1    5  
ATOM 9482  O OP2    . DC  B 2 9  ? 39.791 32.387 42.119 1.00 0.00 ? 75 DC  B OP2    5  
ATOM 9483  O "O5'"  . DC  B 2 9  ? 41.812 31.635 40.908 1.00 0.00 ? 75 DC  B "O5'"  5  
ATOM 9484  C "C5'"  . DC  B 2 9  ? 42.901 30.766 40.612 1.00 0.00 ? 75 DC  B "C5'"  5  
ATOM 9485  C "C4'"  . DC  B 2 9  ? 44.120 31.469 39.981 1.00 0.00 ? 75 DC  B "C4'"  5  
ATOM 9486  O "O4'"  . DC  B 2 9  ? 43.799 31.958 38.684 1.00 0.00 ? 75 DC  B "O4'"  5  
ATOM 9487  C "C3'"  . DC  B 2 9  ? 44.617 32.658 40.820 1.00 0.00 ? 75 DC  B "C3'"  5  
ATOM 9488  O "O3'"  . DC  B 2 9  ? 46.047 32.781 40.820 1.00 0.00 ? 75 DC  B "O3'"  5  
ATOM 9489  C "C2'"  . DC  B 2 9  ? 43.914 33.831 40.137 1.00 0.00 ? 75 DC  B "C2'"  5  
ATOM 9490  C "C1'"  . DC  B 2 9  ? 43.846 33.375 38.678 1.00 0.00 ? 75 DC  B "C1'"  5  
ATOM 9491  N N1     . DC  B 2 9  ? 42.686 33.893 37.891 1.00 0.00 ? 75 DC  B N1     5  
ATOM 9492  C C2     . DC  B 2 9  ? 42.919 34.409 36.613 1.00 0.00 ? 75 DC  B C2     5  
ATOM 9493  O O2     . DC  B 2 9  ? 44.061 34.607 36.196 1.00 0.00 ? 75 DC  B O2     5  
ATOM 9494  N N3     . DC  B 2 9  ? 41.900 34.708 35.775 1.00 0.00 ? 75 DC  B N3     5  
ATOM 9495  C C4     . DC  B 2 9  ? 40.668 34.558 36.218 1.00 0.00 ? 75 DC  B C4     5  
ATOM 9496  N N4     . DC  B 2 9  ? 39.719 34.824 35.373 1.00 0.00 ? 75 DC  B N4     5  
ATOM 9497  C C5     . DC  B 2 9  ? 40.357 34.112 37.528 1.00 0.00 ? 75 DC  B C5     5  
ATOM 9498  C C6     . DC  B 2 9  ? 41.393 33.779 38.340 1.00 0.00 ? 75 DC  B C6     5  
ATOM 9499  H "H5'"  . DC  B 2 9  ? 42.562 29.974 39.944 1.00 0.00 ? 75 DC  B "H5'"  5  
ATOM 9500  H "H5''" . DC  B 2 9  ? 43.238 30.303 41.538 1.00 0.00 ? 75 DC  B "H5''" 5  
ATOM 9501  H "H4'"  . DC  B 2 9  ? 44.917 30.731 39.898 1.00 0.00 ? 75 DC  B "H4'"  5  
ATOM 9502  H "H3'"  . DC  B 2 9  ? 44.261 32.546 41.844 1.00 0.00 ? 75 DC  B "H3'"  5  
ATOM 9503  H "H2'"  . DC  B 2 9  ? 42.923 33.958 40.568 1.00 0.00 ? 75 DC  B "H2'"  5  
ATOM 9504  H "H2''" . DC  B 2 9  ? 44.469 34.760 40.231 1.00 0.00 ? 75 DC  B "H2''" 5  
ATOM 9505  H "H1'"  . DC  B 2 9  ? 44.784 33.683 38.207 1.00 0.00 ? 75 DC  B "H1'"  5  
ATOM 9506  H H41    . DC  B 2 9  ? 38.754 34.763 35.674 1.00 0.00 ? 75 DC  B H41    5  
ATOM 9507  H H42    . DC  B 2 9  ? 39.959 35.076 34.424 1.00 0.00 ? 75 DC  B H42    5  
ATOM 9508  H H5     . DC  B 2 9  ? 39.340 34.024 37.879 1.00 0.00 ? 75 DC  B H5     5  
ATOM 9509  H H6     . DC  B 2 9  ? 41.209 33.406 39.337 1.00 0.00 ? 75 DC  B H6     5  
ATOM 9510  P P      . DC  B 2 10 ? 46.789 33.862 41.763 1.00 0.00 ? 76 DC  B P      5  
ATOM 9511  O OP1    . DC  B 2 10 ? 48.169 33.393 42.042 1.00 0.00 ? 76 DC  B OP1    5  
ATOM 9512  O OP2    . DC  B 2 10 ? 45.907 34.185 42.905 1.00 0.00 ? 76 DC  B OP2    5  
ATOM 9513  O "O5'"  . DC  B 2 10 ? 46.887 35.183 40.872 1.00 0.00 ? 76 DC  B "O5'"  5  
ATOM 9514  C "C5'"  . DC  B 2 10 ? 47.876 35.307 39.859 1.00 0.00 ? 76 DC  B "C5'"  5  
ATOM 9515  C "C4'"  . DC  B 2 10 ? 47.694 36.537 38.963 1.00 0.00 ? 76 DC  B "C4'"  5  
ATOM 9516  O "O4'"  . DC  B 2 10 ? 46.444 36.462 38.285 1.00 0.00 ? 76 DC  B "O4'"  5  
ATOM 9517  C "C3'"  . DC  B 2 10 ? 47.759 37.863 39.737 1.00 0.00 ? 76 DC  B "C3'"  5  
ATOM 9518  O "O3'"  . DC  B 2 10 ? 48.834 38.647 39.231 1.00 0.00 ? 76 DC  B "O3'"  5  
ATOM 9519  C "C2'"  . DC  B 2 10 ? 46.380 38.473 39.485 1.00 0.00 ? 76 DC  B "C2'"  5  
ATOM 9520  C "C1'"  . DC  B 2 10 ? 45.917 37.770 38.211 1.00 0.00 ? 76 DC  B "C1'"  5  
ATOM 9521  N N1     . DC  B 2 10 ? 44.436 37.713 38.024 1.00 0.00 ? 76 DC  B N1     5  
ATOM 9522  C C2     . DC  B 2 10 ? 43.902 38.079 36.782 1.00 0.00 ? 76 DC  B C2     5  
ATOM 9523  O O2     . DC  B 2 10 ? 44.625 38.493 35.874 1.00 0.00 ? 76 DC  B O2     5  
ATOM 9524  N N3     . DC  B 2 10 ? 42.570 38.007 36.543 1.00 0.00 ? 76 DC  B N3     5  
ATOM 9525  C C4     . DC  B 2 10 ? 41.779 37.609 37.520 1.00 0.00 ? 76 DC  B C4     5  
ATOM 9526  N N4     . DC  B 2 10 ? 40.509 37.545 37.249 1.00 0.00 ? 76 DC  B N4     5  
ATOM 9527  C C5     . DC  B 2 10 ? 42.254 37.234 38.804 1.00 0.00 ? 76 DC  B C5     5  
ATOM 9528  C C6     . DC  B 2 10 ? 43.591 37.297 39.025 1.00 0.00 ? 76 DC  B C6     5  
ATOM 9529  H "H5'"  . DC  B 2 10 ? 47.871 34.418 39.228 1.00 0.00 ? 76 DC  B "H5'"  5  
ATOM 9530  H "H5''" . DC  B 2 10 ? 48.851 35.394 40.336 1.00 0.00 ? 76 DC  B "H5''" 5  
ATOM 9531  H "H4'"  . DC  B 2 10 ? 48.496 36.540 38.222 1.00 0.00 ? 76 DC  B "H4'"  5  
ATOM 9532  H "H3'"  . DC  B 2 10 ? 47.907 37.683 40.803 1.00 0.00 ? 76 DC  B "H3'"  5  
ATOM 9533  H "H2'"  . DC  B 2 10 ? 45.738 38.241 40.332 1.00 0.00 ? 76 DC  B "H2'"  5  
ATOM 9534  H "H2''" . DC  B 2 10 ? 46.420 39.549 39.336 1.00 0.00 ? 76 DC  B "H2''" 5  
ATOM 9535  H "H1'"  . DC  B 2 10 ? 46.389 38.289 37.371 1.00 0.00 ? 76 DC  B "H1'"  5  
ATOM 9536  H H41    . DC  B 2 10 ? 39.865 37.202 37.953 1.00 0.00 ? 76 DC  B H41    5  
ATOM 9537  H H42    . DC  B 2 10 ? 40.206 37.754 36.310 1.00 0.00 ? 76 DC  B H42    5  
ATOM 9538  H H5     . DC  B 2 10 ? 41.591 36.901 39.588 1.00 0.00 ? 76 DC  B H5     5  
ATOM 9539  H H6     . DC  B 2 10 ? 43.994 37.005 39.988 1.00 0.00 ? 76 DC  B H6     5  
ATOM 9540  P P      . DC  B 2 11 ? 49.214 40.090 39.810 1.00 0.00 ? 77 DC  B P      5  
ATOM 9541  O OP1    . DC  B 2 11 ? 50.685 40.243 39.734 1.00 0.00 ? 77 DC  B OP1    5  
ATOM 9542  O OP2    . DC  B 2 11 ? 48.542 40.292 41.114 1.00 0.00 ? 77 DC  B OP2    5  
ATOM 9543  O "O5'"  . DC  B 2 11 ? 48.534 41.089 38.771 1.00 0.00 ? 77 DC  B "O5'"  5  
ATOM 9544  C "C5'"  . DC  B 2 11 ? 49.020 41.216 37.441 1.00 0.00 ? 77 DC  B "C5'"  5  
ATOM 9545  C "C4'"  . DC  B 2 11 ? 48.094 42.084 36.575 1.00 0.00 ? 77 DC  B "C4'"  5  
ATOM 9546  O "O4'"  . DC  B 2 11 ? 46.832 41.441 36.436 1.00 0.00 ? 77 DC  B "O4'"  5  
ATOM 9547  C "C3'"  . DC  B 2 11 ? 47.836 43.496 37.126 1.00 0.00 ? 77 DC  B "C3'"  5  
ATOM 9548  O "O3'"  . DC  B 2 11 ? 48.628 44.466 36.438 1.00 0.00 ? 77 DC  B "O3'"  5  
ATOM 9549  C "C2'"  . DC  B 2 11 ? 46.336 43.684 36.880 1.00 0.00 ? 77 DC  B "C2'"  5  
ATOM 9550  C "C1'"  . DC  B 2 11 ? 45.876 42.436 36.127 1.00 0.00 ? 77 DC  B "C1'"  5  
ATOM 9551  N N1     . DC  B 2 11 ? 44.500 42.010 36.521 1.00 0.00 ? 77 DC  B N1     5  
ATOM 9552  C C2     . DC  B 2 11 ? 43.429 42.236 35.644 1.00 0.00 ? 77 DC  B C2     5  
ATOM 9553  O O2     . DC  B 2 11 ? 43.587 42.839 34.580 1.00 0.00 ? 77 DC  B O2     5  
ATOM 9554  N N3     . DC  B 2 11 ? 42.178 41.816 35.949 1.00 0.00 ? 77 DC  B N3     5  
ATOM 9555  C C4     . DC  B 2 11 ? 41.982 41.240 37.117 1.00 0.00 ? 77 DC  B C4     5  
ATOM 9556  N N4     . DC  B 2 11 ? 40.761 40.869 37.362 1.00 0.00 ? 77 DC  B N4     5  
ATOM 9557  C C5     . DC  B 2 11 ? 43.010 41.038 38.079 1.00 0.00 ? 77 DC  B C5     5  
ATOM 9558  C C6     . DC  B 2 11 ? 44.264 41.444 37.749 1.00 0.00 ? 77 DC  B C6     5  
ATOM 9559  H "H5'"  . DC  B 2 11 ? 49.094 40.227 36.986 1.00 0.00 ? 77 DC  B "H5'"  5  
ATOM 9560  H "H5''" . DC  B 2 11 ? 50.014 41.657 37.458 1.00 0.00 ? 77 DC  B "H5''" 5  
ATOM 9561  H "H4'"  . DC  B 2 11 ? 48.544 42.188 35.586 1.00 0.00 ? 77 DC  B "H4'"  5  
ATOM 9562  H "H3'"  . DC  B 2 11 ? 48.038 43.521 38.199 1.00 0.00 ? 77 DC  B "H3'"  5  
ATOM 9563  H "H2'"  . DC  B 2 11 ? 45.830 43.772 37.841 1.00 0.00 ? 77 DC  B "H2'"  5  
ATOM 9564  H "H2''" . DC  B 2 11 ? 46.134 44.558 36.265 1.00 0.00 ? 77 DC  B "H2''" 5  
ATOM 9565  H "H1'"  . DC  B 2 11 ? 45.916 42.641 35.052 1.00 0.00 ? 77 DC  B "H1'"  5  
ATOM 9566  H H41    . DC  B 2 11 ? 40.519 40.434 38.236 1.00 0.00 ? 77 DC  B H41    5  
ATOM 9567  H H42    . DC  B 2 11 ? 40.071 41.043 36.646 1.00 0.00 ? 77 DC  B H42    5  
ATOM 9568  H H5     . DC  B 2 11 ? 42.821 40.591 39.042 1.00 0.00 ? 77 DC  B H5     5  
ATOM 9569  H H6     . DC  B 2 11 ? 45.089 41.325 38.445 1.00 0.00 ? 77 DC  B H6     5  
ATOM 9570  P P      . DC  B 2 12 ? 48.654 46.024 36.840 1.00 0.00 ? 78 DC  B P      5  
ATOM 9571  O OP1    . DC  B 2 12 ? 49.894 46.589 36.264 1.00 0.00 ? 78 DC  B OP1    5  
ATOM 9572  O OP2    . DC  B 2 12 ? 48.482 46.114 38.302 1.00 0.00 ? 78 DC  B OP2    5  
ATOM 9573  O "O5'"  . DC  B 2 12 ? 47.401 46.736 36.139 1.00 0.00 ? 78 DC  B "O5'"  5  
ATOM 9574  C "C5'"  . DC  B 2 12 ? 47.404 47.023 34.743 1.00 0.00 ? 78 DC  B "C5'"  5  
ATOM 9575  C "C4'"  . DC  B 2 12 ? 46.099 47.657 34.226 1.00 0.00 ? 78 DC  B "C4'"  5  
ATOM 9576  O "O4'"  . DC  B 2 12 ? 45.016 46.759 34.456 1.00 0.00 ? 78 DC  B "O4'"  5  
ATOM 9577  C "C3'"  . DC  B 2 12 ? 45.739 49.008 34.874 1.00 0.00 ? 78 DC  B "C3'"  5  
ATOM 9578  O "O3'"  . DC  B 2 12 ? 45.225 49.934 33.910 1.00 0.00 ? 78 DC  B "O3'"  5  
ATOM 9579  C "C2'"  . DC  B 2 12 ? 44.683 48.589 35.890 1.00 0.00 ? 78 DC  B "C2'"  5  
ATOM 9580  C "C1'"  . DC  B 2 12 ? 43.993 47.427 35.173 1.00 0.00 ? 78 DC  B "C1'"  5  
ATOM 9581  N N1     . DC  B 2 12 ? 43.314 46.470 36.092 1.00 0.00 ? 78 DC  B N1     5  
ATOM 9582  C C2     . DC  B 2 12 ? 41.998 46.066 35.824 1.00 0.00 ? 78 DC  B C2     5  
ATOM 9583  O O2     . DC  B 2 12 ? 41.399 46.431 34.809 1.00 0.00 ? 78 DC  B O2     5  
ATOM 9584  N N3     . DC  B 2 12 ? 41.333 45.257 36.687 1.00 0.00 ? 78 DC  B N3     5  
ATOM 9585  C C4     . DC  B 2 12 ? 41.966 44.838 37.766 1.00 0.00 ? 78 DC  B C4     5  
ATOM 9586  N N4     . DC  B 2 12 ? 41.321 44.052 38.573 1.00 0.00 ? 78 DC  B N4     5  
ATOM 9587  C C5     . DC  B 2 12 ? 43.311 45.166 38.063 1.00 0.00 ? 78 DC  B C5     5  
ATOM 9588  C C6     . DC  B 2 12 ? 43.956 45.991 37.207 1.00 0.00 ? 78 DC  B C6     5  
ATOM 9589  H "H5'"  . DC  B 2 12 ? 47.574 46.096 34.191 1.00 0.00 ? 78 DC  B "H5'"  5  
ATOM 9590  H "H5''" . DC  B 2 12 ? 48.227 47.701 34.516 1.00 0.00 ? 78 DC  B "H5''" 5  
ATOM 9591  H "H4'"  . DC  B 2 12 ? 46.213 47.802 33.154 1.00 0.00 ? 78 DC  B "H4'"  5  
ATOM 9592  H "H3'"  . DC  B 2 12 ? 46.610 49.432 35.378 1.00 0.00 ? 78 DC  B "H3'"  5  
ATOM 9593  H "H2'"  . DC  B 2 12 ? 45.196 48.274 36.795 1.00 0.00 ? 78 DC  B "H2'"  5  
ATOM 9594  H "H2''" . DC  B 2 12 ? 43.977 49.378 36.136 1.00 0.00 ? 78 DC  B "H2''" 5  
ATOM 9595  H "H1'"  . DC  B 2 12 ? 43.273 47.851 34.464 1.00 0.00 ? 78 DC  B "H1'"  5  
ATOM 9596  H H41    . DC  B 2 12 ? 41.824 43.659 39.358 1.00 0.00 ? 78 DC  B H41    5  
ATOM 9597  H H42    . DC  B 2 12 ? 40.373 43.766 38.360 1.00 0.00 ? 78 DC  B H42    5  
ATOM 9598  H H5     . DC  B 2 12 ? 43.812 44.801 38.945 1.00 0.00 ? 78 DC  B H5     5  
ATOM 9599  H H6     . DC  B 2 12 ? 44.985 46.271 37.394 1.00 0.00 ? 78 DC  B H6     5  
ATOM 9600  P P      . DG  B 2 13 ? 44.789 51.426 34.311 1.00 0.00 ? 79 DG  B P      5  
ATOM 9601  O OP1    . DG  B 2 13 ? 44.916 52.275 33.106 1.00 0.00 ? 79 DG  B OP1    5  
ATOM 9602  O OP2    . DG  B 2 13 ? 45.549 51.821 35.517 1.00 0.00 ? 79 DG  B OP2    5  
ATOM 9603  O "O5'"  . DG  B 2 13 ? 43.249 51.343 34.710 1.00 0.00 ? 79 DG  B "O5'"  5  
ATOM 9604  C "C5'"  . DG  B 2 13 ? 42.262 51.036 33.729 1.00 0.00 ? 79 DG  B "C5'"  5  
ATOM 9605  C "C4'"  . DG  B 2 13 ? 40.930 50.596 34.352 1.00 0.00 ? 79 DG  B "C4'"  5  
ATOM 9606  O "O4'"  . DG  B 2 13 ? 41.137 49.484 35.208 1.00 0.00 ? 79 DG  B "O4'"  5  
ATOM 9607  C "C3'"  . DG  B 2 13 ? 40.230 51.669 35.210 1.00 0.00 ? 79 DG  B "C3'"  5  
ATOM 9608  O "O3'"  . DG  B 2 13 ? 39.091 52.239 34.577 1.00 0.00 ? 79 DG  B "O3'"  5  
ATOM 9609  C "C2'"  . DG  B 2 13 ? 39.770 50.897 36.444 1.00 0.00 ? 79 DG  B "C2'"  5  
ATOM 9610  C "C1'"  . DG  B 2 13 ? 40.020 49.440 36.069 1.00 0.00 ? 79 DG  B "C1'"  5  
ATOM 9611  N N9     . DG  B 2 13 ? 40.244 48.619 37.275 1.00 0.00 ? 79 DG  B N9     5  
ATOM 9612  C C8     . DG  B 2 13 ? 41.311 48.616 38.140 1.00 0.00 ? 79 DG  B C8     5  
ATOM 9613  N N7     . DG  B 2 13 ? 41.131 47.880 39.207 1.00 0.00 ? 79 DG  B N7     5  
ATOM 9614  C C5     . DG  B 2 13 ? 39.846 47.347 39.026 1.00 0.00 ? 79 DG  B C5     5  
ATOM 9615  C C6     . DG  B 2 13 ? 39.044 46.477 39.846 1.00 0.00 ? 79 DG  B C6     5  
ATOM 9616  O O6     . DG  B 2 13 ? 39.314 45.952 40.932 1.00 0.00 ? 79 DG  B O6     5  
ATOM 9617  N N1     . DG  B 2 13 ? 37.782 46.251 39.333 1.00 0.00 ? 79 DG  B N1     5  
ATOM 9618  C C2     . DG  B 2 13 ? 37.331 46.783 38.171 1.00 0.00 ? 79 DG  B C2     5  
ATOM 9619  N N2     . DG  B 2 13 ? 36.106 46.504 37.817 1.00 0.00 ? 79 DG  B N2     5  
ATOM 9620  N N3     . DG  B 2 13 ? 38.041 47.563 37.369 1.00 0.00 ? 79 DG  B N3     5  
ATOM 9621  C C4     . DG  B 2 13 ? 39.295 47.812 37.853 1.00 0.00 ? 79 DG  B C4     5  
ATOM 9622  H "H5'"  . DG  B 2 13 ? 42.618 50.218 33.101 1.00 0.00 ? 79 DG  B "H5'"  5  
ATOM 9623  H "H5''" . DG  B 2 13 ? 42.092 51.907 33.095 1.00 0.00 ? 79 DG  B "H5''" 5  
ATOM 9624  H "H4'"  . DG  B 2 13 ? 40.254 50.296 33.547 1.00 0.00 ? 79 DG  B "H4'"  5  
ATOM 9625  H "H3'"  . DG  B 2 13 ? 40.939 52.448 35.501 1.00 0.00 ? 79 DG  B "H3'"  5  
ATOM 9626  H "HO3'" . DG  B 2 13 ? 38.464 51.505 34.341 1.00 0.00 ? 79 DG  B "HO3'" 5  
ATOM 9627  H "H2'"  . DG  B 2 13 ? 40.380 51.184 37.298 1.00 0.00 ? 79 DG  B "H2'"  5  
ATOM 9628  H "H2''" . DG  B 2 13 ? 38.717 51.046 36.675 1.00 0.00 ? 79 DG  B "H2''" 5  
ATOM 9629  H "H1'"  . DG  B 2 13 ? 39.151 49.049 35.527 1.00 0.00 ? 79 DG  B "H1'"  5  
ATOM 9630  H H8     . DG  B 2 13 ? 42.212 49.191 37.955 1.00 0.00 ? 79 DG  B H8     5  
ATOM 9631  H H1     . DG  B 2 13 ? 37.209 45.576 39.809 1.00 0.00 ? 79 DG  B H1     5  
ATOM 9632  H H21    . DG  B 2 13 ? 35.786 46.902 36.945 1.00 0.00 ? 79 DG  B H21    5  
ATOM 9633  H H22    . DG  B 2 13 ? 35.480 46.044 38.464 1.00 0.00 ? 79 DG  B H22    5  
ATOM 9634  O "O5'"  . DC  C 3 1  ? 29.430 44.594 41.782 1.00 0.00 ? 80 DC  C "O5'"  5  
ATOM 9635  C "C5'"  . DC  C 3 1  ? 29.603 43.564 40.814 1.00 0.00 ? 80 DC  C "C5'"  5  
ATOM 9636  C "C4'"  . DC  C 3 1  ? 30.733 43.873 39.815 1.00 0.00 ? 80 DC  C "C4'"  5  
ATOM 9637  O "O4'"  . DC  C 3 1  ? 31.993 44.007 40.479 1.00 0.00 ? 80 DC  C "O4'"  5  
ATOM 9638  C "C3'"  . DC  C 3 1  ? 30.892 42.740 38.777 1.00 0.00 ? 80 DC  C "C3'"  5  
ATOM 9639  O "O3'"  . DC  C 3 1  ? 31.102 43.211 37.447 1.00 0.00 ? 80 DC  C "O3'"  5  
ATOM 9640  C "C2'"  . DC  C 3 1  ? 32.183 42.090 39.255 1.00 0.00 ? 80 DC  C "C2'"  5  
ATOM 9641  C "C1'"  . DC  C 3 1  ? 32.947 43.347 39.665 1.00 0.00 ? 80 DC  C "C1'"  5  
ATOM 9642  N N1     . DC  C 3 1  ? 34.274 43.166 40.330 1.00 0.00 ? 80 DC  C N1     5  
ATOM 9643  C C2     . DC  C 3 1  ? 35.092 44.298 40.456 1.00 0.00 ? 80 DC  C C2     5  
ATOM 9644  O O2     . DC  C 3 1  ? 34.712 45.428 40.152 1.00 0.00 ? 80 DC  C O2     5  
ATOM 9645  N N3     . DC  C 3 1  ? 36.365 44.214 40.900 1.00 0.00 ? 80 DC  C N3     5  
ATOM 9646  C C4     . DC  C 3 1  ? 36.855 43.016 41.142 1.00 0.00 ? 80 DC  C C4     5  
ATOM 9647  N N4     . DC  C 3 1  ? 38.104 42.987 41.498 1.00 0.00 ? 80 DC  C N4     5  
ATOM 9648  C C5     . DC  C 3 1  ? 36.093 41.823 41.033 1.00 0.00 ? 80 DC  C C5     5  
ATOM 9649  C C6     . DC  C 3 1  ? 34.804 41.929 40.623 1.00 0.00 ? 80 DC  C C6     5  
ATOM 9650  H "H5'"  . DC  C 3 1  ? 28.676 43.437 40.252 1.00 0.00 ? 80 DC  C "H5'"  5  
ATOM 9651  H "H5''" . DC  C 3 1  ? 29.826 42.623 41.322 1.00 0.00 ? 80 DC  C "H5''" 5  
ATOM 9652  H "H4'"  . DC  C 3 1  ? 30.500 44.802 39.298 1.00 0.00 ? 80 DC  C "H4'"  5  
ATOM 9653  H "H3'"  . DC  C 3 1  ? 30.057 42.036 38.813 1.00 0.00 ? 80 DC  C "H3'"  5  
ATOM 9654  H "H2'"  . DC  C 3 1  ? 31.985 41.451 40.117 1.00 0.00 ? 80 DC  C "H2'"  5  
ATOM 9655  H "H2''" . DC  C 3 1  ? 32.673 41.538 38.458 1.00 0.00 ? 80 DC  C "H2''" 5  
ATOM 9656  H "H1'"  . DC  C 3 1  ? 33.110 43.946 38.760 1.00 0.00 ? 80 DC  C "H1'"  5  
ATOM 9657  H H41    . DC  C 3 1  ? 38.554 42.089 41.591 1.00 0.00 ? 80 DC  C H41    5  
ATOM 9658  H H42    . DC  C 3 1  ? 38.636 43.836 41.383 1.00 0.00 ? 80 DC  C H42    5  
ATOM 9659  H H5     . DC  C 3 1  ? 36.516 40.851 41.235 1.00 0.00 ? 80 DC  C H5     5  
ATOM 9660  H H6     . DC  C 3 1  ? 34.206 41.033 40.501 1.00 0.00 ? 80 DC  C H6     5  
ATOM 9661  H "HO5'" . DC  C 3 1  ? 29.853 45.415 41.434 1.00 0.00 ? 80 DC  C "HO5'" 5  
ATOM 9662  P P      . DG  C 3 2  ? 29.953 43.964 36.630 1.00 0.00 ? 81 DG  C P      5  
ATOM 9663  O OP1    . DG  C 3 2  ? 30.116 45.412 36.913 1.00 0.00 ? 81 DG  C OP1    5  
ATOM 9664  O OP2    . DG  C 3 2  ? 28.671 43.303 36.938 1.00 0.00 ? 81 DG  C OP2    5  
ATOM 9665  O "O5'"  . DG  C 3 2  ? 30.272 43.662 35.079 1.00 0.00 ? 81 DG  C "O5'"  5  
ATOM 9666  C "C5'"  . DG  C 3 2  ? 30.830 44.621 34.177 1.00 0.00 ? 81 DG  C "C5'"  5  
ATOM 9667  C "C4'"  . DG  C 3 2  ? 32.175 44.210 33.563 1.00 0.00 ? 81 DG  C "C4'"  5  
ATOM 9668  O "O4'"  . DG  C 3 2  ? 33.196 44.347 34.545 1.00 0.00 ? 81 DG  C "O4'"  5  
ATOM 9669  C "C3'"  . DG  C 3 2  ? 32.226 42.761 33.033 1.00 0.00 ? 81 DG  C "C3'"  5  
ATOM 9670  O "O3'"  . DG  C 3 2  ? 32.963 42.687 31.816 1.00 0.00 ? 81 DG  C "O3'"  5  
ATOM 9671  C "C2'"  . DG  C 3 2  ? 33.076 42.091 34.105 1.00 0.00 ? 81 DG  C "C2'"  5  
ATOM 9672  C "C1'"  . DG  C 3 2  ? 34.047 43.232 34.392 1.00 0.00 ? 81 DG  C "C1'"  5  
ATOM 9673  N N9     . DG  C 3 2  ? 34.926 43.043 35.562 1.00 0.00 ? 81 DG  C N9     5  
ATOM 9674  C C8     . DG  C 3 2  ? 34.778 42.205 36.638 1.00 0.00 ? 81 DG  C C8     5  
ATOM 9675  N N7     . DG  C 3 2  ? 35.758 42.261 37.501 1.00 0.00 ? 81 DG  C N7     5  
ATOM 9676  C C5     . DG  C 3 2  ? 36.665 43.149 36.906 1.00 0.00 ? 81 DG  C C5     5  
ATOM 9677  C C6     . DG  C 3 2  ? 37.983 43.577 37.292 1.00 0.00 ? 81 DG  C C6     5  
ATOM 9678  O O6     . DG  C 3 2  ? 38.620 43.310 38.306 1.00 0.00 ? 81 DG  C O6     5  
ATOM 9679  N N1     . DG  C 3 2  ? 38.595 44.394 36.365 1.00 0.00 ? 81 DG  C N1     5  
ATOM 9680  C C2     . DG  C 3 2  ? 38.007 44.809 35.223 1.00 0.00 ? 81 DG  C C2     5  
ATOM 9681  N N2     . DG  C 3 2  ? 38.702 45.575 34.431 1.00 0.00 ? 81 DG  C N2     5  
ATOM 9682  N N3     . DG  C 3 2  ? 36.781 44.472 34.836 1.00 0.00 ? 81 DG  C N3     5  
ATOM 9683  C C4     . DG  C 3 2  ? 36.165 43.620 35.713 1.00 0.00 ? 81 DG  C C4     5  
ATOM 9684  H "H5'"  . DG  C 3 2  ? 30.955 45.592 34.653 1.00 0.00 ? 81 DG  C "H5'"  5  
ATOM 9685  H "H5''" . DG  C 3 2  ? 30.133 44.752 33.358 1.00 0.00 ? 81 DG  C "H5''" 5  
ATOM 9686  H "H4'"  . DG  C 3 2  ? 32.391 44.884 32.734 1.00 0.00 ? 81 DG  C "H4'"  5  
ATOM 9687  H "H3'"  . DG  C 3 2  ? 31.236 42.306 32.952 1.00 0.00 ? 81 DG  C "H3'"  5  
ATOM 9688  H "H2'"  . DG  C 3 2  ? 32.467 41.870 34.983 1.00 0.00 ? 81 DG  C "H2'"  5  
ATOM 9689  H "H2''" . DG  C 3 2  ? 33.585 41.202 33.733 1.00 0.00 ? 81 DG  C "H2''" 5  
ATOM 9690  H "H1'"  . DG  C 3 2  ? 34.683 43.380 33.515 1.00 0.00 ? 81 DG  C "H1'"  5  
ATOM 9691  H H8     . DG  C 3 2  ? 33.916 41.563 36.753 1.00 0.00 ? 81 DG  C H8     5  
ATOM 9692  H H1     . DG  C 3 2  ? 39.539 44.695 36.551 1.00 0.00 ? 81 DG  C H1     5  
ATOM 9693  H H21    . DG  C 3 2  ? 38.261 45.902 33.593 1.00 0.00 ? 81 DG  C H21    5  
ATOM 9694  H H22    . DG  C 3 2  ? 39.645 45.856 34.685 1.00 0.00 ? 81 DG  C H22    5  
ATOM 9695  P P      . DG  C 3 3  ? 32.325 42.232 30.429 1.00 0.00 ? 82 DG  C P      5  
ATOM 9696  O OP1    . DG  C 3 3  ? 31.132 43.054 30.133 1.00 0.00 ? 82 DG  C OP1    5  
ATOM 9697  O OP2    . DG  C 3 3  ? 32.212 40.755 30.421 1.00 0.00 ? 82 DG  C OP2    5  
ATOM 9698  O "O5'"  . DG  C 3 3  ? 33.496 42.619 29.417 1.00 0.00 ? 82 DG  C "O5'"  5  
ATOM 9699  C "C5'"  . DG  C 3 3  ? 33.763 43.972 29.070 1.00 0.00 ? 82 DG  C "C5'"  5  
ATOM 9700  C "C4'"  . DG  C 3 3  ? 35.252 44.234 28.784 1.00 0.00 ? 82 DG  C "C4'"  5  
ATOM 9701  O "O4'"  . DG  C 3 3  ? 35.993 44.182 30.002 1.00 0.00 ? 82 DG  C "O4'"  5  
ATOM 9702  C "C3'"  . DG  C 3 3  ? 35.882 43.230 27.808 1.00 0.00 ? 82 DG  C "C3'"  5  
ATOM 9703  O "O3'"  . DG  C 3 3  ? 36.777 43.938 26.953 1.00 0.00 ? 82 DG  C "O3'"  5  
ATOM 9704  C "C2'"  . DG  C 3 3  ? 36.579 42.261 28.759 1.00 0.00 ? 82 DG  C "C2'"  5  
ATOM 9705  C "C1'"  . DG  C 3 3  ? 36.999 43.179 29.907 1.00 0.00 ? 82 DG  C "C1'"  5  
ATOM 9706  N N9     . DG  C 3 3  ? 37.123 42.487 31.213 1.00 0.00 ? 82 DG  C N9     5  
ATOM 9707  C C8     . DG  C 3 3  ? 36.161 41.775 31.889 1.00 0.00 ? 82 DG  C C8     5  
ATOM 9708  N N7     . DG  C 3 3  ? 36.529 41.357 33.072 1.00 0.00 ? 82 DG  C N7     5  
ATOM 9709  C C5     . DG  C 3 3  ? 37.853 41.805 33.180 1.00 0.00 ? 82 DG  C C5     5  
ATOM 9710  C C6     . DG  C 3 3  ? 38.822 41.680 34.239 1.00 0.00 ? 82 DG  C C6     5  
ATOM 9711  O O6     . DG  C 3 3  ? 38.703 41.165 35.352 1.00 0.00 ? 82 DG  C O6     5  
ATOM 9712  N N1     . DG  C 3 3  ? 40.051 42.225 33.933 1.00 0.00 ? 82 DG  C N1     5  
ATOM 9713  C C2     . DG  C 3 3  ? 40.337 42.818 32.750 1.00 0.00 ? 82 DG  C C2     5  
ATOM 9714  N N2     . DG  C 3 3  ? 41.577 43.167 32.553 1.00 0.00 ? 82 DG  C N2     5  
ATOM 9715  N N3     . DG  C 3 3  ? 39.462 43.012 31.763 1.00 0.00 ? 82 DG  C N3     5  
ATOM 9716  C C4     . DG  C 3 3  ? 38.232 42.474 32.033 1.00 0.00 ? 82 DG  C C4     5  
ATOM 9717  H "H5'"  . DG  C 3 3  ? 33.462 44.625 29.889 1.00 0.00 ? 82 DG  C "H5'"  5  
ATOM 9718  H "H5''" . DG  C 3 3  ? 33.171 44.238 28.194 1.00 0.00 ? 82 DG  C "H5''" 5  
ATOM 9719  H "H4'"  . DG  C 3 3  ? 35.339 45.238 28.363 1.00 0.00 ? 82 DG  C "H4'"  5  
ATOM 9720  H "H3'"  . DG  C 3 3  ? 35.111 42.723 27.232 1.00 0.00 ? 82 DG  C "H3'"  5  
ATOM 9721  H "H2'"  . DG  C 3 3  ? 35.866 41.511 29.104 1.00 0.00 ? 82 DG  C "H2'"  5  
ATOM 9722  H "H2''" . DG  C 3 3  ? 37.432 41.772 28.296 1.00 0.00 ? 82 DG  C "H2''" 5  
ATOM 9723  H "H1'"  . DG  C 3 3  ? 37.955 43.643 29.647 1.00 0.00 ? 82 DG  C "H1'"  5  
ATOM 9724  H H8     . DG  C 3 3  ? 35.172 41.610 31.479 1.00 0.00 ? 82 DG  C H8     5  
ATOM 9725  H H1     . DG  C 3 3  ? 40.787 42.139 34.619 1.00 0.00 ? 82 DG  C H1     5  
ATOM 9726  H H21    . DG  C 3 3  ? 41.870 43.348 31.598 1.00 0.00 ? 82 DG  C H21    5  
ATOM 9727  H H22    . DG  C 3 3  ? 42.272 42.984 33.268 1.00 0.00 ? 82 DG  C H22    5  
ATOM 9728  P P      . DG  C 3 4  ? 37.445 43.312 25.646 1.00 0.00 ? 83 DG  C P      5  
ATOM 9729  O OP1    . DG  C 3 4  ? 37.909 44.465 24.838 1.00 0.00 ? 83 DG  C OP1    5  
ATOM 9730  O OP2    . DG  C 3 4  ? 36.523 42.343 25.031 1.00 0.00 ? 83 DG  C OP2    5  
ATOM 9731  O "O5'"  . DG  C 3 4  ? 38.695 42.471 26.135 1.00 0.00 ? 83 DG  C "O5'"  5  
ATOM 9732  C "C5'"  . DG  C 3 4  ? 39.808 43.075 26.770 1.00 0.00 ? 83 DG  C "C5'"  5  
ATOM 9733  C "C4'"  . DG  C 3 4  ? 40.606 42.048 27.579 1.00 0.00 ? 83 DG  C "C4'"  5  
ATOM 9734  O "O4'"  . DG  C 3 4  ? 39.953 41.639 28.764 1.00 0.00 ? 83 DG  C "O4'"  5  
ATOM 9735  C "C3'"  . DG  C 3 4  ? 40.893 40.737 26.840 1.00 0.00 ? 83 DG  C "C3'"  5  
ATOM 9736  O "O3'"  . DG  C 3 4  ? 42.039 40.919 26.024 1.00 0.00 ? 83 DG  C "O3'"  5  
ATOM 9737  C "C2'"  . DG  C 3 4  ? 41.073 39.741 27.993 1.00 0.00 ? 83 DG  C "C2'"  5  
ATOM 9738  C "C1'"  . DG  C 3 4  ? 40.746 40.571 29.241 1.00 0.00 ? 83 DG  C "C1'"  5  
ATOM 9739  N N9     . DG  C 3 4  ? 40.095 39.835 30.350 1.00 0.00 ? 83 DG  C N9     5  
ATOM 9740  C C8     . DG  C 3 4  ? 38.801 39.392 30.472 1.00 0.00 ? 83 DG  C C8     5  
ATOM 9741  N N7     . DG  C 3 4  ? 38.519 38.864 31.637 1.00 0.00 ? 83 DG  C N7     5  
ATOM 9742  C C5     . DG  C 3 4  ? 39.727 38.968 32.343 1.00 0.00 ? 83 DG  C C5     5  
ATOM 9743  C C6     . DG  C 3 4  ? 40.090 38.608 33.691 1.00 0.00 ? 83 DG  C C6     5  
ATOM 9744  O O6     . DG  C 3 4  ? 39.401 38.103 34.581 1.00 0.00 ? 83 DG  C O6     5  
ATOM 9745  N N1     . DG  C 3 4  ? 41.411 38.869 33.994 1.00 0.00 ? 83 DG  C N1     5  
ATOM 9746  C C2     . DG  C 3 4  ? 42.289 39.416 33.121 1.00 0.00 ? 83 DG  C C2     5  
ATOM 9747  N N2     . DG  C 3 4  ? 43.515 39.562 33.531 1.00 0.00 ? 83 DG  C N2     5  
ATOM 9748  N N3     . DG  C 3 4  ? 42.004 39.771 31.874 1.00 0.00 ? 83 DG  C N3     5  
ATOM 9749  C C4     . DG  C 3 4  ? 40.700 39.531 31.546 1.00 0.00 ? 83 DG  C C4     5  
ATOM 9750  H "H5'"  . DG  C 3 4  ? 39.477 43.861 27.452 1.00 0.00 ? 83 DG  C "H5'"  5  
ATOM 9751  H "H5''" . DG  C 3 4  ? 40.460 43.517 26.016 1.00 0.00 ? 83 DG  C "H5''" 5  
ATOM 9752  H "H4'"  . DG  C 3 4  ? 41.556 42.512 27.851 1.00 0.00 ? 83 DG  C "H4'"  5  
ATOM 9753  H "H3'"  . DG  C 3 4  ? 40.024 40.448 26.249 1.00 0.00 ? 83 DG  C "H3'"  5  
ATOM 9754  H "H2'"  . DG  C 3 4  ? 40.367 38.917 27.881 1.00 0.00 ? 83 DG  C "H2'"  5  
ATOM 9755  H "H2''" . DG  C 3 4  ? 42.094 39.368 28.043 1.00 0.00 ? 83 DG  C "H2''" 5  
ATOM 9756  H "H1'"  . DG  C 3 4  ? 41.677 40.986 29.635 1.00 0.00 ? 83 DG  C "H1'"  5  
ATOM 9757  H H8     . DG  C 3 4  ? 38.076 39.505 29.679 1.00 0.00 ? 83 DG  C H8     5  
ATOM 9758  H H1     . DG  C 3 4  ? 41.740 38.634 34.917 1.00 0.00 ? 83 DG  C H1     5  
ATOM 9759  H H21    . DG  C 3 4  ? 44.163 40.029 32.907 1.00 0.00 ? 83 DG  C H21    5  
ATOM 9760  H H22    . DG  C 3 4  ? 43.801 39.214 34.438 1.00 0.00 ? 83 DG  C H22    5  
ATOM 9761  P P      . DG  C 3 5  ? 42.471 39.908 24.872 1.00 0.00 ? 84 DG  C P      5  
ATOM 9762  O OP1    . DG  C 3 5  ? 43.338 40.701 23.979 1.00 0.00 ? 84 DG  C OP1    5  
ATOM 9763  O OP2    . DG  C 3 5  ? 41.262 39.283 24.291 1.00 0.00 ? 84 DG  C OP2    5  
ATOM 9764  O "O5'"  . DG  C 3 5  ? 43.361 38.814 25.600 1.00 0.00 ? 84 DG  C "O5'"  5  
ATOM 9765  C "C5'"  . DG  C 3 5  ? 44.671 39.162 26.027 1.00 0.00 ? 84 DG  C "C5'"  5  
ATOM 9766  C "C4'"  . DG  C 3 5  ? 45.276 38.146 26.992 1.00 0.00 ? 84 DG  C "C4'"  5  
ATOM 9767  O "O4'"  . DG  C 3 5  ? 44.488 38.078 28.179 1.00 0.00 ? 84 DG  C "O4'"  5  
ATOM 9768  C "C3'"  . DG  C 3 5  ? 45.414 36.735 26.401 1.00 0.00 ? 84 DG  C "C3'"  5  
ATOM 9769  O "O3'"  . DG  C 3 5  ? 46.782 36.387 26.580 1.00 0.00 ? 84 DG  C "O3'"  5  
ATOM 9770  C "C2'"  . DG  C 3 5  ? 44.377 35.960 27.213 1.00 0.00 ? 84 DG  C "C2'"  5  
ATOM 9771  C "C1'"  . DG  C 3 5  ? 44.320 36.721 28.535 1.00 0.00 ? 84 DG  C "C1'"  5  
ATOM 9772  N N9     . DG  C 3 5  ? 43.044 36.536 29.267 1.00 0.00 ? 84 DG  C N9     5  
ATOM 9773  C C8     . DG  C 3 5  ? 41.763 36.477 28.768 1.00 0.00 ? 84 DG  C C8     5  
ATOM 9774  N N7     . DG  C 3 5  ? 40.842 36.263 29.665 1.00 0.00 ? 84 DG  C N7     5  
ATOM 9775  C C5     . DG  C 3 5  ? 41.567 36.146 30.858 1.00 0.00 ? 84 DG  C C5     5  
ATOM 9776  C C6     . DG  C 3 5  ? 41.149 35.878 32.210 1.00 0.00 ? 84 DG  C C6     5  
ATOM 9777  O O6     . DG  C 3 5  ? 40.017 35.711 32.671 1.00 0.00 ? 84 DG  C O6     5  
ATOM 9778  N N1     . DG  C 3 5  ? 42.197 35.822 33.104 1.00 0.00 ? 84 DG  C N1     5  
ATOM 9779  C C2     . DG  C 3 5  ? 43.486 36.057 32.774 1.00 0.00 ? 84 DG  C C2     5  
ATOM 9780  N N2     . DG  C 3 5  ? 44.350 35.999 33.749 1.00 0.00 ? 84 DG  C N2     5  
ATOM 9781  N N3     . DG  C 3 5  ? 43.929 36.320 31.547 1.00 0.00 ? 84 DG  C N3     5  
ATOM 9782  C C4     . DG  C 3 5  ? 42.915 36.339 30.624 1.00 0.00 ? 84 DG  C C4     5  
ATOM 9783  H "H5'"  . DG  C 3 5  ? 44.645 40.128 26.533 1.00 0.00 ? 84 DG  C "H5'"  5  
ATOM 9784  H "H5''" . DG  C 3 5  ? 45.323 39.254 25.157 1.00 0.00 ? 84 DG  C "H5''" 5  
ATOM 9785  H "H4'"  . DG  C 3 5  ? 46.273 38.500 27.257 1.00 0.00 ? 84 DG  C "H4'"  5  
ATOM 9786  H "H3'"  . DG  C 3 5  ? 45.159 36.720 25.341 1.00 0.00 ? 84 DG  C "H3'"  5  
ATOM 9787  H "H2'"  . DG  C 3 5  ? 43.423 36.020 26.690 1.00 0.00 ? 84 DG  C "H2'"  5  
ATOM 9788  H "H2''" . DG  C 3 5  ? 44.640 34.918 27.364 1.00 0.00 ? 84 DG  C "H2''" 5  
ATOM 9789  H "H1'"  . DG  C 3 5  ? 45.153 36.398 29.167 1.00 0.00 ? 84 DG  C "H1'"  5  
ATOM 9790  H H8     . DG  C 3 5  ? 41.539 36.613 27.719 1.00 0.00 ? 84 DG  C H8     5  
ATOM 9791  H H1     . DG  C 3 5  ? 41.988 35.572 34.057 1.00 0.00 ? 84 DG  C H1     5  
ATOM 9792  H H21    . DG  C 3 5  ? 45.315 36.215 33.554 1.00 0.00 ? 84 DG  C H21    5  
ATOM 9793  H H22    . DG  C 3 5  ? 44.054 35.721 34.677 1.00 0.00 ? 84 DG  C H22    5  
ATOM 9794  P P      . DA  C 3 6  ? 47.387 34.918 26.595 1.00 0.00 ? 85 DA  C P      5  
ATOM 9795  O OP1    . DA  C 3 6  ? 48.808 35.012 26.211 1.00 0.00 ? 85 DA  C OP1    5  
ATOM 9796  O OP2    . DA  C 3 6  ? 46.509 33.982 25.860 1.00 0.00 ? 85 DA  C OP2    5  
ATOM 9797  O "O5'"  . DA  C 3 6  ? 47.327 34.591 28.147 1.00 0.00 ? 85 DA  C "O5'"  5  
ATOM 9798  C "C5'"  . DA  C 3 6  ? 48.036 35.414 29.065 1.00 0.00 ? 85 DA  C "C5'"  5  
ATOM 9799  C "C4'"  . DA  C 3 6  ? 48.182 34.807 30.461 1.00 0.00 ? 85 DA  C "C4'"  5  
ATOM 9800  O "O4'"  . DA  C 3 6  ? 46.911 34.672 31.085 1.00 0.00 ? 85 DA  C "O4'"  5  
ATOM 9801  C "C3'"  . DA  C 3 6  ? 48.833 33.424 30.424 1.00 0.00 ? 85 DA  C "C3'"  5  
ATOM 9802  O "O3'"  . DA  C 3 6  ? 49.666 33.299 31.570 1.00 0.00 ? 85 DA  C "O3'"  5  
ATOM 9803  C "C2'"  . DA  C 3 6  ? 47.608 32.507 30.427 1.00 0.00 ? 85 DA  C "C2'"  5  
ATOM 9804  C "C1'"  . DA  C 3 6  ? 46.609 33.299 31.270 1.00 0.00 ? 85 DA  C "C1'"  5  
ATOM 9805  N N9     . DA  C 3 6  ? 45.201 33.076 30.877 1.00 0.00 ? 85 DA  C N9     5  
ATOM 9806  C C8     . DA  C 3 6  ? 44.650 33.123 29.621 1.00 0.00 ? 85 DA  C C8     5  
ATOM 9807  N N7     . DA  C 3 6  ? 43.356 32.946 29.588 1.00 0.00 ? 85 DA  C N7     5  
ATOM 9808  C C5     . DA  C 3 6  ? 43.032 32.759 30.944 1.00 0.00 ? 85 DA  C C5     5  
ATOM 9809  C C6     . DA  C 3 6  ? 41.838 32.523 31.669 1.00 0.00 ? 85 DA  C C6     5  
ATOM 9810  N N6     . DA  C 3 6  ? 40.632 32.417 31.146 1.00 0.00 ? 85 DA  C N6     5  
ATOM 9811  N N1     . DA  C 3 6  ? 41.863 32.368 32.990 1.00 0.00 ? 85 DA  C N1     5  
ATOM 9812  C C2     . DA  C 3 6  ? 43.025 32.447 33.617 1.00 0.00 ? 85 DA  C C2     5  
ATOM 9813  N N3     . DA  C 3 6  ? 44.225 32.662 33.087 1.00 0.00 ? 85 DA  C N3     5  
ATOM 9814  C C4     . DA  C 3 6  ? 44.154 32.821 31.732 1.00 0.00 ? 85 DA  C C4     5  
ATOM 9815  H "H5'"  . DA  C 3 6  ? 47.531 36.377 29.152 1.00 0.00 ? 85 DA  C "H5'"  5  
ATOM 9816  H "H5''" . DA  C 3 6  ? 49.042 35.597 28.683 1.00 0.00 ? 85 DA  C "H5''" 5  
ATOM 9817  H "H4'"  . DA  C 3 6  ? 48.805 35.479 31.051 1.00 0.00 ? 85 DA  C "H4'"  5  
ATOM 9818  H "H3'"  . DA  C 3 6  ? 49.415 33.292 29.509 1.00 0.00 ? 85 DA  C "H3'"  5  
ATOM 9819  H "H2'"  . DA  C 3 6  ? 47.254 32.376 29.405 1.00 0.00 ? 85 DA  C "H2'"  5  
ATOM 9820  H "H2''" . DA  C 3 6  ? 47.801 31.529 30.857 1.00 0.00 ? 85 DA  C "H2''" 5  
ATOM 9821  H "H1'"  . DA  C 3 6  ? 46.748 33.031 32.322 1.00 0.00 ? 85 DA  C "H1'"  5  
ATOM 9822  H H8     . DA  C 3 6  ? 45.249 33.304 28.737 1.00 0.00 ? 85 DA  C H8     5  
ATOM 9823  H H61    . DA  C 3 6  ? 40.516 32.457 30.142 1.00 0.00 ? 85 DA  C H61    5  
ATOM 9824  H H62    . DA  C 3 6  ? 39.835 32.343 31.772 1.00 0.00 ? 85 DA  C H62    5  
ATOM 9825  H H2     . DA  C 3 6  ? 42.995 32.303 34.689 1.00 0.00 ? 85 DA  C H2     5  
ATOM 9826  P P      . DT  C 3 7  ? 50.569 32.012 31.805 1.00 0.00 ? 86 DT  C P      5  
ATOM 9827  O OP1    . DT  C 3 7  ? 51.556 32.328 32.849 1.00 0.00 ? 86 DT  C OP1    5  
ATOM 9828  O OP2    . DT  C 3 7  ? 51.058 31.519 30.497 1.00 0.00 ? 86 DT  C OP2    5  
ATOM 9829  O "O5'"  . DT  C 3 7  ? 49.551 30.972 32.439 1.00 0.00 ? 86 DT  C "O5'"  5  
ATOM 9830  C "C5'"  . DT  C 3 7  ? 49.052 31.207 33.753 1.00 0.00 ? 86 DT  C "C5'"  5  
ATOM 9831  C "C4'"  . DT  C 3 7  ? 47.914 30.274 34.151 1.00 0.00 ? 86 DT  C "C4'"  5  
ATOM 9832  O "O4'"  . DT  C 3 7  ? 46.741 30.545 33.409 1.00 0.00 ? 86 DT  C "O4'"  5  
ATOM 9833  C "C3'"  . DT  C 3 7  ? 48.217 28.782 33.972 1.00 0.00 ? 86 DT  C "C3'"  5  
ATOM 9834  O "O3'"  . DT  C 3 7  ? 48.726 28.256 35.191 1.00 0.00 ? 86 DT  C "O3'"  5  
ATOM 9835  C "C2'"  . DT  C 3 7  ? 46.846 28.232 33.558 1.00 0.00 ? 86 DT  C "C2'"  5  
ATOM 9836  C "C1'"  . DT  C 3 7  ? 45.899 29.430 33.604 1.00 0.00 ? 86 DT  C "C1'"  5  
ATOM 9837  N N1     . DT  C 3 7  ? 44.843 29.382 32.561 1.00 0.00 ? 86 DT  C N1     5  
ATOM 9838  C C2     . DT  C 3 7  ? 43.514 29.188 32.960 1.00 0.00 ? 86 DT  C C2     5  
ATOM 9839  O O2     . DT  C 3 7  ? 43.174 29.008 34.129 1.00 0.00 ? 86 DT  C O2     5  
ATOM 9840  N N3     . DT  C 3 7  ? 42.567 29.193 31.960 1.00 0.00 ? 86 DT  C N3     5  
ATOM 9841  C C4     . DT  C 3 7  ? 42.815 29.337 30.614 1.00 0.00 ? 86 DT  C C4     5  
ATOM 9842  O O4     . DT  C 3 7  ? 41.866 29.316 29.835 1.00 0.00 ? 86 DT  C O4     5  
ATOM 9843  C C5     . DT  C 3 7  ? 44.226 29.509 30.263 1.00 0.00 ? 86 DT  C C5     5  
ATOM 9844  C C7     . DT  C 3 7  ? 44.654 29.689 28.817 1.00 0.00 ? 86 DT  C C7     5  
ATOM 9845  C C6     . DT  C 3 7  ? 45.178 29.529 31.232 1.00 0.00 ? 86 DT  C C6     5  
ATOM 9846  H "H5'"  . DT  C 3 7  ? 48.681 32.231 33.826 1.00 0.00 ? 86 DT  C "H5'"  5  
ATOM 9847  H "H5''" . DT  C 3 7  ? 49.857 31.093 34.479 1.00 0.00 ? 86 DT  C "H5''" 5  
ATOM 9848  H "H4'"  . DT  C 3 7  ? 47.693 30.450 35.204 1.00 0.00 ? 86 DT  C "H4'"  5  
ATOM 9849  H "H3'"  . DT  C 3 7  ? 48.937 28.633 33.165 1.00 0.00 ? 86 DT  C "H3'"  5  
ATOM 9850  H "H2'"  . DT  C 3 7  ? 46.912 27.823 32.550 1.00 0.00 ? 86 DT  C "H2'"  5  
ATOM 9851  H "H2''" . DT  C 3 7  ? 46.486 27.474 34.240 1.00 0.00 ? 86 DT  C "H2''" 5  
ATOM 9852  H "H1'"  . DT  C 3 7  ? 45.447 29.487 34.600 1.00 0.00 ? 86 DT  C "H1'"  5  
ATOM 9853  H H3     . DT  C 3 7  ? 41.595 29.120 32.229 1.00 0.00 ? 86 DT  C H3     5  
ATOM 9854  H H71    . DT  C 3 7  ? 44.448 28.777 28.259 1.00 0.00 ? 86 DT  C H71    5  
ATOM 9855  H H72    . DT  C 3 7  ? 44.086 30.504 28.368 1.00 0.00 ? 86 DT  C H72    5  
ATOM 9856  H H73    . DT  C 3 7  ? 45.718 29.913 28.744 1.00 0.00 ? 86 DT  C H73    5  
ATOM 9857  H H6     . DT  C 3 7  ? 46.219 29.663 30.968 1.00 0.00 ? 86 DT  C H6     5  
ATOM 9858  P P      . DT  C 3 8  ? 49.031 26.700 35.420 1.00 0.00 ? 87 DT  C P      5  
ATOM 9859  O OP1    . DT  C 3 8  ? 50.013 26.615 36.521 1.00 0.00 ? 87 DT  C OP1    5  
ATOM 9860  O OP2    . DT  C 3 8  ? 49.333 26.032 34.137 1.00 0.00 ? 87 DT  C OP2    5  
ATOM 9861  O "O5'"  . DT  C 3 8  ? 47.646 26.145 35.944 1.00 0.00 ? 87 DT  C "O5'"  5  
ATOM 9862  C "C5'"  . DT  C 3 8  ? 47.007 26.707 37.082 1.00 0.00 ? 87 DT  C "C5'"  5  
ATOM 9863  C "C4'"  . DT  C 3 8  ? 45.567 26.201 37.181 1.00 0.00 ? 87 DT  C "C4'"  5  
ATOM 9864  O "O4'"  . DT  C 3 8  ? 44.834 26.590 36.028 1.00 0.00 ? 87 DT  C "O4'"  5  
ATOM 9865  C "C3'"  . DT  C 3 8  ? 45.511 24.671 37.285 1.00 0.00 ? 87 DT  C "C3'"  5  
ATOM 9866  O "O3'"  . DT  C 3 8  ? 45.152 24.307 38.613 1.00 0.00 ? 87 DT  C "O3'"  5  
ATOM 9867  C "C2'"  . DT  C 3 8  ? 44.490 24.291 36.206 1.00 0.00 ? 87 DT  C "C2'"  5  
ATOM 9868  C "C1'"  . DT  C 3 8  ? 43.858 25.604 35.759 1.00 0.00 ? 87 DT  C "C1'"  5  
ATOM 9869  N N1     . DT  C 3 8  ? 43.498 25.606 34.313 1.00 0.00 ? 87 DT  C N1     5  
ATOM 9870  C C2     . DT  C 3 8  ? 42.143 25.617 33.964 1.00 0.00 ? 87 DT  C C2     5  
ATOM 9871  O O2     . DT  C 3 8  ? 41.227 25.536 34.776 1.00 0.00 ? 87 DT  C O2     5  
ATOM 9872  N N3     . DT  C 3 8  ? 41.848 25.737 32.628 1.00 0.00 ? 87 DT  C N3     5  
ATOM 9873  C C4     . DT  C 3 8  ? 42.755 25.862 31.604 1.00 0.00 ? 87 DT  C C4     5  
ATOM 9874  O O4     . DT  C 3 8  ? 42.344 26.045 30.456 1.00 0.00 ? 87 DT  C O4     5  
ATOM 9875  C C5     . DT  C 3 8  ? 44.153 25.779 32.025 1.00 0.00 ? 87 DT  C C5     5  
ATOM 9876  C C7     . DT  C 3 8  ? 45.259 25.854 30.991 1.00 0.00 ? 87 DT  C C7     5  
ATOM 9877  C C6     . DT  C 3 8  ? 44.476 25.635 33.340 1.00 0.00 ? 87 DT  C C6     5  
ATOM 9878  H "H5'"  . DT  C 3 8  ? 46.979 27.795 37.003 1.00 0.00 ? 87 DT  C "H5'"  5  
ATOM 9879  H "H5''" . DT  C 3 8  ? 47.557 26.434 37.983 1.00 0.00 ? 87 DT  C "H5''" 5  
ATOM 9880  H "H4'"  . DT  C 3 8  ? 45.090 26.635 38.063 1.00 0.00 ? 87 DT  C "H4'"  5  
ATOM 9881  H "H3'"  . DT  C 3 8  ? 46.482 24.240 37.033 1.00 0.00 ? 87 DT  C "H3'"  5  
ATOM 9882  H "H2'"  . DT  C 3 8  ? 45.011 23.812 35.377 1.00 0.00 ? 87 DT  C "H2'"  5  
ATOM 9883  H "H2''" . DT  C 3 8  ? 43.711 23.639 36.582 1.00 0.00 ? 87 DT  C "H2''" 5  
ATOM 9884  H "H1'"  . DT  C 3 8  ? 42.973 25.797 36.373 1.00 0.00 ? 87 DT  C "H1'"  5  
ATOM 9885  H H3     . DT  C 3 8  ? 40.868 25.706 32.381 1.00 0.00 ? 87 DT  C H3     5  
ATOM 9886  H H71    . DT  C 3 8  ? 46.234 25.678 31.444 1.00 0.00 ? 87 DT  C H71    5  
ATOM 9887  H H72    . DT  C 3 8  ? 45.076 25.102 30.226 1.00 0.00 ? 87 DT  C H72    5  
ATOM 9888  H H73    . DT  C 3 8  ? 45.249 26.828 30.507 1.00 0.00 ? 87 DT  C H73    5  
ATOM 9889  H H6     . DT  C 3 8  ? 45.513 25.567 33.643 1.00 0.00 ? 87 DT  C H6     5  
ATOM 9890  P P      . DA  C 3 9  ? 45.028 22.787 39.098 1.00 0.00 ? 88 DA  C P      5  
ATOM 9891  O OP1    . DA  C 3 9  ? 45.034 22.788 40.577 1.00 0.00 ? 88 DA  C OP1    5  
ATOM 9892  O OP2    . DA  C 3 9  ? 46.013 21.948 38.380 1.00 0.00 ? 88 DA  C OP2    5  
ATOM 9893  O "O5'"  . DA  C 3 9  ? 43.590 22.330 38.624 1.00 0.00 ? 88 DA  C "O5'"  5  
ATOM 9894  C "C5'"  . DA  C 3 9  ? 42.422 22.974 39.108 1.00 0.00 ? 88 DA  C "C5'"  5  
ATOM 9895  C "C4'"  . DA  C 3 9  ? 41.170 22.410 38.436 1.00 0.00 ? 88 DA  C "C4'"  5  
ATOM 9896  O "O4'"  . DA  C 3 9  ? 41.164 22.792 37.068 1.00 0.00 ? 88 DA  C "O4'"  5  
ATOM 9897  C "C3'"  . DA  C 3 9  ? 41.105 20.880 38.528 1.00 0.00 ? 88 DA  C "C3'"  5  
ATOM 9898  O "O3'"  . DA  C 3 9  ? 39.892 20.456 39.148 1.00 0.00 ? 88 DA  C "O3'"  5  
ATOM 9899  C "C2'"  . DA  C 3 9  ? 41.289 20.448 37.075 1.00 0.00 ? 88 DA  C "C2'"  5  
ATOM 9900  C "C1'"  . DA  C 3 9  ? 40.886 21.669 36.255 1.00 0.00 ? 88 DA  C "C1'"  5  
ATOM 9901  N N9     . DA  C 3 9  ? 41.645 21.782 34.986 1.00 0.00 ? 88 DA  C N9     5  
ATOM 9902  C C8     . DA  C 3 9  ? 43.004 21.703 34.782 1.00 0.00 ? 88 DA  C C8     5  
ATOM 9903  N N7     . DA  C 3 9  ? 43.381 21.867 33.540 1.00 0.00 ? 88 DA  C N7     5  
ATOM 9904  C C5     . DA  C 3 9  ? 42.154 22.018 32.868 1.00 0.00 ? 88 DA  C C5     5  
ATOM 9905  C C6     . DA  C 3 9  ? 41.762 22.196 31.519 1.00 0.00 ? 88 DA  C C6     5  
ATOM 9906  N N6     . DA  C 3 9  ? 42.587 22.302 30.497 1.00 0.00 ? 88 DA  C N6     5  
ATOM 9907  N N1     . DA  C 3 9  ? 40.479 22.260 31.170 1.00 0.00 ? 88 DA  C N1     5  
ATOM 9908  C C2     . DA  C 3 9  ? 39.569 22.185 32.131 1.00 0.00 ? 88 DA  C C2     5  
ATOM 9909  N N3     . DA  C 3 9  ? 39.774 22.049 33.435 1.00 0.00 ? 88 DA  C N3     5  
ATOM 9910  C C4     . DA  C 3 9  ? 41.098 21.963 33.739 1.00 0.00 ? 88 DA  C C4     5  
ATOM 9911  H "H5'"  . DA  C 3 9  ? 42.475 24.046 38.907 1.00 0.00 ? 88 DA  C "H5'"  5  
ATOM 9912  H "H5''" . DA  C 3 9  ? 42.341 22.831 40.184 1.00 0.00 ? 88 DA  C "H5''" 5  
ATOM 9913  H "H4'"  . DA  C 3 9  ? 40.298 22.832 38.929 1.00 0.00 ? 88 DA  C "H4'"  5  
ATOM 9914  H "H3'"  . DA  C 3 9  ? 41.949 20.514 39.108 1.00 0.00 ? 88 DA  C "H3'"  5  
ATOM 9915  H "H2'"  . DA  C 3 9  ? 42.339 20.200 36.919 1.00 0.00 ? 88 DA  C "H2'"  5  
ATOM 9916  H "H2''" . DA  C 3 9  ? 40.675 19.594 36.807 1.00 0.00 ? 88 DA  C "H2''" 5  
ATOM 9917  H "H1'"  . DA  C 3 9  ? 39.814 21.619 36.039 1.00 0.00 ? 88 DA  C "H1'"  5  
ATOM 9918  H H8     . DA  C 3 9  ? 43.700 21.547 35.597 1.00 0.00 ? 88 DA  C H8     5  
ATOM 9919  H H61    . DA  C 3 9  ? 43.584 22.266 30.651 1.00 0.00 ? 88 DA  C H61    5  
ATOM 9920  H H62    . DA  C 3 9  ? 42.181 22.448 29.582 1.00 0.00 ? 88 DA  C H62    5  
ATOM 9921  H H2     . DA  C 3 9  ? 38.536 22.248 31.815 1.00 0.00 ? 88 DA  C H2     5  
ATOM 9922  P P      . DG  C 3 10 ? 39.514 18.904 39.326 1.00 0.00 ? 89 DG  C P      5  
ATOM 9923  O OP1    . DG  C 3 10 ? 38.556 18.762 40.442 1.00 0.00 ? 89 DG  C OP1    5  
ATOM 9924  O OP2    . DG  C 3 10 ? 40.777 18.130 39.374 1.00 0.00 ? 89 DG  C OP2    5  
ATOM 9925  O "O5'"  . DG  C 3 10 ? 38.738 18.567 37.980 1.00 0.00 ? 89 DG  C "O5'"  5  
ATOM 9926  C "C5'"  . DG  C 3 10 ? 37.578 19.309 37.615 1.00 0.00 ? 89 DG  C "C5'"  5  
ATOM 9927  C "C4'"  . DG  C 3 10 ? 37.265 19.191 36.119 1.00 0.00 ? 89 DG  C "C4'"  5  
ATOM 9928  O "O4'"  . DG  C 3 10 ? 38.417 19.530 35.359 1.00 0.00 ? 89 DG  C "O4'"  5  
ATOM 9929  C "C3'"  . DG  C 3 10 ? 36.821 17.786 35.679 1.00 0.00 ? 89 DG  C "C3'"  5  
ATOM 9930  O "O3'"  . DG  C 3 10 ? 35.466 17.858 35.236 1.00 0.00 ? 89 DG  C "O3'"  5  
ATOM 9931  C "C2'"  . DG  C 3 10 ? 37.797 17.444 34.553 1.00 0.00 ? 89 DG  C "C2'"  5  
ATOM 9932  C "C1'"  . DG  C 3 10 ? 38.333 18.810 34.151 1.00 0.00 ? 89 DG  C "C1'"  5  
ATOM 9933  N N9     . DG  C 3 10 ? 39.630 18.727 33.444 1.00 0.00 ? 89 DG  C N9     5  
ATOM 9934  C C8     . DG  C 3 10 ? 40.899 18.518 33.925 1.00 0.00 ? 89 DG  C C8     5  
ATOM 9935  N N7     . DG  C 3 10 ? 41.833 18.554 33.005 1.00 0.00 ? 89 DG  C N7     5  
ATOM 9936  C C5     . DG  C 3 10 ? 41.119 18.769 31.813 1.00 0.00 ? 89 DG  C C5     5  
ATOM 9937  C C6     . DG  C 3 10 ? 41.528 18.913 30.432 1.00 0.00 ? 89 DG  C C6     5  
ATOM 9938  O O6     . DG  C 3 10 ? 42.658 18.915 29.933 1.00 0.00 ? 89 DG  C O6     5  
ATOM 9939  N N1     . DG  C 3 10 ? 40.463 19.067 29.564 1.00 0.00 ? 89 DG  C N1     5  
ATOM 9940  C C2     . DG  C 3 10 ? 39.171 19.109 29.960 1.00 0.00 ? 89 DG  C C2     5  
ATOM 9941  N N2     . DG  C 3 10 ? 38.245 19.128 29.053 1.00 0.00 ? 89 DG  C N2     5  
ATOM 9942  N N3     . DG  C 3 10 ? 38.745 19.011 31.207 1.00 0.00 ? 89 DG  C N3     5  
ATOM 9943  C C4     . DG  C 3 10 ? 39.770 18.845 32.088 1.00 0.00 ? 89 DG  C C4     5  
ATOM 9944  H "H5'"  . DG  C 3 10 ? 37.737 20.366 37.829 1.00 0.00 ? 89 DG  C "H5'"  5  
ATOM 9945  H "H5''" . DG  C 3 10 ? 36.721 18.969 38.196 1.00 0.00 ? 89 DG  C "H5''" 5  
ATOM 9946  H "H4'"  . DG  C 3 10 ? 36.467 19.892 35.874 1.00 0.00 ? 89 DG  C "H4'"  5  
ATOM 9947  H "H3'"  . DG  C 3 10 ? 36.939 17.079 36.502 1.00 0.00 ? 89 DG  C "H3'"  5  
ATOM 9948  H "H2'"  . DG  C 3 10 ? 38.603 16.826 34.947 1.00 0.00 ? 89 DG  C "H2'"  5  
ATOM 9949  H "H2''" . DG  C 3 10 ? 37.312 16.952 33.711 1.00 0.00 ? 89 DG  C "H2''" 5  
ATOM 9950  H "H1'"  . DG  C 3 10 ? 37.605 19.295 33.494 1.00 0.00 ? 89 DG  C "H1'"  5  
ATOM 9951  H H8     . DG  C 3 10 ? 41.098 18.360 34.977 1.00 0.00 ? 89 DG  C H8     5  
ATOM 9952  H H1     . DG  C 3 10 ? 40.655 19.152 28.580 1.00 0.00 ? 89 DG  C H1     5  
ATOM 9953  H H21    . DG  C 3 10 ? 37.309 19.019 29.386 1.00 0.00 ? 89 DG  C H21    5  
ATOM 9954  H H22    . DG  C 3 10 ? 38.471 19.086 28.063 1.00 0.00 ? 89 DG  C H22    5  
ATOM 9955  P P      . DA  C 3 11 ? 34.568 16.563 34.968 1.00 0.00 ? 90 DA  C P      5  
ATOM 9956  O OP1    . DA  C 3 11 ? 33.148 16.979 35.046 1.00 0.00 ? 90 DA  C OP1    5  
ATOM 9957  O OP2    . DA  C 3 11 ? 35.017 15.492 35.883 1.00 0.00 ? 90 DA  C OP2    5  
ATOM 9958  O "O5'"  . DA  C 3 11 ? 34.881 16.122 33.472 1.00 0.00 ? 90 DA  C "O5'"  5  
ATOM 9959  C "C5'"  . DA  C 3 11 ? 34.315 16.843 32.388 1.00 0.00 ? 90 DA  C "C5'"  5  
ATOM 9960  C "C4'"  . DA  C 3 11 ? 34.801 16.394 31.009 1.00 0.00 ? 90 DA  C "C4'"  5  
ATOM 9961  O "O4'"  . DA  C 3 11 ? 36.169 16.716 30.807 1.00 0.00 ? 90 DA  C "O4'"  5  
ATOM 9962  C "C3'"  . DA  C 3 11 ? 34.611 14.897 30.731 1.00 0.00 ? 90 DA  C "C3'"  5  
ATOM 9963  O "O3'"  . DA  C 3 11 ? 33.601 14.775 29.736 1.00 0.00 ? 90 DA  C "O3'"  5  
ATOM 9964  C "C2'"  . DA  C 3 11 ? 36.013 14.463 30.283 1.00 0.00 ? 90 DA  C "C2'"  5  
ATOM 9965  C "C1'"  . DA  C 3 11 ? 36.688 15.774 29.892 1.00 0.00 ? 90 DA  C "C1'"  5  
ATOM 9966  N N9     . DA  C 3 11 ? 38.166 15.709 29.990 1.00 0.00 ? 90 DA  C N9     5  
ATOM 9967  C C8     . DA  C 3 11 ? 38.940 15.445 31.095 1.00 0.00 ? 90 DA  C C8     5  
ATOM 9968  N N7     . DA  C 3 11 ? 40.229 15.447 30.870 1.00 0.00 ? 90 DA  C N7     5  
ATOM 9969  C C5     . DA  C 3 11 ? 40.303 15.731 29.493 1.00 0.00 ? 90 DA  C C5     5  
ATOM 9970  C C6     . DA  C 3 11 ? 41.354 15.907 28.557 1.00 0.00 ? 90 DA  C C6     5  
ATOM 9971  N N6     . DA  C 3 11 ? 42.643 15.807 28.818 1.00 0.00 ? 90 DA  C N6     5  
ATOM 9972  N N1     . DA  C 3 11 ? 41.101 16.243 27.292 1.00 0.00 ? 90 DA  C N1     5  
ATOM 9973  C C2     . DA  C 3 11 ? 39.835 16.382 26.925 1.00 0.00 ? 90 DA  C C2     5  
ATOM 9974  N N3     . DA  C 3 11 ? 38.745 16.221 27.666 1.00 0.00 ? 90 DA  C N3     5  
ATOM 9975  C C4     . DA  C 3 11 ? 39.054 15.900 28.956 1.00 0.00 ? 90 DA  C C4     5  
ATOM 9976  H "H5'"  . DA  C 3 11 ? 34.558 17.897 32.505 1.00 0.00 ? 90 DA  C "H5'"  5  
ATOM 9977  H "H5''" . DA  C 3 11 ? 33.231 16.730 32.416 1.00 0.00 ? 90 DA  C "H5''" 5  
ATOM 9978  H "H4'"  . DA  C 3 11 ? 34.218 16.935 30.265 1.00 0.00 ? 90 DA  C "H4'"  5  
ATOM 9979  H "H3'"  . DA  C 3 11 ? 34.319 14.368 31.641 1.00 0.00 ? 90 DA  C "H3'"  5  
ATOM 9980  H "H2'"  . DA  C 3 11 ? 36.528 14.014 31.131 1.00 0.00 ? 90 DA  C "H2'"  5  
ATOM 9981  H "H2''" . DA  C 3 11 ? 36.000 13.765 29.449 1.00 0.00 ? 90 DA  C "H2''" 5  
ATOM 9982  H "H1'"  . DA  C 3 11 ? 36.391 16.042 28.873 1.00 0.00 ? 90 DA  C "H1'"  5  
ATOM 9983  H H8     . DA  C 3 11 ? 38.507 15.263 32.072 1.00 0.00 ? 90 DA  C H8     5  
ATOM 9984  H H61    . DA  C 3 11 ? 42.943 15.543 29.747 1.00 0.00 ? 90 DA  C H61    5  
ATOM 9985  H H62    . DA  C 3 11 ? 43.298 15.990 28.076 1.00 0.00 ? 90 DA  C H62    5  
ATOM 9986  H H2     . DA  C 3 11 ? 39.667 16.647 25.890 1.00 0.00 ? 90 DA  C H2     5  
ATOM 9987  P P      . DG  C 3 12 ? 33.160 13.391 29.083 1.00 0.00 ? 91 DG  C P      5  
ATOM 9988  O OP1    . DG  C 3 12 ? 31.761 13.516 28.611 1.00 0.00 ? 91 DG  C OP1    5  
ATOM 9989  O OP2    . DG  C 3 12 ? 33.501 12.271 29.994 1.00 0.00 ? 91 DG  C OP2    5  
ATOM 9990  O "O5'"  . DG  C 3 12 ? 34.093 13.311 27.796 1.00 0.00 ? 91 DG  C "O5'"  5  
ATOM 9991  C "C5'"  . DG  C 3 12 ? 33.939 14.252 26.740 1.00 0.00 ? 91 DG  C "C5'"  5  
ATOM 9992  C "C4'"  . DG  C 3 12 ? 34.839 13.956 25.537 1.00 0.00 ? 91 DG  C "C4'"  5  
ATOM 9993  O "O4'"  . DG  C 3 12 ? 36.201 14.257 25.816 1.00 0.00 ? 91 DG  C "O4'"  5  
ATOM 9994  C "C3'"  . DG  C 3 12 ? 34.765 12.481 25.129 1.00 0.00 ? 91 DG  C "C3'"  5  
ATOM 9995  O "O3'"  . DG  C 3 12 ? 34.509 12.407 23.741 1.00 0.00 ? 91 DG  C "O3'"  5  
ATOM 9996  C "C2'"  . DG  C 3 12 ? 36.158 11.972 25.477 1.00 0.00 ? 91 DG  C "C2'"  5  
ATOM 9997  C "C1'"  . DG  C 3 12 ? 36.986 13.230 25.242 1.00 0.00 ? 91 DG  C "C1'"  5  
ATOM 9998  N N9     . DG  C 3 12 ? 38.323 13.183 25.873 1.00 0.00 ? 91 DG  C N9     5  
ATOM 9999  C C8     . DG  C 3 12 ? 38.639 12.823 27.158 1.00 0.00 ? 91 DG  C C8     5  
ATOM 10000 N N7     . DG  C 3 12 ? 39.918 12.802 27.414 1.00 0.00 ? 91 DG  C N7     5  
ATOM 10001 C C5     . DG  C 3 12 ? 40.497 13.194 26.201 1.00 0.00 ? 91 DG  C C5     5  
ATOM 10002 C C6     . DG  C 3 12 ? 41.871 13.372 25.824 1.00 0.00 ? 91 DG  C C6     5  
ATOM 10003 O O6     . DG  C 3 12 ? 42.891 13.200 26.488 1.00 0.00 ? 91 DG  C O6     5  
ATOM 10004 N N1     . DG  C 3 12 ? 42.036 13.795 24.526 1.00 0.00 ? 91 DG  C N1     5  
ATOM 10005 C C2     . DG  C 3 12 ? 41.015 14.037 23.676 1.00 0.00 ? 91 DG  C C2     5  
ATOM 10006 N N2     . DG  C 3 12 ? 41.359 14.465 22.494 1.00 0.00 ? 91 DG  C N2     5  
ATOM 10007 N N3     . DG  C 3 12 ? 39.721 13.883 23.966 1.00 0.00 ? 91 DG  C N3     5  
ATOM 10008 C C4     . DG  C 3 12 ? 39.526 13.452 25.255 1.00 0.00 ? 91 DG  C C4     5  
ATOM 10009 H "H5'"  . DG  C 3 12 ? 34.149 15.259 27.105 1.00 0.00 ? 91 DG  C "H5'"  5  
ATOM 10010 H "H5''" . DG  C 3 12 ? 32.909 14.229 26.387 1.00 0.00 ? 91 DG  C "H5''" 5  
ATOM 10011 H "H4'"  . DG  C 3 12 ? 34.506 14.569 24.697 1.00 0.00 ? 91 DG  C "H4'"  5  
ATOM 10012 H "H3'"  . DG  C 3 12 ? 33.997 11.953 25.697 1.00 0.00 ? 91 DG  C "H3'"  5  
ATOM 10013 H "H2'"  . DG  C 3 12 ? 36.183 11.681 26.526 1.00 0.00 ? 91 DG  C "H2'"  5  
ATOM 10014 H "H2''" . DG  C 3 12 ? 36.467 11.151 24.836 1.00 0.00 ? 91 DG  C "H2''" 5  
ATOM 10015 H "H1'"  . DG  C 3 12 ? 37.086 13.388 24.165 1.00 0.00 ? 91 DG  C "H1'"  5  
ATOM 10016 H H8     . DG  C 3 12 ? 37.882 12.580 27.893 1.00 0.00 ? 91 DG  C H8     5  
ATOM 10017 H H1     . DG  C 3 12 ? 42.979 13.968 24.217 1.00 0.00 ? 91 DG  C H1     5  
ATOM 10018 H H21    . DG  C 3 12 ? 40.642 14.755 21.845 1.00 0.00 ? 91 DG  C H21    5  
ATOM 10019 H H22    . DG  C 3 12 ? 42.339 14.624 22.282 1.00 0.00 ? 91 DG  C H22    5  
ATOM 10020 P P      . DC  C 3 13 ? 34.099 11.057 23.018 1.00 0.00 ? 92 DC  C P      5  
ATOM 10021 O OP1    . DC  C 3 13 ? 32.977 11.392 22.120 1.00 0.00 ? 92 DC  C OP1    5  
ATOM 10022 O OP2    . DC  C 3 13 ? 33.912 9.985  24.026 1.00 0.00 ? 92 DC  C OP2    5  
ATOM 10023 O "O5'"  . DC  C 3 13 ? 35.362 10.683 22.106 1.00 0.00 ? 92 DC  C "O5'"  5  
ATOM 10024 C "C5'"  . DC  C 3 13 ? 35.761 11.547 21.040 1.00 0.00 ? 92 DC  C "C5'"  5  
ATOM 10025 C "C4'"  . DC  C 3 13 ? 37.171 11.282 20.485 1.00 0.00 ? 92 DC  C "C4'"  5  
ATOM 10026 O "O4'"  . DC  C 3 13 ? 38.131 11.530 21.504 1.00 0.00 ? 92 DC  C "O4'"  5  
ATOM 10027 C "C3'"  . DC  C 3 13 ? 37.408 9.852  19.964 1.00 0.00 ? 92 DC  C "C3'"  5  
ATOM 10028 O "O3'"  . DC  C 3 13 ? 37.927 9.841  18.639 1.00 0.00 ? 92 DC  C "O3'"  5  
ATOM 10029 C "C2'"  . DC  C 3 13 ? 38.474 9.312  20.910 1.00 0.00 ? 92 DC  C "C2'"  5  
ATOM 10030 C "C1'"  . DC  C 3 13 ? 39.179 10.592 21.362 1.00 0.00 ? 92 DC  C "C1'"  5  
ATOM 10031 N N1     . DC  C 3 13 ? 39.893 10.417 22.655 1.00 0.00 ? 92 DC  C N1     5  
ATOM 10032 C C2     . DC  C 3 13 ? 41.292 10.441 22.687 1.00 0.00 ? 92 DC  C C2     5  
ATOM 10033 O O2     . DC  C 3 13 ? 41.977 10.600 21.673 1.00 0.00 ? 92 DC  C O2     5  
ATOM 10034 N N3     . DC  C 3 13 ? 41.958 10.261 23.851 1.00 0.00 ? 92 DC  C N3     5  
ATOM 10035 C C4     . DC  C 3 13 ? 41.263 10.044 24.946 1.00 0.00 ? 92 DC  C C4     5  
ATOM 10036 N N4     . DC  C 3 13 ? 41.952 9.872  26.035 1.00 0.00 ? 92 DC  C N4     5  
ATOM 10037 C C5     . DC  C 3 13 ? 39.844 9.995  24.981 1.00 0.00 ? 92 DC  C C5     5  
ATOM 10038 C C6     . DC  C 3 13 ? 39.188 10.183 23.809 1.00 0.00 ? 92 DC  C C6     5  
ATOM 10039 H "H5'"  . DC  C 3 13 ? 35.750 12.577 21.400 1.00 0.00 ? 92 DC  C "H5'"  5  
ATOM 10040 H "H5''" . DC  C 3 13 ? 35.041 11.475 20.224 1.00 0.00 ? 92 DC  C "H5''" 5  
ATOM 10041 H "H4'"  . DC  C 3 13 ? 37.353 11.981 19.667 1.00 0.00 ? 92 DC  C "H4'"  5  
ATOM 10042 H "H3'"  . DC  C 3 13 ? 36.503 9.246  20.026 1.00 0.00 ? 92 DC  C "H3'"  5  
ATOM 10043 H "HO3'" . DC  C 3 13 ? 37.201 10.048 18.004 1.00 0.00 ? 92 DC  C "HO3'" 5  
ATOM 10044 H "H2'"  . DC  C 3 13 ? 37.991 8.816  21.752 1.00 0.00 ? 92 DC  C "H2'"  5  
ATOM 10045 H "H2''" . DC  C 3 13 ? 39.162 8.628  20.413 1.00 0.00 ? 92 DC  C "H2''" 5  
ATOM 10046 H "H1'"  . DC  C 3 13 ? 39.865 10.925 20.576 1.00 0.00 ? 92 DC  C "H1'"  5  
ATOM 10047 H H41    . DC  C 3 13 ? 41.448 9.881  26.919 1.00 0.00 ? 92 DC  C H41    5  
ATOM 10048 H H42    . DC  C 3 13 ? 42.953 10.039 25.978 1.00 0.00 ? 92 DC  C H42    5  
ATOM 10049 H H5     . DC  C 3 13 ? 39.297 9.816  25.893 1.00 0.00 ? 92 DC  C H5     5  
ATOM 10050 H H6     . DC  C 3 13 ? 38.107 10.155 23.759 1.00 0.00 ? 92 DC  C H6     5  
ATOM 10051 N N      . GLY A 1 1  ? 47.322 27.358 47.343 1.00 0.00 ? -2 GLY A N      6  
ATOM 10052 C CA     . GLY A 1 1  ? 45.970 26.936 47.741 1.00 0.00 ? -2 GLY A CA     6  
ATOM 10053 C C      . GLY A 1 1  ? 45.169 26.538 46.520 1.00 0.00 ? -2 GLY A C      6  
ATOM 10054 O O      . GLY A 1 1  ? 45.340 27.133 45.454 1.00 0.00 ? -2 GLY A O      6  
ATOM 10055 H H1     . GLY A 1 1  ? 47.790 26.599 46.865 1.00 0.00 ? -2 GLY A H1     6  
ATOM 10056 H H2     . GLY A 1 1  ? 47.873 27.614 48.153 1.00 0.00 ? -2 GLY A H2     6  
ATOM 10057 H H3     . GLY A 1 1  ? 47.271 28.154 46.720 1.00 0.00 ? -2 GLY A H3     6  
ATOM 10058 H HA2    . GLY A 1 1  ? 46.036 26.089 48.423 1.00 0.00 ? -2 GLY A HA2    6  
ATOM 10059 H HA3    . GLY A 1 1  ? 45.469 27.764 48.239 1.00 0.00 ? -2 GLY A HA3    6  
ATOM 10060 N N      . SER A 1 2  ? 44.313 25.521 46.651 1.00 0.00 ? -1 SER A N      6  
ATOM 10061 C CA     . SER A 1 2  ? 43.550 24.929 45.540 1.00 0.00 ? -1 SER A CA     6  
ATOM 10062 C C      . SER A 1 2  ? 42.093 24.642 45.914 1.00 0.00 ? -1 SER A C      6  
ATOM 10063 O O      . SER A 1 2  ? 41.798 24.230 47.039 1.00 0.00 ? -1 SER A O      6  
ATOM 10064 C CB     . SER A 1 2  ? 44.228 23.633 45.092 1.00 0.00 ? -1 SER A CB     6  
ATOM 10065 O OG     . SER A 1 2  ? 43.508 23.039 44.026 1.00 0.00 ? -1 SER A OG     6  
ATOM 10066 H H      . SER A 1 2  ? 44.219 25.080 47.565 1.00 0.00 ? -1 SER A H      6  
ATOM 10067 H HA     . SER A 1 2  ? 43.549 25.617 44.694 1.00 0.00 ? -1 SER A HA     6  
ATOM 10068 H HB2    . SER A 1 2  ? 45.248 23.850 44.775 1.00 0.00 ? -1 SER A HB2    6  
ATOM 10069 H HB3    . SER A 1 2  ? 44.263 22.935 45.931 1.00 0.00 ? -1 SER A HB3    6  
ATOM 10070 H HG     . SER A 1 2  ? 43.903 23.349 43.174 1.00 0.00 ? -1 SER A HG     6  
ATOM 10071 N N      . GLN A 1 3  ? 41.185 24.813 44.951 1.00 0.00 ? 1  GLN A N      6  
ATOM 10072 C CA     . GLN A 1 3  ? 39.748 24.557 45.074 1.00 0.00 ? 1  GLN A CA     6  
ATOM 10073 C C      . GLN A 1 3  ? 39.242 23.713 43.889 1.00 0.00 ? 1  GLN A C      6  
ATOM 10074 O O      . GLN A 1 3  ? 39.669 23.912 42.749 1.00 0.00 ? 1  GLN A O      6  
ATOM 10075 C CB     . GLN A 1 3  ? 39.034 25.920 45.160 1.00 0.00 ? 1  GLN A CB     6  
ATOM 10076 C CG     . GLN A 1 3  ? 37.510 25.866 45.348 1.00 0.00 ? 1  GLN A CG     6  
ATOM 10077 C CD     . GLN A 1 3  ? 37.102 25.177 46.643 1.00 0.00 ? 1  GLN A CD     6  
ATOM 10078 O OE1    . GLN A 1 3  ? 36.765 23.996 46.667 1.00 0.00 ? 1  GLN A OE1    6  
ATOM 10079 N NE2    . GLN A 1 3  ? 37.126 25.870 47.758 1.00 0.00 ? 1  GLN A NE2    6  
ATOM 10080 H H      . GLN A 1 3  ? 41.518 25.137 44.050 1.00 0.00 ? 1  GLN A H      6  
ATOM 10081 H HA     . GLN A 1 3  ? 39.557 24.000 45.994 1.00 0.00 ? 1  GLN A HA     6  
ATOM 10082 H HB2    . GLN A 1 3  ? 39.456 26.482 45.992 1.00 0.00 ? 1  GLN A HB2    6  
ATOM 10083 H HB3    . GLN A 1 3  ? 39.247 26.473 44.246 1.00 0.00 ? 1  GLN A HB3    6  
ATOM 10084 H HG2    . GLN A 1 3  ? 37.128 26.887 45.360 1.00 0.00 ? 1  GLN A HG2    6  
ATOM 10085 H HG3    . GLN A 1 3  ? 37.049 25.355 44.506 1.00 0.00 ? 1  GLN A HG3    6  
ATOM 10086 H HE21   . GLN A 1 3  ? 37.427 26.843 47.736 1.00 0.00 ? 1  GLN A HE21   6  
ATOM 10087 H HE22   . GLN A 1 3  ? 36.953 25.409 48.632 1.00 0.00 ? 1  GLN A HE22   6  
ATOM 10088 N N      . ARG A 1 4  ? 38.284 22.814 44.136 1.00 0.00 ? 2  ARG A N      6  
ATOM 10089 C CA     . ARG A 1 4  ? 37.567 22.075 43.080 1.00 0.00 ? 2  ARG A CA     6  
ATOM 10090 C C      . ARG A 1 4  ? 36.539 22.983 42.401 1.00 0.00 ? 2  ARG A C      6  
ATOM 10091 O O      . ARG A 1 4  ? 35.703 23.565 43.095 1.00 0.00 ? 2  ARG A O      6  
ATOM 10092 C CB     . ARG A 1 4  ? 36.889 20.836 43.688 1.00 0.00 ? 2  ARG A CB     6  
ATOM 10093 C CG     . ARG A 1 4  ? 37.888 19.716 44.016 1.00 0.00 ? 2  ARG A CG     6  
ATOM 10094 C CD     . ARG A 1 4  ? 37.225 18.557 44.776 1.00 0.00 ? 2  ARG A CD     6  
ATOM 10095 N NE     . ARG A 1 4  ? 36.959 18.895 46.188 1.00 0.00 ? 2  ARG A NE     6  
ATOM 10096 C CZ     . ARG A 1 4  ? 35.820 19.234 46.763 1.00 0.00 ? 2  ARG A CZ     6  
ATOM 10097 N NH1    . ARG A 1 4  ? 34.688 19.308 46.129 1.00 0.00 ? 2  ARG A NH1    6  
ATOM 10098 N NH2    . ARG A 1 4  ? 35.825 19.525 48.027 1.00 0.00 1 2  ARG A NH2    6  
ATOM 10099 H H      . ARG A 1 4  ? 37.951 22.729 45.088 1.00 0.00 ? 2  ARG A H      6  
ATOM 10100 H HA     . ARG A 1 4  ? 38.274 21.744 42.314 1.00 0.00 ? 2  ARG A HA     6  
ATOM 10101 H HB2    . ARG A 1 4  ? 36.354 21.131 44.591 1.00 0.00 ? 2  ARG A HB2    6  
ATOM 10102 H HB3    . ARG A 1 4  ? 36.163 20.445 42.975 1.00 0.00 ? 2  ARG A HB3    6  
ATOM 10103 H HG2    . ARG A 1 4  ? 38.292 19.331 43.078 1.00 0.00 ? 2  ARG A HG2    6  
ATOM 10104 H HG3    . ARG A 1 4  ? 38.715 20.107 44.611 1.00 0.00 ? 2  ARG A HG3    6  
ATOM 10105 H HD2    . ARG A 1 4  ? 36.308 18.261 44.266 1.00 0.00 ? 2  ARG A HD2    6  
ATOM 10106 H HD3    . ARG A 1 4  ? 37.904 17.703 44.751 1.00 0.00 ? 2  ARG A HD3    6  
ATOM 10107 H HE     . ARG A 1 4  ? 37.742 18.837 46.831 1.00 0.00 ? 2  ARG A HE     6  
ATOM 10108 H HH11   . ARG A 1 4  ? 34.630 19.061 45.150 1.00 0.00 ? 2  ARG A HH11   6  
ATOM 10109 H HH12   . ARG A 1 4  ? 33.894 19.760 46.568 1.00 0.00 ? 2  ARG A HH12   6  
ATOM 10110 H HH21   . ARG A 1 4  ? 36.706 19.449 48.520 1.00 0.00 ? 2  ARG A HH21   6  
ATOM 10111 H HH22   . ARG A 1 4  ? 34.953 19.657 48.527 1.00 0.00 ? 2  ARG A HH22   6  
ATOM 10112 N N      . ARG A 1 5  ? 36.548 23.096 41.070 1.00 0.00 ? 3  ARG A N      6  
ATOM 10113 C CA     . ARG A 1 5  ? 35.583 23.941 40.328 1.00 0.00 ? 3  ARG A CA     6  
ATOM 10114 C C      . ARG A 1 5  ? 34.187 23.298 40.274 1.00 0.00 ? 3  ARG A C      6  
ATOM 10115 O O      . ARG A 1 5  ? 34.035 22.106 40.545 1.00 0.00 ? 3  ARG A O      6  
ATOM 10116 C CB     . ARG A 1 5  ? 36.152 24.320 38.948 1.00 0.00 ? 3  ARG A CB     6  
ATOM 10117 C CG     . ARG A 1 5  ? 36.199 23.133 37.980 1.00 0.00 ? 3  ARG A CG     6  
ATOM 10118 C CD     . ARG A 1 5  ? 36.904 23.484 36.668 1.00 0.00 ? 3  ARG A CD     6  
ATOM 10119 N NE     . ARG A 1 5  ? 36.997 22.292 35.800 1.00 0.00 ? 3  ARG A NE     6  
ATOM 10120 C CZ     . ARG A 1 5  ? 36.550 22.169 34.563 1.00 0.00 ? 3  ARG A CZ     6  
ATOM 10121 N NH1    . ARG A 1 5  ? 35.935 23.110 33.914 1.00 0.00 1 3  ARG A NH1    6  
ATOM 10122 N NH2    . ARG A 1 5  ? 36.689 21.066 33.902 1.00 0.00 ? 3  ARG A NH2    6  
ATOM 10123 H H      . ARG A 1 5  ? 37.188 22.497 40.560 1.00 0.00 ? 3  ARG A H      6  
ATOM 10124 H HA     . ARG A 1 5  ? 35.469 24.872 40.892 1.00 0.00 ? 3  ARG A HA     6  
ATOM 10125 H HB2    . ARG A 1 5  ? 35.540 25.108 38.509 1.00 0.00 ? 3  ARG A HB2    6  
ATOM 10126 H HB3    . ARG A 1 5  ? 37.161 24.718 39.081 1.00 0.00 ? 3  ARG A HB3    6  
ATOM 10127 H HG2    . ARG A 1 5  ? 36.731 22.315 38.454 1.00 0.00 ? 3  ARG A HG2    6  
ATOM 10128 H HG3    . ARG A 1 5  ? 35.184 22.804 37.759 1.00 0.00 ? 3  ARG A HG3    6  
ATOM 10129 H HD2    . ARG A 1 5  ? 36.355 24.289 36.177 1.00 0.00 ? 3  ARG A HD2    6  
ATOM 10130 H HD3    . ARG A 1 5  ? 37.909 23.851 36.887 1.00 0.00 ? 3  ARG A HD3    6  
ATOM 10131 H HE     . ARG A 1 5  ? 37.460 21.481 36.189 1.00 0.00 ? 3  ARG A HE     6  
ATOM 10132 H HH11   . ARG A 1 5  ? 36.001 24.072 34.220 1.00 0.00 ? 3  ARG A HH11   6  
ATOM 10133 H HH12   . ARG A 1 5  ? 35.640 22.920 32.962 1.00 0.00 ? 3  ARG A HH12   6  
ATOM 10134 H HH21   . ARG A 1 5  ? 37.261 20.309 34.258 1.00 0.00 ? 3  ARG A HH21   6  
ATOM 10135 H HH22   . ARG A 1 5  ? 36.438 21.095 32.917 1.00 0.00 ? 3  ARG A HH22   6  
ATOM 10136 N N      . GLN A 1 6  ? 33.151 24.062 39.920 1.00 0.00 ? 4  GLN A N      6  
ATOM 10137 C CA     . GLN A 1 6  ? 31.761 23.560 39.955 1.00 0.00 ? 4  GLN A CA     6  
ATOM 10138 C C      . GLN A 1 6  ? 31.336 22.751 38.707 1.00 0.00 ? 4  GLN A C      6  
ATOM 10139 O O      . GLN A 1 6  ? 30.451 21.904 38.820 1.00 0.00 ? 4  GLN A O      6  
ATOM 10140 C CB     . GLN A 1 6  ? 30.770 24.707 40.226 1.00 0.00 ? 4  GLN A CB     6  
ATOM 10141 C CG     . GLN A 1 6  ? 31.169 25.698 41.334 1.00 0.00 ? 4  GLN A CG     6  
ATOM 10142 C CD     . GLN A 1 6  ? 31.606 25.023 42.630 1.00 0.00 ? 4  GLN A CD     6  
ATOM 10143 O OE1    . GLN A 1 6  ? 32.745 25.134 43.065 1.00 0.00 ? 4  GLN A OE1    6  
ATOM 10144 N NE2    . GLN A 1 6  ? 30.738 24.283 43.276 1.00 0.00 ? 4  GLN A NE2    6  
ATOM 10145 H H      . GLN A 1 6  ? 33.309 25.052 39.802 1.00 0.00 ? 4  GLN A H      6  
ATOM 10146 H HA     . GLN A 1 6  ? 31.672 22.874 40.799 1.00 0.00 ? 4  GLN A HA     6  
ATOM 10147 H HB2    . GLN A 1 6  ? 30.609 25.267 39.308 1.00 0.00 ? 4  GLN A HB2    6  
ATOM 10148 H HB3    . GLN A 1 6  ? 29.813 24.258 40.500 1.00 0.00 ? 4  GLN A HB3    6  
ATOM 10149 H HG2    . GLN A 1 6  ? 31.976 26.339 40.976 1.00 0.00 ? 4  GLN A HG2    6  
ATOM 10150 H HG3    . GLN A 1 6  ? 30.310 26.331 41.542 1.00 0.00 ? 4  GLN A HG3    6  
ATOM 10151 H HE21   . GLN A 1 6  ? 29.769 24.274 42.975 1.00 0.00 ? 4  GLN A HE21   6  
ATOM 10152 H HE22   . GLN A 1 6  ? 31.023 23.777 44.105 1.00 0.00 ? 4  GLN A HE22   6  
ATOM 10153 N N      . ARG A 1 7  ? 31.978 23.003 37.551 1.00 0.00 ? 5  ARG A N      6  
ATOM 10154 C CA     . ARG A 1 7  ? 31.800 22.375 36.218 1.00 0.00 ? 5  ARG A CA     6  
ATOM 10155 C C      . ARG A 1 7  ? 30.361 21.919 35.896 1.00 0.00 ? 5  ARG A C      6  
ATOM 10156 O O      . ARG A 1 7  ? 29.970 20.782 36.185 1.00 0.00 ? 5  ARG A O      6  
ATOM 10157 C CB     . ARG A 1 7  ? 32.830 21.241 36.014 1.00 0.00 ? 5  ARG A CB     6  
ATOM 10158 C CG     . ARG A 1 7  ? 32.792 20.681 34.577 1.00 0.00 ? 5  ARG A CG     6  
ATOM 10159 C CD     . ARG A 1 7  ? 33.579 19.374 34.414 1.00 0.00 ? 5  ARG A CD     6  
ATOM 10160 N NE     . ARG A 1 7  ? 33.103 18.657 33.221 1.00 0.00 ? 5  ARG A NE     6  
ATOM 10161 C CZ     . ARG A 1 7  ? 33.760 18.228 32.162 1.00 0.00 ? 5  ARG A CZ     6  
ATOM 10162 N NH1    . ARG A 1 7  ? 35.054 18.278 32.025 1.00 0.00 ? 5  ARG A NH1    6  
ATOM 10163 N NH2    . ARG A 1 7  ? 33.093 17.678 31.197 1.00 0.00 1 5  ARG A NH2    6  
ATOM 10164 H H      . ARG A 1 7  ? 32.654 23.747 37.598 1.00 0.00 ? 5  ARG A H      6  
ATOM 10165 H HA     . ARG A 1 7  ? 32.032 23.142 35.476 1.00 0.00 ? 5  ARG A HA     6  
ATOM 10166 H HB2    . ARG A 1 7  ? 33.833 21.620 36.211 1.00 0.00 ? 5  ARG A HB2    6  
ATOM 10167 H HB3    . ARG A 1 7  ? 32.623 20.442 36.726 1.00 0.00 ? 5  ARG A HB3    6  
ATOM 10168 H HG2    . ARG A 1 7  ? 31.760 20.473 34.296 1.00 0.00 ? 5  ARG A HG2    6  
ATOM 10169 H HG3    . ARG A 1 7  ? 33.181 21.428 33.882 1.00 0.00 ? 5  ARG A HG3    6  
ATOM 10170 H HD2    . ARG A 1 7  ? 34.644 19.586 34.356 1.00 0.00 ? 5  ARG A HD2    6  
ATOM 10171 H HD3    . ARG A 1 7  ? 33.397 18.742 35.285 1.00 0.00 ? 5  ARG A HD3    6  
ATOM 10172 H HE     . ARG A 1 7  ? 32.114 18.421 33.205 1.00 0.00 ? 5  ARG A HE     6  
ATOM 10173 H HH11   . ARG A 1 7  ? 35.627 18.491 32.818 1.00 0.00 ? 5  ARG A HH11   6  
ATOM 10174 H HH12   . ARG A 1 7  ? 35.427 17.786 31.222 1.00 0.00 ? 5  ARG A HH12   6  
ATOM 10175 H HH21   . ARG A 1 7  ? 32.081 17.647 31.233 1.00 0.00 ? 5  ARG A HH21   6  
ATOM 10176 H HH22   . ARG A 1 7  ? 33.600 17.274 30.415 1.00 0.00 ? 5  ARG A HH22   6  
ATOM 10177 N N      . THR A 1 8  ? 29.626 22.773 35.187 1.00 0.00 ? 6  THR A N      6  
ATOM 10178 C CA     . THR A 1 8  ? 28.333 22.448 34.563 1.00 0.00 ? 6  THR A CA     6  
ATOM 10179 C C      . THR A 1 8  ? 28.457 21.930 33.117 1.00 0.00 ? 6  THR A C      6  
ATOM 10180 O O      . THR A 1 8  ? 29.554 21.808 32.559 1.00 0.00 ? 6  THR A O      6  
ATOM 10181 C CB     . THR A 1 8  ? 27.385 23.655 34.670 1.00 0.00 ? 6  THR A CB     6  
ATOM 10182 O OG1    . THR A 1 8  ? 26.063 23.182 34.587 1.00 0.00 ? 6  THR A OG1    6  
ATOM 10183 C CG2    . THR A 1 8  ? 27.593 24.690 33.566 1.00 0.00 ? 6  THR A CG2    6  
ATOM 10184 H H      . THR A 1 8  ? 29.989 23.712 35.062 1.00 0.00 ? 6  THR A H      6  
ATOM 10185 H HA     . THR A 1 8  ? 27.868 21.648 35.136 1.00 0.00 ? 6  THR A HA     6  
ATOM 10186 H HB     . THR A 1 8  ? 27.522 24.128 35.643 1.00 0.00 ? 6  THR A HB     6  
ATOM 10187 H HG1    . THR A 1 8  ? 25.503 23.769 35.133 1.00 0.00 ? 6  THR A HG1    6  
ATOM 10188 H HG21   . THR A 1 8  ? 28.651 24.807 33.353 1.00 0.00 ? 6  THR A HG21   6  
ATOM 10189 H HG22   . THR A 1 8  ? 27.076 24.397 32.652 1.00 0.00 ? 6  THR A HG22   6  
ATOM 10190 H HG23   . THR A 1 8  ? 27.204 25.649 33.894 1.00 0.00 ? 6  THR A HG23   6  
ATOM 10191 N N      . HIS A 1 9  ? 27.308 21.646 32.504 1.00 0.00 ? 7  HIS A N      6  
ATOM 10192 C CA     . HIS A 1 9  ? 27.096 21.396 31.075 1.00 0.00 ? 7  HIS A CA     6  
ATOM 10193 C C      . HIS A 1 9  ? 25.842 22.154 30.603 1.00 0.00 ? 7  HIS A C      6  
ATOM 10194 O O      . HIS A 1 9  ? 24.927 22.372 31.398 1.00 0.00 ? 7  HIS A O      6  
ATOM 10195 C CB     . HIS A 1 9  ? 27.017 19.885 30.811 1.00 0.00 ? 7  HIS A CB     6  
ATOM 10196 C CG     . HIS A 1 9  ? 25.928 19.119 31.529 1.00 0.00 ? 7  HIS A CG     6  
ATOM 10197 N ND1    . HIS A 1 9  ? 25.830 18.912 32.913 1.00 0.00 ? 7  HIS A ND1    6  
ATOM 10198 C CD2    . HIS A 1 9  ? 24.971 18.368 30.911 1.00 0.00 ? 7  HIS A CD2    6  
ATOM 10199 C CE1    . HIS A 1 9  ? 24.819 18.040 33.084 1.00 0.00 ? 7  HIS A CE1    6  
ATOM 10200 N NE2    . HIS A 1 9  ? 24.288 17.698 31.901 1.00 0.00 ? 7  HIS A NE2    6  
ATOM 10201 H H      . HIS A 1 9  ? 26.467 21.825 33.044 1.00 0.00 ? 7  HIS A H      6  
ATOM 10202 H HA     . HIS A 1 9  ? 27.943 21.794 30.515 1.00 0.00 ? 7  HIS A HA     6  
ATOM 10203 H HB2    . HIS A 1 9  ? 26.884 19.739 29.740 1.00 0.00 ? 7  HIS A HB2    6  
ATOM 10204 H HB3    . HIS A 1 9  ? 27.972 19.439 31.086 1.00 0.00 ? 7  HIS A HB3    6  
ATOM 10205 H HD2    . HIS A 1 9  ? 24.840 18.260 29.842 1.00 0.00 ? 7  HIS A HD2    6  
ATOM 10206 H HE1    . HIS A 1 9  ? 24.495 17.642 34.039 1.00 0.00 ? 7  HIS A HE1    6  
ATOM 10207 H HE2    . HIS A 1 9  ? 23.577 16.976 31.767 1.00 0.00 ? 7  HIS A HE2    6  
ATOM 10208 N N      . PHE A 1 10 ? 25.798 22.595 29.342 1.00 0.00 ? 8  PHE A N      6  
ATOM 10209 C CA     . PHE A 1 10 ? 24.777 23.530 28.838 1.00 0.00 ? 8  PHE A CA     6  
ATOM 10210 C C      . PHE A 1 10 ? 23.854 22.904 27.791 1.00 0.00 ? 8  PHE A C      6  
ATOM 10211 O O      . PHE A 1 10 ? 24.329 22.289 26.833 1.00 0.00 ? 8  PHE A O      6  
ATOM 10212 C CB     . PHE A 1 10 ? 25.445 24.795 28.277 1.00 0.00 ? 8  PHE A CB     6  
ATOM 10213 C CG     . PHE A 1 10 ? 26.168 25.624 29.319 1.00 0.00 ? 8  PHE A CG     6  
ATOM 10214 C CD1    . PHE A 1 10 ? 25.424 26.319 30.291 1.00 0.00 ? 8  PHE A CD1    6  
ATOM 10215 C CD2    . PHE A 1 10 ? 27.574 25.700 29.328 1.00 0.00 ? 8  PHE A CD2    6  
ATOM 10216 C CE1    . PHE A 1 10 ? 26.082 27.074 31.275 1.00 0.00 ? 8  PHE A CE1    6  
ATOM 10217 C CE2    . PHE A 1 10 ? 28.230 26.465 30.309 1.00 0.00 ? 8  PHE A CE2    6  
ATOM 10218 C CZ     . PHE A 1 10 ? 27.482 27.148 31.284 1.00 0.00 ? 8  PHE A CZ     6  
ATOM 10219 H H      . PHE A 1 10 ? 26.537 22.318 28.702 1.00 0.00 ? 8  PHE A H      6  
ATOM 10220 H HA     . PHE A 1 10 ? 24.145 23.846 29.666 1.00 0.00 ? 8  PHE A HA     6  
ATOM 10221 H HB2    . PHE A 1 10 ? 26.142 24.514 27.486 1.00 0.00 ? 8  PHE A HB2    6  
ATOM 10222 H HB3    . PHE A 1 10 ? 24.675 25.424 27.828 1.00 0.00 ? 8  PHE A HB3    6  
ATOM 10223 H HD1    . PHE A 1 10 ? 24.345 26.268 30.290 1.00 0.00 ? 8  PHE A HD1    6  
ATOM 10224 H HD2    . PHE A 1 10 ? 28.156 25.171 28.585 1.00 0.00 ? 8  PHE A HD2    6  
ATOM 10225 H HE1    . PHE A 1 10 ? 25.512 27.587 32.035 1.00 0.00 ? 8  PHE A HE1    6  
ATOM 10226 H HE2    . PHE A 1 10 ? 29.307 26.525 30.318 1.00 0.00 ? 8  PHE A HE2    6  
ATOM 10227 H HZ     . PHE A 1 10 ? 27.981 27.717 32.053 1.00 0.00 ? 8  PHE A HZ     6  
ATOM 10228 N N      . THR A 1 11 ? 22.543 23.116 27.934 1.00 0.00 ? 9  THR A N      6  
ATOM 10229 C CA     . THR A 1 11 ? 21.550 22.687 26.933 1.00 0.00 ? 9  THR A CA     6  
ATOM 10230 C C      . THR A 1 11 ? 21.541 23.617 25.719 1.00 0.00 ? 9  THR A C      6  
ATOM 10231 O O      . THR A 1 11 ? 21.862 24.806 25.821 1.00 0.00 ? 9  THR A O      6  
ATOM 10232 C CB     . THR A 1 11 ? 20.124 22.591 27.509 1.00 0.00 ? 9  THR A CB     6  
ATOM 10233 O OG1    . THR A 1 11 ? 19.599 23.871 27.781 1.00 0.00 ? 9  THR A OG1    6  
ATOM 10234 C CG2    . THR A 1 11 ? 20.046 21.768 28.794 1.00 0.00 ? 9  THR A CG2    6  
ATOM 10235 H H      . THR A 1 11 ? 22.216 23.674 28.715 1.00 0.00 ? 9  THR A H      6  
ATOM 10236 H HA     . THR A 1 11 ? 21.825 21.692 26.583 1.00 0.00 ? 9  THR A HA     6  
ATOM 10237 H HB     . THR A 1 11 ? 19.495 22.118 26.758 1.00 0.00 ? 9  THR A HB     6  
ATOM 10238 H HG1    . THR A 1 11 ? 18.736 23.757 28.223 1.00 0.00 ? 9  THR A HG1    6  
ATOM 10239 H HG21   . THR A 1 11 ? 20.567 22.276 29.607 1.00 0.00 ? 9  THR A HG21   6  
ATOM 10240 H HG22   . THR A 1 11 ? 19.001 21.627 29.073 1.00 0.00 ? 9  THR A HG22   6  
ATOM 10241 H HG23   . THR A 1 11 ? 20.498 20.790 28.631 1.00 0.00 ? 9  THR A HG23   6  
ATOM 10242 N N      . SER A 1 12 ? 21.098 23.113 24.566 1.00 0.00 ? 10 SER A N      6  
ATOM 10243 C CA     . SER A 1 12 ? 20.889 23.958 23.383 1.00 0.00 ? 10 SER A CA     6  
ATOM 10244 C C      . SER A 1 12 ? 19.857 25.070 23.627 1.00 0.00 ? 10 SER A C      6  
ATOM 10245 O O      . SER A 1 12 ? 20.022 26.156 23.085 1.00 0.00 ? 10 SER A O      6  
ATOM 10246 C CB     . SER A 1 12 ? 20.505 23.122 22.158 1.00 0.00 ? 10 SER A CB     6  
ATOM 10247 O OG     . SER A 1 12 ? 21.393 22.031 21.993 1.00 0.00 ? 10 SER A OG     6  
ATOM 10248 H H      . SER A 1 12 ? 20.931 22.117 24.479 1.00 0.00 ? 10 SER A H      6  
ATOM 10249 H HA     . SER A 1 12 ? 21.833 24.448 23.150 1.00 0.00 ? 10 SER A HA     6  
ATOM 10250 H HB2    . SER A 1 12 ? 19.490 22.747 22.269 1.00 0.00 ? 10 SER A HB2    6  
ATOM 10251 H HB3    . SER A 1 12 ? 20.545 23.755 21.271 1.00 0.00 ? 10 SER A HB3    6  
ATOM 10252 H HG     . SER A 1 12 ? 22.305 22.385 21.920 1.00 0.00 ? 10 SER A HG     6  
ATOM 10253 N N      . GLN A 1 13 ? 18.853 24.882 24.497 1.00 0.00 ? 11 GLN A N      6  
ATOM 10254 C CA     . GLN A 1 13 ? 17.952 25.974 24.908 1.00 0.00 ? 11 GLN A CA     6  
ATOM 10255 C C      . GLN A 1 13 ? 18.662 27.045 25.755 1.00 0.00 ? 11 GLN A C      6  
ATOM 10256 O O      . GLN A 1 13 ? 18.447 28.232 25.510 1.00 0.00 ? 11 GLN A O      6  
ATOM 10257 C CB     . GLN A 1 13 ? 16.713 25.418 25.627 1.00 0.00 ? 11 GLN A CB     6  
ATOM 10258 C CG     . GLN A 1 13 ? 15.739 26.472 26.202 1.00 0.00 ? 11 GLN A CG     6  
ATOM 10259 C CD     . GLN A 1 13 ? 15.118 27.418 25.168 1.00 0.00 ? 11 GLN A CD     6  
ATOM 10260 O OE1    . GLN A 1 13 ? 13.984 27.257 24.736 1.00 0.00 ? 11 GLN A OE1    6  
ATOM 10261 N NE2    . GLN A 1 13 ? 15.812 28.447 24.735 1.00 0.00 ? 11 GLN A NE2    6  
ATOM 10262 H H      . GLN A 1 13 ? 18.715 23.955 24.881 1.00 0.00 ? 11 GLN A H      6  
ATOM 10263 H HA     . GLN A 1 13 ? 17.602 26.467 24.001 1.00 0.00 ? 11 GLN A HA     6  
ATOM 10264 H HB2    . GLN A 1 13 ? 16.167 24.793 24.925 1.00 0.00 ? 11 GLN A HB2    6  
ATOM 10265 H HB3    . GLN A 1 13 ? 17.050 24.787 26.447 1.00 0.00 ? 11 GLN A HB3    6  
ATOM 10266 H HG2    . GLN A 1 13 ? 14.928 25.944 26.704 1.00 0.00 ? 11 GLN A HG2    6  
ATOM 10267 H HG3    . GLN A 1 13 ? 16.252 27.063 26.960 1.00 0.00 ? 11 GLN A HG3    6  
ATOM 10268 H HE21   . GLN A 1 13 ? 16.747 28.606 25.096 1.00 0.00 ? 11 GLN A HE21   6  
ATOM 10269 H HE22   . GLN A 1 13 ? 15.451 29.044 24.002 1.00 0.00 ? 11 GLN A HE22   6  
ATOM 10270 N N      . GLN A 1 14 ? 19.524 26.680 26.712 1.00 0.00 ? 12 GLN A N      6  
ATOM 10271 C CA     . GLN A 1 14 ? 20.317 27.677 27.447 1.00 0.00 ? 12 GLN A CA     6  
ATOM 10272 C C      . GLN A 1 14 ? 21.171 28.505 26.471 1.00 0.00 ? 12 GLN A C      6  
ATOM 10273 O O      . GLN A 1 14 ? 21.190 29.736 26.535 1.00 0.00 ? 12 GLN A O      6  
ATOM 10274 C CB     . GLN A 1 14 ? 21.186 26.995 28.518 1.00 0.00 ? 12 GLN A CB     6  
ATOM 10275 C CG     . GLN A 1 14 ? 20.356 26.526 29.724 1.00 0.00 ? 12 GLN A CG     6  
ATOM 10276 C CD     . GLN A 1 14 ? 21.186 25.773 30.762 1.00 0.00 ? 12 GLN A CD     6  
ATOM 10277 O OE1    . GLN A 1 14 ? 22.030 24.936 30.456 1.00 0.00 ? 12 GLN A OE1    6  
ATOM 10278 N NE2    . GLN A 1 14 ? 20.994 26.042 32.034 1.00 0.00 ? 12 GLN A NE2    6  
ATOM 10279 H H      . GLN A 1 14 ? 19.692 25.694 26.890 1.00 0.00 ? 12 GLN A H      6  
ATOM 10280 H HA     . GLN A 1 14 ? 19.638 28.370 27.942 1.00 0.00 ? 12 GLN A HA     6  
ATOM 10281 H HB2    . GLN A 1 14 ? 21.714 26.148 28.078 1.00 0.00 ? 12 GLN A HB2    6  
ATOM 10282 H HB3    . GLN A 1 14 ? 21.930 27.709 28.878 1.00 0.00 ? 12 GLN A HB3    6  
ATOM 10283 H HG2    . GLN A 1 14 ? 19.903 27.398 30.191 1.00 0.00 ? 12 GLN A HG2    6  
ATOM 10284 H HG3    . GLN A 1 14 ? 19.546 25.876 29.400 1.00 0.00 ? 12 GLN A HG3    6  
ATOM 10285 H HE21   . GLN A 1 14 ? 20.337 26.771 32.304 1.00 0.00 ? 12 GLN A HE21   6  
ATOM 10286 H HE22   . GLN A 1 14 ? 21.533 25.550 32.727 1.00 0.00 ? 12 GLN A HE22   6  
ATOM 10287 N N      . LEU A 1 15 ? 21.788 27.835 25.494 1.00 0.00 ? 13 LEU A N      6  
ATOM 10288 C CA     . LEU A 1 15 ? 22.572 28.474 24.438 1.00 0.00 ? 13 LEU A CA     6  
ATOM 10289 C C      . LEU A 1 15 ? 21.718 29.331 23.485 1.00 0.00 ? 13 LEU A C      6  
ATOM 10290 O O      . LEU A 1 15 ? 22.174 30.395 23.090 1.00 0.00 ? 13 LEU A O      6  
ATOM 10291 C CB     . LEU A 1 15 ? 23.368 27.390 23.693 1.00 0.00 ? 13 LEU A CB     6  
ATOM 10292 C CG     . LEU A 1 15 ? 24.434 26.711 24.576 1.00 0.00 ? 13 LEU A CG     6  
ATOM 10293 C CD1    . LEU A 1 15 ? 24.921 25.433 23.904 1.00 0.00 ? 13 LEU A CD1    6  
ATOM 10294 C CD2    . LEU A 1 15 ? 25.646 27.613 24.811 1.00 0.00 ? 13 LEU A CD2    6  
ATOM 10295 H H      . LEU A 1 15 ? 21.726 26.821 25.502 1.00 0.00 ? 13 LEU A H      6  
ATOM 10296 H HA     . LEU A 1 15 ? 23.279 29.157 24.904 1.00 0.00 ? 13 LEU A HA     6  
ATOM 10297 H HB2    . LEU A 1 15 ? 22.668 26.639 23.327 1.00 0.00 ? 13 LEU A HB2    6  
ATOM 10298 H HB3    . LEU A 1 15 ? 23.855 27.837 22.825 1.00 0.00 ? 13 LEU A HB3    6  
ATOM 10299 H HG     . LEU A 1 15 ? 24.013 26.440 25.543 1.00 0.00 ? 13 LEU A HG     6  
ATOM 10300 H HD11   . LEU A 1 15 ? 25.712 24.985 24.502 1.00 0.00 ? 13 LEU A HD11   6  
ATOM 10301 H HD12   . LEU A 1 15 ? 24.094 24.727 23.848 1.00 0.00 ? 13 LEU A HD12   6  
ATOM 10302 H HD13   . LEU A 1 15 ? 25.292 25.655 22.906 1.00 0.00 ? 13 LEU A HD13   6  
ATOM 10303 H HD21   . LEU A 1 15 ? 25.344 28.514 25.341 1.00 0.00 ? 13 LEU A HD21   6  
ATOM 10304 H HD22   . LEU A 1 15 ? 26.379 27.083 25.420 1.00 0.00 ? 13 LEU A HD22   6  
ATOM 10305 H HD23   . LEU A 1 15 ? 26.098 27.881 23.857 1.00 0.00 ? 13 LEU A HD23   6  
ATOM 10306 N N      . GLN A 1 16 ? 20.474 28.956 23.174 1.00 0.00 ? 14 GLN A N      6  
ATOM 10307 C CA     . GLN A 1 16 ? 19.601 29.681 22.235 1.00 0.00 ? 14 GLN A CA     6  
ATOM 10308 C C      . GLN A 1 16 ? 19.073 31.044 22.731 1.00 0.00 ? 14 GLN A C      6  
ATOM 10309 O O      . GLN A 1 16 ? 18.537 31.804 21.922 1.00 0.00 ? 14 GLN A O      6  
ATOM 10310 C CB     . GLN A 1 16 ? 18.447 28.763 21.789 1.00 0.00 ? 14 GLN A CB     6  
ATOM 10311 C CG     . GLN A 1 16 ? 18.840 27.800 20.657 1.00 0.00 ? 14 GLN A CG     6  
ATOM 10312 C CD     . GLN A 1 16 ? 18.877 28.495 19.303 1.00 0.00 ? 14 GLN A CD     6  
ATOM 10313 O OE1    . GLN A 1 16 ? 17.877 28.630 18.605 1.00 0.00 ? 14 GLN A OE1    6  
ATOM 10314 N NE2    . GLN A 1 16 ? 20.005 29.009 18.878 1.00 0.00 ? 14 GLN A NE2    6  
ATOM 10315 H H      . GLN A 1 16 ? 20.171 28.041 23.487 1.00 0.00 ? 14 GLN A H      6  
ATOM 10316 H HA     . GLN A 1 16 ? 20.201 29.920 21.358 1.00 0.00 ? 14 GLN A HA     6  
ATOM 10317 H HB2    . GLN A 1 16 ? 18.092 28.193 22.646 1.00 0.00 ? 14 GLN A HB2    6  
ATOM 10318 H HB3    . GLN A 1 16 ? 17.610 29.365 21.436 1.00 0.00 ? 14 GLN A HB3    6  
ATOM 10319 H HG2    . GLN A 1 16 ? 19.814 27.357 20.862 1.00 0.00 ? 14 GLN A HG2    6  
ATOM 10320 H HG3    . GLN A 1 16 ? 18.107 26.995 20.610 1.00 0.00 ? 14 GLN A HG3    6  
ATOM 10321 H HE21   . GLN A 1 16 ? 20.855 28.883 19.430 1.00 0.00 ? 14 GLN A HE21   6  
ATOM 10322 H HE22   . GLN A 1 16 ? 20.046 29.469 17.980 1.00 0.00 ? 14 GLN A HE22   6  
ATOM 10323 N N      . GLU A 1 17 ? 19.246 31.400 24.009 1.00 0.00 ? 15 GLU A N      6  
ATOM 10324 C CA     . GLU A 1 17 ? 19.098 32.792 24.484 1.00 0.00 ? 15 GLU A CA     6  
ATOM 10325 C C      . GLU A 1 17 ? 20.451 33.532 24.504 1.00 0.00 ? 15 GLU A C      6  
ATOM 10326 O O      . GLU A 1 17 ? 20.536 34.712 24.148 1.00 0.00 ? 15 GLU A O      6  
ATOM 10327 C CB     . GLU A 1 17 ? 18.461 32.816 25.886 1.00 0.00 ? 15 GLU A CB     6  
ATOM 10328 C CG     . GLU A 1 17 ? 17.037 32.239 25.969 1.00 0.00 ? 15 GLU A CG     6  
ATOM 10329 C CD     . GLU A 1 17 ? 16.017 33.051 25.162 1.00 0.00 ? 15 GLU A CD     6  
ATOM 10330 O OE1    . GLU A 1 17 ? 15.589 34.144 25.613 1.00 0.00 ? 15 GLU A OE1    6  
ATOM 10331 O OE2    . GLU A 1 17 ? 15.600 32.601 24.066 1.00 0.00 ? 15 GLU A OE2    6  
ATOM 10332 H H      . GLU A 1 17 ? 19.619 30.706 24.644 1.00 0.00 ? 15 GLU A H      6  
ATOM 10333 H HA     . GLU A 1 17 ? 18.447 33.350 23.809 1.00 0.00 ? 15 GLU A HA     6  
ATOM 10334 H HB2    . GLU A 1 17 ? 19.099 32.250 26.566 1.00 0.00 ? 15 GLU A HB2    6  
ATOM 10335 H HB3    . GLU A 1 17 ? 18.433 33.847 26.241 1.00 0.00 ? 15 GLU A HB3    6  
ATOM 10336 H HG2    . GLU A 1 17 ? 17.040 31.203 25.628 1.00 0.00 ? 15 GLU A HG2    6  
ATOM 10337 H HG3    . GLU A 1 17 ? 16.731 32.234 27.017 1.00 0.00 ? 15 GLU A HG3    6  
ATOM 10338 N N      . LEU A 1 18 ? 21.524 32.828 24.886 1.00 0.00 ? 16 LEU A N      6  
ATOM 10339 C CA     . LEU A 1 18 ? 22.881 33.366 25.017 1.00 0.00 ? 16 LEU A CA     6  
ATOM 10340 C C      . LEU A 1 18 ? 23.508 33.717 23.656 1.00 0.00 ? 16 LEU A C      6  
ATOM 10341 O O      . LEU A 1 18 ? 23.957 34.845 23.457 1.00 0.00 ? 16 LEU A O      6  
ATOM 10342 C CB     . LEU A 1 18 ? 23.741 32.342 25.788 1.00 0.00 ? 16 LEU A CB     6  
ATOM 10343 C CG     . LEU A 1 18 ? 23.380 32.172 27.275 1.00 0.00 ? 16 LEU A CG     6  
ATOM 10344 C CD1    . LEU A 1 18 ? 24.035 30.916 27.854 1.00 0.00 ? 16 LEU A CD1    6  
ATOM 10345 C CD2    . LEU A 1 18 ? 23.864 33.360 28.110 1.00 0.00 ? 16 LEU A CD2    6  
ATOM 10346 H H      . LEU A 1 18 ? 21.388 31.854 25.125 1.00 0.00 ? 16 LEU A H      6  
ATOM 10347 H HA     . LEU A 1 18 ? 22.838 34.294 25.587 1.00 0.00 ? 16 LEU A HA     6  
ATOM 10348 H HB2    . LEU A 1 18 ? 23.656 31.377 25.288 1.00 0.00 ? 16 LEU A HB2    6  
ATOM 10349 H HB3    . LEU A 1 18 ? 24.781 32.645 25.728 1.00 0.00 ? 16 LEU A HB3    6  
ATOM 10350 H HG     . LEU A 1 18 ? 22.301 32.082 27.386 1.00 0.00 ? 16 LEU A HG     6  
ATOM 10351 H HD11   . LEU A 1 18 ? 23.738 30.789 28.895 1.00 0.00 ? 16 LEU A HD11   6  
ATOM 10352 H HD12   . LEU A 1 18 ? 23.714 30.039 27.293 1.00 0.00 ? 16 LEU A HD12   6  
ATOM 10353 H HD13   . LEU A 1 18 ? 25.119 30.993 27.794 1.00 0.00 ? 16 LEU A HD13   6  
ATOM 10354 H HD21   . LEU A 1 18 ? 23.561 33.218 29.146 1.00 0.00 ? 16 LEU A HD21   6  
ATOM 10355 H HD22   . LEU A 1 18 ? 24.951 33.433 28.057 1.00 0.00 ? 16 LEU A HD22   6  
ATOM 10356 H HD23   . LEU A 1 18 ? 23.424 34.280 27.737 1.00 0.00 ? 16 LEU A HD23   6  
ATOM 10357 N N      . GLU A 1 19 ? 23.493 32.791 22.694 1.00 0.00 ? 17 GLU A N      6  
ATOM 10358 C CA     . GLU A 1 19 ? 24.062 32.975 21.352 1.00 0.00 ? 17 GLU A CA     6  
ATOM 10359 C C      . GLU A 1 19 ? 23.238 33.959 20.508 1.00 0.00 ? 17 GLU A C      6  
ATOM 10360 O O      . GLU A 1 19 ? 23.807 34.800 19.816 1.00 0.00 ? 17 GLU A O      6  
ATOM 10361 C CB     . GLU A 1 19 ? 24.275 31.612 20.656 1.00 0.00 ? 17 GLU A CB     6  
ATOM 10362 C CG     . GLU A 1 19 ? 23.031 31.019 19.970 1.00 0.00 ? 17 GLU A CG     6  
ATOM 10363 C CD     . GLU A 1 19 ? 23.237 29.553 19.571 1.00 0.00 ? 17 GLU A CD     6  
ATOM 10364 O OE1    . GLU A 1 19 ? 24.126 29.246 18.740 1.00 0.00 ? 17 GLU A OE1    6  
ATOM 10365 O OE2    . GLU A 1 19 ? 22.489 28.670 20.046 1.00 0.00 ? 17 GLU A OE2    6  
ATOM 10366 H H      . GLU A 1 19 ? 23.078 31.891 22.914 1.00 0.00 ? 17 GLU A H      6  
ATOM 10367 H HA     . GLU A 1 19 ? 25.048 33.419 21.477 1.00 0.00 ? 17 GLU A HA     6  
ATOM 10368 H HB2    . GLU A 1 19 ? 25.048 31.737 19.897 1.00 0.00 ? 17 GLU A HB2    6  
ATOM 10369 H HB3    . GLU A 1 19 ? 24.654 30.900 21.392 1.00 0.00 ? 17 GLU A HB3    6  
ATOM 10370 H HG2    . GLU A 1 19 ? 22.171 31.100 20.633 1.00 0.00 ? 17 GLU A HG2    6  
ATOM 10371 H HG3    . GLU A 1 19 ? 22.809 31.601 19.073 1.00 0.00 ? 17 GLU A HG3    6  
ATOM 10372 N N      . ALA A 1 20 ? 21.905 33.927 20.635 1.00 0.00 ? 18 ALA A N      6  
ATOM 10373 C CA     . ALA A 1 20 ? 21.011 34.871 19.966 1.00 0.00 ? 18 ALA A CA     6  
ATOM 10374 C C      . ALA A 1 20 ? 21.231 36.311 20.465 1.00 0.00 ? 18 ALA A C      6  
ATOM 10375 O O      . ALA A 1 20 ? 21.188 37.255 19.675 1.00 0.00 ? 18 ALA A O      6  
ATOM 10376 C CB     . ALA A 1 20 ? 19.566 34.407 20.182 1.00 0.00 ? 18 ALA A CB     6  
ATOM 10377 H H      . ALA A 1 20 ? 21.498 33.218 21.227 1.00 0.00 ? 18 ALA A H      6  
ATOM 10378 H HA     . ALA A 1 20 ? 21.223 34.857 18.895 1.00 0.00 ? 18 ALA A HA     6  
ATOM 10379 H HB1    . ALA A 1 20 ? 19.439 33.399 19.786 1.00 0.00 ? 18 ALA A HB1    6  
ATOM 10380 H HB2    . ALA A 1 20 ? 19.321 34.416 21.246 1.00 0.00 ? 18 ALA A HB2    6  
ATOM 10381 H HB3    . ALA A 1 20 ? 18.887 35.078 19.655 1.00 0.00 ? 18 ALA A HB3    6  
ATOM 10382 N N      . THR A 1 21 ? 21.547 36.484 21.755 1.00 0.00 ? 19 THR A N      6  
ATOM 10383 C CA     . THR A 1 21 ? 21.981 37.779 22.298 1.00 0.00 ? 19 THR A CA     6  
ATOM 10384 C C      . THR A 1 21 ? 23.389 38.138 21.820 1.00 0.00 ? 19 THR A C      6  
ATOM 10385 O O      . THR A 1 21 ? 23.592 39.244 21.326 1.00 0.00 ? 19 THR A O      6  
ATOM 10386 C CB     . THR A 1 21 ? 21.897 37.805 23.831 1.00 0.00 ? 19 THR A CB     6  
ATOM 10387 O OG1    . THR A 1 21 ? 20.576 37.506 24.229 1.00 0.00 ? 19 THR A OG1    6  
ATOM 10388 C CG2    . THR A 1 21 ? 22.233 39.190 24.389 1.00 0.00 ? 19 THR A CG2    6  
ATOM 10389 H H      . THR A 1 21 ? 21.529 35.679 22.369 1.00 0.00 ? 19 THR A H      6  
ATOM 10390 H HA     . THR A 1 21 ? 21.309 38.551 21.924 1.00 0.00 ? 19 THR A HA     6  
ATOM 10391 H HB     . THR A 1 21 ? 22.578 37.067 24.256 1.00 0.00 ? 19 THR A HB     6  
ATOM 10392 H HG1    . THR A 1 21 ? 20.487 36.534 24.241 1.00 0.00 ? 19 THR A HG1    6  
ATOM 10393 H HG21   . THR A 1 21 ? 23.258 39.465 24.141 1.00 0.00 ? 19 THR A HG21   6  
ATOM 10394 H HG22   . THR A 1 21 ? 21.551 39.936 23.980 1.00 0.00 ? 19 THR A HG22   6  
ATOM 10395 H HG23   . THR A 1 21 ? 22.143 39.181 25.472 1.00 0.00 ? 19 THR A HG23   6  
ATOM 10396 N N      . PHE A 1 22 ? 24.354 37.214 21.884 1.00 0.00 ? 20 PHE A N      6  
ATOM 10397 C CA     . PHE A 1 22 ? 25.739 37.439 21.445 1.00 0.00 ? 20 PHE A CA     6  
ATOM 10398 C C      . PHE A 1 22 ? 25.836 37.893 19.977 1.00 0.00 ? 20 PHE A C      6  
ATOM 10399 O O      . PHE A 1 22 ? 26.616 38.790 19.665 1.00 0.00 ? 20 PHE A O      6  
ATOM 10400 C CB     . PHE A 1 22 ? 26.542 36.151 21.694 1.00 0.00 ? 20 PHE A CB     6  
ATOM 10401 C CG     . PHE A 1 22 ? 28.004 36.204 21.288 1.00 0.00 ? 20 PHE A CG     6  
ATOM 10402 C CD1    . PHE A 1 22 ? 28.888 37.075 21.949 1.00 0.00 ? 20 PHE A CD1    6  
ATOM 10403 C CD2    . PHE A 1 22 ? 28.487 35.378 20.253 1.00 0.00 ? 20 PHE A CD2    6  
ATOM 10404 C CE1    . PHE A 1 22 ? 30.235 37.152 21.554 1.00 0.00 ? 20 PHE A CE1    6  
ATOM 10405 C CE2    . PHE A 1 22 ? 29.842 35.433 19.880 1.00 0.00 ? 20 PHE A CE2    6  
ATOM 10406 C CZ     . PHE A 1 22 ? 30.713 36.331 20.520 1.00 0.00 ? 20 PHE A CZ     6  
ATOM 10407 H H      . PHE A 1 22 ? 24.134 36.312 22.296 1.00 0.00 ? 20 PHE A H      6  
ATOM 10408 H HA     . PHE A 1 22 ? 26.168 38.237 22.051 1.00 0.00 ? 20 PHE A HA     6  
ATOM 10409 H HB2    . PHE A 1 22 ? 26.496 35.911 22.758 1.00 0.00 ? 20 PHE A HB2    6  
ATOM 10410 H HB3    . PHE A 1 22 ? 26.063 35.338 21.153 1.00 0.00 ? 20 PHE A HB3    6  
ATOM 10411 H HD1    . PHE A 1 22 ? 28.532 37.691 22.758 1.00 0.00 ? 20 PHE A HD1    6  
ATOM 10412 H HD2    . PHE A 1 22 ? 27.820 34.696 19.742 1.00 0.00 ? 20 PHE A HD2    6  
ATOM 10413 H HE1    . PHE A 1 22 ? 30.898 37.851 22.042 1.00 0.00 ? 20 PHE A HE1    6  
ATOM 10414 H HE2    . PHE A 1 22 ? 30.211 34.792 19.089 1.00 0.00 ? 20 PHE A HE2    6  
ATOM 10415 H HZ     . PHE A 1 22 ? 31.751 36.390 20.216 1.00 0.00 ? 20 PHE A HZ     6  
ATOM 10416 N N      . GLN A 1 23 ? 24.982 37.366 19.090 1.00 0.00 ? 21 GLN A N      6  
ATOM 10417 C CA     . GLN A 1 23 ? 24.908 37.763 17.675 1.00 0.00 ? 21 GLN A CA     6  
ATOM 10418 C C      . GLN A 1 23 ? 24.288 39.156 17.425 1.00 0.00 ? 21 GLN A C      6  
ATOM 10419 O O      . GLN A 1 23 ? 24.230 39.592 16.273 1.00 0.00 ? 21 GLN A O      6  
ATOM 10420 C CB     . GLN A 1 23 ? 24.187 36.665 16.866 1.00 0.00 ? 21 GLN A CB     6  
ATOM 10421 C CG     . GLN A 1 23 ? 24.970 35.344 16.746 1.00 0.00 ? 21 GLN A CG     6  
ATOM 10422 C CD     . GLN A 1 23 ? 26.171 35.423 15.803 1.00 0.00 ? 21 GLN A CD     6  
ATOM 10423 O OE1    . GLN A 1 23 ? 27.118 36.174 16.004 1.00 0.00 ? 21 GLN A OE1    6  
ATOM 10424 N NE2    . GLN A 1 23 ? 26.193 34.653 14.741 1.00 0.00 ? 21 GLN A NE2    6  
ATOM 10425 H H      . GLN A 1 23 ? 24.392 36.597 19.398 1.00 0.00 ? 21 GLN A H      6  
ATOM 10426 H HA     . GLN A 1 23 ? 25.929 37.844 17.305 1.00 0.00 ? 21 GLN A HA     6  
ATOM 10427 H HB2    . GLN A 1 23 ? 23.223 36.461 17.336 1.00 0.00 ? 21 GLN A HB2    6  
ATOM 10428 H HB3    . GLN A 1 23 ? 23.990 37.026 15.855 1.00 0.00 ? 21 GLN A HB3    6  
ATOM 10429 H HG2    . GLN A 1 23 ? 25.322 35.022 17.725 1.00 0.00 ? 21 GLN A HG2    6  
ATOM 10430 H HG3    . GLN A 1 23 ? 24.284 34.580 16.380 1.00 0.00 ? 21 GLN A HG3    6  
ATOM 10431 H HE21   . GLN A 1 23 ? 25.401 34.057 14.524 1.00 0.00 ? 21 GLN A HE21   6  
ATOM 10432 H HE22   . GLN A 1 23 ? 27.023 34.646 14.157 1.00 0.00 ? 21 GLN A HE22   6  
ATOM 10433 N N      . ARG A 1 24 ? 23.852 39.893 18.457 1.00 0.00 ? 22 ARG A N      6  
ATOM 10434 C CA     . ARG A 1 24 ? 23.440 41.313 18.351 1.00 0.00 ? 22 ARG A CA     6  
ATOM 10435 C C      . ARG A 1 24 ? 24.067 42.243 19.397 1.00 0.00 ? 22 ARG A C      6  
ATOM 10436 O O      . ARG A 1 24 ? 24.060 43.459 19.205 1.00 0.00 ? 22 ARG A O      6  
ATOM 10437 C CB     . ARG A 1 24 ? 21.903 41.420 18.340 1.00 0.00 ? 22 ARG A CB     6  
ATOM 10438 C CG     . ARG A 1 24 ? 21.255 41.076 19.690 1.00 0.00 ? 22 ARG A CG     6  
ATOM 10439 C CD     . ARG A 1 24 ? 19.737 41.261 19.640 1.00 0.00 ? 22 ARG A CD     6  
ATOM 10440 N NE     . ARG A 1 24 ? 19.163 41.204 20.995 1.00 0.00 ? 22 ARG A NE     6  
ATOM 10441 C CZ     . ARG A 1 24 ? 18.908 42.220 21.799 1.00 0.00 ? 22 ARG A CZ     6  
ATOM 10442 N NH1    . ARG A 1 24 ? 19.178 43.459 21.509 1.00 0.00 ? 22 ARG A NH1    6  
ATOM 10443 N NH2    . ARG A 1 24 ? 18.366 41.999 22.955 1.00 0.00 1 22 ARG A NH2    6  
ATOM 10444 H H      . ARG A 1 24 ? 23.855 39.454 19.373 1.00 0.00 ? 22 ARG A H      6  
ATOM 10445 H HA     . ARG A 1 24 ? 23.787 41.707 17.395 1.00 0.00 ? 22 ARG A HA     6  
ATOM 10446 H HB2    . ARG A 1 24 ? 21.630 42.442 18.069 1.00 0.00 ? 22 ARG A HB2    6  
ATOM 10447 H HB3    . ARG A 1 24 ? 21.502 40.761 17.571 1.00 0.00 ? 22 ARG A HB3    6  
ATOM 10448 H HG2    . ARG A 1 24 ? 21.473 40.041 19.950 1.00 0.00 ? 22 ARG A HG2    6  
ATOM 10449 H HG3    . ARG A 1 24 ? 21.660 41.729 20.463 1.00 0.00 ? 22 ARG A HG3    6  
ATOM 10450 H HD2    . ARG A 1 24 ? 19.501 42.219 19.174 1.00 0.00 ? 22 ARG A HD2    6  
ATOM 10451 H HD3    . ARG A 1 24 ? 19.304 40.471 19.023 1.00 0.00 ? 22 ARG A HD3    6  
ATOM 10452 H HE     . ARG A 1 24 ? 18.935 40.293 21.378 1.00 0.00 ? 22 ARG A HE     6  
ATOM 10453 H HH11   . ARG A 1 24 ? 19.697 43.699 20.682 1.00 0.00 ? 22 ARG A HH11   6  
ATOM 10454 H HH12   . ARG A 1 24 ? 18.911 44.181 22.171 1.00 0.00 ? 22 ARG A HH12   6  
ATOM 10455 H HH21   . ARG A 1 24 ? 18.235 41.037 23.247 1.00 0.00 ? 22 ARG A HH21   6  
ATOM 10456 H HH22   . ARG A 1 24 ? 18.201 42.792 23.563 1.00 0.00 ? 22 ARG A HH22   6  
ATOM 10457 N N      . ASN A 1 25 ? 24.588 41.702 20.495 1.00 0.00 ? 23 ASN A N      6  
ATOM 10458 C CA     . ASN A 1 25 ? 25.189 42.421 21.615 1.00 0.00 ? 23 ASN A CA     6  
ATOM 10459 C C      . ASN A 1 25 ? 26.290 41.545 22.248 1.00 0.00 ? 23 ASN A C      6  
ATOM 10460 O O      . ASN A 1 25 ? 26.025 40.749 23.151 1.00 0.00 ? 23 ASN A O      6  
ATOM 10461 C CB     . ASN A 1 25 ? 24.064 42.779 22.615 1.00 0.00 ? 23 ASN A CB     6  
ATOM 10462 C CG     . ASN A 1 25 ? 24.533 43.623 23.789 1.00 0.00 ? 23 ASN A CG     6  
ATOM 10463 O OD1    . ASN A 1 25 ? 25.670 44.069 23.864 1.00 0.00 ? 23 ASN A OD1    6  
ATOM 10464 N ND2    . ASN A 1 25 ? 23.657 43.902 24.723 1.00 0.00 ? 23 ASN A ND2    6  
ATOM 10465 H H      . ASN A 1 25 ? 24.493 40.700 20.609 1.00 0.00 ? 23 ASN A H      6  
ATOM 10466 H HA     . ASN A 1 25 ? 25.647 43.342 21.253 1.00 0.00 ? 23 ASN A HA     6  
ATOM 10467 H HB2    . ASN A 1 25 ? 23.286 43.340 22.098 1.00 0.00 ? 23 ASN A HB2    6  
ATOM 10468 H HB3    . ASN A 1 25 ? 23.616 41.865 23.004 1.00 0.00 ? 23 ASN A HB3    6  
ATOM 10469 H HD21   . ASN A 1 25 ? 22.701 43.558 24.653 1.00 0.00 ? 23 ASN A HD21   6  
ATOM 10470 H HD22   . ASN A 1 25 ? 23.906 44.557 25.451 1.00 0.00 ? 23 ASN A HD22   6  
ATOM 10471 N N      . ARG A 1 26 ? 27.530 41.676 21.765 1.00 0.00 ? 24 ARG A N      6  
ATOM 10472 C CA     . ARG A 1 26 ? 28.704 40.914 22.237 1.00 0.00 ? 24 ARG A CA     6  
ATOM 10473 C C      . ARG A 1 26 ? 29.193 41.353 23.621 1.00 0.00 ? 24 ARG A C      6  
ATOM 10474 O O      . ARG A 1 26 ? 29.924 40.602 24.270 1.00 0.00 ? 24 ARG A O      6  
ATOM 10475 C CB     . ARG A 1 26 ? 29.851 41.053 21.222 1.00 0.00 ? 24 ARG A CB     6  
ATOM 10476 C CG     . ARG A 1 26 ? 29.506 40.514 19.820 1.00 0.00 ? 24 ARG A CG     6  
ATOM 10477 C CD     . ARG A 1 26 ? 30.598 40.866 18.804 1.00 0.00 ? 24 ARG A CD     6  
ATOM 10478 N NE     . ARG A 1 26 ? 30.686 42.321 18.573 1.00 0.00 ? 24 ARG A NE     6  
ATOM 10479 C CZ     . ARG A 1 26 ? 31.651 42.960 17.938 1.00 0.00 ? 24 ARG A CZ     6  
ATOM 10480 N NH1    . ARG A 1 26 ? 32.702 42.348 17.468 1.00 0.00 1 24 ARG A NH1    6  
ATOM 10481 N NH2    . ARG A 1 26 ? 31.585 44.246 17.765 1.00 0.00 ? 24 ARG A NH2    6  
ATOM 10482 H H      . ARG A 1 26 ? 27.683 42.340 21.011 1.00 0.00 ? 24 ARG A H      6  
ATOM 10483 H HA     . ARG A 1 26 ? 28.432 39.864 22.316 1.00 0.00 ? 24 ARG A HA     6  
ATOM 10484 H HB2    . ARG A 1 26 ? 30.123 42.107 21.157 1.00 0.00 ? 24 ARG A HB2    6  
ATOM 10485 H HB3    . ARG A 1 26 ? 30.724 40.511 21.591 1.00 0.00 ? 24 ARG A HB3    6  
ATOM 10486 H HG2    . ARG A 1 26 ? 29.406 39.430 19.872 1.00 0.00 ? 24 ARG A HG2    6  
ATOM 10487 H HG3    . ARG A 1 26 ? 28.560 40.926 19.468 1.00 0.00 ? 24 ARG A HG3    6  
ATOM 10488 H HD2    . ARG A 1 26 ? 31.550 40.490 19.174 1.00 0.00 ? 24 ARG A HD2    6  
ATOM 10489 H HD3    . ARG A 1 26 ? 30.370 40.367 17.860 1.00 0.00 ? 24 ARG A HD3    6  
ATOM 10490 H HE     . ARG A 1 26 ? 29.923 42.889 18.935 1.00 0.00 ? 24 ARG A HE     6  
ATOM 10491 H HH11   . ARG A 1 26 ? 32.792 41.347 17.596 1.00 0.00 ? 24 ARG A HH11   6  
ATOM 10492 H HH12   . ARG A 1 26 ? 33.442 42.887 17.049 1.00 0.00 ? 24 ARG A HH12   6  
ATOM 10493 H HH21   . ARG A 1 26 ? 30.805 44.779 18.151 1.00 0.00 ? 24 ARG A HH21   6  
ATOM 10494 H HH22   . ARG A 1 26 ? 32.226 44.736 17.162 1.00 0.00 ? 24 ARG A HH22   6  
ATOM 10495 N N      . TYR A 1 27 ? 28.794 42.548 24.063 1.00 0.00 ? 25 TYR A N      6  
ATOM 10496 C CA     . TYR A 1 27 ? 29.246 43.212 25.292 1.00 0.00 ? 25 TYR A CA     6  
ATOM 10497 C C      . TYR A 1 27 ? 28.044 43.707 26.139 1.00 0.00 ? 25 TYR A C      6  
ATOM 10498 O O      . TYR A 1 27 ? 27.820 44.916 26.252 1.00 0.00 ? 25 TYR A O      6  
ATOM 10499 C CB     . TYR A 1 27 ? 30.221 44.342 24.900 1.00 0.00 ? 25 TYR A CB     6  
ATOM 10500 C CG     . TYR A 1 27 ? 31.273 43.977 23.863 1.00 0.00 ? 25 TYR A CG     6  
ATOM 10501 C CD1    . TYR A 1 27 ? 32.304 43.069 24.178 1.00 0.00 ? 25 TYR A CD1    6  
ATOM 10502 C CD2    . TYR A 1 27 ? 31.211 44.540 22.573 1.00 0.00 ? 25 TYR A CD2    6  
ATOM 10503 C CE1    . TYR A 1 27 ? 33.264 42.723 23.207 1.00 0.00 ? 25 TYR A CE1    6  
ATOM 10504 C CE2    . TYR A 1 27 ? 32.177 44.211 21.605 1.00 0.00 ? 25 TYR A CE2    6  
ATOM 10505 C CZ     . TYR A 1 27 ? 33.204 43.298 21.917 1.00 0.00 ? 25 TYR A CZ     6  
ATOM 10506 O OH     . TYR A 1 27 ? 34.128 42.979 20.970 1.00 0.00 ? 25 TYR A OH     6  
ATOM 10507 H H      . TYR A 1 27 ? 28.231 43.097 23.428 1.00 0.00 ? 25 TYR A H      6  
ATOM 10508 H HA     . TYR A 1 27 ? 29.803 42.501 25.903 1.00 0.00 ? 25 TYR A HA     6  
ATOM 10509 H HB2    . TYR A 1 27 ? 29.648 45.184 24.512 1.00 0.00 ? 25 TYR A HB2    6  
ATOM 10510 H HB3    . TYR A 1 27 ? 30.733 44.685 25.796 1.00 0.00 ? 25 TYR A HB3    6  
ATOM 10511 H HD1    . TYR A 1 27 ? 32.355 42.640 25.169 1.00 0.00 ? 25 TYR A HD1    6  
ATOM 10512 H HD2    . TYR A 1 27 ? 30.416 45.228 22.321 1.00 0.00 ? 25 TYR A HD2    6  
ATOM 10513 H HE1    . TYR A 1 27 ? 34.052 42.030 23.452 1.00 0.00 ? 25 TYR A HE1    6  
ATOM 10514 H HE2    . TYR A 1 27 ? 32.130 44.648 20.619 1.00 0.00 ? 25 TYR A HE2    6  
ATOM 10515 H HH     . TYR A 1 27 ? 34.702 42.252 21.275 1.00 0.00 ? 25 TYR A HH     6  
ATOM 10516 N N      . PRO A 1 28 ? 27.207 42.807 26.698 1.00 0.00 ? 26 PRO A N      6  
ATOM 10517 C CA     . PRO A 1 28 ? 25.983 43.176 27.424 1.00 0.00 ? 26 PRO A CA     6  
ATOM 10518 C C      . PRO A 1 28 ? 26.245 43.831 28.796 1.00 0.00 ? 26 PRO A C      6  
ATOM 10519 O O      . PRO A 1 28 ? 27.387 43.940 29.246 1.00 0.00 ? 26 PRO A O      6  
ATOM 10520 C CB     . PRO A 1 28 ? 25.180 41.871 27.535 1.00 0.00 ? 26 PRO A CB     6  
ATOM 10521 C CG     . PRO A 1 28 ? 26.265 40.797 27.567 1.00 0.00 ? 26 PRO A CG     6  
ATOM 10522 C CD     . PRO A 1 28 ? 27.315 41.355 26.610 1.00 0.00 ? 26 PRO A CD     6  
ATOM 10523 H HA     . PRO A 1 28 ? 25.410 43.882 26.827 1.00 0.00 ? 26 PRO A HA     6  
ATOM 10524 H HB2    . PRO A 1 28 ? 24.550 41.833 28.425 1.00 0.00 ? 26 PRO A HB2    6  
ATOM 10525 H HB3    . PRO A 1 28 ? 24.573 41.742 26.638 1.00 0.00 ? 26 PRO A HB3    6  
ATOM 10526 H HG2    . PRO A 1 28 ? 26.681 40.723 28.571 1.00 0.00 ? 26 PRO A HG2    6  
ATOM 10527 H HG3    . PRO A 1 28 ? 25.886 39.831 27.237 1.00 0.00 ? 26 PRO A HG3    6  
ATOM 10528 H HD2    . PRO A 1 28 ? 28.309 41.006 26.891 1.00 0.00 ? 26 PRO A HD2    6  
ATOM 10529 H HD3    . PRO A 1 28 ? 27.078 41.036 25.594 1.00 0.00 ? 26 PRO A HD3    6  
ATOM 10530 N N      . ASP A 1 29 ? 25.176 44.275 29.462 1.00 0.00 ? 27 ASP A N      6  
ATOM 10531 C CA     . ASP A 1 29 ? 25.182 44.899 30.798 1.00 0.00 ? 27 ASP A CA     6  
ATOM 10532 C C      . ASP A 1 29 ? 24.649 43.975 31.908 1.00 0.00 ? 27 ASP A C      6  
ATOM 10533 O O      . ASP A 1 29 ? 23.863 43.068 31.636 1.00 0.00 ? 27 ASP A O      6  
ATOM 10534 C CB     . ASP A 1 29 ? 24.360 46.192 30.759 1.00 0.00 ? 27 ASP A CB     6  
ATOM 10535 C CG     . ASP A 1 29 ? 22.872 45.936 30.512 1.00 0.00 ? 27 ASP A CG     6  
ATOM 10536 O OD1    . ASP A 1 29 ? 22.478 45.788 29.328 1.00 0.00 ? 27 ASP A OD1    6  
ATOM 10537 O OD2    . ASP A 1 29 ? 22.082 45.909 31.486 1.00 0.00 ? 27 ASP A OD2    6  
ATOM 10538 H H      . ASP A 1 29 ? 24.274 44.193 29.014 1.00 0.00 ? 27 ASP A H      6  
ATOM 10539 H HA     . ASP A 1 29 ? 26.203 45.171 31.058 1.00 0.00 ? 27 ASP A HA     6  
ATOM 10540 H HB2    . ASP A 1 29 ? 24.478 46.705 31.715 1.00 0.00 ? 27 ASP A HB2    6  
ATOM 10541 H HB3    . ASP A 1 29 ? 24.752 46.843 29.975 1.00 0.00 ? 27 ASP A HB3    6  
ATOM 10542 N N      . MET A 1 30 ? 25.024 44.228 33.168 1.00 0.00 ? 28 MET A N      6  
ATOM 10543 C CA     . MET A 1 30 ? 24.666 43.403 34.337 1.00 0.00 ? 28 MET A CA     6  
ATOM 10544 C C      . MET A 1 30 ? 23.160 43.168 34.530 1.00 0.00 ? 28 MET A C      6  
ATOM 10545 O O      . MET A 1 30 ? 22.770 42.108 35.026 1.00 0.00 ? 28 MET A O      6  
ATOM 10546 C CB     . MET A 1 30 ? 25.306 43.985 35.617 1.00 0.00 ? 28 MET A CB     6  
ATOM 10547 C CG     . MET A 1 30 ? 24.551 45.150 36.280 1.00 0.00 ? 28 MET A CG     6  
ATOM 10548 S SD     . MET A 1 30 ? 24.197 46.589 35.234 1.00 0.00 ? 28 MET A SD     6  
ATOM 10549 C CE     . MET A 1 30 ? 25.831 47.359 35.154 1.00 0.00 ? 28 MET A CE     6  
ATOM 10550 H H      . MET A 1 30 ? 25.731 44.946 33.311 1.00 0.00 ? 28 MET A H      6  
ATOM 10551 H HA     . MET A 1 30 ? 25.104 42.420 34.180 1.00 0.00 ? 28 MET A HA     6  
ATOM 10552 H HB2    . MET A 1 30 ? 25.376 43.183 36.353 1.00 0.00 ? 28 MET A HB2    6  
ATOM 10553 H HB3    . MET A 1 30 ? 26.323 44.310 35.398 1.00 0.00 ? 28 MET A HB3    6  
ATOM 10554 H HG2    . MET A 1 30 ? 23.599 44.772 36.654 1.00 0.00 ? 28 MET A HG2    6  
ATOM 10555 H HG3    . MET A 1 30 ? 25.123 45.486 37.145 1.00 0.00 ? 28 MET A HG3    6  
ATOM 10556 H HE1    . MET A 1 30 ? 25.811 48.183 34.442 1.00 0.00 ? 28 MET A HE1    6  
ATOM 10557 H HE2    . MET A 1 30 ? 26.103 47.737 36.138 1.00 0.00 ? 28 MET A HE2    6  
ATOM 10558 H HE3    . MET A 1 30 ? 26.571 46.629 34.837 1.00 0.00 ? 28 MET A HE3    6  
ATOM 10559 N N      . SER A 1 31 ? 22.305 44.113 34.127 1.00 0.00 ? 29 SER A N      6  
ATOM 10560 C CA     . SER A 1 31 ? 20.851 43.961 34.244 1.00 0.00 ? 29 SER A CA     6  
ATOM 10561 C C      . SER A 1 31 ? 20.291 43.077 33.119 1.00 0.00 ? 29 SER A C      6  
ATOM 10562 O O      . SER A 1 31 ? 19.482 42.183 33.362 1.00 0.00 ? 29 SER A O      6  
ATOM 10563 C CB     . SER A 1 31 ? 20.173 45.329 34.312 1.00 0.00 ? 29 SER A CB     6  
ATOM 10564 O OG     . SER A 1 31 ? 18.981 45.210 35.061 1.00 0.00 ? 29 SER A OG     6  
ATOM 10565 H H      . SER A 1 31 ? 22.678 44.959 33.715 1.00 0.00 ? 29 SER A H      6  
ATOM 10566 H HA     . SER A 1 31 ? 20.649 43.469 35.191 1.00 0.00 ? 29 SER A HA     6  
ATOM 10567 H HB2    . SER A 1 31 ? 20.827 46.044 34.815 1.00 0.00 ? 29 SER A HB2    6  
ATOM 10568 H HB3    . SER A 1 31 ? 19.956 45.690 33.308 1.00 0.00 ? 29 SER A HB3    6  
ATOM 10569 H HG     . SER A 1 31 ? 19.244 45.134 36.005 1.00 0.00 ? 29 SER A HG     6  
ATOM 10570 N N      . THR A 1 32 ? 20.809 43.218 31.896 1.00 0.00 ? 30 THR A N      6  
ATOM 10571 C CA     . THR A 1 32 ? 20.516 42.290 30.787 1.00 0.00 ? 30 THR A CA     6  
ATOM 10572 C C      . THR A 1 32 ? 21.046 40.880 31.070 1.00 0.00 ? 30 THR A C      6  
ATOM 10573 O O      . THR A 1 32 ? 20.350 39.897 30.812 1.00 0.00 ? 30 THR A O      6  
ATOM 10574 C CB     . THR A 1 32 ? 21.091 42.843 29.475 1.00 0.00 ? 30 THR A CB     6  
ATOM 10575 O OG1    . THR A 1 32 ? 20.426 44.050 29.165 1.00 0.00 ? 30 THR A OG1    6  
ATOM 10576 C CG2    . THR A 1 32 ? 20.907 41.912 28.277 1.00 0.00 ? 30 THR A CG2    6  
ATOM 10577 H H      . THR A 1 32 ? 21.453 43.988 31.737 1.00 0.00 ? 30 THR A H      6  
ATOM 10578 H HA     . THR A 1 32 ? 19.434 42.203 30.675 1.00 0.00 ? 30 THR A HA     6  
ATOM 10579 H HB     . THR A 1 32 ? 22.155 43.045 29.598 1.00 0.00 ? 30 THR A HB     6  
ATOM 10580 H HG1    . THR A 1 32 ? 21.110 44.755 29.218 1.00 0.00 ? 30 THR A HG1    6  
ATOM 10581 H HG21   . THR A 1 32 ? 21.517 41.019 28.402 1.00 0.00 ? 30 THR A HG21   6  
ATOM 10582 H HG22   . THR A 1 32 ? 19.860 41.621 28.182 1.00 0.00 ? 30 THR A HG22   6  
ATOM 10583 H HG23   . THR A 1 32 ? 21.231 42.417 27.366 1.00 0.00 ? 30 THR A HG23   6  
ATOM 10584 N N      . ARG A 1 33 ? 22.245 40.760 31.656 1.00 0.00 ? 31 ARG A N      6  
ATOM 10585 C CA     . ARG A 1 33 ? 22.835 39.469 32.039 1.00 0.00 ? 31 ARG A CA     6  
ATOM 10586 C C      . ARG A 1 33 ? 22.024 38.758 33.129 1.00 0.00 ? 31 ARG A C      6  
ATOM 10587 O O      . ARG A 1 33 ? 21.888 37.542 33.047 1.00 0.00 ? 31 ARG A O      6  
ATOM 10588 C CB     . ARG A 1 33 ? 24.313 39.638 32.446 1.00 0.00 ? 31 ARG A CB     6  
ATOM 10589 C CG     . ARG A 1 33 ? 25.253 39.985 31.276 1.00 0.00 ? 31 ARG A CG     6  
ATOM 10590 C CD     . ARG A 1 33 ? 26.743 39.833 31.633 1.00 0.00 ? 31 ARG A CD     6  
ATOM 10591 N NE     . ARG A 1 33 ? 27.142 40.603 32.828 1.00 0.00 ? 31 ARG A NE     6  
ATOM 10592 C CZ     . ARG A 1 33 ? 27.554 41.854 32.909 1.00 0.00 ? 31 ARG A CZ     6  
ATOM 10593 N NH1    . ARG A 1 33 ? 27.755 42.640 31.901 1.00 0.00 ? 31 ARG A NH1    6  
ATOM 10594 N NH2    . ARG A 1 33 ? 27.785 42.360 34.075 1.00 0.00 1 31 ARG A NH2    6  
ATOM 10595 H H      . ARG A 1 33 ? 22.774 41.612 31.830 1.00 0.00 ? 31 ARG A H      6  
ATOM 10596 H HA     . ARG A 1 33 ? 22.793 38.802 31.177 1.00 0.00 ? 31 ARG A HA     6  
ATOM 10597 H HB2    . ARG A 1 33 ? 24.382 40.422 33.199 1.00 0.00 ? 31 ARG A HB2    6  
ATOM 10598 H HB3    . ARG A 1 33 ? 24.653 38.700 32.888 1.00 0.00 ? 31 ARG A HB3    6  
ATOM 10599 H HG2    . ARG A 1 33 ? 25.039 39.318 30.440 1.00 0.00 ? 31 ARG A HG2    6  
ATOM 10600 H HG3    . ARG A 1 33 ? 25.071 41.004 30.941 1.00 0.00 ? 31 ARG A HG3    6  
ATOM 10601 H HD2    . ARG A 1 33 ? 26.940 38.778 31.824 1.00 0.00 ? 31 ARG A HD2    6  
ATOM 10602 H HD3    . ARG A 1 33 ? 27.348 40.132 30.777 1.00 0.00 ? 31 ARG A HD3    6  
ATOM 10603 H HE     . ARG A 1 33 ? 27.076 40.139 33.732 1.00 0.00 ? 31 ARG A HE     6  
ATOM 10604 H HH11   . ARG A 1 33 ? 27.826 42.278 30.959 1.00 0.00 ? 31 ARG A HH11   6  
ATOM 10605 H HH12   . ARG A 1 33 ? 27.962 43.615 32.102 1.00 0.00 ? 31 ARG A HH12   6  
ATOM 10606 H HH21   . ARG A 1 33 ? 27.691 41.764 34.891 1.00 0.00 ? 31 ARG A HH21   6  
ATOM 10607 H HH22   . ARG A 1 33 ? 28.008 43.349 34.158 1.00 0.00 ? 31 ARG A HH22   6  
ATOM 10608 N N      . GLU A 1 34 ? 21.435 39.469 34.099 1.00 0.00 ? 32 GLU A N      6  
ATOM 10609 C CA     . GLU A 1 34 ? 20.549 38.825 35.086 1.00 0.00 ? 32 GLU A CA     6  
ATOM 10610 C C      . GLU A 1 34 ? 19.166 38.448 34.527 1.00 0.00 ? 32 GLU A C      6  
ATOM 10611 O O      . GLU A 1 34 ? 18.599 37.452 34.969 1.00 0.00 ? 32 GLU A O      6  
ATOM 10612 C CB     . GLU A 1 34 ? 20.426 39.619 36.396 1.00 0.00 ? 32 GLU A CB     6  
ATOM 10613 C CG     . GLU A 1 34 ? 19.496 40.833 36.346 1.00 0.00 ? 32 GLU A CG     6  
ATOM 10614 C CD     . GLU A 1 34 ? 19.245 41.379 37.746 1.00 0.00 ? 32 GLU A CD     6  
ATOM 10615 O OE1    . GLU A 1 34 ? 18.289 40.923 38.417 1.00 0.00 ? 32 GLU A OE1    6  
ATOM 10616 O OE2    . GLU A 1 34 ? 20.015 42.246 38.219 1.00 0.00 ? 32 GLU A OE2    6  
ATOM 10617 H H      . GLU A 1 34 ? 21.601 40.466 34.157 1.00 0.00 ? 32 GLU A H      6  
ATOM 10618 H HA     . GLU A 1 34 ? 21.018 37.882 35.368 1.00 0.00 ? 32 GLU A HA     6  
ATOM 10619 H HB2    . GLU A 1 34 ? 20.044 38.935 37.152 1.00 0.00 ? 32 GLU A HB2    6  
ATOM 10620 H HB3    . GLU A 1 34 ? 21.413 39.948 36.715 1.00 0.00 ? 32 GLU A HB3    6  
ATOM 10621 H HG2    . GLU A 1 34 ? 19.965 41.596 35.739 1.00 0.00 ? 32 GLU A HG2    6  
ATOM 10622 H HG3    . GLU A 1 34 ? 18.535 40.569 35.903 1.00 0.00 ? 32 GLU A HG3    6  
ATOM 10623 N N      . GLU A 1 35 ? 18.622 39.179 33.547 1.00 0.00 ? 33 GLU A N      6  
ATOM 10624 C CA     . GLU A 1 35 ? 17.365 38.790 32.885 1.00 0.00 ? 33 GLU A CA     6  
ATOM 10625 C C      . GLU A 1 35 ? 17.549 37.498 32.076 1.00 0.00 ? 33 GLU A C      6  
ATOM 10626 O O      . GLU A 1 35 ? 16.785 36.548 32.242 1.00 0.00 ? 33 GLU A O      6  
ATOM 10627 C CB     . GLU A 1 35 ? 16.833 39.935 32.006 1.00 0.00 ? 33 GLU A CB     6  
ATOM 10628 C CG     . GLU A 1 35 ? 16.217 41.057 32.853 1.00 0.00 ? 33 GLU A CG     6  
ATOM 10629 C CD     . GLU A 1 35 ? 15.751 42.231 31.984 1.00 0.00 ? 33 GLU A CD     6  
ATOM 10630 O OE1    . GLU A 1 35 ? 14.617 42.192 31.455 1.00 0.00 ? 33 GLU A OE1    6  
ATOM 10631 O OE2    . GLU A 1 35 ? 16.486 43.237 31.844 1.00 0.00 ? 33 GLU A OE2    6  
ATOM 10632 H H      . GLU A 1 35 ? 19.076 40.043 33.264 1.00 0.00 ? 33 GLU A H      6  
ATOM 10633 H HA     . GLU A 1 35 ? 16.614 38.568 33.645 1.00 0.00 ? 33 GLU A HA     6  
ATOM 10634 H HB2    . GLU A 1 35 ? 17.641 40.336 31.393 1.00 0.00 ? 33 GLU A HB2    6  
ATOM 10635 H HB3    . GLU A 1 35 ? 16.060 39.545 31.343 1.00 0.00 ? 33 GLU A HB3    6  
ATOM 10636 H HG2    . GLU A 1 35 ? 15.366 40.655 33.408 1.00 0.00 ? 33 GLU A HG2    6  
ATOM 10637 H HG3    . GLU A 1 35 ? 16.948 41.411 33.582 1.00 0.00 ? 33 GLU A HG3    6  
ATOM 10638 N N      . ILE A 1 36 ? 18.630 37.400 31.294 1.00 0.00 ? 34 ILE A N      6  
ATOM 10639 C CA     . ILE A 1 36 ? 18.992 36.167 30.574 1.00 0.00 ? 34 ILE A CA     6  
ATOM 10640 C C      . ILE A 1 36 ? 19.272 35.014 31.553 1.00 0.00 ? 34 ILE A C      6  
ATOM 10641 O O      . ILE A 1 36 ? 18.948 33.860 31.257 1.00 0.00 ? 34 ILE A O      6  
ATOM 10642 C CB     . ILE A 1 36 ? 20.172 36.446 29.614 1.00 0.00 ? 34 ILE A CB     6  
ATOM 10643 C CG1    . ILE A 1 36 ? 19.728 37.445 28.517 1.00 0.00 ? 34 ILE A CG1    6  
ATOM 10644 C CG2    . ILE A 1 36 ? 20.685 35.148 28.959 1.00 0.00 ? 34 ILE A CG2    6  
ATOM 10645 C CD1    . ILE A 1 36 ? 20.888 38.039 27.715 1.00 0.00 ? 34 ILE A CD1    6  
ATOM 10646 H H      . ILE A 1 36 ? 19.234 38.214 31.205 1.00 0.00 ? 34 ILE A H      6  
ATOM 10647 H HA     . ILE A 1 36 ? 18.137 35.859 29.975 1.00 0.00 ? 34 ILE A HA     6  
ATOM 10648 H HB     . ILE A 1 36 ? 20.987 36.888 30.189 1.00 0.00 ? 34 ILE A HB     6  
ATOM 10649 H HG12   . ILE A 1 36 ? 19.036 36.953 27.832 1.00 0.00 ? 34 ILE A HG12   6  
ATOM 10650 H HG13   . ILE A 1 36 ? 19.199 38.283 28.969 1.00 0.00 ? 34 ILE A HG13   6  
ATOM 10651 H HG21   . ILE A 1 36 ? 19.869 34.635 28.447 1.00 0.00 ? 34 ILE A HG21   6  
ATOM 10652 H HG22   . ILE A 1 36 ? 21.465 35.373 28.235 1.00 0.00 ? 34 ILE A HG22   6  
ATOM 10653 H HG23   . ILE A 1 36 ? 21.115 34.483 29.707 1.00 0.00 ? 34 ILE A HG23   6  
ATOM 10654 H HD11   . ILE A 1 36 ? 21.630 38.466 28.392 1.00 0.00 ? 34 ILE A HD11   6  
ATOM 10655 H HD12   . ILE A 1 36 ? 21.356 37.278 27.091 1.00 0.00 ? 34 ILE A HD12   6  
ATOM 10656 H HD13   . ILE A 1 36 ? 20.499 38.826 27.071 1.00 0.00 ? 34 ILE A HD13   6  
ATOM 10657 N N      . ALA A 1 37 ? 19.793 35.308 32.749 1.00 0.00 ? 35 ALA A N      6  
ATOM 10658 C CA     . ALA A 1 37 ? 19.963 34.319 33.809 1.00 0.00 ? 35 ALA A CA     6  
ATOM 10659 C C      . ALA A 1 37 ? 18.623 33.743 34.317 1.00 0.00 ? 35 ALA A C      6  
ATOM 10660 O O      . ALA A 1 37 ? 18.571 32.548 34.610 1.00 0.00 ? 35 ALA A O      6  
ATOM 10661 C CB     . ALA A 1 37 ? 20.799 34.934 34.934 1.00 0.00 ? 35 ALA A CB     6  
ATOM 10662 H H      . ALA A 1 37 ? 20.080 36.261 32.933 1.00 0.00 ? 35 ALA A H      6  
ATOM 10663 H HA     . ALA A 1 37 ? 20.531 33.485 33.398 1.00 0.00 ? 35 ALA A HA     6  
ATOM 10664 H HB1    . ALA A 1 37 ? 21.726 35.349 34.539 1.00 0.00 ? 35 ALA A HB1    6  
ATOM 10665 H HB2    . ALA A 1 37 ? 20.240 35.705 35.453 1.00 0.00 ? 35 ALA A HB2    6  
ATOM 10666 H HB3    . ALA A 1 37 ? 21.041 34.164 35.653 1.00 0.00 ? 35 ALA A HB3    6  
ATOM 10667 N N      . VAL A 1 38 ? 17.525 34.518 34.337 1.00 0.00 ? 36 VAL A N      6  
ATOM 10668 C CA     . VAL A 1 38 ? 16.174 33.980 34.622 1.00 0.00 ? 36 VAL A CA     6  
ATOM 10669 C C      . VAL A 1 38 ? 15.751 33.000 33.526 1.00 0.00 ? 36 VAL A C      6  
ATOM 10670 O O      . VAL A 1 38 ? 15.328 31.882 33.824 1.00 0.00 ? 36 VAL A O      6  
ATOM 10671 C CB     . VAL A 1 38 ? 15.085 35.072 34.764 1.00 0.00 ? 36 VAL A CB     6  
ATOM 10672 C CG1    . VAL A 1 38 ? 13.771 34.465 35.277 1.00 0.00 ? 36 VAL A CG1    6  
ATOM 10673 C CG2    . VAL A 1 38 ? 15.466 36.188 35.739 1.00 0.00 ? 36 VAL A CG2    6  
ATOM 10674 H H      . VAL A 1 38 ? 17.610 35.491 34.062 1.00 0.00 ? 36 VAL A H      6  
ATOM 10675 H HA     . VAL A 1 38 ? 16.221 33.427 35.561 1.00 0.00 ? 36 VAL A HA     6  
ATOM 10676 H HB     . VAL A 1 38 ? 14.897 35.527 33.793 1.00 0.00 ? 36 VAL A HB     6  
ATOM 10677 H HG11   . VAL A 1 38 ? 13.930 33.983 36.243 1.00 0.00 ? 36 VAL A HG11   6  
ATOM 10678 H HG12   . VAL A 1 38 ? 13.019 35.248 35.388 1.00 0.00 ? 36 VAL A HG12   6  
ATOM 10679 H HG13   . VAL A 1 38 ? 13.386 33.732 34.569 1.00 0.00 ? 36 VAL A HG13   6  
ATOM 10680 H HG21   . VAL A 1 38 ? 16.286 36.766 35.328 1.00 0.00 ? 36 VAL A HG21   6  
ATOM 10681 H HG22   . VAL A 1 38 ? 14.623 36.864 35.885 1.00 0.00 ? 36 VAL A HG22   6  
ATOM 10682 H HG23   . VAL A 1 38 ? 15.757 35.764 36.698 1.00 0.00 ? 36 VAL A HG23   6  
ATOM 10683 N N      . TRP A 1 39 ? 15.902 33.382 32.254 1.00 0.00 ? 37 TRP A N      6  
ATOM 10684 C CA     . TRP A 1 39 ? 15.438 32.582 31.108 1.00 0.00 ? 37 TRP A CA     6  
ATOM 10685 C C      . TRP A 1 39 ? 16.189 31.252 30.954 1.00 0.00 ? 37 TRP A C      6  
ATOM 10686 O O      . TRP A 1 39 ? 15.628 30.290 30.426 1.00 0.00 ? 37 TRP A O      6  
ATOM 10687 C CB     . TRP A 1 39 ? 15.548 33.414 29.821 1.00 0.00 ? 37 TRP A CB     6  
ATOM 10688 C CG     . TRP A 1 39 ? 15.037 34.828 29.877 1.00 0.00 ? 37 TRP A CG     6  
ATOM 10689 C CD1    . TRP A 1 39 ? 15.543 35.857 29.156 1.00 0.00 ? 37 TRP A CD1    6  
ATOM 10690 C CD2    . TRP A 1 39 ? 13.975 35.412 30.707 1.00 0.00 ? 37 TRP A CD2    6  
ATOM 10691 N NE1    . TRP A 1 39 ? 14.910 37.030 29.513 1.00 0.00 ? 37 TRP A NE1    6  
ATOM 10692 C CE2    . TRP A 1 39 ? 13.985 36.826 30.512 1.00 0.00 ? 37 TRP A CE2    6  
ATOM 10693 C CE3    . TRP A 1 39 ? 13.021 34.909 31.625 1.00 0.00 ? 37 TRP A CE3    6  
ATOM 10694 C CZ2    . TRP A 1 39 ? 13.165 37.698 31.240 1.00 0.00 ? 37 TRP A CZ2    6  
ATOM 10695 C CZ3    . TRP A 1 39 ? 12.170 35.773 32.341 1.00 0.00 ? 37 TRP A CZ3    6  
ATOM 10696 C CH2    . TRP A 1 39 ? 12.253 37.165 32.165 1.00 0.00 ? 37 TRP A CH2    6  
ATOM 10697 H H      . TRP A 1 39 ? 16.234 34.326 32.075 1.00 0.00 ? 37 TRP A H      6  
ATOM 10698 H HA     . TRP A 1 39 ? 14.389 32.328 31.263 1.00 0.00 ? 37 TRP A HA     6  
ATOM 10699 H HB2    . TRP A 1 39 ? 16.602 33.456 29.537 1.00 0.00 ? 37 TRP A HB2    6  
ATOM 10700 H HB3    . TRP A 1 39 ? 15.019 32.886 29.027 1.00 0.00 ? 37 TRP A HB3    6  
ATOM 10701 H HD1    . TRP A 1 39 ? 16.357 35.778 28.443 1.00 0.00 ? 37 TRP A HD1    6  
ATOM 10702 H HE1    . TRP A 1 39 ? 15.105 37.937 29.095 1.00 0.00 ? 37 TRP A HE1    6  
ATOM 10703 H HE3    . TRP A 1 39 ? 12.944 33.847 31.788 1.00 0.00 ? 37 TRP A HE3    6  
ATOM 10704 H HZ2    . TRP A 1 39 ? 13.238 38.765 31.087 1.00 0.00 ? 37 TRP A HZ2    6  
ATOM 10705 H HZ3    . TRP A 1 39 ? 11.454 35.365 33.042 1.00 0.00 ? 37 TRP A HZ3    6  
ATOM 10706 H HH2    . TRP A 1 39 ? 11.608 37.818 32.734 1.00 0.00 ? 37 TRP A HH2    6  
ATOM 10707 N N      . THR A 1 40 ? 17.436 31.195 31.431 1.00 0.00 ? 38 THR A N      6  
ATOM 10708 C CA     . THR A 1 40 ? 18.359 30.049 31.305 1.00 0.00 ? 38 THR A CA     6  
ATOM 10709 C C      . THR A 1 40 ? 18.622 29.301 32.623 1.00 0.00 ? 38 THR A C      6  
ATOM 10710 O O      . THR A 1 40 ? 19.325 28.292 32.622 1.00 0.00 ? 38 THR A O      6  
ATOM 10711 C CB     . THR A 1 40 ? 19.690 30.508 30.684 1.00 0.00 ? 38 THR A CB     6  
ATOM 10712 O OG1    . THR A 1 40 ? 20.285 31.512 31.474 1.00 0.00 ? 38 THR A OG1    6  
ATOM 10713 C CG2    . THR A 1 40 ? 19.516 31.090 29.279 1.00 0.00 ? 38 THR A CG2    6  
ATOM 10714 H H      . THR A 1 40 ? 17.811 32.052 31.819 1.00 0.00 ? 38 THR A H      6  
ATOM 10715 H HA     . THR A 1 40 ? 17.922 29.314 30.629 1.00 0.00 ? 38 THR A HA     6  
ATOM 10716 H HB     . THR A 1 40 ? 20.366 29.657 30.620 1.00 0.00 ? 38 THR A HB     6  
ATOM 10717 H HG1    . THR A 1 40 ? 19.826 32.348 31.281 1.00 0.00 ? 38 THR A HG1    6  
ATOM 10718 H HG21   . THR A 1 40 ? 18.954 32.022 29.311 1.00 0.00 ? 38 THR A HG21   6  
ATOM 10719 H HG22   . THR A 1 40 ? 20.497 31.278 28.844 1.00 0.00 ? 38 THR A HG22   6  
ATOM 10720 H HG23   . THR A 1 40 ? 18.981 30.381 28.648 1.00 0.00 ? 38 THR A HG23   6  
ATOM 10721 N N      . ASN A 1 41 ? 18.056 29.763 33.745 1.00 0.00 ? 39 ASN A N      6  
ATOM 10722 C CA     . ASN A 1 41 ? 18.318 29.275 35.107 1.00 0.00 ? 39 ASN A CA     6  
ATOM 10723 C C      . ASN A 1 41 ? 19.808 29.317 35.524 1.00 0.00 ? 39 ASN A C      6  
ATOM 10724 O O      . ASN A 1 41 ? 20.330 28.397 36.163 1.00 0.00 ? 39 ASN A O      6  
ATOM 10725 C CB     . ASN A 1 41 ? 17.609 27.927 35.334 1.00 0.00 ? 39 ASN A CB     6  
ATOM 10726 C CG     . ASN A 1 41 ? 17.425 27.637 36.814 1.00 0.00 ? 39 ASN A CG     6  
ATOM 10727 O OD1    . ASN A 1 41 ? 16.704 28.351 37.498 1.00 0.00 ? 39 ASN A OD1    6  
ATOM 10728 N ND2    . ASN A 1 41 ? 18.035 26.609 37.351 1.00 0.00 ? 39 ASN A ND2    6  
ATOM 10729 H H      . ASN A 1 41 ? 17.489 30.598 33.665 1.00 0.00 ? 39 ASN A H      6  
ATOM 10730 H HA     . ASN A 1 41 ? 17.831 30.000 35.764 1.00 0.00 ? 39 ASN A HA     6  
ATOM 10731 H HB2    . ASN A 1 41 ? 16.624 27.953 34.872 1.00 0.00 ? 39 ASN A HB2    6  
ATOM 10732 H HB3    . ASN A 1 41 ? 18.170 27.129 34.855 1.00 0.00 ? 39 ASN A HB3    6  
ATOM 10733 H HD21   . ASN A 1 41 ? 18.656 26.050 36.781 1.00 0.00 ? 39 ASN A HD21   6  
ATOM 10734 H HD22   . ASN A 1 41 ? 17.950 26.462 38.347 1.00 0.00 ? 39 ASN A HD22   6  
ATOM 10735 N N      . LEU A 1 42 ? 20.493 30.401 35.162 1.00 0.00 ? 40 LEU A N      6  
ATOM 10736 C CA     . LEU A 1 42 ? 21.854 30.758 35.587 1.00 0.00 ? 40 LEU A CA     6  
ATOM 10737 C C      . LEU A 1 42 ? 21.795 31.845 36.688 1.00 0.00 ? 40 LEU A C      6  
ATOM 10738 O O      . LEU A 1 42 ? 20.723 32.182 37.193 1.00 0.00 ? 40 LEU A O      6  
ATOM 10739 C CB     . LEU A 1 42 ? 22.649 31.195 34.328 1.00 0.00 ? 40 LEU A CB     6  
ATOM 10740 C CG     . LEU A 1 42 ? 23.449 30.075 33.634 1.00 0.00 ? 40 LEU A CG     6  
ATOM 10741 C CD1    . LEU A 1 42 ? 22.584 28.926 33.123 1.00 0.00 ? 40 LEU A CD1    6  
ATOM 10742 C CD2    . LEU A 1 42 ? 24.200 30.668 32.438 1.00 0.00 ? 40 LEU A CD2    6  
ATOM 10743 H H      . LEU A 1 42 ? 19.961 31.123 34.688 1.00 0.00 ? 40 LEU A H      6  
ATOM 10744 H HA     . LEU A 1 42 ? 22.352 29.892 36.027 1.00 0.00 ? 40 LEU A HA     6  
ATOM 10745 H HB2    . LEU A 1 42 ? 21.968 31.649 33.606 1.00 0.00 ? 40 LEU A HB2    6  
ATOM 10746 H HB3    . LEU A 1 42 ? 23.369 31.965 34.595 1.00 0.00 ? 40 LEU A HB3    6  
ATOM 10747 H HG     . LEU A 1 42 ? 24.179 29.678 34.338 1.00 0.00 ? 40 LEU A HG     6  
ATOM 10748 H HD11   . LEU A 1 42 ? 22.114 28.414 33.960 1.00 0.00 ? 40 LEU A HD11   6  
ATOM 10749 H HD12   . LEU A 1 42 ? 21.817 29.311 32.454 1.00 0.00 ? 40 LEU A HD12   6  
ATOM 10750 H HD13   . LEU A 1 42 ? 23.200 28.204 32.590 1.00 0.00 ? 40 LEU A HD13   6  
ATOM 10751 H HD21   . LEU A 1 42 ? 24.810 29.898 31.966 1.00 0.00 ? 40 LEU A HD21   6  
ATOM 10752 H HD22   . LEU A 1 42 ? 23.488 31.056 31.709 1.00 0.00 ? 40 LEU A HD22   6  
ATOM 10753 H HD23   . LEU A 1 42 ? 24.854 31.472 32.770 1.00 0.00 ? 40 LEU A HD23   6  
ATOM 10754 N N      . THR A 1 43 ? 22.946 32.433 37.023 1.00 0.00 ? 41 THR A N      6  
ATOM 10755 C CA     . THR A 1 43 ? 23.058 33.755 37.672 1.00 0.00 ? 41 THR A CA     6  
ATOM 10756 C C      . THR A 1 43 ? 23.813 34.737 36.762 1.00 0.00 ? 41 THR A C      6  
ATOM 10757 O O      . THR A 1 43 ? 24.512 34.300 35.845 1.00 0.00 ? 41 THR A O      6  
ATOM 10758 C CB     . THR A 1 43 ? 23.753 33.670 39.039 1.00 0.00 ? 41 THR A CB     6  
ATOM 10759 O OG1    . THR A 1 43 ? 25.048 33.130 38.906 1.00 0.00 ? 41 THR A OG1    6  
ATOM 10760 C CG2    . THR A 1 43 ? 22.996 32.796 40.037 1.00 0.00 ? 41 THR A CG2    6  
ATOM 10761 H H      . THR A 1 43 ? 23.786 32.089 36.584 1.00 0.00 ? 41 THR A H      6  
ATOM 10762 H HA     . THR A 1 43 ? 22.061 34.160 37.837 1.00 0.00 ? 41 THR A HA     6  
ATOM 10763 H HB     . THR A 1 43 ? 23.833 34.676 39.454 1.00 0.00 ? 41 THR A HB     6  
ATOM 10764 H HG1    . THR A 1 43 ? 24.960 32.173 39.074 1.00 0.00 ? 41 THR A HG1    6  
ATOM 10765 H HG21   . THR A 1 43 ? 22.926 31.768 39.681 1.00 0.00 ? 41 THR A HG21   6  
ATOM 10766 H HG22   . THR A 1 43 ? 23.502 32.815 41.002 1.00 0.00 ? 41 THR A HG22   6  
ATOM 10767 H HG23   . THR A 1 43 ? 21.988 33.189 40.162 1.00 0.00 ? 41 THR A HG23   6  
ATOM 10768 N N      . GLU A 1 44 ? 23.718 36.052 37.008 1.00 0.00 ? 42 GLU A N      6  
ATOM 10769 C CA     . GLU A 1 44 ? 24.457 37.090 36.252 1.00 0.00 ? 42 GLU A CA     6  
ATOM 10770 C C      . GLU A 1 44 ? 25.944 36.758 36.091 1.00 0.00 ? 42 GLU A C      6  
ATOM 10771 O O      . GLU A 1 44 ? 26.467 36.838 34.980 1.00 0.00 ? 42 GLU A O      6  
ATOM 10772 C CB     . GLU A 1 44 ? 24.305 38.457 36.946 1.00 0.00 ? 42 GLU A CB     6  
ATOM 10773 C CG     . GLU A 1 44 ? 25.023 39.639 36.257 1.00 0.00 ? 42 GLU A CG     6  
ATOM 10774 C CD     . GLU A 1 44 ? 26.539 39.753 36.510 1.00 0.00 ? 42 GLU A CD     6  
ATOM 10775 O OE1    . GLU A 1 44 ? 26.998 39.630 37.670 1.00 0.00 ? 42 GLU A OE1    6  
ATOM 10776 O OE2    . GLU A 1 44 ? 27.307 40.052 35.565 1.00 0.00 ? 42 GLU A OE2    6  
ATOM 10777 H H      . GLU A 1 44 ? 23.036 36.356 37.695 1.00 0.00 ? 42 GLU A H      6  
ATOM 10778 H HA     . GLU A 1 44 ? 24.030 37.163 35.249 1.00 0.00 ? 42 GLU A HA     6  
ATOM 10779 H HB2    . GLU A 1 44 ? 23.242 38.685 36.965 1.00 0.00 ? 42 GLU A HB2    6  
ATOM 10780 H HB3    . GLU A 1 44 ? 24.637 38.382 37.980 1.00 0.00 ? 42 GLU A HB3    6  
ATOM 10781 H HG2    . GLU A 1 44 ? 24.836 39.571 35.188 1.00 0.00 ? 42 GLU A HG2    6  
ATOM 10782 H HG3    . GLU A 1 44 ? 24.561 40.562 36.611 1.00 0.00 ? 42 GLU A HG3    6  
ATOM 10783 N N      . ALA A 1 45 ? 26.606 36.338 37.174 1.00 0.00 ? 43 ALA A N      6  
ATOM 10784 C CA     . ALA A 1 45 ? 28.004 35.926 37.152 1.00 0.00 ? 43 ALA A CA     6  
ATOM 10785 C C      . ALA A 1 45 ? 28.249 34.789 36.145 1.00 0.00 ? 43 ALA A C      6  
ATOM 10786 O O      . ALA A 1 45 ? 29.138 34.897 35.304 1.00 0.00 ? 43 ALA A O      6  
ATOM 10787 C CB     . ALA A 1 45 ? 28.409 35.526 38.576 1.00 0.00 ? 43 ALA A CB     6  
ATOM 10788 H H      . ALA A 1 45 ? 26.127 36.346 38.062 1.00 0.00 ? 43 ALA A H      6  
ATOM 10789 H HA     . ALA A 1 45 ? 28.616 36.776 36.846 1.00 0.00 ? 43 ALA A HA     6  
ATOM 10790 H HB1    . ALA A 1 45 ? 29.454 35.220 38.587 1.00 0.00 ? 43 ALA A HB1    6  
ATOM 10791 H HB2    . ALA A 1 45 ? 28.287 36.376 39.249 1.00 0.00 ? 43 ALA A HB2    6  
ATOM 10792 H HB3    . ALA A 1 45 ? 27.793 34.696 38.926 1.00 0.00 ? 43 ALA A HB3    6  
ATOM 10793 N N      . ARG A 1 46 ? 27.417 33.737 36.139 1.00 0.00 ? 44 ARG A N      6  
ATOM 10794 C CA     . ARG A 1 46 ? 27.550 32.614 35.192 1.00 0.00 ? 44 ARG A CA     6  
ATOM 10795 C C      . ARG A 1 46 ? 27.275 33.021 33.743 1.00 0.00 ? 44 ARG A C      6  
ATOM 10796 O O      . ARG A 1 46 ? 27.970 32.543 32.850 1.00 0.00 ? 44 ARG A O      6  
ATOM 10797 C CB     . ARG A 1 46 ? 26.660 31.437 35.616 1.00 0.00 ? 44 ARG A CB     6  
ATOM 10798 C CG     . ARG A 1 46 ? 27.032 30.831 36.978 1.00 0.00 ? 44 ARG A CG     6  
ATOM 10799 C CD     . ARG A 1 46 ? 28.453 30.247 37.030 1.00 0.00 ? 44 ARG A CD     6  
ATOM 10800 N NE     . ARG A 1 46 ? 28.714 29.590 38.323 1.00 0.00 ? 44 ARG A NE     6  
ATOM 10801 C CZ     . ARG A 1 46 ? 28.286 28.403 38.708 1.00 0.00 ? 44 ARG A CZ     6  
ATOM 10802 N NH1    . ARG A 1 46 ? 27.560 27.633 37.958 1.00 0.00 ? 44 ARG A NH1    6  
ATOM 10803 N NH2    . ARG A 1 46 ? 28.571 27.959 39.893 1.00 0.00 1 44 ARG A NH2    6  
ATOM 10804 H H      . ARG A 1 46 ? 26.638 33.744 36.787 1.00 0.00 ? 44 ARG A H      6  
ATOM 10805 H HA     . ARG A 1 46 ? 28.588 32.283 35.197 1.00 0.00 ? 44 ARG A HA     6  
ATOM 10806 H HB2    . ARG A 1 46 ? 25.623 31.768 35.654 1.00 0.00 ? 44 ARG A HB2    6  
ATOM 10807 H HB3    . ARG A 1 46 ? 26.731 30.654 34.860 1.00 0.00 ? 44 ARG A HB3    6  
ATOM 10808 H HG2    . ARG A 1 46 ? 26.941 31.592 37.752 1.00 0.00 ? 44 ARG A HG2    6  
ATOM 10809 H HG3    . ARG A 1 46 ? 26.314 30.040 37.197 1.00 0.00 ? 44 ARG A HG3    6  
ATOM 10810 H HD2    . ARG A 1 46 ? 28.593 29.532 36.217 1.00 0.00 ? 44 ARG A HD2    6  
ATOM 10811 H HD3    . ARG A 1 46 ? 29.178 31.051 36.901 1.00 0.00 ? 44 ARG A HD3    6  
ATOM 10812 H HE     . ARG A 1 46 ? 29.217 30.127 39.019 1.00 0.00 ? 44 ARG A HE     6  
ATOM 10813 H HH11   . ARG A 1 46 ? 27.337 27.914 37.007 1.00 0.00 ? 44 ARG A HH11   6  
ATOM 10814 H HH12   . ARG A 1 46 ? 27.453 26.661 38.217 1.00 0.00 ? 44 ARG A HH12   6  
ATOM 10815 H HH21   . ARG A 1 46 ? 29.183 28.484 40.507 1.00 0.00 ? 44 ARG A HH21   6  
ATOM 10816 H HH22   . ARG A 1 46 ? 28.088 27.136 40.231 1.00 0.00 ? 44 ARG A HH22   6  
ATOM 10817 N N      . VAL A 1 47 ? 26.340 33.946 33.501 1.00 0.00 ? 45 VAL A N      6  
ATOM 10818 C CA     . VAL A 1 47 ? 26.114 34.529 32.162 1.00 0.00 ? 45 VAL A CA     6  
ATOM 10819 C C      . VAL A 1 47 ? 27.327 35.356 31.714 1.00 0.00 ? 45 VAL A C      6  
ATOM 10820 O O      . VAL A 1 47 ? 27.771 35.229 30.574 1.00 0.00 ? 45 VAL A O      6  
ATOM 10821 C CB     . VAL A 1 47 ? 24.813 35.362 32.127 1.00 0.00 ? 45 VAL A CB     6  
ATOM 10822 C CG1    . VAL A 1 47 ? 24.610 36.083 30.787 1.00 0.00 ? 45 VAL A CG1    6  
ATOM 10823 C CG2    . VAL A 1 47 ? 23.592 34.461 32.350 1.00 0.00 ? 45 VAL A CG2    6  
ATOM 10824 H H      . VAL A 1 47 ? 25.794 34.285 34.286 1.00 0.00 ? 45 VAL A H      6  
ATOM 10825 H HA     . VAL A 1 47 ? 26.007 33.717 31.442 1.00 0.00 ? 45 VAL A HA     6  
ATOM 10826 H HB     . VAL A 1 47 ? 24.841 36.113 32.917 1.00 0.00 ? 45 VAL A HB     6  
ATOM 10827 H HG11   . VAL A 1 47 ? 24.650 35.366 29.968 1.00 0.00 ? 45 VAL A HG11   6  
ATOM 10828 H HG12   . VAL A 1 47 ? 23.642 36.581 30.778 1.00 0.00 ? 45 VAL A HG12   6  
ATOM 10829 H HG13   . VAL A 1 47 ? 25.384 36.835 30.639 1.00 0.00 ? 45 VAL A HG13   6  
ATOM 10830 H HG21   . VAL A 1 47 ? 22.679 35.052 32.286 1.00 0.00 ? 45 VAL A HG21   6  
ATOM 10831 H HG22   . VAL A 1 47 ? 23.558 33.674 31.597 1.00 0.00 ? 45 VAL A HG22   6  
ATOM 10832 H HG23   . VAL A 1 47 ? 23.635 34.009 33.339 1.00 0.00 ? 45 VAL A HG23   6  
ATOM 10833 N N      . ARG A 1 48 ? 27.924 36.153 32.608 1.00 0.00 ? 46 ARG A N      6  
ATOM 10834 C CA     . ARG A 1 48 ? 29.146 36.932 32.340 1.00 0.00 ? 46 ARG A CA     6  
ATOM 10835 C C      . ARG A 1 48 ? 30.343 36.027 32.020 1.00 0.00 ? 46 ARG A C      6  
ATOM 10836 O O      . ARG A 1 48 ? 31.065 36.286 31.056 1.00 0.00 ? 46 ARG A O      6  
ATOM 10837 C CB     . ARG A 1 48 ? 29.429 37.816 33.564 1.00 0.00 ? 46 ARG A CB     6  
ATOM 10838 C CG     . ARG A 1 48 ? 30.336 39.011 33.244 1.00 0.00 ? 46 ARG A CG     6  
ATOM 10839 C CD     . ARG A 1 48 ? 31.058 39.518 34.495 1.00 0.00 ? 46 ARG A CD     6  
ATOM 10840 N NE     . ARG A 1 48 ? 30.182 39.712 35.669 1.00 0.00 ? 46 ARG A NE     6  
ATOM 10841 C CZ     . ARG A 1 48 ? 30.613 39.823 36.913 1.00 0.00 ? 46 ARG A CZ     6  
ATOM 10842 N NH1    . ARG A 1 48 ? 31.880 39.939 37.199 1.00 0.00 ? 46 ARG A NH1    6  
ATOM 10843 N NH2    . ARG A 1 48 ? 29.767 39.811 37.897 1.00 0.00 1 46 ARG A NH2    6  
ATOM 10844 H H      . ARG A 1 48 ? 27.504 36.222 33.535 1.00 0.00 ? 46 ARG A H      6  
ATOM 10845 H HA     . ARG A 1 48 ? 28.979 37.561 31.466 1.00 0.00 ? 46 ARG A HA     6  
ATOM 10846 H HB2    . ARG A 1 48 ? 28.490 38.207 33.958 1.00 0.00 ? 46 ARG A HB2    6  
ATOM 10847 H HB3    . ARG A 1 48 ? 29.889 37.206 34.343 1.00 0.00 ? 46 ARG A HB3    6  
ATOM 10848 H HG2    . ARG A 1 48 ? 31.097 38.713 32.521 1.00 0.00 ? 46 ARG A HG2    6  
ATOM 10849 H HG3    . ARG A 1 48 ? 29.747 39.815 32.805 1.00 0.00 ? 46 ARG A HG3    6  
ATOM 10850 H HD2    . ARG A 1 48 ? 31.806 38.767 34.749 1.00 0.00 ? 46 ARG A HD2    6  
ATOM 10851 H HD3    . ARG A 1 48 ? 31.568 40.452 34.256 1.00 0.00 ? 46 ARG A HD3    6  
ATOM 10852 H HE     . ARG A 1 48 ? 29.169 39.701 35.543 1.00 0.00 ? 46 ARG A HE     6  
ATOM 10853 H HH11   . ARG A 1 48 ? 32.565 39.864 36.455 1.00 0.00 ? 46 ARG A HH11   6  
ATOM 10854 H HH12   . ARG A 1 48 ? 32.193 40.118 38.140 1.00 0.00 ? 46 ARG A HH12   6  
ATOM 10855 H HH21   . ARG A 1 48 ? 28.773 39.697 37.699 1.00 0.00 ? 46 ARG A HH21   6  
ATOM 10856 H HH22   . ARG A 1 48 ? 30.087 39.800 38.854 1.00 0.00 ? 46 ARG A HH22   6  
ATOM 10857 N N      . VAL A 1 49 ? 30.506 34.944 32.785 1.00 0.00 ? 47 VAL A N      6  
ATOM 10858 C CA     . VAL A 1 49 ? 31.509 33.888 32.562 1.00 0.00 ? 47 VAL A CA     6  
ATOM 10859 C C      . VAL A 1 49 ? 31.297 33.202 31.212 1.00 0.00 ? 47 VAL A C      6  
ATOM 10860 O O      . VAL A 1 49 ? 32.255 33.051 30.455 1.00 0.00 ? 47 VAL A O      6  
ATOM 10861 C CB     . VAL A 1 49 ? 31.504 32.879 33.728 1.00 0.00 ? 47 VAL A CB     6  
ATOM 10862 C CG1    . VAL A 1 49 ? 32.343 31.626 33.456 1.00 0.00 ? 47 VAL A CG1    6  
ATOM 10863 C CG2    . VAL A 1 49 ? 32.088 33.542 34.980 1.00 0.00 ? 47 VAL A CG2    6  
ATOM 10864 H H      . VAL A 1 49 ? 29.896 34.854 33.591 1.00 0.00 ? 47 VAL A H      6  
ATOM 10865 H HA     . VAL A 1 49 ? 32.495 34.344 32.537 1.00 0.00 ? 47 VAL A HA     6  
ATOM 10866 H HB     . VAL A 1 49 ? 30.482 32.565 33.934 1.00 0.00 ? 47 VAL A HB     6  
ATOM 10867 H HG11   . VAL A 1 49 ? 33.366 31.904 33.202 1.00 0.00 ? 47 VAL A HG11   6  
ATOM 10868 H HG12   . VAL A 1 49 ? 32.342 30.991 34.341 1.00 0.00 ? 47 VAL A HG12   6  
ATOM 10869 H HG13   . VAL A 1 49 ? 31.915 31.053 32.633 1.00 0.00 ? 47 VAL A HG13   6  
ATOM 10870 H HG21   . VAL A 1 49 ? 31.506 34.411 35.268 1.00 0.00 ? 47 VAL A HG21   6  
ATOM 10871 H HG22   . VAL A 1 49 ? 32.095 32.839 35.813 1.00 0.00 ? 47 VAL A HG22   6  
ATOM 10872 H HG23   . VAL A 1 49 ? 33.099 33.884 34.776 1.00 0.00 ? 47 VAL A HG23   6  
ATOM 10873 N N      . TRP A 1 50 ? 30.053 32.870 30.855 1.00 0.00 ? 48 TRP A N      6  
ATOM 10874 C CA     . TRP A 1 50 ? 29.747 32.310 29.538 1.00 0.00 ? 48 TRP A CA     6  
ATOM 10875 C C      . TRP A 1 50 ? 30.126 33.271 28.406 1.00 0.00 ? 48 TRP A C      6  
ATOM 10876 O O      . TRP A 1 50 ? 30.782 32.852 27.455 1.00 0.00 ? 48 TRP A O      6  
ATOM 10877 C CB     . TRP A 1 50 ? 28.274 31.906 29.437 1.00 0.00 ? 48 TRP A CB     6  
ATOM 10878 C CG     . TRP A 1 50 ? 27.961 31.199 28.155 1.00 0.00 ? 48 TRP A CG     6  
ATOM 10879 C CD1    . TRP A 1 50 ? 28.001 29.859 27.983 1.00 0.00 ? 48 TRP A CD1    6  
ATOM 10880 C CD2    . TRP A 1 50 ? 27.655 31.761 26.836 1.00 0.00 ? 48 TRP A CD2    6  
ATOM 10881 N NE1    . TRP A 1 50 ? 27.755 29.555 26.662 1.00 0.00 ? 48 TRP A NE1    6  
ATOM 10882 C CE2    . TRP A 1 50 ? 27.523 30.685 25.908 1.00 0.00 ? 48 TRP A CE2    6  
ATOM 10883 C CE3    . TRP A 1 50 ? 27.491 33.067 26.322 1.00 0.00 ? 48 TRP A CE3    6  
ATOM 10884 C CZ2    . TRP A 1 50 ? 27.230 30.893 24.551 1.00 0.00 ? 48 TRP A CZ2    6  
ATOM 10885 C CZ3    . TRP A 1 50 ? 27.213 33.290 24.959 1.00 0.00 ? 48 TRP A CZ3    6  
ATOM 10886 C CH2    . TRP A 1 50 ? 27.070 32.205 24.076 1.00 0.00 ? 48 TRP A CH2    6  
ATOM 10887 H H      . TRP A 1 50 ? 29.296 32.974 31.524 1.00 0.00 ? 48 TRP A H      6  
ATOM 10888 H HA     . TRP A 1 50 ? 30.348 31.408 29.405 1.00 0.00 ? 48 TRP A HA     6  
ATOM 10889 H HB2    . TRP A 1 50 ? 28.028 31.244 30.270 1.00 0.00 ? 48 TRP A HB2    6  
ATOM 10890 H HB3    . TRP A 1 50 ? 27.641 32.790 29.513 1.00 0.00 ? 48 TRP A HB3    6  
ATOM 10891 H HD1    . TRP A 1 50 ? 28.232 29.136 28.759 1.00 0.00 ? 48 TRP A HD1    6  
ATOM 10892 H HE1    . TRP A 1 50 ? 27.852 28.610 26.299 1.00 0.00 ? 48 TRP A HE1    6  
ATOM 10893 H HE3    . TRP A 1 50 ? 27.575 33.906 26.991 1.00 0.00 ? 48 TRP A HE3    6  
ATOM 10894 H HZ2    . TRP A 1 50 ? 27.126 30.052 23.887 1.00 0.00 ? 48 TRP A HZ2    6  
ATOM 10895 H HZ3    . TRP A 1 50 ? 27.084 34.302 24.595 1.00 0.00 ? 48 TRP A HZ3    6  
ATOM 10896 H HH2    . TRP A 1 50 ? 26.837 32.381 23.034 1.00 0.00 ? 48 TRP A HH2    6  
ATOM 10897 N N      . PHE A 1 51 ? 29.792 34.563 28.518 1.00 0.00 ? 49 PHE A N      6  
ATOM 10898 C CA     . PHE A 1 51 ? 30.124 35.561 27.492 1.00 0.00 ? 49 PHE A CA     6  
ATOM 10899 C C      . PHE A 1 51 ? 31.640 35.714 27.290 1.00 0.00 ? 49 PHE A C      6  
ATOM 10900 O O      . PHE A 1 51 ? 32.100 35.693 26.144 1.00 0.00 ? 49 PHE A O      6  
ATOM 10901 C CB     . PHE A 1 51 ? 29.445 36.907 27.810 1.00 0.00 ? 49 PHE A CB     6  
ATOM 10902 C CG     . PHE A 1 51 ? 28.151 37.123 27.045 1.00 0.00 ? 49 PHE A CG     6  
ATOM 10903 C CD1    . PHE A 1 51 ? 26.954 36.513 27.471 1.00 0.00 ? 49 PHE A CD1    6  
ATOM 10904 C CD2    . PHE A 1 51 ? 28.149 37.908 25.876 1.00 0.00 ? 49 PHE A CD2    6  
ATOM 10905 C CE1    . PHE A 1 51 ? 25.772 36.671 26.725 1.00 0.00 ? 49 PHE A CE1    6  
ATOM 10906 C CE2    . PHE A 1 51 ? 26.963 38.076 25.139 1.00 0.00 ? 49 PHE A CE2    6  
ATOM 10907 C CZ     . PHE A 1 51 ? 25.777 37.449 25.556 1.00 0.00 ? 49 PHE A CZ     6  
ATOM 10908 H H      . PHE A 1 51 ? 29.239 34.850 29.319 1.00 0.00 ? 49 PHE A H      6  
ATOM 10909 H HA     . PHE A 1 51 ? 29.733 35.208 26.536 1.00 0.00 ? 49 PHE A HA     6  
ATOM 10910 H HB2    . PHE A 1 51 ? 29.255 36.989 28.881 1.00 0.00 ? 49 PHE A HB2    6  
ATOM 10911 H HB3    . PHE A 1 51 ? 30.129 37.717 27.549 1.00 0.00 ? 49 PHE A HB3    6  
ATOM 10912 H HD1    . PHE A 1 51 ? 26.944 35.903 28.359 1.00 0.00 ? 49 PHE A HD1    6  
ATOM 10913 H HD2    . PHE A 1 51 ? 29.060 38.383 25.538 1.00 0.00 ? 49 PHE A HD2    6  
ATOM 10914 H HE1    . PHE A 1 51 ? 24.861 36.185 27.045 1.00 0.00 ? 49 PHE A HE1    6  
ATOM 10915 H HE2    . PHE A 1 51 ? 26.961 38.689 24.251 1.00 0.00 ? 49 PHE A HE2    6  
ATOM 10916 H HZ     . PHE A 1 51 ? 24.872 37.567 24.978 1.00 0.00 ? 49 PHE A HZ     6  
ATOM 10917 N N      . LYS A 1 52 ? 32.439 35.793 28.368 1.00 0.00 ? 50 LYS A N      6  
ATOM 10918 C CA     . LYS A 1 52 ? 33.906 35.847 28.229 1.00 0.00 ? 50 LYS A CA     6  
ATOM 10919 C C      . LYS A 1 52 ? 34.492 34.534 27.693 1.00 0.00 ? 50 LYS A C      6  
ATOM 10920 O O      . LYS A 1 52 ? 35.367 34.586 26.835 1.00 0.00 ? 50 LYS A O      6  
ATOM 10921 C CB     . LYS A 1 52 ? 34.595 36.397 29.495 1.00 0.00 ? 50 LYS A CB     6  
ATOM 10922 C CG     . LYS A 1 52 ? 34.570 35.488 30.731 1.00 0.00 ? 50 LYS A CG     6  
ATOM 10923 C CD     . LYS A 1 52 ? 35.068 36.196 32.006 1.00 0.00 ? 50 LYS A CD     6  
ATOM 10924 C CE     . LYS A 1 52 ? 36.561 36.560 31.963 1.00 0.00 ? 50 LYS A CE     6  
ATOM 10925 N NZ     . LYS A 1 52 ? 36.919 37.534 33.022 1.00 0.00 1 50 LYS A NZ     6  
ATOM 10926 H H      . LYS A 1 52 ? 32.016 35.802 29.292 1.00 0.00 ? 50 LYS A H      6  
ATOM 10927 H HA     . LYS A 1 52 ? 34.124 36.574 27.444 1.00 0.00 ? 50 LYS A HA     6  
ATOM 10928 H HB2    . LYS A 1 52 ? 35.635 36.599 29.247 1.00 0.00 ? 50 LYS A HB2    6  
ATOM 10929 H HB3    . LYS A 1 52 ? 34.126 37.350 29.748 1.00 0.00 ? 50 LYS A HB3    6  
ATOM 10930 H HG2    . LYS A 1 52 ? 33.541 35.193 30.898 1.00 0.00 ? 50 LYS A HG2    6  
ATOM 10931 H HG3    . LYS A 1 52 ? 35.166 34.593 30.550 1.00 0.00 ? 50 LYS A HG3    6  
ATOM 10932 H HD2    . LYS A 1 52 ? 34.473 37.098 32.149 1.00 0.00 ? 50 LYS A HD2    6  
ATOM 10933 H HD3    . LYS A 1 52 ? 34.894 35.540 32.861 1.00 0.00 ? 50 LYS A HD3    6  
ATOM 10934 H HE2    . LYS A 1 52 ? 37.158 35.649 32.075 1.00 0.00 ? 50 LYS A HE2    6  
ATOM 10935 H HE3    . LYS A 1 52 ? 36.795 36.998 30.988 1.00 0.00 ? 50 LYS A HE3    6  
ATOM 10936 H HZ1    . LYS A 1 52 ? 36.409 38.406 32.900 1.00 0.00 ? 50 LYS A HZ1    6  
ATOM 10937 H HZ2    . LYS A 1 52 ? 36.729 37.191 33.959 1.00 0.00 ? 50 LYS A HZ2    6  
ATOM 10938 H HZ3    . LYS A 1 52 ? 37.910 37.770 32.968 1.00 0.00 ? 50 LYS A HZ3    6  
ATOM 10939 N N      . ASN A 1 53 ? 33.952 33.369 28.066 1.00 0.00 ? 51 ASN A N      6  
ATOM 10940 C CA     . ASN A 1 53 ? 34.368 32.082 27.488 1.00 0.00 ? 51 ASN A CA     6  
ATOM 10941 C C      . ASN A 1 53 ? 33.960 31.912 26.010 1.00 0.00 ? 51 ASN A C      6  
ATOM 10942 O O      . ASN A 1 53 ? 34.757 31.392 25.231 1.00 0.00 ? 51 ASN A O      6  
ATOM 10943 C CB     . ASN A 1 53 ? 33.855 30.921 28.355 1.00 0.00 ? 51 ASN A CB     6  
ATOM 10944 C CG     . ASN A 1 53 ? 34.688 30.666 29.599 1.00 0.00 ? 51 ASN A CG     6  
ATOM 10945 O OD1    . ASN A 1 53 ? 35.897 30.874 29.644 1.00 0.00 ? 51 ASN A OD1    6  
ATOM 10946 N ND2    . ASN A 1 53 ? 34.080 30.132 30.624 1.00 0.00 ? 51 ASN A ND2    6  
ATOM 10947 H H      . ASN A 1 53 ? 33.236 33.370 28.786 1.00 0.00 ? 51 ASN A H      6  
ATOM 10948 H HA     . ASN A 1 53 ? 35.457 32.045 27.498 1.00 0.00 ? 51 ASN A HA     6  
ATOM 10949 H HB2    . ASN A 1 53 ? 32.817 31.099 28.637 1.00 0.00 ? 51 ASN A HB2    6  
ATOM 10950 H HB3    . ASN A 1 53 ? 33.888 29.999 27.775 1.00 0.00 ? 51 ASN A HB3    6  
ATOM 10951 H HD21   . ASN A 1 53 ? 33.091 29.903 30.557 1.00 0.00 ? 51 ASN A HD21   6  
ATOM 10952 H HD22   . ASN A 1 53 ? 34.624 29.982 31.464 1.00 0.00 ? 51 ASN A HD22   6  
ATOM 10953 N N      . ARG A 1 54 ? 32.788 32.395 25.571 1.00 0.00 ? 52 ARG A N      6  
ATOM 10954 C CA     . ARG A 1 54 ? 32.369 32.363 24.155 1.00 0.00 ? 52 ARG A CA     6  
ATOM 10955 C C      . ARG A 1 54 ? 33.250 33.263 23.282 1.00 0.00 ? 52 ARG A C      6  
ATOM 10956 O O      . ARG A 1 54 ? 33.607 32.852 22.181 1.00 0.00 ? 52 ARG A O      6  
ATOM 10957 C CB     . ARG A 1 54 ? 30.862 32.678 24.029 1.00 0.00 ? 52 ARG A CB     6  
ATOM 10958 C CG     . ARG A 1 54 ? 30.343 32.802 22.579 1.00 0.00 ? 52 ARG A CG     6  
ATOM 10959 C CD     . ARG A 1 54 ? 30.570 31.585 21.660 1.00 0.00 ? 52 ARG A CD     6  
ATOM 10960 N NE     . ARG A 1 54 ? 29.658 30.454 21.940 1.00 0.00 ? 52 ARG A NE     6  
ATOM 10961 C CZ     . ARG A 1 54 ? 28.690 29.990 21.161 1.00 0.00 ? 52 ARG A CZ     6  
ATOM 10962 N NH1    . ARG A 1 54 ? 28.367 30.534 20.019 1.00 0.00 ? 52 ARG A NH1    6  
ATOM 10963 N NH2    . ARG A 1 54 ? 28.008 28.943 21.528 1.00 0.00 1 52 ARG A NH2    6  
ATOM 10964 H H      . ARG A 1 54 ? 32.131 32.753 26.261 1.00 0.00 ? 52 ARG A H      6  
ATOM 10965 H HA     . ARG A 1 54 ? 32.523 31.348 23.789 1.00 0.00 ? 52 ARG A HA     6  
ATOM 10966 H HB2    . ARG A 1 54 ? 30.296 31.898 24.540 1.00 0.00 ? 52 ARG A HB2    6  
ATOM 10967 H HB3    . ARG A 1 54 ? 30.657 33.622 24.539 1.00 0.00 ? 52 ARG A HB3    6  
ATOM 10968 H HG2    . ARG A 1 54 ? 29.277 33.029 22.603 1.00 0.00 ? 52 ARG A HG2    6  
ATOM 10969 H HG3    . ARG A 1 54 ? 30.830 33.662 22.118 1.00 0.00 ? 52 ARG A HG3    6  
ATOM 10970 H HD2    . ARG A 1 54 ? 30.440 31.922 20.633 1.00 0.00 ? 52 ARG A HD2    6  
ATOM 10971 H HD3    . ARG A 1 54 ? 31.601 31.243 21.748 1.00 0.00 ? 52 ARG A HD3    6  
ATOM 10972 H HE     . ARG A 1 54 ? 29.788 29.964 22.821 1.00 0.00 ? 52 ARG A HE     6  
ATOM 10973 H HH11   . ARG A 1 54 ? 28.956 31.250 19.606 1.00 0.00 ? 52 ARG A HH11   6  
ATOM 10974 H HH12   . ARG A 1 54 ? 27.657 30.125 19.423 1.00 0.00 ? 52 ARG A HH12   6  
ATOM 10975 H HH21   . ARG A 1 54 ? 28.337 28.355 22.289 1.00 0.00 ? 52 ARG A HH21   6  
ATOM 10976 H HH22   . ARG A 1 54 ? 27.245 28.600 20.956 1.00 0.00 ? 52 ARG A HH22   6  
ATOM 10977 N N      . ARG A 1 55 ? 33.689 34.428 23.779 1.00 0.00 ? 53 ARG A N      6  
ATOM 10978 C CA     . ARG A 1 55 ? 34.710 35.253 23.096 1.00 0.00 ? 53 ARG A CA     6  
ATOM 10979 C C      . ARG A 1 55 ? 36.102 34.616 23.148 1.00 0.00 ? 53 ARG A C      6  
ATOM 10980 O O      . ARG A 1 55 ? 36.805 34.593 22.139 1.00 0.00 ? 53 ARG A O      6  
ATOM 10981 C CB     . ARG A 1 55 ? 34.735 36.677 23.671 1.00 0.00 ? 53 ARG A CB     6  
ATOM 10982 C CG     . ARG A 1 55 ? 33.429 37.441 23.398 1.00 0.00 ? 53 ARG A CG     6  
ATOM 10983 C CD     . ARG A 1 55 ? 33.524 38.922 23.789 1.00 0.00 ? 53 ARG A CD     6  
ATOM 10984 N NE     . ARG A 1 55 ? 33.920 39.101 25.197 1.00 0.00 ? 53 ARG A NE     6  
ATOM 10985 C CZ     . ARG A 1 55 ? 33.210 39.610 26.182 1.00 0.00 ? 53 ARG A CZ     6  
ATOM 10986 N NH1    . ARG A 1 55 ? 31.994 40.050 26.063 1.00 0.00 ? 53 ARG A NH1    6  
ATOM 10987 N NH2    . ARG A 1 55 ? 33.721 39.707 27.367 1.00 0.00 1 53 ARG A NH2    6  
ATOM 10988 H H      . ARG A 1 55 ? 33.316 34.734 24.673 1.00 0.00 ? 53 ARG A H      6  
ATOM 10989 H HA     . ARG A 1 55 ? 34.460 35.320 22.034 1.00 0.00 ? 53 ARG A HA     6  
ATOM 10990 H HB2    . ARG A 1 55 ? 34.923 36.630 24.745 1.00 0.00 ? 53 ARG A HB2    6  
ATOM 10991 H HB3    . ARG A 1 55 ? 35.553 37.220 23.197 1.00 0.00 ? 53 ARG A HB3    6  
ATOM 10992 H HG2    . ARG A 1 55 ? 33.207 37.384 22.333 1.00 0.00 ? 53 ARG A HG2    6  
ATOM 10993 H HG3    . ARG A 1 55 ? 32.606 36.982 23.945 1.00 0.00 ? 53 ARG A HG3    6  
ATOM 10994 H HD2    . ARG A 1 55 ? 34.273 39.396 23.157 1.00 0.00 ? 53 ARG A HD2    6  
ATOM 10995 H HD3    . ARG A 1 55 ? 32.566 39.405 23.584 1.00 0.00 ? 53 ARG A HD3    6  
ATOM 10996 H HE     . ARG A 1 55 ? 34.875 38.853 25.429 1.00 0.00 ? 53 ARG A HE     6  
ATOM 10997 H HH11   . ARG A 1 55 ? 31.501 40.061 25.178 1.00 0.00 ? 53 ARG A HH11   6  
ATOM 10998 H HH12   . ARG A 1 55 ? 31.578 40.486 26.880 1.00 0.00 ? 53 ARG A HH12   6  
ATOM 10999 H HH21   . ARG A 1 55 ? 34.653 39.336 27.541 1.00 0.00 ? 53 ARG A HH21   6  
ATOM 11000 H HH22   . ARG A 1 55 ? 33.186 40.206 28.065 1.00 0.00 ? 53 ARG A HH22   6  
ATOM 11001 N N      . ALA A 1 56 ? 36.495 34.034 24.283 1.00 0.00 ? 54 ALA A N      6  
ATOM 11002 C CA     . ALA A 1 56 ? 37.759 33.303 24.414 1.00 0.00 ? 54 ALA A CA     6  
ATOM 11003 C C      . ALA A 1 56 ? 37.798 32.007 23.576 1.00 0.00 ? 54 ALA A C      6  
ATOM 11004 O O      . ALA A 1 56 ? 38.884 31.515 23.268 1.00 0.00 ? 54 ALA A O      6  
ATOM 11005 C CB     . ALA A 1 56 ? 38.039 33.029 25.895 1.00 0.00 ? 54 ALA A CB     6  
ATOM 11006 H H      . ALA A 1 56 ? 35.921 34.147 25.111 1.00 0.00 ? 54 ALA A H      6  
ATOM 11007 H HA     . ALA A 1 56 ? 38.554 33.949 24.045 1.00 0.00 ? 54 ALA A HA     6  
ATOM 11008 H HB1    . ALA A 1 56 ? 38.007 33.962 26.462 1.00 0.00 ? 54 ALA A HB1    6  
ATOM 11009 H HB2    . ALA A 1 56 ? 37.302 32.335 26.295 1.00 0.00 ? 54 ALA A HB2    6  
ATOM 11010 H HB3    . ALA A 1 56 ? 39.033 32.593 26.002 1.00 0.00 ? 54 ALA A HB3    6  
ATOM 11011 N N      . LYS A 1 57 ? 36.645 31.483 23.138 1.00 0.00 ? 55 LYS A N      6  
ATOM 11012 C CA     . LYS A 1 57 ? 36.545 30.317 22.251 1.00 0.00 ? 55 LYS A CA     6  
ATOM 11013 C C      . LYS A 1 57 ? 37.399 30.497 20.991 1.00 0.00 ? 55 LYS A C      6  
ATOM 11014 O O      . LYS A 1 57 ? 38.138 29.578 20.653 1.00 0.00 ? 55 LYS A O      6  
ATOM 11015 C CB     . LYS A 1 57 ? 35.064 30.048 21.911 1.00 0.00 ? 55 LYS A CB     6  
ATOM 11016 C CG     . LYS A 1 57 ? 34.769 28.584 21.538 1.00 0.00 ? 55 LYS A CG     6  
ATOM 11017 C CD     . LYS A 1 57 ? 34.641 27.632 22.745 1.00 0.00 ? 55 LYS A CD     6  
ATOM 11018 C CE     . LYS A 1 57 ? 33.382 27.867 23.597 1.00 0.00 ? 55 LYS A CE     6  
ATOM 11019 N NZ     . LYS A 1 57 ? 32.153 27.311 22.976 1.00 0.00 1 55 LYS A NZ     6  
ATOM 11020 H H      . LYS A 1 57 ? 35.787 31.855 23.529 1.00 0.00 ? 55 LYS A H      6  
ATOM 11021 H HA     . LYS A 1 57 ? 36.948 29.455 22.783 1.00 0.00 ? 55 LYS A HA     6  
ATOM 11022 H HB2    . LYS A 1 57 ? 34.436 30.322 22.757 1.00 0.00 ? 55 LYS A HB2    6  
ATOM 11023 H HB3    . LYS A 1 57 ? 34.776 30.683 21.071 1.00 0.00 ? 55 LYS A HB3    6  
ATOM 11024 H HG2    . LYS A 1 57 ? 33.841 28.550 20.969 1.00 0.00 ? 55 LYS A HG2    6  
ATOM 11025 H HG3    . LYS A 1 57 ? 35.563 28.223 20.888 1.00 0.00 ? 55 LYS A HG3    6  
ATOM 11026 H HD2    . LYS A 1 57 ? 34.634 26.604 22.386 1.00 0.00 ? 55 LYS A HD2    6  
ATOM 11027 H HD3    . LYS A 1 57 ? 35.519 27.747 23.381 1.00 0.00 ? 55 LYS A HD3    6  
ATOM 11028 H HE2    . LYS A 1 57 ? 33.527 27.394 24.573 1.00 0.00 ? 55 LYS A HE2    6  
ATOM 11029 H HE3    . LYS A 1 57 ? 33.260 28.940 23.767 1.00 0.00 ? 55 LYS A HE3    6  
ATOM 11030 H HZ1    . LYS A 1 57 ? 32.065 27.551 21.989 1.00 0.00 ? 55 LYS A HZ1    6  
ATOM 11031 H HZ2    . LYS A 1 57 ? 32.116 26.296 23.040 1.00 0.00 ? 55 LYS A HZ2    6  
ATOM 11032 H HZ3    . LYS A 1 57 ? 31.320 27.674 23.437 1.00 0.00 ? 55 LYS A HZ3    6  
ATOM 11033 N N      . TRP A 1 58 ? 37.423 31.690 20.378 1.00 0.00 ? 56 TRP A N      6  
ATOM 11034 C CA     . TRP A 1 58 ? 38.225 31.922 19.164 1.00 0.00 ? 56 TRP A CA     6  
ATOM 11035 C C      . TRP A 1 58 ? 39.738 31.934 19.418 1.00 0.00 ? 56 TRP A C      6  
ATOM 11036 O O      . TRP A 1 58 ? 40.500 31.511 18.554 1.00 0.00 ? 56 TRP A O      6  
ATOM 11037 C CB     . TRP A 1 58 ? 37.751 33.166 18.391 1.00 0.00 ? 56 TRP A CB     6  
ATOM 11038 C CG     . TRP A 1 58 ? 38.327 34.520 18.718 1.00 0.00 ? 56 TRP A CG     6  
ATOM 11039 C CD1    . TRP A 1 58 ? 39.633 34.880 18.639 1.00 0.00 ? 56 TRP A CD1    6  
ATOM 11040 C CD2    . TRP A 1 58 ? 37.608 35.760 19.009 1.00 0.00 ? 56 TRP A CD2    6  
ATOM 11041 N NE1    . TRP A 1 58 ? 39.771 36.222 18.924 1.00 0.00 ? 56 TRP A NE1    6  
ATOM 11042 C CE2    . TRP A 1 58 ? 38.549 36.831 19.077 1.00 0.00 ? 56 TRP A CE2    6  
ATOM 11043 C CE3    . TRP A 1 58 ? 36.248 36.103 19.154 1.00 0.00 ? 56 TRP A CE3    6  
ATOM 11044 C CZ2    . TRP A 1 58 ? 38.163 38.171 19.231 1.00 0.00 ? 56 TRP A CZ2    6  
ATOM 11045 C CZ3    . TRP A 1 58 ? 35.847 37.442 19.317 1.00 0.00 ? 56 TRP A CZ3    6  
ATOM 11046 C CH2    . TRP A 1 58 ? 36.796 38.479 19.335 1.00 0.00 ? 56 TRP A CH2    6  
ATOM 11047 H H      . TRP A 1 58 ? 36.822 32.428 20.714 1.00 0.00 ? 56 TRP A H      6  
ATOM 11048 H HA     . TRP A 1 58 ? 38.048 31.071 18.504 1.00 0.00 ? 56 TRP A HA     6  
ATOM 11049 H HB2    . TRP A 1 58 ? 37.963 32.987 17.337 1.00 0.00 ? 56 TRP A HB2    6  
ATOM 11050 H HB3    . TRP A 1 58 ? 36.666 33.228 18.468 1.00 0.00 ? 56 TRP A HB3    6  
ATOM 11051 H HD1    . TRP A 1 58 ? 40.452 34.225 18.366 1.00 0.00 ? 56 TRP A HD1    6  
ATOM 11052 H HE1    . TRP A 1 58 ? 40.670 36.700 18.984 1.00 0.00 ? 56 TRP A HE1    6  
ATOM 11053 H HE3    . TRP A 1 58 ? 35.502 35.323 19.109 1.00 0.00 ? 56 TRP A HE3    6  
ATOM 11054 H HZ2    . TRP A 1 58 ? 38.911 38.952 19.241 1.00 0.00 ? 56 TRP A HZ2    6  
ATOM 11055 H HZ3    . TRP A 1 58 ? 34.793 37.670 19.400 1.00 0.00 ? 56 TRP A HZ3    6  
ATOM 11056 H HH2    . TRP A 1 58 ? 36.471 39.508 19.416 1.00 0.00 ? 56 TRP A HH2    6  
ATOM 11057 N N      . ARG A 1 59 ? 40.213 32.368 20.597 1.00 0.00 ? 57 ARG A N      6  
ATOM 11058 C CA     . ARG A 1 59 ? 41.649 32.286 20.927 1.00 0.00 ? 57 ARG A CA     6  
ATOM 11059 C C      . ARG A 1 59 ? 42.052 30.884 21.376 1.00 0.00 ? 57 ARG A C      6  
ATOM 11060 O O      . ARG A 1 59 ? 43.156 30.450 21.065 1.00 0.00 ? 57 ARG A O      6  
ATOM 11061 C CB     . ARG A 1 59 ? 42.098 33.402 21.889 1.00 0.00 ? 57 ARG A CB     6  
ATOM 11062 C CG     . ARG A 1 59 ? 41.684 33.223 23.359 1.00 0.00 ? 57 ARG A CG     6  
ATOM 11063 C CD     . ARG A 1 59 ? 42.187 34.367 24.241 1.00 0.00 ? 57 ARG A CD     6  
ATOM 11064 N NE     . ARG A 1 59 ? 41.543 35.637 23.874 1.00 0.00 ? 57 ARG A NE     6  
ATOM 11065 C CZ     . ARG A 1 59 ? 42.050 36.849 23.923 1.00 0.00 ? 57 ARG A CZ     6  
ATOM 11066 N NH1    . ARG A 1 59 ? 43.239 37.132 24.357 1.00 0.00 ? 57 ARG A NH1    6  
ATOM 11067 N NH2    . ARG A 1 59 ? 41.340 37.843 23.502 1.00 0.00 1 57 ARG A NH2    6  
ATOM 11068 H H      . ARG A 1 59 ? 39.557 32.724 21.279 1.00 0.00 ? 57 ARG A H      6  
ATOM 11069 H HA     . ARG A 1 59 ? 42.211 32.459 20.007 1.00 0.00 ? 57 ARG A HA     6  
ATOM 11070 H HB2    . ARG A 1 59 ? 43.187 33.458 21.851 1.00 0.00 ? 57 ARG A HB2    6  
ATOM 11071 H HB3    . ARG A 1 59 ? 41.706 34.349 21.515 1.00 0.00 ? 57 ARG A HB3    6  
ATOM 11072 H HG2    . ARG A 1 59 ? 40.603 33.201 23.424 1.00 0.00 ? 57 ARG A HG2    6  
ATOM 11073 H HG3    . ARG A 1 59 ? 42.091 32.289 23.744 1.00 0.00 ? 57 ARG A HG3    6  
ATOM 11074 H HD2    . ARG A 1 59 ? 41.959 34.138 25.284 1.00 0.00 ? 57 ARG A HD2    6  
ATOM 11075 H HD3    . ARG A 1 59 ? 43.266 34.434 24.132 1.00 0.00 ? 57 ARG A HD3    6  
ATOM 11076 H HE     . ARG A 1 59 ? 40.612 35.597 23.472 1.00 0.00 ? 57 ARG A HE     6  
ATOM 11077 H HH11   . ARG A 1 59 ? 43.917 36.401 24.528 1.00 0.00 ? 57 ARG A HH11   6  
ATOM 11078 H HH12   . ARG A 1 59 ? 43.529 38.104 24.271 1.00 0.00 ? 57 ARG A HH12   6  
ATOM 11079 H HH21   . ARG A 1 59 ? 40.465 37.670 23.038 1.00 0.00 ? 57 ARG A HH21   6  
ATOM 11080 H HH22   . ARG A 1 59 ? 41.806 38.747 23.413 1.00 0.00 ? 57 ARG A HH22   6  
ATOM 11081 N N      . LYS A 1 60 ? 41.156 30.153 22.048 1.00 0.00 ? 58 LYS A N      6  
ATOM 11082 C CA     . LYS A 1 60 ? 41.388 28.787 22.551 1.00 0.00 ? 58 LYS A CA     6  
ATOM 11083 C C      . LYS A 1 60 ? 41.334 27.735 21.436 1.00 0.00 ? 58 LYS A C      6  
ATOM 11084 O O      . LYS A 1 60 ? 42.252 26.916 21.355 1.00 0.00 ? 58 LYS A O      6  
ATOM 11085 C CB     . LYS A 1 60 ? 40.413 28.493 23.705 1.00 0.00 ? 58 LYS A CB     6  
ATOM 11086 C CG     . LYS A 1 60 ? 40.820 29.287 24.960 1.00 0.00 ? 58 LYS A CG     6  
ATOM 11087 C CD     . LYS A 1 60 ? 39.834 29.131 26.127 1.00 0.00 ? 58 LYS A CD     6  
ATOM 11088 C CE     . LYS A 1 60 ? 40.226 29.993 27.340 1.00 0.00 ? 58 LYS A CE     6  
ATOM 11089 N NZ     . LYS A 1 60 ? 41.527 29.607 27.939 1.00 0.00 1 58 LYS A NZ     6  
ATOM 11090 H H      . LYS A 1 60 ? 40.274 30.602 22.280 1.00 0.00 ? 58 LYS A H      6  
ATOM 11091 H HA     . LYS A 1 60 ? 42.402 28.730 22.952 1.00 0.00 ? 58 LYS A HA     6  
ATOM 11092 H HB2    . LYS A 1 60 ? 39.394 28.748 23.409 1.00 0.00 ? 58 LYS A HB2    6  
ATOM 11093 H HB3    . LYS A 1 60 ? 40.447 27.429 23.937 1.00 0.00 ? 58 LYS A HB3    6  
ATOM 11094 H HG2    . LYS A 1 60 ? 41.801 28.936 25.275 1.00 0.00 ? 58 LYS A HG2    6  
ATOM 11095 H HG3    . LYS A 1 60 ? 40.895 30.347 24.717 1.00 0.00 ? 58 LYS A HG3    6  
ATOM 11096 H HD2    . LYS A 1 60 ? 38.843 29.445 25.793 1.00 0.00 ? 58 LYS A HD2    6  
ATOM 11097 H HD3    . LYS A 1 60 ? 39.770 28.087 26.428 1.00 0.00 ? 58 LYS A HD3    6  
ATOM 11098 H HE2    . LYS A 1 60 ? 40.262 31.043 27.037 1.00 0.00 ? 58 LYS A HE2    6  
ATOM 11099 H HE3    . LYS A 1 60 ? 39.443 29.893 28.095 1.00 0.00 ? 58 LYS A HE3    6  
ATOM 11100 H HZ1    . LYS A 1 60 ? 42.315 29.788 27.318 1.00 0.00 ? 58 LYS A HZ1    6  
ATOM 11101 H HZ2    . LYS A 1 60 ? 41.680 30.113 28.809 1.00 0.00 ? 58 LYS A HZ2    6  
ATOM 11102 H HZ3    . LYS A 1 60 ? 41.567 28.622 28.185 1.00 0.00 ? 58 LYS A HZ3    6  
ATOM 11103 N N      . ARG A 1 61 ? 40.358 27.831 20.522 1.00 0.00 ? 59 ARG A N      6  
ATOM 11104 C CA     . ARG A 1 61 ? 40.299 27.100 19.234 1.00 0.00 ? 59 ARG A CA     6  
ATOM 11105 C C      . ARG A 1 61 ? 41.211 27.686 18.147 1.00 0.00 ? 59 ARG A C      6  
ATOM 11106 O O      . ARG A 1 61 ? 41.416 27.053 17.114 1.00 0.00 ? 59 ARG A O      6  
ATOM 11107 C CB     . ARG A 1 61 ? 38.852 27.046 18.718 1.00 0.00 ? 59 ARG A CB     6  
ATOM 11108 C CG     . ARG A 1 61 ? 37.888 26.313 19.661 1.00 0.00 ? 59 ARG A CG     6  
ATOM 11109 C CD     . ARG A 1 61 ? 36.517 26.245 18.990 1.00 0.00 ? 59 ARG A CD     6  
ATOM 11110 N NE     . ARG A 1 61 ? 35.547 25.469 19.777 1.00 0.00 ? 59 ARG A NE     6  
ATOM 11111 C CZ     . ARG A 1 61 ? 34.346 25.118 19.365 1.00 0.00 ? 59 ARG A CZ     6  
ATOM 11112 N NH1    . ARG A 1 61 ? 33.873 25.486 18.207 1.00 0.00 1 59 ARG A NH1    6  
ATOM 11113 N NH2    . ARG A 1 61 ? 33.602 24.384 20.135 1.00 0.00 ? 59 ARG A NH2    6  
ATOM 11114 H H      . ARG A 1 61 ? 39.621 28.506 20.701 1.00 0.00 ? 59 ARG A H      6  
ATOM 11115 H HA     . ARG A 1 61 ? 40.647 26.079 19.395 1.00 0.00 ? 59 ARG A HA     6  
ATOM 11116 H HB2    . ARG A 1 61 ? 38.493 28.061 18.541 1.00 0.00 ? 59 ARG A HB2    6  
ATOM 11117 H HB3    . ARG A 1 61 ? 38.850 26.525 17.759 1.00 0.00 ? 59 ARG A HB3    6  
ATOM 11118 H HG2    . ARG A 1 61 ? 38.251 25.303 19.842 1.00 0.00 ? 59 ARG A HG2    6  
ATOM 11119 H HG3    . ARG A 1 61 ? 37.804 26.842 20.610 1.00 0.00 ? 59 ARG A HG3    6  
ATOM 11120 H HD2    . ARG A 1 61 ? 36.142 27.261 18.846 1.00 0.00 ? 59 ARG A HD2    6  
ATOM 11121 H HD3    . ARG A 1 61 ? 36.633 25.778 18.010 1.00 0.00 ? 59 ARG A HD3    6  
ATOM 11122 H HE     . ARG A 1 61 ? 35.829 25.113 20.688 1.00 0.00 ? 59 ARG A HE     6  
ATOM 11123 H HH11   . ARG A 1 61 ? 34.434 26.083 17.616 1.00 0.00 ? 59 ARG A HH11   6  
ATOM 11124 H HH12   . ARG A 1 61 ? 32.919 25.261 17.938 1.00 0.00 ? 59 ARG A HH12   6  
ATOM 11125 H HH21   . ARG A 1 61 ? 33.973 24.074 21.021 1.00 0.00 ? 59 ARG A HH21   6  
ATOM 11126 H HH22   . ARG A 1 61 ? 32.724 24.017 19.773 1.00 0.00 ? 59 ARG A HH22   6  
ATOM 11127 N N      . GLU A 1 62 ? 41.780 28.856 18.428 1.00 0.00 ? 60 GLU A N      6  
ATOM 11128 C CA     . GLU A 1 62 ? 42.824 29.576 17.694 1.00 0.00 ? 60 GLU A CA     6  
ATOM 11129 C C      . GLU A 1 62 ? 42.413 30.144 16.324 1.00 0.00 ? 60 GLU A C      6  
ATOM 11130 O O      . GLU A 1 62 ? 42.237 29.407 15.353 1.00 0.00 ? 60 GLU A O      6  
ATOM 11131 C CB     . GLU A 1 62 ? 44.093 28.715 17.579 1.00 0.00 ? 60 GLU A CB     6  
ATOM 11132 C CG     . GLU A 1 62 ? 44.664 28.271 18.933 1.00 0.00 ? 60 GLU A CG     6  
ATOM 11133 C CD     . GLU A 1 62 ? 45.769 27.214 18.843 1.00 0.00 ? 60 GLU A CD     6  
ATOM 11134 O OE1    . GLU A 1 62 ? 46.120 26.711 17.744 1.00 0.00 ? 60 GLU A OE1    6  
ATOM 11135 O OE2    . GLU A 1 62 ? 46.293 26.839 19.920 1.00 0.00 ? 60 GLU A OE2    6  
ATOM 11136 H H      . GLU A 1 62 ? 41.442 29.311 19.258 1.00 0.00 ? 60 GLU A H      6  
ATOM 11137 H HA     . GLU A 1 62 ? 43.101 30.434 18.308 1.00 0.00 ? 60 GLU A HA     6  
ATOM 11138 H HB2    . GLU A 1 62 ? 43.875 27.835 16.976 1.00 0.00 ? 60 GLU A HB2    6  
ATOM 11139 H HB3    . GLU A 1 62 ? 44.834 29.313 17.061 1.00 0.00 ? 60 GLU A HB3    6  
ATOM 11140 H HG2    . GLU A 1 62 ? 45.047 29.148 19.455 1.00 0.00 ? 60 GLU A HG2    6  
ATOM 11141 H HG3    . GLU A 1 62 ? 43.866 27.847 19.541 1.00 0.00 ? 60 GLU A HG3    6  
ATOM 11142 N N      . GLU A 1 63 ? 42.370 31.474 16.210 1.00 0.00 ? 61 GLU A N      6  
ATOM 11143 C CA     . GLU A 1 63 ? 42.387 32.187 14.923 1.00 0.00 ? 61 GLU A CA     6  
ATOM 11144 C C      . GLU A 1 63 ? 43.827 32.414 14.436 1.00 0.00 ? 61 GLU A C      6  
ATOM 11145 O O      . GLU A 1 63 ? 44.122 32.175 13.265 1.00 0.00 ? 61 GLU A O      6  
ATOM 11146 C CB     . GLU A 1 63 ? 41.661 33.540 15.049 1.00 0.00 ? 61 GLU A CB     6  
ATOM 11147 C CG     . GLU A 1 63 ? 40.147 33.421 15.273 1.00 0.00 ? 61 GLU A CG     6  
ATOM 11148 C CD     . GLU A 1 63 ? 39.387 32.838 14.076 1.00 0.00 ? 61 GLU A CD     6  
ATOM 11149 O OE1    . GLU A 1 63 ? 39.806 33.008 12.906 1.00 0.00 ? 61 GLU A OE1    6  
ATOM 11150 O OE2    . GLU A 1 63 ? 38.310 32.231 14.277 1.00 0.00 ? 61 GLU A OE2    6  
ATOM 11151 H H      . GLU A 1 63 ? 42.379 32.026 17.058 1.00 0.00 ? 61 GLU A H      6  
ATOM 11152 H HA     . GLU A 1 63 ? 41.881 31.591 14.162 1.00 0.00 ? 61 GLU A HA     6  
ATOM 11153 H HB2    . GLU A 1 63 ? 42.088 34.093 15.886 1.00 0.00 ? 61 GLU A HB2    6  
ATOM 11154 H HB3    . GLU A 1 63 ? 41.839 34.128 14.148 1.00 0.00 ? 61 GLU A HB3    6  
ATOM 11155 H HG2    . GLU A 1 63 ? 39.967 32.807 16.156 1.00 0.00 ? 61 GLU A HG2    6  
ATOM 11156 H HG3    . GLU A 1 63 ? 39.752 34.418 15.479 1.00 0.00 ? 61 GLU A HG3    6  
ATOM 11157 N N      . PHE A 1 64 ? 44.722 32.850 15.335 1.00 0.00 ? 62 PHE A N      6  
ATOM 11158 C CA     . PHE A 1 64 ? 46.131 33.165 15.039 1.00 0.00 ? 62 PHE A CA     6  
ATOM 11159 C C      . PHE A 1 64 ? 47.137 32.838 16.161 1.00 0.00 ? 62 PHE A C      6  
ATOM 11160 O O      . PHE A 1 64 ? 48.338 32.796 15.889 1.00 0.00 ? 62 PHE A O      6  
ATOM 11161 C CB     . PHE A 1 64 ? 46.243 34.636 14.607 1.00 0.00 ? 62 PHE A CB     6  
ATOM 11162 C CG     . PHE A 1 64 ? 45.719 35.644 15.612 1.00 0.00 ? 62 PHE A CG     6  
ATOM 11163 C CD1    . PHE A 1 64 ? 46.505 36.019 16.718 1.00 0.00 ? 62 PHE A CD1    6  
ATOM 11164 C CD2    . PHE A 1 64 ? 44.434 36.197 15.450 1.00 0.00 ? 62 PHE A CD2    6  
ATOM 11165 C CE1    . PHE A 1 64 ? 46.000 36.929 17.663 1.00 0.00 ? 62 PHE A CE1    6  
ATOM 11166 C CE2    . PHE A 1 64 ? 43.932 37.109 16.396 1.00 0.00 ? 62 PHE A CE2    6  
ATOM 11167 C CZ     . PHE A 1 64 ? 44.718 37.479 17.500 1.00 0.00 ? 62 PHE A CZ     6  
ATOM 11168 H H      . PHE A 1 64 ? 44.375 33.073 16.261 1.00 0.00 ? 62 PHE A H      6  
ATOM 11169 H HA     . PHE A 1 64 ? 46.446 32.557 14.193 1.00 0.00 ? 62 PHE A HA     6  
ATOM 11170 H HB2    . PHE A 1 64 ? 47.290 34.866 14.399 1.00 0.00 ? 62 PHE A HB2    6  
ATOM 11171 H HB3    . PHE A 1 64 ? 45.698 34.759 13.671 1.00 0.00 ? 62 PHE A HB3    6  
ATOM 11172 H HD1    . PHE A 1 64 ? 47.498 35.612 16.849 1.00 0.00 ? 62 PHE A HD1    6  
ATOM 11173 H HD2    . PHE A 1 64 ? 43.827 35.924 14.597 1.00 0.00 ? 62 PHE A HD2    6  
ATOM 11174 H HE1    . PHE A 1 64 ? 46.600 37.213 18.515 1.00 0.00 ? 62 PHE A HE1    6  
ATOM 11175 H HE2    . PHE A 1 64 ? 42.946 37.530 16.266 1.00 0.00 ? 62 PHE A HE2    6  
ATOM 11176 H HZ     . PHE A 1 64 ? 44.343 38.190 18.225 1.00 0.00 ? 62 PHE A HZ     6  
ATOM 11177 N N      . ILE A 1 65 ? 46.703 32.561 17.399 1.00 0.00 ? 63 ILE A N      6  
ATOM 11178 C CA     . ILE A 1 65 ? 47.585 31.932 18.404 1.00 0.00 ? 63 ILE A CA     6  
ATOM 11179 C C      . ILE A 1 65 ? 48.038 30.557 17.881 1.00 0.00 ? 63 ILE A C      6  
ATOM 11180 O O      . ILE A 1 65 ? 47.239 29.821 17.303 1.00 0.00 ? 63 ILE A O      6  
ATOM 11181 C CB     . ILE A 1 65 ? 46.896 31.825 19.786 1.00 0.00 ? 63 ILE A CB     6  
ATOM 11182 C CG1    . ILE A 1 65 ? 46.470 33.192 20.370 1.00 0.00 ? 63 ILE A CG1    6  
ATOM 11183 C CG2    . ILE A 1 65 ? 47.797 31.089 20.795 1.00 0.00 ? 63 ILE A CG2    6  
ATOM 11184 C CD1    . ILE A 1 65 ? 47.607 34.199 20.588 1.00 0.00 ? 63 ILE A CD1    6  
ATOM 11185 H H      . ILE A 1 65 ? 45.723 32.678 17.616 1.00 0.00 ? 63 ILE A H      6  
ATOM 11186 H HA     . ILE A 1 65 ? 48.478 32.548 18.511 1.00 0.00 ? 63 ILE A HA     6  
ATOM 11187 H HB     . ILE A 1 65 ? 45.986 31.237 19.666 1.00 0.00 ? 63 ILE A HB     6  
ATOM 11188 H HG12   . ILE A 1 65 ? 45.739 33.650 19.707 1.00 0.00 ? 63 ILE A HG12   6  
ATOM 11189 H HG13   . ILE A 1 65 ? 45.971 33.027 21.325 1.00 0.00 ? 63 ILE A HG13   6  
ATOM 11190 H HG21   . ILE A 1 65 ? 47.372 31.156 21.797 1.00 0.00 ? 63 ILE A HG21   6  
ATOM 11191 H HG22   . ILE A 1 65 ? 47.867 30.032 20.537 1.00 0.00 ? 63 ILE A HG22   6  
ATOM 11192 H HG23   . ILE A 1 65 ? 48.796 31.522 20.812 1.00 0.00 ? 63 ILE A HG23   6  
ATOM 11193 H HD11   . ILE A 1 65 ? 48.076 34.443 19.636 1.00 0.00 ? 63 ILE A HD11   6  
ATOM 11194 H HD12   . ILE A 1 65 ? 47.203 35.113 21.016 1.00 0.00 ? 63 ILE A HD12   6  
ATOM 11195 H HD13   . ILE A 1 65 ? 48.348 33.791 21.273 1.00 0.00 ? 63 ILE A HD13   6  
ATOM 11196 N N      . VAL A 1 66 ? 49.319 30.208 18.042 1.00 0.00 ? 64 VAL A N      6  
ATOM 11197 C CA     . VAL A 1 66 ? 49.898 28.986 17.453 1.00 0.00 ? 64 VAL A CA     6  
ATOM 11198 C C      . VAL A 1 66 ? 51.034 28.390 18.301 1.00 0.00 ? 64 VAL A C      6  
ATOM 11199 O O      . VAL A 1 66 ? 51.692 29.115 19.053 1.00 0.00 ? 64 VAL A O      6  
ATOM 11200 C CB     . VAL A 1 66 ? 50.319 29.261 15.993 1.00 0.00 ? 64 VAL A CB     6  
ATOM 11201 C CG1    . VAL A 1 66 ? 51.534 30.190 15.877 1.00 0.00 ? 64 VAL A CG1    6  
ATOM 11202 C CG2    . VAL A 1 66 ? 50.575 27.972 15.207 1.00 0.00 ? 64 VAL A CG2    6  
ATOM 11203 H H      . VAL A 1 66 ? 49.940 30.846 18.518 1.00 0.00 ? 64 VAL A H      6  
ATOM 11204 H HA     . VAL A 1 66 ? 49.109 28.240 17.417 1.00 0.00 ? 64 VAL A HA     6  
ATOM 11205 H HB     . VAL A 1 66 ? 49.483 29.759 15.498 1.00 0.00 ? 64 VAL A HB     6  
ATOM 11206 H HG11   . VAL A 1 66 ? 51.728 30.408 14.827 1.00 0.00 ? 64 VAL A HG11   6  
ATOM 11207 H HG12   . VAL A 1 66 ? 51.334 31.132 16.387 1.00 0.00 ? 64 VAL A HG12   6  
ATOM 11208 H HG13   . VAL A 1 66 ? 52.420 29.723 16.308 1.00 0.00 ? 64 VAL A HG13   6  
ATOM 11209 H HG21   . VAL A 1 66 ? 51.495 27.495 15.541 1.00 0.00 ? 64 VAL A HG21   6  
ATOM 11210 H HG22   . VAL A 1 66 ? 49.736 27.287 15.333 1.00 0.00 ? 64 VAL A HG22   6  
ATOM 11211 H HG23   . VAL A 1 66 ? 50.664 28.212 14.149 1.00 0.00 ? 64 VAL A HG23   6  
ATOM 11212 N N      . THR A 1 67 ? 51.257 27.079 18.187 1.00 0.00 ? 65 THR A N      6  
ATOM 11213 C CA     . THR A 1 67 ? 52.376 26.310 18.767 1.00 0.00 ? 65 THR A CA     6  
ATOM 11214 C C      . THR A 1 67 ? 52.796 25.160 17.834 1.00 0.00 ? 65 THR A C      6  
ATOM 11215 O O      . THR A 1 67 ? 52.206 24.990 16.761 1.00 0.00 ? 65 THR A O      6  
ATOM 11216 C CB     . THR A 1 67 ? 52.016 25.799 20.172 1.00 0.00 ? 65 THR A CB     6  
ATOM 11217 O OG1    . THR A 1 67 ? 53.199 25.472 20.854 1.00 0.00 ? 65 THR A OG1    6  
ATOM 11218 C CG2    . THR A 1 67 ? 51.109 24.567 20.220 1.00 0.00 ? 65 THR A CG2    6  
ATOM 11219 H H      . THR A 1 67 ? 50.625 26.552 17.596 1.00 0.00 ? 65 THR A H      6  
ATOM 11220 H HA     . THR A 1 67 ? 53.238 26.970 18.871 1.00 0.00 ? 65 THR A HA     6  
ATOM 11221 H HB     . THR A 1 67 ? 51.532 26.608 20.719 1.00 0.00 ? 65 THR A HB     6  
ATOM 11222 H HG1    . THR A 1 67 ? 52.915 25.293 21.782 1.00 0.00 ? 65 THR A HG1    6  
ATOM 11223 H HG21   . THR A 1 67 ? 50.832 24.366 21.254 1.00 0.00 ? 65 THR A HG21   6  
ATOM 11224 H HG22   . THR A 1 67 ? 50.202 24.746 19.648 1.00 0.00 ? 65 THR A HG22   6  
ATOM 11225 H HG23   . THR A 1 67 ? 51.620 23.692 19.819 1.00 0.00 ? 65 THR A HG23   6  
ATOM 11226 N N      . ASP A 1 68 ? 53.819 24.382 18.209 1.00 0.00 ? 66 ASP A N      6  
ATOM 11227 C CA     . ASP A 1 68 ? 54.382 23.277 17.407 1.00 0.00 ? 66 ASP A CA     6  
ATOM 11228 C C      . ASP A 1 68 ? 55.042 22.172 18.256 1.00 0.00 ? 66 ASP A C      6  
ATOM 11229 O O      . ASP A 1 68 ? 56.231 22.319 18.621 1.00 0.00 ? 66 ASP A O      6  
ATOM 11230 C CB     . ASP A 1 68 ? 55.362 23.896 16.383 1.00 0.00 ? 66 ASP A CB     6  
ATOM 11231 C CG     . ASP A 1 68 ? 55.878 22.921 15.324 1.00 0.00 ? 66 ASP A CG     6  
ATOM 11232 O OD1    . ASP A 1 68 ? 55.107 22.061 14.825 1.00 0.00 ? 66 ASP A OD1    6  
ATOM 11233 O OD2    . ASP A 1 68 ? 57.035 23.075 14.862 1.00 0.00 ? 66 ASP A OD2    6  
ATOM 11234 O OXT    . ASP A 1 68 ? 54.379 21.154 18.559 1.00 0.00 ? 66 ASP A OXT    6  
ATOM 11235 H H      . ASP A 1 68 ? 54.191 24.543 19.139 1.00 0.00 ? 66 ASP A H      6  
ATOM 11236 H HA     . ASP A 1 68 ? 53.572 22.797 16.857 1.00 0.00 ? 66 ASP A HA     6  
ATOM 11237 H HB2    . ASP A 1 68 ? 54.854 24.706 15.855 1.00 0.00 ? 66 ASP A HB2    6  
ATOM 11238 H HB3    . ASP A 1 68 ? 56.208 24.337 16.914 1.00 0.00 ? 66 ASP A HB3    6  
ATOM 11239 O "O5'"  . DG  B 2 1  ? 51.446 11.708 31.320 1.00 0.00 ? 67 DG  B "O5'"  6  
ATOM 11240 C "C5'"  . DG  B 2 1  ? 52.301 11.398 30.220 1.00 0.00 ? 67 DG  B "C5'"  6  
ATOM 11241 C "C4'"  . DG  B 2 1  ? 51.800 11.841 28.825 1.00 0.00 ? 67 DG  B "C4'"  6  
ATOM 11242 O "O4'"  . DG  B 2 1  ? 50.508 11.292 28.569 1.00 0.00 ? 67 DG  B "O4'"  6  
ATOM 11243 C "C3'"  . DG  B 2 1  ? 51.713 13.361 28.610 1.00 0.00 ? 67 DG  B "C3'"  6  
ATOM 11244 O "O3'"  . DG  B 2 1  ? 52.144 13.663 27.284 1.00 0.00 ? 67 DG  B "O3'"  6  
ATOM 11245 C "C2'"  . DG  B 2 1  ? 50.229 13.626 28.849 1.00 0.00 ? 67 DG  B "C2'"  6  
ATOM 11246 C "C1'"  . DG  B 2 1  ? 49.558 12.331 28.385 1.00 0.00 ? 67 DG  B "C1'"  6  
ATOM 11247 N N9     . DG  B 2 1  ? 48.341 11.990 29.161 1.00 0.00 ? 67 DG  B N9     6  
ATOM 11248 C C8     . DG  B 2 1  ? 48.205 11.923 30.527 1.00 0.00 ? 67 DG  B C8     6  
ATOM 11249 N N7     . DG  B 2 1  ? 47.052 11.459 30.935 1.00 0.00 ? 67 DG  B N7     6  
ATOM 11250 C C5     . DG  B 2 1  ? 46.358 11.222 29.742 1.00 0.00 ? 67 DG  B C5     6  
ATOM 11251 C C6     . DG  B 2 1  ? 45.058 10.660 29.500 1.00 0.00 ? 67 DG  B C6     6  
ATOM 11252 O O6     . DG  B 2 1  ? 44.262 10.172 30.305 1.00 0.00 ? 67 DG  B O6     6  
ATOM 11253 N N1     . DG  B 2 1  ? 44.697 10.646 28.172 1.00 0.00 ? 67 DG  B N1     6  
ATOM 11254 C C2     . DG  B 2 1  ? 45.524 11.020 27.168 1.00 0.00 ? 67 DG  B C2     6  
ATOM 11255 N N2     . DG  B 2 1  ? 45.087 10.851 25.952 1.00 0.00 ? 67 DG  B N2     6  
ATOM 11256 N N3     . DG  B 2 1  ? 46.771 11.463 27.336 1.00 0.00 ? 67 DG  B N3     6  
ATOM 11257 C C4     . DG  B 2 1  ? 47.128 11.571 28.653 1.00 0.00 ? 67 DG  B C4     6  
ATOM 11258 H "H5'"  . DG  B 2 1  ? 52.442 10.316 30.190 1.00 0.00 ? 67 DG  B "H5'"  6  
ATOM 11259 H "H5''" . DG  B 2 1  ? 53.282 11.845 30.394 1.00 0.00 ? 67 DG  B "H5''" 6  
ATOM 11260 H "H4'"  . DG  B 2 1  ? 52.495 11.439 28.089 1.00 0.00 ? 67 DG  B "H4'"  6  
ATOM 11261 H "H3'"  . DG  B 2 1  ? 52.335 13.884 29.336 1.00 0.00 ? 67 DG  B "H3'"  6  
ATOM 11262 H "H2'"  . DG  B 2 1  ? 50.058 13.797 29.909 1.00 0.00 ? 67 DG  B "H2'"  6  
ATOM 11263 H "H2''" . DG  B 2 1  ? 49.874 14.483 28.289 1.00 0.00 ? 67 DG  B "H2''" 6  
ATOM 11264 H "H1'"  . DG  B 2 1  ? 49.315 12.417 27.321 1.00 0.00 ? 67 DG  B "H1'"  6  
ATOM 11265 H H8     . DG  B 2 1  ? 49.009 12.197 31.200 1.00 0.00 ? 67 DG  B H8     6  
ATOM 11266 H H1     . DG  B 2 1  ? 43.776 10.309 27.943 1.00 0.00 ? 67 DG  B H1     6  
ATOM 11267 H H21    . DG  B 2 1  ? 45.738 11.068 25.203 1.00 0.00 ? 67 DG  B H21    6  
ATOM 11268 H H22    . DG  B 2 1  ? 44.149 10.517 25.765 1.00 0.00 ? 67 DG  B H22    6  
ATOM 11269 H "HO5'" . DG  B 2 1  ? 51.509 12.665 31.544 1.00 0.00 ? 67 DG  B "HO5'" 6  
ATOM 11270 P P      . DC  B 2 2  ? 52.162 15.130 26.641 1.00 0.00 ? 68 DC  B P      6  
ATOM 11271 O OP1    . DC  B 2 2  ? 53.105 15.116 25.493 1.00 0.00 ? 68 DC  B OP1    6  
ATOM 11272 O OP2    . DC  B 2 2  ? 52.317 16.168 27.685 1.00 0.00 ? 68 DC  B OP2    6  
ATOM 11273 O "O5'"  . DC  B 2 2  ? 50.685 15.292 26.066 1.00 0.00 ? 68 DC  B "O5'"  6  
ATOM 11274 C "C5'"  . DC  B 2 2  ? 50.231 14.535 24.952 1.00 0.00 ? 68 DC  B "C5'"  6  
ATOM 11275 C "C4'"  . DC  B 2 2  ? 48.768 14.849 24.595 1.00 0.00 ? 68 DC  B "C4'"  6  
ATOM 11276 O "O4'"  . DC  B 2 2  ? 47.878 14.263 25.542 1.00 0.00 ? 68 DC  B "O4'"  6  
ATOM 11277 C "C3'"  . DC  B 2 2  ? 48.469 16.359 24.527 1.00 0.00 ? 68 DC  B "C3'"  6  
ATOM 11278 O "O3'"  . DC  B 2 2  ? 47.971 16.721 23.242 1.00 0.00 ? 68 DC  B "O3'"  6  
ATOM 11279 C "C2'"  . DC  B 2 2  ? 47.450 16.551 25.649 1.00 0.00 ? 68 DC  B "C2'"  6  
ATOM 11280 C "C1'"  . DC  B 2 2  ? 46.815 15.169 25.775 1.00 0.00 ? 68 DC  B "C1'"  6  
ATOM 11281 N N1     . DC  B 2 2  ? 46.201 14.923 27.112 1.00 0.00 ? 68 DC  B N1     6  
ATOM 11282 C C2     . DC  B 2 2  ? 44.866 14.501 27.197 1.00 0.00 ? 68 DC  B C2     6  
ATOM 11283 O O2     . DC  B 2 2  ? 44.177 14.287 26.199 1.00 0.00 ? 68 DC  B O2     6  
ATOM 11284 N N3     . DC  B 2 2  ? 44.272 14.320 28.401 1.00 0.00 ? 68 DC  B N3     6  
ATOM 11285 C C4     . DC  B 2 2  ? 44.981 14.548 29.488 1.00 0.00 ? 68 DC  B C4     6  
ATOM 11286 N N4     . DC  B 2 2  ? 44.370 14.364 30.613 1.00 0.00 ? 68 DC  B N4     6  
ATOM 11287 C C5     . DC  B 2 2  ? 46.338 14.952 29.474 1.00 0.00 ? 68 DC  B C5     6  
ATOM 11288 C C6     . DC  B 2 2  ? 46.919 15.136 28.264 1.00 0.00 ? 68 DC  B C6     6  
ATOM 11289 H "H5'"  . DC  B 2 2  ? 50.319 13.469 25.169 1.00 0.00 ? 68 DC  B "H5'"  6  
ATOM 11290 H "H5''" . DC  B 2 2  ? 50.860 14.759 24.092 1.00 0.00 ? 68 DC  B "H5''" 6  
ATOM 11291 H "H4'"  . DC  B 2 2  ? 48.562 14.416 23.615 1.00 0.00 ? 68 DC  B "H4'"  6  
ATOM 11292 H "H3'"  . DC  B 2 2  ? 49.369 16.935 24.746 1.00 0.00 ? 68 DC  B "H3'"  6  
ATOM 11293 H "H2'"  . DC  B 2 2  ? 47.988 16.840 26.551 1.00 0.00 ? 68 DC  B "H2'"  6  
ATOM 11294 H "H2''" . DC  B 2 2  ? 46.700 17.306 25.427 1.00 0.00 ? 68 DC  B "H2''" 6  
ATOM 11295 H "H1'"  . DC  B 2 2  ? 46.065 15.071 24.982 1.00 0.00 ? 68 DC  B "H1'"  6  
ATOM 11296 H H41    . DC  B 2 2  ? 43.406 14.065 30.599 1.00 0.00 ? 68 DC  B H41    6  
ATOM 11297 H H42    . DC  B 2 2  ? 44.877 14.486 31.478 1.00 0.00 ? 68 DC  B H42    6  
ATOM 11298 H H5     . DC  B 2 2  ? 46.897 15.132 30.380 1.00 0.00 ? 68 DC  B H5     6  
ATOM 11299 H H6     . DC  B 2 2  ? 47.951 15.458 28.200 1.00 0.00 ? 68 DC  B H6     6  
ATOM 11300 P P      . DT  B 2 3  ? 47.527 18.222 22.893 1.00 0.00 ? 69 DT  B P      6  
ATOM 11301 O OP1    . DT  B 2 3  ? 47.713 18.430 21.440 1.00 0.00 ? 69 DT  B OP1    6  
ATOM 11302 O OP2    . DT  B 2 3  ? 48.195 19.144 23.833 1.00 0.00 ? 69 DT  B OP2    6  
ATOM 11303 O "O5'"  . DT  B 2 3  ? 45.967 18.257 23.198 1.00 0.00 ? 69 DT  B "O5'"  6  
ATOM 11304 C "C5'"  . DT  B 2 3  ? 45.049 17.500 22.420 1.00 0.00 ? 69 DT  B "C5'"  6  
ATOM 11305 C "C4'"  . DT  B 2 3  ? 43.631 17.583 22.993 1.00 0.00 ? 69 DT  B "C4'"  6  
ATOM 11306 O "O4'"  . DT  B 2 3  ? 43.619 17.088 24.323 1.00 0.00 ? 69 DT  B "O4'"  6  
ATOM 11307 C "C3'"  . DT  B 2 3  ? 43.080 19.018 23.044 1.00 0.00 ? 69 DT  B "C3'"  6  
ATOM 11308 O "O3'"  . DT  B 2 3  ? 42.186 19.297 21.963 1.00 0.00 ? 69 DT  B "O3'"  6  
ATOM 11309 C "C2'"  . DT  B 2 3  ? 42.385 19.083 24.407 1.00 0.00 ? 69 DT  B "C2'"  6  
ATOM 11310 C "C1'"  . DT  B 2 3  ? 42.537 17.683 25.009 1.00 0.00 ? 69 DT  B "C1'"  6  
ATOM 11311 N N1     . DT  B 2 3  ? 42.812 17.707 26.475 1.00 0.00 ? 69 DT  B N1     6  
ATOM 11312 C C2     . DT  B 2 3  ? 41.796 17.301 27.350 1.00 0.00 ? 69 DT  B C2     6  
ATOM 11313 O O2     . DT  B 2 3  ? 40.662 16.999 26.985 1.00 0.00 ? 69 DT  B O2     6  
ATOM 11314 N N3     . DT  B 2 3  ? 42.109 17.261 28.687 1.00 0.00 ? 69 DT  B N3     6  
ATOM 11315 C C4     . DT  B 2 3  ? 43.316 17.609 29.247 1.00 0.00 ? 69 DT  B C4     6  
ATOM 11316 O O4     . DT  B 2 3  ? 43.467 17.467 30.461 1.00 0.00 ? 69 DT  B O4     6  
ATOM 11317 C C5     . DT  B 2 3  ? 44.310 18.100 28.291 1.00 0.00 ? 69 DT  B C5     6  
ATOM 11318 C C7     . DT  B 2 3  ? 45.667 18.571 28.780 1.00 0.00 ? 69 DT  B C7     6  
ATOM 11319 C C6     . DT  B 2 3  ? 44.035 18.130 26.958 1.00 0.00 ? 69 DT  B C6     6  
ATOM 11320 H "H5'"  . DT  B 2 3  ? 45.356 16.453 22.406 1.00 0.00 ? 69 DT  B "H5'"  6  
ATOM 11321 H "H5''" . DT  B 2 3  ? 45.039 17.873 21.395 1.00 0.00 ? 69 DT  B "H5''" 6  
ATOM 11322 H "H4'"  . DT  B 2 3  ? 42.973 16.969 22.379 1.00 0.00 ? 69 DT  B "H4'"  6  
ATOM 11323 H "H3'"  . DT  B 2 3  ? 43.920 19.717 23.034 1.00 0.00 ? 69 DT  B "H3'"  6  
ATOM 11324 H "H2'"  . DT  B 2 3  ? 42.889 19.828 25.023 1.00 0.00 ? 69 DT  B "H2'"  6  
ATOM 11325 H "H2''" . DT  B 2 3  ? 41.329 19.333 24.310 1.00 0.00 ? 69 DT  B "H2''" 6  
ATOM 11326 H "H1'"  . DT  B 2 3  ? 41.631 17.105 24.806 1.00 0.00 ? 69 DT  B "H1'"  6  
ATOM 11327 H H3     . DT  B 2 3  ? 41.383 16.955 29.318 1.00 0.00 ? 69 DT  B H3     6  
ATOM 11328 H H71    . DT  B 2 3  ? 46.317 18.830 27.945 1.00 0.00 ? 69 DT  B H71    6  
ATOM 11329 H H72    . DT  B 2 3  ? 45.538 19.445 29.420 1.00 0.00 ? 69 DT  B H72    6  
ATOM 11330 H H73    . DT  B 2 3  ? 46.138 17.787 29.373 1.00 0.00 ? 69 DT  B H73    6  
ATOM 11331 H H6     . DT  B 2 3  ? 44.782 18.477 26.252 1.00 0.00 ? 69 DT  B H6     6  
ATOM 11332 P P      . DC  B 2 4  ? 41.778 20.814 21.589 1.00 0.00 ? 70 DC  B P      6  
ATOM 11333 O OP1    . DC  B 2 4  ? 41.356 20.871 20.169 1.00 0.00 ? 70 DC  B OP1    6  
ATOM 11334 O OP2    . DC  B 2 4  ? 42.843 21.727 22.050 1.00 0.00 ? 70 DC  B OP2    6  
ATOM 11335 O "O5'"  . DC  B 2 4  ? 40.463 21.089 22.459 1.00 0.00 ? 70 DC  B "O5'"  6  
ATOM 11336 C "C5'"  . DC  B 2 4  ? 39.237 20.449 22.117 1.00 0.00 ? 70 DC  B "C5'"  6  
ATOM 11337 C "C4'"  . DC  B 2 4  ? 38.085 20.665 23.105 1.00 0.00 ? 70 DC  B "C4'"  6  
ATOM 11338 O "O4'"  . DC  B 2 4  ? 38.526 20.265 24.399 1.00 0.00 ? 70 DC  B "O4'"  6  
ATOM 11339 C "C3'"  . DC  B 2 4  ? 37.518 22.088 23.204 1.00 0.00 ? 70 DC  B "C3'"  6  
ATOM 11340 O "O3'"  . DC  B 2 4  ? 36.098 21.992 23.320 1.00 0.00 ? 70 DC  B "O3'"  6  
ATOM 11341 C "C2'"  . DC  B 2 4  ? 38.174 22.618 24.472 1.00 0.00 ? 70 DC  B "C2'"  6  
ATOM 11342 C "C1'"  . DC  B 2 4  ? 38.383 21.349 25.301 1.00 0.00 ? 70 DC  B "C1'"  6  
ATOM 11343 N N1     . DC  B 2 4  ? 39.560 21.388 26.223 1.00 0.00 ? 70 DC  B N1     6  
ATOM 11344 C C2     . DC  B 2 4  ? 39.386 20.971 27.549 1.00 0.00 ? 70 DC  B C2     6  
ATOM 11345 O O2     . DC  B 2 4  ? 38.290 20.588 27.961 1.00 0.00 ? 70 DC  B O2     6  
ATOM 11346 N N3     . DC  B 2 4  ? 40.419 20.985 28.427 1.00 0.00 ? 70 DC  B N3     6  
ATOM 11347 C C4     . DC  B 2 4  ? 41.594 21.416 28.015 1.00 0.00 ? 70 DC  B C4     6  
ATOM 11348 N N4     . DC  B 2 4  ? 42.548 21.436 28.900 1.00 0.00 ? 70 DC  B N4     6  
ATOM 11349 C C5     . DC  B 2 4  ? 41.840 21.840 26.681 1.00 0.00 ? 70 DC  B C5     6  
ATOM 11350 C C6     . DC  B 2 4  ? 40.803 21.801 25.805 1.00 0.00 ? 70 DC  B C6     6  
ATOM 11351 H "H5'"  . DC  B 2 4  ? 39.412 19.378 22.050 1.00 0.00 ? 70 DC  B "H5'"  6  
ATOM 11352 H "H5''" . DC  B 2 4  ? 38.912 20.776 21.132 1.00 0.00 ? 70 DC  B "H5''" 6  
ATOM 11353 H "H4'"  . DC  B 2 4  ? 37.275 20.013 22.788 1.00 0.00 ? 70 DC  B "H4'"  6  
ATOM 11354 H "H3'"  . DC  B 2 4  ? 37.800 22.683 22.332 1.00 0.00 ? 70 DC  B "H3'"  6  
ATOM 11355 H "H2'"  . DC  B 2 4  ? 39.117 23.096 24.215 1.00 0.00 ? 70 DC  B "H2'"  6  
ATOM 11356 H "H2''" . DC  B 2 4  ? 37.532 23.324 24.995 1.00 0.00 ? 70 DC  B "H2''" 6  
ATOM 11357 H "H1'"  . DC  B 2 4  ? 37.462 21.195 25.872 1.00 0.00 ? 70 DC  B "H1'"  6  
ATOM 11358 H H41    . DC  B 2 4  ? 43.416 21.910 28.691 1.00 0.00 ? 70 DC  B H41    6  
ATOM 11359 H H42    . DC  B 2 4  ? 42.350 21.113 29.840 1.00 0.00 ? 70 DC  B H42    6  
ATOM 11360 H H5     . DC  B 2 4  ? 42.812 22.174 26.355 1.00 0.00 ? 70 DC  B H5     6  
ATOM 11361 H H6     . DC  B 2 4  ? 40.955 22.087 24.768 1.00 0.00 ? 70 DC  B H6     6  
ATOM 11362 P P      . DT  B 2 5  ? 35.118 23.250 23.198 1.00 0.00 ? 71 DT  B P      6  
ATOM 11363 O OP1    . DT  B 2 5  ? 33.796 22.721 22.778 1.00 0.00 ? 71 DT  B OP1    6  
ATOM 11364 O OP2    . DT  B 2 5  ? 35.753 24.267 22.337 1.00 0.00 ? 71 DT  B OP2    6  
ATOM 11365 O "O5'"  . DT  B 2 5  ? 34.963 23.848 24.670 1.00 0.00 ? 71 DT  B "O5'"  6  
ATOM 11366 C "C5'"  . DT  B 2 5  ? 34.207 23.168 25.669 1.00 0.00 ? 71 DT  B "C5'"  6  
ATOM 11367 C "C4'"  . DT  B 2 5  ? 34.276 23.801 27.068 1.00 0.00 ? 71 DT  B "C4'"  6  
ATOM 11368 O "O4'"  . DT  B 2 5  ? 35.578 23.550 27.575 1.00 0.00 ? 71 DT  B "O4'"  6  
ATOM 11369 C "C3'"  . DT  B 2 5  ? 34.048 25.330 27.095 1.00 0.00 ? 71 DT  B "C3'"  6  
ATOM 11370 O "O3'"  . DT  B 2 5  ? 33.423 25.801 28.288 1.00 0.00 ? 71 DT  B "O3'"  6  
ATOM 11371 C "C2'"  . DT  B 2 5  ? 35.486 25.837 27.139 1.00 0.00 ? 71 DT  B "C2'"  6  
ATOM 11372 C "C1'"  . DT  B 2 5  ? 36.084 24.772 28.062 1.00 0.00 ? 71 DT  B "C1'"  6  
ATOM 11373 N N1     . DT  B 2 5  ? 37.564 24.689 28.173 1.00 0.00 ? 71 DT  B N1     6  
ATOM 11374 C C2     . DT  B 2 5  ? 38.069 24.193 29.383 1.00 0.00 ? 71 DT  B C2     6  
ATOM 11375 O O2     . DT  B 2 5  ? 37.368 23.784 30.312 1.00 0.00 ? 71 DT  B O2     6  
ATOM 11376 N N3     . DT  B 2 5  ? 39.433 24.176 29.519 1.00 0.00 ? 71 DT  B N3     6  
ATOM 11377 C C4     . DT  B 2 5  ? 40.344 24.576 28.577 1.00 0.00 ? 71 DT  B C4     6  
ATOM 11378 O O4     . DT  B 2 5  ? 41.538 24.568 28.874 1.00 0.00 ? 71 DT  B O4     6  
ATOM 11379 C C5     . DT  B 2 5  ? 39.765 24.998 27.304 1.00 0.00 ? 71 DT  B C5     6  
ATOM 11380 C C7     . DT  B 2 5  ? 40.671 25.374 26.145 1.00 0.00 ? 71 DT  B C7     6  
ATOM 11381 C C6     . DT  B 2 5  ? 38.415 25.050 27.141 1.00 0.00 ? 71 DT  B C6     6  
ATOM 11382 H "H5'"  . DT  B 2 5  ? 34.585 22.150 25.753 1.00 0.00 ? 71 DT  B "H5'"  6  
ATOM 11383 H "H5''" . DT  B 2 5  ? 33.165 23.116 25.362 1.00 0.00 ? 71 DT  B "H5''" 6  
ATOM 11384 H "H4'"  . DT  B 2 5  ? 33.544 23.313 27.713 1.00 0.00 ? 71 DT  B "H4'"  6  
ATOM 11385 H "H3'"  . DT  B 2 5  ? 33.525 25.683 26.205 1.00 0.00 ? 71 DT  B "H3'"  6  
ATOM 11386 H "H2'"  . DT  B 2 5  ? 35.917 25.808 26.140 1.00 0.00 ? 71 DT  B "H2'"  6  
ATOM 11387 H "H2''" . DT  B 2 5  ? 35.553 26.835 27.573 1.00 0.00 ? 71 DT  B "H2''" 6  
ATOM 11388 H "H1'"  . DT  B 2 5  ? 35.669 24.945 29.061 1.00 0.00 ? 71 DT  B "H1'"  6  
ATOM 11389 H H3     . DT  B 2 5  ? 39.803 23.866 30.406 1.00 0.00 ? 71 DT  B H3     6  
ATOM 11390 H H71    . DT  B 2 5  ? 40.091 25.577 25.245 1.00 0.00 ? 71 DT  B H71    6  
ATOM 11391 H H72    . DT  B 2 5  ? 41.268 26.247 26.409 1.00 0.00 ? 71 DT  B H72    6  
ATOM 11392 H H73    . DT  B 2 5  ? 41.359 24.555 25.941 1.00 0.00 ? 71 DT  B H73    6  
ATOM 11393 H H6     . DT  B 2 5  ? 38.005 25.363 26.188 1.00 0.00 ? 71 DT  B H6     6  
ATOM 11394 P P      . DA  B 2 6  ? 31.848 25.743 28.553 1.00 0.00 ? 72 DA  B P      6  
ATOM 11395 O OP1    . DA  B 2 6  ? 31.322 24.481 27.995 1.00 0.00 ? 72 DA  B OP1    6  
ATOM 11396 O OP2    . DA  B 2 6  ? 31.248 27.025 28.124 1.00 0.00 ? 72 DA  B OP2    6  
ATOM 11397 O "O5'"  . DA  B 2 6  ? 31.786 25.676 30.156 1.00 0.00 ? 72 DA  B "O5'"  6  
ATOM 11398 C "C5'"  . DA  B 2 6  ? 31.659 24.443 30.859 1.00 0.00 ? 72 DA  B "C5'"  6  
ATOM 11399 C "C4'"  . DA  B 2 6  ? 31.929 24.521 32.379 1.00 0.00 ? 72 DA  B "C4'"  6  
ATOM 11400 O "O4'"  . DA  B 2 6  ? 33.328 24.569 32.643 1.00 0.00 ? 72 DA  B "O4'"  6  
ATOM 11401 C "C3'"  . DA  B 2 6  ? 31.319 25.728 33.106 1.00 0.00 ? 72 DA  B "C3'"  6  
ATOM 11402 O "O3'"  . DA  B 2 6  ? 31.041 25.373 34.462 1.00 0.00 ? 72 DA  B "O3'"  6  
ATOM 11403 C "C2'"  . DA  B 2 6  ? 32.442 26.755 32.993 1.00 0.00 ? 72 DA  B "C2'"  6  
ATOM 11404 C "C1'"  . DA  B 2 6  ? 33.689 25.877 33.060 1.00 0.00 ? 72 DA  B "C1'"  6  
ATOM 11405 N N9     . DA  B 2 6  ? 34.817 26.359 32.233 1.00 0.00 ? 72 DA  B N9     6  
ATOM 11406 C C8     . DA  B 2 6  ? 34.818 26.886 30.961 1.00 0.00 ? 72 DA  B C8     6  
ATOM 11407 N N7     . DA  B 2 6  ? 36.008 27.171 30.495 1.00 0.00 ? 72 DA  B N7     6  
ATOM 11408 C C5     . DA  B 2 6  ? 36.850 26.818 31.561 1.00 0.00 ? 72 DA  B C5     6  
ATOM 11409 C C6     . DA  B 2 6  ? 38.246 26.847 31.786 1.00 0.00 ? 72 DA  B C6     6  
ATOM 11410 N N6     . DA  B 2 6  ? 39.150 27.299 30.938 1.00 0.00 ? 72 DA  B N6     6  
ATOM 11411 N N1     . DA  B 2 6  ? 38.758 26.435 32.941 1.00 0.00 ? 72 DA  B N1     6  
ATOM 11412 C C2     . DA  B 2 6  ? 37.939 25.999 33.883 1.00 0.00 ? 72 DA  B C2     6  
ATOM 11413 N N3     . DA  B 2 6  ? 36.616 25.898 33.825 1.00 0.00 ? 72 DA  B N3     6  
ATOM 11414 C C4     . DA  B 2 6  ? 36.133 26.332 32.621 1.00 0.00 ? 72 DA  B C4     6  
ATOM 11415 H "H5'"  . DA  B 2 6  ? 32.355 23.716 30.436 1.00 0.00 ? 72 DA  B "H5'"  6  
ATOM 11416 H "H5''" . DA  B 2 6  ? 30.648 24.063 30.710 1.00 0.00 ? 72 DA  B "H5''" 6  
ATOM 11417 H "H4'"  . DA  B 2 6  ? 31.523 23.611 32.820 1.00 0.00 ? 72 DA  B "H4'"  6  
ATOM 11418 H "H3'"  . DA  B 2 6  ? 30.417 26.075 32.597 1.00 0.00 ? 72 DA  B "H3'"  6  
ATOM 11419 H "H2'"  . DA  B 2 6  ? 32.368 27.275 32.041 1.00 0.00 ? 72 DA  B "H2'"  6  
ATOM 11420 H "H2''" . DA  B 2 6  ? 32.424 27.482 33.802 1.00 0.00 ? 72 DA  B "H2''" 6  
ATOM 11421 H "H1'"  . DA  B 2 6  ? 34.005 25.838 34.106 1.00 0.00 ? 72 DA  B "H1'"  6  
ATOM 11422 H H8     . DA  B 2 6  ? 33.911 27.036 30.388 1.00 0.00 ? 72 DA  B H8     6  
ATOM 11423 H H61    . DA  B 2 6  ? 38.832 27.791 30.111 1.00 0.00 ? 72 DA  B H61    6  
ATOM 11424 H H62    . DA  B 2 6  ? 40.118 27.291 31.229 1.00 0.00 ? 72 DA  B H62    6  
ATOM 11425 H H2     . DA  B 2 6  ? 38.402 25.672 34.804 1.00 0.00 ? 72 DA  B H2     6  
ATOM 11426 P P      . DA  B 2 7  ? 30.289 26.364 35.481 1.00 0.00 ? 73 DA  B P      6  
ATOM 11427 O OP1    . DA  B 2 7  ? 29.699 25.492 36.520 1.00 0.00 ? 73 DA  B OP1    6  
ATOM 11428 O OP2    . DA  B 2 7  ? 29.419 27.266 34.693 1.00 0.00 ? 73 DA  B OP2    6  
ATOM 11429 O "O5'"  . DA  B 2 7  ? 31.478 27.226 36.140 1.00 0.00 ? 73 DA  B "O5'"  6  
ATOM 11430 C "C5'"  . DA  B 2 7  ? 32.265 26.686 37.189 1.00 0.00 ? 73 DA  B "C5'"  6  
ATOM 11431 C "C4'"  . DA  B 2 7  ? 33.549 27.467 37.498 1.00 0.00 ? 73 DA  B "C4'"  6  
ATOM 11432 O "O4'"  . DA  B 2 7  ? 34.392 27.533 36.362 1.00 0.00 ? 73 DA  B "O4'"  6  
ATOM 11433 C "C3'"  . DA  B 2 7  ? 33.353 28.893 38.033 1.00 0.00 ? 73 DA  B "C3'"  6  
ATOM 11434 O "O3'"  . DA  B 2 7  ? 33.569 28.840 39.440 1.00 0.00 ? 73 DA  B "O3'"  6  
ATOM 11435 C "C2'"  . DA  B 2 7  ? 34.420 29.688 37.272 1.00 0.00 ? 73 DA  B "C2'"  6  
ATOM 11436 C "C1'"  . DA  B 2 7  ? 35.261 28.632 36.548 1.00 0.00 ? 73 DA  B "C1'"  6  
ATOM 11437 N N9     . DA  B 2 7  ? 35.727 29.094 35.221 1.00 0.00 ? 73 DA  B N9     6  
ATOM 11438 C C8     . DA  B 2 7  ? 34.954 29.419 34.136 1.00 0.00 ? 73 DA  B C8     6  
ATOM 11439 N N7     . DA  B 2 7  ? 35.627 29.844 33.102 1.00 0.00 ? 73 DA  B N7     6  
ATOM 11440 C C5     . DA  B 2 7  ? 36.958 29.781 33.541 1.00 0.00 ? 73 DA  B C5     6  
ATOM 11441 C C6     . DA  B 2 7  ? 38.218 30.077 32.965 1.00 0.00 ? 73 DA  B C6     6  
ATOM 11442 N N6     . DA  B 2 7  ? 38.404 30.551 31.748 1.00 0.00 ? 73 DA  B N6     6  
ATOM 11443 N N1     . DA  B 2 7  ? 39.349 29.874 33.642 1.00 0.00 ? 73 DA  B N1     6  
ATOM 11444 C C2     . DA  B 2 7  ? 39.258 29.400 34.877 1.00 0.00 ? 73 DA  B C2     6  
ATOM 11445 N N3     . DA  B 2 7  ? 38.158 29.091 35.559 1.00 0.00 ? 73 DA  B N3     6  
ATOM 11446 C C4     . DA  B 2 7  ? 37.029 29.306 34.825 1.00 0.00 ? 73 DA  B C4     6  
ATOM 11447 H "H5'"  . DA  B 2 7  ? 32.550 25.669 36.923 1.00 0.00 ? 73 DA  B "H5'"  6  
ATOM 11448 H "H5''" . DA  B 2 7  ? 31.658 26.659 38.092 1.00 0.00 ? 73 DA  B "H5''" 6  
ATOM 11449 H "H4'"  . DA  B 2 7  ? 34.092 26.920 38.268 1.00 0.00 ? 73 DA  B "H4'"  6  
ATOM 11450 H "H3'"  . DA  B 2 7  ? 32.352 29.265 37.797 1.00 0.00 ? 73 DA  B "H3'"  6  
ATOM 11451 H "H2'"  . DA  B 2 7  ? 33.929 30.353 36.561 1.00 0.00 ? 73 DA  B "H2'"  6  
ATOM 11452 H "H2''" . DA  B 2 7  ? 35.048 30.269 37.941 1.00 0.00 ? 73 DA  B "H2''" 6  
ATOM 11453 H "H1'"  . DA  B 2 7  ? 36.114 28.347 37.177 1.00 0.00 ? 73 DA  B "H1'"  6  
ATOM 11454 H H8     . DA  B 2 7  ? 33.876 29.323 34.149 1.00 0.00 ? 73 DA  B H8     6  
ATOM 11455 H H61    . DA  B 2 7  ? 37.595 30.759 31.176 1.00 0.00 ? 73 DA  B H61    6  
ATOM 11456 H H62    . DA  B 2 7  ? 39.347 30.726 31.446 1.00 0.00 ? 73 DA  B H62    6  
ATOM 11457 H H2     . DA  B 2 7  ? 40.193 29.254 35.402 1.00 0.00 ? 73 DA  B H2     6  
ATOM 11458 P P      . DT  B 2 8  ? 33.539 30.108 40.423 1.00 0.00 ? 74 DT  B P      6  
ATOM 11459 O OP1    . DT  B 2 8  ? 33.145 29.613 41.762 1.00 0.00 ? 74 DT  B OP1    6  
ATOM 11460 O OP2    . DT  B 2 8  ? 32.754 31.207 39.812 1.00 0.00 ? 74 DT  B OP2    6  
ATOM 11461 O "O5'"  . DT  B 2 8  ? 35.057 30.618 40.512 1.00 0.00 ? 74 DT  B "O5'"  6  
ATOM 11462 C "C5'"  . DT  B 2 8  ? 36.105 29.756 40.946 1.00 0.00 ? 74 DT  B "C5'"  6  
ATOM 11463 C "C4'"  . DT  B 2 8  ? 37.499 30.225 40.496 1.00 0.00 ? 74 DT  B "C4'"  6  
ATOM 11464 O "O4'"  . DT  B 2 8  ? 37.511 30.394 39.088 1.00 0.00 ? 74 DT  B "O4'"  6  
ATOM 11465 C "C3'"  . DT  B 2 8  ? 37.992 31.551 41.108 1.00 0.00 ? 74 DT  B "C3'"  6  
ATOM 11466 O "O3'"  . DT  B 2 8  ? 38.912 31.293 42.166 1.00 0.00 ? 74 DT  B "O3'"  6  
ATOM 11467 C "C2'"  . DT  B 2 8  ? 38.639 32.258 39.912 1.00 0.00 ? 74 DT  B "C2'"  6  
ATOM 11468 C "C1'"  . DT  B 2 8  ? 38.595 31.242 38.776 1.00 0.00 ? 74 DT  B "C1'"  6  
ATOM 11469 N N1     . DT  B 2 8  ? 38.406 31.912 37.462 1.00 0.00 ? 74 DT  B N1     6  
ATOM 11470 C C2     . DT  B 2 8  ? 39.540 32.176 36.689 1.00 0.00 ? 74 DT  B C2     6  
ATOM 11471 O O2     . DT  B 2 8  ? 40.689 31.939 37.055 1.00 0.00 ? 74 DT  B O2     6  
ATOM 11472 N N3     . DT  B 2 8  ? 39.327 32.742 35.457 1.00 0.00 ? 74 DT  B N3     6  
ATOM 11473 C C4     . DT  B 2 8  ? 38.114 33.105 34.927 1.00 0.00 ? 74 DT  B C4     6  
ATOM 11474 O O4     . DT  B 2 8  ? 38.080 33.593 33.799 1.00 0.00 ? 74 DT  B O4     6  
ATOM 11475 C C5     . DT  B 2 8  ? 36.977 32.864 35.811 1.00 0.00 ? 74 DT  B C5     6  
ATOM 11476 C C7     . DT  B 2 8  ? 35.583 33.236 35.359 1.00 0.00 ? 74 DT  B C7     6  
ATOM 11477 C C6     . DT  B 2 8  ? 37.152 32.296 37.034 1.00 0.00 ? 74 DT  B C6     6  
ATOM 11478 H "H5'"  . DT  B 2 8  ? 35.951 28.764 40.518 1.00 0.00 ? 74 DT  B "H5'"  6  
ATOM 11479 H "H5''" . DT  B 2 8  ? 36.084 29.664 42.034 1.00 0.00 ? 74 DT  B "H5''" 6  
ATOM 11480 H "H4'"  . DT  B 2 8  ? 38.222 29.447 40.749 1.00 0.00 ? 74 DT  B "H4'"  6  
ATOM 11481 H "H3'"  . DT  B 2 8  ? 37.148 32.138 41.466 1.00 0.00 ? 74 DT  B "H3'"  6  
ATOM 11482 H "H2'"  . DT  B 2 8  ? 38.054 33.140 39.657 1.00 0.00 ? 74 DT  B "H2'"  6  
ATOM 11483 H "H2''" . DT  B 2 8  ? 39.673 32.536 40.099 1.00 0.00 ? 74 DT  B "H2''" 6  
ATOM 11484 H "H1'"  . DT  B 2 8  ? 39.520 30.655 38.779 1.00 0.00 ? 74 DT  B "H1'"  6  
ATOM 11485 H H3     . DT  B 2 8  ? 40.139 32.925 34.889 1.00 0.00 ? 74 DT  B H3     6  
ATOM 11486 H H71    . DT  B 2 8  ? 34.841 32.930 36.095 1.00 0.00 ? 74 DT  B H71    6  
ATOM 11487 H H72    . DT  B 2 8  ? 35.530 34.315 35.215 1.00 0.00 ? 74 DT  B H72    6  
ATOM 11488 H H73    . DT  B 2 8  ? 35.375 32.746 34.407 1.00 0.00 ? 74 DT  B H73    6  
ATOM 11489 H H6     . DT  B 2 8  ? 36.303 32.132 37.687 1.00 0.00 ? 74 DT  B H6     6  
ATOM 11490 P P      . DC  B 2 9  ? 39.554 32.444 43.089 1.00 0.00 ? 75 DC  B P      6  
ATOM 11491 O OP1    . DC  B 2 9  ? 40.106 31.777 44.292 1.00 0.00 ? 75 DC  B OP1    6  
ATOM 11492 O OP2    . DC  B 2 9  ? 38.573 33.535 43.277 1.00 0.00 ? 75 DC  B OP2    6  
ATOM 11493 O "O5'"  . DC  B 2 9  ? 40.761 33.074 42.259 1.00 0.00 ? 75 DC  B "O5'"  6  
ATOM 11494 C "C5'"  . DC  B 2 9  ? 41.928 32.331 41.930 1.00 0.00 ? 75 DC  B "C5'"  6  
ATOM 11495 C "C4'"  . DC  B 2 9  ? 42.937 33.149 41.101 1.00 0.00 ? 75 DC  B "C4'"  6  
ATOM 11496 O "O4'"  . DC  B 2 9  ? 42.486 33.354 39.759 1.00 0.00 ? 75 DC  B "O4'"  6  
ATOM 11497 C "C3'"  . DC  B 2 9  ? 43.209 34.538 41.701 1.00 0.00 ? 75 DC  B "C3'"  6  
ATOM 11498 O "O3'"  . DC  B 2 9  ? 44.601 34.817 41.643 1.00 0.00 ? 75 DC  B "O3'"  6  
ATOM 11499 C "C2'"  . DC  B 2 9  ? 42.401 35.447 40.780 1.00 0.00 ? 75 DC  B "C2'"  6  
ATOM 11500 C "C1'"  . DC  B 2 9  ? 42.592 34.736 39.443 1.00 0.00 ? 75 DC  B "C1'"  6  
ATOM 11501 N N1     . DC  B 2 9  ? 41.608 35.147 38.400 1.00 0.00 ? 75 DC  B N1     6  
ATOM 11502 C C2     . DC  B 2 9  ? 42.070 35.562 37.140 1.00 0.00 ? 75 DC  B C2     6  
ATOM 11503 O O2     . DC  B 2 9  ? 43.269 35.587 36.853 1.00 0.00 ? 75 DC  B O2     6  
ATOM 11504 N N3     . DC  B 2 9  ? 41.203 35.950 36.173 1.00 0.00 ? 75 DC  B N3     6  
ATOM 11505 C C4     . DC  B 2 9  ? 39.917 35.946 36.455 1.00 0.00 ? 75 DC  B C4     6  
ATOM 11506 N N4     . DC  B 2 9  ? 39.115 36.302 35.501 1.00 0.00 ? 75 DC  B N4     6  
ATOM 11507 C C5     . DC  B 2 9  ? 39.384 35.574 37.715 1.00 0.00 ? 75 DC  B C5     6  
ATOM 11508 C C6     . DC  B 2 9  ? 40.261 35.171 38.667 1.00 0.00 ? 75 DC  B C6     6  
ATOM 11509 H "H5'"  . DC  B 2 9  ? 41.646 31.445 41.358 1.00 0.00 ? 75 DC  B "H5'"  6  
ATOM 11510 H "H5''" . DC  B 2 9  ? 42.416 32.003 42.848 1.00 0.00 ? 75 DC  B "H5''" 6  
ATOM 11511 H "H4'"  . DC  B 2 9  ? 43.877 32.595 41.083 1.00 0.00 ? 75 DC  B "H4'"  6  
ATOM 11512 H "H3'"  . DC  B 2 9  ? 42.841 34.592 42.728 1.00 0.00 ? 75 DC  B "H3'"  6  
ATOM 11513 H "H2'"  . DC  B 2 9  ? 41.361 35.443 41.104 1.00 0.00 ? 75 DC  B "H2'"  6  
ATOM 11514 H "H2''" . DC  B 2 9  ? 42.772 36.468 40.747 1.00 0.00 ? 75 DC  B "H2''" 6  
ATOM 11515 H "H1'"  . DC  B 2 9  ? 43.610 34.952 39.102 1.00 0.00 ? 75 DC  B "H1'"  6  
ATOM 11516 H H41    . DC  B 2 9  ? 38.138 36.446 35.710 1.00 0.00 ? 75 DC  B H41    6  
ATOM 11517 H H42    . DC  B 2 9  ? 39.495 36.466 34.578 1.00 0.00 ? 75 DC  B H42    6  
ATOM 11518 H H5     . DC  B 2 9  ? 38.327 35.588 37.929 1.00 0.00 ? 75 DC  B H5     6  
ATOM 11519 H H6     . DC  B 2 9  ? 39.905 34.858 39.641 1.00 0.00 ? 75 DC  B H6     6  
ATOM 11520 P P      . DC  B 2 10 ? 45.239 36.118 42.301 1.00 0.00 ? 76 DC  B P      6  
ATOM 11521 O OP1    . DC  B 2 10 ? 46.670 35.836 42.534 1.00 0.00 ? 76 DC  B OP1    6  
ATOM 11522 O OP2    . DC  B 2 10 ? 44.394 36.518 43.448 1.00 0.00 ? 76 DC  B OP2    6  
ATOM 11523 O "O5'"  . DC  B 2 10 ? 45.122 37.226 41.152 1.00 0.00 ? 76 DC  B "O5'"  6  
ATOM 11524 C "C5'"  . DC  B 2 10 ? 45.933 37.108 39.987 1.00 0.00 ? 76 DC  B "C5'"  6  
ATOM 11525 C "C4'"  . DC  B 2 10 ? 45.680 38.167 38.910 1.00 0.00 ? 76 DC  B "C4'"  6  
ATOM 11526 O "O4'"  . DC  B 2 10 ? 44.390 38.069 38.337 1.00 0.00 ? 76 DC  B "O4'"  6  
ATOM 11527 C "C3'"  . DC  B 2 10 ? 45.820 39.616 39.393 1.00 0.00 ? 76 DC  B "C3'"  6  
ATOM 11528 O "O3'"  . DC  B 2 10 ? 47.114 40.130 39.081 1.00 0.00 ? 76 DC  B "O3'"  6  
ATOM 11529 C "C2'"  . DC  B 2 10 ? 44.698 40.338 38.634 1.00 0.00 ? 76 DC  B "C2'"  6  
ATOM 11530 C "C1'"  . DC  B 2 10 ? 44.214 39.282 37.639 1.00 0.00 ? 76 DC  B "C1'"  6  
ATOM 11531 N N1     . DC  B 2 10 ? 42.804 39.451 37.195 1.00 0.00 ? 76 DC  B N1     6  
ATOM 11532 C C2     . DC  B 2 10 ? 42.547 39.861 35.879 1.00 0.00 ? 76 DC  B C2     6  
ATOM 11533 O O2     . DC  B 2 10 ? 43.444 40.245 35.128 1.00 0.00 ? 76 DC  B O2     6  
ATOM 11534 N N3     . DC  B 2 10 ? 41.289 39.865 35.387 1.00 0.00 ? 76 DC  B N3     6  
ATOM 11535 C C4     . DC  B 2 10 ? 40.305 39.544 36.199 1.00 0.00 ? 76 DC  B C4     6  
ATOM 11536 N N4     . DC  B 2 10 ? 39.118 39.579 35.677 1.00 0.00 ? 76 DC  B N4     6  
ATOM 11537 C C5     . DC  B 2 10 ? 40.486 39.205 37.568 1.00 0.00 ? 76 DC  B C5     6  
ATOM 11538 C C6     . DC  B 2 10 ? 41.759 39.160 38.037 1.00 0.00 ? 76 DC  B C6     6  
ATOM 11539 H "H5'"  . DC  B 2 10 ? 45.767 36.131 39.533 1.00 0.00 ? 76 DC  B "H5'"  6  
ATOM 11540 H "H5''" . DC  B 2 10 ? 46.983 37.173 40.277 1.00 0.00 ? 76 DC  B "H5''" 6  
ATOM 11541 H "H4'"  . DC  B 2 10 ? 46.403 38.001 38.111 1.00 0.00 ? 76 DC  B "H4'"  6  
ATOM 11542 H "H3'"  . DC  B 2 10 ? 45.630 39.660 40.468 1.00 0.00 ? 76 DC  B "H3'"  6  
ATOM 11543 H "H2'"  . DC  B 2 10 ? 43.903 40.610 39.329 1.00 0.00 ? 76 DC  B "H2'"  6  
ATOM 11544 H "H2''" . DC  B 2 10 ? 45.059 41.219 38.109 1.00 0.00 ? 76 DC  B "H2''" 6  
ATOM 11545 H "H1'"  . DC  B 2 10 ? 44.879 39.286 36.768 1.00 0.00 ? 76 DC  B "H1'"  6  
ATOM 11546 H H41    . DC  B 2 10 ? 38.319 39.444 36.278 1.00 0.00 ? 76 DC  B H41    6  
ATOM 11547 H H42    . DC  B 2 10 ? 39.026 39.803 34.696 1.00 0.00 ? 76 DC  B H42    6  
ATOM 11548 H H5     . DC  B 2 10 ? 39.658 38.967 38.217 1.00 0.00 ? 76 DC  B H5     6  
ATOM 11549 H H6     . DC  B 2 10 ? 41.967 38.879 39.064 1.00 0.00 ? 76 DC  B H6     6  
ATOM 11550 P P      . DC  B 2 11 ? 47.655 41.485 39.746 1.00 0.00 ? 77 DC  B P      6  
ATOM 11551 O OP1    . DC  B 2 11 ? 49.130 41.491 39.652 1.00 0.00 ? 77 DC  B OP1    6  
ATOM 11552 O OP2    . DC  B 2 11 ? 47.040 41.608 41.080 1.00 0.00 ? 77 DC  B OP2    6  
ATOM 11553 O "O5'"  . DC  B 2 11 ? 47.103 42.671 38.811 1.00 0.00 ? 77 DC  B "O5'"  6  
ATOM 11554 C "C5'"  . DC  B 2 11 ? 47.627 42.866 37.498 1.00 0.00 ? 77 DC  B "C5'"  6  
ATOM 11555 C "C4'"  . DC  B 2 11 ? 46.759 43.747 36.588 1.00 0.00 ? 77 DC  B "C4'"  6  
ATOM 11556 O "O4'"  . DC  B 2 11 ? 45.497 43.137 36.361 1.00 0.00 ? 77 DC  B "O4'"  6  
ATOM 11557 C "C3'"  . DC  B 2 11 ? 46.511 45.194 37.063 1.00 0.00 ? 77 DC  B "C3'"  6  
ATOM 11558 O "O3'"  . DC  B 2 11 ? 47.292 46.055 36.237 1.00 0.00 ? 77 DC  B "O3'"  6  
ATOM 11559 C "C2'"  . DC  B 2 11 ? 44.996 45.348 36.885 1.00 0.00 ? 77 DC  B "C2'"  6  
ATOM 11560 C "C1'"  . DC  B 2 11 ? 44.597 44.164 36.002 1.00 0.00 ? 77 DC  B "C1'"  6  
ATOM 11561 N N1     . DC  B 2 11 ? 43.186 43.719 36.204 1.00 0.00 ? 77 DC  B N1     6  
ATOM 11562 C C2     . DC  B 2 11 ? 42.287 43.757 35.127 1.00 0.00 ? 77 DC  B C2     6  
ATOM 11563 O O2     . DC  B 2 11 ? 42.655 44.086 33.996 1.00 0.00 ? 77 DC  B O2     6  
ATOM 11564 N N3     . DC  B 2 11 ? 40.983 43.423 35.296 1.00 0.00 ? 77 DC  B N3     6  
ATOM 11565 C C4     . DC  B 2 11 ? 40.586 43.043 36.496 1.00 0.00 ? 77 DC  B C4     6  
ATOM 11566 N N4     . DC  B 2 11 ? 39.334 42.711 36.612 1.00 0.00 ? 77 DC  B N4     6  
ATOM 11567 C C5     . DC  B 2 11 ? 41.455 42.941 37.617 1.00 0.00 ? 77 DC  B C5     6  
ATOM 11568 C C6     . DC  B 2 11 ? 42.752 43.292 37.436 1.00 0.00 ? 77 DC  B C6     6  
ATOM 11569 H "H5'"  . DC  B 2 11 ? 47.737 41.897 37.008 1.00 0.00 ? 77 DC  B "H5'"  6  
ATOM 11570 H "H5''" . DC  B 2 11 ? 48.615 43.320 37.559 1.00 0.00 ? 77 DC  B "H5''" 6  
ATOM 11571 H "H4'"  . DC  B 2 11 ? 47.269 43.810 35.624 1.00 0.00 ? 77 DC  B "H4'"  6  
ATOM 11572 H "H3'"  . DC  B 2 11 ? 46.781 45.318 38.112 1.00 0.00 ? 77 DC  B "H3'"  6  
ATOM 11573 H "H2'"  . DC  B 2 11 ? 44.520 45.292 37.864 1.00 0.00 ? 77 DC  B "H2'"  6  
ATOM 11574 H "H2''" . DC  B 2 11 ? 44.726 46.284 36.404 1.00 0.00 ? 77 DC  B "H2''" 6  
ATOM 11575 H "H1'"  . DC  B 2 11 ? 44.768 44.447 34.958 1.00 0.00 ? 77 DC  B "H1'"  6  
ATOM 11576 H H41    . DC  B 2 11 ? 38.990 42.343 37.488 1.00 0.00 ? 77 DC  B H41    6  
ATOM 11577 H H42    . DC  B 2 11 ? 38.772 42.723 35.774 1.00 0.00 ? 77 DC  B H42    6  
ATOM 11578 H H5     . DC  B 2 11 ? 41.111 42.611 38.585 1.00 0.00 ? 77 DC  B H5     6  
ATOM 11579 H H6     . DC  B 2 11 ? 43.461 43.241 38.257 1.00 0.00 ? 77 DC  B H6     6  
ATOM 11580 P P      . DC  B 2 12 ? 47.206 47.655 36.214 1.00 0.00 ? 78 DC  B P      6  
ATOM 11581 O OP1    . DC  B 2 12 ? 48.546 48.177 35.868 1.00 0.00 ? 78 DC  B OP1    6  
ATOM 11582 O OP2    . DC  B 2 12 ? 46.544 48.162 37.437 1.00 0.00 ? 78 DC  B OP2    6  
ATOM 11583 O "O5'"  . DC  B 2 12 ? 46.259 47.939 34.970 1.00 0.00 ? 78 DC  B "O5'"  6  
ATOM 11584 C "C5'"  . DC  B 2 12 ? 46.561 47.386 33.697 1.00 0.00 ? 78 DC  B "C5'"  6  
ATOM 11585 C "C4'"  . DC  B 2 12 ? 45.671 47.912 32.565 1.00 0.00 ? 78 DC  B "C4'"  6  
ATOM 11586 O "O4'"  . DC  B 2 12 ? 44.306 47.551 32.759 1.00 0.00 ? 78 DC  B "O4'"  6  
ATOM 11587 C "C3'"  . DC  B 2 12 ? 45.734 49.431 32.397 1.00 0.00 ? 78 DC  B "C3'"  6  
ATOM 11588 O "O3'"  . DC  B 2 12 ? 45.773 49.711 31.000 1.00 0.00 ? 78 DC  B "O3'"  6  
ATOM 11589 C "C2'"  . DC  B 2 12 ? 44.466 49.892 33.122 1.00 0.00 ? 78 DC  B "C2'"  6  
ATOM 11590 C "C1'"  . DC  B 2 12 ? 43.502 48.703 32.973 1.00 0.00 ? 78 DC  B "C1'"  6  
ATOM 11591 N N1     . DC  B 2 12 ? 42.599 48.410 34.133 1.00 0.00 ? 78 DC  B N1     6  
ATOM 11592 C C2     . DC  B 2 12 ? 41.273 48.014 33.883 1.00 0.00 ? 78 DC  B C2     6  
ATOM 11593 O O2     . DC  B 2 12 ? 40.765 48.110 32.763 1.00 0.00 ? 78 DC  B O2     6  
ATOM 11594 N N3     . DC  B 2 12 ? 40.496 47.498 34.870 1.00 0.00 ? 78 DC  B N3     6  
ATOM 11595 C C4     . DC  B 2 12 ? 41.014 47.390 36.079 1.00 0.00 ? 78 DC  B C4     6  
ATOM 11596 N N4     . DC  B 2 12 ? 40.292